data_2N0K
# 
_entry.id   2N0K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104269   RCSB  
2N0K         PDB   
25527        BMRB  
D_1000104269 WWPDB 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          25527 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'NMR distance, dihedral, and residual dipolar coupling constraints.' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N0K 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rajagopal, P.' 1 
'Klevit, R.E.'  2 
'Shi, L.'       3 
'Baker, D.'     4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A conserved histidine modulates HSPB5 structure to trigger chaperone activity in response to stress-related acidosis.' 
Elife                  4   ?    ?    2015 ?      US 2050-084X ?    ? 25962097 10.7554/eLife.07304       
1       
'alphaB-crystallin: a hybrid solid-state/solution-state NMR investigation reveals structural aspects of the heterogeneous oligomer.' 
J.Mol.Biol.            385 1481 1497 2009 JMOBAK UK 0022-2836 0070 ? 19041879 10.1016/j.jmb.2008.10.097 
2       'Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.' 
Nat.Struct.Mol.Biol.   17  1037 1042 2010 ?      US 1545-9993 ?    ? 20802487 10.1038/nsmb.1891         
3       
'N-terminal domain of alphaB-crystallin provides a conformational switch for multimerization and structural heterogeneity.' 
Proc.Natl.Acad.Sci.USA 108 6409 6414 2011 PNASA6 US 0027-8424 0040 ? 21464278 10.1073/pnas.1014656108   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rajagopal, P.'    1  
primary 'Tse, E.'          2  
primary 'Borst, A.J.'      3  
primary 'Delbecq, S.P.'    4  
primary 'Shi, L.'          5  
primary 'Southworth, D.R.' 6  
primary 'Klevit, R.E.'     7  
1       'Jehle, S.'        8  
1       'van Rossum, B.'   9  
1       'Stout, J.R.'      10 
1       'Noguchi, S.M.'    11 
1       'Falber, K.'       12 
1       'Rehbein, K.'      13 
1       'Oschkinat, H.'    14 
1       'Klevit, R.E.'     15 
1       'Rajagopal, P.'    16 
2       'Jehle, S.'        17 
2       'Rajagopal, P.'    18 
2       'Bardiaux, B.'     19 
2       'Markovic, S.'     20 
2       'Kuhne, R.'        21 
2       'Stout, J.R.'      22 
2       'Higman, V.A.'     23 
2       'Klevit, R.E.'     24 
2       'van Rossum, B.J.' 25 
2       'Oschkinat, H.'    26 
3       'Jehle, S.'        27 
3       'Vollmar, B.S.'    28 
3       'Bardiaux, B.'     29 
3       'Dove, K.K.'       30 
3       'Rajagopal, P.'    31 
3       'Gonen, T.'        32 
3       'Oschkinat, H.'    33 
3       'Klevit, R.E.'     34 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Alpha-crystallin B chain' 
_entity.formula_weight             10200.497 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              N146D 
_entity.pdbx_fragment              'unp residues 64-152' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Alpha(B)-crystallin, Heat shock protein beta-5, HspB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL
TVDGPRKQV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL
TVDGPRKQV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  LEU n 
1 3  SER n 
1 4  GLU n 
1 5  MET n 
1 6  ARG n 
1 7  LEU n 
1 8  GLU n 
1 9  LYS n 
1 10 ASP n 
1 11 ARG n 
1 12 PHE n 
1 13 SER n 
1 14 VAL n 
1 15 ASN n 
1 16 LEU n 
1 17 ASP n 
1 18 VAL n 
1 19 LYS n 
1 20 HIS n 
1 21 PHE n 
1 22 SER n 
1 23 PRO n 
1 24 GLU n 
1 25 GLU n 
1 26 LEU n 
1 27 LYS n 
1 28 VAL n 
1 29 LYS n 
1 30 VAL n 
1 31 LEU n 
1 32 GLY n 
1 33 ASP n 
1 34 VAL n 
1 35 ILE n 
1 36 GLU n 
1 37 VAL n 
1 38 HIS n 
1 39 GLY n 
1 40 LYS n 
1 41 HIS n 
1 42 GLU n 
1 43 GLU n 
1 44 ARG n 
1 45 GLN n 
1 46 ASP n 
1 47 GLU n 
1 48 HIS n 
1 49 GLY n 
1 50 PHE n 
1 51 ILE n 
1 52 SER n 
1 53 ARG n 
1 54 GLU n 
1 55 PHE n 
1 56 HIS n 
1 57 ARG n 
1 58 LYS n 
1 59 TYR n 
1 60 ARG n 
1 61 ILE n 
1 62 PRO n 
1 63 ALA n 
1 64 ASP n 
1 65 VAL n 
1 66 ASP n 
1 67 PRO n 
1 68 LEU n 
1 69 THR n 
1 70 ILE n 
1 71 THR n 
1 72 SER n 
1 73 SER n 
1 74 LEU n 
1 75 SER n 
1 76 SER n 
1 77 ASP n 
1 78 GLY n 
1 79 VAL n 
1 80 LEU n 
1 81 THR n 
1 82 VAL n 
1 83 ASP n 
1 84 GLY n 
1 85 PRO n 
1 86 ARG n 
1 87 LYS n 
1 88 GLN n 
1 89 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CRYA2, CRYAB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET24a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CRYAB_HUMAN 
_struct_ref.pdbx_db_accession          P02511 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL
TVNGPRKQV
;
_struct_ref.pdbx_align_begin           64 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2N0K A 1 ? 89 ? P02511 64 ? 152 ? 64 152 
2 1 2N0K B 1 ? 89 ? P02511 64 ? 152 ? 64 152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2N0K ASP A 83 ? UNP P02511 ASN 146 'ENGINEERED MUTATION' 146 1 
2 2N0K ASP B 83 ? UNP P02511 ASN 146 'ENGINEERED MUTATION' 146 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'           
2 2  2 '2D 1H-15N HSQC'           
1 3  2 '2D 1H-15N HSQC'           
1 4  1 '3D 1H-15N NOESY'          
1 5  4 '2D 1H-13C HSQC aliphatic' 
1 6  4 '2D 1H-13C HSQC aromatic'  
1 7  2 '3D HNCACB'                
1 8  2 '3D HBHA(CO)NH'            
1 9  2 '3D HNCO'                  
1 10 2 '3D HNCA'                  
1 11 2 '3D HN(CO)CA'              
1 12 2 '3D HN(COCA)CB'            
1 13 4 '3D HCCH-TOCSY'            
1 14 5 '3D H(CCO)NH'              
1 15 5 '3D C(CO)NH'               
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 100 7.5 ambient ? 295 K 
2 100 6.5 ambient ? 295 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 

'0.6 mM [U-100% 13C; U-100% 15N] HSPB5-ACD, 50 mM sodium phosphate, 100 mM sodium chloride, .1 mM EDTA, 1 mM PMSF, 90% H2O/10% D2O' 
1 '90% H2O/10% D2O' 
;0.6 mM [U-100% 13C; U-100% 15N; U-80% 2H] HSPB5-ACD, 50 mM sodium phosphate, 100 mM sodium chloride, .1 mM EDTA, 1 mM PMSF, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
;0.6  mM [U-100% 13C; U-100% 15N; U-80% 2H] HSPB5-ACD, 50 mM sodium phosphate, 100 mM sodium chloride, .1 mM EDTA, 1 mM PMSF, 14 mg/mL Pf1 phage, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
'1.0 mM [U-100% 13C; U-100% 15N] HSPB5-ACD, 50 mM sodium phosphate, 100 mM sodium chloride, .1 mM EDTA, 1 mM PMSF, 100% D2O' 4 
'100% D2O'        
;1.0 mM [U-100% 13C; U-100% 15N; 50% 2H] HSPB5-ACD, 50 mM sodium phosphate, 100 mM sodium chloride, .1 mM EDTA, 1 mM PMSF, 90% H2O/10% D2O
;
5 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
600 Bruker Avance 2 'Bruker Avance' 
500 Bruker Avance 3 'Bruker Avance' 
900 Bruker Avance 4 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2N0K 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2N0K 
_pdbx_nmr_details.text       'Solution structure was determined with NOEs and RDCs.' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             9 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N0K 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N0K 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                                         'data analysis'             NMRPipe ? 
1  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                                         processing                  NMRPipe ? 
2  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                                         'peak picking'              NMRPipe ? 
3  
'Johnson, One Moon Scientific'                                                              'data analysis'             NMRView ? 
4  
'Johnson, One Moon Scientific'                                                              'chemical shift assignment' NMRView ? 
5  
'Johnson, One Moon Scientific'                                                              'peak picking'              NMRView ? 
6  
'Zimmerman, Moseley, Kulikowski and Montelione'                                             'chemical shift assignment' AutoAssign 
? 7  
'Zimmerman, Moseley, Kulikowski and Montelione'                                             'peak picking'              AutoAssign 
? 8  
'Shen, Vernon, Baker and Bax'                                                               'structure solution'        CS-Rosetta 
? 9  
'Shen, Vernon, Baker and Bax'                                                               'chemical shift assignment' CS-Rosetta 
? 10 
'Shen, Vernon, Baker and Bax'                                                               'peak picking'              CS-Rosetta 
? 11 
'(RosettaOligomer)-Sgourakis, Lange, DiMaio, Andre, Fitzkee, Rossi, Montelione, Bax, Baker' 'structure solution'        
RosettaOligomer ? 12 
'(RosettaOligomer)-Sgourakis, Lange, DiMaio, Andre, Fitzkee, Rossi, Montelione, Bax, Baker' 'chemical shift assignment' 
RosettaOligomer ? 13 
'(RosettaOligomer)-Sgourakis, Lange, DiMaio, Andre, Fitzkee, Rossi, Montelione, Bax, Baker' 'peak picking'              
RosettaOligomer ? 14 
'Cornilescu, Delaglio and Bax'                                                              refinement                  TALOS ? 15 
'Cornilescu, Delaglio and Bax'                                                              'chemical shift assignment' TALOS ? 16 
'Cornilescu, Delaglio and Bax'                                                              'peak picking'              TALOS ? 17 
'(GUARDD)-Kleckner, Foster'                                                                 'data analysis'             GUARDD ? 
18 
'(GUARDD)-Kleckner, Foster'                                                                 'chemical shift assignment' GUARDD ? 
19 
'(GUARDD)-Kleckner, Foster'                                                                 'peak picking'              GUARDD ? 
20 
?                                                                                           refinement                  
RosettaOligomer ? 21 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N0K 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N0K 
_struct.title                     'Chemical shift assignments and structure of the alpha-crystallin domain from human, HSPB5' 
_struct.pdbx_descriptor           'Alpha-crystallin B chain' 
_struct.pdbx_model_details        'closest to the average, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N0K 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'crystallin, human, ACD, Protein, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 66 ? ILE A 70 ? ASP A 129 ILE A 133 5 ? 5 
HELX_P HELX_P2 2 ASP B 66 ? ILE B 70 ? ASP B 129 ILE B 133 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 49 A . ? GLY 112 A PHE 50 A ? PHE 113 A 5 9.52 
2 GLY 49 B . ? GLY 112 B PHE 50 B ? PHE 113 B 5 9.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 12 ? LEU A 16 ? PHE A 75  LEU A 79  
A 2 VAL A 79 ? ASP A 83 ? VAL A 142 ASP A 146 
A 3 THR A 71 ? LEU A 74 ? THR A 134 LEU A 137 
A 4 LEU A 26 ? LEU A 31 ? LEU A 89  LEU A 94  
A 5 VAL A 34 ? HIS A 41 ? VAL A 97  HIS A 104 
A 6 GLY A 49 ? ARG A 60 ? GLY A 112 ARG A 123 
B 1 GLY B 49 ? ARG B 60 ? GLY B 112 ARG B 123 
B 2 VAL B 34 ? HIS B 41 ? VAL B 97  HIS B 104 
B 3 LEU B 26 ? LEU B 31 ? LEU B 89  LEU B 94  
B 4 PHE B 12 ? LEU B 16 ? PHE B 75  LEU B 79  
B 5 VAL B 79 ? ASP B 83 ? VAL B 142 ASP B 146 
B 6 THR B 71 ? LEU B 74 ? THR B 134 LEU B 137 
# 
_atom_sites.entry_id                    2N0K 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 17.187  -3.953  -45.657 1.00 0.00 ? 64  GLY A N    1 
ATOM 2     C CA   . GLY A 1 1  ? 15.731  -4.021  -45.695 1.00 0.00 ? 64  GLY A CA   1 
ATOM 3     C C    . GLY A 1 1  ? 15.163  -4.431  -44.344 1.00 0.00 ? 64  GLY A C    1 
ATOM 4     O O    . GLY A 1 1  ? 15.523  -5.475  -43.799 1.00 0.00 ? 64  GLY A O    1 
ATOM 5     H H1   . GLY A 1 1  ? 17.538  -3.728  -46.578 1.00 0.00 ? 64  GLY A H1   1 
ATOM 6     H H2   . GLY A 1 1  ? 17.481  -3.214  -44.985 1.00 0.00 ? 64  GLY A H2   1 
ATOM 7     H H3   . GLY A 1 1  ? 17.571  -4.869  -45.355 1.00 0.00 ? 64  GLY A H3   1 
ATOM 8     H HA2  . GLY A 1 1  ? 15.335  -3.042  -45.966 1.00 0.00 ? 64  GLY A HA2  1 
ATOM 9     H HA3  . GLY A 1 1  ? 15.427  -4.749  -46.448 1.00 0.00 ? 64  GLY A HA3  1 
ATOM 10    N N    . LEU A 1 2  ? 14.275  -3.602  -43.805 1.00 0.00 ? 65  LEU A N    1 
ATOM 11    C CA   . LEU A 1 2  ? 13.645  -3.886  -42.520 1.00 0.00 ? 65  LEU A CA   1 
ATOM 12    C C    . LEU A 1 2  ? 12.220  -4.395  -42.704 1.00 0.00 ? 65  LEU A C    1 
ATOM 13    O O    . LEU A 1 2  ? 11.434  -4.424  -41.757 1.00 0.00 ? 65  LEU A O    1 
ATOM 14    C CB   . LEU A 1 2  ? 13.635  -2.626  -41.646 1.00 0.00 ? 65  LEU A CB   1 
ATOM 15    C CG   . LEU A 1 2  ? 15.012  -2.069  -41.266 1.00 0.00 ? 65  LEU A CG   1 
ATOM 16    C CD1  . LEU A 1 2  ? 14.840  -0.788  -40.461 1.00 0.00 ? 65  LEU A CD1  1 
ATOM 17    C CD2  . LEU A 1 2  ? 15.781  -3.114  -40.469 1.00 0.00 ? 65  LEU A CD2  1 
ATOM 18    H H    . LEU A 1 2  ? 14.021  -2.752  -44.307 1.00 0.00 ? 65  LEU A H    1 
ATOM 19    H HA   . LEU A 1 2  ? 14.224  -4.640  -42.003 1.00 0.00 ? 65  LEU A HA   1 
ATOM 20    H HB2  . LEU A 1 2  ? 13.095  -1.846  -42.182 1.00 0.00 ? 65  LEU A HB2  1 
ATOM 21    H HB3  . LEU A 1 2  ? 13.094  -2.854  -40.727 1.00 0.00 ? 65  LEU A HB3  1 
ATOM 22    H HG   . LEU A 1 2  ? 15.560  -1.841  -42.182 1.00 0.00 ? 65  LEU A HG   1 
ATOM 23    H HD11 . LEU A 1 2  ? 14.281  -1.006  -39.552 1.00 0.00 ? 65  LEU A HD11 1 
ATOM 24    H HD12 . LEU A 1 2  ? 14.296  -0.050  -41.054 1.00 0.00 ? 65  LEU A HD12 1 
ATOM 25    H HD13 . LEU A 1 2  ? 15.821  -0.390  -40.198 1.00 0.00 ? 65  LEU A HD13 1 
ATOM 26    H HD21 . LEU A 1 2  ? 15.108  -3.621  -39.787 1.00 0.00 ? 65  LEU A HD21 1 
ATOM 27    H HD22 . LEU A 1 2  ? 16.570  -2.624  -39.896 1.00 0.00 ? 65  LEU A HD22 1 
ATOM 28    H HD23 . LEU A 1 2  ? 16.231  -3.843  -41.142 1.00 0.00 ? 65  LEU A HD23 1 
ATOM 29    N N    . SER A 1 3  ? 11.894  -4.793  -43.929 1.00 0.00 ? 66  SER A N    1 
ATOM 30    C CA   . SER A 1 3  ? 10.593  -5.381  -44.222 1.00 0.00 ? 66  SER A CA   1 
ATOM 31    C C    . SER A 1 3  ? 10.715  -6.520  -45.225 1.00 0.00 ? 66  SER A C    1 
ATOM 32    O O    . SER A 1 3  ? 9.777   -6.810  -45.967 1.00 0.00 ? 66  SER A O    1 
ATOM 33    C CB   . SER A 1 3  ? 9.650   -4.321  -44.759 1.00 0.00 ? 66  SER A CB   1 
ATOM 34    O OG   . SER A 1 3  ? 10.157  -3.747  -45.932 1.00 0.00 ? 66  SER A OG   1 
ATOM 35    H H    . SER A 1 3  ? 12.595  -4.757  -44.669 1.00 0.00 ? 66  SER A H    1 
ATOM 36    H HA   . SER A 1 3  ? 10.164  -5.770  -43.309 1.00 0.00 ? 66  SER A HA   1 
ATOM 37    H HB2  . SER A 1 3  ? 8.686   -4.770  -44.982 1.00 0.00 ? 66  SER A HB2  1 
ATOM 38    H HB3  . SER A 1 3  ? 9.515   -3.547  -44.000 1.00 0.00 ? 66  SER A HB3  1 
ATOM 39    H HG   . SER A 1 3  ? 11.108  -3.877  -45.930 1.00 0.00 ? 66  SER A HG   1 
ATOM 40    N N    . GLU A 1 4  ? 11.878  -7.162  -45.245 1.00 0.00 ? 67  GLU A N    1 
ATOM 41    C CA   . GLU A 1 4  ? 12.216  -8.106  -46.304 1.00 0.00 ? 67  GLU A CA   1 
ATOM 42    C C    . GLU A 1 4  ? 12.113  -9.544  -45.814 1.00 0.00 ? 67  GLU A C    1 
ATOM 43    O O    . GLU A 1 4  ? 12.603  -9.879  -44.736 1.00 0.00 ? 67  GLU A O    1 
ATOM 44    C CB   . GLU A 1 4  ? 13.626  -7.836  -46.830 1.00 0.00 ? 67  GLU A CB   1 
ATOM 45    C CG   . GLU A 1 4  ? 14.066  -8.762  -47.955 1.00 0.00 ? 67  GLU A CG   1 
ATOM 46    C CD   . GLU A 1 4  ? 15.451  -8.455  -48.457 1.00 0.00 ? 67  GLU A CD   1 
ATOM 47    O OE1  . GLU A 1 4  ? 16.042  -7.517  -47.979 1.00 0.00 ? 67  GLU A OE1  1 
ATOM 48    O OE2  . GLU A 1 4  ? 15.918  -9.163  -49.319 1.00 0.00 ? 67  GLU A OE2  1 
ATOM 49    H H    . GLU A 1 4  ? 12.622  -6.845  -44.624 1.00 0.00 ? 67  GLU A H    1 
ATOM 50    H HA   . GLU A 1 4  ? 11.535  -7.993  -47.124 1.00 0.00 ? 67  GLU A HA   1 
ATOM 51    H HB2  . GLU A 1 4  ? 13.665  -6.808  -47.197 1.00 0.00 ? 67  GLU A HB2  1 
ATOM 52    H HB3  . GLU A 1 4  ? 14.333  -7.939  -46.008 1.00 0.00 ? 67  GLU A HB3  1 
ATOM 53    H HG2  . GLU A 1 4  ? 14.044  -9.787  -47.592 1.00 0.00 ? 67  GLU A HG2  1 
ATOM 54    H HG3  . GLU A 1 4  ? 13.362  -8.661  -48.781 1.00 0.00 ? 67  GLU A HG3  1 
ATOM 55    N N    . MET A 1 5  ? 11.472  -10.390 -46.612 1.00 0.00 ? 68  MET A N    1 
ATOM 56    C CA   . MET A 1 5  ? 11.540  -11.834 -46.410 1.00 0.00 ? 68  MET A CA   1 
ATOM 57    C C    . MET A 1 5  ? 12.498  -12.484 -47.402 1.00 0.00 ? 68  MET A C    1 
ATOM 58    O O    . MET A 1 5  ? 12.447  -12.209 -48.600 1.00 0.00 ? 68  MET A O    1 
ATOM 59    C CB   . MET A 1 5  ? 10.148  -12.450 -46.533 1.00 0.00 ? 68  MET A CB   1 
ATOM 60    C CG   . MET A 1 5  ? 10.125  -13.971 -46.480 1.00 0.00 ? 68  MET A CG   1 
ATOM 61    S SD   . MET A 1 5  ? 8.457   -14.646 -46.601 1.00 0.00 ? 68  MET A SD   1 
ATOM 62    C CE   . MET A 1 5  ? 8.113   -14.382 -48.340 1.00 0.00 ? 68  MET A CE   1 
ATOM 63    H H    . MET A 1 5  ? 11.129  -10.047 -47.506 1.00 0.00 ? 68  MET A H    1 
ATOM 64    H HA   . MET A 1 5  ? 11.909  -12.031 -45.405 1.00 0.00 ? 68  MET A HA   1 
ATOM 65    H HB2  . MET A 1 5  ? 9.520   -12.089 -45.731 1.00 0.00 ? 68  MET A HB2  1 
ATOM 66    H HB3  . MET A 1 5  ? 9.745   -12.134 -47.484 1.00 0.00 ? 68  MET A HB3  1 
ATOM 67    H HG2  . MET A 1 5  ? 10.704  -14.362 -47.316 1.00 0.00 ? 68  MET A HG2  1 
ATOM 68    H HG3  . MET A 1 5  ? 10.578  -14.306 -45.557 1.00 0.00 ? 68  MET A HG3  1 
ATOM 69    H HE1  . MET A 1 5  ? 8.968   -13.911 -48.822 1.00 0.00 ? 68  MET A HE1  1 
ATOM 70    H HE2  . MET A 1 5  ? 7.913   -15.342 -48.816 1.00 0.00 ? 68  MET A HE2  1 
ATOM 71    H HE3  . MET A 1 5  ? 7.240   -13.740 -48.444 1.00 0.00 ? 68  MET A HE3  1 
ATOM 72    N N    . ARG A 1 6  ? 13.369  -13.348 -46.892 1.00 0.00 ? 69  ARG A N    1 
ATOM 73    C CA   . ARG A 1 6  ? 14.318  -14.064 -47.736 1.00 0.00 ? 69  ARG A CA   1 
ATOM 74    C C    . ARG A 1 6  ? 14.820  -15.328 -47.051 1.00 0.00 ? 69  ARG A C    1 
ATOM 75    O O    . ARG A 1 6  ? 15.279  -15.285 -45.908 1.00 0.00 ? 69  ARG A O    1 
ATOM 76    C CB   . ARG A 1 6  ? 15.502  -13.175 -48.087 1.00 0.00 ? 69  ARG A CB   1 
ATOM 77    C CG   . ARG A 1 6  ? 16.528  -13.810 -49.013 1.00 0.00 ? 69  ARG A CG   1 
ATOM 78    C CD   . ARG A 1 6  ? 17.503  -12.810 -49.520 1.00 0.00 ? 69  ARG A CD   1 
ATOM 79    N NE   . ARG A 1 6  ? 18.395  -12.345 -48.470 1.00 0.00 ? 69  ARG A NE   1 
ATOM 80    C CZ   . ARG A 1 6  ? 19.190  -11.261 -48.569 1.00 0.00 ? 69  ARG A CZ   1 
ATOM 81    N NH1  . ARG A 1 6  ? 19.192  -10.544 -49.671 1.00 0.00 ? 69  ARG A NH1  1 
ATOM 82    N NH2  . ARG A 1 6  ? 19.967  -10.918 -47.557 1.00 0.00 ? 69  ARG A NH2  1 
ATOM 83    H H    . ARG A 1 6  ? 13.354  -13.540 -45.892 1.00 0.00 ? 69  ARG A H    1 
ATOM 84    H HA   . ARG A 1 6  ? 13.823  -14.351 -48.664 1.00 0.00 ? 69  ARG A HA   1 
ATOM 85    H HB2  . ARG A 1 6  ? 15.122  -12.275 -48.566 1.00 0.00 ? 69  ARG A HB2  1 
ATOM 86    H HB3  . ARG A 1 6  ? 16.002  -12.894 -47.161 1.00 0.00 ? 69  ARG A HB3  1 
ATOM 87    H HG2  . ARG A 1 6  ? 17.067  -14.581 -48.463 1.00 0.00 ? 69  ARG A HG2  1 
ATOM 88    H HG3  . ARG A 1 6  ? 16.003  -14.267 -49.851 1.00 0.00 ? 69  ARG A HG3  1 
ATOM 89    H HD2  . ARG A 1 6  ? 18.102  -13.264 -50.309 1.00 0.00 ? 69  ARG A HD2  1 
ATOM 90    H HD3  . ARG A 1 6  ? 16.964  -11.957 -49.928 1.00 0.00 ? 69  ARG A HD3  1 
ATOM 91    H HE   . ARG A 1 6  ? 18.418  -12.852 -47.633 1.00 0.00 ? 69  ARG A HE   1 
ATOM 92    H HH11 . ARG A 1 6  ? 18.604  -10.802 -50.437 1.00 0.00 ? 69  ARG A HH11 1 
ATOM 93    H HH12 . ARG A 1 6  ? 19.789  -9.732  -49.744 1.00 0.00 ? 69  ARG A HH12 1 
ATOM 94    H HH21 . ARG A 1 6  ? 19.968  -11.459 -46.717 1.00 0.00 ? 69  ARG A HH21 1 
ATOM 95    H HH22 . ARG A 1 6  ? 20.556  -10.113 -47.632 1.00 0.00 ? 69  ARG A HH22 1 
ATOM 96    N N    . LEU A 1 7  ? 14.734  -16.452 -47.753 1.00 0.00 ? 70  LEU A N    1 
ATOM 97    C CA   . LEU A 1 7  ? 15.435  -17.666 -47.348 1.00 0.00 ? 70  LEU A CA   1 
ATOM 98    C C    . LEU A 1 7  ? 16.915  -17.592 -47.707 1.00 0.00 ? 70  LEU A C    1 
ATOM 99    O O    . LEU A 1 7  ? 17.281  -17.652 -48.880 1.00 0.00 ? 70  LEU A O    1 
ATOM 100   C CB   . LEU A 1 7  ? 14.801  -18.892 -48.017 1.00 0.00 ? 70  LEU A CB   1 
ATOM 101   C CG   . LEU A 1 7  ? 15.462  -20.239 -47.696 1.00 0.00 ? 70  LEU A CG   1 
ATOM 102   C CD1  . LEU A 1 7  ? 15.330  -20.528 -46.207 1.00 0.00 ? 70  LEU A CD1  1 
ATOM 103   C CD2  . LEU A 1 7  ? 14.808  -21.333 -48.527 1.00 0.00 ? 70  LEU A CD2  1 
ATOM 104   H H    . LEU A 1 7  ? 14.385  -16.396 -48.710 1.00 0.00 ? 70  LEU A H    1 
ATOM 105   H HA   . LEU A 1 7  ? 15.332  -17.741 -46.293 1.00 0.00 ? 70  LEU A HA   1 
ATOM 106   H HB2  . LEU A 1 7  ? 13.760  -18.956 -47.707 1.00 0.00 ? 70  LEU A HB2  1 
ATOM 107   H HB3  . LEU A 1 7  ? 14.833  -18.737 -49.096 1.00 0.00 ? 70  LEU A HB3  1 
ATOM 108   H HG   . LEU A 1 7  ? 16.518  -20.183 -47.953 1.00 0.00 ? 70  LEU A HG   1 
ATOM 109   H HD11 . LEU A 1 7  ? 15.693  -19.716 -45.604 1.00 0.00 ? 70  LEU A HD11 1 
ATOM 110   H HD12 . LEU A 1 7  ? 15.901  -21.428 -45.975 1.00 0.00 ? 70  LEU A HD12 1 
ATOM 111   H HD13 . LEU A 1 7  ? 14.291  -20.709 -46.005 1.00 0.00 ? 70  LEU A HD13 1 
ATOM 112   H HD21 . LEU A 1 7  ? 13.740  -21.363 -48.306 1.00 0.00 ? 70  LEU A HD21 1 
ATOM 113   H HD22 . LEU A 1 7  ? 15.257  -22.295 -48.278 1.00 0.00 ? 70  LEU A HD22 1 
ATOM 114   H HD23 . LEU A 1 7  ? 14.952  -21.129 -49.588 1.00 0.00 ? 70  LEU A HD23 1 
ATOM 115   N N    . GLU A 1 8  ? 17.758  -17.465 -46.688 1.00 0.00 ? 71  GLU A N    1 
ATOM 116   C CA   . GLU A 1 8  ? 19.200  -17.403 -46.893 1.00 0.00 ? 71  GLU A CA   1 
ATOM 117   C C    . GLU A 1 8  ? 19.748  -18.743 -47.368 1.00 0.00 ? 71  GLU A C    1 
ATOM 118   O O    . GLU A 1 8  ? 18.998  -19.704 -47.542 1.00 0.00 ? 71  GLU A O    1 
ATOM 119   C CB   . GLU A 1 8  ? 19.905  -16.982 -45.600 1.00 0.00 ? 71  GLU A CB   1 
ATOM 120   C CG   . GLU A 1 8  ? 19.467  -15.629 -45.059 1.00 0.00 ? 71  GLU A CG   1 
ATOM 121   C CD   . GLU A 1 8  ? 19.877  -14.483 -45.941 1.00 0.00 ? 71  GLU A CD   1 
ATOM 122   O OE1  . GLU A 1 8  ? 20.795  -14.647 -46.708 1.00 0.00 ? 71  GLU A OE1  1 
ATOM 123   O OE2  . GLU A 1 8  ? 19.273  -13.441 -45.848 1.00 0.00 ? 71  GLU A OE2  1 
ATOM 124   H H    . GLU A 1 8  ? 17.391  -17.412 -45.745 1.00 0.00 ? 71  GLU A H    1 
ATOM 125   H HA   . GLU A 1 8  ? 19.405  -16.654 -47.657 1.00 0.00 ? 71  GLU A HA   1 
ATOM 126   H HB2  . GLU A 1 8  ? 19.720  -17.743 -44.857 1.00 0.00 ? 71  GLU A HB2  1 
ATOM 127   H HB3  . GLU A 1 8  ? 20.977  -16.933 -45.793 1.00 0.00 ? 71  GLU A HB3  1 
ATOM 128   H HG2  . GLU A 1 8  ? 18.381  -15.632 -44.979 1.00 0.00 ? 71  GLU A HG2  1 
ATOM 129   H HG3  . GLU A 1 8  ? 19.894  -15.488 -44.065 1.00 0.00 ? 71  GLU A HG3  1 
ATOM 130   N N    . LYS A 1 9  ? 21.060  -18.803 -47.572 1.00 0.00 ? 72  LYS A N    1 
ATOM 131   C CA   . LYS A 1 9  ? 21.717  -20.040 -47.977 1.00 0.00 ? 72  LYS A CA   1 
ATOM 132   C C    . LYS A 1 9  ? 20.971  -21.257 -47.446 1.00 0.00 ? 72  LYS A C    1 
ATOM 133   O O    . LYS A 1 9  ? 20.510  -22.100 -48.218 1.00 0.00 ? 72  LYS A O    1 
ATOM 134   C CB   . LYS A 1 9  ? 23.167  -20.057 -47.490 1.00 0.00 ? 72  LYS A CB   1 
ATOM 135   C CG   . LYS A 1 9  ? 23.949  -21.301 -47.891 1.00 0.00 ? 72  LYS A CG   1 
ATOM 136   C CD   . LYS A 1 9  ? 25.392  -21.225 -47.416 1.00 0.00 ? 72  LYS A CD   1 
ATOM 137   C CE   . LYS A 1 9  ? 26.165  -22.483 -47.782 1.00 0.00 ? 72  LYS A CE   1 
ATOM 138   N NZ   . LYS A 1 9  ? 27.576  -22.426 -47.315 1.00 0.00 ? 72  LYS A NZ   1 
ATOM 139   H H    . LYS A 1 9  ? 21.627  -17.971 -47.403 1.00 0.00 ? 72  LYS A H    1 
ATOM 140   H HA   . LYS A 1 9  ? 21.725  -20.083 -49.064 1.00 0.00 ? 72  LYS A HA   1 
ATOM 141   H HB2  . LYS A 1 9  ? 23.681  -19.185 -47.890 1.00 0.00 ? 72  LYS A HB2  1 
ATOM 142   H HB3  . LYS A 1 9  ? 23.159  -19.989 -46.400 1.00 0.00 ? 72  LYS A HB3  1 
ATOM 143   H HG2  . LYS A 1 9  ? 23.474  -22.178 -47.451 1.00 0.00 ? 72  LYS A HG2  1 
ATOM 144   H HG3  . LYS A 1 9  ? 23.939  -21.390 -48.977 1.00 0.00 ? 72  LYS A HG3  1 
ATOM 145   H HD2  . LYS A 1 9  ? 25.874  -20.363 -47.876 1.00 0.00 ? 72  LYS A HD2  1 
ATOM 146   H HD3  . LYS A 1 9  ? 25.402  -21.105 -46.331 1.00 0.00 ? 72  LYS A HD3  1 
ATOM 147   H HE2  . LYS A 1 9  ? 25.676  -23.342 -47.324 1.00 0.00 ? 72  LYS A HE2  1 
ATOM 148   H HE3  . LYS A 1 9  ? 26.152  -22.600 -48.866 1.00 0.00 ? 72  LYS A HE3  1 
ATOM 149   H HZ1  . LYS A 1 9  ? 27.861  -23.351 -46.935 1.00 0.00 ? 72  LYS A HZ1  1 
ATOM 150   H HZ2  . LYS A 1 9  ? 27.659  -21.704 -46.568 1.00 0.00 ? 72  LYS A HZ2  1 
ATOM 151   H HZ3  . LYS A 1 9  ? 28.177  -22.180 -48.089 1.00 0.00 ? 72  LYS A HZ3  1 
ATOM 152   N N    . ASP A 1 10 ? 20.855  -21.345 -46.126 1.00 0.00 ? 73  ASP A N    1 
ATOM 153   C CA   . ASP A 1 10 ? 20.097  -22.418 -45.494 1.00 0.00 ? 73  ASP A CA   1 
ATOM 154   C C    . ASP A 1 10 ? 19.420  -21.936 -44.216 1.00 0.00 ? 73  ASP A C    1 
ATOM 155   O O    . ASP A 1 10 ? 19.477  -22.602 -43.182 1.00 0.00 ? 73  ASP A O    1 
ATOM 156   C CB   . ASP A 1 10 ? 21.009  -23.606 -45.178 1.00 0.00 ? 73  ASP A CB   1 
ATOM 157   C CG   . ASP A 1 10 ? 22.121  -23.253 -44.199 1.00 0.00 ? 73  ASP A CG   1 
ATOM 158   O OD1  . ASP A 1 10 ? 22.201  -22.115 -43.803 1.00 0.00 ? 73  ASP A OD1  1 
ATOM 159   O OD2  . ASP A 1 10 ? 22.882  -24.127 -43.855 1.00 0.00 ? 73  ASP A OD2  1 
ATOM 160   H H    . ASP A 1 10 ? 21.245  -20.604 -45.544 1.00 0.00 ? 73  ASP A H    1 
ATOM 161   H HA   . ASP A 1 10 ? 19.319  -22.751 -46.182 1.00 0.00 ? 73  ASP A HA   1 
ATOM 162   H HB2  . ASP A 1 10 ? 20.410  -24.408 -44.749 1.00 0.00 ? 73  ASP A HB2  1 
ATOM 163   H HB3  . ASP A 1 10 ? 21.459  -23.957 -46.107 1.00 0.00 ? 73  ASP A HB3  1 
ATOM 164   N N    . ARG A 1 11 ? 18.778  -20.775 -44.295 1.00 0.00 ? 74  ARG A N    1 
ATOM 165   C CA   . ARG A 1 11 ? 18.167  -20.157 -43.125 1.00 0.00 ? 74  ARG A CA   1 
ATOM 166   C C    . ARG A 1 11 ? 17.117  -19.129 -43.529 1.00 0.00 ? 74  ARG A C    1 
ATOM 167   O O    . ARG A 1 11 ? 17.389  -18.234 -44.329 1.00 0.00 ? 74  ARG A O    1 
ATOM 168   C CB   . ARG A 1 11 ? 19.223  -19.485 -42.260 1.00 0.00 ? 74  ARG A CB   1 
ATOM 169   C CG   . ARG A 1 11 ? 18.698  -18.864 -40.976 1.00 0.00 ? 74  ARG A CG   1 
ATOM 170   C CD   . ARG A 1 11 ? 19.803  -18.368 -40.116 1.00 0.00 ? 74  ARG A CD   1 
ATOM 171   N NE   . ARG A 1 11 ? 19.308  -17.805 -38.870 1.00 0.00 ? 74  ARG A NE   1 
ATOM 172   C CZ   . ARG A 1 11 ? 20.085  -17.272 -37.908 1.00 0.00 ? 74  ARG A CZ   1 
ATOM 173   N NH1  . ARG A 1 11 ? 21.391  -17.236 -38.064 1.00 0.00 ? 74  ARG A NH1  1 
ATOM 174   N NH2  . ARG A 1 11 ? 19.539  -16.785 -36.808 1.00 0.00 ? 74  ARG A NH2  1 
ATOM 175   H H    . ARG A 1 11 ? 18.778  -20.267 -45.180 1.00 0.00 ? 74  ARG A H    1 
ATOM 176   H HA   . ARG A 1 11 ? 17.685  -20.931 -42.566 1.00 0.00 ? 74  ARG A HA   1 
ATOM 177   H HB2  . ARG A 1 11 ? 19.956  -20.241 -41.980 1.00 0.00 ? 74  ARG A HB2  1 
ATOM 178   H HB3  . ARG A 1 11 ? 19.725  -18.719 -42.838 1.00 0.00 ? 74  ARG A HB3  1 
ATOM 179   H HG2  . ARG A 1 11 ? 18.056  -18.026 -41.238 1.00 0.00 ? 74  ARG A HG2  1 
ATOM 180   H HG3  . ARG A 1 11 ? 18.128  -19.584 -40.417 1.00 0.00 ? 74  ARG A HG3  1 
ATOM 181   H HD2  . ARG A 1 11 ? 20.472  -19.197 -39.888 1.00 0.00 ? 74  ARG A HD2  1 
ATOM 182   H HD3  . ARG A 1 11 ? 20.354  -17.597 -40.655 1.00 0.00 ? 74  ARG A HD3  1 
ATOM 183   H HE   . ARG A 1 11 ? 18.339  -17.816 -38.720 1.00 0.00 ? 74  ARG A HE   1 
ATOM 184   H HH11 . ARG A 1 11 ? 21.807  -17.605 -38.895 1.00 0.00 ? 74  ARG A HH11 1 
ATOM 185   H HH12 . ARG A 1 11 ? 21.974  -16.835 -37.343 1.00 0.00 ? 74  ARG A HH12 1 
ATOM 186   H HH21 . ARG A 1 11 ? 18.546  -16.812 -36.684 1.00 0.00 ? 74  ARG A HH21 1 
ATOM 187   H HH22 . ARG A 1 11 ? 20.120  -16.391 -36.098 1.00 0.00 ? 74  ARG A HH22 1 
ATOM 188   N N    . PHE A 1 12 ? 15.919  -19.264 -42.973 1.00 0.00 ? 75  PHE A N    1 
ATOM 189   C CA   . PHE A 1 12 ? 14.814  -18.374 -43.308 1.00 0.00 ? 75  PHE A CA   1 
ATOM 190   C C    . PHE A 1 12 ? 14.688  -17.246 -42.290 1.00 0.00 ? 75  PHE A C    1 
ATOM 191   O O    . PHE A 1 12 ? 14.443  -17.488 -41.110 1.00 0.00 ? 75  PHE A O    1 
ATOM 192   C CB   . PHE A 1 12 ? 13.499  -19.154 -43.378 1.00 0.00 ? 75  PHE A CB   1 
ATOM 193   C CG   . PHE A 1 12 ? 12.281  -18.281 -43.470 1.00 0.00 ? 75  PHE A CG   1 
ATOM 194   C CD1  . PHE A 1 12 ? 11.645  -17.829 -42.325 1.00 0.00 ? 75  PHE A CD1  1 
ATOM 195   C CD2  . PHE A 1 12 ? 11.769  -17.909 -44.704 1.00 0.00 ? 75  PHE A CD2  1 
ATOM 196   C CE1  . PHE A 1 12 ? 10.523  -17.028 -42.408 1.00 0.00 ? 75  PHE A CE1  1 
ATOM 197   C CE2  . PHE A 1 12 ? 10.647  -17.106 -44.790 1.00 0.00 ? 75  PHE A CE2  1 
ATOM 198   C CZ   . PHE A 1 12 ? 10.023  -16.667 -43.642 1.00 0.00 ? 75  PHE A CZ   1 
ATOM 199   H H    . PHE A 1 12 ? 15.757  -20.034 -42.325 1.00 0.00 ? 75  PHE A H    1 
ATOM 200   H HA   . PHE A 1 12 ? 14.985  -17.926 -44.265 1.00 0.00 ? 75  PHE A HA   1 
ATOM 201   H HB2  . PHE A 1 12 ? 13.528  -19.795 -44.230 1.00 0.00 ? 75  PHE A HB2  1 
ATOM 202   H HB3  . PHE A 1 12 ? 13.422  -19.759 -42.489 1.00 0.00 ? 75  PHE A HB3  1 
ATOM 203   H HD1  . PHE A 1 12 ? 12.033  -18.111 -41.357 1.00 0.00 ? 75  PHE A HD1  1 
ATOM 204   H HD2  . PHE A 1 12 ? 12.259  -18.244 -45.605 1.00 0.00 ? 75  PHE A HD2  1 
ATOM 205   H HE1  . PHE A 1 12 ? 10.035  -16.686 -41.505 1.00 0.00 ? 75  PHE A HE1  1 
ATOM 206   H HE2  . PHE A 1 12 ? 10.257  -16.826 -45.758 1.00 0.00 ? 75  PHE A HE2  1 
ATOM 207   H HZ   . PHE A 1 12 ? 9.025   -16.271 -43.713 1.00 0.00 ? 75  PHE A HZ   1 
ATOM 208   N N    . SER A 1 13 ? 14.855  -16.013 -42.757 1.00 0.00 ? 76  SER A N    1 
ATOM 209   C CA   . SER A 1 13 ? 14.809  -14.850 -41.880 1.00 0.00 ? 76  SER A CA   1 
ATOM 210   C C    . SER A 1 13 ? 13.927  -13.755 -42.463 1.00 0.00 ? 76  SER A C    1 
ATOM 211   O O    . SER A 1 13 ? 13.836  -13.600 -43.680 1.00 0.00 ? 76  SER A O    1 
ATOM 212   C CB   . SER A 1 13 ? 16.212  -14.315 -41.650 1.00 0.00 ? 76  SER A CB   1 
ATOM 213   O OG   . SER A 1 13 ? 16.786  -13.881 -42.852 1.00 0.00 ? 76  SER A OG   1 
ATOM 214   H H    . SER A 1 13 ? 15.058  -15.882 -43.749 1.00 0.00 ? 76  SER A H    1 
ATOM 215   H HA   . SER A 1 13 ? 14.394  -15.126 -40.935 1.00 0.00 ? 76  SER A HA   1 
ATOM 216   H HB2  . SER A 1 13 ? 16.168  -13.477 -40.959 1.00 0.00 ? 76  SER A HB2  1 
ATOM 217   H HB3  . SER A 1 13 ? 16.822  -15.106 -41.211 1.00 0.00 ? 76  SER A HB3  1 
ATOM 218   H HG   . SER A 1 13 ? 16.372  -14.369 -43.566 1.00 0.00 ? 76  SER A HG   1 
ATOM 219   N N    . VAL A 1 14 ? 13.278  -12.995 -41.587 1.00 0.00 ? 77  VAL A N    1 
ATOM 220   C CA   . VAL A 1 14 ? 12.414  -11.902 -42.014 1.00 0.00 ? 77  VAL A CA   1 
ATOM 221   C C    . VAL A 1 14 ? 12.573  -10.689 -41.107 1.00 0.00 ? 77  VAL A C    1 
ATOM 222   O O    . VAL A 1 14 ? 12.627  -10.818 -39.884 1.00 0.00 ? 77  VAL A O    1 
ATOM 223   C CB   . VAL A 1 14 ? 10.940  -12.352 -42.008 1.00 0.00 ? 77  VAL A CB   1 
ATOM 224   C CG1  . VAL A 1 14 ? 10.033  -11.204 -42.427 1.00 0.00 ? 77  VAL A CG1  1 
ATOM 225   C CG2  . VAL A 1 14 ? 10.761  -13.546 -42.934 1.00 0.00 ? 77  VAL A CG2  1 
ATOM 226   H H    . VAL A 1 14 ? 13.399  -13.172 -40.590 1.00 0.00 ? 77  VAL A H    1 
ATOM 227   H HA   . VAL A 1 14 ? 12.675  -11.605 -43.031 1.00 0.00 ? 77  VAL A HA   1 
ATOM 228   H HB   . VAL A 1 14 ? 10.690  -12.632 -40.996 1.00 0.00 ? 77  VAL A HB   1 
ATOM 229   H HG11 . VAL A 1 14 ? 10.020  -11.140 -43.515 1.00 0.00 ? 77  VAL A HG11 1 
ATOM 230   H HG12 . VAL A 1 14 ? 10.370  -10.263 -42.028 1.00 0.00 ? 77  VAL A HG12 1 
ATOM 231   H HG13 . VAL A 1 14 ? 9.020   -11.401 -42.074 1.00 0.00 ? 77  VAL A HG13 1 
ATOM 232   H HG21 . VAL A 1 14 ? 9.773   -13.523 -43.401 1.00 0.00 ? 77  VAL A HG21 1 
ATOM 233   H HG22 . VAL A 1 14 ? 10.855  -14.459 -42.353 1.00 0.00 ? 77  VAL A HG22 1 
ATOM 234   H HG23 . VAL A 1 14 ? 11.521  -13.542 -43.702 1.00 0.00 ? 77  VAL A HG23 1 
ATOM 235   N N    . ASN A 1 15 ? 12.651  -9.508  -41.714 1.00 0.00 ? 78  ASN A N    1 
ATOM 236   C CA   . ASN A 1 15 ? 12.504  -8.258  -40.979 1.00 0.00 ? 78  ASN A CA   1 
ATOM 237   C C    . ASN A 1 15 ? 11.149  -7.616  -41.249 1.00 0.00 ? 78  ASN A C    1 
ATOM 238   O O    . ASN A 1 15 ? 10.604  -7.734  -42.347 1.00 0.00 ? 78  ASN A O    1 
ATOM 239   C CB   . ASN A 1 15 ? 13.628  -7.298  -41.327 1.00 0.00 ? 78  ASN A CB   1 
ATOM 240   C CG   . ASN A 1 15 ? 14.960  -7.756  -40.800 1.00 0.00 ? 78  ASN A CG   1 
ATOM 241   O OD1  . ASN A 1 15 ? 15.037  -8.405  -39.752 1.00 0.00 ? 78  ASN A OD1  1 
ATOM 242   N ND2  . ASN A 1 15 ? 16.011  -7.429  -41.508 1.00 0.00 ? 78  ASN A ND2  1 
ATOM 243   H H    . ASN A 1 15 ? 12.556  -9.479  -42.729 1.00 0.00 ? 78  ASN A H    1 
ATOM 244   H HA   . ASN A 1 15 ? 12.566  -8.467  -39.905 1.00 0.00 ? 78  ASN A HA   1 
ATOM 245   H HB2  . ASN A 1 15 ? 13.681  -7.193  -42.411 1.00 0.00 ? 78  ASN A HB2  1 
ATOM 246   H HB3  . ASN A 1 15 ? 13.394  -6.338  -40.879 1.00 0.00 ? 78  ASN A HB3  1 
ATOM 247   H HD21 . ASN A 1 15 ? 15.911  -6.886  -42.366 1.00 0.00 ? 78  ASN A HD21 1 
ATOM 248   H HD22 . ASN A 1 15 ? 16.937  -7.721  -41.194 1.00 0.00 ? 78  ASN A HD22 1 
ATOM 249   N N    . LEU A 1 16 ? 10.611  -6.936  -40.243 1.00 0.00 ? 79  LEU A N    1 
ATOM 250   C CA   . LEU A 1 16 ? 9.258   -6.397  -40.319 1.00 0.00 ? 79  LEU A CA   1 
ATOM 251   C C    . LEU A 1 16 ? 9.164   -5.044  -39.625 1.00 0.00 ? 79  LEU A C    1 
ATOM 252   O O    . LEU A 1 16 ? 9.843   -4.797  -38.629 1.00 0.00 ? 79  LEU A O    1 
ATOM 253   C CB   . LEU A 1 16 ? 8.262   -7.375  -39.684 1.00 0.00 ? 79  LEU A CB   1 
ATOM 254   C CG   . LEU A 1 16 ? 8.106   -8.723  -40.400 1.00 0.00 ? 79  LEU A CG   1 
ATOM 255   C CD1  . LEU A 1 16 ? 7.352   -9.692  -39.498 1.00 0.00 ? 79  LEU A CD1  1 
ATOM 256   C CD2  . LEU A 1 16 ? 7.373   -8.518  -41.717 1.00 0.00 ? 79  LEU A CD2  1 
ATOM 257   H H    . LEU A 1 16 ? 11.104  -6.892  -39.350 1.00 0.00 ? 79  LEU A H    1 
ATOM 258   H HA   . LEU A 1 16 ? 8.976   -6.270  -41.362 1.00 0.00 ? 79  LEU A HA   1 
ATOM 259   H HB2  . LEU A 1 16 ? 8.639   -7.583  -38.709 1.00 0.00 ? 79  LEU A HB2  1 
ATOM 260   H HB3  . LEU A 1 16 ? 7.286   -6.897  -39.593 1.00 0.00 ? 79  LEU A HB3  1 
ATOM 261   H HG   . LEU A 1 16 ? 9.093   -9.128  -40.583 1.00 0.00 ? 79  LEU A HG   1 
ATOM 262   H HD11 . LEU A 1 16 ? 6.363   -9.281  -39.295 1.00 0.00 ? 79  LEU A HD11 1 
ATOM 263   H HD12 . LEU A 1 16 ? 7.890   -9.822  -38.560 1.00 0.00 ? 79  LEU A HD12 1 
ATOM 264   H HD13 . LEU A 1 16 ? 7.251   -10.649 -39.998 1.00 0.00 ? 79  LEU A HD13 1 
ATOM 265   H HD21 . LEU A 1 16 ? 6.865   -9.440  -42.005 1.00 0.00 ? 79  LEU A HD21 1 
ATOM 266   H HD22 . LEU A 1 16 ? 8.091   -8.251  -42.494 1.00 0.00 ? 79  LEU A HD22 1 
ATOM 267   H HD23 . LEU A 1 16 ? 6.646   -7.719  -41.624 1.00 0.00 ? 79  LEU A HD23 1 
ATOM 268   N N    . ASP A 1 17 ? 8.317   -4.170  -40.158 1.00 0.00 ? 80  ASP A N    1 
ATOM 269   C CA   . ASP A 1 17 ? 8.152   -2.831  -39.605 1.00 0.00 ? 80  ASP A CA   1 
ATOM 270   C C    . ASP A 1 17 ? 7.204   -2.839  -38.414 1.00 0.00 ? 80  ASP A C    1 
ATOM 271   O O    . ASP A 1 17 ? 6.008   -3.100  -38.560 1.00 0.00 ? 80  ASP A O    1 
ATOM 272   C CB   . ASP A 1 17 ? 7.627   -1.870  -40.676 1.00 0.00 ? 80  ASP A CB   1 
ATOM 273   C CG   . ASP A 1 17 ? 7.388   -0.462  -40.144 1.00 0.00 ? 80  ASP A CG   1 
ATOM 274   O OD1  . ASP A 1 17 ? 7.482   -0.275  -38.954 1.00 0.00 ? 80  ASP A OD1  1 
ATOM 275   O OD2  . ASP A 1 17 ? 7.112   0.409   -40.934 1.00 0.00 ? 80  ASP A OD2  1 
ATOM 276   H H    . ASP A 1 17 ? 7.786   -4.433  -40.989 1.00 0.00 ? 80  ASP A H    1 
ATOM 277   H HA   . ASP A 1 17 ? 9.123   -2.462  -39.269 1.00 0.00 ? 80  ASP A HA   1 
ATOM 278   H HB2  . ASP A 1 17 ? 8.352   -1.819  -41.488 1.00 0.00 ? 80  ASP A HB2  1 
ATOM 279   H HB3  . ASP A 1 17 ? 6.688   -2.262  -41.067 1.00 0.00 ? 80  ASP A HB3  1 
ATOM 280   N N    . VAL A 1 18 ? 7.741   -2.551  -37.234 1.00 0.00 ? 81  VAL A N    1 
ATOM 281   C CA   . VAL A 1 18 ? 6.918   -2.325  -36.052 1.00 0.00 ? 81  VAL A CA   1 
ATOM 282   C C    . VAL A 1 18 ? 7.383   -1.090  -35.287 1.00 0.00 ? 81  VAL A C    1 
ATOM 283   O O    . VAL A 1 18 ? 7.508   -1.119  -34.063 1.00 0.00 ? 81  VAL A O    1 
ATOM 284   C CB   . VAL A 1 18 ? 6.969   -3.551  -35.120 1.00 0.00 ? 81  VAL A CB   1 
ATOM 285   C CG1  . VAL A 1 18 ? 6.110   -3.318  -33.887 1.00 0.00 ? 81  VAL A CG1  1 
ATOM 286   C CG2  . VAL A 1 18 ? 6.513   -4.790  -35.873 1.00 0.00 ? 81  VAL A CG2  1 
ATOM 287   H H    . VAL A 1 18 ? 8.731   -2.309  -37.188 1.00 0.00 ? 81  VAL A H    1 
ATOM 288   H HA   . VAL A 1 18 ? 5.879   -2.174  -36.348 1.00 0.00 ? 81  VAL A HA   1 
ATOM 289   H HB   . VAL A 1 18 ? 8.007   -3.687  -34.824 1.00 0.00 ? 81  VAL A HB   1 
ATOM 290   H HG11 . VAL A 1 18 ? 5.637   -2.336  -33.914 1.00 0.00 ? 81  VAL A HG11 1 
ATOM 291   H HG12 . VAL A 1 18 ? 6.697   -3.396  -32.980 1.00 0.00 ? 81  VAL A HG12 1 
ATOM 292   H HG13 . VAL A 1 18 ? 5.318   -4.057  -33.852 1.00 0.00 ? 81  VAL A HG13 1 
ATOM 293   H HG21 . VAL A 1 18 ? 5.536   -4.601  -36.319 1.00 0.00 ? 81  VAL A HG21 1 
ATOM 294   H HG22 . VAL A 1 18 ? 7.230   -5.027  -36.658 1.00 0.00 ? 81  VAL A HG22 1 
ATOM 295   H HG23 . VAL A 1 18 ? 6.442   -5.624  -35.189 1.00 0.00 ? 81  VAL A HG23 1 
ATOM 296   N N    . LYS A 1 19 ? 7.635   -0.010  -36.015 1.00 0.00 ? 82  LYS A N    1 
ATOM 297   C CA   . LYS A 1 19 ? 8.366   1.128   -35.470 1.00 0.00 ? 82  LYS A CA   1 
ATOM 298   C C    . LYS A 1 19 ? 7.470   1.984   -34.585 1.00 0.00 ? 82  LYS A C    1 
ATOM 299   O O    . LYS A 1 19 ? 7.942   2.632   -33.649 1.00 0.00 ? 82  LYS A O    1 
ATOM 300   C CB   . LYS A 1 19 ? 8.954   1.977   -36.599 1.00 0.00 ? 82  LYS A CB   1 
ATOM 301   C CG   . LYS A 1 19 ? 10.084  1.304   -37.369 1.00 0.00 ? 82  LYS A CG   1 
ATOM 302   C CD   . LYS A 1 19 ? 10.605  2.202   -38.482 1.00 0.00 ? 82  LYS A CD   1 
ATOM 303   C CE   . LYS A 1 19 ? 11.736  1.531   -39.249 1.00 0.00 ? 82  LYS A CE   1 
ATOM 304   N NZ   . LYS A 1 19 ? 12.242  2.389   -40.354 1.00 0.00 ? 82  LYS A NZ   1 
ATOM 305   H H    . LYS A 1 19 ? 7.546   -0.077  -37.030 1.00 0.00 ? 82  LYS A H    1 
ATOM 306   H HA   . LYS A 1 19 ? 9.186   0.799   -34.878 1.00 0.00 ? 82  LYS A HA   1 
ATOM 307   H HB2  . LYS A 1 19 ? 8.159   2.215   -37.306 1.00 0.00 ? 82  LYS A HB2  1 
ATOM 308   H HB3  . LYS A 1 19 ? 9.334   2.909   -36.173 1.00 0.00 ? 82  LYS A HB3  1 
ATOM 309   H HG2  . LYS A 1 19 ? 10.897  1.081   -36.678 1.00 0.00 ? 82  LYS A HG2  1 
ATOM 310   H HG3  . LYS A 1 19 ? 9.712   0.375   -37.803 1.00 0.00 ? 82  LYS A HG3  1 
ATOM 311   H HD2  . LYS A 1 19 ? 9.789   2.422   -39.172 1.00 0.00 ? 82  LYS A HD2  1 
ATOM 312   H HD3  . LYS A 1 19 ? 10.972  3.132   -38.049 1.00 0.00 ? 82  LYS A HD3  1 
ATOM 313   H HE2  . LYS A 1 19 ? 12.553  1.323   -38.561 1.00 0.00 ? 82  LYS A HE2  1 
ATOM 314   H HE3  . LYS A 1 19 ? 11.371  0.590   -39.666 1.00 0.00 ? 82  LYS A HE3  1 
ATOM 315   H HZ1  . LYS A 1 19 ? 11.879  2.036   -41.264 1.00 0.00 ? 82  LYS A HZ1  1 
ATOM 316   H HZ2  . LYS A 1 19 ? 13.283  2.370   -40.365 1.00 0.00 ? 82  LYS A HZ2  1 
ATOM 317   H HZ3  . LYS A 1 19 ? 11.927  3.338   -40.213 1.00 0.00 ? 82  LYS A HZ3  1 
ATOM 318   N N    . HIS A 1 20 ? 6.176   1.985   -34.884 1.00 0.00 ? 83  HIS A N    1 
ATOM 319   C CA   . HIS A 1 20 ? 5.274   3.016   -34.383 1.00 0.00 ? 83  HIS A CA   1 
ATOM 320   C C    . HIS A 1 20 ? 4.143   2.407   -33.565 1.00 0.00 ? 83  HIS A C    1 
ATOM 321   O O    . HIS A 1 20 ? 3.242   3.111   -33.112 1.00 0.00 ? 83  HIS A O    1 
ATOM 322   C CB   . HIS A 1 20 ? 4.690   3.834   -35.541 1.00 0.00 ? 83  HIS A CB   1 
ATOM 323   C CG   . HIS A 1 20 ? 5.727   4.521   -36.373 1.00 0.00 ? 83  HIS A CG   1 
ATOM 324   N ND1  . HIS A 1 20 ? 5.945   4.208   -37.698 1.00 0.00 ? 83  HIS A ND1  1 
ATOM 325   C CD2  . HIS A 1 20 ? 6.606   5.505   -36.070 1.00 0.00 ? 83  HIS A CD2  1 
ATOM 326   C CE1  . HIS A 1 20 ? 6.913   4.971   -38.175 1.00 0.00 ? 83  HIS A CE1  1 
ATOM 327   N NE2  . HIS A 1 20 ? 7.331   5.765   -37.207 1.00 0.00 ? 83  HIS A NE2  1 
ATOM 328   H H    . HIS A 1 20 ? 5.880   1.462   -35.710 1.00 0.00 ? 83  HIS A H    1 
ATOM 329   H HA   . HIS A 1 20 ? 5.821   3.704   -33.738 1.00 0.00 ? 83  HIS A HA   1 
ATOM 330   H HB2  . HIS A 1 20 ? 4.118   3.169   -36.183 1.00 0.00 ? 83  HIS A HB2  1 
ATOM 331   H HB3  . HIS A 1 20 ? 4.016   4.588   -35.128 1.00 0.00 ? 83  HIS A HB3  1 
ATOM 332   H HD2  . HIS A 1 20 ? 6.855   5.839   -35.073 1.00 0.00 ? 83  HIS A HD2  1 
ATOM 333   H HE1  . HIS A 1 20 ? 7.294   4.947   -39.185 1.00 0.00 ? 83  HIS A HE1  1 
ATOM 334   H HE2  . HIS A 1 20 ? 8.066   6.453   -37.290 1.00 0.00 ? 83  HIS A HE2  1 
ATOM 335   N N    . PHE A 1 21 ? 4.197   1.091   -33.377 1.00 0.00 ? 84  PHE A N    1 
ATOM 336   C CA   . PHE A 1 21 ? 3.208   0.393   -32.565 1.00 0.00 ? 84  PHE A CA   1 
ATOM 337   C C    . PHE A 1 21 ? 3.832   -0.785  -31.829 1.00 0.00 ? 84  PHE A C    1 
ATOM 338   O O    . PHE A 1 21 ? 5.031   -1.036  -31.946 1.00 0.00 ? 84  PHE A O    1 
ATOM 339   C CB   . PHE A 1 21 ? 2.051   -0.100  -33.437 1.00 0.00 ? 84  PHE A CB   1 
ATOM 340   C CG   . PHE A 1 21 ? 2.475   -1.035  -34.533 1.00 0.00 ? 84  PHE A CG   1 
ATOM 341   C CD1  . PHE A 1 21 ? 2.977   -0.545  -35.730 1.00 0.00 ? 84  PHE A CD1  1 
ATOM 342   C CD2  . PHE A 1 21 ? 2.374   -2.409  -34.370 1.00 0.00 ? 84  PHE A CD2  1 
ATOM 343   C CE1  . PHE A 1 21 ? 3.366   -1.404  -36.738 1.00 0.00 ? 84  PHE A CE1  1 
ATOM 344   C CE2  . PHE A 1 21 ? 2.764   -3.272  -35.377 1.00 0.00 ? 84  PHE A CE2  1 
ATOM 345   C CZ   . PHE A 1 21 ? 3.259   -2.769  -36.562 1.00 0.00 ? 84  PHE A CZ   1 
ATOM 346   H H    . PHE A 1 21 ? 4.980   0.572   -33.772 1.00 0.00 ? 84  PHE A H    1 
ATOM 347   H HA   . PHE A 1 21 ? 2.812   1.076   -31.808 1.00 0.00 ? 84  PHE A HA   1 
ATOM 348   H HB2  . PHE A 1 21 ? 1.314   -0.594  -32.805 1.00 0.00 ? 84  PHE A HB2  1 
ATOM 349   H HB3  . PHE A 1 21 ? 1.604   0.777   -33.890 1.00 0.00 ? 84  PHE A HB3  1 
ATOM 350   H HD1  . PHE A 1 21 ? 3.109   0.515   -35.860 1.00 0.00 ? 84  PHE A HD1  1 
ATOM 351   H HD2  . PHE A 1 21 ? 1.982   -2.806  -33.445 1.00 0.00 ? 84  PHE A HD2  1 
ATOM 352   H HE1  . PHE A 1 21 ? 3.754   -1.008  -37.666 1.00 0.00 ? 84  PHE A HE1  1 
ATOM 353   H HE2  . PHE A 1 21 ? 2.653   -4.324  -35.248 1.00 0.00 ? 84  PHE A HE2  1 
ATOM 354   H HZ   . PHE A 1 21 ? 3.597   -3.443  -37.334 1.00 0.00 ? 84  PHE A HZ   1 
ATOM 355   N N    . SER A 1 22 ? 3.013   -1.504  -31.070 1.00 0.00 ? 85  SER A N    1 
ATOM 356   C CA   . SER A 1 22 ? 3.499   -2.266  -29.926 1.00 0.00 ? 85  SER A CA   1 
ATOM 357   C C    . SER A 1 22 ? 3.019   -3.711  -29.982 1.00 0.00 ? 85  SER A C    1 
ATOM 358   O O    . SER A 1 22 ? 2.131   -4.049  -30.764 1.00 0.00 ? 85  SER A O    1 
ATOM 359   C CB   . SER A 1 22 ? 3.037   -1.620  -28.634 1.00 0.00 ? 85  SER A CB   1 
ATOM 360   O OG   . SER A 1 22 ? 3.592   -0.343  -28.485 1.00 0.00 ? 85  SER A OG   1 
ATOM 361   H H    . SER A 1 22 ? 2.055   -1.163  -30.998 1.00 0.00 ? 85  SER A H    1 
ATOM 362   H HA   . SER A 1 22 ? 4.579   -2.249  -29.930 1.00 0.00 ? 85  SER A HA   1 
ATOM 363   H HB2  . SER A 1 22 ? 1.959   -1.501  -28.682 1.00 0.00 ? 85  SER A HB2  1 
ATOM 364   H HB3  . SER A 1 22 ? 3.266   -2.224  -27.781 1.00 0.00 ? 85  SER A HB3  1 
ATOM 365   H HG   . SER A 1 22 ? 3.185   0.241   -29.130 1.00 0.00 ? 85  SER A HG   1 
ATOM 366   N N    . PRO A 1 23 ? 3.613   -4.559  -29.148 1.00 0.00 ? 86  PRO A N    1 
ATOM 367   C CA   . PRO A 1 23 ? 3.215   -5.958  -29.068 1.00 0.00 ? 86  PRO A CA   1 
ATOM 368   C C    . PRO A 1 23 ? 1.711   -6.094  -28.860 1.00 0.00 ? 86  PRO A C    1 
ATOM 369   O O    . PRO A 1 23 ? 1.099   -7.068  -29.300 1.00 0.00 ? 86  PRO A O    1 
ATOM 370   C CB   . PRO A 1 23 ? 4.000   -6.471  -27.856 1.00 0.00 ? 86  PRO A CB   1 
ATOM 371   C CG   . PRO A 1 23 ? 5.234   -5.636  -27.839 1.00 0.00 ? 86  PRO A CG   1 
ATOM 372   C CD   . PRO A 1 23 ? 4.761   -4.263  -28.237 1.00 0.00 ? 86  PRO A CD   1 
ATOM 373   H HA   . PRO A 1 23 ? 3.540   -6.502  -29.935 1.00 0.00 ? 86  PRO A HA   1 
ATOM 374   H HB2  . PRO A 1 23 ? 3.426   -6.313  -26.936 1.00 0.00 ? 86  PRO A HB2  1 
ATOM 375   H HB3  . PRO A 1 23 ? 4.253   -7.527  -27.970 1.00 0.00 ? 86  PRO A HB3  1 
ATOM 376   H HG2  . PRO A 1 23 ? 5.681   -5.630  -26.839 1.00 0.00 ? 86  PRO A HG2  1 
ATOM 377   H HG3  . PRO A 1 23 ? 5.946   -6.013  -28.572 1.00 0.00 ? 86  PRO A HG3  1 
ATOM 378   H HD2  . PRO A 1 23 ? 4.450   -3.733  -27.344 1.00 0.00 ? 86  PRO A HD2  1 
ATOM 379   H HD3  . PRO A 1 23 ? 5.556   -3.733  -28.751 1.00 0.00 ? 86  PRO A HD3  1 
ATOM 380   N N    . GLU A 1 24 ? 1.121   -5.109  -28.191 1.00 0.00 ? 87  GLU A N    1 
ATOM 381   C CA   . GLU A 1 24 ? -0.300  -5.148  -27.867 1.00 0.00 ? 87  GLU A CA   1 
ATOM 382   C C    . GLU A 1 24 ? -1.154  -5.080  -29.127 1.00 0.00 ? 87  GLU A C    1 
ATOM 383   O O    . GLU A 1 24 ? -2.216  -5.698  -29.201 1.00 0.00 ? 87  GLU A O    1 
ATOM 384   C CB   . GLU A 1 24 ? -0.665  -3.994  -26.929 1.00 0.00 ? 87  GLU A CB   1 
ATOM 385   C CG   . GLU A 1 24 ? -0.071  -4.108  -25.533 1.00 0.00 ? 87  GLU A CG   1 
ATOM 386   C CD   . GLU A 1 24 ? -0.397  -2.924  -24.662 1.00 0.00 ? 87  GLU A CD   1 
ATOM 387   O OE1  . GLU A 1 24 ? -0.954  -1.977  -25.164 1.00 0.00 ? 87  GLU A OE1  1 
ATOM 388   O OE2  . GLU A 1 24 ? -0.087  -2.969  -23.495 1.00 0.00 ? 87  GLU A OE2  1 
ATOM 389   H H    . GLU A 1 24 ? 1.691   -4.338  -27.843 1.00 0.00 ? 87  GLU A H    1 
ATOM 390   H HA   . GLU A 1 24 ? -0.520  -6.080  -27.350 1.00 0.00 ? 87  GLU A HA   1 
ATOM 391   H HB2  . GLU A 1 24 ? -0.309  -3.064  -27.373 1.00 0.00 ? 87  GLU A HB2  1 
ATOM 392   H HB3  . GLU A 1 24 ? -1.750  -3.948  -26.835 1.00 0.00 ? 87  GLU A HB3  1 
ATOM 393   H HG2  . GLU A 1 24 ? -0.466  -5.008  -25.064 1.00 0.00 ? 87  GLU A HG2  1 
ATOM 394   H HG3  . GLU A 1 24 ? 1.011   -4.196  -25.622 1.00 0.00 ? 87  GLU A HG3  1 
ATOM 395   N N    . GLU A 1 25 ? -0.682  -4.328  -30.116 1.00 0.00 ? 88  GLU A N    1 
ATOM 396   C CA   . GLU A 1 25 ? -1.378  -4.219  -31.393 1.00 0.00 ? 88  GLU A CA   1 
ATOM 397   C C    . GLU A 1 25 ? -0.691  -5.054  -32.467 1.00 0.00 ? 88  GLU A C    1 
ATOM 398   O O    . GLU A 1 25 ? -1.189  -5.173  -33.585 1.00 0.00 ? 88  GLU A O    1 
ATOM 399   C CB   . GLU A 1 25 ? -1.449  -2.756  -31.839 1.00 0.00 ? 88  GLU A CB   1 
ATOM 400   C CG   . GLU A 1 25 ? -2.252  -1.854  -30.910 1.00 0.00 ? 88  GLU A CG   1 
ATOM 401   C CD   . GLU A 1 25 ? -2.304  -0.429  -31.380 1.00 0.00 ? 88  GLU A CD   1 
ATOM 402   O OE1  . GLU A 1 25 ? -1.808  -0.157  -32.447 1.00 0.00 ? 88  GLU A OE1  1 
ATOM 403   O OE2  . GLU A 1 25 ? -2.840  0.391   -30.672 1.00 0.00 ? 88  GLU A OE2  1 
ATOM 404   H H    . GLU A 1 25 ? 0.206   -3.845  -29.994 1.00 0.00 ? 88  GLU A H    1 
ATOM 405   H HA   . GLU A 1 25 ? -2.404  -4.581  -31.281 1.00 0.00 ? 88  GLU A HA   1 
ATOM 406   H HB2  . GLU A 1 25 ? -0.434  -2.366  -31.901 1.00 0.00 ? 88  GLU A HB2  1 
ATOM 407   H HB3  . GLU A 1 25 ? -1.905  -2.708  -32.805 1.00 0.00 ? 88  GLU A HB3  1 
ATOM 408   H HG2  . GLU A 1 25 ? -3.266  -2.243  -30.847 1.00 0.00 ? 88  GLU A HG2  1 
ATOM 409   H HG3  . GLU A 1 25 ? -1.797  -1.883  -29.919 1.00 0.00 ? 88  GLU A HG3  1 
ATOM 410   N N    . LEU A 1 26 ? 0.456   -5.627  -32.118 1.00 0.00 ? 89  LEU A N    1 
ATOM 411   C CA   . LEU A 1 26 ? 1.200   -6.472  -33.045 1.00 0.00 ? 89  LEU A CA   1 
ATOM 412   C C    . LEU A 1 26 ? 0.844   -7.942  -32.855 1.00 0.00 ? 89  LEU A C    1 
ATOM 413   O O    . LEU A 1 26 ? 1.391   -8.616  -31.982 1.00 0.00 ? 89  LEU A O    1 
ATOM 414   C CB   . LEU A 1 26 ? 2.708   -6.276  -32.846 1.00 0.00 ? 89  LEU A CB   1 
ATOM 415   C CG   . LEU A 1 26 ? 3.613   -7.249  -33.614 1.00 0.00 ? 89  LEU A CG   1 
ATOM 416   C CD1  . LEU A 1 26 ? 3.464   -7.010  -35.110 1.00 0.00 ? 89  LEU A CD1  1 
ATOM 417   C CD2  . LEU A 1 26 ? 5.056   -7.058  -33.171 1.00 0.00 ? 89  LEU A CD2  1 
ATOM 418   H H    . LEU A 1 26 ? 0.814   -5.489  -31.173 1.00 0.00 ? 89  LEU A H    1 
ATOM 419   H HA   . LEU A 1 26 ? 0.942   -6.177  -34.038 1.00 0.00 ? 89  LEU A HA   1 
ATOM 420   H HB2  . LEU A 1 26 ? 2.967   -5.266  -33.144 1.00 0.00 ? 89  LEU A HB2  1 
ATOM 421   H HB3  . LEU A 1 26 ? 2.907   -6.378  -31.806 1.00 0.00 ? 89  LEU A HB3  1 
ATOM 422   H HG   . LEU A 1 26 ? 3.299   -8.251  -33.393 1.00 0.00 ? 89  LEU A HG   1 
ATOM 423   H HD11 . LEU A 1 26 ? 3.998   -7.805  -35.629 1.00 0.00 ? 89  LEU A HD11 1 
ATOM 424   H HD12 . LEU A 1 26 ? 3.917   -6.062  -35.374 1.00 0.00 ? 89  LEU A HD12 1 
ATOM 425   H HD13 . LEU A 1 26 ? 2.439   -7.032  -35.410 1.00 0.00 ? 89  LEU A HD13 1 
ATOM 426   H HD21 . LEU A 1 26 ? 5.733   -7.387  -33.950 1.00 0.00 ? 89  LEU A HD21 1 
ATOM 427   H HD22 . LEU A 1 26 ? 5.234   -7.657  -32.277 1.00 0.00 ? 89  LEU A HD22 1 
ATOM 428   H HD23 . LEU A 1 26 ? 5.255   -6.023  -32.936 1.00 0.00 ? 89  LEU A HD23 1 
ATOM 429   N N    . LYS A 1 27 ? -0.073  -8.434  -33.680 1.00 0.00 ? 90  LYS A N    1 
ATOM 430   C CA   . LYS A 1 27 ? -0.613  -9.779  -33.514 1.00 0.00 ? 90  LYS A CA   1 
ATOM 431   C C    . LYS A 1 27 ? 0.124   -10.780 -34.393 1.00 0.00 ? 90  LYS A C    1 
ATOM 432   O O    . LYS A 1 27 ? -0.400  -11.228 -35.411 1.00 0.00 ? 90  LYS A O    1 
ATOM 433   C CB   . LYS A 1 27 ? -2.110  -9.798  -33.832 1.00 0.00 ? 90  LYS A CB   1 
ATOM 434   C CG   . LYS A 1 27 ? -2.962  -8.952  -32.898 1.00 0.00 ? 90  LYS A CG   1 
ATOM 435   C CD   . LYS A 1 27 ? -4.439  -9.054  -33.252 1.00 0.00 ? 90  LYS A CD   1 
ATOM 436   C CE   . LYS A 1 27 ? -5.292  -8.201  -32.326 1.00 0.00 ? 90  LYS A CE   1 
ATOM 437   N NZ   . LYS A 1 27 ? -6.738  -8.290  -32.664 1.00 0.00 ? 90  LYS A NZ   1 
ATOM 438   H H    . LYS A 1 27 ? -0.498  -7.815  -34.372 1.00 0.00 ? 90  LYS A H    1 
ATOM 439   H HA   . LYS A 1 27 ? -0.494  -10.093 -32.474 1.00 0.00 ? 90  LYS A HA   1 
ATOM 440   H HB2  . LYS A 1 27 ? -2.252  -9.421  -34.824 1.00 0.00 ? 90  LYS A HB2  1 
ATOM 441   H HB3  . LYS A 1 27 ? -2.449  -10.819 -33.789 1.00 0.00 ? 90  LYS A HB3  1 
ATOM 442   H HG2  . LYS A 1 27 ? -2.817  -9.304  -31.874 1.00 0.00 ? 90  LYS A HG2  1 
ATOM 443   H HG3  . LYS A 1 27 ? -2.649  -7.911  -32.970 1.00 0.00 ? 90  LYS A HG3  1 
ATOM 444   H HD2  . LYS A 1 27 ? -4.581  -8.717  -34.278 1.00 0.00 ? 90  LYS A HD2  1 
ATOM 445   H HD3  . LYS A 1 27 ? -4.755  -10.092 -33.167 1.00 0.00 ? 90  LYS A HD3  1 
ATOM 446   H HE2  . LYS A 1 27 ? -5.147  -8.539  -31.302 1.00 0.00 ? 90  LYS A HE2  1 
ATOM 447   H HE3  . LYS A 1 27 ? -4.971  -7.161  -32.408 1.00 0.00 ? 90  LYS A HE3  1 
ATOM 448   H HZ1  . LYS A 1 27 ? -7.088  -9.241  -32.435 1.00 0.00 ? 90  LYS A HZ1  1 
ATOM 449   H HZ2  . LYS A 1 27 ? -6.864  -8.108  -33.682 1.00 0.00 ? 90  LYS A HZ2  1 
ATOM 450   H HZ3  . LYS A 1 27 ? -7.252  -7.603  -32.131 1.00 0.00 ? 90  LYS A HZ3  1 
ATOM 451   N N    . VAL A 1 28 ? 1.342   -11.129 -33.992 1.00 0.00 ? 91  VAL A N    1 
ATOM 452   C CA   . VAL A 1 28 ? 2.109   -12.160 -34.677 1.00 0.00 ? 91  VAL A CA   1 
ATOM 453   C C    . VAL A 1 28 ? 1.389   -13.503 -34.630 1.00 0.00 ? 91  VAL A C    1 
ATOM 454   O O    . VAL A 1 28 ? 1.401   -14.189 -33.608 1.00 0.00 ? 91  VAL A O    1 
ATOM 455   C CB   . VAL A 1 28 ? 3.502   -12.307 -34.038 1.00 0.00 ? 91  VAL A CB   1 
ATOM 456   C CG1  . VAL A 1 28 ? 4.290   -13.411 -34.725 1.00 0.00 ? 91  VAL A CG1  1 
ATOM 457   C CG2  . VAL A 1 28 ? 4.248   -10.983 -34.114 1.00 0.00 ? 91  VAL A CG2  1 
ATOM 458   H H    . VAL A 1 28 ? 1.705   -10.734 -33.124 1.00 0.00 ? 91  VAL A H    1 
ATOM 459   H HA   . VAL A 1 28 ? 2.240   -11.862 -35.694 1.00 0.00 ? 91  VAL A HA   1 
ATOM 460   H HB   . VAL A 1 28 ? 3.371   -12.580 -32.989 1.00 0.00 ? 91  VAL A HB   1 
ATOM 461   H HG11 . VAL A 1 28 ? 5.322   -13.407 -34.369 1.00 0.00 ? 91  VAL A HG11 1 
ATOM 462   H HG12 . VAL A 1 28 ? 4.279   -13.242 -35.799 1.00 0.00 ? 91  VAL A HG12 1 
ATOM 463   H HG13 . VAL A 1 28 ? 3.842   -14.379 -34.506 1.00 0.00 ? 91  VAL A HG13 1 
ATOM 464   H HG21 . VAL A 1 28 ? 5.300   -11.147 -33.889 1.00 0.00 ? 91  VAL A HG21 1 
ATOM 465   H HG22 . VAL A 1 28 ? 3.833   -10.311 -33.382 1.00 0.00 ? 91  VAL A HG22 1 
ATOM 466   H HG23 . VAL A 1 28 ? 4.147   -10.561 -35.108 1.00 0.00 ? 91  VAL A HG23 1 
ATOM 467   N N    . LYS A 1 29 ? 0.763   -13.874 -35.742 1.00 0.00 ? 92  LYS A N    1 
ATOM 468   C CA   . LYS A 1 29 ? 0.037   -15.134 -35.830 1.00 0.00 ? 92  LYS A CA   1 
ATOM 469   C C    . LYS A 1 29 ? 0.629   -16.038 -36.905 1.00 0.00 ? 92  LYS A C    1 
ATOM 470   O O    . LYS A 1 29 ? 1.187   -15.559 -37.893 1.00 0.00 ? 92  LYS A O    1 
ATOM 471   C CB   . LYS A 1 29 ? -1.444  -14.880 -36.113 1.00 0.00 ? 92  LYS A CB   1 
ATOM 472   C CG   . LYS A 1 29 ? -2.191  -14.186 -34.983 1.00 0.00 ? 92  LYS A CG   1 
ATOM 473   C CD   . LYS A 1 29 ? -3.665  -14.011 -35.319 1.00 0.00 ? 92  LYS A CD   1 
ATOM 474   C CE   . LYS A 1 29 ? -4.414  -13.325 -34.186 1.00 0.00 ? 92  LYS A CE   1 
ATOM 475   N NZ   . LYS A 1 29 ? -5.864  -13.180 -34.485 1.00 0.00 ? 92  LYS A NZ   1 
ATOM 476   H H    . LYS A 1 29 ? 0.789   -13.263 -36.559 1.00 0.00 ? 92  LYS A H    1 
ATOM 477   H HA   . LYS A 1 29 ? 0.101   -15.663 -34.876 1.00 0.00 ? 92  LYS A HA   1 
ATOM 478   H HB2  . LYS A 1 29 ? -1.517  -14.258 -37.004 1.00 0.00 ? 92  LYS A HB2  1 
ATOM 479   H HB3  . LYS A 1 29 ? -1.930  -15.837 -36.313 1.00 0.00 ? 92  LYS A HB3  1 
ATOM 480   H HG2  . LYS A 1 29 ? -2.098  -14.787 -34.078 1.00 0.00 ? 92  LYS A HG2  1 
ATOM 481   H HG3  . LYS A 1 29 ? -1.744  -13.206 -34.812 1.00 0.00 ? 92  LYS A HG3  1 
ATOM 482   H HD2  . LYS A 1 29 ? -3.755  -13.404 -36.220 1.00 0.00 ? 92  LYS A HD2  1 
ATOM 483   H HD3  . LYS A 1 29 ? -4.107  -14.989 -35.500 1.00 0.00 ? 92  LYS A HD3  1 
ATOM 484   H HE2  . LYS A 1 29 ? -4.301  -13.917 -33.279 1.00 0.00 ? 92  LYS A HE2  1 
ATOM 485   H HE3  . LYS A 1 29 ? -3.995  -12.346 -34.023 1.00 0.00 ? 92  LYS A HE3  1 
ATOM 486   H HZ1  . LYS A 1 29 ? -6.216  -14.061 -34.914 1.00 0.00 ? 92  LYS A HZ1  1 
ATOM 487   H HZ2  . LYS A 1 29 ? -6.000  -12.392 -35.150 1.00 0.00 ? 92  LYS A HZ2  1 
ATOM 488   H HZ3  . LYS A 1 29 ? -6.369  -12.994 -33.631 1.00 0.00 ? 92  LYS A HZ3  1 
ATOM 489   N N    . VAL A 1 30 ? 0.501   -17.345 -36.708 1.00 0.00 ? 93  VAL A N    1 
ATOM 490   C CA   . VAL A 1 30 ? 0.854   -18.313 -37.739 1.00 0.00 ? 93  VAL A CA   1 
ATOM 491   C C    . VAL A 1 30 ? -0.278  -19.307 -37.973 1.00 0.00 ? 93  VAL A C    1 
ATOM 492   O O    . VAL A 1 30 ? -1.073  -19.578 -37.074 1.00 0.00 ? 93  VAL A O    1 
ATOM 493   C CB   . VAL A 1 30 ? 2.129   -19.078 -37.339 1.00 0.00 ? 93  VAL A CB   1 
ATOM 494   C CG1  . VAL A 1 30 ? 3.305   -18.121 -37.204 1.00 0.00 ? 93  VAL A CG1  1 
ATOM 495   C CG2  . VAL A 1 30 ? 1.896   -19.834 -36.041 1.00 0.00 ? 93  VAL A CG2  1 
ATOM 496   H H    . VAL A 1 30 ? 0.003   -17.672 -35.879 1.00 0.00 ? 93  VAL A H    1 
ATOM 497   H HA   . VAL A 1 30 ? 1.046   -17.792 -38.677 1.00 0.00 ? 93  VAL A HA   1 
ATOM 498   H HB   . VAL A 1 30 ? 2.360   -19.801 -38.127 1.00 0.00 ? 93  VAL A HB   1 
ATOM 499   H HG11 . VAL A 1 30 ? 2.981   -17.220 -36.683 1.00 0.00 ? 93  VAL A HG11 1 
ATOM 500   H HG12 . VAL A 1 30 ? 3.682   -17.859 -38.173 1.00 0.00 ? 93  VAL A HG12 1 
ATOM 501   H HG13 . VAL A 1 30 ? 4.104   -18.594 -36.631 1.00 0.00 ? 93  VAL A HG13 1 
ATOM 502   H HG21 . VAL A 1 30 ? 1.128   -20.590 -36.185 1.00 0.00 ? 93  VAL A HG21 1 
ATOM 503   H HG22 . VAL A 1 30 ? 1.571   -19.131 -35.272 1.00 0.00 ? 93  VAL A HG22 1 
ATOM 504   H HG23 . VAL A 1 30 ? 2.819   -20.317 -35.722 1.00 0.00 ? 93  VAL A HG23 1 
ATOM 505   N N    . LEU A 1 31 ? -0.344  -19.844 -39.185 1.00 0.00 ? 94  LEU A N    1 
ATOM 506   C CA   . LEU A 1 31 ? -1.368  -20.822 -39.534 1.00 0.00 ? 94  LEU A CA   1 
ATOM 507   C C    . LEU A 1 31 ? -0.765  -22.016 -40.262 1.00 0.00 ? 94  LEU A C    1 
ATOM 508   O O    . LEU A 1 31 ? -0.918  -22.157 -41.476 1.00 0.00 ? 94  LEU A O    1 
ATOM 509   C CB   . LEU A 1 31 ? -2.445  -20.172 -40.411 1.00 0.00 ? 94  LEU A CB   1 
ATOM 510   C CG   . LEU A 1 31 ? -3.228  -19.023 -39.761 1.00 0.00 ? 94  LEU A CG   1 
ATOM 511   C CD1  . LEU A 1 31 ? -4.058  -18.310 -40.820 1.00 0.00 ? 94  LEU A CD1  1 
ATOM 512   C CD2  . LEU A 1 31 ? -4.113  -19.576 -38.653 1.00 0.00 ? 94  LEU A CD2  1 
ATOM 513   H H    . LEU A 1 31 ? 0.348   -19.582 -39.887 1.00 0.00 ? 94  LEU A H    1 
ATOM 514   H HA   . LEU A 1 31 ? -1.841  -21.196 -38.625 1.00 0.00 ? 94  LEU A HA   1 
ATOM 515   H HB2  . LEU A 1 31 ? -2.000  -19.800 -41.311 1.00 0.00 ? 94  LEU A HB2  1 
ATOM 516   H HB3  . LEU A 1 31 ? -3.160  -20.946 -40.687 1.00 0.00 ? 94  LEU A HB3  1 
ATOM 517   H HG   . LEU A 1 31 ? -2.514  -18.319 -39.333 1.00 0.00 ? 94  LEU A HG   1 
ATOM 518   H HD11 . LEU A 1 31 ? -4.739  -19.021 -41.284 1.00 0.00 ? 94  LEU A HD11 1 
ATOM 519   H HD12 . LEU A 1 31 ? -3.402  -17.885 -41.580 1.00 0.00 ? 94  LEU A HD12 1 
ATOM 520   H HD13 . LEU A 1 31 ? -4.633  -17.511 -40.350 1.00 0.00 ? 94  LEU A HD13 1 
ATOM 521   H HD21 . LEU A 1 31 ? -3.512  -19.829 -37.782 1.00 0.00 ? 94  LEU A HD21 1 
ATOM 522   H HD22 . LEU A 1 31 ? -4.642  -20.464 -39.000 1.00 0.00 ? 94  LEU A HD22 1 
ATOM 523   H HD23 . LEU A 1 31 ? -4.843  -18.815 -38.372 1.00 0.00 ? 94  LEU A HD23 1 
ATOM 524   N N    . GLY A 1 32 ? -0.077  -22.873 -39.515 1.00 0.00 ? 95  GLY A N    1 
ATOM 525   C CA   . GLY A 1 32 ? 0.550   -24.059 -40.089 1.00 0.00 ? 95  GLY A CA   1 
ATOM 526   C C    . GLY A 1 32 ? 1.884   -23.716 -40.740 1.00 0.00 ? 95  GLY A C    1 
ATOM 527   O O    . GLY A 1 32 ? 2.881   -23.493 -40.053 1.00 0.00 ? 95  GLY A O    1 
ATOM 528   H H    . GLY A 1 32 ? 0.009   -22.702 -38.515 1.00 0.00 ? 95  GLY A H    1 
ATOM 529   H HA2  . GLY A 1 32 ? 0.717   -24.789 -39.298 1.00 0.00 ? 95  GLY A HA2  1 
ATOM 530   H HA3  . GLY A 1 32 ? -0.115  -24.489 -40.838 1.00 0.00 ? 95  GLY A HA3  1 
ATOM 531   N N    . ASP A 1 33 ? 1.895   -23.674 -42.067 1.00 0.00 ? 96  ASP A N    1 
ATOM 532   C CA   . ASP A 1 33 ? 3.046   -23.174 -42.807 1.00 0.00 ? 96  ASP A CA   1 
ATOM 533   C C    . ASP A 1 33 ? 2.850   -21.718 -43.211 1.00 0.00 ? 96  ASP A C    1 
ATOM 534   O O    . ASP A 1 33 ? 3.370   -21.271 -44.235 1.00 0.00 ? 96  ASP A O    1 
ATOM 535   C CB   . ASP A 1 33 ? 3.294   -24.025 -44.055 1.00 0.00 ? 96  ASP A CB   1 
ATOM 536   C CG   . ASP A 1 33 ? 2.123   -24.007 -45.030 1.00 0.00 ? 96  ASP A CG   1 
ATOM 537   O OD1  . ASP A 1 33 ? 1.085   -23.506 -44.668 1.00 0.00 ? 96  ASP A OD1  1 
ATOM 538   O OD2  . ASP A 1 33 ? 2.279   -24.493 -46.122 1.00 0.00 ? 96  ASP A OD2  1 
ATOM 539   H H    . ASP A 1 33 ? 1.024   -23.841 -42.572 1.00 0.00 ? 96  ASP A H    1 
ATOM 540   H HA   . ASP A 1 33 ? 3.925   -23.248 -42.172 1.00 0.00 ? 96  ASP A HA   1 
ATOM 541   H HB2  . ASP A 1 33 ? 4.179   -23.649 -44.567 1.00 0.00 ? 96  ASP A HB2  1 
ATOM 542   H HB3  . ASP A 1 33 ? 3.477   -25.056 -43.751 1.00 0.00 ? 96  ASP A HB3  1 
ATOM 543   N N    . VAL A 1 34 ? 2.099   -20.981 -42.402 1.00 0.00 ? 97  VAL A N    1 
ATOM 544   C CA   . VAL A 1 34 ? 1.783   -19.591 -42.705 1.00 0.00 ? 97  VAL A CA   1 
ATOM 545   C C    . VAL A 1 34 ? 2.199   -18.668 -41.564 1.00 0.00 ? 97  VAL A C    1 
ATOM 546   O O    . VAL A 1 34 ? 2.030   -19.003 -40.391 1.00 0.00 ? 97  VAL A O    1 
ATOM 547   C CB   . VAL A 1 34 ? 0.273   -19.429 -42.966 1.00 0.00 ? 97  VAL A CB   1 
ATOM 548   C CG1  . VAL A 1 34 ? -0.067  -17.973 -43.246 1.00 0.00 ? 97  VAL A CG1  1 
ATOM 549   C CG2  . VAL A 1 34 ? -0.149  -20.315 -44.126 1.00 0.00 ? 97  VAL A CG2  1 
ATOM 550   H H    . VAL A 1 34 ? 1.689   -21.411 -41.573 1.00 0.00 ? 97  VAL A H    1 
ATOM 551   H HA   . VAL A 1 34 ? 2.299   -19.278 -43.591 1.00 0.00 ? 97  VAL A HA   1 
ATOM 552   H HB   . VAL A 1 34 ? -0.226  -19.746 -42.072 1.00 0.00 ? 97  VAL A HB   1 
ATOM 553   H HG11 . VAL A 1 34 ? -1.066  -17.914 -43.674 1.00 0.00 ? 97  VAL A HG11 1 
ATOM 554   H HG12 . VAL A 1 34 ? 0.657   -17.564 -43.949 1.00 0.00 ? 97  VAL A HG12 1 
ATOM 555   H HG13 . VAL A 1 34 ? -0.034  -17.403 -42.319 1.00 0.00 ? 97  VAL A HG13 1 
ATOM 556   H HG21 . VAL A 1 34 ? -1.201  -20.578 -44.009 1.00 0.00 ? 97  VAL A HG21 1 
ATOM 557   H HG22 . VAL A 1 34 ? -0.024  -19.778 -45.066 1.00 0.00 ? 97  VAL A HG22 1 
ATOM 558   H HG23 . VAL A 1 34 ? 0.445   -21.229 -44.151 1.00 0.00 ? 97  VAL A HG23 1 
ATOM 559   N N    . ILE A 1 35 ? 2.742   -17.509 -41.915 1.00 0.00 ? 98  ILE A N    1 
ATOM 560   C CA   . ILE A 1 35 ? 3.102   -16.501 -40.925 1.00 0.00 ? 98  ILE A CA   1 
ATOM 561   C C    . ILE A 1 35 ? 2.322   -15.209 -41.147 1.00 0.00 ? 98  ILE A C    1 
ATOM 562   O O    . ILE A 1 35 ? 2.743   -14.344 -41.913 1.00 0.00 ? 98  ILE A O    1 
ATOM 563   C CB   . ILE A 1 35 ? 4.611   -16.204 -40.966 1.00 0.00 ? 98  ILE A CB   1 
ATOM 564   C CG1  . ILE A 1 35 ? 5.415   -17.495 -40.783 1.00 0.00 ? 98  ILE A CG1  1 
ATOM 565   C CG2  . ILE A 1 35 ? 4.983   -15.186 -39.899 1.00 0.00 ? 98  ILE A CG2  1 
ATOM 566   C CD1  . ILE A 1 35 ? 6.890   -17.341 -41.075 1.00 0.00 ? 98  ILE A CD1  1 
ATOM 567   H H    . ILE A 1 35 ? 2.840   -17.286 -42.905 1.00 0.00 ? 98  ILE A H    1 
ATOM 568   H HA   . ILE A 1 35 ? 2.854   -16.856 -39.934 1.00 0.00 ? 98  ILE A HA   1 
ATOM 569   H HB   . ILE A 1 35 ? 4.852   -15.782 -41.944 1.00 0.00 ? 98  ILE A HB   1 
ATOM 570   H HG12 . ILE A 1 35 ? 5.300   -17.844 -39.762 1.00 0.00 ? 98  ILE A HG12 1 
ATOM 571   H HG13 . ILE A 1 35 ? 5.006   -18.243 -41.453 1.00 0.00 ? 98  ILE A HG13 1 
ATOM 572   H HG21 . ILE A 1 35 ? 5.888   -14.657 -40.181 1.00 0.00 ? 98  ILE A HG21 1 
ATOM 573   H HG22 . ILE A 1 35 ? 5.154   -15.698 -38.951 1.00 0.00 ? 98  ILE A HG22 1 
ATOM 574   H HG23 . ILE A 1 35 ? 4.190   -14.463 -39.758 1.00 0.00 ? 98  ILE A HG23 1 
ATOM 575   H HD11 . ILE A 1 35 ? 7.045   -17.271 -42.151 1.00 0.00 ? 98  ILE A HD11 1 
ATOM 576   H HD12 . ILE A 1 35 ? 7.428   -18.206 -40.687 1.00 0.00 ? 98  ILE A HD12 1 
ATOM 577   H HD13 . ILE A 1 35 ? 7.263   -16.437 -40.595 1.00 0.00 ? 98  ILE A HD13 1 
ATOM 578   N N    . GLU A 1 36 ? 1.186   -15.087 -40.469 1.00 0.00 ? 99  GLU A N    1 
ATOM 579   C CA   . GLU A 1 36 ? 0.351   -13.897 -40.584 1.00 0.00 ? 99  GLU A CA   1 
ATOM 580   C C    . GLU A 1 36 ? 0.613   -12.928 -39.439 1.00 0.00 ? 99  GLU A C    1 
ATOM 581   O O    . GLU A 1 36 ? -0.060  -12.973 -38.408 1.00 0.00 ? 99  GLU A O    1 
ATOM 582   C CB   . GLU A 1 36 ? -1.129  -14.285 -40.609 1.00 0.00 ? 99  GLU A CB   1 
ATOM 583   C CG   . GLU A 1 36 ? -2.082  -13.115 -40.803 1.00 0.00 ? 99  GLU A CG   1 
ATOM 584   C CD   . GLU A 1 36 ? -3.528  -13.516 -40.708 1.00 0.00 ? 99  GLU A CD   1 
ATOM 585   O OE1  . GLU A 1 36 ? -3.791  -14.675 -40.495 1.00 0.00 ? 99  GLU A OE1  1 
ATOM 586   O OE2  . GLU A 1 36 ? -4.372  -12.662 -40.848 1.00 0.00 ? 99  GLU A OE2  1 
ATOM 587   H H    . GLU A 1 36 ? 0.898   -15.838 -39.843 1.00 0.00 ? 99  GLU A H    1 
ATOM 588   H HA   . GLU A 1 36 ? 0.571   -13.369 -41.493 1.00 0.00 ? 99  GLU A HA   1 
ATOM 589   H HB2  . GLU A 1 36 ? -1.298  -15.007 -41.390 1.00 0.00 ? 99  GLU A HB2  1 
ATOM 590   H HB3  . GLU A 1 36 ? -1.369  -14.748 -39.653 1.00 0.00 ? 99  GLU A HB3  1 
ATOM 591   H HG2  . GLU A 1 36 ? -1.880  -12.368 -40.035 1.00 0.00 ? 99  GLU A HG2  1 
ATOM 592   H HG3  . GLU A 1 36 ? -1.897  -12.676 -41.779 1.00 0.00 ? 99  GLU A HG3  1 
ATOM 593   N N    . VAL A 1 37 ? 1.593   -12.050 -39.626 1.00 0.00 ? 100 VAL A N    1 
ATOM 594   C CA   . VAL A 1 37 ? 1.893   -11.015 -38.644 1.00 0.00 ? 100 VAL A CA   1 
ATOM 595   C C    . VAL A 1 37 ? 0.897   -9.865  -38.734 1.00 0.00 ? 100 VAL A C    1 
ATOM 596   O O    . VAL A 1 37 ? 1.229   -8.782  -39.216 1.00 0.00 ? 100 VAL A O    1 
ATOM 597   C CB   . VAL A 1 37 ? 3.319   -10.475 -38.855 1.00 0.00 ? 100 VAL A CB   1 
ATOM 598   C CG1  . VAL A 1 37 ? 3.638   -9.401  -37.826 1.00 0.00 ? 100 VAL A CG1  1 
ATOM 599   C CG2  . VAL A 1 37 ? 4.322   -11.616 -38.775 1.00 0.00 ? 100 VAL A CG2  1 
ATOM 600   H H    . VAL A 1 37 ? 2.094   -12.054 -40.512 1.00 0.00 ? 100 VAL A H    1 
ATOM 601   H HA   . VAL A 1 37 ? 1.825   -11.450 -37.671 1.00 0.00 ? 100 VAL A HA   1 
ATOM 602   H HB   . VAL A 1 37 ? 3.403   -10.029 -39.826 1.00 0.00 ? 100 VAL A HB   1 
ATOM 603   H HG11 . VAL A 1 37 ? 3.320   -8.426  -38.199 1.00 0.00 ? 100 VAL A HG11 1 
ATOM 604   H HG12 . VAL A 1 37 ? 4.702   -9.364  -37.620 1.00 0.00 ? 100 VAL A HG12 1 
ATOM 605   H HG13 . VAL A 1 37 ? 3.103   -9.612  -36.903 1.00 0.00 ? 100 VAL A HG13 1 
ATOM 606   H HG21 . VAL A 1 37 ? 4.280   -12.184 -39.700 1.00 0.00 ? 100 VAL A HG21 1 
ATOM 607   H HG22 . VAL A 1 37 ? 4.065   -12.265 -37.940 1.00 0.00 ? 100 VAL A HG22 1 
ATOM 608   H HG23 . VAL A 1 37 ? 5.331   -11.240 -38.640 1.00 0.00 ? 100 VAL A HG23 1 
ATOM 609   N N    . HIS A 1 38 ? -0.323  -10.108 -38.268 1.00 0.00 ? 101 HIS A N    1 
ATOM 610   C CA   . HIS A 1 38 ? -1.339  -9.063  -38.203 1.00 0.00 ? 101 HIS A CA   1 
ATOM 611   C C    . HIS A 1 38 ? -0.893  -7.919  -37.302 1.00 0.00 ? 101 HIS A C    1 
ATOM 612   O O    . HIS A 1 38 ? -1.366  -7.784  -36.173 1.00 0.00 ? 101 HIS A O    1 
ATOM 613   C CB   . HIS A 1 38 ? -2.668  -9.633  -37.696 1.00 0.00 ? 101 HIS A CB   1 
ATOM 614   C CG   . HIS A 1 38 ? -3.734  -8.598  -37.508 1.00 0.00 ? 101 HIS A CG   1 
ATOM 615   N ND1  . HIS A 1 38 ? -3.629  -7.584  -36.576 1.00 0.00 ? 101 HIS A ND1  1 
ATOM 616   C CD2  . HIS A 1 38 ? -4.923  -8.418  -38.127 1.00 0.00 ? 101 HIS A CD2  1 
ATOM 617   C CE1  . HIS A 1 38 ? -4.709  -6.825  -36.635 1.00 0.00 ? 101 HIS A CE1  1 
ATOM 618   N NE2  . HIS A 1 38 ? -5.509  -7.311  -37.567 1.00 0.00 ? 101 HIS A NE2  1 
ATOM 619   H H    . HIS A 1 38 ? -0.528  -11.024 -37.869 1.00 0.00 ? 101 HIS A H    1 
ATOM 620   H HA   . HIS A 1 38 ? -1.481  -8.679  -39.208 1.00 0.00 ? 101 HIS A HA   1 
ATOM 621   H HB2  . HIS A 1 38 ? -3.030  -10.339 -38.444 1.00 0.00 ? 101 HIS A HB2  1 
ATOM 622   H HB3  . HIS A 1 38 ? -2.502  -10.173 -36.778 1.00 0.00 ? 101 HIS A HB3  1 
ATOM 623   H HD2  . HIS A 1 38 ? -5.418  -9.147  -38.754 1.00 0.00 ? 101 HIS A HD2  1 
ATOM 624   H HE1  . HIS A 1 38 ? -4.902  -5.958  -36.023 1.00 0.00 ? 101 HIS A HE1  1 
ATOM 625   H HE2  . HIS A 1 38 ? -6.408  -6.929  -37.825 1.00 0.00 ? 101 HIS A HE2  1 
ATOM 626   N N    . GLY A 1 39 ? 0.016   -7.093  -37.809 1.00 0.00 ? 102 GLY A N    1 
ATOM 627   C CA   . GLY A 1 39 ? 0.406   -5.869  -37.121 1.00 0.00 ? 102 GLY A CA   1 
ATOM 628   C C    . GLY A 1 39 ? -0.746  -4.872  -37.075 1.00 0.00 ? 102 GLY A C    1 
ATOM 629   O O    . GLY A 1 39 ? -1.772  -5.064  -37.725 1.00 0.00 ? 102 GLY A O    1 
ATOM 630   H H    . GLY A 1 39 ? 0.346   -7.239  -38.763 1.00 0.00 ? 102 GLY A H    1 
ATOM 631   H HA2  . GLY A 1 39 ? 0.628   -6.137  -36.121 1.00 0.00 ? 102 GLY A HA2  1 
ATOM 632   H HA3  . GLY A 1 39 ? 1.290   -5.441  -37.581 1.00 0.00 ? 102 GLY A HA3  1 
ATOM 633   N N    . LYS A 1 40 ? -0.569  -3.806  -36.300 1.00 0.00 ? 103 LYS A N    1 
ATOM 634   C CA   . LYS A 1 40 ? -1.541  -2.721  -36.256 1.00 0.00 ? 103 LYS A CA   1 
ATOM 635   C C    . LYS A 1 40 ? -0.984  -1.513  -35.514 1.00 0.00 ? 103 LYS A C    1 
ATOM 636   O O    . LYS A 1 40 ? -0.558  -1.622  -34.364 1.00 0.00 ? 103 LYS A O    1 
ATOM 637   C CB   . LYS A 1 40 ? -2.839  -3.190  -35.598 1.00 0.00 ? 103 LYS A CB   1 
ATOM 638   C CG   . LYS A 1 40 ? -3.925  -2.126  -35.516 1.00 0.00 ? 103 LYS A CG   1 
ATOM 639   C CD   . LYS A 1 40 ? -5.244  -2.716  -35.043 1.00 0.00 ? 103 LYS A CD   1 
ATOM 640   C CE   . LYS A 1 40 ? -5.171  -3.138  -33.582 1.00 0.00 ? 103 LYS A CE   1 
ATOM 641   N NZ   . LYS A 1 40 ? -6.520  -3.403  -33.012 1.00 0.00 ? 103 LYS A NZ   1 
ATOM 642   H H    . LYS A 1 40 ? 0.309   -3.709  -35.791 1.00 0.00 ? 103 LYS A H    1 
ATOM 643   H HA   . LYS A 1 40 ? -1.744  -2.417  -37.249 1.00 0.00 ? 103 LYS A HA   1 
ATOM 644   H HB2  . LYS A 1 40 ? -3.238  -4.004  -36.202 1.00 0.00 ? 103 LYS A HB2  1 
ATOM 645   H HB3  . LYS A 1 40 ? -2.624  -3.573  -34.617 1.00 0.00 ? 103 LYS A HB3  1 
ATOM 646   H HG2  . LYS A 1 40 ? -3.576  -1.385  -34.817 1.00 0.00 ? 103 LYS A HG2  1 
ATOM 647   H HG3  . LYS A 1 40 ? -4.050  -1.664  -36.489 1.00 0.00 ? 103 LYS A HG3  1 
ATOM 648   H HD2  . LYS A 1 40 ? -6.028  -1.968  -35.155 1.00 0.00 ? 103 LYS A HD2  1 
ATOM 649   H HD3  . LYS A 1 40 ? -5.489  -3.585  -35.652 1.00 0.00 ? 103 LYS A HD3  1 
ATOM 650   H HE2  . LYS A 1 40 ? -4.584  -4.051  -33.504 1.00 0.00 ? 103 LYS A HE2  1 
ATOM 651   H HE3  . LYS A 1 40 ? -4.690  -2.351  -33.004 1.00 0.00 ? 103 LYS A HE3  1 
ATOM 652   H HZ1  . LYS A 1 40 ? -6.458  -4.141  -32.282 1.00 0.00 ? 103 LYS A HZ1  1 
ATOM 653   H HZ2  . LYS A 1 40 ? -7.152  -3.720  -33.773 1.00 0.00 ? 103 LYS A HZ2  1 
ATOM 654   H HZ3  . LYS A 1 40 ? -6.884  -2.555  -32.603 1.00 0.00 ? 103 LYS A HZ3  1 
ATOM 655   N N    . HIS A 1 41 ? -0.991  -0.363  -36.178 1.00 0.00 ? 104 HIS A N    1 
ATOM 656   C CA   . HIS A 1 41 ? -0.838  0.916   -35.494 1.00 0.00 ? 104 HIS A CA   1 
ATOM 657   C C    . HIS A 1 41 ? -2.129  1.724   -35.536 1.00 0.00 ? 104 HIS A C    1 
ATOM 658   O O    . HIS A 1 41 ? -2.520  2.235   -36.586 1.00 0.00 ? 104 HIS A O    1 
ATOM 659   C CB   . HIS A 1 41 ? 0.299   1.732   -36.123 1.00 0.00 ? 104 HIS A CB   1 
ATOM 660   C CG   . HIS A 1 41 ? 0.576   3.022   -35.414 1.00 0.00 ? 104 HIS A CG   1 
ATOM 661   N ND1  . HIS A 1 41 ? 1.267   4.059   -36.004 1.00 0.00 ? 104 HIS A ND1  1 
ATOM 662   C CD2  . HIS A 1 41 ? 0.255   3.443   -34.169 1.00 0.00 ? 104 HIS A CD2  1 
ATOM 663   C CE1  . HIS A 1 41 ? 1.359   5.064   -35.150 1.00 0.00 ? 104 HIS A CE1  1 
ATOM 664   N NE2  . HIS A 1 41 ? 0.754   4.714   -34.029 1.00 0.00 ? 104 HIS A NE2  1 
ATOM 665   H H    . HIS A 1 41 ? -1.409  -0.354  -37.107 1.00 0.00 ? 104 HIS A H    1 
ATOM 666   H HA   . HIS A 1 41 ? -0.592  0.746   -34.448 1.00 0.00 ? 104 HIS A HA   1 
ATOM 667   H HB2  . HIS A 1 41 ? 1.178   1.148   -36.165 1.00 0.00 ? 104 HIS A HB2  1 
ATOM 668   H HB3  . HIS A 1 41 ? -0.004  1.972   -37.141 1.00 0.00 ? 104 HIS A HB3  1 
ATOM 669   H HD1  . HIS A 1 41 ? 1.660   4.050   -36.944 1.00 0.00 ? 104 HIS A HD1  1 
ATOM 670   H HD2  . HIS A 1 41 ? -0.093  2.810   -33.365 1.00 0.00 ? 104 HIS A HD2  1 
ATOM 671   H HE1  . HIS A 1 41 ? 1.868   5.998   -35.328 1.00 0.00 ? 104 HIS A HE1  1 
ATOM 672   N N    . GLU A 1 42 ? -2.789  1.833   -34.388 1.00 0.00 ? 105 GLU A N    1 
ATOM 673   C CA   . GLU A 1 42 ? -3.977  2.668   -34.264 1.00 0.00 ? 105 GLU A CA   1 
ATOM 674   C C    . GLU A 1 42 ? -3.619  4.064   -33.770 1.00 0.00 ? 105 GLU A C    1 
ATOM 675   O O    . GLU A 1 42 ? -2.507  4.301   -33.300 1.00 0.00 ? 105 GLU A O    1 
ATOM 676   C CB   . GLU A 1 42 ? -4.986  2.023   -33.312 1.00 0.00 ? 105 GLU A CB   1 
ATOM 677   C CG   . GLU A 1 42 ? -5.575  0.712   -33.814 1.00 0.00 ? 105 GLU A CG   1 
ATOM 678   C CD   . GLU A 1 42 ? -6.706  0.211   -32.958 1.00 0.00 ? 105 GLU A CD   1 
ATOM 679   O OE1  . GLU A 1 42 ? -6.839  0.678   -31.853 1.00 0.00 ? 105 GLU A OE1  1 
ATOM 680   O OE2  . GLU A 1 42 ? -7.434  -0.640  -33.410 1.00 0.00 ? 105 GLU A OE2  1 
ATOM 681   H H    . GLU A 1 42 ? -2.403  1.401   -33.550 1.00 0.00 ? 105 GLU A H    1 
ATOM 682   H HA   . GLU A 1 42 ? -4.449  2.754   -35.243 1.00 0.00 ? 105 GLU A HA   1 
ATOM 683   H HB2  . GLU A 1 42 ? -4.486  1.831   -32.363 1.00 0.00 ? 105 GLU A HB2  1 
ATOM 684   H HB3  . GLU A 1 42 ? -5.804  2.723   -33.144 1.00 0.00 ? 105 GLU A HB3  1 
ATOM 685   H HG2  . GLU A 1 42 ? -5.931  0.850   -34.835 1.00 0.00 ? 105 GLU A HG2  1 
ATOM 686   H HG3  . GLU A 1 42 ? -4.793  -0.022  -33.806 1.00 0.00 ? 105 GLU A HG3  1 
ATOM 687   N N    . GLU A 1 43 ? -4.571  4.986   -33.879 1.00 0.00 ? 106 GLU A N    1 
ATOM 688   C CA   . GLU A 1 43 ? -4.354  6.363   -33.450 1.00 0.00 ? 106 GLU A CA   1 
ATOM 689   C C    . GLU A 1 43 ? -3.058  6.920   -34.021 1.00 0.00 ? 106 GLU A C    1 
ATOM 690   O O    . GLU A 1 43 ? -2.156  7.306   -33.275 1.00 0.00 ? 106 GLU A O    1 
ATOM 691   C CB   . GLU A 1 43 ? -4.330  6.448   -31.923 1.00 0.00 ? 106 GLU A CB   1 
ATOM 692   C CG   . GLU A 1 43 ? -5.616  5.991   -31.247 1.00 0.00 ? 106 GLU A CG   1 
ATOM 693   C CD   . GLU A 1 43 ? -5.586  6.168   -29.754 1.00 0.00 ? 106 GLU A CD   1 
ATOM 694   O OE1  . GLU A 1 43 ? -4.543  6.480   -29.233 1.00 0.00 ? 106 GLU A OE1  1 
ATOM 695   O OE2  . GLU A 1 43 ? -6.609  5.989   -29.133 1.00 0.00 ? 106 GLU A OE2  1 
ATOM 696   H H    . GLU A 1 43 ? -5.472  4.723   -34.277 1.00 0.00 ? 106 GLU A H    1 
ATOM 697   H HA   . GLU A 1 43 ? -5.186  6.969   -33.807 1.00 0.00 ? 106 GLU A HA   1 
ATOM 698   H HB2  . GLU A 1 43 ? -3.514  5.822   -31.561 1.00 0.00 ? 106 GLU A HB2  1 
ATOM 699   H HB3  . GLU A 1 43 ? -4.140  7.481   -31.630 1.00 0.00 ? 106 GLU A HB3  1 
ATOM 700   H HG2  . GLU A 1 43 ? -6.444  6.571   -31.653 1.00 0.00 ? 106 GLU A HG2  1 
ATOM 701   H HG3  . GLU A 1 43 ? -5.772  4.937   -31.475 1.00 0.00 ? 106 GLU A HG3  1 
ATOM 702   N N    . ARG A 1 44 ? -2.968  6.961   -35.346 1.00 0.00 ? 107 ARG A N    1 
ATOM 703   C CA   . ARG A 1 44 ? -1.729  7.330   -36.019 1.00 0.00 ? 107 ARG A CA   1 
ATOM 704   C C    . ARG A 1 44 ? -1.850  8.693   -36.686 1.00 0.00 ? 107 ARG A C    1 
ATOM 705   O O    . ARG A 1 44 ? -2.255  8.794   -37.844 1.00 0.00 ? 107 ARG A O    1 
ATOM 706   C CB   . ARG A 1 44 ? -1.356  6.288   -37.064 1.00 0.00 ? 107 ARG A CB   1 
ATOM 707   C CG   . ARG A 1 44 ? -0.105  6.606   -37.865 1.00 0.00 ? 107 ARG A CG   1 
ATOM 708   C CD   . ARG A 1 44 ? 0.232   5.511   -38.813 1.00 0.00 ? 107 ARG A CD   1 
ATOM 709   N NE   . ARG A 1 44 ? 1.318   5.885   -39.706 1.00 0.00 ? 107 ARG A NE   1 
ATOM 710   C CZ   . ARG A 1 44 ? 2.621   5.644   -39.468 1.00 0.00 ? 107 ARG A CZ   1 
ATOM 711   N NH1  . ARG A 1 44 ? 2.987   5.033   -38.363 1.00 0.00 ? 107 ARG A NH1  1 
ATOM 712   N NH2  . ARG A 1 44 ? 3.535   6.023   -40.346 1.00 0.00 ? 107 ARG A NH2  1 
ATOM 713   H H    . ARG A 1 44 ? -3.746  6.610   -35.905 1.00 0.00 ? 107 ARG A H    1 
ATOM 714   H HA   . ARG A 1 44 ? -0.916  7.384   -35.293 1.00 0.00 ? 107 ARG A HA   1 
ATOM 715   H HB2  . ARG A 1 44 ? -1.177  5.348   -36.539 1.00 0.00 ? 107 ARG A HB2  1 
ATOM 716   H HB3  . ARG A 1 44 ? -2.194  6.157   -37.714 1.00 0.00 ? 107 ARG A HB3  1 
ATOM 717   H HG2  . ARG A 1 44 ? -0.291  7.508   -38.448 1.00 0.00 ? 107 ARG A HG2  1 
ATOM 718   H HG3  . ARG A 1 44 ? 0.727   6.780   -37.191 1.00 0.00 ? 107 ARG A HG3  1 
ATOM 719   H HD2  . ARG A 1 44 ? 0.545   4.648   -38.237 1.00 0.00 ? 107 ARG A HD2  1 
ATOM 720   H HD3  . ARG A 1 44 ? -0.635  5.245   -39.388 1.00 0.00 ? 107 ARG A HD3  1 
ATOM 721   H HE   . ARG A 1 44 ? 1.085   6.352   -40.534 1.00 0.00 ? 107 ARG A HE   1 
ATOM 722   H HH11 . ARG A 1 44 ? 2.300   4.752   -37.696 1.00 0.00 ? 107 ARG A HH11 1 
ATOM 723   H HH12 . ARG A 1 44 ? 3.964   4.849   -38.187 1.00 0.00 ? 107 ARG A HH12 1 
ATOM 724   H HH21 . ARG A 1 44 ? 3.261   6.490   -41.187 1.00 0.00 ? 107 ARG A HH21 1 
ATOM 725   H HH22 . ARG A 1 44 ? 4.501   5.841   -40.168 1.00 0.00 ? 107 ARG A HH22 1 
ATOM 726   N N    . GLN A 1 45 ? -1.495  9.741   -35.950 1.00 0.00 ? 108 GLN A N    1 
ATOM 727   C CA   . GLN A 1 45 ? -1.480  11.093  -36.497 1.00 0.00 ? 108 GLN A CA   1 
ATOM 728   C C    . GLN A 1 45 ? -0.515  11.200  -37.672 1.00 0.00 ? 108 GLN A C    1 
ATOM 729   O O    . GLN A 1 45 ? 0.595   10.671  -37.627 1.00 0.00 ? 108 GLN A O    1 
ATOM 730   C CB   . GLN A 1 45 ? -1.099  12.104  -35.413 1.00 0.00 ? 108 GLN A CB   1 
ATOM 731   C CG   . GLN A 1 45 ? -2.125  12.241  -34.301 1.00 0.00 ? 108 GLN A CG   1 
ATOM 732   C CD   . GLN A 1 45 ? -1.755  13.320  -33.302 1.00 0.00 ? 108 GLN A CD   1 
ATOM 733   O OE1  . GLN A 1 45 ? -0.628  13.360  -32.799 1.00 0.00 ? 108 GLN A OE1  1 
ATOM 734   N NE2  . GLN A 1 45 ? -2.702  14.203  -33.006 1.00 0.00 ? 108 GLN A NE2  1 
ATOM 735   H H    . GLN A 1 45 ? -1.148  9.586   -35.004 1.00 0.00 ? 108 GLN A H    1 
ATOM 736   H HA   . GLN A 1 45 ? -2.472  11.337  -36.841 1.00 0.00 ? 108 GLN A HA   1 
ATOM 737   H HB2  . GLN A 1 45 ? -0.154  11.795  -34.972 1.00 0.00 ? 108 GLN A HB2  1 
ATOM 738   H HB3  . GLN A 1 45 ? -0.968  13.081  -35.881 1.00 0.00 ? 108 GLN A HB3  1 
ATOM 739   H HG2  . GLN A 1 45 ? -3.091  12.475  -34.744 1.00 0.00 ? 108 GLN A HG2  1 
ATOM 740   H HG3  . GLN A 1 45 ? -2.193  11.287  -33.778 1.00 0.00 ? 108 GLN A HG3  1 
ATOM 741   H HE21 . GLN A 1 45 ? -3.626  14.135  -33.434 1.00 0.00 ? 108 GLN A HE21 1 
ATOM 742   H HE22 . GLN A 1 45 ? -2.498  14.951  -32.345 1.00 0.00 ? 108 GLN A HE22 1 
ATOM 743   N N    . ASP A 1 46 ? -0.947  11.890  -38.723 1.00 0.00 ? 109 ASP A N    1 
ATOM 744   C CA   . ASP A 1 46 ? -0.102  12.120  -39.888 1.00 0.00 ? 109 ASP A CA   1 
ATOM 745   C C    . ASP A 1 46 ? -0.523  13.377  -40.635 1.00 0.00 ? 109 ASP A C    1 
ATOM 746   O O    . ASP A 1 46 ? -0.994  14.341  -40.031 1.00 0.00 ? 109 ASP A O    1 
ATOM 747   C CB   . ASP A 1 46 ? -0.153  10.916  -40.834 1.00 0.00 ? 109 ASP A CB   1 
ATOM 748   C CG   . ASP A 1 46 ? -1.531  10.703  -41.446 1.00 0.00 ? 109 ASP A CG   1 
ATOM 749   O OD1  . ASP A 1 46 ? -2.414  11.476  -41.158 1.00 0.00 ? 109 ASP A OD1  1 
ATOM 750   O OD2  . ASP A 1 46 ? -1.687  9.772   -42.198 1.00 0.00 ? 109 ASP A OD2  1 
ATOM 751   H H    . ASP A 1 46 ? -1.877  12.310  -38.692 1.00 0.00 ? 109 ASP A H    1 
ATOM 752   H HA   . ASP A 1 46 ? 0.930   12.256  -39.556 1.00 0.00 ? 109 ASP A HA   1 
ATOM 753   H HB2  . ASP A 1 46 ? 0.575   11.057  -41.630 1.00 0.00 ? 109 ASP A HB2  1 
ATOM 754   H HB3  . ASP A 1 46 ? 0.116   10.024  -40.269 1.00 0.00 ? 109 ASP A HB3  1 
ATOM 755   N N    . GLU A 1 47 ? -0.348  13.364  -41.951 1.00 0.00 ? 110 GLU A N    1 
ATOM 756   C CA   . GLU A 1 47 ? -0.600  14.545  -42.770 1.00 0.00 ? 110 GLU A CA   1 
ATOM 757   C C    . GLU A 1 47 ? -2.081  14.898  -42.786 1.00 0.00 ? 110 GLU A C    1 
ATOM 758   O O    . GLU A 1 47 ? -2.458  16.021  -43.118 1.00 0.00 ? 110 GLU A O    1 
ATOM 759   C CB   . GLU A 1 47 ? -0.105  14.319  -44.200 1.00 0.00 ? 110 GLU A CB   1 
ATOM 760   C CG   . GLU A 1 47 ? 1.403   14.152  -44.324 1.00 0.00 ? 110 GLU A CG   1 
ATOM 761   C CD   . GLU A 1 47 ? 1.856   12.735  -44.116 1.00 0.00 ? 110 GLU A CD   1 
ATOM 762   O OE1  . GLU A 1 47 ? 1.018   11.885  -43.929 1.00 0.00 ? 110 GLU A OE1  1 
ATOM 763   O OE2  . GLU A 1 47 ? 3.040   12.499  -44.147 1.00 0.00 ? 110 GLU A OE2  1 
ATOM 764   H H    . GLU A 1 47 ? 0.063   12.543  -42.387 1.00 0.00 ? 110 GLU A H    1 
ATOM 765   H HA   . GLU A 1 47 ? -0.053  15.389  -42.355 1.00 0.00 ? 110 GLU A HA   1 
ATOM 766   H HB2  . GLU A 1 47 ? -0.591  13.434  -44.600 1.00 0.00 ? 110 GLU A HB2  1 
ATOM 767   H HB3  . GLU A 1 47 ? -0.395  15.178  -44.779 1.00 0.00 ? 110 GLU A HB3  1 
ATOM 768   H HG2  . GLU A 1 47 ? 1.728   14.478  -45.315 1.00 0.00 ? 110 GLU A HG2  1 
ATOM 769   H HG3  . GLU A 1 47 ? 1.882   14.783  -43.573 1.00 0.00 ? 110 GLU A HG3  1 
ATOM 770   N N    . HIS A 1 48 ? -2.919  13.932  -42.423 1.00 0.00 ? 111 HIS A N    1 
ATOM 771   C CA   . HIS A 1 48 ? -4.352  14.171  -42.289 1.00 0.00 ? 111 HIS A CA   1 
ATOM 772   C C    . HIS A 1 48 ? -4.895  13.547  -41.011 1.00 0.00 ? 111 HIS A C    1 
ATOM 773   O O    . HIS A 1 48 ? -5.241  12.368  -40.982 1.00 0.00 ? 111 HIS A O    1 
ATOM 774   C CB   . HIS A 1 48 ? -5.110  13.612  -43.499 1.00 0.00 ? 111 HIS A CB   1 
ATOM 775   C CG   . HIS A 1 48 ? -4.747  12.199  -43.834 1.00 0.00 ? 111 HIS A CG   1 
ATOM 776   N ND1  . HIS A 1 48 ? -3.687  11.877  -44.656 1.00 0.00 ? 111 HIS A ND1  1 
ATOM 777   C CD2  . HIS A 1 48 ? -5.305  11.022  -43.459 1.00 0.00 ? 111 HIS A CD2  1 
ATOM 778   C CE1  . HIS A 1 48 ? -3.608  10.561  -44.773 1.00 0.00 ? 111 HIS A CE1  1 
ATOM 779   N NE2  . HIS A 1 48 ? -4.577  10.022  -44.056 1.00 0.00 ? 111 HIS A NE2  1 
ATOM 780   H H    . HIS A 1 48 ? -2.539  13.029  -42.144 1.00 0.00 ? 111 HIS A H    1 
ATOM 781   H HA   . HIS A 1 48 ? -4.537  15.234  -42.223 1.00 0.00 ? 111 HIS A HA   1 
ATOM 782   H HB2  . HIS A 1 48 ? -6.179  13.669  -43.314 1.00 0.00 ? 111 HIS A HB2  1 
ATOM 783   H HB3  . HIS A 1 48 ? -4.863  14.224  -44.362 1.00 0.00 ? 111 HIS A HB3  1 
ATOM 784   H HD2  . HIS A 1 48 ? -5.992  10.887  -42.645 1.00 0.00 ? 111 HIS A HD2  1 
ATOM 785   H HE1  . HIS A 1 48 ? -2.876  10.024  -45.356 1.00 0.00 ? 111 HIS A HE1  1 
ATOM 786   H HE2  . HIS A 1 48 ? -4.755  9.032   -43.963 1.00 0.00 ? 111 HIS A HE2  1 
ATOM 787   N N    . GLY A 1 49 ? -4.970  14.351  -39.954 1.00 0.00 ? 112 GLY A N    1 
ATOM 788   C CA   . GLY A 1 49 ? -5.473  13.879  -38.669 1.00 0.00 ? 112 GLY A CA   1 
ATOM 789   C C    . GLY A 1 49 ? -4.955  12.481  -38.354 1.00 0.00 ? 112 GLY A C    1 
ATOM 790   O O    . GLY A 1 49 ? -3.792  12.169  -38.603 1.00 0.00 ? 112 GLY A O    1 
ATOM 791   H H    . GLY A 1 49 ? -4.667  15.318  -40.046 1.00 0.00 ? 112 GLY A H    1 
ATOM 792   H HA2  . GLY A 1 49 ? -5.098  14.553  -37.899 1.00 0.00 ? 112 GLY A HA2  1 
ATOM 793   H HA3  . GLY A 1 49 ? -6.547  13.893  -38.631 1.00 0.00 ? 112 GLY A HA3  1 
ATOM 794   N N    . PHE A 1 50 ? -5.829  11.643  -37.805 1.00 0.00 ? 113 PHE A N    1 
ATOM 795   C CA   . PHE A 1 50 ? -5.453  10.287  -37.424 1.00 0.00 ? 113 PHE A CA   1 
ATOM 796   C C    . PHE A 1 50 ? -5.591  9.325   -38.596 1.00 0.00 ? 113 PHE A C    1 
ATOM 797   O O    . PHE A 1 50 ? -6.431  9.518   -39.475 1.00 0.00 ? 113 PHE A O    1 
ATOM 798   C CB   . PHE A 1 50 ? -6.314  9.801   -36.255 1.00 0.00 ? 113 PHE A CB   1 
ATOM 799   C CG   . PHE A 1 50 ? -5.945  10.416  -34.935 1.00 0.00 ? 113 PHE A CG   1 
ATOM 800   C CD1  . PHE A 1 50 ? -4.913  9.895   -34.173 1.00 0.00 ? 113 PHE A CD1  1 
ATOM 801   C CD2  . PHE A 1 50 ? -6.635  11.521  -34.454 1.00 0.00 ? 113 PHE A CD2  1 
ATOM 802   C CE1  . PHE A 1 50 ? -4.574  10.459  -32.958 1.00 0.00 ? 113 PHE A CE1  1 
ATOM 803   C CE2  . PHE A 1 50 ? -6.298  12.089  -33.239 1.00 0.00 ? 113 PHE A CE2  1 
ATOM 804   C CZ   . PHE A 1 50 ? -5.268  11.557  -32.492 1.00 0.00 ? 113 PHE A CZ   1 
ATOM 805   H H    . PHE A 1 50 ? -6.779  11.962  -37.612 1.00 0.00 ? 113 PHE A H    1 
ATOM 806   H HA   . PHE A 1 50 ? -4.424  10.278  -37.095 1.00 0.00 ? 113 PHE A HA   1 
ATOM 807   H HB2  . PHE A 1 50 ? -7.350  10.041  -36.475 1.00 0.00 ? 113 PHE A HB2  1 
ATOM 808   H HB3  . PHE A 1 50 ? -6.215  8.716   -36.171 1.00 0.00 ? 113 PHE A HB3  1 
ATOM 809   H HD1  . PHE A 1 50 ? -4.370  9.049   -34.543 1.00 0.00 ? 113 PHE A HD1  1 
ATOM 810   H HD2  . PHE A 1 50 ? -7.440  11.941  -35.037 1.00 0.00 ? 113 PHE A HD2  1 
ATOM 811   H HE1  . PHE A 1 50 ? -3.767  10.040  -32.374 1.00 0.00 ? 113 PHE A HE1  1 
ATOM 812   H HE2  . PHE A 1 50 ? -6.843  12.946  -32.873 1.00 0.00 ? 113 PHE A HE2  1 
ATOM 813   H HZ   . PHE A 1 50 ? -5.062  11.943  -31.505 1.00 0.00 ? 113 PHE A HZ   1 
ATOM 814   N N    . ILE A 1 51 ? -4.761  8.288   -38.606 1.00 0.00 ? 114 ILE A N    1 
ATOM 815   C CA   . ILE A 1 51 ? -5.030  7.099   -39.408 1.00 0.00 ? 114 ILE A CA   1 
ATOM 816   C C    . ILE A 1 51 ? -4.794  5.827   -38.602 1.00 0.00 ? 114 ILE A C    1 
ATOM 817   O O    . ILE A 1 51 ? -4.756  5.858   -37.373 1.00 0.00 ? 114 ILE A O    1 
ATOM 818   C CB   . ILE A 1 51 ? -4.150  7.078   -40.670 1.00 0.00 ? 114 ILE A CB   1 
ATOM 819   C CG1  . ILE A 1 51 ? -2.676  6.906   -40.292 1.00 0.00 ? 114 ILE A CG1  1 
ATOM 820   C CG2  . ILE A 1 51 ? -4.350  8.350   -41.478 1.00 0.00 ? 114 ILE A CG2  1 
ATOM 821   C CD1  . ILE A 1 51 ? -1.779  6.579   -41.464 1.00 0.00 ? 114 ILE A CD1  1 
ATOM 822   H H    . ILE A 1 51 ? -4.139  8.179   -37.806 1.00 0.00 ? 114 ILE A H    1 
ATOM 823   H HA   . ILE A 1 51 ? -6.063  7.081   -39.704 1.00 0.00 ? 114 ILE A HA   1 
ATOM 824   H HB   . ILE A 1 51 ? -4.454  6.235   -41.292 1.00 0.00 ? 114 ILE A HB   1 
ATOM 825   H HG12 . ILE A 1 51 ? -2.311  7.799   -39.816 1.00 0.00 ? 114 ILE A HG12 1 
ATOM 826   H HG13 . ILE A 1 51 ? -2.610  6.087   -39.617 1.00 0.00 ? 114 ILE A HG13 1 
ATOM 827   H HG21 . ILE A 1 51 ? -3.712  9.136   -41.074 1.00 0.00 ? 114 ILE A HG21 1 
ATOM 828   H HG22 . ILE A 1 51 ? -5.367  8.685   -41.435 1.00 0.00 ? 114 ILE A HG22 1 
ATOM 829   H HG23 . ILE A 1 51 ? -4.077  8.180   -42.517 1.00 0.00 ? 114 ILE A HG23 1 
ATOM 830   H HD11 . ILE A 1 51 ? -0.735  6.669   -41.172 1.00 0.00 ? 114 ILE A HD11 1 
ATOM 831   H HD12 . ILE A 1 51 ? -1.974  5.558   -41.793 1.00 0.00 ? 114 ILE A HD12 1 
ATOM 832   H HD13 . ILE A 1 51 ? -1.986  7.269   -42.282 1.00 0.00 ? 114 ILE A HD13 1 
ATOM 833   N N    . SER A 1 52 ? -4.635  4.710   -39.304 1.00 0.00 ? 115 SER A N    1 
ATOM 834   C CA   . SER A 1 52 ? -4.159  3.478   -38.687 1.00 0.00 ? 115 SER A CA   1 
ATOM 835   C C    . SER A 1 52 ? -3.572  2.532   -39.725 1.00 0.00 ? 115 SER A C    1 
ATOM 836   O O    . SER A 1 52 ? -4.063  2.449   -40.851 1.00 0.00 ? 115 SER A O    1 
ATOM 837   C CB   . SER A 1 52 ? -5.292  2.792   -37.949 1.00 0.00 ? 115 SER A CB   1 
ATOM 838   O OG   . SER A 1 52 ? -4.877  1.562   -37.423 1.00 0.00 ? 115 SER A OG   1 
ATOM 839   H H    . SER A 1 52 ? -4.636  4.766   -40.320 1.00 0.00 ? 115 SER A H    1 
ATOM 840   H HA   . SER A 1 52 ? -3.384  3.725   -37.969 1.00 0.00 ? 115 SER A HA   1 
ATOM 841   H HB2  . SER A 1 52 ? -5.639  3.429   -37.141 1.00 0.00 ? 115 SER A HB2  1 
ATOM 842   H HB3  . SER A 1 52 ? -6.104  2.640   -38.651 1.00 0.00 ? 115 SER A HB3  1 
ATOM 843   H HG   . SER A 1 52 ? -4.624  0.997   -38.157 1.00 0.00 ? 115 SER A HG   1 
ATOM 844   N N    . ARG A 1 53 ? -2.519  1.819   -39.340 1.00 0.00 ? 116 ARG A N    1 
ATOM 845   C CA   . ARG A 1 53 ? -1.916  0.814   -40.209 1.00 0.00 ? 116 ARG A CA   1 
ATOM 846   C C    . ARG A 1 53 ? -2.146  -0.592  -39.664 1.00 0.00 ? 116 ARG A C    1 
ATOM 847   O O    . ARG A 1 53 ? -1.291  -1.148  -38.975 1.00 0.00 ? 116 ARG A O    1 
ATOM 848   C CB   . ARG A 1 53 ? -0.422  1.060   -40.354 1.00 0.00 ? 116 ARG A CB   1 
ATOM 849   C CG   . ARG A 1 53 ? -0.053  2.371   -41.031 1.00 0.00 ? 116 ARG A CG   1 
ATOM 850   C CD   . ARG A 1 53 ? 1.404   2.453   -41.313 1.00 0.00 ? 116 ARG A CD   1 
ATOM 851   N NE   . ARG A 1 53 ? 2.198   2.344   -40.099 1.00 0.00 ? 116 ARG A NE   1 
ATOM 852   C CZ   . ARG A 1 53 ? 3.487   1.955   -40.062 1.00 0.00 ? 116 ARG A CZ   1 
ATOM 853   N NH1  . ARG A 1 53 ? 4.113   1.643   -41.175 1.00 0.00 ? 116 ARG A NH1  1 
ATOM 854   N NH2  . ARG A 1 53 ? 4.124   1.886   -38.905 1.00 0.00 ? 116 ARG A NH2  1 
ATOM 855   H H    . ARG A 1 53 ? -2.169  1.922   -38.388 1.00 0.00 ? 116 ARG A H    1 
ATOM 856   H HA   . ARG A 1 53 ? -2.361  0.872   -41.205 1.00 0.00 ? 116 ARG A HA   1 
ATOM 857   H HB2  . ARG A 1 53 ? 0.028   1.048   -39.363 1.00 0.00 ? 116 ARG A HB2  1 
ATOM 858   H HB3  . ARG A 1 53 ? -0.003  0.252   -40.938 1.00 0.00 ? 116 ARG A HB3  1 
ATOM 859   H HG2  . ARG A 1 53 ? -0.612  2.451   -41.963 1.00 0.00 ? 116 ARG A HG2  1 
ATOM 860   H HG3  . ARG A 1 53 ? -0.329  3.187   -40.375 1.00 0.00 ? 116 ARG A HG3  1 
ATOM 861   H HD2  . ARG A 1 53 ? 1.678   1.637   -41.979 1.00 0.00 ? 116 ARG A HD2  1 
ATOM 862   H HD3  . ARG A 1 53 ? 1.625   3.404   -41.798 1.00 0.00 ? 116 ARG A HD3  1 
ATOM 863   H HE   . ARG A 1 53 ? 1.762   2.566   -39.248 1.00 0.00 ? 116 ARG A HE   1 
ATOM 864   H HH11 . ARG A 1 53 ? 3.632   1.693   -42.050 1.00 0.00 ? 116 ARG A HH11 1 
ATOM 865   H HH12 . ARG A 1 53 ? 5.079   1.352   -41.146 1.00 0.00 ? 116 ARG A HH12 1 
ATOM 866   H HH21 . ARG A 1 53 ? 3.651   2.122   -38.056 1.00 0.00 ? 116 ARG A HH21 1 
ATOM 867   H HH22 . ARG A 1 53 ? 5.080   1.597   -38.882 1.00 0.00 ? 116 ARG A HH22 1 
ATOM 868   N N    . GLU A 1 54 ? -3.305  -1.159  -39.981 1.00 0.00 ? 117 GLU A N    1 
ATOM 869   C CA   . GLU A 1 54 ? -3.647  -2.501  -39.526 1.00 0.00 ? 117 GLU A CA   1 
ATOM 870   C C    . GLU A 1 54 ? -3.312  -3.544  -40.587 1.00 0.00 ? 117 GLU A C    1 
ATOM 871   O O    . GLU A 1 54 ? -3.872  -3.530  -41.682 1.00 0.00 ? 117 GLU A O    1 
ATOM 872   C CB   . GLU A 1 54 ? -5.133  -2.581  -39.171 1.00 0.00 ? 117 GLU A CB   1 
ATOM 873   C CG   . GLU A 1 54 ? -5.599  -3.957  -38.717 1.00 0.00 ? 117 GLU A CG   1 
ATOM 874   C CD   . GLU A 1 54 ? -7.058  -3.991  -38.356 1.00 0.00 ? 117 GLU A CD   1 
ATOM 875   O OE1  . GLU A 1 54 ? -7.678  -2.956  -38.367 1.00 0.00 ? 117 GLU A OE1  1 
ATOM 876   O OE2  . GLU A 1 54 ? -7.554  -5.055  -38.069 1.00 0.00 ? 117 GLU A OE2  1 
ATOM 877   H H    . GLU A 1 54 ? -3.969  -0.644  -40.559 1.00 0.00 ? 117 GLU A H    1 
ATOM 878   H HA   . GLU A 1 54 ? -3.091  -2.743  -38.645 1.00 0.00 ? 117 GLU A HA   1 
ATOM 879   H HB2  . GLU A 1 54 ? -5.325  -1.886  -38.361 1.00 0.00 ? 117 GLU A HB2  1 
ATOM 880   H HB3  . GLU A 1 54 ? -5.711  -2.272  -40.013 1.00 0.00 ? 117 GLU A HB3  1 
ATOM 881   H HG2  . GLU A 1 54 ? -5.432  -4.665  -39.530 1.00 0.00 ? 117 GLU A HG2  1 
ATOM 882   H HG3  . GLU A 1 54 ? -5.010  -4.260  -37.854 1.00 0.00 ? 117 GLU A HG3  1 
ATOM 883   N N    . PHE A 1 55 ? -2.397  -4.447  -40.252 1.00 0.00 ? 118 PHE A N    1 
ATOM 884   C CA   . PHE A 1 55 ? -1.763  -5.302  -41.250 1.00 0.00 ? 118 PHE A CA   1 
ATOM 885   C C    . PHE A 1 55 ? -2.352  -6.706  -41.222 1.00 0.00 ? 118 PHE A C    1 
ATOM 886   O O    . PHE A 1 55 ? -2.924  -7.131  -40.220 1.00 0.00 ? 118 PHE A O    1 
ATOM 887   C CB   . PHE A 1 55 ? -0.254  -5.370  -41.015 1.00 0.00 ? 118 PHE A CB   1 
ATOM 888   C CG   . PHE A 1 55 ? 0.439   -4.042  -41.131 1.00 0.00 ? 118 PHE A CG   1 
ATOM 889   C CD1  . PHE A 1 55 ? 0.580   -3.422  -42.361 1.00 0.00 ? 118 PHE A CD1  1 
ATOM 890   C CD2  . PHE A 1 55 ? 0.949   -3.410  -40.005 1.00 0.00 ? 118 PHE A CD2  1 
ATOM 891   C CE1  . PHE A 1 55 ? 1.218   -2.200  -42.470 1.00 0.00 ? 118 PHE A CE1  1 
ATOM 892   C CE2  . PHE A 1 55 ? 1.586   -2.188  -40.109 1.00 0.00 ? 118 PHE A CE2  1 
ATOM 893   C CZ   . PHE A 1 55 ? 1.720   -1.583  -41.341 1.00 0.00 ? 118 PHE A CZ   1 
ATOM 894   H H    . PHE A 1 55 ? -1.949  -4.365  -39.342 1.00 0.00 ? 118 PHE A H    1 
ATOM 895   H HA   . PHE A 1 55 ? -1.923  -4.899  -42.229 1.00 0.00 ? 118 PHE A HA   1 
ATOM 896   H HB2  . PHE A 1 55 ? -0.049  -5.814  -40.042 1.00 0.00 ? 118 PHE A HB2  1 
ATOM 897   H HB3  . PHE A 1 55 ? 0.141   -6.009  -41.788 1.00 0.00 ? 118 PHE A HB3  1 
ATOM 898   H HD1  . PHE A 1 55 ? 0.188   -3.900  -43.246 1.00 0.00 ? 118 PHE A HD1  1 
ATOM 899   H HD2  . PHE A 1 55 ? 0.835   -3.866  -39.044 1.00 0.00 ? 118 PHE A HD2  1 
ATOM 900   H HE1  . PHE A 1 55 ? 1.322   -1.729  -43.435 1.00 0.00 ? 118 PHE A HE1  1 
ATOM 901   H HE2  . PHE A 1 55 ? 1.981   -1.707  -39.227 1.00 0.00 ? 118 PHE A HE2  1 
ATOM 902   H HZ   . PHE A 1 55 ? 2.251   -0.647  -41.429 1.00 0.00 ? 118 PHE A HZ   1 
ATOM 903   N N    . HIS A 1 56 ? -2.207  -7.424  -42.331 1.00 0.00 ? 119 HIS A N    1 
ATOM 904   C CA   . HIS A 1 56 ? -2.416  -8.867  -42.342 1.00 0.00 ? 119 HIS A CA   1 
ATOM 905   C C    . HIS A 1 56 ? -1.255  -9.587  -43.018 1.00 0.00 ? 119 HIS A C    1 
ATOM 906   O O    . HIS A 1 56 ? -1.419  -10.191 -44.078 1.00 0.00 ? 119 HIS A O    1 
ATOM 907   C CB   . HIS A 1 56 ? -3.726  -9.218  -43.054 1.00 0.00 ? 119 HIS A CB   1 
ATOM 908   C CG   . HIS A 1 56 ? -4.946  -8.692  -42.364 1.00 0.00 ? 119 HIS A CG   1 
ATOM 909   N ND1  . HIS A 1 56 ? -5.411  -7.408  -42.552 1.00 0.00 ? 119 HIS A ND1  1 
ATOM 910   C CD2  . HIS A 1 56 ? -5.794  -9.275  -41.486 1.00 0.00 ? 119 HIS A CD2  1 
ATOM 911   C CE1  . HIS A 1 56 ? -6.495  -7.224  -41.819 1.00 0.00 ? 119 HIS A CE1  1 
ATOM 912   N NE2  . HIS A 1 56 ? -6.747  -8.341  -41.163 1.00 0.00 ? 119 HIS A NE2  1 
ATOM 913   H H    . HIS A 1 56 ? -1.680  -7.017  -43.104 1.00 0.00 ? 119 HIS A H    1 
ATOM 914   H HA   . HIS A 1 56 ? -2.494  -9.236  -41.313 1.00 0.00 ? 119 HIS A HA   1 
ATOM 915   H HB2  . HIS A 1 56 ? -3.683  -8.782  -44.051 1.00 0.00 ? 119 HIS A HB2  1 
ATOM 916   H HB3  . HIS A 1 56 ? -3.810  -10.301 -43.146 1.00 0.00 ? 119 HIS A HB3  1 
ATOM 917   H HD1  . HIS A 1 56 ? -4.992  -6.706  -43.146 1.00 0.00 ? 119 HIS A HD1  1 
ATOM 918   H HD2  . HIS A 1 56 ? -5.853  -10.335 -41.286 1.00 0.00 ? 119 HIS A HD2  1 
ATOM 919   H HE1  . HIS A 1 56 ? -7.075  -6.313  -41.770 1.00 0.00 ? 119 HIS A HE1  1 
ATOM 920   H HE2  . HIS A 1 56 ? -7.518  -8.485  -40.526 1.00 0.00 ? 119 HIS A HE2  1 
ATOM 921   N N    . ARG A 1 57 ? -0.083  -9.519  -42.397 1.00 0.00 ? 120 ARG A N    1 
ATOM 922   C CA   . ARG A 1 57 ? 1.167   -9.824  -43.086 1.00 0.00 ? 120 ARG A CA   1 
ATOM 923   C C    . ARG A 1 57 ? 1.352   -11.325 -43.253 1.00 0.00 ? 120 ARG A C    1 
ATOM 924   O O    . ARG A 1 57 ? 2.176   -11.939 -42.574 1.00 0.00 ? 120 ARG A O    1 
ATOM 925   C CB   . ARG A 1 57 ? 2.352   -9.251  -42.322 1.00 0.00 ? 120 ARG A CB   1 
ATOM 926   C CG   . ARG A 1 57 ? 2.326   -7.741  -42.139 1.00 0.00 ? 120 ARG A CG   1 
ATOM 927   C CD   . ARG A 1 57 ? 3.551   -7.250  -41.456 1.00 0.00 ? 120 ARG A CD   1 
ATOM 928   N NE   . ARG A 1 57 ? 3.667   -5.803  -41.527 1.00 0.00 ? 120 ARG A NE   1 
ATOM 929   C CZ   . ARG A 1 57 ? 4.428   -5.055  -40.703 1.00 0.00 ? 120 ARG A CZ   1 
ATOM 930   N NH1  . ARG A 1 57 ? 5.136   -5.632  -39.758 1.00 0.00 ? 120 ARG A NH1  1 
ATOM 931   N NH2  . ARG A 1 57 ? 4.466   -3.742  -40.849 1.00 0.00 ? 120 ARG A NH2  1 
ATOM 932   H H    . ARG A 1 57 ? -0.029  -8.956  -41.549 1.00 0.00 ? 120 ARG A H    1 
ATOM 933   H HA   . ARG A 1 57 ? 1.167   -9.402  -44.039 1.00 0.00 ? 120 ARG A HA   1 
ATOM 934   H HB2  . ARG A 1 57 ? 2.347   -9.707  -41.359 1.00 0.00 ? 120 ARG A HB2  1 
ATOM 935   H HB3  . ARG A 1 57 ? 3.269   -9.521  -42.842 1.00 0.00 ? 120 ARG A HB3  1 
ATOM 936   H HG2  . ARG A 1 57 ? 2.205   -7.249  -43.097 1.00 0.00 ? 120 ARG A HG2  1 
ATOM 937   H HG3  . ARG A 1 57 ? 1.482   -7.524  -41.504 1.00 0.00 ? 120 ARG A HG3  1 
ATOM 938   H HD2  . ARG A 1 57 ? 3.539   -7.554  -40.412 1.00 0.00 ? 120 ARG A HD2  1 
ATOM 939   H HD3  . ARG A 1 57 ? 4.411   -7.688  -41.948 1.00 0.00 ? 120 ARG A HD3  1 
ATOM 940   H HE   . ARG A 1 57 ? 3.145   -5.336  -42.213 1.00 0.00 ? 120 ARG A HE   1 
ATOM 941   H HH11 . ARG A 1 57 ? 5.108   -6.626  -39.647 1.00 0.00 ? 120 ARG A HH11 1 
ATOM 942   H HH12 . ARG A 1 57 ? 5.707   -5.071  -39.142 1.00 0.00 ? 120 ARG A HH12 1 
ATOM 943   H HH21 . ARG A 1 57 ? 3.930   -3.300  -41.566 1.00 0.00 ? 120 ARG A HH21 1 
ATOM 944   H HH22 . ARG A 1 57 ? 5.035   -3.190  -40.236 1.00 0.00 ? 120 ARG A HH22 1 
ATOM 945   N N    . LYS A 1 58 ? 0.581   -11.914 -44.161 1.00 0.00 ? 121 LYS A N    1 
ATOM 946   C CA   . LYS A 1 58 ? 0.523   -13.365 -44.291 1.00 0.00 ? 121 LYS A CA   1 
ATOM 947   C C    . LYS A 1 58 ? 1.504   -13.865 -45.344 1.00 0.00 ? 121 LYS A C    1 
ATOM 948   O O    . LYS A 1 58 ? 1.204   -13.862 -46.536 1.00 0.00 ? 121 LYS A O    1 
ATOM 949   C CB   . LYS A 1 58 ? -0.897  -13.813 -44.642 1.00 0.00 ? 121 LYS A CB   1 
ATOM 950   C CG   . LYS A 1 58 ? -1.139  -15.310 -44.494 1.00 0.00 ? 121 LYS A CG   1 
ATOM 951   C CD   . LYS A 1 58 ? -2.534  -15.694 -44.963 1.00 0.00 ? 121 LYS A CD   1 
ATOM 952   C CE   . LYS A 1 58 ? -3.604  -15.128 -44.042 1.00 0.00 ? 121 LYS A CE   1 
ATOM 953   N NZ   . LYS A 1 58 ? -4.971  -15.550 -44.451 1.00 0.00 ? 121 LYS A NZ   1 
ATOM 954   H H    . LYS A 1 58 ? -0.095  -11.347 -44.670 1.00 0.00 ? 121 LYS A H    1 
ATOM 955   H HA   . LYS A 1 58 ? 0.794   -13.848 -43.372 1.00 0.00 ? 121 LYS A HA   1 
ATOM 956   H HB2  . LYS A 1 58 ? -1.564  -13.280 -43.986 1.00 0.00 ? 121 LYS A HB2  1 
ATOM 957   H HB3  . LYS A 1 58 ? -1.117  -13.526 -45.668 1.00 0.00 ? 121 LYS A HB3  1 
ATOM 958   H HG2  . LYS A 1 58 ? -0.403  -15.841 -45.094 1.00 0.00 ? 121 LYS A HG2  1 
ATOM 959   H HG3  . LYS A 1 58 ? -1.022  -15.582 -43.462 1.00 0.00 ? 121 LYS A HG3  1 
ATOM 960   H HD2  . LYS A 1 58 ? -2.691  -15.297 -45.967 1.00 0.00 ? 121 LYS A HD2  1 
ATOM 961   H HD3  . LYS A 1 58 ? -2.624  -16.780 -44.993 1.00 0.00 ? 121 LYS A HD3  1 
ATOM 962   H HE2  . LYS A 1 58 ? -3.416  -15.473 -43.026 1.00 0.00 ? 121 LYS A HE2  1 
ATOM 963   H HE3  . LYS A 1 58 ? -3.572  -14.044 -44.062 1.00 0.00 ? 121 LYS A HE3  1 
ATOM 964   H HZ1  . LYS A 1 58 ? -5.635  -15.412 -43.664 1.00 0.00 ? 121 LYS A HZ1  1 
ATOM 965   H HZ2  . LYS A 1 58 ? -4.948  -16.556 -44.714 1.00 0.00 ? 121 LYS A HZ2  1 
ATOM 966   H HZ3  . LYS A 1 58 ? -5.269  -15.001 -45.244 1.00 0.00 ? 121 LYS A HZ3  1 
ATOM 967   N N    . TYR A 1 59 ? 2.679   -14.294 -44.891 1.00 0.00 ? 122 TYR A N    1 
ATOM 968   C CA   . TYR A 1 59 ? 3.652   -14.925 -45.773 1.00 0.00 ? 122 TYR A CA   1 
ATOM 969   C C    . TYR A 1 59 ? 4.003   -16.327 -45.291 1.00 0.00 ? 122 TYR A C    1 
ATOM 970   O O    . TYR A 1 59 ? 4.054   -16.586 -44.089 1.00 0.00 ? 122 TYR A O    1 
ATOM 971   C CB   . TYR A 1 59 ? 4.917   -14.070 -45.877 1.00 0.00 ? 122 TYR A CB   1 
ATOM 972   C CG   . TYR A 1 59 ? 5.534   -13.728 -44.538 1.00 0.00 ? 122 TYR A CG   1 
ATOM 973   C CD1  . TYR A 1 59 ? 6.474   -14.576 -43.971 1.00 0.00 ? 122 TYR A CD1  1 
ATOM 974   C CD2  . TYR A 1 59 ? 5.160   -12.567 -43.879 1.00 0.00 ? 122 TYR A CD2  1 
ATOM 975   C CE1  . TYR A 1 59 ? 7.036   -14.264 -42.749 1.00 0.00 ? 122 TYR A CE1  1 
ATOM 976   C CE2  . TYR A 1 59 ? 5.723   -12.255 -42.657 1.00 0.00 ? 122 TYR A CE2  1 
ATOM 977   C CZ   . TYR A 1 59 ? 6.659   -13.098 -42.092 1.00 0.00 ? 122 TYR A CZ   1 
ATOM 978   O OH   . TYR A 1 59 ? 7.218   -12.789 -40.874 1.00 0.00 ? 122 TYR A OH   1 
ATOM 979   H H    . TYR A 1 59 ? 2.847   -14.290 -43.887 1.00 0.00 ? 122 TYR A H    1 
ATOM 980   H HA   . TYR A 1 59 ? 3.226   -15.031 -46.772 1.00 0.00 ? 122 TYR A HA   1 
ATOM 981   H HB2  . TYR A 1 59 ? 5.656   -14.583 -46.484 1.00 0.00 ? 122 TYR A HB2  1 
ATOM 982   H HB3  . TYR A 1 59 ? 4.655   -13.137 -46.355 1.00 0.00 ? 122 TYR A HB3  1 
ATOM 983   H HD1  . TYR A 1 59 ? 6.763   -15.483 -44.483 1.00 0.00 ? 122 TYR A HD1  1 
ATOM 984   H HD2  . TYR A 1 59 ? 4.424   -11.916 -44.318 1.00 0.00 ? 122 TYR A HD2  1 
ATOM 985   H HE1  . TYR A 1 59 ? 7.769   -14.915 -42.304 1.00 0.00 ? 122 TYR A HE1  1 
ATOM 986   H HE2  . TYR A 1 59 ? 5.432   -11.349 -42.144 1.00 0.00 ? 122 TYR A HE2  1 
ATOM 987   H HH   . TYR A 1 59 ? 6.511   -12.529 -40.280 1.00 0.00 ? 122 TYR A HH   1 
ATOM 988   N N    . ARG A 1 60 ? 4.244   -17.231 -46.236 1.00 0.00 ? 123 ARG A N    1 
ATOM 989   C CA   . ARG A 1 60 ? 4.266   -18.659 -45.944 1.00 0.00 ? 123 ARG A CA   1 
ATOM 990   C C    . ARG A 1 60 ? 5.681   -19.139 -45.653 1.00 0.00 ? 123 ARG A C    1 
ATOM 991   O O    . ARG A 1 60 ? 6.658   -18.492 -46.032 1.00 0.00 ? 123 ARG A O    1 
ATOM 992   C CB   . ARG A 1 60 ? 3.692   -19.452 -47.110 1.00 0.00 ? 123 ARG A CB   1 
ATOM 993   C CG   . ARG A 1 60 ? 2.194   -19.688 -47.046 1.00 0.00 ? 123 ARG A CG   1 
ATOM 994   C CD   . ARG A 1 60 ? 1.433   -18.412 -47.074 1.00 0.00 ? 123 ARG A CD   1 
ATOM 995   N NE   . ARG A 1 60 ? 0.023   -18.627 -47.353 1.00 0.00 ? 123 ARG A NE   1 
ATOM 996   C CZ   . ARG A 1 60 ? -0.856  -17.650 -47.655 1.00 0.00 ? 123 ARG A CZ   1 
ATOM 997   N NH1  . ARG A 1 60 ? -0.453  -16.400 -47.712 1.00 0.00 ? 123 ARG A NH1  1 
ATOM 998   N NH2  . ARG A 1 60 ? -2.120  -17.948 -47.892 1.00 0.00 ? 123 ARG A NH2  1 
ATOM 999   H H    . ARG A 1 60 ? 4.134   -16.944 -47.208 1.00 0.00 ? 123 ARG A H    1 
ATOM 1000  H HA   . ARG A 1 60 ? 3.671   -18.870 -45.080 1.00 0.00 ? 123 ARG A HA   1 
ATOM 1001  H HB2  . ARG A 1 60 ? 3.897   -18.901 -48.025 1.00 0.00 ? 123 ARG A HB2  1 
ATOM 1002  H HB3  . ARG A 1 60 ? 4.188   -20.425 -47.176 1.00 0.00 ? 123 ARG A HB3  1 
ATOM 1003  H HG2  . ARG A 1 60 ? 1.878   -20.307 -47.886 1.00 0.00 ? 123 ARG A HG2  1 
ATOM 1004  H HG3  . ARG A 1 60 ? 1.975   -20.211 -46.118 1.00 0.00 ? 123 ARG A HG3  1 
ATOM 1005  H HD2  . ARG A 1 60 ? 1.530   -17.911 -46.115 1.00 0.00 ? 123 ARG A HD2  1 
ATOM 1006  H HD3  . ARG A 1 60 ? 1.847   -17.772 -47.856 1.00 0.00 ? 123 ARG A HD3  1 
ATOM 1007  H HE   . ARG A 1 60 ? -0.312  -19.549 -47.318 1.00 0.00 ? 123 ARG A HE   1 
ATOM 1008  H HH11 . ARG A 1 60 ? 0.505   -16.173 -47.532 1.00 0.00 ? 123 ARG A HH11 1 
ATOM 1009  H HH12 . ARG A 1 60 ? -1.111  -15.668 -47.937 1.00 0.00 ? 123 ARG A HH12 1 
ATOM 1010  H HH21 . ARG A 1 60 ? -2.429  -18.898 -47.848 1.00 0.00 ? 123 ARG A HH21 1 
ATOM 1011  H HH22 . ARG A 1 60 ? -2.769  -17.221 -48.115 1.00 0.00 ? 123 ARG A HH22 1 
ATOM 1012  N N    . ILE A 1 61 ? 5.786   -20.279 -44.978 1.00 0.00 ? 124 ILE A N    1 
ATOM 1013  C CA   . ILE A 1 61 ? 7.082   -20.878 -44.683 1.00 0.00 ? 124 ILE A CA   1 
ATOM 1014  C C    . ILE A 1 61 ? 7.520   -21.817 -45.802 1.00 0.00 ? 124 ILE A C    1 
ATOM 1015  O O    . ILE A 1 61 ? 6.779   -22.718 -46.194 1.00 0.00 ? 124 ILE A O    1 
ATOM 1016  C CB   . ILE A 1 61 ? 7.041   -21.649 -43.352 1.00 0.00 ? 124 ILE A CB   1 
ATOM 1017  C CG1  . ILE A 1 61 ? 6.623   -20.719 -42.210 1.00 0.00 ? 124 ILE A CG1  1 
ATOM 1018  C CG2  . ILE A 1 61 ? 8.395   -22.279 -43.060 1.00 0.00 ? 124 ILE A CG2  1 
ATOM 1019  C CD1  . ILE A 1 61 ? 6.236   -21.445 -40.942 1.00 0.00 ? 124 ILE A CD1  1 
ATOM 1020  H H    . ILE A 1 61 ? 4.942   -20.769 -44.706 1.00 0.00 ? 124 ILE A H    1 
ATOM 1021  H HA   . ILE A 1 61 ? 7.784   -20.074 -44.540 1.00 0.00 ? 124 ILE A HA   1 
ATOM 1022  H HB   . ILE A 1 61 ? 6.297   -22.442 -43.436 1.00 0.00 ? 124 ILE A HB   1 
ATOM 1023  H HG12 . ILE A 1 61 ? 7.463   -20.067 -41.998 1.00 0.00 ? 124 ILE A HG12 1 
ATOM 1024  H HG13 . ILE A 1 61 ? 5.781   -20.115 -42.544 1.00 0.00 ? 124 ILE A HG13 1 
ATOM 1025  H HG21 . ILE A 1 61 ? 8.626   -22.995 -43.835 1.00 0.00 ? 124 ILE A HG21 1 
ATOM 1026  H HG22 . ILE A 1 61 ? 8.392   -22.796 -42.109 1.00 0.00 ? 124 ILE A HG22 1 
ATOM 1027  H HG23 . ILE A 1 61 ? 9.153   -21.502 -43.045 1.00 0.00 ? 124 ILE A HG23 1 
ATOM 1028  H HD11 . ILE A 1 61 ? 5.236   -21.846 -41.043 1.00 0.00 ? 124 ILE A HD11 1 
ATOM 1029  H HD12 . ILE A 1 61 ? 6.264   -20.750 -40.103 1.00 0.00 ? 124 ILE A HD12 1 
ATOM 1030  H HD13 . ILE A 1 61 ? 6.937   -22.260 -40.762 1.00 0.00 ? 124 ILE A HD13 1 
ATOM 1031  N N    . PRO A 1 62 ? 8.728   -21.601 -46.309 1.00 0.00 ? 125 PRO A N    1 
ATOM 1032  C CA   . PRO A 1 62 ? 9.320   -22.502 -47.292 1.00 0.00 ? 125 PRO A CA   1 
ATOM 1033  C C    . PRO A 1 62 ? 9.213   -23.954 -46.843 1.00 0.00 ? 125 PRO A C    1 
ATOM 1034  O O    . PRO A 1 62 ? 9.392   -24.264 -45.665 1.00 0.00 ? 125 PRO A O    1 
ATOM 1035  C CB   . PRO A 1 62 ? 10.778  -22.034 -47.353 1.00 0.00 ? 125 PRO A CB   1 
ATOM 1036  C CG   . PRO A 1 62 ? 10.712  -20.583 -47.024 1.00 0.00 ? 125 PRO A CG   1 
ATOM 1037  C CD   . PRO A 1 62 ? 9.652   -20.489 -45.958 1.00 0.00 ? 125 PRO A CD   1 
ATOM 1038  H HA   . PRO A 1 62 ? 8.839   -22.362 -48.256 1.00 0.00 ? 125 PRO A HA   1 
ATOM 1039  H HB2  . PRO A 1 62 ? 11.381  -22.582 -46.633 1.00 0.00 ? 125 PRO A HB2  1 
ATOM 1040  H HB3  . PRO A 1 62 ? 11.180  -22.171 -48.359 1.00 0.00 ? 125 PRO A HB3  1 
ATOM 1041  H HG2  . PRO A 1 62 ? 11.678  -20.247 -46.641 1.00 0.00 ? 125 PRO A HG2  1 
ATOM 1042  H HG3  . PRO A 1 62 ? 10.426  -19.996 -47.902 1.00 0.00 ? 125 PRO A HG3  1 
ATOM 1043  H HD2  . PRO A 1 62 ? 10.085  -20.610 -44.963 1.00 0.00 ? 125 PRO A HD2  1 
ATOM 1044  H HD3  . PRO A 1 62 ? 9.140   -19.534 -46.051 1.00 0.00 ? 125 PRO A HD3  1 
ATOM 1045  N N    . ALA A 1 63 ? 8.920   -24.840 -47.787 1.00 0.00 ? 126 ALA A N    1 
ATOM 1046  C CA   . ALA A 1 63 ? 8.708   -26.249 -47.478 1.00 0.00 ? 126 ALA A CA   1 
ATOM 1047  C C    . ALA A 1 63 ? 9.951   -26.867 -46.851 1.00 0.00 ? 126 ALA A C    1 
ATOM 1048  O O    . ALA A 1 63 ? 9.887   -27.942 -46.254 1.00 0.00 ? 126 ALA A O    1 
ATOM 1049  C CB   . ALA A 1 63 ? 8.312   -27.013 -48.733 1.00 0.00 ? 126 ALA A CB   1 
ATOM 1050  H H    . ALA A 1 63 ? 8.769   -24.516 -48.744 1.00 0.00 ? 126 ALA A H    1 
ATOM 1051  H HA   . ALA A 1 63 ? 7.892   -26.329 -46.762 1.00 0.00 ? 126 ALA A HA   1 
ATOM 1052  H HB1  . ALA A 1 63 ? 7.530   -26.464 -49.259 1.00 0.00 ? 126 ALA A HB1  1 
ATOM 1053  H HB2  . ALA A 1 63 ? 7.940   -28.000 -48.458 1.00 0.00 ? 126 ALA A HB2  1 
ATOM 1054  H HB3  . ALA A 1 63 ? 9.180   -27.119 -49.383 1.00 0.00 ? 126 ALA A HB3  1 
ATOM 1055  N N    . ASP A 1 64 ? 11.082  -26.185 -46.993 1.00 0.00 ? 127 ASP A N    1 
ATOM 1056  C CA   . ASP A 1 64 ? 12.351  -26.689 -46.483 1.00 0.00 ? 127 ASP A CA   1 
ATOM 1057  C C    . ASP A 1 64 ? 12.729  -26.008 -45.175 1.00 0.00 ? 127 ASP A C    1 
ATOM 1058  O O    . ASP A 1 64 ? 13.881  -26.062 -44.744 1.00 0.00 ? 127 ASP A O    1 
ATOM 1059  C CB   . ASP A 1 64 ? 13.463  -26.483 -47.513 1.00 0.00 ? 127 ASP A CB   1 
ATOM 1060  C CG   . ASP A 1 64 ? 13.273  -27.325 -48.768 1.00 0.00 ? 127 ASP A CG   1 
ATOM 1061  O OD1  . ASP A 1 64 ? 12.820  -28.437 -48.650 1.00 0.00 ? 127 ASP A OD1  1 
ATOM 1062  O OD2  . ASP A 1 64 ? 13.582  -26.845 -49.833 1.00 0.00 ? 127 ASP A OD2  1 
ATOM 1063  H H    . ASP A 1 64 ? 11.071  -25.305 -47.507 1.00 0.00 ? 127 ASP A H    1 
ATOM 1064  H HA   . ASP A 1 64 ? 12.267  -27.762 -46.297 1.00 0.00 ? 127 ASP A HA   1 
ATOM 1065  H HB2  . ASP A 1 64 ? 13.480  -25.432 -47.798 1.00 0.00 ? 127 ASP A HB2  1 
ATOM 1066  H HB3  . ASP A 1 64 ? 14.421  -26.742 -47.059 1.00 0.00 ? 127 ASP A HB3  1 
ATOM 1067  N N    . VAL A 1 65 ? 11.751  -25.364 -44.545 1.00 0.00 ? 128 VAL A N    1 
ATOM 1068  C CA   . VAL A 1 65 ? 11.983  -24.662 -43.287 1.00 0.00 ? 128 VAL A CA   1 
ATOM 1069  C C    . VAL A 1 65 ? 10.988  -25.097 -42.221 1.00 0.00 ? 128 VAL A C    1 
ATOM 1070  O O    . VAL A 1 65 ? 9.786   -25.182 -42.476 1.00 0.00 ? 128 VAL A O    1 
ATOM 1071  C CB   . VAL A 1 65 ? 11.870  -23.138 -43.499 1.00 0.00 ? 128 VAL A CB   1 
ATOM 1072  C CG1  . VAL A 1 65 ? 12.003  -22.407 -42.171 1.00 0.00 ? 128 VAL A CG1  1 
ATOM 1073  C CG2  . VAL A 1 65 ? 12.934  -22.671 -44.480 1.00 0.00 ? 128 VAL A CG2  1 
ATOM 1074  H H    . VAL A 1 65 ? 10.817  -25.358 -44.953 1.00 0.00 ? 128 VAL A H    1 
ATOM 1075  H HA   . VAL A 1 65 ? 12.963  -24.889 -42.916 1.00 0.00 ? 128 VAL A HA   1 
ATOM 1076  H HB   . VAL A 1 65 ? 10.892  -22.923 -43.914 1.00 0.00 ? 128 VAL A HB   1 
ATOM 1077  H HG11 . VAL A 1 65 ? 11.786  -21.357 -42.332 1.00 0.00 ? 128 VAL A HG11 1 
ATOM 1078  H HG12 . VAL A 1 65 ? 13.020  -22.516 -41.794 1.00 0.00 ? 128 VAL A HG12 1 
ATOM 1079  H HG13 . VAL A 1 65 ? 11.305  -22.798 -41.438 1.00 0.00 ? 128 VAL A HG13 1 
ATOM 1080  H HG21 . VAL A 1 65 ? 13.089  -23.419 -45.259 1.00 0.00 ? 128 VAL A HG21 1 
ATOM 1081  H HG22 . VAL A 1 65 ? 13.873  -22.489 -43.965 1.00 0.00 ? 128 VAL A HG22 1 
ATOM 1082  H HG23 . VAL A 1 65 ? 12.595  -21.749 -44.933 1.00 0.00 ? 128 VAL A HG23 1 
ATOM 1083  N N    . ASP A 1 66 ? 11.494  -25.377 -41.025 1.00 0.00 ? 129 ASP A N    1 
ATOM 1084  C CA   . ASP A 1 66 ? 10.664  -25.883 -39.939 1.00 0.00 ? 129 ASP A CA   1 
ATOM 1085  C C    . ASP A 1 66 ? 10.001  -24.743 -39.175 1.00 0.00 ? 129 ASP A C    1 
ATOM 1086  O O    . ASP A 1 66 ? 10.680  -23.899 -38.588 1.00 0.00 ? 129 ASP A O    1 
ATOM 1087  C CB   . ASP A 1 66 ? 11.496  -26.735 -38.977 1.00 0.00 ? 129 ASP A CB   1 
ATOM 1088  C CG   . ASP A 1 66 ? 10.651  -27.420 -37.912 1.00 0.00 ? 129 ASP A CG   1 
ATOM 1089  O OD1  . ASP A 1 66 ? 9.494   -27.092 -37.797 1.00 0.00 ? 129 ASP A OD1  1 
ATOM 1090  O OD2  . ASP A 1 66 ? 11.173  -28.265 -37.223 1.00 0.00 ? 129 ASP A OD2  1 
ATOM 1091  H H    . ASP A 1 66 ? 12.503  -25.297 -40.887 1.00 0.00 ? 129 ASP A H    1 
ATOM 1092  H HA   . ASP A 1 66 ? 9.935   -26.557 -40.358 1.00 0.00 ? 129 ASP A HA   1 
ATOM 1093  H HB2  . ASP A 1 66 ? 12.067  -27.466 -39.518 1.00 0.00 ? 129 ASP A HB2  1 
ATOM 1094  H HB3  . ASP A 1 66 ? 12.187  -26.066 -38.466 1.00 0.00 ? 129 ASP A HB3  1 
ATOM 1095  N N    . PRO A 1 67 ? 8.673   -24.723 -39.186 1.00 0.00 ? 130 PRO A N    1 
ATOM 1096  C CA   . PRO A 1 67 ? 7.917   -23.687 -38.492 1.00 0.00 ? 130 PRO A CA   1 
ATOM 1097  C C    . PRO A 1 67 ? 8.351   -23.570 -37.038 1.00 0.00 ? 130 PRO A C    1 
ATOM 1098  O O    . PRO A 1 67 ? 8.349   -22.480 -36.465 1.00 0.00 ? 130 PRO A O    1 
ATOM 1099  C CB   . PRO A 1 67 ? 6.470   -24.179 -38.612 1.00 0.00 ? 130 PRO A CB   1 
ATOM 1100  C CG   . PRO A 1 67 ? 6.449   -24.945 -39.890 1.00 0.00 ? 130 PRO A CG   1 
ATOM 1101  C CD   . PRO A 1 67 ? 7.777   -25.653 -39.924 1.00 0.00 ? 130 PRO A CD   1 
ATOM 1102  H HA   . PRO A 1 67 ? 8.039   -22.734 -38.980 1.00 0.00 ? 130 PRO A HA   1 
ATOM 1103  H HB2  . PRO A 1 67 ? 6.203   -24.816 -37.763 1.00 0.00 ? 130 PRO A HB2  1 
ATOM 1104  H HB3  . PRO A 1 67 ? 5.789   -23.330 -38.677 1.00 0.00 ? 130 PRO A HB3  1 
ATOM 1105  H HG2  . PRO A 1 67 ? 5.636   -25.677 -39.860 1.00 0.00 ? 130 PRO A HG2  1 
ATOM 1106  H HG3  . PRO A 1 67 ? 6.330   -24.303 -40.754 1.00 0.00 ? 130 PRO A HG3  1 
ATOM 1107  H HD2  . PRO A 1 67 ? 7.727   -26.624 -39.423 1.00 0.00 ? 130 PRO A HD2  1 
ATOM 1108  H HD3  . PRO A 1 67 ? 8.091   -25.761 -40.959 1.00 0.00 ? 130 PRO A HD3  1 
ATOM 1109  N N    . LEU A 1 68 ? 8.725   -24.699 -36.444 1.00 0.00 ? 131 LEU A N    1 
ATOM 1110  C CA   . LEU A 1 68 ? 9.024   -24.752 -35.017 1.00 0.00 ? 131 LEU A CA   1 
ATOM 1111  C C    . LEU A 1 68 ? 10.351  -24.073 -34.707 1.00 0.00 ? 131 LEU A C    1 
ATOM 1112  O O    . LEU A 1 68 ? 10.596  -23.654 -33.576 1.00 0.00 ? 131 LEU A O    1 
ATOM 1113  C CB   . LEU A 1 68 ? 9.060   -26.208 -34.538 1.00 0.00 ? 131 LEU A CB   1 
ATOM 1114  C CG   . LEU A 1 68 ? 7.728   -26.965 -34.602 1.00 0.00 ? 131 LEU A CG   1 
ATOM 1115  C CD1  . LEU A 1 68 ? 7.949   -28.421 -34.215 1.00 0.00 ? 131 LEU A CD1  1 
ATOM 1116  C CD2  . LEU A 1 68 ? 6.720   -26.299 -33.675 1.00 0.00 ? 131 LEU A CD2  1 
ATOM 1117  H H    . LEU A 1 68 ? 8.682   -25.571 -36.972 1.00 0.00 ? 131 LEU A H    1 
ATOM 1118  H HA   . LEU A 1 68 ? 8.242   -24.236 -34.466 1.00 0.00 ? 131 LEU A HA   1 
ATOM 1119  H HB2  . LEU A 1 68 ? 9.783   -26.748 -35.151 1.00 0.00 ? 131 LEU A HB2  1 
ATOM 1120  H HB3  . LEU A 1 68 ? 9.411   -26.222 -33.504 1.00 0.00 ? 131 LEU A HB3  1 
ATOM 1121  H HG   . LEU A 1 68 ? 7.356   -26.923 -35.629 1.00 0.00 ? 131 LEU A HG   1 
ATOM 1122  H HD11 . LEU A 1 68 ? 8.738   -28.851 -34.830 1.00 0.00 ? 131 LEU A HD11 1 
ATOM 1123  H HD12 . LEU A 1 68 ? 7.024   -28.979 -34.365 1.00 0.00 ? 131 LEU A HD12 1 
ATOM 1124  H HD13 . LEU A 1 68 ? 8.238   -28.473 -33.165 1.00 0.00 ? 131 LEU A HD13 1 
ATOM 1125  H HD21 . LEU A 1 68 ? 5.922   -27.007 -33.447 1.00 0.00 ? 131 LEU A HD21 1 
ATOM 1126  H HD22 . LEU A 1 68 ? 6.288   -25.425 -34.157 1.00 0.00 ? 131 LEU A HD22 1 
ATOM 1127  H HD23 . LEU A 1 68 ? 7.208   -26.000 -32.747 1.00 0.00 ? 131 LEU A HD23 1 
ATOM 1128  N N    . THR A 1 69 ? 11.207  -23.971 -35.718 1.00 0.00 ? 132 THR A N    1 
ATOM 1129  C CA   . THR A 1 69 ? 12.527  -23.373 -35.547 1.00 0.00 ? 132 THR A CA   1 
ATOM 1130  C C    . THR A 1 69 ? 12.492  -21.876 -35.824 1.00 0.00 ? 132 THR A C    1 
ATOM 1131  O O    . THR A 1 69 ? 13.495  -21.181 -35.660 1.00 0.00 ? 132 THR A O    1 
ATOM 1132  C CB   . THR A 1 69 ? 13.563  -24.046 -36.464 1.00 0.00 ? 132 THR A CB   1 
ATOM 1133  O OG1  . THR A 1 69 ? 13.178  -23.870 -37.834 1.00 0.00 ? 132 THR A OG1  1 
ATOM 1134  C CG2  . THR A 1 69 ? 13.664  -25.532 -36.157 1.00 0.00 ? 132 THR A CG2  1 
ATOM 1135  H H    . THR A 1 69 ? 10.948  -24.346 -36.630 1.00 0.00 ? 132 THR A H    1 
ATOM 1136  H HA   . THR A 1 69 ? 12.852  -23.519 -34.513 1.00 0.00 ? 132 THR A HA   1 
ATOM 1137  H HB   . THR A 1 69 ? 14.528  -23.597 -36.294 1.00 0.00 ? 132 THR A HB   1 
ATOM 1138  H HG1  . THR A 1 69 ? 13.664  -23.120 -38.186 1.00 0.00 ? 132 THR A HG1  1 
ATOM 1139  H HG21 . THR A 1 69 ? 12.663  -25.958 -36.103 1.00 0.00 ? 132 THR A HG21 1 
ATOM 1140  H HG22 . THR A 1 69 ? 14.170  -25.671 -35.202 1.00 0.00 ? 132 THR A HG22 1 
ATOM 1141  H HG23 . THR A 1 69 ? 14.228  -26.032 -36.944 1.00 0.00 ? 132 THR A HG23 1 
ATOM 1142  N N    . ILE A 1 70 ? 11.333  -21.382 -36.245 1.00 0.00 ? 133 ILE A N    1 
ATOM 1143  C CA   . ILE A 1 70 ? 11.163  -19.964 -36.535 1.00 0.00 ? 133 ILE A CA   1 
ATOM 1144  C C    . ILE A 1 70 ? 10.738  -19.195 -35.293 1.00 0.00 ? 133 ILE A C    1 
ATOM 1145  O O    . ILE A 1 70 ? 9.704   -19.487 -34.692 1.00 0.00 ? 133 ILE A O    1 
ATOM 1146  C CB   . ILE A 1 70 ? 10.123  -19.753 -37.653 1.00 0.00 ? 133 ILE A CB   1 
ATOM 1147  C CG1  . ILE A 1 70 ? 10.599  -20.404 -38.953 1.00 0.00 ? 133 ILE A CG1  1 
ATOM 1148  C CG2  . ILE A 1 70 ? 9.861   -18.270 -37.859 1.00 0.00 ? 133 ILE A CG2  1 
ATOM 1149  C CD1  . ILE A 1 70 ? 9.557   -20.408 -40.050 1.00 0.00 ? 133 ILE A CD1  1 
ATOM 1150  H H    . ILE A 1 70 ? 10.537  -22.014 -36.356 1.00 0.00 ? 133 ILE A H    1 
ATOM 1151  H HA   . ILE A 1 70 ? 12.090  -19.532 -36.851 1.00 0.00 ? 133 ILE A HA   1 
ATOM 1152  H HB   . ILE A 1 70 ? 9.190   -20.232 -37.348 1.00 0.00 ? 133 ILE A HB   1 
ATOM 1153  H HG12 . ILE A 1 70 ? 11.434  -19.816 -39.327 1.00 0.00 ? 133 ILE A HG12 1 
ATOM 1154  H HG13 . ILE A 1 70 ? 10.932  -21.424 -38.752 1.00 0.00 ? 133 ILE A HG13 1 
ATOM 1155  H HG21 . ILE A 1 70 ? 9.289   -18.118 -38.773 1.00 0.00 ? 133 ILE A HG21 1 
ATOM 1156  H HG22 . ILE A 1 70 ? 10.813  -17.748 -37.939 1.00 0.00 ? 133 ILE A HG22 1 
ATOM 1157  H HG23 . ILE A 1 70 ? 9.297   -17.872 -37.016 1.00 0.00 ? 133 ILE A HG23 1 
ATOM 1158  H HD11 . ILE A 1 70 ? 9.606   -19.487 -40.635 1.00 0.00 ? 133 ILE A HD11 1 
ATOM 1159  H HD12 . ILE A 1 70 ? 9.734   -21.259 -40.708 1.00 0.00 ? 133 ILE A HD12 1 
ATOM 1160  H HD13 . ILE A 1 70 ? 8.567   -20.499 -39.604 1.00 0.00 ? 133 ILE A HD13 1 
ATOM 1161  N N    . THR A 1 71 ? 11.540  -18.206 -34.912 1.00 0.00 ? 134 THR A N    1 
ATOM 1162  C CA   . THR A 1 71 ? 11.262  -17.408 -33.725 1.00 0.00 ? 134 THR A CA   1 
ATOM 1163  C C    . THR A 1 71 ? 11.267  -15.919 -34.049 1.00 0.00 ? 134 THR A C    1 
ATOM 1164  O O    . THR A 1 71 ? 12.156  -15.430 -34.745 1.00 0.00 ? 134 THR A O    1 
ATOM 1165  C CB   . THR A 1 71 ? 12.280  -17.698 -32.608 1.00 0.00 ? 134 THR A CB   1 
ATOM 1166  O OG1  . THR A 1 71 ? 12.224  -19.086 -32.254 1.00 0.00 ? 134 THR A OG1  1 
ATOM 1167  C CG2  . THR A 1 71 ? 11.980  -16.853 -31.379 1.00 0.00 ? 134 THR A CG2  1 
ATOM 1168  H H    . THR A 1 71 ? 12.382  -18.010 -35.453 1.00 0.00 ? 134 THR A H    1 
ATOM 1169  H HA   . THR A 1 71 ? 10.269  -17.657 -33.340 1.00 0.00 ? 134 THR A HA   1 
ATOM 1170  H HB   . THR A 1 71 ? 13.280  -17.459 -32.968 1.00 0.00 ? 134 THR A HB   1 
ATOM 1171  H HG1  . THR A 1 71 ? 11.525  -19.197 -31.607 1.00 0.00 ? 134 THR A HG1  1 
ATOM 1172  H HG21 . THR A 1 71 ? 12.242  -15.814 -31.579 1.00 0.00 ? 134 THR A HG21 1 
ATOM 1173  H HG22 . THR A 1 71 ? 12.565  -17.217 -30.533 1.00 0.00 ? 134 THR A HG22 1 
ATOM 1174  H HG23 . THR A 1 71 ? 10.919  -16.921 -31.143 1.00 0.00 ? 134 THR A HG23 1 
ATOM 1175  N N    . SER A 1 72 ? 10.270  -15.202 -33.540 1.00 0.00 ? 135 SER A N    1 
ATOM 1176  C CA   . SER A 1 72 ? 10.178  -13.763 -33.745 1.00 0.00 ? 135 SER A CA   1 
ATOM 1177  C C    . SER A 1 72 ? 10.910  -13.001 -32.649 1.00 0.00 ? 135 SER A C    1 
ATOM 1178  O O    . SER A 1 72 ? 11.149  -13.532 -31.564 1.00 0.00 ? 135 SER A O    1 
ATOM 1179  C CB   . SER A 1 72 ? 8.724   -13.333 -33.788 1.00 0.00 ? 135 SER A CB   1 
ATOM 1180  O OG   . SER A 1 72 ? 8.132   -13.441 -32.524 1.00 0.00 ? 135 SER A OG   1 
ATOM 1181  H H    . SER A 1 72 ? 9.567   -15.669 -32.968 1.00 0.00 ? 135 SER A H    1 
ATOM 1182  H HA   . SER A 1 72 ? 10.630  -13.512 -34.681 1.00 0.00 ? 135 SER A HA   1 
ATOM 1183  H HB2  . SER A 1 72 ? 8.652   -12.318 -34.141 1.00 0.00 ? 135 SER A HB2  1 
ATOM 1184  H HB3  . SER A 1 72 ? 8.188   -13.991 -34.476 1.00 0.00 ? 135 SER A HB3  1 
ATOM 1185  H HG   . SER A 1 72 ? 7.457   -14.123 -32.557 1.00 0.00 ? 135 SER A HG   1 
ATOM 1186  N N    . SER A 1 73 ? 11.265  -11.753 -32.937 1.00 0.00 ? 136 SER A N    1 
ATOM 1187  C CA   . SER A 1 73 ? 11.958  -10.912 -31.971 1.00 0.00 ? 136 SER A CA   1 
ATOM 1188  C C    . SER A 1 73 ? 11.809  -9.435  -32.318 1.00 0.00 ? 136 SER A C    1 
ATOM 1189  O O    . SER A 1 73 ? 12.178  -9.004  -33.411 1.00 0.00 ? 136 SER A O    1 
ATOM 1190  C CB   . SER A 1 73 ? 13.427  -11.280 -31.915 1.00 0.00 ? 136 SER A CB   1 
ATOM 1191  O OG   . SER A 1 73 ? 14.121  -10.453 -31.022 1.00 0.00 ? 136 SER A OG   1 
ATOM 1192  H H    . SER A 1 73 ? 11.036  -11.370 -33.856 1.00 0.00 ? 136 SER A H    1 
ATOM 1193  H HA   . SER A 1 73 ? 11.527  -11.078 -30.982 1.00 0.00 ? 136 SER A HA   1 
ATOM 1194  H HB2  . SER A 1 73 ? 13.531  -12.312 -31.589 1.00 0.00 ? 136 SER A HB2  1 
ATOM 1195  H HB3  . SER A 1 73 ? 13.854  -11.179 -32.916 1.00 0.00 ? 136 SER A HB3  1 
ATOM 1196  H HG   . SER A 1 73 ? 15.058  -10.504 -31.226 1.00 0.00 ? 136 SER A HG   1 
ATOM 1197  N N    . LEU A 1 74 ? 11.266  -8.664  -31.382 1.00 0.00 ? 137 LEU A N    1 
ATOM 1198  C CA   . LEU A 1 74 ? 10.991  -7.253  -31.618 1.00 0.00 ? 137 LEU A CA   1 
ATOM 1199  C C    . LEU A 1 74 ? 12.043  -6.369  -30.961 1.00 0.00 ? 137 LEU A C    1 
ATOM 1200  O O    . LEU A 1 74 ? 12.230  -6.409  -29.743 1.00 0.00 ? 137 LEU A O    1 
ATOM 1201  C CB   . LEU A 1 74 ? 9.600   -6.887  -31.083 1.00 0.00 ? 137 LEU A CB   1 
ATOM 1202  C CG   . LEU A 1 74 ? 9.200   -5.412  -31.221 1.00 0.00 ? 137 LEU A CG   1 
ATOM 1203  C CD1  . LEU A 1 74 ? 9.152   -5.033  -32.695 1.00 0.00 ? 137 LEU A CD1  1 
ATOM 1204  C CD2  . LEU A 1 74 ? 7.852   -5.188  -30.553 1.00 0.00 ? 137 LEU A CD2  1 
ATOM 1205  H H    . LEU A 1 74 ? 10.971  -9.086  -30.502 1.00 0.00 ? 137 LEU A H    1 
ATOM 1206  H HA   . LEU A 1 74 ? 11.007  -7.063  -32.676 1.00 0.00 ? 137 LEU A HA   1 
ATOM 1207  H HB2  . LEU A 1 74 ? 8.864   -7.483  -31.604 1.00 0.00 ? 137 LEU A HB2  1 
ATOM 1208  H HB3  . LEU A 1 74 ? 9.568   -7.152  -30.025 1.00 0.00 ? 137 LEU A HB3  1 
ATOM 1209  H HG   . LEU A 1 74 ? 9.947   -4.795  -30.721 1.00 0.00 ? 137 LEU A HG   1 
ATOM 1210  H HD11 . LEU A 1 74 ? 10.131  -5.119  -33.153 1.00 0.00 ? 137 LEU A HD11 1 
ATOM 1211  H HD12 . LEU A 1 74 ? 8.835   -4.005  -32.754 1.00 0.00 ? 137 LEU A HD12 1 
ATOM 1212  H HD13 . LEU A 1 74 ? 8.441   -5.672  -33.213 1.00 0.00 ? 137 LEU A HD13 1 
ATOM 1213  H HD21 . LEU A 1 74 ? 7.476   -4.200  -30.823 1.00 0.00 ? 137 LEU A HD21 1 
ATOM 1214  H HD22 . LEU A 1 74 ? 7.968   -5.248  -29.473 1.00 0.00 ? 137 LEU A HD22 1 
ATOM 1215  H HD23 . LEU A 1 74 ? 7.149   -5.949  -30.889 1.00 0.00 ? 137 LEU A HD23 1 
ATOM 1216  N N    . SER A 1 75 ? 12.726  -5.568  -31.772 1.00 0.00 ? 138 SER A N    1 
ATOM 1217  C CA   . SER A 1 75 ? 13.802  -4.715  -31.278 1.00 0.00 ? 138 SER A CA   1 
ATOM 1218  C C    . SER A 1 75 ? 13.251  -3.436  -30.661 1.00 0.00 ? 138 SER A C    1 
ATOM 1219  O O    . SER A 1 75 ? 12.076  -3.111  -30.829 1.00 0.00 ? 138 SER A O    1 
ATOM 1220  C CB   . SER A 1 75 ? 14.755  -4.374  -32.406 1.00 0.00 ? 138 SER A CB   1 
ATOM 1221  O OG   . SER A 1 75 ? 14.157  -3.495  -33.319 1.00 0.00 ? 138 SER A OG   1 
ATOM 1222  H H    . SER A 1 75 ? 12.527  -5.583  -32.772 1.00 0.00 ? 138 SER A H    1 
ATOM 1223  H HA   . SER A 1 75 ? 14.359  -5.253  -30.510 1.00 0.00 ? 138 SER A HA   1 
ATOM 1224  H HB2  . SER A 1 75 ? 15.642  -3.899  -31.996 1.00 0.00 ? 138 SER A HB2  1 
ATOM 1225  H HB3  . SER A 1 75 ? 15.049  -5.295  -32.914 1.00 0.00 ? 138 SER A HB3  1 
ATOM 1226  H HG   . SER A 1 75 ? 13.632  -4.017  -33.931 1.00 0.00 ? 138 SER A HG   1 
ATOM 1227  N N    . SER A 1 76 ? 14.106  -2.715  -29.946 1.00 0.00 ? 139 SER A N    1 
ATOM 1228  C CA   . SER A 1 76 ? 13.728  -1.437  -29.358 1.00 0.00 ? 139 SER A CA   1 
ATOM 1229  C C    . SER A 1 76 ? 13.527  -0.375  -30.432 1.00 0.00 ? 139 SER A C    1 
ATOM 1230  O O    . SER A 1 76 ? 12.887  0.649   -30.193 1.00 0.00 ? 139 SER A O    1 
ATOM 1231  C CB   . SER A 1 76 ? 14.785  -0.980  -28.372 1.00 0.00 ? 139 SER A CB   1 
ATOM 1232  O OG   . SER A 1 76 ? 15.977  -0.652  -29.030 1.00 0.00 ? 139 SER A OG   1 
ATOM 1233  H H    . SER A 1 76 ? 15.071  -3.037  -29.852 1.00 0.00 ? 139 SER A H    1 
ATOM 1234  H HA   . SER A 1 76 ? 12.786  -1.574  -28.826 1.00 0.00 ? 139 SER A HA   1 
ATOM 1235  H HB2  . SER A 1 76 ? 14.427  -0.102  -27.842 1.00 0.00 ? 139 SER A HB2  1 
ATOM 1236  H HB3  . SER A 1 76 ? 14.973  -1.780  -27.651 1.00 0.00 ? 139 SER A HB3  1 
ATOM 1237  H HG   . SER A 1 76 ? 16.520  -0.131  -28.435 1.00 0.00 ? 139 SER A HG   1 
ATOM 1238  N N    . ASP A 1 77 ? 14.080  -0.625  -31.614 1.00 0.00 ? 140 ASP A N    1 
ATOM 1239  C CA   . ASP A 1 77 ? 13.902  0.273   -32.748 1.00 0.00 ? 140 ASP A CA   1 
ATOM 1240  C C    . ASP A 1 77 ? 12.591  -0.009  -33.473 1.00 0.00 ? 140 ASP A C    1 
ATOM 1241  O O    . ASP A 1 77 ? 12.201  0.729   -34.377 1.00 0.00 ? 140 ASP A O    1 
ATOM 1242  C CB   . ASP A 1 77 ? 15.072  0.141   -33.727 1.00 0.00 ? 140 ASP A CB   1 
ATOM 1243  C CG   . ASP A 1 77 ? 16.385  0.656   -33.152 1.00 0.00 ? 140 ASP A CG   1 
ATOM 1244  O OD1  . ASP A 1 77 ? 16.342  1.479   -32.267 1.00 0.00 ? 140 ASP A OD1  1 
ATOM 1245  O OD2  . ASP A 1 77 ? 17.417  0.221   -33.602 1.00 0.00 ? 140 ASP A OD2  1 
ATOM 1246  H H    . ASP A 1 77 ? 14.588  -1.498  -31.749 1.00 0.00 ? 140 ASP A H    1 
ATOM 1247  H HA   . ASP A 1 77 ? 13.883  1.300   -32.382 1.00 0.00 ? 140 ASP A HA   1 
ATOM 1248  H HB2  . ASP A 1 77 ? 15.191  -0.912  -33.981 1.00 0.00 ? 140 ASP A HB2  1 
ATOM 1249  H HB3  . ASP A 1 77 ? 14.842  0.701   -34.634 1.00 0.00 ? 140 ASP A HB3  1 
ATOM 1250  N N    . GLY A 1 78 ? 11.917  -1.080  -33.072 1.00 0.00 ? 141 GLY A N    1 
ATOM 1251  C CA   . GLY A 1 78 ? 10.643  -1.455  -33.673 1.00 0.00 ? 141 GLY A CA   1 
ATOM 1252  C C    . GLY A 1 78 ? 10.853  -2.244  -34.960 1.00 0.00 ? 141 GLY A C    1 
ATOM 1253  O O    . GLY A 1 78 ? 10.197  -1.988  -35.971 1.00 0.00 ? 141 GLY A O    1 
ATOM 1254  H H    . GLY A 1 78 ? 12.295  -1.650  -32.315 1.00 0.00 ? 141 GLY A H    1 
ATOM 1255  H HA2  . GLY A 1 78 ? 10.098  -2.075  -32.969 1.00 0.00 ? 141 GLY A HA2  1 
ATOM 1256  H HA3  . GLY A 1 78 ? 10.071  -0.578  -33.866 1.00 0.00 ? 141 GLY A HA3  1 
ATOM 1257  N N    . VAL A 1 79 ? 11.769  -3.206  -34.915 1.00 0.00 ? 142 VAL A N    1 
ATOM 1258  C CA   . VAL A 1 79 ? 11.945  -4.148  -36.014 1.00 0.00 ? 142 VAL A CA   1 
ATOM 1259  C C    . VAL A 1 79 ? 11.686  -5.578  -35.562 1.00 0.00 ? 142 VAL A C    1 
ATOM 1260  O O    . VAL A 1 79 ? 12.430  -6.125  -34.746 1.00 0.00 ? 142 VAL A O    1 
ATOM 1261  C CB   . VAL A 1 79 ? 13.373  -4.042  -36.584 1.00 0.00 ? 142 VAL A CB   1 
ATOM 1262  C CG1  . VAL A 1 79 ? 13.566  -5.031  -37.724 1.00 0.00 ? 142 VAL A CG1  1 
ATOM 1263  C CG2  . VAL A 1 79 ? 13.641  -2.620  -37.052 1.00 0.00 ? 142 VAL A CG2  1 
ATOM 1264  H H    . VAL A 1 79 ? 12.258  -3.381  -34.038 1.00 0.00 ? 142 VAL A H    1 
ATOM 1265  H HA   . VAL A 1 79 ? 11.248  -3.913  -36.822 1.00 0.00 ? 142 VAL A HA   1 
ATOM 1266  H HB   . VAL A 1 79 ? 14.077  -4.285  -35.790 1.00 0.00 ? 142 VAL A HB   1 
ATOM 1267  H HG11 . VAL A 1 79 ? 12.948  -4.727  -38.569 1.00 0.00 ? 142 VAL A HG11 1 
ATOM 1268  H HG12 . VAL A 1 79 ? 13.296  -6.039  -37.417 1.00 0.00 ? 142 VAL A HG12 1 
ATOM 1269  H HG13 . VAL A 1 79 ? 14.610  -5.028  -38.023 1.00 0.00 ? 142 VAL A HG13 1 
ATOM 1270  H HG21 . VAL A 1 79 ? 14.669  -2.539  -37.408 1.00 0.00 ? 142 VAL A HG21 1 
ATOM 1271  H HG22 . VAL A 1 79 ? 13.488  -1.925  -36.226 1.00 0.00 ? 142 VAL A HG22 1 
ATOM 1272  H HG23 . VAL A 1 79 ? 12.955  -2.377  -37.864 1.00 0.00 ? 142 VAL A HG23 1 
ATOM 1273  N N    . LEU A 1 80 ? 10.630  -6.180  -36.096 1.00 0.00 ? 143 LEU A N    1 
ATOM 1274  C CA   . LEU A 1 80 ? 10.278  -7.553  -35.755 1.00 0.00 ? 143 LEU A CA   1 
ATOM 1275  C C    . LEU A 1 80 ? 10.958  -8.544  -36.690 1.00 0.00 ? 143 LEU A C    1 
ATOM 1276  O O    . LEU A 1 80 ? 10.714  -8.542  -37.897 1.00 0.00 ? 143 LEU A O    1 
ATOM 1277  C CB   . LEU A 1 80 ? 8.757   -7.742  -35.819 1.00 0.00 ? 143 LEU A CB   1 
ATOM 1278  C CG   . LEU A 1 80 ? 8.246   -9.153  -35.501 1.00 0.00 ? 143 LEU A CG   1 
ATOM 1279  C CD1  . LEU A 1 80 ? 8.426   -9.434  -34.016 1.00 0.00 ? 143 LEU A CD1  1 
ATOM 1280  C CD2  . LEU A 1 80 ? 6.784   -9.268  -35.907 1.00 0.00 ? 143 LEU A CD2  1 
ATOM 1281  H H    . LEU A 1 80 ? 10.057  -5.675  -36.772 1.00 0.00 ? 143 LEU A H    1 
ATOM 1282  H HA   . LEU A 1 80 ? 10.603  -7.770  -34.748 1.00 0.00 ? 143 LEU A HA   1 
ATOM 1283  H HB2  . LEU A 1 80 ? 8.314   -7.056  -35.103 1.00 0.00 ? 143 LEU A HB2  1 
ATOM 1284  H HB3  . LEU A 1 80 ? 8.428   -7.447  -36.789 1.00 0.00 ? 143 LEU A HB3  1 
ATOM 1285  H HG   . LEU A 1 80 ? 8.838   -9.875  -36.064 1.00 0.00 ? 143 LEU A HG   1 
ATOM 1286  H HD11 . LEU A 1 80 ? 7.832   -10.298 -33.736 1.00 0.00 ? 143 LEU A HD11 1 
ATOM 1287  H HD12 . LEU A 1 80 ? 8.083   -8.581  -33.441 1.00 0.00 ? 143 LEU A HD12 1 
ATOM 1288  H HD13 . LEU A 1 80 ? 9.475   -9.629  -33.794 1.00 0.00 ? 143 LEU A HD13 1 
ATOM 1289  H HD21 . LEU A 1 80 ? 6.645   -10.166 -36.514 1.00 0.00 ? 143 LEU A HD21 1 
ATOM 1290  H HD22 . LEU A 1 80 ? 6.463   -8.401  -36.484 1.00 0.00 ? 143 LEU A HD22 1 
ATOM 1291  H HD23 . LEU A 1 80 ? 6.156   -9.343  -35.029 1.00 0.00 ? 143 LEU A HD23 1 
ATOM 1292  N N    . THR A 1 81 ? 11.812  -9.391  -36.125 1.00 0.00 ? 144 THR A N    1 
ATOM 1293  C CA   . THR A 1 81 ? 12.596  -10.333 -36.918 1.00 0.00 ? 144 THR A CA   1 
ATOM 1294  C C    . THR A 1 81 ? 12.089  -11.758 -36.741 1.00 0.00 ? 144 THR A C    1 
ATOM 1295  O O    . THR A 1 81 ? 12.257  -12.359 -35.679 1.00 0.00 ? 144 THR A O    1 
ATOM 1296  C CB   . THR A 1 81 ? 14.088  -10.261 -36.545 1.00 0.00 ? 144 THR A CB   1 
ATOM 1297  O OG1  . THR A 1 81 ? 14.590  -8.947  -36.820 1.00 0.00 ? 144 THR A OG1  1 
ATOM 1298  C CG2  . THR A 1 81 ? 14.885  -11.283 -37.341 1.00 0.00 ? 144 THR A CG2  1 
ATOM 1299  H H    . THR A 1 81 ? 11.975  -9.336  -35.124 1.00 0.00 ? 144 THR A H    1 
ATOM 1300  H HA   . THR A 1 81 ? 12.508  -10.064 -37.956 1.00 0.00 ? 144 THR A HA   1 
ATOM 1301  H HB   . THR A 1 81 ? 14.202  -10.473 -35.483 1.00 0.00 ? 144 THR A HB   1 
ATOM 1302  H HG1  . THR A 1 81 ? 15.088  -8.650  -36.053 1.00 0.00 ? 144 THR A HG1  1 
ATOM 1303  H HG21 . THR A 1 81 ? 14.603  -11.220 -38.391 1.00 0.00 ? 144 THR A HG21 1 
ATOM 1304  H HG22 . THR A 1 81 ? 14.671  -12.283 -36.966 1.00 0.00 ? 144 THR A HG22 1 
ATOM 1305  H HG23 . THR A 1 81 ? 15.950  -11.075 -37.239 1.00 0.00 ? 144 THR A HG23 1 
ATOM 1306  N N    . VAL A 1 82 ? 11.472  -12.295 -37.786 1.00 0.00 ? 145 VAL A N    1 
ATOM 1307  C CA   . VAL A 1 82 ? 10.939  -13.652 -37.748 1.00 0.00 ? 145 VAL A CA   1 
ATOM 1308  C C    . VAL A 1 82 ? 11.795  -14.604 -38.571 1.00 0.00 ? 145 VAL A C    1 
ATOM 1309  O O    . VAL A 1 82 ? 11.812  -14.534 -39.800 1.00 0.00 ? 145 VAL A O    1 
ATOM 1310  C CB   . VAL A 1 82 ? 9.493   -13.673 -38.282 1.00 0.00 ? 145 VAL A CB   1 
ATOM 1311  C CG1  . VAL A 1 82 ? 8.933   -15.087 -38.244 1.00 0.00 ? 145 VAL A CG1  1 
ATOM 1312  C CG2  . VAL A 1 82 ? 8.627   -12.727 -37.466 1.00 0.00 ? 145 VAL A CG2  1 
ATOM 1313  H H    . VAL A 1 82 ? 11.367  -11.744 -38.638 1.00 0.00 ? 145 VAL A H    1 
ATOM 1314  H HA   . VAL A 1 82 ? 10.923  -14.020 -36.736 1.00 0.00 ? 145 VAL A HA   1 
ATOM 1315  H HB   . VAL A 1 82 ? 9.494   -13.342 -39.309 1.00 0.00 ? 145 VAL A HB   1 
ATOM 1316  H HG11 . VAL A 1 82 ? 9.435   -15.705 -38.987 1.00 0.00 ? 145 VAL A HG11 1 
ATOM 1317  H HG12 . VAL A 1 82 ? 7.863   -15.063 -38.458 1.00 0.00 ? 145 VAL A HG12 1 
ATOM 1318  H HG13 . VAL A 1 82 ? 9.097   -15.508 -37.251 1.00 0.00 ? 145 VAL A HG13 1 
ATOM 1319  H HG21 . VAL A 1 82 ? 8.757   -12.944 -36.416 1.00 0.00 ? 145 VAL A HG21 1 
ATOM 1320  H HG22 . VAL A 1 82 ? 7.578   -12.848 -37.739 1.00 0.00 ? 145 VAL A HG22 1 
ATOM 1321  H HG23 . VAL A 1 82 ? 8.935   -11.702 -37.660 1.00 0.00 ? 145 VAL A HG23 1 
ATOM 1322  N N    . ASP A 1 83 ? 12.508  -15.493 -37.887 1.00 0.00 ? 146 ASP A N    1 
ATOM 1323  C CA   . ASP A 1 83 ? 13.646  -16.185 -38.483 1.00 0.00 ? 146 ASP A CA   1 
ATOM 1324  C C    . ASP A 1 83 ? 13.795  -17.589 -37.910 1.00 0.00 ? 146 ASP A C    1 
ATOM 1325  O O    . ASP A 1 83 ? 13.996  -17.762 -36.709 1.00 0.00 ? 146 ASP A O    1 
ATOM 1326  C CB   . ASP A 1 83 ? 14.934  -15.394 -38.253 1.00 0.00 ? 146 ASP A CB   1 
ATOM 1327  C CG   . ASP A 1 83 ? 16.179  -16.145 -38.709 1.00 0.00 ? 146 ASP A CG   1 
ATOM 1328  O OD1  . ASP A 1 83 ? 16.102  -17.339 -38.873 1.00 0.00 ? 146 ASP A OD1  1 
ATOM 1329  O OD2  . ASP A 1 83 ? 17.196  -15.515 -38.888 1.00 0.00 ? 146 ASP A OD2  1 
ATOM 1330  H H    . ASP A 1 83 ? 12.468  -15.445 -36.869 1.00 0.00 ? 146 ASP A H    1 
ATOM 1331  H HA   . ASP A 1 83 ? 13.455  -16.274 -39.530 1.00 0.00 ? 146 ASP A HA   1 
ATOM 1332  H HB2  . ASP A 1 83 ? 14.874  -14.449 -38.788 1.00 0.00 ? 146 ASP A HB2  1 
ATOM 1333  H HB3  . ASP A 1 83 ? 15.026  -15.183 -37.187 1.00 0.00 ? 146 ASP A HB3  1 
ATOM 1334  N N    . GLY A 1 84 ? 13.697  -18.591 -38.780 1.00 0.00 ? 147 GLY A N    1 
ATOM 1335  C CA   . GLY A 1 84 ? 14.009  -19.964 -38.402 1.00 0.00 ? 147 GLY A CA   1 
ATOM 1336  C C    . GLY A 1 84 ? 14.821  -20.661 -39.489 1.00 0.00 ? 147 GLY A C    1 
ATOM 1337  O O    . GLY A 1 84 ? 14.487  -20.589 -40.670 1.00 0.00 ? 147 GLY A O    1 
ATOM 1338  H H    . GLY A 1 84 ? 13.552  -18.368 -39.764 1.00 0.00 ? 147 GLY A H    1 
ATOM 1339  H HA2  . GLY A 1 84 ? 14.479  -19.980 -37.440 1.00 0.00 ? 147 GLY A HA2  1 
ATOM 1340  H HA3  . GLY A 1 84 ? 13.106  -20.525 -38.328 1.00 0.00 ? 147 GLY A HA3  1 
ATOM 1341  N N    . PRO A 1 85 ? 15.889  -21.335 -39.079 1.00 0.00 ? 148 PRO A N    1 
ATOM 1342  C CA   . PRO A 1 85 ? 16.731  -22.075 -40.011 1.00 0.00 ? 148 PRO A CA   1 
ATOM 1343  C C    . PRO A 1 85 ? 15.938  -23.155 -40.734 1.00 0.00 ? 148 PRO A C    1 
ATOM 1344  O O    . PRO A 1 85 ? 14.850  -23.534 -40.300 1.00 0.00 ? 148 PRO A O    1 
ATOM 1345  C CB   . PRO A 1 85 ? 17.806  -22.679 -39.101 1.00 0.00 ? 148 PRO A CB   1 
ATOM 1346  C CG   . PRO A 1 85 ? 17.835  -21.771 -37.919 1.00 0.00 ? 148 PRO A CG   1 
ATOM 1347  C CD   . PRO A 1 85 ? 16.396  -21.384 -37.709 1.00 0.00 ? 148 PRO A CD   1 
ATOM 1348  H HA   . PRO A 1 85 ? 17.173  -21.424 -40.711 1.00 0.00 ? 148 PRO A HA   1 
ATOM 1349  H HB2  . PRO A 1 85 ? 17.527  -23.687 -38.791 1.00 0.00 ? 148 PRO A HB2  1 
ATOM 1350  H HB3  . PRO A 1 85 ? 18.774  -22.684 -39.596 1.00 0.00 ? 148 PRO A HB3  1 
ATOM 1351  H HG2  . PRO A 1 85 ? 18.228  -22.298 -37.043 1.00 0.00 ? 148 PRO A HG2  1 
ATOM 1352  H HG3  . PRO A 1 85 ? 18.439  -20.888 -38.131 1.00 0.00 ? 148 PRO A HG3  1 
ATOM 1353  H HD2  . PRO A 1 85 ? 15.879  -22.122 -37.113 1.00 0.00 ? 148 PRO A HD2  1 
ATOM 1354  H HD3  . PRO A 1 85 ? 16.365  -20.407 -37.241 1.00 0.00 ? 148 PRO A HD3  1 
ATOM 1355  N N    . ARG A 1 86 ? 16.486  -23.646 -41.841 1.00 0.00 ? 149 ARG A N    1 
ATOM 1356  C CA   . ARG A 1 86 ? 15.838  -24.696 -42.617 1.00 0.00 ? 149 ARG A CA   1 
ATOM 1357  C C    . ARG A 1 86 ? 15.598  -25.939 -41.770 1.00 0.00 ? 149 ARG A C    1 
ATOM 1358  O O    . ARG A 1 86 ? 16.113  -26.054 -40.658 1.00 0.00 ? 149 ARG A O    1 
ATOM 1359  C CB   . ARG A 1 86 ? 16.683  -25.066 -43.828 1.00 0.00 ? 149 ARG A CB   1 
ATOM 1360  C CG   . ARG A 1 86 ? 16.630  -24.069 -44.973 1.00 0.00 ? 149 ARG A CG   1 
ATOM 1361  C CD   . ARG A 1 86 ? 17.317  -24.586 -46.185 1.00 0.00 ? 149 ARG A CD   1 
ATOM 1362  N NE   . ARG A 1 86 ? 17.304  -23.620 -47.271 1.00 0.00 ? 149 ARG A NE   1 
ATOM 1363  C CZ   . ARG A 1 86 ? 17.903  -23.802 -48.465 1.00 0.00 ? 149 ARG A CZ   1 
ATOM 1364  N NH1  . ARG A 1 86 ? 18.558  -24.915 -48.708 1.00 0.00 ? 149 ARG A NH1  1 
ATOM 1365  N NH2  . ARG A 1 86 ? 17.830  -22.861 -49.389 1.00 0.00 ? 149 ARG A NH2  1 
ATOM 1366  H H    . ARG A 1 86 ? 17.392  -23.291 -42.146 1.00 0.00 ? 149 ARG A H    1 
ATOM 1367  H HA   . ARG A 1 86 ? 14.910  -24.309 -42.973 1.00 0.00 ? 149 ARG A HA   1 
ATOM 1368  H HB2  . ARG A 1 86 ? 17.717  -25.156 -43.507 1.00 0.00 ? 149 ARG A HB2  1 
ATOM 1369  H HB3  . ARG A 1 86 ? 16.351  -26.035 -44.208 1.00 0.00 ? 149 ARG A HB3  1 
ATOM 1370  H HG2  . ARG A 1 86 ? 15.585  -23.869 -45.214 1.00 0.00 ? 149 ARG A HG2  1 
ATOM 1371  H HG3  . ARG A 1 86 ? 17.112  -23.144 -44.660 1.00 0.00 ? 149 ARG A HG3  1 
ATOM 1372  H HD2  . ARG A 1 86 ? 18.348  -24.833 -45.932 1.00 0.00 ? 149 ARG A HD2  1 
ATOM 1373  H HD3  . ARG A 1 86 ? 16.806  -25.489 -46.517 1.00 0.00 ? 149 ARG A HD3  1 
ATOM 1374  H HE   . ARG A 1 86 ? 16.830  -22.774 -47.123 1.00 0.00 ? 149 ARG A HE   1 
ATOM 1375  H HH11 . ARG A 1 86 ? 18.614  -25.626 -48.007 1.00 0.00 ? 149 ARG A HH11 1 
ATOM 1376  H HH12 . ARG A 1 86 ? 19.006  -25.052 -49.603 1.00 0.00 ? 149 ARG A HH12 1 
ATOM 1377  H HH21 . ARG A 1 86 ? 17.334  -22.011 -49.207 1.00 0.00 ? 149 ARG A HH21 1 
ATOM 1378  H HH22 . ARG A 1 86 ? 18.273  -22.999 -50.276 1.00 0.00 ? 149 ARG A HH22 1 
ATOM 1379  N N    . LYS A 1 87 ? 14.812  -26.867 -42.303 1.00 0.00 ? 150 LYS A N    1 
ATOM 1380  C CA   . LYS A 1 87 ? 14.713  -28.207 -41.734 1.00 0.00 ? 150 LYS A CA   1 
ATOM 1381  C C    . LYS A 1 87 ? 16.047  -28.940 -41.821 1.00 0.00 ? 150 LYS A C    1 
ATOM 1382  O O    . LYS A 1 87 ? 16.335  -29.821 -41.011 1.00 0.00 ? 150 LYS A O    1 
ATOM 1383  C CB   . LYS A 1 87 ? 13.623  -29.012 -42.441 1.00 0.00 ? 150 LYS A CB   1 
ATOM 1384  C CG   . LYS A 1 87 ? 12.205  -28.534 -42.158 1.00 0.00 ? 150 LYS A CG   1 
ATOM 1385  C CD   . LYS A 1 87 ? 11.194  -29.245 -43.045 1.00 0.00 ? 150 LYS A CD   1 
ATOM 1386  C CE   . LYS A 1 87 ? 9.768   -28.871 -42.671 1.00 0.00 ? 150 LYS A CE   1 
ATOM 1387  N NZ   . LYS A 1 87 ? 8.767   -29.568 -43.525 1.00 0.00 ? 150 LYS A NZ   1 
ATOM 1388  H H    . LYS A 1 87 ? 14.456  -26.719 -43.241 1.00 0.00 ? 150 LYS A H    1 
ATOM 1389  H HA   . LYS A 1 87 ? 14.434  -28.094 -40.686 1.00 0.00 ? 150 LYS A HA   1 
ATOM 1390  H HB2  . LYS A 1 87 ? 13.796  -28.938 -43.514 1.00 0.00 ? 150 LYS A HB2  1 
ATOM 1391  H HB3  . LYS A 1 87 ? 13.708  -30.057 -42.142 1.00 0.00 ? 150 LYS A HB3  1 
ATOM 1392  H HG2  . LYS A 1 87 ? 11.966  -28.784 -41.135 1.00 0.00 ? 150 LYS A HG2  1 
ATOM 1393  H HG3  . LYS A 1 87 ? 12.138  -27.459 -42.308 1.00 0.00 ? 150 LYS A HG3  1 
ATOM 1394  H HD2  . LYS A 1 87 ? 11.373  -28.957 -44.081 1.00 0.00 ? 150 LYS A HD2  1 
ATOM 1395  H HD3  . LYS A 1 87 ? 11.318  -30.323 -42.944 1.00 0.00 ? 150 LYS A HD3  1 
ATOM 1396  H HE2  . LYS A 1 87 ? 9.594   -29.144 -41.631 1.00 0.00 ? 150 LYS A HE2  1 
ATOM 1397  H HE3  . LYS A 1 87 ? 9.643   -27.795 -42.782 1.00 0.00 ? 150 LYS A HE3  1 
ATOM 1398  H HZ1  . LYS A 1 87 ? 8.788   -30.586 -43.316 1.00 0.00 ? 150 LYS A HZ1  1 
ATOM 1399  H HZ2  . LYS A 1 87 ? 9.005   -29.413 -44.525 1.00 0.00 ? 150 LYS A HZ2  1 
ATOM 1400  H HZ3  . LYS A 1 87 ? 7.845   -29.202 -43.335 1.00 0.00 ? 150 LYS A HZ3  1 
ATOM 1401  N N    . GLN A 1 88 ? 16.855  -28.573 -42.808 1.00 0.00 ? 151 GLN A N    1 
ATOM 1402  C CA   . GLN A 1 88 ? 18.170  -29.176 -42.987 1.00 0.00 ? 151 GLN A CA   1 
ATOM 1403  C C    . GLN A 1 88 ? 19.081  -28.871 -41.805 1.00 0.00 ? 151 GLN A C    1 
ATOM 1404  O O    . GLN A 1 88 ? 19.874  -29.717 -41.386 1.00 0.00 ? 151 GLN A O    1 
ATOM 1405  C CB   . GLN A 1 88 ? 18.814  -28.682 -44.286 1.00 0.00 ? 151 GLN A CB   1 
ATOM 1406  C CG   . GLN A 1 88 ? 18.125  -29.170 -45.546 1.00 0.00 ? 151 GLN A CG   1 
ATOM 1407  C CD   . GLN A 1 88 ? 18.656  -28.492 -46.796 1.00 0.00 ? 151 GLN A CD   1 
ATOM 1408  O OE1  . GLN A 1 88 ? 19.065  -27.328 -46.761 1.00 0.00 ? 151 GLN A OE1  1 
ATOM 1409  N NE2  . GLN A 1 88 ? 18.654  -29.217 -47.910 1.00 0.00 ? 151 GLN A NE2  1 
ATOM 1410  H H    . GLN A 1 88 ? 16.559  -27.832 -43.445 1.00 0.00 ? 151 GLN A H    1 
ATOM 1411  H HA   . GLN A 1 88 ? 18.043  -30.257 -43.064 1.00 0.00 ? 151 GLN A HA   1 
ATOM 1412  H HB2  . GLN A 1 88 ? 18.794  -27.592 -44.285 1.00 0.00 ? 151 GLN A HB2  1 
ATOM 1413  H HB3  . GLN A 1 88 ? 19.853  -29.016 -44.312 1.00 0.00 ? 151 GLN A HB3  1 
ATOM 1414  H HG2  . GLN A 1 88 ? 18.273  -30.247 -45.633 1.00 0.00 ? 151 GLN A HG2  1 
ATOM 1415  H HG3  . GLN A 1 88 ? 17.060  -28.961 -45.460 1.00 0.00 ? 151 GLN A HG3  1 
ATOM 1416  H HE21 . GLN A 1 88 ? 18.304  -30.176 -47.907 1.00 0.00 ? 151 GLN A HE21 1 
ATOM 1417  H HE22 . GLN A 1 88 ? 19.008  -28.807 -48.774 1.00 0.00 ? 151 GLN A HE22 1 
ATOM 1418  N N    . VAL A 1 89 ? 18.964  -27.662 -41.270 1.00 0.00 ? 152 VAL A N    1 
ATOM 1419  C CA   . VAL A 1 89 ? 19.777  -27.244 -40.134 1.00 0.00 ? 152 VAL A CA   1 
ATOM 1420  C C    . VAL A 1 89 ? 19.360  -27.971 -38.863 1.00 0.00 ? 152 VAL A C    1 
ATOM 1421  O O    . VAL A 1 89 ? 20.233  -28.287 -38.071 1.00 0.00 ? 152 VAL A O    1 
ATOM 1422  C CB   . VAL A 1 89 ? 19.651  -25.724 -39.918 1.00 0.00 ? 152 VAL A CB   1 
ATOM 1423  C CG1  . VAL A 1 89 ? 20.412  -25.299 -38.671 1.00 0.00 ? 152 VAL A CG1  1 
ATOM 1424  C CG2  . VAL A 1 89 ? 20.163  -24.982 -41.143 1.00 0.00 ? 152 VAL A CG2  1 
ATOM 1425  O OXT  . VAL A 1 89 ? 18.168  -28.132 -38.664 1.00 0.00 ? 152 VAL A OXT  1 
ATOM 1426  H H    . VAL A 1 89 ? 18.286  -27.009 -41.666 1.00 0.00 ? 152 VAL A H    1 
ATOM 1427  H HA   . VAL A 1 89 ? 20.819  -27.474 -40.345 1.00 0.00 ? 152 VAL A HA   1 
ATOM 1428  H HB   . VAL A 1 89 ? 18.598  -25.488 -39.783 1.00 0.00 ? 152 VAL A HB   1 
ATOM 1429  H HG11 . VAL A 1 89 ? 19.886  -25.640 -37.780 1.00 0.00 ? 152 VAL A HG11 1 
ATOM 1430  H HG12 . VAL A 1 89 ? 20.497  -24.211 -38.646 1.00 0.00 ? 152 VAL A HG12 1 
ATOM 1431  H HG13 . VAL A 1 89 ? 21.409  -25.740 -38.693 1.00 0.00 ? 152 VAL A HG13 1 
ATOM 1432  H HG21 . VAL A 1 89 ? 19.507  -25.177 -41.987 1.00 0.00 ? 152 VAL A HG21 1 
ATOM 1433  H HG22 . VAL A 1 89 ? 21.168  -25.337 -41.377 1.00 0.00 ? 152 VAL A HG22 1 
ATOM 1434  H HG23 . VAL A 1 89 ? 20.196  -23.912 -40.949 1.00 0.00 ? 152 VAL A HG23 1 
ATOM 1435  N N    . GLY B 1 1  ? 1.717   16.745  -52.620 1.00 0.00 ? 64  GLY B N    1 
ATOM 1436  C CA   . GLY B 1 1  ? 1.334   15.767  -51.609 1.00 0.00 ? 64  GLY B CA   1 
ATOM 1437  C C    . GLY B 1 1  ? 0.011   15.101  -51.959 1.00 0.00 ? 64  GLY B C    1 
ATOM 1438  O O    . GLY B 1 1  ? -1.002  15.775  -52.158 1.00 0.00 ? 64  GLY B O    1 
ATOM 1439  H H1   . GLY B 1 1  ? 2.628   17.119  -52.397 1.00 0.00 ? 64  GLY B H1   1 
ATOM 1440  H H2   . GLY B 1 1  ? 1.750   16.284  -53.554 1.00 0.00 ? 64  GLY B H2   1 
ATOM 1441  H H3   . GLY B 1 1  ? 1.021   17.517  -52.638 1.00 0.00 ? 64  GLY B H3   1 
ATOM 1442  H HA2  . GLY B 1 1  ? 2.110   15.007  -51.539 1.00 0.00 ? 64  GLY B HA2  1 
ATOM 1443  H HA3  . GLY B 1 1  ? 1.238   16.269  -50.646 1.00 0.00 ? 64  GLY B HA3  1 
ATOM 1444  N N    . LEU B 1 2  ? 0.023   13.774  -52.034 1.00 0.00 ? 65  LEU B N    1 
ATOM 1445  C CA   . LEU B 1 2  ? -1.180  13.013  -52.347 1.00 0.00 ? 65  LEU B CA   1 
ATOM 1446  C C    . LEU B 1 2  ? -1.771  12.375  -51.097 1.00 0.00 ? 65  LEU B C    1 
ATOM 1447  O O    . LEU B 1 2  ? -2.610  11.479  -51.182 1.00 0.00 ? 65  LEU B O    1 
ATOM 1448  C CB   . LEU B 1 2  ? -0.866  11.927  -53.383 1.00 0.00 ? 65  LEU B CB   1 
ATOM 1449  C CG   . LEU B 1 2  ? -0.382  12.431  -54.749 1.00 0.00 ? 65  LEU B CG   1 
ATOM 1450  C CD1  . LEU B 1 2  ? -0.046  11.240  -55.639 1.00 0.00 ? 65  LEU B CD1  1 
ATOM 1451  C CD2  . LEU B 1 2  ? -1.460  13.298  -55.380 1.00 0.00 ? 65  LEU B CD2  1 
ATOM 1452  H H    . LEU B 1 2  ? 0.895   13.276  -51.860 1.00 0.00 ? 65  LEU B H    1 
ATOM 1453  H HA   . LEU B 1 2  ? -1.916  13.679  -52.783 1.00 0.00 ? 65  LEU B HA   1 
ATOM 1454  H HB2  . LEU B 1 2  ? -0.093  11.280  -52.971 1.00 0.00 ? 65  LEU B HB2  1 
ATOM 1455  H HB3  . LEU B 1 2  ? -1.767  11.332  -53.538 1.00 0.00 ? 65  LEU B HB3  1 
ATOM 1456  H HG   . LEU B 1 2  ? 0.522   13.026  -54.600 1.00 0.00 ? 65  LEU B HG   1 
ATOM 1457  H HD11 . LEU B 1 2  ? 0.686   10.604  -55.143 1.00 0.00 ? 65  LEU B HD11 1 
ATOM 1458  H HD12 . LEU B 1 2  ? 0.364   11.601  -56.584 1.00 0.00 ? 65  LEU B HD12 1 
ATOM 1459  H HD13 . LEU B 1 2  ? -0.953  10.668  -55.832 1.00 0.00 ? 65  LEU B HD13 1 
ATOM 1460  H HD21 . LEU B 1 2  ? -1.297  13.352  -56.458 1.00 0.00 ? 65  LEU B HD21 1 
ATOM 1461  H HD22 . LEU B 1 2  ? -1.421  14.306  -54.968 1.00 0.00 ? 65  LEU B HD22 1 
ATOM 1462  H HD23 . LEU B 1 2  ? -2.439  12.866  -55.189 1.00 0.00 ? 65  LEU B HD23 1 
ATOM 1463  N N    . SER B 1 3  ? -1.325  12.842  -49.934 1.00 0.00 ? 66  SER B N    1 
ATOM 1464  C CA   . SER B 1 3  ? -1.870  12.378  -48.664 1.00 0.00 ? 66  SER B CA   1 
ATOM 1465  C C    . SER B 1 3  ? -1.986  13.522  -47.664 1.00 0.00 ? 66  SER B C    1 
ATOM 1466  O O    . SER B 1 3  ? -1.933  13.308  -46.453 1.00 0.00 ? 66  SER B O    1 
ATOM 1467  C CB   . SER B 1 3  ? -0.996  11.280  -48.090 1.00 0.00 ? 66  SER B CB   1 
ATOM 1468  O OG   . SER B 1 3  ? 0.311   11.738  -47.877 1.00 0.00 ? 66  SER B OG   1 
ATOM 1469  H H    . SER B 1 3  ? -0.637  13.595  -49.929 1.00 0.00 ? 66  SER B H    1 
ATOM 1470  H HA   . SER B 1 3  ? -2.855  11.962  -48.828 1.00 0.00 ? 66  SER B HA   1 
ATOM 1471  H HB2  . SER B 1 3  ? -1.407  10.948  -47.142 1.00 0.00 ? 66  SER B HB2  1 
ATOM 1472  H HB3  . SER B 1 3  ? -0.979  10.436  -48.785 1.00 0.00 ? 66  SER B HB3  1 
ATOM 1473  H HG   . SER B 1 3  ? 0.357   12.098  -46.988 1.00 0.00 ? 66  SER B HG   1 
ATOM 1474  N N    . GLU B 1 4  ? -2.142  14.736  -48.177 1.00 0.00 ? 67  GLU B N    1 
ATOM 1475  C CA   . GLU B 1 4  ? -2.029  15.936  -47.357 1.00 0.00 ? 67  GLU B CA   1 
ATOM 1476  C C    . GLU B 1 4  ? -3.399  16.538  -47.067 1.00 0.00 ? 67  GLU B C    1 
ATOM 1477  O O    . GLU B 1 4  ? -4.227  16.679  -47.966 1.00 0.00 ? 67  GLU B O    1 
ATOM 1478  C CB   . GLU B 1 4  ? -1.141  16.975  -48.049 1.00 0.00 ? 67  GLU B CB   1 
ATOM 1479  C CG   . GLU B 1 4  ? -0.948  18.261  -47.258 1.00 0.00 ? 67  GLU B CG   1 
ATOM 1480  C CD   . GLU B 1 4  ? -0.060  19.249  -47.961 1.00 0.00 ? 67  GLU B CD   1 
ATOM 1481  O OE1  . GLU B 1 4  ? 0.437   18.930  -49.014 1.00 0.00 ? 67  GLU B OE1  1 
ATOM 1482  O OE2  . GLU B 1 4  ? 0.124   20.327  -47.442 1.00 0.00 ? 67  GLU B OE2  1 
ATOM 1483  H H    . GLU B 1 4  ? -2.142  14.842  -49.192 1.00 0.00 ? 67  GLU B H    1 
ATOM 1484  H HA   . GLU B 1 4  ? -1.576  15.695  -46.417 1.00 0.00 ? 67  GLU B HA   1 
ATOM 1485  H HB2  . GLU B 1 4  ? -0.163  16.527  -48.221 1.00 0.00 ? 67  GLU B HB2  1 
ATOM 1486  H HB3  . GLU B 1 4  ? -1.586  17.230  -49.011 1.00 0.00 ? 67  GLU B HB3  1 
ATOM 1487  H HG2  . GLU B 1 4  ? -1.923  18.721  -47.094 1.00 0.00 ? 67  GLU B HG2  1 
ATOM 1488  H HG3  . GLU B 1 4  ? -0.506  18.011  -46.294 1.00 0.00 ? 67  GLU B HG3  1 
ATOM 1489  N N    . MET B 1 5  ? -3.632  16.887  -45.808 1.00 0.00 ? 68  MET B N    1 
ATOM 1490  C CA   . MET B 1 5  ? -4.770  17.720  -45.441 1.00 0.00 ? 68  MET B CA   1 
ATOM 1491  C C    . MET B 1 5  ? -4.342  19.159  -45.184 1.00 0.00 ? 68  MET B C    1 
ATOM 1492  O O    . MET B 1 5  ? -3.368  19.410  -44.474 1.00 0.00 ? 68  MET B O    1 
ATOM 1493  C CB   . MET B 1 5  ? -5.470  17.145  -44.211 1.00 0.00 ? 68  MET B CB   1 
ATOM 1494  C CG   . MET B 1 5  ? -6.590  18.014  -43.658 1.00 0.00 ? 68  MET B CG   1 
ATOM 1495  S SD   . MET B 1 5  ? -7.400  17.279  -42.224 1.00 0.00 ? 68  MET B SD   1 
ATOM 1496  C CE   . MET B 1 5  ? -6.151  17.530  -40.966 1.00 0.00 ? 68  MET B CE   1 
ATOM 1497  H H    . MET B 1 5  ? -2.878  16.775  -45.126 1.00 0.00 ? 68  MET B H    1 
ATOM 1498  H HA   . MET B 1 5  ? -5.483  17.720  -46.265 1.00 0.00 ? 68  MET B HA   1 
ATOM 1499  H HB2  . MET B 1 5  ? -5.898  16.183  -44.454 1.00 0.00 ? 68  MET B HB2  1 
ATOM 1500  H HB3  . MET B 1 5  ? -4.715  17.026  -43.445 1.00 0.00 ? 68  MET B HB3  1 
ATOM 1501  H HG2  . MET B 1 5  ? -6.172  18.973  -43.350 1.00 0.00 ? 68  MET B HG2  1 
ATOM 1502  H HG3  . MET B 1 5  ? -7.325  18.191  -44.431 1.00 0.00 ? 68  MET B HG3  1 
ATOM 1503  H HE1  . MET B 1 5  ? -5.283  18.030  -41.396 1.00 0.00 ? 68  MET B HE1  1 
ATOM 1504  H HE2  . MET B 1 5  ? -6.564  18.149  -40.168 1.00 0.00 ? 68  MET B HE2  1 
ATOM 1505  H HE3  . MET B 1 5  ? -5.848  16.569  -40.556 1.00 0.00 ? 68  MET B HE3  1 
ATOM 1506  N N    . ARG B 1 6  ? -5.076  20.101  -45.766 1.00 0.00 ? 69  ARG B N    1 
ATOM 1507  C CA   . ARG B 1 6  ? -4.794  21.518  -45.574 1.00 0.00 ? 69  ARG B CA   1 
ATOM 1508  C C    . ARG B 1 6  ? -6.018  22.371  -45.877 1.00 0.00 ? 69  ARG B C    1 
ATOM 1509  O O    . ARG B 1 6  ? -6.630  22.240  -46.938 1.00 0.00 ? 69  ARG B O    1 
ATOM 1510  C CB   . ARG B 1 6  ? -3.639  21.961  -46.461 1.00 0.00 ? 69  ARG B CB   1 
ATOM 1511  C CG   . ARG B 1 6  ? -3.226  23.414  -46.298 1.00 0.00 ? 69  ARG B CG   1 
ATOM 1512  C CD   . ARG B 1 6  ? -1.942  23.702  -46.988 1.00 0.00 ? 69  ARG B CD   1 
ATOM 1513  N NE   . ARG B 1 6  ? -2.084  23.662  -48.434 1.00 0.00 ? 69  ARG B NE   1 
ATOM 1514  C CZ   . ARG B 1 6  ? -1.054  23.616  -49.302 1.00 0.00 ? 69  ARG B CZ   1 
ATOM 1515  N NH1  . ARG B 1 6  ? 0.182   23.606  -48.855 1.00 0.00 ? 69  ARG B NH1  1 
ATOM 1516  N NH2  . ARG B 1 6  ? -1.287  23.584  -50.603 1.00 0.00 ? 69  ARG B NH2  1 
ATOM 1517  H H    . ARG B 1 6  ? -5.877  19.829  -46.334 1.00 0.00 ? 69  ARG B H    1 
ATOM 1518  H HA   . ARG B 1 6  ? -4.506  21.687  -44.535 1.00 0.00 ? 69  ARG B HA   1 
ATOM 1519  H HB2  . ARG B 1 6  ? -2.778  21.332  -46.238 1.00 0.00 ? 69  ARG B HB2  1 
ATOM 1520  H HB3  . ARG B 1 6  ? -3.928  21.800  -47.500 1.00 0.00 ? 69  ARG B HB3  1 
ATOM 1521  H HG2  . ARG B 1 6  ? -4.004  24.051  -46.721 1.00 0.00 ? 69  ARG B HG2  1 
ATOM 1522  H HG3  . ARG B 1 6  ? -3.125  23.629  -45.233 1.00 0.00 ? 69  ARG B HG3  1 
ATOM 1523  H HD2  . ARG B 1 6  ? -1.596  24.693  -46.698 1.00 0.00 ? 69  ARG B HD2  1 
ATOM 1524  H HD3  . ARG B 1 6  ? -1.200  22.962  -46.685 1.00 0.00 ? 69  ARG B HD3  1 
ATOM 1525  H HE   . ARG B 1 6  ? -2.991  23.667  -48.803 1.00 0.00 ? 69  ARG B HE   1 
ATOM 1526  H HH11 . ARG B 1 6  ? 0.361   23.629  -47.871 1.00 0.00 ? 69  ARG B HH11 1 
ATOM 1527  H HH12 . ARG B 1 6  ? 0.953   23.574  -49.507 1.00 0.00 ? 69  ARG B HH12 1 
ATOM 1528  H HH21 . ARG B 1 6  ? -2.227  23.591  -50.946 1.00 0.00 ? 69  ARG B HH21 1 
ATOM 1529  H HH22 . ARG B 1 6  ? -0.520  23.553  -51.245 1.00 0.00 ? 69  ARG B HH22 1 
ATOM 1530  N N    . LEU B 1 7  ? -6.375  23.244  -44.940 1.00 0.00 ? 70  LEU B N    1 
ATOM 1531  C CA   . LEU B 1 7  ? -7.330  24.311  -45.210 1.00 0.00 ? 70  LEU B CA   1 
ATOM 1532  C C    . LEU B 1 7  ? -6.677  25.452  -45.982 1.00 0.00 ? 70  LEU B C    1 
ATOM 1533  O O    . LEU B 1 7  ? -5.853  26.189  -45.439 1.00 0.00 ? 70  LEU B O    1 
ATOM 1534  C CB   . LEU B 1 7  ? -7.915  24.843  -43.896 1.00 0.00 ? 70  LEU B CB   1 
ATOM 1535  C CG   . LEU B 1 7  ? -8.920  25.994  -44.034 1.00 0.00 ? 70  LEU B CG   1 
ATOM 1536  C CD1  . LEU B 1 7  ? -10.141 25.515  -44.806 1.00 0.00 ? 70  LEU B CD1  1 
ATOM 1537  C CD2  . LEU B 1 7  ? -9.309  26.494  -42.651 1.00 0.00 ? 70  LEU B CD2  1 
ATOM 1538  H H    . LEU B 1 7  ? -5.790  23.322  -44.107 1.00 0.00 ? 70  LEU B H    1 
ATOM 1539  H HA   . LEU B 1 7  ? -8.106  23.887  -45.799 1.00 0.00 ? 70  LEU B HA   1 
ATOM 1540  H HB2  . LEU B 1 7  ? -8.423  24.027  -43.385 1.00 0.00 ? 70  LEU B HB2  1 
ATOM 1541  H HB3  . LEU B 1 7  ? -7.086  25.179  -43.273 1.00 0.00 ? 70  LEU B HB3  1 
ATOM 1542  H HG   . LEU B 1 7  ? -8.448  26.808  -44.586 1.00 0.00 ? 70  LEU B HG   1 
ATOM 1543  H HD11 . LEU B 1 7  ? -10.795 26.367  -44.987 1.00 0.00 ? 70  LEU B HD11 1 
ATOM 1544  H HD12 . LEU B 1 7  ? -10.652 24.804  -44.189 1.00 0.00 ? 70  LEU B HD12 1 
ATOM 1545  H HD13 . LEU B 1 7  ? -9.873  25.066  -45.748 1.00 0.00 ? 70  LEU B HD13 1 
ATOM 1546  H HD21 . LEU B 1 7  ? -8.426  26.856  -42.126 1.00 0.00 ? 70  LEU B HD21 1 
ATOM 1547  H HD22 . LEU B 1 7  ? -9.758  25.676  -42.087 1.00 0.00 ? 70  LEU B HD22 1 
ATOM 1548  H HD23 . LEU B 1 7  ? -10.033 27.306  -42.749 1.00 0.00 ? 70  LEU B HD23 1 
ATOM 1549  N N    . GLU B 1 8  ? -7.051  25.592  -47.248 1.00 0.00 ? 71  GLU B N    1 
ATOM 1550  C CA   . GLU B 1 8  ? -6.516  26.656  -48.090 1.00 0.00 ? 71  GLU B CA   1 
ATOM 1551  C C    . GLU B 1 8  ? -7.020  28.021  -47.640 1.00 0.00 ? 71  GLU B C    1 
ATOM 1552  O O    . GLU B 1 8  ? -7.771  28.127  -46.669 1.00 0.00 ? 71  GLU B O    1 
ATOM 1553  C CB   . GLU B 1 8  ? -6.897  26.418  -49.554 1.00 0.00 ? 71  GLU B CB   1 
ATOM 1554  C CG   . GLU B 1 8  ? -6.404  25.097  -50.126 1.00 0.00 ? 71  GLU B CG   1 
ATOM 1555  C CD   . GLU B 1 8  ? -4.906  25.037  -50.254 1.00 0.00 ? 71  GLU B CD   1 
ATOM 1556  O OE1  . GLU B 1 8  ? -4.290  26.076  -50.299 1.00 0.00 ? 71  GLU B OE1  1 
ATOM 1557  O OE2  . GLU B 1 8  ? -4.377  23.953  -50.306 1.00 0.00 ? 71  GLU B OE2  1 
ATOM 1558  H H    . GLU B 1 8  ? -7.726  24.947  -47.640 1.00 0.00 ? 71  GLU B H    1 
ATOM 1559  H HA   . GLU B 1 8  ? -5.430  26.641  -48.012 1.00 0.00 ? 71  GLU B HA   1 
ATOM 1560  H HB2  . GLU B 1 8  ? -7.973  26.460  -49.629 1.00 0.00 ? 71  GLU B HB2  1 
ATOM 1561  H HB3  . GLU B 1 8  ? -6.471  27.224  -50.155 1.00 0.00 ? 71  GLU B HB3  1 
ATOM 1562  H HG2  . GLU B 1 8  ? -6.725  24.300  -49.458 1.00 0.00 ? 71  GLU B HG2  1 
ATOM 1563  H HG3  . GLU B 1 8  ? -6.853  24.942  -51.107 1.00 0.00 ? 71  GLU B HG3  1 
ATOM 1564  N N    . LYS B 1 9  ? -6.602  29.064  -48.350 1.00 0.00 ? 72  LYS B N    1 
ATOM 1565  C CA   . LYS B 1 9  ? -7.052  30.420  -48.057 1.00 0.00 ? 72  LYS B CA   1 
ATOM 1566  C C    . LYS B 1 9  ? -8.449  30.417  -47.452 1.00 0.00 ? 72  LYS B C    1 
ATOM 1567  O O    . LYS B 1 9  ? -8.652  30.883  -46.328 1.00 0.00 ? 72  LYS B O    1 
ATOM 1568  C CB   . LYS B 1 9  ? -7.029  31.276  -49.323 1.00 0.00 ? 72  LYS B CB   1 
ATOM 1569  C CG   . LYS B 1 9  ? -7.453  32.724  -49.111 1.00 0.00 ? 72  LYS B CG   1 
ATOM 1570  C CD   . LYS B 1 9  ? -7.358  33.522  -50.402 1.00 0.00 ? 72  LYS B CD   1 
ATOM 1571  C CE   . LYS B 1 9  ? -7.819  34.959  -50.200 1.00 0.00 ? 72  LYS B CE   1 
ATOM 1572  N NZ   . LYS B 1 9  ? -7.738  35.750  -51.459 1.00 0.00 ? 72  LYS B NZ   1 
ATOM 1573  H H    . LYS B 1 9  ? -5.985  28.907  -49.146 1.00 0.00 ? 72  LYS B H    1 
ATOM 1574  H HA   . LYS B 1 9  ? -6.364  30.861  -47.337 1.00 0.00 ? 72  LYS B HA   1 
ATOM 1575  H HB2  . LYS B 1 9  ? -6.018  31.273  -49.727 1.00 0.00 ? 72  LYS B HB2  1 
ATOM 1576  H HB3  . LYS B 1 9  ? -7.700  30.819  -50.054 1.00 0.00 ? 72  LYS B HB3  1 
ATOM 1577  H HG2  . LYS B 1 9  ? -8.485  32.742  -48.756 1.00 0.00 ? 72  LYS B HG2  1 
ATOM 1578  H HG3  . LYS B 1 9  ? -6.805  33.177  -48.362 1.00 0.00 ? 72  LYS B HG3  1 
ATOM 1579  H HD2  . LYS B 1 9  ? -6.322  33.527  -50.740 1.00 0.00 ? 72  LYS B HD2  1 
ATOM 1580  H HD3  . LYS B 1 9  ? -7.982  33.052  -51.160 1.00 0.00 ? 72  LYS B HD3  1 
ATOM 1581  H HE2  . LYS B 1 9  ? -8.851  34.953  -49.853 1.00 0.00 ? 72  LYS B HE2  1 
ATOM 1582  H HE3  . LYS B 1 9  ? -7.190  35.428  -49.443 1.00 0.00 ? 72  LYS B HE3  1 
ATOM 1583  H HZ1  . LYS B 1 9  ? -7.856  36.761  -51.249 1.00 0.00 ? 72  LYS B HZ1  1 
ATOM 1584  H HZ2  . LYS B 1 9  ? -8.490  35.441  -52.108 1.00 0.00 ? 72  LYS B HZ2  1 
ATOM 1585  H HZ3  . LYS B 1 9  ? -6.838  35.601  -51.892 1.00 0.00 ? 72  LYS B HZ3  1 
ATOM 1586  N N    . ASP B 1 10 ? -9.413  29.890  -48.200 1.00 0.00 ? 73  ASP B N    1 
ATOM 1587  C CA   . ASP B 1 10 ? -10.778 29.755  -47.707 1.00 0.00 ? 73  ASP B CA   1 
ATOM 1588  C C    . ASP B 1 10 ? -11.445 28.508  -48.273 1.00 0.00 ? 73  ASP B C    1 
ATOM 1589  O O    . ASP B 1 10 ? -12.587 28.557  -48.733 1.00 0.00 ? 73  ASP B O    1 
ATOM 1590  C CB   . ASP B 1 10 ? -11.605 30.992  -48.070 1.00 0.00 ? 73  ASP B CB   1 
ATOM 1591  C CG   . ASP B 1 10 ? -11.727 31.202  -49.573 1.00 0.00 ? 73  ASP B CG   1 
ATOM 1592  O OD1  . ASP B 1 10 ? -11.161 30.430  -50.310 1.00 0.00 ? 73  ASP B OD1  1 
ATOM 1593  O OD2  . ASP B 1 10 ? -12.386 32.134  -49.970 1.00 0.00 ? 73  ASP B OD2  1 
ATOM 1594  H H    . ASP B 1 10 ? -9.176  29.506  -49.115 1.00 0.00 ? 73  ASP B H    1 
ATOM 1595  H HA   . ASP B 1 10 ? -10.753 29.661  -46.622 1.00 0.00 ? 73  ASP B HA   1 
ATOM 1596  H HB2  . ASP B 1 10 ? -12.604 30.885  -47.651 1.00 0.00 ? 73  ASP B HB2  1 
ATOM 1597  H HB3  . ASP B 1 10 ? -11.130 31.868  -47.631 1.00 0.00 ? 73  ASP B HB3  1 
ATOM 1598  N N    . ARG B 1 11 ? -10.729 27.389  -48.234 1.00 0.00 ? 74  ARG B N    1 
ATOM 1599  C CA   . ARG B 1 11 ? -11.213 26.147  -48.824 1.00 0.00 ? 74  ARG B CA   1 
ATOM 1600  C C    . ARG B 1 11 ? -10.475 24.943  -48.254 1.00 0.00 ? 74  ARG B C    1 
ATOM 1601  O O    . ARG B 1 11 ? -9.245  24.901  -48.250 1.00 0.00 ? 74  ARG B O    1 
ATOM 1602  C CB   . ARG B 1 11 ? -11.047 26.173  -50.336 1.00 0.00 ? 74  ARG B CB   1 
ATOM 1603  C CG   . ARG B 1 11 ? -11.584 24.947  -51.058 1.00 0.00 ? 74  ARG B CG   1 
ATOM 1604  C CD   . ARG B 1 11 ? -11.526 25.110  -52.533 1.00 0.00 ? 74  ARG B CD   1 
ATOM 1605  N NE   . ARG B 1 11 ? -12.072 23.955  -53.229 1.00 0.00 ? 74  ARG B NE   1 
ATOM 1606  C CZ   . ARG B 1 11 ? -12.137 23.829  -54.568 1.00 0.00 ? 74  ARG B CZ   1 
ATOM 1607  N NH1  . ARG B 1 11 ? -11.685 24.792  -55.341 1.00 0.00 ? 74  ARG B NH1  1 
ATOM 1608  N NH2  . ARG B 1 11 ? -12.652 22.736  -55.105 1.00 0.00 ? 74  ARG B NH2  1 
ATOM 1609  H H    . ARG B 1 11 ? -9.784  27.420  -47.848 1.00 0.00 ? 74  ARG B H    1 
ATOM 1610  H HA   . ARG B 1 11 ? -12.249 26.058  -48.577 1.00 0.00 ? 74  ARG B HA   1 
ATOM 1611  H HB2  . ARG B 1 11 ? -11.586 27.036  -50.718 1.00 0.00 ? 74  ARG B HB2  1 
ATOM 1612  H HB3  . ARG B 1 11 ? -9.997  26.290  -50.579 1.00 0.00 ? 74  ARG B HB3  1 
ATOM 1613  H HG2  . ARG B 1 11 ? -10.971 24.090  -50.780 1.00 0.00 ? 74  ARG B HG2  1 
ATOM 1614  H HG3  . ARG B 1 11 ? -12.602 24.760  -50.774 1.00 0.00 ? 74  ARG B HG3  1 
ATOM 1615  H HD2  . ARG B 1 11 ? -12.101 25.993  -52.811 1.00 0.00 ? 74  ARG B HD2  1 
ATOM 1616  H HD3  . ARG B 1 11 ? -10.488 25.246  -52.837 1.00 0.00 ? 74  ARG B HD3  1 
ATOM 1617  H HE   . ARG B 1 11 ? -12.418 23.219  -52.684 1.00 0.00 ? 74  ARG B HE   1 
ATOM 1618  H HH11 . ARG B 1 11 ? -11.296 25.619  -54.937 1.00 0.00 ? 74  ARG B HH11 1 
ATOM 1619  H HH12 . ARG B 1 11 ? -11.732 24.697  -56.346 1.00 0.00 ? 74  ARG B HH12 1 
ATOM 1620  H HH21 . ARG B 1 11 ? -12.995 22.002  -54.519 1.00 0.00 ? 74  ARG B HH21 1 
ATOM 1621  H HH22 . ARG B 1 11 ? -12.697 22.647  -56.100 1.00 0.00 ? 74  ARG B HH22 1 
ATOM 1622  N N    . PHE B 1 12 ? -11.233 23.962  -47.773 1.00 0.00 ? 75  PHE B N    1 
ATOM 1623  C CA   . PHE B 1 12 ? -10.653 22.774  -47.162 1.00 0.00 ? 75  PHE B CA   1 
ATOM 1624  C C    . PHE B 1 12 ? -10.555 21.630  -48.163 1.00 0.00 ? 75  PHE B C    1 
ATOM 1625  O O    . PHE B 1 12 ? -11.568 21.157  -48.680 1.00 0.00 ? 75  PHE B O    1 
ATOM 1626  C CB   . PHE B 1 12 ? -11.484 22.333  -45.956 1.00 0.00 ? 75  PHE B CB   1 
ATOM 1627  C CG   . PHE B 1 12 ? -11.105 20.982  -45.419 1.00 0.00 ? 75  PHE B CG   1 
ATOM 1628  C CD1  . PHE B 1 12 ? -11.697 19.830  -45.914 1.00 0.00 ? 75  PHE B CD1  1 
ATOM 1629  C CD2  . PHE B 1 12 ? -10.152 20.861  -44.418 1.00 0.00 ? 75  PHE B CD2  1 
ATOM 1630  C CE1  . PHE B 1 12 ? -11.349 18.589  -45.420 1.00 0.00 ? 75  PHE B CE1  1 
ATOM 1631  C CE2  . PHE B 1 12 ? -9.802  19.618  -43.923 1.00 0.00 ? 75  PHE B CE2  1 
ATOM 1632  C CZ   . PHE B 1 12 ? -10.402 18.483  -44.425 1.00 0.00 ? 75  PHE B CZ   1 
ATOM 1633  H H    . PHE B 1 12 ? -12.247 24.063  -47.798 1.00 0.00 ? 75  PHE B H    1 
ATOM 1634  H HA   . PHE B 1 12 ? -9.660  22.988  -46.821 1.00 0.00 ? 75  PHE B HA   1 
ATOM 1635  H HB2  . PHE B 1 12 ? -11.371 23.055  -45.178 1.00 0.00 ? 75  PHE B HB2  1 
ATOM 1636  H HB3  . PHE B 1 12 ? -12.519 22.303  -46.254 1.00 0.00 ? 75  PHE B HB3  1 
ATOM 1637  H HD1  . PHE B 1 12 ? -12.440 19.909  -46.693 1.00 0.00 ? 75  PHE B HD1  1 
ATOM 1638  H HD2  . PHE B 1 12 ? -9.673  21.746  -44.031 1.00 0.00 ? 75  PHE B HD2  1 
ATOM 1639  H HE1  . PHE B 1 12 ? -11.820 17.699  -45.814 1.00 0.00 ? 75  PHE B HE1  1 
ATOM 1640  H HE2  . PHE B 1 12 ? -9.060  19.537  -43.141 1.00 0.00 ? 75  PHE B HE2  1 
ATOM 1641  H HZ   . PHE B 1 12 ? -9.948  17.529  -44.224 1.00 0.00 ? 75  PHE B HZ   1 
ATOM 1642  N N    . SER B 1 13 ? -9.331  21.190  -48.434 1.00 0.00 ? 76  SER B N    1 
ATOM 1643  C CA   . SER B 1 13 ? -9.096  20.134  -49.413 1.00 0.00 ? 76  SER B CA   1 
ATOM 1644  C C    . SER B 1 13 ? -8.151  19.074  -48.861 1.00 0.00 ? 76  SER B C    1 
ATOM 1645  O O    . SER B 1 13 ? -7.261  19.375  -48.067 1.00 0.00 ? 76  SER B O    1 
ATOM 1646  C CB   . SER B 1 13 ? -8.523  20.722  -50.688 1.00 0.00 ? 76  SER B CB   1 
ATOM 1647  O OG   . SER B 1 13 ? -7.279  21.324  -50.449 1.00 0.00 ? 76  SER B OG   1 
ATOM 1648  H H    . SER B 1 13 ? -8.535  21.628  -47.973 1.00 0.00 ? 76  SER B H    1 
ATOM 1649  H HA   . SER B 1 13 ? -10.018 19.650  -49.650 1.00 0.00 ? 76  SER B HA   1 
ATOM 1650  H HB2  . SER B 1 13 ? -8.394  19.933  -51.423 1.00 0.00 ? 76  SER B HB2  1 
ATOM 1651  H HB3  . SER B 1 13 ? -9.223  21.465  -51.078 1.00 0.00 ? 76  SER B HB3  1 
ATOM 1652  H HG   . SER B 1 13 ? -6.963  21.703  -51.272 1.00 0.00 ? 76  SER B HG   1 
ATOM 1653  N N    . VAL B 1 14 ? -8.351  17.832  -49.288 1.00 0.00 ? 77  VAL B N    1 
ATOM 1654  C CA   . VAL B 1 14 ? -7.507  16.727  -48.851 1.00 0.00 ? 77  VAL B CA   1 
ATOM 1655  C C    . VAL B 1 14 ? -7.204  15.776  -50.002 1.00 0.00 ? 77  VAL B C    1 
ATOM 1656  O O    . VAL B 1 14 ? -8.089  15.432  -50.785 1.00 0.00 ? 77  VAL B O    1 
ATOM 1657  C CB   . VAL B 1 14 ? -8.192  15.948  -47.714 1.00 0.00 ? 77  VAL B CB   1 
ATOM 1658  C CG1  . VAL B 1 14 ? -7.325  14.777  -47.274 1.00 0.00 ? 77  VAL B CG1  1 
ATOM 1659  C CG2  . VAL B 1 14 ? -8.473  16.880  -46.543 1.00 0.00 ? 77  VAL B CG2  1 
ATOM 1660  H H    . VAL B 1 14 ? -9.103  17.649  -49.952 1.00 0.00 ? 77  VAL B H    1 
ATOM 1661  H HA   . VAL B 1 14 ? -6.559  17.117  -48.473 1.00 0.00 ? 77  VAL B HA   1 
ATOM 1662  H HB   . VAL B 1 14 ? -9.120  15.557  -48.099 1.00 0.00 ? 77  VAL B HB   1 
ATOM 1663  H HG11 . VAL B 1 14 ? -6.561  15.138  -46.584 1.00 0.00 ? 77  VAL B HG11 1 
ATOM 1664  H HG12 . VAL B 1 14 ? -6.841  14.303  -48.111 1.00 0.00 ? 77  VAL B HG12 1 
ATOM 1665  H HG13 . VAL B 1 14 ? -7.946  14.044  -46.757 1.00 0.00 ? 77  VAL B HG13 1 
ATOM 1666  H HG21 . VAL B 1 14 ? -7.778  17.707  -46.550 1.00 0.00 ? 77  VAL B HG21 1 
ATOM 1667  H HG22 . VAL B 1 14 ? -8.388  16.340  -45.597 1.00 0.00 ? 77  VAL B HG22 1 
ATOM 1668  H HG23 . VAL B 1 14 ? -9.482  17.271  -46.639 1.00 0.00 ? 77  VAL B HG23 1 
ATOM 1669  N N    . ASN B 1 15 ? -5.947  15.356  -50.103 1.00 0.00 ? 78  ASN B N    1 
ATOM 1670  C CA   . ASN B 1 15 ? -5.582  14.231  -50.953 1.00 0.00 ? 78  ASN B CA   1 
ATOM 1671  C C    . ASN B 1 15 ? -5.280  12.988  -50.125 1.00 0.00 ? 78  ASN B C    1 
ATOM 1672  O O    . ASN B 1 15 ? -4.775  13.083  -49.006 1.00 0.00 ? 78  ASN B O    1 
ATOM 1673  C CB   . ASN B 1 15 ? -4.394  14.588  -51.829 1.00 0.00 ? 78  ASN B CB   1 
ATOM 1674  C CG   . ASN B 1 15 ? -4.737  15.607  -52.879 1.00 0.00 ? 78  ASN B CG   1 
ATOM 1675  O OD1  . ASN B 1 15 ? -5.872  15.655  -53.368 1.00 0.00 ? 78  ASN B OD1  1 
ATOM 1676  N ND2  . ASN B 1 15 ? -3.779  16.424  -53.236 1.00 0.00 ? 78  ASN B ND2  1 
ATOM 1677  H H    . ASN B 1 15 ? -5.280  15.653  -49.389 1.00 0.00 ? 78  ASN B H    1 
ATOM 1678  H HA   . ASN B 1 15 ? -6.423  13.995  -51.614 1.00 0.00 ? 78  ASN B HA   1 
ATOM 1679  H HB2  . ASN B 1 15 ? -3.591  14.969  -51.200 1.00 0.00 ? 78  ASN B HB2  1 
ATOM 1680  H HB3  . ASN B 1 15 ? -4.066  13.680  -52.328 1.00 0.00 ? 78  ASN B HB3  1 
ATOM 1681  H HD21 . ASN B 1 15 ? -2.852  16.351  -52.816 1.00 0.00 ? 78  ASN B HD21 1 
ATOM 1682  H HD22 . ASN B 1 15 ? -3.967  17.138  -53.941 1.00 0.00 ? 78  ASN B HD22 1 
ATOM 1683  N N    . LEU B 1 16 ? -5.595  11.823  -50.679 1.00 0.00 ? 79  LEU B N    1 
ATOM 1684  C CA   . LEU B 1 16 ? -5.496  10.570  -49.939 1.00 0.00 ? 79  LEU B CA   1 
ATOM 1685  C C    . LEU B 1 16 ? -5.017  9.437   -50.836 1.00 0.00 ? 79  LEU B C    1 
ATOM 1686  O O    . LEU B 1 16 ? -5.333  9.398   -52.026 1.00 0.00 ? 79  LEU B O    1 
ATOM 1687  C CB   . LEU B 1 16 ? -6.855  10.207  -49.327 1.00 0.00 ? 79  LEU B CB   1 
ATOM 1688  C CG   . LEU B 1 16 ? -7.378  11.170  -48.252 1.00 0.00 ? 79  LEU B CG   1 
ATOM 1689  C CD1  . LEU B 1 16 ? -8.846  10.872  -47.976 1.00 0.00 ? 79  LEU B CD1  1 
ATOM 1690  C CD2  . LEU B 1 16 ? -6.542  11.021  -46.989 1.00 0.00 ? 79  LEU B CD2  1 
ATOM 1691  H H    . LEU B 1 16 ? -6.032  11.812  -51.601 1.00 0.00 ? 79  LEU B H    1 
ATOM 1692  H HA   . LEU B 1 16 ? -4.787  10.687  -49.122 1.00 0.00 ? 79  LEU B HA   1 
ATOM 1693  H HB2  . LEU B 1 16 ? -7.555  10.232  -50.133 1.00 0.00 ? 79  LEU B HB2  1 
ATOM 1694  H HB3  . LEU B 1 16 ? -6.816  9.195   -48.922 1.00 0.00 ? 79  LEU B HB3  1 
ATOM 1695  H HG   . LEU B 1 16 ? -7.300  12.179  -48.633 1.00 0.00 ? 79  LEU B HG   1 
ATOM 1696  H HD11 . LEU B 1 16 ? -8.932  9.848   -47.616 1.00 0.00 ? 79  LEU B HD11 1 
ATOM 1697  H HD12 . LEU B 1 16 ? -9.424  10.984  -48.891 1.00 0.00 ? 79  LEU B HD12 1 
ATOM 1698  H HD13 . LEU B 1 16 ? -9.220  11.555  -47.222 1.00 0.00 ? 79  LEU B HD13 1 
ATOM 1699  H HD21 . LEU B 1 16 ? -5.666  11.665  -47.056 1.00 0.00 ? 79  LEU B HD21 1 
ATOM 1700  H HD22 . LEU B 1 16 ? -6.216  9.995   -46.867 1.00 0.00 ? 79  LEU B HD22 1 
ATOM 1701  H HD23 . LEU B 1 16 ? -7.133  11.318  -46.119 1.00 0.00 ? 79  LEU B HD23 1 
ATOM 1702  N N    . ASP B 1 17 ? -4.255  8.513   -50.260 1.00 0.00 ? 80  ASP B N    1 
ATOM 1703  C CA   . ASP B 1 17 ? -3.709  7.391   -51.013 1.00 0.00 ? 80  ASP B CA   1 
ATOM 1704  C C    . ASP B 1 17 ? -4.736  6.275   -51.159 1.00 0.00 ? 80  ASP B C    1 
ATOM 1705  O O    . ASP B 1 17 ? -5.118  5.638   -50.177 1.00 0.00 ? 80  ASP B O    1 
ATOM 1706  C CB   . ASP B 1 17 ? -2.451  6.849   -50.331 1.00 0.00 ? 80  ASP B CB   1 
ATOM 1707  C CG   . ASP B 1 17 ? -1.861  5.640   -51.048 1.00 0.00 ? 80  ASP B CG   1 
ATOM 1708  O OD1  . ASP B 1 17 ? -2.490  5.149   -51.956 1.00 0.00 ? 80  ASP B OD1  1 
ATOM 1709  O OD2  . ASP B 1 17 ? -0.791  5.222   -50.681 1.00 0.00 ? 80  ASP B OD2  1 
ATOM 1710  H H    . ASP B 1 17 ? -4.023  8.605   -49.270 1.00 0.00 ? 80  ASP B H    1 
ATOM 1711  H HA   . ASP B 1 17 ? -3.430  7.734   -52.011 1.00 0.00 ? 80  ASP B HA   1 
ATOM 1712  H HB2  . ASP B 1 17 ? -1.699  7.637   -50.301 1.00 0.00 ? 80  ASP B HB2  1 
ATOM 1713  H HB3  . ASP B 1 17 ? -2.703  6.563   -49.310 1.00 0.00 ? 80  ASP B HB3  1 
ATOM 1714  N N    . VAL B 1 18 ? -5.178  6.042   -52.390 1.00 0.00 ? 81  VAL B N    1 
ATOM 1715  C CA   . VAL B 1 18 ? -6.000  4.878   -52.701 1.00 0.00 ? 81  VAL B CA   1 
ATOM 1716  C C    . VAL B 1 18 ? -5.514  4.185   -53.968 1.00 0.00 ? 81  VAL B C    1 
ATOM 1717  O O    . VAL B 1 18 ? -6.311  3.831   -54.837 1.00 0.00 ? 81  VAL B O    1 
ATOM 1718  C CB   . VAL B 1 18 ? -7.472  5.296   -52.878 1.00 0.00 ? 81  VAL B CB   1 
ATOM 1719  C CG1  . VAL B 1 18 ? -8.333  4.085   -53.201 1.00 0.00 ? 81  VAL B CG1  1 
ATOM 1720  C CG2  . VAL B 1 18 ? -7.968  5.994   -51.622 1.00 0.00 ? 81  VAL B CG2  1 
ATOM 1721  H H    . VAL B 1 18 ? -4.792  6.583   -53.163 1.00 0.00 ? 81  VAL B H    1 
ATOM 1722  H HA   . VAL B 1 18 ? -5.954  4.163   -51.879 1.00 0.00 ? 81  VAL B HA   1 
ATOM 1723  H HB   . VAL B 1 18 ? -7.508  6.001   -53.705 1.00 0.00 ? 81  VAL B HB   1 
ATOM 1724  H HG11 . VAL B 1 18 ? -7.737  3.171   -53.241 1.00 0.00 ? 81  VAL B HG11 1 
ATOM 1725  H HG12 . VAL B 1 18 ? -8.843  4.207   -54.149 1.00 0.00 ? 81  VAL B HG12 1 
ATOM 1726  H HG13 . VAL B 1 18 ? -9.076  3.950   -52.423 1.00 0.00 ? 81  VAL B HG13 1 
ATOM 1727  H HG21 . VAL B 1 18 ? -9.027  6.185   -51.708 1.00 0.00 ? 81  VAL B HG21 1 
ATOM 1728  H HG22 . VAL B 1 18 ? -7.783  5.353   -50.761 1.00 0.00 ? 81  VAL B HG22 1 
ATOM 1729  H HG23 . VAL B 1 18 ? -7.436  6.936   -51.493 1.00 0.00 ? 81  VAL B HG23 1 
ATOM 1730  N N    . LYS B 1 19 ? -4.204  3.993   -54.067 1.00 0.00 ? 82  LYS B N    1 
ATOM 1731  C CA   . LYS B 1 19 ? -3.576  3.629   -55.331 1.00 0.00 ? 82  LYS B CA   1 
ATOM 1732  C C    . LYS B 1 19 ? -3.774  2.152   -55.638 1.00 0.00 ? 82  LYS B C    1 
ATOM 1733  O O    . LYS B 1 19 ? -3.816  1.747   -56.802 1.00 0.00 ? 82  LYS B O    1 
ATOM 1734  C CB   . LYS B 1 19 ? -2.084  3.965   -55.305 1.00 0.00 ? 82  LYS B CB   1 
ATOM 1735  C CG   . LYS B 1 19 ? -1.776  5.457   -55.297 1.00 0.00 ? 82  LYS B CG   1 
ATOM 1736  C CD   . LYS B 1 19 ? -0.275  5.711   -55.254 1.00 0.00 ? 82  LYS B CD   1 
ATOM 1737  C CE   . LYS B 1 19 ? 0.033   7.201   -55.250 1.00 0.00 ? 82  LYS B CE   1 
ATOM 1738  N NZ   . LYS B 1 19 ? 1.497   7.464   -55.188 1.00 0.00 ? 82  LYS B NZ   1 
ATOM 1739  H H    . LYS B 1 19 ? -3.605  4.353   -53.323 1.00 0.00 ? 82  LYS B H    1 
ATOM 1740  H HA   . LYS B 1 19 ? -4.000  4.184   -56.134 1.00 0.00 ? 82  LYS B HA   1 
ATOM 1741  H HB2  . LYS B 1 19 ? -1.643  3.524   -54.412 1.00 0.00 ? 82  LYS B HB2  1 
ATOM 1742  H HB3  . LYS B 1 19 ? -1.612  3.520   -56.184 1.00 0.00 ? 82  LYS B HB3  1 
ATOM 1743  H HG2  . LYS B 1 19 ? -2.189  5.909   -56.198 1.00 0.00 ? 82  LYS B HG2  1 
ATOM 1744  H HG3  . LYS B 1 19 ? -2.239  5.910   -54.420 1.00 0.00 ? 82  LYS B HG3  1 
ATOM 1745  H HD2  . LYS B 1 19 ? 0.138   5.259   -54.351 1.00 0.00 ? 82  LYS B HD2  1 
ATOM 1746  H HD3  . LYS B 1 19 ? 0.188   5.255   -56.128 1.00 0.00 ? 82  LYS B HD3  1 
ATOM 1747  H HE2  . LYS B 1 19 ? -0.367  7.646   -56.159 1.00 0.00 ? 82  LYS B HE2  1 
ATOM 1748  H HE3  . LYS B 1 19 ? -0.448  7.658   -54.386 1.00 0.00 ? 82  LYS B HE3  1 
ATOM 1749  H HZ1  . LYS B 1 19 ? 1.991   6.796   -55.809 1.00 0.00 ? 82  LYS B HZ1  1 
ATOM 1750  H HZ2  . LYS B 1 19 ? 1.828   7.340   -54.208 1.00 0.00 ? 82  LYS B HZ2  1 
ATOM 1751  H HZ3  . LYS B 1 19 ? 1.683   8.409   -55.491 1.00 0.00 ? 82  LYS B HZ3  1 
ATOM 1752  N N    . HIS B 1 20 ? -3.896  1.345   -54.589 1.00 0.00 ? 83  HIS B N    1 
ATOM 1753  C CA   . HIS B 1 20 ? -3.717  -0.097  -54.707 1.00 0.00 ? 83  HIS B CA   1 
ATOM 1754  C C    . HIS B 1 20 ? -4.969  -0.845  -54.264 1.00 0.00 ? 83  HIS B C    1 
ATOM 1755  O O    . HIS B 1 20 ? -4.989  -2.075  -54.228 1.00 0.00 ? 83  HIS B O    1 
ATOM 1756  C CB   . HIS B 1 20 ? -2.517  -0.565  -53.877 1.00 0.00 ? 83  HIS B CB   1 
ATOM 1757  C CG   . HIS B 1 20 ? -1.225  0.074   -54.278 1.00 0.00 ? 83  HIS B CG   1 
ATOM 1758  N ND1  . HIS B 1 20 ? -0.518  0.913   -53.441 1.00 0.00 ? 83  HIS B ND1  1 
ATOM 1759  C CD2  . HIS B 1 20 ? -0.509  -0.002  -55.426 1.00 0.00 ? 83  HIS B CD2  1 
ATOM 1760  C CE1  . HIS B 1 20 ? 0.577   1.325   -54.058 1.00 0.00 ? 83  HIS B CE1  1 
ATOM 1761  N NE2  . HIS B 1 20 ? 0.605   0.783   -55.262 1.00 0.00 ? 83  HIS B NE2  1 
ATOM 1762  H H    . HIS B 1 20 ? -3.794  1.756   -53.661 1.00 0.00 ? 83  HIS B H    1 
ATOM 1763  H HA   . HIS B 1 20 ? -3.520  -0.363  -55.746 1.00 0.00 ? 83  HIS B HA   1 
ATOM 1764  H HB2  . HIS B 1 20 ? -2.705  -0.333  -52.829 1.00 0.00 ? 83  HIS B HB2  1 
ATOM 1765  H HB3  . HIS B 1 20 ? -2.419  -1.647  -53.983 1.00 0.00 ? 83  HIS B HB3  1 
ATOM 1766  H HD2  . HIS B 1 20 ? -0.868  -0.401  -56.363 1.00 0.00 ? 83  HIS B HD2  1 
ATOM 1767  H HE1  . HIS B 1 20 ? 1.322   1.988   -53.642 1.00 0.00 ? 83  HIS B HE1  1 
ATOM 1768  H HE2  . HIS B 1 20 ? 1.329   0.925   -55.951 1.00 0.00 ? 83  HIS B HE2  1 
ATOM 1769  N N    . PHE B 1 21 ? -6.012  -0.095  -53.927 1.00 0.00 ? 84  PHE B N    1 
ATOM 1770  C CA   . PHE B 1 21 ? -7.288  -0.685  -53.540 1.00 0.00 ? 84  PHE B CA   1 
ATOM 1771  C C    . PHE B 1 21 ? -8.455  0.184   -53.989 1.00 0.00 ? 84  PHE B C    1 
ATOM 1772  O O    . PHE B 1 21 ? -8.261  1.229   -54.609 1.00 0.00 ? 84  PHE B O    1 
ATOM 1773  C CB   . PHE B 1 21 ? -7.347  -0.884  -52.024 1.00 0.00 ? 84  PHE B CB   1 
ATOM 1774  C CG   . PHE B 1 21 ? -7.183  0.386   -51.239 1.00 0.00 ? 84  PHE B CG   1 
ATOM 1775  C CD1  . PHE B 1 21 ? -5.920  0.900   -50.977 1.00 0.00 ? 84  PHE B CD1  1 
ATOM 1776  C CD2  . PHE B 1 21 ? -8.290  1.072   -50.764 1.00 0.00 ? 84  PHE B CD2  1 
ATOM 1777  C CE1  . PHE B 1 21 ? -5.769  2.067   -50.254 1.00 0.00 ? 84  PHE B CE1  1 
ATOM 1778  C CE2  . PHE B 1 21 ? -8.142  2.241   -50.040 1.00 0.00 ? 84  PHE B CE2  1 
ATOM 1779  C CZ   . PHE B 1 21 ? -6.881  2.738   -49.786 1.00 0.00 ? 84  PHE B CZ   1 
ATOM 1780  H H    . PHE B 1 21 ? -5.927  0.920   -53.993 1.00 0.00 ? 84  PHE B H    1 
ATOM 1781  H HA   . PHE B 1 21 ? -7.400  -1.657  -54.027 1.00 0.00 ? 84  PHE B HA   1 
ATOM 1782  H HB2  . PHE B 1 21 ? -8.296  -1.350  -51.762 1.00 0.00 ? 84  PHE B HB2  1 
ATOM 1783  H HB3  . PHE B 1 21 ? -6.536  -1.554  -51.764 1.00 0.00 ? 84  PHE B HB3  1 
ATOM 1784  H HD1  . PHE B 1 21 ? -5.052  0.410   -51.375 1.00 0.00 ? 84  PHE B HD1  1 
ATOM 1785  H HD2  . PHE B 1 21 ? -9.279  0.684   -50.956 1.00 0.00 ? 84  PHE B HD2  1 
ATOM 1786  H HE1  . PHE B 1 21 ? -4.781  2.457   -50.057 1.00 0.00 ? 84  PHE B HE1  1 
ATOM 1787  H HE2  . PHE B 1 21 ? -9.001  2.741   -49.657 1.00 0.00 ? 84  PHE B HE2  1 
ATOM 1788  H HZ   . PHE B 1 21 ? -6.763  3.622   -49.177 1.00 0.00 ? 84  PHE B HZ   1 
ATOM 1789  N N    . SER B 1 22 ? -9.669  -0.252  -53.671 1.00 0.00 ? 85  SER B N    1 
ATOM 1790  C CA   . SER B 1 22 ? -10.845 0.115   -54.449 1.00 0.00 ? 85  SER B CA   1 
ATOM 1791  C C    . SER B 1 22 ? -11.951 0.656   -53.554 1.00 0.00 ? 85  SER B C    1 
ATOM 1792  O O    . SER B 1 22 ? -11.894 0.523   -52.331 1.00 0.00 ? 85  SER B O    1 
ATOM 1793  C CB   . SER B 1 22 ? -11.352 -1.083  -55.227 1.00 0.00 ? 85  SER B CB   1 
ATOM 1794  O OG   . SER B 1 22 ? -10.408 -1.506  -56.171 1.00 0.00 ? 85  SER B OG   1 
ATOM 1795  H H    . SER B 1 22 ? -9.710  -1.164  -53.214 1.00 0.00 ? 85  SER B H    1 
ATOM 1796  H HA   . SER B 1 22 ? -10.564 0.874   -55.166 1.00 0.00 ? 85  SER B HA   1 
ATOM 1797  H HB2  . SER B 1 22 ? -11.501 -1.901  -54.530 1.00 0.00 ? 85  SER B HB2  1 
ATOM 1798  H HB3  . SER B 1 22 ? -12.289 -0.884  -55.705 1.00 0.00 ? 85  SER B HB3  1 
ATOM 1799  H HG   . SER B 1 22 ? -10.801 -2.206  -56.698 1.00 0.00 ? 85  SER B HG   1 
ATOM 1800  N N    . PRO B 1 23 ? -12.956 1.271   -54.169 1.00 0.00 ? 86  PRO B N    1 
ATOM 1801  C CA   . PRO B 1 23 ? -14.101 1.792   -53.433 1.00 0.00 ? 86  PRO B CA   1 
ATOM 1802  C C    . PRO B 1 23 ? -14.704 0.728   -52.523 1.00 0.00 ? 86  PRO B C    1 
ATOM 1803  O O    . PRO B 1 23 ? -15.256 1.038   -51.468 1.00 0.00 ? 86  PRO B O    1 
ATOM 1804  C CB   . PRO B 1 23 ? -15.072 2.199   -54.545 1.00 0.00 ? 86  PRO B CB   1 
ATOM 1805  C CG   . PRO B 1 23 ? -14.187 2.571   -55.685 1.00 0.00 ? 86  PRO B CG   1 
ATOM 1806  C CD   . PRO B 1 23 ? -13.065 1.567   -55.631 1.00 0.00 ? 86  PRO B CD   1 
ATOM 1807  H HA   . PRO B 1 23 ? -13.834 2.672   -52.879 1.00 0.00 ? 86  PRO B HA   1 
ATOM 1808  H HB2  . PRO B 1 23 ? -15.710 1.354   -54.824 1.00 0.00 ? 86  PRO B HB2  1 
ATOM 1809  H HB3  . PRO B 1 23 ? -15.683 3.052   -54.242 1.00 0.00 ? 86  PRO B HB3  1 
ATOM 1810  H HG2  . PRO B 1 23 ? -14.732 2.509   -56.633 1.00 0.00 ? 86  PRO B HG2  1 
ATOM 1811  H HG3  . PRO B 1 23 ? -13.794 3.576   -55.538 1.00 0.00 ? 86  PRO B HG3  1 
ATOM 1812  H HD2  . PRO B 1 23 ? -13.356 0.692   -56.204 1.00 0.00 ? 86  PRO B HD2  1 
ATOM 1813  H HD3  . PRO B 1 23 ? -12.154 2.008   -56.020 1.00 0.00 ? 86  PRO B HD3  1 
ATOM 1814  N N    . GLU B 1 24 ? -14.593 -0.529  -52.940 1.00 0.00 ? 87  GLU B N    1 
ATOM 1815  C CA   . GLU B 1 24 ? -15.184 -1.637  -52.199 1.00 0.00 ? 87  GLU B CA   1 
ATOM 1816  C C    . GLU B 1 24 ? -14.516 -1.809  -50.839 1.00 0.00 ? 87  GLU B C    1 
ATOM 1817  O O    . GLU B 1 24 ? -15.167 -2.167  -49.859 1.00 0.00 ? 87  GLU B O    1 
ATOM 1818  C CB   . GLU B 1 24 ? -15.074 -2.936  -53.001 1.00 0.00 ? 87  GLU B CB   1 
ATOM 1819  C CG   . GLU B 1 24 ? -15.931 -2.972  -54.258 1.00 0.00 ? 87  GLU B CG   1 
ATOM 1820  C CD   . GLU B 1 24 ? -15.746 -4.234  -55.054 1.00 0.00 ? 87  GLU B CD   1 
ATOM 1821  O OE1  . GLU B 1 24 ? -14.880 -5.006  -54.717 1.00 0.00 ? 87  GLU B OE1  1 
ATOM 1822  O OE2  . GLU B 1 24 ? -16.473 -4.426  -56.000 1.00 0.00 ? 87  GLU B OE2  1 
ATOM 1823  H H    . GLU B 1 24 ? -14.137 -0.716  -53.832 1.00 0.00 ? 87  GLU B H    1 
ATOM 1824  H HA   . GLU B 1 24 ? -16.243 -1.430  -52.039 1.00 0.00 ? 87  GLU B HA   1 
ATOM 1825  H HB2  . GLU B 1 24 ? -14.033 -3.071  -53.295 1.00 0.00 ? 87  GLU B HB2  1 
ATOM 1826  H HB3  . GLU B 1 24 ? -15.371 -3.768  -52.362 1.00 0.00 ? 87  GLU B HB3  1 
ATOM 1827  H HG2  . GLU B 1 24 ? -16.978 -2.888  -53.965 1.00 0.00 ? 87  GLU B HG2  1 
ATOM 1828  H HG3  . GLU B 1 24 ? -15.667 -2.117  -54.881 1.00 0.00 ? 87  GLU B HG3  1 
ATOM 1829  N N    . GLU B 1 25 ? -13.213 -1.551  -50.790 1.00 0.00 ? 88  GLU B N    1 
ATOM 1830  C CA   . GLU B 1 25 ? -12.464 -1.631  -49.542 1.00 0.00 ? 88  GLU B CA   1 
ATOM 1831  C C    . GLU B 1 25 ? -12.178 -0.242  -48.983 1.00 0.00 ? 88  GLU B C    1 
ATOM 1832  O O    . GLU B 1 25 ? -11.648 -0.104  -47.882 1.00 0.00 ? 88  GLU B O    1 
ATOM 1833  C CB   . GLU B 1 25 ? -11.150 -2.385  -49.755 1.00 0.00 ? 88  GLU B CB   1 
ATOM 1834  C CG   . GLU B 1 25 ? -11.321 -3.840  -50.168 1.00 0.00 ? 88  GLU B CG   1 
ATOM 1835  C CD   . GLU B 1 25 ? -10.011 -4.551  -50.363 1.00 0.00 ? 88  GLU B CD   1 
ATOM 1836  O OE1  . GLU B 1 25 ? -8.991  -3.960  -50.099 1.00 0.00 ? 88  GLU B OE1  1 
ATOM 1837  O OE2  . GLU B 1 25 ? -10.030 -5.686  -50.779 1.00 0.00 ? 88  GLU B OE2  1 
ATOM 1838  H H    . GLU B 1 25 ? -12.731 -1.254  -51.638 1.00 0.00 ? 88  GLU B H    1 
ATOM 1839  H HA   . GLU B 1 25 ? -13.047 -2.184  -48.802 1.00 0.00 ? 88  GLU B HA   1 
ATOM 1840  H HB2  . GLU B 1 25 ? -10.579 -1.873  -50.529 1.00 0.00 ? 88  GLU B HB2  1 
ATOM 1841  H HB3  . GLU B 1 25 ? -10.589 -2.375  -48.843 1.00 0.00 ? 88  GLU B HB3  1 
ATOM 1842  H HG2  . GLU B 1 25 ? -11.889 -4.352  -49.393 1.00 0.00 ? 88  GLU B HG2  1 
ATOM 1843  H HG3  . GLU B 1 25 ? -11.882 -3.871  -51.103 1.00 0.00 ? 88  GLU B HG3  1 
ATOM 1844  N N    . LEU B 1 26 ? -12.532 0.785   -49.751 1.00 0.00 ? 89  LEU B N    1 
ATOM 1845  C CA   . LEU B 1 26 ? -12.338 2.164   -49.322 1.00 0.00 ? 89  LEU B CA   1 
ATOM 1846  C C    . LEU B 1 26 ? -13.592 2.715   -48.659 1.00 0.00 ? 89  LEU B C    1 
ATOM 1847  O O    . LEU B 1 26 ? -14.513 3.176   -49.334 1.00 0.00 ? 89  LEU B O    1 
ATOM 1848  C CB   . LEU B 1 26 ? -11.957 3.042   -50.521 1.00 0.00 ? 89  LEU B CB   1 
ATOM 1849  C CG   . LEU B 1 26 ? -11.918 4.552   -50.254 1.00 0.00 ? 89  LEU B CG   1 
ATOM 1850  C CD1  . LEU B 1 26 ? -10.798 4.866   -49.271 1.00 0.00 ? 89  LEU B CD1  1 
ATOM 1851  C CD2  . LEU B 1 26 ? -11.719 5.296   -51.566 1.00 0.00 ? 89  LEU B CD2  1 
ATOM 1852  H H    . LEU B 1 26 ? -12.971 0.602   -50.655 1.00 0.00 ? 89  LEU B H    1 
ATOM 1853  H HA   . LEU B 1 26 ? -11.536 2.178   -48.618 1.00 0.00 ? 89  LEU B HA   1 
ATOM 1854  H HB2  . LEU B 1 26 ? -10.979 2.736   -50.877 1.00 0.00 ? 89  LEU B HB2  1 
ATOM 1855  H HB3  . LEU B 1 26 ? -12.666 2.853   -51.293 1.00 0.00 ? 89  LEU B HB3  1 
ATOM 1856  H HG   . LEU B 1 26 ? -12.853 4.843   -49.814 1.00 0.00 ? 89  LEU B HG   1 
ATOM 1857  H HD11 . LEU B 1 26 ? -9.839  4.722   -49.755 1.00 0.00 ? 89  LEU B HD11 1 
ATOM 1858  H HD12 . LEU B 1 26 ? -10.870 4.267   -48.391 1.00 0.00 ? 89  LEU B HD12 1 
ATOM 1859  H HD13 . LEU B 1 26 ? -10.888 5.913   -48.987 1.00 0.00 ? 89  LEU B HD13 1 
ATOM 1860  H HD21 . LEU B 1 26 ? -11.269 6.264   -51.383 1.00 0.00 ? 89  LEU B HD21 1 
ATOM 1861  H HD22 . LEU B 1 26 ? -12.691 5.445   -52.039 1.00 0.00 ? 89  LEU B HD22 1 
ATOM 1862  H HD23 . LEU B 1 26 ? -11.094 4.729   -52.241 1.00 0.00 ? 89  LEU B HD23 1 
ATOM 1863  N N    . LYS B 1 27 ? -13.623 2.668   -47.331 1.00 0.00 ? 90  LYS B N    1 
ATOM 1864  C CA   . LYS B 1 27 ? -14.820 3.023   -46.578 1.00 0.00 ? 90  LYS B CA   1 
ATOM 1865  C C    . LYS B 1 27 ? -14.769 4.474   -46.118 1.00 0.00 ? 90  LYS B C    1 
ATOM 1866  O O    . LYS B 1 27 ? -14.544 4.752   -44.940 1.00 0.00 ? 90  LYS B O    1 
ATOM 1867  C CB   . LYS B 1 27 ? -14.993 2.093   -45.376 1.00 0.00 ? 90  LYS B CB   1 
ATOM 1868  C CG   . LYS B 1 27 ? -15.219 0.633   -45.739 1.00 0.00 ? 90  LYS B CG   1 
ATOM 1869  C CD   . LYS B 1 27 ? -15.422 -0.221  -44.496 1.00 0.00 ? 90  LYS B CD   1 
ATOM 1870  C CE   . LYS B 1 27 ? -15.638 -1.684  -44.854 1.00 0.00 ? 90  LYS B CE   1 
ATOM 1871  N NZ   . LYS B 1 27 ? -15.835 -2.530  -43.648 1.00 0.00 ? 90  LYS B NZ   1 
ATOM 1872  H H    . LYS B 1 27 ? -12.834 2.256   -46.833 1.00 0.00 ? 90  LYS B H    1 
ATOM 1873  H HA   . LYS B 1 27 ? -15.701 2.906   -47.215 1.00 0.00 ? 90  LYS B HA   1 
ATOM 1874  H HB2  . LYS B 1 27 ? -14.108 2.139   -44.778 1.00 0.00 ? 90  LYS B HB2  1 
ATOM 1875  H HB3  . LYS B 1 27 ? -15.831 2.445   -44.797 1.00 0.00 ? 90  LYS B HB3  1 
ATOM 1876  H HG2  . LYS B 1 27 ? -16.107 0.559   -46.368 1.00 0.00 ? 90  LYS B HG2  1 
ATOM 1877  H HG3  . LYS B 1 27 ? -14.355 0.261   -46.289 1.00 0.00 ? 90  LYS B HG3  1 
ATOM 1878  H HD2  . LYS B 1 27 ? -14.538 -0.136  -43.861 1.00 0.00 ? 90  LYS B HD2  1 
ATOM 1879  H HD3  . LYS B 1 27 ? -16.293 0.142   -43.949 1.00 0.00 ? 90  LYS B HD3  1 
ATOM 1880  H HE2  . LYS B 1 27 ? -16.518 -1.765  -45.491 1.00 0.00 ? 90  LYS B HE2  1 
ATOM 1881  H HE3  . LYS B 1 27 ? -14.767 -2.042  -45.403 1.00 0.00 ? 90  LYS B HE3  1 
ATOM 1882  H HZ1  . LYS B 1 27 ? -16.611 -3.202  -43.811 1.00 0.00 ? 90  LYS B HZ1  1 
ATOM 1883  H HZ2  . LYS B 1 27 ? -16.069 -1.917  -42.840 1.00 0.00 ? 90  LYS B HZ2  1 
ATOM 1884  H HZ3  . LYS B 1 27 ? -14.985 -3.038  -43.451 1.00 0.00 ? 90  LYS B HZ3  1 
ATOM 1885  N N    . VAL B 1 28 ? -14.982 5.395   -47.051 1.00 0.00 ? 91  VAL B N    1 
ATOM 1886  C CA   . VAL B 1 28 ? -15.072 6.812   -46.723 1.00 0.00 ? 91  VAL B CA   1 
ATOM 1887  C C    . VAL B 1 28 ? -16.233 7.084   -45.774 1.00 0.00 ? 91  VAL B C    1 
ATOM 1888  O O    . VAL B 1 28 ? -17.392 7.116   -46.190 1.00 0.00 ? 91  VAL B O    1 
ATOM 1889  C CB   . VAL B 1 28 ? -15.255 7.647   -48.004 1.00 0.00 ? 91  VAL B CB   1 
ATOM 1890  C CG1  . VAL B 1 28 ? -15.390 9.123   -47.663 1.00 0.00 ? 91  VAL B CG1  1 
ATOM 1891  C CG2  . VAL B 1 28 ? -14.081 7.416   -48.944 1.00 0.00 ? 91  VAL B CG2  1 
ATOM 1892  H H    . VAL B 1 28 ? -15.184 5.093   -48.003 1.00 0.00 ? 91  VAL B H    1 
ATOM 1893  H HA   . VAL B 1 28 ? -14.156 7.109   -46.260 1.00 0.00 ? 91  VAL B HA   1 
ATOM 1894  H HB   . VAL B 1 28 ? -16.174 7.324   -48.496 1.00 0.00 ? 91  VAL B HB   1 
ATOM 1895  H HG11 . VAL B 1 28 ? -16.332 9.299   -47.145 1.00 0.00 ? 91  VAL B HG11 1 
ATOM 1896  H HG12 . VAL B 1 28 ? -15.372 9.719   -48.575 1.00 0.00 ? 91  VAL B HG12 1 
ATOM 1897  H HG13 . VAL B 1 28 ? -14.565 9.418   -47.020 1.00 0.00 ? 91  VAL B HG13 1 
ATOM 1898  H HG21 . VAL B 1 28 ? -14.082 8.180   -49.721 1.00 0.00 ? 91  VAL B HG21 1 
ATOM 1899  H HG22 . VAL B 1 28 ? -14.194 6.448   -49.406 1.00 0.00 ? 91  VAL B HG22 1 
ATOM 1900  H HG23 . VAL B 1 28 ? -13.148 7.460   -48.390 1.00 0.00 ? 91  VAL B HG23 1 
ATOM 1901  N N    . LYS B 1 29 ? -15.916 7.278   -44.497 1.00 0.00 ? 92  LYS B N    1 
ATOM 1902  C CA   . LYS B 1 29 ? -16.931 7.547   -43.488 1.00 0.00 ? 92  LYS B CA   1 
ATOM 1903  C C    . LYS B 1 29 ? -16.717 8.910   -42.840 1.00 0.00 ? 92  LYS B C    1 
ATOM 1904  O O    . LYS B 1 29 ? -15.588 9.393   -42.747 1.00 0.00 ? 92  LYS B O    1 
ATOM 1905  C CB   . LYS B 1 29 ? -16.930 6.451   -42.421 1.00 0.00 ? 92  LYS B CB   1 
ATOM 1906  C CG   . LYS B 1 29 ? -17.367 5.083   -42.926 1.00 0.00 ? 92  LYS B CG   1 
ATOM 1907  C CD   . LYS B 1 29 ? -17.383 4.059   -41.799 1.00 0.00 ? 92  LYS B CD   1 
ATOM 1908  C CE   . LYS B 1 29 ? -17.830 2.693   -42.299 1.00 0.00 ? 92  LYS B CE   1 
ATOM 1909  N NZ   . LYS B 1 29 ? -17.888 1.690   -41.201 1.00 0.00 ? 92  LYS B NZ   1 
ATOM 1910  H H    . LYS B 1 29 ? -14.936 7.241   -44.213 1.00 0.00 ? 92  LYS B H    1 
ATOM 1911  H HA   . LYS B 1 29 ? -17.919 7.548   -43.951 1.00 0.00 ? 92  LYS B HA   1 
ATOM 1912  H HB2  . LYS B 1 29 ? -15.918 6.363   -42.028 1.00 0.00 ? 92  LYS B HB2  1 
ATOM 1913  H HB3  . LYS B 1 29 ? -17.595 6.751   -41.612 1.00 0.00 ? 92  LYS B HB3  1 
ATOM 1914  H HG2  . LYS B 1 29 ? -18.369 5.165   -43.347 1.00 0.00 ? 92  LYS B HG2  1 
ATOM 1915  H HG3  . LYS B 1 29 ? -16.675 4.750   -43.700 1.00 0.00 ? 92  LYS B HG3  1 
ATOM 1916  H HD2  . LYS B 1 29 ? -16.378 3.972   -41.384 1.00 0.00 ? 92  LYS B HD2  1 
ATOM 1917  H HD3  . LYS B 1 29 ? -18.066 4.397   -41.020 1.00 0.00 ? 92  LYS B HD3  1 
ATOM 1918  H HE2  . LYS B 1 29 ? -18.820 2.787   -42.739 1.00 0.00 ? 92  LYS B HE2  1 
ATOM 1919  H HE3  . LYS B 1 29 ? -17.142 2.346   -43.051 1.00 0.00 ? 92  LYS B HE3  1 
ATOM 1920  H HZ1  . LYS B 1 29 ? -17.356 0.839   -41.476 1.00 0.00 ? 92  LYS B HZ1  1 
ATOM 1921  H HZ2  . LYS B 1 29 ? -18.877 1.436   -41.011 1.00 0.00 ? 92  LYS B HZ2  1 
ATOM 1922  H HZ3  . LYS B 1 29 ? -17.478 2.085   -40.367 1.00 0.00 ? 92  LYS B HZ3  1 
ATOM 1923  N N    . VAL B 1 30 ? -17.807 9.525   -42.394 1.00 0.00 ? 93  VAL B N    1 
ATOM 1924  C CA   . VAL B 1 30 ? -17.726 10.740  -41.591 1.00 0.00 ? 93  VAL B CA   1 
ATOM 1925  C C    . VAL B 1 30 ? -18.556 10.616  -40.319 1.00 0.00 ? 93  VAL B C    1 
ATOM 1926  O O    . VAL B 1 30 ? -19.538 9.875   -40.277 1.00 0.00 ? 93  VAL B O    1 
ATOM 1927  C CB   . VAL B 1 30 ? -18.218 11.952  -42.405 1.00 0.00 ? 93  VAL B CB   1 
ATOM 1928  C CG1  . VAL B 1 30 ? -17.340 12.162  -43.630 1.00 0.00 ? 93  VAL B CG1  1 
ATOM 1929  C CG2  . VAL B 1 30 ? -19.669 11.747  -42.813 1.00 0.00 ? 93  VAL B CG2  1 
ATOM 1930  H H    . VAL B 1 30 ? -18.707 9.054   -42.480 1.00 0.00 ? 93  VAL B H    1 
ATOM 1931  H HA   . VAL B 1 30 ? -16.689 10.918  -41.304 1.00 0.00 ? 93  VAL B HA   1 
ATOM 1932  H HB   . VAL B 1 30 ? -18.155 12.840  -41.774 1.00 0.00 ? 93  VAL B HB   1 
ATOM 1933  H HG11 . VAL B 1 30 ? -16.421 12.639  -43.346 1.00 0.00 ? 93  VAL B HG11 1 
ATOM 1934  H HG12 . VAL B 1 30 ? -17.856 12.799  -44.351 1.00 0.00 ? 93  VAL B HG12 1 
ATOM 1935  H HG13 . VAL B 1 30 ? -17.121 11.200  -44.092 1.00 0.00 ? 93  VAL B HG13 1 
ATOM 1936  H HG21 . VAL B 1 30 ? -20.302 11.706  -41.926 1.00 0.00 ? 93  VAL B HG21 1 
ATOM 1937  H HG22 . VAL B 1 30 ? -19.756 10.810  -43.363 1.00 0.00 ? 93  VAL B HG22 1 
ATOM 1938  H HG23 . VAL B 1 30 ? -19.996 12.570  -43.447 1.00 0.00 ? 93  VAL B HG23 1 
ATOM 1939  N N    . LEU B 1 31 ? -18.152 11.345  -39.285 1.00 0.00 ? 94  LEU B N    1 
ATOM 1940  C CA   . LEU B 1 31 ? -18.869 11.332  -38.015 1.00 0.00 ? 94  LEU B CA   1 
ATOM 1941  C C    . LEU B 1 31 ? -19.086 12.746  -37.490 1.00 0.00 ? 94  LEU B C    1 
ATOM 1942  O O    . LEU B 1 31 ? -18.424 13.178  -36.546 1.00 0.00 ? 94  LEU B O    1 
ATOM 1943  C CB   . LEU B 1 31 ? -18.094 10.509  -36.977 1.00 0.00 ? 94  LEU B CB   1 
ATOM 1944  C CG   . LEU B 1 31 ? -17.902 9.025   -37.315 1.00 0.00 ? 94  LEU B CG   1 
ATOM 1945  C CD1  . LEU B 1 31 ? -16.900 8.409   -36.346 1.00 0.00 ? 94  LEU B CD1  1 
ATOM 1946  C CD2  . LEU B 1 31 ? -19.243 8.310   -37.243 1.00 0.00 ? 94  LEU B CD2  1 
ATOM 1947  H H    . LEU B 1 31 ? -17.332 11.944  -39.384 1.00 0.00 ? 94  LEU B H    1 
ATOM 1948  H HA   . LEU B 1 31 ? -19.851 10.878  -38.152 1.00 0.00 ? 94  LEU B HA   1 
ATOM 1949  H HB2  . LEU B 1 31 ? -17.127 10.942  -36.824 1.00 0.00 ? 94  LEU B HB2  1 
ATOM 1950  H HB3  . LEU B 1 31 ? -18.637 10.568  -36.035 1.00 0.00 ? 94  LEU B HB3  1 
ATOM 1951  H HG   . LEU B 1 31 ? -17.507 8.951   -38.331 1.00 0.00 ? 94  LEU B HG   1 
ATOM 1952  H HD11 . LEU B 1 31 ? -17.268 8.522   -35.327 1.00 0.00 ? 94  LEU B HD11 1 
ATOM 1953  H HD12 . LEU B 1 31 ? -15.937 8.910   -36.443 1.00 0.00 ? 94  LEU B HD12 1 
ATOM 1954  H HD13 . LEU B 1 31 ? -16.782 7.350   -36.577 1.00 0.00 ? 94  LEU B HD13 1 
ATOM 1955  H HD21 . LEU B 1 31 ? -19.775 8.597   -36.335 1.00 0.00 ? 94  LEU B HD21 1 
ATOM 1956  H HD22 . LEU B 1 31 ? -19.066 7.233   -37.228 1.00 0.00 ? 94  LEU B HD22 1 
ATOM 1957  H HD23 . LEU B 1 31 ? -19.848 8.559   -38.114 1.00 0.00 ? 94  LEU B HD23 1 
ATOM 1958  N N    . GLY B 1 32 ? -20.018 13.462  -38.107 1.00 0.00 ? 95  GLY B N    1 
ATOM 1959  C CA   . GLY B 1 32 ? -20.327 14.830  -37.703 1.00 0.00 ? 95  GLY B CA   1 
ATOM 1960  C C    . GLY B 1 32 ? -19.325 15.818  -38.289 1.00 0.00 ? 95  GLY B C    1 
ATOM 1961  O O    . GLY B 1 32 ? -19.374 16.136  -39.477 1.00 0.00 ? 95  GLY B O    1 
ATOM 1962  H H    . GLY B 1 32 ? -20.537 13.045  -38.880 1.00 0.00 ? 95  GLY B H    1 
ATOM 1963  H HA2  . GLY B 1 32 ? -21.327 15.087  -38.052 1.00 0.00 ? 95  GLY B HA2  1 
ATOM 1964  H HA3  . GLY B 1 32 ? -20.301 14.898  -36.615 1.00 0.00 ? 95  GLY B HA3  1 
ATOM 1965  N N    . ASP B 1 33 ? -18.416 16.299  -37.448 1.00 0.00 ? 96  ASP B N    1 
ATOM 1966  C CA   . ASP B 1 33 ? -17.288 17.097  -37.915 1.00 0.00 ? 96  ASP B CA   1 
ATOM 1967  C C    . ASP B 1 33 ? -16.037 16.241  -38.069 1.00 0.00 ? 96  ASP B C    1 
ATOM 1968  O O    . ASP B 1 33 ? -14.918 16.730  -37.915 1.00 0.00 ? 96  ASP B O    1 
ATOM 1969  C CB   . ASP B 1 33 ? -17.009 18.250  -36.947 1.00 0.00 ? 96  ASP B CB   1 
ATOM 1970  C CG   . ASP B 1 33 ? -16.641 17.773  -35.549 1.00 0.00 ? 96  ASP B CG   1 
ATOM 1971  O OD1  . ASP B 1 33 ? -16.780 16.602  -35.285 1.00 0.00 ? 96  ASP B OD1  1 
ATOM 1972  O OD2  . ASP B 1 33 ? -16.225 18.584  -34.757 1.00 0.00 ? 96  ASP B OD2  1 
ATOM 1973  H H    . ASP B 1 33 ? -18.415 15.971  -36.482 1.00 0.00 ? 96  ASP B H    1 
ATOM 1974  H HA   . ASP B 1 33 ? -17.544 17.527  -38.880 1.00 0.00 ? 96  ASP B HA   1 
ATOM 1975  H HB2  . ASP B 1 33 ? -16.185 18.845  -37.340 1.00 0.00 ? 96  ASP B HB2  1 
ATOM 1976  H HB3  . ASP B 1 33 ? -17.897 18.879  -36.880 1.00 0.00 ? 96  ASP B HB3  1 
ATOM 1977  N N    . VAL B 1 34 ? -16.234 14.965  -38.378 1.00 0.00 ? 97  VAL B N    1 
ATOM 1978  C CA   . VAL B 1 34 ? -15.124 14.026  -38.495 1.00 0.00 ? 97  VAL B CA   1 
ATOM 1979  C C    . VAL B 1 34 ? -15.122 13.343  -39.857 1.00 0.00 ? 97  VAL B C    1 
ATOM 1980  O O    . VAL B 1 34 ? -16.176 12.983  -40.383 1.00 0.00 ? 97  VAL B O    1 
ATOM 1981  C CB   . VAL B 1 34 ? -15.212 12.956  -37.390 1.00 0.00 ? 97  VAL B CB   1 
ATOM 1982  C CG1  . VAL B 1 34 ? -14.075 11.953  -37.529 1.00 0.00 ? 97  VAL B CG1  1 
ATOM 1983  C CG2  . VAL B 1 34 ? -15.178 13.622  -36.023 1.00 0.00 ? 97  VAL B CG2  1 
ATOM 1984  H H    . VAL B 1 34 ? -17.187 14.618  -38.485 1.00 0.00 ? 97  VAL B H    1 
ATOM 1985  H HA   . VAL B 1 34 ? -14.192 14.537  -38.376 1.00 0.00 ? 97  VAL B HA   1 
ATOM 1986  H HB   . VAL B 1 34 ? -16.150 12.457  -37.523 1.00 0.00 ? 97  VAL B HB   1 
ATOM 1987  H HG11 . VAL B 1 34 ? -13.143 12.486  -37.705 1.00 0.00 ? 97  VAL B HG11 1 
ATOM 1988  H HG12 . VAL B 1 34 ? -14.278 11.287  -38.368 1.00 0.00 ? 97  VAL B HG12 1 
ATOM 1989  H HG13 . VAL B 1 34 ? -13.997 11.370  -36.612 1.00 0.00 ? 97  VAL B HG13 1 
ATOM 1990  H HG21 . VAL B 1 34 ? -15.666 14.596  -36.053 1.00 0.00 ? 97  VAL B HG21 1 
ATOM 1991  H HG22 . VAL B 1 34 ? -15.699 12.984  -35.306 1.00 0.00 ? 97  VAL B HG22 1 
ATOM 1992  H HG23 . VAL B 1 34 ? -14.145 13.745  -35.696 1.00 0.00 ? 97  VAL B HG23 1 
ATOM 1993  N N    . ILE B 1 35 ? -13.933 13.169  -40.424 1.00 0.00 ? 98  ILE B N    1 
ATOM 1994  C CA   . ILE B 1 35 ? -13.783 12.452  -41.684 1.00 0.00 ? 98  ILE B CA   1 
ATOM 1995  C C    . ILE B 1 35 ? -12.912 11.213  -41.511 1.00 0.00 ? 98  ILE B C    1 
ATOM 1996  O O    . ILE B 1 35 ? -11.689 11.283  -41.616 1.00 0.00 ? 98  ILE B O    1 
ATOM 1997  C CB   . ILE B 1 35 ? -13.173 13.361  -42.765 1.00 0.00 ? 98  ILE B CB   1 
ATOM 1998  C CG1  . ILE B 1 35 ? -14.012 14.631  -42.930 1.00 0.00 ? 98  ILE B CG1  1 
ATOM 1999  C CG2  . ILE B 1 35 ? -13.064 12.617  -44.087 1.00 0.00 ? 98  ILE B CG2  1 
ATOM 2000  C CD1  . ILE B 1 35 ? -13.347 15.697  -43.770 1.00 0.00 ? 98  ILE B CD1  1 
ATOM 2001  H H    . ILE B 1 35 ? -13.099 13.478  -39.928 1.00 0.00 ? 98  ILE B H    1 
ATOM 2002  H HA   . ILE B 1 35 ? -14.750 12.116  -42.032 1.00 0.00 ? 98  ILE B HA   1 
ATOM 2003  H HB   . ILE B 1 35 ? -12.169 13.647  -42.445 1.00 0.00 ? 98  ILE B HB   1 
ATOM 2004  H HG12 . ILE B 1 35 ? -14.960 14.376  -43.386 1.00 0.00 ? 98  ILE B HG12 1 
ATOM 2005  H HG13 . ILE B 1 35 ? -14.201 15.041  -41.942 1.00 0.00 ? 98  ILE B HG13 1 
ATOM 2006  H HG21 . ILE B 1 35 ? -14.010 12.687  -44.623 1.00 0.00 ? 98  ILE B HG21 1 
ATOM 2007  H HG22 . ILE B 1 35 ? -12.838 11.571  -43.927 1.00 0.00 ? 98  ILE B HG22 1 
ATOM 2008  H HG23 . ILE B 1 35 ? -12.282 13.052  -44.701 1.00 0.00 ? 98  ILE B HG23 1 
ATOM 2009  H HD11 . ILE B 1 35 ? -12.546 16.166  -43.200 1.00 0.00 ? 98  ILE B HD11 1 
ATOM 2010  H HD12 . ILE B 1 35 ? -14.084 16.450  -44.048 1.00 0.00 ? 98  ILE B HD12 1 
ATOM 2011  H HD13 . ILE B 1 35 ? -12.934 15.244  -44.671 1.00 0.00 ? 98  ILE B HD13 1 
ATOM 2012  N N    . GLU B 1 36 ? -13.553 10.079  -41.248 1.00 0.00 ? 99  GLU B N    1 
ATOM 2013  C CA   . GLU B 1 36 ? -12.839 8.820   -41.068 1.00 0.00 ? 99  GLU B CA   1 
ATOM 2014  C C    . GLU B 1 36 ? -12.841 7.998   -42.351 1.00 0.00 ? 99  GLU B C    1 
ATOM 2015  O O    . GLU B 1 36 ? -13.720 7.161   -42.560 1.00 0.00 ? 99  GLU B O    1 
ATOM 2016  C CB   . GLU B 1 36 ? -13.461 8.010   -39.929 1.00 0.00 ? 99  GLU B CB   1 
ATOM 2017  C CG   . GLU B 1 36 ? -12.738 6.709   -39.614 1.00 0.00 ? 99  GLU B CG   1 
ATOM 2018  C CD   . GLU B 1 36 ? -13.441 5.886   -38.570 1.00 0.00 ? 99  GLU B CD   1 
ATOM 2019  O OE1  . GLU B 1 36 ? -14.470 6.311   -38.099 1.00 0.00 ? 99  GLU B OE1  1 
ATOM 2020  O OE2  . GLU B 1 36 ? -12.951 4.832   -38.243 1.00 0.00 ? 99  GLU B OE2  1 
ATOM 2021  H H    . GLU B 1 36 ? -14.570 10.087  -41.183 1.00 0.00 ? 99  GLU B H    1 
ATOM 2022  H HA   . GLU B 1 36 ? -11.812 9.004   -40.820 1.00 0.00 ? 99  GLU B HA   1 
ATOM 2023  H HB2  . GLU B 1 36 ? -13.502 8.614   -39.038 1.00 0.00 ? 99  GLU B HB2  1 
ATOM 2024  H HB3  . GLU B 1 36 ? -14.480 7.755   -40.220 1.00 0.00 ? 99  GLU B HB3  1 
ATOM 2025  H HG2  . GLU B 1 36 ? -12.665 6.117   -40.526 1.00 0.00 ? 99  GLU B HG2  1 
ATOM 2026  H HG3  . GLU B 1 36 ? -11.738 6.946   -39.266 1.00 0.00 ? 99  GLU B HG3  1 
ATOM 2027  N N    . VAL B 1 37 ? -11.854 8.239   -43.205 1.00 0.00 ? 100 VAL B N    1 
ATOM 2028  C CA   . VAL B 1 37 ? -11.694 7.466   -44.431 1.00 0.00 ? 100 VAL B CA   1 
ATOM 2029  C C    . VAL B 1 37 ? -11.064 6.108   -44.147 1.00 0.00 ? 100 VAL B C    1 
ATOM 2030  O O    . VAL B 1 37 ? -9.895  5.880   -44.461 1.00 0.00 ? 100 VAL B O    1 
ATOM 2031  C CB   . VAL B 1 37 ? -10.820 8.236   -45.438 1.00 0.00 ? 100 VAL B CB   1 
ATOM 2032  C CG1  . VAL B 1 37 ? -10.658 7.437   -46.722 1.00 0.00 ? 100 VAL B CG1  1 
ATOM 2033  C CG2  . VAL B 1 37 ? -11.435 9.597   -45.724 1.00 0.00 ? 100 VAL B CG2  1 
ATOM 2034  H H    . VAL B 1 37 ? -11.148 8.933   -42.958 1.00 0.00 ? 100 VAL B H    1 
ATOM 2035  H HA   . VAL B 1 37 ? -12.663 7.311   -44.857 1.00 0.00 ? 100 VAL B HA   1 
ATOM 2036  H HB   . VAL B 1 37 ? -9.842  8.395   -45.029 1.00 0.00 ? 100 VAL B HB   1 
ATOM 2037  H HG11 . VAL B 1 37 ? -10.510 8.091   -47.571 1.00 0.00 ? 100 VAL B HG11 1 
ATOM 2038  H HG12 . VAL B 1 37 ? -11.549 6.833   -46.888 1.00 0.00 ? 100 VAL B HG12 1 
ATOM 2039  H HG13 . VAL B 1 37 ? -9.797  6.771   -46.637 1.00 0.00 ? 100 VAL B HG13 1 
ATOM 2040  H HG21 . VAL B 1 37 ? -11.235 10.254  -44.881 1.00 0.00 ? 100 VAL B HG21 1 
ATOM 2041  H HG22 . VAL B 1 37 ? -12.512 9.491   -45.850 1.00 0.00 ? 100 VAL B HG22 1 
ATOM 2042  H HG23 . VAL B 1 37 ? -11.009 10.038  -46.619 1.00 0.00 ? 100 VAL B HG23 1 
ATOM 2043  N N    . HIS B 1 38 ? -11.843 5.212   -43.553 1.00 0.00 ? 101 HIS B N    1 
ATOM 2044  C CA   . HIS B 1 38 ? -11.397 3.844   -43.318 1.00 0.00 ? 101 HIS B CA   1 
ATOM 2045  C C    . HIS B 1 38 ? -11.070 3.139   -44.628 1.00 0.00 ? 101 HIS B C    1 
ATOM 2046  O O    . HIS B 1 38 ? -11.835 2.301   -45.101 1.00 0.00 ? 101 HIS B O    1 
ATOM 2047  C CB   . HIS B 1 38 ? -12.462 3.050   -42.556 1.00 0.00 ? 101 HIS B CB   1 
ATOM 2048  C CG   . HIS B 1 38 ? -12.116 1.606   -42.365 1.00 0.00 ? 101 HIS B CG   1 
ATOM 2049  N ND1  . HIS B 1 38 ? -11.985 0.727   -43.420 1.00 0.00 ? 101 HIS B ND1  1 
ATOM 2050  C CD2  . HIS B 1 38 ? -11.871 0.888   -41.243 1.00 0.00 ? 101 HIS B CD2  1 
ATOM 2051  C CE1  . HIS B 1 38 ? -11.674 -0.471  -42.953 1.00 0.00 ? 101 HIS B CE1  1 
ATOM 2052  N NE2  . HIS B 1 38 ? -11.600 -0.399  -41.638 1.00 0.00 ? 101 HIS B NE2  1 
ATOM 2053  H H    . HIS B 1 38 ? -12.808 5.463   -43.333 1.00 0.00 ? 101 HIS B H    1 
ATOM 2054  H HA   . HIS B 1 38 ? -10.495 3.894   -42.715 1.00 0.00 ? 101 HIS B HA   1 
ATOM 2055  H HB2  . HIS B 1 38 ? -12.560 3.495   -41.565 1.00 0.00 ? 101 HIS B HB2  1 
ATOM 2056  H HB3  . HIS B 1 38 ? -13.411 3.143   -43.057 1.00 0.00 ? 101 HIS B HB3  1 
ATOM 2057  H HD2  . HIS B 1 38 ? -12.099 1.207   -40.237 1.00 0.00 ? 101 HIS B HD2  1 
ATOM 2058  H HE1  . HIS B 1 38 ? -11.508 -1.356  -43.549 1.00 0.00 ? 101 HIS B HE1  1 
ATOM 2059  H HE2  . HIS B 1 38 ? -11.380 -1.167  -41.020 1.00 0.00 ? 101 HIS B HE2  1 
ATOM 2060  N N    . GLY B 1 39 ? -9.924  3.483   -45.210 1.00 0.00 ? 102 GLY B N    1 
ATOM 2061  C CA   . GLY B 1 39 ? -9.413  2.772   -46.373 1.00 0.00 ? 102 GLY B CA   1 
ATOM 2062  C C    . GLY B 1 39 ? -9.022  1.343   -46.018 1.00 0.00 ? 102 GLY B C    1 
ATOM 2063  O O    . GLY B 1 39 ? -8.980  0.974   -44.845 1.00 0.00 ? 102 GLY B O    1 
ATOM 2064  H H    . GLY B 1 39 ? -9.317  4.164   -44.752 1.00 0.00 ? 102 GLY B H    1 
ATOM 2065  H HA2  . GLY B 1 39 ? -10.211 2.714   -47.070 1.00 0.00 ? 102 GLY B HA2  1 
ATOM 2066  H HA3  . GLY B 1 39 ? -8.589  3.316   -46.820 1.00 0.00 ? 102 GLY B HA3  1 
ATOM 2067  N N    . LYS B 1 40 ? -8.732  0.543   -47.040 1.00 0.00 ? 103 LYS B N    1 
ATOM 2068  C CA   . LYS B 1 40 ? -8.231  -0.811  -46.834 1.00 0.00 ? 103 LYS B CA   1 
ATOM 2069  C C    . LYS B 1 40 ? -7.726  -1.415  -48.139 1.00 0.00 ? 103 LYS B C    1 
ATOM 2070  O O    . LYS B 1 40 ? -8.457  -1.480  -49.127 1.00 0.00 ? 103 LYS B O    1 
ATOM 2071  C CB   . LYS B 1 40 ? -9.319  -1.700  -46.229 1.00 0.00 ? 103 LYS B CB   1 
ATOM 2072  C CG   . LYS B 1 40 ? -8.883  -3.135  -45.966 1.00 0.00 ? 103 LYS B CG   1 
ATOM 2073  C CD   . LYS B 1 40 ? -9.941  -3.898  -45.180 1.00 0.00 ? 103 LYS B CD   1 
ATOM 2074  C CE   . LYS B 1 40 ? -11.186 -4.142  -46.020 1.00 0.00 ? 103 LYS B CE   1 
ATOM 2075  N NZ   . LYS B 1 40 ? -12.084 -5.155  -45.402 1.00 0.00 ? 103 LYS B NZ   1 
ATOM 2076  H H    . LYS B 1 40 ? -8.784  0.916   -47.987 1.00 0.00 ? 103 LYS B H    1 
ATOM 2077  H HA   . LYS B 1 40 ? -7.412  -0.764  -46.169 1.00 0.00 ? 103 LYS B HA   1 
ATOM 2078  H HB2  . LYS B 1 40 ? -9.594  -1.271  -45.267 1.00 0.00 ? 103 LYS B HB2  1 
ATOM 2079  H HB3  . LYS B 1 40 ? -10.186 -1.686  -46.864 1.00 0.00 ? 103 LYS B HB3  1 
ATOM 2080  H HG2  . LYS B 1 40 ? -8.735  -3.593  -46.931 1.00 0.00 ? 103 LYS B HG2  1 
ATOM 2081  H HG3  . LYS B 1 40 ? -7.945  -3.135  -45.424 1.00 0.00 ? 103 LYS B HG3  1 
ATOM 2082  H HD2  . LYS B 1 40 ? -9.528  -4.858  -44.874 1.00 0.00 ? 103 LYS B HD2  1 
ATOM 2083  H HD3  . LYS B 1 40 ? -10.214 -3.327  -44.294 1.00 0.00 ? 103 LYS B HD3  1 
ATOM 2084  H HE2  . LYS B 1 40 ? -11.742 -3.213  -46.116 1.00 0.00 ? 103 LYS B HE2  1 
ATOM 2085  H HE3  . LYS B 1 40 ? -10.891 -4.489  -47.010 1.00 0.00 ? 103 LYS B HE3  1 
ATOM 2086  H HZ1  . LYS B 1 40 ? -11.504 -5.886  -44.941 1.00 0.00 ? 103 LYS B HZ1  1 
ATOM 2087  H HZ2  . LYS B 1 40 ? -12.680 -5.595  -46.134 1.00 0.00 ? 103 LYS B HZ2  1 
ATOM 2088  H HZ3  . LYS B 1 40 ? -12.671 -4.707  -44.713 1.00 0.00 ? 103 LYS B HZ3  1 
ATOM 2089  N N    . HIS B 1 41 ? -6.474  -1.855  -48.135 1.00 0.00 ? 104 HIS B N    1 
ATOM 2090  C CA   . HIS B 1 41 ? -5.978  -2.765  -49.161 1.00 0.00 ? 104 HIS B CA   1 
ATOM 2091  C C    . HIS B 1 41 ? -5.697  -4.147  -48.585 1.00 0.00 ? 104 HIS B C    1 
ATOM 2092  O O    . HIS B 1 41 ? -4.738  -4.335  -47.836 1.00 0.00 ? 104 HIS B O    1 
ATOM 2093  C CB   . HIS B 1 41 ? -4.706  -2.208  -49.809 1.00 0.00 ? 104 HIS B CB   1 
ATOM 2094  C CG   . HIS B 1 41 ? -4.189  -3.048  -50.936 1.00 0.00 ? 104 HIS B CG   1 
ATOM 2095  N ND1  . HIS B 1 41 ? -2.893  -2.954  -51.399 1.00 0.00 ? 104 HIS B ND1  1 
ATOM 2096  C CD2  . HIS B 1 41 ? -4.793  -3.994  -51.693 1.00 0.00 ? 104 HIS B CD2  1 
ATOM 2097  C CE1  . HIS B 1 41 ? -2.723  -3.810  -52.393 1.00 0.00 ? 104 HIS B CE1  1 
ATOM 2098  N NE2  . HIS B 1 41 ? -3.860  -4.451  -52.591 1.00 0.00 ? 104 HIS B NE2  1 
ATOM 2099  H H    . HIS B 1 41 ? -5.958  -1.808  -47.257 1.00 0.00 ? 104 HIS B H    1 
ATOM 2100  H HA   . HIS B 1 41 ? -6.732  -2.882  -49.939 1.00 0.00 ? 104 HIS B HA   1 
ATOM 2101  H HB2  . HIS B 1 41 ? -4.876  -1.222  -50.143 1.00 0.00 ? 104 HIS B HB2  1 
ATOM 2102  H HB3  . HIS B 1 41 ? -3.938  -2.183  -49.037 1.00 0.00 ? 104 HIS B HB3  1 
ATOM 2103  H HD1  . HIS B 1 41 ? -2.183  -2.317  -51.046 1.00 0.00 ? 104 HIS B HD1  1 
ATOM 2104  H HD2  . HIS B 1 41 ? -5.737  -4.469  -51.468 1.00 0.00 ? 104 HIS B HD2  1 
ATOM 2105  H HE1  . HIS B 1 41 ? -1.817  -3.939  -52.967 1.00 0.00 ? 104 HIS B HE1  1 
ATOM 2106  N N    . GLU B 1 42 ? -6.541  -5.112  -48.937 1.00 0.00 ? 105 GLU B N    1 
ATOM 2107  C CA   . GLU B 1 42 ? -6.321  -6.500  -48.548 1.00 0.00 ? 105 GLU B CA   1 
ATOM 2108  C C    . GLU B 1 42 ? -5.570  -7.264  -49.629 1.00 0.00 ? 105 GLU B C    1 
ATOM 2109  O O    . GLU B 1 42 ? -5.437  -6.792  -50.758 1.00 0.00 ? 105 GLU B O    1 
ATOM 2110  C CB   . GLU B 1 42 ? -7.658  -7.188  -48.258 1.00 0.00 ? 105 GLU B CB   1 
ATOM 2111  C CG   . GLU B 1 42 ? -8.400  -6.637  -47.049 1.00 0.00 ? 105 GLU B CG   1 
ATOM 2112  C CD   . GLU B 1 42 ? -9.599  -7.462  -46.672 1.00 0.00 ? 105 GLU B CD   1 
ATOM 2113  O OE1  . GLU B 1 42 ? -10.032 -8.251  -47.477 1.00 0.00 ? 105 GLU B OE1  1 
ATOM 2114  O OE2  . GLU B 1 42 ? -10.086 -7.302  -45.577 1.00 0.00 ? 105 GLU B OE2  1 
ATOM 2115  H H    . GLU B 1 42 ? -7.306  -4.895  -49.576 1.00 0.00 ? 105 GLU B H    1 
ATOM 2116  H HA   . GLU B 1 42 ? -5.730  -6.522  -47.634 1.00 0.00 ? 105 GLU B HA   1 
ATOM 2117  H HB2  . GLU B 1 42 ? -8.296  -7.079  -49.134 1.00 0.00 ? 105 GLU B HB2  1 
ATOM 2118  H HB3  . GLU B 1 42 ? -7.472  -8.249  -48.087 1.00 0.00 ? 105 GLU B HB3  1 
ATOM 2119  H HG2  . GLU B 1 42 ? -7.716  -6.589  -46.203 1.00 0.00 ? 105 GLU B HG2  1 
ATOM 2120  H HG3  . GLU B 1 42 ? -8.734  -5.649  -47.295 1.00 0.00 ? 105 GLU B HG3  1 
ATOM 2121  N N    . GLU B 1 43 ? -5.078  -8.448  -49.276 1.00 0.00 ? 106 GLU B N    1 
ATOM 2122  C CA   . GLU B 1 43 ? -4.332  -9.276  -50.216 1.00 0.00 ? 106 GLU B CA   1 
ATOM 2123  C C    . GLU B 1 43 ? -3.240  -8.474  -50.911 1.00 0.00 ? 106 GLU B C    1 
ATOM 2124  O O    . GLU B 1 43 ? -3.234  -8.343  -52.136 1.00 0.00 ? 106 GLU B O    1 
ATOM 2125  C CB   . GLU B 1 43 ? -5.272  -9.883  -51.258 1.00 0.00 ? 106 GLU B CB   1 
ATOM 2126  C CG   . GLU B 1 43 ? -6.361  -10.777 -50.676 1.00 0.00 ? 106 GLU B CG   1 
ATOM 2127  C CD   . GLU B 1 43 ? -7.212  -11.423 -51.733 1.00 0.00 ? 106 GLU B CD   1 
ATOM 2128  O OE1  . GLU B 1 43 ? -7.078  -11.064 -52.879 1.00 0.00 ? 106 GLU B OE1  1 
ATOM 2129  O OE2  . GLU B 1 43 ? -8.001  -12.274 -51.395 1.00 0.00 ? 106 GLU B OE2  1 
ATOM 2130  H H    . GLU B 1 43 ? -5.223  -8.781  -48.325 1.00 0.00 ? 106 GLU B H    1 
ATOM 2131  H HA   . GLU B 1 43 ? -3.869  -10.094 -49.665 1.00 0.00 ? 106 GLU B HA   1 
ATOM 2132  H HB2  . GLU B 1 43 ? -5.754  -9.067  -51.798 1.00 0.00 ? 106 GLU B HB2  1 
ATOM 2133  H HB3  . GLU B 1 43 ? -4.687  -10.474 -51.961 1.00 0.00 ? 106 GLU B HB3  1 
ATOM 2134  H HG2  . GLU B 1 43 ? -5.883  -11.558 -50.085 1.00 0.00 ? 106 GLU B HG2  1 
ATOM 2135  H HG3  . GLU B 1 43 ? -6.997  -10.174 -50.029 1.00 0.00 ? 106 GLU B HG3  1 
ATOM 2136  N N    . ARG B 1 44 ? -2.313  -7.936  -50.123 1.00 0.00 ? 107 ARG B N    1 
ATOM 2137  C CA   . ARG B 1 44 ? -1.301  -7.023  -50.643 1.00 0.00 ? 107 ARG B CA   1 
ATOM 2138  C C    . ARG B 1 44 ? 0.076   -7.671  -50.640 1.00 0.00 ? 107 ARG B C    1 
ATOM 2139  O O    . ARG B 1 44 ? 0.813   -7.584  -49.657 1.00 0.00 ? 107 ARG B O    1 
ATOM 2140  C CB   . ARG B 1 44 ? -1.260  -5.746  -49.817 1.00 0.00 ? 107 ARG B CB   1 
ATOM 2141  C CG   . ARG B 1 44 ? -0.196  -4.747  -50.240 1.00 0.00 ? 107 ARG B CG   1 
ATOM 2142  C CD   . ARG B 1 44 ? -0.264  -3.499  -49.437 1.00 0.00 ? 107 ARG B CD   1 
ATOM 2143  N NE   . ARG B 1 44 ? 0.857   -2.615  -49.712 1.00 0.00 ? 107 ARG B NE   1 
ATOM 2144  C CZ   . ARG B 1 44 ? 0.851   -1.635  -50.638 1.00 0.00 ? 107 ARG B CZ   1 
ATOM 2145  N NH1  . ARG B 1 44 ? -0.222  -1.429  -51.368 1.00 0.00 ? 107 ARG B NH1  1 
ATOM 2146  N NH2  . ARG B 1 44 ? 1.924   -0.883  -50.811 1.00 0.00 ? 107 ARG B NH2  1 
ATOM 2147  H H    . ARG B 1 44 ? -2.383  -8.070  -49.114 1.00 0.00 ? 107 ARG B H    1 
ATOM 2148  H HA   . ARG B 1 44 ? -1.543  -6.750  -51.671 1.00 0.00 ? 107 ARG B HA   1 
ATOM 2149  H HB2  . ARG B 1 44 ? -2.228  -5.256  -49.921 1.00 0.00 ? 107 ARG B HB2  1 
ATOM 2150  H HB3  . ARG B 1 44 ? -1.128  -6.018  -48.792 1.00 0.00 ? 107 ARG B HB3  1 
ATOM 2151  H HG2  . ARG B 1 44 ? 0.783   -5.197  -50.080 1.00 0.00 ? 107 ARG B HG2  1 
ATOM 2152  H HG3  . ARG B 1 44 ? -0.314  -4.514  -51.296 1.00 0.00 ? 107 ARG B HG3  1 
ATOM 2153  H HD2  . ARG B 1 44 ? -1.181  -2.980  -49.694 1.00 0.00 ? 107 ARG B HD2  1 
ATOM 2154  H HD3  . ARG B 1 44 ? -0.289  -3.739  -48.389 1.00 0.00 ? 107 ARG B HD3  1 
ATOM 2155  H HE   . ARG B 1 44 ? 1.679   -2.747  -49.195 1.00 0.00 ? 107 ARG B HE   1 
ATOM 2156  H HH11 . ARG B 1 44 ? -1.031  -1.997  -51.240 1.00 0.00 ? 107 ARG B HH11 1 
ATOM 2157  H HH12 . ARG B 1 44 ? -0.227  -0.694  -52.061 1.00 0.00 ? 107 ARG B HH12 1 
ATOM 2158  H HH21 . ARG B 1 44 ? 2.743   -1.039  -50.258 1.00 0.00 ? 107 ARG B HH21 1 
ATOM 2159  H HH22 . ARG B 1 44 ? 1.917   -0.157  -51.500 1.00 0.00 ? 107 ARG B HH22 1 
ATOM 2160  N N    . GLN B 1 45 ? 0.421   -8.320  -51.748 1.00 0.00 ? 108 GLN B N    1 
ATOM 2161  C CA   . GLN B 1 45 ? 1.745   -8.911  -51.909 1.00 0.00 ? 108 GLN B CA   1 
ATOM 2162  C C    . GLN B 1 45 ? 2.836   -7.849  -51.822 1.00 0.00 ? 108 GLN B C    1 
ATOM 2163  O O    . GLN B 1 45 ? 2.703   -6.762  -52.386 1.00 0.00 ? 108 GLN B O    1 
ATOM 2164  C CB   . GLN B 1 45 ? 1.841   -9.650  -53.245 1.00 0.00 ? 108 GLN B CB   1 
ATOM 2165  C CG   . GLN B 1 45 ? 0.952   -10.877 -53.344 1.00 0.00 ? 108 GLN B CG   1 
ATOM 2166  C CD   . GLN B 1 45 ? 1.149   -11.633 -54.643 1.00 0.00 ? 108 GLN B CD   1 
ATOM 2167  O OE1  . GLN B 1 45 ? 1.124   -11.047 -55.727 1.00 0.00 ? 108 GLN B OE1  1 
ATOM 2168  N NE2  . GLN B 1 45 ? 1.346   -12.943 -54.541 1.00 0.00 ? 108 GLN B NE2  1 
ATOM 2169  H H    . GLN B 1 45 ? -0.228  -8.339  -52.532 1.00 0.00 ? 108 GLN B H    1 
ATOM 2170  H HA   . GLN B 1 45 ? 1.901   -9.630  -51.123 1.00 0.00 ? 108 GLN B HA   1 
ATOM 2171  H HB2  . GLN B 1 45 ? 1.563   -8.961  -54.039 1.00 0.00 ? 108 GLN B HB2  1 
ATOM 2172  H HB3  . GLN B 1 45 ? 2.876   -9.965  -53.396 1.00 0.00 ? 108 GLN B HB3  1 
ATOM 2173  H HG2  . GLN B 1 45 ? 1.173   -11.537 -52.506 1.00 0.00 ? 108 GLN B HG2  1 
ATOM 2174  H HG3  . GLN B 1 45 ? -0.088  -10.556 -53.279 1.00 0.00 ? 108 GLN B HG3  1 
ATOM 2175  H HE21 . GLN B 1 45 ? 1.354   -13.398 -53.628 1.00 0.00 ? 108 GLN B HE21 1 
ATOM 2176  H HE22 . GLN B 1 45 ? 1.491   -13.493 -55.387 1.00 0.00 ? 108 GLN B HE22 1 
ATOM 2177  N N    . ASP B 1 46 ? 3.911   -8.171  -51.113 1.00 0.00 ? 109 ASP B N    1 
ATOM 2178  C CA   . ASP B 1 46 ? 5.051   -7.269  -51.000 1.00 0.00 ? 109 ASP B CA   1 
ATOM 2179  C C    . ASP B 1 46 ? 6.335   -8.038  -50.710 1.00 0.00 ? 109 ASP B C    1 
ATOM 2180  O O    . ASP B 1 46 ? 6.504   -9.174  -51.152 1.00 0.00 ? 109 ASP B O    1 
ATOM 2181  C CB   . ASP B 1 46 ? 4.810   -6.234  -49.898 1.00 0.00 ? 109 ASP B CB   1 
ATOM 2182  C CG   . ASP B 1 46 ? 4.724   -6.855  -48.511 1.00 0.00 ? 109 ASP B CG   1 
ATOM 2183  O OD1  . ASP B 1 46 ? 4.864   -8.050  -48.406 1.00 0.00 ? 109 ASP B OD1  1 
ATOM 2184  O OD2  . ASP B 1 46 ? 4.519   -6.128  -47.568 1.00 0.00 ? 109 ASP B OD2  1 
ATOM 2185  H H    . ASP B 1 46 ? 3.961   -9.091  -50.679 1.00 0.00 ? 109 ASP B H    1 
ATOM 2186  H HA   . ASP B 1 46 ? 5.183   -6.744  -51.948 1.00 0.00 ? 109 ASP B HA   1 
ATOM 2187  H HB2  . ASP B 1 46 ? 5.615   -5.502  -49.913 1.00 0.00 ? 109 ASP B HB2  1 
ATOM 2188  H HB3  . ASP B 1 46 ? 3.868   -5.723  -50.109 1.00 0.00 ? 109 ASP B HB3  1 
ATOM 2189  N N    . GLU B 1 47 ? 7.237   -7.412  -49.962 1.00 0.00 ? 110 GLU B N    1 
ATOM 2190  C CA   . GLU B 1 47 ? 8.553   -7.986  -49.708 1.00 0.00 ? 110 GLU B CA   1 
ATOM 2191  C C    . GLU B 1 47 ? 8.449   -9.242  -48.852 1.00 0.00 ? 110 GLU B C    1 
ATOM 2192  O O    . GLU B 1 47 ? 9.373   -10.054 -48.810 1.00 0.00 ? 110 GLU B O    1 
ATOM 2193  C CB   . GLU B 1 47 ? 9.458   -6.962  -49.020 1.00 0.00 ? 110 GLU B CB   1 
ATOM 2194  C CG   . GLU B 1 47 ? 9.794   -5.746  -49.871 1.00 0.00 ? 110 GLU B CG   1 
ATOM 2195  C CD   . GLU B 1 47 ? 8.762   -4.657  -49.772 1.00 0.00 ? 110 GLU B CD   1 
ATOM 2196  O OE1  . GLU B 1 47 ? 7.829   -4.817  -49.022 1.00 0.00 ? 110 GLU B OE1  1 
ATOM 2197  O OE2  . GLU B 1 47 ? 8.908   -3.666  -50.447 1.00 0.00 ? 110 GLU B OE2  1 
ATOM 2198  H H    . GLU B 1 47 ? 7.042   -6.465  -49.642 1.00 0.00 ? 110 GLU B H    1 
ATOM 2199  H HA   . GLU B 1 47 ? 9.014   -8.258  -50.656 1.00 0.00 ? 110 GLU B HA   1 
ATOM 2200  H HB2  . GLU B 1 47 ? 8.975   -6.630  -48.106 1.00 0.00 ? 110 GLU B HB2  1 
ATOM 2201  H HB3  . GLU B 1 47 ? 10.378  -7.462  -48.773 1.00 0.00 ? 110 GLU B HB3  1 
ATOM 2202  H HG2  . GLU B 1 47 ? 10.761  -5.338  -49.565 1.00 0.00 ? 110 GLU B HG2  1 
ATOM 2203  H HG3  . GLU B 1 47 ? 9.865   -6.064  -50.913 1.00 0.00 ? 110 GLU B HG3  1 
ATOM 2204  N N    . HIS B 1 48 ? 7.318   -9.398  -48.172 1.00 0.00 ? 111 HIS B N    1 
ATOM 2205  C CA   . HIS B 1 48 ? 7.046   -10.607 -47.402 1.00 0.00 ? 111 HIS B CA   1 
ATOM 2206  C C    . HIS B 1 48 ? 5.625   -11.101 -47.641 1.00 0.00 ? 111 HIS B C    1 
ATOM 2207  O O    . HIS B 1 48 ? 4.683   -10.653 -46.989 1.00 0.00 ? 111 HIS B O    1 
ATOM 2208  C CB   . HIS B 1 48 ? 7.260   -10.356 -45.907 1.00 0.00 ? 111 HIS B CB   1 
ATOM 2209  C CG   . HIS B 1 48 ? 6.568   -9.131  -45.396 1.00 0.00 ? 111 HIS B CG   1 
ATOM 2210  N ND1  . HIS B 1 48 ? 7.144   -7.878  -45.440 1.00 0.00 ? 111 HIS B ND1  1 
ATOM 2211  C CD2  . HIS B 1 48 ? 5.350   -8.966  -44.830 1.00 0.00 ? 111 HIS B CD2  1 
ATOM 2212  C CE1  . HIS B 1 48 ? 6.306   -6.994  -44.922 1.00 0.00 ? 111 HIS B CE1  1 
ATOM 2213  N NE2  . HIS B 1 48 ? 5.212   -7.629  -44.546 1.00 0.00 ? 111 HIS B NE2  1 
ATOM 2214  H H    . HIS B 1 48 ? 6.585   -8.694  -48.264 1.00 0.00 ? 111 HIS B H    1 
ATOM 2215  H HA   . HIS B 1 48 ? 7.711   -11.394 -47.725 1.00 0.00 ? 111 HIS B HA   1 
ATOM 2216  H HB2  . HIS B 1 48 ? 6.916   -11.218 -45.340 1.00 0.00 ? 111 HIS B HB2  1 
ATOM 2217  H HB3  . HIS B 1 48 ? 8.326   -10.222 -45.736 1.00 0.00 ? 111 HIS B HB3  1 
ATOM 2218  H HD2  . HIS B 1 48 ? 4.543   -9.678  -44.859 1.00 0.00 ? 111 HIS B HD2  1 
ATOM 2219  H HE1  . HIS B 1 48 ? 6.490   -5.933  -44.825 1.00 0.00 ? 111 HIS B HE1  1 
ATOM 2220  H HE2  . HIS B 1 48 ? 4.404   -7.201  -44.118 1.00 0.00 ? 111 HIS B HE2  1 
ATOM 2221  N N    . GLY B 1 49 ? 5.478   -12.028 -48.581 1.00 0.00 ? 112 GLY B N    1 
ATOM 2222  C CA   . GLY B 1 49 ? 4.172   -12.588 -48.908 1.00 0.00 ? 112 GLY B CA   1 
ATOM 2223  C C    . GLY B 1 49 ? 3.100   -11.507 -48.929 1.00 0.00 ? 112 GLY B C    1 
ATOM 2224  O O    . GLY B 1 49 ? 3.329   -10.401 -49.418 1.00 0.00 ? 112 GLY B O    1 
ATOM 2225  H H    . GLY B 1 49 ? 6.301   -12.356 -49.086 1.00 0.00 ? 112 GLY B H    1 
ATOM 2226  H HA2  . GLY B 1 49 ? 4.233   -13.014 -49.910 1.00 0.00 ? 112 GLY B HA2  1 
ATOM 2227  H HA3  . GLY B 1 49 ? 3.893   -13.373 -48.229 1.00 0.00 ? 112 GLY B HA3  1 
ATOM 2228  N N    . PHE B 1 50 ? 1.926   -11.833 -48.395 1.00 0.00 ? 113 PHE B N    1 
ATOM 2229  C CA   . PHE B 1 50 ? 0.806   -10.901 -48.381 1.00 0.00 ? 113 PHE B CA   1 
ATOM 2230  C C    . PHE B 1 50 ? 0.864   -9.985  -47.166 1.00 0.00 ? 113 PHE B C    1 
ATOM 2231  O O    . PHE B 1 50 ? 1.374   -10.367 -46.112 1.00 0.00 ? 113 PHE B O    1 
ATOM 2232  C CB   . PHE B 1 50 ? -0.522  -11.662 -48.390 1.00 0.00 ? 113 PHE B CB   1 
ATOM 2233  C CG   . PHE B 1 50 ? -0.866  -12.264 -49.723 1.00 0.00 ? 113 PHE B CG   1 
ATOM 2234  C CD1  . PHE B 1 50 ? -1.484  -11.506 -50.704 1.00 0.00 ? 113 PHE B CD1  1 
ATOM 2235  C CD2  . PHE B 1 50 ? -0.571  -13.591 -49.997 1.00 0.00 ? 113 PHE B CD2  1 
ATOM 2236  C CE1  . PHE B 1 50 ? -1.803  -12.058 -51.930 1.00 0.00 ? 113 PHE B CE1  1 
ATOM 2237  C CE2  . PHE B 1 50 ? -0.886  -14.147 -51.223 1.00 0.00 ? 113 PHE B CE2  1 
ATOM 2238  C CZ   . PHE B 1 50 ? -1.502  -13.380 -52.188 1.00 0.00 ? 113 PHE B CZ   1 
ATOM 2239  H H    . PHE B 1 50 ? 1.791   -12.768 -48.012 1.00 0.00 ? 113 PHE B H    1 
ATOM 2240  H HA   . PHE B 1 50 ? 0.835   -10.288 -49.270 1.00 0.00 ? 113 PHE B HA   1 
ATOM 2241  H HB2  . PHE B 1 50 ? -0.460  -12.457 -47.654 1.00 0.00 ? 113 PHE B HB2  1 
ATOM 2242  H HB3  . PHE B 1 50 ? -1.323  -10.977 -48.102 1.00 0.00 ? 113 PHE B HB3  1 
ATOM 2243  H HD1  . PHE B 1 50 ? -1.706  -10.478 -50.505 1.00 0.00 ? 113 PHE B HD1  1 
ATOM 2244  H HD2  . PHE B 1 50 ? -0.085  -14.195 -49.244 1.00 0.00 ? 113 PHE B HD2  1 
ATOM 2245  H HE1  . PHE B 1 50 ? -2.286  -11.454 -52.684 1.00 0.00 ? 113 PHE B HE1  1 
ATOM 2246  H HE2  . PHE B 1 50 ? -0.654  -15.181 -51.423 1.00 0.00 ? 113 PHE B HE2  1 
ATOM 2247  H HZ   . PHE B 1 50 ? -1.774  -13.820 -53.137 1.00 0.00 ? 113 PHE B HZ   1 
ATOM 2248  N N    . ILE B 1 51 ? 0.338   -8.774  -47.318 1.00 0.00 ? 114 ILE B N    1 
ATOM 2249  C CA   . ILE B 1 51 ? -0.042  -7.955  -46.173 1.00 0.00 ? 114 ILE B CA   1 
ATOM 2250  C C    . ILE B 1 51 ? -1.418  -7.333  -46.374 1.00 0.00 ? 114 ILE B C    1 
ATOM 2251  O O    . ILE B 1 51 ? -2.199  -7.787  -47.210 1.00 0.00 ? 114 ILE B O    1 
ATOM 2252  C CB   . ILE B 1 51 ? 0.994   -6.844  -45.923 1.00 0.00 ? 114 ILE B CB   1 
ATOM 2253  C CG1  . ILE B 1 51 ? 0.984   -5.837  -47.077 1.00 0.00 ? 114 ILE B CG1  1 
ATOM 2254  C CG2  . ILE B 1 51 ? 2.381   -7.441  -45.744 1.00 0.00 ? 114 ILE B CG2  1 
ATOM 2255  C CD1  . ILE B 1 51 ? 1.748   -4.566  -46.786 1.00 0.00 ? 114 ILE B CD1  1 
ATOM 2256  H H    . ILE B 1 51 ? -0.114  -8.567  -48.209 1.00 0.00 ? 114 ILE B H    1 
ATOM 2257  H HA   . ILE B 1 51 ? -0.115  -8.565  -45.290 1.00 0.00 ? 114 ILE B HA   1 
ATOM 2258  H HB   . ILE B 1 51 ? 0.730   -6.323  -45.003 1.00 0.00 ? 114 ILE B HB   1 
ATOM 2259  H HG12 . ILE B 1 51 ? 1.392   -6.287  -47.966 1.00 0.00 ? 114 ILE B HG12 1 
ATOM 2260  H HG13 . ILE B 1 51 ? -0.025  -5.555  -47.251 1.00 0.00 ? 114 ILE B HG13 1 
ATOM 2261  H HG21 . ILE B 1 51 ? 2.342   -8.376  -45.223 1.00 0.00 ? 114 ILE B HG21 1 
ATOM 2262  H HG22 . ILE B 1 51 ? 3.013   -6.756  -45.188 1.00 0.00 ? 114 ILE B HG22 1 
ATOM 2263  H HG23 . ILE B 1 51 ? 2.828   -7.610  -46.726 1.00 0.00 ? 114 ILE B HG23 1 
ATOM 2264  H HD11 . ILE B 1 51 ? 1.205   -3.971  -46.048 1.00 0.00 ? 114 ILE B HD11 1 
ATOM 2265  H HD12 . ILE B 1 51 ? 1.857   -3.990  -47.705 1.00 0.00 ? 114 ILE B HD12 1 
ATOM 2266  H HD13 . ILE B 1 51 ? 2.734   -4.816  -46.395 1.00 0.00 ? 114 ILE B HD13 1 
ATOM 2267  N N    . SER B 1 52 ? -1.708  -6.291  -45.602 1.00 0.00 ? 115 SER B N    1 
ATOM 2268  C CA   . SER B 1 52 ? -2.872  -5.451  -45.855 1.00 0.00 ? 115 SER B CA   1 
ATOM 2269  C C    . SER B 1 52 ? -2.714  -4.079  -45.211 1.00 0.00 ? 115 SER B C    1 
ATOM 2270  O O    . SER B 1 52 ? -2.150  -3.955  -44.124 1.00 0.00 ? 115 SER B O    1 
ATOM 2271  C CB   . SER B 1 52 ? -4.125  -6.123  -45.329 1.00 0.00 ? 115 SER B CB   1 
ATOM 2272  O OG   . SER B 1 52 ? -5.243  -5.293  -45.483 1.00 0.00 ? 115 SER B OG   1 
ATOM 2273  H H    . SER B 1 52 ? -0.999  -5.943  -44.962 1.00 0.00 ? 115 SER B H    1 
ATOM 2274  H HA   . SER B 1 52 ? -2.980  -5.315  -46.927 1.00 0.00 ? 115 SER B HA   1 
ATOM 2275  H HB2  . SER B 1 52 ? -4.292  -7.053  -45.865 1.00 0.00 ? 115 SER B HB2  1 
ATOM 2276  H HB3  . SER B 1 52 ? -3.971  -6.343  -44.279 1.00 0.00 ? 115 SER B HB3  1 
ATOM 2277  H HG   . SER B 1 52 ? -5.427  -5.218  -46.418 1.00 0.00 ? 115 SER B HG   1 
ATOM 2278  N N    . ARG B 1 53 ? -3.213  -3.052  -45.889 1.00 0.00 ? 116 ARG B N    1 
ATOM 2279  C CA   . ARG B 1 53 ? -3.205  -1.699  -45.344 1.00 0.00 ? 116 ARG B CA   1 
ATOM 2280  C C    . ARG B 1 53 ? -4.618  -1.228  -45.019 1.00 0.00 ? 116 ARG B C    1 
ATOM 2281  O O    . ARG B 1 53 ? -5.258  -0.549  -45.821 1.00 0.00 ? 116 ARG B O    1 
ATOM 2282  C CB   . ARG B 1 53 ? -2.567  -0.729  -46.328 1.00 0.00 ? 116 ARG B CB   1 
ATOM 2283  C CG   . ARG B 1 53 ? -1.099  -0.996  -46.625 1.00 0.00 ? 116 ARG B CG   1 
ATOM 2284  C CD   . ARG B 1 53 ? -0.496  0.094   -47.434 1.00 0.00 ? 116 ARG B CD   1 
ATOM 2285  N NE   . ARG B 1 53 ? -1.178  0.269   -48.707 1.00 0.00 ? 116 ARG B NE   1 
ATOM 2286  C CZ   . ARG B 1 53 ? -1.162  1.401   -49.435 1.00 0.00 ? 116 ARG B CZ   1 
ATOM 2287  N NH1  . ARG B 1 53 ? -0.494  2.449   -49.008 1.00 0.00 ? 116 ARG B NH1  1 
ATOM 2288  N NH2  . ARG B 1 53 ? -1.817  1.459   -50.582 1.00 0.00 ? 116 ARG B NH2  1 
ATOM 2289  H H    . ARG B 1 53 ? -3.686  -3.222  -46.778 1.00 0.00 ? 116 ARG B H    1 
ATOM 2290  H HA   . ARG B 1 53 ? -2.616  -1.674  -44.424 1.00 0.00 ? 116 ARG B HA   1 
ATOM 2291  H HB2  . ARG B 1 53 ? -3.120  -0.778  -47.264 1.00 0.00 ? 116 ARG B HB2  1 
ATOM 2292  H HB3  . ARG B 1 53 ? -2.651  0.269   -45.921 1.00 0.00 ? 116 ARG B HB3  1 
ATOM 2293  H HG2  . ARG B 1 53 ? -0.564  -1.090  -45.680 1.00 0.00 ? 116 ARG B HG2  1 
ATOM 2294  H HG3  . ARG B 1 53 ? -1.020  -1.925  -47.175 1.00 0.00 ? 116 ARG B HG3  1 
ATOM 2295  H HD2  . ARG B 1 53 ? -0.567  1.025   -46.874 1.00 0.00 ? 116 ARG B HD2  1 
ATOM 2296  H HD3  . ARG B 1 53 ? 0.555   -0.131  -47.621 1.00 0.00 ? 116 ARG B HD3  1 
ATOM 2297  H HE   . ARG B 1 53 ? -1.689  -0.492  -49.056 1.00 0.00 ? 116 ARG B HE   1 
ATOM 2298  H HH11 . ARG B 1 53 ? 0.004   2.406   -48.138 1.00 0.00 ? 116 ARG B HH11 1 
ATOM 2299  H HH12 . ARG B 1 53 ? -0.481  3.297   -49.556 1.00 0.00 ? 116 ARG B HH12 1 
ATOM 2300  H HH21 . ARG B 1 53 ? -2.327  0.663   -50.911 1.00 0.00 ? 116 ARG B HH21 1 
ATOM 2301  H HH22 . ARG B 1 53 ? -1.801  2.300   -51.121 1.00 0.00 ? 116 ARG B HH22 1 
ATOM 2302  N N    . GLU B 1 54 ? -5.098  -1.594  -43.835 1.00 0.00 ? 117 GLU B N    1 
ATOM 2303  C CA   . GLU B 1 54 ? -6.435  -1.207  -43.399 1.00 0.00 ? 117 GLU B CA   1 
ATOM 2304  C C    . GLU B 1 54 ? -6.394  0.050   -42.540 1.00 0.00 ? 117 GLU B C    1 
ATOM 2305  O O    . GLU B 1 54 ? -5.798  0.056   -41.463 1.00 0.00 ? 117 GLU B O    1 
ATOM 2306  C CB   . GLU B 1 54 ? -7.092  -2.348  -42.619 1.00 0.00 ? 117 GLU B CB   1 
ATOM 2307  C CG   . GLU B 1 54 ? -8.483  -2.029  -42.090 1.00 0.00 ? 117 GLU B CG   1 
ATOM 2308  C CD   . GLU B 1 54 ? -9.106  -3.180  -41.349 1.00 0.00 ? 117 GLU B CD   1 
ATOM 2309  O OE1  . GLU B 1 54 ? -8.517  -4.233  -41.323 1.00 0.00 ? 117 GLU B OE1  1 
ATOM 2310  O OE2  . GLU B 1 54 ? -10.172 -3.005  -40.809 1.00 0.00 ? 117 GLU B OE2  1 
ATOM 2311  H H    . GLU B 1 54 ? -4.514  -2.155  -43.215 1.00 0.00 ? 117 GLU B H    1 
ATOM 2312  H HA   . GLU B 1 54 ? -7.052  -1.000  -44.248 1.00 0.00 ? 117 GLU B HA   1 
ATOM 2313  H HB2  . GLU B 1 54 ? -7.181  -3.201  -43.282 1.00 0.00 ? 117 GLU B HB2  1 
ATOM 2314  H HB3  . GLU B 1 54 ? -6.458  -2.627  -41.808 1.00 0.00 ? 117 GLU B HB3  1 
ATOM 2315  H HG2  . GLU B 1 54 ? -8.407  -1.183  -41.408 1.00 0.00 ? 117 GLU B HG2  1 
ATOM 2316  H HG3  . GLU B 1 54 ? -9.124  -1.754  -42.927 1.00 0.00 ? 117 GLU B HG3  1 
ATOM 2317  N N    . PHE B 1 55 ? -7.027  1.112   -43.022 1.00 0.00 ? 118 PHE B N    1 
ATOM 2318  C CA   . PHE B 1 55 ? -6.820  2.446   -42.470 1.00 0.00 ? 118 PHE B CA   1 
ATOM 2319  C C    . PHE B 1 55 ? -7.980  2.855   -41.572 1.00 0.00 ? 118 PHE B C    1 
ATOM 2320  O O    . PHE B 1 55 ? -9.085  2.326   -41.687 1.00 0.00 ? 118 PHE B O    1 
ATOM 2321  C CB   . PHE B 1 55 ? -6.653  3.469   -43.594 1.00 0.00 ? 118 PHE B CB   1 
ATOM 2322  C CG   . PHE B 1 55 ? -5.463  3.212   -44.475 1.00 0.00 ? 118 PHE B CG   1 
ATOM 2323  C CD1  . PHE B 1 55 ? -4.176  3.406   -44.001 1.00 0.00 ? 118 PHE B CD1  1 
ATOM 2324  C CD2  . PHE B 1 55 ? -5.632  2.775   -45.781 1.00 0.00 ? 118 PHE B CD2  1 
ATOM 2325  C CE1  . PHE B 1 55 ? -3.080  3.171   -44.810 1.00 0.00 ? 118 PHE B CE1  1 
ATOM 2326  C CE2  . PHE B 1 55 ? -4.538  2.539   -46.593 1.00 0.00 ? 118 PHE B CE2  1 
ATOM 2327  C CZ   . PHE B 1 55 ? -3.263  2.736   -46.107 1.00 0.00 ? 118 PHE B CZ   1 
ATOM 2328  H H    . PHE B 1 55 ? -7.462  1.040   -43.939 1.00 0.00 ? 118 PHE B H    1 
ATOM 2329  H HA   . PHE B 1 55 ? -5.927  2.462   -41.877 1.00 0.00 ? 118 PHE B HA   1 
ATOM 2330  H HB2  . PHE B 1 55 ? -7.557  3.514   -44.196 1.00 0.00 ? 118 PHE B HB2  1 
ATOM 2331  H HB3  . PHE B 1 55 ? -6.498  4.421   -43.111 1.00 0.00 ? 118 PHE B HB3  1 
ATOM 2332  H HD1  . PHE B 1 55 ? -4.028  3.745   -42.986 1.00 0.00 ? 118 PHE B HD1  1 
ATOM 2333  H HD2  . PHE B 1 55 ? -6.618  2.606   -46.159 1.00 0.00 ? 118 PHE B HD2  1 
ATOM 2334  H HE1  . PHE B 1 55 ? -2.082  3.329   -44.429 1.00 0.00 ? 118 PHE B HE1  1 
ATOM 2335  H HE2  . PHE B 1 55 ? -4.683  2.200   -47.609 1.00 0.00 ? 118 PHE B HE2  1 
ATOM 2336  H HZ   . PHE B 1 55 ? -2.408  2.569   -46.747 1.00 0.00 ? 118 PHE B HZ   1 
ATOM 2337  N N    . HIS B 1 56 ? -7.721  3.803   -40.677 1.00 0.00 ? 119 HIS B N    1 
ATOM 2338  C CA   . HIS B 1 56 ? -8.790  4.518   -39.989 1.00 0.00 ? 119 HIS B CA   1 
ATOM 2339  C C    . HIS B 1 56 ? -8.568  6.025   -40.045 1.00 0.00 ? 119 HIS B C    1 
ATOM 2340  O O    . HIS B 1 56 ? -8.338  6.667   -39.021 1.00 0.00 ? 119 HIS B O    1 
ATOM 2341  C CB   . HIS B 1 56 ? -8.893  4.065   -38.530 1.00 0.00 ? 119 HIS B CB   1 
ATOM 2342  C CG   . HIS B 1 56 ? -9.275  2.627   -38.371 1.00 0.00 ? 119 HIS B CG   1 
ATOM 2343  N ND1  . HIS B 1 56 ? -8.354  1.603   -38.423 1.00 0.00 ? 119 HIS B ND1  1 
ATOM 2344  C CD2  . HIS B 1 56 ? -10.478 2.043   -38.162 1.00 0.00 ? 119 HIS B CD2  1 
ATOM 2345  C CE1  . HIS B 1 56 ? -8.974  0.448   -38.253 1.00 0.00 ? 119 HIS B CE1  1 
ATOM 2346  N NE2  . HIS B 1 56 ? -10.264 0.689   -38.095 1.00 0.00 ? 119 HIS B NE2  1 
ATOM 2347  H H    . HIS B 1 56 ? -6.793  4.224   -40.674 1.00 0.00 ? 119 HIS B H    1 
ATOM 2348  H HA   . HIS B 1 56 ? -9.751  4.298   -40.468 1.00 0.00 ? 119 HIS B HA   1 
ATOM 2349  H HB2  . HIS B 1 56 ? -7.915  4.210   -38.072 1.00 0.00 ? 119 HIS B HB2  1 
ATOM 2350  H HB3  . HIS B 1 56 ? -9.623  4.686   -38.008 1.00 0.00 ? 119 HIS B HB3  1 
ATOM 2351  H HD1  . HIS B 1 56 ? -7.360  1.705   -38.576 1.00 0.00 ? 119 HIS B HD1  1 
ATOM 2352  H HD2  . HIS B 1 56 ? -11.436 2.525   -38.284 1.00 0.00 ? 119 HIS B HD2  1 
ATOM 2353  H HE1  . HIS B 1 56 ? -8.506  -0.524  -38.246 1.00 0.00 ? 119 HIS B HE1  1 
ATOM 2354  H HE2  . HIS B 1 56 ? -10.977 -0.011  -37.947 1.00 0.00 ? 119 HIS B HE2  1 
ATOM 2355  N N    . ARG B 1 57 ? -8.642  6.584   -41.248 1.00 0.00 ? 120 ARG B N    1 
ATOM 2356  C CA   . ARG B 1 57 ? -8.096  7.911   -41.511 1.00 0.00 ? 120 ARG B CA   1 
ATOM 2357  C C    . ARG B 1 57 ? -9.004  9.000   -40.960 1.00 0.00 ? 120 ARG B C    1 
ATOM 2358  O O    . ARG B 1 57 ? -9.685  9.697   -41.715 1.00 0.00 ? 120 ARG B O    1 
ATOM 2359  C CB   . ARG B 1 57 ? -7.902  8.123   -43.005 1.00 0.00 ? 120 ARG B CB   1 
ATOM 2360  C CG   . ARG B 1 57 ? -6.957  7.136   -43.675 1.00 0.00 ? 120 ARG B CG   1 
ATOM 2361  C CD   . ARG B 1 57 ? -6.757  7.457   -45.111 1.00 0.00 ? 120 ARG B CD   1 
ATOM 2362  N NE   . ARG B 1 57 ? -5.654  6.702   -45.687 1.00 0.00 ? 120 ARG B NE   1 
ATOM 2363  C CZ   . ARG B 1 57 ? -5.480  6.488   -47.004 1.00 0.00 ? 120 ARG B CZ   1 
ATOM 2364  N NH1  . ARG B 1 57 ? -6.340  6.978   -47.870 1.00 0.00 ? 120 ARG B NH1  1 
ATOM 2365  N NH2  . ARG B 1 57 ? -4.444  5.786   -47.429 1.00 0.00 ? 120 ARG B NH2  1 
ATOM 2366  H H    . ARG B 1 57 ? -8.789  5.967   -42.048 1.00 0.00 ? 120 ARG B H    1 
ATOM 2367  H HA   . ARG B 1 57 ? -7.167  8.018   -41.049 1.00 0.00 ? 120 ARG B HA   1 
ATOM 2368  H HB2  . ARG B 1 57 ? -8.860  8.030   -43.457 1.00 0.00 ? 120 ARG B HB2  1 
ATOM 2369  H HB3  . ARG B 1 57 ? -7.523  9.133   -43.172 1.00 0.00 ? 120 ARG B HB3  1 
ATOM 2370  H HG2  . ARG B 1 57 ? -6.005  7.117   -43.155 1.00 0.00 ? 120 ARG B HG2  1 
ATOM 2371  H HG3  . ARG B 1 57 ? -7.429  6.169   -43.610 1.00 0.00 ? 120 ARG B HG3  1 
ATOM 2372  H HD2  . ARG B 1 57 ? -7.666  7.235   -45.670 1.00 0.00 ? 120 ARG B HD2  1 
ATOM 2373  H HD3  . ARG B 1 57 ? -6.533  8.514   -45.195 1.00 0.00 ? 120 ARG B HD3  1 
ATOM 2374  H HE   . ARG B 1 57 ? -4.998  6.313   -45.071 1.00 0.00 ? 120 ARG B HE   1 
ATOM 2375  H HH11 . ARG B 1 57 ? -7.125  7.509   -47.550 1.00 0.00 ? 120 ARG B HH11 1 
ATOM 2376  H HH12 . ARG B 1 57 ? -6.208  6.817   -48.858 1.00 0.00 ? 120 ARG B HH12 1 
ATOM 2377  H HH21 . ARG B 1 57 ? -3.788  5.412   -46.773 1.00 0.00 ? 120 ARG B HH21 1 
ATOM 2378  H HH22 . ARG B 1 57 ? -4.315  5.632   -48.408 1.00 0.00 ? 120 ARG B HH22 1 
ATOM 2379  N N    . LYS B 1 58 ? -9.013  9.145   -39.639 1.00 0.00 ? 121 LYS B N    1 
ATOM 2380  C CA   . LYS B 1 58 ? -9.973  10.017  -38.970 1.00 0.00 ? 121 LYS B CA   1 
ATOM 2381  C C    . LYS B 1 58 ? -9.389  11.407  -38.747 1.00 0.00 ? 121 LYS B C    1 
ATOM 2382  O O    . LYS B 1 58 ? -8.674  11.641  -37.773 1.00 0.00 ? 121 LYS B O    1 
ATOM 2383  C CB   . LYS B 1 58 ? -10.408 9.408   -37.636 1.00 0.00 ? 121 LYS B CB   1 
ATOM 2384  C CG   . LYS B 1 58 ? -11.627 10.074  -37.011 1.00 0.00 ? 121 LYS B CG   1 
ATOM 2385  C CD   . LYS B 1 58 ? -11.932 9.489   -35.640 1.00 0.00 ? 121 LYS B CD   1 
ATOM 2386  C CE   . LYS B 1 58 ? -12.404 8.046   -35.746 1.00 0.00 ? 121 LYS B CE   1 
ATOM 2387  N NZ   . LYS B 1 58 ? -12.771 7.482   -34.419 1.00 0.00 ? 121 LYS B NZ   1 
ATOM 2388  H H    . LYS B 1 58 ? -8.442  8.517   -39.075 1.00 0.00 ? 121 LYS B H    1 
ATOM 2389  H HA   . LYS B 1 58 ? -10.852 10.153  -39.568 1.00 0.00 ? 121 LYS B HA   1 
ATOM 2390  H HB2  . LYS B 1 58 ? -10.626 8.369   -37.823 1.00 0.00 ? 121 LYS B HB2  1 
ATOM 2391  H HB3  . LYS B 1 58 ? -9.580  9.469   -36.933 1.00 0.00 ? 121 LYS B HB3  1 
ATOM 2392  H HG2  . LYS B 1 58 ? -11.428 11.139  -36.906 1.00 0.00 ? 121 LYS B HG2  1 
ATOM 2393  H HG3  . LYS B 1 58 ? -12.471 9.931   -37.657 1.00 0.00 ? 121 LYS B HG3  1 
ATOM 2394  H HD2  . LYS B 1 58 ? -11.028 9.517   -35.034 1.00 0.00 ? 121 LYS B HD2  1 
ATOM 2395  H HD3  . LYS B 1 58 ? -12.705 10.084  -35.152 1.00 0.00 ? 121 LYS B HD3  1 
ATOM 2396  H HE2  . LYS B 1 58 ? -13.272 8.003   -36.401 1.00 0.00 ? 121 LYS B HE2  1 
ATOM 2397  H HE3  . LYS B 1 58 ? -11.614 7.431   -36.161 1.00 0.00 ? 121 LYS B HE3  1 
ATOM 2398  H HZ1  . LYS B 1 58 ? -13.113 8.251   -33.808 1.00 0.00 ? 121 LYS B HZ1  1 
ATOM 2399  H HZ2  . LYS B 1 58 ? -11.935 7.038   -33.986 1.00 0.00 ? 121 LYS B HZ2  1 
ATOM 2400  H HZ3  . LYS B 1 58 ? -13.499 6.792   -34.535 1.00 0.00 ? 121 LYS B HZ3  1 
ATOM 2401  N N    . TYR B 1 59 ? -9.702  12.326  -39.655 1.00 0.00 ? 122 TYR B N    1 
ATOM 2402  C CA   . TYR B 1 59 ? -9.329  13.726  -39.486 1.00 0.00 ? 122 TYR B CA   1 
ATOM 2403  C C    . TYR B 1 59 ? -10.556 14.629  -39.504 1.00 0.00 ? 122 TYR B C    1 
ATOM 2404  O O    . TYR B 1 59 ? -11.521 14.367  -40.224 1.00 0.00 ? 122 TYR B O    1 
ATOM 2405  C CB   . TYR B 1 59 ? -8.341  14.151  -40.575 1.00 0.00 ? 122 TYR B CB   1 
ATOM 2406  C CG   . TYR B 1 59 ? -8.831  13.882  -41.981 1.00 0.00 ? 122 TYR B CG   1 
ATOM 2407  C CD1  . TYR B 1 59 ? -9.576  14.842  -42.652 1.00 0.00 ? 122 TYR B CD1  1 
ATOM 2408  C CD2  . TYR B 1 59 ? -8.534  12.677  -42.600 1.00 0.00 ? 122 TYR B CD2  1 
ATOM 2409  C CE1  . TYR B 1 59 ? -10.022 14.596  -43.935 1.00 0.00 ? 122 TYR B CE1  1 
ATOM 2410  C CE2  . TYR B 1 59 ? -8.981  12.431  -43.884 1.00 0.00 ? 122 TYR B CE2  1 
ATOM 2411  C CZ   . TYR B 1 59 ? -9.722  13.386  -44.552 1.00 0.00 ? 122 TYR B CZ   1 
ATOM 2412  O OH   . TYR B 1 59 ? -10.167 13.141  -45.830 1.00 0.00 ? 122 TYR B OH   1 
ATOM 2413  H H    . TYR B 1 59 ? -10.322 12.066  -40.422 1.00 0.00 ? 122 TYR B H    1 
ATOM 2414  H HA   . TYR B 1 59 ? -8.851  13.862  -38.515 1.00 0.00 ? 122 TYR B HA   1 
ATOM 2415  H HB2  . TYR B 1 59 ? -8.123  15.211  -40.476 1.00 0.00 ? 122 TYR B HB2  1 
ATOM 2416  H HB3  . TYR B 1 59 ? -7.429  13.590  -40.443 1.00 0.00 ? 122 TYR B HB3  1 
ATOM 2417  H HD1  . TYR B 1 59 ? -9.810  15.780  -42.170 1.00 0.00 ? 122 TYR B HD1  1 
ATOM 2418  H HD2  . TYR B 1 59 ? -7.964  11.932  -42.074 1.00 0.00 ? 122 TYR B HD2  1 
ATOM 2419  H HE1  . TYR B 1 59 ? -10.599 15.335  -44.462 1.00 0.00 ? 122 TYR B HE1  1 
ATOM 2420  H HE2  . TYR B 1 59 ? -8.749  11.493  -44.366 1.00 0.00 ? 122 TYR B HE2  1 
ATOM 2421  H HH   . TYR B 1 59 ? -10.661 13.910  -46.125 1.00 0.00 ? 122 TYR B HH   1 
ATOM 2422  N N    . ARG B 1 60 ? -10.513 15.692  -38.709 1.00 0.00 ? 123 ARG B N    1 
ATOM 2423  C CA   . ARG B 1 60 ? -11.714 16.449  -38.377 1.00 0.00 ? 123 ARG B CA   1 
ATOM 2424  C C    . ARG B 1 60 ? -11.898 17.630  -39.320 1.00 0.00 ? 123 ARG B C    1 
ATOM 2425  O O    . ARG B 1 60 ? -10.948 18.080  -39.962 1.00 0.00 ? 123 ARG B O    1 
ATOM 2426  C CB   . ARG B 1 60 ? -11.649 16.953  -36.942 1.00 0.00 ? 123 ARG B CB   1 
ATOM 2427  C CG   . ARG B 1 60 ? -12.228 16.006  -35.905 1.00 0.00 ? 123 ARG B CG   1 
ATOM 2428  C CD   . ARG B 1 60 ? -11.491 14.719  -35.864 1.00 0.00 ? 123 ARG B CD   1 
ATOM 2429  N NE   . ARG B 1 60 ? -11.806 13.949  -34.671 1.00 0.00 ? 123 ARG B NE   1 
ATOM 2430  C CZ   . ARG B 1 60 ? -11.131 12.857  -34.263 1.00 0.00 ? 123 ARG B CZ   1 
ATOM 2431  N NH1  . ARG B 1 60 ? -10.106 12.421  -34.961 1.00 0.00 ? 123 ARG B NH1  1 
ATOM 2432  N NH2  . ARG B 1 60 ? -11.498 12.227  -33.161 1.00 0.00 ? 123 ARG B NH2  1 
ATOM 2433  H H    . ARG B 1 60 ? -9.694  15.809  -38.113 1.00 0.00 ? 123 ARG B H    1 
ATOM 2434  H HA   . ARG B 1 60 ? -12.580 15.829  -38.467 1.00 0.00 ? 123 ARG B HA   1 
ATOM 2435  H HB2  . ARG B 1 60 ? -10.604 17.116  -36.689 1.00 0.00 ? 123 ARG B HB2  1 
ATOM 2436  H HB3  . ARG B 1 60 ? -12.176 17.910  -36.861 1.00 0.00 ? 123 ARG B HB3  1 
ATOM 2437  H HG2  . ARG B 1 60 ? -12.188 16.468  -34.919 1.00 0.00 ? 123 ARG B HG2  1 
ATOM 2438  H HG3  . ARG B 1 60 ? -13.265 15.815  -36.167 1.00 0.00 ? 123 ARG B HG3  1 
ATOM 2439  H HD2  . ARG B 1 60 ? -11.745 14.128  -36.741 1.00 0.00 ? 123 ARG B HD2  1 
ATOM 2440  H HD3  . ARG B 1 60 ? -10.419 14.926  -35.869 1.00 0.00 ? 123 ARG B HD3  1 
ATOM 2441  H HE   . ARG B 1 60 ? -12.565 14.249  -34.126 1.00 0.00 ? 123 ARG B HE   1 
ATOM 2442  H HH11 . ARG B 1 60 ? -9.828  12.896  -35.796 1.00 0.00 ? 123 ARG B HH11 1 
ATOM 2443  H HH12 . ARG B 1 60 ? -9.599  11.603  -34.653 1.00 0.00 ? 123 ARG B HH12 1 
ATOM 2444  H HH21 . ARG B 1 60 ? -12.276 12.558  -32.628 1.00 0.00 ? 123 ARG B HH21 1 
ATOM 2445  H HH22 . ARG B 1 60 ? -10.994 11.417  -32.861 1.00 0.00 ? 123 ARG B HH22 1 
ATOM 2446  N N    . ILE B 1 61 ? -13.126 18.131  -39.399 1.00 0.00 ? 124 ILE B N    1 
ATOM 2447  C CA   . ILE B 1 61 ? -13.427 19.297  -40.221 1.00 0.00 ? 124 ILE B CA   1 
ATOM 2448  C C    . ILE B 1 61 ? -13.247 20.588  -39.432 1.00 0.00 ? 124 ILE B C    1 
ATOM 2449  O O    . ILE B 1 61 ? -13.810 20.747  -38.348 1.00 0.00 ? 124 ILE B O    1 
ATOM 2450  C CB   . ILE B 1 61 ? -14.863 19.228  -40.771 1.00 0.00 ? 124 ILE B CB   1 
ATOM 2451  C CG1  . ILE B 1 61 ? -15.060 17.946  -41.587 1.00 0.00 ? 124 ILE B CG1  1 
ATOM 2452  C CG2  . ILE B 1 61 ? -15.169 20.453  -41.618 1.00 0.00 ? 124 ILE B CG2  1 
ATOM 2453  C CD1  . ILE B 1 61 ? -16.508 17.628  -41.884 1.00 0.00 ? 124 ILE B CD1  1 
ATOM 2454  H H    . ILE B 1 61 ? -13.861 17.722  -38.837 1.00 0.00 ? 124 ILE B H    1 
ATOM 2455  H HA   . ILE B 1 61 ? -12.777 19.264  -41.081 1.00 0.00 ? 124 ILE B HA   1 
ATOM 2456  H HB   . ILE B 1 61 ? -15.555 19.206  -39.928 1.00 0.00 ? 124 ILE B HB   1 
ATOM 2457  H HG12 . ILE B 1 61 ? -14.531 18.074  -42.525 1.00 0.00 ? 124 ILE B HG12 1 
ATOM 2458  H HG13 . ILE B 1 61 ? -14.616 17.116  -41.040 1.00 0.00 ? 124 ILE B HG13 1 
ATOM 2459  H HG21 . ILE B 1 61 ? -16.163 20.402  -42.043 1.00 0.00 ? 124 ILE B HG21 1 
ATOM 2460  H HG22 . ILE B 1 61 ? -14.442 20.522  -42.421 1.00 0.00 ? 124 ILE B HG22 1 
ATOM 2461  H HG23 . ILE B 1 61 ? -15.109 21.335  -40.994 1.00 0.00 ? 124 ILE B HG23 1 
ATOM 2462  H HD11 . ILE B 1 61 ? -17.023 18.508  -42.170 1.00 0.00 ? 124 ILE B HD11 1 
ATOM 2463  H HD12 . ILE B 1 61 ? -16.559 16.901  -42.695 1.00 0.00 ? 124 ILE B HD12 1 
ATOM 2464  H HD13 . ILE B 1 61 ? -16.976 17.209  -40.993 1.00 0.00 ? 124 ILE B HD13 1 
ATOM 2465  N N    . PRO B 1 62 ? -12.461 21.507  -39.981 1.00 0.00 ? 125 PRO B N    1 
ATOM 2466  C CA   . PRO B 1 62 ? -12.306 22.833  -39.393 1.00 0.00 ? 125 PRO B CA   1 
ATOM 2467  C C    . PRO B 1 62 ? -13.659 23.454  -39.068 1.00 0.00 ? 125 PRO B C    1 
ATOM 2468  O O    . PRO B 1 62 ? -14.612 23.323  -39.836 1.00 0.00 ? 125 PRO B O    1 
ATOM 2469  C CB   . PRO B 1 62 ? -11.575 23.612  -40.492 1.00 0.00 ? 125 PRO B CB   1 
ATOM 2470  C CG   . PRO B 1 62 ? -10.777 22.576  -41.208 1.00 0.00 ? 125 PRO B CG   1 
ATOM 2471  C CD   . PRO B 1 62 ? -11.676 21.368  -41.235 1.00 0.00 ? 125 PRO B CD   1 
ATOM 2472  H HA   . PRO B 1 62 ? -11.688 22.771  -38.500 1.00 0.00 ? 125 PRO B HA   1 
ATOM 2473  H HB2  . PRO B 1 62 ? -12.289 24.096  -41.153 1.00 0.00 ? 125 PRO B HB2  1 
ATOM 2474  H HB3  . PRO B 1 62 ? -10.909 24.354  -40.051 1.00 0.00 ? 125 PRO B HB3  1 
ATOM 2475  H HG2  . PRO B 1 62 ? -10.554 22.919  -42.219 1.00 0.00 ? 125 PRO B HG2  1 
ATOM 2476  H HG3  . PRO B 1 62 ? -9.855  22.354  -40.668 1.00 0.00 ? 125 PRO B HG3  1 
ATOM 2477  H HD2  . PRO B 1 62 ? -12.311 21.375  -42.122 1.00 0.00 ? 125 PRO B HD2  1 
ATOM 2478  H HD3  . PRO B 1 62 ? -11.062 20.468  -41.197 1.00 0.00 ? 125 PRO B HD3  1 
ATOM 2479  N N    . ALA B 1 63 ? -13.736 24.129  -37.927 1.00 0.00 ? 126 ALA B N    1 
ATOM 2480  C CA   . ALA B 1 63 ? -14.992 24.703  -37.460 1.00 0.00 ? 126 ALA B CA   1 
ATOM 2481  C C    . ALA B 1 63 ? -15.539 25.718  -38.455 1.00 0.00 ? 126 ALA B C    1 
ATOM 2482  O O    . ALA B 1 63 ? -16.713 26.088  -38.397 1.00 0.00 ? 126 ALA B O    1 
ATOM 2483  C CB   . ALA B 1 63 ? -14.804 25.348  -36.095 1.00 0.00 ? 126 ALA B CB   1 
ATOM 2484  H H    . ALA B 1 63 ? -12.913 24.190  -37.328 1.00 0.00 ? 126 ALA B H    1 
ATOM 2485  H HA   . ALA B 1 63 ? -15.724 23.901  -37.355 1.00 0.00 ? 126 ALA B HA   1 
ATOM 2486  H HB1  . ALA B 1 63 ? -14.078 26.156  -36.174 1.00 0.00 ? 126 ALA B HB1  1 
ATOM 2487  H HB2  . ALA B 1 63 ? -14.441 24.600  -35.388 1.00 0.00 ? 126 ALA B HB2  1 
ATOM 2488  H HB3  . ALA B 1 63 ? -15.756 25.746  -35.744 1.00 0.00 ? 126 ALA B HB3  1 
ATOM 2489  N N    . ASP B 1 64 ? -14.682 26.166  -39.366 1.00 0.00 ? 127 ASP B N    1 
ATOM 2490  C CA   . ASP B 1 64 ? -15.064 27.176  -40.346 1.00 0.00 ? 127 ASP B CA   1 
ATOM 2491  C C    . ASP B 1 64 ? -15.351 26.546  -41.703 1.00 0.00 ? 127 ASP B C    1 
ATOM 2492  O O    . ASP B 1 64 ? -15.390 27.235  -42.722 1.00 0.00 ? 127 ASP B O    1 
ATOM 2493  C CB   . ASP B 1 64 ? -13.964 28.229  -40.488 1.00 0.00 ? 127 ASP B CB   1 
ATOM 2494  C CG   . ASP B 1 64 ? -13.779 29.067  -39.229 1.00 0.00 ? 127 ASP B CG   1 
ATOM 2495  O OD1  . ASP B 1 64 ? -14.759 29.365  -38.590 1.00 0.00 ? 127 ASP B OD1  1 
ATOM 2496  O OD2  . ASP B 1 64 ? -12.661 29.401  -38.921 1.00 0.00 ? 127 ASP B OD2  1 
ATOM 2497  H H    . ASP B 1 64 ? -13.720 25.828  -39.356 1.00 0.00 ? 127 ASP B H    1 
ATOM 2498  H HA   . ASP B 1 64 ? -15.971 27.687  -40.006 1.00 0.00 ? 127 ASP B HA   1 
ATOM 2499  H HB2  . ASP B 1 64 ? -13.025 27.721  -40.708 1.00 0.00 ? 127 ASP B HB2  1 
ATOM 2500  H HB3  . ASP B 1 64 ? -14.211 28.894  -41.317 1.00 0.00 ? 127 ASP B HB3  1 
ATOM 2501  N N    . VAL B 1 65 ? -15.551 25.233  -41.709 1.00 0.00 ? 128 VAL B N    1 
ATOM 2502  C CA   . VAL B 1 65 ? -15.824 24.505  -42.943 1.00 0.00 ? 128 VAL B CA   1 
ATOM 2503  C C    . VAL B 1 65 ? -17.084 23.659  -42.816 1.00 0.00 ? 128 VAL B C    1 
ATOM 2504  O O    . VAL B 1 65 ? -17.272 22.953  -41.825 1.00 0.00 ? 128 VAL B O    1 
ATOM 2505  C CB   . VAL B 1 65 ? -14.633 23.597  -43.304 1.00 0.00 ? 128 VAL B CB   1 
ATOM 2506  C CG1  . VAL B 1 65 ? -14.957 22.756  -44.530 1.00 0.00 ? 128 VAL B CG1  1 
ATOM 2507  C CG2  . VAL B 1 65 ? -13.392 24.442  -43.543 1.00 0.00 ? 128 VAL B CG2  1 
ATOM 2508  H H    . VAL B 1 65 ? -15.507 24.720  -40.829 1.00 0.00 ? 128 VAL B H    1 
ATOM 2509  H HA   . VAL B 1 65 ? -15.992 25.198  -43.746 1.00 0.00 ? 128 VAL B HA   1 
ATOM 2510  H HB   . VAL B 1 65 ? -14.448 22.930  -42.469 1.00 0.00 ? 128 VAL B HB   1 
ATOM 2511  H HG11 . VAL B 1 65 ? -15.888 22.214  -44.398 1.00 0.00 ? 128 VAL B HG11 1 
ATOM 2512  H HG12 . VAL B 1 65 ? -14.157 22.041  -44.681 1.00 0.00 ? 128 VAL B HG12 1 
ATOM 2513  H HG13 . VAL B 1 65 ? -15.040 23.402  -45.403 1.00 0.00 ? 128 VAL B HG13 1 
ATOM 2514  H HG21 . VAL B 1 65 ? -13.370 24.806  -44.569 1.00 0.00 ? 128 VAL B HG21 1 
ATOM 2515  H HG22 . VAL B 1 65 ? -12.523 23.823  -43.369 1.00 0.00 ? 128 VAL B HG22 1 
ATOM 2516  H HG23 . VAL B 1 65 ? -13.371 25.291  -42.858 1.00 0.00 ? 128 VAL B HG23 1 
ATOM 2517  N N    . ASP B 1 66 ? -17.948 23.736  -43.823 1.00 0.00 ? 129 ASP B N    1 
ATOM 2518  C CA   . ASP B 1 66 ? -19.227 23.039  -43.791 1.00 0.00 ? 129 ASP B CA   1 
ATOM 2519  C C    . ASP B 1 66 ? -19.086 21.602  -44.279 1.00 0.00 ? 129 ASP B C    1 
ATOM 2520  O O    . ASP B 1 66 ? -18.708 21.361  -45.426 1.00 0.00 ? 129 ASP B O    1 
ATOM 2521  C CB   . ASP B 1 66 ? -20.261 23.776  -44.646 1.00 0.00 ? 129 ASP B CB   1 
ATOM 2522  C CG   . ASP B 1 66 ? -21.660 23.184  -44.524 1.00 0.00 ? 129 ASP B CG   1 
ATOM 2523  O OD1  . ASP B 1 66 ? -21.789 22.125  -43.958 1.00 0.00 ? 129 ASP B OD1  1 
ATOM 2524  O OD2  . ASP B 1 66 ? -22.585 23.799  -44.998 1.00 0.00 ? 129 ASP B OD2  1 
ATOM 2525  H H    . ASP B 1 66 ? -17.734 24.351  -44.610 1.00 0.00 ? 129 ASP B H    1 
ATOM 2526  H HA   . ASP B 1 66 ? -19.610 23.080  -42.785 1.00 0.00 ? 129 ASP B HA   1 
ATOM 2527  H HB2  . ASP B 1 66 ? -20.284 24.818  -44.396 1.00 0.00 ? 129 ASP B HB2  1 
ATOM 2528  H HB3  . ASP B 1 66 ? -19.953 23.676  -45.686 1.00 0.00 ? 129 ASP B HB3  1 
ATOM 2529  N N    . PRO B 1 67 ? -19.392 20.652  -43.402 1.00 0.00 ? 130 PRO B N    1 
ATOM 2530  C CA   . PRO B 1 67 ? -19.302 19.238  -43.744 1.00 0.00 ? 130 PRO B CA   1 
ATOM 2531  C C    . PRO B 1 67 ? -20.071 18.929  -45.021 1.00 0.00 ? 130 PRO B C    1 
ATOM 2532  O O    . PRO B 1 67 ? -19.678 18.062  -45.802 1.00 0.00 ? 130 PRO B O    1 
ATOM 2533  C CB   . PRO B 1 67 ? -19.927 18.549  -42.527 1.00 0.00 ? 130 PRO B CB   1 
ATOM 2534  C CG   . PRO B 1 67 ? -19.634 19.471  -41.393 1.00 0.00 ? 130 PRO B CG   1 
ATOM 2535  C CD   . PRO B 1 67 ? -19.786 20.848  -41.981 1.00 0.00 ? 130 PRO B CD   1 
ATOM 2536  H HA   . PRO B 1 67 ? -18.275 18.938  -43.866 1.00 0.00 ? 130 PRO B HA   1 
ATOM 2537  H HB2  . PRO B 1 67 ? -21.007 18.418  -42.664 1.00 0.00 ? 130 PRO B HB2  1 
ATOM 2538  H HB3  . PRO B 1 67 ? -19.448 17.584  -42.353 1.00 0.00 ? 130 PRO B HB3  1 
ATOM 2539  H HG2  . PRO B 1 67 ? -20.375 19.318  -40.602 1.00 0.00 ? 130 PRO B HG2  1 
ATOM 2540  H HG3  . PRO B 1 67 ? -18.637 19.329  -40.992 1.00 0.00 ? 130 PRO B HG3  1 
ATOM 2541  H HD2  . PRO B 1 67 ? -20.818 21.202  -41.908 1.00 0.00 ? 130 PRO B HD2  1 
ATOM 2542  H HD3  . PRO B 1 67 ? -19.103 21.526  -41.475 1.00 0.00 ? 130 PRO B HD3  1 
ATOM 2543  N N    . LEU B 1 68 ? -21.173 19.643  -45.230 1.00 0.00 ? 131 LEU B N    1 
ATOM 2544  C CA   . LEU B 1 68 ? -22.079 19.352  -46.334 1.00 0.00 ? 131 LEU B CA   1 
ATOM 2545  C C    . LEU B 1 68 ? -21.476 19.773  -47.668 1.00 0.00 ? 131 LEU B C    1 
ATOM 2546  O O    . LEU B 1 68 ? -21.864 19.271  -48.723 1.00 0.00 ? 131 LEU B O    1 
ATOM 2547  C CB   . LEU B 1 68 ? -23.419 20.066  -46.123 1.00 0.00 ? 131 LEU B CB   1 
ATOM 2548  C CG   . LEU B 1 68 ? -24.242 19.595  -44.917 1.00 0.00 ? 131 LEU B CG   1 
ATOM 2549  C CD1  . LEU B 1 68 ? -25.477 20.474  -44.769 1.00 0.00 ? 131 LEU B CD1  1 
ATOM 2550  C CD2  . LEU B 1 68 ? -24.630 18.134  -45.105 1.00 0.00 ? 131 LEU B CD2  1 
ATOM 2551  H H    . LEU B 1 68 ? -21.454 20.332  -44.530 1.00 0.00 ? 131 LEU B H    1 
ATOM 2552  H HA   . LEU B 1 68 ? -22.269 18.283  -46.373 1.00 0.00 ? 131 LEU B HA   1 
ATOM 2553  H HB2  . LEU B 1 68 ? -23.221 21.129  -46.000 1.00 0.00 ? 131 LEU B HB2  1 
ATOM 2554  H HB3  . LEU B 1 68 ? -24.024 19.932  -47.022 1.00 0.00 ? 131 LEU B HB3  1 
ATOM 2555  H HG   . LEU B 1 68 ? -23.628 19.692  -44.021 1.00 0.00 ? 131 LEU B HG   1 
ATOM 2556  H HD11 . LEU B 1 68 ? -26.102 20.369  -45.657 1.00 0.00 ? 131 LEU B HD11 1 
ATOM 2557  H HD12 . LEU B 1 68 ? -25.176 21.516  -44.658 1.00 0.00 ? 131 LEU B HD12 1 
ATOM 2558  H HD13 . LEU B 1 68 ? -26.039 20.162  -43.890 1.00 0.00 ? 131 LEU B HD13 1 
ATOM 2559  H HD21 . LEU B 1 68 ? -24.907 17.954  -46.145 1.00 0.00 ? 131 LEU B HD21 1 
ATOM 2560  H HD22 . LEU B 1 68 ? -25.481 17.904  -44.460 1.00 0.00 ? 131 LEU B HD22 1 
ATOM 2561  H HD23 . LEU B 1 68 ? -23.797 17.487  -44.836 1.00 0.00 ? 131 LEU B HD23 1 
ATOM 2562  N N    . THR B 1 69 ? -20.523 20.699  -47.614 1.00 0.00 ? 132 THR B N    1 
ATOM 2563  C CA   . THR B 1 69 ? -19.887 21.213  -48.821 1.00 0.00 ? 132 THR B CA   1 
ATOM 2564  C C    . THR B 1 69 ? -18.649 20.402  -49.180 1.00 0.00 ? 132 THR B C    1 
ATOM 2565  O O    . THR B 1 69 ? -18.017 20.638  -50.210 1.00 0.00 ? 132 THR B O    1 
ATOM 2566  C CB   . THR B 1 69 ? -19.503 22.696  -48.655 1.00 0.00 ? 132 THR B CB   1 
ATOM 2567  O OG1  . THR B 1 69 ? -18.569 22.832  -47.576 1.00 0.00 ? 132 THR B OG1  1 
ATOM 2568  C CG2  . THR B 1 69 ? -20.736 23.537  -48.363 1.00 0.00 ? 132 THR B CG2  1 
ATOM 2569  H H    . THR B 1 69 ? -20.251 21.081  -46.709 1.00 0.00 ? 132 THR B H    1 
ATOM 2570  H HA   . THR B 1 69 ? -20.593 21.146  -49.653 1.00 0.00 ? 132 THR B HA   1 
ATOM 2571  H HB   . THR B 1 69 ? -19.059 23.049  -49.571 1.00 0.00 ? 132 THR B HB   1 
ATOM 2572  H HG1  . THR B 1 69 ? -18.215 23.724  -47.601 1.00 0.00 ? 132 THR B HG1  1 
ATOM 2573  H HG21 . THR B 1 69 ? -20.432 24.536  -48.048 1.00 0.00 ? 132 THR B HG21 1 
ATOM 2574  H HG22 . THR B 1 69 ? -21.314 23.065  -47.570 1.00 0.00 ? 132 THR B HG22 1 
ATOM 2575  H HG23 . THR B 1 69 ? -21.346 23.613  -49.264 1.00 0.00 ? 132 THR B HG23 1 
ATOM 2576  N N    . ILE B 1 70 ? -18.308 19.443  -48.327 1.00 0.00 ? 133 ILE B N    1 
ATOM 2577  C CA   . ILE B 1 70 ? -17.152 18.587  -48.558 1.00 0.00 ? 133 ILE B CA   1 
ATOM 2578  C C    . ILE B 1 70 ? -17.531 17.358  -49.376 1.00 0.00 ? 133 ILE B C    1 
ATOM 2579  O O    . ILE B 1 70 ? -18.389 16.575  -48.973 1.00 0.00 ? 133 ILE B O    1 
ATOM 2580  C CB   . ILE B 1 70 ? -16.521 18.142  -47.225 1.00 0.00 ? 133 ILE B CB   1 
ATOM 2581  C CG1  . ILE B 1 70 ? -16.007 19.358  -46.449 1.00 0.00 ? 133 ILE B CG1  1 
ATOM 2582  C CG2  . ILE B 1 70 ? -15.396 17.150  -47.474 1.00 0.00 ? 133 ILE B CG2  1 
ATOM 2583  C CD1  . ILE B 1 70 ? -15.542 19.033  -45.046 1.00 0.00 ? 133 ILE B CD1  1 
ATOM 2584  H H    . ILE B 1 70 ? -18.879 19.295  -47.495 1.00 0.00 ? 133 ILE B H    1 
ATOM 2585  H HA   . ILE B 1 70 ? -16.408 19.104  -49.129 1.00 0.00 ? 133 ILE B HA   1 
ATOM 2586  H HB   . ILE B 1 70 ? -17.290 17.650  -46.627 1.00 0.00 ? 133 ILE B HB   1 
ATOM 2587  H HG12 . ILE B 1 70 ? -15.138 19.740  -46.978 1.00 0.00 ? 133 ILE B HG12 1 
ATOM 2588  H HG13 . ILE B 1 70 ? -16.782 20.124  -46.414 1.00 0.00 ? 133 ILE B HG13 1 
ATOM 2589  H HG21 . ILE B 1 70 ? -15.810 16.195  -47.797 1.00 0.00 ? 133 ILE B HG21 1 
ATOM 2590  H HG22 . ILE B 1 70 ? -14.824 17.001  -46.561 1.00 0.00 ? 133 ILE B HG22 1 
ATOM 2591  H HG23 . ILE B 1 70 ? -14.741 17.542  -48.254 1.00 0.00 ? 133 ILE B HG23 1 
ATOM 2592  H HD11 . ILE B 1 70 ? -14.489 18.743  -45.045 1.00 0.00 ? 133 ILE B HD11 1 
ATOM 2593  H HD12 . ILE B 1 70 ? -15.671 19.912  -44.414 1.00 0.00 ? 133 ILE B HD12 1 
ATOM 2594  H HD13 . ILE B 1 70 ? -16.141 18.214  -44.649 1.00 0.00 ? 133 ILE B HD13 1 
ATOM 2595  N N    . THR B 1 71 ? -16.883 17.195  -50.524 1.00 0.00 ? 134 THR B N    1 
ATOM 2596  C CA   . THR B 1 71 ? -17.168 16.076  -51.413 1.00 0.00 ? 134 THR B CA   1 
ATOM 2597  C C    . THR B 1 71 ? -15.897 15.315  -51.765 1.00 0.00 ? 134 THR B C    1 
ATOM 2598  O O    . THR B 1 71 ? -14.871 15.915  -52.083 1.00 0.00 ? 134 THR B O    1 
ATOM 2599  C CB   . THR B 1 71 ? -17.861 16.552  -52.703 1.00 0.00 ? 134 THR B CB   1 
ATOM 2600  O OG1  . THR B 1 71 ? -19.092 17.207  -52.374 1.00 0.00 ? 134 THR B OG1  1 
ATOM 2601  C CG2  . THR B 1 71 ? -18.147 15.375  -53.622 1.00 0.00 ? 134 THR B CG2  1 
ATOM 2602  H H    . THR B 1 71 ? -16.179 17.879  -50.800 1.00 0.00 ? 134 THR B H    1 
ATOM 2603  H HA   . THR B 1 71 ? -17.843 15.375  -50.914 1.00 0.00 ? 134 THR B HA   1 
ATOM 2604  H HB   . THR B 1 71 ? -17.206 17.256  -53.218 1.00 0.00 ? 134 THR B HB   1 
ATOM 2605  H HG1  . THR B 1 71 ? -18.919 17.828  -51.663 1.00 0.00 ? 134 THR B HG1  1 
ATOM 2606  H HG21 . THR B 1 71 ? -18.610 14.573  -53.049 1.00 0.00 ? 134 THR B HG21 1 
ATOM 2607  H HG22 . THR B 1 71 ? -17.212 15.016  -54.054 1.00 0.00 ? 134 THR B HG22 1 
ATOM 2608  H HG23 . THR B 1 71 ? -18.821 15.687  -54.420 1.00 0.00 ? 134 THR B HG23 1 
ATOM 2609  N N    . SER B 1 72 ? -15.970 13.989  -51.707 1.00 0.00 ? 135 SER B N    1 
ATOM 2610  C CA   . SER B 1 72 ? -14.835 13.143  -52.053 1.00 0.00 ? 135 SER B CA   1 
ATOM 2611  C C    . SER B 1 72 ? -14.838 12.795  -53.537 1.00 0.00 ? 135 SER B C    1 
ATOM 2612  O O    . SER B 1 72 ? -15.873 12.874  -54.199 1.00 0.00 ? 135 SER B O    1 
ATOM 2613  C CB   . SER B 1 72 ? -14.862 11.871  -51.227 1.00 0.00 ? 135 SER B CB   1 
ATOM 2614  O OG   . SER B 1 72 ? -15.917 11.039  -51.619 1.00 0.00 ? 135 SER B OG   1 
ATOM 2615  H H    . SER B 1 72 ? -16.853 13.552  -51.439 1.00 0.00 ? 135 SER B H    1 
ATOM 2616  H HA   . SER B 1 72 ? -13.927 13.664  -51.836 1.00 0.00 ? 135 SER B HA   1 
ATOM 2617  H HB2  . SER B 1 72 ? -13.926 11.349  -51.332 1.00 0.00 ? 135 SER B HB2  1 
ATOM 2618  H HB3  . SER B 1 72 ? -15.004 12.143  -50.179 1.00 0.00 ? 135 SER B HB3  1 
ATOM 2619  H HG   . SER B 1 72 ? -16.717 11.570  -51.656 1.00 0.00 ? 135 SER B HG   1 
ATOM 2620  N N    . SER B 1 73 ? -13.675 12.412  -54.052 1.00 0.00 ? 136 SER B N    1 
ATOM 2621  C CA   . SER B 1 73 ? -13.545 12.039  -55.454 1.00 0.00 ? 136 SER B CA   1 
ATOM 2622  C C    . SER B 1 73 ? -12.305 11.184  -55.684 1.00 0.00 ? 136 SER B C    1 
ATOM 2623  O O    . SER B 1 73 ? -11.188 11.600  -55.379 1.00 0.00 ? 136 SER B O    1 
ATOM 2624  C CB   . SER B 1 73 ? -13.481 13.281  -56.321 1.00 0.00 ? 136 SER B CB   1 
ATOM 2625  O OG   . SER B 1 73 ? -13.313 12.944  -57.671 1.00 0.00 ? 136 SER B OG   1 
ATOM 2626  H H    . SER B 1 73 ? -12.854 12.367  -53.448 1.00 0.00 ? 136 SER B H    1 
ATOM 2627  H HA   . SER B 1 73 ? -14.422 11.461  -55.748 1.00 0.00 ? 136 SER B HA   1 
ATOM 2628  H HB2  . SER B 1 73 ? -14.404 13.845  -56.214 1.00 0.00 ? 136 SER B HB2  1 
ATOM 2629  H HB3  . SER B 1 73 ? -12.644 13.900  -55.990 1.00 0.00 ? 136 SER B HB3  1 
ATOM 2630  H HG   . SER B 1 73 ? -13.571 12.027  -57.775 1.00 0.00 ? 136 SER B HG   1 
ATOM 2631  N N    . LEU B 1 74 ? -12.509 9.987   -56.225 1.00 0.00 ? 137 LEU B N    1 
ATOM 2632  C CA   . LEU B 1 74 ? -11.421 9.040   -56.420 1.00 0.00 ? 137 LEU B CA   1 
ATOM 2633  C C    . LEU B 1 74 ? -10.968 9.012   -57.874 1.00 0.00 ? 137 LEU B C    1 
ATOM 2634  O O    . LEU B 1 74 ? -11.754 8.713   -58.774 1.00 0.00 ? 137 LEU B O    1 
ATOM 2635  C CB   . LEU B 1 74 ? -11.857 7.633   -55.988 1.00 0.00 ? 137 LEU B CB   1 
ATOM 2636  C CG   . LEU B 1 74 ? -10.818 6.523   -56.189 1.00 0.00 ? 137 LEU B CG   1 
ATOM 2637  C CD1  . LEU B 1 74 ? -9.588  6.817   -55.341 1.00 0.00 ? 137 LEU B CD1  1 
ATOM 2638  C CD2  . LEU B 1 74 ? -11.430 5.182   -55.818 1.00 0.00 ? 137 LEU B CD2  1 
ATOM 2639  H H    . LEU B 1 74 ? -13.462 9.698   -56.443 1.00 0.00 ? 137 LEU B H    1 
ATOM 2640  H HA   . LEU B 1 74 ? -10.581 9.337   -55.815 1.00 0.00 ? 137 LEU B HA   1 
ATOM 2641  H HB2  . LEU B 1 74 ? -12.118 7.663   -54.939 1.00 0.00 ? 137 LEU B HB2  1 
ATOM 2642  H HB3  . LEU B 1 74 ? -12.750 7.372   -56.557 1.00 0.00 ? 137 LEU B HB3  1 
ATOM 2643  H HG   . LEU B 1 74 ? -10.526 6.498   -57.238 1.00 0.00 ? 137 LEU B HG   1 
ATOM 2644  H HD11 . LEU B 1 74 ? -9.873  6.881   -54.294 1.00 0.00 ? 137 LEU B HD11 1 
ATOM 2645  H HD12 . LEU B 1 74 ? -9.107  7.738   -55.656 1.00 0.00 ? 137 LEU B HD12 1 
ATOM 2646  H HD13 . LEU B 1 74 ? -8.895  6.004   -55.478 1.00 0.00 ? 137 LEU B HD13 1 
ATOM 2647  H HD21 . LEU B 1 74 ? -11.921 5.259   -54.846 1.00 0.00 ? 137 LEU B HD21 1 
ATOM 2648  H HD22 . LEU B 1 74 ? -10.646 4.426   -55.770 1.00 0.00 ? 137 LEU B HD22 1 
ATOM 2649  H HD23 . LEU B 1 74 ? -12.162 4.896   -56.573 1.00 0.00 ? 137 LEU B HD23 1 
ATOM 2650  N N    . SER B 1 75 ? -9.695  9.326   -58.099 1.00 0.00 ? 138 SER B N    1 
ATOM 2651  C CA   . SER B 1 75 ? -9.150  9.394   -59.451 1.00 0.00 ? 138 SER B CA   1 
ATOM 2652  C C    . SER B 1 75 ? -8.788  8.009   -59.969 1.00 0.00 ? 138 SER B C    1 
ATOM 2653  O O    . SER B 1 75 ? -8.734  7.044   -59.207 1.00 0.00 ? 138 SER B O    1 
ATOM 2654  C CB   . SER B 1 75 ? -7.929  10.291  -59.475 1.00 0.00 ? 138 SER B CB   1 
ATOM 2655  O OG   . SER B 1 75 ? -6.851  9.686   -58.816 1.00 0.00 ? 138 SER B OG   1 
ATOM 2656  H H    . SER B 1 75 ? -9.097  9.568   -57.311 1.00 0.00 ? 138 SER B H    1 
ATOM 2657  H HA   . SER B 1 75 ? -9.904  9.823   -60.116 1.00 0.00 ? 138 SER B HA   1 
ATOM 2658  H HB2  . SER B 1 75 ? -7.643  10.486  -60.506 1.00 0.00 ? 138 SER B HB2  1 
ATOM 2659  H HB3  . SER B 1 75 ? -8.175  11.239  -58.990 1.00 0.00 ? 138 SER B HB3  1 
ATOM 2660  H HG   . SER B 1 75 ? -6.803  8.774   -59.111 1.00 0.00 ? 138 SER B HG   1 
ATOM 2661  N N    . SER B 1 76 ? -8.536  7.918   -61.270 1.00 0.00 ? 139 SER B N    1 
ATOM 2662  C CA   . SER B 1 76 ? -8.111  6.665   -61.882 1.00 0.00 ? 139 SER B CA   1 
ATOM 2663  C C    . SER B 1 76 ? -6.697  6.294   -61.452 1.00 0.00 ? 139 SER B C    1 
ATOM 2664  O O    . SER B 1 76 ? -6.287  5.140   -61.569 1.00 0.00 ? 139 SER B O    1 
ATOM 2665  C CB   . SER B 1 76 ? -8.177  6.773   -63.394 1.00 0.00 ? 139 SER B CB   1 
ATOM 2666  O OG   . SER B 1 76 ? -7.216  7.671   -63.875 1.00 0.00 ? 139 SER B OG   1 
ATOM 2667  H H    . SER B 1 76 ? -8.589  8.758   -61.846 1.00 0.00 ? 139 SER B H    1 
ATOM 2668  H HA   . SER B 1 76 ? -8.793  5.879   -61.555 1.00 0.00 ? 139 SER B HA   1 
ATOM 2669  H HB2  . SER B 1 76 ? -7.992  5.796   -63.832 1.00 0.00 ? 139 SER B HB2  1 
ATOM 2670  H HB3  . SER B 1 76 ? -9.175  7.113   -63.684 1.00 0.00 ? 139 SER B HB3  1 
ATOM 2671  H HG   . SER B 1 76 ? -7.664  8.339   -64.401 1.00 0.00 ? 139 SER B HG   1 
ATOM 2672  N N    . ASP B 1 77 ? -5.958  7.280   -60.953 1.00 0.00 ? 140 ASP B N    1 
ATOM 2673  C CA   . ASP B 1 77 ? -4.616  7.043   -60.435 1.00 0.00 ? 140 ASP B CA   1 
ATOM 2674  C C    . ASP B 1 77 ? -4.661  6.555   -58.992 1.00 0.00 ? 140 ASP B C    1 
ATOM 2675  O O    . ASP B 1 77 ? -3.637  6.177   -58.424 1.00 0.00 ? 140 ASP B O    1 
ATOM 2676  C CB   . ASP B 1 77 ? -3.776  8.321   -60.522 1.00 0.00 ? 140 ASP B CB   1 
ATOM 2677  C CG   . ASP B 1 77 ? -3.467  8.731   -61.956 1.00 0.00 ? 140 ASP B CG   1 
ATOM 2678  O OD1  . ASP B 1 77 ? -3.477  7.877   -62.812 1.00 0.00 ? 140 ASP B OD1  1 
ATOM 2679  O OD2  . ASP B 1 77 ? -3.223  9.890   -62.181 1.00 0.00 ? 140 ASP B OD2  1 
ATOM 2680  H H    . ASP B 1 77 ? -6.364  8.212   -60.871 1.00 0.00 ? 140 ASP B H    1 
ATOM 2681  H HA   . ASP B 1 77 ? -4.135  6.280   -61.049 1.00 0.00 ? 140 ASP B HA   1 
ATOM 2682  H HB2  . ASP B 1 77 ? -4.328  9.127   -60.041 1.00 0.00 ? 140 ASP B HB2  1 
ATOM 2683  H HB3  . ASP B 1 77 ? -2.836  8.165   -59.991 1.00 0.00 ? 140 ASP B HB3  1 
ATOM 2684  N N    . GLY B 1 78 ? -5.852  6.565   -58.406 1.00 0.00 ? 141 GLY B N    1 
ATOM 2685  C CA   . GLY B 1 78 ? -6.035  6.111   -57.034 1.00 0.00 ? 141 GLY B CA   1 
ATOM 2686  C C    . GLY B 1 78 ? -5.694  7.213   -56.038 1.00 0.00 ? 141 GLY B C    1 
ATOM 2687  O O    . GLY B 1 78 ? -5.006  6.974   -55.045 1.00 0.00 ? 141 GLY B O    1 
ATOM 2688  H H    . GLY B 1 78 ? -6.663  6.888   -58.935 1.00 0.00 ? 141 GLY B H    1 
ATOM 2689  H HA2  . GLY B 1 78 ? -7.075  5.830   -56.898 1.00 0.00 ? 141 GLY B HA2  1 
ATOM 2690  H HA3  . GLY B 1 78 ? -5.431  5.253   -56.860 1.00 0.00 ? 141 GLY B HA3  1 
ATOM 2691  N N    . VAL B 1 79 ? -6.180  8.419   -56.310 1.00 0.00 ? 142 VAL B N    1 
ATOM 2692  C CA   . VAL B 1 79 ? -6.079  9.518   -55.359 1.00 0.00 ? 142 VAL B CA   1 
ATOM 2693  C C    . VAL B 1 79 ? -7.457  10.018  -54.944 1.00 0.00 ? 142 VAL B C    1 
ATOM 2694  O O    . VAL B 1 79 ? -8.201  10.563  -55.759 1.00 0.00 ? 142 VAL B O    1 
ATOM 2695  C CB   . VAL B 1 79 ? -5.276  10.681  -55.970 1.00 0.00 ? 142 VAL B CB   1 
ATOM 2696  C CG1  . VAL B 1 79 ? -5.178  11.837  -54.984 1.00 0.00 ? 142 VAL B CG1  1 
ATOM 2697  C CG2  . VAL B 1 79 ? -3.892  10.201  -56.376 1.00 0.00 ? 142 VAL B CG2  1 
ATOM 2698  H H    . VAL B 1 79 ? -6.763  8.540   -57.137 1.00 0.00 ? 142 VAL B H    1 
ATOM 2699  H HA   . VAL B 1 79 ? -5.552  9.186   -54.460 1.00 0.00 ? 142 VAL B HA   1 
ATOM 2700  H HB   . VAL B 1 79 ? -5.802  11.029  -56.860 1.00 0.00 ? 142 VAL B HB   1 
ATOM 2701  H HG11 . VAL B 1 79 ? -6.161  12.132  -54.627 1.00 0.00 ? 142 VAL B HG11 1 
ATOM 2702  H HG12 . VAL B 1 79 ? -4.718  12.688  -55.481 1.00 0.00 ? 142 VAL B HG12 1 
ATOM 2703  H HG13 . VAL B 1 79 ? -4.560  11.532  -54.139 1.00 0.00 ? 142 VAL B HG13 1 
ATOM 2704  H HG21 . VAL B 1 79 ? -3.340  9.908   -55.482 1.00 0.00 ? 142 VAL B HG21 1 
ATOM 2705  H HG22 . VAL B 1 79 ? -3.359  11.003  -56.886 1.00 0.00 ? 142 VAL B HG22 1 
ATOM 2706  H HG23 . VAL B 1 79 ? -3.982  9.343   -57.043 1.00 0.00 ? 142 VAL B HG23 1 
ATOM 2707  N N    . LEU B 1 80 ? -7.793  9.827   -53.673 1.00 0.00 ? 143 LEU B N    1 
ATOM 2708  C CA   . LEU B 1 80 ? -9.078  10.267  -53.146 1.00 0.00 ? 143 LEU B CA   1 
ATOM 2709  C C    . LEU B 1 80 ? -8.997  11.692  -52.614 1.00 0.00 ? 143 LEU B C    1 
ATOM 2710  O O    . LEU B 1 80 ? -8.259  11.972  -51.670 1.00 0.00 ? 143 LEU B O    1 
ATOM 2711  C CB   . LEU B 1 80 ? -9.544  9.324   -52.029 1.00 0.00 ? 143 LEU B CB   1 
ATOM 2712  C CG   . LEU B 1 80 ? -10.881 9.683   -51.369 1.00 0.00 ? 143 LEU B CG   1 
ATOM 2713  C CD1  . LEU B 1 80 ? -12.018 9.420   -52.348 1.00 0.00 ? 143 LEU B CD1  1 
ATOM 2714  C CD2  . LEU B 1 80 ? -11.055 8.868   -50.096 1.00 0.00 ? 143 LEU B CD2  1 
ATOM 2715  H H    . LEU B 1 80 ? -7.127  9.374   -53.047 1.00 0.00 ? 143 LEU B H    1 
ATOM 2716  H HA   . LEU B 1 80 ? -9.817  10.248  -53.936 1.00 0.00 ? 143 LEU B HA   1 
ATOM 2717  H HB2  . LEU B 1 80 ? -9.641  8.334   -52.461 1.00 0.00 ? 143 LEU B HB2  1 
ATOM 2718  H HB3  . LEU B 1 80 ? -8.775  9.279   -51.294 1.00 0.00 ? 143 LEU B HB3  1 
ATOM 2719  H HG   . LEU B 1 80 ? -10.876 10.747  -51.122 1.00 0.00 ? 143 LEU B HG   1 
ATOM 2720  H HD11 . LEU B 1 80 ? -12.043 10.198  -53.110 1.00 0.00 ? 143 LEU B HD11 1 
ATOM 2721  H HD12 . LEU B 1 80 ? -12.961 9.408   -51.810 1.00 0.00 ? 143 LEU B HD12 1 
ATOM 2722  H HD13 . LEU B 1 80 ? -11.878 8.455   -52.817 1.00 0.00 ? 143 LEU B HD13 1 
ATOM 2723  H HD21 . LEU B 1 80 ? -10.137 8.345   -49.831 1.00 0.00 ? 143 LEU B HD21 1 
ATOM 2724  H HD22 . LEU B 1 80 ? -11.839 8.132   -50.228 1.00 0.00 ? 143 LEU B HD22 1 
ATOM 2725  H HD23 . LEU B 1 80 ? -11.333 9.532   -49.274 1.00 0.00 ? 143 LEU B HD23 1 
ATOM 2726  N N    . THR B 1 81 ? -9.760  12.590  -53.227 1.00 0.00 ? 144 THR B N    1 
ATOM 2727  C CA   . THR B 1 81 ? -9.711  14.006  -52.876 1.00 0.00 ? 144 THR B CA   1 
ATOM 2728  C C    . THR B 1 81 ? -10.964 14.431  -52.120 1.00 0.00 ? 144 THR B C    1 
ATOM 2729  O O    . THR B 1 81 ? -12.050 14.507  -52.697 1.00 0.00 ? 144 THR B O    1 
ATOM 2730  C CB   . THR B 1 81 ? -9.540  14.882  -54.130 1.00 0.00 ? 144 THR B CB   1 
ATOM 2731  O OG1  . THR B 1 81 ? -8.301  14.559  -54.777 1.00 0.00 ? 144 THR B OG1  1 
ATOM 2732  C CG2  . THR B 1 81 ? -9.543  16.355  -53.754 1.00 0.00 ? 144 THR B CG2  1 
ATOM 2733  H H    . THR B 1 81 ? -10.342 12.296  -54.005 1.00 0.00 ? 144 THR B H    1 
ATOM 2734  H HA   . THR B 1 81 ? -8.859  14.174  -52.244 1.00 0.00 ? 144 THR B HA   1 
ATOM 2735  H HB   . THR B 1 81 ? -10.364 14.691  -54.817 1.00 0.00 ? 144 THR B HB   1 
ATOM 2736  H HG1  . THR B 1 81 ? -8.451  14.555  -55.726 1.00 0.00 ? 144 THR B HG1  1 
ATOM 2737  H HG21 . THR B 1 81 ? -9.201  16.950  -54.603 1.00 0.00 ? 144 THR B HG21 1 
ATOM 2738  H HG22 . THR B 1 81 ? -8.873  16.514  -52.908 1.00 0.00 ? 144 THR B HG22 1 
ATOM 2739  H HG23 . THR B 1 81 ? -10.551 16.659  -53.482 1.00 0.00 ? 144 THR B HG23 1 
ATOM 2740  N N    . VAL B 1 82 ? -10.809 14.705  -50.831 1.00 0.00 ? 145 VAL B N    1 
ATOM 2741  C CA   . VAL B 1 82 ? -11.927 15.121  -49.994 1.00 0.00 ? 145 VAL B CA   1 
ATOM 2742  C C    . VAL B 1 82 ? -11.848 16.606  -49.665 1.00 0.00 ? 145 VAL B C    1 
ATOM 2743  O O    . VAL B 1 82 ? -10.983 17.038  -48.904 1.00 0.00 ? 145 VAL B O    1 
ATOM 2744  C CB   . VAL B 1 82 ? -11.946 14.309  -48.684 1.00 0.00 ? 145 VAL B CB   1 
ATOM 2745  C CG1  . VAL B 1 82 ? -13.113 14.739  -47.809 1.00 0.00 ? 145 VAL B CG1  1 
ATOM 2746  C CG2  . VAL B 1 82 ? -12.026 12.823  -48.999 1.00 0.00 ? 145 VAL B CG2  1 
ATOM 2747  H H    . VAL B 1 82 ? -9.880  14.620  -50.415 1.00 0.00 ? 145 VAL B H    1 
ATOM 2748  H HA   . VAL B 1 82 ? -12.860 14.950  -50.505 1.00 0.00 ? 145 VAL B HA   1 
ATOM 2749  H HB   . VAL B 1 82 ? -11.034 14.497  -48.142 1.00 0.00 ? 145 VAL B HB   1 
ATOM 2750  H HG11 . VAL B 1 82 ? -13.220 14.047  -46.974 1.00 0.00 ? 145 VAL B HG11 1 
ATOM 2751  H HG12 . VAL B 1 82 ? -14.025 14.734  -48.404 1.00 0.00 ? 145 VAL B HG12 1 
ATOM 2752  H HG13 . VAL B 1 82 ? -12.936 15.742  -47.423 1.00 0.00 ? 145 VAL B HG13 1 
ATOM 2753  H HG21 . VAL B 1 82 ? -12.842 12.652  -49.684 1.00 0.00 ? 145 VAL B HG21 1 
ATOM 2754  H HG22 . VAL B 1 82 ? -11.096 12.505  -49.465 1.00 0.00 ? 145 VAL B HG22 1 
ATOM 2755  H HG23 . VAL B 1 82 ? -12.188 12.254  -48.084 1.00 0.00 ? 145 VAL B HG23 1 
ATOM 2756  N N    . ASP B 1 83 ? -12.755 17.384  -50.248 1.00 0.00 ? 146 ASP B N    1 
ATOM 2757  C CA   . ASP B 1 83 ? -12.573 18.827  -50.351 1.00 0.00 ? 146 ASP B CA   1 
ATOM 2758  C C    . ASP B 1 83 ? -13.909 19.556  -50.296 1.00 0.00 ? 146 ASP B C    1 
ATOM 2759  O O    . ASP B 1 83 ? -14.776 19.349  -51.143 1.00 0.00 ? 146 ASP B O    1 
ATOM 2760  C CB   . ASP B 1 83 ? -11.845 19.184  -51.648 1.00 0.00 ? 146 ASP B CB   1 
ATOM 2761  C CG   . ASP B 1 83 ? -11.771 20.686  -51.891 1.00 0.00 ? 146 ASP B CG   1 
ATOM 2762  O OD1  . ASP B 1 83 ? -12.528 21.403  -51.286 1.00 0.00 ? 146 ASP B OD1  1 
ATOM 2763  O OD2  . ASP B 1 83 ? -10.955 21.100  -52.682 1.00 0.00 ? 146 ASP B OD2  1 
ATOM 2764  H H    . ASP B 1 83 ? -13.404 16.945  -50.901 1.00 0.00 ? 146 ASP B H    1 
ATOM 2765  H HA   . ASP B 1 83 ? -11.992 19.139  -49.510 1.00 0.00 ? 146 ASP B HA   1 
ATOM 2766  H HB2  . ASP B 1 83 ? -10.836 18.779  -51.616 1.00 0.00 ? 146 ASP B HB2  1 
ATOM 2767  H HB3  . ASP B 1 83 ? -12.377 18.723  -52.482 1.00 0.00 ? 146 ASP B HB3  1 
ATOM 2768  N N    . GLY B 1 84 ? -14.071 20.409  -49.288 1.00 0.00 ? 147 GLY B N    1 
ATOM 2769  C CA   . GLY B 1 84 ? -15.217 21.308  -49.223 1.00 0.00 ? 147 GLY B CA   1 
ATOM 2770  C C    . GLY B 1 84 ? -14.796 22.706  -48.791 1.00 0.00 ? 147 GLY B C    1 
ATOM 2771  O O    . GLY B 1 84 ? -14.046 22.870  -47.829 1.00 0.00 ? 147 GLY B O    1 
ATOM 2772  H H    . GLY B 1 84 ? -13.299 20.544  -48.636 1.00 0.00 ? 147 GLY B H    1 
ATOM 2773  H HA2  . GLY B 1 84 ? -15.749 21.288  -50.154 1.00 0.00 ? 147 GLY B HA2  1 
ATOM 2774  H HA3  . GLY B 1 84 ? -15.888 20.973  -48.465 1.00 0.00 ? 147 GLY B HA3  1 
ATOM 2775  N N    . PRO B 1 85 ? -15.281 23.713  -49.509 1.00 0.00 ? 148 PRO B N    1 
ATOM 2776  C CA   . PRO B 1 85 ? -14.983 25.103  -49.180 1.00 0.00 ? 148 PRO B CA   1 
ATOM 2777  C C    . PRO B 1 85 ? -15.468 25.455  -47.780 1.00 0.00 ? 148 PRO B C    1 
ATOM 2778  O O    . PRO B 1 85 ? -16.291 24.745  -47.202 1.00 0.00 ? 148 PRO B O    1 
ATOM 2779  C CB   . PRO B 1 85 ? -15.747 25.882  -50.255 1.00 0.00 ? 148 PRO B CB   1 
ATOM 2780  C CG   . PRO B 1 85 ? -15.878 24.917  -51.384 1.00 0.00 ? 148 PRO B CG   1 
ATOM 2781  C CD   . PRO B 1 85 ? -16.096 23.586  -50.717 1.00 0.00 ? 148 PRO B CD   1 
ATOM 2782  H HA   . PRO B 1 85 ? -13.951 25.288  -49.262 1.00 0.00 ? 148 PRO B HA   1 
ATOM 2783  H HB2  . PRO B 1 85 ? -16.737 26.170  -49.892 1.00 0.00 ? 148 PRO B HB2  1 
ATOM 2784  H HB3  . PRO B 1 85 ? -15.185 26.758  -50.569 1.00 0.00 ? 148 PRO B HB3  1 
ATOM 2785  H HG2  . PRO B 1 85 ? -16.733 25.182  -52.015 1.00 0.00 ? 148 PRO B HG2  1 
ATOM 2786  H HG3  . PRO B 1 85 ? -14.960 24.900  -51.978 1.00 0.00 ? 148 PRO B HG3  1 
ATOM 2787  H HD2  . PRO B 1 85 ? -17.138 23.436  -50.484 1.00 0.00 ? 148 PRO B HD2  1 
ATOM 2788  H HD3  . PRO B 1 85 ? -15.719 22.806  -51.368 1.00 0.00 ? 148 PRO B HD3  1 
ATOM 2789  N N    . ARG B 1 86 ? -14.950 26.552  -47.238 1.00 0.00 ? 149 ARG B N    1 
ATOM 2790  C CA   . ARG B 1 86 ? -15.343 27.010  -45.911 1.00 0.00 ? 149 ARG B CA   1 
ATOM 2791  C C    . ARG B 1 86 ? -16.842 27.262  -45.837 1.00 0.00 ? 149 ARG B C    1 
ATOM 2792  O O    . ARG B 1 86 ? -17.531 27.278  -46.856 1.00 0.00 ? 149 ARG B O    1 
ATOM 2793  C CB   . ARG B 1 86 ? -14.597 28.284  -45.543 1.00 0.00 ? 149 ARG B CB   1 
ATOM 2794  C CG   . ARG B 1 86 ? -13.146 28.082  -45.137 1.00 0.00 ? 149 ARG B CG   1 
ATOM 2795  C CD   . ARG B 1 86 ? -12.545 29.334  -44.609 1.00 0.00 ? 149 ARG B CD   1 
ATOM 2796  N NE   . ARG B 1 86 ? -11.145 29.157  -44.256 1.00 0.00 ? 149 ARG B NE   1 
ATOM 2797  C CZ   . ARG B 1 86 ? -10.339 30.137  -43.807 1.00 0.00 ? 149 ARG B CZ   1 
ATOM 2798  N NH1  . ARG B 1 86 ? -10.807 31.358  -43.663 1.00 0.00 ? 149 ARG B NH1  1 
ATOM 2799  N NH2  . ARG B 1 86 ? -9.078  29.874  -43.511 1.00 0.00 ? 149 ARG B NH2  1 
ATOM 2800  H H    . ARG B 1 86 ? -14.273 27.099  -47.770 1.00 0.00 ? 149 ARG B H    1 
ATOM 2801  H HA   . ARG B 1 86 ? -15.062 26.254  -45.213 1.00 0.00 ? 149 ARG B HA   1 
ATOM 2802  H HB2  . ARG B 1 86 ? -14.618 28.952  -46.399 1.00 0.00 ? 149 ARG B HB2  1 
ATOM 2803  H HB3  . ARG B 1 86 ? -15.116 28.768  -44.710 1.00 0.00 ? 149 ARG B HB3  1 
ATOM 2804  H HG2  . ARG B 1 86 ? -13.104 27.313  -44.365 1.00 0.00 ? 149 ARG B HG2  1 
ATOM 2805  H HG3  . ARG B 1 86 ? -12.577 27.757  -46.007 1.00 0.00 ? 149 ARG B HG3  1 
ATOM 2806  H HD2  . ARG B 1 86 ? -12.632 30.119  -45.358 1.00 0.00 ? 149 ARG B HD2  1 
ATOM 2807  H HD3  . ARG B 1 86 ? -13.095 29.633  -43.715 1.00 0.00 ? 149 ARG B HD3  1 
ATOM 2808  H HE   . ARG B 1 86 ? -10.762 28.260  -44.357 1.00 0.00 ? 149 ARG B HE   1 
ATOM 2809  H HH11 . ARG B 1 86 ? -11.760 31.560  -43.888 1.00 0.00 ? 149 ARG B HH11 1 
ATOM 2810  H HH12 . ARG B 1 86 ? -10.203 32.094  -43.325 1.00 0.00 ? 149 ARG B HH12 1 
ATOM 2811  H HH21 . ARG B 1 86 ? -8.720  28.947  -43.620 1.00 0.00 ? 149 ARG B HH21 1 
ATOM 2812  H HH22 . ARG B 1 86 ? -8.483  30.606  -43.177 1.00 0.00 ? 149 ARG B HH22 1 
ATOM 2813  N N    . LYS B 1 87 ? -17.345 27.457  -44.622 1.00 0.00 ? 150 LYS B N    1 
ATOM 2814  C CA   . LYS B 1 87 ? -18.695 27.972  -44.424 1.00 0.00 ? 150 LYS B CA   1 
ATOM 2815  C C    . LYS B 1 87 ? -18.829 29.388  -44.971 1.00 0.00 ? 150 LYS B C    1 
ATOM 2816  O O    . LYS B 1 87 ? -19.917 29.813  -45.358 1.00 0.00 ? 150 LYS B O    1 
ATOM 2817  C CB   . LYS B 1 87 ? -19.066 27.944  -42.942 1.00 0.00 ? 150 LYS B CB   1 
ATOM 2818  C CG   . LYS B 1 87 ? -19.264 26.546  -42.369 1.00 0.00 ? 150 LYS B CG   1 
ATOM 2819  C CD   . LYS B 1 87 ? -19.433 26.587  -40.858 1.00 0.00 ? 150 LYS B CD   1 
ATOM 2820  C CE   . LYS B 1 87 ? -19.765 25.211  -40.299 1.00 0.00 ? 150 LYS B CE   1 
ATOM 2821  N NZ   . LYS B 1 87 ? -19.943 25.238  -38.823 1.00 0.00 ? 150 LYS B NZ   1 
ATOM 2822  H H    . LYS B 1 87 ? -16.706 27.471  -43.832 1.00 0.00 ? 150 LYS B H    1 
ATOM 2823  H HA   . LYS B 1 87 ? -19.374 27.310  -44.962 1.00 0.00 ? 150 LYS B HA   1 
ATOM 2824  H HB2  . LYS B 1 87 ? -18.263 28.426  -42.386 1.00 0.00 ? 150 LYS B HB2  1 
ATOM 2825  H HB3  . LYS B 1 87 ? -19.985 28.517  -42.800 1.00 0.00 ? 150 LYS B HB3  1 
ATOM 2826  H HG2  . LYS B 1 87 ? -20.176 26.143  -42.782 1.00 0.00 ? 150 LYS B HG2  1 
ATOM 2827  H HG3  . LYS B 1 87 ? -18.421 25.913  -42.632 1.00 0.00 ? 150 LYS B HG3  1 
ATOM 2828  H HD2  . LYS B 1 87 ? -18.500 26.931  -40.410 1.00 0.00 ? 150 LYS B HD2  1 
ATOM 2829  H HD3  . LYS B 1 87 ? -20.234 27.279  -40.601 1.00 0.00 ? 150 LYS B HD3  1 
ATOM 2830  H HE2  . LYS B 1 87 ? -20.689 24.861  -40.760 1.00 0.00 ? 150 LYS B HE2  1 
ATOM 2831  H HE3  . LYS B 1 87 ? -18.959 24.521  -40.551 1.00 0.00 ? 150 LYS B HE3  1 
ATOM 2832  H HZ1  . LYS B 1 87 ? -19.896 26.220  -38.492 1.00 0.00 ? 150 LYS B HZ1  1 
ATOM 2833  H HZ2  . LYS B 1 87 ? -19.188 24.682  -38.371 1.00 0.00 ? 150 LYS B HZ2  1 
ATOM 2834  H HZ3  . LYS B 1 87 ? -20.842 24.844  -38.584 1.00 0.00 ? 150 LYS B HZ3  1 
ATOM 2835  N N    . GLN B 1 88 ? -17.716 30.114  -45.001 1.00 0.00 ? 151 GLN B N    1 
ATOM 2836  C CA   . GLN B 1 88 ? -17.703 31.474  -45.526 1.00 0.00 ? 151 GLN B CA   1 
ATOM 2837  C C    . GLN B 1 88 ? -18.043 31.495  -47.010 1.00 0.00 ? 151 GLN B C    1 
ATOM 2838  O O    . GLN B 1 88 ? -18.722 32.403  -47.489 1.00 0.00 ? 151 GLN B O    1 
ATOM 2839  C CB   . GLN B 1 88 ? -16.336 32.124  -45.293 1.00 0.00 ? 151 GLN B CB   1 
ATOM 2840  C CG   . GLN B 1 88 ? -16.020 32.400  -43.833 1.00 0.00 ? 151 GLN B CG   1 
ATOM 2841  C CD   . GLN B 1 88 ? -14.583 32.843  -43.627 1.00 0.00 ? 151 GLN B CD   1 
ATOM 2842  O OE1  . GLN B 1 88 ? -13.680 32.425  -44.357 1.00 0.00 ? 151 GLN B OE1  1 
ATOM 2843  N NE2  . GLN B 1 88 ? -14.364 33.692  -42.630 1.00 0.00 ? 151 GLN B NE2  1 
ATOM 2844  H H    . GLN B 1 88 ? -16.844 29.702  -44.671 1.00 0.00 ? 151 GLN B H    1 
ATOM 2845  H HA   . GLN B 1 88 ? -18.450 32.057  -44.988 1.00 0.00 ? 151 GLN B HA   1 
ATOM 2846  H HB2  . GLN B 1 88 ? -15.568 31.461  -45.690 1.00 0.00 ? 151 GLN B HB2  1 
ATOM 2847  H HB3  . GLN B 1 88 ? -16.301 33.069  -45.837 1.00 0.00 ? 151 GLN B HB3  1 
ATOM 2848  H HG2  . GLN B 1 88 ? -16.692 33.178  -43.470 1.00 0.00 ? 151 GLN B HG2  1 
ATOM 2849  H HG3  . GLN B 1 88 ? -16.191 31.487  -43.265 1.00 0.00 ? 151 GLN B HG3  1 
ATOM 2850  H HE21 . GLN B 1 88 ? -15.131 34.014  -42.040 1.00 0.00 ? 151 GLN B HE21 1 
ATOM 2851  H HE22 . GLN B 1 88 ? -13.413 34.021  -42.453 1.00 0.00 ? 151 GLN B HE22 1 
ATOM 2852  N N    . VAL B 1 89 ? -17.566 30.490  -47.736 1.00 0.00 ? 152 VAL B N    1 
ATOM 2853  C CA   . VAL B 1 89 ? -17.819 30.390  -49.168 1.00 0.00 ? 152 VAL B CA   1 
ATOM 2854  C C    . VAL B 1 89 ? -19.277 30.050  -49.447 1.00 0.00 ? 152 VAL B C    1 
ATOM 2855  O O    . VAL B 1 89 ? -19.877 29.394  -48.611 1.00 0.00 ? 152 VAL B O    1 
ATOM 2856  C CB   . VAL B 1 89 ? -16.915 29.313  -49.797 1.00 0.00 ? 152 VAL B CB   1 
ATOM 2857  C CG1  . VAL B 1 89 ? -17.247 29.132  -51.271 1.00 0.00 ? 152 VAL B CG1  1 
ATOM 2858  C CG2  . VAL B 1 89 ? -15.454 29.695  -49.617 1.00 0.00 ? 152 VAL B CG2  1 
ATOM 2859  O OXT  . VAL B 1 89 ? -19.784 30.485  -50.467 1.00 0.00 ? 152 VAL B OXT  1 
ATOM 2860  H H    . VAL B 1 89 ? -17.007 29.768  -47.278 1.00 0.00 ? 152 VAL B H    1 
ATOM 2861  H HA   . VAL B 1 89 ? -17.585 31.345  -49.633 1.00 0.00 ? 152 VAL B HA   1 
ATOM 2862  H HB   . VAL B 1 89 ? -17.095 28.375  -49.279 1.00 0.00 ? 152 VAL B HB   1 
ATOM 2863  H HG11 . VAL B 1 89 ? -18.207 28.627  -51.374 1.00 0.00 ? 152 VAL B HG11 1 
ATOM 2864  H HG12 . VAL B 1 89 ? -16.474 28.533  -51.753 1.00 0.00 ? 152 VAL B HG12 1 
ATOM 2865  H HG13 . VAL B 1 89 ? -17.300 30.111  -51.747 1.00 0.00 ? 152 VAL B HG13 1 
ATOM 2866  H HG21 . VAL B 1 89 ? -15.304 30.708  -49.993 1.00 0.00 ? 152 VAL B HG21 1 
ATOM 2867  H HG22 . VAL B 1 89 ? -14.814 29.009  -50.169 1.00 0.00 ? 152 VAL B HG22 1 
ATOM 2868  H HG23 . VAL B 1 89 ? -15.194 29.661  -48.562 1.00 0.00 ? 152 VAL B HG23 1 
ATOM 2869  N N    . GLY A 1 1  ? 10.768  -0.544  -48.367 1.00 0.00 ? 64  GLY A N    2 
ATOM 2870  C CA   . GLY A 1 1  ? 10.109  -1.842  -48.473 1.00 0.00 ? 64  GLY A CA   2 
ATOM 2871  C C    . GLY A 1 1  ? 10.620  -2.808  -47.412 1.00 0.00 ? 64  GLY A C    2 
ATOM 2872  O O    . GLY A 1 1  ? 11.587  -2.515  -46.708 1.00 0.00 ? 64  GLY A O    2 
ATOM 2873  H H1   . GLY A 1 1  ? 11.015  -0.369  -47.404 1.00 0.00 ? 64  GLY A H1   2 
ATOM 2874  H H2   . GLY A 1 1  ? 11.628  -0.546  -48.953 1.00 0.00 ? 64  GLY A H2   2 
ATOM 2875  H H3   . GLY A 1 1  ? 10.122  0.198   -48.700 1.00 0.00 ? 64  GLY A H3   2 
ATOM 2876  H HA2  . GLY A 1 1  ? 9.034   -1.709  -48.348 1.00 0.00 ? 64  GLY A HA2  2 
ATOM 2877  H HA3  . GLY A 1 1  ? 10.302  -2.262  -49.460 1.00 0.00 ? 64  GLY A HA3  2 
ATOM 2878  N N    . LEU A 1 2  ? 9.965   -3.959  -47.304 1.00 0.00 ? 65  LEU A N    2 
ATOM 2879  C CA   . LEU A 1 2  ? 10.352  -4.970  -46.326 1.00 0.00 ? 65  LEU A CA   2 
ATOM 2880  C C    . LEU A 1 2  ? 11.013  -6.163  -47.001 1.00 0.00 ? 65  LEU A C    2 
ATOM 2881  O O    . LEU A 1 2  ? 10.860  -6.372  -48.205 1.00 0.00 ? 65  LEU A O    2 
ATOM 2882  C CB   . LEU A 1 2  ? 9.124   -5.437  -45.534 1.00 0.00 ? 65  LEU A CB   2 
ATOM 2883  C CG   . LEU A 1 2  ? 8.350   -4.337  -44.796 1.00 0.00 ? 65  LEU A CG   2 
ATOM 2884  C CD1  . LEU A 1 2  ? 7.143   -4.947  -44.094 1.00 0.00 ? 65  LEU A CD1  2 
ATOM 2885  C CD2  . LEU A 1 2  ? 9.272   -3.649  -43.798 1.00 0.00 ? 65  LEU A CD2  2 
ATOM 2886  H H    . LEU A 1 2  ? 9.170   -4.139  -47.917 1.00 0.00 ? 65  LEU A H    2 
ATOM 2887  H HA   . LEU A 1 2  ? 11.064  -4.544  -45.615 1.00 0.00 ? 65  LEU A HA   2 
ATOM 2888  H HB2  . LEU A 1 2  ? 8.439   -5.891  -46.245 1.00 0.00 ? 65  LEU A HB2  2 
ATOM 2889  H HB3  . LEU A 1 2  ? 9.434   -6.192  -44.812 1.00 0.00 ? 65  LEU A HB3  2 
ATOM 2890  H HG   . LEU A 1 2  ? 8.008   -3.604  -45.532 1.00 0.00 ? 65  LEU A HG   2 
ATOM 2891  H HD11 . LEU A 1 2  ? 7.415   -5.307  -43.117 1.00 0.00 ? 65  LEU A HD11 2 
ATOM 2892  H HD12 . LEU A 1 2  ? 6.732   -5.772  -44.679 1.00 0.00 ? 65  LEU A HD12 2 
ATOM 2893  H HD13 . LEU A 1 2  ? 6.376   -4.178  -43.987 1.00 0.00 ? 65  LEU A HD13 2 
ATOM 2894  H HD21 . LEU A 1 2  ? 8.663   -3.116  -43.077 1.00 0.00 ? 65  LEU A HD21 2 
ATOM 2895  H HD22 . LEU A 1 2  ? 9.920   -2.941  -44.316 1.00 0.00 ? 65  LEU A HD22 2 
ATOM 2896  H HD23 . LEU A 1 2  ? 9.881   -4.390  -43.282 1.00 0.00 ? 65  LEU A HD23 2 
ATOM 2897  N N    . SER A 1 3  ? 11.748  -6.946  -46.219 1.00 0.00 ? 66  SER A N    2 
ATOM 2898  C CA   . SER A 1 3  ? 12.556  -8.032  -46.762 1.00 0.00 ? 66  SER A CA   2 
ATOM 2899  C C    . SER A 1 3  ? 11.839  -9.370  -46.630 1.00 0.00 ? 66  SER A C    2 
ATOM 2900  O O    . SER A 1 3  ? 11.698  -9.903  -45.529 1.00 0.00 ? 66  SER A O    2 
ATOM 2901  C CB   . SER A 1 3  ? 13.894  -8.092  -46.054 1.00 0.00 ? 66  SER A CB   2 
ATOM 2902  O OG   . SER A 1 3  ? 14.680  -9.140  -46.552 1.00 0.00 ? 66  SER A OG   2 
ATOM 2903  H H    . SER A 1 3  ? 11.850  -6.706  -45.234 1.00 0.00 ? 66  SER A H    2 
ATOM 2904  H HA   . SER A 1 3  ? 12.748  -7.852  -47.823 1.00 0.00 ? 66  SER A HA   2 
ATOM 2905  H HB2  . SER A 1 3  ? 14.423  -7.152  -46.161 1.00 0.00 ? 66  SER A HB2  2 
ATOM 2906  H HB3  . SER A 1 3  ? 13.711  -8.287  -45.013 1.00 0.00 ? 66  SER A HB3  2 
ATOM 2907  H HG   . SER A 1 3  ? 14.163  -9.948  -46.516 1.00 0.00 ? 66  SER A HG   2 
ATOM 2908  N N    . GLU A 1 4  ? 11.392  -9.910  -47.759 1.00 0.00 ? 67  GLU A N    2 
ATOM 2909  C CA   . GLU A 1 4  ? 10.784  -11.236 -47.786 1.00 0.00 ? 67  GLU A CA   2 
ATOM 2910  C C    . GLU A 1 4  ? 11.735  -12.288 -47.227 1.00 0.00 ? 67  GLU A C    2 
ATOM 2911  O O    . GLU A 1 4  ? 12.938  -12.252 -47.487 1.00 0.00 ? 67  GLU A O    2 
ATOM 2912  C CB   . GLU A 1 4  ? 10.377  -11.607 -49.212 1.00 0.00 ? 67  GLU A CB   2 
ATOM 2913  C CG   . GLU A 1 4  ? 9.702   -12.965 -49.340 1.00 0.00 ? 67  GLU A CG   2 
ATOM 2914  C CD   . GLU A 1 4  ? 9.299   -13.288 -50.751 1.00 0.00 ? 67  GLU A CD   2 
ATOM 2915  O OE1  . GLU A 1 4  ? 9.412   -12.429 -51.592 1.00 0.00 ? 67  GLU A OE1  2 
ATOM 2916  O OE2  . GLU A 1 4  ? 8.878   -14.396 -50.990 1.00 0.00 ? 67  GLU A OE2  2 
ATOM 2917  H H    . GLU A 1 4  ? 11.559  -9.424  -48.640 1.00 0.00 ? 67  GLU A H    2 
ATOM 2918  H HA   . GLU A 1 4  ? 9.890   -11.214 -47.174 1.00 0.00 ? 67  GLU A HA   2 
ATOM 2919  H HB2  . GLU A 1 4  ? 9.693   -10.847 -49.592 1.00 0.00 ? 67  GLU A HB2  2 
ATOM 2920  H HB3  . GLU A 1 4  ? 11.272  -11.615 -49.831 1.00 0.00 ? 67  GLU A HB3  2 
ATOM 2921  H HG2  . GLU A 1 4  ? 10.390  -13.730 -48.988 1.00 0.00 ? 67  GLU A HG2  2 
ATOM 2922  H HG3  . GLU A 1 4  ? 8.811   -12.969 -48.710 1.00 0.00 ? 67  GLU A HG3  2 
ATOM 2923  N N    . MET A 1 5  ? 11.187  -13.225 -46.461 1.00 0.00 ? 68  MET A N    2 
ATOM 2924  C CA   . MET A 1 5  ? 11.980  -14.309 -45.892 1.00 0.00 ? 68  MET A CA   2 
ATOM 2925  C C    . MET A 1 5  ? 13.047  -14.784 -46.872 1.00 0.00 ? 68  MET A C    2 
ATOM 2926  O O    . MET A 1 5  ? 12.733  -15.243 -47.970 1.00 0.00 ? 68  MET A O    2 
ATOM 2927  C CB   . MET A 1 5  ? 11.073  -15.469 -45.488 1.00 0.00 ? 68  MET A CB   2 
ATOM 2928  C CG   . MET A 1 5  ? 11.793  -16.619 -44.796 1.00 0.00 ? 68  MET A CG   2 
ATOM 2929  S SD   . MET A 1 5  ? 10.670  -17.931 -44.278 1.00 0.00 ? 68  MET A SD   2 
ATOM 2930  C CE   . MET A 1 5  ? 9.829   -17.137 -42.910 1.00 0.00 ? 68  MET A CE   2 
ATOM 2931  H H    . MET A 1 5  ? 10.182  -13.202 -46.289 1.00 0.00 ? 68  MET A H    2 
ATOM 2932  H HA   . MET A 1 5  ? 12.484  -13.943 -45.002 1.00 0.00 ? 68  MET A HA   2 
ATOM 2933  H HB2  . MET A 1 5  ? 10.288  -15.104 -44.832 1.00 0.00 ? 68  MET A HB2  2 
ATOM 2934  H HB3  . MET A 1 5  ? 10.614  -15.864 -46.394 1.00 0.00 ? 68  MET A HB3  2 
ATOM 2935  H HG2  . MET A 1 5  ? 12.538  -17.032 -45.474 1.00 0.00 ? 68  MET A HG2  2 
ATOM 2936  H HG3  . MET A 1 5  ? 12.295  -16.222 -43.913 1.00 0.00 ? 68  MET A HG3  2 
ATOM 2937  H HE1  . MET A 1 5  ? 10.553  -16.565 -42.330 1.00 0.00 ? 68  MET A HE1  2 
ATOM 2938  H HE2  . MET A 1 5  ? 9.369   -17.891 -42.274 1.00 0.00 ? 68  MET A HE2  2 
ATOM 2939  H HE3  . MET A 1 5  ? 9.061   -16.466 -43.295 1.00 0.00 ? 68  MET A HE3  2 
ATOM 2940  N N    . ARG A 1 6  ? 14.306  -14.671 -46.466 1.00 0.00 ? 69  ARG A N    2 
ATOM 2941  C CA   . ARG A 1 6  ? 15.423  -15.051 -47.324 1.00 0.00 ? 69  ARG A CA   2 
ATOM 2942  C C    . ARG A 1 6  ? 16.240  -16.174 -46.700 1.00 0.00 ? 69  ARG A C    2 
ATOM 2943  O O    . ARG A 1 6  ? 16.819  -16.011 -45.624 1.00 0.00 ? 69  ARG A O    2 
ATOM 2944  C CB   . ARG A 1 6  ? 16.327  -13.856 -47.587 1.00 0.00 ? 69  ARG A CB   2 
ATOM 2945  C CG   . ARG A 1 6  ? 17.582  -14.168 -48.387 1.00 0.00 ? 69  ARG A CG   2 
ATOM 2946  C CD   . ARG A 1 6  ? 18.395  -12.947 -48.630 1.00 0.00 ? 69  ARG A CD   2 
ATOM 2947  N NE   . ARG A 1 6  ? 19.610  -13.243 -49.373 1.00 0.00 ? 69  ARG A NE   2 
ATOM 2948  C CZ   . ARG A 1 6  ? 20.544  -12.334 -49.702 1.00 0.00 ? 69  ARG A CZ   2 
ATOM 2949  N NH1  . ARG A 1 6  ? 20.392  -11.076 -49.351 1.00 0.00 ? 69  ARG A NH1  2 
ATOM 2950  N NH2  . ARG A 1 6  ? 21.617  -12.704 -50.381 1.00 0.00 ? 69  ARG A NH2  2 
ATOM 2951  H H    . ARG A 1 6  ? 14.499  -14.276 -45.547 1.00 0.00 ? 69  ARG A H    2 
ATOM 2952  H HA   . ARG A 1 6  ? 15.050  -15.404 -48.290 1.00 0.00 ? 69  ARG A HA   2 
ATOM 2953  H HB2  . ARG A 1 6  ? 15.755  -13.103 -48.129 1.00 0.00 ? 69  ARG A HB2  2 
ATOM 2954  H HB3  . ARG A 1 6  ? 16.627  -13.439 -46.624 1.00 0.00 ? 69  ARG A HB3  2 
ATOM 2955  H HG2  . ARG A 1 6  ? 18.190  -14.884 -47.838 1.00 0.00 ? 69  ARG A HG2  2 
ATOM 2956  H HG3  . ARG A 1 6  ? 17.291  -14.595 -49.347 1.00 0.00 ? 69  ARG A HG3  2 
ATOM 2957  H HD2  . ARG A 1 6  ? 17.800  -12.233 -49.198 1.00 0.00 ? 69  ARG A HD2  2 
ATOM 2958  H HD3  . ARG A 1 6  ? 18.666  -12.506 -47.670 1.00 0.00 ? 69  ARG A HD3  2 
ATOM 2959  H HE   . ARG A 1 6  ? 19.757  -14.171 -49.651 1.00 0.00 ? 69  ARG A HE   2 
ATOM 2960  H HH11 . ARG A 1 6  ? 19.582  -10.793 -48.836 1.00 0.00 ? 69  ARG A HH11 2 
ATOM 2961  H HH12 . ARG A 1 6  ? 21.094  -10.395 -49.601 1.00 0.00 ? 69  ARG A HH12 2 
ATOM 2962  H HH21 . ARG A 1 6  ? 21.737  -13.659 -50.652 1.00 0.00 ? 69  ARG A HH21 2 
ATOM 2963  H HH22 . ARG A 1 6  ? 22.311  -12.024 -50.623 1.00 0.00 ? 69  ARG A HH22 2 
ATOM 2964  N N    . LEU A 1 7  ? 16.283  -17.316 -47.378 1.00 0.00 ? 70  LEU A N    2 
ATOM 2965  C CA   . LEU A 1 7  ? 17.023  -18.472 -46.888 1.00 0.00 ? 70  LEU A CA   2 
ATOM 2966  C C    . LEU A 1 7  ? 18.508  -18.353 -47.207 1.00 0.00 ? 70  LEU A C    2 
ATOM 2967  O O    . LEU A 1 7  ? 18.906  -18.388 -48.370 1.00 0.00 ? 70  LEU A O    2 
ATOM 2968  C CB   . LEU A 1 7  ? 16.463  -19.761 -47.502 1.00 0.00 ? 70  LEU A CB   2 
ATOM 2969  C CG   . LEU A 1 7  ? 15.141  -20.263 -46.903 1.00 0.00 ? 70  LEU A CG   2 
ATOM 2970  C CD1  . LEU A 1 7  ? 14.039  -19.252 -47.184 1.00 0.00 ? 70  LEU A CD1  2 
ATOM 2971  C CD2  . LEU A 1 7  ? 14.803  -21.623 -47.498 1.00 0.00 ? 70  LEU A CD2  2 
ATOM 2972  H H    . LEU A 1 7  ? 15.784  -17.387 -48.265 1.00 0.00 ? 70  LEU A H    2 
ATOM 2973  H HA   . LEU A 1 7  ? 16.924  -18.541 -45.824 1.00 0.00 ? 70  LEU A HA   2 
ATOM 2974  H HB2  . LEU A 1 7  ? 16.301  -19.588 -48.564 1.00 0.00 ? 70  LEU A HB2  2 
ATOM 2975  H HB3  . LEU A 1 7  ? 17.211  -20.552 -47.394 1.00 0.00 ? 70  LEU A HB3  2 
ATOM 2976  H HG   . LEU A 1 7  ? 15.270  -20.394 -45.842 1.00 0.00 ? 70  LEU A HG   2 
ATOM 2977  H HD11 . LEU A 1 7  ? 14.217  -18.336 -46.624 1.00 0.00 ? 70  LEU A HD11 2 
ATOM 2978  H HD12 . LEU A 1 7  ? 13.081  -19.680 -46.887 1.00 0.00 ? 70  LEU A HD12 2 
ATOM 2979  H HD13 . LEU A 1 7  ? 14.018  -19.025 -48.250 1.00 0.00 ? 70  LEU A HD13 2 
ATOM 2980  H HD21 . LEU A 1 7  ? 14.674  -21.520 -48.574 1.00 0.00 ? 70  LEU A HD21 2 
ATOM 2981  H HD22 . LEU A 1 7  ? 13.877  -21.990 -47.054 1.00 0.00 ? 70  LEU A HD22 2 
ATOM 2982  H HD23 . LEU A 1 7  ? 15.607  -22.328 -47.294 1.00 0.00 ? 70  LEU A HD23 2 
ATOM 2983  N N    . GLU A 1 8  ? 19.323  -18.212 -46.167 1.00 0.00 ? 71  GLU A N    2 
ATOM 2984  C CA   . GLU A 1 8  ? 20.770  -18.300 -46.309 1.00 0.00 ? 71  GLU A CA   2 
ATOM 2985  C C    . GLU A 1 8  ? 21.243  -19.748 -46.239 1.00 0.00 ? 71  GLU A C    2 
ATOM 2986  O O    . GLU A 1 8  ? 20.441  -20.662 -46.050 1.00 0.00 ? 71  GLU A O    2 
ATOM 2987  C CB   . GLU A 1 8  ? 21.467  -17.471 -45.228 1.00 0.00 ? 71  GLU A CB   2 
ATOM 2988  C CG   . GLU A 1 8  ? 21.148  -15.984 -45.273 1.00 0.00 ? 71  GLU A CG   2 
ATOM 2989  C CD   . GLU A 1 8  ? 21.699  -15.306 -46.498 1.00 0.00 ? 71  GLU A CD   2 
ATOM 2990  O OE1  . GLU A 1 8  ? 22.662  -15.790 -47.040 1.00 0.00 ? 71  GLU A OE1  2 
ATOM 2991  O OE2  . GLU A 1 8  ? 21.152  -14.303 -46.892 1.00 0.00 ? 71  GLU A OE2  2 
ATOM 2992  H H    . GLU A 1 8  ? 18.924  -18.218 -45.240 1.00 0.00 ? 71  GLU A H    2 
ATOM 2993  H HA   . GLU A 1 8  ? 21.046  -17.889 -47.284 1.00 0.00 ? 71  GLU A HA   2 
ATOM 2994  H HB2  . GLU A 1 8  ? 21.171  -17.869 -44.256 1.00 0.00 ? 71  GLU A HB2  2 
ATOM 2995  H HB3  . GLU A 1 8  ? 22.543  -17.590 -45.343 1.00 0.00 ? 71  GLU A HB3  2 
ATOM 2996  H HG2  . GLU A 1 8  ? 20.065  -15.867 -45.271 1.00 0.00 ? 71  GLU A HG2  2 
ATOM 2997  H HG3  . GLU A 1 8  ? 21.556  -15.501 -44.385 1.00 0.00 ? 71  GLU A HG3  2 
ATOM 2998  N N    . LYS A 1 9  ? 22.547  -19.946 -46.389 1.00 0.00 ? 72  LYS A N    2 
ATOM 2999  C CA   . LYS A 1 9  ? 23.121  -21.288 -46.407 1.00 0.00 ? 72  LYS A CA   2 
ATOM 3000  C C    . LYS A 1 9  ? 22.119  -22.322 -45.915 1.00 0.00 ? 72  LYS A C    2 
ATOM 3001  O O    . LYS A 1 9  ? 21.615  -23.132 -46.692 1.00 0.00 ? 72  LYS A O    2 
ATOM 3002  C CB   . LYS A 1 9  ? 24.391  -21.340 -45.560 1.00 0.00 ? 72  LYS A CB   2 
ATOM 3003  C CG   . LYS A 1 9  ? 25.085  -22.696 -45.548 1.00 0.00 ? 72  LYS A CG   2 
ATOM 3004  C CD   . LYS A 1 9  ? 26.369  -22.652 -44.732 1.00 0.00 ? 72  LYS A CD   2 
ATOM 3005  C CE   . LYS A 1 9  ? 27.047  -24.014 -44.693 1.00 0.00 ? 72  LYS A CE   2 
ATOM 3006  N NZ   . LYS A 1 9  ? 28.304  -23.987 -43.899 1.00 0.00 ? 72  LYS A NZ   2 
ATOM 3007  H H    . LYS A 1 9  ? 23.158  -19.145 -46.552 1.00 0.00 ? 72  LYS A H    2 
ATOM 3008  H HA   . LYS A 1 9  ? 23.395  -21.538 -47.432 1.00 0.00 ? 72  LYS A HA   2 
ATOM 3009  H HB2  . LYS A 1 9  ? 25.093  -20.597 -45.940 1.00 0.00 ? 72  LYS A HB2  2 
ATOM 3010  H HB3  . LYS A 1 9  ? 24.128  -21.080 -44.533 1.00 0.00 ? 72  LYS A HB3  2 
ATOM 3011  H HG2  . LYS A 1 9  ? 24.411  -23.435 -45.118 1.00 0.00 ? 72  LYS A HG2  2 
ATOM 3012  H HG3  . LYS A 1 9  ? 25.324  -22.975 -46.573 1.00 0.00 ? 72  LYS A HG3  2 
ATOM 3013  H HD2  . LYS A 1 9  ? 27.051  -21.928 -45.178 1.00 0.00 ? 72  LYS A HD2  2 
ATOM 3014  H HD3  . LYS A 1 9  ? 26.133  -22.344 -43.713 1.00 0.00 ? 72  LYS A HD3  2 
ATOM 3015  H HE2  . LYS A 1 9  ? 26.365  -24.738 -44.250 1.00 0.00 ? 72  LYS A HE2  2 
ATOM 3016  H HE3  . LYS A 1 9  ? 27.280  -24.321 -45.715 1.00 0.00 ? 72  LYS A HE3  2 
ATOM 3017  H HZ1  . LYS A 1 9  ? 29.031  -23.459 -44.420 1.00 0.00 ? 72  LYS A HZ1  2 
ATOM 3018  H HZ2  . LYS A 1 9  ? 28.635  -24.960 -43.730 1.00 0.00 ? 72  LYS A HZ2  2 
ATOM 3019  H HZ3  . LYS A 1 9  ? 28.130  -23.534 -43.013 1.00 0.00 ? 72  LYS A HZ3  2 
ATOM 3020  N N    . ASP A 1 10 ? 21.832  -22.287 -44.618 1.00 0.00 ? 73  ASP A N    2 
ATOM 3021  C CA   . ASP A 1 10 ? 20.861  -23.199 -44.025 1.00 0.00 ? 73  ASP A CA   2 
ATOM 3022  C C    . ASP A 1 10 ? 20.048  -22.509 -42.937 1.00 0.00 ? 73  ASP A C    2 
ATOM 3023  O O    . ASP A 1 10 ? 19.828  -23.064 -41.861 1.00 0.00 ? 73  ASP A O    2 
ATOM 3024  C CB   . ASP A 1 10 ? 21.566  -24.426 -43.437 1.00 0.00 ? 73  ASP A CB   2 
ATOM 3025  C CG   . ASP A 1 10 ? 22.536  -24.075 -42.319 1.00 0.00 ? 73  ASP A CG   2 
ATOM 3026  O OD1  . ASP A 1 10 ? 22.692  -22.909 -42.039 1.00 0.00 ? 73  ASP A OD1  2 
ATOM 3027  O OD2  . ASP A 1 10 ? 23.110  -24.972 -41.754 1.00 0.00 ? 73  ASP A OD2  2 
ATOM 3028  H H    . ASP A 1 10 ? 22.273  -21.581 -44.030 1.00 0.00 ? 73  ASP A H    2 
ATOM 3029  H HA   . ASP A 1 10 ? 20.178  -23.529 -44.796 1.00 0.00 ? 73  ASP A HA   2 
ATOM 3030  H HB2  . ASP A 1 10 ? 20.814  -25.111 -43.046 1.00 0.00 ? 73  ASP A HB2  2 
ATOM 3031  H HB3  . ASP A 1 10 ? 22.117  -24.926 -44.236 1.00 0.00 ? 73  ASP A HB3  2 
ATOM 3032  N N    . ARG A 1 11 ? 19.603  -21.290 -43.225 1.00 0.00 ? 74  ARG A N    2 
ATOM 3033  C CA   . ARG A 1 11 ? 18.887  -20.482 -42.242 1.00 0.00 ? 74  ARG A CA   2 
ATOM 3034  C C    . ARG A 1 11 ? 18.294  -19.234 -42.883 1.00 0.00 ? 74  ARG A C    2 
ATOM 3035  O O    . ARG A 1 11 ? 18.953  -18.555 -43.668 1.00 0.00 ? 74  ARG A O    2 
ATOM 3036  C CB   . ARG A 1 11 ? 19.816  -20.076 -41.107 1.00 0.00 ? 74  ARG A CB   2 
ATOM 3037  C CG   . ARG A 1 11 ? 19.161  -19.249 -40.012 1.00 0.00 ? 74  ARG A CG   2 
ATOM 3038  C CD   . ARG A 1 11 ? 20.087  -19.016 -38.873 1.00 0.00 ? 74  ARG A CD   2 
ATOM 3039  N NE   . ARG A 1 11 ? 19.481  -18.189 -37.843 1.00 0.00 ? 74  ARG A NE   2 
ATOM 3040  C CZ   . ARG A 1 11 ? 20.093  -17.816 -36.704 1.00 0.00 ? 74  ARG A CZ   2 
ATOM 3041  N NH1  . ARG A 1 11 ? 21.327  -18.204 -36.463 1.00 0.00 ? 74  ARG A NH1  2 
ATOM 3042  N NH2  . ARG A 1 11 ? 19.455  -17.058 -35.827 1.00 0.00 ? 74  ARG A NH2  2 
ATOM 3043  H H    . ARG A 1 11 ? 19.830  -20.879 -44.131 1.00 0.00 ? 74  ARG A H    2 
ATOM 3044  H HA   . ARG A 1 11 ? 18.078  -21.074 -41.849 1.00 0.00 ? 74  ARG A HA   2 
ATOM 3045  H HB2  . ARG A 1 11 ? 20.213  -20.981 -40.649 1.00 0.00 ? 74  ARG A HB2  2 
ATOM 3046  H HB3  . ARG A 1 11 ? 20.645  -19.504 -41.527 1.00 0.00 ? 74  ARG A HB3  2 
ATOM 3047  H HG2  . ARG A 1 11 ? 18.867  -18.286 -40.431 1.00 0.00 ? 74  ARG A HG2  2 
ATOM 3048  H HG3  . ARG A 1 11 ? 18.277  -19.769 -39.650 1.00 0.00 ? 74  ARG A HG3  2 
ATOM 3049  H HD2  . ARG A 1 11 ? 20.358  -19.976 -38.438 1.00 0.00 ? 74  ARG A HD2  2 
ATOM 3050  H HD3  . ARG A 1 11 ? 20.985  -18.519 -39.244 1.00 0.00 ? 74  ARG A HD3  2 
ATOM 3051  H HE   . ARG A 1 11 ? 18.562  -17.879 -37.990 1.00 0.00 ? 74  ARG A HE   2 
ATOM 3052  H HH11 . ARG A 1 11 ? 21.812  -18.775 -37.124 1.00 0.00 ? 74  ARG A HH11 2 
ATOM 3053  H HH12 . ARG A 1 11 ? 21.785  -17.925 -35.607 1.00 0.00 ? 74  ARG A HH12 2 
ATOM 3054  H HH21 . ARG A 1 11 ? 18.518  -16.760 -36.009 1.00 0.00 ? 74  ARG A HH21 2 
ATOM 3055  H HH22 . ARG A 1 11 ? 19.912  -16.783 -34.981 1.00 0.00 ? 74  ARG A HH22 2 
ATOM 3056  N N    . PHE A 1 12 ? 17.046  -18.936 -42.540 1.00 0.00 ? 75  PHE A N    2 
ATOM 3057  C CA   . PHE A 1 12 ? 16.337  -17.807 -43.133 1.00 0.00 ? 75  PHE A CA   2 
ATOM 3058  C C    . PHE A 1 12 ? 16.081  -16.715 -42.101 1.00 0.00 ? 75  PHE A C    2 
ATOM 3059  O O    . PHE A 1 12 ? 16.097  -16.969 -40.896 1.00 0.00 ? 75  PHE A O    2 
ATOM 3060  C CB   . PHE A 1 12 ? 15.007  -18.269 -43.734 1.00 0.00 ? 75  PHE A CB   2 
ATOM 3061  C CG   . PHE A 1 12 ? 14.127  -19.006 -42.765 1.00 0.00 ? 75  PHE A CG   2 
ATOM 3062  C CD1  . PHE A 1 12 ? 13.280  -18.315 -41.912 1.00 0.00 ? 75  PHE A CD1  2 
ATOM 3063  C CD2  . PHE A 1 12 ? 14.146  -20.390 -42.703 1.00 0.00 ? 75  PHE A CD2  2 
ATOM 3064  C CE1  . PHE A 1 12 ? 12.469  -18.992 -41.020 1.00 0.00 ? 75  PHE A CE1  2 
ATOM 3065  C CE2  . PHE A 1 12 ? 13.335  -21.070 -41.814 1.00 0.00 ? 75  PHE A CE2  2 
ATOM 3066  C CZ   . PHE A 1 12 ? 12.496  -20.368 -40.971 1.00 0.00 ? 75  PHE A CZ   2 
ATOM 3067  H H    . PHE A 1 12 ? 16.551  -19.548 -41.890 1.00 0.00 ? 75  PHE A H    2 
ATOM 3068  H HA   . PHE A 1 12 ? 16.943  -17.377 -43.909 1.00 0.00 ? 75  PHE A HA   2 
ATOM 3069  H HB2  . PHE A 1 12 ? 14.464  -17.393 -44.081 1.00 0.00 ? 75  PHE A HB2  2 
ATOM 3070  H HB3  . PHE A 1 12 ? 15.204  -18.893 -44.563 1.00 0.00 ? 75  PHE A HB3  2 
ATOM 3071  H HD1  . PHE A 1 12 ? 13.257  -17.236 -41.946 1.00 0.00 ? 75  PHE A HD1  2 
ATOM 3072  H HD2  . PHE A 1 12 ? 14.799  -20.944 -43.360 1.00 0.00 ? 75  PHE A HD2  2 
ATOM 3073  H HE1  . PHE A 1 12 ? 11.812  -18.435 -40.382 1.00 0.00 ? 75  PHE A HE1  2 
ATOM 3074  H HE2  . PHE A 1 12 ? 13.351  -22.144 -41.768 1.00 0.00 ? 75  PHE A HE2  2 
ATOM 3075  H HZ   . PHE A 1 12 ? 11.816  -20.898 -40.319 1.00 0.00 ? 75  PHE A HZ   2 
ATOM 3076  N N    . SER A 1 13 ? 15.848  -15.500 -42.583 1.00 0.00 ? 76  SER A N    2 
ATOM 3077  C CA   . SER A 1 13 ? 15.539  -14.375 -41.707 1.00 0.00 ? 76  SER A CA   2 
ATOM 3078  C C    . SER A 1 13 ? 14.527  -13.436 -42.351 1.00 0.00 ? 76  SER A C    2 
ATOM 3079  O O    . SER A 1 13 ? 14.368  -13.424 -43.572 1.00 0.00 ? 76  SER A O    2 
ATOM 3080  C CB   . SER A 1 13 ? 16.807  -13.613 -41.369 1.00 0.00 ? 76  SER A CB   2 
ATOM 3081  O OG   . SER A 1 13 ? 17.337  -12.993 -42.510 1.00 0.00 ? 76  SER A OG   2 
ATOM 3082  H H    . SER A 1 13 ? 15.845  -15.359 -43.593 1.00 0.00 ? 76  SER A H    2 
ATOM 3083  H HA   . SER A 1 13 ? 15.106  -14.742 -40.789 1.00 0.00 ? 76  SER A HA   2 
ATOM 3084  H HB2  . SER A 1 13 ? 16.583  -12.851 -40.628 1.00 0.00 ? 76  SER A HB2  2 
ATOM 3085  H HB3  . SER A 1 13 ? 17.540  -14.309 -40.956 1.00 0.00 ? 76  SER A HB3  2 
ATOM 3086  H HG   . SER A 1 13 ? 18.229  -12.704 -42.309 1.00 0.00 ? 76  SER A HG   2 
ATOM 3087  N N    . VAL A 1 14 ? 13.845  -12.652 -41.525 1.00 0.00 ? 77  VAL A N    2 
ATOM 3088  C CA   . VAL A 1 14 ? 12.801  -11.757 -42.005 1.00 0.00 ? 77  VAL A CA   2 
ATOM 3089  C C    . VAL A 1 14 ? 12.941  -10.369 -41.397 1.00 0.00 ? 77  VAL A C    2 
ATOM 3090  O O    . VAL A 1 14 ? 13.335  -10.225 -40.240 1.00 0.00 ? 77  VAL A O    2 
ATOM 3091  C CB   . VAL A 1 14 ? 11.410  -12.326 -41.662 1.00 0.00 ? 77  VAL A CB   2 
ATOM 3092  C CG1  . VAL A 1 14 ? 10.321  -11.331 -42.031 1.00 0.00 ? 77  VAL A CG1  2 
ATOM 3093  C CG2  . VAL A 1 14 ? 11.199  -13.648 -42.384 1.00 0.00 ? 77  VAL A CG2  2 
ATOM 3094  H H    . VAL A 1 14 ? 14.017  -12.717 -40.520 1.00 0.00 ? 77  VAL A H    2 
ATOM 3095  H HA   . VAL A 1 14 ? 12.866  -11.661 -43.091 1.00 0.00 ? 77  VAL A HA   2 
ATOM 3096  H HB   . VAL A 1 14 ? 11.382  -12.488 -40.595 1.00 0.00 ? 77  VAL A HB   2 
ATOM 3097  H HG11 . VAL A 1 14 ? 9.343   -11.800 -41.918 1.00 0.00 ? 77  VAL A HG11 2 
ATOM 3098  H HG12 . VAL A 1 14 ? 10.457  -11.004 -43.063 1.00 0.00 ? 77  VAL A HG12 2 
ATOM 3099  H HG13 . VAL A 1 14 ? 10.396  -10.484 -41.370 1.00 0.00 ? 77  VAL A HG13 2 
ATOM 3100  H HG21 . VAL A 1 14 ? 10.384  -14.188 -41.902 1.00 0.00 ? 77  VAL A HG21 2 
ATOM 3101  H HG22 . VAL A 1 14 ? 10.931  -13.444 -43.415 1.00 0.00 ? 77  VAL A HG22 2 
ATOM 3102  H HG23 . VAL A 1 14 ? 12.100  -14.255 -42.352 1.00 0.00 ? 77  VAL A HG23 2 
ATOM 3103  N N    . ASN A 1 15 ? 12.615  -9.348  -42.182 1.00 0.00 ? 78  ASN A N    2 
ATOM 3104  C CA   . ASN A 1 15 ? 12.634  -7.972  -41.698 1.00 0.00 ? 78  ASN A CA   2 
ATOM 3105  C C    . ASN A 1 15 ? 11.294  -7.286  -41.937 1.00 0.00 ? 78  ASN A C    2 
ATOM 3106  O O    . ASN A 1 15 ? 10.975  -6.898  -43.060 1.00 0.00 ? 78  ASN A O    2 
ATOM 3107  C CB   . ASN A 1 15 ? 13.756  -7.190  -42.354 1.00 0.00 ? 78  ASN A CB   2 
ATOM 3108  C CG   . ASN A 1 15 ? 13.862  -5.784  -41.834 1.00 0.00 ? 78  ASN A CG   2 
ATOM 3109  O OD1  . ASN A 1 15 ? 12.850  -5.149  -41.516 1.00 0.00 ? 78  ASN A OD1  2 
ATOM 3110  N ND2  . ASN A 1 15 ? 15.068  -5.283  -41.743 1.00 0.00 ? 78  ASN A ND2  2 
ATOM 3111  H H    . ASN A 1 15 ? 12.281  -9.533  -43.128 1.00 0.00 ? 78  ASN A H    2 
ATOM 3112  H HA   . ASN A 1 15 ? 12.817  -7.965  -40.620 1.00 0.00 ? 78  ASN A HA   2 
ATOM 3113  H HB2  . ASN A 1 15 ? 14.703  -7.706  -42.212 1.00 0.00 ? 78  ASN A HB2  2 
ATOM 3114  H HB3  . ASN A 1 15 ? 13.540  -7.123  -43.403 1.00 0.00 ? 78  ASN A HB3  2 
ATOM 3115  H HD21 . ASN A 1 15 ? 15.879  -5.831  -42.029 1.00 0.00 ? 78  ASN A HD21 2 
ATOM 3116  H HD22 . ASN A 1 15 ? 15.193  -4.336  -41.387 1.00 0.00 ? 78  ASN A HD22 2 
ATOM 3117  N N    . LEU A 1 16 ? 10.511  -7.140  -40.872 1.00 0.00 ? 79  LEU A N    2 
ATOM 3118  C CA   . LEU A 1 16 ? 9.235   -6.441  -40.950 1.00 0.00 ? 79  LEU A CA   2 
ATOM 3119  C C    . LEU A 1 16 ? 9.245   -5.181  -40.092 1.00 0.00 ? 79  LEU A C    2 
ATOM 3120  O O    . LEU A 1 16 ? 9.968   -5.099  -39.100 1.00 0.00 ? 79  LEU A O    2 
ATOM 3121  C CB   . LEU A 1 16 ? 8.096   -7.365  -40.500 1.00 0.00 ? 79  LEU A CB   2 
ATOM 3122  C CG   . LEU A 1 16 ? 7.950   -8.673  -41.286 1.00 0.00 ? 79  LEU A CG   2 
ATOM 3123  C CD1  . LEU A 1 16 ? 6.859   -9.527  -40.657 1.00 0.00 ? 79  LEU A CD1  2 
ATOM 3124  C CD2  . LEU A 1 16 ? 7.627   -8.358  -42.740 1.00 0.00 ? 79  LEU A CD2  2 
ATOM 3125  H H    . LEU A 1 16 ? 10.839  -7.474  -39.966 1.00 0.00 ? 79  LEU A H    2 
ATOM 3126  H HA   . LEU A 1 16 ? 9.052   -6.150  -41.971 1.00 0.00 ? 79  LEU A HA   2 
ATOM 3127  H HB2  . LEU A 1 16 ? 8.263   -7.626  -39.480 1.00 0.00 ? 79  LEU A HB2  2 
ATOM 3128  H HB3  . LEU A 1 16 ? 7.159   -6.814  -40.574 1.00 0.00 ? 79  LEU A HB3  2 
ATOM 3129  H HG   . LEU A 1 16 ? 8.878   -9.194  -41.233 1.00 0.00 ? 79  LEU A HG   2 
ATOM 3130  H HD11 . LEU A 1 16 ? 7.165   -9.834  -39.660 1.00 0.00 ? 79  LEU A HD11 2 
ATOM 3131  H HD12 . LEU A 1 16 ? 6.690   -10.411 -41.269 1.00 0.00 ? 79  LEU A HD12 2 
ATOM 3132  H HD13 . LEU A 1 16 ? 5.939   -8.948  -40.593 1.00 0.00 ? 79  LEU A HD13 2 
ATOM 3133  H HD21 . LEU A 1 16 ? 7.257   -9.258  -43.231 1.00 0.00 ? 79  LEU A HD21 2 
ATOM 3134  H HD22 . LEU A 1 16 ? 8.525   -8.018  -43.256 1.00 0.00 ? 79  LEU A HD22 2 
ATOM 3135  H HD23 . LEU A 1 16 ? 6.863   -7.582  -42.787 1.00 0.00 ? 79  LEU A HD23 2 
ATOM 3136  N N    . ASP A 1 17 ? 8.436   -4.201  -40.482 1.00 0.00 ? 80  ASP A N    2 
ATOM 3137  C CA   . ASP A 1 17 ? 8.369   -2.933  -39.765 1.00 0.00 ? 80  ASP A CA   2 
ATOM 3138  C C    . ASP A 1 17 ? 7.134   -2.868  -38.876 1.00 0.00 ? 80  ASP A C    2 
ATOM 3139  O O    . ASP A 1 17 ? 6.005   -2.845  -39.365 1.00 0.00 ? 80  ASP A O    2 
ATOM 3140  C CB   . ASP A 1 17 ? 8.359   -1.761  -40.749 1.00 0.00 ? 80  ASP A CB   2 
ATOM 3141  C CG   . ASP A 1 17 ? 8.331   -0.405  -40.053 1.00 0.00 ? 80  ASP A CG   2 
ATOM 3142  O OD1  . ASP A 1 17 ? 8.050   -0.368  -38.878 1.00 0.00 ? 80  ASP A OD1  2 
ATOM 3143  O OD2  . ASP A 1 17 ? 8.593   0.578   -40.703 1.00 0.00 ? 80  ASP A OD2  2 
ATOM 3144  H H    . ASP A 1 17 ? 7.863   -4.329  -41.316 1.00 0.00 ? 80  ASP A H    2 
ATOM 3145  H HA   . ASP A 1 17 ? 9.251   -2.830  -39.127 1.00 0.00 ? 80  ASP A HA   2 
ATOM 3146  H HB2  . ASP A 1 17 ? 9.269   -1.805  -41.342 1.00 0.00 ? 80  ASP A HB2  2 
ATOM 3147  H HB3  . ASP A 1 17 ? 7.494   -1.849  -41.403 1.00 0.00 ? 80  ASP A HB3  2 
ATOM 3148  N N    . VAL A 1 18 ? 7.354   -2.839  -37.566 1.00 0.00 ? 81  VAL A N    2 
ATOM 3149  C CA   . VAL A 1 18 ? 6.262   -2.720  -36.607 1.00 0.00 ? 81  VAL A CA   2 
ATOM 3150  C C    . VAL A 1 18 ? 6.561   -1.654  -35.560 1.00 0.00 ? 81  VAL A C    2 
ATOM 3151  O O    . VAL A 1 18 ? 6.375   -1.876  -34.364 1.00 0.00 ? 81  VAL A O    2 
ATOM 3152  C CB   . VAL A 1 18 ? 6.017   -4.070  -35.905 1.00 0.00 ? 81  VAL A CB   2 
ATOM 3153  C CG1  . VAL A 1 18 ? 5.480   -5.095  -36.895 1.00 0.00 ? 81  VAL A CG1  2 
ATOM 3154  C CG2  . VAL A 1 18 ? 7.307   -4.561  -35.266 1.00 0.00 ? 81  VAL A CG2  2 
ATOM 3155  H H    . VAL A 1 18 ? 8.315   -2.849  -37.224 1.00 0.00 ? 81  VAL A H    2 
ATOM 3156  H HA   . VAL A 1 18 ? 5.344   -2.434  -37.128 1.00 0.00 ? 81  VAL A HA   2 
ATOM 3157  H HB   . VAL A 1 18 ? 5.272   -3.923  -35.122 1.00 0.00 ? 81  VAL A HB   2 
ATOM 3158  H HG11 . VAL A 1 18 ? 4.449   -4.856  -37.149 1.00 0.00 ? 81  VAL A HG11 2 
ATOM 3159  H HG12 . VAL A 1 18 ? 5.525   -6.090  -36.451 1.00 0.00 ? 81  VAL A HG12 2 
ATOM 3160  H HG13 . VAL A 1 18 ? 6.091   -5.074  -37.798 1.00 0.00 ? 81  VAL A HG13 2 
ATOM 3161  H HG21 . VAL A 1 18 ? 7.729   -3.785  -34.631 1.00 0.00 ? 81  VAL A HG21 2 
ATOM 3162  H HG22 . VAL A 1 18 ? 8.019   -4.811  -36.049 1.00 0.00 ? 81  VAL A HG22 2 
ATOM 3163  H HG23 . VAL A 1 18 ? 7.097   -5.438  -34.658 1.00 0.00 ? 81  VAL A HG23 2 
ATOM 3164  N N    . LYS A 1 19 ? 7.028   -0.498  -36.018 1.00 0.00 ? 82  LYS A N    2 
ATOM 3165  C CA   . LYS A 1 19 ? 7.328   0.615   -35.125 1.00 0.00 ? 82  LYS A CA   2 
ATOM 3166  C C    . LYS A 1 19 ? 6.059   1.360   -34.729 1.00 0.00 ? 82  LYS A C    2 
ATOM 3167  O O    . LYS A 1 19 ? 5.185   1.603   -35.559 1.00 0.00 ? 82  LYS A O    2 
ATOM 3168  C CB   . LYS A 1 19 ? 8.319   1.577   -35.782 1.00 0.00 ? 82  LYS A CB   2 
ATOM 3169  C CG   . LYS A 1 19 ? 8.908   2.614   -34.836 1.00 0.00 ? 82  LYS A CG   2 
ATOM 3170  C CD   . LYS A 1 19 ? 9.905   3.514   -35.553 1.00 0.00 ? 82  LYS A CD   2 
ATOM 3171  C CE   . LYS A 1 19 ? 10.551  4.503   -34.594 1.00 0.00 ? 82  LYS A CE   2 
ATOM 3172  N NZ   . LYS A 1 19 ? 11.511  5.404   -35.287 1.00 0.00 ? 82  LYS A NZ   2 
ATOM 3173  H H    . LYS A 1 19 ? 7.152   -0.374  -37.023 1.00 0.00 ? 82  LYS A H    2 
ATOM 3174  H HA   . LYS A 1 19 ? 7.783   0.225   -34.218 1.00 0.00 ? 82  LYS A HA   2 
ATOM 3175  H HB2  . LYS A 1 19 ? 9.138   0.997   -36.205 1.00 0.00 ? 82  LYS A HB2  2 
ATOM 3176  H HB3  . LYS A 1 19 ? 7.805   2.099   -36.587 1.00 0.00 ? 82  LYS A HB3  2 
ATOM 3177  H HG2  . LYS A 1 19 ? 8.101   3.225   -34.432 1.00 0.00 ? 82  LYS A HG2  2 
ATOM 3178  H HG3  . LYS A 1 19 ? 9.416   2.100   -34.021 1.00 0.00 ? 82  LYS A HG3  2 
ATOM 3179  H HD2  . LYS A 1 19 ? 10.681  2.896   -36.005 1.00 0.00 ? 82  LYS A HD2  2 
ATOM 3180  H HD3  . LYS A 1 19 ? 9.385   4.067   -36.334 1.00 0.00 ? 82  LYS A HD3  2 
ATOM 3181  H HE2  . LYS A 1 19 ? 9.773   5.106   -34.130 1.00 0.00 ? 82  LYS A HE2  2 
ATOM 3182  H HE3  . LYS A 1 19 ? 11.081  3.947   -33.819 1.00 0.00 ? 82  LYS A HE3  2 
ATOM 3183  H HZ1  . LYS A 1 19 ? 12.479  5.186   -34.981 1.00 0.00 ? 82  LYS A HZ1  2 
ATOM 3184  H HZ2  . LYS A 1 19 ? 11.288  6.395   -35.061 1.00 0.00 ? 82  LYS A HZ2  2 
ATOM 3185  H HZ3  . LYS A 1 19 ? 11.438  5.264   -36.284 1.00 0.00 ? 82  LYS A HZ3  2 
ATOM 3186  N N    . HIS A 1 20 ? 5.967   1.720   -33.452 1.00 0.00 ? 83  HIS A N    2 
ATOM 3187  C CA   . HIS A 1 20 ? 4.768   2.362   -32.923 1.00 0.00 ? 83  HIS A CA   2 
ATOM 3188  C C    . HIS A 1 20 ? 3.616   1.370   -32.811 1.00 0.00 ? 83  HIS A C    2 
ATOM 3189  O O    . HIS A 1 20 ? 2.456   1.730   -33.004 1.00 0.00 ? 83  HIS A O    2 
ATOM 3190  C CB   . HIS A 1 20 ? 4.351   3.542   -33.808 1.00 0.00 ? 83  HIS A CB   2 
ATOM 3191  C CG   . HIS A 1 20 ? 5.470   4.487   -34.116 1.00 0.00 ? 83  HIS A CG   2 
ATOM 3192  N ND1  . HIS A 1 20 ? 6.136   5.194   -33.134 1.00 0.00 ? 83  HIS A ND1  2 
ATOM 3193  C CD2  . HIS A 1 20 ? 6.038   4.845   -35.290 1.00 0.00 ? 83  HIS A CD2  2 
ATOM 3194  C CE1  . HIS A 1 20 ? 7.068   5.947   -33.698 1.00 0.00 ? 83  HIS A CE1  2 
ATOM 3195  N NE2  . HIS A 1 20 ? 7.028   5.753   -35.003 1.00 0.00 ? 83  HIS A NE2  2 
ATOM 3196  H H    . HIS A 1 20 ? 6.721   1.477   -32.810 1.00 0.00 ? 83  HIS A H    2 
ATOM 3197  H HA   . HIS A 1 20 ? 4.997   2.739   -31.925 1.00 0.00 ? 83  HIS A HA   2 
ATOM 3198  H HB2  . HIS A 1 20 ? 3.914   3.183   -34.732 1.00 0.00 ? 83  HIS A HB2  2 
ATOM 3199  H HB3  . HIS A 1 20 ? 3.588   4.096   -33.264 1.00 0.00 ? 83  HIS A HB3  2 
ATOM 3200  H HD2  . HIS A 1 20 ? 5.623   4.650   -36.270 1.00 0.00 ? 83  HIS A HD2  2 
ATOM 3201  H HE1  . HIS A 1 20 ? 7.744   6.607   -33.174 1.00 0.00 ? 83  HIS A HE1  2 
ATOM 3202  H HE2  . HIS A 1 20 ? 7.628   6.200   -35.681 1.00 0.00 ? 83  HIS A HE2  2 
ATOM 3203  N N    . PHE A 1 21 ? 3.945   0.122   -32.499 1.00 0.00 ? 84  PHE A N    2 
ATOM 3204  C CA   . PHE A 1 21 ? 2.934   -0.888  -32.209 1.00 0.00 ? 84  PHE A CA   2 
ATOM 3205  C C    . PHE A 1 21 ? 3.139   -1.494  -30.827 1.00 0.00 ? 84  PHE A C    2 
ATOM 3206  O O    . PHE A 1 21 ? 4.271   -1.651  -30.371 1.00 0.00 ? 84  PHE A O    2 
ATOM 3207  C CB   . PHE A 1 21 ? 2.964   -1.992  -33.267 1.00 0.00 ? 84  PHE A CB   2 
ATOM 3208  C CG   . PHE A 1 21 ? 2.508   -1.543  -34.627 1.00 0.00 ? 84  PHE A CG   2 
ATOM 3209  C CD1  . PHE A 1 21 ? 3.360   -0.827  -35.456 1.00 0.00 ? 84  PHE A CD1  2 
ATOM 3210  C CD2  . PHE A 1 21 ? 1.231   -1.834  -35.081 1.00 0.00 ? 84  PHE A CD2  2 
ATOM 3211  C CE1  . PHE A 1 21 ? 2.943   -0.412  -36.706 1.00 0.00 ? 84  PHE A CE1  2 
ATOM 3212  C CE2  . PHE A 1 21 ? 0.812   -1.421  -36.329 1.00 0.00 ? 84  PHE A CE2  2 
ATOM 3213  C CZ   . PHE A 1 21 ? 1.670   -0.709  -37.144 1.00 0.00 ? 84  PHE A CZ   2 
ATOM 3214  H H    . PHE A 1 21 ? 4.924   -0.106  -32.331 1.00 0.00 ? 84  PHE A H    2 
ATOM 3215  H HA   . PHE A 1 21 ? 1.940   -0.431  -32.234 1.00 0.00 ? 84  PHE A HA   2 
ATOM 3216  H HB2  . PHE A 1 21 ? 3.989   -2.328  -33.362 1.00 0.00 ? 84  PHE A HB2  2 
ATOM 3217  H HB3  . PHE A 1 21 ? 2.351   -2.804  -32.941 1.00 0.00 ? 84  PHE A HB3  2 
ATOM 3218  H HD1  . PHE A 1 21 ? 4.338   -0.582  -35.108 1.00 0.00 ? 84  PHE A HD1  2 
ATOM 3219  H HD2  . PHE A 1 21 ? 0.557   -2.389  -34.446 1.00 0.00 ? 84  PHE A HD2  2 
ATOM 3220  H HE1  . PHE A 1 21 ? 3.618   0.145   -37.340 1.00 0.00 ? 84  PHE A HE1  2 
ATOM 3221  H HE2  . PHE A 1 21 ? -0.184  -1.658  -36.672 1.00 0.00 ? 84  PHE A HE2  2 
ATOM 3222  H HZ   . PHE A 1 21 ? 1.526   -0.739  -38.200 1.00 0.00 ? 84  PHE A HZ   2 
ATOM 3223  N N    . SER A 1 22 ? 2.040   -1.833  -30.165 1.00 0.00 ? 85  SER A N    2 
ATOM 3224  C CA   . SER A 1 22 ? 2.099   -2.460  -28.851 1.00 0.00 ? 85  SER A CA   2 
ATOM 3225  C C    . SER A 1 22 ? 1.663   -3.919  -28.915 1.00 0.00 ? 85  SER A C    2 
ATOM 3226  O O    . SER A 1 22 ? 0.856   -4.299  -29.764 1.00 0.00 ? 85  SER A O    2 
ATOM 3227  C CB   . SER A 1 22 ? 1.222   -1.705  -27.871 1.00 0.00 ? 85  SER A CB   2 
ATOM 3228  O OG   . SER A 1 22 ? 1.720   -0.416  -27.643 1.00 0.00 ? 85  SER A OG   2 
ATOM 3229  H H    . SER A 1 22 ? 1.130   -1.685  -30.602 1.00 0.00 ? 85  SER A H    2 
ATOM 3230  H HA   . SER A 1 22 ? 3.113   -2.378  -28.500 1.00 0.00 ? 85  SER A HA   2 
ATOM 3231  H HB2  . SER A 1 22 ? 0.219   -1.623  -28.279 1.00 0.00 ? 85  SER A HB2  2 
ATOM 3232  H HB3  . SER A 1 22 ? 1.181   -2.259  -26.929 1.00 0.00 ? 85  SER A HB3  2 
ATOM 3233  H HG   . SER A 1 22 ? 1.941   -0.031  -28.493 1.00 0.00 ? 85  SER A HG   2 
ATOM 3234  N N    . PRO A 1 23 ? 2.202   -4.734  -28.015 1.00 0.00 ? 86  PRO A N    2 
ATOM 3235  C CA   . PRO A 1 23 ? 1.855   -6.148  -27.957 1.00 0.00 ? 86  PRO A CA   2 
ATOM 3236  C C    . PRO A 1 23 ? 0.352   -6.343  -27.816 1.00 0.00 ? 86  PRO A C    2 
ATOM 3237  O O    . PRO A 1 23 ? -0.192  -7.371  -28.214 1.00 0.00 ? 86  PRO A O    2 
ATOM 3238  C CB   . PRO A 1 23 ? 2.607   -6.636  -26.714 1.00 0.00 ? 86  PRO A CB   2 
ATOM 3239  C CG   . PRO A 1 23 ? 3.774   -5.714  -26.606 1.00 0.00 ? 86  PRO A CG   2 
ATOM 3240  C CD   . PRO A 1 23 ? 3.230   -4.373  -27.020 1.00 0.00 ? 86  PRO A CD   2 
ATOM 3241  H HA   . PRO A 1 23 ? 2.223   -6.669  -28.837 1.00 0.00 ? 86  PRO A HA   2 
ATOM 3242  H HB2  . PRO A 1 23 ? 1.974   -6.560  -25.825 1.00 0.00 ? 86  PRO A HB2  2 
ATOM 3243  H HB3  . PRO A 1 23 ? 2.950   -7.663  -26.850 1.00 0.00 ? 86  PRO A HB3  2 
ATOM 3244  H HG2  . PRO A 1 23 ? 4.138   -5.686  -25.575 1.00 0.00 ? 86  PRO A HG2  2 
ATOM 3245  H HG3  . PRO A 1 23 ? 4.571   -6.023  -27.285 1.00 0.00 ? 86  PRO A HG3  2 
ATOM 3246  H HD2  . PRO A 1 23 ? 2.782   -3.855  -26.165 1.00 0.00 ? 86  PRO A HD2  2 
ATOM 3247  H HD3  . PRO A 1 23 ? 4.028   -3.788  -27.458 1.00 0.00 ? 86  PRO A HD3  2 
ATOM 3248  N N    . GLU A 1 24 ? -0.317  -5.345  -27.245 1.00 0.00 ? 87  GLU A N    2 
ATOM 3249  C CA   . GLU A 1 24 ? -1.759  -5.406  -27.045 1.00 0.00 ? 87  GLU A CA   2 
ATOM 3250  C C    . GLU A 1 24 ? -2.503  -5.393  -28.375 1.00 0.00 ? 87  GLU A C    2 
ATOM 3251  O O    . GLU A 1 24 ? -3.615  -5.906  -28.482 1.00 0.00 ? 87  GLU A O    2 
ATOM 3252  C CB   . GLU A 1 24 ? -2.229  -4.236  -26.177 1.00 0.00 ? 87  GLU A CB   2 
ATOM 3253  C CG   . GLU A 1 24 ? -1.751  -4.294  -24.733 1.00 0.00 ? 87  GLU A CG   2 
ATOM 3254  C CD   . GLU A 1 24 ? -2.202  -3.113  -23.920 1.00 0.00 ? 87  GLU A CD   2 
ATOM 3255  O OE1  . GLU A 1 24 ? -2.766  -2.207  -24.485 1.00 0.00 ? 87  GLU A OE1  2 
ATOM 3256  O OE2  . GLU A 1 24 ? -1.982  -3.115  -22.731 1.00 0.00 ? 87  GLU A OE2  2 
ATOM 3257  H H    . GLU A 1 24 ? 0.194   -4.519  -26.934 1.00 0.00 ? 87  GLU A H    2 
ATOM 3258  H HA   . GLU A 1 24 ? -1.998  -6.331  -26.521 1.00 0.00 ? 87  GLU A HA   2 
ATOM 3259  H HB2  . GLU A 1 24 ? -1.859  -3.310  -26.620 1.00 0.00 ? 87  GLU A HB2  2 
ATOM 3260  H HB3  . GLU A 1 24 ? -3.319  -4.215  -26.174 1.00 0.00 ? 87  GLU A HB3  2 
ATOM 3261  H HG2  . GLU A 1 24 ? -2.141  -5.203  -24.277 1.00 0.00 ? 87  GLU A HG2  2 
ATOM 3262  H HG3  . GLU A 1 24 ? -0.661  -4.334  -24.730 1.00 0.00 ? 87  GLU A HG3  2 
ATOM 3263  N N    . GLU A 1 25 ? -1.878  -4.801  -29.389 1.00 0.00 ? 88  GLU A N    2 
ATOM 3264  C CA   . GLU A 1 25 ? -2.488  -4.699  -30.710 1.00 0.00 ? 88  GLU A CA   2 
ATOM 3265  C C    . GLU A 1 25 ? -1.615  -5.358  -31.771 1.00 0.00 ? 88  GLU A C    2 
ATOM 3266  O O    . GLU A 1 25 ? -2.023  -5.494  -32.925 1.00 0.00 ? 88  GLU A O    2 
ATOM 3267  C CB   . GLU A 1 25 ? -2.731  -3.232  -31.073 1.00 0.00 ? 88  GLU A CB   2 
ATOM 3268  C CG   . GLU A 1 25 ? -3.703  -2.510  -30.150 1.00 0.00 ? 88  GLU A CG   2 
ATOM 3269  C CD   . GLU A 1 25 ? -5.093  -3.077  -30.206 1.00 0.00 ? 88  GLU A CD   2 
ATOM 3270  O OE1  . GLU A 1 25 ? -5.485  -3.540  -31.252 1.00 0.00 ? 88  GLU A OE1  2 
ATOM 3271  O OE2  . GLU A 1 25 ? -5.768  -3.048  -29.203 1.00 0.00 ? 88  GLU A OE2  2 
ATOM 3272  H H    . GLU A 1 25 ? -0.956  -4.388  -29.238 1.00 0.00 ? 88  GLU A H    2 
ATOM 3273  H HA   . GLU A 1 25 ? -3.457  -5.201  -30.709 1.00 0.00 ? 88  GLU A HA   2 
ATOM 3274  H HB2  . GLU A 1 25 ? -1.771  -2.718  -31.032 1.00 0.00 ? 88  GLU A HB2  2 
ATOM 3275  H HB3  . GLU A 1 25 ? -3.101  -3.176  -32.068 1.00 0.00 ? 88  GLU A HB3  2 
ATOM 3276  H HG2  . GLU A 1 25 ? -3.338  -2.594  -29.128 1.00 0.00 ? 88  GLU A HG2  2 
ATOM 3277  H HG3  . GLU A 1 25 ? -3.739  -1.455  -30.426 1.00 0.00 ? 88  GLU A HG3  2 
ATOM 3278  N N    . LEU A 1 26 ? -0.415  -5.763  -31.375 1.00 0.00 ? 89  LEU A N    2 
ATOM 3279  C CA   . LEU A 1 26 ? 0.552   -6.327  -32.310 1.00 0.00 ? 89  LEU A CA   2 
ATOM 3280  C C    . LEU A 1 26 ? 0.710   -7.827  -32.099 1.00 0.00 ? 89  LEU A C    2 
ATOM 3281  O O    . LEU A 1 26 ? 1.148   -8.269  -31.035 1.00 0.00 ? 89  LEU A O    2 
ATOM 3282  C CB   . LEU A 1 26 ? 1.910   -5.633  -32.152 1.00 0.00 ? 89  LEU A CB   2 
ATOM 3283  C CG   . LEU A 1 26 ? 3.034   -6.157  -33.059 1.00 0.00 ? 89  LEU A CG   2 
ATOM 3284  C CD1  . LEU A 1 26 ? 2.675   -5.893  -34.513 1.00 0.00 ? 89  LEU A CD1  2 
ATOM 3285  C CD2  . LEU A 1 26 ? 4.341   -5.477  -32.687 1.00 0.00 ? 89  LEU A CD2  2 
ATOM 3286  H H    . LEU A 1 26 ? -0.137  -5.617  -30.408 1.00 0.00 ? 89  LEU A H    2 
ATOM 3287  H HA   . LEU A 1 26 ? 0.220   -6.157  -33.314 1.00 0.00 ? 89  LEU A HA   2 
ATOM 3288  H HB2  . LEU A 1 26 ? 1.763   -4.594  -32.340 1.00 0.00 ? 89  LEU A HB2  2 
ATOM 3289  H HB3  . LEU A 1 26 ? 2.228   -5.755  -31.115 1.00 0.00 ? 89  LEU A HB3  2 
ATOM 3290  H HG   . LEU A 1 26 ? 3.137   -7.233  -32.914 1.00 0.00 ? 89  LEU A HG   2 
ATOM 3291  H HD11 . LEU A 1 26 ? 3.557   -6.014  -35.138 1.00 0.00 ? 89  LEU A HD11 2 
ATOM 3292  H HD12 . LEU A 1 26 ? 2.296   -4.877  -34.616 1.00 0.00 ? 89  LEU A HD12 2 
ATOM 3293  H HD13 . LEU A 1 26 ? 1.911   -6.599  -34.842 1.00 0.00 ? 89  LEU A HD13 2 
ATOM 3294  H HD21 . LEU A 1 26 ? 5.076   -5.624  -33.474 1.00 0.00 ? 89  LEU A HD21 2 
ATOM 3295  H HD22 . LEU A 1 26 ? 4.720   -5.911  -31.761 1.00 0.00 ? 89  LEU A HD22 2 
ATOM 3296  H HD23 . LEU A 1 26 ? 4.176   -4.417  -32.539 1.00 0.00 ? 89  LEU A HD23 2 
ATOM 3297  N N    . LYS A 1 27 ? 0.354   -8.603  -33.114 1.00 0.00 ? 90  LYS A N    2 
ATOM 3298  C CA   . LYS A 1 27 ? 0.356   -10.059 -33.006 1.00 0.00 ? 90  LYS A CA   2 
ATOM 3299  C C    . LYS A 1 27 ? 1.250   -10.689 -34.065 1.00 0.00 ? 90  LYS A C    2 
ATOM 3300  O O    . LYS A 1 27 ? 1.359   -10.182 -35.180 1.00 0.00 ? 90  LYS A O    2 
ATOM 3301  C CB   . LYS A 1 27 ? -1.067  -10.605 -33.123 1.00 0.00 ? 90  LYS A CB   2 
ATOM 3302  C CG   . LYS A 1 27 ? -2.006  -10.165 -32.008 1.00 0.00 ? 90  LYS A CG   2 
ATOM 3303  C CD   . LYS A 1 27 ? -3.401  -10.742 -32.200 1.00 0.00 ? 90  LYS A CD   2 
ATOM 3304  C CE   . LYS A 1 27 ? -4.348  -10.276 -31.103 1.00 0.00 ? 90  LYS A CE   2 
ATOM 3305  N NZ   . LYS A 1 27 ? -5.726  -10.804 -31.298 1.00 0.00 ? 90  LYS A NZ   2 
ATOM 3306  H H    . LYS A 1 27 ? -0.010  -8.175  -33.964 1.00 0.00 ? 90  LYS A H    2 
ATOM 3307  H HA   . LYS A 1 27 ? 0.739   -10.354 -32.026 1.00 0.00 ? 90  LYS A HA   2 
ATOM 3308  H HB2  . LYS A 1 27 ? -1.484  -10.270 -34.071 1.00 0.00 ? 90  LYS A HB2  2 
ATOM 3309  H HB3  . LYS A 1 27 ? -1.021  -11.696 -33.128 1.00 0.00 ? 90  LYS A HB3  2 
ATOM 3310  H HG2  . LYS A 1 27 ? -1.605  -10.507 -31.053 1.00 0.00 ? 90  LYS A HG2  2 
ATOM 3311  H HG3  . LYS A 1 27 ? -2.067  -9.077  -32.005 1.00 0.00 ? 90  LYS A HG3  2 
ATOM 3312  H HD2  . LYS A 1 27 ? -3.789  -10.417 -33.166 1.00 0.00 ? 90  LYS A HD2  2 
ATOM 3313  H HD3  . LYS A 1 27 ? -3.342  -11.830 -32.181 1.00 0.00 ? 90  LYS A HD3  2 
ATOM 3314  H HE2  . LYS A 1 27 ? -3.972  -10.620 -30.141 1.00 0.00 ? 90  LYS A HE2  2 
ATOM 3315  H HE3  . LYS A 1 27 ? -4.380  -9.186  -31.104 1.00 0.00 ? 90  LYS A HE3  2 
ATOM 3316  H HZ1  . LYS A 1 27 ? -6.328  -10.528 -30.496 1.00 0.00 ? 90  LYS A HZ1  2 
ATOM 3317  H HZ2  . LYS A 1 27 ? -5.689  -11.843 -31.363 1.00 0.00 ? 90  LYS A HZ2  2 
ATOM 3318  H HZ3  . LYS A 1 27 ? -6.112  -10.427 -32.152 1.00 0.00 ? 90  LYS A HZ3  2 
ATOM 3319  N N    . VAL A 1 28 ? 1.888   -11.799 -33.707 1.00 0.00 ? 91  VAL A N    2 
ATOM 3320  C CA   . VAL A 1 28 ? 2.644   -12.592 -34.670 1.00 0.00 ? 91  VAL A CA   2 
ATOM 3321  C C    . VAL A 1 28 ? 2.173   -14.040 -34.682 1.00 0.00 ? 91  VAL A C    2 
ATOM 3322  O O    . VAL A 1 28 ? 2.393   -14.782 -33.725 1.00 0.00 ? 91  VAL A O    2 
ATOM 3323  C CB   . VAL A 1 28 ? 4.147   -12.544 -34.337 1.00 0.00 ? 91  VAL A CB   2 
ATOM 3324  C CG1  . VAL A 1 28 ? 4.940   -13.373 -35.337 1.00 0.00 ? 91  VAL A CG1  2 
ATOM 3325  C CG2  . VAL A 1 28 ? 4.631   -11.103 -34.325 1.00 0.00 ? 91  VAL A CG2  2 
ATOM 3326  H H    . VAL A 1 28 ? 1.736   -12.178 -32.771 1.00 0.00 ? 91  VAL A H    2 
ATOM 3327  H HA   . VAL A 1 28 ? 2.513   -12.182 -35.675 1.00 0.00 ? 91  VAL A HA   2 
ATOM 3328  H HB   . VAL A 1 28 ? 4.289   -12.969 -33.341 1.00 0.00 ? 91  VAL A HB   2 
ATOM 3329  H HG11 . VAL A 1 28 ? 4.689   -13.055 -36.336 1.00 0.00 ? 91  VAL A HG11 2 
ATOM 3330  H HG12 . VAL A 1 28 ? 4.705   -14.431 -35.219 1.00 0.00 ? 91  VAL A HG12 2 
ATOM 3331  H HG13 . VAL A 1 28 ? 6.008   -13.221 -35.167 1.00 0.00 ? 91  VAL A HG13 2 
ATOM 3332  H HG21 . VAL A 1 28 ? 5.664   -11.066 -33.982 1.00 0.00 ? 91  VAL A HG21 2 
ATOM 3333  H HG22 . VAL A 1 28 ? 4.006   -10.510 -33.657 1.00 0.00 ? 91  VAL A HG22 2 
ATOM 3334  H HG23 . VAL A 1 28 ? 4.570   -10.700 -35.336 1.00 0.00 ? 91  VAL A HG23 2 
ATOM 3335  N N    . LYS A 1 29 ? 1.527   -14.437 -35.772 1.00 0.00 ? 92  LYS A N    2 
ATOM 3336  C CA   . LYS A 1 29 ? 0.866   -15.736 -35.840 1.00 0.00 ? 92  LYS A CA   2 
ATOM 3337  C C    . LYS A 1 29 ? 1.345   -16.535 -37.047 1.00 0.00 ? 92  LYS A C    2 
ATOM 3338  O O    . LYS A 1 29 ? 1.667   -15.966 -38.091 1.00 0.00 ? 92  LYS A O    2 
ATOM 3339  C CB   . LYS A 1 29 ? -0.652  -15.563 -35.895 1.00 0.00 ? 92  LYS A CB   2 
ATOM 3340  C CG   . LYS A 1 29 ? -1.428  -16.866 -36.045 1.00 0.00 ? 92  LYS A CG   2 
ATOM 3341  C CD   . LYS A 1 29 ? -2.929  -16.622 -36.013 1.00 0.00 ? 92  LYS A CD   2 
ATOM 3342  C CE   . LYS A 1 29 ? -3.707  -17.919 -36.175 1.00 0.00 ? 92  LYS A CE   2 
ATOM 3343  N NZ   . LYS A 1 29 ? -5.177  -17.696 -36.135 1.00 0.00 ? 92  LYS A NZ   2 
ATOM 3344  H H    . LYS A 1 29 ? 1.361   -13.767 -36.524 1.00 0.00 ? 92  LYS A H    2 
ATOM 3345  H HA   . LYS A 1 29 ? 1.101   -16.316 -34.946 1.00 0.00 ? 92  LYS A HA   2 
ATOM 3346  H HB2  . LYS A 1 29 ? -0.976  -15.084 -34.971 1.00 0.00 ? 92  LYS A HB2  2 
ATOM 3347  H HB3  . LYS A 1 29 ? -0.905  -14.916 -36.725 1.00 0.00 ? 92  LYS A HB3  2 
ATOM 3348  H HG2  . LYS A 1 29 ? -1.164  -17.327 -36.997 1.00 0.00 ? 92  LYS A HG2  2 
ATOM 3349  H HG3  . LYS A 1 29 ? -1.160  -17.538 -35.231 1.00 0.00 ? 92  LYS A HG3  2 
ATOM 3350  H HD2  . LYS A 1 29 ? -3.194  -16.161 -35.060 1.00 0.00 ? 92  LYS A HD2  2 
ATOM 3351  H HD3  . LYS A 1 29 ? -3.197  -15.947 -36.826 1.00 0.00 ? 92  LYS A HD3  2 
ATOM 3352  H HE2  . LYS A 1 29 ? -3.424  -18.375 -37.114 1.00 0.00 ? 92  LYS A HE2  2 
ATOM 3353  H HE3  . LYS A 1 29 ? -3.432  -18.591 -35.360 1.00 0.00 ? 92  LYS A HE3  2 
ATOM 3354  H HZ1  . LYS A 1 29 ? -5.643  -18.319 -36.825 1.00 0.00 ? 92  LYS A HZ1  2 
ATOM 3355  H HZ2  . LYS A 1 29 ? -5.376  -16.702 -36.373 1.00 0.00 ? 92  LYS A HZ2  2 
ATOM 3356  H HZ3  . LYS A 1 29 ? -5.525  -17.898 -35.208 1.00 0.00 ? 92  LYS A HZ3  2 
ATOM 3357  N N    . VAL A 1 30 ? 1.391   -17.852 -36.897 1.00 0.00 ? 93  VAL A N    2 
ATOM 3358  C CA   . VAL A 1 30 ? 1.538   -18.749 -38.039 1.00 0.00 ? 93  VAL A CA   2 
ATOM 3359  C C    . VAL A 1 30 ? 0.269   -19.562 -38.266 1.00 0.00 ? 93  VAL A C    2 
ATOM 3360  O O    . VAL A 1 30 ? -0.128  -20.363 -37.421 1.00 0.00 ? 93  VAL A O    2 
ATOM 3361  C CB   . VAL A 1 30 ? 2.723   -19.705 -37.817 1.00 0.00 ? 93  VAL A CB   2 
ATOM 3362  C CG1  . VAL A 1 30 ? 2.882   -20.642 -39.006 1.00 0.00 ? 93  VAL A CG1  2 
ATOM 3363  C CG2  . VAL A 1 30 ? 3.998   -18.906 -37.587 1.00 0.00 ? 93  VAL A CG2  2 
ATOM 3364  H H    . VAL A 1 30 ? 1.071   -18.246 -36.014 1.00 0.00 ? 93  VAL A H    2 
ATOM 3365  H HA   . VAL A 1 30 ? 1.731   -18.173 -38.917 1.00 0.00 ? 93  VAL A HA   2 
ATOM 3366  H HB   . VAL A 1 30 ? 2.524   -20.305 -36.928 1.00 0.00 ? 93  VAL A HB   2 
ATOM 3367  H HG11 . VAL A 1 30 ? 3.836   -21.153 -38.944 1.00 0.00 ? 93  VAL A HG11 2 
ATOM 3368  H HG12 . VAL A 1 30 ? 2.842   -20.055 -39.923 1.00 0.00 ? 93  VAL A HG12 2 
ATOM 3369  H HG13 . VAL A 1 30 ? 2.075   -21.374 -39.009 1.00 0.00 ? 93  VAL A HG13 2 
ATOM 3370  H HG21 . VAL A 1 30 ? 3.915   -18.357 -36.649 1.00 0.00 ? 93  VAL A HG21 2 
ATOM 3371  H HG22 . VAL A 1 30 ? 4.852   -19.554 -37.542 1.00 0.00 ? 93  VAL A HG22 2 
ATOM 3372  H HG23 . VAL A 1 30 ? 4.121   -18.200 -38.404 1.00 0.00 ? 93  VAL A HG23 2 
ATOM 3373  N N    . LEU A 1 31 ? -0.364  -19.350 -39.415 1.00 0.00 ? 94  LEU A N    2 
ATOM 3374  C CA   . LEU A 1 31 ? -1.670  -19.936 -39.689 1.00 0.00 ? 94  LEU A CA   2 
ATOM 3375  C C    . LEU A 1 31 ? -1.561  -21.088 -40.681 1.00 0.00 ? 94  LEU A C    2 
ATOM 3376  O O    . LEU A 1 31 ? -2.022  -20.987 -41.816 1.00 0.00 ? 94  LEU A O    2 
ATOM 3377  C CB   . LEU A 1 31 ? -2.625  -18.869 -40.240 1.00 0.00 ? 94  LEU A CB   2 
ATOM 3378  C CG   . LEU A 1 31 ? -4.023  -19.366 -40.630 1.00 0.00 ? 94  LEU A CG   2 
ATOM 3379  C CD1  . LEU A 1 31 ? -4.737  -19.895 -39.393 1.00 0.00 ? 94  LEU A CD1  2 
ATOM 3380  C CD2  . LEU A 1 31 ? -4.807  -18.228 -41.268 1.00 0.00 ? 94  LEU A CD2  2 
ATOM 3381  H H    . LEU A 1 31 ? 0.010   -18.655 -40.061 1.00 0.00 ? 94  LEU A H    2 
ATOM 3382  H HA   . LEU A 1 31 ? -2.083  -20.325 -38.764 1.00 0.00 ? 94  LEU A HA   2 
ATOM 3383  H HB2  . LEU A 1 31 ? -2.758  -18.127 -39.455 1.00 0.00 ? 94  LEU A HB2  2 
ATOM 3384  H HB3  . LEU A 1 31 ? -2.173  -18.380 -41.085 1.00 0.00 ? 94  LEU A HB3  2 
ATOM 3385  H HG   . LEU A 1 31 ? -3.942  -20.169 -41.348 1.00 0.00 ? 94  LEU A HG   2 
ATOM 3386  H HD11 . LEU A 1 31 ? -5.743  -20.199 -39.683 1.00 0.00 ? 94  LEU A HD11 2 
ATOM 3387  H HD12 . LEU A 1 31 ? -4.812  -19.109 -38.657 1.00 0.00 ? 94  LEU A HD12 2 
ATOM 3388  H HD13 . LEU A 1 31 ? -4.221  -20.751 -38.974 1.00 0.00 ? 94  LEU A HD13 2 
ATOM 3389  H HD21 . LEU A 1 31 ? -4.735  -17.343 -40.638 1.00 0.00 ? 94  LEU A HD21 2 
ATOM 3390  H HD22 . LEU A 1 31 ? -5.852  -18.519 -41.371 1.00 0.00 ? 94  LEU A HD22 2 
ATOM 3391  H HD23 . LEU A 1 31 ? -4.396  -18.013 -42.246 1.00 0.00 ? 94  LEU A HD23 2 
ATOM 3392  N N    . GLY A 1 32 ? -0.946  -22.183 -40.242 1.00 0.00 ? 95  GLY A N    2 
ATOM 3393  C CA   . GLY A 1 32 ? -0.904  -23.406 -41.035 1.00 0.00 ? 95  GLY A CA   2 
ATOM 3394  C C    . GLY A 1 32 ? 0.163   -23.320 -42.119 1.00 0.00 ? 95  GLY A C    2 
ATOM 3395  O O    . GLY A 1 32 ? 1.356   -23.430 -41.842 1.00 0.00 ? 95  GLY A O    2 
ATOM 3396  H H    . GLY A 1 32 ? -0.613  -22.207 -39.279 1.00 0.00 ? 95  GLY A H    2 
ATOM 3397  H HA2  . GLY A 1 32 ? -0.672  -24.248 -40.383 1.00 0.00 ? 95  GLY A HA2  2 
ATOM 3398  H HA3  . GLY A 1 32 ? -1.872  -23.581 -41.503 1.00 0.00 ? 95  GLY A HA3  2 
ATOM 3399  N N    . ASP A 1 33 ? -0.278  -23.124 -43.359 1.00 0.00 ? 96  ASP A N    2 
ATOM 3400  C CA   . ASP A 1 33 ? 0.635   -23.059 -44.493 1.00 0.00 ? 96  ASP A CA   2 
ATOM 3401  C C    . ASP A 1 33 ? 1.137   -21.639 -44.717 1.00 0.00 ? 96  ASP A C    2 
ATOM 3402  O O    . ASP A 1 33 ? 2.002   -21.401 -45.561 1.00 0.00 ? 96  ASP A O    2 
ATOM 3403  C CB   . ASP A 1 33 ? -0.051  -23.570 -45.764 1.00 0.00 ? 96  ASP A CB   2 
ATOM 3404  C CG   . ASP A 1 33 ? -0.360  -25.061 -45.711 1.00 0.00 ? 96  ASP A CG   2 
ATOM 3405  O OD1  . ASP A 1 33 ? 0.319   -25.764 -45.002 1.00 0.00 ? 96  ASP A OD1  2 
ATOM 3406  O OD2  . ASP A 1 33 ? -1.273  -25.482 -46.379 1.00 0.00 ? 96  ASP A OD2  2 
ATOM 3407  H H    . ASP A 1 33 ? -1.281  -23.046 -43.524 1.00 0.00 ? 96  ASP A H    2 
ATOM 3408  H HA   . ASP A 1 33 ? 1.495   -23.701 -44.298 1.00 0.00 ? 96  ASP A HA   2 
ATOM 3409  H HB2  . ASP A 1 33 ? -0.986  -23.026 -45.896 1.00 0.00 ? 96  ASP A HB2  2 
ATOM 3410  H HB3  . ASP A 1 33 ? 0.596   -23.376 -46.620 1.00 0.00 ? 96  ASP A HB3  2 
ATOM 3411  N N    . VAL A 1 34 ? 0.590   -20.697 -43.957 1.00 0.00 ? 97  VAL A N    2 
ATOM 3412  C CA   . VAL A 1 34 ? 0.999   -19.301 -44.053 1.00 0.00 ? 97  VAL A CA   2 
ATOM 3413  C C    . VAL A 1 34 ? 1.475   -18.773 -42.705 1.00 0.00 ? 97  VAL A C    2 
ATOM 3414  O O    . VAL A 1 34 ? 1.230   -19.385 -41.667 1.00 0.00 ? 97  VAL A O    2 
ATOM 3415  C CB   . VAL A 1 34 ? -0.169  -18.434 -44.558 1.00 0.00 ? 97  VAL A CB   2 
ATOM 3416  C CG1  . VAL A 1 34 ? -0.570  -18.847 -45.966 1.00 0.00 ? 97  VAL A CG1  2 
ATOM 3417  C CG2  . VAL A 1 34 ? -1.349  -18.549 -43.604 1.00 0.00 ? 97  VAL A CG2  2 
ATOM 3418  H H    . VAL A 1 34 ? -0.117  -20.958 -43.271 1.00 0.00 ? 97  VAL A H    2 
ATOM 3419  H HA   . VAL A 1 34 ? 1.820   -19.205 -44.738 1.00 0.00 ? 97  VAL A HA   2 
ATOM 3420  H HB   . VAL A 1 34 ? 0.186   -17.404 -44.583 1.00 0.00 ? 97  VAL A HB   2 
ATOM 3421  H HG11 . VAL A 1 34 ? -0.716  -19.927 -46.002 1.00 0.00 ? 97  VAL A HG11 2 
ATOM 3422  H HG12 . VAL A 1 34 ? 0.217   -18.566 -46.629 1.00 0.00 ? 97  VAL A HG12 2 
ATOM 3423  H HG13 . VAL A 1 34 ? -1.489  -18.341 -46.255 1.00 0.00 ? 97  VAL A HG13 2 
ATOM 3424  H HG21 . VAL A 1 34 ? -1.103  -19.242 -42.812 1.00 0.00 ? 97  VAL A HG21 2 
ATOM 3425  H HG22 . VAL A 1 34 ? -2.238  -18.913 -44.125 1.00 0.00 ? 97  VAL A HG22 2 
ATOM 3426  H HG23 . VAL A 1 34 ? -1.568  -17.574 -43.168 1.00 0.00 ? 97  VAL A HG23 2 
ATOM 3427  N N    . ILE A 1 35 ? 2.156   -17.632 -42.730 1.00 0.00 ? 98  ILE A N    2 
ATOM 3428  C CA   . ILE A 1 35 ? 2.584   -16.969 -41.504 1.00 0.00 ? 98  ILE A CA   2 
ATOM 3429  C C    . ILE A 1 35 ? 1.871   -15.635 -41.322 1.00 0.00 ? 98  ILE A C    2 
ATOM 3430  O O    . ILE A 1 35 ? 2.289   -14.617 -41.875 1.00 0.00 ? 98  ILE A O    2 
ATOM 3431  C CB   . ILE A 1 35 ? 4.107   -16.743 -41.505 1.00 0.00 ? 98  ILE A CB   2 
ATOM 3432  C CG1  . ILE A 1 35 ? 4.845   -18.081 -41.583 1.00 0.00 ? 98  ILE A CG1  2 
ATOM 3433  C CG2  . ILE A 1 35 ? 4.530   -15.970 -40.265 1.00 0.00 ? 98  ILE A CG2  2 
ATOM 3434  C CD1  . ILE A 1 35 ? 6.333   -17.946 -41.813 1.00 0.00 ? 98  ILE A CD1  2 
ATOM 3435  H H    . ILE A 1 35 ? 2.312   -17.167 -43.623 1.00 0.00 ? 98  ILE A H    2 
ATOM 3436  H HA   . ILE A 1 35 ? 2.354   -17.594 -40.670 1.00 0.00 ? 98  ILE A HA   2 
ATOM 3437  H HB   . ILE A 1 35 ? 4.361   -16.164 -42.392 1.00 0.00 ? 98  ILE A HB   2 
ATOM 3438  H HG12 . ILE A 1 35 ? 4.680   -18.611 -40.644 1.00 0.00 ? 98  ILE A HG12 2 
ATOM 3439  H HG13 . ILE A 1 35 ? 4.409   -18.668 -42.393 1.00 0.00 ? 98  ILE A HG13 2 
ATOM 3440  H HG21 . ILE A 1 35 ? 4.892   -14.980 -40.547 1.00 0.00 ? 98  ILE A HG21 2 
ATOM 3441  H HG22 . ILE A 1 35 ? 5.331   -16.496 -39.740 1.00 0.00 ? 98  ILE A HG22 2 
ATOM 3442  H HG23 . ILE A 1 35 ? 3.696   -15.856 -39.571 1.00 0.00 ? 98  ILE A HG23 2 
ATOM 3443  H HD11 . ILE A 1 35 ? 6.675   -16.961 -41.496 1.00 0.00 ? 98  ILE A HD11 2 
ATOM 3444  H HD12 . ILE A 1 35 ? 6.857   -18.711 -41.239 1.00 0.00 ? 98  ILE A HD12 2 
ATOM 3445  H HD13 . ILE A 1 35 ? 6.548   -18.079 -42.873 1.00 0.00 ? 98  ILE A HD13 2 
ATOM 3446  N N    . GLU A 1 36 ? 0.795   -15.646 -40.543 1.00 0.00 ? 99  GLU A N    2 
ATOM 3447  C CA   . GLU A 1 36 ? -0.070  -14.478 -40.414 1.00 0.00 ? 99  GLU A CA   2 
ATOM 3448  C C    . GLU A 1 36 ? 0.477   -13.498 -39.385 1.00 0.00 ? 99  GLU A C    2 
ATOM 3449  O O    . GLU A 1 36 ? 0.156   -13.584 -38.200 1.00 0.00 ? 99  GLU A O    2 
ATOM 3450  C CB   . GLU A 1 36 ? -1.486  -14.906 -40.024 1.00 0.00 ? 99  GLU A CB   2 
ATOM 3451  C CG   . GLU A 1 36 ? -2.497  -13.768 -39.978 1.00 0.00 ? 99  GLU A CG   2 
ATOM 3452  C CD   . GLU A 1 36 ? -3.868  -14.220 -39.561 1.00 0.00 ? 99  GLU A CD   2 
ATOM 3453  O OE1  . GLU A 1 36 ? -4.017  -15.369 -39.222 1.00 0.00 ? 99  GLU A OE1  2 
ATOM 3454  O OE2  . GLU A 1 36 ? -4.769  -13.414 -39.584 1.00 0.00 ? 99  GLU A OE2  2 
ATOM 3455  H H    . GLU A 1 36 ? 0.495   -16.530 -40.130 1.00 0.00 ? 99  GLU A H    2 
ATOM 3456  H HA   . GLU A 1 36 ? -0.136  -13.958 -41.364 1.00 0.00 ? 99  GLU A HA   2 
ATOM 3457  H HB2  . GLU A 1 36 ? -1.831  -15.675 -40.703 1.00 0.00 ? 99  GLU A HB2  2 
ATOM 3458  H HB3  . GLU A 1 36 ? -1.443  -15.332 -39.022 1.00 0.00 ? 99  GLU A HB3  2 
ATOM 3459  H HG2  . GLU A 1 36 ? -2.147  -13.010 -39.278 1.00 0.00 ? 99  GLU A HG2  2 
ATOM 3460  H HG3  . GLU A 1 36 ? -2.556  -13.331 -40.976 1.00 0.00 ? 99  GLU A HG3  2 
ATOM 3461  N N    . VAL A 1 37 ? 1.304   -12.566 -39.845 1.00 0.00 ? 100 VAL A N    2 
ATOM 3462  C CA   . VAL A 1 37 ? 1.746   -11.455 -39.012 1.00 0.00 ? 100 VAL A CA   2 
ATOM 3463  C C    . VAL A 1 37 ? 0.790   -10.273 -39.116 1.00 0.00 ? 100 VAL A C    2 
ATOM 3464  O O    . VAL A 1 37 ? 0.575   -9.730  -40.198 1.00 0.00 ? 100 VAL A O    2 
ATOM 3465  C CB   . VAL A 1 37 ? 3.160   -11.006 -39.425 1.00 0.00 ? 100 VAL A CB   2 
ATOM 3466  C CG1  . VAL A 1 37 ? 3.605   -9.815  -38.591 1.00 0.00 ? 100 VAL A CG1  2 
ATOM 3467  C CG2  . VAL A 1 37 ? 4.136   -12.164 -39.277 1.00 0.00 ? 100 VAL A CG2  2 
ATOM 3468  H H    . VAL A 1 37 ? 1.499   -12.537 -40.845 1.00 0.00 ? 100 VAL A H    2 
ATOM 3469  H HA   . VAL A 1 37 ? 1.782   -11.787 -37.973 1.00 0.00 ? 100 VAL A HA   2 
ATOM 3470  H HB   . VAL A 1 37 ? 3.140   -10.697 -40.437 1.00 0.00 ? 100 VAL A HB   2 
ATOM 3471  H HG11 . VAL A 1 37 ? 4.663   -9.618  -38.750 1.00 0.00 ? 100 VAL A HG11 2 
ATOM 3472  H HG12 . VAL A 1 37 ? 3.435   -10.033 -37.537 1.00 0.00 ? 100 VAL A HG12 2 
ATOM 3473  H HG13 . VAL A 1 37 ? 3.032   -8.931  -38.873 1.00 0.00 ? 100 VAL A HG13 2 
ATOM 3474  H HG21 . VAL A 1 37 ? 5.161   -11.800 -39.198 1.00 0.00 ? 100 VAL A HG21 2 
ATOM 3475  H HG22 . VAL A 1 37 ? 4.057   -12.805 -40.155 1.00 0.00 ? 100 VAL A HG22 2 
ATOM 3476  H HG23 . VAL A 1 37 ? 3.892   -12.745 -38.397 1.00 0.00 ? 100 VAL A HG23 2 
ATOM 3477  N N    . HIS A 1 38 ? 0.218   -9.881  -37.982 1.00 0.00 ? 101 HIS A N    2 
ATOM 3478  C CA   . HIS A 1 38 ? -0.933  -8.986  -37.977 1.00 0.00 ? 101 HIS A CA   2 
ATOM 3479  C C    . HIS A 1 38 ? -0.873  -8.019  -36.801 1.00 0.00 ? 101 HIS A C    2 
ATOM 3480  O O    . HIS A 1 38 ? -0.661  -8.425  -35.661 1.00 0.00 ? 101 HIS A O    2 
ATOM 3481  C CB   . HIS A 1 38 ? -2.239  -9.787  -37.919 1.00 0.00 ? 101 HIS A CB   2 
ATOM 3482  C CG   . HIS A 1 38 ? -2.219  -10.900 -36.918 1.00 0.00 ? 101 HIS A CG   2 
ATOM 3483  N ND1  . HIS A 1 38 ? -3.351  -11.321 -36.251 1.00 0.00 ? 101 HIS A ND1  2 
ATOM 3484  C CD2  . HIS A 1 38 ? -1.206  -11.677 -36.470 1.00 0.00 ? 101 HIS A CD2  2 
ATOM 3485  C CE1  . HIS A 1 38 ? -3.034  -12.312 -35.438 1.00 0.00 ? 101 HIS A CE1  2 
ATOM 3486  N NE2  . HIS A 1 38 ? -1.739  -12.547 -35.549 1.00 0.00 ? 101 HIS A NE2  2 
ATOM 3487  H H    . HIS A 1 38 ? 0.431   -10.391 -37.131 1.00 0.00 ? 101 HIS A H    2 
ATOM 3488  H HA   . HIS A 1 38 ? -0.914  -8.402  -38.889 1.00 0.00 ? 101 HIS A HA   2 
ATOM 3489  H HB2  . HIS A 1 38 ? -3.063  -9.120  -37.675 1.00 0.00 ? 101 HIS A HB2  2 
ATOM 3490  H HB3  . HIS A 1 38 ? -2.424  -10.223 -38.895 1.00 0.00 ? 101 HIS A HB3  2 
ATOM 3491  H HD2  . HIS A 1 38 ? -0.278  -11.834 -36.956 1.00 0.00 ? 101 HIS A HD2  2 
ATOM 3492  H HE1  . HIS A 1 38 ? -3.721  -12.838 -34.791 1.00 0.00 ? 101 HIS A HE1  2 
ATOM 3493  H HE2  . HIS A 1 38 ? -1.224  -13.252 -35.040 1.00 0.00 ? 101 HIS A HE2  2 
ATOM 3494  N N    . GLY A 1 39 ? -1.062  -6.735  -37.091 1.00 0.00 ? 102 GLY A N    2 
ATOM 3495  C CA   . GLY A 1 39 ? -0.850  -5.689  -36.096 1.00 0.00 ? 102 GLY A CA   2 
ATOM 3496  C C    . GLY A 1 39 ? -1.997  -4.685  -36.100 1.00 0.00 ? 102 GLY A C    2 
ATOM 3497  O O    . GLY A 1 39 ? -3.004  -4.882  -36.781 1.00 0.00 ? 102 GLY A O    2 
ATOM 3498  H H    . GLY A 1 39 ? -1.209  -6.463  -38.059 1.00 0.00 ? 102 GLY A H    2 
ATOM 3499  H HA2  . GLY A 1 39 ? -0.848  -6.149  -35.122 1.00 0.00 ? 102 GLY A HA2  2 
ATOM 3500  H HA3  . GLY A 1 39 ? 0.096   -5.171  -36.250 1.00 0.00 ? 102 GLY A HA3  2 
ATOM 3501  N N    . LYS A 1 40 ? -1.841  -3.612  -35.334 1.00 0.00 ? 103 LYS A N    2 
ATOM 3502  C CA   . LYS A 1 40 ? -2.779  -2.498  -35.375 1.00 0.00 ? 103 LYS A CA   2 
ATOM 3503  C C    . LYS A 1 40 ? -2.256  -1.308  -34.583 1.00 0.00 ? 103 LYS A C    2 
ATOM 3504  O O    . LYS A 1 40 ? -2.016  -1.407  -33.378 1.00 0.00 ? 103 LYS A O    2 
ATOM 3505  C CB   . LYS A 1 40 ? -4.146  -2.927  -34.840 1.00 0.00 ? 103 LYS A CB   2 
ATOM 3506  C CG   . LYS A 1 40 ? -5.231  -1.863  -34.957 1.00 0.00 ? 103 LYS A CG   2 
ATOM 3507  C CD   . LYS A 1 40 ? -6.591  -2.416  -34.563 1.00 0.00 ? 103 LYS A CD   2 
ATOM 3508  C CE   . LYS A 1 40 ? -7.689  -1.383  -34.767 1.00 0.00 ? 103 LYS A CE   2 
ATOM 3509  N NZ   . LYS A 1 40 ? -9.027  -1.910  -34.383 1.00 0.00 ? 103 LYS A NZ   2 
ATOM 3510  H H    . LYS A 1 40 ? -0.976  -3.513  -34.802 1.00 0.00 ? 103 LYS A H    2 
ATOM 3511  H HA   . LYS A 1 40 ? -2.892  -2.186  -36.392 1.00 0.00 ? 103 LYS A HA   2 
ATOM 3512  H HB2  . LYS A 1 40 ? -4.478  -3.787  -35.405 1.00 0.00 ? 103 LYS A HB2  2 
ATOM 3513  H HB3  . LYS A 1 40 ? -4.064  -3.219  -33.816 1.00 0.00 ? 103 LYS A HB3  2 
ATOM 3514  H HG2  . LYS A 1 40 ? -4.977  -1.032  -34.299 1.00 0.00 ? 103 LYS A HG2  2 
ATOM 3515  H HG3  . LYS A 1 40 ? -5.273  -1.512  -35.987 1.00 0.00 ? 103 LYS A HG3  2 
ATOM 3516  H HD2  . LYS A 1 40 ? -6.807  -3.292  -35.174 1.00 0.00 ? 103 LYS A HD2  2 
ATOM 3517  H HD3  . LYS A 1 40 ? -6.568  -2.707  -33.511 1.00 0.00 ? 103 LYS A HD3  2 
ATOM 3518  H HE2  . LYS A 1 40 ? -7.473  -0.532  -34.155 1.00 0.00 ? 103 LYS A HE2  2 
ATOM 3519  H HE3  . LYS A 1 40 ? -7.709  -1.080  -35.816 1.00 0.00 ? 103 LYS A HE3  2 
ATOM 3520  H HZ1  . LYS A 1 40 ? -8.914  -2.853  -33.962 1.00 0.00 ? 103 LYS A HZ1  2 
ATOM 3521  H HZ2  . LYS A 1 40 ? -9.631  -1.973  -35.227 1.00 0.00 ? 103 LYS A HZ2  2 
ATOM 3522  H HZ3  . LYS A 1 40 ? -9.453  -1.290  -33.709 1.00 0.00 ? 103 LYS A HZ3  2 
ATOM 3523  N N    . HIS A 1 41 ? -2.083  -0.178  -35.261 1.00 0.00 ? 104 HIS A N    2 
ATOM 3524  C CA   . HIS A 1 41 ? -1.778  1.080   -34.593 1.00 0.00 ? 104 HIS A CA   2 
ATOM 3525  C C    . HIS A 1 41 ? -2.854  2.124   -34.868 1.00 0.00 ? 104 HIS A C    2 
ATOM 3526  O O    . HIS A 1 41 ? -2.995  2.602   -35.994 1.00 0.00 ? 104 HIS A O    2 
ATOM 3527  C CB   . HIS A 1 41 ? -0.414  1.615   -35.037 1.00 0.00 ? 104 HIS A CB   2 
ATOM 3528  C CG   . HIS A 1 41 ? -0.003  2.871   -34.336 1.00 0.00 ? 104 HIS A CG   2 
ATOM 3529  N ND1  . HIS A 1 41 ? 0.999   3.693   -34.810 1.00 0.00 ? 104 HIS A ND1  2 
ATOM 3530  C CD2  . HIS A 1 41 ? -0.458  3.448   -33.200 1.00 0.00 ? 104 HIS A CD2  2 
ATOM 3531  C CE1  . HIS A 1 41 ? 1.144   4.722   -33.992 1.00 0.00 ? 104 HIS A CE1  2 
ATOM 3532  N NE2  . HIS A 1 41 ? 0.273   4.595   -33.008 1.00 0.00 ? 104 HIS A NE2  2 
ATOM 3533  H H    . HIS A 1 41 ? -2.332  -0.158  -36.250 1.00 0.00 ? 104 HIS A H    2 
ATOM 3534  H HA   . HIS A 1 41 ? -1.734  0.921   -33.511 1.00 0.00 ? 104 HIS A HA   2 
ATOM 3535  H HB2  . HIS A 1 41 ? 0.340   0.851   -34.854 1.00 0.00 ? 104 HIS A HB2  2 
ATOM 3536  H HB3  . HIS A 1 41 ? -0.464  1.812   -36.109 1.00 0.00 ? 104 HIS A HB3  2 
ATOM 3537  H HD1  . HIS A 1 41 ? 1.544   3.537   -35.656 1.00 0.00 ? 104 HIS A HD1  2 
ATOM 3538  H HD2  . HIS A 1 41 ? -1.376  3.192   -32.692 1.00 0.00 ? 104 HIS A HD2  2 
ATOM 3539  H HE1  . HIS A 1 41 ? 1.855   5.526   -34.111 1.00 0.00 ? 104 HIS A HE1  2 
ATOM 3540  N N    . GLU A 1 42 ? -3.609  2.474   -33.834 1.00 0.00 ? 105 GLU A N    2 
ATOM 3541  C CA   . GLU A 1 42 ? -4.845  3.229   -34.008 1.00 0.00 ? 105 GLU A CA   2 
ATOM 3542  C C    . GLU A 1 42 ? -4.563  4.717   -34.172 1.00 0.00 ? 105 GLU A C    2 
ATOM 3543  O O    . GLU A 1 42 ? -4.920  5.320   -35.185 1.00 0.00 ? 105 GLU A O    2 
ATOM 3544  C CB   . GLU A 1 42 ? -5.780  3.004   -32.819 1.00 0.00 ? 105 GLU A CB   2 
ATOM 3545  C CG   . GLU A 1 42 ? -6.337  1.592   -32.715 1.00 0.00 ? 105 GLU A CG   2 
ATOM 3546  C CD   . GLU A 1 42 ? -7.202  1.393   -31.502 1.00 0.00 ? 105 GLU A CD   2 
ATOM 3547  O OE1  . GLU A 1 42 ? -7.266  2.281   -30.688 1.00 0.00 ? 105 GLU A OE1  2 
ATOM 3548  O OE2  . GLU A 1 42 ? -7.803  0.349   -31.392 1.00 0.00 ? 105 GLU A OE2  2 
ATOM 3549  H H    . GLU A 1 42 ? -3.451  2.005   -32.942 1.00 0.00 ? 105 GLU A H    2 
ATOM 3550  H HA   . GLU A 1 42 ? -5.360  2.881   -34.888 1.00 0.00 ? 105 GLU A HA   2 
ATOM 3551  H HB2  . GLU A 1 42 ? -5.230  3.212   -31.901 1.00 0.00 ? 105 GLU A HB2  2 
ATOM 3552  H HB3  . GLU A 1 42 ? -6.618  3.698   -32.893 1.00 0.00 ? 105 GLU A HB3  2 
ATOM 3553  H HG2  . GLU A 1 42 ? -6.936  1.436   -33.601 1.00 0.00 ? 105 GLU A HG2  2 
ATOM 3554  H HG3  . GLU A 1 42 ? -5.510  0.879   -32.702 1.00 0.00 ? 105 GLU A HG3  2 
ATOM 3555  N N    . GLU A 1 43 ? -3.920  5.305   -33.169 1.00 0.00 ? 106 GLU A N    2 
ATOM 3556  C CA   . GLU A 1 43 ? -3.531  6.709   -33.226 1.00 0.00 ? 106 GLU A CA   2 
ATOM 3557  C C    . GLU A 1 43 ? -2.140  6.871   -33.826 1.00 0.00 ? 106 GLU A C    2 
ATOM 3558  O O    . GLU A 1 43 ? -1.145  6.920   -33.105 1.00 0.00 ? 106 GLU A O    2 
ATOM 3559  C CB   . GLU A 1 43 ? -3.570  7.331   -31.828 1.00 0.00 ? 106 GLU A CB   2 
ATOM 3560  C CG   . GLU A 1 43 ? -4.959  7.390   -31.205 1.00 0.00 ? 106 GLU A CG   2 
ATOM 3561  C CD   . GLU A 1 43 ? -4.960  8.027   -29.843 1.00 0.00 ? 106 GLU A CD   2 
ATOM 3562  O OE1  . GLU A 1 43 ? -3.902  8.330   -29.349 1.00 0.00 ? 106 GLU A OE1  2 
ATOM 3563  O OE2  . GLU A 1 43 ? -6.022  8.207   -29.296 1.00 0.00 ? 106 GLU A OE2  2 
ATOM 3564  H H    . GLU A 1 43 ? -3.650  4.748   -32.359 1.00 0.00 ? 106 GLU A H    2 
ATOM 3565  H HA   . GLU A 1 43 ? -4.238  7.237   -33.828 1.00 0.00 ? 106 GLU A HA   2 
ATOM 3566  H HB2  . GLU A 1 43 ? -2.931  6.741   -31.174 1.00 0.00 ? 106 GLU A HB2  2 
ATOM 3567  H HB3  . GLU A 1 43 ? -3.174  8.348   -31.884 1.00 0.00 ? 106 GLU A HB3  2 
ATOM 3568  H HG2  . GLU A 1 43 ? -5.607  7.968   -31.863 1.00 0.00 ? 106 GLU A HG2  2 
ATOM 3569  H HG3  . GLU A 1 43 ? -5.348  6.375   -31.123 1.00 0.00 ? 106 GLU A HG3  2 
ATOM 3570  N N    . ARG A 1 44 ? -2.078  6.956   -35.152 1.00 0.00 ? 107 ARG A N    2 
ATOM 3571  C CA   . ARG A 1 44 ? -0.805  6.992   -35.857 1.00 0.00 ? 107 ARG A CA   2 
ATOM 3572  C C    . ARG A 1 44 ? -0.688  8.245   -36.716 1.00 0.00 ? 107 ARG A C    2 
ATOM 3573  O O    . ARG A 1 44 ? -0.991  8.224   -37.909 1.00 0.00 ? 107 ARG A O    2 
ATOM 3574  C CB   . ARG A 1 44 ? -0.643  5.762   -36.736 1.00 0.00 ? 107 ARG A CB   2 
ATOM 3575  C CG   . ARG A 1 44 ? 0.705   5.639   -37.429 1.00 0.00 ? 107 ARG A CG   2 
ATOM 3576  C CD   . ARG A 1 44 ? 0.826   4.360   -38.172 1.00 0.00 ? 107 ARG A CD   2 
ATOM 3577  N NE   . ARG A 1 44 ? 2.104   4.251   -38.858 1.00 0.00 ? 107 ARG A NE   2 
ATOM 3578  C CZ   . ARG A 1 44 ? 3.211   3.696   -38.329 1.00 0.00 ? 107 ARG A CZ   2 
ATOM 3579  N NH1  . ARG A 1 44 ? 3.182   3.205   -37.110 1.00 0.00 ? 107 ARG A NH1  2 
ATOM 3580  N NH2  . ARG A 1 44 ? 4.327   3.645   -39.035 1.00 0.00 ? 107 ARG A NH2  2 
ATOM 3581  H H    . ARG A 1 44 ? -2.940  6.895   -35.694 1.00 0.00 ? 107 ARG A H    2 
ATOM 3582  H HA   . ARG A 1 44 ? 0.018   7.002   -35.137 1.00 0.00 ? 107 ARG A HA   2 
ATOM 3583  H HB2  . ARG A 1 44 ? -0.786  4.876   -36.118 1.00 0.00 ? 107 ARG A HB2  2 
ATOM 3584  H HB3  . ARG A 1 44 ? -1.403  5.792   -37.464 1.00 0.00 ? 107 ARG A HB3  2 
ATOM 3585  H HG2  . ARG A 1 44 ? 0.807   6.461   -38.137 1.00 0.00 ? 107 ARG A HG2  2 
ATOM 3586  H HG3  . ARG A 1 44 ? 1.496   5.703   -36.683 1.00 0.00 ? 107 ARG A HG3  2 
ATOM 3587  H HD2  . ARG A 1 44 ? 0.750   3.541   -37.455 1.00 0.00 ? 107 ARG A HD2  2 
ATOM 3588  H HD3  . ARG A 1 44 ? 0.016   4.276   -38.888 1.00 0.00 ? 107 ARG A HD3  2 
ATOM 3589  H HE   . ARG A 1 44 ? 2.167   4.619   -39.764 1.00 0.00 ? 107 ARG A HE   2 
ATOM 3590  H HH11 . ARG A 1 44 ? 2.340   3.243   -36.575 1.00 0.00 ? 107 ARG A HH11 2 
ATOM 3591  H HH12 . ARG A 1 44 ? 4.012   2.788   -36.714 1.00 0.00 ? 107 ARG A HH12 2 
ATOM 3592  H HH21 . ARG A 1 44 ? 4.353   4.018   -39.962 1.00 0.00 ? 107 ARG A HH21 2 
ATOM 3593  H HH22 . ARG A 1 44 ? 5.146   3.228   -38.640 1.00 0.00 ? 107 ARG A HH22 2 
ATOM 3594  N N    . GLN A 1 45 ? -0.242  9.336   -36.105 1.00 0.00 ? 108 GLN A N    2 
ATOM 3595  C CA   . GLN A 1 45 ? -0.035  10.588  -36.823 1.00 0.00 ? 108 GLN A CA   2 
ATOM 3596  C C    . GLN A 1 45 ? 0.671   10.350  -38.153 1.00 0.00 ? 108 GLN A C    2 
ATOM 3597  O O    . GLN A 1 45 ? 1.760   9.780   -38.194 1.00 0.00 ? 108 GLN A O    2 
ATOM 3598  C CB   . GLN A 1 45 ? 0.774   11.568  -35.971 1.00 0.00 ? 108 GLN A CB   2 
ATOM 3599  C CG   . GLN A 1 45 ? 1.102   12.876  -36.670 1.00 0.00 ? 108 GLN A CG   2 
ATOM 3600  C CD   . GLN A 1 45 ? -0.126  13.739  -36.889 1.00 0.00 ? 108 GLN A CD   2 
ATOM 3601  O OE1  . GLN A 1 45 ? -0.881  14.020  -35.954 1.00 0.00 ? 108 GLN A OE1  2 
ATOM 3602  N NE2  . GLN A 1 45 ? -0.335  14.165  -38.129 1.00 0.00 ? 108 GLN A NE2  2 
ATOM 3603  H H    . GLN A 1 45 ? 0.008   9.284   -35.117 1.00 0.00 ? 108 GLN A H    2 
ATOM 3604  H HA   . GLN A 1 45 ? -0.991  11.050  -37.008 1.00 0.00 ? 108 GLN A HA   2 
ATOM 3605  H HB2  . GLN A 1 45 ? 0.206   11.795  -35.070 1.00 0.00 ? 108 GLN A HB2  2 
ATOM 3606  H HB3  . GLN A 1 45 ? 1.703   11.077  -35.683 1.00 0.00 ? 108 GLN A HB3  2 
ATOM 3607  H HG2  . GLN A 1 45 ? 1.803   13.438  -36.050 1.00 0.00 ? 108 GLN A HG2  2 
ATOM 3608  H HG3  . GLN A 1 45 ? 1.575   12.673  -37.629 1.00 0.00 ? 108 GLN A HG3  2 
ATOM 3609  H HE21 . GLN A 1 45 ? 0.313   13.922  -38.880 1.00 0.00 ? 108 GLN A HE21 2 
ATOM 3610  H HE22 . GLN A 1 45 ? -1.150  14.744  -38.329 1.00 0.00 ? 108 GLN A HE22 2 
ATOM 3611  N N    . ASP A 1 46 ? 0.041   10.790  -39.236 1.00 0.00 ? 109 ASP A N    2 
ATOM 3612  C CA   . ASP A 1 46 ? 0.583   10.580  -40.575 1.00 0.00 ? 109 ASP A CA   2 
ATOM 3613  C C    . ASP A 1 46 ? 0.522   11.859  -41.401 1.00 0.00 ? 109 ASP A C    2 
ATOM 3614  O O    . ASP A 1 46 ? 0.455   12.958  -40.853 1.00 0.00 ? 109 ASP A O    2 
ATOM 3615  C CB   . ASP A 1 46 ? -0.180  9.465   -41.294 1.00 0.00 ? 109 ASP A CB   2 
ATOM 3616  C CG   . ASP A 1 46 ? 0.695   8.669   -42.251 1.00 0.00 ? 109 ASP A CG   2 
ATOM 3617  O OD1  . ASP A 1 46 ? 1.884   8.888   -42.261 1.00 0.00 ? 109 ASP A OD1  2 
ATOM 3618  O OD2  . ASP A 1 46 ? 0.169   7.850   -42.966 1.00 0.00 ? 109 ASP A OD2  2 
ATOM 3619  H H    . ASP A 1 46 ? -0.856  11.244  -39.139 1.00 0.00 ? 109 ASP A H    2 
ATOM 3620  H HA   . ASP A 1 46 ? 1.630   10.292  -40.488 1.00 0.00 ? 109 ASP A HA   2 
ATOM 3621  H HB2  . ASP A 1 46 ? -0.538  8.789   -40.528 1.00 0.00 ? 109 ASP A HB2  2 
ATOM 3622  H HB3  . ASP A 1 46 ? -1.032  9.882   -41.835 1.00 0.00 ? 109 ASP A HB3  2 
ATOM 3623  N N    . GLU A 1 47 ? 0.547   11.706  -42.720 1.00 0.00 ? 110 GLU A N    2 
ATOM 3624  C CA   . GLU A 1 47 ? 0.445   12.845  -43.624 1.00 0.00 ? 110 GLU A CA   2 
ATOM 3625  C C    . GLU A 1 47 ? -0.937  13.482  -43.553 1.00 0.00 ? 110 GLU A C    2 
ATOM 3626  O O    . GLU A 1 47 ? -1.085  14.691  -43.734 1.00 0.00 ? 110 GLU A O    2 
ATOM 3627  C CB   . GLU A 1 47 ? 0.747   12.415  -45.060 1.00 0.00 ? 110 GLU A CB   2 
ATOM 3628  C CG   . GLU A 1 47 ? 2.198   12.028  -45.310 1.00 0.00 ? 110 GLU A CG   2 
ATOM 3629  C CD   . GLU A 1 47 ? 2.439   11.526  -46.706 1.00 0.00 ? 110 GLU A CD   2 
ATOM 3630  O OE1  . GLU A 1 47 ? 1.519   11.016  -47.299 1.00 0.00 ? 110 GLU A OE1  2 
ATOM 3631  O OE2  . GLU A 1 47 ? 3.541   11.656  -47.181 1.00 0.00 ? 110 GLU A OE2  2 
ATOM 3632  H H    . GLU A 1 47 ? 0.605   10.766  -43.109 1.00 0.00 ? 110 GLU A H    2 
ATOM 3633  H HA   . GLU A 1 47 ? 1.189   13.587  -43.329 1.00 0.00 ? 110 GLU A HA   2 
ATOM 3634  H HB2  . GLU A 1 47 ? 0.119   11.557  -45.299 1.00 0.00 ? 110 GLU A HB2  2 
ATOM 3635  H HB3  . GLU A 1 47 ? 0.493   13.235  -45.733 1.00 0.00 ? 110 GLU A HB3  2 
ATOM 3636  H HG2  . GLU A 1 47 ? 2.822   12.904  -45.138 1.00 0.00 ? 110 GLU A HG2  2 
ATOM 3637  H HG3  . GLU A 1 47 ? 2.474   11.248  -44.600 1.00 0.00 ? 110 GLU A HG3  2 
ATOM 3638  N N    . HIS A 1 48 ? -1.949  12.661  -43.290 1.00 0.00 ? 111 HIS A N    2 
ATOM 3639  C CA   . HIS A 1 48 ? -3.320  13.145  -43.182 1.00 0.00 ? 111 HIS A CA   2 
ATOM 3640  C C    . HIS A 1 48 ? -3.897  12.854  -41.801 1.00 0.00 ? 111 HIS A C    2 
ATOM 3641  O O    . HIS A 1 48 ? -4.536  11.824  -41.592 1.00 0.00 ? 111 HIS A O    2 
ATOM 3642  C CB   . HIS A 1 48 ? -4.206  12.510  -44.258 1.00 0.00 ? 111 HIS A CB   2 
ATOM 3643  C CG   . HIS A 1 48 ? -3.792  12.850  -45.657 1.00 0.00 ? 111 HIS A CG   2 
ATOM 3644  N ND1  . HIS A 1 48 ? -2.693  12.280  -46.264 1.00 0.00 ? 111 HIS A ND1  2 
ATOM 3645  C CD2  . HIS A 1 48 ? -4.327  13.700  -46.564 1.00 0.00 ? 111 HIS A CD2  2 
ATOM 3646  C CE1  . HIS A 1 48 ? -2.571  12.766  -47.488 1.00 0.00 ? 111 HIS A CE1  2 
ATOM 3647  N NE2  . HIS A 1 48 ? -3.549  13.628  -47.693 1.00 0.00 ? 111 HIS A NE2  2 
ATOM 3648  H H    . HIS A 1 48 ? -1.762  11.668  -43.150 1.00 0.00 ? 111 HIS A H    2 
ATOM 3649  H HA   . HIS A 1 48 ? -3.326  14.212  -43.356 1.00 0.00 ? 111 HIS A HA   2 
ATOM 3650  H HB2  . HIS A 1 48 ? -4.135  11.430  -44.146 1.00 0.00 ? 111 HIS A HB2  2 
ATOM 3651  H HB3  . HIS A 1 48 ? -5.228  12.798  -44.120 1.00 0.00 ? 111 HIS A HB3  2 
ATOM 3652  H HD2  . HIS A 1 48 ? -5.311  14.142  -46.500 1.00 0.00 ? 111 HIS A HD2  2 
ATOM 3653  H HE1  . HIS A 1 48 ? -1.789  12.533  -48.185 1.00 0.00 ? 111 HIS A HE1  2 
ATOM 3654  H HE2  . HIS A 1 48 ? -3.701  14.151  -48.543 1.00 0.00 ? 111 HIS A HE2  2 
ATOM 3655  N N    . GLY A 1 49 ? -3.669  13.768  -40.866 1.00 0.00 ? 112 GLY A N    2 
ATOM 3656  C CA   . GLY A 1 49 ? -4.097  13.573  -39.485 1.00 0.00 ? 112 GLY A CA   2 
ATOM 3657  C C    . GLY A 1 49 ? -3.340  12.422  -38.832 1.00 0.00 ? 112 GLY A C    2 
ATOM 3658  O O    . GLY A 1 49 ? -2.119  12.327  -38.943 1.00 0.00 ? 112 GLY A O    2 
ATOM 3659  H H    . GLY A 1 49 ? -3.123  14.596  -41.106 1.00 0.00 ? 112 GLY A H    2 
ATOM 3660  H HA2  . GLY A 1 49 ? -3.921  14.489  -38.923 1.00 0.00 ? 112 GLY A HA2  2 
ATOM 3661  H HA3  . GLY A 1 49 ? -5.148  13.336  -39.472 1.00 0.00 ? 112 GLY A HA3  2 
ATOM 3662  N N    . PHE A 1 50 ? -4.076  11.550  -38.152 1.00 0.00 ? 113 PHE A N    2 
ATOM 3663  C CA   . PHE A 1 50 ? -3.539  10.267  -37.718 1.00 0.00 ? 113 PHE A CA   2 
ATOM 3664  C C    . PHE A 1 50 ? -4.311  9.107   -38.331 1.00 0.00 ? 113 PHE A C    2 
ATOM 3665  O O    . PHE A 1 50 ? -5.511  9.215   -38.586 1.00 0.00 ? 113 PHE A O    2 
ATOM 3666  C CB   . PHE A 1 50 ? -3.573  10.160  -36.193 1.00 0.00 ? 113 PHE A CB   2 
ATOM 3667  C CG   . PHE A 1 50 ? -4.945  9.905   -35.635 1.00 0.00 ? 113 PHE A CG   2 
ATOM 3668  C CD1  . PHE A 1 50 ? -5.439  8.613   -35.534 1.00 0.00 ? 113 PHE A CD1  2 
ATOM 3669  C CD2  . PHE A 1 50 ? -5.743  10.956  -35.211 1.00 0.00 ? 113 PHE A CD2  2 
ATOM 3670  C CE1  . PHE A 1 50 ? -6.699  8.376   -35.022 1.00 0.00 ? 113 PHE A CE1  2 
ATOM 3671  C CE2  . PHE A 1 50 ? -7.005  10.723  -34.698 1.00 0.00 ? 113 PHE A CE2  2 
ATOM 3672  C CZ   . PHE A 1 50 ? -7.484  9.432   -34.603 1.00 0.00 ? 113 PHE A CZ   2 
ATOM 3673  H H    . PHE A 1 50 ? -5.088  11.677  -38.143 1.00 0.00 ? 113 PHE A H    2 
ATOM 3674  H HA   . PHE A 1 50 ? -2.517  10.163  -38.066 1.00 0.00 ? 113 PHE A HA   2 
ATOM 3675  H HB2  . PHE A 1 50 ? -2.924  9.343   -35.882 1.00 0.00 ? 113 PHE A HB2  2 
ATOM 3676  H HB3  . PHE A 1 50 ? -3.190  11.090  -35.772 1.00 0.00 ? 113 PHE A HB3  2 
ATOM 3677  H HD1  . PHE A 1 50 ? -4.837  7.789   -35.887 1.00 0.00 ? 113 PHE A HD1  2 
ATOM 3678  H HD2  . PHE A 1 50 ? -5.371  11.966  -35.283 1.00 0.00 ? 113 PHE A HD2  2 
ATOM 3679  H HE1  . PHE A 1 50 ? -7.073  7.366   -34.952 1.00 0.00 ? 113 PHE A HE1  2 
ATOM 3680  H HE2  . PHE A 1 50 ? -7.618  11.552  -34.371 1.00 0.00 ? 113 PHE A HE2  2 
ATOM 3681  H HZ   . PHE A 1 50 ? -8.389  9.236   -34.045 1.00 0.00 ? 113 PHE A HZ   2 
ATOM 3682  N N    . ILE A 1 51 ? -3.619  7.999   -38.567 1.00 0.00 ? 114 ILE A N    2 
ATOM 3683  C CA   . ILE A 1 51 ? -4.220  6.845   -39.225 1.00 0.00 ? 114 ILE A CA   2 
ATOM 3684  C C    . ILE A 1 51 ? -4.376  5.679   -38.257 1.00 0.00 ? 114 ILE A C    2 
ATOM 3685  O O    . ILE A 1 51 ? -3.615  5.549   -37.298 1.00 0.00 ? 114 ILE A O    2 
ATOM 3686  C CB   . ILE A 1 51 ? -3.378  6.400   -40.434 1.00 0.00 ? 114 ILE A CB   2 
ATOM 3687  C CG1  . ILE A 1 51 ? -1.959  6.034   -39.992 1.00 0.00 ? 114 ILE A CG1  2 
ATOM 3688  C CG2  . ILE A 1 51 ? -3.344  7.495   -41.491 1.00 0.00 ? 114 ILE A CG2  2 
ATOM 3689  C CD1  . ILE A 1 51 ? -1.112  5.436   -41.090 1.00 0.00 ? 114 ILE A CD1  2 
ATOM 3690  H H    . ILE A 1 51 ? -2.630  7.976   -38.343 1.00 0.00 ? 114 ILE A H    2 
ATOM 3691  H HA   . ILE A 1 51 ? -5.204  7.107   -39.563 1.00 0.00 ? 114 ILE A HA   2 
ATOM 3692  H HB   . ILE A 1 51 ? -3.850  5.514   -40.866 1.00 0.00 ? 114 ILE A HB   2 
ATOM 3693  H HG12 . ILE A 1 51 ? -1.472  6.896   -39.582 1.00 0.00 ? 114 ILE A HG12 2 
ATOM 3694  H HG13 . ILE A 1 51 ? -2.054  5.273   -39.233 1.00 0.00 ? 114 ILE A HG13 2 
ATOM 3695  H HG21 . ILE A 1 51 ? -3.272  7.057   -42.487 1.00 0.00 ? 114 ILE A HG21 2 
ATOM 3696  H HG22 . ILE A 1 51 ? -2.499  8.141   -41.325 1.00 0.00 ? 114 ILE A HG22 2 
ATOM 3697  H HG23 . ILE A 1 51 ? -4.250  8.087   -41.434 1.00 0.00 ? 114 ILE A HG23 2 
ATOM 3698  H HD11 . ILE A 1 51 ? -1.279  5.991   -42.008 1.00 0.00 ? 114 ILE A HD11 2 
ATOM 3699  H HD12 . ILE A 1 51 ? -0.059  5.496   -40.813 1.00 0.00 ? 114 ILE A HD12 2 
ATOM 3700  H HD13 . ILE A 1 51 ? -1.391  4.393   -41.239 1.00 0.00 ? 114 ILE A HD13 2 
ATOM 3701  N N    . SER A 1 52 ? -5.365  4.831   -38.514 1.00 0.00 ? 115 SER A N    2 
ATOM 3702  C CA   . SER A 1 52 ? -5.561  3.618   -37.727 1.00 0.00 ? 115 SER A CA   2 
ATOM 3703  C C    . SER A 1 52 ? -5.541  2.378   -38.612 1.00 0.00 ? 115 SER A C    2 
ATOM 3704  O O    . SER A 1 52 ? -6.559  1.999   -39.190 1.00 0.00 ? 115 SER A O    2 
ATOM 3705  C CB   . SER A 1 52 ? -6.874  3.692   -36.974 1.00 0.00 ? 115 SER A CB   2 
ATOM 3706  O OG   . SER A 1 52 ? -7.112  2.509   -36.262 1.00 0.00 ? 115 SER A OG   2 
ATOM 3707  H H    . SER A 1 52 ? -5.951  4.987   -39.334 1.00 0.00 ? 115 SER A H    2 
ATOM 3708  H HA   . SER A 1 52 ? -4.764  3.530   -37.007 1.00 0.00 ? 115 SER A HA   2 
ATOM 3709  H HB2  . SER A 1 52 ? -6.864  4.527   -36.282 1.00 0.00 ? 115 SER A HB2  2 
ATOM 3710  H HB3  . SER A 1 52 ? -7.676  3.822   -37.677 1.00 0.00 ? 115 SER A HB3  2 
ATOM 3711  H HG   . SER A 1 52 ? -7.963  2.581   -35.823 1.00 0.00 ? 115 SER A HG   2 
ATOM 3712  N N    . ARG A 1 53 ? -4.375  1.747   -38.711 1.00 0.00 ? 116 ARG A N    2 
ATOM 3713  C CA   . ARG A 1 53 ? -4.173  0.657   -39.656 1.00 0.00 ? 116 ARG A CA   2 
ATOM 3714  C C    . ARG A 1 53 ? -4.095  -0.685  -38.941 1.00 0.00 ? 116 ARG A C    2 
ATOM 3715  O O    . ARG A 1 53 ? -3.200  -0.916  -38.129 1.00 0.00 ? 116 ARG A O    2 
ATOM 3716  C CB   . ARG A 1 53 ? -2.900  0.875   -40.461 1.00 0.00 ? 116 ARG A CB   2 
ATOM 3717  C CG   . ARG A 1 53 ? -2.984  1.973   -41.508 1.00 0.00 ? 116 ARG A CG   2 
ATOM 3718  C CD   . ARG A 1 53 ? -1.785  1.989   -42.385 1.00 0.00 ? 116 ARG A CD   2 
ATOM 3719  N NE   . ARG A 1 53 ? -1.875  3.023   -43.404 1.00 0.00 ? 116 ARG A NE   2 
ATOM 3720  C CZ   . ARG A 1 53 ? -0.909  3.294   -44.304 1.00 0.00 ? 116 ARG A CZ   2 
ATOM 3721  N NH1  . ARG A 1 53 ? 0.209   2.600   -44.300 1.00 0.00 ? 116 ARG A NH1  2 
ATOM 3722  N NH2  . ARG A 1 53 ? -1.085  4.255   -45.194 1.00 0.00 ? 116 ARG A NH2  2 
ATOM 3723  H H    . ARG A 1 53 ? -3.565  2.128   -38.222 1.00 0.00 ? 116 ARG A H    2 
ATOM 3724  H HA   . ARG A 1 53 ? -4.994  0.625   -40.360 1.00 0.00 ? 116 ARG A HA   2 
ATOM 3725  H HB2  . ARG A 1 53 ? -2.097  1.133   -39.772 1.00 0.00 ? 116 ARG A HB2  2 
ATOM 3726  H HB3  . ARG A 1 53 ? -2.639  -0.057  -40.969 1.00 0.00 ? 116 ARG A HB3  2 
ATOM 3727  H HG2  . ARG A 1 53 ? -3.868  1.793   -42.123 1.00 0.00 ? 116 ARG A HG2  2 
ATOM 3728  H HG3  . ARG A 1 53 ? -3.086  2.930   -41.006 1.00 0.00 ? 116 ARG A HG3  2 
ATOM 3729  H HD2  . ARG A 1 53 ? -0.901  2.169   -41.774 1.00 0.00 ? 116 ARG A HD2  2 
ATOM 3730  H HD3  . ARG A 1 53 ? -1.691  1.020   -42.876 1.00 0.00 ? 116 ARG A HD3  2 
ATOM 3731  H HE   . ARG A 1 53 ? -2.692  3.562   -43.439 1.00 0.00 ? 116 ARG A HE   2 
ATOM 3732  H HH11 . ARG A 1 53 ? 0.344   1.872   -43.628 1.00 0.00 ? 116 ARG A HH11 2 
ATOM 3733  H HH12 . ARG A 1 53 ? 0.931   2.804   -44.976 1.00 0.00 ? 116 ARG A HH12 2 
ATOM 3734  H HH21 . ARG A 1 53 ? -1.935  4.784   -45.203 1.00 0.00 ? 116 ARG A HH21 2 
ATOM 3735  H HH22 . ARG A 1 53 ? -0.367  4.454   -45.861 1.00 0.00 ? 116 ARG A HH22 2 
ATOM 3736  N N    . GLU A 1 54 ? -5.038  -1.570  -39.248 1.00 0.00 ? 117 GLU A N    2 
ATOM 3737  C CA   . GLU A 1 54 ? -4.987  -2.945  -38.765 1.00 0.00 ? 117 GLU A CA   2 
ATOM 3738  C C    . GLU A 1 54 ? -4.426  -3.882  -39.827 1.00 0.00 ? 117 GLU A C    2 
ATOM 3739  O O    . GLU A 1 54 ? -4.974  -3.991  -40.923 1.00 0.00 ? 117 GLU A O    2 
ATOM 3740  C CB   . GLU A 1 54 ? -6.380  -3.414  -38.339 1.00 0.00 ? 117 GLU A CB   2 
ATOM 3741  C CG   . GLU A 1 54 ? -6.431  -4.846  -37.826 1.00 0.00 ? 117 GLU A CG   2 
ATOM 3742  C CD   . GLU A 1 54 ? -7.812  -5.266  -37.404 1.00 0.00 ? 117 GLU A CD   2 
ATOM 3743  O OE1  . GLU A 1 54 ? -8.697  -4.446  -37.434 1.00 0.00 ? 117 GLU A OE1  2 
ATOM 3744  O OE2  . GLU A 1 54 ? -7.981  -6.409  -37.050 1.00 0.00 ? 117 GLU A OE2  2 
ATOM 3745  H H    . GLU A 1 54 ? -5.735  -1.321  -39.949 1.00 0.00 ? 117 GLU A H    2 
ATOM 3746  H HA   . GLU A 1 54 ? -4.341  -2.997  -37.894 1.00 0.00 ? 117 GLU A HA   2 
ATOM 3747  H HB2  . GLU A 1 54 ? -6.755  -2.753  -37.559 1.00 0.00 ? 117 GLU A HB2  2 
ATOM 3748  H HB3  . GLU A 1 54 ? -7.026  -3.352  -39.198 1.00 0.00 ? 117 GLU A HB3  2 
ATOM 3749  H HG2  . GLU A 1 54 ? -6.096  -5.515  -38.615 1.00 0.00 ? 117 GLU A HG2  2 
ATOM 3750  H HG3  . GLU A 1 54 ? -5.761  -4.936  -36.976 1.00 0.00 ? 117 GLU A HG3  2 
ATOM 3751  N N    . PHE A 1 55 ? -3.331  -4.556  -39.495 1.00 0.00 ? 118 PHE A N    2 
ATOM 3752  C CA   . PHE A 1 55 ? -2.524  -5.247  -40.494 1.00 0.00 ? 118 PHE A CA   2 
ATOM 3753  C C    . PHE A 1 55 ? -2.751  -6.752  -40.441 1.00 0.00 ? 118 PHE A C    2 
ATOM 3754  O O    . PHE A 1 55 ? -2.923  -7.326  -39.364 1.00 0.00 ? 118 PHE A O    2 
ATOM 3755  C CB   . PHE A 1 55 ? -1.040  -4.944  -40.286 1.00 0.00 ? 118 PHE A CB   2 
ATOM 3756  C CG   . PHE A 1 55 ? -0.687  -3.494  -40.470 1.00 0.00 ? 118 PHE A CG   2 
ATOM 3757  C CD1  . PHE A 1 55 ? -0.825  -2.594  -39.424 1.00 0.00 ? 118 PHE A CD1  2 
ATOM 3758  C CD2  . PHE A 1 55 ? -0.218  -3.027  -41.689 1.00 0.00 ? 118 PHE A CD2  2 
ATOM 3759  C CE1  . PHE A 1 55 ? -0.502  -1.261  -39.592 1.00 0.00 ? 118 PHE A CE1  2 
ATOM 3760  C CE2  . PHE A 1 55 ? 0.108   -1.696  -41.859 1.00 0.00 ? 118 PHE A CE2  2 
ATOM 3761  C CZ   . PHE A 1 55 ? -0.035  -0.812  -40.809 1.00 0.00 ? 118 PHE A CZ   2 
ATOM 3762  H H    . PHE A 1 55 ? -2.909  -4.387  -38.581 1.00 0.00 ? 118 PHE A H    2 
ATOM 3763  H HA   . PHE A 1 55 ? -2.792  -4.901  -41.494 1.00 0.00 ? 118 PHE A HA   2 
ATOM 3764  H HB2  . PHE A 1 55 ? -0.763  -5.236  -39.279 1.00 0.00 ? 118 PHE A HB2  2 
ATOM 3765  H HB3  . PHE A 1 55 ? -0.464  -5.541  -40.995 1.00 0.00 ? 118 PHE A HB3  2 
ATOM 3766  H HD1  . PHE A 1 55 ? -1.192  -2.942  -38.469 1.00 0.00 ? 118 PHE A HD1  2 
ATOM 3767  H HD2  . PHE A 1 55 ? -0.103  -3.715  -42.512 1.00 0.00 ? 118 PHE A HD2  2 
ATOM 3768  H HE1  . PHE A 1 55 ? -0.634  -0.568  -38.774 1.00 0.00 ? 118 PHE A HE1  2 
ATOM 3769  H HE2  . PHE A 1 55 ? 0.477   -1.349  -42.812 1.00 0.00 ? 118 PHE A HE2  2 
ATOM 3770  H HZ   . PHE A 1 55 ? 0.320   0.204   -40.906 1.00 0.00 ? 118 PHE A HZ   2 
ATOM 3771  N N    . HIS A 1 56 ? -2.750  -7.389  -41.607 1.00 0.00 ? 119 HIS A N    2 
ATOM 3772  C CA   . HIS A 1 56 ? -2.433  -8.807  -41.706 1.00 0.00 ? 119 HIS A CA   2 
ATOM 3773  C C    . HIS A 1 56 ? -1.455  -9.076  -42.842 1.00 0.00 ? 119 HIS A C    2 
ATOM 3774  O O    . HIS A 1 56 ? -1.362  -8.297  -43.791 1.00 0.00 ? 119 HIS A O    2 
ATOM 3775  C CB   . HIS A 1 56 ? -3.706  -9.634  -41.915 1.00 0.00 ? 119 HIS A CB   2 
ATOM 3776  C CG   . HIS A 1 56 ? -4.761  -9.386  -40.880 1.00 0.00 ? 119 HIS A CG   2 
ATOM 3777  N ND1  . HIS A 1 56 ? -5.618  -8.307  -40.934 1.00 0.00 ? 119 HIS A ND1  2 
ATOM 3778  C CD2  . HIS A 1 56 ? -5.096  -10.078 -39.765 1.00 0.00 ? 119 HIS A CD2  2 
ATOM 3779  C CE1  . HIS A 1 56 ? -6.435  -8.346  -39.894 1.00 0.00 ? 119 HIS A CE1  2 
ATOM 3780  N NE2  . HIS A 1 56 ? -6.139  -9.411  -39.172 1.00 0.00 ? 119 HIS A NE2  2 
ATOM 3781  H H    . HIS A 1 56 ? -2.534  -6.822  -42.427 1.00 0.00 ? 119 HIS A H    2 
ATOM 3782  H HA   . HIS A 1 56 ? -1.959  -9.146  -40.795 1.00 0.00 ? 119 HIS A HA   2 
ATOM 3783  H HB2  . HIS A 1 56 ? -4.083  -9.423  -42.895 1.00 0.00 ? 119 HIS A HB2  2 
ATOM 3784  H HB3  . HIS A 1 56 ? -3.430  -10.689 -41.876 1.00 0.00 ? 119 HIS A HB3  2 
ATOM 3785  H HD1  . HIS A 1 56 ? -5.625  -7.589  -41.658 1.00 0.00 ? 119 HIS A HD1  2 
ATOM 3786  H HD2  . HIS A 1 56 ? -4.714  -11.048 -39.482 1.00 0.00 ? 119 HIS A HD2  2 
ATOM 3787  H HE1  . HIS A 1 56 ? -7.213  -7.628  -39.677 1.00 0.00 ? 119 HIS A HE1  2 
ATOM 3788  H HE2  . HIS A 1 56 ? -6.605  -9.690  -38.320 1.00 0.00 ? 119 HIS A HE2  2 
ATOM 3789  N N    . ARG A 1 57 ? -0.729  -10.186 -42.742 1.00 0.00 ? 120 ARG A N    2 
ATOM 3790  C CA   . ARG A 1 57 ? 0.052   -10.693 -43.863 1.00 0.00 ? 120 ARG A CA   2 
ATOM 3791  C C    . ARG A 1 57 ? 0.289   -12.193 -43.735 1.00 0.00 ? 120 ARG A C    2 
ATOM 3792  O O    . ARG A 1 57 ? 1.115   -12.633 -42.936 1.00 0.00 ? 120 ARG A O    2 
ATOM 3793  C CB   . ARG A 1 57 ? 1.391   -9.976  -43.952 1.00 0.00 ? 120 ARG A CB   2 
ATOM 3794  C CG   . ARG A 1 57 ? 2.439   -10.457 -42.962 1.00 0.00 ? 120 ARG A CG   2 
ATOM 3795  C CD   . ARG A 1 57 ? 3.419   -9.388  -42.636 1.00 0.00 ? 120 ARG A CD   2 
ATOM 3796  N NE   . ARG A 1 57 ? 2.844   -8.372  -41.769 1.00 0.00 ? 120 ARG A NE   2 
ATOM 3797  C CZ   . ARG A 1 57 ? 3.284   -7.101  -41.686 1.00 0.00 ? 120 ARG A CZ   2 
ATOM 3798  N NH1  . ARG A 1 57 ? 4.300   -6.706  -42.420 1.00 0.00 ? 120 ARG A NH1  2 
ATOM 3799  N NH2  . ARG A 1 57 ? 2.691   -6.251  -40.862 1.00 0.00 ? 120 ARG A NH2  2 
ATOM 3800  H H    . ARG A 1 57 ? -0.897  -10.804 -41.949 1.00 0.00 ? 120 ARG A H    2 
ATOM 3801  H HA   . ARG A 1 57 ? -0.491  -10.528 -44.785 1.00 0.00 ? 120 ARG A HA   2 
ATOM 3802  H HB2  . ARG A 1 57 ? 1.796   -10.109 -44.959 1.00 0.00 ? 120 ARG A HB2  2 
ATOM 3803  H HB3  . ARG A 1 57 ? 1.208   -8.912  -43.782 1.00 0.00 ? 120 ARG A HB3  2 
ATOM 3804  H HG2  . ARG A 1 57 ? 1.920   -10.728 -42.052 1.00 0.00 ? 120 ARG A HG2  2 
ATOM 3805  H HG3  . ARG A 1 57 ? 2.961   -11.327 -43.365 1.00 0.00 ? 120 ARG A HG3  2 
ATOM 3806  H HD2  . ARG A 1 57 ? 4.298   -9.819  -42.161 1.00 0.00 ? 120 ARG A HD2  2 
ATOM 3807  H HD3  . ARG A 1 57 ? 3.725   -8.906  -43.567 1.00 0.00 ? 120 ARG A HD3  2 
ATOM 3808  H HE   . ARG A 1 57 ? 2.087   -8.633  -41.207 1.00 0.00 ? 120 ARG A HE   2 
ATOM 3809  H HH11 . ARG A 1 57 ? 4.749   -7.347  -43.041 1.00 0.00 ? 120 ARG A HH11 2 
ATOM 3810  H HH12 . ARG A 1 57 ? 4.628   -5.753  -42.355 1.00 0.00 ? 120 ARG A HH12 2 
ATOM 3811  H HH21 . ARG A 1 57 ? 1.918   -6.547  -40.303 1.00 0.00 ? 120 ARG A HH21 2 
ATOM 3812  H HH22 . ARG A 1 57 ? 3.020   -5.309  -40.801 1.00 0.00 ? 120 ARG A HH22 2 
ATOM 3813  N N    . LYS A 1 58 ? -0.440  -12.972 -44.525 1.00 0.00 ? 121 LYS A N    2 
ATOM 3814  C CA   . LYS A 1 58 ? -0.319  -14.425 -44.491 1.00 0.00 ? 121 LYS A CA   2 
ATOM 3815  C C    . LYS A 1 58 ? 0.730   -14.914 -45.480 1.00 0.00 ? 121 LYS A C    2 
ATOM 3816  O O    . LYS A 1 58 ? 0.420   -15.203 -46.634 1.00 0.00 ? 121 LYS A O    2 
ATOM 3817  C CB   . LYS A 1 58 ? -1.670  -15.082 -44.789 1.00 0.00 ? 121 LYS A CB   2 
ATOM 3818  C CG   . LYS A 1 58 ? -2.719  -14.884 -43.704 1.00 0.00 ? 121 LYS A CG   2 
ATOM 3819  C CD   . LYS A 1 58 ? -4.009  -15.616 -44.042 1.00 0.00 ? 121 LYS A CD   2 
ATOM 3820  C CE   . LYS A 1 58 ? -5.138  -15.213 -43.104 1.00 0.00 ? 121 LYS A CE   2 
ATOM 3821  N NZ   . LYS A 1 58 ? -6.425  -15.866 -43.471 1.00 0.00 ? 121 LYS A NZ   2 
ATOM 3822  H H    . LYS A 1 58 ? -1.111  -12.543 -45.165 1.00 0.00 ? 121 LYS A H    2 
ATOM 3823  H HA   . LYS A 1 58 ? -0.018  -14.740 -43.497 1.00 0.00 ? 121 LYS A HA   2 
ATOM 3824  H HB2  . LYS A 1 58 ? -2.058  -14.622 -45.700 1.00 0.00 ? 121 LYS A HB2  2 
ATOM 3825  H HB3  . LYS A 1 58 ? -1.548  -16.138 -44.972 1.00 0.00 ? 121 LYS A HB3  2 
ATOM 3826  H HG2  . LYS A 1 58 ? -2.326  -15.274 -42.782 1.00 0.00 ? 121 LYS A HG2  2 
ATOM 3827  H HG3  . LYS A 1 58 ? -2.930  -13.821 -43.588 1.00 0.00 ? 121 LYS A HG3  2 
ATOM 3828  H HD2  . LYS A 1 58 ? -4.294  -15.361 -45.063 1.00 0.00 ? 121 LYS A HD2  2 
ATOM 3829  H HD3  . LYS A 1 58 ? -3.841  -16.685 -43.980 1.00 0.00 ? 121 LYS A HD3  2 
ATOM 3830  H HE2  . LYS A 1 58 ? -4.872  -15.502 -42.090 1.00 0.00 ? 121 LYS A HE2  2 
ATOM 3831  H HE3  . LYS A 1 58 ? -5.264  -14.131 -43.145 1.00 0.00 ? 121 LYS A HE3  2 
ATOM 3832  H HZ1  . LYS A 1 58 ? -6.237  -16.836 -43.794 1.00 0.00 ? 121 LYS A HZ1  2 
ATOM 3833  H HZ2  . LYS A 1 58 ? -6.880  -15.326 -44.235 1.00 0.00 ? 121 LYS A HZ2  2 
ATOM 3834  H HZ3  . LYS A 1 58 ? -7.034  -15.890 -42.665 1.00 0.00 ? 121 LYS A HZ3  2 
ATOM 3835  N N    . TYR A 1 59 ? 1.973   -15.003 -45.018 1.00 0.00 ? 122 TYR A N    2 
ATOM 3836  C CA   . TYR A 1 59 ? 3.090   -15.349 -45.888 1.00 0.00 ? 122 TYR A CA   2 
ATOM 3837  C C    . TYR A 1 59 ? 3.286   -16.857 -45.960 1.00 0.00 ? 122 TYR A C    2 
ATOM 3838  O O    . TYR A 1 59 ? 3.475   -17.519 -44.940 1.00 0.00 ? 122 TYR A O    2 
ATOM 3839  C CB   . TYR A 1 59 ? 4.373   -14.670 -45.405 1.00 0.00 ? 122 TYR A CB   2 
ATOM 3840  C CG   . TYR A 1 59 ? 5.606   -15.063 -46.191 1.00 0.00 ? 122 TYR A CG   2 
ATOM 3841  C CD1  . TYR A 1 59 ? 5.777   -14.603 -47.489 1.00 0.00 ? 122 TYR A CD1  2 
ATOM 3842  C CD2  . TYR A 1 59 ? 6.562   -15.886 -45.616 1.00 0.00 ? 122 TYR A CD2  2 
ATOM 3843  C CE1  . TYR A 1 59 ? 6.901   -14.962 -48.206 1.00 0.00 ? 122 TYR A CE1  2 
ATOM 3844  C CE2  . TYR A 1 59 ? 7.686   -16.245 -46.333 1.00 0.00 ? 122 TYR A CE2  2 
ATOM 3845  C CZ   . TYR A 1 59 ? 7.856   -15.786 -47.624 1.00 0.00 ? 122 TYR A CZ   2 
ATOM 3846  O OH   . TYR A 1 59 ? 8.976   -16.145 -48.338 1.00 0.00 ? 122 TYR A OH   2 
ATOM 3847  H H    . TYR A 1 59 ? 2.161   -14.736 -44.053 1.00 0.00 ? 122 TYR A H    2 
ATOM 3848  H HA   . TYR A 1 59 ? 2.892   -14.995 -46.894 1.00 0.00 ? 122 TYR A HA   2 
ATOM 3849  H HB2  . TYR A 1 59 ? 4.225   -13.616 -45.498 1.00 0.00 ? 122 TYR A HB2  2 
ATOM 3850  H HB3  . TYR A 1 59 ? 4.521   -14.909 -44.356 1.00 0.00 ? 122 TYR A HB3  2 
ATOM 3851  H HD1  . TYR A 1 59 ? 5.018   -14.007 -47.943 1.00 0.00 ? 122 TYR A HD1  2 
ATOM 3852  H HD2  . TYR A 1 59 ? 6.432   -16.246 -44.605 1.00 0.00 ? 122 TYR A HD2  2 
ATOM 3853  H HE1  . TYR A 1 59 ? 7.036   -14.604 -49.217 1.00 0.00 ? 122 TYR A HE1  2 
ATOM 3854  H HE2  . TYR A 1 59 ? 8.432   -16.885 -45.886 1.00 0.00 ? 122 TYR A HE2  2 
ATOM 3855  H HH   . TYR A 1 59 ? 8.692   -16.441 -49.205 1.00 0.00 ? 122 TYR A HH   2 
ATOM 3856  N N    . ARG A 1 60 ? 3.240   -17.398 -47.175 1.00 0.00 ? 123 ARG A N    2 
ATOM 3857  C CA   . ARG A 1 60 ? 3.209   -18.843 -47.369 1.00 0.00 ? 123 ARG A CA   2 
ATOM 3858  C C    . ARG A 1 60 ? 4.567   -19.465 -47.080 1.00 0.00 ? 123 ARG A C    2 
ATOM 3859  O O    . ARG A 1 60 ? 5.605   -18.917 -47.450 1.00 0.00 ? 123 ARG A O    2 
ATOM 3860  C CB   . ARG A 1 60 ? 2.792   -19.182 -48.793 1.00 0.00 ? 123 ARG A CB   2 
ATOM 3861  C CG   . ARG A 1 60 ? 1.295   -19.355 -48.997 1.00 0.00 ? 123 ARG A CG   2 
ATOM 3862  C CD   . ARG A 1 60 ? 0.606   -18.049 -49.155 1.00 0.00 ? 123 ARG A CD   2 
ATOM 3863  N NE   . ARG A 1 60 ? 0.914   -17.425 -50.434 1.00 0.00 ? 123 ARG A NE   2 
ATOM 3864  C CZ   . ARG A 1 60 ? 0.407   -16.248 -50.853 1.00 0.00 ? 123 ARG A CZ   2 
ATOM 3865  N NH1  . ARG A 1 60 ? -0.426  -15.582 -50.084 1.00 0.00 ? 123 ARG A NH1  2 
ATOM 3866  N NH2  . ARG A 1 60 ? 0.749   -15.765 -52.032 1.00 0.00 ? 123 ARG A NH2  2 
ATOM 3867  H H    . ARG A 1 60 ? 3.052   -16.788 -47.969 1.00 0.00 ? 123 ARG A H    2 
ATOM 3868  H HA   . ARG A 1 60 ? 2.496   -19.292 -46.706 1.00 0.00 ? 123 ARG A HA   2 
ATOM 3869  H HB2  . ARG A 1 60 ? 3.130   -18.374 -49.443 1.00 0.00 ? 123 ARG A HB2  2 
ATOM 3870  H HB3  . ARG A 1 60 ? 3.292   -20.104 -49.111 1.00 0.00 ? 123 ARG A HB3  2 
ATOM 3871  H HG2  . ARG A 1 60 ? 1.128   -19.921 -49.917 1.00 0.00 ? 123 ARG A HG2  2 
ATOM 3872  H HG3  . ARG A 1 60 ? 0.874   -19.919 -48.172 1.00 0.00 ? 123 ARG A HG3  2 
ATOM 3873  H HD2  . ARG A 1 60 ? -0.469  -18.184 -49.074 1.00 0.00 ? 123 ARG A HD2  2 
ATOM 3874  H HD3  . ARG A 1 60 ? 0.948   -17.374 -48.371 1.00 0.00 ? 123 ARG A HD3  2 
ATOM 3875  H HE   . ARG A 1 60 ? 1.526   -17.900 -51.035 1.00 0.00 ? 123 ARG A HE   2 
ATOM 3876  H HH11 . ARG A 1 60 ? -0.687  -15.947 -49.190 1.00 0.00 ? 123 ARG A HH11 2 
ATOM 3877  H HH12 . ARG A 1 60 ? -0.802  -14.698 -50.397 1.00 0.00 ? 123 ARG A HH12 2 
ATOM 3878  H HH21 . ARG A 1 60 ? 1.383   -16.271 -52.620 1.00 0.00 ? 123 ARG A HH21 2 
ATOM 3879  H HH22 . ARG A 1 60 ? 0.373   -14.890 -52.338 1.00 0.00 ? 123 ARG A HH22 2 
ATOM 3880  N N    . ILE A 1 61 ? 4.555   -20.614 -46.413 1.00 0.00 ? 124 ILE A N    2 
ATOM 3881  C CA   . ILE A 1 61 ? 5.785   -21.246 -45.950 1.00 0.00 ? 124 ILE A CA   2 
ATOM 3882  C C    . ILE A 1 61 ? 6.329   -22.222 -46.985 1.00 0.00 ? 124 ILE A C    2 
ATOM 3883  O O    . ILE A 1 61 ? 5.697   -23.234 -47.289 1.00 0.00 ? 124 ILE A O    2 
ATOM 3884  C CB   . ILE A 1 61 ? 5.555   -21.985 -44.617 1.00 0.00 ? 124 ILE A CB   2 
ATOM 3885  C CG1  . ILE A 1 61 ? 5.093   -21.002 -43.537 1.00 0.00 ? 124 ILE A CG1  2 
ATOM 3886  C CG2  . ILE A 1 61 ? 6.824   -22.701 -44.182 1.00 0.00 ? 124 ILE A CG2  2 
ATOM 3887  C CD1  . ILE A 1 61 ? 4.711   -21.667 -42.233 1.00 0.00 ? 124 ILE A CD1  2 
ATOM 3888  H H    . ILE A 1 61 ? 3.660   -21.005 -46.126 1.00 0.00 ? 124 ILE A H    2 
ATOM 3889  H HA   . ILE A 1 61 ? 6.503   -20.474 -45.721 1.00 0.00 ? 124 ILE A HA   2 
ATOM 3890  H HB   . ILE A 1 61 ? 4.773   -22.727 -44.763 1.00 0.00 ? 124 ILE A HB   2 
ATOM 3891  H HG12 . ILE A 1 61 ? 5.901   -20.293 -43.356 1.00 0.00 ? 124 ILE A HG12 2 
ATOM 3892  H HG13 . ILE A 1 61 ? 4.228   -20.458 -43.920 1.00 0.00 ? 124 ILE A HG13 2 
ATOM 3893  H HG21 . ILE A 1 61 ? 7.581   -21.953 -44.043 1.00 0.00 ? 124 ILE A HG21 2 
ATOM 3894  H HG22 . ILE A 1 61 ? 7.138   -23.429 -44.912 1.00 0.00 ? 124 ILE A HG22 2 
ATOM 3895  H HG23 . ILE A 1 61 ? 6.641   -23.203 -43.233 1.00 0.00 ? 124 ILE A HG23 2 
ATOM 3896  H HD11 . ILE A 1 61 ? 4.289   -22.654 -42.432 1.00 0.00 ? 124 ILE A HD11 2 
ATOM 3897  H HD12 . ILE A 1 61 ? 3.971   -21.054 -41.718 1.00 0.00 ? 124 ILE A HD12 2 
ATOM 3898  H HD13 . ILE A 1 61 ? 5.596   -21.770 -41.606 1.00 0.00 ? 124 ILE A HD13 2 
ATOM 3899  N N    . PRO A 1 62 ? 7.503   -21.912 -47.524 1.00 0.00 ? 125 PRO A N    2 
ATOM 3900  C CA   . PRO A 1 62 ? 8.216   -22.842 -48.393 1.00 0.00 ? 125 PRO A CA   2 
ATOM 3901  C C    . PRO A 1 62 ? 8.438   -24.181 -47.703 1.00 0.00 ? 125 PRO A C    2 
ATOM 3902  O O    . PRO A 1 62 ? 8.472   -24.260 -46.475 1.00 0.00 ? 125 PRO A O    2 
ATOM 3903  C CB   . PRO A 1 62 ? 9.540   -22.116 -48.658 1.00 0.00 ? 125 PRO A CB   2 
ATOM 3904  C CG   . PRO A 1 62 ? 9.220   -20.678 -48.435 1.00 0.00 ? 125 PRO A CG   2 
ATOM 3905  C CD   . PRO A 1 62 ? 8.251   -20.684 -47.284 1.00 0.00 ? 125 PRO A CD   2 
ATOM 3906  H HA   . PRO A 1 62 ? 7.661   -22.971 -49.321 1.00 0.00 ? 125 PRO A HA   2 
ATOM 3907  H HB2  . PRO A 1 62 ? 10.309  -22.466 -47.981 1.00 0.00 ? 125 PRO A HB2  2 
ATOM 3908  H HB3  . PRO A 1 62 ? 9.854   -22.270 -49.692 1.00 0.00 ? 125 PRO A HB3  2 
ATOM 3909  H HG2  . PRO A 1 62 ? 10.131  -20.135 -48.165 1.00 0.00 ? 125 PRO A HG2  2 
ATOM 3910  H HG3  . PRO A 1 62 ? 8.766   -20.235 -49.326 1.00 0.00 ? 125 PRO A HG3  2 
ATOM 3911  H HD2  . PRO A 1 62 ? 8.743   -20.665 -46.330 1.00 0.00 ? 125 PRO A HD2  2 
ATOM 3912  H HD3  . PRO A 1 62 ? 7.601   -19.834 -47.392 1.00 0.00 ? 125 PRO A HD3  2 
ATOM 3913  N N    . ALA A 1 63 ? 8.587   -25.233 -48.500 1.00 0.00 ? 126 ALA A N    2 
ATOM 3914  C CA   . ALA A 1 63 ? 8.826   -26.569 -47.969 1.00 0.00 ? 126 ALA A CA   2 
ATOM 3915  C C    . ALA A 1 63 ? 10.165  -26.644 -47.246 1.00 0.00 ? 126 ALA A C    2 
ATOM 3916  O O    . ALA A 1 63 ? 10.450  -27.616 -46.545 1.00 0.00 ? 126 ALA A O    2 
ATOM 3917  C CB   . ALA A 1 63 ? 8.771   -27.601 -49.086 1.00 0.00 ? 126 ALA A CB   2 
ATOM 3918  H H    . ALA A 1 63 ? 8.549   -25.102 -49.512 1.00 0.00 ? 126 ALA A H    2 
ATOM 3919  H HA   . ALA A 1 63 ? 8.035   -26.799 -47.255 1.00 0.00 ? 126 ALA A HA   2 
ATOM 3920  H HB1  . ALA A 1 63 ? 8.853   -28.602 -48.663 1.00 0.00 ? 126 ALA A HB1  2 
ATOM 3921  H HB2  . ALA A 1 63 ? 9.599   -27.429 -49.773 1.00 0.00 ? 126 ALA A HB2  2 
ATOM 3922  H HB3  . ALA A 1 63 ? 7.827   -27.509 -49.623 1.00 0.00 ? 126 ALA A HB3  2 
ATOM 3923  N N    . ASP A 1 64 ? 10.982  -25.612 -47.421 1.00 0.00 ? 127 ASP A N    2 
ATOM 3924  C CA   . ASP A 1 64 ? 12.300  -25.565 -46.795 1.00 0.00 ? 127 ASP A CA   2 
ATOM 3925  C C    . ASP A 1 64 ? 12.301  -24.638 -45.585 1.00 0.00 ? 127 ASP A C    2 
ATOM 3926  O O    . ASP A 1 64 ? 13.360  -24.291 -45.060 1.00 0.00 ? 127 ASP A O    2 
ATOM 3927  C CB   . ASP A 1 64 ? 13.355  -25.101 -47.803 1.00 0.00 ? 127 ASP A CB   2 
ATOM 3928  C CG   . ASP A 1 64 ? 13.576  -26.099 -48.931 1.00 0.00 ? 127 ASP A CG   2 
ATOM 3929  O OD1  . ASP A 1 64 ? 13.507  -27.278 -48.677 1.00 0.00 ? 127 ASP A OD1  2 
ATOM 3930  O OD2  . ASP A 1 64 ? 13.812  -25.673 -50.036 1.00 0.00 ? 127 ASP A OD2  2 
ATOM 3931  H H    . ASP A 1 64 ? 10.689  -24.835 -48.014 1.00 0.00 ? 127 ASP A H    2 
ATOM 3932  H HA   . ASP A 1 64 ? 12.580  -26.567 -46.461 1.00 0.00 ? 127 ASP A HA   2 
ATOM 3933  H HB2  . ASP A 1 64 ? 13.028  -24.154 -48.232 1.00 0.00 ? 127 ASP A HB2  2 
ATOM 3934  H HB3  . ASP A 1 64 ? 14.301  -24.946 -47.281 1.00 0.00 ? 127 ASP A HB3  2 
ATOM 3935  N N    . VAL A 1 65 ? 11.112  -24.242 -45.149 1.00 0.00 ? 128 VAL A N    2 
ATOM 3936  C CA   . VAL A 1 65 ? 10.976  -23.312 -44.035 1.00 0.00 ? 128 VAL A CA   2 
ATOM 3937  C C    . VAL A 1 65 ? 10.149  -23.917 -42.908 1.00 0.00 ? 128 VAL A C    2 
ATOM 3938  O O    . VAL A 1 65 ? 9.137   -24.574 -43.153 1.00 0.00 ? 128 VAL A O    2 
ATOM 3939  C CB   . VAL A 1 65 ? 10.314  -22.004 -44.507 1.00 0.00 ? 128 VAL A CB   2 
ATOM 3940  C CG1  . VAL A 1 65 ? 9.944   -21.132 -43.316 1.00 0.00 ? 128 VAL A CG1  2 
ATOM 3941  C CG2  . VAL A 1 65 ? 11.249  -21.260 -45.449 1.00 0.00 ? 128 VAL A CG2  2 
ATOM 3942  H H    . VAL A 1 65 ? 10.273  -24.560 -45.632 1.00 0.00 ? 128 VAL A H    2 
ATOM 3943  H HA   . VAL A 1 65 ? 11.961  -23.061 -43.635 1.00 0.00 ? 128 VAL A HA   2 
ATOM 3944  H HB   . VAL A 1 65 ? 9.431   -22.281 -45.057 1.00 0.00 ? 128 VAL A HB   2 
ATOM 3945  H HG11 . VAL A 1 65 ? 9.343   -21.662 -42.584 1.00 0.00 ? 128 VAL A HG11 2 
ATOM 3946  H HG12 . VAL A 1 65 ? 9.381   -20.274 -43.679 1.00 0.00 ? 128 VAL A HG12 2 
ATOM 3947  H HG13 . VAL A 1 65 ? 10.853  -20.782 -42.849 1.00 0.00 ? 128 VAL A HG13 2 
ATOM 3948  H HG21 . VAL A 1 65 ? 10.790  -20.353 -45.824 1.00 0.00 ? 128 VAL A HG21 2 
ATOM 3949  H HG22 . VAL A 1 65 ? 11.537  -21.900 -46.272 1.00 0.00 ? 128 VAL A HG22 2 
ATOM 3950  H HG23 . VAL A 1 65 ? 12.143  -20.991 -44.887 1.00 0.00 ? 128 VAL A HG23 2 
ATOM 3951  N N    . ASP A 1 66 ? 10.585  -23.693 -41.674 1.00 0.00 ? 129 ASP A N    2 
ATOM 3952  C CA   . ASP A 1 66 ? 9.940   -24.292 -40.511 1.00 0.00 ? 129 ASP A CA   2 
ATOM 3953  C C    . ASP A 1 66 ? 9.685   -23.253 -39.427 1.00 0.00 ? 129 ASP A C    2 
ATOM 3954  O O    . ASP A 1 66 ? 10.621  -22.694 -38.858 1.00 0.00 ? 129 ASP A O    2 
ATOM 3955  C CB   . ASP A 1 66 ? 10.795  -25.429 -39.948 1.00 0.00 ? 129 ASP A CB   2 
ATOM 3956  C CG   . ASP A 1 66 ? 10.096  -26.205 -38.840 1.00 0.00 ? 129 ASP A CG   2 
ATOM 3957  O OD1  . ASP A 1 66 ? 9.057   -25.770 -38.402 1.00 0.00 ? 129 ASP A OD1  2 
ATOM 3958  O OD2  . ASP A 1 66 ? 10.606  -27.225 -38.445 1.00 0.00 ? 129 ASP A OD2  2 
ATOM 3959  H H    . ASP A 1 66 ? 11.438  -23.147 -41.540 1.00 0.00 ? 129 ASP A H    2 
ATOM 3960  H HA   . ASP A 1 66 ? 9.018   -24.744 -40.837 1.00 0.00 ? 129 ASP A HA   2 
ATOM 3961  H HB2  . ASP A 1 66 ? 11.012  -26.102 -40.753 1.00 0.00 ? 129 ASP A HB2  2 
ATOM 3962  H HB3  . ASP A 1 66 ? 11.725  -25.015 -39.560 1.00 0.00 ? 129 ASP A HB3  2 
ATOM 3963  N N    . PRO A 1 67 ? 8.410   -23.003 -39.142 1.00 0.00 ? 130 PRO A N    2 
ATOM 3964  C CA   . PRO A 1 67 ? 8.027   -21.939 -38.222 1.00 0.00 ? 130 PRO A CA   2 
ATOM 3965  C C    . PRO A 1 67 ? 8.152   -22.394 -36.774 1.00 0.00 ? 130 PRO A C    2 
ATOM 3966  O O    . PRO A 1 67 ? 7.782   -21.665 -35.852 1.00 0.00 ? 130 PRO A O    2 
ATOM 3967  C CB   . PRO A 1 67 ? 6.569   -21.662 -38.603 1.00 0.00 ? 130 PRO A CB   2 
ATOM 3968  C CG   . PRO A 1 67 ? 6.057   -22.982 -39.072 1.00 0.00 ? 130 PRO A CG   2 
ATOM 3969  C CD   . PRO A 1 67 ? 7.213   -23.585 -39.825 1.00 0.00 ? 130 PRO A CD   2 
ATOM 3970  H HA   . PRO A 1 67 ? 8.619   -21.039 -38.382 1.00 0.00 ? 130 PRO A HA   2 
ATOM 3971  H HB2  . PRO A 1 67 ? 6.012   -21.333 -37.732 1.00 0.00 ? 130 PRO A HB2  2 
ATOM 3972  H HB3  . PRO A 1 67 ? 6.509   -20.925 -39.407 1.00 0.00 ? 130 PRO A HB3  2 
ATOM 3973  H HG2  . PRO A 1 67 ? 5.789   -23.604 -38.209 1.00 0.00 ? 130 PRO A HG2  2 
ATOM 3974  H HG3  . PRO A 1 67 ? 5.199   -22.868 -39.726 1.00 0.00 ? 130 PRO A HG3  2 
ATOM 3975  H HD2  . PRO A 1 67 ? 7.201   -24.670 -39.685 1.00 0.00 ? 130 PRO A HD2  2 
ATOM 3976  H HD3  . PRO A 1 67 ? 7.178   -23.326 -40.882 1.00 0.00 ? 130 PRO A HD3  2 
ATOM 3977  N N    . LEU A 1 68 ? 8.675   -23.598 -36.580 1.00 0.00 ? 131 LEU A N    2 
ATOM 3978  C CA   . LEU A 1 68 ? 8.984   -24.092 -35.243 1.00 0.00 ? 131 LEU A CA   2 
ATOM 3979  C C    . LEU A 1 68 ? 10.464  -23.927 -34.924 1.00 0.00 ? 131 LEU A C    2 
ATOM 3980  O O    . LEU A 1 68 ? 10.930  -24.340 -33.862 1.00 0.00 ? 131 LEU A O    2 
ATOM 3981  C CB   . LEU A 1 68 ? 8.592   -25.570 -35.121 1.00 0.00 ? 131 LEU A CB   2 
ATOM 3982  C CG   . LEU A 1 68 ? 7.104   -25.884 -35.341 1.00 0.00 ? 131 LEU A CG   2 
ATOM 3983  C CD1  . LEU A 1 68 ? 6.883   -27.386 -35.248 1.00 0.00 ? 131 LEU A CD1  2 
ATOM 3984  C CD2  . LEU A 1 68 ? 6.272   -25.143 -34.305 1.00 0.00 ? 131 LEU A CD2  2 
ATOM 3985  H H    . LEU A 1 68 ? 8.978   -24.142 -37.387 1.00 0.00 ? 131 LEU A H    2 
ATOM 3986  H HA   . LEU A 1 68 ? 8.409   -23.529 -34.507 1.00 0.00 ? 131 LEU A HA   2 
ATOM 3987  H HB2  . LEU A 1 68 ? 9.166   -26.129 -35.856 1.00 0.00 ? 131 LEU A HB2  2 
ATOM 3988  H HB3  . LEU A 1 68 ? 8.869   -25.917 -34.126 1.00 0.00 ? 131 LEU A HB3  2 
ATOM 3989  H HG   . LEU A 1 68 ? 6.821   -25.545 -36.339 1.00 0.00 ? 131 LEU A HG   2 
ATOM 3990  H HD11 . LEU A 1 68 ? 7.479   -27.895 -36.007 1.00 0.00 ? 131 LEU A HD11 2 
ATOM 3991  H HD12 . LEU A 1 68 ? 5.828   -27.607 -35.410 1.00 0.00 ? 131 LEU A HD12 2 
ATOM 3992  H HD13 . LEU A 1 68 ? 7.182   -27.734 -34.259 1.00 0.00 ? 131 LEU A HD13 2 
ATOM 3993  H HD21 . LEU A 1 68 ? 6.767   -25.190 -33.333 1.00 0.00 ? 131 LEU A HD21 2 
ATOM 3994  H HD22 . LEU A 1 68 ? 5.290   -25.612 -34.232 1.00 0.00 ? 131 LEU A HD22 2 
ATOM 3995  H HD23 . LEU A 1 68 ? 6.146   -24.103 -34.600 1.00 0.00 ? 131 LEU A HD23 2 
ATOM 3996  N N    . THR A 1 69 ? 11.200  -23.320 -35.849 1.00 0.00 ? 132 THR A N    2 
ATOM 3997  C CA   . THR A 1 69 ? 12.631  -23.108 -35.672 1.00 0.00 ? 132 THR A CA   2 
ATOM 3998  C C    . THR A 1 69 ? 12.960  -21.624 -35.572 1.00 0.00 ? 132 THR A C    2 
ATOM 3999  O O    . THR A 1 69 ? 14.128  -21.235 -35.573 1.00 0.00 ? 132 THR A O    2 
ATOM 4000  C CB   . THR A 1 69 ? 13.433  -23.739 -36.828 1.00 0.00 ? 132 THR A CB   2 
ATOM 4001  O OG1  . THR A 1 69 ? 13.020  -23.158 -38.072 1.00 0.00 ? 132 THR A OG1  2 
ATOM 4002  C CG2  . THR A 1 69 ? 13.205  -25.242 -36.874 1.00 0.00 ? 132 THR A CG2  2 
ATOM 4003  H H    . THR A 1 69 ? 10.759  -23.000 -36.712 1.00 0.00 ? 132 THR A H    2 
ATOM 4004  H HA   . THR A 1 69 ? 12.961  -23.589 -34.746 1.00 0.00 ? 132 THR A HA   2 
ATOM 4005  H HB   . THR A 1 69 ? 14.478  -23.568 -36.679 1.00 0.00 ? 132 THR A HB   2 
ATOM 4006  H HG1  . THR A 1 69 ? 13.123  -22.207 -38.003 1.00 0.00 ? 132 THR A HG1  2 
ATOM 4007  H HG21 . THR A 1 69 ? 13.654  -25.704 -35.995 1.00 0.00 ? 132 THR A HG21 2 
ATOM 4008  H HG22 . THR A 1 69 ? 13.663  -25.653 -37.775 1.00 0.00 ? 132 THR A HG22 2 
ATOM 4009  H HG23 . THR A 1 69 ? 12.136  -25.446 -36.886 1.00 0.00 ? 132 THR A HG23 2 
ATOM 4010  N N    . ILE A 1 70 ? 11.923  -20.798 -35.485 1.00 0.00 ? 133 ILE A N    2 
ATOM 4011  C CA   . ILE A 1 70 ? 12.083  -19.352 -35.589 1.00 0.00 ? 133 ILE A CA   2 
ATOM 4012  C C    . ILE A 1 70 ? 12.041  -18.694 -34.214 1.00 0.00 ? 133 ILE A C    2 
ATOM 4013  O O    . ILE A 1 70 ? 11.428  -19.218 -33.283 1.00 0.00 ? 133 ILE A O    2 
ATOM 4014  C CB   . ILE A 1 70 ? 10.992  -18.741 -36.485 1.00 0.00 ? 133 ILE A CB   2 
ATOM 4015  C CG1  . ILE A 1 70 ? 9.605   -19.019 -35.902 1.00 0.00 ? 133 ILE A CG1  2 
ATOM 4016  C CG2  . ILE A 1 70 ? 11.098  -19.286 -37.899 1.00 0.00 ? 133 ILE A CG2  2 
ATOM 4017  C CD1  . ILE A 1 70 ? 8.480   -18.344 -36.655 1.00 0.00 ? 133 ILE A CD1  2 
ATOM 4018  H H    . ILE A 1 70 ? 10.981  -21.189 -35.515 1.00 0.00 ? 133 ILE A H    2 
ATOM 4019  H HA   . ILE A 1 70 ? 13.037  -19.128 -36.026 1.00 0.00 ? 133 ILE A HA   2 
ATOM 4020  H HB   . ILE A 1 70 ? 11.142  -17.663 -36.522 1.00 0.00 ? 133 ILE A HB   2 
ATOM 4021  H HG12 . ILE A 1 70 ? 9.459   -20.095 -35.922 1.00 0.00 ? 133 ILE A HG12 2 
ATOM 4022  H HG13 . ILE A 1 70 ? 9.580   -18.690 -34.861 1.00 0.00 ? 133 ILE A HG13 2 
ATOM 4023  H HG21 . ILE A 1 70 ? 12.124  -19.196 -38.239 1.00 0.00 ? 133 ILE A HG21 2 
ATOM 4024  H HG22 . ILE A 1 70 ? 10.445  -18.741 -38.571 1.00 0.00 ? 133 ILE A HG22 2 
ATOM 4025  H HG23 . ILE A 1 70 ? 10.816  -20.337 -37.893 1.00 0.00 ? 133 ILE A HG23 2 
ATOM 4026  H HD11 . ILE A 1 70 ? 7.835   -19.098 -37.110 1.00 0.00 ? 133 ILE A HD11 2 
ATOM 4027  H HD12 . ILE A 1 70 ? 7.895   -17.738 -35.963 1.00 0.00 ? 133 ILE A HD12 2 
ATOM 4028  H HD13 . ILE A 1 70 ? 8.897   -17.705 -37.434 1.00 0.00 ? 133 ILE A HD13 2 
ATOM 4029  N N    . THR A 1 71 ? 12.697  -17.546 -34.094 1.00 0.00 ? 134 THR A N    2 
ATOM 4030  C CA   . THR A 1 71 ? 12.604  -16.735 -32.886 1.00 0.00 ? 134 THR A CA   2 
ATOM 4031  C C    . THR A 1 71 ? 12.388  -15.265 -33.224 1.00 0.00 ? 134 THR A C    2 
ATOM 4032  O O    . THR A 1 71 ? 13.348  -14.514 -33.408 1.00 0.00 ? 134 THR A O    2 
ATOM 4033  C CB   . THR A 1 71 ? 13.866  -16.887 -32.016 1.00 0.00 ? 134 THR A CB   2 
ATOM 4034  O OG1  . THR A 1 71 ? 14.072  -18.270 -31.703 1.00 0.00 ? 134 THR A OG1  2 
ATOM 4035  C CG2  . THR A 1 71 ? 13.725  -16.093 -30.728 1.00 0.00 ? 134 THR A CG2  2 
ATOM 4036  H H    . THR A 1 71 ? 13.164  -17.159 -34.912 1.00 0.00 ? 134 THR A H    2 
ATOM 4037  H HA   . THR A 1 71 ? 11.747  -17.065 -32.291 1.00 0.00 ? 134 THR A HA   2 
ATOM 4038  H HB   . THR A 1 71 ? 14.726  -16.515 -32.570 1.00 0.00 ? 134 THR A HB   2 
ATOM 4039  H HG1  . THR A 1 71 ? 14.954  -18.515 -31.988 1.00 0.00 ? 134 THR A HG1  2 
ATOM 4040  H HG21 . THR A 1 71 ? 12.765  -16.321 -30.267 1.00 0.00 ? 134 THR A HG21 2 
ATOM 4041  H HG22 . THR A 1 71 ? 13.779  -15.026 -30.951 1.00 0.00 ? 134 THR A HG22 2 
ATOM 4042  H HG23 . THR A 1 71 ? 14.528  -16.358 -30.041 1.00 0.00 ? 134 THR A HG23 2 
ATOM 4043  N N    . SER A 1 72 ? 11.126  -14.861 -33.306 1.00 0.00 ? 135 SER A N    2 
ATOM 4044  C CA   . SER A 1 72 ? 10.784  -13.478 -33.613 1.00 0.00 ? 135 SER A CA   2 
ATOM 4045  C C    . SER A 1 72 ? 11.243  -12.537 -32.505 1.00 0.00 ? 135 SER A C    2 
ATOM 4046  O O    . SER A 1 72 ? 11.432  -12.954 -31.363 1.00 0.00 ? 135 SER A O    2 
ATOM 4047  C CB   . SER A 1 72 ? 9.287   -13.342 -33.816 1.00 0.00 ? 135 SER A CB   2 
ATOM 4048  O OG   . SER A 1 72 ? 8.602   -13.494 -32.604 1.00 0.00 ? 135 SER A OG   2 
ATOM 4049  H H    . SER A 1 72 ? 10.378  -15.532 -33.138 1.00 0.00 ? 135 SER A H    2 
ATOM 4050  H HA   . SER A 1 72 ? 11.285  -13.190 -34.523 1.00 0.00 ? 135 SER A HA   2 
ATOM 4051  H HB2  . SER A 1 72 ? 9.058   -12.379 -34.245 1.00 0.00 ? 135 SER A HB2  2 
ATOM 4052  H HB3  . SER A 1 72 ? 8.966   -14.127 -34.495 1.00 0.00 ? 135 SER A HB3  2 
ATOM 4053  H HG   . SER A 1 72 ? 7.733   -13.861 -32.788 1.00 0.00 ? 135 SER A HG   2 
ATOM 4054  N N    . SER A 1 73 ? 11.418  -11.266 -32.850 1.00 0.00 ? 136 SER A N    2 
ATOM 4055  C CA   . SER A 1 73 ? 11.919  -10.278 -31.903 1.00 0.00 ? 136 SER A CA   2 
ATOM 4056  C C    . SER A 1 73 ? 11.835  -8.870  -32.479 1.00 0.00 ? 136 SER A C    2 
ATOM 4057  O O    . SER A 1 73 ? 11.986  -8.674  -33.686 1.00 0.00 ? 136 SER A O    2 
ATOM 4058  C CB   . SER A 1 73 ? 13.353  -10.595 -31.526 1.00 0.00 ? 136 SER A CB   2 
ATOM 4059  O OG   . SER A 1 73 ? 13.868  -9.632  -30.649 1.00 0.00 ? 136 SER A OG   2 
ATOM 4060  H H    . SER A 1 73 ? 11.256  -10.987 -33.818 1.00 0.00 ? 136 SER A H    2 
ATOM 4061  H HA   . SER A 1 73 ? 11.308  -10.325 -31.002 1.00 0.00 ? 136 SER A HA   2 
ATOM 4062  H HB2  . SER A 1 73 ? 13.394  -11.564 -31.040 1.00 0.00 ? 136 SER A HB2  2 
ATOM 4063  H HB3  . SER A 1 73 ? 13.958  -10.626 -32.436 1.00 0.00 ? 136 SER A HB3  2 
ATOM 4064  H HG   . SER A 1 73 ? 13.721  -9.936  -29.753 1.00 0.00 ? 136 SER A HG   2 
ATOM 4065  N N    . LEU A 1 74 ? 11.595  -7.894  -31.610 1.00 0.00 ? 137 LEU A N    2 
ATOM 4066  C CA   . LEU A 1 74 ? 11.513  -6.499  -32.027 1.00 0.00 ? 137 LEU A CA   2 
ATOM 4067  C C    . LEU A 1 74 ? 12.780  -5.738  -31.656 1.00 0.00 ? 137 LEU A C    2 
ATOM 4068  O O    . LEU A 1 74 ? 13.278  -5.854  -30.536 1.00 0.00 ? 137 LEU A O    2 
ATOM 4069  C CB   . LEU A 1 74 ? 10.296  -5.823  -31.385 1.00 0.00 ? 137 LEU A CB   2 
ATOM 4070  C CG   . LEU A 1 74 ? 8.956   -6.057  -32.094 1.00 0.00 ? 137 LEU A CG   2 
ATOM 4071  C CD1  . LEU A 1 74 ? 8.432   -7.444  -31.746 1.00 0.00 ? 137 LEU A CD1  2 
ATOM 4072  C CD2  . LEU A 1 74 ? 7.966   -4.978  -31.678 1.00 0.00 ? 137 LEU A CD2  2 
ATOM 4073  H H    . LEU A 1 74 ? 11.479  -8.121  -30.622 1.00 0.00 ? 137 LEU A H    2 
ATOM 4074  H HA   . LEU A 1 74 ? 11.393  -6.449  -33.113 1.00 0.00 ? 137 LEU A HA   2 
ATOM 4075  H HB2  . LEU A 1 74 ? 10.213  -6.183  -30.361 1.00 0.00 ? 137 LEU A HB2  2 
ATOM 4076  H HB3  . LEU A 1 74 ? 10.479  -4.742  -31.353 1.00 0.00 ? 137 LEU A HB3  2 
ATOM 4077  H HG   . LEU A 1 74 ? 9.111   -6.000  -33.171 1.00 0.00 ? 137 LEU A HG   2 
ATOM 4078  H HD11 . LEU A 1 74 ? 8.319   -7.521  -30.664 1.00 0.00 ? 137 LEU A HD11 2 
ATOM 4079  H HD12 . LEU A 1 74 ? 9.128   -8.206  -32.093 1.00 0.00 ? 137 LEU A HD12 2 
ATOM 4080  H HD13 . LEU A 1 74 ? 7.460   -7.589  -32.217 1.00 0.00 ? 137 LEU A HD13 2 
ATOM 4081  H HD21 . LEU A 1 74 ? 7.866   -4.981  -30.592 1.00 0.00 ? 137 LEU A HD21 2 
ATOM 4082  H HD22 . LEU A 1 74 ? 6.997   -5.184  -32.132 1.00 0.00 ? 137 LEU A HD22 2 
ATOM 4083  H HD23 . LEU A 1 74 ? 8.322   -4.002  -32.005 1.00 0.00 ? 137 LEU A HD23 2 
ATOM 4084  N N    . SER A 1 75 ? 13.296  -4.959  -32.601 1.00 0.00 ? 138 SER A N    2 
ATOM 4085  C CA   . SER A 1 75 ? 14.488  -4.154  -32.365 1.00 0.00 ? 138 SER A CA   2 
ATOM 4086  C C    . SER A 1 75 ? 14.145  -2.861  -31.636 1.00 0.00 ? 138 SER A C    2 
ATOM 4087  O O    . SER A 1 75 ? 12.974  -2.574  -31.380 1.00 0.00 ? 138 SER A O    2 
ATOM 4088  C CB   . SER A 1 75 ? 15.175  -3.841  -33.677 1.00 0.00 ? 138 SER A CB   2 
ATOM 4089  O OG   . SER A 1 75 ? 14.467  -2.864  -34.393 1.00 0.00 ? 138 SER A OG   2 
ATOM 4090  H H    . SER A 1 75 ? 12.830  -4.898  -33.506 1.00 0.00 ? 138 SER A H    2 
ATOM 4091  H HA   . SER A 1 75 ? 15.178  -4.728  -31.744 1.00 0.00 ? 138 SER A HA   2 
ATOM 4092  H HB2  . SER A 1 75 ? 16.178  -3.471  -33.484 1.00 0.00 ? 138 SER A HB2  2 
ATOM 4093  H HB3  . SER A 1 75 ? 15.242  -4.754  -34.273 1.00 0.00 ? 138 SER A HB3  2 
ATOM 4094  H HG   . SER A 1 75 ? 13.856  -2.443  -33.785 1.00 0.00 ? 138 SER A HG   2 
ATOM 4095  N N    . SER A 1 76 ? 15.169  -2.083  -31.308 1.00 0.00 ? 139 SER A N    2 
ATOM 4096  C CA   . SER A 1 76 ? 14.972  -0.773  -30.698 1.00 0.00 ? 139 SER A CA   2 
ATOM 4097  C C    . SER A 1 76 ? 14.344  0.205   -31.684 1.00 0.00 ? 139 SER A C    2 
ATOM 4098  O O    . SER A 1 76 ? 13.831  1.253   -31.290 1.00 0.00 ? 139 SER A O    2 
ATOM 4099  C CB   . SER A 1 76 ? 16.295  -0.224  -30.202 1.00 0.00 ? 139 SER A CB   2 
ATOM 4100  O OG   . SER A 1 76 ? 17.149  0.074   -31.272 1.00 0.00 ? 139 SER A OG   2 
ATOM 4101  H H    . SER A 1 76 ? 16.113  -2.374  -31.561 1.00 0.00 ? 139 SER A H    2 
ATOM 4102  H HA   . SER A 1 76 ? 14.300  -0.896  -29.851 1.00 0.00 ? 139 SER A HA   2 
ATOM 4103  H HB2  . SER A 1 76 ? 16.116  0.686   -29.635 1.00 0.00 ? 139 SER A HB2  2 
ATOM 4104  H HB3  . SER A 1 76 ? 16.769  -0.962  -29.549 1.00 0.00 ? 139 SER A HB3  2 
ATOM 4105  H HG   . SER A 1 76 ? 16.604  0.370   -32.005 1.00 0.00 ? 139 SER A HG   2 
ATOM 4106  N N    . ASP A 1 77 ? 14.387  -0.145  -32.964 1.00 0.00 ? 140 ASP A N    2 
ATOM 4107  C CA   . ASP A 1 77 ? 13.785  0.680   -34.004 1.00 0.00 ? 140 ASP A CA   2 
ATOM 4108  C C    . ASP A 1 77 ? 12.381  0.196   -34.349 1.00 0.00 ? 140 ASP A C    2 
ATOM 4109  O O    . ASP A 1 77 ? 11.699  0.784   -35.187 1.00 0.00 ? 140 ASP A O    2 
ATOM 4110  C CB   . ASP A 1 77 ? 14.654  0.677   -35.264 1.00 0.00 ? 140 ASP A CB   2 
ATOM 4111  C CG   . ASP A 1 77 ? 16.002  1.352   -35.054 1.00 0.00 ? 140 ASP A CG   2 
ATOM 4112  O OD1  . ASP A 1 77 ? 16.086  2.221   -34.218 1.00 0.00 ? 140 ASP A OD1  2 
ATOM 4113  O OD2  . ASP A 1 77 ? 16.936  0.993   -35.730 1.00 0.00 ? 140 ASP A OD2  2 
ATOM 4114  H H    . ASP A 1 77 ? 14.819  -1.031  -33.226 1.00 0.00 ? 140 ASP A H    2 
ATOM 4115  H HA   . ASP A 1 77 ? 13.716  1.712   -33.648 1.00 0.00 ? 140 ASP A HA   2 
ATOM 4116  H HB2  . ASP A 1 77 ? 14.825  -0.358  -35.563 1.00 0.00 ? 140 ASP A HB2  2 
ATOM 4117  H HB3  . ASP A 1 77 ? 14.122  1.193   -36.064 1.00 0.00 ? 140 ASP A HB3  2 
ATOM 4118  N N    . GLY A 1 78 ? 11.956  -0.879  -33.696 1.00 0.00 ? 141 GLY A N    2 
ATOM 4119  C CA   . GLY A 1 78 ? 10.622  -1.429  -33.911 1.00 0.00 ? 141 GLY A CA   2 
ATOM 4120  C C    . GLY A 1 78 ? 10.589  -2.337  -35.133 1.00 0.00 ? 141 GLY A C    2 
ATOM 4121  O O    . GLY A 1 78 ? 9.587   -2.402  -35.844 1.00 0.00 ? 141 GLY A O    2 
ATOM 4122  H H    . GLY A 1 78 ? 12.568  -1.318  -33.008 1.00 0.00 ? 141 GLY A H    2 
ATOM 4123  H HA2  . GLY A 1 78 ? 10.325  -2.004  -33.032 1.00 0.00 ? 141 GLY A HA2  2 
ATOM 4124  H HA3  . GLY A 1 78 ? 9.919   -0.615  -34.053 1.00 0.00 ? 141 GLY A HA3  2 
ATOM 4125  N N    . VAL A 1 79 ? 11.693  -3.038  -35.374 1.00 0.00 ? 142 VAL A N    2 
ATOM 4126  C CA   . VAL A 1 79 ? 11.786  -3.963  -36.496 1.00 0.00 ? 142 VAL A CA   2 
ATOM 4127  C C    . VAL A 1 79 ? 11.566  -5.400  -36.042 1.00 0.00 ? 142 VAL A C    2 
ATOM 4128  O O    . VAL A 1 79 ? 12.350  -5.944  -35.266 1.00 0.00 ? 142 VAL A O    2 
ATOM 4129  C CB   . VAL A 1 79 ? 13.162  -3.845  -37.173 1.00 0.00 ? 142 VAL A CB   2 
ATOM 4130  C CG1  . VAL A 1 79 ? 13.275  -4.836  -38.324 1.00 0.00 ? 142 VAL A CG1  2 
ATOM 4131  C CG2  . VAL A 1 79 ? 13.379  -2.422  -37.665 1.00 0.00 ? 142 VAL A CG2  2 
ATOM 4132  H H    . VAL A 1 79 ? 12.491  -2.940  -34.744 1.00 0.00 ? 142 VAL A H    2 
ATOM 4133  H HA   . VAL A 1 79 ? 11.024  -3.711  -37.237 1.00 0.00 ? 142 VAL A HA   2 
ATOM 4134  H HB   . VAL A 1 79 ? 13.931  -4.084  -36.436 1.00 0.00 ? 142 VAL A HB   2 
ATOM 4135  H HG11 . VAL A 1 79 ? 12.390  -4.752  -38.955 1.00 0.00 ? 142 VAL A HG11 2 
ATOM 4136  H HG12 . VAL A 1 79 ? 13.349  -5.851  -37.934 1.00 0.00 ? 142 VAL A HG12 2 
ATOM 4137  H HG13 . VAL A 1 79 ? 14.163  -4.608  -38.914 1.00 0.00 ? 142 VAL A HG13 2 
ATOM 4138  H HG21 . VAL A 1 79 ? 13.140  -1.718  -36.866 1.00 0.00 ? 142 VAL A HG21 2 
ATOM 4139  H HG22 . VAL A 1 79 ? 14.418  -2.295  -37.964 1.00 0.00 ? 142 VAL A HG22 2 
ATOM 4140  H HG23 . VAL A 1 79 ? 12.728  -2.237  -38.521 1.00 0.00 ? 142 VAL A HG23 2 
ATOM 4141  N N    . LEU A 1 80 ? 10.494  -6.014  -36.534 1.00 0.00 ? 143 LEU A N    2 
ATOM 4142  C CA   . LEU A 1 80 ? 10.204  -7.410  -36.234 1.00 0.00 ? 143 LEU A CA   2 
ATOM 4143  C C    . LEU A 1 80 ? 11.057  -8.344  -37.083 1.00 0.00 ? 143 LEU A C    2 
ATOM 4144  O O    . LEU A 1 80 ? 11.010  -8.296  -38.311 1.00 0.00 ? 143 LEU A O    2 
ATOM 4145  C CB   . LEU A 1 80 ? 8.719   -7.707  -36.471 1.00 0.00 ? 143 LEU A CB   2 
ATOM 4146  C CG   . LEU A 1 80 ? 8.285   -9.160  -36.235 1.00 0.00 ? 143 LEU A CG   2 
ATOM 4147  C CD1  . LEU A 1 80 ? 8.478   -9.515  -34.768 1.00 0.00 ? 143 LEU A CD1  2 
ATOM 4148  C CD2  . LEU A 1 80 ? 6.830   -9.329  -36.653 1.00 0.00 ? 143 LEU A CD2  2 
ATOM 4149  H H    . LEU A 1 80 ? 9.889   -5.511  -37.186 1.00 0.00 ? 143 LEU A H    2 
ATOM 4150  H HA   . LEU A 1 80 ? 10.431  -7.592  -35.183 1.00 0.00 ? 143 LEU A HA   2 
ATOM 4151  H HB2  . LEU A 1 80 ? 8.149   -7.097  -35.792 1.00 0.00 ? 143 LEU A HB2  2 
ATOM 4152  H HB3  . LEU A 1 80 ? 8.475   -7.413  -37.465 1.00 0.00 ? 143 LEU A HB3  2 
ATOM 4153  H HG   . LEU A 1 80 ? 8.905   -9.817  -36.846 1.00 0.00 ? 143 LEU A HG   2 
ATOM 4154  H HD11 . LEU A 1 80 ? 9.533   -9.700  -34.563 1.00 0.00 ? 143 LEU A HD11 2 
ATOM 4155  H HD12 . LEU A 1 80 ? 7.902   -10.411 -34.540 1.00 0.00 ? 143 LEU A HD12 2 
ATOM 4156  H HD13 . LEU A 1 80 ? 8.125   -8.704  -34.144 1.00 0.00 ? 143 LEU A HD13 2 
ATOM 4157  H HD21 . LEU A 1 80 ? 6.189   -8.874  -35.898 1.00 0.00 ? 143 LEU A HD21 2 
ATOM 4158  H HD22 . LEU A 1 80 ? 6.597   -10.392 -36.730 1.00 0.00 ? 143 LEU A HD22 2 
ATOM 4159  H HD23 . LEU A 1 80 ? 6.650   -8.850  -37.613 1.00 0.00 ? 143 LEU A HD23 2 
ATOM 4160  N N    . THR A 1 81 ? 11.837  -9.191  -36.421 1.00 0.00 ? 144 THR A N    2 
ATOM 4161  C CA   . THR A 1 81 ? 12.773  -10.071 -37.109 1.00 0.00 ? 144 THR A CA   2 
ATOM 4162  C C    . THR A 1 81 ? 12.454  -11.536 -36.837 1.00 0.00 ? 144 THR A C    2 
ATOM 4163  O O    . THR A 1 81 ? 12.873  -12.092 -35.822 1.00 0.00 ? 144 THR A O    2 
ATOM 4164  C CB   . THR A 1 81 ? 14.225  -9.771  -36.697 1.00 0.00 ? 144 THR A CB   2 
ATOM 4165  O OG1  . THR A 1 81 ? 14.535  -8.402  -36.989 1.00 0.00 ? 144 THR A OG1  2 
ATOM 4166  C CG2  . THR A 1 81 ? 15.192  -10.679 -37.442 1.00 0.00 ? 144 THR A CG2  2 
ATOM 4167  H H    . THR A 1 81 ? 11.835  -9.172  -35.402 1.00 0.00 ? 144 THR A H    2 
ATOM 4168  H HA   . THR A 1 81 ? 12.691  -9.912  -38.173 1.00 0.00 ? 144 THR A HA   2 
ATOM 4169  H HB   . THR A 1 81 ? 14.337  -9.941  -35.626 1.00 0.00 ? 144 THR A HB   2 
ATOM 4170  H HG1  . THR A 1 81 ? 14.271  -7.868  -36.237 1.00 0.00 ? 144 THR A HG1  2 
ATOM 4171  H HG21 . THR A 1 81 ? 16.214  -10.330 -37.288 1.00 0.00 ? 144 THR A HG21 2 
ATOM 4172  H HG22 . THR A 1 81 ? 14.957  -10.656 -38.507 1.00 0.00 ? 144 THR A HG22 2 
ATOM 4173  H HG23 . THR A 1 81 ? 15.095  -11.698 -37.071 1.00 0.00 ? 144 THR A HG23 2 
ATOM 4174  N N    . VAL A 1 82 ? 11.715  -12.156 -37.749 1.00 0.00 ? 145 VAL A N    2 
ATOM 4175  C CA   . VAL A 1 82 ? 11.443  -13.586 -37.674 1.00 0.00 ? 145 VAL A CA   2 
ATOM 4176  C C    . VAL A 1 82 ? 12.490  -14.387 -38.438 1.00 0.00 ? 145 VAL A C    2 
ATOM 4177  O O    . VAL A 1 82 ? 12.640  -14.232 -39.650 1.00 0.00 ? 145 VAL A O    2 
ATOM 4178  C CB   . VAL A 1 82 ? 10.046  -13.896 -38.244 1.00 0.00 ? 145 VAL A CB   2 
ATOM 4179  C CG1  . VAL A 1 82 ? 9.761   -15.389 -38.172 1.00 0.00 ? 145 VAL A CG1  2 
ATOM 4180  C CG2  . VAL A 1 82 ? 8.991   -13.108 -37.486 1.00 0.00 ? 145 VAL A CG2  2 
ATOM 4181  H H    . VAL A 1 82 ? 11.418  -11.639 -38.578 1.00 0.00 ? 145 VAL A H    2 
ATOM 4182  H HA   . VAL A 1 82 ? 11.462  -13.903 -36.638 1.00 0.00 ? 145 VAL A HA   2 
ATOM 4183  H HB   . VAL A 1 82 ? 10.022  -13.607 -39.286 1.00 0.00 ? 145 VAL A HB   2 
ATOM 4184  H HG11 . VAL A 1 82 ? 8.713   -15.572 -38.409 1.00 0.00 ? 145 VAL A HG11 2 
ATOM 4185  H HG12 . VAL A 1 82 ? 9.970   -15.729 -37.158 1.00 0.00 ? 145 VAL A HG12 2 
ATOM 4186  H HG13 . VAL A 1 82 ? 10.394  -15.926 -38.876 1.00 0.00 ? 145 VAL A HG13 2 
ATOM 4187  H HG21 . VAL A 1 82 ? 8.603   -13.698 -36.666 1.00 0.00 ? 145 VAL A HG21 2 
ATOM 4188  H HG22 . VAL A 1 82 ? 8.166   -12.863 -38.159 1.00 0.00 ? 145 VAL A HG22 2 
ATOM 4189  H HG23 . VAL A 1 82 ? 9.411   -12.180 -37.093 1.00 0.00 ? 145 VAL A HG23 2 
ATOM 4190  N N    . ASP A 1 83 ? 13.212  -15.242 -37.722 1.00 0.00 ? 146 ASP A N    2 
ATOM 4191  C CA   . ASP A 1 83 ? 14.370  -15.928 -38.285 1.00 0.00 ? 146 ASP A CA   2 
ATOM 4192  C C    . ASP A 1 83 ? 14.586  -17.280 -37.619 1.00 0.00 ? 146 ASP A C    2 
ATOM 4193  O O    . ASP A 1 83 ? 14.398  -17.424 -36.410 1.00 0.00 ? 146 ASP A O    2 
ATOM 4194  C CB   . ASP A 1 83 ? 15.627  -15.068 -38.135 1.00 0.00 ? 146 ASP A CB   2 
ATOM 4195  C CG   . ASP A 1 83 ? 16.060  -14.900 -36.684 1.00 0.00 ? 146 ASP A CG   2 
ATOM 4196  O OD1  . ASP A 1 83 ? 16.731  -15.768 -36.181 1.00 0.00 ? 146 ASP A OD1  2 
ATOM 4197  O OD2  . ASP A 1 83 ? 15.714  -13.904 -36.093 1.00 0.00 ? 146 ASP A OD2  2 
ATOM 4198  H H    . ASP A 1 83 ? 13.049  -15.298 -36.716 1.00 0.00 ? 146 ASP A H    2 
ATOM 4199  H HA   . ASP A 1 83 ? 14.180  -16.111 -39.336 1.00 0.00 ? 146 ASP A HA   2 
ATOM 4200  H HB2  . ASP A 1 83 ? 16.441  -15.530 -38.691 1.00 0.00 ? 146 ASP A HB2  2 
ATOM 4201  H HB3  . ASP A 1 83 ? 15.425  -14.081 -38.555 1.00 0.00 ? 146 ASP A HB3  2 
ATOM 4202  N N    . GLY A 1 84 ? 14.987  -18.267 -38.412 1.00 0.00 ? 147 GLY A N    2 
ATOM 4203  C CA   . GLY A 1 84 ? 15.158  -19.627 -37.916 1.00 0.00 ? 147 GLY A CA   2 
ATOM 4204  C C    . GLY A 1 84 ? 15.818  -20.516 -38.961 1.00 0.00 ? 147 GLY A C    2 
ATOM 4205  O O    . GLY A 1 84 ? 15.685  -20.282 -40.163 1.00 0.00 ? 147 GLY A O    2 
ATOM 4206  H H    . GLY A 1 84 ? 15.109  -18.084 -39.407 1.00 0.00 ? 147 GLY A H    2 
ATOM 4207  H HA2  . GLY A 1 84 ? 15.756  -19.551 -37.024 1.00 0.00 ? 147 GLY A HA2  2 
ATOM 4208  H HA3  . GLY A 1 84 ? 14.201  -20.062 -37.663 1.00 0.00 ? 147 GLY A HA3  2 
ATOM 4209  N N    . PRO A 1 85 ? 16.532  -21.537 -38.498 1.00 0.00 ? 148 PRO A N    2 
ATOM 4210  C CA   . PRO A 1 85 ? 17.143  -22.513 -39.392 1.00 0.00 ? 148 PRO A CA   2 
ATOM 4211  C C    . PRO A 1 85 ? 16.110  -23.126 -40.328 1.00 0.00 ? 148 PRO A C    2 
ATOM 4212  O O    . PRO A 1 85 ? 14.931  -23.216 -39.991 1.00 0.00 ? 148 PRO A O    2 
ATOM 4213  C CB   . PRO A 1 85 ? 17.716  -23.554 -38.425 1.00 0.00 ? 148 PRO A CB   2 
ATOM 4214  C CG   . PRO A 1 85 ? 17.971  -22.787 -37.171 1.00 0.00 ? 148 PRO A CG   2 
ATOM 4215  C CD   . PRO A 1 85 ? 16.819  -21.823 -37.083 1.00 0.00 ? 148 PRO A CD   2 
ATOM 4216  H HA   . PRO A 1 85 ? 17.951  -22.063 -39.945 1.00 0.00 ? 148 PRO A HA   2 
ATOM 4217  H HB2  . PRO A 1 85 ? 16.990  -24.353 -38.243 1.00 0.00 ? 148 PRO A HB2  2 
ATOM 4218  H HB3  . PRO A 1 85 ? 18.650  -23.972 -38.810 1.00 0.00 ? 148 PRO A HB3  2 
ATOM 4219  H HG2  . PRO A 1 85 ? 17.977  -23.463 -36.309 1.00 0.00 ? 148 PRO A HG2  2 
ATOM 4220  H HG3  . PRO A 1 85 ? 18.921  -22.253 -37.239 1.00 0.00 ? 148 PRO A HG3  2 
ATOM 4221  H HD2  . PRO A 1 85 ? 15.985  -22.248 -36.563 1.00 0.00 ? 148 PRO A HD2  2 
ATOM 4222  H HD3  . PRO A 1 85 ? 17.166  -20.927 -36.580 1.00 0.00 ? 148 PRO A HD3  2 
ATOM 4223  N N    . ARG A 1 86 ? 16.562  -23.547 -41.505 1.00 0.00 ? 149 ARG A N    2 
ATOM 4224  C CA   . ARG A 1 86 ? 15.673  -24.142 -42.497 1.00 0.00 ? 149 ARG A CA   2 
ATOM 4225  C C    . ARG A 1 86 ? 14.948  -25.355 -41.930 1.00 0.00 ? 149 ARG A C    2 
ATOM 4226  O O    . ARG A 1 86 ? 15.313  -25.869 -40.873 1.00 0.00 ? 149 ARG A O    2 
ATOM 4227  C CB   . ARG A 1 86 ? 16.457  -24.555 -43.734 1.00 0.00 ? 149 ARG A CB   2 
ATOM 4228  C CG   . ARG A 1 86 ? 16.946  -23.402 -44.598 1.00 0.00 ? 149 ARG A CG   2 
ATOM 4229  C CD   . ARG A 1 86 ? 17.635  -23.884 -45.820 1.00 0.00 ? 149 ARG A CD   2 
ATOM 4230  N NE   . ARG A 1 86 ? 18.200  -22.790 -46.592 1.00 0.00 ? 149 ARG A NE   2 
ATOM 4231  C CZ   . ARG A 1 86 ? 18.776  -22.925 -47.802 1.00 0.00 ? 149 ARG A CZ   2 
ATOM 4232  N NH1  . ARG A 1 86 ? 18.857  -24.110 -48.363 1.00 0.00 ? 149 ARG A NH1  2 
ATOM 4233  N NH2  . ARG A 1 86 ? 19.260  -21.865 -48.426 1.00 0.00 ? 149 ARG A NH2  2 
ATOM 4234  H H    . ARG A 1 86 ? 17.554  -23.442 -41.724 1.00 0.00 ? 149 ARG A H    2 
ATOM 4235  H HA   . ARG A 1 86 ? 14.943  -23.405 -42.802 1.00 0.00 ? 149 ARG A HA   2 
ATOM 4236  H HB2  . ARG A 1 86 ? 17.324  -25.125 -43.415 1.00 0.00 ? 149 ARG A HB2  2 
ATOM 4237  H HB3  . ARG A 1 86 ? 15.826  -25.194 -44.356 1.00 0.00 ? 149 ARG A HB3  2 
ATOM 4238  H HG2  . ARG A 1 86 ? 16.091  -22.787 -44.880 1.00 0.00 ? 149 ARG A HG2  2 
ATOM 4239  H HG3  . ARG A 1 86 ? 17.647  -22.802 -44.018 1.00 0.00 ? 149 ARG A HG3  2 
ATOM 4240  H HD2  . ARG A 1 86 ? 18.410  -24.598 -45.552 1.00 0.00 ? 149 ARG A HD2  2 
ATOM 4241  H HD3  . ARG A 1 86 ? 16.896  -24.388 -46.443 1.00 0.00 ? 149 ARG A HD3  2 
ATOM 4242  H HE   . ARG A 1 86 ? 18.167  -21.892 -46.200 1.00 0.00 ? 149 ARG A HE   2 
ATOM 4243  H HH11 . ARG A 1 86 ? 18.492  -24.914 -47.893 1.00 0.00 ? 149 ARG A HH11 2 
ATOM 4244  H HH12 . ARG A 1 86 ? 19.289  -24.210 -49.271 1.00 0.00 ? 149 ARG A HH12 2 
ATOM 4245  H HH21 . ARG A 1 86 ? 19.202  -20.960 -48.001 1.00 0.00 ? 149 ARG A HH21 2 
ATOM 4246  H HH22 . ARG A 1 86 ? 19.685  -21.967 -49.324 1.00 0.00 ? 149 ARG A HH22 2 
ATOM 4247  N N    . LYS A 1 87 ? 13.922  -25.809 -42.640 1.00 0.00 ? 150 LYS A N    2 
ATOM 4248  C CA   . LYS A 1 87 ? 13.216  -27.031 -42.273 1.00 0.00 ? 150 LYS A CA   2 
ATOM 4249  C C    . LYS A 1 87 ? 14.103  -28.256 -42.456 1.00 0.00 ? 150 LYS A C    2 
ATOM 4250  O O    . LYS A 1 87 ? 13.957  -29.253 -41.749 1.00 0.00 ? 150 LYS A O    2 
ATOM 4251  C CB   . LYS A 1 87 ? 11.937  -27.181 -43.095 1.00 0.00 ? 150 LYS A CB   2 
ATOM 4252  C CG   . LYS A 1 87 ? 11.012  -28.296 -42.628 1.00 0.00 ? 150 LYS A CG   2 
ATOM 4253  C CD   . LYS A 1 87 ? 9.670   -28.239 -43.343 1.00 0.00 ? 150 LYS A CD   2 
ATOM 4254  C CE   . LYS A 1 87 ? 8.715   -29.299 -42.813 1.00 0.00 ? 150 LYS A CE   2 
ATOM 4255  N NZ   . LYS A 1 87 ? 7.390   -29.241 -43.490 1.00 0.00 ? 150 LYS A NZ   2 
ATOM 4256  H H    . LYS A 1 87 ? 13.684  -25.347 -43.518 1.00 0.00 ? 150 LYS A H    2 
ATOM 4257  H HA   . LYS A 1 87 ? 12.958  -26.966 -41.223 1.00 0.00 ? 150 LYS A HA   2 
ATOM 4258  H HB2  . LYS A 1 87 ? 11.384  -26.245 -43.061 1.00 0.00 ? 150 LYS A HB2  2 
ATOM 4259  H HB3  . LYS A 1 87 ? 12.223  -27.377 -44.130 1.00 0.00 ? 150 LYS A HB3  2 
ATOM 4260  H HG2  . LYS A 1 87 ? 11.487  -29.254 -42.849 1.00 0.00 ? 150 LYS A HG2  2 
ATOM 4261  H HG3  . LYS A 1 87 ? 10.853  -28.217 -41.556 1.00 0.00 ? 150 LYS A HG3  2 
ATOM 4262  H HD2  . LYS A 1 87 ? 9.230   -27.255 -43.192 1.00 0.00 ? 150 LYS A HD2  2 
ATOM 4263  H HD3  . LYS A 1 87 ? 9.826   -28.406 -44.407 1.00 0.00 ? 150 LYS A HD3  2 
ATOM 4264  H HE2  . LYS A 1 87 ? 9.152   -30.284 -42.975 1.00 0.00 ? 150 LYS A HE2  2 
ATOM 4265  H HE3  . LYS A 1 87 ? 8.574   -29.142 -41.742 1.00 0.00 ? 150 LYS A HE3  2 
ATOM 4266  H HZ1  . LYS A 1 87 ? 6.853   -28.426 -43.132 1.00 0.00 ? 150 LYS A HZ1  2 
ATOM 4267  H HZ2  . LYS A 1 87 ? 6.858   -30.117 -43.302 1.00 0.00 ? 150 LYS A HZ2  2 
ATOM 4268  H HZ3  . LYS A 1 87 ? 7.527   -29.140 -44.486 1.00 0.00 ? 150 LYS A HZ3  2 
ATOM 4269  N N    . GLN A 1 88 ? 15.023  -28.175 -43.411 1.00 0.00 ? 151 GLN A N    2 
ATOM 4270  C CA   . GLN A 1 88 ? 15.977  -29.253 -43.648 1.00 0.00 ? 151 GLN A CA   2 
ATOM 4271  C C    . GLN A 1 88 ? 16.865  -29.480 -42.432 1.00 0.00 ? 151 GLN A C    2 
ATOM 4272  O O    . GLN A 1 88 ? 17.262  -30.608 -42.143 1.00 0.00 ? 151 GLN A O    2 
ATOM 4273  C CB   . GLN A 1 88 ? 16.839  -28.943 -44.876 1.00 0.00 ? 151 GLN A CB   2 
ATOM 4274  C CG   . GLN A 1 88 ? 16.079  -28.971 -46.192 1.00 0.00 ? 151 GLN A CG   2 
ATOM 4275  C CD   . GLN A 1 88 ? 16.963  -28.629 -47.376 1.00 0.00 ? 151 GLN A CD   2 
ATOM 4276  O OE1  . GLN A 1 88 ? 18.191  -28.717 -47.298 1.00 0.00 ? 151 GLN A OE1  2 
ATOM 4277  N NE2  . GLN A 1 88 ? 16.341  -28.234 -48.481 1.00 0.00 ? 151 GLN A NE2  2 
ATOM 4278  H H    . GLN A 1 88 ? 15.100  -27.316 -43.954 1.00 0.00 ? 151 GLN A H    2 
ATOM 4279  H HA   . GLN A 1 88 ? 15.416  -30.165 -43.849 1.00 0.00 ? 151 GLN A HA   2 
ATOM 4280  H HB2  . GLN A 1 88 ? 17.269  -27.950 -44.752 1.00 0.00 ? 151 GLN A HB2  2 
ATOM 4281  H HB3  . GLN A 1 88 ? 17.650  -29.675 -44.929 1.00 0.00 ? 151 GLN A HB3  2 
ATOM 4282  H HG2  . GLN A 1 88 ? 15.672  -29.972 -46.334 1.00 0.00 ? 151 GLN A HG2  2 
ATOM 4283  H HG3  . GLN A 1 88 ? 15.259  -28.256 -46.137 1.00 0.00 ? 151 GLN A HG3  2 
ATOM 4284  H HE21 . GLN A 1 88 ? 15.324  -28.175 -48.514 1.00 0.00 ? 151 GLN A HE21 2 
ATOM 4285  H HE22 . GLN A 1 88 ? 16.893  -27.988 -49.303 1.00 0.00 ? 151 GLN A HE22 2 
ATOM 4286  N N    . VAL A 1 89 ? 17.179  -28.401 -41.724 1.00 0.00 ? 152 VAL A N    2 
ATOM 4287  C CA   . VAL A 1 89 ? 18.017  -28.480 -40.534 1.00 0.00 ? 152 VAL A CA   2 
ATOM 4288  C C    . VAL A 1 89 ? 17.343  -29.294 -39.439 1.00 0.00 ? 152 VAL A C    2 
ATOM 4289  O O    . VAL A 1 89 ? 17.853  -30.350 -39.110 1.00 0.00 ? 152 VAL A O    2 
ATOM 4290  C CB   . VAL A 1 89 ? 18.328  -27.067 -40.005 1.00 0.00 ? 152 VAL A CB   2 
ATOM 4291  C CG1  . VAL A 1 89 ? 19.102  -27.148 -38.697 1.00 0.00 ? 152 VAL A CG1  2 
ATOM 4292  C CG2  . VAL A 1 89 ? 19.110  -26.286 -41.047 1.00 0.00 ? 152 VAL A CG2  2 
ATOM 4293  O OXT  . VAL A 1 89 ? 16.343  -28.830 -38.918 1.00 0.00 ? 152 VAL A OXT  2 
ATOM 4294  H H    . VAL A 1 89 ? 16.817  -27.493 -42.017 1.00 0.00 ? 152 VAL A H    2 
ATOM 4295  H HA   . VAL A 1 89 ? 18.956  -28.960 -40.801 1.00 0.00 ? 152 VAL A HA   2 
ATOM 4296  H HB   . VAL A 1 89 ? 17.384  -26.554 -39.817 1.00 0.00 ? 152 VAL A HB   2 
ATOM 4297  H HG11 . VAL A 1 89 ? 19.917  -27.867 -38.805 1.00 0.00 ? 152 VAL A HG11 2 
ATOM 4298  H HG12 . VAL A 1 89 ? 18.440  -27.468 -37.893 1.00 0.00 ? 152 VAL A HG12 2 
ATOM 4299  H HG13 . VAL A 1 89 ? 19.515  -26.167 -38.457 1.00 0.00 ? 152 VAL A HG13 2 
ATOM 4300  H HG21 . VAL A 1 89 ? 20.148  -26.621 -41.047 1.00 0.00 ? 152 VAL A HG21 2 
ATOM 4301  H HG22 . VAL A 1 89 ? 18.680  -26.450 -42.033 1.00 0.00 ? 152 VAL A HG22 2 
ATOM 4302  H HG23 . VAL A 1 89 ? 19.074  -25.222 -40.809 1.00 0.00 ? 152 VAL A HG23 2 
ATOM 4303  N N    . GLY B 1 1  ? 4.487   8.696   -51.586 1.00 0.00 ? 64  GLY B N    2 
ATOM 4304  C CA   . GLY B 1 1  ? 3.707   9.343   -50.538 1.00 0.00 ? 64  GLY B CA   2 
ATOM 4305  C C    . GLY B 1 1  ? 2.436   9.966   -51.100 1.00 0.00 ? 64  GLY B C    2 
ATOM 4306  O O    . GLY B 1 1  ? 2.250   10.027  -52.317 1.00 0.00 ? 64  GLY B O    2 
ATOM 4307  H H1   . GLY B 1 1  ? 5.231   9.312   -51.880 1.00 0.00 ? 64  GLY B H1   2 
ATOM 4308  H H2   . GLY B 1 1  ? 4.894   7.811   -51.216 1.00 0.00 ? 64  GLY B H2   2 
ATOM 4309  H H3   . GLY B 1 1  ? 3.873   8.482   -52.398 1.00 0.00 ? 64  GLY B H3   2 
ATOM 4310  H HA2  . GLY B 1 1  ? 3.437   8.604   -49.783 1.00 0.00 ? 64  GLY B HA2  2 
ATOM 4311  H HA3  . GLY B 1 1  ? 4.310   10.122  -50.072 1.00 0.00 ? 64  GLY B HA3  2 
ATOM 4312  N N    . LEU B 1 2  ? 1.566   10.428  -50.210 1.00 0.00 ? 65  LEU B N    2 
ATOM 4313  C CA   . LEU B 1 2  ? 0.309   11.046  -50.617 1.00 0.00 ? 65  LEU B CA   2 
ATOM 4314  C C    . LEU B 1 2  ? 0.339   12.552  -50.395 1.00 0.00 ? 65  LEU B C    2 
ATOM 4315  O O    . LEU B 1 2  ? 1.155   13.060  -49.626 1.00 0.00 ? 65  LEU B O    2 
ATOM 4316  C CB   . LEU B 1 2  ? -0.861  10.431  -49.837 1.00 0.00 ? 65  LEU B CB   2 
ATOM 4317  C CG   . LEU B 1 2  ? -1.020  8.911   -49.967 1.00 0.00 ? 65  LEU B CG   2 
ATOM 4318  C CD1  . LEU B 1 2  ? -2.189  8.448   -49.109 1.00 0.00 ? 65  LEU B CD1  2 
ATOM 4319  C CD2  . LEU B 1 2  ? -1.232  8.543   -51.427 1.00 0.00 ? 65  LEU B CD2  2 
ATOM 4320  H H    . LEU B 1 2  ? 1.779   10.344  -49.217 1.00 0.00 ? 65  LEU B H    2 
ATOM 4321  H HA   . LEU B 1 2  ? 0.133   10.863  -51.680 1.00 0.00 ? 65  LEU B HA   2 
ATOM 4322  H HB2  . LEU B 1 2  ? -0.694  10.650  -48.788 1.00 0.00 ? 65  LEU B HB2  2 
ATOM 4323  H HB3  . LEU B 1 2  ? -1.786  10.909  -50.157 1.00 0.00 ? 65  LEU B HB3  2 
ATOM 4324  H HG   . LEU B 1 2  ? -0.099  8.438   -49.609 1.00 0.00 ? 65  LEU B HG   2 
ATOM 4325  H HD11 . LEU B 1 2  ? -2.038  7.400   -48.849 1.00 0.00 ? 65  LEU B HD11 2 
ATOM 4326  H HD12 . LEU B 1 2  ? -3.117  8.540   -49.650 1.00 0.00 ? 65  LEU B HD12 2 
ATOM 4327  H HD13 . LEU B 1 2  ? -2.248  9.032   -48.188 1.00 0.00 ? 65  LEU B HD13 2 
ATOM 4328  H HD21 . LEU B 1 2  ? -1.655  7.546   -51.475 1.00 0.00 ? 65  LEU B HD21 2 
ATOM 4329  H HD22 . LEU B 1 2  ? -0.279  8.554   -51.957 1.00 0.00 ? 65  LEU B HD22 2 
ATOM 4330  H HD23 . LEU B 1 2  ? -1.918  9.250   -51.896 1.00 0.00 ? 65  LEU B HD23 2 
ATOM 4331  N N    . SER B 1 3  ? -0.556  13.262  -51.073 1.00 0.00 ? 66  SER B N    2 
ATOM 4332  C CA   . SER B 1 3  ? -0.539  14.721  -51.069 1.00 0.00 ? 66  SER B CA   2 
ATOM 4333  C C    . SER B 1 3  ? -1.547  15.281  -50.073 1.00 0.00 ? 66  SER B C    2 
ATOM 4334  O O    . SER B 1 3  ? -2.757  15.204  -50.289 1.00 0.00 ? 66  SER B O    2 
ATOM 4335  C CB   . SER B 1 3  ? -0.840  15.250  -52.458 1.00 0.00 ? 66  SER B CB   2 
ATOM 4336  O OG   . SER B 1 3  ? -0.843  16.651  -52.472 1.00 0.00 ? 66  SER B OG   2 
ATOM 4337  H H    . SER B 1 3  ? -1.191  12.780  -51.708 1.00 0.00 ? 66  SER B H    2 
ATOM 4338  H HA   . SER B 1 3  ? 0.452   15.077  -50.786 1.00 0.00 ? 66  SER B HA   2 
ATOM 4339  H HB2  . SER B 1 3  ? -0.116  14.874  -53.172 1.00 0.00 ? 66  SER B HB2  2 
ATOM 4340  H HB3  . SER B 1 3  ? -1.825  14.917  -52.733 1.00 0.00 ? 66  SER B HB3  2 
ATOM 4341  H HG   . SER B 1 3  ? -1.269  16.946  -53.282 1.00 0.00 ? 66  SER B HG   2 
ATOM 4342  N N    . GLU B 1 4  ? -1.040  15.847  -48.983 1.00 0.00 ? 67  GLU B N    2 
ATOM 4343  C CA   . GLU B 1 4  ? -1.886  16.515  -48.002 1.00 0.00 ? 67  GLU B CA   2 
ATOM 4344  C C    . GLU B 1 4  ? -2.703  17.630  -48.648 1.00 0.00 ? 67  GLU B C    2 
ATOM 4345  O O    . GLU B 1 4  ? -2.206  18.361  -49.503 1.00 0.00 ? 67  GLU B O    2 
ATOM 4346  C CB   . GLU B 1 4  ? -1.039  17.086  -46.865 1.00 0.00 ? 67  GLU B CB   2 
ATOM 4347  C CG   . GLU B 1 4  ? -1.838  17.779  -45.769 1.00 0.00 ? 67  GLU B CG   2 
ATOM 4348  C CD   . GLU B 1 4  ? -0.974  18.310  -44.662 1.00 0.00 ? 67  GLU B CD   2 
ATOM 4349  O OE1  . GLU B 1 4  ? 0.201   18.031  -44.663 1.00 0.00 ? 67  GLU B OE1  2 
ATOM 4350  O OE2  . GLU B 1 4  ? -1.491  18.994  -43.809 1.00 0.00 ? 67  GLU B OE2  2 
ATOM 4351  H H    . GLU B 1 4  ? -0.026  15.894  -48.876 1.00 0.00 ? 67  GLU B H    2 
ATOM 4352  H HA   . GLU B 1 4  ? -2.566  15.785  -47.582 1.00 0.00 ? 67  GLU B HA   2 
ATOM 4353  H HB2  . GLU B 1 4  ? -0.470  16.275  -46.410 1.00 0.00 ? 67  GLU B HB2  2 
ATOM 4354  H HB3  . GLU B 1 4  ? -0.343  17.812  -47.288 1.00 0.00 ? 67  GLU B HB3  2 
ATOM 4355  H HG2  . GLU B 1 4  ? -2.389  18.609  -46.211 1.00 0.00 ? 67  GLU B HG2  2 
ATOM 4356  H HG3  . GLU B 1 4  ? -2.548  17.062  -45.352 1.00 0.00 ? 67  GLU B HG3  2 
ATOM 4357  N N    . MET B 1 5  ? -3.960  17.753  -48.233 1.00 0.00 ? 68  MET B N    2 
ATOM 4358  C CA   . MET B 1 5  ? -4.837  18.797  -48.746 1.00 0.00 ? 68  MET B CA   2 
ATOM 4359  C C    . MET B 1 5  ? -4.074  20.099  -48.965 1.00 0.00 ? 68  MET B C    2 
ATOM 4360  O O    . MET B 1 5  ? -3.516  20.667  -48.027 1.00 0.00 ? 68  MET B O    2 
ATOM 4361  C CB   . MET B 1 5  ? -6.006  19.021  -47.790 1.00 0.00 ? 68  MET B CB   2 
ATOM 4362  C CG   . MET B 1 5  ? -7.035  20.030  -48.278 1.00 0.00 ? 68  MET B CG   2 
ATOM 4363  S SD   . MET B 1 5  ? -8.429  20.206  -47.147 1.00 0.00 ? 68  MET B SD   2 
ATOM 4364  C CE   . MET B 1 5  ? -9.274  18.651  -47.409 1.00 0.00 ? 68  MET B CE   2 
ATOM 4365  H H    . MET B 1 5  ? -4.311  17.116  -47.516 1.00 0.00 ? 68  MET B H    2 
ATOM 4366  H HA   . MET B 1 5  ? -5.236  18.479  -49.705 1.00 0.00 ? 68  MET B HA   2 
ATOM 4367  H HB2  . MET B 1 5  ? -6.507  18.074  -47.601 1.00 0.00 ? 68  MET B HB2  2 
ATOM 4368  H HB3  . MET B 1 5  ? -5.600  19.390  -46.847 1.00 0.00 ? 68  MET B HB3  2 
ATOM 4369  H HG2  . MET B 1 5  ? -6.550  20.999  -48.406 1.00 0.00 ? 68  MET B HG2  2 
ATOM 4370  H HG3  . MET B 1 5  ? -7.410  19.693  -49.245 1.00 0.00 ? 68  MET B HG3  2 
ATOM 4371  H HE1  . MET B 1 5  ? -10.315 18.743  -47.098 1.00 0.00 ? 68  MET B HE1  2 
ATOM 4372  H HE2  . MET B 1 5  ? -8.788  17.867  -46.827 1.00 0.00 ? 68  MET B HE2  2 
ATOM 4373  H HE3  . MET B 1 5  ? -9.235  18.396  -48.468 1.00 0.00 ? 68  MET B HE3  2 
ATOM 4374  N N    . ARG B 1 6  ? -4.053  20.564  -50.209 1.00 0.00 ? 69  ARG B N    2 
ATOM 4375  C CA   . ARG B 1 6  ? -3.324  21.776  -50.560 1.00 0.00 ? 69  ARG B CA   2 
ATOM 4376  C C    . ARG B 1 6  ? -4.264  22.845  -51.106 1.00 0.00 ? 69  ARG B C    2 
ATOM 4377  O O    . ARG B 1 6  ? -4.907  22.653  -52.139 1.00 0.00 ? 69  ARG B O    2 
ATOM 4378  C CB   . ARG B 1 6  ? -2.250  21.475  -51.597 1.00 0.00 ? 69  ARG B CB   2 
ATOM 4379  C CG   . ARG B 1 6  ? -1.498  22.691  -52.110 1.00 0.00 ? 69  ARG B CG   2 
ATOM 4380  C CD   . ARG B 1 6  ? -0.447  22.315  -53.090 1.00 0.00 ? 69  ARG B CD   2 
ATOM 4381  N NE   . ARG B 1 6  ? 0.257   23.477  -53.604 1.00 0.00 ? 69  ARG B NE   2 
ATOM 4382  C CZ   . ARG B 1 6  ? 1.236   23.430  -54.529 1.00 0.00 ? 69  ARG B CZ   2 
ATOM 4383  N NH1  . ARG B 1 6  ? 1.613   22.276  -55.028 1.00 0.00 ? 69  ARG B NH1  2 
ATOM 4384  N NH2  . ARG B 1 6  ? 1.816   24.546  -54.932 1.00 0.00 ? 69  ARG B NH2  2 
ATOM 4385  H H    . ARG B 1 6  ? -4.530  20.042  -50.944 1.00 0.00 ? 69  ARG B H    2 
ATOM 4386  H HA   . ARG B 1 6  ? -2.829  22.182  -49.675 1.00 0.00 ? 69  ARG B HA   2 
ATOM 4387  H HB2  . ARG B 1 6  ? -1.527  20.790  -51.155 1.00 0.00 ? 69  ARG B HB2  2 
ATOM 4388  H HB3  . ARG B 1 6  ? -2.726  20.981  -52.446 1.00 0.00 ? 69  ARG B HB3  2 
ATOM 4389  H HG2  . ARG B 1 6  ? -2.200  23.369  -52.597 1.00 0.00 ? 69  ARG B HG2  2 
ATOM 4390  H HG3  . ARG B 1 6  ? -1.031  23.198  -51.266 1.00 0.00 ? 69  ARG B HG3  2 
ATOM 4391  H HD2  . ARG B 1 6  ? 0.271   21.656  -52.603 1.00 0.00 ? 69  ARG B HD2  2 
ATOM 4392  H HD3  . ARG B 1 6  ? -0.913  21.786  -53.922 1.00 0.00 ? 69  ARG B HD3  2 
ATOM 4393  H HE   . ARG B 1 6  ? 0.001   24.356  -53.254 1.00 0.00 ? 69  ARG B HE   2 
ATOM 4394  H HH11 . ARG B 1 6  ? 1.177   21.430  -54.723 1.00 0.00 ? 69  ARG B HH11 2 
ATOM 4395  H HH12 . ARG B 1 6  ? 2.346   22.242  -55.723 1.00 0.00 ? 69  ARG B HH12 2 
ATOM 4396  H HH21 . ARG B 1 6  ? 1.532   25.428  -54.554 1.00 0.00 ? 69  ARG B HH21 2 
ATOM 4397  H HH22 . ARG B 1 6  ? 2.542   24.510  -55.620 1.00 0.00 ? 69  ARG B HH22 2 
ATOM 4398  N N    . LEU B 1 7  ? -4.340  23.971  -50.405 1.00 0.00 ? 70  LEU B N    2 
ATOM 4399  C CA   . LEU B 1 7  ? -5.207  25.071  -50.814 1.00 0.00 ? 70  LEU B CA   2 
ATOM 4400  C C    . LEU B 1 7  ? -4.551  25.918  -51.897 1.00 0.00 ? 70  LEU B C    2 
ATOM 4401  O O    . LEU B 1 7  ? -3.548  26.587  -51.652 1.00 0.00 ? 70  LEU B O    2 
ATOM 4402  C CB   . LEU B 1 7  ? -5.553  25.951  -49.606 1.00 0.00 ? 70  LEU B CB   2 
ATOM 4403  C CG   . LEU B 1 7  ? -6.606  25.382  -48.647 1.00 0.00 ? 70  LEU B CG   2 
ATOM 4404  C CD1  . LEU B 1 7  ? -6.070  24.114  -47.995 1.00 0.00 ? 70  LEU B CD1  2 
ATOM 4405  C CD2  . LEU B 1 7  ? -6.958  26.428  -47.600 1.00 0.00 ? 70  LEU B CD2  2 
ATOM 4406  H H    . LEU B 1 7  ? -3.779  24.070  -49.560 1.00 0.00 ? 70  LEU B H    2 
ATOM 4407  H HA   . LEU B 1 7  ? -6.123  24.683  -51.214 1.00 0.00 ? 70  LEU B HA   2 
ATOM 4408  H HB2  . LEU B 1 7  ? -4.641  26.116  -49.034 1.00 0.00 ? 70  LEU B HB2  2 
ATOM 4409  H HB3  . LEU B 1 7  ? -5.909  26.917  -49.970 1.00 0.00 ? 70  LEU B HB3  2 
ATOM 4410  H HG   . LEU B 1 7  ? -7.501  25.166  -49.205 1.00 0.00 ? 70  LEU B HG   2 
ATOM 4411  H HD11 . LEU B 1 7  ? -5.094  24.317  -47.556 1.00 0.00 ? 70  LEU B HD11 2 
ATOM 4412  H HD12 . LEU B 1 7  ? -5.974  23.322  -48.737 1.00 0.00 ? 70  LEU B HD12 2 
ATOM 4413  H HD13 . LEU B 1 7  ? -6.758  23.795  -47.212 1.00 0.00 ? 70  LEU B HD13 2 
ATOM 4414  H HD21 . LEU B 1 7  ? -6.059  26.698  -47.048 1.00 0.00 ? 70  LEU B HD21 2 
ATOM 4415  H HD22 . LEU B 1 7  ? -7.696  26.015  -46.911 1.00 0.00 ? 70  LEU B HD22 2 
ATOM 4416  H HD23 . LEU B 1 7  ? -7.368  27.314  -48.083 1.00 0.00 ? 70  LEU B HD23 2 
ATOM 4417  N N    . GLU B 1 8  ? -5.124  25.884  -53.094 1.00 0.00 ? 71  GLU B N    2 
ATOM 4418  C CA   . GLU B 1 8  ? -4.734  26.804  -54.157 1.00 0.00 ? 71  GLU B CA   2 
ATOM 4419  C C    . GLU B 1 8  ? -5.485  28.125  -54.045 1.00 0.00 ? 71  GLU B C    2 
ATOM 4420  O O    . GLU B 1 8  ? -6.322  28.301  -53.160 1.00 0.00 ? 71  GLU B O    2 
ATOM 4421  C CB   . GLU B 1 8  ? -4.989  26.175  -55.528 1.00 0.00 ? 71  GLU B CB   2 
ATOM 4422  C CG   . GLU B 1 8  ? -4.199  24.900  -55.790 1.00 0.00 ? 71  GLU B CG   2 
ATOM 4423  C CD   . GLU B 1 8  ? -2.719  25.138  -55.897 1.00 0.00 ? 71  GLU B CD   2 
ATOM 4424  O OE1  . GLU B 1 8  ? -2.337  26.230  -56.238 1.00 0.00 ? 71  GLU B OE1  2 
ATOM 4425  O OE2  . GLU B 1 8  ? -1.972  24.226  -55.635 1.00 0.00 ? 71  GLU B OE2  2 
ATOM 4426  H H    . GLU B 1 8  ? -5.964  25.334  -53.210 1.00 0.00 ? 71  GLU B H    2 
ATOM 4427  H HA   . GLU B 1 8  ? -3.664  27.001  -54.065 1.00 0.00 ? 71  GLU B HA   2 
ATOM 4428  H HB2  . GLU B 1 8  ? -6.053  25.957  -55.607 1.00 0.00 ? 71  GLU B HB2  2 
ATOM 4429  H HB3  . GLU B 1 8  ? -4.720  26.901  -56.294 1.00 0.00 ? 71  GLU B HB3  2 
ATOM 4430  H HG2  . GLU B 1 8  ? -4.380  24.211  -54.965 1.00 0.00 ? 71  GLU B HG2  2 
ATOM 4431  H HG3  . GLU B 1 8  ? -4.553  24.440  -56.714 1.00 0.00 ? 71  GLU B HG3  2 
ATOM 4432  N N    . LYS B 1 9  ? -5.183  29.051  -54.949 1.00 0.00 ? 72  LYS B N    2 
ATOM 4433  C CA   . LYS B 1 9  ? -5.780  30.381  -54.913 1.00 0.00 ? 72  LYS B CA   2 
ATOM 4434  C C    . LYS B 1 9  ? -6.972  30.423  -53.969 1.00 0.00 ? 72  LYS B C    2 
ATOM 4435  O O    . LYS B 1 9  ? -6.911  31.036  -52.903 1.00 0.00 ? 72  LYS B O    2 
ATOM 4436  C CB   . LYS B 1 9  ? -6.203  30.814  -56.317 1.00 0.00 ? 72  LYS B CB   2 
ATOM 4437  C CG   . LYS B 1 9  ? -6.806  32.212  -56.388 1.00 0.00 ? 72  LYS B CG   2 
ATOM 4438  C CD   . LYS B 1 9  ? -7.150  32.593  -57.821 1.00 0.00 ? 72  LYS B CD   2 
ATOM 4439  C CE   . LYS B 1 9  ? -7.781  33.976  -57.890 1.00 0.00 ? 72  LYS B CE   2 
ATOM 4440  N NZ   . LYS B 1 9  ? -8.122  34.362  -59.285 1.00 0.00 ? 72  LYS B NZ   2 
ATOM 4441  H H    . LYS B 1 9  ? -4.472  28.847  -55.651 1.00 0.00 ? 72  LYS B H    2 
ATOM 4442  H HA   . LYS B 1 9  ? -5.035  31.091  -54.556 1.00 0.00 ? 72  LYS B HA   2 
ATOM 4443  H HB2  . LYS B 1 9  ? -5.330  30.782  -56.968 1.00 0.00 ? 72  LYS B HB2  2 
ATOM 4444  H HB3  . LYS B 1 9  ? -6.942  30.101  -56.685 1.00 0.00 ? 72  LYS B HB3  2 
ATOM 4445  H HG2  . LYS B 1 9  ? -7.714  32.239  -55.781 1.00 0.00 ? 72  LYS B HG2  2 
ATOM 4446  H HG3  . LYS B 1 9  ? -6.085  32.926  -55.993 1.00 0.00 ? 72  LYS B HG3  2 
ATOM 4447  H HD2  . LYS B 1 9  ? -6.240  32.586  -58.420 1.00 0.00 ? 72  LYS B HD2  2 
ATOM 4448  H HD3  . LYS B 1 9  ? -7.851  31.863  -58.225 1.00 0.00 ? 72  LYS B HD3  2 
ATOM 4449  H HE2  . LYS B 1 9  ? -8.690  33.979  -57.290 1.00 0.00 ? 72  LYS B HE2  2 
ATOM 4450  H HE3  . LYS B 1 9  ? -7.079  34.704  -57.481 1.00 0.00 ? 72  LYS B HE3  2 
ATOM 4451  H HZ1  . LYS B 1 9  ? -8.028  33.529  -59.901 1.00 0.00 ? 72  LYS B HZ1  2 
ATOM 4452  H HZ2  . LYS B 1 9  ? -7.474  35.109  -59.608 1.00 0.00 ? 72  LYS B HZ2  2 
ATOM 4453  H HZ3  . LYS B 1 9  ? -9.073  34.701  -59.318 1.00 0.00 ? 72  LYS B HZ3  2 
ATOM 4454  N N    . ASP B 1 10 ? -8.059  29.771  -54.365 1.00 0.00 ? 73  ASP B N    2 
ATOM 4455  C CA   . ASP B 1 10 ? -9.256  29.703  -53.538 1.00 0.00 ? 73  ASP B CA   2 
ATOM 4456  C C    . ASP B 1 10 ? -9.929  28.340  -53.650 1.00 0.00 ? 73  ASP B C    2 
ATOM 4457  O O    . ASP B 1 10 ? -11.148 28.247  -53.784 1.00 0.00 ? 73  ASP B O    2 
ATOM 4458  C CB   . ASP B 1 10 ? -10.247 30.799  -53.936 1.00 0.00 ? 73  ASP B CB   2 
ATOM 4459  C CG   . ASP B 1 10 ? -10.733 30.666  -55.373 1.00 0.00 ? 73  ASP B CG   2 
ATOM 4460  O OD1  . ASP B 1 10 ? -10.278 29.778  -56.054 1.00 0.00 ? 73  ASP B OD1  2 
ATOM 4461  O OD2  . ASP B 1 10 ? -11.555 31.455  -55.777 1.00 0.00 ? 73  ASP B OD2  2 
ATOM 4462  H H    . ASP B 1 10 ? -8.039  29.270  -55.255 1.00 0.00 ? 73  ASP B H    2 
ATOM 4463  H HA   . ASP B 1 10 ? -8.973  29.853  -52.506 1.00 0.00 ? 73  ASP B HA   2 
ATOM 4464  H HB2  . ASP B 1 10 ? -11.108 30.758  -53.272 1.00 0.00 ? 73  ASP B HB2  2 
ATOM 4465  H HB3  . ASP B 1 10 ? -9.759  31.769  -53.822 1.00 0.00 ? 73  ASP B HB3  2 
ATOM 4466  N N    . ARG B 1 11 ? -9.124  27.283  -53.597 1.00 0.00 ? 74  ARG B N    2 
ATOM 4467  C CA   . ARG B 1 11 ? -9.627  25.927  -53.783 1.00 0.00 ? 74  ARG B CA   2 
ATOM 4468  C C    . ARG B 1 11 ? -8.558  24.893  -53.456 1.00 0.00 ? 74  ARG B C    2 
ATOM 4469  O O    . ARG B 1 11 ? -7.402  25.035  -53.859 1.00 0.00 ? 74  ARG B O    2 
ATOM 4470  C CB   . ARG B 1 11 ? -10.106 25.724  -55.212 1.00 0.00 ? 74  ARG B CB   2 
ATOM 4471  C CG   . ARG B 1 11 ? -10.674 24.345  -55.507 1.00 0.00 ? 74  ARG B CG   2 
ATOM 4472  C CD   . ARG B 1 11 ? -11.250 24.269  -56.873 1.00 0.00 ? 74  ARG B CD   2 
ATOM 4473  N NE   . ARG B 1 11 ? -11.756 22.939  -57.176 1.00 0.00 ? 74  ARG B NE   2 
ATOM 4474  C CZ   . ARG B 1 11 ? -12.327 22.586  -58.343 1.00 0.00 ? 74  ARG B CZ   2 
ATOM 4475  N NH1  . ARG B 1 11 ? -12.459 23.471  -59.306 1.00 0.00 ? 74  ARG B NH1  2 
ATOM 4476  N NH2  . ARG B 1 11 ? -12.756 21.347  -58.522 1.00 0.00 ? 74  ARG B NH2  2 
ATOM 4477  H H    . ARG B 1 11 ? -8.120  27.430  -53.498 1.00 0.00 ? 74  ARG B H    2 
ATOM 4478  H HA   . ARG B 1 11 ? -10.453 25.778  -53.106 1.00 0.00 ? 74  ARG B HA   2 
ATOM 4479  H HB2  . ARG B 1 11 ? -10.884 26.457  -55.421 1.00 0.00 ? 74  ARG B HB2  2 
ATOM 4480  H HB3  . ARG B 1 11 ? -9.266  25.905  -55.886 1.00 0.00 ? 74  ARG B HB3  2 
ATOM 4481  H HG2  . ARG B 1 11 ? -9.871  23.611  -55.422 1.00 0.00 ? 74  ARG B HG2  2 
ATOM 4482  H HG3  . ARG B 1 11 ? -11.449 24.114  -54.782 1.00 0.00 ? 74  ARG B HG3  2 
ATOM 4483  H HD2  . ARG B 1 11 ? -12.070 24.982  -56.952 1.00 0.00 ? 74  ARG B HD2  2 
ATOM 4484  H HD3  . ARG B 1 11 ? -10.478 24.528  -57.598 1.00 0.00 ? 74  ARG B HD3  2 
ATOM 4485  H HE   . ARG B 1 11 ? -11.674 22.251  -56.481 1.00 0.00 ? 74  ARG B HE   2 
ATOM 4486  H HH11 . ARG B 1 11 ? -12.135 24.408  -59.173 1.00 0.00 ? 74  ARG B HH11 2 
ATOM 4487  H HH12 . ARG B 1 11 ? -12.889 23.205  -60.180 1.00 0.00 ? 74  ARG B HH12 2 
ATOM 4488  H HH21 . ARG B 1 11 ? -12.655 20.671  -57.792 1.00 0.00 ? 74  ARG B HH21 2 
ATOM 4489  H HH22 . ARG B 1 11 ? -13.181 21.088  -59.389 1.00 0.00 ? 74  ARG B HH22 2 
ATOM 4490  N N    . PHE B 1 12 ? -8.949  23.856  -52.724 1.00 0.00 ? 75  PHE B N    2 
ATOM 4491  C CA   . PHE B 1 12 ? -8.008  22.832  -52.283 1.00 0.00 ? 75  PHE B CA   2 
ATOM 4492  C C    . PHE B 1 12 ? -8.287  21.498  -52.963 1.00 0.00 ? 75  PHE B C    2 
ATOM 4493  O O    . PHE B 1 12 ? -9.391  21.260  -53.454 1.00 0.00 ? 75  PHE B O    2 
ATOM 4494  C CB   . PHE B 1 12 ? -8.079  22.662  -50.764 1.00 0.00 ? 75  PHE B CB   2 
ATOM 4495  C CG   . PHE B 1 12 ? -9.461  22.375  -50.250 1.00 0.00 ? 75  PHE B CG   2 
ATOM 4496  C CD1  . PHE B 1 12 ? -9.954  21.080  -50.225 1.00 0.00 ? 75  PHE B CD1  2 
ATOM 4497  C CD2  . PHE B 1 12 ? -10.273 23.403  -49.792 1.00 0.00 ? 75  PHE B CD2  2 
ATOM 4498  C CE1  . PHE B 1 12 ? -11.225 20.816  -49.751 1.00 0.00 ? 75  PHE B CE1  2 
ATOM 4499  C CE2  . PHE B 1 12 ? -11.543 23.143  -49.319 1.00 0.00 ? 75  PHE B CE2  2 
ATOM 4500  C CZ   . PHE B 1 12 ? -12.020 21.848  -49.298 1.00 0.00 ? 75  PHE B CZ   2 
ATOM 4501  H H    . PHE B 1 12 ? -9.918  23.806  -52.413 1.00 0.00 ? 75  PHE B H    2 
ATOM 4502  H HA   . PHE B 1 12 ? -7.009  23.126  -52.557 1.00 0.00 ? 75  PHE B HA   2 
ATOM 4503  H HB2  . PHE B 1 12 ? -7.436  21.830  -50.483 1.00 0.00 ? 75  PHE B HB2  2 
ATOM 4504  H HB3  . PHE B 1 12 ? -7.714  23.539  -50.302 1.00 0.00 ? 75  PHE B HB3  2 
ATOM 4505  H HD1  . PHE B 1 12 ? -9.335  20.269  -50.581 1.00 0.00 ? 75  PHE B HD1  2 
ATOM 4506  H HD2  . PHE B 1 12 ? -9.903  24.419  -49.805 1.00 0.00 ? 75  PHE B HD2  2 
ATOM 4507  H HE1  . PHE B 1 12 ? -11.579 19.805  -49.731 1.00 0.00 ? 75  PHE B HE1  2 
ATOM 4508  H HE2  . PHE B 1 12 ? -12.170 23.942  -48.963 1.00 0.00 ? 75  PHE B HE2  2 
ATOM 4509  H HZ   . PHE B 1 12 ? -13.030 21.647  -48.974 1.00 0.00 ? 75  PHE B HZ   2 
ATOM 4510  N N    . SER B 1 13 ? -7.283  20.631  -52.988 1.00 0.00 ? 76  SER B N    2 
ATOM 4511  C CA   . SER B 1 13 ? -7.432  19.298  -53.562 1.00 0.00 ? 76  SER B CA   2 
ATOM 4512  C C    . SER B 1 13 ? -6.623  18.268  -52.785 1.00 0.00 ? 76  SER B C    2 
ATOM 4513  O O    . SER B 1 13 ? -5.673  18.613  -52.082 1.00 0.00 ? 76  SER B O    2 
ATOM 4514  C CB   . SER B 1 13 ? -6.997  19.305  -55.015 1.00 0.00 ? 76  SER B CB   2 
ATOM 4515  O OG   . SER B 1 13 ? -5.621  19.546  -55.125 1.00 0.00 ? 76  SER B OG   2 
ATOM 4516  H H    . SER B 1 13 ? -6.393  20.890  -52.556 1.00 0.00 ? 76  SER B H    2 
ATOM 4517  H HA   . SER B 1 13 ? -8.468  19.002  -53.517 1.00 0.00 ? 76  SER B HA   2 
ATOM 4518  H HB2  . SER B 1 13 ? -7.221  18.341  -55.464 1.00 0.00 ? 76  SER B HB2  2 
ATOM 4519  H HB3  . SER B 1 13 ? -7.551  20.083  -55.546 1.00 0.00 ? 76  SER B HB3  2 
ATOM 4520  H HG   . SER B 1 13 ? -5.472  20.103  -55.892 1.00 0.00 ? 76  SER B HG   2 
ATOM 4521  N N    . VAL B 1 14 ? -7.007  17.003  -52.915 1.00 0.00 ? 77  VAL B N    2 
ATOM 4522  C CA   . VAL B 1 14 ? -6.361  15.927  -52.171 1.00 0.00 ? 77  VAL B CA   2 
ATOM 4523  C C    . VAL B 1 14 ? -6.049  14.743  -53.076 1.00 0.00 ? 77  VAL B C    2 
ATOM 4524  O O    . VAL B 1 14 ? -6.809  14.434  -53.993 1.00 0.00 ? 77  VAL B O    2 
ATOM 4525  C CB   . VAL B 1 14 ? -7.264  15.462  -51.012 1.00 0.00 ? 77  VAL B CB   2 
ATOM 4526  C CG1  . VAL B 1 14 ? -6.661  14.246  -50.324 1.00 0.00 ? 77  VAL B CG1  2 
ATOM 4527  C CG2  . VAL B 1 14 ? -7.461  16.600  -50.021 1.00 0.00 ? 77  VAL B CG2  2 
ATOM 4528  H H    . VAL B 1 14 ? -7.809  16.782  -53.504 1.00 0.00 ? 77  VAL B H    2 
ATOM 4529  H HA   . VAL B 1 14 ? -5.422  16.285  -51.742 1.00 0.00 ? 77  VAL B HA   2 
ATOM 4530  H HB   . VAL B 1 14 ? -8.216  15.181  -51.436 1.00 0.00 ? 77  VAL B HB   2 
ATOM 4531  H HG11 . VAL B 1 14 ? -7.234  14.014  -49.426 1.00 0.00 ? 77  VAL B HG11 2 
ATOM 4532  H HG12 . VAL B 1 14 ? -5.624  14.452  -50.058 1.00 0.00 ? 77  VAL B HG12 2 
ATOM 4533  H HG13 . VAL B 1 14 ? -6.705  13.415  -51.005 1.00 0.00 ? 77  VAL B HG13 2 
ATOM 4534  H HG21 . VAL B 1 14 ? -8.329  16.380  -49.400 1.00 0.00 ? 77  VAL B HG21 2 
ATOM 4535  H HG22 . VAL B 1 14 ? -6.582  16.673  -49.394 1.00 0.00 ? 77  VAL B HG22 2 
ATOM 4536  H HG23 . VAL B 1 14 ? -7.623  17.540  -50.541 1.00 0.00 ? 77  VAL B HG23 2 
ATOM 4537  N N    . ASN B 1 15 ? -4.928  14.081  -52.812 1.00 0.00 ? 78  ASN B N    2 
ATOM 4538  C CA   . ASN B 1 15 ? -4.553  12.884  -53.553 1.00 0.00 ? 78  ASN B CA   2 
ATOM 4539  C C    . ASN B 1 15 ? -4.282  11.715  -52.616 1.00 0.00 ? 78  ASN B C    2 
ATOM 4540  O O    . ASN B 1 15 ? -3.237  11.655  -51.968 1.00 0.00 ? 78  ASN B O    2 
ATOM 4541  C CB   . ASN B 1 15 ? -3.341  13.156  -54.428 1.00 0.00 ? 78  ASN B CB   2 
ATOM 4542  C CG   . ASN B 1 15 ? -2.958  11.970  -55.270 1.00 0.00 ? 78  ASN B CG   2 
ATOM 4543  O OD1  . ASN B 1 15 ? -3.088  10.820  -54.837 1.00 0.00 ? 78  ASN B OD1  2 
ATOM 4544  N ND2  . ASN B 1 15 ? -2.483  12.229  -56.460 1.00 0.00 ? 78  ASN B ND2  2 
ATOM 4545  H H    . ASN B 1 15 ? -4.349  14.377  -52.026 1.00 0.00 ? 78  ASN B H    2 
ATOM 4546  H HA   . ASN B 1 15 ? -5.373  12.591  -54.213 1.00 0.00 ? 78  ASN B HA   2 
ATOM 4547  H HB2  . ASN B 1 15 ? -3.529  14.014  -55.069 1.00 0.00 ? 78  ASN B HB2  2 
ATOM 4548  H HB3  . ASN B 1 15 ? -2.510  13.366  -53.783 1.00 0.00 ? 78  ASN B HB3  2 
ATOM 4549  H HD21 . ASN B 1 15 ? -2.373  13.193  -56.779 1.00 0.00 ? 78  ASN B HD21 2 
ATOM 4550  H HD22 . ASN B 1 15 ? -2.218  11.457  -57.073 1.00 0.00 ? 78  ASN B HD22 2 
ATOM 4551  N N    . LEU B 1 16 ? -5.232  10.787  -52.545 1.00 0.00 ? 79  LEU B N    2 
ATOM 4552  C CA   . LEU B 1 16 ? -5.070  9.584   -51.738 1.00 0.00 ? 79  LEU B CA   2 
ATOM 4553  C C    . LEU B 1 16 ? -5.060  8.335   -52.607 1.00 0.00 ? 79  LEU B C    2 
ATOM 4554  O O    . LEU B 1 16 ? -5.647  8.314   -53.689 1.00 0.00 ? 79  LEU B O    2 
ATOM 4555  C CB   . LEU B 1 16 ? -6.197  9.487   -50.702 1.00 0.00 ? 79  LEU B CB   2 
ATOM 4556  C CG   . LEU B 1 16 ? -6.321  10.672  -49.737 1.00 0.00 ? 79  LEU B CG   2 
ATOM 4557  C CD1  . LEU B 1 16 ? -7.545  10.481  -48.852 1.00 0.00 ? 79  LEU B CD1  2 
ATOM 4558  C CD2  . LEU B 1 16 ? -5.054  10.783  -48.904 1.00 0.00 ? 79  LEU B CD2  2 
ATOM 4559  H H    . LEU B 1 16 ? -6.072  10.889  -53.115 1.00 0.00 ? 79  LEU B H    2 
ATOM 4560  H HA   . LEU B 1 16 ? -4.129  9.632   -51.214 1.00 0.00 ? 79  LEU B HA   2 
ATOM 4561  H HB2  . LEU B 1 16 ? -7.123  9.404   -51.225 1.00 0.00 ? 79  LEU B HB2  2 
ATOM 4562  H HB3  . LEU B 1 16 ? -6.045  8.582   -50.114 1.00 0.00 ? 79  LEU B HB3  2 
ATOM 4563  H HG   . LEU B 1 16 ? -6.445  11.559  -50.320 1.00 0.00 ? 79  LEU B HG   2 
ATOM 4564  H HD11 . LEU B 1 16 ? -8.447  10.526  -49.459 1.00 0.00 ? 79  LEU B HD11 2 
ATOM 4565  H HD12 . LEU B 1 16 ? -7.575  11.271  -48.102 1.00 0.00 ? 79  LEU B HD12 2 
ATOM 4566  H HD13 . LEU B 1 16 ? -7.485  9.514   -48.356 1.00 0.00 ? 79  LEU B HD13 2 
ATOM 4567  H HD21 . LEU B 1 16 ? -4.246  11.200  -49.506 1.00 0.00 ? 79  LEU B HD21 2 
ATOM 4568  H HD22 . LEU B 1 16 ? -4.768  9.799   -48.535 1.00 0.00 ? 79  LEU B HD22 2 
ATOM 4569  H HD23 . LEU B 1 16 ? -5.240  11.446  -48.055 1.00 0.00 ? 79  LEU B HD23 2 
ATOM 4570  N N    . ASP B 1 17 ? -4.386  7.293   -52.130 1.00 0.00 ? 80  ASP B N    2 
ATOM 4571  C CA   . ASP B 1 17 ? -4.276  6.045   -52.875 1.00 0.00 ? 80  ASP B CA   2 
ATOM 4572  C C    . ASP B 1 17 ? -5.229  4.991   -52.328 1.00 0.00 ? 80  ASP B C    2 
ATOM 4573  O O    . ASP B 1 17 ? -5.078  4.527   -51.200 1.00 0.00 ? 80  ASP B O    2 
ATOM 4574  C CB   . ASP B 1 17 ? -2.841  5.517   -52.825 1.00 0.00 ? 80  ASP B CB   2 
ATOM 4575  C CG   . ASP B 1 17 ? -2.655  4.232   -53.624 1.00 0.00 ? 80  ASP B CG   2 
ATOM 4576  O OD1  . ASP B 1 17 ? -3.640  3.624   -53.969 1.00 0.00 ? 80  ASP B OD1  2 
ATOM 4577  O OD2  . ASP B 1 17 ? -1.530  3.874   -53.880 1.00 0.00 ? 80  ASP B OD2  2 
ATOM 4578  H H    . ASP B 1 17 ? -3.915  7.373   -51.227 1.00 0.00 ? 80  ASP B H    2 
ATOM 4579  H HA   . ASP B 1 17 ? -4.532  6.225   -53.923 1.00 0.00 ? 80  ASP B HA   2 
ATOM 4580  H HB2  . ASP B 1 17 ? -2.184  6.269   -53.257 1.00 0.00 ? 80  ASP B HB2  2 
ATOM 4581  H HB3  . ASP B 1 17 ? -2.559  5.340   -51.786 1.00 0.00 ? 80  ASP B HB3  2 
ATOM 4582  N N    . VAL B 1 18 ? -6.217  4.617   -53.137 1.00 0.00 ? 81  VAL B N    2 
ATOM 4583  C CA   . VAL B 1 18 ? -7.165  3.577   -52.759 1.00 0.00 ? 81  VAL B CA   2 
ATOM 4584  C C    . VAL B 1 18 ? -7.349  2.563   -53.881 1.00 0.00 ? 81  VAL B C    2 
ATOM 4585  O O    . VAL B 1 18 ? -8.473  2.193   -54.218 1.00 0.00 ? 81  VAL B O    2 
ATOM 4586  C CB   . VAL B 1 18 ? -8.528  4.201   -52.407 1.00 0.00 ? 81  VAL B CB   2 
ATOM 4587  C CG1  . VAL B 1 18 ? -8.423  5.030   -51.134 1.00 0.00 ? 81  VAL B CG1  2 
ATOM 4588  C CG2  . VAL B 1 18 ? -9.025  5.050   -53.565 1.00 0.00 ? 81  VAL B CG2  2 
ATOM 4589  H H    . VAL B 1 18 ? -6.281  5.032   -54.067 1.00 0.00 ? 81  VAL B H    2 
ATOM 4590  H HA   . VAL B 1 18 ? -6.794  3.042   -51.881 1.00 0.00 ? 81  VAL B HA   2 
ATOM 4591  H HB   . VAL B 1 18 ? -9.243  3.394   -52.233 1.00 0.00 ? 81  VAL B HB   2 
ATOM 4592  H HG11 . VAL B 1 18 ? -9.318  5.641   -51.020 1.00 0.00 ? 81  VAL B HG11 2 
ATOM 4593  H HG12 . VAL B 1 18 ? -7.547  5.679   -51.202 1.00 0.00 ? 81  VAL B HG12 2 
ATOM 4594  H HG13 . VAL B 1 18 ? -8.321  4.372   -50.273 1.00 0.00 ? 81  VAL B HG13 2 
ATOM 4595  H HG21 . VAL B 1 18 ? -8.374  5.915   -53.673 1.00 0.00 ? 81  VAL B HG21 2 
ATOM 4596  H HG22 . VAL B 1 18 ? -10.045 5.371   -53.367 1.00 0.00 ? 81  VAL B HG22 2 
ATOM 4597  H HG23 . VAL B 1 18 ? -9.010  4.471   -54.487 1.00 0.00 ? 81  VAL B HG23 2 
ATOM 4598  N N    . LYS B 1 19 ? -6.237  2.119   -54.458 1.00 0.00 ? 82  LYS B N    2 
ATOM 4599  C CA   . LYS B 1 19 ? -6.272  1.126   -55.526 1.00 0.00 ? 82  LYS B CA   2 
ATOM 4600  C C    . LYS B 1 19 ? -6.463  -0.278  -54.965 1.00 0.00 ? 82  LYS B C    2 
ATOM 4601  O O    . LYS B 1 19 ? -5.858  -0.643  -53.957 1.00 0.00 ? 82  LYS B O    2 
ATOM 4602  C CB   . LYS B 1 19 ? -4.991  1.190   -56.358 1.00 0.00 ? 82  LYS B CB   2 
ATOM 4603  C CG   . LYS B 1 19 ? -5.043  0.394   -57.654 1.00 0.00 ? 82  LYS B CG   2 
ATOM 4604  C CD   . LYS B 1 19 ? -3.747  0.531   -58.440 1.00 0.00 ? 82  LYS B CD   2 
ATOM 4605  C CE   . LYS B 1 19 ? -3.825  -0.201  -59.771 1.00 0.00 ? 82  LYS B CE   2 
ATOM 4606  N NZ   . LYS B 1 19 ? -2.555  -0.096  -60.539 1.00 0.00 ? 82  LYS B NZ   2 
ATOM 4607  H H    . LYS B 1 19 ? -5.335  2.459   -54.125 1.00 0.00 ? 82  LYS B H    2 
ATOM 4608  H HA   . LYS B 1 19 ? -7.111  1.342   -56.178 1.00 0.00 ? 82  LYS B HA   2 
ATOM 4609  H HB2  . LYS B 1 19 ? -4.789  2.231   -56.603 1.00 0.00 ? 82  LYS B HB2  2 
ATOM 4610  H HB3  . LYS B 1 19 ? -4.169  0.807   -55.751 1.00 0.00 ? 82  LYS B HB3  2 
ATOM 4611  H HG2  . LYS B 1 19 ? -5.211  -0.657  -57.419 1.00 0.00 ? 82  LYS B HG2  2 
ATOM 4612  H HG3  . LYS B 1 19 ? -5.868  0.766   -58.263 1.00 0.00 ? 82  LYS B HG3  2 
ATOM 4613  H HD2  . LYS B 1 19 ? -3.551  1.587   -58.625 1.00 0.00 ? 82  LYS B HD2  2 
ATOM 4614  H HD3  . LYS B 1 19 ? -2.930  0.111   -57.853 1.00 0.00 ? 82  LYS B HD3  2 
ATOM 4615  H HE2  . LYS B 1 19 ? -4.039  -1.253  -59.584 1.00 0.00 ? 82  LYS B HE2  2 
ATOM 4616  H HE3  . LYS B 1 19 ? -4.634  0.228   -60.363 1.00 0.00 ? 82  LYS B HE3  2 
ATOM 4617  H HZ1  . LYS B 1 19 ? -2.100  0.812   -60.324 1.00 0.00 ? 82  LYS B HZ1  2 
ATOM 4618  H HZ2  . LYS B 1 19 ? -2.754  -0.150  -61.559 1.00 0.00 ? 82  LYS B HZ2  2 
ATOM 4619  H HZ3  . LYS B 1 19 ? -1.939  -0.852  -60.275 1.00 0.00 ? 82  LYS B HZ3  2 
ATOM 4620  N N    . HIS B 1 20 ? -7.309  -1.062  -55.625 1.00 0.00 ? 83  HIS B N    2 
ATOM 4621  C CA   . HIS B 1 20 ? -7.647  -2.398  -55.148 1.00 0.00 ? 83  HIS B CA   2 
ATOM 4622  C C    . HIS B 1 20 ? -8.544  -2.332  -53.916 1.00 0.00 ? 83  HIS B C    2 
ATOM 4623  O O    . HIS B 1 20 ? -8.451  -3.174  -53.024 1.00 0.00 ? 83  HIS B O    2 
ATOM 4624  C CB   . HIS B 1 20 ? -6.379  -3.193  -54.820 1.00 0.00 ? 83  HIS B CB   2 
ATOM 4625  C CG   . HIS B 1 20 ? -5.357  -3.174  -55.915 1.00 0.00 ? 83  HIS B CG   2 
ATOM 4626  N ND1  . HIS B 1 20 ? -5.604  -3.691  -57.170 1.00 0.00 ? 83  HIS B ND1  2 
ATOM 4627  C CD2  . HIS B 1 20 ? -4.090  -2.703  -55.943 1.00 0.00 ? 83  HIS B CD2  2 
ATOM 4628  C CE1  . HIS B 1 20 ? -4.529  -3.536  -57.924 1.00 0.00 ? 83  HIS B CE1  2 
ATOM 4629  N NE2  . HIS B 1 20 ? -3.597  -2.941  -57.203 1.00 0.00 ? 83  HIS B NE2  2 
ATOM 4630  H H    . HIS B 1 20 ? -7.789  -0.694  -56.448 1.00 0.00 ? 83  HIS B H    2 
ATOM 4631  H HA   . HIS B 1 20 ? -8.189  -2.915  -55.940 1.00 0.00 ? 83  HIS B HA   2 
ATOM 4632  H HB2  . HIS B 1 20 ? -5.932  -2.831  -53.903 1.00 0.00 ? 83  HIS B HB2  2 
ATOM 4633  H HB3  . HIS B 1 20 ? -6.680  -4.228  -54.667 1.00 0.00 ? 83  HIS B HB3  2 
ATOM 4634  H HD2  . HIS B 1 20 ? -3.505  -2.430  -55.077 1.00 0.00 ? 83  HIS B HD2  2 
ATOM 4635  H HE1  . HIS B 1 20 ? -4.432  -3.848  -58.954 1.00 0.00 ? 83  HIS B HE1  2 
ATOM 4636  H HE2  . HIS B 1 20 ? -2.671  -2.699  -57.526 1.00 0.00 ? 83  HIS B HE2  2 
ATOM 4637  N N    . PHE B 1 21 ? -9.410  -1.326  -53.875 1.00 0.00 ? 84  PHE B N    2 
ATOM 4638  C CA   . PHE B 1 21 ? -10.428 -1.233  -52.836 1.00 0.00 ? 84  PHE B CA   2 
ATOM 4639  C C    . PHE B 1 21 ? -11.826 -1.163  -53.436 1.00 0.00 ? 84  PHE B C    2 
ATOM 4640  O O    . PHE B 1 21 ? -12.024 -0.586  -54.506 1.00 0.00 ? 84  PHE B O    2 
ATOM 4641  C CB   . PHE B 1 21 ? -10.183 -0.004  -51.959 1.00 0.00 ? 84  PHE B CB   2 
ATOM 4642  C CG   . PHE B 1 21 ? -8.945  -0.100  -51.111 1.00 0.00 ? 84  PHE B CG   2 
ATOM 4643  C CD1  . PHE B 1 21 ? -7.694  0.133   -51.662 1.00 0.00 ? 84  PHE B CD1  2 
ATOM 4644  C CD2  . PHE B 1 21 ? -9.030  -0.424  -49.767 1.00 0.00 ? 84  PHE B CD2  2 
ATOM 4645  C CE1  . PHE B 1 21 ? -6.555  0.045   -50.885 1.00 0.00 ? 84  PHE B CE1  2 
ATOM 4646  C CE2  . PHE B 1 21 ? -7.893  -0.512  -48.989 1.00 0.00 ? 84  PHE B CE2  2 
ATOM 4647  C CZ   . PHE B 1 21 ? -6.655  -0.277  -49.548 1.00 0.00 ? 84  PHE B CZ   2 
ATOM 4648  H H    . PHE B 1 21 ? -9.452  -0.674  -54.660 1.00 0.00 ? 84  PHE B H    2 
ATOM 4649  H HA   . PHE B 1 21 ? -10.379 -2.114  -52.192 1.00 0.00 ? 84  PHE B HA   2 
ATOM 4650  H HB2  . PHE B 1 21 ? -10.062 0.849   -52.615 1.00 0.00 ? 84  PHE B HB2  2 
ATOM 4651  H HB3  . PHE B 1 21 ? -11.032 0.149   -51.326 1.00 0.00 ? 84  PHE B HB3  2 
ATOM 4652  H HD1  . PHE B 1 21 ? -7.617  0.366   -52.701 1.00 0.00 ? 84  PHE B HD1  2 
ATOM 4653  H HD2  . PHE B 1 21 ? -9.998  -0.609  -49.323 1.00 0.00 ? 84  PHE B HD2  2 
ATOM 4654  H HE1  . PHE B 1 21 ? -5.587  0.231   -51.328 1.00 0.00 ? 84  PHE B HE1  2 
ATOM 4655  H HE2  . PHE B 1 21 ? -7.973  -0.760  -47.941 1.00 0.00 ? 84  PHE B HE2  2 
ATOM 4656  H HZ   . PHE B 1 21 ? -5.855  0.048   -48.920 1.00 0.00 ? 84  PHE B HZ   2 
ATOM 4657  N N    . SER B 1 22 ? -12.791 -1.758  -52.745 1.00 0.00 ? 85  SER B N    2 
ATOM 4658  C CA   . SER B 1 22 ? -14.180 -1.730  -53.189 1.00 0.00 ? 85  SER B CA   2 
ATOM 4659  C C    . SER B 1 22 ? -15.033 -0.853  -52.280 1.00 0.00 ? 85  SER B C    2 
ATOM 4660  O O    . SER B 1 22 ? -14.743 -0.707  -51.092 1.00 0.00 ? 85  SER B O    2 
ATOM 4661  C CB   . SER B 1 22 ? -14.746 -3.137  -53.223 1.00 0.00 ? 85  SER B CB   2 
ATOM 4662  O OG   . SER B 1 22 ? -14.104 -3.912  -54.200 1.00 0.00 ? 85  SER B OG   2 
ATOM 4663  H H    . SER B 1 22 ? -12.565 -2.215  -51.863 1.00 0.00 ? 85  SER B H    2 
ATOM 4664  H HA   . SER B 1 22 ? -14.189 -1.356  -54.199 1.00 0.00 ? 85  SER B HA   2 
ATOM 4665  H HB2  . SER B 1 22 ? -14.600 -3.607  -52.254 1.00 0.00 ? 85  SER B HB2  2 
ATOM 4666  H HB3  . SER B 1 22 ? -15.817 -3.083  -53.437 1.00 0.00 ? 85  SER B HB3  2 
ATOM 4667  H HG   . SER B 1 22 ? -14.780 -4.340  -54.732 1.00 0.00 ? 85  SER B HG   2 
ATOM 4668  N N    . PRO B 1 23 ? -16.085 -0.270  -52.844 1.00 0.00 ? 86  PRO B N    2 
ATOM 4669  C CA   . PRO B 1 23 ? -16.992 0.579   -52.082 1.00 0.00 ? 86  PRO B CA   2 
ATOM 4670  C C    . PRO B 1 23 ? -17.550 -0.158  -50.872 1.00 0.00 ? 86  PRO B C    2 
ATOM 4671  O O    . PRO B 1 23 ? -17.920 0.458   -49.873 1.00 0.00 ? 86  PRO B O    2 
ATOM 4672  C CB   . PRO B 1 23 ? -18.088 0.911   -53.097 1.00 0.00 ? 86  PRO B CB   2 
ATOM 4673  C CG   . PRO B 1 23 ? -17.404 0.824   -54.419 1.00 0.00 ? 86  PRO B CG   2 
ATOM 4674  C CD   . PRO B 1 23 ? -16.453 -0.333  -54.273 1.00 0.00 ? 86  PRO B CD   2 
ATOM 4675  H HA   . PRO B 1 23 ? -16.488 1.493   -51.771 1.00 0.00 ? 86  PRO B HA   2 
ATOM 4676  H HB2  . PRO B 1 23 ? -18.904 0.183   -53.038 1.00 0.00 ? 86  PRO B HB2  2 
ATOM 4677  H HB3  . PRO B 1 23 ? -18.471 1.921   -52.936 1.00 0.00 ? 86  PRO B HB3  2 
ATOM 4678  H HG2  . PRO B 1 23 ? -18.134 0.630   -55.211 1.00 0.00 ? 86  PRO B HG2  2 
ATOM 4679  H HG3  . PRO B 1 23 ? -16.852 1.743   -54.626 1.00 0.00 ? 86  PRO B HG3  2 
ATOM 4680  H HD2  . PRO B 1 23 ? -16.951 -1.279  -54.505 1.00 0.00 ? 86  PRO B HD2  2 
ATOM 4681  H HD3  . PRO B 1 23 ? -15.598 -0.173  -54.916 1.00 0.00 ? 86  PRO B HD3  2 
ATOM 4682  N N    . GLU B 1 24 ? -17.607 -1.483  -50.967 1.00 0.00 ? 87  GLU B N    2 
ATOM 4683  C CA   . GLU B 1 24 ? -18.125 -2.306  -49.881 1.00 0.00 ? 87  GLU B CA   2 
ATOM 4684  C C    . GLU B 1 24 ? -17.215 -2.246  -48.660 1.00 0.00 ? 87  GLU B C    2 
ATOM 4685  O O    . GLU B 1 24 ? -17.664 -2.437  -47.530 1.00 0.00 ? 87  GLU B O    2 
ATOM 4686  C CB   . GLU B 1 24 ? -18.279 -3.759  -50.341 1.00 0.00 ? 87  GLU B CB   2 
ATOM 4687  C CG   . GLU B 1 24 ? -19.362 -3.973  -51.388 1.00 0.00 ? 87  GLU B CG   2 
ATOM 4688  C CD   . GLU B 1 24 ? -19.464 -5.404  -51.839 1.00 0.00 ? 87  GLU B CD   2 
ATOM 4689  O OE1  . GLU B 1 24 ? -18.636 -6.191  -51.447 1.00 0.00 ? 87  GLU B OE1  2 
ATOM 4690  O OE2  . GLU B 1 24 ? -20.368 -5.711  -52.579 1.00 0.00 ? 87  GLU B OE2  2 
ATOM 4691  H H    . GLU B 1 24 ? -17.285 -1.932  -51.825 1.00 0.00 ? 87  GLU B H    2 
ATOM 4692  H HA   . GLU B 1 24 ? -19.110 -1.933  -49.602 1.00 0.00 ? 87  GLU B HA   2 
ATOM 4693  H HB2  . GLU B 1 24 ? -17.329 -4.089  -50.763 1.00 0.00 ? 87  GLU B HB2  2 
ATOM 4694  H HB3  . GLU B 1 24 ? -18.515 -4.376  -49.474 1.00 0.00 ? 87  GLU B HB3  2 
ATOM 4695  H HG2  . GLU B 1 24 ? -20.318 -3.671  -50.962 1.00 0.00 ? 87  GLU B HG2  2 
ATOM 4696  H HG3  . GLU B 1 24 ? -19.140 -3.345  -52.250 1.00 0.00 ? 87  GLU B HG3  2 
ATOM 4697  N N    . GLU B 1 25 ? -15.935 -1.977  -48.894 1.00 0.00 ? 88  GLU B N    2 
ATOM 4698  C CA   . GLU B 1 25 ? -14.956 -1.912  -47.815 1.00 0.00 ? 88  GLU B CA   2 
ATOM 4699  C C    . GLU B 1 25 ? -14.273 -0.552  -47.774 1.00 0.00 ? 88  GLU B C    2 
ATOM 4700  O O    . GLU B 1 25 ? -13.514 -0.257  -46.850 1.00 0.00 ? 88  GLU B O    2 
ATOM 4701  C CB   . GLU B 1 25 ? -13.909 -3.016  -47.980 1.00 0.00 ? 88  GLU B CB   2 
ATOM 4702  C CG   . GLU B 1 25 ? -14.467 -4.429  -47.898 1.00 0.00 ? 88  GLU B CG   2 
ATOM 4703  C CD   . GLU B 1 25 ? -15.048 -4.752  -46.551 1.00 0.00 ? 88  GLU B CD   2 
ATOM 4704  O OE1  . GLU B 1 25 ? -14.555 -4.242  -45.574 1.00 0.00 ? 88  GLU B OE1  2 
ATOM 4705  O OE2  . GLU B 1 25 ? -15.989 -5.511  -46.497 1.00 0.00 ? 88  GLU B OE2  2 
ATOM 4706  H H    . GLU B 1 25 ? -15.621 -1.834  -49.853 1.00 0.00 ? 88  GLU B H    2 
ATOM 4707  H HA   . GLU B 1 25 ? -15.451 -2.070  -46.855 1.00 0.00 ? 88  GLU B HA   2 
ATOM 4708  H HB2  . GLU B 1 25 ? -13.440 -2.883  -48.956 1.00 0.00 ? 88  GLU B HB2  2 
ATOM 4709  H HB3  . GLU B 1 25 ? -13.161 -2.902  -47.229 1.00 0.00 ? 88  GLU B HB3  2 
ATOM 4710  H HG2  . GLU B 1 25 ? -15.252 -4.533  -48.647 1.00 0.00 ? 88  GLU B HG2  2 
ATOM 4711  H HG3  . GLU B 1 25 ? -13.672 -5.142  -48.125 1.00 0.00 ? 88  GLU B HG3  2 
ATOM 4712  N N    . LEU B 1 26 ? -14.545 0.273   -48.779 1.00 0.00 ? 89  LEU B N    2 
ATOM 4713  C CA   . LEU B 1 26 ? -13.889 1.570   -48.907 1.00 0.00 ? 89  LEU B CA   2 
ATOM 4714  C C    . LEU B 1 26 ? -14.853 2.707   -48.592 1.00 0.00 ? 89  LEU B C    2 
ATOM 4715  O O    . LEU B 1 26 ? -15.851 2.895   -49.284 1.00 0.00 ? 89  LEU B O    2 
ATOM 4716  C CB   . LEU B 1 26 ? -13.328 1.742   -50.323 1.00 0.00 ? 89  LEU B CB   2 
ATOM 4717  C CG   . LEU B 1 26 ? -12.637 3.084   -50.605 1.00 0.00 ? 89  LEU B CG   2 
ATOM 4718  C CD1  . LEU B 1 26 ? -11.404 3.218   -49.722 1.00 0.00 ? 89  LEU B CD1  2 
ATOM 4719  C CD2  . LEU B 1 26 ? -12.266 3.163   -52.077 1.00 0.00 ? 89  LEU B CD2  2 
ATOM 4720  H H    . LEU B 1 26 ? -15.179 -0.037  -49.511 1.00 0.00 ? 89  LEU B H    2 
ATOM 4721  H HA   . LEU B 1 26 ? -13.065 1.624   -48.225 1.00 0.00 ? 89  LEU B HA   2 
ATOM 4722  H HB2  . LEU B 1 26 ? -12.638 0.950   -50.492 1.00 0.00 ? 89  LEU B HB2  2 
ATOM 4723  H HB3  . LEU B 1 26 ? -14.157 1.635   -51.025 1.00 0.00 ? 89  LEU B HB3  2 
ATOM 4724  H HG   . LEU B 1 26 ? -13.325 3.897   -50.366 1.00 0.00 ? 89  LEU B HG   2 
ATOM 4725  H HD11 . LEU B 1 26 ? -10.771 4.021   -50.093 1.00 0.00 ? 89  LEU B HD11 2 
ATOM 4726  H HD12 . LEU B 1 26 ? -10.847 2.281   -49.736 1.00 0.00 ? 89  LEU B HD12 2 
ATOM 4727  H HD13 . LEU B 1 26 ? -11.701 3.445   -48.698 1.00 0.00 ? 89  LEU B HD13 2 
ATOM 4728  H HD21 . LEU B 1 26 ? -13.165 3.352   -52.664 1.00 0.00 ? 89  LEU B HD21 2 
ATOM 4729  H HD22 . LEU B 1 26 ? -11.828 2.227   -52.397 1.00 0.00 ? 89  LEU B HD22 2 
ATOM 4730  H HD23 . LEU B 1 26 ? -11.559 3.971   -52.242 1.00 0.00 ? 89  LEU B HD23 2 
ATOM 4731  N N    . LYS B 1 27 ? -14.546 3.460   -47.543 1.00 0.00 ? 90  LYS B N    2 
ATOM 4732  C CA   . LYS B 1 27 ? -15.438 4.513   -47.068 1.00 0.00 ? 90  LYS B CA   2 
ATOM 4733  C C    . LYS B 1 27 ? -14.737 5.865   -47.055 1.00 0.00 ? 90  LYS B C    2 
ATOM 4734  O O    . LYS B 1 27 ? -13.535 5.949   -46.797 1.00 0.00 ? 90  LYS B O    2 
ATOM 4735  C CB   . LYS B 1 27 ? -15.965 4.180   -45.672 1.00 0.00 ? 90  LYS B CB   2 
ATOM 4736  C CG   . LYS B 1 27 ? -16.828 2.927   -45.607 1.00 0.00 ? 90  LYS B CG   2 
ATOM 4737  C CD   . LYS B 1 27 ? -17.305 2.657   -44.187 1.00 0.00 ? 90  LYS B CD   2 
ATOM 4738  C CE   . LYS B 1 27 ? -18.142 1.387   -44.116 1.00 0.00 ? 90  LYS B CE   2 
ATOM 4739  N NZ   . LYS B 1 27 ? -18.586 1.092   -42.727 1.00 0.00 ? 90  LYS B NZ   2 
ATOM 4740  H H    . LYS B 1 27 ? -13.709 3.244   -47.002 1.00 0.00 ? 90  LYS B H    2 
ATOM 4741  H HA   . LYS B 1 27 ? -16.301 4.592   -47.733 1.00 0.00 ? 90  LYS B HA   2 
ATOM 4742  H HB2  . LYS B 1 27 ? -15.111 4.041   -45.010 1.00 0.00 ? 90  LYS B HB2  2 
ATOM 4743  H HB3  . LYS B 1 27 ? -16.554 5.027   -45.312 1.00 0.00 ? 90  LYS B HB3  2 
ATOM 4744  H HG2  . LYS B 1 27 ? -17.694 3.057   -46.256 1.00 0.00 ? 90  LYS B HG2  2 
ATOM 4745  H HG3  . LYS B 1 27 ? -16.243 2.075   -45.953 1.00 0.00 ? 90  LYS B HG3  2 
ATOM 4746  H HD2  . LYS B 1 27 ? -16.439 2.551   -43.536 1.00 0.00 ? 90  LYS B HD2  2 
ATOM 4747  H HD3  . LYS B 1 27 ? -17.908 3.499   -43.849 1.00 0.00 ? 90  LYS B HD3  2 
ATOM 4748  H HE2  . LYS B 1 27 ? -19.019 1.506   -44.750 1.00 0.00 ? 90  LYS B HE2  2 
ATOM 4749  H HE3  . LYS B 1 27 ? -17.546 0.552   -44.483 1.00 0.00 ? 90  LYS B HE3  2 
ATOM 4750  H HZ1  . LYS B 1 27 ? -19.453 1.630   -42.519 1.00 0.00 ? 90  LYS B HZ1  2 
ATOM 4751  H HZ2  . LYS B 1 27 ? -17.837 1.371   -42.062 1.00 0.00 ? 90  LYS B HZ2  2 
ATOM 4752  H HZ3  . LYS B 1 27 ? -18.771 0.103   -42.633 1.00 0.00 ? 90  LYS B HZ3  2 
ATOM 4753  N N    . VAL B 1 28 ? -15.493 6.920   -47.334 1.00 0.00 ? 91  VAL B N    2 
ATOM 4754  C CA   . VAL B 1 28 ? -14.989 8.282   -47.197 1.00 0.00 ? 91  VAL B CA   2 
ATOM 4755  C C    . VAL B 1 28 ? -15.885 9.113   -46.289 1.00 0.00 ? 91  VAL B C    2 
ATOM 4756  O O    . VAL B 1 28 ? -17.014 9.444   -46.650 1.00 0.00 ? 91  VAL B O    2 
ATOM 4757  C CB   . VAL B 1 28 ? -14.893 8.958   -48.579 1.00 0.00 ? 91  VAL B CB   2 
ATOM 4758  C CG1  . VAL B 1 28 ? -14.371 10.379  -48.440 1.00 0.00 ? 91  VAL B CG1  2 
ATOM 4759  C CG2  . VAL B 1 28 ? -13.997 8.139   -49.495 1.00 0.00 ? 91  VAL B CG2  2 
ATOM 4760  H H    . VAL B 1 28 ? -16.488 6.781   -47.517 1.00 0.00 ? 91  VAL B H    2 
ATOM 4761  H HA   . VAL B 1 28 ? -13.984 8.267   -46.764 1.00 0.00 ? 91  VAL B HA   2 
ATOM 4762  H HB   . VAL B 1 28 ? -15.895 8.995   -49.010 1.00 0.00 ? 91  VAL B HB   2 
ATOM 4763  H HG11 . VAL B 1 28 ? -13.435 10.362  -47.903 1.00 0.00 ? 91  VAL B HG11 2 
ATOM 4764  H HG12 . VAL B 1 28 ? -15.089 10.997  -47.904 1.00 0.00 ? 91  VAL B HG12 2 
ATOM 4765  H HG13 . VAL B 1 28 ? -14.207 10.801  -49.432 1.00 0.00 ? 91  VAL B HG13 2 
ATOM 4766  H HG21 . VAL B 1 28 ? -12.967 8.220   -49.148 1.00 0.00 ? 91  VAL B HG21 2 
ATOM 4767  H HG22 . VAL B 1 28 ? -14.069 8.518   -50.513 1.00 0.00 ? 91  VAL B HG22 2 
ATOM 4768  H HG23 . VAL B 1 28 ? -14.306 7.094   -49.474 1.00 0.00 ? 91  VAL B HG23 2 
ATOM 4769  N N    . LYS B 1 29 ? -15.376 9.448   -45.109 1.00 0.00 ? 92  LYS B N    2 
ATOM 4770  C CA   . LYS B 1 29 ? -16.187 10.082  -44.077 1.00 0.00 ? 92  LYS B CA   2 
ATOM 4771  C C    . LYS B 1 29 ? -15.551 11.384  -43.600 1.00 0.00 ? 92  LYS B C    2 
ATOM 4772  O O    . LYS B 1 29 ? -14.329 11.513  -43.569 1.00 0.00 ? 92  LYS B O    2 
ATOM 4773  C CB   . LYS B 1 29 ? -16.389 9.134   -42.896 1.00 0.00 ? 92  LYS B CB   2 
ATOM 4774  C CG   . LYS B 1 29 ? -17.161 9.737   -41.728 1.00 0.00 ? 92  LYS B CG   2 
ATOM 4775  C CD   . LYS B 1 29 ? -17.390 8.712   -40.629 1.00 0.00 ? 92  LYS B CD   2 
ATOM 4776  C CE   . LYS B 1 29 ? -18.153 9.314   -39.458 1.00 0.00 ? 92  LYS B CE   2 
ATOM 4777  N NZ   . LYS B 1 29 ? -18.392 8.320   -38.377 1.00 0.00 ? 92  LYS B NZ   2 
ATOM 4778  H H    . LYS B 1 29 ? -14.438 9.125   -44.862 1.00 0.00 ? 92  LYS B H    2 
ATOM 4779  H HA   . LYS B 1 29 ? -17.173 10.323  -44.482 1.00 0.00 ? 92  LYS B HA   2 
ATOM 4780  H HB2  . LYS B 1 29 ? -16.938 8.262   -43.247 1.00 0.00 ? 92  LYS B HB2  2 
ATOM 4781  H HB3  . LYS B 1 29 ? -15.422 8.808   -42.535 1.00 0.00 ? 92  LYS B HB3  2 
ATOM 4782  H HG2  . LYS B 1 29 ? -16.593 10.574  -41.323 1.00 0.00 ? 92  LYS B HG2  2 
ATOM 4783  H HG3  . LYS B 1 29 ? -18.128 10.094  -42.087 1.00 0.00 ? 92  LYS B HG3  2 
ATOM 4784  H HD2  . LYS B 1 29 ? -17.957 7.875   -41.034 1.00 0.00 ? 92  LYS B HD2  2 
ATOM 4785  H HD3  . LYS B 1 29 ? -16.424 8.353   -40.273 1.00 0.00 ? 92  LYS B HD3  2 
ATOM 4786  H HE2  . LYS B 1 29 ? -17.590 10.154  -39.073 1.00 0.00 ? 92  LYS B HE2  2 
ATOM 4787  H HE3  . LYS B 1 29 ? -19.116 9.673   -39.823 1.00 0.00 ? 92  LYS B HE3  2 
ATOM 4788  H HZ1  . LYS B 1 29 ? -18.094 8.720   -37.466 1.00 0.00 ? 92  LYS B HZ1  2 
ATOM 4789  H HZ2  . LYS B 1 29 ? -17.840 7.459   -38.577 1.00 0.00 ? 92  LYS B HZ2  2 
ATOM 4790  H HZ3  . LYS B 1 29 ? -19.375 8.090   -38.341 1.00 0.00 ? 92  LYS B HZ3  2 
ATOM 4791  N N    . VAL B 1 30 ? -16.391 12.344  -43.230 1.00 0.00 ? 93  VAL B N    2 
ATOM 4792  C CA   . VAL B 1 30 ? -15.939 13.511  -42.482 1.00 0.00 ? 93  VAL B CA   2 
ATOM 4793  C C    . VAL B 1 30 ? -16.490 13.502  -41.062 1.00 0.00 ? 93  VAL B C    2 
ATOM 4794  O O    . VAL B 1 30 ? -17.700 13.579  -40.852 1.00 0.00 ? 93  VAL B O    2 
ATOM 4795  C CB   . VAL B 1 30 ? -16.379 14.805  -43.192 1.00 0.00 ? 93  VAL B CB   2 
ATOM 4796  C CG1  . VAL B 1 30 ? -15.907 16.026  -42.416 1.00 0.00 ? 93  VAL B CG1  2 
ATOM 4797  C CG2  . VAL B 1 30 ? -15.835 14.826  -44.612 1.00 0.00 ? 93  VAL B CG2  2 
ATOM 4798  H H    . VAL B 1 30 ? -17.391 12.142  -43.250 1.00 0.00 ? 93  VAL B H    2 
ATOM 4799  H HA   . VAL B 1 30 ? -14.875 13.502  -42.429 1.00 0.00 ? 93  VAL B HA   2 
ATOM 4800  H HB   . VAL B 1 30 ? -17.469 14.821  -43.235 1.00 0.00 ? 93  VAL B HB   2 
ATOM 4801  H HG11 . VAL B 1 30 ? -16.023 16.917  -43.026 1.00 0.00 ? 93  VAL B HG11 2 
ATOM 4802  H HG12 . VAL B 1 30 ? -14.856 15.895  -42.159 1.00 0.00 ? 93  VAL B HG12 2 
ATOM 4803  H HG13 . VAL B 1 30 ? -16.493 16.131  -41.504 1.00 0.00 ? 93  VAL B HG13 2 
ATOM 4804  H HG21 . VAL B 1 30 ? -16.044 15.766  -45.086 1.00 0.00 ? 93  VAL B HG21 2 
ATOM 4805  H HG22 . VAL B 1 30 ? -16.298 14.025  -45.188 1.00 0.00 ? 93  VAL B HG22 2 
ATOM 4806  H HG23 . VAL B 1 30 ? -14.760 14.667  -44.580 1.00 0.00 ? 93  VAL B HG23 2 
ATOM 4807  N N    . LEU B 1 31 ? -15.592 13.410  -40.085 1.00 0.00 ? 94  LEU B N    2 
ATOM 4808  C CA   . LEU B 1 31 ? -15.990 13.226  -38.694 1.00 0.00 ? 94  LEU B CA   2 
ATOM 4809  C C    . LEU B 1 31 ? -15.807 14.511  -37.895 1.00 0.00 ? 94  LEU B C    2 
ATOM 4810  O O    . LEU B 1 31 ? -14.943 14.592  -37.023 1.00 0.00 ? 94  LEU B O    2 
ATOM 4811  C CB   . LEU B 1 31 ? -15.173 12.099  -38.054 1.00 0.00 ? 94  LEU B CB   2 
ATOM 4812  C CG   . LEU B 1 31 ? -15.449 11.839  -36.566 1.00 0.00 ? 94  LEU B CG   2 
ATOM 4813  C CD1  . LEU B 1 31 ? -16.893 11.392  -36.388 1.00 0.00 ? 94  LEU B CD1  2 
ATOM 4814  C CD2  . LEU B 1 31 ? -14.483 10.784  -36.047 1.00 0.00 ? 94  LEU B CD2  2 
ATOM 4815  H H    . LEU B 1 31 ? -14.605 13.328  -40.329 1.00 0.00 ? 94  LEU B H    2 
ATOM 4816  H HA   . LEU B 1 31 ? -17.040 12.955  -38.662 1.00 0.00 ? 94  LEU B HA   2 
ATOM 4817  H HB2  . LEU B 1 31 ? -15.422 11.184  -38.589 1.00 0.00 ? 94  LEU B HB2  2 
ATOM 4818  H HB3  . LEU B 1 31 ? -14.122 12.287  -38.192 1.00 0.00 ? 94  LEU B HB3  2 
ATOM 4819  H HG   . LEU B 1 31 ? -15.298 12.748  -35.999 1.00 0.00 ? 94  LEU B HG   2 
ATOM 4820  H HD11 . LEU B 1 31 ? -17.587 12.167  -36.695 1.00 0.00 ? 94  LEU B HD11 2 
ATOM 4821  H HD12 . LEU B 1 31 ? -17.054 11.175  -35.331 1.00 0.00 ? 94  LEU B HD12 2 
ATOM 4822  H HD13 . LEU B 1 31 ? -17.066 10.492  -36.961 1.00 0.00 ? 94  LEU B HD13 2 
ATOM 4823  H HD21 . LEU B 1 31 ? -14.484 9.928   -36.726 1.00 0.00 ? 94  LEU B HD21 2 
ATOM 4824  H HD22 . LEU B 1 31 ? -14.796 10.461  -35.055 1.00 0.00 ? 94  LEU B HD22 2 
ATOM 4825  H HD23 . LEU B 1 31 ? -13.488 11.202  -35.992 1.00 0.00 ? 94  LEU B HD23 2 
ATOM 4826  N N    . GLY B 1 32 ? -16.625 15.513  -38.199 1.00 0.00 ? 95  GLY B N    2 
ATOM 4827  C CA   . GLY B 1 32 ? -16.656 16.741  -37.416 1.00 0.00 ? 95  GLY B CA   2 
ATOM 4828  C C    . GLY B 1 32 ? -15.500 17.660  -37.787 1.00 0.00 ? 95  GLY B C    2 
ATOM 4829  O O    . GLY B 1 32 ? -15.515 18.302  -38.836 1.00 0.00 ? 95  GLY B O    2 
ATOM 4830  H H    . GLY B 1 32 ? -17.337 15.367  -38.917 1.00 0.00 ? 95  GLY B H    2 
ATOM 4831  H HA2  . GLY B 1 32 ? -17.593 17.266  -37.602 1.00 0.00 ? 95  GLY B HA2  2 
ATOM 4832  H HA3  . GLY B 1 32 ? -16.592 16.507  -36.352 1.00 0.00 ? 95  GLY B HA3  2 
ATOM 4833  N N    . ASP B 1 33 ? -14.494 17.718  -36.918 1.00 0.00 ? 96  ASP B N    2 
ATOM 4834  C CA   . ASP B 1 33 ? -13.343 18.585  -37.135 1.00 0.00 ? 96  ASP B CA   2 
ATOM 4835  C C    . ASP B 1 33 ? -12.267 17.877  -37.946 1.00 0.00 ? 96  ASP B C    2 
ATOM 4836  O O    . ASP B 1 33 ? -11.264 18.483  -38.327 1.00 0.00 ? 96  ASP B O    2 
ATOM 4837  C CB   . ASP B 1 33 ? -12.761 19.050  -35.798 1.00 0.00 ? 96  ASP B CB   2 
ATOM 4838  C CG   . ASP B 1 33 ? -13.697 19.977  -35.035 1.00 0.00 ? 96  ASP B CG   2 
ATOM 4839  O OD1  . ASP B 1 33 ? -14.502 20.625  -35.661 1.00 0.00 ? 96  ASP B OD1  2 
ATOM 4840  O OD2  . ASP B 1 33 ? -13.598 20.032  -33.832 1.00 0.00 ? 96  ASP B OD2  2 
ATOM 4841  H H    . ASP B 1 33 ? -14.547 17.166  -36.062 1.00 0.00 ? 96  ASP B H    2 
ATOM 4842  H HA   . ASP B 1 33 ? -13.663 19.472  -37.685 1.00 0.00 ? 96  ASP B HA   2 
ATOM 4843  H HB2  . ASP B 1 33 ? -12.561 18.174  -35.183 1.00 0.00 ? 96  ASP B HB2  2 
ATOM 4844  H HB3  . ASP B 1 33 ? -11.820 19.573  -35.982 1.00 0.00 ? 96  ASP B HB3  2 
ATOM 4845  N N    . VAL B 1 34 ? -12.478 16.592  -38.209 1.00 0.00 ? 97  VAL B N    2 
ATOM 4846  C CA   . VAL B 1 34 ? -11.538 15.808  -38.998 1.00 0.00 ? 97  VAL B CA   2 
ATOM 4847  C C    . VAL B 1 34 ? -12.221 15.186  -40.210 1.00 0.00 ? 97  VAL B C    2 
ATOM 4848  O O    . VAL B 1 34 ? -13.448 15.132  -40.285 1.00 0.00 ? 97  VAL B O    2 
ATOM 4849  C CB   . VAL B 1 34 ? -10.917 14.693  -38.134 1.00 0.00 ? 97  VAL B CB   2 
ATOM 4850  C CG1  . VAL B 1 34 ? -10.105 15.292  -36.996 1.00 0.00 ? 97  VAL B CG1  2 
ATOM 4851  C CG2  . VAL B 1 34 ? -12.009 13.783  -37.597 1.00 0.00 ? 97  VAL B CG2  2 
ATOM 4852  H H    . VAL B 1 34 ? -13.332 16.148  -37.871 1.00 0.00 ? 97  VAL B H    2 
ATOM 4853  H HA   . VAL B 1 34 ? -10.751 16.438  -39.366 1.00 0.00 ? 97  VAL B HA   2 
ATOM 4854  H HB   . VAL B 1 34 ? -10.246 14.128  -38.782 1.00 0.00 ? 97  VAL B HB   2 
ATOM 4855  H HG11 . VAL B 1 34 ? -9.239  15.757  -37.415 1.00 0.00 ? 97  VAL B HG11 2 
ATOM 4856  H HG12 . VAL B 1 34 ? -9.797  14.507  -36.304 1.00 0.00 ? 97  VAL B HG12 2 
ATOM 4857  H HG13 . VAL B 1 34 ? -10.704 16.036  -36.471 1.00 0.00 ? 97  VAL B HG13 2 
ATOM 4858  H HG21 . VAL B 1 34 ? -12.972 14.151  -37.917 1.00 0.00 ? 97  VAL B HG21 2 
ATOM 4859  H HG22 . VAL B 1 34 ? -11.990 13.749  -36.506 1.00 0.00 ? 97  VAL B HG22 2 
ATOM 4860  H HG23 . VAL B 1 34 ? -11.871 12.771  -37.985 1.00 0.00 ? 97  VAL B HG23 2 
ATOM 4861  N N    . ILE B 1 35 ? -11.417 14.715  -41.158 1.00 0.00 ? 98  ILE B N    2 
ATOM 4862  C CA   . ILE B 1 35 ? -11.939 14.010  -42.322 1.00 0.00 ? 98  ILE B CA   2 
ATOM 4863  C C    . ILE B 1 35 ? -11.507 12.549  -42.320 1.00 0.00 ? 98  ILE B C    2 
ATOM 4864  O O    . ILE B 1 35 ? -10.408 12.216  -42.763 1.00 0.00 ? 98  ILE B O    2 
ATOM 4865  C CB   . ILE B 1 35 ? -11.472 14.683  -43.627 1.00 0.00 ? 98  ILE B CB   2 
ATOM 4866  C CG1  . ILE B 1 35 ? -11.982 16.123  -43.697 1.00 0.00 ? 98  ILE B CG1  2 
ATOM 4867  C CG2  . ILE B 1 35 ? -11.943 13.888  -44.833 1.00 0.00 ? 98  ILE B CG2  2 
ATOM 4868  C CD1  . ILE B 1 35 ? -11.389 16.927  -44.832 1.00 0.00 ? 98  ILE B CD1  2 
ATOM 4869  H H    . ILE B 1 35 ? -10.409 14.776  -41.029 1.00 0.00 ? 98  ILE B H    2 
ATOM 4870  H HA   . ILE B 1 35 ? -13.005 14.049  -42.307 1.00 0.00 ? 98  ILE B HA   2 
ATOM 4871  H HB   . ILE B 1 35 ? -10.383 14.711  -43.621 1.00 0.00 ? 98  ILE B HB   2 
ATOM 4872  H HG12 . ILE B 1 35 ? -13.063 16.089  -43.818 1.00 0.00 ? 98  ILE B HG12 2 
ATOM 4873  H HG13 . ILE B 1 35 ? -11.755 16.616  -42.751 1.00 0.00 ? 98  ILE B HG13 2 
ATOM 4874  H HG21 . ILE B 1 35 ? -11.088 13.448  -45.349 1.00 0.00 ? 98  ILE B HG21 2 
ATOM 4875  H HG22 . ILE B 1 35 ? -12.477 14.535  -45.533 1.00 0.00 ? 98  ILE B HG22 2 
ATOM 4876  H HG23 . ILE B 1 35 ? -12.622 13.088  -44.533 1.00 0.00 ? 98  ILE B HG23 2 
ATOM 4877  H HD11 . ILE B 1 35 ? -11.026 16.263  -45.616 1.00 0.00 ? 98  ILE B HD11 2 
ATOM 4878  H HD12 . ILE B 1 35 ? -12.154 17.586  -45.243 1.00 0.00 ? 98  ILE B HD12 2 
ATOM 4879  H HD13 . ILE B 1 35 ? -10.561 17.527  -44.454 1.00 0.00 ? 98  ILE B HD13 2 
ATOM 4880  N N    . GLU B 1 36 ? -12.380 11.681  -41.823 1.00 0.00 ? 99  GLU B N    2 
ATOM 4881  C CA   . GLU B 1 36 ? -12.033 10.279  -41.611 1.00 0.00 ? 99  GLU B CA   2 
ATOM 4882  C C    . GLU B 1 36 ? -12.193 9.472   -42.894 1.00 0.00 ? 99  GLU B C    2 
ATOM 4883  O O    . GLU B 1 36 ? -13.263 8.930   -43.167 1.00 0.00 ? 99  GLU B O    2 
ATOM 4884  C CB   . GLU B 1 36 ? -12.899 9.676   -40.504 1.00 0.00 ? 99  GLU B CB   2 
ATOM 4885  C CG   . GLU B 1 36 ? -12.535 8.246   -40.130 1.00 0.00 ? 99  GLU B CG   2 
ATOM 4886  C CD   . GLU B 1 36 ? -13.426 7.676   -39.062 1.00 0.00 ? 99  GLU B CD   2 
ATOM 4887  O OE1  . GLU B 1 36 ? -14.367 8.332   -38.687 1.00 0.00 ? 99  GLU B OE1  2 
ATOM 4888  O OE2  . GLU B 1 36 ? -13.166 6.581   -38.621 1.00 0.00 ? 99  GLU B OE2  2 
ATOM 4889  H H    . GLU B 1 36 ? -13.266 12.028  -41.457 1.00 0.00 ? 99  GLU B H    2 
ATOM 4890  H HA   . GLU B 1 36 ? -10.998 10.195  -41.296 1.00 0.00 ? 99  GLU B HA   2 
ATOM 4891  H HB2  . GLU B 1 36 ? -12.857 10.308  -39.628 1.00 0.00 ? 99  GLU B HB2  2 
ATOM 4892  H HB3  . GLU B 1 36 ? -13.929 9.655   -40.863 1.00 0.00 ? 99  GLU B HB3  2 
ATOM 4893  H HG2  . GLU B 1 36 ? -12.598 7.618   -41.018 1.00 0.00 ? 99  GLU B HG2  2 
ATOM 4894  H HG3  . GLU B 1 36 ? -11.506 8.247   -39.767 1.00 0.00 ? 99  GLU B HG3  2 
ATOM 4895  N N    . VAL B 1 37 ? -11.123 9.398   -43.677 1.00 0.00 ? 100 VAL B N    2 
ATOM 4896  C CA   . VAL B 1 37 ? -11.078 8.505   -44.829 1.00 0.00 ? 100 VAL B CA   2 
ATOM 4897  C C    . VAL B 1 37 ? -10.556 7.129   -44.442 1.00 0.00 ? 100 VAL B C    2 
ATOM 4898  O O    . VAL B 1 37 ? -9.435  6.994   -43.953 1.00 0.00 ? 100 VAL B O    2 
ATOM 4899  C CB   . VAL B 1 37 ? -10.181 9.100   -45.932 1.00 0.00 ? 100 VAL B CB   2 
ATOM 4900  C CG1  . VAL B 1 37 ? -10.092 8.151   -47.116 1.00 0.00 ? 100 VAL B CG1  2 
ATOM 4901  C CG2  . VAL B 1 37 ? -10.721 10.455  -46.364 1.00 0.00 ? 100 VAL B CG2  2 
ATOM 4902  H H    . VAL B 1 37 ? -10.261 9.846   -43.370 1.00 0.00 ? 100 VAL B H    2 
ATOM 4903  H HA   . VAL B 1 37 ? -12.087 8.398   -45.231 1.00 0.00 ? 100 VAL B HA   2 
ATOM 4904  H HB   . VAL B 1 37 ? -9.203  9.224   -45.546 1.00 0.00 ? 100 VAL B HB   2 
ATOM 4905  H HG11 . VAL B 1 37 ? -11.097 7.838   -47.398 1.00 0.00 ? 100 VAL B HG11 2 
ATOM 4906  H HG12 . VAL B 1 37 ? -9.504  7.275   -46.843 1.00 0.00 ? 100 VAL B HG12 2 
ATOM 4907  H HG13 . VAL B 1 37 ? -9.620  8.646   -47.962 1.00 0.00 ? 100 VAL B HG13 2 
ATOM 4908  H HG21 . VAL B 1 37 ? -10.395 11.209  -45.647 1.00 0.00 ? 100 VAL B HG21 2 
ATOM 4909  H HG22 . VAL B 1 37 ? -11.803 10.435  -46.383 1.00 0.00 ? 100 VAL B HG22 2 
ATOM 4910  H HG23 . VAL B 1 37 ? -10.343 10.722  -47.352 1.00 0.00 ? 100 VAL B HG23 2 
ATOM 4911  N N    . HIS B 1 38 ? -11.376 6.107   -44.662 1.00 0.00 ? 101 HIS B N    2 
ATOM 4912  C CA   . HIS B 1 38 ? -11.146 4.796   -44.064 1.00 0.00 ? 101 HIS B CA   2 
ATOM 4913  C C    . HIS B 1 38 ? -11.539 3.677   -45.020 1.00 0.00 ? 101 HIS B C    2 
ATOM 4914  O O    . HIS B 1 38 ? -12.633 3.688   -45.586 1.00 0.00 ? 101 HIS B O    2 
ATOM 4915  C CB   . HIS B 1 38 ? -11.928 4.656   -42.754 1.00 0.00 ? 101 HIS B CB   2 
ATOM 4916  C CG   . HIS B 1 38 ? -13.342 5.139   -42.841 1.00 0.00 ? 101 HIS B CG   2 
ATOM 4917  N ND1  . HIS B 1 38 ? -14.364 4.588   -42.096 1.00 0.00 ? 101 HIS B ND1  2 
ATOM 4918  C CD2  . HIS B 1 38 ? -13.904 6.120   -43.585 1.00 0.00 ? 101 HIS B CD2  2 
ATOM 4919  C CE1  . HIS B 1 38 ? -15.494 5.211   -42.378 1.00 0.00 ? 101 HIS B CE1  2 
ATOM 4920  N NE2  . HIS B 1 38 ? -15.243 6.144   -43.279 1.00 0.00 ? 101 HIS B NE2  2 
ATOM 4921  H H    . HIS B 1 38 ? -12.295 6.299   -45.049 1.00 0.00 ? 101 HIS B H    2 
ATOM 4922  H HA   . HIS B 1 38 ? -10.085 4.698   -43.858 1.00 0.00 ? 101 HIS B HA   2 
ATOM 4923  H HB2  . HIS B 1 38 ? -11.940 3.611   -42.450 1.00 0.00 ? 101 HIS B HB2  2 
ATOM 4924  H HB3  . HIS B 1 38 ? -11.426 5.233   -41.985 1.00 0.00 ? 101 HIS B HB3  2 
ATOM 4925  H HD2  . HIS B 1 38 ? -13.393 6.923   -44.047 1.00 0.00 ? 101 HIS B HD2  2 
ATOM 4926  H HE1  . HIS B 1 38 ? -16.457 4.993   -41.942 1.00 0.00 ? 101 HIS B HE1  2 
ATOM 4927  H HE2  . HIS B 1 38 ? -15.925 6.773   -43.679 1.00 0.00 ? 101 HIS B HE2  2 
ATOM 4928  N N    . GLY B 1 39 ? -10.642 2.715   -45.198 1.00 0.00 ? 102 GLY B N    2 
ATOM 4929  C CA   . GLY B 1 39 ? -10.813 1.686   -46.217 1.00 0.00 ? 102 GLY B CA   2 
ATOM 4930  C C    . GLY B 1 39 ? -10.513 0.301   -45.659 1.00 0.00 ? 102 GLY B C    2 
ATOM 4931  O O    . GLY B 1 39 ? -10.300 0.139   -44.456 1.00 0.00 ? 102 GLY B O    2 
ATOM 4932  H H    . GLY B 1 39 ? -9.747  2.781   -44.719 1.00 0.00 ? 102 GLY B H    2 
ATOM 4933  H HA2  . GLY B 1 39 ? -11.848 1.680   -46.515 1.00 0.00 ? 102 GLY B HA2  2 
ATOM 4934  H HA3  . GLY B 1 39 ? -10.191 1.877   -47.092 1.00 0.00 ? 102 GLY B HA3  2 
ATOM 4935  N N    . LYS B 1 40 ? -10.501 -0.695  -46.537 1.00 0.00 ? 103 LYS B N    2 
ATOM 4936  C CA   . LYS B 1 40 ? -10.061 -2.034  -46.167 1.00 0.00 ? 103 LYS B CA   2 
ATOM 4937  C C    . LYS B 1 40 ? -9.921  -2.927  -47.395 1.00 0.00 ? 103 LYS B C    2 
ATOM 4938  O O    . LYS B 1 40 ? -10.889 -3.155  -48.121 1.00 0.00 ? 103 LYS B O    2 
ATOM 4939  C CB   . LYS B 1 40 ? -11.035 -2.663  -45.169 1.00 0.00 ? 103 LYS B CB   2 
ATOM 4940  C CG   . LYS B 1 40 ? -10.596 -4.017  -44.630 1.00 0.00 ? 103 LYS B CG   2 
ATOM 4941  C CD   . LYS B 1 40 ? -11.524 -4.498  -43.523 1.00 0.00 ? 103 LYS B CD   2 
ATOM 4942  C CE   . LYS B 1 40 ? -11.034 -5.805  -42.919 1.00 0.00 ? 103 LYS B CE   2 
ATOM 4943  N NZ   . LYS B 1 40 ? -11.936 -6.290  -41.839 1.00 0.00 ? 103 LYS B NZ   2 
ATOM 4944  H H    . LYS B 1 40 ? -10.678 -0.485  -47.519 1.00 0.00 ? 103 LYS B H    2 
ATOM 4945  H HA   . LYS B 1 40 ? -9.099  -1.964  -45.708 1.00 0.00 ? 103 LYS B HA   2 
ATOM 4946  H HB2  . LYS B 1 40 ? -11.132 -1.997  -44.324 1.00 0.00 ? 103 LYS B HB2  2 
ATOM 4947  H HB3  . LYS B 1 40 ? -11.999 -2.771  -45.615 1.00 0.00 ? 103 LYS B HB3  2 
ATOM 4948  H HG2  . LYS B 1 40 ? -10.608 -4.740  -45.445 1.00 0.00 ? 103 LYS B HG2  2 
ATOM 4949  H HG3  . LYS B 1 40 ? -9.585  -3.933  -44.234 1.00 0.00 ? 103 LYS B HG3  2 
ATOM 4950  H HD2  . LYS B 1 40 ? -11.568 -3.737  -42.743 1.00 0.00 ? 103 LYS B HD2  2 
ATOM 4951  H HD3  . LYS B 1 40 ? -12.522 -4.647  -43.935 1.00 0.00 ? 103 LYS B HD3  2 
ATOM 4952  H HE2  . LYS B 1 40 ? -11.006 -6.548  -43.692 1.00 0.00 ? 103 LYS B HE2  2 
ATOM 4953  H HE3  . LYS B 1 40 ? -10.032 -5.664  -42.516 1.00 0.00 ? 103 LYS B HE3  2 
ATOM 4954  H HZ1  . LYS B 1 40 ? -12.895 -6.415  -42.218 1.00 0.00 ? 103 LYS B HZ1  2 
ATOM 4955  H HZ2  . LYS B 1 40 ? -11.956 -5.590  -41.068 1.00 0.00 ? 103 LYS B HZ2  2 
ATOM 4956  H HZ3  . LYS B 1 40 ? -11.595 -7.173  -41.485 1.00 0.00 ? 103 LYS B HZ3  2 
ATOM 4957  N N    . HIS B 1 41 ? -8.713  -3.431  -47.620 1.00 0.00 ? 104 HIS B N    2 
ATOM 4958  C CA   . HIS B 1 41 ? -8.487  -4.450  -48.636 1.00 0.00 ? 104 HIS B CA   2 
ATOM 4959  C C    . HIS B 1 41 ? -7.931  -5.728  -48.022 1.00 0.00 ? 104 HIS B C    2 
ATOM 4960  O O    . HIS B 1 41 ? -6.794  -5.756  -47.547 1.00 0.00 ? 104 HIS B O    2 
ATOM 4961  C CB   . HIS B 1 41 ? -7.527  -3.937  -49.716 1.00 0.00 ? 104 HIS B CB   2 
ATOM 4962  C CG   . HIS B 1 41 ? -7.302  -4.905  -50.834 1.00 0.00 ? 104 HIS B CG   2 
ATOM 4963  N ND1  . HIS B 1 41 ? -6.243  -4.796  -51.712 1.00 0.00 ? 104 HIS B ND1  2 
ATOM 4964  C CD2  . HIS B 1 41 ? -7.998  -6.002  -51.215 1.00 0.00 ? 104 HIS B CD2  2 
ATOM 4965  C CE1  . HIS B 1 41 ? -6.298  -5.784  -52.586 1.00 0.00 ? 104 HIS B CE1  2 
ATOM 4966  N NE2  . HIS B 1 41 ? -7.354  -6.529  -52.309 1.00 0.00 ? 104 HIS B NE2  2 
ATOM 4967  H H    . HIS B 1 41 ? -7.965  -3.226  -46.960 1.00 0.00 ? 104 HIS B H    2 
ATOM 4968  H HA   . HIS B 1 41 ? -9.432  -4.699  -49.127 1.00 0.00 ? 104 HIS B HA   2 
ATOM 4969  H HB2  . HIS B 1 41 ? -7.928  -3.012  -50.132 1.00 0.00 ? 104 HIS B HB2  2 
ATOM 4970  H HB3  . HIS B 1 41 ? -6.570  -3.723  -49.239 1.00 0.00 ? 104 HIS B HB3  2 
ATOM 4971  H HD1  . HIS B 1 41 ? -5.529  -4.071  -51.690 1.00 0.00 ? 104 HIS B HD1  2 
ATOM 4972  H HD2  . HIS B 1 41 ? -8.994  -6.257  -50.888 1.00 0.00 ? 104 HIS B HD2  2 
ATOM 4973  H HE1  . HIS B 1 41 ? -5.596  -5.952  -53.392 1.00 0.00 ? 104 HIS B HE1  2 
ATOM 4974  N N    . GLU B 1 42 ? -8.736  -6.785  -48.033 1.00 0.00 ? 105 GLU B N    2 
ATOM 4975  C CA   . GLU B 1 42 ? -8.454  -7.970  -47.232 1.00 0.00 ? 105 GLU B CA   2 
ATOM 4976  C C    . GLU B 1 42 ? -7.438  -8.872  -47.921 1.00 0.00 ? 105 GLU B C    2 
ATOM 4977  O O    . GLU B 1 42 ? -6.372  -9.155  -47.372 1.00 0.00 ? 105 GLU B O    2 
ATOM 4978  C CB   . GLU B 1 42 ? -9.744  -8.750  -46.964 1.00 0.00 ? 105 GLU B CB   2 
ATOM 4979  C CG   . GLU B 1 42 ? -10.733 -8.034  -46.057 1.00 0.00 ? 105 GLU B CG   2 
ATOM 4980  C CD   . GLU B 1 42 ? -12.011 -8.802  -45.864 1.00 0.00 ? 105 GLU B CD   2 
ATOM 4981  O OE1  . GLU B 1 42 ? -12.187 -9.799  -46.520 1.00 0.00 ? 105 GLU B OE1  2 
ATOM 4982  O OE2  . GLU B 1 42 ? -12.813 -8.393  -45.056 1.00 0.00 ? 105 GLU B OE2  2 
ATOM 4983  H H    . GLU B 1 42 ? -9.675  -6.670  -48.414 1.00 0.00 ? 105 GLU B H    2 
ATOM 4984  H HA   . GLU B 1 42 ? -8.058  -7.676  -46.277 1.00 0.00 ? 105 GLU B HA   2 
ATOM 4985  H HB2  . GLU B 1 42 ? -10.243 -8.935  -47.917 1.00 0.00 ? 105 GLU B HB2  2 
ATOM 4986  H HB3  . GLU B 1 42 ? -9.490  -9.708  -46.508 1.00 0.00 ? 105 GLU B HB3  2 
ATOM 4987  H HG2  . GLU B 1 42 ? -10.244 -7.927  -45.099 1.00 0.00 ? 105 GLU B HG2  2 
ATOM 4988  H HG3  . GLU B 1 42 ? -10.953 -7.048  -46.467 1.00 0.00 ? 105 GLU B HG3  2 
ATOM 4989  N N    . GLU B 1 43 ? -7.774  -9.321  -49.126 1.00 0.00 ? 106 GLU B N    2 
ATOM 4990  C CA   . GLU B 1 43 ? -6.863  -10.139 -49.919 1.00 0.00 ? 106 GLU B CA   2 
ATOM 4991  C C    . GLU B 1 43 ? -5.981  -9.274  -50.809 1.00 0.00 ? 106 GLU B C    2 
ATOM 4992  O O    . GLU B 1 43 ? -6.310  -9.022  -51.968 1.00 0.00 ? 106 GLU B O    2 
ATOM 4993  C CB   . GLU B 1 43 ? -7.650  -11.134 -50.776 1.00 0.00 ? 106 GLU B CB   2 
ATOM 4994  C CG   . GLU B 1 43 ? -8.430  -12.171 -49.978 1.00 0.00 ? 106 GLU B CG   2 
ATOM 4995  C CD   . GLU B 1 43 ? -9.172  -13.142 -50.853 1.00 0.00 ? 106 GLU B CD   2 
ATOM 4996  O OE1  . GLU B 1 43 ? -9.163  -12.965 -52.048 1.00 0.00 ? 106 GLU B OE1  2 
ATOM 4997  O OE2  . GLU B 1 43 ? -9.749  -14.063 -50.326 1.00 0.00 ? 106 GLU B OE2  2 
ATOM 4998  H H    . GLU B 1 43 ? -8.673  -9.046  -49.523 1.00 0.00 ? 106 GLU B H    2 
ATOM 4999  H HA   . GLU B 1 43 ? -6.249  -10.709 -49.257 1.00 0.00 ? 106 GLU B HA   2 
ATOM 5000  H HB2  . GLU B 1 43 ? -8.358  -10.572 -51.384 1.00 0.00 ? 106 GLU B HB2  2 
ATOM 5001  H HB3  . GLU B 1 43 ? -6.956  -11.656 -51.434 1.00 0.00 ? 106 GLU B HB3  2 
ATOM 5002  H HG2  . GLU B 1 43 ? -7.726  -12.724 -49.354 1.00 0.00 ? 106 GLU B HG2  2 
ATOM 5003  H HG3  . GLU B 1 43 ? -9.144  -11.652 -49.338 1.00 0.00 ? 106 GLU B HG3  2 
ATOM 5004  N N    . ARG B 1 44 ? -4.856  -8.824  -50.261 1.00 0.00 ? 107 ARG B N    2 
ATOM 5005  C CA   . ARG B 1 44 ? -3.983  -7.890  -50.962 1.00 0.00 ? 107 ARG B CA   2 
ATOM 5006  C C    . ARG B 1 44 ? -2.577  -8.453  -51.102 1.00 0.00 ? 107 ARG B C    2 
ATOM 5007  O O    . ARG B 1 44 ? -1.699  -8.174  -50.284 1.00 0.00 ? 107 ARG B O    2 
ATOM 5008  C CB   . ARG B 1 44 ? -3.924  -6.559  -50.228 1.00 0.00 ? 107 ARG B CB   2 
ATOM 5009  C CG   . ARG B 1 44 ? -3.133  -5.471  -50.938 1.00 0.00 ? 107 ARG B CG   2 
ATOM 5010  C CD   . ARG B 1 44 ? -3.215  -4.174  -50.219 1.00 0.00 ? 107 ARG B CD   2 
ATOM 5011  N NE   . ARG B 1 44 ? -2.437  -3.138  -50.880 1.00 0.00 ? 107 ARG B NE   2 
ATOM 5012  C CZ   . ARG B 1 44 ? -2.921  -2.301  -51.818 1.00 0.00 ? 107 ARG B CZ   2 
ATOM 5013  N NH1  . ARG B 1 44 ? -4.178  -2.390  -52.195 1.00 0.00 ? 107 ARG B NH1  2 
ATOM 5014  N NH2  . ARG B 1 44 ? -2.133  -1.390  -52.360 1.00 0.00 ? 107 ARG B NH2  2 
ATOM 5015  H H    . ARG B 1 44 ? -4.647  -9.059  -49.290 1.00 0.00 ? 107 ARG B H    2 
ATOM 5016  H HA   . ARG B 1 44 ? -4.371  -7.703  -51.964 1.00 0.00 ? 107 ARG B HA   2 
ATOM 5017  H HB2  . ARG B 1 44 ? -4.940  -6.199  -50.085 1.00 0.00 ? 107 ARG B HB2  2 
ATOM 5018  H HB3  . ARG B 1 44 ? -3.489  -6.739  -49.285 1.00 0.00 ? 107 ARG B HB3  2 
ATOM 5019  H HG2  . ARG B 1 44 ? -2.086  -5.774  -50.984 1.00 0.00 ? 107 ARG B HG2  2 
ATOM 5020  H HG3  . ARG B 1 44 ? -3.518  -5.352  -51.949 1.00 0.00 ? 107 ARG B HG3  2 
ATOM 5021  H HD2  . ARG B 1 44 ? -4.259  -3.861  -50.201 1.00 0.00 ? 107 ARG B HD2  2 
ATOM 5022  H HD3  . ARG B 1 44 ? -2.869  -4.299  -49.199 1.00 0.00 ? 107 ARG B HD3  2 
ATOM 5023  H HE   . ARG B 1 44 ? -1.493  -3.049  -50.635 1.00 0.00 ? 107 ARG B HE   2 
ATOM 5024  H HH11 . ARG B 1 44 ? -4.777  -3.078  -51.786 1.00 0.00 ? 107 ARG B HH11 2 
ATOM 5025  H HH12 . ARG B 1 44 ? -4.539  -1.763  -52.898 1.00 0.00 ? 107 ARG B HH12 2 
ATOM 5026  H HH21 . ARG B 1 44 ? -1.178  -1.321  -52.076 1.00 0.00 ? 107 ARG B HH21 2 
ATOM 5027  H HH22 . ARG B 1 44 ? -2.494  -0.770  -53.055 1.00 0.00 ? 107 ARG B HH22 2 
ATOM 5028  N N    . GLN B 1 45 ? -2.364  -9.249  -52.145 1.00 0.00 ? 108 GLN B N    2 
ATOM 5029  C CA   . GLN B 1 45 ? -1.047  -9.813  -52.424 1.00 0.00 ? 108 GLN B CA   2 
ATOM 5030  C C    . GLN B 1 45 ? 0.045   -8.763  -52.274 1.00 0.00 ? 108 GLN B C    2 
ATOM 5031  O O    . GLN B 1 45 ? 0.008   -7.718  -52.923 1.00 0.00 ? 108 GLN B O    2 
ATOM 5032  C CB   . GLN B 1 45 ? -1.008  -10.410 -53.832 1.00 0.00 ? 108 GLN B CB   2 
ATOM 5033  C CG   . GLN B 1 45 ? 0.350   -10.958 -54.240 1.00 0.00 ? 108 GLN B CG   2 
ATOM 5034  C CD   . GLN B 1 45 ? 0.726   -12.204 -53.461 1.00 0.00 ? 108 GLN B CD   2 
ATOM 5035  O OE1  . GLN B 1 45 ? -0.039  -13.171 -53.400 1.00 0.00 ? 108 GLN B OE1  2 
ATOM 5036  N NE2  . GLN B 1 45 ? 1.911   -12.190 -52.859 1.00 0.00 ? 108 GLN B NE2  2 
ATOM 5037  H H    . GLN B 1 45 ? -3.128  -9.428  -52.794 1.00 0.00 ? 108 GLN B H    2 
ATOM 5038  H HA   . GLN B 1 45 ? -0.859  -10.621 -51.736 1.00 0.00 ? 108 GLN B HA   2 
ATOM 5039  H HB2  . GLN B 1 45 ? -1.734  -11.220 -53.888 1.00 0.00 ? 108 GLN B HB2  2 
ATOM 5040  H HB3  . GLN B 1 45 ? -1.301  -9.631  -54.538 1.00 0.00 ? 108 GLN B HB3  2 
ATOM 5041  H HG2  . GLN B 1 45 ? 0.320   -11.217 -55.298 1.00 0.00 ? 108 GLN B HG2  2 
ATOM 5042  H HG3  . GLN B 1 45 ? 1.110   -10.196 -54.091 1.00 0.00 ? 108 GLN B HG3  2 
ATOM 5043  H HE21 . GLN B 1 45 ? 2.524   -11.379 -52.938 1.00 0.00 ? 108 GLN B HE21 2 
ATOM 5044  H HE22 . GLN B 1 45 ? 2.207   -13.003 -52.318 1.00 0.00 ? 108 GLN B HE22 2 
ATOM 5045  N N    . ASP B 1 46 ? 1.017   -9.048  -51.415 1.00 0.00 ? 109 ASP B N    2 
ATOM 5046  C CA   . ASP B 1 46 ? 2.096   -8.106  -51.139 1.00 0.00 ? 109 ASP B CA   2 
ATOM 5047  C C    . ASP B 1 46 ? 3.452   -8.801  -51.162 1.00 0.00 ? 109 ASP B C    2 
ATOM 5048  O O    . ASP B 1 46 ? 3.607   -9.862  -51.764 1.00 0.00 ? 109 ASP B O    2 
ATOM 5049  C CB   . ASP B 1 46 ? 1.886   -7.431  -49.780 1.00 0.00 ? 109 ASP B CB   2 
ATOM 5050  C CG   . ASP B 1 46 ? 2.411   -6.004  -49.741 1.00 0.00 ? 109 ASP B CG   2 
ATOM 5051  O OD1  . ASP B 1 46 ? 2.805   -5.507  -50.770 1.00 0.00 ? 109 ASP B OD1  2 
ATOM 5052  O OD2  . ASP B 1 46 ? 2.413   -5.421  -48.683 1.00 0.00 ? 109 ASP B OD2  2 
ATOM 5053  H H    . ASP B 1 46 ? 0.988   -9.923  -50.907 1.00 0.00 ? 109 ASP B H    2 
ATOM 5054  H HA   . ASP B 1 46 ? 2.100   -7.343  -51.916 1.00 0.00 ? 109 ASP B HA   2 
ATOM 5055  H HB2  . ASP B 1 46 ? 0.818   -7.399  -49.610 1.00 0.00 ? 109 ASP B HB2  2 
ATOM 5056  H HB3  . ASP B 1 46 ? 2.361   -8.019  -48.992 1.00 0.00 ? 109 ASP B HB3  2 
ATOM 5057  N N    . GLU B 1 47 ? 4.432   -8.194  -50.501 1.00 0.00 ? 110 GLU B N    2 
ATOM 5058  C CA   . GLU B 1 47 ? 5.765   -8.779  -50.403 1.00 0.00 ? 110 GLU B CA   2 
ATOM 5059  C C    . GLU B 1 47 ? 5.750   -10.046 -49.558 1.00 0.00 ? 110 GLU B C    2 
ATOM 5060  O O    . GLU B 1 47 ? 6.530   -10.969 -49.792 1.00 0.00 ? 110 GLU B O    2 
ATOM 5061  C CB   . GLU B 1 47 ? 6.747   -7.768  -49.807 1.00 0.00 ? 110 GLU B CB   2 
ATOM 5062  C CG   . GLU B 1 47 ? 7.061   -6.586  -50.713 1.00 0.00 ? 110 GLU B CG   2 
ATOM 5063  C CD   . GLU B 1 47 ? 7.958   -5.570  -50.062 1.00 0.00 ? 110 GLU B CD   2 
ATOM 5064  O OE1  . GLU B 1 47 ? 7.943   -5.479  -48.859 1.00 0.00 ? 110 GLU B OE1  2 
ATOM 5065  O OE2  . GLU B 1 47 ? 8.658   -4.884  -50.770 1.00 0.00 ? 110 GLU B OE2  2 
ATOM 5066  H H    . GLU B 1 47 ? 4.238   -7.315  -50.022 1.00 0.00 ? 110 GLU B H    2 
ATOM 5067  H HA   . GLU B 1 47 ? 6.105   -9.031  -51.407 1.00 0.00 ? 110 GLU B HA   2 
ATOM 5068  H HB2  . GLU B 1 47 ? 6.323   -7.383  -48.880 1.00 0.00 ? 110 GLU B HB2  2 
ATOM 5069  H HB3  . GLU B 1 47 ? 7.684   -8.280  -49.581 1.00 0.00 ? 110 GLU B HB3  2 
ATOM 5070  H HG2  . GLU B 1 47 ? 7.546   -6.959  -51.616 1.00 0.00 ? 110 GLU B HG2  2 
ATOM 5071  H HG3  . GLU B 1 47 ? 6.121   -6.102  -50.990 1.00 0.00 ? 110 GLU B HG3  2 
ATOM 5072  N N    . HIS B 1 48 ? 4.858   -10.084 -48.573 1.00 0.00 ? 111 HIS B N    2 
ATOM 5073  C CA   . HIS B 1 48 ? 4.729   -11.244 -47.700 1.00 0.00 ? 111 HIS B CA   2 
ATOM 5074  C C    . HIS B 1 48 ? 3.333   -11.845 -47.785 1.00 0.00 ? 111 HIS B C    2 
ATOM 5075  O O    . HIS B 1 48 ? 2.451   -11.500 -46.999 1.00 0.00 ? 111 HIS B O    2 
ATOM 5076  C CB   . HIS B 1 48 ? 5.045   -10.868 -46.248 1.00 0.00 ? 111 HIS B CB   2 
ATOM 5077  C CG   . HIS B 1 48 ? 6.445   -10.388 -46.041 1.00 0.00 ? 111 HIS B CG   2 
ATOM 5078  N ND1  . HIS B 1 48 ? 6.867   -9.132  -46.429 1.00 0.00 ? 111 HIS B ND1  2 
ATOM 5079  C CD2  . HIS B 1 48 ? 7.525   -10.992 -45.490 1.00 0.00 ? 111 HIS B CD2  2 
ATOM 5080  C CE1  . HIS B 1 48 ? 8.144   -8.985  -46.122 1.00 0.00 ? 111 HIS B CE1  2 
ATOM 5081  N NE2  . HIS B 1 48 ? 8.566   -10.099 -45.551 1.00 0.00 ? 111 HIS B NE2  2 
ATOM 5082  H H    . HIS B 1 48 ? 4.239   -9.286  -48.428 1.00 0.00 ? 111 HIS B H    2 
ATOM 5083  H HA   . HIS B 1 48 ? 5.458   -11.987 -47.999 1.00 0.00 ? 111 HIS B HA   2 
ATOM 5084  H HB2  . HIS B 1 48 ? 4.374   -10.059 -45.967 1.00 0.00 ? 111 HIS B HB2  2 
ATOM 5085  H HB3  . HIS B 1 48 ? 4.863   -11.700 -45.599 1.00 0.00 ? 111 HIS B HB3  2 
ATOM 5086  H HD2  . HIS B 1 48 ? 7.496   -11.889 -44.889 1.00 0.00 ? 111 HIS B HD2  2 
ATOM 5087  H HE1  . HIS B 1 48 ? 8.751   -8.126  -46.334 1.00 0.00 ? 111 HIS B HE1  2 
ATOM 5088  H HE2  . HIS B 1 48 ? 9.503   -10.267 -45.215 1.00 0.00 ? 111 HIS B HE2  2 
ATOM 5089  N N    . GLY B 1 49 ? 3.137   -12.743 -48.744 1.00 0.00 ? 112 GLY B N    2 
ATOM 5090  C CA   . GLY B 1 49 ? 1.827   -13.335 -48.984 1.00 0.00 ? 112 GLY B CA   2 
ATOM 5091  C C    . GLY B 1 49 ? 0.836   -12.290 -49.483 1.00 0.00 ? 112 GLY B C    2 
ATOM 5092  O O    . GLY B 1 49 ? 1.146   -11.503 -50.379 1.00 0.00 ? 112 GLY B O    2 
ATOM 5093  H H    . GLY B 1 49 ? 3.910   -12.976 -49.368 1.00 0.00 ? 112 GLY B H    2 
ATOM 5094  H HA2  . GLY B 1 49 ? 1.921   -14.131 -49.724 1.00 0.00 ? 112 GLY B HA2  2 
ATOM 5095  H HA3  . GLY B 1 49 ? 1.450   -13.745 -48.061 1.00 0.00 ? 112 GLY B HA3  2 
ATOM 5096  N N    . PHE B 1 50 ? -0.358  -12.288 -48.900 1.00 0.00 ? 113 PHE B N    2 
ATOM 5097  C CA   . PHE B 1 50 ? -1.295  -11.184 -49.073 1.00 0.00 ? 113 PHE B CA   2 
ATOM 5098  C C    . PHE B 1 50 ? -1.617  -10.519 -47.740 1.00 0.00 ? 113 PHE B C    2 
ATOM 5099  O O    . PHE B 1 50 ? -1.623  -11.172 -46.696 1.00 0.00 ? 113 PHE B O    2 
ATOM 5100  C CB   . PHE B 1 50 ? -2.586  -11.676 -49.729 1.00 0.00 ? 113 PHE B CB   2 
ATOM 5101  C CG   . PHE B 1 50 ? -3.482  -12.445 -48.800 1.00 0.00 ? 113 PHE B CG   2 
ATOM 5102  C CD1  . PHE B 1 50 ? -4.388  -11.785 -47.983 1.00 0.00 ? 113 PHE B CD1  2 
ATOM 5103  C CD2  . PHE B 1 50 ? -3.420  -13.829 -48.740 1.00 0.00 ? 113 PHE B CD2  2 
ATOM 5104  C CE1  . PHE B 1 50 ? -5.214  -12.491 -47.129 1.00 0.00 ? 113 PHE B CE1  2 
ATOM 5105  C CE2  . PHE B 1 50 ? -4.245  -14.538 -47.887 1.00 0.00 ? 113 PHE B CE2  2 
ATOM 5106  C CZ   . PHE B 1 50 ? -5.141  -13.868 -47.080 1.00 0.00 ? 113 PHE B CZ   2 
ATOM 5107  H H    . PHE B 1 50 ? -0.520  -12.946 -48.136 1.00 0.00 ? 113 PHE B H    2 
ATOM 5108  H HA   . PHE B 1 50 ? -0.844  -10.414 -49.689 1.00 0.00 ? 113 PHE B HA   2 
ATOM 5109  H HB2  . PHE B 1 50 ? -3.142  -10.817 -50.102 1.00 0.00 ? 113 PHE B HB2  2 
ATOM 5110  H HB3  . PHE B 1 50 ? -2.322  -12.317 -50.572 1.00 0.00 ? 113 PHE B HB3  2 
ATOM 5111  H HD1  . PHE B 1 50 ? -4.425  -10.706 -48.001 1.00 0.00 ? 113 PHE B HD1  2 
ATOM 5112  H HD2  . PHE B 1 50 ? -2.720  -14.358 -49.370 1.00 0.00 ? 113 PHE B HD2  2 
ATOM 5113  H HE1  . PHE B 1 50 ? -5.912  -11.965 -46.495 1.00 0.00 ? 113 PHE B HE1  2 
ATOM 5114  H HE2  . PHE B 1 50 ? -4.188  -15.615 -47.851 1.00 0.00 ? 113 PHE B HE2  2 
ATOM 5115  H HZ   . PHE B 1 50 ? -5.897  -14.423 -46.545 1.00 0.00 ? 113 PHE B HZ   2 
ATOM 5116  N N    . ILE B 1 51 ? -1.884  -9.220  -47.783 1.00 0.00 ? 114 ILE B N    2 
ATOM 5117  C CA   . ILE B 1 51 ? -2.130  -8.448  -46.570 1.00 0.00 ? 114 ILE B CA   2 
ATOM 5118  C C    . ILE B 1 51 ? -3.587  -8.009  -46.483 1.00 0.00 ? 114 ILE B C    2 
ATOM 5119  O O    . ILE B 1 51 ? -4.256  -7.838  -47.500 1.00 0.00 ? 114 ILE B O    2 
ATOM 5120  C CB   . ILE B 1 51 ? -1.216  -7.210  -46.511 1.00 0.00 ? 114 ILE B CB   2 
ATOM 5121  C CG1  . ILE B 1 51 ? -1.455  -6.312  -47.728 1.00 0.00 ? 114 ILE B CG1  2 
ATOM 5122  C CG2  . ILE B 1 51 ? 0.243   -7.630  -46.436 1.00 0.00 ? 114 ILE B CG2  2 
ATOM 5123  C CD1  . ILE B 1 51 ? -0.715  -4.996  -47.671 1.00 0.00 ? 114 ILE B CD1  2 
ATOM 5124  H H    . ILE B 1 51 ? -1.855  -8.738  -48.674 1.00 0.00 ? 114 ILE B H    2 
ATOM 5125  H HA   . ILE B 1 51 ? -1.934  -9.067  -45.715 1.00 0.00 ? 114 ILE B HA   2 
ATOM 5126  H HB   . ILE B 1 51 ? -1.465  -6.651  -45.606 1.00 0.00 ? 114 ILE B HB   2 
ATOM 5127  H HG12 . ILE B 1 51 ? -1.198  -6.839  -48.625 1.00 0.00 ? 114 ILE B HG12 2 
ATOM 5128  H HG13 . ILE B 1 51 ? -2.506  -6.070  -47.736 1.00 0.00 ? 114 ILE B HG13 2 
ATOM 5129  H HG21 . ILE B 1 51 ? 0.322   -8.597  -45.947 1.00 0.00 ? 114 ILE B HG21 2 
ATOM 5130  H HG22 . ILE B 1 51 ? 0.820   -6.902  -45.862 1.00 0.00 ? 114 ILE B HG22 2 
ATOM 5131  H HG23 . ILE B 1 51 ? 0.658   -7.708  -47.427 1.00 0.00 ? 114 ILE B HG23 2 
ATOM 5132  H HD11 . ILE B 1 51 ? -0.655  -4.564  -48.670 1.00 0.00 ? 114 ILE B HD11 2 
ATOM 5133  H HD12 . ILE B 1 51 ? -1.246  -4.310  -47.011 1.00 0.00 ? 114 ILE B HD12 2 
ATOM 5134  H HD13 . ILE B 1 51 ? 0.292   -5.163  -47.287 1.00 0.00 ? 114 ILE B HD13 2 
ATOM 5135  N N    . SER B 1 52 ? -4.070  -7.826  -45.258 1.00 0.00 ? 115 SER B N    2 
ATOM 5136  C CA   . SER B 1 52 ? -5.418  -7.311  -45.036 1.00 0.00 ? 115 SER B CA   2 
ATOM 5137  C C    . SER B 1 52 ? -5.388  -6.048  -44.184 1.00 0.00 ? 115 SER B C    2 
ATOM 5138  O O    . SER B 1 52 ? -5.362  -6.118  -42.955 1.00 0.00 ? 115 SER B O    2 
ATOM 5139  C CB   . SER B 1 52 ? -6.275  -8.365  -44.367 1.00 0.00 ? 115 SER B CB   2 
ATOM 5140  O OG   . SER B 1 52 ? -7.555  -7.866  -44.084 1.00 0.00 ? 115 SER B OG   2 
ATOM 5141  H H    . SER B 1 52 ? -3.458  -7.971  -44.457 1.00 0.00 ? 115 SER B H    2 
ATOM 5142  H HA   . SER B 1 52 ? -5.864  -7.065  -45.986 1.00 0.00 ? 115 SER B HA   2 
ATOM 5143  H HB2  . SER B 1 52 ? -6.369  -9.235  -45.006 1.00 0.00 ? 115 SER B HB2  2 
ATOM 5144  H HB3  . SER B 1 52 ? -5.819  -8.653  -43.438 1.00 0.00 ? 115 SER B HB3  2 
ATOM 5145  H HG   . SER B 1 52 ? -8.194  -8.563  -44.248 1.00 0.00 ? 115 SER B HG   2 
ATOM 5146  N N    . ARG B 1 53 ? -5.395  -4.895  -44.844 1.00 0.00 ? 116 ARG B N    2 
ATOM 5147  C CA   . ARG B 1 53 ? -5.194  -3.622  -44.162 1.00 0.00 ? 116 ARG B CA   2 
ATOM 5148  C C    . ARG B 1 53 ? -6.493  -2.830  -44.078 1.00 0.00 ? 116 ARG B C    2 
ATOM 5149  O O    . ARG B 1 53 ? -7.069  -2.457  -45.097 1.00 0.00 ? 116 ARG B O    2 
ATOM 5150  C CB   . ARG B 1 53 ? -4.143  -2.790  -44.881 1.00 0.00 ? 116 ARG B CB   2 
ATOM 5151  C CG   . ARG B 1 53 ? -2.714  -3.282  -44.715 1.00 0.00 ? 116 ARG B CG   2 
ATOM 5152  C CD   . ARG B 1 53 ? -1.732  -2.313  -45.267 1.00 0.00 ? 116 ARG B CD   2 
ATOM 5153  N NE   . ARG B 1 53 ? -0.361  -2.769  -45.087 1.00 0.00 ? 116 ARG B NE   2 
ATOM 5154  C CZ   . ARG B 1 53 ? 0.727   -2.112  -45.532 1.00 0.00 ? 116 ARG B CZ   2 
ATOM 5155  N NH1  . ARG B 1 53 ? 0.591   -0.977  -46.182 1.00 0.00 ? 116 ARG B NH1  2 
ATOM 5156  N NH2  . ARG B 1 53 ? 1.932   -2.609  -45.318 1.00 0.00 ? 116 ARG B NH2  2 
ATOM 5157  H H    . ARG B 1 53 ? -5.394  -4.911  -45.864 1.00 0.00 ? 116 ARG B H    2 
ATOM 5158  H HA   . ARG B 1 53 ? -4.833  -3.796  -43.158 1.00 0.00 ? 116 ARG B HA   2 
ATOM 5159  H HB2  . ARG B 1 53 ? -4.372  -2.790  -45.945 1.00 0.00 ? 116 ARG B HB2  2 
ATOM 5160  H HB3  . ARG B 1 53 ? -4.193  -1.763  -44.513 1.00 0.00 ? 116 ARG B HB3  2 
ATOM 5161  H HG2  . ARG B 1 53 ? -2.519  -3.411  -43.650 1.00 0.00 ? 116 ARG B HG2  2 
ATOM 5162  H HG3  . ARG B 1 53 ? -2.608  -4.239  -45.217 1.00 0.00 ? 116 ARG B HG3  2 
ATOM 5163  H HD2  . ARG B 1 53 ? -1.925  -2.182  -46.331 1.00 0.00 ? 116 ARG B HD2  2 
ATOM 5164  H HD3  . ARG B 1 53 ? -1.853  -1.357  -44.759 1.00 0.00 ? 116 ARG B HD3  2 
ATOM 5165  H HE   . ARG B 1 53 ? -0.221  -3.612  -44.608 1.00 0.00 ? 116 ARG B HE   2 
ATOM 5166  H HH11 . ARG B 1 53 ? -0.322  -0.599  -46.347 1.00 0.00 ? 116 ARG B HH11 2 
ATOM 5167  H HH12 . ARG B 1 53 ? 1.408   -0.485  -46.514 1.00 0.00 ? 116 ARG B HH12 2 
ATOM 5168  H HH21 . ARG B 1 53 ? 2.039   -3.473  -44.824 1.00 0.00 ? 116 ARG B HH21 2 
ATOM 5169  H HH22 . ARG B 1 53 ? 2.738   -2.120  -45.650 1.00 0.00 ? 116 ARG B HH22 2 
ATOM 5170  N N    . GLU B 1 54 ? -6.947  -2.578  -42.854 1.00 0.00 ? 117 GLU B N    2 
ATOM 5171  C CA   . GLU B 1 54 ? -8.085  -1.693  -42.628 1.00 0.00 ? 117 GLU B CA   2 
ATOM 5172  C C    . GLU B 1 54 ? -7.623  -0.295  -42.233 1.00 0.00 ? 117 GLU B C    2 
ATOM 5173  O O    . GLU B 1 54 ? -6.927  -0.118  -41.235 1.00 0.00 ? 117 GLU B O    2 
ATOM 5174  C CB   . GLU B 1 54 ? -8.997  -2.265  -41.540 1.00 0.00 ? 117 GLU B CB   2 
ATOM 5175  C CG   . GLU B 1 54 ? -10.213 -1.404  -41.224 1.00 0.00 ? 117 GLU B CG   2 
ATOM 5176  C CD   . GLU B 1 54 ? -11.093 -2.005  -40.164 1.00 0.00 ? 117 GLU B CD   2 
ATOM 5177  O OE1  . GLU B 1 54 ? -10.814 -3.100  -39.736 1.00 0.00 ? 117 GLU B OE1  2 
ATOM 5178  O OE2  . GLU B 1 54 ? -12.047 -1.369  -39.782 1.00 0.00 ? 117 GLU B OE2  2 
ATOM 5179  H H    . GLU B 1 54 ? -6.403  -2.896  -42.052 1.00 0.00 ? 117 GLU B H    2 
ATOM 5180  H HA   . GLU B 1 54 ? -8.665  -1.613  -43.539 1.00 0.00 ? 117 GLU B HA   2 
ATOM 5181  H HB2  . GLU B 1 54 ? -9.342  -3.252  -41.847 1.00 0.00 ? 117 GLU B HB2  2 
ATOM 5182  H HB3  . GLU B 1 54 ? -8.418  -2.357  -40.637 1.00 0.00 ? 117 GLU B HB3  2 
ATOM 5183  H HG2  . GLU B 1 54 ? -9.874  -0.431  -40.877 1.00 0.00 ? 117 GLU B HG2  2 
ATOM 5184  H HG3  . GLU B 1 54 ? -10.792 -1.275  -42.132 1.00 0.00 ? 117 GLU B HG3  2 
ATOM 5185  N N    . PHE B 1 55 ? -8.017  0.697   -43.027 1.00 0.00 ? 118 PHE B N    2 
ATOM 5186  C CA   . PHE B 1 55 ? -7.415  2.023   -42.949 1.00 0.00 ? 118 PHE B CA   2 
ATOM 5187  C C    . PHE B 1 55 ? -8.343  3.009   -42.247 1.00 0.00 ? 118 PHE B C    2 
ATOM 5188  O O    . PHE B 1 55 ? -9.561  2.954   -42.411 1.00 0.00 ? 118 PHE B O    2 
ATOM 5189  C CB   . PHE B 1 55 ? -7.081  2.541   -44.349 1.00 0.00 ? 118 PHE B CB   2 
ATOM 5190  C CG   . PHE B 1 55 ? -6.053  1.715   -45.070 1.00 0.00 ? 118 PHE B CG   2 
ATOM 5191  C CD1  . PHE B 1 55 ? -6.426  0.584   -45.782 1.00 0.00 ? 118 PHE B CD1  2 
ATOM 5192  C CD2  . PHE B 1 55 ? -4.711  2.066   -45.037 1.00 0.00 ? 118 PHE B CD2  2 
ATOM 5193  C CE1  . PHE B 1 55 ? -5.481  -0.176  -46.444 1.00 0.00 ? 118 PHE B CE1  2 
ATOM 5194  C CE2  . PHE B 1 55 ? -3.767  1.308   -45.700 1.00 0.00 ? 118 PHE B CE2  2 
ATOM 5195  C CZ   . PHE B 1 55 ? -4.152  0.184   -46.404 1.00 0.00 ? 118 PHE B CZ   2 
ATOM 5196  H H    . PHE B 1 55 ? -8.562  0.473   -43.858 1.00 0.00 ? 118 PHE B H    2 
ATOM 5197  H HA   . PHE B 1 55 ? -6.483  1.977   -42.386 1.00 0.00 ? 118 PHE B HA   2 
ATOM 5198  H HB2  . PHE B 1 55 ? -7.989  2.548   -44.945 1.00 0.00 ? 118 PHE B HB2  2 
ATOM 5199  H HB3  . PHE B 1 55 ? -6.714  3.565   -44.260 1.00 0.00 ? 118 PHE B HB3  2 
ATOM 5200  H HD1  . PHE B 1 55 ? -7.467  0.296   -45.814 1.00 0.00 ? 118 PHE B HD1  2 
ATOM 5201  H HD2  . PHE B 1 55 ? -4.406  2.944   -44.488 1.00 0.00 ? 118 PHE B HD2  2 
ATOM 5202  H HE1  . PHE B 1 55 ? -5.784  -1.064  -46.978 1.00 0.00 ? 118 PHE B HE1  2 
ATOM 5203  H HE2  . PHE B 1 55 ? -2.725  1.596   -45.670 1.00 0.00 ? 118 PHE B HE2  2 
ATOM 5204  H HZ   . PHE B 1 55 ? -3.432  -0.350  -47.005 1.00 0.00 ? 118 PHE B HZ   2 
ATOM 5205  N N    . HIS B 1 56 ? -7.757  3.908   -41.464 1.00 0.00 ? 119 HIS B N    2 
ATOM 5206  C CA   . HIS B 1 56 ? -8.392  5.184   -41.157 1.00 0.00 ? 119 HIS B CA   2 
ATOM 5207  C C    . HIS B 1 56 ? -7.409  6.338   -41.306 1.00 0.00 ? 119 HIS B C    2 
ATOM 5208  O O    . HIS B 1 56 ? -6.196  6.149   -41.214 1.00 0.00 ? 119 HIS B O    2 
ATOM 5209  C CB   . HIS B 1 56 ? -8.967  5.177   -39.738 1.00 0.00 ? 119 HIS B CB   2 
ATOM 5210  C CG   . HIS B 1 56 ? -9.897  4.033   -39.472 1.00 0.00 ? 119 HIS B CG   2 
ATOM 5211  N ND1  . HIS B 1 56 ? -9.450  2.769   -39.150 1.00 0.00 ? 119 HIS B ND1  2 
ATOM 5212  C CD2  . HIS B 1 56 ? -11.250 3.963   -39.481 1.00 0.00 ? 119 HIS B CD2  2 
ATOM 5213  C CE1  . HIS B 1 56 ? -10.489 1.970   -38.973 1.00 0.00 ? 119 HIS B CE1  2 
ATOM 5214  N NE2  . HIS B 1 56 ? -11.591 2.670   -39.168 1.00 0.00 ? 119 HIS B NE2  2 
ATOM 5215  H H    . HIS B 1 56 ? -6.737  3.901   -41.455 1.00 0.00 ? 119 HIS B H    2 
ATOM 5216  H HA   . HIS B 1 56 ? -9.202  5.371   -41.847 1.00 0.00 ? 119 HIS B HA   2 
ATOM 5217  H HB2  . HIS B 1 56 ? -8.148  5.167   -39.047 1.00 0.00 ? 119 HIS B HB2  2 
ATOM 5218  H HB3  . HIS B 1 56 ? -9.520  6.108   -39.596 1.00 0.00 ? 119 HIS B HB3  2 
ATOM 5219  H HD1  . HIS B 1 56 ? -8.473  2.489   -39.060 1.00 0.00 ? 119 HIS B HD1  2 
ATOM 5220  H HD2  . HIS B 1 56 ? -11.924 4.799   -39.572 1.00 0.00 ? 119 HIS B HD2  2 
ATOM 5221  H HE1  . HIS B 1 56 ? -10.440 0.922   -38.712 1.00 0.00 ? 119 HIS B HE1  2 
ATOM 5222  H HE2  . HIS B 1 56 ? -12.533 2.312   -39.098 1.00 0.00 ? 119 HIS B HE2  2 
ATOM 5223  N N    . ARG B 1 57 ? -7.938  7.535   -41.536 1.00 0.00 ? 120 ARG B N    2 
ATOM 5224  C CA   . ARG B 1 57 ? -7.145  8.754   -41.445 1.00 0.00 ? 120 ARG B CA   2 
ATOM 5225  C C    . ARG B 1 57 ? -8.022  9.965   -41.155 1.00 0.00 ? 120 ARG B C    2 
ATOM 5226  O O    . ARG B 1 57 ? -8.723  10.463  -42.036 1.00 0.00 ? 120 ARG B O    2 
ATOM 5227  C CB   . ARG B 1 57 ? -6.376  8.989   -42.739 1.00 0.00 ? 120 ARG B CB   2 
ATOM 5228  C CG   . ARG B 1 57 ? -7.202  9.570   -43.874 1.00 0.00 ? 120 ARG B CG   2 
ATOM 5229  C CD   . ARG B 1 57 ? -6.651  9.193   -45.204 1.00 0.00 ? 120 ARG B CD   2 
ATOM 5230  N NE   . ARG B 1 57 ? -6.914  7.798   -45.520 1.00 0.00 ? 120 ARG B NE   2 
ATOM 5231  C CZ   . ARG B 1 57 ? -6.180  7.057   -46.374 1.00 0.00 ? 120 ARG B CZ   2 
ATOM 5232  N NH1  . ARG B 1 57 ? -5.145  7.588   -46.983 1.00 0.00 ? 120 ARG B NH1  2 
ATOM 5233  N NH2  . ARG B 1 57 ? -6.504  5.794   -46.597 1.00 0.00 ? 120 ARG B NH2  2 
ATOM 5234  H H    . ARG B 1 57 ? -8.954  7.620   -41.551 1.00 0.00 ? 120 ARG B H    2 
ATOM 5235  H HA   . ARG B 1 57 ? -6.435  8.665   -40.631 1.00 0.00 ? 120 ARG B HA   2 
ATOM 5236  H HB2  . ARG B 1 57 ? -5.553  9.678   -42.538 1.00 0.00 ? 120 ARG B HB2  2 
ATOM 5237  H HB3  . ARG B 1 57 ? -5.964  8.027   -43.059 1.00 0.00 ? 120 ARG B HB3  2 
ATOM 5238  H HG2  . ARG B 1 57 ? -8.199  9.161   -43.791 1.00 0.00 ? 120 ARG B HG2  2 
ATOM 5239  H HG3  . ARG B 1 57 ? -7.240  10.660  -43.788 1.00 0.00 ? 120 ARG B HG3  2 
ATOM 5240  H HD2  . ARG B 1 57 ? -7.074  9.831   -45.977 1.00 0.00 ? 120 ARG B HD2  2 
ATOM 5241  H HD3  . ARG B 1 57 ? -5.569  9.338   -45.183 1.00 0.00 ? 120 ARG B HD3  2 
ATOM 5242  H HE   . ARG B 1 57 ? -7.683  7.372   -45.085 1.00 0.00 ? 120 ARG B HE   2 
ATOM 5243  H HH11 . ARG B 1 57 ? -4.901  8.543   -46.816 1.00 0.00 ? 120 ARG B HH11 2 
ATOM 5244  H HH12 . ARG B 1 57 ? -4.596  7.032   -47.621 1.00 0.00 ? 120 ARG B HH12 2 
ATOM 5245  H HH21 . ARG B 1 57 ? -7.291  5.386   -46.137 1.00 0.00 ? 120 ARG B HH21 2 
ATOM 5246  H HH22 . ARG B 1 57 ? -5.956  5.247   -47.230 1.00 0.00 ? 120 ARG B HH22 2 
ATOM 5247  N N    . LYS B 1 58 ? -7.984  10.432  -39.911 1.00 0.00 ? 121 LYS B N    2 
ATOM 5248  C CA   . LYS B 1 58 ? -8.787  11.577  -39.499 1.00 0.00 ? 121 LYS B CA   2 
ATOM 5249  C C    . LYS B 1 58 ? -8.029  12.883  -39.694 1.00 0.00 ? 121 LYS B C    2 
ATOM 5250  O O    . LYS B 1 58 ? -7.331  13.347  -38.795 1.00 0.00 ? 121 LYS B O    2 
ATOM 5251  C CB   . LYS B 1 58 ? -9.213  11.431  -38.035 1.00 0.00 ? 121 LYS B CB   2 
ATOM 5252  C CG   . LYS B 1 58 ? -10.211 10.309  -37.780 1.00 0.00 ? 121 LYS B CG   2 
ATOM 5253  C CD   . LYS B 1 58 ? -10.634 10.269  -36.319 1.00 0.00 ? 121 LYS B CD   2 
ATOM 5254  C CE   . LYS B 1 58 ? -11.417 9.003   -36.003 1.00 0.00 ? 121 LYS B CE   2 
ATOM 5255  N NZ   . LYS B 1 58 ? -11.774 8.914   -34.561 1.00 0.00 ? 121 LYS B NZ   2 
ATOM 5256  H H    . LYS B 1 58 ? -7.383  9.973   -39.226 1.00 0.00 ? 121 LYS B H    2 
ATOM 5257  H HA   . LYS B 1 58 ? -9.692  11.620  -40.095 1.00 0.00 ? 121 LYS B HA   2 
ATOM 5258  H HB2  . LYS B 1 58 ? -8.317  11.203  -37.462 1.00 0.00 ? 121 LYS B HB2  2 
ATOM 5259  H HB3  . LYS B 1 58 ? -9.623  12.359  -37.665 1.00 0.00 ? 121 LYS B HB3  2 
ATOM 5260  H HG2  . LYS B 1 58 ? -11.078 10.487  -38.391 1.00 0.00 ? 121 LYS B HG2  2 
ATOM 5261  H HG3  . LYS B 1 58 ? -9.762  9.354   -38.050 1.00 0.00 ? 121 LYS B HG3  2 
ATOM 5262  H HD2  . LYS B 1 58 ? -9.741  10.290  -35.699 1.00 0.00 ? 121 LYS B HD2  2 
ATOM 5263  H HD3  . LYS B 1 58 ? -11.237 11.141  -36.097 1.00 0.00 ? 121 LYS B HD3  2 
ATOM 5264  H HE2  . LYS B 1 58 ? -12.330 8.999   -36.593 1.00 0.00 ? 121 LYS B HE2  2 
ATOM 5265  H HE3  . LYS B 1 58 ? -10.814 8.136   -36.275 1.00 0.00 ? 121 LYS B HE3  2 
ATOM 5266  H HZ1  . LYS B 1 58 ? -11.284 8.104   -34.128 1.00 0.00 ? 121 LYS B HZ1  2 
ATOM 5267  H HZ2  . LYS B 1 58 ? -12.802 8.791   -34.459 1.00 0.00 ? 121 LYS B HZ2  2 
ATOM 5268  H HZ3  . LYS B 1 58 ? -11.491 9.763   -34.094 1.00 0.00 ? 121 LYS B HZ3  2 
ATOM 5269  N N    . TYR B 1 59 ? -8.169  13.469  -40.878 1.00 0.00 ? 122 TYR B N    2 
ATOM 5270  C CA   . TYR B 1 59 ? -7.412  14.662  -41.237 1.00 0.00 ? 122 TYR B CA   2 
ATOM 5271  C C    . TYR B 1 59 ? -8.142  15.929  -40.814 1.00 0.00 ? 122 TYR B C    2 
ATOM 5272  O O    . TYR B 1 59 ? -9.285  16.159  -41.210 1.00 0.00 ? 122 TYR B O    2 
ATOM 5273  C CB   . TYR B 1 59 ? -7.135  14.686  -42.743 1.00 0.00 ? 122 TYR B CB   2 
ATOM 5274  C CG   . TYR B 1 59 ? -6.445  15.948  -43.216 1.00 0.00 ? 122 TYR B CG   2 
ATOM 5275  C CD1  . TYR B 1 59 ? -5.111  16.167  -42.905 1.00 0.00 ? 122 TYR B CD1  2 
ATOM 5276  C CD2  . TYR B 1 59 ? -7.148  16.886  -43.958 1.00 0.00 ? 122 TYR B CD2  2 
ATOM 5277  C CE1  . TYR B 1 59 ? -4.481  17.318  -43.337 1.00 0.00 ? 122 TYR B CE1  2 
ATOM 5278  C CE2  . TYR B 1 59 ? -6.516  18.036  -44.390 1.00 0.00 ? 122 TYR B CE2  2 
ATOM 5279  C CZ   . TYR B 1 59 ? -5.189  18.254  -44.082 1.00 0.00 ? 122 TYR B CZ   2 
ATOM 5280  O OH   . TYR B 1 59 ? -4.561  19.400  -44.512 1.00 0.00 ? 122 TYR B OH   2 
ATOM 5281  H H    . TYR B 1 59 ? -8.755  13.023  -41.584 1.00 0.00 ? 122 TYR B H    2 
ATOM 5282  H HA   . TYR B 1 59 ? -6.452  14.651  -40.732 1.00 0.00 ? 122 TYR B HA   2 
ATOM 5283  H HB2  . TYR B 1 59 ? -6.513  13.848  -42.964 1.00 0.00 ? 122 TYR B HB2  2 
ATOM 5284  H HB3  . TYR B 1 59 ? -8.077  14.569  -43.271 1.00 0.00 ? 122 TYR B HB3  2 
ATOM 5285  H HD1  . TYR B 1 59 ? -4.585  15.463  -42.297 1.00 0.00 ? 122 TYR B HD1  2 
ATOM 5286  H HD2  . TYR B 1 59 ? -8.186  16.718  -44.203 1.00 0.00 ? 122 TYR B HD2  2 
ATOM 5287  H HE1  . TYR B 1 59 ? -3.443  17.490  -43.095 1.00 0.00 ? 122 TYR B HE1  2 
ATOM 5288  H HE2  . TYR B 1 59 ? -7.063  18.766  -44.968 1.00 0.00 ? 122 TYR B HE2  2 
ATOM 5289  H HH   . TYR B 1 59 ? -4.969  20.147  -44.068 1.00 0.00 ? 122 TYR B HH   2 
ATOM 5290  N N    . ARG B 1 60 ? -7.478  16.747  -40.005 1.00 0.00 ? 123 ARG B N    2 
ATOM 5291  C CA   . ARG B 1 60 ? -8.126  17.885  -39.364 1.00 0.00 ? 123 ARG B CA   2 
ATOM 5292  C C    . ARG B 1 60 ? -8.400  18.999  -40.367 1.00 0.00 ? 123 ARG B C    2 
ATOM 5293  O O    . ARG B 1 60 ? -7.565  19.295  -41.223 1.00 0.00 ? 123 ARG B O    2 
ATOM 5294  C CB   . ARG B 1 60 ? -7.266  18.424  -38.233 1.00 0.00 ? 123 ARG B CB   2 
ATOM 5295  C CG   . ARG B 1 60 ? -7.534  17.802  -36.871 1.00 0.00 ? 123 ARG B CG   2 
ATOM 5296  C CD   . ARG B 1 60 ? -6.840  16.499  -36.717 1.00 0.00 ? 123 ARG B CD   2 
ATOM 5297  N NE   . ARG B 1 60 ? -5.400  16.664  -36.583 1.00 0.00 ? 123 ARG B NE   2 
ATOM 5298  C CZ   . ARG B 1 60 ? -4.528  15.652  -36.405 1.00 0.00 ? 123 ARG B CZ   2 
ATOM 5299  N NH1  . ARG B 1 60 ? -4.963  14.414  -36.343 1.00 0.00 ? 123 ARG B NH1  2 
ATOM 5300  N NH2  . ARG B 1 60 ? -3.236  15.906  -36.296 1.00 0.00 ? 123 ARG B NH2  2 
ATOM 5301  H H    . ARG B 1 60 ? -6.544  16.475  -39.697 1.00 0.00 ? 123 ARG B H    2 
ATOM 5302  H HA   . ARG B 1 60 ? -9.068  17.588  -38.945 1.00 0.00 ? 123 ARG B HA   2 
ATOM 5303  H HB2  . ARG B 1 60 ? -6.222  18.243  -38.489 1.00 0.00 ? 123 ARG B HB2  2 
ATOM 5304  H HB3  . ARG B 1 60 ? -7.408  19.510  -38.148 1.00 0.00 ? 123 ARG B HB3  2 
ATOM 5305  H HG2  . ARG B 1 60 ? -7.144  18.469  -36.097 1.00 0.00 ? 123 ARG B HG2  2 
ATOM 5306  H HG3  . ARG B 1 60 ? -8.600  17.693  -36.719 1.00 0.00 ? 123 ARG B HG3  2 
ATOM 5307  H HD2  . ARG B 1 60 ? -7.223  15.976  -35.842 1.00 0.00 ? 123 ARG B HD2  2 
ATOM 5308  H HD3  . ARG B 1 60 ? -7.020  15.900  -37.610 1.00 0.00 ? 123 ARG B HD3  2 
ATOM 5309  H HE   . ARG B 1 60 ? -5.043  17.576  -36.614 1.00 0.00 ? 123 ARG B HE   2 
ATOM 5310  H HH11 . ARG B 1 60 ? -5.941  14.220  -36.425 1.00 0.00 ? 123 ARG B HH11 2 
ATOM 5311  H HH12 . ARG B 1 60 ? -4.308  13.656  -36.212 1.00 0.00 ? 123 ARG B HH12 2 
ATOM 5312  H HH21 . ARG B 1 60 ? -2.903  16.848  -36.341 1.00 0.00 ? 123 ARG B HH21 2 
ATOM 5313  H HH22 . ARG B 1 60 ? -2.591  15.152  -36.166 1.00 0.00 ? 123 ARG B HH22 2 
ATOM 5314  N N    . ILE B 1 61 ? -9.572  19.614  -40.257 1.00 0.00 ? 124 ILE B N    2 
ATOM 5315  C CA   . ILE B 1 61 ? -10.016 20.599  -41.236 1.00 0.00 ? 124 ILE B CA   2 
ATOM 5316  C C    . ILE B 1 61 ? -9.603  22.007  -40.826 1.00 0.00 ? 124 ILE B C    2 
ATOM 5317  O O    . ILE B 1 61 ? -10.061 22.528  -39.809 1.00 0.00 ? 124 ILE B O    2 
ATOM 5318  C CB   . ILE B 1 61 ? -11.545 20.544  -41.415 1.00 0.00 ? 124 ILE B CB   2 
ATOM 5319  C CG1  . ILE B 1 61 ? -11.972 19.160  -41.911 1.00 0.00 ? 124 ILE B CG1  2 
ATOM 5320  C CG2  . ILE B 1 61 ? -12.007 21.624  -42.379 1.00 0.00 ? 124 ILE B CG2  2 
ATOM 5321  C CD1  . ILE B 1 61 ? -13.472 18.975  -41.982 1.00 0.00 ? 124 ILE B CD1  2 
ATOM 5322  H H    . ILE B 1 61 ? -10.219 19.309  -39.533 1.00 0.00 ? 124 ILE B H    2 
ATOM 5323  H HA   . ILE B 1 61 ? -9.611  20.332  -42.198 1.00 0.00 ? 124 ILE B HA   2 
ATOM 5324  H HB   . ILE B 1 61 ? -12.016 20.722  -40.450 1.00 0.00 ? 124 ILE B HB   2 
ATOM 5325  H HG12 . ILE B 1 61 ? -11.544 19.007  -42.903 1.00 0.00 ? 124 ILE B HG12 2 
ATOM 5326  H HG13 . ILE B 1 61 ? -11.559 18.412  -41.231 1.00 0.00 ? 124 ILE B HG13 2 
ATOM 5327  H HG21 . ILE B 1 61 ? -13.088 21.557  -42.496 1.00 0.00 ? 124 ILE B HG21 2 
ATOM 5328  H HG22 . ILE B 1 61 ? -11.538 21.430  -43.324 1.00 0.00 ? 124 ILE B HG22 2 
ATOM 5329  H HG23 . ILE B 1 61 ? -11.748 22.609  -42.023 1.00 0.00 ? 124 ILE B HG23 2 
ATOM 5330  H HD11 . ILE B 1 61 ? -13.728 17.922  -41.866 1.00 0.00 ? 124 ILE B HD11 2 
ATOM 5331  H HD12 . ILE B 1 61 ? -13.833 19.328  -42.949 1.00 0.00 ? 124 ILE B HD12 2 
ATOM 5332  H HD13 . ILE B 1 61 ? -13.945 19.552  -41.188 1.00 0.00 ? 124 ILE B HD13 2 
ATOM 5333  N N    . PRO B 1 62 ? -8.738  22.619  -41.626 1.00 0.00 ? 125 PRO B N    2 
ATOM 5334  C CA   . PRO B 1 62 ? -8.392  24.025  -41.450 1.00 0.00 ? 125 PRO B CA   2 
ATOM 5335  C C    . PRO B 1 62 ? -9.637  24.904  -41.467 1.00 0.00 ? 125 PRO B C    2 
ATOM 5336  O O    . PRO B 1 62 ? -10.658 24.538  -42.049 1.00 0.00 ? 125 PRO B O    2 
ATOM 5337  C CB   . PRO B 1 62 ? -7.481  24.310  -42.648 1.00 0.00 ? 125 PRO B CB   2 
ATOM 5338  C CG   . PRO B 1 62 ? -6.936  22.973  -43.018 1.00 0.00 ? 125 PRO B CG   2 
ATOM 5339  C CD   . PRO B 1 62 ? -8.082  22.024  -42.786 1.00 0.00 ? 125 PRO B CD   2 
ATOM 5340  H HA   . PRO B 1 62 ? -7.843  24.153  -40.518 1.00 0.00 ? 125 PRO B HA   2 
ATOM 5341  H HB2  . PRO B 1 62 ? -8.046  24.754  -43.460 1.00 0.00 ? 125 PRO B HB2  2 
ATOM 5342  H HB3  . PRO B 1 62 ? -6.664  24.971  -42.354 1.00 0.00 ? 125 PRO B HB3  2 
ATOM 5343  H HG2  . PRO B 1 62 ? -6.648  22.970  -44.075 1.00 0.00 ? 125 PRO B HG2  2 
ATOM 5344  H HG3  . PRO B 1 62 ? -6.080  22.712  -42.392 1.00 0.00 ? 125 PRO B HG3  2 
ATOM 5345  H HD2  . PRO B 1 62 ? -8.727  21.936  -43.639 1.00 0.00 ? 125 PRO B HD2  2 
ATOM 5346  H HD3  . PRO B 1 62 ? -7.671  21.064  -42.520 1.00 0.00 ? 125 PRO B HD3  2 
ATOM 5347  N N    . ALA B 1 63 ? -9.544  26.065  -40.829 1.00 0.00 ? 126 ALA B N    2 
ATOM 5348  C CA   . ALA B 1 63 ? -10.656 27.008  -40.788 1.00 0.00 ? 126 ALA B CA   2 
ATOM 5349  C C    . ALA B 1 63 ? -10.977 27.541  -42.178 1.00 0.00 ? 126 ALA B C    2 
ATOM 5350  O O    . ALA B 1 63 ? -12.013 28.173  -42.388 1.00 0.00 ? 126 ALA B O    2 
ATOM 5351  C CB   . ALA B 1 63 ? -10.343 28.156  -39.841 1.00 0.00 ? 126 ALA B CB   2 
ATOM 5352  H H    . ALA B 1 63 ? -8.670  26.313  -40.368 1.00 0.00 ? 126 ALA B H    2 
ATOM 5353  H HA   . ALA B 1 63 ? -11.532 26.482  -40.410 1.00 0.00 ? 126 ALA B HA   2 
ATOM 5354  H HB1  . ALA B 1 63 ? -9.405  28.623  -40.141 1.00 0.00 ? 126 ALA B HB1  2 
ATOM 5355  H HB2  . ALA B 1 63 ? -10.251 27.776  -38.823 1.00 0.00 ? 126 ALA B HB2  2 
ATOM 5356  H HB3  . ALA B 1 63 ? -11.146 28.892  -39.882 1.00 0.00 ? 126 ALA B HB3  2 
ATOM 5357  N N    . ASP B 1 64 ? -10.083 27.283  -43.127 1.00 0.00 ? 127 ASP B N    2 
ATOM 5358  C CA   . ASP B 1 64 ? -10.263 27.749  -44.497 1.00 0.00 ? 127 ASP B CA   2 
ATOM 5359  C C    . ASP B 1 64 ? -10.721 26.617  -45.408 1.00 0.00 ? 127 ASP B C    2 
ATOM 5360  O O    . ASP B 1 64 ? -10.713 26.750  -46.631 1.00 0.00 ? 127 ASP B O    2 
ATOM 5361  C CB   . ASP B 1 64 ? -8.962  28.349  -45.034 1.00 0.00 ? 127 ASP B CB   2 
ATOM 5362  C CG   . ASP B 1 64 ? -8.557  29.628  -44.314 1.00 0.00 ? 127 ASP B CG   2 
ATOM 5363  O OD1  . ASP B 1 64 ? -9.429  30.383  -43.953 1.00 0.00 ? 127 ASP B OD1  2 
ATOM 5364  O OD2  . ASP B 1 64 ? -7.384  29.839  -44.135 1.00 0.00 ? 127 ASP B OD2  2 
ATOM 5365  H H    . ASP B 1 64 ? -9.242  26.753  -42.891 1.00 0.00 ? 127 ASP B H    2 
ATOM 5366  H HA   . ASP B 1 64 ? -11.023 28.534  -44.516 1.00 0.00 ? 127 ASP B HA   2 
ATOM 5367  H HB2  . ASP B 1 64 ? -8.167  27.615  -44.913 1.00 0.00 ? 127 ASP B HB2  2 
ATOM 5368  H HB3  . ASP B 1 64 ? -9.083  28.568  -46.096 1.00 0.00 ? 127 ASP B HB3  2 
ATOM 5369  N N    . VAL B 1 65 ? -11.119 25.502  -44.805 1.00 0.00 ? 128 VAL B N    2 
ATOM 5370  C CA   . VAL B 1 65 ? -11.530 24.325  -45.561 1.00 0.00 ? 128 VAL B CA   2 
ATOM 5371  C C    . VAL B 1 65 ? -12.954 23.914  -45.211 1.00 0.00 ? 128 VAL B C    2 
ATOM 5372  O O    . VAL B 1 65 ? -13.348 23.937  -44.045 1.00 0.00 ? 128 VAL B O    2 
ATOM 5373  C CB   . VAL B 1 65 ? -10.576 23.149  -45.278 1.00 0.00 ? 128 VAL B CB   2 
ATOM 5374  C CG1  . VAL B 1 65 ? -11.134 21.859  -45.862 1.00 0.00 ? 128 VAL B CG1  2 
ATOM 5375  C CG2  . VAL B 1 65 ? -9.200  23.449  -45.851 1.00 0.00 ? 128 VAL B CG2  2 
ATOM 5376  H H    . VAL B 1 65 ? -11.097 25.453  -43.785 1.00 0.00 ? 128 VAL B H    2 
ATOM 5377  H HA   . VAL B 1 65 ? -11.490 24.536  -46.630 1.00 0.00 ? 128 VAL B HA   2 
ATOM 5378  H HB   . VAL B 1 65 ? -10.486 23.067  -44.208 1.00 0.00 ? 128 VAL B HB   2 
ATOM 5379  H HG11 . VAL B 1 65 ? -11.110 21.930  -46.938 1.00 0.00 ? 128 VAL B HG11 2 
ATOM 5380  H HG12 . VAL B 1 65 ? -12.150 21.660  -45.533 1.00 0.00 ? 128 VAL B HG12 2 
ATOM 5381  H HG13 . VAL B 1 65 ? -10.493 21.036  -45.549 1.00 0.00 ? 128 VAL B HG13 2 
ATOM 5382  H HG21 . VAL B 1 65 ? -8.502  22.649  -45.639 1.00 0.00 ? 128 VAL B HG21 2 
ATOM 5383  H HG22 . VAL B 1 65 ? -8.827  24.384  -45.457 1.00 0.00 ? 128 VAL B HG22 2 
ATOM 5384  H HG23 . VAL B 1 65 ? -9.304  23.544  -46.932 1.00 0.00 ? 128 VAL B HG23 2 
ATOM 5385  N N    . ASP B 1 66 ? -13.722 23.541  -46.227 1.00 0.00 ? 129 ASP B N    2 
ATOM 5386  C CA   . ASP B 1 66 ? -15.131 23.212  -46.043 1.00 0.00 ? 129 ASP B CA   2 
ATOM 5387  C C    . ASP B 1 66 ? -15.486 21.899  -46.728 1.00 0.00 ? 129 ASP B C    2 
ATOM 5388  O O    . ASP B 1 66 ? -15.420 21.789  -47.954 1.00 0.00 ? 129 ASP B O    2 
ATOM 5389  C CB   . ASP B 1 66 ? -16.020 24.333  -46.585 1.00 0.00 ? 129 ASP B CB   2 
ATOM 5390  C CG   . ASP B 1 66 ? -17.495 24.128  -46.267 1.00 0.00 ? 129 ASP B CG   2 
ATOM 5391  O OD1  . ASP B 1 66 ? -17.840 23.069  -45.801 1.00 0.00 ? 129 ASP B OD1  2 
ATOM 5392  O OD2  . ASP B 1 66 ? -18.263 25.033  -46.494 1.00 0.00 ? 129 ASP B OD2  2 
ATOM 5393  H H    . ASP B 1 66 ? -13.335 23.553  -47.171 1.00 0.00 ? 129 ASP B H    2 
ATOM 5394  H HA   . ASP B 1 66 ? -15.327 23.161  -44.987 1.00 0.00 ? 129 ASP B HA   2 
ATOM 5395  H HB2  . ASP B 1 66 ? -15.699 25.250  -46.134 1.00 0.00 ? 129 ASP B HB2  2 
ATOM 5396  H HB3  . ASP B 1 66 ? -15.892 24.396  -47.666 1.00 0.00 ? 129 ASP B HB3  2 
ATOM 5397  N N    . PRO B 1 67 ? -15.862 20.903  -45.932 1.00 0.00 ? 130 PRO B N    2 
ATOM 5398  C CA   . PRO B 1 67 ? -16.097 19.560  -46.446 1.00 0.00 ? 130 PRO B CA   2 
ATOM 5399  C C    . PRO B 1 67 ? -17.482 19.444  -47.069 1.00 0.00 ? 130 PRO B C    2 
ATOM 5400  O O    . PRO B 1 67 ? -17.903 18.360  -47.472 1.00 0.00 ? 130 PRO B O    2 
ATOM 5401  C CB   . PRO B 1 67 ? -15.966 18.683  -45.196 1.00 0.00 ? 130 PRO B CB   2 
ATOM 5402  C CG   . PRO B 1 67 ? -16.433 19.561  -44.084 1.00 0.00 ? 130 PRO B CG   2 
ATOM 5403  C CD   . PRO B 1 67 ? -15.904 20.925  -44.436 1.00 0.00 ? 130 PRO B CD   2 
ATOM 5404  H HA   . PRO B 1 67 ? -15.339 19.269  -47.166 1.00 0.00 ? 130 PRO B HA   2 
ATOM 5405  H HB2  . PRO B 1 67 ? -16.608 17.813  -45.280 1.00 0.00 ? 130 PRO B HB2  2 
ATOM 5406  H HB3  . PRO B 1 67 ? -14.928 18.389  -45.035 1.00 0.00 ? 130 PRO B HB3  2 
ATOM 5407  H HG2  . PRO B 1 67 ? -17.529 19.565  -44.050 1.00 0.00 ? 130 PRO B HG2  2 
ATOM 5408  H HG3  . PRO B 1 67 ? -16.039 19.237  -43.130 1.00 0.00 ? 130 PRO B HG3  2 
ATOM 5409  H HD2  . PRO B 1 67 ? -16.618 21.682  -44.100 1.00 0.00 ? 130 PRO B HD2  2 
ATOM 5410  H HD3  . PRO B 1 67 ? -14.919 21.095  -44.000 1.00 0.00 ? 130 PRO B HD3  2 
ATOM 5411  N N    . LEU B 1 68 ? -18.188 20.567  -47.144 1.00 0.00 ? 131 LEU B N    2 
ATOM 5412  C CA   . LEU B 1 68 ? -19.464 20.625  -47.847 1.00 0.00 ? 131 LEU B CA   2 
ATOM 5413  C C    . LEU B 1 68 ? -19.296 21.203  -49.246 1.00 0.00 ? 131 LEU B C    2 
ATOM 5414  O O    . LEU B 1 68 ? -20.272 21.386  -49.973 1.00 0.00 ? 131 LEU B O    2 
ATOM 5415  C CB   . LEU B 1 68 ? -20.467 21.472  -47.054 1.00 0.00 ? 131 LEU B CB   2 
ATOM 5416  C CG   . LEU B 1 68 ? -20.798 20.965  -45.642 1.00 0.00 ? 131 LEU B CG   2 
ATOM 5417  C CD1  . LEU B 1 68 ? -21.752 21.938  -44.965 1.00 0.00 ? 131 LEU B CD1  2 
ATOM 5418  C CD2  . LEU B 1 68 ? -21.407 19.574  -45.734 1.00 0.00 ? 131 LEU B CD2  2 
ATOM 5419  H H    . LEU B 1 68 ? -17.772 21.434  -46.806 1.00 0.00 ? 131 LEU B H    2 
ATOM 5420  H HA   . LEU B 1 68 ? -19.872 19.617  -47.939 1.00 0.00 ? 131 LEU B HA   2 
ATOM 5421  H HB2  . LEU B 1 68 ? -20.058 22.478  -46.965 1.00 0.00 ? 131 LEU B HB2  2 
ATOM 5422  H HB3  . LEU B 1 68 ? -21.396 21.526  -47.623 1.00 0.00 ? 131 LEU B HB3  2 
ATOM 5423  H HG   . LEU B 1 68 ? -19.873 20.917  -45.065 1.00 0.00 ? 131 LEU B HG   2 
ATOM 5424  H HD11 . LEU B 1 68 ? -22.686 21.977  -45.524 1.00 0.00 ? 131 LEU B HD11 2 
ATOM 5425  H HD12 . LEU B 1 68 ? -21.306 22.932  -44.933 1.00 0.00 ? 131 LEU B HD12 2 
ATOM 5426  H HD13 . LEU B 1 68 ? -21.954 21.598  -43.949 1.00 0.00 ? 131 LEU B HD13 2 
ATOM 5427  H HD21 . LEU B 1 68 ? -20.623 18.830  -45.871 1.00 0.00 ? 131 LEU B HD21 2 
ATOM 5428  H HD22 . LEU B 1 68 ? -22.102 19.529  -46.575 1.00 0.00 ? 131 LEU B HD22 2 
ATOM 5429  H HD23 . LEU B 1 68 ? -21.947 19.355  -44.812 1.00 0.00 ? 131 LEU B HD23 2 
ATOM 5430  N N    . THR B 1 69 ? -18.053 21.491  -49.617 1.00 0.00 ? 132 THR B N    2 
ATOM 5431  C CA   . THR B 1 69 ? -17.756 22.058  -50.926 1.00 0.00 ? 132 THR B CA   2 
ATOM 5432  C C    . THR B 1 69 ? -16.942 21.091  -51.775 1.00 0.00 ? 132 THR B C    2 
ATOM 5433  O O    . THR B 1 69 ? -16.464 21.445  -52.853 1.00 0.00 ? 132 THR B O    2 
ATOM 5434  C CB   . THR B 1 69 ? -16.998 23.393  -50.793 1.00 0.00 ? 132 THR B CB   2 
ATOM 5435  O OG1  . THR B 1 69 ? -15.772 23.180  -50.083 1.00 0.00 ? 132 THR B OG1  2 
ATOM 5436  C CG2  . THR B 1 69 ? -17.842 24.413  -50.045 1.00 0.00 ? 132 THR B CG2  2 
ATOM 5437  H H    . THR B 1 69 ? -17.283 21.320  -48.971 1.00 0.00 ? 132 THR B H    2 
ATOM 5438  H HA   . THR B 1 69 ? -18.689 22.265  -51.455 1.00 0.00 ? 132 THR B HA   2 
ATOM 5439  H HB   . THR B 1 69 ? -16.787 23.789  -51.764 1.00 0.00 ? 132 THR B HB   2 
ATOM 5440  H HG1  . THR B 1 69 ? -15.348 22.403  -50.454 1.00 0.00 ? 132 THR B HG1  2 
ATOM 5441  H HG21 . THR B 1 69 ? -17.309 25.361  -49.991 1.00 0.00 ? 132 THR B HG21 2 
ATOM 5442  H HG22 . THR B 1 69 ? -18.039 24.049  -49.036 1.00 0.00 ? 132 THR B HG22 2 
ATOM 5443  H HG23 . THR B 1 69 ? -18.786 24.556  -50.570 1.00 0.00 ? 132 THR B HG23 2 
ATOM 5444  N N    . ILE B 1 70 ? -16.788 19.866  -51.284 1.00 0.00 ? 133 ILE B N    2 
ATOM 5445  C CA   . ILE B 1 70 ? -15.870 18.907  -51.887 1.00 0.00 ? 133 ILE B CA   2 
ATOM 5446  C C    . ILE B 1 70 ? -16.619 17.892  -52.742 1.00 0.00 ? 133 ILE B C    2 
ATOM 5447  O O    . ILE B 1 70 ? -17.793 17.609  -52.502 1.00 0.00 ? 133 ILE B O    2 
ATOM 5448  C CB   . ILE B 1 70 ? -15.058 18.169  -50.808 1.00 0.00 ? 133 ILE B CB   2 
ATOM 5449  C CG1  . ILE B 1 70 ? -15.990 17.400  -49.870 1.00 0.00 ? 133 ILE B CG1  2 
ATOM 5450  C CG2  . ILE B 1 70 ? -14.200 19.150  -50.025 1.00 0.00 ? 133 ILE B CG2  2 
ATOM 5451  C CD1  . ILE B 1 70 ? -15.267 16.544  -48.855 1.00 0.00 ? 133 ILE B CD1  2 
ATOM 5452  H H    . ILE B 1 70 ? -17.194 19.648  -50.373 1.00 0.00 ? 133 ILE B H    2 
ATOM 5453  H HA   . ILE B 1 70 ? -15.180 19.424  -52.525 1.00 0.00 ? 133 ILE B HA   2 
ATOM 5454  H HB   . ILE B 1 70 ? -14.405 17.458  -51.305 1.00 0.00 ? 133 ILE B HB   2 
ATOM 5455  H HG12 . ILE B 1 70 ? -16.595 18.126  -49.344 1.00 0.00 ? 133 ILE B HG12 2 
ATOM 5456  H HG13 . ILE B 1 70 ? -16.648 16.757  -50.453 1.00 0.00 ? 133 ILE B HG13 2 
ATOM 5457  H HG21 . ILE B 1 70 ? -13.483 18.609  -49.416 1.00 0.00 ? 133 ILE B HG21 2 
ATOM 5458  H HG22 . ILE B 1 70 ? -14.842 19.756  -49.387 1.00 0.00 ? 133 ILE B HG22 2 
ATOM 5459  H HG23 . ILE B 1 70 ? -13.670 19.792  -50.719 1.00 0.00 ? 133 ILE B HG23 2 
ATOM 5460  H HD11 . ILE B 1 70 ? -14.663 17.167  -48.201 1.00 0.00 ? 133 ILE B HD11 2 
ATOM 5461  H HD12 . ILE B 1 70 ? -15.998 15.998  -48.258 1.00 0.00 ? 133 ILE B HD12 2 
ATOM 5462  H HD13 . ILE B 1 70 ? -14.622 15.835  -49.374 1.00 0.00 ? 133 ILE B HD13 2 
ATOM 5463  N N    . THR B 1 71 ? -15.934 17.349  -53.743 1.00 0.00 ? 134 THR B N    2 
ATOM 5464  C CA   . THR B 1 71 ? -16.475 16.251  -54.534 1.00 0.00 ? 134 THR B CA   2 
ATOM 5465  C C    . THR B 1 71 ? -15.439 15.153  -54.735 1.00 0.00 ? 134 THR B C    2 
ATOM 5466  O O    . THR B 1 71 ? -14.661 15.185  -55.688 1.00 0.00 ? 134 THR B O    2 
ATOM 5467  C CB   . THR B 1 71 ? -16.972 16.749  -55.904 1.00 0.00 ? 134 THR B CB   2 
ATOM 5468  O OG1  . THR B 1 71 ? -17.943 17.786  -55.716 1.00 0.00 ? 134 THR B OG1  2 
ATOM 5469  C CG2  . THR B 1 71 ? -17.599 15.607  -56.691 1.00 0.00 ? 134 THR B CG2  2 
ATOM 5470  H H    . THR B 1 71 ? -14.957 17.612  -53.870 1.00 0.00 ? 134 THR B H    2 
ATOM 5471  H HA   . THR B 1 71 ? -17.329 15.810  -54.010 1.00 0.00 ? 134 THR B HA   2 
ATOM 5472  H HB   . THR B 1 71 ? -16.130 17.146  -56.467 1.00 0.00 ? 134 THR B HB   2 
ATOM 5473  H HG1  . THR B 1 71 ? -17.738 18.237  -54.895 1.00 0.00 ? 134 THR B HG1  2 
ATOM 5474  H HG21 . THR B 1 71 ? -18.111 16.003  -57.568 1.00 0.00 ? 134 THR B HG21 2 
ATOM 5475  H HG22 . THR B 1 71 ? -18.318 15.088  -56.056 1.00 0.00 ? 134 THR B HG22 2 
ATOM 5476  H HG23 . THR B 1 71 ? -16.822 14.913  -57.006 1.00 0.00 ? 134 THR B HG23 2 
ATOM 5477  N N    . SER B 1 72 ? -15.433 14.180  -53.828 1.00 0.00 ? 135 SER B N    2 
ATOM 5478  C CA   . SER B 1 72 ? -14.498 13.065  -53.909 1.00 0.00 ? 135 SER B CA   2 
ATOM 5479  C C    . SER B 1 72 ? -14.765 12.211  -55.142 1.00 0.00 ? 135 SER B C    2 
ATOM 5480  O O    . SER B 1 72 ? -15.871 12.215  -55.685 1.00 0.00 ? 135 SER B O    2 
ATOM 5481  C CB   . SER B 1 72 ? -14.599 12.209  -52.662 1.00 0.00 ? 135 SER B CB   2 
ATOM 5482  O OG   . SER B 1 72 ? -15.809 11.504  -52.630 1.00 0.00 ? 135 SER B OG   2 
ATOM 5483  H H    . SER B 1 72 ? -16.108 14.210  -53.065 1.00 0.00 ? 135 SER B H    2 
ATOM 5484  H HA   . SER B 1 72 ? -13.497 13.454  -53.985 1.00 0.00 ? 135 SER B HA   2 
ATOM 5485  H HB2  . SER B 1 72 ? -13.772 11.515  -52.624 1.00 0.00 ? 135 SER B HB2  2 
ATOM 5486  H HB3  . SER B 1 72 ? -14.557 12.867  -51.795 1.00 0.00 ? 135 SER B HB3  2 
ATOM 5487  H HG   . SER B 1 72 ? -16.316 11.763  -53.404 1.00 0.00 ? 135 SER B HG   2 
ATOM 5488  N N    . SER B 1 73 ? -13.746 11.478  -55.582 1.00 0.00 ? 136 SER B N    2 
ATOM 5489  C CA   . SER B 1 73 ? -13.849 10.671  -56.791 1.00 0.00 ? 136 SER B CA   2 
ATOM 5490  C C    . SER B 1 73 ? -12.626 9.777   -56.960 1.00 0.00 ? 136 SER B C    2 
ATOM 5491  O O    . SER B 1 73 ? -11.517 10.150  -56.581 1.00 0.00 ? 136 SER B O    2 
ATOM 5492  C CB   . SER B 1 73 ? -14.004 11.565  -58.004 1.00 0.00 ? 136 SER B CB   2 
ATOM 5493  O OG   . SER B 1 73 ? -14.059 10.808  -59.183 1.00 0.00 ? 136 SER B OG   2 
ATOM 5494  H H    . SER B 1 73 ? -12.853 11.531  -55.093 1.00 0.00 ? 136 SER B H    2 
ATOM 5495  H HA   . SER B 1 73 ? -14.735 10.042  -56.711 1.00 0.00 ? 136 SER B HA   2 
ATOM 5496  H HB2  . SER B 1 73 ? -14.921 12.142  -57.917 1.00 0.00 ? 136 SER B HB2  2 
ATOM 5497  H HB3  . SER B 1 73 ? -13.154 12.251  -58.045 1.00 0.00 ? 136 SER B HB3  2 
ATOM 5498  H HG   . SER B 1 73 ? -13.171 10.500  -59.379 1.00 0.00 ? 136 SER B HG   2 
ATOM 5499  N N    . LEU B 1 74 ? -12.837 8.597   -57.533 1.00 0.00 ? 137 LEU B N    2 
ATOM 5500  C CA   . LEU B 1 74 ? -11.750 7.657   -57.774 1.00 0.00 ? 137 LEU B CA   2 
ATOM 5501  C C    . LEU B 1 74 ? -11.343 7.651   -59.242 1.00 0.00 ? 137 LEU B C    2 
ATOM 5502  O O    . LEU B 1 74 ? -12.193 7.609   -60.131 1.00 0.00 ? 137 LEU B O    2 
ATOM 5503  C CB   . LEU B 1 74 ? -12.164 6.244   -57.346 1.00 0.00 ? 137 LEU B CB   2 
ATOM 5504  C CG   . LEU B 1 74 ? -12.026 5.936   -55.849 1.00 0.00 ? 137 LEU B CG   2 
ATOM 5505  C CD1  . LEU B 1 74 ? -13.189 6.559   -55.093 1.00 0.00 ? 137 LEU B CD1  2 
ATOM 5506  C CD2  . LEU B 1 74 ? -11.986 4.428   -55.644 1.00 0.00 ? 137 LEU B CD2  2 
ATOM 5507  H H    . LEU B 1 74 ? -13.781 8.347   -57.826 1.00 0.00 ? 137 LEU B H    2 
ATOM 5508  H HA   . LEU B 1 74 ? -10.878 7.945   -57.182 1.00 0.00 ? 137 LEU B HA   2 
ATOM 5509  H HB2  . LEU B 1 74 ? -13.205 6.095   -57.635 1.00 0.00 ? 137 LEU B HB2  2 
ATOM 5510  H HB3  . LEU B 1 74 ? -11.549 5.523   -57.900 1.00 0.00 ? 137 LEU B HB3  2 
ATOM 5511  H HG   . LEU B 1 74 ? -11.097 6.368   -55.481 1.00 0.00 ? 137 LEU B HG   2 
ATOM 5512  H HD11 . LEU B 1 74 ? -13.176 7.643   -55.213 1.00 0.00 ? 137 LEU B HD11 2 
ATOM 5513  H HD12 . LEU B 1 74 ? -13.110 6.304   -54.035 1.00 0.00 ? 137 LEU B HD12 2 
ATOM 5514  H HD13 . LEU B 1 74 ? -14.125 6.165   -55.485 1.00 0.00 ? 137 LEU B HD13 2 
ATOM 5515  H HD21 . LEU B 1 74 ? -11.060 4.023   -56.054 1.00 0.00 ? 137 LEU B HD21 2 
ATOM 5516  H HD22 . LEU B 1 74 ? -12.837 3.971   -56.150 1.00 0.00 ? 137 LEU B HD22 2 
ATOM 5517  H HD23 . LEU B 1 74 ? -12.036 4.209   -54.578 1.00 0.00 ? 137 LEU B HD23 2 
ATOM 5518  N N    . SER B 1 75 ? -10.038 7.694   -59.491 1.00 0.00 ? 138 SER B N    2 
ATOM 5519  C CA   . SER B 1 75 ? -9.515  7.663   -60.852 1.00 0.00 ? 138 SER B CA   2 
ATOM 5520  C C    . SER B 1 75 ? -9.461  6.239   -61.389 1.00 0.00 ? 138 SER B C    2 
ATOM 5521  O O    . SER B 1 75 ? -9.772  5.283   -60.677 1.00 0.00 ? 138 SER B O    2 
ATOM 5522  C CB   . SER B 1 75 ? -8.134  8.283   -60.893 1.00 0.00 ? 138 SER B CB   2 
ATOM 5523  O OG   . SER B 1 75 ? -7.179  7.418   -60.341 1.00 0.00 ? 138 SER B OG   2 
ATOM 5524  H H    . SER B 1 75 ? -9.383  7.718   -58.711 1.00 0.00 ? 138 SER B H    2 
ATOM 5525  H HA   . SER B 1 75 ? -10.177 8.252   -61.492 1.00 0.00 ? 138 SER B HA   2 
ATOM 5526  H HB2  . SER B 1 75 ? -7.860  8.489   -61.925 1.00 0.00 ? 138 SER B HB2  2 
ATOM 5527  H HB3  . SER B 1 75 ? -8.146  9.222   -60.334 1.00 0.00 ? 138 SER B HB3  2 
ATOM 5528  H HG   . SER B 1 75 ? -6.485  7.280   -60.992 1.00 0.00 ? 138 SER B HG   2 
ATOM 5529  N N    . SER B 1 76 ? -9.065  6.103   -62.649 1.00 0.00 ? 139 SER B N    2 
ATOM 5530  C CA   . SER B 1 76 ? -8.875  4.789   -63.255 1.00 0.00 ? 139 SER B CA   2 
ATOM 5531  C C    . SER B 1 76 ? -7.684  4.066   -62.638 1.00 0.00 ? 139 SER B C    2 
ATOM 5532  O O    . SER B 1 76 ? -7.534  2.855   -62.792 1.00 0.00 ? 139 SER B O    2 
ATOM 5533  C CB   . SER B 1 76 ? -8.672  4.929   -64.751 1.00 0.00 ? 139 SER B CB   2 
ATOM 5534  O OG   . SER B 1 76 ? -7.456  5.565   -65.036 1.00 0.00 ? 139 SER B OG   2 
ATOM 5535  H H    . SER B 1 76 ? -8.811  6.936   -63.180 1.00 0.00 ? 139 SER B H    2 
ATOM 5536  H HA   . SER B 1 76 ? -9.774  4.200   -63.074 1.00 0.00 ? 139 SER B HA   2 
ATOM 5537  H HB2  . SER B 1 76 ? -8.665  3.942   -65.206 1.00 0.00 ? 139 SER B HB2  2 
ATOM 5538  H HB3  . SER B 1 76 ? -9.499  5.509   -65.173 1.00 0.00 ? 139 SER B HB3  2 
ATOM 5539  H HG   . SER B 1 76 ? -6.793  5.206   -64.444 1.00 0.00 ? 139 SER B HG   2 
ATOM 5540  N N    . ASP B 1 77 ? -6.840  4.817   -61.939 1.00 0.00 ? 140 ASP B N    2 
ATOM 5541  C CA   . ASP B 1 77 ? -5.684  4.240   -61.259 1.00 0.00 ? 140 ASP B CA   2 
ATOM 5542  C C    . ASP B 1 77 ? -5.990  3.953   -59.797 1.00 0.00 ? 140 ASP B C    2 
ATOM 5543  O O    . ASP B 1 77 ? -5.147  3.437   -59.065 1.00 0.00 ? 140 ASP B O    2 
ATOM 5544  C CB   . ASP B 1 77 ? -4.481  5.180   -61.360 1.00 0.00 ? 140 ASP B CB   2 
ATOM 5545  C CG   . ASP B 1 77 ? -3.973  5.342   -62.787 1.00 0.00 ? 140 ASP B CG   2 
ATOM 5546  O OD1  . ASP B 1 77 ? -4.144  4.433   -63.564 1.00 0.00 ? 140 ASP B OD1  2 
ATOM 5547  O OD2  . ASP B 1 77 ? -3.419  6.374   -63.085 1.00 0.00 ? 140 ASP B OD2  2 
ATOM 5548  H H    . ASP B 1 77 ? -7.025  5.815   -61.840 1.00 0.00 ? 140 ASP B H    2 
ATOM 5549  H HA   . ASP B 1 77 ? -5.415  3.300   -61.748 1.00 0.00 ? 140 ASP B HA   2 
ATOM 5550  H HB2  . ASP B 1 77 ? -4.775  6.159   -60.981 1.00 0.00 ? 140 ASP B HB2  2 
ATOM 5551  H HB3  . ASP B 1 77 ? -3.673  4.789   -60.741 1.00 0.00 ? 140 ASP B HB3  2 
ATOM 5552  N N    . GLY B 1 78 ? -7.205  4.289   -59.373 1.00 0.00 ? 141 GLY B N    2 
ATOM 5553  C CA   . GLY B 1 78 ? -7.636  4.041   -58.004 1.00 0.00 ? 141 GLY B CA   2 
ATOM 5554  C C    . GLY B 1 78 ? -7.164  5.147   -57.069 1.00 0.00 ? 141 GLY B C    2 
ATOM 5555  O O    . GLY B 1 78 ? -6.854  4.899   -55.903 1.00 0.00 ? 141 GLY B O    2 
ATOM 5556  H H    . GLY B 1 78 ? -7.862  4.708   -60.033 1.00 0.00 ? 141 GLY B H    2 
ATOM 5557  H HA2  . GLY B 1 78 ? -8.724  3.990   -57.973 1.00 0.00 ? 141 GLY B HA2  2 
ATOM 5558  H HA3  . GLY B 1 78 ? -7.227  3.094   -57.666 1.00 0.00 ? 141 GLY B HA3  2 
ATOM 5559  N N    . VAL B 1 79 ? -7.111  6.371   -57.588 1.00 0.00 ? 142 VAL B N    2 
ATOM 5560  C CA   . VAL B 1 79 ? -6.701  7.522   -56.792 1.00 0.00 ? 142 VAL B CA   2 
ATOM 5561  C C    . VAL B 1 79 ? -7.908  8.315   -56.311 1.00 0.00 ? 142 VAL B C    2 
ATOM 5562  O O    . VAL B 1 79 ? -8.655  8.875   -57.112 1.00 0.00 ? 142 VAL B O    2 
ATOM 5563  C CB   . VAL B 1 79 ? -5.784  8.441   -57.619 1.00 0.00 ? 142 VAL B CB   2 
ATOM 5564  C CG1  . VAL B 1 79 ? -5.382  9.664   -56.806 1.00 0.00 ? 142 VAL B CG1  2 
ATOM 5565  C CG2  . VAL B 1 79 ? -4.554  7.670   -58.076 1.00 0.00 ? 142 VAL B CG2  2 
ATOM 5566  H H    . VAL B 1 79 ? -7.384  6.510   -58.562 1.00 0.00 ? 142 VAL B H    2 
ATOM 5567  H HA   . VAL B 1 79 ? -6.139  7.183   -55.920 1.00 0.00 ? 142 VAL B HA   2 
ATOM 5568  H HB   . VAL B 1 79 ? -6.333  8.777   -58.501 1.00 0.00 ? 142 VAL B HB   2 
ATOM 5569  H HG11 . VAL B 1 79 ? -5.028  9.341   -55.828 1.00 0.00 ? 142 VAL B HG11 2 
ATOM 5570  H HG12 . VAL B 1 79 ? -6.239  10.326  -56.685 1.00 0.00 ? 142 VAL B HG12 2 
ATOM 5571  H HG13 . VAL B 1 79 ? -4.582  10.198  -57.322 1.00 0.00 ? 142 VAL B HG13 2 
ATOM 5572  H HG21 . VAL B 1 79 ? -3.927  8.313   -58.694 1.00 0.00 ? 142 VAL B HG21 2 
ATOM 5573  H HG22 . VAL B 1 79 ? -3.990  7.346   -57.200 1.00 0.00 ? 142 VAL B HG22 2 
ATOM 5574  H HG23 . VAL B 1 79 ? -4.860  6.798   -58.653 1.00 0.00 ? 142 VAL B HG23 2 
ATOM 5575  N N    . LEU B 1 80 ? -8.094  8.361   -54.995 1.00 0.00 ? 143 LEU B N    2 
ATOM 5576  C CA   . LEU B 1 80 ? -9.173  9.141   -54.400 1.00 0.00 ? 143 LEU B CA   2 
ATOM 5577  C C    . LEU B 1 80 ? -8.815  10.619  -54.344 1.00 0.00 ? 143 LEU B C    2 
ATOM 5578  O O    . LEU B 1 80 ? -7.814  11.003  -53.740 1.00 0.00 ? 143 LEU B O    2 
ATOM 5579  C CB   . LEU B 1 80 ? -9.479  8.628   -52.988 1.00 0.00 ? 143 LEU B CB   2 
ATOM 5580  C CG   . LEU B 1 80 ? -10.569 9.392   -52.225 1.00 0.00 ? 143 LEU B CG   2 
ATOM 5581  C CD1  . LEU B 1 80 ? -11.900 9.235   -52.946 1.00 0.00 ? 143 LEU B CD1  2 
ATOM 5582  C CD2  . LEU B 1 80 ? -10.654 8.865   -50.798 1.00 0.00 ? 143 LEU B CD2  2 
ATOM 5583  H H    . LEU B 1 80 ? -7.432  7.885   -54.385 1.00 0.00 ? 143 LEU B H    2 
ATOM 5584  H HA   . LEU B 1 80 ? -10.065 9.020   -55.012 1.00 0.00 ? 143 LEU B HA   2 
ATOM 5585  H HB2  . LEU B 1 80 ? -9.814  7.609   -53.075 1.00 0.00 ? 143 LEU B HB2  2 
ATOM 5586  H HB3  . LEU B 1 80 ? -8.571  8.633   -52.427 1.00 0.00 ? 143 LEU B HB3  2 
ATOM 5587  H HG   . LEU B 1 80 ? -10.302 10.448  -52.195 1.00 0.00 ? 143 LEU B HG   2 
ATOM 5588  H HD11 . LEU B 1 80 ? -11.930 9.881   -53.823 1.00 0.00 ? 143 LEU B HD11 2 
ATOM 5589  H HD12 . LEU B 1 80 ? -12.706 9.507   -52.268 1.00 0.00 ? 143 LEU B HD12 2 
ATOM 5590  H HD13 . LEU B 1 80 ? -12.033 8.203   -53.252 1.00 0.00 ? 143 LEU B HD13 2 
ATOM 5591  H HD21 . LEU B 1 80 ? -11.233 9.562   -50.192 1.00 0.00 ? 143 LEU B HD21 2 
ATOM 5592  H HD22 . LEU B 1 80 ? -9.658  8.758   -50.373 1.00 0.00 ? 143 LEU B HD22 2 
ATOM 5593  H HD23 . LEU B 1 80 ? -11.151 7.895   -50.806 1.00 0.00 ? 143 LEU B HD23 2 
ATOM 5594  N N    . THR B 1 81 ? -9.640  11.447  -54.975 1.00 0.00 ? 144 THR B N    2 
ATOM 5595  C CA   . THR B 1 81 ? -9.363  12.874  -55.080 1.00 0.00 ? 144 THR B CA   2 
ATOM 5596  C C    . THR B 1 81 ? -10.464 13.700  -54.424 1.00 0.00 ? 144 THR B C    2 
ATOM 5597  O O    . THR B 1 81 ? -11.492 13.979  -55.039 1.00 0.00 ? 144 THR B O    2 
ATOM 5598  C CB   . THR B 1 81 ? -9.205  13.302  -56.551 1.00 0.00 ? 144 THR B CB   2 
ATOM 5599  O OG1  . THR B 1 81 ? -8.143  12.552  -57.156 1.00 0.00 ? 144 THR B OG1  2 
ATOM 5600  C CG2  . THR B 1 81 ? -8.889  14.787  -56.645 1.00 0.00 ? 144 THR B CG2  2 
ATOM 5601  H H    . THR B 1 81 ? -10.446 11.065  -55.462 1.00 0.00 ? 144 THR B H    2 
ATOM 5602  H HA   . THR B 1 81 ? -8.439  13.094  -54.570 1.00 0.00 ? 144 THR B HA   2 
ATOM 5603  H HB   . THR B 1 81 ? -10.132 13.102  -57.086 1.00 0.00 ? 144 THR B HB   2 
ATOM 5604  H HG1  . THR B 1 81 ? -8.042  12.859  -58.061 1.00 0.00 ? 144 THR B HG1  2 
ATOM 5605  H HG21 . THR B 1 81 ? -8.103  15.035  -55.932 1.00 0.00 ? 144 THR B HG21 2 
ATOM 5606  H HG22 . THR B 1 81 ? -9.784  15.363  -56.413 1.00 0.00 ? 144 THR B HG22 2 
ATOM 5607  H HG23 . THR B 1 81 ? -8.552  15.027  -57.652 1.00 0.00 ? 144 THR B HG23 2 
ATOM 5608  N N    . VAL B 1 82 ? -10.241 14.085  -53.173 1.00 0.00 ? 145 VAL B N    2 
ATOM 5609  C CA   . VAL B 1 82 ? -11.153 14.981  -52.475 1.00 0.00 ? 145 VAL B CA   2 
ATOM 5610  C C    . VAL B 1 82 ? -10.748 16.437  -52.662 1.00 0.00 ? 145 VAL B C    2 
ATOM 5611  O O    . VAL B 1 82 ? -9.656  16.844  -52.262 1.00 0.00 ? 145 VAL B O    2 
ATOM 5612  C CB   . VAL B 1 82 ? -11.180 14.648  -50.971 1.00 0.00 ? 145 VAL B CB   2 
ATOM 5613  C CG1  . VAL B 1 82 ? -12.129 15.585  -50.235 1.00 0.00 ? 145 VAL B CG1  2 
ATOM 5614  C CG2  . VAL B 1 82 ? -11.589 13.198  -50.768 1.00 0.00 ? 145 VAL B CG2  2 
ATOM 5615  H H    . VAL B 1 82 ? -9.357  13.833  -52.730 1.00 0.00 ? 145 VAL B H    2 
ATOM 5616  H HA   . VAL B 1 82 ? -12.157 14.854  -52.867 1.00 0.00 ? 145 VAL B HA   2 
ATOM 5617  H HB   . VAL B 1 82 ? -10.186 14.794  -50.563 1.00 0.00 ? 145 VAL B HB   2 
ATOM 5618  H HG11 . VAL B 1 82 ? -13.034 15.674  -50.821 1.00 0.00 ? 145 VAL B HG11 2 
ATOM 5619  H HG12 . VAL B 1 82 ? -11.669 16.566  -50.125 1.00 0.00 ? 145 VAL B HG12 2 
ATOM 5620  H HG13 . VAL B 1 82 ? -12.366 15.180  -49.250 1.00 0.00 ? 145 VAL B HG13 2 
ATOM 5621  H HG21 . VAL B 1 82 ? -12.663 13.131  -50.638 1.00 0.00 ? 145 VAL B HG21 2 
ATOM 5622  H HG22 . VAL B 1 82 ? -11.105 12.806  -49.871 1.00 0.00 ? 145 VAL B HG22 2 
ATOM 5623  H HG23 . VAL B 1 82 ? -11.289 12.591  -51.625 1.00 0.00 ? 145 VAL B HG23 2 
ATOM 5624  N N    . ASP B 1 83 ? -11.632 17.219  -53.271 1.00 0.00 ? 146 ASP B N    2 
ATOM 5625  C CA   . ASP B 1 83 ? -11.300 18.577  -53.684 1.00 0.00 ? 146 ASP B CA   2 
ATOM 5626  C C    . ASP B 1 83 ? -12.532 19.470  -53.685 1.00 0.00 ? 146 ASP B C    2 
ATOM 5627  O O    . ASP B 1 83 ? -13.626 19.038  -54.054 1.00 0.00 ? 146 ASP B O    2 
ATOM 5628  C CB   . ASP B 1 83 ? -10.661 18.573  -55.076 1.00 0.00 ? 146 ASP B CB   2 
ATOM 5629  C CG   . ASP B 1 83 ? -11.637 18.160  -56.171 1.00 0.00 ? 146 ASP B CG   2 
ATOM 5630  O OD1  . ASP B 1 83 ? -12.369 19.001  -56.635 1.00 0.00 ? 146 ASP B OD1  2 
ATOM 5631  O OD2  . ASP B 1 83 ? -11.637 17.009  -56.535 1.00 0.00 ? 146 ASP B OD2  2 
ATOM 5632  H H    . ASP B 1 83 ? -12.506 16.808  -53.598 1.00 0.00 ? 146 ASP B H    2 
ATOM 5633  H HA   . ASP B 1 83 ? -10.600 18.991  -52.966 1.00 0.00 ? 146 ASP B HA   2 
ATOM 5634  H HB2  . ASP B 1 83 ? -10.288 19.572  -55.298 1.00 0.00 ? 146 ASP B HB2  2 
ATOM 5635  H HB3  . ASP B 1 83 ? -9.825  17.873  -55.072 1.00 0.00 ? 146 ASP B HB3  2 
ATOM 5636  N N    . GLY B 1 84 ? -12.352 20.720  -53.271 1.00 0.00 ? 147 GLY B N    2 
ATOM 5637  C CA   . GLY B 1 84 ? -13.464 21.655  -53.151 1.00 0.00 ? 147 GLY B CA   2 
ATOM 5638  C C    . GLY B 1 84 ? -12.968 23.066  -52.864 1.00 0.00 ? 147 GLY B C    2 
ATOM 5639  O O    . GLY B 1 84 ? -11.906 23.253  -52.272 1.00 0.00 ? 147 GLY B O    2 
ATOM 5640  H H    . GLY B 1 84 ? -11.424 21.008  -52.964 1.00 0.00 ? 147 GLY B H    2 
ATOM 5641  H HA2  . GLY B 1 84 ? -14.003 21.607  -54.081 1.00 0.00 ? 147 GLY B HA2  2 
ATOM 5642  H HA3  . GLY B 1 84 ? -14.124 21.363  -52.348 1.00 0.00 ? 147 GLY B HA3  2 
ATOM 5643  N N    . PRO B 1 85 ? -13.744 24.059  -53.286 1.00 0.00 ? 148 PRO B N    2 
ATOM 5644  C CA   . PRO B 1 85 ? -13.429 25.454  -52.999 1.00 0.00 ? 148 PRO B CA   2 
ATOM 5645  C C    . PRO B 1 85 ? -13.248 25.681  -51.503 1.00 0.00 ? 148 PRO B C    2 
ATOM 5646  O O    . PRO B 1 85 ? -13.833 24.975  -50.684 1.00 0.00 ? 148 PRO B O    2 
ATOM 5647  C CB   . PRO B 1 85 ? -14.652 26.201  -53.541 1.00 0.00 ? 148 PRO B CB   2 
ATOM 5648  C CG   . PRO B 1 85 ? -15.177 25.312  -54.617 1.00 0.00 ? 148 PRO B CG   2 
ATOM 5649  C CD   . PRO B 1 85 ? -14.974 23.920  -54.084 1.00 0.00 ? 148 PRO B CD   2 
ATOM 5650  H HA   . PRO B 1 85 ? -12.558 25.762  -53.549 1.00 0.00 ? 148 PRO B HA   2 
ATOM 5651  H HB2  . PRO B 1 85 ? -15.402 26.333  -52.753 1.00 0.00 ? 148 PRO B HB2  2 
ATOM 5652  H HB3  . PRO B 1 85 ? -14.365 27.169  -53.954 1.00 0.00 ? 148 PRO B HB3  2 
ATOM 5653  H HG2  . PRO B 1 85 ? -16.239 25.509  -54.786 1.00 0.00 ? 148 PRO B HG2  2 
ATOM 5654  H HG3  . PRO B 1 85 ? -14.612 25.459  -55.540 1.00 0.00 ? 148 PRO B HG3  2 
ATOM 5655  H HD2  . PRO B 1 85 ? -15.813 23.590  -53.507 1.00 0.00 ? 148 PRO B HD2  2 
ATOM 5656  H HD3  . PRO B 1 85 ? -14.805 23.256  -54.924 1.00 0.00 ? 148 PRO B HD3  2 
ATOM 5657  N N    . ARG B 1 86 ? -12.435 26.672  -51.156 1.00 0.00 ? 149 ARG B N    2 
ATOM 5658  C CA   . ARG B 1 86 ? -12.168 26.989  -49.759 1.00 0.00 ? 149 ARG B CA   2 
ATOM 5659  C C    . ARG B 1 86 ? -13.456 27.293  -49.004 1.00 0.00 ? 149 ARG B C    2 
ATOM 5660  O O    . ARG B 1 86 ? -14.508 27.497  -49.612 1.00 0.00 ? 149 ARG B O    2 
ATOM 5661  C CB   . ARG B 1 86 ? -11.229 28.180  -49.650 1.00 0.00 ? 149 ARG B CB   2 
ATOM 5662  C CG   . ARG B 1 86 ? -9.789  27.898  -50.051 1.00 0.00 ? 149 ARG B CG   2 
ATOM 5663  C CD   . ARG B 1 86 ? -8.919  29.084  -49.850 1.00 0.00 ? 149 ARG B CD   2 
ATOM 5664  N NE   . ARG B 1 86 ? -7.567  28.853  -50.333 1.00 0.00 ? 149 ARG B NE   2 
ATOM 5665  C CZ   . ARG B 1 86 ? -6.541  29.712  -50.173 1.00 0.00 ? 149 ARG B CZ   2 
ATOM 5666  N NH1  . ARG B 1 86 ? -6.728  30.850  -49.542 1.00 0.00 ? 149 ARG B NH1  2 
ATOM 5667  N NH2  . ARG B 1 86 ? -5.346  29.410  -50.649 1.00 0.00 ? 149 ARG B NH2  2 
ATOM 5668  H H    . ARG B 1 86 ? -11.979 27.223  -51.884 1.00 0.00 ? 149 ARG B H    2 
ATOM 5669  H HA   . ARG B 1 86 ? -11.679 26.141  -49.294 1.00 0.00 ? 149 ARG B HA   2 
ATOM 5670  H HB2  . ARG B 1 86 ? -11.606 28.970  -50.291 1.00 0.00 ? 149 ARG B HB2  2 
ATOM 5671  H HB3  . ARG B 1 86 ? -11.226 28.537  -48.617 1.00 0.00 ? 149 ARG B HB3  2 
ATOM 5672  H HG2  . ARG B 1 86 ? -9.415  27.065  -49.453 1.00 0.00 ? 149 ARG B HG2  2 
ATOM 5673  H HG3  . ARG B 1 86 ? -9.765  27.626  -51.106 1.00 0.00 ? 149 ARG B HG3  2 
ATOM 5674  H HD2  . ARG B 1 86 ? -9.354  29.949  -50.338 1.00 0.00 ? 149 ARG B HD2  2 
ATOM 5675  H HD3  . ARG B 1 86 ? -8.863  29.281  -48.778 1.00 0.00 ? 149 ARG B HD3  2 
ATOM 5676  H HE   . ARG B 1 86 ? -7.394  28.020  -50.817 1.00 0.00 ? 149 ARG B HE   2 
ATOM 5677  H HH11 . ARG B 1 86 ? -7.632  31.081  -49.180 1.00 0.00 ? 149 ARG B HH11 2 
ATOM 5678  H HH12 . ARG B 1 86 ? -5.958  31.493  -49.421 1.00 0.00 ? 149 ARG B HH12 2 
ATOM 5679  H HH21 . ARG B 1 86 ? -5.201  28.546  -51.133 1.00 0.00 ? 149 ARG B HH21 2 
ATOM 5680  H HH22 . ARG B 1 86 ? -4.585  30.048  -50.526 1.00 0.00 ? 149 ARG B HH22 2 
ATOM 5681  N N    . LYS B 1 87 ? -13.369 27.323  -47.680 1.00 0.00 ? 150 LYS B N    2 
ATOM 5682  C CA   . LYS B 1 87 ? -14.497 27.716  -46.847 1.00 0.00 ? 150 LYS B CA   2 
ATOM 5683  C C    . LYS B 1 87 ? -14.828 29.193  -47.024 1.00 0.00 ? 150 LYS B C    2 
ATOM 5684  O O    . LYS B 1 87 ? -15.979 29.603  -46.882 1.00 0.00 ? 150 LYS B O    2 
ATOM 5685  C CB   . LYS B 1 87 ? -14.206 27.419  -45.374 1.00 0.00 ? 150 LYS B CB   2 
ATOM 5686  C CG   . LYS B 1 87 ? -15.406 27.576  -44.450 1.00 0.00 ? 150 LYS B CG   2 
ATOM 5687  C CD   . LYS B 1 87 ? -15.102 27.052  -43.053 1.00 0.00 ? 150 LYS B CD   2 
ATOM 5688  C CE   . LYS B 1 87 ? -16.327 27.125  -42.156 1.00 0.00 ? 150 LYS B CE   2 
ATOM 5689  N NZ   . LYS B 1 87 ? -16.051 26.595  -40.792 1.00 0.00 ? 150 LYS B NZ   2 
ATOM 5690  H H    . LYS B 1 87 ? -12.463 27.165  -47.241 1.00 0.00 ? 150 LYS B H    2 
ATOM 5691  H HA   . LYS B 1 87 ? -15.361 27.146  -47.161 1.00 0.00 ? 150 LYS B HA   2 
ATOM 5692  H HB2  . LYS B 1 87 ? -13.840 26.399  -45.288 1.00 0.00 ? 150 LYS B HB2  2 
ATOM 5693  H HB3  . LYS B 1 87 ? -13.420 28.098  -45.041 1.00 0.00 ? 150 LYS B HB3  2 
ATOM 5694  H HG2  . LYS B 1 87 ? -15.652 28.636  -44.379 1.00 0.00 ? 150 LYS B HG2  2 
ATOM 5695  H HG3  . LYS B 1 87 ? -16.259 27.040  -44.859 1.00 0.00 ? 150 LYS B HG3  2 
ATOM 5696  H HD2  . LYS B 1 87 ? -14.779 26.013  -43.128 1.00 0.00 ? 150 LYS B HD2  2 
ATOM 5697  H HD3  . LYS B 1 87 ? -14.306 27.647  -42.613 1.00 0.00 ? 150 LYS B HD3  2 
ATOM 5698  H HE2  . LYS B 1 87 ? -16.640 28.166  -42.073 1.00 0.00 ? 150 LYS B HE2  2 
ATOM 5699  H HE3  . LYS B 1 87 ? -17.133 26.544  -42.607 1.00 0.00 ? 150 LYS B HE3  2 
ATOM 5700  H HZ1  . LYS B 1 87 ? -15.074 26.236  -40.759 1.00 0.00 ? 150 LYS B HZ1  2 
ATOM 5701  H HZ2  . LYS B 1 87 ? -16.713 25.824  -40.573 1.00 0.00 ? 150 LYS B HZ2  2 
ATOM 5702  H HZ3  . LYS B 1 87 ? -16.160 27.336  -40.115 1.00 0.00 ? 150 LYS B HZ3  2 
ATOM 5703  N N    . GLN B 1 88 ? -13.810 29.987  -47.342 1.00 0.00 ? 151 GLN B N    2 
ATOM 5704  C CA   . GLN B 1 88 ? -14.001 31.408  -47.603 1.00 0.00 ? 151 GLN B CA   2 
ATOM 5705  C C    . GLN B 1 88 ? -14.903 31.628  -48.811 1.00 0.00 ? 151 GLN B C    2 
ATOM 5706  O O    . GLN B 1 88 ? -15.672 32.591  -48.857 1.00 0.00 ? 151 GLN B O    2 
ATOM 5707  C CB   . GLN B 1 88 ? -12.651 32.098  -47.825 1.00 0.00 ? 151 GLN B CB   2 
ATOM 5708  C CG   . GLN B 1 88 ? -11.781 32.175  -46.582 1.00 0.00 ? 151 GLN B CG   2 
ATOM 5709  C CD   . GLN B 1 88 ? -10.443 32.835  -46.853 1.00 0.00 ? 151 GLN B CD   2 
ATOM 5710  O OE1  . GLN B 1 88 ? -10.279 33.554  -47.844 1.00 0.00 ? 151 GLN B OE1  2 
ATOM 5711  N NE2  . GLN B 1 88 ? -9.476  32.596  -45.974 1.00 0.00 ? 151 GLN B NE2  2 
ATOM 5712  H H    . GLN B 1 88 ? -12.882 29.582  -47.457 1.00 0.00 ? 151 GLN B H    2 
ATOM 5713  H HA   . GLN B 1 88 ? -14.469 31.855  -46.727 1.00 0.00 ? 151 GLN B HA   2 
ATOM 5714  H HB2  . GLN B 1 88 ? -12.106 31.545  -48.586 1.00 0.00 ? 151 GLN B HB2  2 
ATOM 5715  H HB3  . GLN B 1 88 ? -12.830 33.111  -48.185 1.00 0.00 ? 151 GLN B HB3  2 
ATOM 5716  H HG2  . GLN B 1 88 ? -12.313 32.751  -45.824 1.00 0.00 ? 151 GLN B HG2  2 
ATOM 5717  H HG3  . GLN B 1 88 ? -11.614 31.165  -46.210 1.00 0.00 ? 151 GLN B HG3  2 
ATOM 5718  H HE21 . GLN B 1 88 ? -9.646  32.001  -45.162 1.00 0.00 ? 151 GLN B HE21 2 
ATOM 5719  H HE22 . GLN B 1 88 ? -8.558  33.015  -46.116 1.00 0.00 ? 151 GLN B HE22 2 
ATOM 5720  N N    . VAL B 1 89 ? -14.804 30.736  -49.789 1.00 0.00 ? 152 VAL B N    2 
ATOM 5721  C CA   . VAL B 1 89 ? -15.614 30.828  -50.997 1.00 0.00 ? 152 VAL B CA   2 
ATOM 5722  C C    . VAL B 1 89 ? -17.096 30.669  -50.679 1.00 0.00 ? 152 VAL B C    2 
ATOM 5723  O O    . VAL B 1 89 ? -17.471 29.598  -50.230 1.00 0.00 ? 152 VAL B O    2 
ATOM 5724  C CB   . VAL B 1 89 ? -15.190 29.748  -52.009 1.00 0.00 ? 152 VAL B CB   2 
ATOM 5725  C CG1  . VAL B 1 89 ? -16.110 29.764  -53.220 1.00 0.00 ? 152 VAL B CG1  2 
ATOM 5726  C CG2  . VAL B 1 89 ? -13.744 29.971  -52.428 1.00 0.00 ? 152 VAL B CG2  2 
ATOM 5727  O OXT  . VAL B 1 89 ? -17.850 31.581  -50.976 1.00 0.00 ? 152 VAL B OXT  2 
ATOM 5728  H H    . VAL B 1 89 ? -14.148 29.962  -49.688 1.00 0.00 ? 152 VAL B H    2 
ATOM 5729  H HA   . VAL B 1 89 ? -15.455 31.806  -51.453 1.00 0.00 ? 152 VAL B HA   2 
ATOM 5730  H HB   . VAL B 1 89 ? -15.270 28.773  -51.527 1.00 0.00 ? 152 VAL B HB   2 
ATOM 5731  H HG11 . VAL B 1 89 ? -16.234 30.792  -53.563 1.00 0.00 ? 152 VAL B HG11 2 
ATOM 5732  H HG12 . VAL B 1 89 ? -17.082 29.350  -52.954 1.00 0.00 ? 152 VAL B HG12 2 
ATOM 5733  H HG13 . VAL B 1 89 ? -15.670 29.166  -54.019 1.00 0.00 ? 152 VAL B HG13 2 
ATOM 5734  H HG21 . VAL B 1 89 ? -13.698 30.793  -53.141 1.00 0.00 ? 152 VAL B HG21 2 
ATOM 5735  H HG22 . VAL B 1 89 ? -13.142 30.218  -51.556 1.00 0.00 ? 152 VAL B HG22 2 
ATOM 5736  H HG23 . VAL B 1 89 ? -13.355 29.065  -52.893 1.00 0.00 ? 152 VAL B HG23 2 
ATOM 5737  N N    . GLY A 1 1  ? 12.157  -3.963  -53.204 1.00 0.00 ? 64  GLY A N    3 
ATOM 5738  C CA   . GLY A 1 1  ? 11.244  -4.838  -53.930 1.00 0.00 ? 64  GLY A CA   3 
ATOM 5739  C C    . GLY A 1 1  ? 10.544  -5.808  -52.987 1.00 0.00 ? 64  GLY A C    3 
ATOM 5740  O O    . GLY A 1 1  ? 9.439   -5.544  -52.516 1.00 0.00 ? 64  GLY A O    3 
ATOM 5741  H H1   . GLY A 1 1  ? 11.677  -3.556  -52.414 1.00 0.00 ? 64  GLY A H1   3 
ATOM 5742  H H2   . GLY A 1 1  ? 12.972  -4.514  -52.869 1.00 0.00 ? 64  GLY A H2   3 
ATOM 5743  H H3   . GLY A 1 1  ? 12.486  -3.208  -53.836 1.00 0.00 ? 64  GLY A H3   3 
ATOM 5744  H HA2  . GLY A 1 1  ? 10.494  -4.230  -54.439 1.00 0.00 ? 64  GLY A HA2  3 
ATOM 5745  H HA3  . GLY A 1 1  ? 11.806  -5.405  -54.674 1.00 0.00 ? 64  GLY A HA3  3 
ATOM 5746  N N    . LEU A 1 2  ? 11.197  -6.932  -52.715 1.00 0.00 ? 65  LEU A N    3 
ATOM 5747  C CA   . LEU A 1 2  ? 10.637  -7.947  -51.829 1.00 0.00 ? 65  LEU A CA   3 
ATOM 5748  C C    . LEU A 1 2  ? 11.199  -7.819  -50.419 1.00 0.00 ? 65  LEU A C    3 
ATOM 5749  O O    . LEU A 1 2  ? 12.249  -7.210  -50.211 1.00 0.00 ? 65  LEU A O    3 
ATOM 5750  C CB   . LEU A 1 2  ? 10.930  -9.350  -52.377 1.00 0.00 ? 65  LEU A CB   3 
ATOM 5751  C CG   . LEU A 1 2  ? 10.373  -9.649  -53.773 1.00 0.00 ? 65  LEU A CG   3 
ATOM 5752  C CD1  . LEU A 1 2  ? 10.810  -11.041 -54.208 1.00 0.00 ? 65  LEU A CD1  3 
ATOM 5753  C CD2  . LEU A 1 2  ? 8.856   -9.535  -53.750 1.00 0.00 ? 65  LEU A CD2  3 
ATOM 5754  H H    . LEU A 1 2  ? 12.112  -7.092  -53.136 1.00 0.00 ? 65  LEU A H    3 
ATOM 5755  H HA   . LEU A 1 2  ? 9.554   -7.827  -51.776 1.00 0.00 ? 65  LEU A HA   3 
ATOM 5756  H HB2  . LEU A 1 2  ? 12.011  -9.479  -52.409 1.00 0.00 ? 65  LEU A HB2  3 
ATOM 5757  H HB3  . LEU A 1 2  ? 10.517  -10.082 -51.680 1.00 0.00 ? 65  LEU A HB3  3 
ATOM 5758  H HG   . LEU A 1 2  ? 10.777  -8.916  -54.473 1.00 0.00 ? 65  LEU A HG   3 
ATOM 5759  H HD11 . LEU A 1 2  ? 11.895  -11.127 -54.133 1.00 0.00 ? 65  LEU A HD11 3 
ATOM 5760  H HD12 . LEU A 1 2  ? 10.502  -11.209 -55.241 1.00 0.00 ? 65  LEU A HD12 3 
ATOM 5761  H HD13 . LEU A 1 2  ? 10.340  -11.784 -53.563 1.00 0.00 ? 65  LEU A HD13 3 
ATOM 5762  H HD21 . LEU A 1 2  ? 8.441   -10.048 -54.620 1.00 0.00 ? 65  LEU A HD21 3 
ATOM 5763  H HD22 . LEU A 1 2  ? 8.558   -8.486  -53.780 1.00 0.00 ? 65  LEU A HD22 3 
ATOM 5764  H HD23 . LEU A 1 2  ? 8.464   -9.997  -52.840 1.00 0.00 ? 65  LEU A HD23 3 
ATOM 5765  N N    . SER A 1 3  ? 10.493  -8.394  -49.451 1.00 0.00 ? 66  SER A N    3 
ATOM 5766  C CA   . SER A 1 3  ? 10.898  -8.311  -48.054 1.00 0.00 ? 66  SER A CA   3 
ATOM 5767  C C    . SER A 1 3  ? 12.265  -8.948  -47.837 1.00 0.00 ? 66  SER A C    3 
ATOM 5768  O O    . SER A 1 3  ? 12.528  -10.051 -48.315 1.00 0.00 ? 66  SER A O    3 
ATOM 5769  C CB   . SER A 1 3  ? 9.870   -8.988  -47.170 1.00 0.00 ? 66  SER A CB   3 
ATOM 5770  O OG   . SER A 1 3  ? 10.265  -8.962  -45.826 1.00 0.00 ? 66  SER A OG   3 
ATOM 5771  H H    . SER A 1 3  ? 9.624   -8.880  -49.686 1.00 0.00 ? 66  SER A H    3 
ATOM 5772  H HA   . SER A 1 3  ? 10.958  -7.260  -47.767 1.00 0.00 ? 66  SER A HA   3 
ATOM 5773  H HB2  . SER A 1 3  ? 8.918   -8.467  -47.265 1.00 0.00 ? 66  SER A HB2  3 
ATOM 5774  H HB3  . SER A 1 3  ? 9.753   -10.008 -47.519 1.00 0.00 ? 66  SER A HB3  3 
ATOM 5775  H HG   . SER A 1 3  ? 11.132  -8.550  -45.781 1.00 0.00 ? 66  SER A HG   3 
ATOM 5776  N N    . GLU A 1 4  ? 13.130  -8.247  -47.113 1.00 0.00 ? 67  GLU A N    3 
ATOM 5777  C CA   . GLU A 1 4  ? 14.471  -8.744  -46.828 1.00 0.00 ? 67  GLU A CA   3 
ATOM 5778  C C    . GLU A 1 4  ? 14.420  -10.043 -46.034 1.00 0.00 ? 67  GLU A C    3 
ATOM 5779  O O    . GLU A 1 4  ? 13.725  -10.135 -45.022 1.00 0.00 ? 67  GLU A O    3 
ATOM 5780  C CB   . GLU A 1 4  ? 15.279  -7.695  -46.059 1.00 0.00 ? 67  GLU A CB   3 
ATOM 5781  C CG   . GLU A 1 4  ? 16.723  -8.088  -45.788 1.00 0.00 ? 67  GLU A CG   3 
ATOM 5782  C CD   . GLU A 1 4  ? 17.486  -7.030  -45.041 1.00 0.00 ? 67  GLU A CD   3 
ATOM 5783  O OE1  . GLU A 1 4  ? 16.875  -6.096  -44.581 1.00 0.00 ? 67  GLU A OE1  3 
ATOM 5784  O OE2  . GLU A 1 4  ? 18.683  -7.156  -44.930 1.00 0.00 ? 67  GLU A OE2  3 
ATOM 5785  H H    . GLU A 1 4  ? 12.851  -7.337  -46.747 1.00 0.00 ? 67  GLU A H    3 
ATOM 5786  H HA   . GLU A 1 4  ? 14.976  -8.938  -47.774 1.00 0.00 ? 67  GLU A HA   3 
ATOM 5787  H HB2  . GLU A 1 4  ? 15.293  -6.781  -46.653 1.00 0.00 ? 67  GLU A HB2  3 
ATOM 5788  H HB3  . GLU A 1 4  ? 14.794  -7.488  -45.126 1.00 0.00 ? 67  GLU A HB3  3 
ATOM 5789  H HG2  . GLU A 1 4  ? 16.722  -9.003  -45.196 1.00 0.00 ? 67  GLU A HG2  3 
ATOM 5790  H HG3  . GLU A 1 4  ? 17.221  -8.281  -46.739 1.00 0.00 ? 67  GLU A HG3  3 
ATOM 5791  N N    . MET A 1 5  ? 15.161  -11.044 -46.498 1.00 0.00 ? 68  MET A N    3 
ATOM 5792  C CA   . MET A 1 5  ? 15.217  -12.333 -45.817 1.00 0.00 ? 68  MET A CA   3 
ATOM 5793  C C    . MET A 1 5  ? 16.527  -13.052 -46.111 1.00 0.00 ? 68  MET A C    3 
ATOM 5794  O O    . MET A 1 5  ? 17.204  -12.755 -47.095 1.00 0.00 ? 68  MET A O    3 
ATOM 5795  C CB   . MET A 1 5  ? 14.030  -13.200 -46.231 1.00 0.00 ? 68  MET A CB   3 
ATOM 5796  C CG   . MET A 1 5  ? 14.046  -13.639 -47.687 1.00 0.00 ? 68  MET A CG   3 
ATOM 5797  S SD   . MET A 1 5  ? 12.564  -14.556 -48.154 1.00 0.00 ? 68  MET A SD   3 
ATOM 5798  C CE   . MET A 1 5  ? 12.694  -15.980 -47.077 1.00 0.00 ? 68  MET A CE   3 
ATOM 5799  H H    . MET A 1 5  ? 15.717  -10.903 -47.341 1.00 0.00 ? 68  MET A H    3 
ATOM 5800  H HA   . MET A 1 5  ? 15.167  -12.157 -44.743 1.00 0.00 ? 68  MET A HA   3 
ATOM 5801  H HB2  . MET A 1 5  ? 14.018  -14.091 -45.605 1.00 0.00 ? 68  MET A HB2  3 
ATOM 5802  H HB3  . MET A 1 5  ? 13.111  -12.636 -46.054 1.00 0.00 ? 68  MET A HB3  3 
ATOM 5803  H HG2  . MET A 1 5  ? 14.136  -12.755 -48.317 1.00 0.00 ? 68  MET A HG2  3 
ATOM 5804  H HG3  . MET A 1 5  ? 14.916  -14.278 -47.844 1.00 0.00 ? 68  MET A HG3  3 
ATOM 5805  H HE1  . MET A 1 5  ? 12.148  -16.819 -47.510 1.00 0.00 ? 68  MET A HE1  3 
ATOM 5806  H HE2  . MET A 1 5  ? 13.744  -16.249 -46.967 1.00 0.00 ? 68  MET A HE2  3 
ATOM 5807  H HE3  . MET A 1 5  ? 12.276  -15.738 -46.102 1.00 0.00 ? 68  MET A HE3  3 
ATOM 5808  N N    . ARG A 1 6  ? 16.882  -13.999 -45.248 1.00 0.00 ? 69  ARG A N    3 
ATOM 5809  C CA   . ARG A 1 6  ? 18.133  -14.736 -45.391 1.00 0.00 ? 69  ARG A CA   3 
ATOM 5810  C C    . ARG A 1 6  ? 17.893  -16.238 -45.357 1.00 0.00 ? 69  ARG A C    3 
ATOM 5811  O O    . ARG A 1 6  ? 18.047  -16.879 -44.317 1.00 0.00 ? 69  ARG A O    3 
ATOM 5812  C CB   . ARG A 1 6  ? 19.107  -14.355 -44.286 1.00 0.00 ? 69  ARG A CB   3 
ATOM 5813  C CG   . ARG A 1 6  ? 20.453  -15.057 -44.351 1.00 0.00 ? 69  ARG A CG   3 
ATOM 5814  C CD   . ARG A 1 6  ? 21.379  -14.570 -43.296 1.00 0.00 ? 69  ARG A CD   3 
ATOM 5815  N NE   . ARG A 1 6  ? 22.708  -15.144 -43.434 1.00 0.00 ? 69  ARG A NE   3 
ATOM 5816  C CZ   . ARG A 1 6  ? 23.724  -14.939 -42.571 1.00 0.00 ? 69  ARG A CZ   3 
ATOM 5817  N NH1  . ARG A 1 6  ? 23.545  -14.172 -41.517 1.00 0.00 ? 69  ARG A NH1  3 
ATOM 5818  N NH2  . ARG A 1 6  ? 24.897  -15.505 -42.785 1.00 0.00 ? 69  ARG A NH2  3 
ATOM 5819  H H    . ARG A 1 6  ? 16.281  -14.193 -44.447 1.00 0.00 ? 69  ARG A H    3 
ATOM 5820  H HA   . ARG A 1 6  ? 18.599  -14.493 -46.348 1.00 0.00 ? 69  ARG A HA   3 
ATOM 5821  H HB2  . ARG A 1 6  ? 19.280  -13.281 -44.330 1.00 0.00 ? 69  ARG A HB2  3 
ATOM 5822  H HB3  . ARG A 1 6  ? 18.650  -14.596 -43.332 1.00 0.00 ? 69  ARG A HB3  3 
ATOM 5823  H HG2  . ARG A 1 6  ? 20.304  -16.129 -44.226 1.00 0.00 ? 69  ARG A HG2  3 
ATOM 5824  H HG3  . ARG A 1 6  ? 20.901  -14.868 -45.326 1.00 0.00 ? 69  ARG A HG3  3 
ATOM 5825  H HD2  . ARG A 1 6  ? 21.456  -13.486 -43.364 1.00 0.00 ? 69  ARG A HD2  3 
ATOM 5826  H HD3  . ARG A 1 6  ? 20.976  -14.843 -42.320 1.00 0.00 ? 69  ARG A HD3  3 
ATOM 5827  H HE   . ARG A 1 6  ? 22.875  -15.724 -44.206 1.00 0.00 ? 69  ARG A HE   3 
ATOM 5828  H HH11 . ARG A 1 6  ? 22.657  -13.742 -41.353 1.00 0.00 ? 69  ARG A HH11 3 
ATOM 5829  H HH12 . ARG A 1 6  ? 24.307  -14.017 -40.872 1.00 0.00 ? 69  ARG A HH12 3 
ATOM 5830  H HH21 . ARG A 1 6  ? 25.036  -16.090 -43.586 1.00 0.00 ? 69  ARG A HH21 3 
ATOM 5831  H HH22 . ARG A 1 6  ? 25.648  -15.351 -42.145 1.00 0.00 ? 69  ARG A HH22 3 
ATOM 5832  N N    . LEU A 1 7  ? 17.514  -16.798 -46.501 1.00 0.00 ? 70  LEU A N    3 
ATOM 5833  C CA   . LEU A 1 7  ? 17.385  -18.245 -46.642 1.00 0.00 ? 70  LEU A CA   3 
ATOM 5834  C C    . LEU A 1 7  ? 18.595  -18.841 -47.348 1.00 0.00 ? 70  LEU A C    3 
ATOM 5835  O O    . LEU A 1 7  ? 18.816  -18.598 -48.534 1.00 0.00 ? 70  LEU A O    3 
ATOM 5836  C CB   . LEU A 1 7  ? 16.111  -18.590 -47.421 1.00 0.00 ? 70  LEU A CB   3 
ATOM 5837  C CG   . LEU A 1 7  ? 15.913  -20.074 -47.753 1.00 0.00 ? 70  LEU A CG   3 
ATOM 5838  C CD1  . LEU A 1 7  ? 15.737  -20.864 -46.464 1.00 0.00 ? 70  LEU A CD1  3 
ATOM 5839  C CD2  . LEU A 1 7  ? 14.706  -20.237 -48.663 1.00 0.00 ? 70  LEU A CD2  3 
ATOM 5840  H H    . LEU A 1 7  ? 17.430  -16.212 -47.331 1.00 0.00 ? 70  LEU A H    3 
ATOM 5841  H HA   . LEU A 1 7  ? 17.301  -18.682 -45.655 1.00 0.00 ? 70  LEU A HA   3 
ATOM 5842  H HB2  . LEU A 1 7  ? 15.250  -18.262 -46.839 1.00 0.00 ? 70  LEU A HB2  3 
ATOM 5843  H HB3  . LEU A 1 7  ? 16.129  -18.027 -48.356 1.00 0.00 ? 70  LEU A HB3  3 
ATOM 5844  H HG   . LEU A 1 7  ? 16.797  -20.442 -48.276 1.00 0.00 ? 70  LEU A HG   3 
ATOM 5845  H HD11 . LEU A 1 7  ? 14.994  -20.399 -45.844 1.00 0.00 ? 70  LEU A HD11 3 
ATOM 5846  H HD12 . LEU A 1 7  ? 16.676  -20.911 -45.936 1.00 0.00 ? 70  LEU A HD12 3 
ATOM 5847  H HD13 . LEU A 1 7  ? 15.418  -21.877 -46.707 1.00 0.00 ? 70  LEU A HD13 3 
ATOM 5848  H HD21 . LEU A 1 7  ? 14.966  -19.909 -49.671 1.00 0.00 ? 70  LEU A HD21 3 
ATOM 5849  H HD22 . LEU A 1 7  ? 13.885  -19.630 -48.291 1.00 0.00 ? 70  LEU A HD22 3 
ATOM 5850  H HD23 . LEU A 1 7  ? 14.400  -21.283 -48.696 1.00 0.00 ? 70  LEU A HD23 3 
ATOM 5851  N N    . GLU A 1 8  ? 19.380  -19.619 -46.611 1.00 0.00 ? 71  GLU A N    3 
ATOM 5852  C CA   . GLU A 1 8  ? 20.584  -20.233 -47.157 1.00 0.00 ? 71  GLU A CA   3 
ATOM 5853  C C    . GLU A 1 8  ? 20.461  -21.751 -47.199 1.00 0.00 ? 71  GLU A C    3 
ATOM 5854  O O    . GLU A 1 8  ? 19.363  -22.289 -47.346 1.00 0.00 ? 71  GLU A O    3 
ATOM 5855  C CB   . GLU A 1 8  ? 21.808  -19.832 -46.331 1.00 0.00 ? 71  GLU A CB   3 
ATOM 5856  C CG   . GLU A 1 8  ? 22.049  -18.332 -46.248 1.00 0.00 ? 71  GLU A CG   3 
ATOM 5857  C CD   . GLU A 1 8  ? 23.307  -17.982 -45.504 1.00 0.00 ? 71  GLU A CD   3 
ATOM 5858  O OE1  . GLU A 1 8  ? 23.898  -18.862 -44.927 1.00 0.00 ? 71  GLU A OE1  3 
ATOM 5859  O OE2  . GLU A 1 8  ? 23.676  -16.831 -45.512 1.00 0.00 ? 71  GLU A OE2  3 
ATOM 5860  H H    . GLU A 1 8  ? 19.144  -19.782 -45.632 1.00 0.00 ? 71  GLU A H    3 
ATOM 5861  H HA   . GLU A 1 8  ? 20.742  -19.880 -48.179 1.00 0.00 ? 71  GLU A HA   3 
ATOM 5862  H HB2  . GLU A 1 8  ? 21.721  -20.254 -45.338 1.00 0.00 ? 71  GLU A HB2  3 
ATOM 5863  H HB3  . GLU A 1 8  ? 22.689  -20.259 -46.807 1.00 0.00 ? 71  GLU A HB3  3 
ATOM 5864  H HG2  . GLU A 1 8  ? 22.109  -17.928 -47.258 1.00 0.00 ? 71  GLU A HG2  3 
ATOM 5865  H HG3  . GLU A 1 8  ? 21.200  -17.885 -45.734 1.00 0.00 ? 71  GLU A HG3  3 
ATOM 5866  N N    . LYS A 1 9  ? 21.590  -22.435 -47.068 1.00 0.00 ? 72  LYS A N    3 
ATOM 5867  C CA   . LYS A 1 9  ? 21.604  -23.891 -47.017 1.00 0.00 ? 72  LYS A CA   3 
ATOM 5868  C C    . LYS A 1 9  ? 21.067  -24.401 -45.685 1.00 0.00 ? 72  LYS A C    3 
ATOM 5869  O O    . LYS A 1 9  ? 20.514  -25.498 -45.606 1.00 0.00 ? 72  LYS A O    3 
ATOM 5870  C CB   . LYS A 1 9  ? 23.017  -24.425 -47.252 1.00 0.00 ? 72  LYS A CB   3 
ATOM 5871  C CG   . LYS A 1 9  ? 23.536  -24.233 -48.671 1.00 0.00 ? 72  LYS A CG   3 
ATOM 5872  C CD   . LYS A 1 9  ? 24.947  -24.777 -48.824 1.00 0.00 ? 72  LYS A CD   3 
ATOM 5873  C CE   . LYS A 1 9  ? 25.465  -24.586 -50.242 1.00 0.00 ? 72  LYS A CE   3 
ATOM 5874  N NZ   . LYS A 1 9  ? 26.860  -25.082 -50.398 1.00 0.00 ? 72  LYS A NZ   3 
ATOM 5875  H H    . LYS A 1 9  ? 22.467  -21.936 -46.945 1.00 0.00 ? 72  LYS A H    3 
ATOM 5876  H HA   . LYS A 1 9  ? 20.966  -24.266 -47.819 1.00 0.00 ? 72  LYS A HA   3 
ATOM 5877  H HB2  . LYS A 1 9  ? 23.692  -23.908 -46.569 1.00 0.00 ? 72  LYS A HB2  3 
ATOM 5878  H HB3  . LYS A 1 9  ? 23.034  -25.490 -47.019 1.00 0.00 ? 72  LYS A HB3  3 
ATOM 5879  H HG2  . LYS A 1 9  ? 22.872  -24.755 -49.362 1.00 0.00 ? 72  LYS A HG2  3 
ATOM 5880  H HG3  . LYS A 1 9  ? 23.539  -23.168 -48.906 1.00 0.00 ? 72  LYS A HG3  3 
ATOM 5881  H HD2  . LYS A 1 9  ? 25.606  -24.254 -48.133 1.00 0.00 ? 72  LYS A HD2  3 
ATOM 5882  H HD3  . LYS A 1 9  ? 24.944  -25.841 -48.586 1.00 0.00 ? 72  LYS A HD3  3 
ATOM 5883  H HE2  . LYS A 1 9  ? 24.819  -25.131 -50.930 1.00 0.00 ? 72  LYS A HE2  3 
ATOM 5884  H HE3  . LYS A 1 9  ? 25.433  -23.524 -50.489 1.00 0.00 ? 72  LYS A HE3  3 
ATOM 5885  H HZ1  . LYS A 1 9  ? 27.155  -25.007 -51.391 1.00 0.00 ? 72  LYS A HZ1  3 
ATOM 5886  H HZ2  . LYS A 1 9  ? 26.903  -26.077 -50.096 1.00 0.00 ? 72  LYS A HZ2  3 
ATOM 5887  H HZ3  . LYS A 1 9  ? 27.479  -24.529 -49.822 1.00 0.00 ? 72  LYS A HZ3  3 
ATOM 5888  N N    . ASP A 1 10 ? 21.232  -23.597 -44.641 1.00 0.00 ? 73  ASP A N    3 
ATOM 5889  C CA   . ASP A 1 10 ? 20.755  -23.961 -43.311 1.00 0.00 ? 73  ASP A CA   3 
ATOM 5890  C C    . ASP A 1 10 ? 20.423  -22.724 -42.489 1.00 0.00 ? 73  ASP A C    3 
ATOM 5891  O O    . ASP A 1 10 ? 20.605  -22.710 -41.269 1.00 0.00 ? 73  ASP A O    3 
ATOM 5892  C CB   . ASP A 1 10 ? 21.799  -24.806 -42.579 1.00 0.00 ? 73  ASP A CB   3 
ATOM 5893  C CG   . ASP A 1 10 ? 23.120  -24.074 -42.382 1.00 0.00 ? 73  ASP A CG   3 
ATOM 5894  O OD1  . ASP A 1 10 ? 23.228  -22.952 -42.820 1.00 0.00 ? 73  ASP A OD1  3 
ATOM 5895  O OD2  . ASP A 1 10 ? 24.010  -24.642 -41.795 1.00 0.00 ? 73  ASP A OD2  3 
ATOM 5896  H H    . ASP A 1 10 ? 21.697  -22.698 -44.775 1.00 0.00 ? 73  ASP A H    3 
ATOM 5897  H HA   . ASP A 1 10 ? 19.848  -24.553 -43.403 1.00 0.00 ? 73  ASP A HA   3 
ATOM 5898  H HB2  . ASP A 1 10 ? 21.410  -25.085 -41.609 1.00 0.00 ? 73  ASP A HB2  3 
ATOM 5899  H HB3  . ASP A 1 10 ? 21.985  -25.710 -43.159 1.00 0.00 ? 73  ASP A HB3  3 
ATOM 5900  N N    . ARG A 1 11 ? 19.936  -21.685 -43.159 1.00 0.00 ? 74  ARG A N    3 
ATOM 5901  C CA   . ARG A 1 11 ? 19.556  -20.451 -42.487 1.00 0.00 ? 74  ARG A CA   3 
ATOM 5902  C C    . ARG A 1 11 ? 18.214  -19.937 -42.993 1.00 0.00 ? 74  ARG A C    3 
ATOM 5903  O O    . ARG A 1 11 ? 17.820  -20.216 -44.126 1.00 0.00 ? 74  ARG A O    3 
ATOM 5904  C CB   . ARG A 1 11 ? 20.615  -19.377 -42.696 1.00 0.00 ? 74  ARG A CB   3 
ATOM 5905  C CG   . ARG A 1 11 ? 21.963  -19.679 -42.063 1.00 0.00 ? 74  ARG A CG   3 
ATOM 5906  C CD   . ARG A 1 11 ? 21.909  -19.591 -40.580 1.00 0.00 ? 74  ARG A CD   3 
ATOM 5907  N NE   . ARG A 1 11 ? 23.219  -19.773 -39.976 1.00 0.00 ? 74  ARG A NE   3 
ATOM 5908  C CZ   . ARG A 1 11 ? 23.736  -20.965 -39.617 1.00 0.00 ? 74  ARG A CZ   3 
ATOM 5909  N NH1  . ARG A 1 11 ? 23.041  -22.065 -39.803 1.00 0.00 ? 74  ARG A NH1  3 
ATOM 5910  N NH2  . ARG A 1 11 ? 24.938  -21.025 -39.074 1.00 0.00 ? 74  ARG A NH2  3 
ATOM 5911  H H    . ARG A 1 11 ? 19.803  -21.761 -44.167 1.00 0.00 ? 74  ARG A H    3 
ATOM 5912  H HA   . ARG A 1 11 ? 19.446  -20.634 -41.422 1.00 0.00 ? 74  ARG A HA   3 
ATOM 5913  H HB2  . ARG A 1 11 ? 20.738  -19.206 -43.752 1.00 0.00 ? 74  ARG A HB2  3 
ATOM 5914  H HB3  . ARG A 1 11 ? 20.244  -18.454 -42.246 1.00 0.00 ? 74  ARG A HB3  3 
ATOM 5915  H HG2  . ARG A 1 11 ? 22.251  -20.692 -42.347 1.00 0.00 ? 74  ARG A HG2  3 
ATOM 5916  H HG3  . ARG A 1 11 ? 22.711  -18.977 -42.435 1.00 0.00 ? 74  ARG A HG3  3 
ATOM 5917  H HD2  . ARG A 1 11 ? 21.519  -18.614 -40.295 1.00 0.00 ? 74  ARG A HD2  3 
ATOM 5918  H HD3  . ARG A 1 11 ? 21.255  -20.365 -40.192 1.00 0.00 ? 74  ARG A HD3  3 
ATOM 5919  H HE   . ARG A 1 11 ? 23.774  -18.977 -39.834 1.00 0.00 ? 74  ARG A HE   3 
ATOM 5920  H HH11 . ARG A 1 11 ? 22.131  -22.020 -40.216 1.00 0.00 ? 74  ARG A HH11 3 
ATOM 5921  H HH12 . ARG A 1 11 ? 23.427  -22.957 -39.529 1.00 0.00 ? 74  ARG A HH12 3 
ATOM 5922  H HH21 . ARG A 1 11 ? 25.470  -20.188 -38.933 1.00 0.00 ? 74  ARG A HH21 3 
ATOM 5923  H HH22 . ARG A 1 11 ? 25.319  -21.908 -38.802 1.00 0.00 ? 74  ARG A HH22 3 
ATOM 5924  N N    . PHE A 1 12 ? 17.515  -19.186 -42.149 1.00 0.00 ? 75  PHE A N    3 
ATOM 5925  C CA   . PHE A 1 12 ? 16.262  -18.552 -42.542 1.00 0.00 ? 75  PHE A CA   3 
ATOM 5926  C C    . PHE A 1 12 ? 15.868  -17.454 -41.564 1.00 0.00 ? 75  PHE A C    3 
ATOM 5927  O O    . PHE A 1 12 ? 15.670  -17.710 -40.377 1.00 0.00 ? 75  PHE A O    3 
ATOM 5928  C CB   . PHE A 1 12 ? 15.141  -19.592 -42.629 1.00 0.00 ? 75  PHE A CB   3 
ATOM 5929  C CG   . PHE A 1 12 ? 13.773  -18.994 -42.789 1.00 0.00 ? 75  PHE A CG   3 
ATOM 5930  C CD1  . PHE A 1 12 ? 13.291  -18.656 -44.045 1.00 0.00 ? 75  PHE A CD1  3 
ATOM 5931  C CD2  . PHE A 1 12 ? 12.964  -18.769 -41.684 1.00 0.00 ? 75  PHE A CD2  3 
ATOM 5932  C CE1  . PHE A 1 12 ? 12.031  -18.108 -44.193 1.00 0.00 ? 75  PHE A CE1  3 
ATOM 5933  C CE2  . PHE A 1 12 ? 11.705  -18.223 -41.831 1.00 0.00 ? 75  PHE A CE2  3 
ATOM 5934  C CZ   . PHE A 1 12 ? 11.238  -17.890 -43.086 1.00 0.00 ? 75  PHE A CZ   3 
ATOM 5935  H H    . PHE A 1 12 ? 17.907  -18.979 -41.231 1.00 0.00 ? 75  PHE A H    3 
ATOM 5936  H HA   . PHE A 1 12 ? 16.375  -18.110 -43.525 1.00 0.00 ? 75  PHE A HA   3 
ATOM 5937  H HB2  . PHE A 1 12 ? 15.333  -20.235 -43.488 1.00 0.00 ? 75  PHE A HB2  3 
ATOM 5938  H HB3  . PHE A 1 12 ? 15.166  -20.194 -41.740 1.00 0.00 ? 75  PHE A HB3  3 
ATOM 5939  H HD1  . PHE A 1 12 ? 13.903  -18.801 -44.907 1.00 0.00 ? 75  PHE A HD1  3 
ATOM 5940  H HD2  . PHE A 1 12 ? 13.325  -19.028 -40.700 1.00 0.00 ? 75  PHE A HD2  3 
ATOM 5941  H HE1  . PHE A 1 12 ? 11.668  -17.849 -45.177 1.00 0.00 ? 75  PHE A HE1  3 
ATOM 5942  H HE2  . PHE A 1 12 ? 11.084  -18.054 -40.964 1.00 0.00 ? 75  PHE A HE2  3 
ATOM 5943  H HZ   . PHE A 1 12 ? 10.233  -17.512 -43.208 1.00 0.00 ? 75  PHE A HZ   3 
ATOM 5944  N N    . SER A 1 13 ? 15.758  -16.231 -42.070 1.00 0.00 ? 76  SER A N    3 
ATOM 5945  C CA   . SER A 1 13 ? 15.401  -15.087 -41.239 1.00 0.00 ? 76  SER A CA   3 
ATOM 5946  C C    . SER A 1 13 ? 14.567  -14.078 -42.017 1.00 0.00 ? 76  SER A C    3 
ATOM 5947  O O    . SER A 1 13 ? 14.785  -13.867 -43.210 1.00 0.00 ? 76  SER A O    3 
ATOM 5948  C CB   . SER A 1 13 ? 16.654  -14.418 -40.707 1.00 0.00 ? 76  SER A CB   3 
ATOM 5949  O OG   . SER A 1 13 ? 16.334  -13.273 -39.965 1.00 0.00 ? 76  SER A OG   3 
ATOM 5950  H H    . SER A 1 13 ? 15.932  -16.087 -43.064 1.00 0.00 ? 76  SER A H    3 
ATOM 5951  H HA   . SER A 1 13 ? 14.803  -15.436 -40.415 1.00 0.00 ? 76  SER A HA   3 
ATOM 5952  H HB2  . SER A 1 13 ? 17.188  -15.113 -40.066 1.00 0.00 ? 76  SER A HB2  3 
ATOM 5953  H HB3  . SER A 1 13 ? 17.291  -14.141 -41.541 1.00 0.00 ? 76  SER A HB3  3 
ATOM 5954  H HG   . SER A 1 13 ? 17.133  -12.749 -39.859 1.00 0.00 ? 76  SER A HG   3 
ATOM 5955  N N    . VAL A 1 14 ? 13.608  -13.460 -41.336 1.00 0.00 ? 77  VAL A N    3 
ATOM 5956  C CA   . VAL A 1 14 ? 12.672  -12.550 -41.985 1.00 0.00 ? 77  VAL A CA   3 
ATOM 5957  C C    . VAL A 1 14 ? 12.680  -11.182 -41.316 1.00 0.00 ? 77  VAL A C    3 
ATOM 5958  O O    . VAL A 1 14 ? 12.409  -11.064 -40.121 1.00 0.00 ? 77  VAL A O    3 
ATOM 5959  C CB   . VAL A 1 14 ? 11.245  -13.132 -41.942 1.00 0.00 ? 77  VAL A CB   3 
ATOM 5960  C CG1  . VAL A 1 14 ? 10.251  -12.147 -42.539 1.00 0.00 ? 77  VAL A CG1  3 
ATOM 5961  C CG2  . VAL A 1 14 ? 11.204  -14.459 -42.688 1.00 0.00 ? 77  VAL A CG2  3 
ATOM 5962  H H    . VAL A 1 14 ? 13.467  -13.694 -40.352 1.00 0.00 ? 77  VAL A H    3 
ATOM 5963  H HA   . VAL A 1 14 ? 12.947  -12.414 -43.033 1.00 0.00 ? 77  VAL A HA   3 
ATOM 5964  H HB   . VAL A 1 14 ? 11.002  -13.295 -40.922 1.00 0.00 ? 77  VAL A HB   3 
ATOM 5965  H HG11 . VAL A 1 14 ? 9.239   -12.461 -42.277 1.00 0.00 ? 77  VAL A HG11 3 
ATOM 5966  H HG12 . VAL A 1 14 ? 10.361  -12.158 -43.619 1.00 0.00 ? 77  VAL A HG12 3 
ATOM 5967  H HG13 . VAL A 1 14 ? 10.417  -11.144 -42.187 1.00 0.00 ? 77  VAL A HG13 3 
ATOM 5968  H HG21 . VAL A 1 14 ? 11.412  -14.289 -43.744 1.00 0.00 ? 77  VAL A HG21 3 
ATOM 5969  H HG22 . VAL A 1 14 ? 10.214  -14.899 -42.579 1.00 0.00 ? 77  VAL A HG22 3 
ATOM 5970  H HG23 . VAL A 1 14 ? 11.951  -15.134 -42.272 1.00 0.00 ? 77  VAL A HG23 3 
ATOM 5971  N N    . ASN A 1 15 ? 12.989  -10.152 -42.093 1.00 0.00 ? 78  ASN A N    3 
ATOM 5972  C CA   . ASN A 1 15 ? 12.942  -8.780  -41.601 1.00 0.00 ? 78  ASN A CA   3 
ATOM 5973  C C    . ASN A 1 15 ? 11.565  -8.164  -41.819 1.00 0.00 ? 78  ASN A C    3 
ATOM 5974  O O    . ASN A 1 15 ? 11.142  -7.957  -42.956 1.00 0.00 ? 78  ASN A O    3 
ATOM 5975  C CB   . ASN A 1 15 ? 14.015  -7.935  -42.266 1.00 0.00 ? 78  ASN A CB   3 
ATOM 5976  C CG   . ASN A 1 15 ? 14.059  -6.531  -41.728 1.00 0.00 ? 78  ASN A CG   3 
ATOM 5977  O OD1  . ASN A 1 15 ? 13.308  -6.179  -40.813 1.00 0.00 ? 78  ASN A OD1  3 
ATOM 5978  N ND2  . ASN A 1 15 ? 14.928  -5.723  -42.281 1.00 0.00 ? 78  ASN A ND2  3 
ATOM 5979  H H    . ASN A 1 15 ? 13.185  -10.314 -43.081 1.00 0.00 ? 78  ASN A H    3 
ATOM 5980  H HA   . ASN A 1 15 ? 13.144  -8.787  -40.527 1.00 0.00 ? 78  ASN A HA   3 
ATOM 5981  H HB2  . ASN A 1 15 ? 14.987  -8.408  -42.130 1.00 0.00 ? 78  ASN A HB2  3 
ATOM 5982  H HB3  . ASN A 1 15 ? 13.775  -7.900  -43.313 1.00 0.00 ? 78  ASN A HB3  3 
ATOM 5983  H HD21 . ASN A 1 15 ? 15.530  -6.048  -43.037 1.00 0.00 ? 78  ASN A HD21 3 
ATOM 5984  H HD22 . ASN A 1 15 ? 14.997  -4.762  -41.950 1.00 0.00 ? 78  ASN A HD22 3 
ATOM 5985  N N    . LEU A 1 16 ? 10.871  -7.875  -40.725 1.00 0.00 ? 79  LEU A N    3 
ATOM 5986  C CA   . LEU A 1 16 ? 9.512   -7.352  -40.794 1.00 0.00 ? 79  LEU A CA   3 
ATOM 5987  C C    . LEU A 1 16 ? 9.446   -5.917  -40.285 1.00 0.00 ? 79  LEU A C    3 
ATOM 5988  O O    . LEU A 1 16 ? 10.180  -5.539  -39.373 1.00 0.00 ? 79  LEU A O    3 
ATOM 5989  C CB   . LEU A 1 16 ? 8.563   -8.236  -39.976 1.00 0.00 ? 79  LEU A CB   3 
ATOM 5990  C CG   . LEU A 1 16 ? 8.458   -9.700  -40.429 1.00 0.00 ? 79  LEU A CG   3 
ATOM 5991  C CD1  . LEU A 1 16 ? 7.724   -10.509 -39.369 1.00 0.00 ? 79  LEU A CD1  3 
ATOM 5992  C CD2  . LEU A 1 16 ? 7.735   -9.766  -41.766 1.00 0.00 ? 79  LEU A CD2  3 
ATOM 5993  H H    . LEU A 1 16 ? 11.273  -8.085  -39.814 1.00 0.00 ? 79  LEU A H    3 
ATOM 5994  H HA   . LEU A 1 16 ? 9.164   -7.353  -41.827 1.00 0.00 ? 79  LEU A HA   3 
ATOM 5995  H HB2  . LEU A 1 16 ? 8.919   -8.237  -38.953 1.00 0.00 ? 79  LEU A HB2  3 
ATOM 5996  H HB3  . LEU A 1 16 ? 7.565   -7.793  -39.996 1.00 0.00 ? 79  LEU A HB3  3 
ATOM 5997  H HG   . LEU A 1 16 ? 9.463   -10.087 -40.533 1.00 0.00 ? 79  LEU A HG   3 
ATOM 5998  H HD11 . LEU A 1 16 ? 8.388   -10.724 -38.542 1.00 0.00 ? 79  LEU A HD11 3 
ATOM 5999  H HD12 . LEU A 1 16 ? 7.391   -11.454 -39.800 1.00 0.00 ? 79  LEU A HD12 3 
ATOM 6000  H HD13 . LEU A 1 16 ? 6.860   -9.956  -39.014 1.00 0.00 ? 79  LEU A HD13 3 
ATOM 6001  H HD21 . LEU A 1 16 ? 7.467   -10.798 -41.987 1.00 0.00 ? 79  LEU A HD21 3 
ATOM 6002  H HD22 . LEU A 1 16 ? 8.384   -9.395  -42.557 1.00 0.00 ? 79  LEU A HD22 3 
ATOM 6003  H HD23 . LEU A 1 16 ? 6.829   -9.161  -41.727 1.00 0.00 ? 79  LEU A HD23 3 
ATOM 6004  N N    . ASP A 1 17 ? 8.561   -5.125  -40.880 1.00 0.00 ? 80  ASP A N    3 
ATOM 6005  C CA   . ASP A 1 17 ? 8.512   -3.693  -40.607 1.00 0.00 ? 80  ASP A CA   3 
ATOM 6006  C C    . ASP A 1 17 ? 7.356   -3.350  -39.676 1.00 0.00 ? 80  ASP A C    3 
ATOM 6007  O O    . ASP A 1 17 ? 6.193   -3.374  -40.078 1.00 0.00 ? 80  ASP A O    3 
ATOM 6008  C CB   . ASP A 1 17 ? 8.375   -2.903  -41.912 1.00 0.00 ? 80  ASP A CB   3 
ATOM 6009  C CG   . ASP A 1 17 ? 8.387   -1.396  -41.695 1.00 0.00 ? 80  ASP A CG   3 
ATOM 6010  O OD1  . ASP A 1 17 ? 8.342   -0.978  -40.563 1.00 0.00 ? 80  ASP A OD1  3 
ATOM 6011  O OD2  . ASP A 1 17 ? 8.441   -0.678  -42.666 1.00 0.00 ? 80  ASP A OD2  3 
ATOM 6012  H H    . ASP A 1 17 ? 8.000   -5.498  -41.646 1.00 0.00 ? 80  ASP A H    3 
ATOM 6013  H HA   . ASP A 1 17 ? 9.439   -3.376  -40.124 1.00 0.00 ? 80  ASP A HA   3 
ATOM 6014  H HB2  . ASP A 1 17 ? 9.201   -3.170  -42.569 1.00 0.00 ? 80  ASP A HB2  3 
ATOM 6015  H HB3  . ASP A 1 17 ? 7.438   -3.184  -42.394 1.00 0.00 ? 80  ASP A HB3  3 
ATOM 6016  N N    . VAL A 1 18 ? 7.684   -3.029  -38.429 1.00 0.00 ? 81  VAL A N    3 
ATOM 6017  C CA   . VAL A 1 18 ? 6.684   -2.597  -37.459 1.00 0.00 ? 81  VAL A CA   3 
ATOM 6018  C C    . VAL A 1 18 ? 7.266   -1.590  -36.477 1.00 0.00 ? 81  VAL A C    3 
ATOM 6019  O O    . VAL A 1 18 ? 6.896   -1.569  -35.303 1.00 0.00 ? 81  VAL A O    3 
ATOM 6020  C CB   . VAL A 1 18 ? 6.134   -3.808  -36.684 1.00 0.00 ? 81  VAL A CB   3 
ATOM 6021  C CG1  . VAL A 1 18 ? 5.374   -4.740  -37.618 1.00 0.00 ? 81  VAL A CG1  3 
ATOM 6022  C CG2  . VAL A 1 18 ? 7.273   -4.546  -35.998 1.00 0.00 ? 81  VAL A CG2  3 
ATOM 6023  H H    . VAL A 1 18 ? 8.668   -3.008  -38.163 1.00 0.00 ? 81  VAL A H    3 
ATOM 6024  H HA   . VAL A 1 18 ? 5.853   -2.120  -37.986 1.00 0.00 ? 81  VAL A HA   3 
ATOM 6025  H HB   . VAL A 1 18 ? 5.450   -3.435  -35.943 1.00 0.00 ? 81  VAL A HB   3 
ATOM 6026  H HG11 . VAL A 1 18 ? 4.670   -4.168  -38.222 1.00 0.00 ? 81  VAL A HG11 3 
ATOM 6027  H HG12 . VAL A 1 18 ? 4.833   -5.479  -37.031 1.00 0.00 ? 81  VAL A HG12 3 
ATOM 6028  H HG13 . VAL A 1 18 ? 6.084   -5.246  -38.276 1.00 0.00 ? 81  VAL A HG13 3 
ATOM 6029  H HG21 . VAL A 1 18 ? 6.864   -5.445  -35.546 1.00 0.00 ? 81  VAL A HG21 3 
ATOM 6030  H HG22 . VAL A 1 18 ? 8.033   -4.800  -36.729 1.00 0.00 ? 81  VAL A HG22 3 
ATOM 6031  H HG23 . VAL A 1 18 ? 7.708   -3.912  -35.224 1.00 0.00 ? 81  VAL A HG23 3 
ATOM 6032  N N    . LYS A 1 19 ? 8.181   -0.760  -36.962 1.00 0.00 ? 82  LYS A N    3 
ATOM 6033  C CA   . LYS A 1 19 ? 8.990   0.086   -36.089 1.00 0.00 ? 82  LYS A CA   3 
ATOM 6034  C C    . LYS A 1 19 ? 8.128   1.114   -35.369 1.00 0.00 ? 82  LYS A C    3 
ATOM 6035  O O    . LYS A 1 19 ? 8.518   1.644   -34.328 1.00 0.00 ? 82  LYS A O    3 
ATOM 6036  C CB   . LYS A 1 19 ? 10.086  0.788   -36.891 1.00 0.00 ? 82  LYS A CB   3 
ATOM 6037  C CG   . LYS A 1 19 ? 11.178  -0.137  -37.408 1.00 0.00 ? 82  LYS A CG   3 
ATOM 6038  C CD   . LYS A 1 19 ? 12.206  0.625   -38.233 1.00 0.00 ? 82  LYS A CD   3 
ATOM 6039  C CE   . LYS A 1 19 ? 13.291  -0.302  -38.761 1.00 0.00 ? 82  LYS A CE   3 
ATOM 6040  N NZ   . LYS A 1 19 ? 14.253  0.413   -39.643 1.00 0.00 ? 82  LYS A NZ   3 
ATOM 6041  H H    . LYS A 1 19 ? 8.461   -0.859  -37.938 1.00 0.00 ? 82  LYS A H    3 
ATOM 6042  H HA   . LYS A 1 19 ? 9.473   -0.529  -35.363 1.00 0.00 ? 82  LYS A HA   3 
ATOM 6043  H HB2  . LYS A 1 19 ? 9.630   1.283   -37.748 1.00 0.00 ? 82  LYS A HB2  3 
ATOM 6044  H HB3  . LYS A 1 19 ? 10.550  1.547   -36.257 1.00 0.00 ? 82  LYS A HB3  3 
ATOM 6045  H HG2  . LYS A 1 19 ? 11.677  -0.604  -36.557 1.00 0.00 ? 82  LYS A HG2  3 
ATOM 6046  H HG3  . LYS A 1 19 ? 10.724  -0.910  -38.029 1.00 0.00 ? 82  LYS A HG3  3 
ATOM 6047  H HD2  . LYS A 1 19 ? 11.704  1.095   -39.077 1.00 0.00 ? 82  LYS A HD2  3 
ATOM 6048  H HD3  . LYS A 1 19 ? 12.662  1.395   -37.611 1.00 0.00 ? 82  LYS A HD3  3 
ATOM 6049  H HE2  . LYS A 1 19 ? 13.834  -0.701  -37.915 1.00 0.00 ? 82  LYS A HE2  3 
ATOM 6050  H HE3  . LYS A 1 19 ? 12.829  -1.120  -39.314 1.00 0.00 ? 82  LYS A HE3  3 
ATOM 6051  H HZ1  . LYS A 1 19 ? 14.664  -0.252  -40.328 1.00 0.00 ? 82  LYS A HZ1  3 
ATOM 6052  H HZ2  . LYS A 1 19 ? 15.012  0.829   -39.065 1.00 0.00 ? 82  LYS A HZ2  3 
ATOM 6053  H HZ3  . LYS A 1 19 ? 13.769  1.148   -40.139 1.00 0.00 ? 82  LYS A HZ3  3 
ATOM 6054  N N    . HIS A 1 20 ? 6.954   1.392   -35.926 1.00 0.00 ? 83  HIS A N    3 
ATOM 6055  C CA   . HIS A 1 20 ? 6.103   2.465   -35.425 1.00 0.00 ? 83  HIS A CA   3 
ATOM 6056  C C    . HIS A 1 20 ? 5.070   1.934   -34.441 1.00 0.00 ? 83  HIS A C    3 
ATOM 6057  O O    . HIS A 1 20 ? 4.255   2.692   -33.912 1.00 0.00 ? 83  HIS A O    3 
ATOM 6058  C CB   . HIS A 1 20 ? 5.396   3.179   -36.584 1.00 0.00 ? 83  HIS A CB   3 
ATOM 6059  C CG   . HIS A 1 20 ? 6.334   3.797   -37.572 1.00 0.00 ? 83  HIS A CG   3 
ATOM 6060  N ND1  . HIS A 1 20 ? 6.876   3.089   -38.622 1.00 0.00 ? 83  HIS A ND1  3 
ATOM 6061  C CD2  . HIS A 1 20 ? 6.826   5.054   -37.669 1.00 0.00 ? 83  HIS A CD2  3 
ATOM 6062  C CE1  . HIS A 1 20 ? 7.662   3.889   -39.327 1.00 0.00 ? 83  HIS A CE1  3 
ATOM 6063  N NE2  . HIS A 1 20 ? 7.649   5.084   -38.768 1.00 0.00 ? 83  HIS A NE2  3 
ATOM 6064  H H    . HIS A 1 20 ? 6.700   0.938   -36.804 1.00 0.00 ? 83  HIS A H    3 
ATOM 6065  H HA   . HIS A 1 20 ? 6.716   3.209   -34.914 1.00 0.00 ? 83  HIS A HA   3 
ATOM 6066  H HB2  . HIS A 1 20 ? 4.828   2.422   -37.105 1.00 0.00 ? 83  HIS A HB2  3 
ATOM 6067  H HB3  . HIS A 1 20 ? 4.719   3.938   -36.193 1.00 0.00 ? 83  HIS A HB3  3 
ATOM 6068  H HD2  . HIS A 1 20 ? 6.776   5.809   -36.897 1.00 0.00 ? 83  HIS A HD2  3 
ATOM 6069  H HE1  . HIS A 1 20 ? 8.217   3.608   -40.210 1.00 0.00 ? 83  HIS A HE1  3 
ATOM 6070  H HE2  . HIS A 1 20 ? 8.162   5.891   -39.095 1.00 0.00 ? 83  HIS A HE2  3 
ATOM 6071  N N    . PHE A 1 21 ? 5.107   0.630   -34.197 1.00 0.00 ? 84  PHE A N    3 
ATOM 6072  C CA   . PHE A 1 21 ? 4.047   -0.042  -33.455 1.00 0.00 ? 84  PHE A CA   3 
ATOM 6073  C C    . PHE A 1 21 ? 4.512   -0.425  -32.057 1.00 0.00 ? 84  PHE A C    3 
ATOM 6074  O O    . PHE A 1 21 ? 5.700   -0.347  -31.742 1.00 0.00 ? 84  PHE A O    3 
ATOM 6075  C CB   . PHE A 1 21 ? 3.582   -1.294  -34.202 1.00 0.00 ? 84  PHE A CB   3 
ATOM 6076  C CG   . PHE A 1 21 ? 3.054   -1.014  -35.581 1.00 0.00 ? 84  PHE A CG   3 
ATOM 6077  C CD1  . PHE A 1 21 ? 3.905   -0.601  -36.595 1.00 0.00 ? 84  PHE A CD1  3 
ATOM 6078  C CD2  . PHE A 1 21 ? 1.704   -1.163  -35.868 1.00 0.00 ? 84  PHE A CD2  3 
ATOM 6079  C CE1  . PHE A 1 21 ? 3.422   -0.344  -37.863 1.00 0.00 ? 84  PHE A CE1  3 
ATOM 6080  C CE2  . PHE A 1 21 ? 1.219   -0.907  -37.135 1.00 0.00 ? 84  PHE A CE2  3 
ATOM 6081  C CZ   . PHE A 1 21 ? 2.077   -0.497  -38.133 1.00 0.00 ? 84  PHE A CZ   3 
ATOM 6082  H H    . PHE A 1 21 ? 5.790   0.055   -34.692 1.00 0.00 ? 84  PHE A H    3 
ATOM 6083  H HA   . PHE A 1 21 ? 3.183   0.619   -33.359 1.00 0.00 ? 84  PHE A HA   3 
ATOM 6084  H HB2  . PHE A 1 21 ? 4.450   -1.939  -34.289 1.00 0.00 ? 84  PHE A HB2  3 
ATOM 6085  H HB3  . PHE A 1 21 ? 2.821   -1.792  -33.606 1.00 0.00 ? 84  PHE A HB3  3 
ATOM 6086  H HD1  . PHE A 1 21 ? 4.950   -0.477  -36.390 1.00 0.00 ? 84  PHE A HD1  3 
ATOM 6087  H HD2  . PHE A 1 21 ? 1.027   -1.481  -35.089 1.00 0.00 ? 84  PHE A HD2  3 
ATOM 6088  H HE1  . PHE A 1 21 ? 4.094   -0.017  -38.642 1.00 0.00 ? 84  PHE A HE1  3 
ATOM 6089  H HE2  . PHE A 1 21 ? 0.167   -1.030  -37.347 1.00 0.00 ? 84  PHE A HE2  3 
ATOM 6090  H HZ   . PHE A 1 21 ? 1.662   0.036   -38.976 1.00 0.00 ? 84  PHE A HZ   3 
ATOM 6091  N N    . SER A 1 22 ? 3.569   -0.841  -31.217 1.00 0.00 ? 85  SER A N    3 
ATOM 6092  C CA   . SER A 1 22 ? 3.896   -1.377  -29.902 1.00 0.00 ? 85  SER A CA   3 
ATOM 6093  C C    . SER A 1 22 ? 3.748   -2.894  -29.875 1.00 0.00 ? 85  SER A C    3 
ATOM 6094  O O    . SER A 1 22 ? 3.027   -3.472  -30.688 1.00 0.00 ? 85  SER A O    3 
ATOM 6095  C CB   . SER A 1 22 ? 3.004   -0.756  -28.847 1.00 0.00 ? 85  SER A CB   3 
ATOM 6096  O OG   . SER A 1 22 ? 3.270   0.613   -28.709 1.00 0.00 ? 85  SER A OG   3 
ATOM 6097  H H    . SER A 1 22 ? 2.607   -0.894  -31.545 1.00 0.00 ? 85  SER A H    3 
ATOM 6098  H HA   . SER A 1 22 ? 4.915   -1.092  -29.677 1.00 0.00 ? 85  SER A HA   3 
ATOM 6099  H HB2  . SER A 1 22 ? 1.977   -0.869  -29.155 1.00 0.00 ? 85  SER A HB2  3 
ATOM 6100  H HB3  . SER A 1 22 ? 3.140   -1.261  -27.895 1.00 0.00 ? 85  SER A HB3  3 
ATOM 6101  H HG   . SER A 1 22 ? 2.892   1.072   -29.463 1.00 0.00 ? 85  SER A HG   3 
ATOM 6102  N N    . PRO A 1 23 ? 4.435   -3.533  -28.933 1.00 0.00 ? 86  PRO A N    3 
ATOM 6103  C CA   . PRO A 1 23 ? 4.338   -4.977  -28.762 1.00 0.00 ? 86  PRO A CA   3 
ATOM 6104  C C    . PRO A 1 23 ? 2.888   -5.417  -28.595 1.00 0.00 ? 86  PRO A C    3 
ATOM 6105  O O    . PRO A 1 23 ? 2.503   -6.502  -29.028 1.00 0.00 ? 86  PRO A O    3 
ATOM 6106  C CB   . PRO A 1 23 ? 5.154   -5.231  -27.491 1.00 0.00 ? 86  PRO A CB   3 
ATOM 6107  C CG   . PRO A 1 23 ? 6.147   -4.117  -27.467 1.00 0.00 ? 86  PRO A CG   3 
ATOM 6108  C CD   . PRO A 1 23 ? 5.384   -2.925  -27.977 1.00 0.00 ? 86  PRO A CD   3 
ATOM 6109  H HA   . PRO A 1 23 ? 4.797   -5.490  -29.605 1.00 0.00 ? 86  PRO A HA   3 
ATOM 6110  H HB2  . PRO A 1 23 ? 4.512   -5.192  -26.604 1.00 0.00 ? 86  PRO A HB2  3 
ATOM 6111  H HB3  . PRO A 1 23 ? 5.667   -6.194  -27.546 1.00 0.00 ? 86  PRO A HB3  3 
ATOM 6112  H HG2  . PRO A 1 23 ? 6.504   -3.950  -26.446 1.00 0.00 ? 86  PRO A HG2  3 
ATOM 6113  H HG3  . PRO A 1 23 ? 6.984   -4.339  -28.131 1.00 0.00 ? 86  PRO A HG3  3 
ATOM 6114  H HD2  . PRO A 1 23 ? 4.867   -2.436  -27.149 1.00 0.00 ? 86  PRO A HD2  3 
ATOM 6115  H HD3  . PRO A 1 23 ? 6.066   -2.245  -28.469 1.00 0.00 ? 86  PRO A HD3  3 
ATOM 6116  N N    . GLU A 1 24 ? 2.088   -4.566  -27.962 1.00 0.00 ? 87  GLU A N    3 
ATOM 6117  C CA   . GLU A 1 24 ? 0.674   -4.856  -27.753 1.00 0.00 ? 87  GLU A CA   3 
ATOM 6118  C C    . GLU A 1 24 ? -0.134  -4.602  -29.020 1.00 0.00 ? 87  GLU A C    3 
ATOM 6119  O O    . GLU A 1 24 ? -1.226  -5.139  -29.188 1.00 0.00 ? 87  GLU A O    3 
ATOM 6120  C CB   . GLU A 1 24 ? 0.119   -4.009  -26.605 1.00 0.00 ? 87  GLU A CB   3 
ATOM 6121  C CG   . GLU A 1 24 ? 0.699   -4.348  -25.238 1.00 0.00 ? 87  GLU A CG   3 
ATOM 6122  C CD   . GLU A 1 24 ? 0.143   -3.487  -24.137 1.00 0.00 ? 87  GLU A CD   3 
ATOM 6123  O OE1  . GLU A 1 24 ? -0.592  -2.576  -24.435 1.00 0.00 ? 87  GLU A OE1  3 
ATOM 6124  O OE2  . GLU A 1 24 ? 0.453   -3.742  -22.997 1.00 0.00 ? 87  GLU A OE2  3 
ATOM 6125  H H    . GLU A 1 24 ? 2.470   -3.682  -27.628 1.00 0.00 ? 87  GLU A H    3 
ATOM 6126  H HA   . GLU A 1 24 ? 0.568   -5.905  -27.479 1.00 0.00 ? 87  GLU A HA   3 
ATOM 6127  H HB2  . GLU A 1 24 ? 0.337   -2.962  -26.816 1.00 0.00 ? 87  GLU A HB2  3 
ATOM 6128  H HB3  . GLU A 1 24 ? -0.962  -4.142  -26.560 1.00 0.00 ? 87  GLU A HB3  3 
ATOM 6129  H HG2  . GLU A 1 24 ? 0.475   -5.392  -25.018 1.00 0.00 ? 87  GLU A HG2  3 
ATOM 6130  H HG3  . GLU A 1 24 ? 1.781   -4.217  -25.279 1.00 0.00 ? 87  GLU A HG3  3 
ATOM 6131  N N    . GLU A 1 25 ? 0.412   -3.777  -29.908 1.00 0.00 ? 88  GLU A N    3 
ATOM 6132  C CA   . GLU A 1 25 ? -0.220  -3.509  -31.193 1.00 0.00 ? 88  GLU A CA   3 
ATOM 6133  C C    . GLU A 1 25 ? 0.157   -4.566  -32.222 1.00 0.00 ? 88  GLU A C    3 
ATOM 6134  O O    . GLU A 1 25 ? -0.497  -4.701  -33.257 1.00 0.00 ? 88  GLU A O    3 
ATOM 6135  C CB   . GLU A 1 25 ? 0.175   -2.122  -31.704 1.00 0.00 ? 88  GLU A CB   3 
ATOM 6136  C CG   . GLU A 1 25 ? -0.422  -0.967  -30.913 1.00 0.00 ? 88  GLU A CG   3 
ATOM 6137  C CD   . GLU A 1 25 ? 0.046   0.378   -31.397 1.00 0.00 ? 88  GLU A CD   3 
ATOM 6138  O OE1  . GLU A 1 25 ? 1.078   0.438   -32.020 1.00 0.00 ? 88  GLU A OE1  3 
ATOM 6139  O OE2  . GLU A 1 25 ? -0.633  1.346   -31.144 1.00 0.00 ? 88  GLU A OE2  3 
ATOM 6140  H H    . GLU A 1 25 ? 1.326   -3.369  -29.712 1.00 0.00 ? 88  GLU A H    3 
ATOM 6141  H HA   . GLU A 1 25 ? -1.304  -3.517  -31.062 1.00 0.00 ? 88  GLU A HA   3 
ATOM 6142  H HB2  . GLU A 1 25 ? 1.256   -2.045  -31.628 1.00 0.00 ? 88  GLU A HB2  3 
ATOM 6143  H HB3  . GLU A 1 25 ? -0.104  -2.029  -32.742 1.00 0.00 ? 88  GLU A HB3  3 
ATOM 6144  H HG2  . GLU A 1 25 ? -1.506  -1.015  -31.028 1.00 0.00 ? 88  GLU A HG2  3 
ATOM 6145  H HG3  . GLU A 1 25 ? -0.177  -1.083  -29.862 1.00 0.00 ? 88  GLU A HG3  3 
ATOM 6146  N N    . LEU A 1 26 ? 1.218   -5.313  -31.935 1.00 0.00 ? 89  LEU A N    3 
ATOM 6147  C CA   . LEU A 1 26 ? 1.725   -6.315  -32.866 1.00 0.00 ? 89  LEU A CA   3 
ATOM 6148  C C    . LEU A 1 26 ? 1.183   -7.699  -32.535 1.00 0.00 ? 89  LEU A C    3 
ATOM 6149  O O    . LEU A 1 26 ? 1.629   -8.341  -31.585 1.00 0.00 ? 89  LEU A O    3 
ATOM 6150  C CB   . LEU A 1 26 ? 3.258   -6.339  -32.834 1.00 0.00 ? 89  LEU A CB   3 
ATOM 6151  C CG   . LEU A 1 26 ? 3.960   -5.423  -33.846 1.00 0.00 ? 89  LEU A CG   3 
ATOM 6152  C CD1  . LEU A 1 26 ? 2.941   -4.475  -34.463 1.00 0.00 ? 89  LEU A CD1  3 
ATOM 6153  C CD2  . LEU A 1 26 ? 5.072   -4.656  -33.149 1.00 0.00 ? 89  LEU A CD2  3 
ATOM 6154  H H    . LEU A 1 26 ? 1.723   -5.145  -31.064 1.00 0.00 ? 89  LEU A H    3 
ATOM 6155  H HA   . LEU A 1 26 ? 1.384   -6.114  -33.852 1.00 0.00 ? 89  LEU A HA   3 
ATOM 6156  H HB2  . LEU A 1 26 ? 3.547   -6.039  -31.827 1.00 0.00 ? 89  LEU A HB2  3 
ATOM 6157  H HB3  . LEU A 1 26 ? 3.613   -7.359  -32.981 1.00 0.00 ? 89  LEU A HB3  3 
ATOM 6158  H HG   . LEU A 1 26 ? 4.403   -6.035  -34.639 1.00 0.00 ? 89  LEU A HG   3 
ATOM 6159  H HD11 . LEU A 1 26 ? 2.297   -4.033  -33.704 1.00 0.00 ? 89  LEU A HD11 3 
ATOM 6160  H HD12 . LEU A 1 26 ? 2.361   -4.995  -35.199 1.00 0.00 ? 89  LEU A HD12 3 
ATOM 6161  H HD13 . LEU A 1 26 ? 3.463   -3.707  -34.975 1.00 0.00 ? 89  LEU A HD13 3 
ATOM 6162  H HD21 . LEU A 1 26 ? 5.741   -4.226  -33.879 1.00 0.00 ? 89  LEU A HD21 3 
ATOM 6163  H HD22 . LEU A 1 26 ? 5.637   -5.323  -32.503 1.00 0.00 ? 89  LEU A HD22 3 
ATOM 6164  H HD23 . LEU A 1 26 ? 4.636   -3.858  -32.549 1.00 0.00 ? 89  LEU A HD23 3 
ATOM 6165  N N    . LYS A 1 27 ? 0.216   -8.154  -33.323 1.00 0.00 ? 90  LYS A N    3 
ATOM 6166  C CA   . LYS A 1 27 ? -0.285  -9.520  -33.217 1.00 0.00 ? 90  LYS A CA   3 
ATOM 6167  C C    . LYS A 1 27 ? 0.409   -10.440 -34.211 1.00 0.00 ? 90  LYS A C    3 
ATOM 6168  O O    . LYS A 1 27 ? -0.203  -10.905 -35.172 1.00 0.00 ? 90  LYS A O    3 
ATOM 6169  C CB   . LYS A 1 27 ? -1.798  -9.553  -33.430 1.00 0.00 ? 90  LYS A CB   3 
ATOM 6170  C CG   . LYS A 1 27 ? -2.602  -8.809  -32.376 1.00 0.00 ? 90  LYS A CG   3 
ATOM 6171  C CD   . LYS A 1 27 ? -4.091  -8.851  -32.682 1.00 0.00 ? 90  LYS A CD   3 
ATOM 6172  C CE   . LYS A 1 27 ? -4.893  -8.082  -31.643 1.00 0.00 ? 90  LYS A CE   3 
ATOM 6173  N NZ   . LYS A 1 27 ? -6.350  -8.085  -31.950 1.00 0.00 ? 90  LYS A NZ   3 
ATOM 6174  H H    . LYS A 1 27 ? -0.090  -7.581  -34.110 1.00 0.00 ? 90  LYS A H    3 
ATOM 6175  H HA   . LYS A 1 27 ? -0.088  -9.890  -32.205 1.00 0.00 ? 90  LYS A HA   3 
ATOM 6176  H HB2  . LYS A 1 27 ? -1.997  -9.059  -34.365 1.00 0.00 ? 90  LYS A HB2  3 
ATOM 6177  H HB3  . LYS A 1 27 ? -2.133  -10.574 -33.491 1.00 0.00 ? 90  LYS A HB3  3 
ATOM 6178  H HG2  . LYS A 1 27 ? -2.425  -9.284  -31.411 1.00 0.00 ? 90  LYS A HG2  3 
ATOM 6179  H HG3  . LYS A 1 27 ? -2.274  -7.770  -32.331 1.00 0.00 ? 90  LYS A HG3  3 
ATOM 6180  H HD2  . LYS A 1 27 ? -4.261  -8.404  -33.663 1.00 0.00 ? 90  LYS A HD2  3 
ATOM 6181  H HD3  . LYS A 1 27 ? -4.426  -9.888  -32.696 1.00 0.00 ? 90  LYS A HD3  3 
ATOM 6182  H HE2  . LYS A 1 27 ? -4.737  -8.541  -30.667 1.00 0.00 ? 90  LYS A HE2  3 
ATOM 6183  H HE3  . LYS A 1 27 ? -4.539  -7.051  -31.614 1.00 0.00 ? 90  LYS A HE3  3 
ATOM 6184  H HZ1  . LYS A 1 27 ? -6.837  -7.376  -31.367 1.00 0.00 ? 90  LYS A HZ1  3 
ATOM 6185  H HZ2  . LYS A 1 27 ? -6.741  -9.029  -31.748 1.00 0.00 ? 90  LYS A HZ2  3 
ATOM 6186  H HZ3  . LYS A 1 27 ? -6.487  -7.868  -32.927 1.00 0.00 ? 90  LYS A HZ3  3 
ATOM 6187  N N    . VAL A 1 28 ? 1.691   -10.701 -33.975 1.00 0.00 ? 91  VAL A N    3 
ATOM 6188  C CA   . VAL A 1 28 ? 2.488   -11.511 -34.890 1.00 0.00 ? 91  VAL A CA   3 
ATOM 6189  C C    . VAL A 1 28 ? 2.115   -12.983 -34.791 1.00 0.00 ? 91  VAL A C    3 
ATOM 6190  O O    . VAL A 1 28 ? 2.412   -13.644 -33.797 1.00 0.00 ? 91  VAL A O    3 
ATOM 6191  C CB   . VAL A 1 28 ? 3.988   -11.342 -34.580 1.00 0.00 ? 91  VAL A CB   3 
ATOM 6192  C CG1  . VAL A 1 28 ? 4.824   -12.199 -35.520 1.00 0.00 ? 91  VAL A CG1  3 
ATOM 6193  C CG2  . VAL A 1 28 ? 4.379   -9.877  -34.694 1.00 0.00 ? 91  VAL A CG2  3 
ATOM 6194  H H    . VAL A 1 28 ? 2.140   -10.280 -33.164 1.00 0.00 ? 91  VAL A H    3 
ATOM 6195  H HA   . VAL A 1 28 ? 2.314   -11.173 -35.902 1.00 0.00 ? 91  VAL A HA   3 
ATOM 6196  H HB   . VAL A 1 28 ? 4.170   -11.675 -33.559 1.00 0.00 ? 91  VAL A HB   3 
ATOM 6197  H HG11 . VAL A 1 28 ? 4.493   -12.028 -36.545 1.00 0.00 ? 91  VAL A HG11 3 
ATOM 6198  H HG12 . VAL A 1 28 ? 4.703   -13.251 -35.271 1.00 0.00 ? 91  VAL A HG12 3 
ATOM 6199  H HG13 . VAL A 1 28 ? 5.874   -11.923 -35.429 1.00 0.00 ? 91  VAL A HG13 3 
ATOM 6200  H HG21 . VAL A 1 28 ? 4.389   -9.591  -35.733 1.00 0.00 ? 91  VAL A HG21 3 
ATOM 6201  H HG22 . VAL A 1 28 ? 5.368   -9.726  -34.263 1.00 0.00 ? 91  VAL A HG22 3 
ATOM 6202  H HG23 . VAL A 1 28 ? 3.655   -9.273  -34.164 1.00 0.00 ? 91  VAL A HG23 3 
ATOM 6203  N N    . LYS A 1 29 ? 1.460   -13.494 -35.828 1.00 0.00 ? 92  LYS A N    3 
ATOM 6204  C CA   . LYS A 1 29 ? 0.868   -14.825 -35.782 1.00 0.00 ? 92  LYS A CA   3 
ATOM 6205  C C    . LYS A 1 29 ? 1.370   -15.691 -36.930 1.00 0.00 ? 92  LYS A C    3 
ATOM 6206  O O    . LYS A 1 29 ? 1.943   -15.187 -37.896 1.00 0.00 ? 92  LYS A O    3 
ATOM 6207  C CB   . LYS A 1 29 ? -0.658  -14.734 -35.819 1.00 0.00 ? 92  LYS A CB   3 
ATOM 6208  C CG   . LYS A 1 29 ? -1.282  -14.122 -34.571 1.00 0.00 ? 92  LYS A CG   3 
ATOM 6209  C CD   . LYS A 1 29 ? -2.800  -14.120 -34.657 1.00 0.00 ? 92  LYS A CD   3 
ATOM 6210  C CE   . LYS A 1 29 ? -3.426  -13.530 -33.402 1.00 0.00 ? 92  LYS A CE   3 
ATOM 6211  N NZ   . LYS A 1 29 ? -4.913  -13.559 -33.454 1.00 0.00 ? 92  LYS A NZ   3 
ATOM 6212  H H    . LYS A 1 29 ? 1.219   -12.884 -36.610 1.00 0.00 ? 92  LYS A H    3 
ATOM 6213  H HA   . LYS A 1 29 ? 1.143   -15.317 -34.849 1.00 0.00 ? 92  LYS A HA   3 
ATOM 6214  H HB2  . LYS A 1 29 ? -0.942  -14.128 -36.676 1.00 0.00 ? 92  LYS A HB2  3 
ATOM 6215  H HB3  . LYS A 1 29 ? -1.065  -15.738 -35.950 1.00 0.00 ? 92  LYS A HB3  3 
ATOM 6216  H HG2  . LYS A 1 29 ? -0.975  -14.700 -33.699 1.00 0.00 ? 92  LYS A HG2  3 
ATOM 6217  H HG3  . LYS A 1 29 ? -0.929  -13.097 -34.468 1.00 0.00 ? 92  LYS A HG3  3 
ATOM 6218  H HD2  . LYS A 1 29 ? -3.107  -13.522 -35.516 1.00 0.00 ? 92  LYS A HD2  3 
ATOM 6219  H HD3  . LYS A 1 29 ? -3.151  -15.142 -34.786 1.00 0.00 ? 92  LYS A HD3  3 
ATOM 6220  H HE2  . LYS A 1 29 ? -3.098  -14.112 -32.542 1.00 0.00 ? 92  LYS A HE2  3 
ATOM 6221  H HE3  . LYS A 1 29 ? -3.095  -12.512 -33.282 1.00 0.00 ? 92  LYS A HE3  3 
ATOM 6222  H HZ1  . LYS A 1 29 ? -5.281  -12.589 -33.403 1.00 0.00 ? 92  LYS A HZ1  3 
ATOM 6223  H HZ2  . LYS A 1 29 ? -5.283  -14.113 -32.656 1.00 0.00 ? 92  LYS A HZ2  3 
ATOM 6224  H HZ3  . LYS A 1 29 ? -5.209  -13.984 -34.321 1.00 0.00 ? 92  LYS A HZ3  3 
ATOM 6225  N N    . VAL A 1 30 ? 1.148   -16.997 -36.822 1.00 0.00 ? 93  VAL A N    3 
ATOM 6226  C CA   . VAL A 1 30 ? 1.359   -17.907 -37.941 1.00 0.00 ? 93  VAL A CA   3 
ATOM 6227  C C    . VAL A 1 30 ? 0.122   -18.755 -38.203 1.00 0.00 ? 93  VAL A C    3 
ATOM 6228  O O    . VAL A 1 30 ? -0.682  -18.991 -37.302 1.00 0.00 ? 93  VAL A O    3 
ATOM 6229  C CB   . VAL A 1 30 ? 2.562   -18.829 -37.661 1.00 0.00 ? 93  VAL A CB   3 
ATOM 6230  C CG1  . VAL A 1 30 ? 3.829   -18.008 -37.475 1.00 0.00 ? 93  VAL A CG1  3 
ATOM 6231  C CG2  . VAL A 1 30 ? 2.285   -19.680 -36.433 1.00 0.00 ? 93  VAL A CG2  3 
ATOM 6232  H H    . VAL A 1 30 ? 0.639   -17.336 -36.007 1.00 0.00 ? 93  VAL A H    3 
ATOM 6233  H HA   . VAL A 1 30 ? 1.553   -17.340 -38.840 1.00 0.00 ? 93  VAL A HA   3 
ATOM 6234  H HB   . VAL A 1 30 ? 2.686   -19.494 -38.520 1.00 0.00 ? 93  VAL A HB   3 
ATOM 6235  H HG11 . VAL A 1 30 ? 3.681   -16.981 -37.800 1.00 0.00 ? 93  VAL A HG11 3 
ATOM 6236  H HG12 . VAL A 1 30 ? 4.628   -18.452 -38.054 1.00 0.00 ? 93  VAL A HG12 3 
ATOM 6237  H HG13 . VAL A 1 30 ? 4.120   -18.002 -36.420 1.00 0.00 ? 93  VAL A HG13 3 
ATOM 6238  H HG21 . VAL A 1 30 ? 1.507   -20.408 -36.660 1.00 0.00 ? 93  VAL A HG21 3 
ATOM 6239  H HG22 . VAL A 1 30 ? 1.955   -19.037 -35.618 1.00 0.00 ? 93  VAL A HG22 3 
ATOM 6240  H HG23 . VAL A 1 30 ? 3.197   -20.203 -36.139 1.00 0.00 ? 93  VAL A HG23 3 
ATOM 6241  N N    . LEU A 1 31 ? -0.024  -19.212 -39.442 1.00 0.00 ? 94  LEU A N    3 
ATOM 6242  C CA   . LEU A 1 31 ? -1.142  -20.071 -39.814 1.00 0.00 ? 94  LEU A CA   3 
ATOM 6243  C C    . LEU A 1 31 ? -0.656  -21.336 -40.510 1.00 0.00 ? 94  LEU A C    3 
ATOM 6244  O O    . LEU A 1 31 ? -0.903  -21.538 -41.699 1.00 0.00 ? 94  LEU A O    3 
ATOM 6245  C CB   . LEU A 1 31 ? -2.110  -19.315 -40.733 1.00 0.00 ? 94  LEU A CB   3 
ATOM 6246  C CG   . LEU A 1 31 ? -2.779  -18.079 -40.119 1.00 0.00 ? 94  LEU A CG   3 
ATOM 6247  C CD1  . LEU A 1 31 ? -3.515  -17.307 -41.208 1.00 0.00 ? 94  LEU A CD1  3 
ATOM 6248  C CD2  . LEU A 1 31 ? -3.734  -18.511 -39.017 1.00 0.00 ? 94  LEU A CD2  3 
ATOM 6249  H H    . LEU A 1 31 ? 0.682   -18.987 -40.144 1.00 0.00 ? 94  LEU A H    3 
ATOM 6250  H HA   . LEU A 1 31 ? -1.685  -20.379 -38.919 1.00 0.00 ? 94  LEU A HA   3 
ATOM 6251  H HB2  . LEU A 1 31 ? -1.603  -19.015 -41.614 1.00 0.00 ? 94  LEU A HB2  3 
ATOM 6252  H HB3  . LEU A 1 31 ? -2.900  -20.008 -41.022 1.00 0.00 ? 94  LEU A HB3  3 
ATOM 6253  H HG   . LEU A 1 31 ? -2.001  -17.442 -39.695 1.00 0.00 ? 94  LEU A HG   3 
ATOM 6254  H HD11 . LEU A 1 31 ? -4.154  -17.989 -41.770 1.00 0.00 ? 94  LEU A HD11 3 
ATOM 6255  H HD12 . LEU A 1 31 ? -2.791  -16.853 -41.880 1.00 0.00 ? 94  LEU A HD12 3 
ATOM 6256  H HD13 . LEU A 1 31 ? -4.126  -16.525 -40.757 1.00 0.00 ? 94  LEU A HD13 3 
ATOM 6257  H HD21 . LEU A 1 31 ? -4.346  -19.346 -39.359 1.00 0.00 ? 94  LEU A HD21 3 
ATOM 6258  H HD22 . LEU A 1 31 ? -4.382  -17.676 -38.755 1.00 0.00 ? 94  LEU A HD22 3 
ATOM 6259  H HD23 . LEU A 1 31 ? -3.174  -18.811 -38.134 1.00 0.00 ? 94  LEU A HD23 3 
ATOM 6260  N N    . GLY A 1 32 ? 0.038   -22.188 -39.761 1.00 0.00 ? 95  GLY A N    3 
ATOM 6261  C CA   . GLY A 1 32 ? 0.525   -23.454 -40.294 1.00 0.00 ? 95  GLY A CA   3 
ATOM 6262  C C    . GLY A 1 32 ? 1.940   -23.314 -40.843 1.00 0.00 ? 95  GLY A C    3 
ATOM 6263  O O    . GLY A 1 32 ? 2.916   -23.452 -40.109 1.00 0.00 ? 95  GLY A O    3 
ATOM 6264  H H    . GLY A 1 32 ? 0.201   -21.968 -38.778 1.00 0.00 ? 95  GLY A H    3 
ATOM 6265  H HA2  . GLY A 1 32 ? 0.531   -24.197 -39.498 1.00 0.00 ? 95  GLY A HA2  3 
ATOM 6266  H HA3  . GLY A 1 32 ? -0.133  -23.798 -41.094 1.00 0.00 ? 95  GLY A HA3  3 
ATOM 6267  N N    . ASP A 1 33 ? 2.041   -23.036 -42.139 1.00 0.00 ? 96  ASP A N    3 
ATOM 6268  C CA   . ASP A 1 33 ? 3.334   -22.826 -42.778 1.00 0.00 ? 96  ASP A CA   3 
ATOM 6269  C C    . ASP A 1 33 ? 3.466   -21.401 -43.301 1.00 0.00 ? 96  ASP A C    3 
ATOM 6270  O O    . ASP A 1 33 ? 4.246   -21.135 -44.214 1.00 0.00 ? 96  ASP A O    3 
ATOM 6271  C CB   . ASP A 1 33 ? 3.530   -23.818 -43.927 1.00 0.00 ? 96  ASP A CB   3 
ATOM 6272  C CG   . ASP A 1 33 ? 2.486   -23.668 -45.026 1.00 0.00 ? 96  ASP A CG   3 
ATOM 6273  O OD1  . ASP A 1 33 ? 1.519   -22.977 -44.807 1.00 0.00 ? 96  ASP A OD1  3 
ATOM 6274  O OD2  . ASP A 1 33 ? 2.663   -24.246 -46.071 1.00 0.00 ? 96  ASP A OD2  3 
ATOM 6275  H H    . ASP A 1 33 ? 1.189   -22.925 -42.690 1.00 0.00 ? 96  ASP A H    3 
ATOM 6276  H HA   . ASP A 1 33 ? 4.133   -22.989 -42.052 1.00 0.00 ? 96  ASP A HA   3 
ATOM 6277  H HB2  . ASP A 1 33 ? 4.518   -23.663 -44.361 1.00 0.00 ? 96  ASP A HB2  3 
ATOM 6278  H HB3  . ASP A 1 33 ? 3.476   -24.832 -43.528 1.00 0.00 ? 96  ASP A HB3  3 
ATOM 6279  N N    . VAL A 1 34 ? 2.698   -20.488 -42.715 1.00 0.00 ? 97  VAL A N    3 
ATOM 6280  C CA   . VAL A 1 34 ? 2.785   -19.075 -43.064 1.00 0.00 ? 97  VAL A CA   3 
ATOM 6281  C C    . VAL A 1 34 ? 2.846   -18.205 -41.817 1.00 0.00 ? 97  VAL A C    3 
ATOM 6282  O O    . VAL A 1 34 ? 2.548   -18.660 -40.713 1.00 0.00 ? 97  VAL A O    3 
ATOM 6283  C CB   . VAL A 1 34 ? 1.573   -18.661 -43.918 1.00 0.00 ? 97  VAL A CB   3 
ATOM 6284  C CG1  . VAL A 1 34 ? 1.483   -19.524 -45.170 1.00 0.00 ? 97  VAL A CG1  3 
ATOM 6285  C CG2  . VAL A 1 34 ? 0.299   -18.768 -43.095 1.00 0.00 ? 97  VAL A CG2  3 
ATOM 6286  H H    . VAL A 1 34 ? 2.083   -20.776 -41.954 1.00 0.00 ? 97  VAL A H    3 
ATOM 6287  H HA   . VAL A 1 34 ? 3.694   -18.907 -43.613 1.00 0.00 ? 97  VAL A HA   3 
ATOM 6288  H HB   . VAL A 1 34 ? 1.724   -17.634 -44.215 1.00 0.00 ? 97  VAL A HB   3 
ATOM 6289  H HG11 . VAL A 1 34 ? 2.431   -19.548 -45.691 1.00 0.00 ? 97  VAL A HG11 3 
ATOM 6290  H HG12 . VAL A 1 34 ? 0.706   -19.136 -45.828 1.00 0.00 ? 97  VAL A HG12 3 
ATOM 6291  H HG13 . VAL A 1 34 ? 1.217   -20.537 -44.867 1.00 0.00 ? 97  VAL A HG13 3 
ATOM 6292  H HG21 . VAL A 1 34 ? -0.573  -18.721 -43.751 1.00 0.00 ? 97  VAL A HG21 3 
ATOM 6293  H HG22 . VAL A 1 34 ? 0.307   -19.719 -42.566 1.00 0.00 ? 97  VAL A HG22 3 
ATOM 6294  H HG23 . VAL A 1 34 ? 0.263   -17.946 -42.379 1.00 0.00 ? 97  VAL A HG23 3 
ATOM 6295  N N    . ILE A 1 35 ? 3.233   -16.946 -42.000 1.00 0.00 ? 98  ILE A N    3 
ATOM 6296  C CA   . ILE A 1 35 ? 3.440   -16.037 -40.879 1.00 0.00 ? 98  ILE A CA   3 
ATOM 6297  C C    . ILE A 1 35 ? 2.554   -14.802 -41.002 1.00 0.00 ? 98  ILE A C    3 
ATOM 6298  O O    . ILE A 1 35 ? 2.975   -13.779 -41.541 1.00 0.00 ? 98  ILE A O    3 
ATOM 6299  C CB   . ILE A 1 35 ? 4.915   -15.607 -40.783 1.00 0.00 ? 98  ILE A CB   3 
ATOM 6300  C CG1  . ILE A 1 35 ? 5.823   -16.835 -40.693 1.00 0.00 ? 98  ILE A CG1  3 
ATOM 6301  C CG2  . ILE A 1 35 ? 5.126   -14.696 -39.585 1.00 0.00 ? 98  ILE A CG2  3 
ATOM 6302  C CD1  . ILE A 1 35 ? 7.293   -16.521 -40.857 1.00 0.00 ? 98  ILE A CD1  3 
ATOM 6303  H H    . ILE A 1 35 ? 3.480   -16.638 -42.939 1.00 0.00 ? 98  ILE A H    3 
ATOM 6304  H HA   . ILE A 1 35 ? 3.193   -16.532 -39.962 1.00 0.00 ? 98  ILE A HA   3 
ATOM 6305  H HB   . ILE A 1 35 ? 5.170   -15.070 -41.671 1.00 0.00 ? 98  ILE A HB   3 
ATOM 6306  H HG12 . ILE A 1 35 ? 5.686   -17.290 -39.720 1.00 0.00 ? 98  ILE A HG12 3 
ATOM 6307  H HG13 . ILE A 1 35 ? 5.527   -17.542 -41.452 1.00 0.00 ? 98  ILE A HG13 3 
ATOM 6308  H HG21 . ILE A 1 35 ? 6.095   -14.216 -39.666 1.00 0.00 ? 98  ILE A HG21 3 
ATOM 6309  H HG22 . ILE A 1 35 ? 5.092   -15.286 -38.671 1.00 0.00 ? 98  ILE A HG22 3 
ATOM 6310  H HG23 . ILE A 1 35 ? 4.359   -13.926 -39.540 1.00 0.00 ? 98  ILE A HG23 3 
ATOM 6311  H HD11 . ILE A 1 35 ? 7.635   -15.934 -40.010 1.00 0.00 ? 98  ILE A HD11 3 
ATOM 6312  H HD12 . ILE A 1 35 ? 7.860   -17.450 -40.907 1.00 0.00 ? 98  ILE A HD12 3 
ATOM 6313  H HD13 . ILE A 1 35 ? 7.443   -15.954 -41.775 1.00 0.00 ? 98  ILE A HD13 3 
ATOM 6314  N N    . GLU A 1 36 ? 1.331   -14.906 -40.499 1.00 0.00 ? 99  GLU A N    3 
ATOM 6315  C CA   . GLU A 1 36 ? 0.379   -13.802 -40.570 1.00 0.00 ? 99  GLU A CA   3 
ATOM 6316  C C    . GLU A 1 36 ? 0.726   -12.709 -39.568 1.00 0.00 ? 99  GLU A C    3 
ATOM 6317  O O    . GLU A 1 36 ? 0.326   -12.771 -38.404 1.00 0.00 ? 99  GLU A O    3 
ATOM 6318  C CB   . GLU A 1 36 ? -1.043  -14.306 -40.317 1.00 0.00 ? 99  GLU A CB   3 
ATOM 6319  C CG   . GLU A 1 36 ? -2.122  -13.241 -40.443 1.00 0.00 ? 99  GLU A CG   3 
ATOM 6320  C CD   . GLU A 1 36 ? -3.491  -13.749 -40.085 1.00 0.00 ? 99  GLU A CD   3 
ATOM 6321  O OE1  . GLU A 1 36 ? -3.636  -14.310 -39.026 1.00 0.00 ? 99  GLU A OE1  3 
ATOM 6322  O OE2  . GLU A 1 36 ? -4.392  -13.573 -40.871 1.00 0.00 ? 99  GLU A OE2  3 
ATOM 6323  H H    . GLU A 1 36 ? 1.045   -15.780 -40.061 1.00 0.00 ? 99  GLU A H    3 
ATOM 6324  H HA   . GLU A 1 36 ? 0.409   -13.355 -41.544 1.00 0.00 ? 99  GLU A HA   3 
ATOM 6325  H HB2  . GLU A 1 36 ? -1.259  -15.101 -41.033 1.00 0.00 ? 99  GLU A HB2  3 
ATOM 6326  H HB3  . GLU A 1 36 ? -1.090  -14.719 -39.311 1.00 0.00 ? 99  GLU A HB3  3 
ATOM 6327  H HG2  . GLU A 1 36 ? -1.874  -12.412 -39.782 1.00 0.00 ? 99  GLU A HG2  3 
ATOM 6328  H HG3  . GLU A 1 36 ? -2.134  -12.883 -41.473 1.00 0.00 ? 99  GLU A HG3  3 
ATOM 6329  N N    . VAL A 1 37 ? 1.473   -11.709 -40.023 1.00 0.00 ? 100 VAL A N    3 
ATOM 6330  C CA   . VAL A 1 37 ? 1.849   -10.585 -39.175 1.00 0.00 ? 100 VAL A CA   3 
ATOM 6331  C C    . VAL A 1 37 ? 0.725   -9.561  -39.084 1.00 0.00 ? 100 VAL A C    3 
ATOM 6332  O O    . VAL A 1 37 ? 0.501   -8.786  -40.014 1.00 0.00 ? 100 VAL A O    3 
ATOM 6333  C CB   . VAL A 1 37 ? 3.117   -9.903  -39.725 1.00 0.00 ? 100 VAL A CB   3 
ATOM 6334  C CG1  . VAL A 1 37 ? 3.561   -8.780  -38.798 1.00 0.00 ? 100 VAL A CG1  3 
ATOM 6335  C CG2  . VAL A 1 37 ? 4.223   -10.930 -39.896 1.00 0.00 ? 100 VAL A CG2  3 
ATOM 6336  H H    . VAL A 1 37 ? 1.762   -11.714 -41.001 1.00 0.00 ? 100 VAL A H    3 
ATOM 6337  H HA   . VAL A 1 37 ? 2.065   -10.957 -38.181 1.00 0.00 ? 100 VAL A HA   3 
ATOM 6338  H HB   . VAL A 1 37 ? 2.892   -9.468  -40.670 1.00 0.00 ? 100 VAL A HB   3 
ATOM 6339  H HG11 . VAL A 1 37 ? 4.579   -8.478  -39.047 1.00 0.00 ? 100 VAL A HG11 3 
ATOM 6340  H HG12 . VAL A 1 37 ? 3.528   -9.129  -37.775 1.00 0.00 ? 100 VAL A HG12 3 
ATOM 6341  H HG13 . VAL A 1 37 ? 2.893   -7.924  -38.908 1.00 0.00 ? 100 VAL A HG13 3 
ATOM 6342  H HG21 . VAL A 1 37 ? 5.048   -10.486 -40.455 1.00 0.00 ? 100 VAL A HG21 3 
ATOM 6343  H HG22 . VAL A 1 37 ? 3.842   -11.793 -40.441 1.00 0.00 ? 100 VAL A HG22 3 
ATOM 6344  H HG23 . VAL A 1 37 ? 4.579   -11.248 -38.915 1.00 0.00 ? 100 VAL A HG23 3 
ATOM 6345  N N    . HIS A 1 38 ? 0.019   -9.565  -37.957 1.00 0.00 ? 101 HIS A N    3 
ATOM 6346  C CA   . HIS A 1 38 ? -1.181  -8.751  -37.802 1.00 0.00 ? 101 HIS A CA   3 
ATOM 6347  C C    . HIS A 1 38 ? -0.898  -7.510  -36.963 1.00 0.00 ? 101 HIS A C    3 
ATOM 6348  O O    . HIS A 1 38 ? -1.442  -7.351  -35.870 1.00 0.00 ? 101 HIS A O    3 
ATOM 6349  C CB   . HIS A 1 38 ? -2.309  -9.564  -37.160 1.00 0.00 ? 101 HIS A CB   3 
ATOM 6350  C CG   . HIS A 1 38 ? -3.561  -8.777  -36.932 1.00 0.00 ? 101 HIS A CG   3 
ATOM 6351  N ND1  . HIS A 1 38 ? -4.736  -9.359  -36.502 1.00 0.00 ? 101 HIS A ND1  3 
ATOM 6352  C CD2  . HIS A 1 38 ? -3.825  -7.457  -37.073 1.00 0.00 ? 101 HIS A CD2  3 
ATOM 6353  C CE1  . HIS A 1 38 ? -5.668  -8.429  -36.388 1.00 0.00 ? 101 HIS A CE1  3 
ATOM 6354  N NE2  . HIS A 1 38 ? -5.141  -7.267  -36.729 1.00 0.00 ? 101 HIS A NE2  3 
ATOM 6355  H H    . HIS A 1 38 ? 0.245   -10.251 -37.236 1.00 0.00 ? 101 HIS A H    3 
ATOM 6356  H HA   . HIS A 1 38 ? -1.513  -8.417  -38.780 1.00 0.00 ? 101 HIS A HA   3 
ATOM 6357  H HB2  . HIS A 1 38 ? -2.553  -10.371 -37.849 1.00 0.00 ? 101 HIS A HB2  3 
ATOM 6358  H HB3  . HIS A 1 38 ? -1.974  -10.003 -36.243 1.00 0.00 ? 101 HIS A HB3  3 
ATOM 6359  H HD2  . HIS A 1 38 ? -3.257  -6.781  -37.691 1.00 0.00 ? 101 HIS A HD2  3 
ATOM 6360  H HE1  . HIS A 1 38 ? -6.688  -8.594  -36.071 1.00 0.00 ? 101 HIS A HE1  3 
ATOM 6361  H HE2  . HIS A 1 38 ? -5.627  -6.381  -36.735 1.00 0.00 ? 101 HIS A HE2  3 
ATOM 6362  N N    . GLY A 1 39 ? -0.047  -6.632  -37.481 1.00 0.00 ? 102 GLY A N    3 
ATOM 6363  C CA   . GLY A 1 39 ? 0.243   -5.364  -36.823 1.00 0.00 ? 102 GLY A CA   3 
ATOM 6364  C C    . GLY A 1 39 ? -0.895  -4.371  -37.017 1.00 0.00 ? 102 GLY A C    3 
ATOM 6365  O O    . GLY A 1 39 ? -1.637  -4.446  -37.998 1.00 0.00 ? 102 GLY A O    3 
ATOM 6366  H H    . GLY A 1 39 ? 0.353   -6.816  -38.402 1.00 0.00 ? 102 GLY A H    3 
ATOM 6367  H HA2  . GLY A 1 39 ? 0.342   -5.548  -35.767 1.00 0.00 ? 102 GLY A HA2  3 
ATOM 6368  H HA3  . GLY A 1 39 ? 1.169   -4.951  -37.221 1.00 0.00 ? 102 GLY A HA3  3 
ATOM 6369  N N    . LYS A 1 40 ? -1.030  -3.441  -36.077 1.00 0.00 ? 103 LYS A N    3 
ATOM 6370  C CA   . LYS A 1 40 ? -2.188  -2.554  -36.037 1.00 0.00 ? 103 LYS A CA   3 
ATOM 6371  C C    . LYS A 1 40 ? -1.848  -1.237  -35.353 1.00 0.00 ? 103 LYS A C    3 
ATOM 6372  O O    . LYS A 1 40 ? -1.552  -1.205  -34.159 1.00 0.00 ? 103 LYS A O    3 
ATOM 6373  C CB   . LYS A 1 40 ? -3.357  -3.234  -35.321 1.00 0.00 ? 103 LYS A CB   3 
ATOM 6374  C CG   . LYS A 1 40 ? -4.605  -2.370  -35.197 1.00 0.00 ? 103 LYS A CG   3 
ATOM 6375  C CD   . LYS A 1 40 ? -5.774  -3.166  -34.639 1.00 0.00 ? 103 LYS A CD   3 
ATOM 6376  C CE   . LYS A 1 40 ? -7.026  -2.307  -34.520 1.00 0.00 ? 103 LYS A CE   3 
ATOM 6377  N NZ   . LYS A 1 40 ? -8.181  -3.077  -33.986 1.00 0.00 ? 103 LYS A NZ   3 
ATOM 6378  H H    . LYS A 1 40 ? -0.397  -3.460  -35.277 1.00 0.00 ? 103 LYS A H    3 
ATOM 6379  H HA   . LYS A 1 40 ? -2.471  -2.318  -37.042 1.00 0.00 ? 103 LYS A HA   3 
ATOM 6380  H HB2  . LYS A 1 40 ? -3.626  -4.129  -35.879 1.00 0.00 ? 103 LYS A HB2  3 
ATOM 6381  H HB3  . LYS A 1 40 ? -3.029  -3.533  -34.325 1.00 0.00 ? 103 LYS A HB3  3 
ATOM 6382  H HG2  . LYS A 1 40 ? -4.380  -1.561  -34.499 1.00 0.00 ? 103 LYS A HG2  3 
ATOM 6383  H HG3  . LYS A 1 40 ? -4.860  -1.939  -36.155 1.00 0.00 ? 103 LYS A HG3  3 
ATOM 6384  H HD2  . LYS A 1 40 ? -5.979  -4.009  -35.298 1.00 0.00 ? 103 LYS A HD2  3 
ATOM 6385  H HD3  . LYS A 1 40 ? -5.514  -3.544  -33.651 1.00 0.00 ? 103 LYS A HD3  3 
ATOM 6386  H HE2  . LYS A 1 40 ? -6.816  -1.471  -33.853 1.00 0.00 ? 103 LYS A HE2  3 
ATOM 6387  H HE3  . LYS A 1 40 ? -7.282  -1.922  -35.509 1.00 0.00 ? 103 LYS A HE3  3 
ATOM 6388  H HZ1  . LYS A 1 40 ? -9.071  -2.594  -34.224 1.00 0.00 ? 103 LYS A HZ1  3 
ATOM 6389  H HZ2  . LYS A 1 40 ? -8.094  -3.155  -32.951 1.00 0.00 ? 103 LYS A HZ2  3 
ATOM 6390  H HZ3  . LYS A 1 40 ? -8.183  -4.002  -34.392 1.00 0.00 ? 103 LYS A HZ3  3 
ATOM 6391  N N    . HIS A 1 41 ? -1.892  -0.152  -36.118 1.00 0.00 ? 104 HIS A N    3 
ATOM 6392  C CA   . HIS A 1 41 ? -2.073  1.179   -35.549 1.00 0.00 ? 104 HIS A CA   3 
ATOM 6393  C C    . HIS A 1 41 ? -3.541  1.463   -35.263 1.00 0.00 ? 104 HIS A C    3 
ATOM 6394  O O    . HIS A 1 41 ? -4.428  0.872   -35.879 1.00 0.00 ? 104 HIS A O    3 
ATOM 6395  C CB   . HIS A 1 41 ? -1.514  2.250   -36.490 1.00 0.00 ? 104 HIS A CB   3 
ATOM 6396  C CG   . HIS A 1 41 ? -0.028  2.415   -36.401 1.00 0.00 ? 104 HIS A CG   3 
ATOM 6397  N ND1  . HIS A 1 41 ? 0.778   2.511   -37.516 1.00 0.00 ? 104 HIS A ND1  3 
ATOM 6398  C CD2  . HIS A 1 41 ? 0.797   2.501   -35.331 1.00 0.00 ? 104 HIS A CD2  3 
ATOM 6399  C CE1  . HIS A 1 41 ? 2.037   2.650   -37.135 1.00 0.00 ? 104 HIS A CE1  3 
ATOM 6400  N NE2  . HIS A 1 41 ? 2.074   2.646   -35.815 1.00 0.00 ? 104 HIS A NE2  3 
ATOM 6401  H H    . HIS A 1 41 ? -2.207  -0.275  -37.081 1.00 0.00 ? 104 HIS A H    3 
ATOM 6402  H HA   . HIS A 1 41 ? -1.512  1.212   -34.610 1.00 0.00 ? 104 HIS A HA   3 
ATOM 6403  H HB2  . HIS A 1 41 ? -1.776  1.975   -37.486 1.00 0.00 ? 104 HIS A HB2  3 
ATOM 6404  H HB3  . HIS A 1 41 ? -1.980  3.210   -36.255 1.00 0.00 ? 104 HIS A HB3  3 
ATOM 6405  H HD1  . HIS A 1 41 ? 0.456   2.481   -38.484 1.00 0.00 ? 104 HIS A HD1  3 
ATOM 6406  H HD2  . HIS A 1 41 ? 0.483   2.680   -34.313 1.00 0.00 ? 104 HIS A HD2  3 
ATOM 6407  H HE1  . HIS A 1 41 ? 2.860   2.791   -37.805 1.00 0.00 ? 104 HIS A HE1  3 
ATOM 6408  N N    . GLU A 1 42 ? -3.791  2.369   -34.325 1.00 0.00 ? 105 GLU A N    3 
ATOM 6409  C CA   . GLU A 1 42 ? -5.136  2.882   -34.095 1.00 0.00 ? 105 GLU A CA   3 
ATOM 6410  C C    . GLU A 1 42 ? -5.098  4.302   -33.543 1.00 0.00 ? 105 GLU A C    3 
ATOM 6411  O O    . GLU A 1 42 ? -4.357  4.594   -32.604 1.00 0.00 ? 105 GLU A O    3 
ATOM 6412  C CB   . GLU A 1 42 ? -5.898  1.971   -33.129 1.00 0.00 ? 105 GLU A CB   3 
ATOM 6413  C CG   . GLU A 1 42 ? -7.327  2.412   -32.843 1.00 0.00 ? 105 GLU A CG   3 
ATOM 6414  C CD   . GLU A 1 42 ? -8.077  1.439   -31.976 1.00 0.00 ? 105 GLU A CD   3 
ATOM 6415  O OE1  . GLU A 1 42 ? -7.510  0.436   -31.613 1.00 0.00 ? 105 GLU A OE1  3 
ATOM 6416  O OE2  . GLU A 1 42 ? -9.218  1.698   -31.678 1.00 0.00 ? 105 GLU A OE2  3 
ATOM 6417  H H    . GLU A 1 42 ? -3.007  2.843   -33.874 1.00 0.00 ? 105 GLU A H    3 
ATOM 6418  H HA   . GLU A 1 42 ? -5.682  2.907   -35.021 1.00 0.00 ? 105 GLU A HA   3 
ATOM 6419  H HB2  . GLU A 1 42 ? -5.931  0.967   -33.555 1.00 0.00 ? 105 GLU A HB2  3 
ATOM 6420  H HB3  . GLU A 1 42 ? -5.356  1.936   -32.184 1.00 0.00 ? 105 GLU A HB3  3 
ATOM 6421  H HG2  . GLU A 1 42 ? -7.276  3.348   -32.326 1.00 0.00 ? 105 GLU A HG2  3 
ATOM 6422  H HG3  . GLU A 1 42 ? -7.855  2.542   -33.788 1.00 0.00 ? 105 GLU A HG3  3 
ATOM 6423  N N    . GLU A 1 43 ? -5.899  5.181   -34.133 1.00 0.00 ? 106 GLU A N    3 
ATOM 6424  C CA   . GLU A 1 43 ? -5.890  6.593   -33.766 1.00 0.00 ? 106 GLU A CA   3 
ATOM 6425  C C    . GLU A 1 43 ? -4.509  7.204   -33.968 1.00 0.00 ? 106 GLU A C    3 
ATOM 6426  O O    . GLU A 1 43 ? -3.939  7.788   -33.045 1.00 0.00 ? 106 GLU A O    3 
ATOM 6427  C CB   . GLU A 1 43 ? -6.330  6.769   -32.313 1.00 0.00 ? 106 GLU A CB   3 
ATOM 6428  C CG   . GLU A 1 43 ? -7.768  6.354   -32.036 1.00 0.00 ? 106 GLU A CG   3 
ATOM 6429  C CD   . GLU A 1 43 ? -8.205  6.661   -30.628 1.00 0.00 ? 106 GLU A CD   3 
ATOM 6430  O OE1  . GLU A 1 43 ? -7.375  7.040   -29.839 1.00 0.00 ? 106 GLU A OE1  3 
ATOM 6431  O OE2  . GLU A 1 43 ? -9.371  6.513   -30.345 1.00 0.00 ? 106 GLU A OE2  3 
ATOM 6432  H H    . GLU A 1 43 ? -6.483  4.874   -34.912 1.00 0.00 ? 106 GLU A H    3 
ATOM 6433  H HA   . GLU A 1 43 ? -6.603  7.101   -34.394 1.00 0.00 ? 106 GLU A HA   3 
ATOM 6434  H HB2  . GLU A 1 43 ? -5.684  6.181   -31.669 1.00 0.00 ? 106 GLU A HB2  3 
ATOM 6435  H HB3  . GLU A 1 43 ? -6.220  7.821   -32.047 1.00 0.00 ? 106 GLU A HB3  3 
ATOM 6436  H HG2  . GLU A 1 43 ? -8.409  6.912   -32.717 1.00 0.00 ? 106 GLU A HG2  3 
ATOM 6437  H HG3  . GLU A 1 43 ? -7.889  5.309   -32.231 1.00 0.00 ? 106 GLU A HG3  3 
ATOM 6438  N N    . ARG A 1 44 ? -3.977  7.070   -35.178 1.00 0.00 ? 107 ARG A N    3 
ATOM 6439  C CA   . ARG A 1 44 ? -2.620  7.512   -35.471 1.00 0.00 ? 107 ARG A CA   3 
ATOM 6440  C C    . ARG A 1 44 ? -2.621  8.667   -36.464 1.00 0.00 ? 107 ARG A C    3 
ATOM 6441  O O    . ARG A 1 44 ? -2.863  8.478   -37.655 1.00 0.00 ? 107 ARG A O    3 
ATOM 6442  C CB   . ARG A 1 44 ? -1.793  6.365   -36.035 1.00 0.00 ? 107 ARG A CB   3 
ATOM 6443  C CG   . ARG A 1 44 ? -0.362  6.726   -36.397 1.00 0.00 ? 107 ARG A CG   3 
ATOM 6444  C CD   . ARG A 1 44 ? 0.149   5.893   -37.515 1.00 0.00 ? 107 ARG A CD   3 
ATOM 6445  N NE   . ARG A 1 44 ? 1.589   6.023   -37.674 1.00 0.00 ? 107 ARG A NE   3 
ATOM 6446  C CZ   . ARG A 1 44 ? 2.263   5.736   -38.806 1.00 0.00 ? 107 ARG A CZ   3 
ATOM 6447  N NH1  . ARG A 1 44 ? 1.615   5.308   -39.865 1.00 0.00 ? 107 ARG A NH1  3 
ATOM 6448  N NH2  . ARG A 1 44 ? 3.575   5.888   -38.848 1.00 0.00 ? 107 ARG A NH2  3 
ATOM 6449  H H    . ARG A 1 44 ? -4.497  6.560   -35.893 1.00 0.00 ? 107 ARG A H    3 
ATOM 6450  H HA   . ARG A 1 44 ? -2.138  7.857   -34.555 1.00 0.00 ? 107 ARG A HA   3 
ATOM 6451  H HB2  . ARG A 1 44 ? -1.762  5.587   -35.269 1.00 0.00 ? 107 ARG A HB2  3 
ATOM 6452  H HB3  . ARG A 1 44 ? -2.298  5.967   -36.883 1.00 0.00 ? 107 ARG A HB3  3 
ATOM 6453  H HG2  . ARG A 1 44 ? -0.307  7.769   -36.693 1.00 0.00 ? 107 ARG A HG2  3 
ATOM 6454  H HG3  . ARG A 1 44 ? 0.287   6.571   -35.533 1.00 0.00 ? 107 ARG A HG3  3 
ATOM 6455  H HD2  . ARG A 1 44 ? -0.095  4.852   -37.326 1.00 0.00 ? 107 ARG A HD2  3 
ATOM 6456  H HD3  . ARG A 1 44 ? -0.331  6.214   -38.439 1.00 0.00 ? 107 ARG A HD3  3 
ATOM 6457  H HE   . ARG A 1 44 ? 2.103   6.341   -36.903 1.00 0.00 ? 107 ARG A HE   3 
ATOM 6458  H HH11 . ARG A 1 44 ? 0.622   5.194   -39.834 1.00 0.00 ? 107 ARG A HH11 3 
ATOM 6459  H HH12 . ARG A 1 44 ? 2.120   5.093   -40.713 1.00 0.00 ? 107 ARG A HH12 3 
ATOM 6460  H HH21 . ARG A 1 44 ? 4.071   6.216   -38.043 1.00 0.00 ? 107 ARG A HH21 3 
ATOM 6461  H HH22 . ARG A 1 44 ? 4.072   5.674   -39.687 1.00 0.00 ? 107 ARG A HH22 3 
ATOM 6462  N N    . GLN A 1 45 ? -2.349  9.868   -35.965 1.00 0.00 ? 108 GLN A N    3 
ATOM 6463  C CA   . GLN A 1 45 ? -2.285  11.053  -36.810 1.00 0.00 ? 108 GLN A CA   3 
ATOM 6464  C C    . GLN A 1 45 ? -1.111  10.976  -37.778 1.00 0.00 ? 108 GLN A C    3 
ATOM 6465  O O    . GLN A 1 45 ? 0.045   11.126  -37.382 1.00 0.00 ? 108 GLN A O    3 
ATOM 6466  C CB   . GLN A 1 45 ? -2.173  12.320  -35.955 1.00 0.00 ? 108 GLN A CB   3 
ATOM 6467  C CG   . GLN A 1 45 ? -2.043  13.603  -36.756 1.00 0.00 ? 108 GLN A CG   3 
ATOM 6468  C CD   . GLN A 1 45 ? -3.295  13.921  -37.550 1.00 0.00 ? 108 GLN A CD   3 
ATOM 6469  O OE1  . GLN A 1 45 ? -4.371  14.126  -36.982 1.00 0.00 ? 108 GLN A OE1  3 
ATOM 6470  N NE2  . GLN A 1 45 ? -3.164  13.961  -38.871 1.00 0.00 ? 108 GLN A NE2  3 
ATOM 6471  H H    . GLN A 1 45 ? -2.147  9.959   -34.969 1.00 0.00 ? 108 GLN A H    3 
ATOM 6472  H HA   . GLN A 1 45 ? -3.203  11.118  -37.378 1.00 0.00 ? 108 GLN A HA   3 
ATOM 6473  H HB2  . GLN A 1 45 ? -3.060  12.399  -35.337 1.00 0.00 ? 108 GLN A HB2  3 
ATOM 6474  H HB3  . GLN A 1 45 ? -1.303  12.217  -35.305 1.00 0.00 ? 108 GLN A HB3  3 
ATOM 6475  H HG2  . GLN A 1 45 ? -1.856  14.429  -36.069 1.00 0.00 ? 108 GLN A HG2  3 
ATOM 6476  H HG3  . GLN A 1 45 ? -1.197  13.520  -37.437 1.00 0.00 ? 108 GLN A HG3  3 
ATOM 6477  H HE21 . GLN A 1 45 ? -2.259  13.794  -39.309 1.00 0.00 ? 108 GLN A HE21 3 
ATOM 6478  H HE22 . GLN A 1 45 ? -3.981  14.166  -39.448 1.00 0.00 ? 108 GLN A HE22 3 
ATOM 6479  N N    . ASP A 1 46 ? -1.415  10.739  -39.051 1.00 0.00 ? 109 ASP A N    3 
ATOM 6480  C CA   . ASP A 1 46 ? -0.391  10.719  -40.090 1.00 0.00 ? 109 ASP A CA   3 
ATOM 6481  C C    . ASP A 1 46 ? -0.618  11.828  -41.108 1.00 0.00 ? 109 ASP A C    3 
ATOM 6482  O O    . ASP A 1 46 ? -1.116  12.904  -40.770 1.00 0.00 ? 109 ASP A O    3 
ATOM 6483  C CB   . ASP A 1 46 ? -0.377  9.361   -40.799 1.00 0.00 ? 109 ASP A CB   3 
ATOM 6484  C CG   . ASP A 1 46 ? -1.641  9.102   -41.607 1.00 0.00 ? 109 ASP A CG   3 
ATOM 6485  O OD1  . ASP A 1 46 ? -2.529  9.920   -41.564 1.00 0.00 ? 109 ASP A OD1  3 
ATOM 6486  O OD2  . ASP A 1 46 ? -1.707  8.087   -42.259 1.00 0.00 ? 109 ASP A OD2  3 
ATOM 6487  H H    . ASP A 1 46 ? -2.394  10.641  -39.318 1.00 0.00 ? 109 ASP A H    3 
ATOM 6488  H HA   . ASP A 1 46 ? 0.592   10.877  -39.641 1.00 0.00 ? 109 ASP A HA   3 
ATOM 6489  H HB2  . ASP A 1 46 ? 0.483   9.314   -41.464 1.00 0.00 ? 109 ASP A HB2  3 
ATOM 6490  H HB3  . ASP A 1 46 ? -0.280  8.580   -40.046 1.00 0.00 ? 109 ASP A HB3  3 
ATOM 6491  N N    . GLU A 1 47 ? -0.249  11.563  -42.356 1.00 0.00 ? 110 GLU A N    3 
ATOM 6492  C CA   . GLU A 1 47 ? -0.366  12.556  -43.417 1.00 0.00 ? 110 GLU A CA   3 
ATOM 6493  C C    . GLU A 1 47 ? -1.823  12.880  -43.714 1.00 0.00 ? 110 GLU A C    3 
ATOM 6494  O O    . GLU A 1 47 ? -2.147  13.982  -44.160 1.00 0.00 ? 110 GLU A O    3 
ATOM 6495  C CB   . GLU A 1 47 ? 0.326   12.063  -44.690 1.00 0.00 ? 110 GLU A CB   3 
ATOM 6496  C CG   . GLU A 1 47 ? -0.128  10.688  -45.158 1.00 0.00 ? 110 GLU A CG   3 
ATOM 6497  C CD   . GLU A 1 47 ? 0.693   9.570   -44.575 1.00 0.00 ? 110 GLU A CD   3 
ATOM 6498  O OE1  . GLU A 1 47 ? 1.468   9.830   -43.684 1.00 0.00 ? 110 GLU A OE1  3 
ATOM 6499  O OE2  . GLU A 1 47 ? 0.547   8.456   -45.021 1.00 0.00 ? 110 GLU A OE2  3 
ATOM 6500  H H    . GLU A 1 47 ? 0.164   10.658  -42.572 1.00 0.00 ? 110 GLU A H    3 
ATOM 6501  H HA   . GLU A 1 47 ? 0.126   13.471  -43.086 1.00 0.00 ? 110 GLU A HA   3 
ATOM 6502  H HB2  . GLU A 1 47 ? 0.129   12.790  -45.481 1.00 0.00 ? 110 GLU A HB2  3 
ATOM 6503  H HB3  . GLU A 1 47 ? 1.402   12.036  -44.509 1.00 0.00 ? 110 GLU A HB3  3 
ATOM 6504  H HG2  . GLU A 1 47 ? -1.165  10.543  -44.858 1.00 0.00 ? 110 GLU A HG2  3 
ATOM 6505  H HG3  . GLU A 1 47 ? -0.068  10.634  -46.248 1.00 0.00 ? 110 GLU A HG3  3 
ATOM 6506  N N    . HIS A 1 48 ? -2.701  11.915  -43.463 1.00 0.00 ? 111 HIS A N    3 
ATOM 6507  C CA   . HIS A 1 48 ? -4.120  12.075  -43.755 1.00 0.00 ? 111 HIS A CA   3 
ATOM 6508  C C    . HIS A 1 48 ? -4.893  12.501  -42.513 1.00 0.00 ? 111 HIS A C    3 
ATOM 6509  O O    . HIS A 1 48 ? -5.632  13.486  -42.537 1.00 0.00 ? 111 HIS A O    3 
ATOM 6510  C CB   . HIS A 1 48 ? -4.710  10.773  -44.308 1.00 0.00 ? 111 HIS A CB   3 
ATOM 6511  C CG   . HIS A 1 48 ? -4.149  10.377  -45.639 1.00 0.00 ? 111 HIS A CG   3 
ATOM 6512  N ND1  . HIS A 1 48 ? -4.348  11.123  -46.781 1.00 0.00 ? 111 HIS A ND1  3 
ATOM 6513  C CD2  . HIS A 1 48 ? -3.399  9.313   -46.008 1.00 0.00 ? 111 HIS A CD2  3 
ATOM 6514  C CE1  . HIS A 1 48 ? -3.741  10.535  -47.797 1.00 0.00 ? 111 HIS A CE1  3 
ATOM 6515  N NE2  . HIS A 1 48 ? -3.159  9.435   -47.355 1.00 0.00 ? 111 HIS A NE2  3 
ATOM 6516  H H    . HIS A 1 48 ? -2.371  11.022  -43.102 1.00 0.00 ? 111 HIS A H    3 
ATOM 6517  H HA   . HIS A 1 48 ? -4.241  12.842  -44.521 1.00 0.00 ? 111 HIS A HA   3 
ATOM 6518  H HB2  . HIS A 1 48 ? -4.455  9.982   -43.602 1.00 0.00 ? 111 HIS A HB2  3 
ATOM 6519  H HB3  . HIS A 1 48 ? -5.790  10.834  -44.361 1.00 0.00 ? 111 HIS A HB3  3 
ATOM 6520  H HD2  . HIS A 1 48 ? -3.243  8.421   -45.418 1.00 0.00 ? 111 HIS A HD2  3 
ATOM 6521  H HE1  . HIS A 1 48 ? -3.725  10.895  -48.815 1.00 0.00 ? 111 HIS A HE1  3 
ATOM 6522  H HE2  . HIS A 1 48 ? -2.624  8.788   -47.917 1.00 0.00 ? 111 HIS A HE2  3 
ATOM 6523  N N    . GLY A 1 49 ? -4.719  11.755  -41.428 1.00 0.00 ? 112 GLY A N    3 
ATOM 6524  C CA   . GLY A 1 49 ? -5.597  11.869  -40.270 1.00 0.00 ? 112 GLY A CA   3 
ATOM 6525  C C    . GLY A 1 49 ? -5.281  10.800  -39.232 1.00 0.00 ? 112 GLY A C    3 
ATOM 6526  O O    . GLY A 1 49 ? -4.187  10.238  -39.218 1.00 0.00 ? 112 GLY A O    3 
ATOM 6527  H H    . GLY A 1 49 ? -4.122  10.931  -41.501 1.00 0.00 ? 112 GLY A H    3 
ATOM 6528  H HA2  . GLY A 1 49 ? -5.400  12.846  -39.830 1.00 0.00 ? 112 GLY A HA2  3 
ATOM 6529  H HA3  . GLY A 1 49 ? -6.628  11.803  -40.550 1.00 0.00 ? 112 GLY A HA3  3 
ATOM 6530  N N    . PHE A 1 50 ? -6.248  10.521  -38.364 1.00 0.00 ? 113 PHE A N    3 
ATOM 6531  C CA   . PHE A 1 50 ? -6.094  9.485   -37.350 1.00 0.00 ? 113 PHE A CA   3 
ATOM 6532  C C    . PHE A 1 50 ? -6.449  8.113   -37.905 1.00 0.00 ? 113 PHE A C    3 
ATOM 6533  O O    . PHE A 1 50 ? -7.621  7.737   -37.952 1.00 0.00 ? 113 PHE A O    3 
ATOM 6534  C CB   . PHE A 1 50 ? -6.971  9.793   -36.135 1.00 0.00 ? 113 PHE A CB   3 
ATOM 6535  C CG   . PHE A 1 50 ? -6.462  10.928  -35.291 1.00 0.00 ? 113 PHE A CG   3 
ATOM 6536  C CD1  . PHE A 1 50 ? -5.398  10.745  -34.422 1.00 0.00 ? 113 PHE A CD1  3 
ATOM 6537  C CD2  . PHE A 1 50 ? -7.046  12.183  -35.371 1.00 0.00 ? 113 PHE A CD2  3 
ATOM 6538  C CE1  . PHE A 1 50 ? -4.932  11.789  -33.646 1.00 0.00 ? 113 PHE A CE1  3 
ATOM 6539  C CE2  . PHE A 1 50 ? -6.581  13.230  -34.597 1.00 0.00 ? 113 PHE A CE2  3 
ATOM 6540  C CZ   . PHE A 1 50 ? -5.524  13.032  -33.735 1.00 0.00 ? 113 PHE A CZ   3 
ATOM 6541  H H    . PHE A 1 50 ? -7.129  11.031  -38.422 1.00 0.00 ? 113 PHE A H    3 
ATOM 6542  H HA   . PHE A 1 50 ? -5.057  9.470   -37.021 1.00 0.00 ? 113 PHE A HA   3 
ATOM 6543  H HB2  . PHE A 1 50 ? -7.966  10.021  -36.451 1.00 0.00 ? 113 PHE A HB2  3 
ATOM 6544  H HB3  . PHE A 1 50 ? -7.014  8.917   -35.510 1.00 0.00 ? 113 PHE A HB3  3 
ATOM 6545  H HD1  . PHE A 1 50 ? -4.932  9.776   -34.350 1.00 0.00 ? 113 PHE A HD1  3 
ATOM 6546  H HD2  . PHE A 1 50 ? -7.868  12.339  -36.050 1.00 0.00 ? 113 PHE A HD2  3 
ATOM 6547  H HE1  . PHE A 1 50 ? -4.104  11.632  -32.969 1.00 0.00 ? 113 PHE A HE1  3 
ATOM 6548  H HE2  . PHE A 1 50 ? -7.045  14.201  -34.666 1.00 0.00 ? 113 PHE A HE2  3 
ATOM 6549  H HZ   . PHE A 1 50 ? -5.212  13.826  -33.073 1.00 0.00 ? 113 PHE A HZ   3 
ATOM 6550  N N    . ILE A 1 51 ? -5.434  7.369   -38.328 1.00 0.00 ? 114 ILE A N    3 
ATOM 6551  C CA   . ILE A 1 51 ? -5.646  6.105   -39.024 1.00 0.00 ? 114 ILE A CA   3 
ATOM 6552  C C    . ILE A 1 51 ? -5.736  4.944   -38.040 1.00 0.00 ? 114 ILE A C    3 
ATOM 6553  O O    . ILE A 1 51 ? -5.360  5.074   -36.876 1.00 0.00 ? 114 ILE A O    3 
ATOM 6554  C CB   . ILE A 1 51 ? -4.515  5.837   -40.034 1.00 0.00 ? 114 ILE A CB   3 
ATOM 6555  C CG1  . ILE A 1 51 ? -3.205  5.531   -39.301 1.00 0.00 ? 114 ILE A CG1  3 
ATOM 6556  C CG2  . ILE A 1 51 ? -4.341  7.027   -40.965 1.00 0.00 ? 114 ILE A CG2  3 
ATOM 6557  C CD1  . ILE A 1 51 ? -2.117  4.989   -40.198 1.00 0.00 ? 114 ILE A CD1  3 
ATOM 6558  H H    . ILE A 1 51 ? -4.487  7.745   -38.281 1.00 0.00 ? 114 ILE A H    3 
ATOM 6559  H HA   . ILE A 1 51 ? -6.581  6.137   -39.557 1.00 0.00 ? 114 ILE A HA   3 
ATOM 6560  H HB   . ILE A 1 51 ? -4.790  4.970   -40.636 1.00 0.00 ? 114 ILE A HB   3 
ATOM 6561  H HG12 . ILE A 1 51 ? -2.850  6.453   -38.863 1.00 0.00 ? 114 ILE A HG12 3 
ATOM 6562  H HG13 . ILE A 1 51 ? -3.382  4.803   -38.515 1.00 0.00 ? 114 ILE A HG13 3 
ATOM 6563  H HG21 . ILE A 1 51 ? -3.797  7.813   -40.441 1.00 0.00 ? 114 ILE A HG21 3 
ATOM 6564  H HG22 . ILE A 1 51 ? -5.282  7.420   -41.279 1.00 0.00 ? 114 ILE A HG22 3 
ATOM 6565  H HG23 . ILE A 1 51 ? -3.765  6.723   -41.838 1.00 0.00 ? 114 ILE A HG23 3 
ATOM 6566  H HD11 . ILE A 1 51 ? -2.565  4.319   -40.929 1.00 0.00 ? 114 ILE A HD11 3 
ATOM 6567  H HD12 . ILE A 1 51 ? -1.388  4.443   -39.600 1.00 0.00 ? 114 ILE A HD12 3 
ATOM 6568  H HD13 . ILE A 1 51 ? -1.623  5.813   -40.712 1.00 0.00 ? 114 ILE A HD13 3 
ATOM 6569  N N    . SER A 1 52 ? -6.237  3.810   -38.519 1.00 0.00 ? 115 SER A N    3 
ATOM 6570  C CA   . SER A 1 52 ? -6.083  2.546   -37.807 1.00 0.00 ? 115 SER A CA   3 
ATOM 6571  C C    . SER A 1 52 ? -5.851  1.393   -38.775 1.00 0.00 ? 115 SER A C    3 
ATOM 6572  O O    . SER A 1 52 ? -6.799  0.780   -39.264 1.00 0.00 ? 115 SER A O    3 
ATOM 6573  C CB   . SER A 1 52 ? -7.314  2.270   -36.964 1.00 0.00 ? 115 SER A CB   3 
ATOM 6574  O OG   . SER A 1 52 ? -7.143  1.114   -36.190 1.00 0.00 ? 115 SER A OG   3 
ATOM 6575  H H    . SER A 1 52 ? -6.481  3.772   -39.509 1.00 0.00 ? 115 SER A H    3 
ATOM 6576  H HA   . SER A 1 52 ? -5.221  2.605   -37.154 1.00 0.00 ? 115 SER A HA   3 
ATOM 6577  H HB2  . SER A 1 52 ? -7.546  3.117   -36.329 1.00 0.00 ? 115 SER A HB2  3 
ATOM 6578  H HB3  . SER A 1 52 ? -8.142  2.087   -37.637 1.00 0.00 ? 115 SER A HB3  3 
ATOM 6579  H HG   . SER A 1 52 ? -7.829  0.483   -36.417 1.00 0.00 ? 115 SER A HG   3 
ATOM 6580  N N    . ARG A 1 53 ? -4.583  1.102   -39.047 1.00 0.00 ? 116 ARG A N    3 
ATOM 6581  C CA   . ARG A 1 53 ? -4.217  0.265   -40.182 1.00 0.00 ? 116 ARG A CA   3 
ATOM 6582  C C    . ARG A 1 53 ? -3.722  -1.101  -39.722 1.00 0.00 ? 116 ARG A C    3 
ATOM 6583  O O    . ARG A 1 53 ? -2.522  -1.374  -39.735 1.00 0.00 ? 116 ARG A O    3 
ATOM 6584  C CB   . ARG A 1 53 ? -3.135  0.938   -41.016 1.00 0.00 ? 116 ARG A CB   3 
ATOM 6585  C CG   . ARG A 1 53 ? -1.786  1.069   -40.330 1.00 0.00 ? 116 ARG A CG   3 
ATOM 6586  C CD   . ARG A 1 53 ? -0.766  1.661   -41.233 1.00 0.00 ? 116 ARG A CD   3 
ATOM 6587  N NE   . ARG A 1 53 ? 0.528   1.783   -40.583 1.00 0.00 ? 116 ARG A NE   3 
ATOM 6588  C CZ   . ARG A 1 53 ? 1.698   1.942   -41.231 1.00 0.00 ? 116 ARG A CZ   3 
ATOM 6589  N NH1  . ARG A 1 53 ? 1.721   1.992   -42.543 1.00 0.00 ? 116 ARG A NH1  3 
ATOM 6590  N NH2  . ARG A 1 53 ? 2.824   2.044   -40.547 1.00 0.00 ? 116 ARG A NH2  3 
ATOM 6591  H H    . ARG A 1 53 ? -3.862  1.689   -38.630 1.00 0.00 ? 116 ARG A H    3 
ATOM 6592  H HA   . ARG A 1 53 ? -5.078  0.111   -40.817 1.00 0.00 ? 116 ARG A HA   3 
ATOM 6593  H HB2  . ARG A 1 53 ? -3.000  0.384   -41.939 1.00 0.00 ? 116 ARG A HB2  3 
ATOM 6594  H HB3  . ARG A 1 53 ? -3.482  1.942   -41.247 1.00 0.00 ? 116 ARG A HB3  3 
ATOM 6595  H HG2  . ARG A 1 53 ? -1.906  1.741   -39.508 1.00 0.00 ? 116 ARG A HG2  3 
ATOM 6596  H HG3  . ARG A 1 53 ? -1.418  0.125   -39.973 1.00 0.00 ? 116 ARG A HG3  3 
ATOM 6597  H HD2  . ARG A 1 53 ? -0.659  1.013   -42.102 1.00 0.00 ? 116 ARG A HD2  3 
ATOM 6598  H HD3  . ARG A 1 53 ? -1.094  2.644   -41.560 1.00 0.00 ? 116 ARG A HD3  3 
ATOM 6599  H HE   . ARG A 1 53 ? 0.548   1.750   -39.603 1.00 0.00 ? 116 ARG A HE   3 
ATOM 6600  H HH11 . ARG A 1 53 ? 0.870   1.915   -43.064 1.00 0.00 ? 116 ARG A HH11 3 
ATOM 6601  H HH12 . ARG A 1 53 ? 2.599   2.108   -43.028 1.00 0.00 ? 116 ARG A HH12 3 
ATOM 6602  H HH21 . ARG A 1 53 ? 2.811   2.004   -39.549 1.00 0.00 ? 116 ARG A HH21 3 
ATOM 6603  H HH22 . ARG A 1 53 ? 3.692   2.162   -41.030 1.00 0.00 ? 116 ARG A HH22 3 
ATOM 6604  N N    . GLU A 1 54 ? -4.653  -1.955  -39.314 1.00 0.00 ? 117 GLU A N    3 
ATOM 6605  C CA   . GLU A 1 54 ? -4.325  -3.326  -38.939 1.00 0.00 ? 117 GLU A CA   3 
ATOM 6606  C C    . GLU A 1 54 ? -3.987  -4.167  -40.165 1.00 0.00 ? 117 GLU A C    3 
ATOM 6607  O O    . GLU A 1 54 ? -4.523  -3.942  -41.250 1.00 0.00 ? 117 GLU A O    3 
ATOM 6608  C CB   . GLU A 1 54 ? -5.487  -3.964  -38.175 1.00 0.00 ? 117 GLU A CB   3 
ATOM 6609  C CG   . GLU A 1 54 ? -6.615  -4.474  -39.060 1.00 0.00 ? 117 GLU A CG   3 
ATOM 6610  C CD   . GLU A 1 54 ? -7.636  -5.277  -38.302 1.00 0.00 ? 117 GLU A CD   3 
ATOM 6611  O OE1  . GLU A 1 54 ? -7.444  -5.490  -37.128 1.00 0.00 ? 117 GLU A OE1  3 
ATOM 6612  O OE2  . GLU A 1 54 ? -8.611  -5.672  -38.896 1.00 0.00 ? 117 GLU A OE2  3 
ATOM 6613  H H    . GLU A 1 54 ? -5.632  -1.667  -39.346 1.00 0.00 ? 117 GLU A H    3 
ATOM 6614  H HA   . GLU A 1 54 ? -3.475  -3.305  -38.310 1.00 0.00 ? 117 GLU A HA   3 
ATOM 6615  H HB2  . GLU A 1 54 ? -5.111  -4.807  -37.595 1.00 0.00 ? 117 GLU A HB2  3 
ATOM 6616  H HB3  . GLU A 1 54 ? -5.910  -3.231  -37.503 1.00 0.00 ? 117 GLU A HB3  3 
ATOM 6617  H HG2  . GLU A 1 54 ? -7.104  -3.606  -39.472 1.00 0.00 ? 117 GLU A HG2  3 
ATOM 6618  H HG3  . GLU A 1 54 ? -6.224  -5.089  -39.867 1.00 0.00 ? 117 GLU A HG3  3 
ATOM 6619  N N    . PHE A 1 55 ? -3.096  -5.136  -39.983 1.00 0.00 ? 118 PHE A N    3 
ATOM 6620  C CA   . PHE A 1 55 ? -2.598  -5.937  -41.094 1.00 0.00 ? 118 PHE A CA   3 
ATOM 6621  C C    . PHE A 1 55 ? -2.974  -7.403  -40.929 1.00 0.00 ? 118 PHE A C    3 
ATOM 6622  O O    . PHE A 1 55 ? -3.441  -7.818  -39.868 1.00 0.00 ? 118 PHE A O    3 
ATOM 6623  C CB   . PHE A 1 55 ? -1.079  -5.804  -41.213 1.00 0.00 ? 118 PHE A CB   3 
ATOM 6624  C CG   . PHE A 1 55 ? -0.607  -4.390  -41.406 1.00 0.00 ? 118 PHE A CG   3 
ATOM 6625  C CD1  . PHE A 1 55 ? -0.993  -3.663  -42.524 1.00 0.00 ? 118 PHE A CD1  3 
ATOM 6626  C CD2  . PHE A 1 55 ? 0.221   -3.786  -40.472 1.00 0.00 ? 118 PHE A CD2  3 
ATOM 6627  C CE1  . PHE A 1 55 ? -0.558  -2.364  -42.704 1.00 0.00 ? 118 PHE A CE1  3 
ATOM 6628  C CE2  . PHE A 1 55 ? 0.655   -2.487  -40.650 1.00 0.00 ? 118 PHE A CE2  3 
ATOM 6629  C CZ   . PHE A 1 55 ? 0.266   -1.776  -41.767 1.00 0.00 ? 118 PHE A CZ   3 
ATOM 6630  H H    . PHE A 1 55 ? -2.687  -5.275  -39.065 1.00 0.00 ? 118 PHE A H    3 
ATOM 6631  H HA   . PHE A 1 55 ? -3.036  -5.582  -42.029 1.00 0.00 ? 118 PHE A HA   3 
ATOM 6632  H HB2  . PHE A 1 55 ? -0.614  -6.239  -40.330 1.00 0.00 ? 118 PHE A HB2  3 
ATOM 6633  H HB3  . PHE A 1 55 ? -0.788  -6.369  -42.080 1.00 0.00 ? 118 PHE A HB3  3 
ATOM 6634  H HD1  . PHE A 1 55 ? -1.626  -4.124  -43.233 1.00 0.00 ? 118 PHE A HD1  3 
ATOM 6635  H HD2  . PHE A 1 55 ? 0.527   -4.335  -39.595 1.00 0.00 ? 118 PHE A HD2  3 
ATOM 6636  H HE1  . PHE A 1 55 ? -0.863  -1.809  -43.579 1.00 0.00 ? 118 PHE A HE1  3 
ATOM 6637  H HE2  . PHE A 1 55 ? 1.302   -2.045  -39.933 1.00 0.00 ? 118 PHE A HE2  3 
ATOM 6638  H HZ   . PHE A 1 55 ? 0.783   -0.861  -42.014 1.00 0.00 ? 118 PHE A HZ   3 
ATOM 6639  N N    . HIS A 1 56 ? -2.766  -8.185  -41.983 1.00 0.00 ? 119 HIS A N    3 
ATOM 6640  C CA   . HIS A 1 56 ? -2.731  -9.637  -41.864 1.00 0.00 ? 119 HIS A CA   3 
ATOM 6641  C C    . HIS A 1 56 ? -1.692  -10.242 -42.799 1.00 0.00 ? 119 HIS A C    3 
ATOM 6642  O O    . HIS A 1 56 ? -2.023  -11.033 -43.683 1.00 0.00 ? 119 HIS A O    3 
ATOM 6643  C CB   . HIS A 1 56 ? -4.109  -10.240 -42.165 1.00 0.00 ? 119 HIS A CB   3 
ATOM 6644  C CG   . HIS A 1 56 ? -5.178  -9.800  -41.214 1.00 0.00 ? 119 HIS A CG   3 
ATOM 6645  N ND1  . HIS A 1 56 ? -5.880  -8.623  -41.378 1.00 0.00 ? 119 HIS A ND1  3 
ATOM 6646  C CD2  . HIS A 1 56 ? -5.665  -10.374 -40.090 1.00 0.00 ? 119 HIS A CD2  3 
ATOM 6647  C CE1  . HIS A 1 56 ? -6.755  -8.494  -40.394 1.00 0.00 ? 119 HIS A CE1  3 
ATOM 6648  N NE2  . HIS A 1 56 ? -6.642  -9.543  -39.600 1.00 0.00 ? 119 HIS A NE2  3 
ATOM 6649  H H    . HIS A 1 56 ? -2.332  -7.772  -42.808 1.00 0.00 ? 119 HIS A H    3 
ATOM 6650  H HA   . HIS A 1 56 ? -2.466  -9.919  -40.841 1.00 0.00 ? 119 HIS A HA   3 
ATOM 6651  H HB2  . HIS A 1 56 ? -4.373  -9.969  -43.173 1.00 0.00 ? 119 HIS A HB2  3 
ATOM 6652  H HB3  . HIS A 1 56 ? -4.029  -11.327 -42.111 1.00 0.00 ? 119 HIS A HB3  3 
ATOM 6653  H HD1  . HIS A 1 56 ? -5.749  -7.955  -42.137 1.00 0.00 ? 119 HIS A HD1  3 
ATOM 6654  H HD2  . HIS A 1 56 ? -5.202  -11.190 -39.555 1.00 0.00 ? 119 HIS A HD2  3 
ATOM 6655  H HE1  . HIS A 1 56 ? -7.443  -7.673  -40.267 1.00 0.00 ? 119 HIS A HE1  3 
ATOM 6656  H HE2  . HIS A 1 56 ? -7.188  -9.709  -38.766 1.00 0.00 ? 119 HIS A HE2  3 
ATOM 6657  N N    . ARG A 1 57 ? -0.434  -9.866  -42.599 1.00 0.00 ? 120 ARG A N    3 
ATOM 6658  C CA   . ARG A 1 57 ? 0.605   -10.106 -43.595 1.00 0.00 ? 120 ARG A CA   3 
ATOM 6659  C C    . ARG A 1 57 ? 1.037   -11.565 -43.599 1.00 0.00 ? 120 ARG A C    3 
ATOM 6660  O O    . ARG A 1 57 ? 2.012   -11.936 -42.946 1.00 0.00 ? 120 ARG A O    3 
ATOM 6661  C CB   . ARG A 1 57 ? 1.815   -9.222  -43.329 1.00 0.00 ? 120 ARG A CB   3 
ATOM 6662  C CG   . ARG A 1 57 ? 1.517   -7.732  -43.260 1.00 0.00 ? 120 ARG A CG   3 
ATOM 6663  C CD   . ARG A 1 57 ? 2.726   -6.946  -42.901 1.00 0.00 ? 120 ARG A CD   3 
ATOM 6664  N NE   . ARG A 1 57 ? 2.506   -5.516  -43.047 1.00 0.00 ? 120 ARG A NE   3 
ATOM 6665  C CZ   . ARG A 1 57 ? 3.371   -4.566  -42.648 1.00 0.00 ? 120 ARG A CZ   3 
ATOM 6666  N NH1  . ARG A 1 57 ? 4.508   -4.906  -42.081 1.00 0.00 ? 120 ARG A NH1  3 
ATOM 6667  N NH2  . ARG A 1 57 ? 3.079   -3.288  -42.827 1.00 0.00 ? 120 ARG A NH2  3 
ATOM 6668  H H    . ARG A 1 57 ? -0.250  -9.173  -41.872 1.00 0.00 ? 120 ARG A H    3 
ATOM 6669  H HA   . ARG A 1 57 ? 0.232   -9.902  -44.560 1.00 0.00 ? 120 ARG A HA   3 
ATOM 6670  H HB2  . ARG A 1 57 ? 2.296   -9.537  -42.440 1.00 0.00 ? 120 ARG A HB2  3 
ATOM 6671  H HB3  . ARG A 1 57 ? 2.507   -9.365  -44.161 1.00 0.00 ? 120 ARG A HB3  3 
ATOM 6672  H HG2  . ARG A 1 57 ? 1.103   -7.373  -44.195 1.00 0.00 ? 120 ARG A HG2  3 
ATOM 6673  H HG3  . ARG A 1 57 ? 0.796   -7.613  -42.475 1.00 0.00 ? 120 ARG A HG3  3 
ATOM 6674  H HD2  . ARG A 1 57 ? 3.005   -7.156  -41.868 1.00 0.00 ? 120 ARG A HD2  3 
ATOM 6675  H HD3  . ARG A 1 57 ? 3.541   -7.244  -43.560 1.00 0.00 ? 120 ARG A HD3  3 
ATOM 6676  H HE   . ARG A 1 57 ? 1.668   -5.226  -43.460 1.00 0.00 ? 120 ARG A HE   3 
ATOM 6677  H HH11 . ARG A 1 57 ? 4.731   -5.872  -41.945 1.00 0.00 ? 120 ARG A HH11 3 
ATOM 6678  H HH12 . ARG A 1 57 ? 5.157   -4.192  -41.784 1.00 0.00 ? 120 ARG A HH12 3 
ATOM 6679  H HH21 . ARG A 1 57 ? 2.217   -3.026  -43.257 1.00 0.00 ? 120 ARG A HH21 3 
ATOM 6680  H HH22 . ARG A 1 57 ? 3.726   -2.585  -42.530 1.00 0.00 ? 120 ARG A HH22 3 
ATOM 6681  N N    . LYS A 1 58 ? 0.304   -12.392 -44.339 1.00 0.00 ? 121 LYS A N    3 
ATOM 6682  C CA   . LYS A 1 58 ? 0.575   -13.825 -44.383 1.00 0.00 ? 121 LYS A CA   3 
ATOM 6683  C C    . LYS A 1 58 ? 1.910   -14.112 -45.059 1.00 0.00 ? 121 LYS A C    3 
ATOM 6684  O O    . LYS A 1 58 ? 1.955   -14.527 -46.217 1.00 0.00 ? 121 LYS A O    3 
ATOM 6685  C CB   . LYS A 1 58 ? -0.551  -14.560 -45.110 1.00 0.00 ? 121 LYS A CB   3 
ATOM 6686  C CG   . LYS A 1 58 ? -0.459  -16.078 -45.040 1.00 0.00 ? 121 LYS A CG   3 
ATOM 6687  C CD   . LYS A 1 58 ? -1.565  -16.737 -45.850 1.00 0.00 ? 121 LYS A CD   3 
ATOM 6688  C CE   . LYS A 1 58 ? -2.934  -16.467 -45.241 1.00 0.00 ? 121 LYS A CE   3 
ATOM 6689  N NZ   . LYS A 1 58 ? -4.018  -17.182 -45.968 1.00 0.00 ? 121 LYS A NZ   3 
ATOM 6690  H H    . LYS A 1 58 ? -0.497  -12.022 -44.850 1.00 0.00 ? 121 LYS A H    3 
ATOM 6691  H HA   . LYS A 1 58 ? 0.628   -14.225 -43.387 1.00 0.00 ? 121 LYS A HA   3 
ATOM 6692  H HB2  . LYS A 1 58 ? -1.485  -14.229 -44.676 1.00 0.00 ? 121 LYS A HB2  3 
ATOM 6693  H HB3  . LYS A 1 58 ? -0.507  -14.257 -46.134 1.00 0.00 ? 121 LYS A HB3  3 
ATOM 6694  H HG2  . LYS A 1 58 ? 0.489   -16.364 -45.453 1.00 0.00 ? 121 LYS A HG2  3 
ATOM 6695  H HG3  . LYS A 1 58 ? -0.524  -16.395 -44.002 1.00 0.00 ? 121 LYS A HG3  3 
ATOM 6696  H HD2  . LYS A 1 58 ? -1.546  -16.344 -46.866 1.00 0.00 ? 121 LYS A HD2  3 
ATOM 6697  H HD3  . LYS A 1 58 ? -1.395  -17.814 -45.879 1.00 0.00 ? 121 LYS A HD3  3 
ATOM 6698  H HE2  . LYS A 1 58 ? -2.932  -16.791 -44.207 1.00 0.00 ? 121 LYS A HE2  3 
ATOM 6699  H HE3  . LYS A 1 58 ? -3.152  -15.405 -45.285 1.00 0.00 ? 121 LYS A HE3  3 
ATOM 6700  H HZ1  . LYS A 1 58 ? -4.947  -16.831 -45.660 1.00 0.00 ? 121 LYS A HZ1  3 
ATOM 6701  H HZ2  . LYS A 1 58 ? -3.946  -18.202 -45.770 1.00 0.00 ? 121 LYS A HZ2  3 
ATOM 6702  H HZ3  . LYS A 1 58 ? -3.914  -17.026 -46.961 1.00 0.00 ? 121 LYS A HZ3  3 
ATOM 6703  N N    . TYR A 1 59 ? 2.998   -13.887 -44.328 1.00 0.00 ? 122 TYR A N    3 
ATOM 6704  C CA   . TYR A 1 59 ? 4.337   -14.078 -44.874 1.00 0.00 ? 122 TYR A CA   3 
ATOM 6705  C C    . TYR A 1 59 ? 4.734   -15.548 -44.862 1.00 0.00 ? 122 TYR A C    3 
ATOM 6706  O O    . TYR A 1 59 ? 5.052   -16.107 -43.812 1.00 0.00 ? 122 TYR A O    3 
ATOM 6707  C CB   . TYR A 1 59 ? 5.356   -13.247 -44.087 1.00 0.00 ? 122 TYR A CB   3 
ATOM 6708  C CG   . TYR A 1 59 ? 6.757   -13.307 -44.652 1.00 0.00 ? 122 TYR A CG   3 
ATOM 6709  C CD1  . TYR A 1 59 ? 7.421   -14.523 -44.735 1.00 0.00 ? 122 TYR A CD1  3 
ATOM 6710  C CD2  . TYR A 1 59 ? 7.380   -12.147 -45.088 1.00 0.00 ? 122 TYR A CD2  3 
ATOM 6711  C CE1  . TYR A 1 59 ? 8.702   -14.577 -45.251 1.00 0.00 ? 122 TYR A CE1  3 
ATOM 6712  C CE2  . TYR A 1 59 ? 8.660   -12.200 -45.604 1.00 0.00 ? 122 TYR A CE2  3 
ATOM 6713  C CZ   . TYR A 1 59 ? 9.320   -13.421 -45.683 1.00 0.00 ? 122 TYR A CZ   3 
ATOM 6714  O OH   . TYR A 1 59 ? 10.594  -13.477 -46.198 1.00 0.00 ? 122 TYR A OH   3 
ATOM 6715  H H    . TYR A 1 59 ? 2.892   -13.544 -43.375 1.00 0.00 ? 122 TYR A H    3 
ATOM 6716  H HA   . TYR A 1 59 ? 4.361   -13.740 -45.901 1.00 0.00 ? 122 TYR A HA   3 
ATOM 6717  H HB2  . TYR A 1 59 ? 5.011   -12.213 -44.096 1.00 0.00 ? 122 TYR A HB2  3 
ATOM 6718  H HB3  . TYR A 1 59 ? 5.371   -13.582 -43.070 1.00 0.00 ? 122 TYR A HB3  3 
ATOM 6719  H HD1  . TYR A 1 59 ? 6.998   -15.422 -44.377 1.00 0.00 ? 122 TYR A HD1  3 
ATOM 6720  H HD2  . TYR A 1 59 ? 6.890   -11.209 -45.013 1.00 0.00 ? 122 TYR A HD2  3 
ATOM 6721  H HE1  . TYR A 1 59 ? 9.219   -15.523 -45.321 1.00 0.00 ? 122 TYR A HE1  3 
ATOM 6722  H HE2  . TYR A 1 59 ? 9.143   -11.307 -45.922 1.00 0.00 ? 122 TYR A HE2  3 
ATOM 6723  H HH   . TYR A 1 59 ? 10.850  -12.588 -46.458 1.00 0.00 ? 122 TYR A HH   3 
ATOM 6724  N N    . ARG A 1 60 ? 4.711   -16.170 -46.035 1.00 0.00 ? 123 ARG A N    3 
ATOM 6725  C CA   . ARG A 1 60 ? 4.606   -17.621 -46.130 1.00 0.00 ? 123 ARG A CA   3 
ATOM 6726  C C    . ARG A 1 60 ? 5.977   -18.278 -46.062 1.00 0.00 ? 123 ARG A C    3 
ATOM 6727  O O    . ARG A 1 60 ? 6.940   -17.789 -46.653 1.00 0.00 ? 123 ARG A O    3 
ATOM 6728  C CB   . ARG A 1 60 ? 3.916   -18.023 -47.426 1.00 0.00 ? 123 ARG A CB   3 
ATOM 6729  C CG   . ARG A 1 60 ? 2.526   -17.437 -47.621 1.00 0.00 ? 123 ARG A CG   3 
ATOM 6730  C CD   . ARG A 1 60 ? 1.762   -18.169 -48.663 1.00 0.00 ? 123 ARG A CD   3 
ATOM 6731  N NE   . ARG A 1 60 ? 2.413   -18.099 -49.962 1.00 0.00 ? 123 ARG A NE   3 
ATOM 6732  C CZ   . ARG A 1 60 ? 2.088   -18.863 -51.023 1.00 0.00 ? 123 ARG A CZ   3 
ATOM 6733  N NH1  . ARG A 1 60 ? 1.121   -19.749 -50.923 1.00 0.00 ? 123 ARG A NH1  3 
ATOM 6734  N NH2  . ARG A 1 60 ? 2.740   -18.723 -52.164 1.00 0.00 ? 123 ARG A NH2  3 
ATOM 6735  H H    . ARG A 1 60 ? 4.386   -15.626 -46.836 1.00 0.00 ? 123 ARG A H    3 
ATOM 6736  H HA   . ARG A 1 60 ? 4.017   -17.998 -45.332 1.00 0.00 ? 123 ARG A HA   3 
ATOM 6737  H HB2  . ARG A 1 60 ? 4.534   -17.704 -48.265 1.00 0.00 ? 123 ARG A HB2  3 
ATOM 6738  H HB3  . ARG A 1 60 ? 3.841   -19.112 -47.449 1.00 0.00 ? 123 ARG A HB3  3 
ATOM 6739  H HG2  . ARG A 1 60 ? 2.009   -17.476 -46.680 1.00 0.00 ? 123 ARG A HG2  3 
ATOM 6740  H HG3  . ARG A 1 60 ? 2.625   -16.396 -47.931 1.00 0.00 ? 123 ARG A HG3  3 
ATOM 6741  H HD2  . ARG A 1 60 ? 1.689   -19.215 -48.371 1.00 0.00 ? 123 ARG A HD2  3 
ATOM 6742  H HD3  . ARG A 1 60 ? 0.762   -17.752 -48.740 1.00 0.00 ? 123 ARG A HD3  3 
ATOM 6743  H HE   . ARG A 1 60 ? 3.138   -17.450 -50.073 1.00 0.00 ? 123 ARG A HE   3 
ATOM 6744  H HH11 . ARG A 1 60 ? 0.626   -19.855 -50.060 1.00 0.00 ? 123 ARG A HH11 3 
ATOM 6745  H HH12 . ARG A 1 60 ? 0.877   -20.322 -51.718 1.00 0.00 ? 123 ARG A HH12 3 
ATOM 6746  H HH21 . ARG A 1 60 ? 3.478   -18.050 -52.243 1.00 0.00 ? 123 ARG A HH21 3 
ATOM 6747  H HH22 . ARG A 1 60 ? 2.495   -19.291 -52.948 1.00 0.00 ? 123 ARG A HH22 3 
ATOM 6748  N N    . ILE A 1 61 ? 6.060   -19.392 -45.342 1.00 0.00 ? 124 ILE A N    3 
ATOM 6749  C CA   . ILE A 1 61 ? 7.338   -20.043 -45.080 1.00 0.00 ? 124 ILE A CA   3 
ATOM 6750  C C    . ILE A 1 61 ? 7.659   -21.078 -46.152 1.00 0.00 ? 124 ILE A C    3 
ATOM 6751  O O    . ILE A 1 61 ? 6.823   -21.915 -46.489 1.00 0.00 ? 124 ILE A O    3 
ATOM 6752  C CB   . ILE A 1 61 ? 7.337   -20.718 -43.697 1.00 0.00 ? 124 ILE A CB   3 
ATOM 6753  C CG1  . ILE A 1 61 ? 7.069   -19.685 -42.599 1.00 0.00 ? 124 ILE A CG1  3 
ATOM 6754  C CG2  . ILE A 1 61 ? 8.660   -21.429 -43.451 1.00 0.00 ? 124 ILE A CG2  3 
ATOM 6755  C CD1  . ILE A 1 61 ? 6.761   -20.294 -41.251 1.00 0.00 ? 124 ILE A CD1  3 
ATOM 6756  H H    . ILE A 1 61 ? 5.222   -19.731 -44.869 1.00 0.00 ? 124 ILE A H    3 
ATOM 6757  H HA   . ILE A 1 61 ? 8.092   -19.278 -45.034 1.00 0.00 ? 124 ILE A HA   3 
ATOM 6758  H HB   . ILE A 1 61 ? 6.537   -21.458 -43.668 1.00 0.00 ? 124 ILE A HB   3 
ATOM 6759  H HG12 . ILE A 1 61 ? 7.960   -19.073 -42.503 1.00 0.00 ? 124 ILE A HG12 3 
ATOM 6760  H HG13 . ILE A 1 61 ? 6.240   -19.059 -42.915 1.00 0.00 ? 124 ILE A HG13 3 
ATOM 6761  H HG21 . ILE A 1 61 ? 9.463   -20.698 -43.409 1.00 0.00 ? 124 ILE A HG21 3 
ATOM 6762  H HG22 . ILE A 1 61 ? 8.833   -22.131 -44.250 1.00 0.00 ? 124 ILE A HG22 3 
ATOM 6763  H HG23 . ILE A 1 61 ? 8.625   -21.979 -42.518 1.00 0.00 ? 124 ILE A HG23 3 
ATOM 6764  H HD11 . ILE A 1 61 ? 6.585   -19.489 -40.542 1.00 0.00 ? 124 ILE A HD11 3 
ATOM 6765  H HD12 . ILE A 1 61 ? 7.606   -20.898 -40.919 1.00 0.00 ? 124 ILE A HD12 3 
ATOM 6766  H HD13 . ILE A 1 61 ? 5.871   -20.919 -41.325 1.00 0.00 ? 124 ILE A HD13 3 
ATOM 6767  N N    . PRO A 1 62 ? 8.875   -21.013 -46.683 1.00 0.00 ? 125 PRO A N    3 
ATOM 6768  C CA   . PRO A 1 62 ? 9.344   -22.001 -47.647 1.00 0.00 ? 125 PRO A CA   3 
ATOM 6769  C C    . PRO A 1 62 ? 9.106   -23.418 -47.143 1.00 0.00 ? 125 PRO A C    3 
ATOM 6770  O O    . PRO A 1 62 ? 9.213   -23.687 -45.947 1.00 0.00 ? 125 PRO A O    3 
ATOM 6771  C CB   . PRO A 1 62 ? 10.837  -21.686 -47.768 1.00 0.00 ? 125 PRO A CB   3 
ATOM 6772  C CG   . PRO A 1 62 ? 10.926  -20.225 -47.486 1.00 0.00 ? 125 PRO A CG   3 
ATOM 6773  C CD   . PRO A 1 62 ? 9.912   -19.990 -46.401 1.00 0.00 ? 125 PRO A CD   3 
ATOM 6774  H HA   . PRO A 1 62 ? 8.854   -21.848 -48.605 1.00 0.00 ? 125 PRO A HA   3 
ATOM 6775  H HB2  . PRO A 1 62 ? 11.411  -22.258 -47.031 1.00 0.00 ? 125 PRO A HB2  3 
ATOM 6776  H HB3  . PRO A 1 62 ? 11.195  -21.896 -48.776 1.00 0.00 ? 125 PRO A HB3  3 
ATOM 6777  H HG2  . PRO A 1 62 ? 11.927  -19.969 -47.134 1.00 0.00 ? 125 PRO A HG2  3 
ATOM 6778  H HG3  . PRO A 1 62 ? 10.676  -19.644 -48.379 1.00 0.00 ? 125 PRO A HG3  3 
ATOM 6779  H HD2  . PRO A 1 62 ? 10.360  -20.124 -45.416 1.00 0.00 ? 125 PRO A HD2  3 
ATOM 6780  H HD3  . PRO A 1 62 ? 9.500   -18.988 -46.513 1.00 0.00 ? 125 PRO A HD3  3 
ATOM 6781  N N    . ALA A 1 63 ? 8.784   -24.322 -48.062 1.00 0.00 ? 126 ALA A N    3 
ATOM 6782  C CA   . ALA A 1 63 ? 8.521   -25.714 -47.711 1.00 0.00 ? 126 ALA A CA   3 
ATOM 6783  C C    . ALA A 1 63 ? 9.768   -26.384 -47.151 1.00 0.00 ? 126 ALA A C    3 
ATOM 6784  O O    . ALA A 1 63 ? 9.700   -27.485 -46.603 1.00 0.00 ? 126 ALA A O    3 
ATOM 6785  C CB   . ALA A 1 63 ? 8.007   -26.478 -48.920 1.00 0.00 ? 126 ALA A CB   3 
ATOM 6786  H H    . ALA A 1 63 ? 8.710   -24.035 -49.038 1.00 0.00 ? 126 ALA A H    3 
ATOM 6787  H HA   . ALA A 1 63 ? 7.749   -25.732 -46.942 1.00 0.00 ? 126 ALA A HA   3 
ATOM 6788  H HB1  . ALA A 1 63 ? 8.750   -26.436 -49.717 1.00 0.00 ? 126 ALA A HB1  3 
ATOM 6789  H HB2  . ALA A 1 63 ? 7.078   -26.029 -49.267 1.00 0.00 ? 126 ALA A HB2  3 
ATOM 6790  H HB3  . ALA A 1 63 ? 7.829   -27.518 -48.647 1.00 0.00 ? 126 ALA A HB3  3 
ATOM 6791  N N    . ASP A 1 64 ? 10.909  -25.716 -47.291 1.00 0.00 ? 127 ASP A N    3 
ATOM 6792  C CA   . ASP A 1 64 ? 12.175  -26.249 -46.803 1.00 0.00 ? 127 ASP A CA   3 
ATOM 6793  C C    . ASP A 1 64 ? 12.550  -25.637 -45.459 1.00 0.00 ? 127 ASP A C    3 
ATOM 6794  O O    . ASP A 1 64 ? 13.672  -25.804 -44.982 1.00 0.00 ? 127 ASP A O    3 
ATOM 6795  C CB   . ASP A 1 64 ? 13.292  -25.990 -47.818 1.00 0.00 ? 127 ASP A CB   3 
ATOM 6796  C CG   . ASP A 1 64 ? 13.106  -26.768 -49.115 1.00 0.00 ? 127 ASP A CG   3 
ATOM 6797  O OD1  . ASP A 1 64 ? 12.566  -27.848 -49.065 1.00 0.00 ? 127 ASP A OD1  3 
ATOM 6798  O OD2  . ASP A 1 64 ? 13.503  -26.272 -50.142 1.00 0.00 ? 127 ASP A OD2  3 
ATOM 6799  H H    . ASP A 1 64 ? 10.901  -24.807 -47.753 1.00 0.00 ? 127 ASP A H    3 
ATOM 6800  H HA   . ASP A 1 64 ? 12.087  -27.330 -46.676 1.00 0.00 ? 127 ASP A HA   3 
ATOM 6801  H HB2  . ASP A 1 64 ? 13.308  -24.925 -48.049 1.00 0.00 ? 127 ASP A HB2  3 
ATOM 6802  H HB3  . ASP A 1 64 ? 14.247  -26.271 -47.373 1.00 0.00 ? 127 ASP A HB3  3 
ATOM 6803  N N    . VAL A 1 65 ? 11.604  -24.929 -44.853 1.00 0.00 ? 128 VAL A N    3 
ATOM 6804  C CA   . VAL A 1 65 ? 11.841  -24.273 -43.574 1.00 0.00 ? 128 VAL A CA   3 
ATOM 6805  C C    . VAL A 1 65 ? 10.802  -24.690 -42.538 1.00 0.00 ? 128 VAL A C    3 
ATOM 6806  O O    . VAL A 1 65 ? 9.610   -24.762 -42.836 1.00 0.00 ? 128 VAL A O    3 
ATOM 6807  C CB   . VAL A 1 65 ? 11.805  -22.743 -43.742 1.00 0.00 ? 128 VAL A CB   3 
ATOM 6808  C CG1  . VAL A 1 65 ? 11.903  -22.052 -42.392 1.00 0.00 ? 128 VAL A CG1  3 
ATOM 6809  C CG2  . VAL A 1 65 ? 12.933  -22.297 -44.660 1.00 0.00 ? 128 VAL A CG2  3 
ATOM 6810  H H    . VAL A 1 65 ? 10.693  -24.832 -45.302 1.00 0.00 ? 128 VAL A H    3 
ATOM 6811  H HA   . VAL A 1 65 ? 12.799  -24.554 -43.200 1.00 0.00 ? 128 VAL A HA   3 
ATOM 6812  H HB   . VAL A 1 65 ? 10.877  -22.482 -44.205 1.00 0.00 ? 128 VAL A HB   3 
ATOM 6813  H HG11 . VAL A 1 65 ? 12.732  -22.476 -41.824 1.00 0.00 ? 128 VAL A HG11 3 
ATOM 6814  H HG12 . VAL A 1 65 ? 10.973  -22.187 -41.838 1.00 0.00 ? 128 VAL A HG12 3 
ATOM 6815  H HG13 . VAL A 1 65 ? 12.073  -20.997 -42.549 1.00 0.00 ? 128 VAL A HG13 3 
ATOM 6816  H HG21 . VAL A 1 65 ? 12.637  -21.391 -45.194 1.00 0.00 ? 128 VAL A HG21 3 
ATOM 6817  H HG22 . VAL A 1 65 ? 13.170  -23.077 -45.387 1.00 0.00 ? 128 VAL A HG22 3 
ATOM 6818  H HG23 . VAL A 1 65 ? 13.819  -22.077 -44.064 1.00 0.00 ? 128 VAL A HG23 3 
ATOM 6819  N N    . ASP A 1 66 ? 11.263  -24.966 -41.323 1.00 0.00 ? 129 ASP A N    3 
ATOM 6820  C CA   . ASP A 1 66 ? 10.397  -25.492 -40.275 1.00 0.00 ? 129 ASP A CA   3 
ATOM 6821  C C    . ASP A 1 66 ? 9.709   -24.367 -39.512 1.00 0.00 ? 129 ASP A C    3 
ATOM 6822  O O    . ASP A 1 66 ? 10.365  -23.547 -38.871 1.00 0.00 ? 129 ASP A O    3 
ATOM 6823  C CB   . ASP A 1 66 ? 11.198  -26.361 -39.303 1.00 0.00 ? 129 ASP A CB   3 
ATOM 6824  C CG   . ASP A 1 66 ? 10.315  -27.094 -38.300 1.00 0.00 ? 129 ASP A CG   3 
ATOM 6825  O OD1  . ASP A 1 66 ? 9.176   -26.720 -38.156 1.00 0.00 ? 129 ASP A OD1  3 
ATOM 6826  O OD2  . ASP A 1 66 ? 10.789  -28.022 -37.689 1.00 0.00 ? 129 ASP A OD2  3 
ATOM 6827  H H    . ASP A 1 66 ? 12.267  -24.903 -41.152 1.00 0.00 ? 129 ASP A H    3 
ATOM 6828  H HA   . ASP A 1 66 ? 9.684   -26.140 -40.741 1.00 0.00 ? 129 ASP A HA   3 
ATOM 6829  H HB2  . ASP A 1 66 ? 11.763  -27.095 -39.876 1.00 0.00 ? 129 ASP A HB2  3 
ATOM 6830  H HB3  . ASP A 1 66 ? 11.893  -25.729 -38.763 1.00 0.00 ? 129 ASP A HB3  3 
ATOM 6831  N N    . PRO A 1 67 ? 8.383   -24.333 -39.588 1.00 0.00 ? 130 PRO A N    3 
ATOM 6832  C CA   . PRO A 1 67 ? 7.612   -23.232 -39.022 1.00 0.00 ? 130 PRO A CA   3 
ATOM 6833  C C    . PRO A 1 67 ? 7.509   -23.352 -37.508 1.00 0.00 ? 130 PRO A C    3 
ATOM 6834  O O    . PRO A 1 67 ? 7.022   -22.444 -36.834 1.00 0.00 ? 130 PRO A O    3 
ATOM 6835  C CB   . PRO A 1 67 ? 6.244   -23.388 -39.694 1.00 0.00 ? 130 PRO A CB   3 
ATOM 6836  C CG   . PRO A 1 67 ? 6.140   -24.848 -39.978 1.00 0.00 ? 130 PRO A CG   3 
ATOM 6837  C CD   . PRO A 1 67 ? 7.530   -25.251 -40.386 1.00 0.00 ? 130 PRO A CD   3 
ATOM 6838  H HA   . PRO A 1 67 ? 8.044   -22.279 -39.277 1.00 0.00 ? 130 PRO A HA   3 
ATOM 6839  H HB2  . PRO A 1 67 ? 5.435   -23.052 -39.042 1.00 0.00 ? 130 PRO A HB2  3 
ATOM 6840  H HB3  . PRO A 1 67 ? 6.231   -22.845 -40.628 1.00 0.00 ? 130 PRO A HB3  3 
ATOM 6841  H HG2  . PRO A 1 67 ? 5.818   -25.381 -39.075 1.00 0.00 ? 130 PRO A HG2  3 
ATOM 6842  H HG3  . PRO A 1 67 ? 5.441   -25.034 -40.795 1.00 0.00 ? 130 PRO A HG3  3 
ATOM 6843  H HD2  . PRO A 1 67 ? 7.698   -26.285 -40.073 1.00 0.00 ? 130 PRO A HD2  3 
ATOM 6844  H HD3  . PRO A 1 67 ? 7.683   -25.133 -41.459 1.00 0.00 ? 130 PRO A HD3  3 
ATOM 6845  N N    . LEU A 1 68 ? 7.972   -24.480 -36.976 1.00 0.00 ? 131 LEU A N    3 
ATOM 6846  C CA   . LEU A 1 68 ? 7.889   -24.741 -35.544 1.00 0.00 ? 131 LEU A CA   3 
ATOM 6847  C C    . LEU A 1 68 ? 9.215   -24.445 -34.854 1.00 0.00 ? 131 LEU A C    3 
ATOM 6848  O O    . LEU A 1 68 ? 9.377   -24.709 -33.663 1.00 0.00 ? 131 LEU A O    3 
ATOM 6849  C CB   . LEU A 1 68 ? 7.491   -26.200 -35.292 1.00 0.00 ? 131 LEU A CB   3 
ATOM 6850  C CG   . LEU A 1 68 ? 6.136   -26.629 -35.871 1.00 0.00 ? 131 LEU A CG   3 
ATOM 6851  C CD1  . LEU A 1 68 ? 5.910   -28.109 -35.590 1.00 0.00 ? 131 LEU A CD1  3 
ATOM 6852  C CD2  . LEU A 1 68 ? 5.032   -25.782 -35.256 1.00 0.00 ? 131 LEU A CD2  3 
ATOM 6853  H H    . LEU A 1 68 ? 8.353   -25.200 -37.590 1.00 0.00 ? 131 LEU A H    3 
ATOM 6854  H HA   . LEU A 1 68 ? 7.124   -24.105 -35.098 1.00 0.00 ? 131 LEU A HA   3 
ATOM 6855  H HB2  . LEU A 1 68 ? 8.261   -26.837 -35.724 1.00 0.00 ? 131 LEU A HB2  3 
ATOM 6856  H HB3  . LEU A 1 68 ? 7.471   -26.369 -34.213 1.00 0.00 ? 131 LEU A HB3  3 
ATOM 6857  H HG   . LEU A 1 68 ? 6.153   -26.470 -36.949 1.00 0.00 ? 131 LEU A HG   3 
ATOM 6858  H HD11 . LEU A 1 68 ? 6.777   -28.683 -35.915 1.00 0.00 ? 131 LEU A HD11 3 
ATOM 6859  H HD12 . LEU A 1 68 ? 5.027   -28.449 -36.131 1.00 0.00 ? 131 LEU A HD12 3 
ATOM 6860  H HD13 . LEU A 1 68 ? 5.759   -28.253 -34.520 1.00 0.00 ? 131 LEU A HD13 3 
ATOM 6861  H HD21 . LEU A 1 68 ? 4.072   -26.281 -35.398 1.00 0.00 ? 131 LEU A HD21 3 
ATOM 6862  H HD22 . LEU A 1 68 ? 4.998   -24.804 -35.738 1.00 0.00 ? 131 LEU A HD22 3 
ATOM 6863  H HD23 . LEU A 1 68 ? 5.216   -25.654 -34.188 1.00 0.00 ? 131 LEU A HD23 3 
ATOM 6864  N N    . THR A 1 69 ? 10.158  -23.892 -35.608 1.00 0.00 ? 132 THR A N    3 
ATOM 6865  C CA   . THR A 1 69 ? 11.479  -23.578 -35.077 1.00 0.00 ? 132 THR A CA   3 
ATOM 6866  C C    . THR A 1 69 ? 11.811  -22.103 -35.261 1.00 0.00 ? 132 THR A C    3 
ATOM 6867  O O    . THR A 1 69 ? 12.960  -21.691 -35.097 1.00 0.00 ? 132 THR A O    3 
ATOM 6868  C CB   . THR A 1 69 ? 12.566  -24.441 -35.746 1.00 0.00 ? 132 THR A CB   3 
ATOM 6869  O OG1  . THR A 1 69 ? 12.561  -24.204 -37.159 1.00 0.00 ? 132 THR A OG1  3 
ATOM 6870  C CG2  . THR A 1 69 ? 12.312  -25.918 -35.483 1.00 0.00 ? 132 THR A CG2  3 
ATOM 6871  H H    . THR A 1 69 ? 9.962   -23.698 -36.590 1.00 0.00 ? 132 THR A H    3 
ATOM 6872  H HA   . THR A 1 69 ? 11.502  -23.791 -34.005 1.00 0.00 ? 132 THR A HA   3 
ATOM 6873  H HB   . THR A 1 69 ? 13.518  -24.189 -35.315 1.00 0.00 ? 132 THR A HB   3 
ATOM 6874  H HG1  . THR A 1 69 ? 13.385  -23.766 -37.384 1.00 0.00 ? 132 THR A HG1  3 
ATOM 6875  H HG21 . THR A 1 69 ? 11.421  -26.232 -36.026 1.00 0.00 ? 132 THR A HG21 3 
ATOM 6876  H HG22 . THR A 1 69 ? 12.162  -26.075 -34.415 1.00 0.00 ? 132 THR A HG22 3 
ATOM 6877  H HG23 . THR A 1 69 ? 13.167  -26.501 -35.821 1.00 0.00 ? 132 THR A HG23 3 
ATOM 6878  N N    . ILE A 1 70 ? 10.799  -21.313 -35.600 1.00 0.00 ? 133 ILE A N    3 
ATOM 6879  C CA   . ILE A 1 70 ? 10.984  -19.881 -35.816 1.00 0.00 ? 133 ILE A CA   3 
ATOM 6880  C C    . ILE A 1 70 ? 10.614  -19.086 -34.572 1.00 0.00 ? 133 ILE A C    3 
ATOM 6881  O O    . ILE A 1 70 ? 9.704   -19.459 -33.832 1.00 0.00 ? 133 ILE A O    3 
ATOM 6882  C CB   . ILE A 1 70 ? 10.143  -19.393 -37.010 1.00 0.00 ? 133 ILE A CB   3 
ATOM 6883  C CG1  . ILE A 1 70 ? 8.653   -19.624 -36.742 1.00 0.00 ? 133 ILE A CG1  3 
ATOM 6884  C CG2  . ILE A 1 70 ? 10.573  -20.096 -38.287 1.00 0.00 ? 133 ILE A CG2  3 
ATOM 6885  C CD1  . ILE A 1 70 ? 7.748   -19.107 -37.838 1.00 0.00 ? 133 ILE A CD1  3 
ATOM 6886  H H    . ILE A 1 70 ? 9.870   -21.717 -35.716 1.00 0.00 ? 133 ILE A H    3 
ATOM 6887  H HA   . ILE A 1 70 ? 12.017  -19.687 -36.030 1.00 0.00 ? 133 ILE A HA   3 
ATOM 6888  H HB   . ILE A 1 70 ? 10.313  -18.332 -37.128 1.00 0.00 ? 133 ILE A HB   3 
ATOM 6889  H HG12 . ILE A 1 70 ? 8.499   -20.691 -36.623 1.00 0.00 ? 133 ILE A HG12 3 
ATOM 6890  H HG13 . ILE A 1 70 ? 8.382   -19.128 -35.808 1.00 0.00 ? 133 ILE A HG13 3 
ATOM 6891  H HG21 . ILE A 1 70 ? 11.535  -19.702 -38.614 1.00 0.00 ? 133 ILE A HG21 3 
ATOM 6892  H HG22 . ILE A 1 70 ? 9.839   -19.937 -39.073 1.00 0.00 ? 133 ILE A HG22 3 
ATOM 6893  H HG23 . ILE A 1 70 ? 10.668  -21.165 -38.094 1.00 0.00 ? 133 ILE A HG23 3 
ATOM 6894  H HD11 . ILE A 1 70 ? 7.527   -19.916 -38.529 1.00 0.00 ? 133 ILE A HD11 3 
ATOM 6895  H HD12 . ILE A 1 70 ? 6.820   -18.738 -37.401 1.00 0.00 ? 133 ILE A HD12 3 
ATOM 6896  H HD13 . ILE A 1 70 ? 8.246   -18.298 -38.371 1.00 0.00 ? 133 ILE A HD13 3 
ATOM 6897  N N    . THR A 1 71 ? 11.323  -17.986 -34.346 1.00 0.00 ? 134 THR A N    3 
ATOM 6898  C CA   . THR A 1 71 ? 11.116  -17.172 -33.155 1.00 0.00 ? 134 THR A CA   3 
ATOM 6899  C C    . THR A 1 71 ? 11.177  -15.684 -33.488 1.00 0.00 ? 134 THR A C    3 
ATOM 6900  O O    . THR A 1 71 ? 12.257  -15.101 -33.573 1.00 0.00 ? 134 THR A O    3 
ATOM 6901  C CB   . THR A 1 71 ? 12.160  -17.500 -32.071 1.00 0.00 ? 134 THR A CB   3 
ATOM 6902  O OG1  . THR A 1 71 ? 12.093  -18.896 -31.749 1.00 0.00 ? 134 THR A OG1  3 
ATOM 6903  C CG2  . THR A 1 71 ? 11.900  -16.682 -30.815 1.00 0.00 ? 134 THR A CG2  3 
ATOM 6904  H H    . THR A 1 71 ? 12.069  -17.734 -34.995 1.00 0.00 ? 134 THR A H    3 
ATOM 6905  H HA   . THR A 1 71 ? 10.127  -17.381 -32.746 1.00 0.00 ? 134 THR A HA   3 
ATOM 6906  H HB   . THR A 1 71 ? 13.155  -17.268 -32.448 1.00 0.00 ? 134 THR A HB   3 
ATOM 6907  H HG1  . THR A 1 71 ? 11.301  -19.041 -31.224 1.00 0.00 ? 134 THR A HG1  3 
ATOM 6908  H HG21 . THR A 1 71 ? 10.838  -16.719 -30.570 1.00 0.00 ? 134 THR A HG21 3 
ATOM 6909  H HG22 . THR A 1 71 ? 12.197  -15.648 -30.990 1.00 0.00 ? 134 THR A HG22 3 
ATOM 6910  H HG23 . THR A 1 71 ? 12.477  -17.092 -29.986 1.00 0.00 ? 134 THR A HG23 3 
ATOM 6911  N N    . SER A 1 72 ? 10.010  -15.078 -33.672 1.00 0.00 ? 135 SER A N    3 
ATOM 6912  C CA   . SER A 1 72 ? 9.918   -13.634 -33.854 1.00 0.00 ? 135 SER A CA   3 
ATOM 6913  C C    . SER A 1 72 ? 10.321  -12.891 -32.588 1.00 0.00 ? 135 SER A C    3 
ATOM 6914  O O    . SER A 1 72 ? 10.247  -13.437 -31.485 1.00 0.00 ? 135 SER A O    3 
ATOM 6915  C CB   . SER A 1 72 ? 8.506   -13.247 -34.250 1.00 0.00 ? 135 SER A CB   3 
ATOM 6916  O OG   . SER A 1 72 ? 7.624   -13.395 -33.171 1.00 0.00 ? 135 SER A OG   3 
ATOM 6917  H H    . SER A 1 72 ? 9.152   -15.617 -33.564 1.00 0.00 ? 135 SER A H    3 
ATOM 6918  H HA   . SER A 1 72 ? 10.580  -13.339 -34.629 1.00 0.00 ? 135 SER A HA   3 
ATOM 6919  H HB2  . SER A 1 72 ? 8.486   -12.236 -34.608 1.00 0.00 ? 135 SER A HB2  3 
ATOM 6920  H HB3  . SER A 1 72 ? 8.170   -13.915 -35.038 1.00 0.00 ? 135 SER A HB3  3 
ATOM 6921  H HG   . SER A 1 72 ? 7.964   -12.857 -32.452 1.00 0.00 ? 135 SER A HG   3 
ATOM 6922  N N    . SER A 1 73 ? 10.749  -11.644 -32.749 1.00 0.00 ? 136 SER A N    3 
ATOM 6923  C CA   . SER A 1 73 ? 11.168  -10.825 -31.617 1.00 0.00 ? 136 SER A CA   3 
ATOM 6924  C C    . SER A 1 73 ? 11.240  -9.352  -32.000 1.00 0.00 ? 136 SER A C    3 
ATOM 6925  O O    . SER A 1 73 ? 11.366  -9.012  -33.177 1.00 0.00 ? 136 SER A O    3 
ATOM 6926  C CB   . SER A 1 73 ? 12.518  -11.291 -31.108 1.00 0.00 ? 136 SER A CB   3 
ATOM 6927  O OG   . SER A 1 73 ? 13.521  -11.057 -32.058 1.00 0.00 ? 136 SER A OG   3 
ATOM 6928  H H    . SER A 1 73 ? 10.791  -11.251 -33.689 1.00 0.00 ? 136 SER A H    3 
ATOM 6929  H HA   . SER A 1 73 ? 10.436  -10.937 -30.818 1.00 0.00 ? 136 SER A HA   3 
ATOM 6930  H HB2  . SER A 1 73 ? 12.765  -10.751 -30.199 1.00 0.00 ? 136 SER A HB2  3 
ATOM 6931  H HB3  . SER A 1 73 ? 12.465  -12.360 -30.884 1.00 0.00 ? 136 SER A HB3  3 
ATOM 6932  H HG   . SER A 1 73 ? 14.260  -11.639 -31.868 1.00 0.00 ? 136 SER A HG   3 
ATOM 6933  N N    . LEU A 1 74 ? 11.159  -8.481  -31.000 1.00 0.00 ? 137 LEU A N    3 
ATOM 6934  C CA   . LEU A 1 74 ? 11.159  -7.042  -31.235 1.00 0.00 ? 137 LEU A CA   3 
ATOM 6935  C C    . LEU A 1 74 ? 12.405  -6.390  -30.645 1.00 0.00 ? 137 LEU A C    3 
ATOM 6936  O O    . LEU A 1 74 ? 12.980  -6.890  -29.679 1.00 0.00 ? 137 LEU A O    3 
ATOM 6937  C CB   . LEU A 1 74 ? 9.905   -6.405  -30.630 1.00 0.00 ? 137 LEU A CB   3 
ATOM 6938  C CG   . LEU A 1 74 ? 8.568   -6.867  -31.225 1.00 0.00 ? 137 LEU A CG   3 
ATOM 6939  C CD1  . LEU A 1 74 ? 7.419   -6.288  -30.411 1.00 0.00 ? 137 LEU A CD1  3 
ATOM 6940  C CD2  . LEU A 1 74 ? 8.484   -6.431  -32.681 1.00 0.00 ? 137 LEU A CD2  3 
ATOM 6941  H H    . LEU A 1 74 ? 11.043  -8.825  -30.046 1.00 0.00 ? 137 LEU A H    3 
ATOM 6942  H HA   . LEU A 1 74 ? 11.169  -6.838  -32.299 1.00 0.00 ? 137 LEU A HA   3 
ATOM 6943  H HB2  . LEU A 1 74 ? 9.895   -6.624  -29.563 1.00 0.00 ? 137 LEU A HB2  3 
ATOM 6944  H HB3  . LEU A 1 74 ? 9.975   -5.323  -30.757 1.00 0.00 ? 137 LEU A HB3  3 
ATOM 6945  H HG   . LEU A 1 74 ? 8.525   -7.955  -31.180 1.00 0.00 ? 137 LEU A HG   3 
ATOM 6946  H HD11 . LEU A 1 74 ? 7.548   -6.536  -29.357 1.00 0.00 ? 137 LEU A HD11 3 
ATOM 6947  H HD12 . LEU A 1 74 ? 6.478   -6.704  -30.769 1.00 0.00 ? 137 LEU A HD12 3 
ATOM 6948  H HD13 . LEU A 1 74 ? 7.407   -5.204  -30.529 1.00 0.00 ? 137 LEU A HD13 3 
ATOM 6949  H HD21 . LEU A 1 74 ? 9.213   -6.949  -33.266 1.00 0.00 ? 137 LEU A HD21 3 
ATOM 6950  H HD22 . LEU A 1 74 ? 8.674   -5.358  -32.735 1.00 0.00 ? 137 LEU A HD22 3 
ATOM 6951  H HD23 . LEU A 1 74 ? 7.487   -6.640  -33.061 1.00 0.00 ? 137 LEU A HD23 3 
ATOM 6952  N N    . SER A 1 75 ? 12.813  -5.270  -31.231 1.00 0.00 ? 138 SER A N    3 
ATOM 6953  C CA   . SER A 1 75 ? 13.936  -4.499  -30.711 1.00 0.00 ? 138 SER A CA   3 
ATOM 6954  C C    . SER A 1 75 ? 13.464  -3.203  -30.067 1.00 0.00 ? 138 SER A C    3 
ATOM 6955  O O    . SER A 1 75 ? 12.266  -2.922  -30.020 1.00 0.00 ? 138 SER A O    3 
ATOM 6956  C CB   . SER A 1 75 ? 14.917  -4.190  -31.827 1.00 0.00 ? 138 SER A CB   3 
ATOM 6957  O OG   . SER A 1 75 ? 14.451  -3.141  -32.629 1.00 0.00 ? 138 SER A OG   3 
ATOM 6958  H H    . SER A 1 75 ? 12.283  -4.899  -32.020 1.00 0.00 ? 138 SER A H    3 
ATOM 6959  H HA   . SER A 1 75 ? 14.459  -5.084  -29.948 1.00 0.00 ? 138 SER A HA   3 
ATOM 6960  H HB2  . SER A 1 75 ? 15.875  -3.901  -31.402 1.00 0.00 ? 138 SER A HB2  3 
ATOM 6961  H HB3  . SER A 1 75 ? 15.056  -5.087  -32.433 1.00 0.00 ? 138 SER A HB3  3 
ATOM 6962  H HG   . SER A 1 75 ? 14.853  -2.327  -32.316 1.00 0.00 ? 138 SER A HG   3 
ATOM 6963  N N    . SER A 1 76 ? 14.410  -2.416  -29.567 1.00 0.00 ? 139 SER A N    3 
ATOM 6964  C CA   . SER A 1 76 ? 14.101  -1.109  -29.000 1.00 0.00 ? 139 SER A CA   3 
ATOM 6965  C C    . SER A 1 76 ? 13.664  -0.130  -30.083 1.00 0.00 ? 139 SER A C    3 
ATOM 6966  O O    . SER A 1 76 ? 13.066  0.906   -29.790 1.00 0.00 ? 139 SER A O    3 
ATOM 6967  C CB   . SER A 1 76 ? 15.310  -0.559  -28.268 1.00 0.00 ? 139 SER A CB   3 
ATOM 6968  O OG   . SER A 1 76 ? 16.343  -0.252  -29.162 1.00 0.00 ? 139 SER A OG   3 
ATOM 6969  H H    . SER A 1 76 ? 15.387  -2.703  -29.648 1.00 0.00 ? 139 SER A H    3 
ATOM 6970  H HA   . SER A 1 76 ? 13.284  -1.233  -28.291 1.00 0.00 ? 139 SER A HA   3 
ATOM 6971  H HB2  . SER A 1 76 ? 15.028  0.347   -27.738 1.00 0.00 ? 139 SER A HB2  3 
ATOM 6972  H HB3  . SER A 1 76 ? 15.660  -1.300  -27.544 1.00 0.00 ? 139 SER A HB3  3 
ATOM 6973  H HG   . SER A 1 76 ? 16.118  -0.641  -30.010 1.00 0.00 ? 139 SER A HG   3 
ATOM 6974  N N    . ASP A 1 77 ? 13.963  -0.464  -31.332 1.00 0.00 ? 140 ASP A N    3 
ATOM 6975  C CA   . ASP A 1 77 ? 13.578  0.375   -32.462 1.00 0.00 ? 140 ASP A CA   3 
ATOM 6976  C C    . ASP A 1 77 ? 12.297  -0.134  -33.110 1.00 0.00 ? 140 ASP A C    3 
ATOM 6977  O O    . ASP A 1 77 ? 11.747  0.509   -34.006 1.00 0.00 ? 140 ASP A O    3 
ATOM 6978  C CB   . ASP A 1 77 ? 14.700  0.418   -33.503 1.00 0.00 ? 140 ASP A CB   3 
ATOM 6979  C CG   . ASP A 1 77 ? 15.951  1.124   -32.996 1.00 0.00 ? 140 ASP A CG   3 
ATOM 6980  O OD1  . ASP A 1 77 ? 15.825  1.986   -32.158 1.00 0.00 ? 140 ASP A OD1  3 
ATOM 6981  O OD2  . ASP A 1 77 ? 17.018  0.796   -33.453 1.00 0.00 ? 140 ASP A OD2  3 
ATOM 6982  H H    . ASP A 1 77 ? 14.456  -1.341  -31.509 1.00 0.00 ? 140 ASP A H    3 
ATOM 6983  H HA   . ASP A 1 77 ? 13.408  1.396   -32.112 1.00 0.00 ? 140 ASP A HA   3 
ATOM 6984  H HB2  . ASP A 1 77 ? 14.960  -0.605  -33.773 1.00 0.00 ? 140 ASP A HB2  3 
ATOM 6985  H HB3  . ASP A 1 77 ? 14.338  0.936   -34.392 1.00 0.00 ? 140 ASP A HB3  3 
ATOM 6986  N N    . GLY A 1 78 ? 11.822  -1.286  -32.653 1.00 0.00 ? 141 GLY A N    3 
ATOM 6987  C CA   . GLY A 1 78 ? 10.608  -1.884  -33.191 1.00 0.00 ? 141 GLY A CA   3 
ATOM 6988  C C    . GLY A 1 78 ? 10.916  -2.790  -34.377 1.00 0.00 ? 141 GLY A C    3 
ATOM 6989  O O    . GLY A 1 78 ? 10.064  -3.013  -35.237 1.00 0.00 ? 141 GLY A O    3 
ATOM 6990  H H    . GLY A 1 78 ? 12.326  -1.765  -31.907 1.00 0.00 ? 141 GLY A H    3 
ATOM 6991  H HA2  . GLY A 1 78 ? 10.163  -2.498  -32.408 1.00 0.00 ? 141 GLY A HA2  3 
ATOM 6992  H HA3  . GLY A 1 78 ? 9.902   -1.111  -33.454 1.00 0.00 ? 141 GLY A HA3  3 
ATOM 6993  N N    . VAL A 1 79 ? 12.139  -3.309  -34.415 1.00 0.00 ? 142 VAL A N    3 
ATOM 6994  C CA   . VAL A 1 79 ? 12.557  -4.204  -35.489 1.00 0.00 ? 142 VAL A CA   3 
ATOM 6995  C C    . VAL A 1 79 ? 12.070  -5.624  -35.241 1.00 0.00 ? 142 VAL A C    3 
ATOM 6996  O O    . VAL A 1 79 ? 12.622  -6.345  -34.411 1.00 0.00 ? 142 VAL A O    3 
ATOM 6997  C CB   . VAL A 1 79 ? 14.093  -4.203  -35.613 1.00 0.00 ? 142 VAL A CB   3 
ATOM 6998  C CG1  . VAL A 1 79 ? 14.537  -5.165  -36.706 1.00 0.00 ? 142 VAL A CG1  3 
ATOM 6999  C CG2  . VAL A 1 79 ? 14.590  -2.795  -35.899 1.00 0.00 ? 142 VAL A CG2  3 
ATOM 7000  H H    . VAL A 1 79 ? 12.795  -3.091  -33.665 1.00 0.00 ? 142 VAL A H    3 
ATOM 7001  H HA   . VAL A 1 79 ? 12.141  -3.848  -36.431 1.00 0.00 ? 142 VAL A HA   3 
ATOM 7002  H HB   . VAL A 1 79 ? 14.513  -4.542  -34.667 1.00 0.00 ? 142 VAL A HB   3 
ATOM 7003  H HG11 . VAL A 1 79 ? 15.594  -5.009  -36.922 1.00 0.00 ? 142 VAL A HG11 3 
ATOM 7004  H HG12 . VAL A 1 79 ? 13.951  -4.979  -37.606 1.00 0.00 ? 142 VAL A HG12 3 
ATOM 7005  H HG13 . VAL A 1 79 ? 14.383  -6.193  -36.376 1.00 0.00 ? 142 VAL A HG13 3 
ATOM 7006  H HG21 . VAL A 1 79 ? 14.556  -2.618  -36.971 1.00 0.00 ? 142 VAL A HG21 3 
ATOM 7007  H HG22 . VAL A 1 79 ? 13.970  -2.056  -35.387 1.00 0.00 ? 142 VAL A HG22 3 
ATOM 7008  H HG23 . VAL A 1 79 ? 15.621  -2.698  -35.557 1.00 0.00 ? 142 VAL A HG23 3 
ATOM 7009  N N    . LEU A 1 80 ? 11.032  -6.023  -35.970 1.00 0.00 ? 143 LEU A N    3 
ATOM 7010  C CA   . LEU A 1 80 ? 10.487  -7.370  -35.854 1.00 0.00 ? 143 LEU A CA   3 
ATOM 7011  C C    . LEU A 1 80 ? 11.204  -8.337  -36.785 1.00 0.00 ? 143 LEU A C    3 
ATOM 7012  O O    . LEU A 1 80 ? 11.222  -8.146  -38.001 1.00 0.00 ? 143 LEU A O    3 
ATOM 7013  C CB   . LEU A 1 80 ? 8.986   -7.365  -36.171 1.00 0.00 ? 143 LEU A CB   3 
ATOM 7014  C CG   . LEU A 1 80 ? 8.303   -8.737  -36.188 1.00 0.00 ? 143 LEU A CG   3 
ATOM 7015  C CD1  . LEU A 1 80 ? 8.347   -9.344  -34.793 1.00 0.00 ? 143 LEU A CD1  3 
ATOM 7016  C CD2  . LEU A 1 80 ? 6.870   -8.585  -36.674 1.00 0.00 ? 143 LEU A CD2  3 
ATOM 7017  H H    . LEU A 1 80 ? 10.623  -5.378  -36.646 1.00 0.00 ? 143 LEU A H    3 
ATOM 7018  H HA   . LEU A 1 80 ? 10.622  -7.715  -34.843 1.00 0.00 ? 143 LEU A HA   3 
ATOM 7019  H HB2  . LEU A 1 80 ? 8.507   -6.774  -35.419 1.00 0.00 ? 143 LEU A HB2  3 
ATOM 7020  H HB3  . LEU A 1 80 ? 8.845   -6.889  -37.133 1.00 0.00 ? 143 LEU A HB3  3 
ATOM 7021  H HG   . LEU A 1 80 ? 8.843   -9.385  -36.862 1.00 0.00 ? 143 LEU A HG   3 
ATOM 7022  H HD11 . LEU A 1 80 ? 9.356   -9.673  -34.545 1.00 0.00 ? 143 LEU A HD11 3 
ATOM 7023  H HD12 . LEU A 1 80 ? 7.672   -10.192 -34.769 1.00 0.00 ? 143 LEU A HD12 3 
ATOM 7024  H HD13 . LEU A 1 80 ? 8.009   -8.624  -34.069 1.00 0.00 ? 143 LEU A HD13 3 
ATOM 7025  H HD21 . LEU A 1 80 ? 6.297   -8.018  -35.939 1.00 0.00 ? 143 LEU A HD21 3 
ATOM 7026  H HD22 . LEU A 1 80 ? 6.430   -9.573  -36.791 1.00 0.00 ? 143 LEU A HD22 3 
ATOM 7027  H HD23 . LEU A 1 80 ? 6.854   -8.061  -37.629 1.00 0.00 ? 143 LEU A HD23 3 
ATOM 7028  N N    . THR A 1 81 ? 11.798  -9.377  -36.207 1.00 0.00 ? 144 THR A N    3 
ATOM 7029  C CA   . THR A 1 81 ? 12.502  -10.388 -36.988 1.00 0.00 ? 144 THR A CA   3 
ATOM 7030  C C    . THR A 1 81 ? 12.121  -11.793 -36.545 1.00 0.00 ? 144 THR A C    3 
ATOM 7031  O O    . THR A 1 81 ? 12.360  -12.182 -35.401 1.00 0.00 ? 144 THR A O    3 
ATOM 7032  C CB   . THR A 1 81 ? 14.028  -10.207 -36.876 1.00 0.00 ? 144 THR A CB   3 
ATOM 7033  O OG1  . THR A 1 81 ? 14.395  -8.905  -37.352 1.00 0.00 ? 144 THR A OG1  3 
ATOM 7034  C CG2  . THR A 1 81 ? 14.752  -11.264 -37.694 1.00 0.00 ? 144 THR A CG2  3 
ATOM 7035  H H    . THR A 1 81 ? 11.740  -9.484  -35.195 1.00 0.00 ? 144 THR A H    3 
ATOM 7036  H HA   . THR A 1 81 ? 12.228  -10.282 -38.030 1.00 0.00 ? 144 THR A HA   3 
ATOM 7037  H HB   . THR A 1 81 ? 14.325  -10.302 -35.831 1.00 0.00 ? 144 THR A HB   3 
ATOM 7038  H HG1  . THR A 1 81 ? 14.767  -9.005  -38.231 1.00 0.00 ? 144 THR A HG1  3 
ATOM 7039  H HG21 . THR A 1 81 ? 14.649  -12.234 -37.207 1.00 0.00 ? 144 THR A HG21 3 
ATOM 7040  H HG22 . THR A 1 81 ? 15.809  -11.007 -37.773 1.00 0.00 ? 144 THR A HG22 3 
ATOM 7041  H HG23 . THR A 1 81 ? 14.315  -11.311 -38.691 1.00 0.00 ? 144 THR A HG23 3 
ATOM 7042  N N    . VAL A 1 82 ? 11.525  -12.554 -37.458 1.00 0.00 ? 145 VAL A N    3 
ATOM 7043  C CA   . VAL A 1 82 ? 11.208  -13.953 -37.199 1.00 0.00 ? 145 VAL A CA   3 
ATOM 7044  C C    . VAL A 1 82 ? 12.080  -14.878 -38.039 1.00 0.00 ? 145 VAL A C    3 
ATOM 7045  O O    . VAL A 1 82 ? 12.270  -14.653 -39.234 1.00 0.00 ? 145 VAL A O    3 
ATOM 7046  C CB   . VAL A 1 82 ? 9.725   -14.231 -37.506 1.00 0.00 ? 145 VAL A CB   3 
ATOM 7047  C CG1  . VAL A 1 82 ? 9.411   -13.902 -38.958 1.00 0.00 ? 145 VAL A CG1  3 
ATOM 7048  C CG2  . VAL A 1 82 ? 9.396   -15.685 -37.200 1.00 0.00 ? 145 VAL A CG2  3 
ATOM 7049  H H    . VAL A 1 82 ? 11.370  -12.171 -38.391 1.00 0.00 ? 145 VAL A H    3 
ATOM 7050  H HA   . VAL A 1 82 ? 11.407  -14.201 -36.170 1.00 0.00 ? 145 VAL A HA   3 
ATOM 7051  H HB   . VAL A 1 82 ? 9.128   -13.584 -36.886 1.00 0.00 ? 145 VAL A HB   3 
ATOM 7052  H HG11 . VAL A 1 82 ? 9.789   -12.910 -39.182 1.00 0.00 ? 145 VAL A HG11 3 
ATOM 7053  H HG12 . VAL A 1 82 ? 8.333   -13.908 -39.098 1.00 0.00 ? 145 VAL A HG12 3 
ATOM 7054  H HG13 . VAL A 1 82 ? 9.868   -14.642 -39.608 1.00 0.00 ? 145 VAL A HG13 3 
ATOM 7055  H HG21 . VAL A 1 82 ? 8.314   -15.804 -37.144 1.00 0.00 ? 145 VAL A HG21 3 
ATOM 7056  H HG22 . VAL A 1 82 ? 9.786   -16.312 -37.999 1.00 0.00 ? 145 VAL A HG22 3 
ATOM 7057  H HG23 . VAL A 1 82 ? 9.842   -15.980 -36.251 1.00 0.00 ? 145 VAL A HG23 3 
ATOM 7058  N N    . ASP A 1 83 ? 12.606  -15.922 -37.407 1.00 0.00 ? 146 ASP A N    3 
ATOM 7059  C CA   . ASP A 1 83 ? 13.699  -16.696 -37.984 1.00 0.00 ? 146 ASP A CA   3 
ATOM 7060  C C    . ASP A 1 83 ? 13.826  -18.057 -37.311 1.00 0.00 ? 146 ASP A C    3 
ATOM 7061  O O    . ASP A 1 83 ? 13.624  -18.183 -36.102 1.00 0.00 ? 146 ASP A O    3 
ATOM 7062  C CB   . ASP A 1 83 ? 15.020  -15.933 -37.859 1.00 0.00 ? 146 ASP A CB   3 
ATOM 7063  C CG   . ASP A 1 83 ? 15.460  -15.740 -36.414 1.00 0.00 ? 146 ASP A CG   3 
ATOM 7064  O OD1  . ASP A 1 83 ? 15.170  -16.593 -35.606 1.00 0.00 ? 146 ASP A OD1  3 
ATOM 7065  O OD2  . ASP A 1 83 ? 16.081  -14.746 -36.131 1.00 0.00 ? 146 ASP A OD2  3 
ATOM 7066  H H    . ASP A 1 83 ? 12.434  -16.010 -36.405 1.00 0.00 ? 146 ASP A H    3 
ATOM 7067  H HA   . ASP A 1 83 ? 13.479  -16.845 -39.040 1.00 0.00 ? 146 ASP A HA   3 
ATOM 7068  H HB2  . ASP A 1 83 ? 15.802  -16.461 -38.395 1.00 0.00 ? 146 ASP A HB2  3 
ATOM 7069  H HB3  . ASP A 1 83 ? 14.891  -14.943 -38.293 1.00 0.00 ? 146 ASP A HB3  3 
ATOM 7070  N N    . GLY A 1 84 ? 14.161  -19.072 -38.098 1.00 0.00 ? 147 GLY A N    3 
ATOM 7071  C CA   . GLY A 1 84 ? 14.224  -20.440 -37.600 1.00 0.00 ? 147 GLY A CA   3 
ATOM 7072  C C    . GLY A 1 84 ? 14.942  -21.353 -38.584 1.00 0.00 ? 147 GLY A C    3 
ATOM 7073  O O    . GLY A 1 84 ? 14.890  -21.139 -39.797 1.00 0.00 ? 147 GLY A O    3 
ATOM 7074  H H    . GLY A 1 84 ? 14.291  -18.901 -39.096 1.00 0.00 ? 147 GLY A H    3 
ATOM 7075  H HA2  . GLY A 1 84 ? 14.721  -20.399 -36.647 1.00 0.00 ? 147 GLY A HA2  3 
ATOM 7076  H HA3  . GLY A 1 84 ? 13.225  -20.836 -37.456 1.00 0.00 ? 147 GLY A HA3  3 
ATOM 7077  N N    . PRO A 1 85 ? 15.613  -22.372 -38.058 1.00 0.00 ? 148 PRO A N    3 
ATOM 7078  C CA   . PRO A 1 85 ? 16.389  -23.288 -38.886 1.00 0.00 ? 148 PRO A CA   3 
ATOM 7079  C C    . PRO A 1 85 ? 15.522  -23.928 -39.963 1.00 0.00 ? 148 PRO A C    3 
ATOM 7080  O O    . PRO A 1 85 ? 14.334  -24.167 -39.755 1.00 0.00 ? 148 PRO A O    3 
ATOM 7081  C CB   . PRO A 1 85 ? 16.891  -24.326 -37.875 1.00 0.00 ? 148 PRO A CB   3 
ATOM 7082  C CG   . PRO A 1 85 ? 16.977  -23.573 -36.592 1.00 0.00 ? 148 PRO A CG   3 
ATOM 7083  C CD   . PRO A 1 85 ? 15.787  -22.648 -36.620 1.00 0.00 ? 148 PRO A CD   3 
ATOM 7084  H HA   . PRO A 1 85 ? 17.238  -22.781 -39.339 1.00 0.00 ? 148 PRO A HA   3 
ATOM 7085  H HB2  . PRO A 1 85 ? 16.182  -25.157 -37.788 1.00 0.00 ? 148 PRO A HB2  3 
ATOM 7086  H HB3  . PRO A 1 85 ? 17.875  -24.695 -38.164 1.00 0.00 ? 148 PRO A HB3  3 
ATOM 7087  H HG2  . PRO A 1 85 ? 16.912  -24.262 -35.743 1.00 0.00 ? 148 PRO A HG2  3 
ATOM 7088  H HG3  . PRO A 1 85 ? 17.905  -23.000 -36.545 1.00 0.00 ? 148 PRO A HG3  3 
ATOM 7089  H HD2  . PRO A 1 85 ? 14.915  -23.126 -36.229 1.00 0.00 ? 148 PRO A HD2  3 
ATOM 7090  H HD3  . PRO A 1 85 ? 16.027  -21.754 -36.062 1.00 0.00 ? 148 PRO A HD3  3 
ATOM 7091  N N    . ARG A 1 86 ? 16.125  -24.199 -41.117 1.00 0.00 ? 149 ARG A N    3 
ATOM 7092  C CA   . ARG A 1 86 ? 15.450  -24.939 -42.176 1.00 0.00 ? 149 ARG A CA   3 
ATOM 7093  C C    . ARG A 1 86 ? 15.024  -26.320 -41.698 1.00 0.00 ? 149 ARG A C    3 
ATOM 7094  O O    . ARG A 1 86 ? 15.387  -26.748 -40.603 1.00 0.00 ? 149 ARG A O    3 
ATOM 7095  C CB   . ARG A 1 86 ? 16.359  -25.083 -43.388 1.00 0.00 ? 149 ARG A CB   3 
ATOM 7096  C CG   . ARG A 1 86 ? 16.555  -23.811 -44.197 1.00 0.00 ? 149 ARG A CG   3 
ATOM 7097  C CD   . ARG A 1 86 ? 17.395  -24.046 -45.398 1.00 0.00 ? 149 ARG A CD   3 
ATOM 7098  N NE   . ARG A 1 86 ? 16.856  -25.106 -46.237 1.00 0.00 ? 149 ARG A NE   3 
ATOM 7099  C CZ   . ARG A 1 86 ? 17.362  -25.466 -47.432 1.00 0.00 ? 149 ARG A CZ   3 
ATOM 7100  N NH1  . ARG A 1 86 ? 18.415  -24.844 -47.916 1.00 0.00 ? 149 ARG A NH1  3 
ATOM 7101  N NH2  . ARG A 1 86 ? 16.799  -26.445 -48.119 1.00 0.00 ? 149 ARG A NH2  3 
ATOM 7102  H H    . ARG A 1 86 ? 17.118  -23.994 -41.216 1.00 0.00 ? 149 ARG A H    3 
ATOM 7103  H HA   . ARG A 1 86 ? 14.601  -24.357 -42.457 1.00 0.00 ? 149 ARG A HA   3 
ATOM 7104  H HB2  . ARG A 1 86 ? 17.337  -25.416 -43.043 1.00 0.00 ? 149 ARG A HB2  3 
ATOM 7105  H HB3  . ARG A 1 86 ? 15.943  -25.848 -44.050 1.00 0.00 ? 149 ARG A HB3  3 
ATOM 7106  H HG2  . ARG A 1 86 ? 15.584  -23.460 -44.520 1.00 0.00 ? 149 ARG A HG2  3 
ATOM 7107  H HG3  . ARG A 1 86 ? 17.020  -23.056 -43.566 1.00 0.00 ? 149 ARG A HG3  3 
ATOM 7108  H HD2  . ARG A 1 86 ? 17.444  -23.134 -45.988 1.00 0.00 ? 149 ARG A HD2  3 
ATOM 7109  H HD3  . ARG A 1 86 ? 18.393  -24.321 -45.090 1.00 0.00 ? 149 ARG A HD3  3 
ATOM 7110  H HE   . ARG A 1 86 ? 16.071  -25.590 -45.907 1.00 0.00 ? 149 ARG A HE   3 
ATOM 7111  H HH11 . ARG A 1 86 ? 18.841  -24.102 -47.396 1.00 0.00 ? 149 ARG A HH11 3 
ATOM 7112  H HH12 . ARG A 1 86 ? 18.794  -25.114 -48.812 1.00 0.00 ? 149 ARG A HH12 3 
ATOM 7113  H HH21 . ARG A 1 86 ? 15.999  -26.922 -47.755 1.00 0.00 ? 149 ARG A HH21 3 
ATOM 7114  H HH22 . ARG A 1 86 ? 17.176  -26.709 -49.006 1.00 0.00 ? 149 ARG A HH22 3 
ATOM 7115  N N    . LYS A 1 87 ? 14.250  -27.014 -42.525 1.00 0.00 ? 150 LYS A N    3 
ATOM 7116  C CA   . LYS A 1 87 ? 13.963  -28.425 -42.303 1.00 0.00 ? 150 LYS A CA   3 
ATOM 7117  C C    . LYS A 1 87 ? 15.149  -29.297 -42.697 1.00 0.00 ? 150 LYS A C    3 
ATOM 7118  O O    . LYS A 1 87 ? 15.288  -30.425 -42.219 1.00 0.00 ? 150 LYS A O    3 
ATOM 7119  C CB   . LYS A 1 87 ? 12.717  -28.850 -43.085 1.00 0.00 ? 150 LYS A CB   3 
ATOM 7120  C CG   . LYS A 1 87 ? 11.411  -28.288 -42.538 1.00 0.00 ? 150 LYS A CG   3 
ATOM 7121  C CD   . LYS A 1 87 ? 10.236  -28.653 -43.432 1.00 0.00 ? 150 LYS A CD   3 
ATOM 7122  C CE   . LYS A 1 87 ? 8.916   -28.211 -42.819 1.00 0.00 ? 150 LYS A CE   3 
ATOM 7123  N NZ   . LYS A 1 87 ? 7.755   -28.564 -43.681 1.00 0.00 ? 150 LYS A NZ   3 
ATOM 7124  H H    . LYS A 1 87 ? 14.016  -26.611 -43.428 1.00 0.00 ? 150 LYS A H    3 
ATOM 7125  H HA   . LYS A 1 87 ? 13.761  -28.562 -41.240 1.00 0.00 ? 150 LYS A HA   3 
ATOM 7126  H HB2  . LYS A 1 87 ? 12.831  -28.509 -44.112 1.00 0.00 ? 150 LYS A HB2  3 
ATOM 7127  H HB3  . LYS A 1 87 ? 12.653  -29.940 -43.079 1.00 0.00 ? 150 LYS A HB3  3 
ATOM 7128  H HG2  . LYS A 1 87 ? 11.241  -28.696 -41.542 1.00 0.00 ? 150 LYS A HG2  3 
ATOM 7129  H HG3  . LYS A 1 87 ? 11.491  -27.206 -42.477 1.00 0.00 ? 150 LYS A HG3  3 
ATOM 7130  H HD2  . LYS A 1 87 ? 10.362  -28.169 -44.401 1.00 0.00 ? 150 LYS A HD2  3 
ATOM 7131  H HD3  . LYS A 1 87 ? 10.217  -29.734 -43.570 1.00 0.00 ? 150 LYS A HD3  3 
ATOM 7132  H HE2  . LYS A 1 87 ? 8.796   -28.683 -41.847 1.00 0.00 ? 150 LYS A HE2  3 
ATOM 7133  H HE3  . LYS A 1 87 ? 8.937   -27.129 -42.693 1.00 0.00 ? 150 LYS A HE3  3 
ATOM 7134  H HZ1  . LYS A 1 87 ? 7.507   -29.559 -43.530 1.00 0.00 ? 150 LYS A HZ1  3 
ATOM 7135  H HZ2  . LYS A 1 87 ? 8.013   -28.419 -44.680 1.00 0.00 ? 150 LYS A HZ2  3 
ATOM 7136  H HZ3  . LYS A 1 87 ? 6.967   -27.978 -43.446 1.00 0.00 ? 150 LYS A HZ3  3 
ATOM 7137  N N    . GLN A 1 88 ? 16.000  -28.771 -43.569 1.00 0.00 ? 151 GLN A N    3 
ATOM 7138  C CA   . GLN A 1 88 ? 17.179  -29.499 -44.025 1.00 0.00 ? 151 GLN A CA   3 
ATOM 7139  C C    . GLN A 1 88 ? 18.411  -29.107 -43.220 1.00 0.00 ? 151 GLN A C    3 
ATOM 7140  O O    . GLN A 1 88 ? 19.504  -29.631 -43.444 1.00 0.00 ? 151 GLN A O    3 
ATOM 7141  C CB   . GLN A 1 88 ? 17.423  -29.244 -45.515 1.00 0.00 ? 151 GLN A CB   3 
ATOM 7142  C CG   . GLN A 1 88 ? 16.279  -29.674 -46.414 1.00 0.00 ? 151 GLN A CG   3 
ATOM 7143  C CD   . GLN A 1 88 ? 15.989  -31.159 -46.315 1.00 0.00 ? 151 GLN A CD   3 
ATOM 7144  O OE1  . GLN A 1 88 ? 16.888  -31.992 -46.457 1.00 0.00 ? 151 GLN A OE1  3 
ATOM 7145  N NE2  . GLN A 1 88 ? 14.730  -31.501 -46.069 1.00 0.00 ? 151 GLN A NE2  3 
ATOM 7146  H H    . GLN A 1 88 ? 15.828  -27.832 -43.929 1.00 0.00 ? 151 GLN A H    3 
ATOM 7147  H HA   . GLN A 1 88 ? 17.010  -30.570 -43.893 1.00 0.00 ? 151 GLN A HA   3 
ATOM 7148  H HB2  . GLN A 1 88 ? 17.601  -28.181 -45.655 1.00 0.00 ? 151 GLN A HB2  3 
ATOM 7149  H HB3  . GLN A 1 88 ? 18.318  -29.791 -45.814 1.00 0.00 ? 151 GLN A HB3  3 
ATOM 7150  H HG2  . GLN A 1 88 ? 15.387  -29.120 -46.123 1.00 0.00 ? 151 GLN A HG2  3 
ATOM 7151  H HG3  . GLN A 1 88 ? 16.523  -29.430 -47.450 1.00 0.00 ? 151 GLN A HG3  3 
ATOM 7152  H HE21 . GLN A 1 88 ? 14.008  -30.787 -45.963 1.00 0.00 ? 151 GLN A HE21 3 
ATOM 7153  H HE22 . GLN A 1 88 ? 14.486  -32.488 -45.987 1.00 0.00 ? 151 GLN A HE22 3 
ATOM 7154  N N    . VAL A 1 89 ? 18.231  -28.185 -42.282 1.00 0.00 ? 152 VAL A N    3 
ATOM 7155  C CA   . VAL A 1 89 ? 19.321  -27.749 -41.417 1.00 0.00 ? 152 VAL A CA   3 
ATOM 7156  C C    . VAL A 1 89 ? 20.199  -28.923 -41.004 1.00 0.00 ? 152 VAL A C    3 
ATOM 7157  O O    . VAL A 1 89 ? 19.652  -29.986 -40.760 1.00 0.00 ? 152 VAL A O    3 
ATOM 7158  C CB   . VAL A 1 89 ? 18.760  -27.064 -40.156 1.00 0.00 ? 152 VAL A CB   3 
ATOM 7159  C CG1  . VAL A 1 89 ? 17.972  -28.057 -39.316 1.00 0.00 ? 152 VAL A CG1  3 
ATOM 7160  C CG2  . VAL A 1 89 ? 19.896  -26.457 -39.348 1.00 0.00 ? 152 VAL A CG2  3 
ATOM 7161  O OXT  . VAL A 1 89 ? 21.409  -28.765 -41.010 1.00 0.00 ? 152 VAL A OXT  3 
ATOM 7162  H H    . VAL A 1 89 ? 17.299  -27.798 -42.140 1.00 0.00 ? 152 VAL A H    3 
ATOM 7163  H HA   . VAL A 1 89 ? 19.931  -27.029 -41.963 1.00 0.00 ? 152 VAL A HA   3 
ATOM 7164  H HB   . VAL A 1 89 ? 18.080  -26.268 -40.469 1.00 0.00 ? 152 VAL A HB   3 
ATOM 7165  H HG11 . VAL A 1 89 ? 17.388  -27.521 -38.567 1.00 0.00 ? 152 VAL A HG11 3 
ATOM 7166  H HG12 . VAL A 1 89 ? 18.665  -28.736 -38.820 1.00 0.00 ? 152 VAL A HG12 3 
ATOM 7167  H HG13 . VAL A 1 89 ? 17.301  -28.626 -39.959 1.00 0.00 ? 152 VAL A HG13 3 
ATOM 7168  H HG21 . VAL A 1 89 ? 19.582  -26.347 -38.308 1.00 0.00 ? 152 VAL A HG21 3 
ATOM 7169  H HG22 . VAL A 1 89 ? 20.782  -27.087 -39.384 1.00 0.00 ? 152 VAL A HG22 3 
ATOM 7170  H HG23 . VAL A 1 89 ? 20.141  -25.471 -39.743 1.00 0.00 ? 152 VAL A HG23 3 
ATOM 7171  N N    . GLY B 1 1  ? 5.383   14.737  -47.388 1.00 0.00 ? 64  GLY B N    3 
ATOM 7172  C CA   . GLY B 1 1  ? 5.151   14.979  -45.968 1.00 0.00 ? 64  GLY B CA   3 
ATOM 7173  C C    . GLY B 1 1  ? 3.687   14.761  -45.606 1.00 0.00 ? 64  GLY B C    3 
ATOM 7174  O O    . GLY B 1 1  ? 3.300   13.675  -45.175 1.00 0.00 ? 64  GLY B O    3 
ATOM 7175  H H1   . GLY B 1 1  ? 6.374   14.783  -47.578 1.00 0.00 ? 64  GLY B H1   3 
ATOM 7176  H H2   . GLY B 1 1  ? 5.027   13.792  -47.640 1.00 0.00 ? 64  GLY B H2   3 
ATOM 7177  H H3   . GLY B 1 1  ? 4.890   15.457  -47.949 1.00 0.00 ? 64  GLY B H3   3 
ATOM 7178  H HA2  . GLY B 1 1  ? 5.770   14.300  -45.383 1.00 0.00 ? 64  GLY B HA2  3 
ATOM 7179  H HA3  . GLY B 1 1  ? 5.428   16.008  -45.732 1.00 0.00 ? 64  GLY B HA3  3 
ATOM 7180  N N    . LEU B 1 2  ? 2.877   15.798  -45.783 1.00 0.00 ? 65  LEU B N    3 
ATOM 7181  C CA   . LEU B 1 2  ? 1.453   15.722  -45.470 1.00 0.00 ? 65  LEU B CA   3 
ATOM 7182  C C    . LEU B 1 2  ? 0.630   15.449  -46.721 1.00 0.00 ? 65  LEU B C    3 
ATOM 7183  O O    . LEU B 1 2  ? 1.090   15.672  -47.841 1.00 0.00 ? 65  LEU B O    3 
ATOM 7184  C CB   . LEU B 1 2  ? 0.985   17.028  -44.816 1.00 0.00 ? 65  LEU B CB   3 
ATOM 7185  C CG   . LEU B 1 2  ? 1.688   17.407  -43.507 1.00 0.00 ? 65  LEU B CG   3 
ATOM 7186  C CD1  . LEU B 1 2  ? 1.172   18.756  -43.024 1.00 0.00 ? 65  LEU B CD1  3 
ATOM 7187  C CD2  . LEU B 1 2  ? 1.444   16.324  -42.468 1.00 0.00 ? 65  LEU B CD2  3 
ATOM 7188  H H    . LEU B 1 2  ? 3.260   16.672  -46.144 1.00 0.00 ? 65  LEU B H    3 
ATOM 7189  H HA   . LEU B 1 2  ? 1.279   14.910  -44.764 1.00 0.00 ? 65  LEU B HA   3 
ATOM 7190  H HB2  . LEU B 1 2  ? 1.140   17.835  -45.530 1.00 0.00 ? 65  LEU B HB2  3 
ATOM 7191  H HB3  . LEU B 1 2  ? -0.084  16.943  -44.616 1.00 0.00 ? 65  LEU B HB3  3 
ATOM 7192  H HG   . LEU B 1 2  ? 2.760   17.485  -43.698 1.00 0.00 ? 65  LEU B HG   3 
ATOM 7193  H HD11 . LEU B 1 2  ? 1.375   19.519  -43.775 1.00 0.00 ? 65  LEU B HD11 3 
ATOM 7194  H HD12 . LEU B 1 2  ? 1.674   19.022  -42.094 1.00 0.00 ? 65  LEU B HD12 3 
ATOM 7195  H HD13 . LEU B 1 2  ? 0.099   18.689  -42.853 1.00 0.00 ? 65  LEU B HD13 3 
ATOM 7196  H HD21 . LEU B 1 2  ? 0.404   15.998  -42.511 1.00 0.00 ? 65  LEU B HD21 3 
ATOM 7197  H HD22 . LEU B 1 2  ? 1.654   16.725  -41.473 1.00 0.00 ? 65  LEU B HD22 3 
ATOM 7198  H HD23 . LEU B 1 2  ? 2.099   15.472  -42.652 1.00 0.00 ? 65  LEU B HD23 3 
ATOM 7199  N N    . SER B 1 3  ? -0.593  14.964  -46.524 1.00 0.00 ? 66  SER B N    3 
ATOM 7200  C CA   . SER B 1 3  ? -1.469  14.620  -47.637 1.00 0.00 ? 66  SER B CA   3 
ATOM 7201  C C    . SER B 1 3  ? -1.774  15.841  -48.494 1.00 0.00 ? 66  SER B C    3 
ATOM 7202  O O    . SER B 1 3  ? -2.105  16.909  -47.978 1.00 0.00 ? 66  SER B O    3 
ATOM 7203  C CB   . SER B 1 3  ? -2.761  14.019  -47.118 1.00 0.00 ? 66  SER B CB   3 
ATOM 7204  O OG   . SER B 1 3  ? -3.639  13.729  -48.171 1.00 0.00 ? 66  SER B OG   3 
ATOM 7205  H H    . SER B 1 3  ? -0.912  14.796  -45.571 1.00 0.00 ? 66  SER B H    3 
ATOM 7206  H HA   . SER B 1 3  ? -0.973  13.877  -48.259 1.00 0.00 ? 66  SER B HA   3 
ATOM 7207  H HB2  . SER B 1 3  ? -2.539  13.100  -46.582 1.00 0.00 ? 66  SER B HB2  3 
ATOM 7208  H HB3  . SER B 1 3  ? -3.205  14.734  -46.431 1.00 0.00 ? 66  SER B HB3  3 
ATOM 7209  H HG   . SER B 1 3  ? -3.317  12.943  -48.618 1.00 0.00 ? 66  SER B HG   3 
ATOM 7210  N N    . GLU B 1 4  ? -1.664  15.679  -49.808 1.00 0.00 ? 67  GLU B N    3 
ATOM 7211  C CA   . GLU B 1 4  ? -1.931  16.765  -50.741 1.00 0.00 ? 67  GLU B CA   3 
ATOM 7212  C C    . GLU B 1 4  ? -3.374  17.242  -50.633 1.00 0.00 ? 67  GLU B C    3 
ATOM 7213  O O    . GLU B 1 4  ? -4.306  16.439  -50.662 1.00 0.00 ? 67  GLU B O    3 
ATOM 7214  C CB   . GLU B 1 4  ? -1.636  16.324  -52.177 1.00 0.00 ? 67  GLU B CB   3 
ATOM 7215  C CG   . GLU B 1 4  ? -1.804  17.419  -53.220 1.00 0.00 ? 67  GLU B CG   3 
ATOM 7216  C CD   . GLU B 1 4  ? -1.496  16.951  -54.615 1.00 0.00 ? 67  GLU B CD   3 
ATOM 7217  O OE1  . GLU B 1 4  ? -1.334  15.770  -54.803 1.00 0.00 ? 67  GLU B OE1  3 
ATOM 7218  O OE2  . GLU B 1 4  ? -1.422  17.778  -55.494 1.00 0.00 ? 67  GLU B OE2  3 
ATOM 7219  H H    . GLU B 1 4  ? -1.387  14.767  -50.175 1.00 0.00 ? 67  GLU B H    3 
ATOM 7220  H HA   . GLU B 1 4  ? -1.274  17.599  -50.499 1.00 0.00 ? 67  GLU B HA   3 
ATOM 7221  H HB2  . GLU B 1 4  ? -0.600  15.988  -52.218 1.00 0.00 ? 67  GLU B HB2  3 
ATOM 7222  H HB3  . GLU B 1 4  ? -2.271  15.498  -52.433 1.00 0.00 ? 67  GLU B HB3  3 
ATOM 7223  H HG2  . GLU B 1 4  ? -2.837  17.763  -53.187 1.00 0.00 ? 67  GLU B HG2  3 
ATOM 7224  H HG3  . GLU B 1 4  ? -1.143  18.249  -52.969 1.00 0.00 ? 67  GLU B HG3  3 
ATOM 7225  N N    . MET B 1 5  ? -3.552  18.554  -50.509 1.00 0.00 ? 68  MET B N    3 
ATOM 7226  C CA   . MET B 1 5  ? -4.885  19.141  -50.419 1.00 0.00 ? 68  MET B CA   3 
ATOM 7227  C C    . MET B 1 5  ? -4.885  20.579  -50.918 1.00 0.00 ? 68  MET B C    3 
ATOM 7228  O O    . MET B 1 5  ? -3.840  21.229  -50.973 1.00 0.00 ? 68  MET B O    3 
ATOM 7229  C CB   . MET B 1 5  ? -5.392  19.074  -48.981 1.00 0.00 ? 68  MET B CB   3 
ATOM 7230  C CG   . MET B 1 5  ? -4.623  19.946  -48.000 1.00 0.00 ? 68  MET B CG   3 
ATOM 7231  S SD   . MET B 1 5  ? -5.185  19.738  -46.296 1.00 0.00 ? 68  MET B SD   3 
ATOM 7232  C CE   . MET B 1 5  ? -6.879  20.303  -46.429 1.00 0.00 ? 68  MET B CE   3 
ATOM 7233  H H    . MET B 1 5  ? -2.737  19.167  -50.494 1.00 0.00 ? 68  MET B H    3 
ATOM 7234  H HA   . MET B 1 5  ? -5.556  18.567  -51.056 1.00 0.00 ? 68  MET B HA   3 
ATOM 7235  H HB2  . MET B 1 5  ? -6.436  19.384  -48.968 1.00 0.00 ? 68  MET B HB2  3 
ATOM 7236  H HB3  . MET B 1 5  ? -5.331  18.039  -48.639 1.00 0.00 ? 68  MET B HB3  3 
ATOM 7237  H HG2  . MET B 1 5  ? -3.565  19.693  -48.062 1.00 0.00 ? 68  MET B HG2  3 
ATOM 7238  H HG3  . MET B 1 5  ? -4.759  20.988  -48.287 1.00 0.00 ? 68  MET B HG3  3 
ATOM 7239  H HE1  . MET B 1 5  ? -6.930  21.114  -47.153 1.00 0.00 ? 68  MET B HE1  3 
ATOM 7240  H HE2  . MET B 1 5  ? -7.225  20.658  -45.458 1.00 0.00 ? 68  MET B HE2  3 
ATOM 7241  H HE3  . MET B 1 5  ? -7.513  19.479  -46.760 1.00 0.00 ? 68  MET B HE3  3 
ATOM 7242  N N    . ARG B 1 6  ? -6.064  21.074  -51.282 1.00 0.00 ? 69  ARG B N    3 
ATOM 7243  C CA   . ARG B 1 6  ? -6.198  22.425  -51.815 1.00 0.00 ? 69  ARG B CA   3 
ATOM 7244  C C    . ARG B 1 6  ? -7.262  23.210  -51.059 1.00 0.00 ? 69  ARG B C    3 
ATOM 7245  O O    . ARG B 1 6  ? -8.406  23.304  -51.501 1.00 0.00 ? 69  ARG B O    3 
ATOM 7246  C CB   . ARG B 1 6  ? -6.553  22.384  -53.293 1.00 0.00 ? 69  ARG B CB   3 
ATOM 7247  C CG   . ARG B 1 6  ? -6.701  23.745  -53.952 1.00 0.00 ? 69  ARG B CG   3 
ATOM 7248  C CD   . ARG B 1 6  ? -6.961  23.626  -55.409 1.00 0.00 ? 69  ARG B CD   3 
ATOM 7249  N NE   . ARG B 1 6  ? -6.975  24.922  -56.066 1.00 0.00 ? 69  ARG B NE   3 
ATOM 7250  C CZ   . ARG B 1 6  ? -7.262  25.118  -57.368 1.00 0.00 ? 69  ARG B CZ   3 
ATOM 7251  N NH1  . ARG B 1 6  ? -7.555  24.092  -58.137 1.00 0.00 ? 69  ARG B NH1  3 
ATOM 7252  N NH2  . ARG B 1 6  ? -7.248  26.338  -57.872 1.00 0.00 ? 69  ARG B NH2  3 
ATOM 7253  H H    . ARG B 1 6  ? -6.891  20.481  -51.219 1.00 0.00 ? 69  ARG B H    3 
ATOM 7254  H HA   . ARG B 1 6  ? -5.251  22.959  -51.712 1.00 0.00 ? 69  ARG B HA   3 
ATOM 7255  H HB2  . ARG B 1 6  ? -5.779  21.831  -53.822 1.00 0.00 ? 69  ARG B HB2  3 
ATOM 7256  H HB3  . ARG B 1 6  ? -7.494  21.857  -53.402 1.00 0.00 ? 69  ARG B HB3  3 
ATOM 7257  H HG2  . ARG B 1 6  ? -7.527  24.281  -53.486 1.00 0.00 ? 69  ARG B HG2  3 
ATOM 7258  H HG3  . ARG B 1 6  ? -5.779  24.306  -53.804 1.00 0.00 ? 69  ARG B HG3  3 
ATOM 7259  H HD2  . ARG B 1 6  ? -6.182  23.011  -55.860 1.00 0.00 ? 69  ARG B HD2  3 
ATOM 7260  H HD3  . ARG B 1 6  ? -7.928  23.145  -55.556 1.00 0.00 ? 69  ARG B HD3  3 
ATOM 7261  H HE   . ARG B 1 6  ? -6.762  25.710  -55.525 1.00 0.00 ? 69  ARG B HE   3 
ATOM 7262  H HH11 . ARG B 1 6  ? -7.566  23.167  -57.757 1.00 0.00 ? 69  ARG B HH11 3 
ATOM 7263  H HH12 . ARG B 1 6  ? -7.770  24.239  -59.113 1.00 0.00 ? 69  ARG B HH12 3 
ATOM 7264  H HH21 . ARG B 1 6  ? -7.024  27.120  -57.290 1.00 0.00 ? 69  ARG B HH21 3 
ATOM 7265  H HH22 . ARG B 1 6  ? -7.461  26.481  -58.840 1.00 0.00 ? 69  ARG B HH22 3 
ATOM 7266  N N    . LEU B 1 7  ? -6.877  23.773  -49.919 1.00 0.00 ? 70  LEU B N    3 
ATOM 7267  C CA   . LEU B 1 7  ? -7.756  24.664  -49.170 1.00 0.00 ? 70  LEU B CA   3 
ATOM 7268  C C    . LEU B 1 7  ? -7.396  26.125  -49.413 1.00 0.00 ? 70  LEU B C    3 
ATOM 7269  O O    . LEU B 1 7  ? -6.334  26.590  -49.002 1.00 0.00 ? 70  LEU B O    3 
ATOM 7270  C CB   . LEU B 1 7  ? -7.671  24.353  -47.670 1.00 0.00 ? 70  LEU B CB   3 
ATOM 7271  C CG   . LEU B 1 7  ? -8.449  25.302  -46.750 1.00 0.00 ? 70  LEU B CG   3 
ATOM 7272  C CD1  . LEU B 1 7  ? -9.941  25.174  -47.031 1.00 0.00 ? 70  LEU B CD1  3 
ATOM 7273  C CD2  . LEU B 1 7  ? -8.137  24.973  -45.298 1.00 0.00 ? 70  LEU B CD2  3 
ATOM 7274  H H    . LEU B 1 7  ? -5.905  23.676  -49.625 1.00 0.00 ? 70  LEU B H    3 
ATOM 7275  H HA   . LEU B 1 7  ? -8.774  24.493  -49.487 1.00 0.00 ? 70  LEU B HA   3 
ATOM 7276  H HB2  . LEU B 1 7  ? -8.046  23.345  -47.503 1.00 0.00 ? 70  LEU B HB2  3 
ATOM 7277  H HB3  . LEU B 1 7  ? -6.620  24.382  -47.384 1.00 0.00 ? 70  LEU B HB3  3 
ATOM 7278  H HG   . LEU B 1 7  ? -8.136  26.328  -46.948 1.00 0.00 ? 70  LEU B HG   3 
ATOM 7279  H HD11 . LEU B 1 7  ? -10.168 25.614  -47.989 1.00 0.00 ? 70  LEU B HD11 3 
ATOM 7280  H HD12 . LEU B 1 7  ? -10.496 25.704  -46.259 1.00 0.00 ? 70  LEU B HD12 3 
ATOM 7281  H HD13 . LEU B 1 7  ? -10.228 24.140  -47.029 1.00 0.00 ? 70  LEU B HD13 3 
ATOM 7282  H HD21 . LEU B 1 7  ? -8.168  23.896  -45.154 1.00 0.00 ? 70  LEU B HD21 3 
ATOM 7283  H HD22 . LEU B 1 7  ? -8.865  25.448  -44.641 1.00 0.00 ? 70  LEU B HD22 3 
ATOM 7284  H HD23 . LEU B 1 7  ? -7.140  25.337  -45.052 1.00 0.00 ? 70  LEU B HD23 3 
ATOM 7285  N N    . GLU B 1 8  ? -8.289  26.844  -50.084 1.00 0.00 ? 71  GLU B N    3 
ATOM 7286  C CA   . GLU B 1 8  ? -8.057  28.248  -50.406 1.00 0.00 ? 71  GLU B CA   3 
ATOM 7287  C C    . GLU B 1 8  ? -9.053  29.149  -49.687 1.00 0.00 ? 71  GLU B C    3 
ATOM 7288  O O    . GLU B 1 8  ? -9.521  28.826  -48.595 1.00 0.00 ? 71  GLU B O    3 
ATOM 7289  C CB   . GLU B 1 8  ? -8.148  28.471  -51.916 1.00 0.00 ? 71  GLU B CB   3 
ATOM 7290  C CG   . GLU B 1 8  ? -7.170  27.641  -52.735 1.00 0.00 ? 71  GLU B CG   3 
ATOM 7291  C CD   . GLU B 1 8  ? -7.229  27.951  -54.207 1.00 0.00 ? 71  GLU B CD   3 
ATOM 7292  O OE1  . GLU B 1 8  ? -8.109  28.671  -54.607 1.00 0.00 ? 71  GLU B OE1  3 
ATOM 7293  O OE2  . GLU B 1 8  ? -6.389  27.465  -54.928 1.00 0.00 ? 71  GLU B OE2  3 
ATOM 7294  H H    . GLU B 1 8  ? -9.154  26.403  -50.400 1.00 0.00 ? 71  GLU B H    3 
ATOM 7295  H HA   . GLU B 1 8  ? -7.053  28.535  -50.086 1.00 0.00 ? 71  GLU B HA   3 
ATOM 7296  H HB2  . GLU B 1 8  ? -9.162  28.286  -52.243 1.00 0.00 ? 71  GLU B HB2  3 
ATOM 7297  H HB3  . GLU B 1 8  ? -7.907  29.514  -52.116 1.00 0.00 ? 71  GLU B HB3  3 
ATOM 7298  H HG2  . GLU B 1 8  ? -6.158  27.825  -52.372 1.00 0.00 ? 71  GLU B HG2  3 
ATOM 7299  H HG3  . GLU B 1 8  ? -7.414  26.590  -52.587 1.00 0.00 ? 71  GLU B HG3  3 
ATOM 7300  N N    . LYS B 1 9  ? -9.376  30.278  -50.307 1.00 0.00 ? 72  LYS B N    3 
ATOM 7301  C CA   . LYS B 1 9  ? -10.370 31.194  -49.764 1.00 0.00 ? 72  LYS B CA   3 
ATOM 7302  C C    . LYS B 1 9  ? -11.779 30.634  -49.919 1.00 0.00 ? 72  LYS B C    3 
ATOM 7303  O O    . LYS B 1 9  ? -12.667 30.936  -49.126 1.00 0.00 ? 72  LYS B O    3 
ATOM 7304  C CB   . LYS B 1 9  ? -10.269 32.560  -50.444 1.00 0.00 ? 72  LYS B CB   3 
ATOM 7305  C CG   . LYS B 1 9  ? -9.012  33.345  -50.099 1.00 0.00 ? 72  LYS B CG   3 
ATOM 7306  C CD   . LYS B 1 9  ? -8.980  34.685  -50.818 1.00 0.00 ? 72  LYS B CD   3 
ATOM 7307  C CE   . LYS B 1 9  ? -7.722  35.471  -50.472 1.00 0.00 ? 72  LYS B CE   3 
ATOM 7308  N NZ   . LYS B 1 9  ? -7.660  36.769  -51.198 1.00 0.00 ? 72  LYS B NZ   3 
ATOM 7309  H H    . LYS B 1 9  ? -8.959  30.490  -51.209 1.00 0.00 ? 72  LYS B H    3 
ATOM 7310  H HA   . LYS B 1 9  ? -10.164 31.330  -48.703 1.00 0.00 ? 72  LYS B HA   3 
ATOM 7311  H HB2  . LYS B 1 9  ? -10.288 32.406  -51.522 1.00 0.00 ? 72  LYS B HB2  3 
ATOM 7312  H HB3  . LYS B 1 9  ? -11.138 33.158  -50.161 1.00 0.00 ? 72  LYS B HB3  3 
ATOM 7313  H HG2  . LYS B 1 9  ? -8.988  33.516  -49.021 1.00 0.00 ? 72  LYS B HG2  3 
ATOM 7314  H HG3  . LYS B 1 9  ? -8.138  32.763  -50.392 1.00 0.00 ? 72  LYS B HG3  3 
ATOM 7315  H HD2  . LYS B 1 9  ? -9.004  34.512  -51.893 1.00 0.00 ? 72  LYS B HD2  3 
ATOM 7316  H HD3  . LYS B 1 9  ? -9.853  35.266  -50.527 1.00 0.00 ? 72  LYS B HD3  3 
ATOM 7317  H HE2  . LYS B 1 9  ? -7.713  35.666  -49.400 1.00 0.00 ? 72  LYS B HE2  3 
ATOM 7318  H HE3  . LYS B 1 9  ? -6.850  34.874  -50.735 1.00 0.00 ? 72  LYS B HE3  3 
ATOM 7319  H HZ1  . LYS B 1 9  ? -7.233  36.621  -52.133 1.00 0.00 ? 72  LYS B HZ1  3 
ATOM 7320  H HZ2  . LYS B 1 9  ? -7.088  37.448  -50.657 1.00 0.00 ? 72  LYS B HZ2  3 
ATOM 7321  H HZ3  . LYS B 1 9  ? -8.595  37.133  -51.311 1.00 0.00 ? 72  LYS B HZ3  3 
ATOM 7322  N N    . ASP B 1 10 ? -11.972 29.814  -50.948 1.00 0.00 ? 73  ASP B N    3 
ATOM 7323  C CA   . ASP B 1 10 ? -13.270 29.202  -51.204 1.00 0.00 ? 73  ASP B CA   3 
ATOM 7324  C C    . ASP B 1 10 ? -13.115 27.866  -51.920 1.00 0.00 ? 73  ASP B C    3 
ATOM 7325  O O    . ASP B 1 10 ? -13.953 27.491  -52.741 1.00 0.00 ? 73  ASP B O    3 
ATOM 7326  C CB   . ASP B 1 10 ? -14.151 30.137  -52.037 1.00 0.00 ? 73  ASP B CB   3 
ATOM 7327  C CG   . ASP B 1 10 ? -13.547 30.464  -53.395 1.00 0.00 ? 73  ASP B CG   3 
ATOM 7328  O OD1  . ASP B 1 10 ? -12.468 29.995  -53.673 1.00 0.00 ? 73  ASP B OD1  3 
ATOM 7329  O OD2  . ASP B 1 10 ? -14.171 31.178  -54.143 1.00 0.00 ? 73  ASP B OD2  3 
ATOM 7330  H H    . ASP B 1 10 ? -11.190 29.601  -51.568 1.00 0.00 ? 73  ASP B H    3 
ATOM 7331  H HA   . ASP B 1 10 ? -13.777 29.018  -50.261 1.00 0.00 ? 73  ASP B HA   3 
ATOM 7332  H HB2  . ASP B 1 10 ? -15.116 29.671  -52.188 1.00 0.00 ? 73  ASP B HB2  3 
ATOM 7333  H HB3  . ASP B 1 10 ? -14.290 31.066  -51.484 1.00 0.00 ? 73  ASP B HB3  3 
ATOM 7334  N N    . ARG B 1 11 ? -12.041 27.151  -51.606 1.00 0.00 ? 74  ARG B N    3 
ATOM 7335  C CA   . ARG B 1 11 ? -11.789 25.843  -52.199 1.00 0.00 ? 74  ARG B CA   3 
ATOM 7336  C C    . ARG B 1 11 ? -11.351 24.835  -51.147 1.00 0.00 ? 74  ARG B C    3 
ATOM 7337  O O    . ARG B 1 11 ? -10.793 25.205  -50.113 1.00 0.00 ? 74  ARG B O    3 
ATOM 7338  C CB   . ARG B 1 11 ? -10.720 25.944  -53.278 1.00 0.00 ? 74  ARG B CB   3 
ATOM 7339  C CG   . ARG B 1 11 ? -11.109 26.773  -54.490 1.00 0.00 ? 74  ARG B CG   3 
ATOM 7340  C CD   . ARG B 1 11 ? -12.134 26.089  -55.318 1.00 0.00 ? 74  ARG B CD   3 
ATOM 7341  N NE   . ARG B 1 11 ? -12.432 26.829  -56.534 1.00 0.00 ? 74  ARG B NE   3 
ATOM 7342  C CZ   . ARG B 1 11 ? -13.376 27.785  -56.636 1.00 0.00 ? 74  ARG B CZ   3 
ATOM 7343  N NH1  . ARG B 1 11 ? -14.105 28.103  -55.589 1.00 0.00 ? 74  ARG B NH1  3 
ATOM 7344  N NH2  . ARG B 1 11 ? -13.570 28.400  -57.790 1.00 0.00 ? 74  ARG B NH2  3 
ATOM 7345  H H    . ARG B 1 11 ? -11.386 27.514  -50.912 1.00 0.00 ? 74  ARG B H    3 
ATOM 7346  H HA   . ARG B 1 11 ? -12.706 25.465  -52.645 1.00 0.00 ? 74  ARG B HA   3 
ATOM 7347  H HB2  . ARG B 1 11 ? -9.817  26.335  -52.840 1.00 0.00 ? 74  ARG B HB2  3 
ATOM 7348  H HB3  . ARG B 1 11 ? -10.511 24.931  -53.629 1.00 0.00 ? 74  ARG B HB3  3 
ATOM 7349  H HG2  . ARG B 1 11 ? -11.514 27.721  -54.136 1.00 0.00 ? 74  ARG B HG2  3 
ATOM 7350  H HG3  . ARG B 1 11 ? -10.228 26.967  -55.102 1.00 0.00 ? 74  ARG B HG3  3 
ATOM 7351  H HD2  . ARG B 1 11 ? -11.775 25.098  -55.586 1.00 0.00 ? 74  ARG B HD2  3 
ATOM 7352  H HD3  . ARG B 1 11 ? -13.059 25.994  -54.754 1.00 0.00 ? 74  ARG B HD3  3 
ATOM 7353  H HE   . ARG B 1 11 ? -11.900 26.633  -57.332 1.00 0.00 ? 74  ARG B HE   3 
ATOM 7354  H HH11 . ARG B 1 11 ? -13.958 27.638  -54.716 1.00 0.00 ? 74  ARG B HH11 3 
ATOM 7355  H HH12 . ARG B 1 11 ? -14.814 28.818  -55.667 1.00 0.00 ? 74  ARG B HH12 3 
ATOM 7356  H HH21 . ARG B 1 11 ? -13.015 28.162  -58.586 1.00 0.00 ? 74  ARG B HH21 3 
ATOM 7357  H HH22 . ARG B 1 11 ? -14.274 29.108  -57.862 1.00 0.00 ? 74  ARG B HH22 3 
ATOM 7358  N N    . PHE B 1 12 ? -11.606 23.560  -51.413 1.00 0.00 ? 75  PHE B N    3 
ATOM 7359  C CA   . PHE B 1 12 ? -11.152 22.484  -50.537 1.00 0.00 ? 75  PHE B CA   3 
ATOM 7360  C C    . PHE B 1 12 ? -11.214 21.136  -51.240 1.00 0.00 ? 75  PHE B C    3 
ATOM 7361  O O    . PHE B 1 12 ? -12.283 20.695  -51.662 1.00 0.00 ? 75  PHE B O    3 
ATOM 7362  C CB   . PHE B 1 12 ? -11.999 22.443  -49.263 1.00 0.00 ? 75  PHE B CB   3 
ATOM 7363  C CG   . PHE B 1 12 ? -11.761 21.223  -48.420 1.00 0.00 ? 75  PHE B CG   3 
ATOM 7364  C CD1  . PHE B 1 12 ? -10.722 21.189  -47.500 1.00 0.00 ? 75  PHE B CD1  3 
ATOM 7365  C CD2  . PHE B 1 12 ? -12.574 20.106  -48.543 1.00 0.00 ? 75  PHE B CD2  3 
ATOM 7366  C CE1  . PHE B 1 12 ? -10.505 20.068  -46.722 1.00 0.00 ? 75  PHE B CE1  3 
ATOM 7367  C CE2  . PHE B 1 12 ? -12.358 18.984  -47.766 1.00 0.00 ? 75  PHE B CE2  3 
ATOM 7368  C CZ   . PHE B 1 12 ? -11.321 18.965  -46.856 1.00 0.00 ? 75  PHE B CZ   3 
ATOM 7369  H H    . PHE B 1 12 ? -12.060 23.319  -52.294 1.00 0.00 ? 75  PHE B H    3 
ATOM 7370  H HA   . PHE B 1 12 ? -10.125 22.670  -50.243 1.00 0.00 ? 75  PHE B HA   3 
ATOM 7371  H HB2  . PHE B 1 12 ? -11.762 23.323  -48.665 1.00 0.00 ? 75  PHE B HB2  3 
ATOM 7372  H HB3  . PHE B 1 12 ? -13.036 22.488  -49.540 1.00 0.00 ? 75  PHE B HB3  3 
ATOM 7373  H HD1  . PHE B 1 12 ? -10.073 22.030  -47.400 1.00 0.00 ? 75  PHE B HD1  3 
ATOM 7374  H HD2  . PHE B 1 12 ? -13.385 20.116  -49.255 1.00 0.00 ? 75  PHE B HD2  3 
ATOM 7375  H HE1  . PHE B 1 12 ? -9.694  20.056  -46.008 1.00 0.00 ? 75  PHE B HE1  3 
ATOM 7376  H HE2  . PHE B 1 12 ? -12.999 18.122  -47.872 1.00 0.00 ? 75  PHE B HE2  3 
ATOM 7377  H HZ   . PHE B 1 12 ? -11.153 18.090  -46.246 1.00 0.00 ? 75  PHE B HZ   3 
ATOM 7378  N N    . SER B 1 13 ? -10.063 20.484  -51.362 1.00 0.00 ? 76  SER B N    3 
ATOM 7379  C CA   . SER B 1 13 ? -9.982  19.190  -52.029 1.00 0.00 ? 76  SER B CA   3 
ATOM 7380  C C    . SER B 1 13 ? -8.919  18.307  -51.387 1.00 0.00 ? 76  SER B C    3 
ATOM 7381  O O    . SER B 1 13 ? -7.872  18.791  -50.961 1.00 0.00 ? 76  SER B O    3 
ATOM 7382  C CB   . SER B 1 13 ? -9.677  19.378  -53.502 1.00 0.00 ? 76  SER B CB   3 
ATOM 7383  O OG   . SER B 1 13 ? -9.524  18.142  -54.144 1.00 0.00 ? 76  SER B OG   3 
ATOM 7384  H H    . SER B 1 13 ? -9.212  20.906  -50.987 1.00 0.00 ? 76  SER B H    3 
ATOM 7385  H HA   . SER B 1 13 ? -10.931 18.689  -51.920 1.00 0.00 ? 76  SER B HA   3 
ATOM 7386  H HB2  . SER B 1 13 ? -10.492 19.918  -53.973 1.00 0.00 ? 76  SER B HB2  3 
ATOM 7387  H HB3  . SER B 1 13 ? -8.763  19.954  -53.605 1.00 0.00 ? 76  SER B HB3  3 
ATOM 7388  H HG   . SER B 1 13 ? -10.391 17.846  -54.428 1.00 0.00 ? 76  SER B HG   3 
ATOM 7389  N N    . VAL B 1 14 ? -9.195  17.010  -51.324 1.00 0.00 ? 77  VAL B N    3 
ATOM 7390  C CA   . VAL B 1 14 ? -8.311  16.071  -50.643 1.00 0.00 ? 77  VAL B CA   3 
ATOM 7391  C C    . VAL B 1 14 ? -7.892  14.936  -51.570 1.00 0.00 ? 77  VAL B C    3 
ATOM 7392  O O    . VAL B 1 14 ? -8.733  14.208  -52.092 1.00 0.00 ? 77  VAL B O    3 
ATOM 7393  C CB   . VAL B 1 14 ? -9.008  15.482  -49.401 1.00 0.00 ? 77  VAL B CB   3 
ATOM 7394  C CG1  . VAL B 1 14 ? -8.124  14.438  -48.738 1.00 0.00 ? 77  VAL B CG1  3 
ATOM 7395  C CG2  . VAL B 1 14 ? -9.353  16.599  -48.424 1.00 0.00 ? 77  VAL B CG2  3 
ATOM 7396  H H    . VAL B 1 14 ? -10.090 16.674  -51.680 1.00 0.00 ? 77  VAL B H    3 
ATOM 7397  H HA   . VAL B 1 14 ? -7.408  16.586  -50.307 1.00 0.00 ? 77  VAL B HA   3 
ATOM 7398  H HB   . VAL B 1 14 ? -9.904  15.019  -49.732 1.00 0.00 ? 77  VAL B HB   3 
ATOM 7399  H HG11 . VAL B 1 14 ? -7.683  13.770  -49.459 1.00 0.00 ? 77  VAL B HG11 3 
ATOM 7400  H HG12 . VAL B 1 14 ? -8.721  13.863  -48.031 1.00 0.00 ? 77  VAL B HG12 3 
ATOM 7401  H HG13 . VAL B 1 14 ? -7.328  14.950  -48.204 1.00 0.00 ? 77  VAL B HG13 3 
ATOM 7402  H HG21 . VAL B 1 14 ? -10.103 17.252  -48.865 1.00 0.00 ? 77  VAL B HG21 3 
ATOM 7403  H HG22 . VAL B 1 14 ? -8.455  17.176  -48.198 1.00 0.00 ? 77  VAL B HG22 3 
ATOM 7404  H HG23 . VAL B 1 14 ? -9.745  16.163  -47.505 1.00 0.00 ? 77  VAL B HG23 3 
ATOM 7405  N N    . ASN B 1 15 ? -6.585  14.796  -51.769 1.00 0.00 ? 78  ASN B N    3 
ATOM 7406  C CA   . ASN B 1 15 ? -6.046  13.693  -52.557 1.00 0.00 ? 78  ASN B CA   3 
ATOM 7407  C C    . ASN B 1 15 ? -5.757  12.481  -51.682 1.00 0.00 ? 78  ASN B C    3 
ATOM 7408  O O    . ASN B 1 15 ? -4.881  12.522  -50.819 1.00 0.00 ? 78  ASN B O    3 
ATOM 7409  C CB   . ASN B 1 15 ? -4.795  14.129  -53.299 1.00 0.00 ? 78  ASN B CB   3 
ATOM 7410  C CG   . ASN B 1 15 ? -4.249  13.051  -54.192 1.00 0.00 ? 78  ASN B CG   3 
ATOM 7411  O OD1  . ASN B 1 15 ? -4.830  11.966  -54.303 1.00 0.00 ? 78  ASN B OD1  3 
ATOM 7412  N ND2  . ASN B 1 15 ? -3.142  13.330  -54.832 1.00 0.00 ? 78  ASN B ND2  3 
ATOM 7413  H H    . ASN B 1 15 ? -5.938  15.422  -51.290 1.00 0.00 ? 78  ASN B H    3 
ATOM 7414  H HA   . ASN B 1 15 ? -6.789  13.402  -53.304 1.00 0.00 ? 78  ASN B HA   3 
ATOM 7415  H HB2  . ASN B 1 15 ? -5.010  15.019  -53.889 1.00 0.00 ? 78  ASN B HB2  3 
ATOM 7416  H HB3  . ASN B 1 15 ? -4.060  14.365  -52.548 1.00 0.00 ? 78  ASN B HB3  3 
ATOM 7417  H HD21 . ASN B 1 15 ? -2.689  14.237  -54.716 1.00 0.00 ? 78  ASN B HD21 3 
ATOM 7418  H HD22 . ASN B 1 15 ? -2.734  12.631  -55.454 1.00 0.00 ? 78  ASN B HD22 3 
ATOM 7419  N N    . LEU B 1 16 ? -6.497  11.403  -51.911 1.00 0.00 ? 79  LEU B N    3 
ATOM 7420  C CA   . LEU B 1 16 ? -6.373  10.200  -51.094 1.00 0.00 ? 79  LEU B CA   3 
ATOM 7421  C C    . LEU B 1 16 ? -5.808  9.040   -51.905 1.00 0.00 ? 79  LEU B C    3 
ATOM 7422  O O    . LEU B 1 16 ? -6.074  8.919   -53.101 1.00 0.00 ? 79  LEU B O    3 
ATOM 7423  C CB   . LEU B 1 16 ? -7.738  9.811   -50.515 1.00 0.00 ? 79  LEU B CB   3 
ATOM 7424  C CG   . LEU B 1 16 ? -8.396  10.854  -49.600 1.00 0.00 ? 79  LEU B CG   3 
ATOM 7425  C CD1  . LEU B 1 16 ? -9.844  10.463  -49.342 1.00 0.00 ? 79  LEU B CD1  3 
ATOM 7426  C CD2  . LEU B 1 16 ? -7.614  10.953  -48.298 1.00 0.00 ? 79  LEU B CD2  3 
ATOM 7427  H H    . LEU B 1 16 ? -7.216  11.440  -52.631 1.00 0.00 ? 79  LEU B H    3 
ATOM 7428  H HA   . LEU B 1 16 ? -5.695  10.383  -50.262 1.00 0.00 ? 79  LEU B HA   3 
ATOM 7429  H HB2  . LEU B 1 16 ? -8.409  9.641   -51.348 1.00 0.00 ? 79  LEU B HB2  3 
ATOM 7430  H HB3  . LEU B 1 16 ? -7.631  8.878   -49.959 1.00 0.00 ? 79  LEU B HB3  3 
ATOM 7431  H HG   . LEU B 1 16 ? -8.378  11.806  -50.114 1.00 0.00 ? 79  LEU B HG   3 
ATOM 7432  H HD11 . LEU B 1 16 ? -9.905  9.399   -49.133 1.00 0.00 ? 79  LEU B HD11 3 
ATOM 7433  H HD12 . LEU B 1 16 ? -10.454 10.708  -50.203 1.00 0.00 ? 79  LEU B HD12 3 
ATOM 7434  H HD13 . LEU B 1 16 ? -10.221 11.018  -48.482 1.00 0.00 ? 79  LEU B HD13 3 
ATOM 7435  H HD21 . LEU B 1 16 ? -8.190  11.522  -47.569 1.00 0.00 ? 79  LEU B HD21 3 
ATOM 7436  H HD22 . LEU B 1 16 ? -6.667  11.459  -48.471 1.00 0.00 ? 79  LEU B HD22 3 
ATOM 7437  H HD23 . LEU B 1 16 ? -7.426  9.952   -47.906 1.00 0.00 ? 79  LEU B HD23 3 
ATOM 7438  N N    . ASP B 1 17 ? -5.030  8.188   -51.246 1.00 0.00 ? 80  ASP B N    3 
ATOM 7439  C CA   . ASP B 1 17 ? -4.292  7.135   -51.935 1.00 0.00 ? 80  ASP B CA   3 
ATOM 7440  C C    . ASP B 1 17 ? -4.971  5.783   -51.758 1.00 0.00 ? 80  ASP B C    3 
ATOM 7441  O O    . ASP B 1 17 ? -4.928  5.191   -50.679 1.00 0.00 ? 80  ASP B O    3 
ATOM 7442  C CB   . ASP B 1 17 ? -2.854  7.063   -51.416 1.00 0.00 ? 80  ASP B CB   3 
ATOM 7443  C CG   . ASP B 1 17 ? -2.014  6.023   -52.149 1.00 0.00 ? 80  ASP B CG   3 
ATOM 7444  O OD1  . ASP B 1 17 ? -2.566  5.277   -52.919 1.00 0.00 ? 80  ASP B OD1  3 
ATOM 7445  O OD2  . ASP B 1 17 ? -0.826  5.989   -51.928 1.00 0.00 ? 80  ASP B OD2  3 
ATOM 7446  H H    . ASP B 1 17 ? -4.832  8.362   -50.261 1.00 0.00 ? 80  ASP B H    3 
ATOM 7447  H HA   . ASP B 1 17 ? -4.248  7.352   -53.004 1.00 0.00 ? 80  ASP B HA   3 
ATOM 7448  H HB2  . ASP B 1 17 ? -2.390  8.041   -51.543 1.00 0.00 ? 80  ASP B HB2  3 
ATOM 7449  H HB3  . ASP B 1 17 ? -2.872  6.815   -50.355 1.00 0.00 ? 80  ASP B HB3  3 
ATOM 7450  N N    . VAL B 1 18 ? -5.597  5.298   -52.824 1.00 0.00 ? 81  VAL B N    3 
ATOM 7451  C CA   . VAL B 1 18 ? -6.215  3.977   -52.816 1.00 0.00 ? 81  VAL B CA   3 
ATOM 7452  C C    . VAL B 1 18 ? -6.146  3.327   -54.191 1.00 0.00 ? 81  VAL B C    3 
ATOM 7453  O O    . VAL B 1 18 ? -7.056  2.602   -54.593 1.00 0.00 ? 81  VAL B O    3 
ATOM 7454  C CB   . VAL B 1 18 ? -7.684  4.076   -52.370 1.00 0.00 ? 81  VAL B CB   3 
ATOM 7455  C CG1  . VAL B 1 18 ? -7.773  4.542   -50.923 1.00 0.00 ? 81  VAL B CG1  3 
ATOM 7456  C CG2  . VAL B 1 18 ? -8.441  5.024   -53.288 1.00 0.00 ? 81  VAL B CG2  3 
ATOM 7457  H H    . VAL B 1 18 ? -5.580  5.828   -53.695 1.00 0.00 ? 81  VAL B H    3 
ATOM 7458  H HA   . VAL B 1 18 ? -5.684  3.334   -52.109 1.00 0.00 ? 81  VAL B HA   3 
ATOM 7459  H HB   . VAL B 1 18 ? -8.112  3.092   -52.438 1.00 0.00 ? 81  VAL B HB   3 
ATOM 7460  H HG11 . VAL B 1 18 ? -7.103  3.947   -50.301 1.00 0.00 ? 81  VAL B HG11 3 
ATOM 7461  H HG12 . VAL B 1 18 ? -8.797  4.425   -50.569 1.00 0.00 ? 81  VAL B HG12 3 
ATOM 7462  H HG13 . VAL B 1 18 ? -7.485  5.591   -50.866 1.00 0.00 ? 81  VAL B HG13 3 
ATOM 7463  H HG21 . VAL B 1 18 ? -8.497  4.600   -54.291 1.00 0.00 ? 81  VAL B HG21 3 
ATOM 7464  H HG22 . VAL B 1 18 ? -9.444  5.145   -52.888 1.00 0.00 ? 81  VAL B HG22 3 
ATOM 7465  H HG23 . VAL B 1 18 ? -7.930  5.979   -53.324 1.00 0.00 ? 81  VAL B HG23 3 
ATOM 7466  N N    . LYS B 1 19 ? -5.064  3.597   -54.913 1.00 0.00 ? 82  LYS B N    3 
ATOM 7467  C CA   . LYS B 1 19 ? -4.977  3.242   -56.326 1.00 0.00 ? 82  LYS B CA   3 
ATOM 7468  C C    . LYS B 1 19 ? -4.993  1.732   -56.519 1.00 0.00 ? 82  LYS B C    3 
ATOM 7469  O O    . LYS B 1 19 ? -5.320  1.236   -57.597 1.00 0.00 ? 82  LYS B O    3 
ATOM 7470  C CB   . LYS B 1 19 ? -3.714  3.838   -56.951 1.00 0.00 ? 82  LYS B CB   3 
ATOM 7471  C CG   . LYS B 1 19 ? -3.734  5.356   -57.083 1.00 0.00 ? 82  LYS B CG   3 
ATOM 7472  C CD   . LYS B 1 19 ? -2.430  5.876   -57.667 1.00 0.00 ? 82  LYS B CD   3 
ATOM 7473  C CE   . LYS B 1 19 ? -2.444  7.393   -57.788 1.00 0.00 ? 82  LYS B CE   3 
ATOM 7474  N NZ   . LYS B 1 19 ? -1.140  7.924   -58.274 1.00 0.00 ? 82  LYS B NZ   3 
ATOM 7475  H H    . LYS B 1 19 ? -4.366  4.233   -54.528 1.00 0.00 ? 82  LYS B H    3 
ATOM 7476  H HA   . LYS B 1 19 ? -5.814  3.664   -56.841 1.00 0.00 ? 82  LYS B HA   3 
ATOM 7477  H HB2  . LYS B 1 19 ? -2.858  3.564   -56.338 1.00 0.00 ? 82  LYS B HB2  3 
ATOM 7478  H HB3  . LYS B 1 19 ? -3.583  3.408   -57.946 1.00 0.00 ? 82  LYS B HB3  3 
ATOM 7479  H HG2  . LYS B 1 19 ? -4.558  5.641   -57.736 1.00 0.00 ? 82  LYS B HG2  3 
ATOM 7480  H HG3  . LYS B 1 19 ? -3.883  5.796   -56.097 1.00 0.00 ? 82  LYS B HG3  3 
ATOM 7481  H HD2  . LYS B 1 19 ? -1.606  5.580   -57.018 1.00 0.00 ? 82  LYS B HD2  3 
ATOM 7482  H HD3  . LYS B 1 19 ? -2.283  5.440   -58.655 1.00 0.00 ? 82  LYS B HD3  3 
ATOM 7483  H HE2  . LYS B 1 19 ? -3.211  7.670   -58.496 1.00 0.00 ? 82  LYS B HE2  3 
ATOM 7484  H HE3  . LYS B 1 19 ? -2.671  7.829   -56.816 1.00 0.00 ? 82  LYS B HE3  3 
ATOM 7485  H HZ1  . LYS B 1 19 ? -1.103  8.953   -58.129 1.00 0.00 ? 82  LYS B HZ1  3 
ATOM 7486  H HZ2  . LYS B 1 19 ? -1.037  7.712   -59.287 1.00 0.00 ? 82  LYS B HZ2  3 
ATOM 7487  H HZ3  . LYS B 1 19 ? -0.388  7.486   -57.761 1.00 0.00 ? 82  LYS B HZ3  3 
ATOM 7488  N N    . HIS B 1 20 ? -4.639  1.002   -55.464 1.00 0.00 ? 83  HIS B N    3 
ATOM 7489  C CA   . HIS B 1 20 ? -4.463  -0.442  -55.556 1.00 0.00 ? 83  HIS B CA   3 
ATOM 7490  C C    . HIS B 1 20 ? -5.733  -1.179  -55.150 1.00 0.00 ? 83  HIS B C    3 
ATOM 7491  O O    . HIS B 1 20 ? -5.779  -2.409  -55.159 1.00 0.00 ? 83  HIS B O    3 
ATOM 7492  C CB   . HIS B 1 20 ? -3.294  -0.902  -54.678 1.00 0.00 ? 83  HIS B CB   3 
ATOM 7493  C CG   . HIS B 1 20 ? -1.983  -0.282  -55.050 1.00 0.00 ? 83  HIS B CG   3 
ATOM 7494  N ND1  . HIS B 1 20 ? -1.581  0.945   -54.569 1.00 0.00 ? 83  HIS B ND1  3 
ATOM 7495  C CD2  . HIS B 1 20 ? -0.985  -0.720  -55.851 1.00 0.00 ? 83  HIS B CD2  3 
ATOM 7496  C CE1  . HIS B 1 20 ? -0.387  1.236   -55.062 1.00 0.00 ? 83  HIS B CE1  3 
ATOM 7497  N NE2  . HIS B 1 20 ? -0.006  0.242   -55.842 1.00 0.00 ? 83  HIS B NE2  3 
ATOM 7498  H H    . HIS B 1 20 ? -4.353  1.471   -54.606 1.00 0.00 ? 83  HIS B H    3 
ATOM 7499  H HA   . HIS B 1 20 ? -4.222  -0.716  -56.584 1.00 0.00 ? 83  HIS B HA   3 
ATOM 7500  H HB2  . HIS B 1 20 ? -3.528  -0.589  -53.671 1.00 0.00 ? 83  HIS B HB2  3 
ATOM 7501  H HB3  . HIS B 1 20 ? -3.211  -1.989  -54.711 1.00 0.00 ? 83  HIS B HB3  3 
ATOM 7502  H HD2  . HIS B 1 20 ? -0.874  -1.731  -56.216 1.00 0.00 ? 83  HIS B HD2  3 
ATOM 7503  H HE1  . HIS B 1 20 ? 0.178   2.134   -54.858 1.00 0.00 ? 83  HIS B HE1  3 
ATOM 7504  H HE2  . HIS B 1 20 ? 0.865   0.197   -56.351 1.00 0.00 ? 83  HIS B HE2  3 
ATOM 7505  N N    . PHE B 1 21 ? -6.763  -0.420  -54.793 1.00 0.00 ? 84  PHE B N    3 
ATOM 7506  C CA   . PHE B 1 21 ? -7.954  -0.987  -54.175 1.00 0.00 ? 84  PHE B CA   3 
ATOM 7507  C C    . PHE B 1 21 ? -9.129  -0.994  -55.146 1.00 0.00 ? 84  PHE B C    3 
ATOM 7508  O O    . PHE B 1 21 ? -9.068  -0.386  -56.214 1.00 0.00 ? 84  PHE B O    3 
ATOM 7509  C CB   . PHE B 1 21 ? -8.332  -0.199  -52.917 1.00 0.00 ? 84  PHE B CB   3 
ATOM 7510  C CG   . PHE B 1 21 ? -7.253  -0.176  -51.873 1.00 0.00 ? 84  PHE B CG   3 
ATOM 7511  C CD1  . PHE B 1 21 ? -6.078  0.528   -52.085 1.00 0.00 ? 84  PHE B CD1  3 
ATOM 7512  C CD2  . PHE B 1 21 ? -7.412  -0.857  -50.675 1.00 0.00 ? 84  PHE B CD2  3 
ATOM 7513  C CE1  . PHE B 1 21 ? -5.085  0.550   -51.125 1.00 0.00 ? 84  PHE B CE1  3 
ATOM 7514  C CE2  . PHE B 1 21 ? -6.421  -0.836  -49.713 1.00 0.00 ? 84  PHE B CE2  3 
ATOM 7515  C CZ   . PHE B 1 21 ? -5.258  -0.132  -49.936 1.00 0.00 ? 84  PHE B CZ   3 
ATOM 7516  H H    . PHE B 1 21 ? -6.649  0.593   -54.782 1.00 0.00 ? 84  PHE B H    3 
ATOM 7517  H HA   . PHE B 1 21 ? -7.760  -2.016  -53.868 1.00 0.00 ? 84  PHE B HA   3 
ATOM 7518  H HB2  . PHE B 1 21 ? -8.523  0.819   -53.243 1.00 0.00 ? 84  PHE B HB2  3 
ATOM 7519  H HB3  . PHE B 1 21 ? -9.246  -0.622  -52.503 1.00 0.00 ? 84  PHE B HB3  3 
ATOM 7520  H HD1  . PHE B 1 21 ? -5.935  1.055   -53.006 1.00 0.00 ? 84  PHE B HD1  3 
ATOM 7521  H HD2  . PHE B 1 21 ? -8.321  -1.413  -50.494 1.00 0.00 ? 84  PHE B HD2  3 
ATOM 7522  H HE1  . PHE B 1 21 ? -4.172  1.098   -51.304 1.00 0.00 ? 84  PHE B HE1  3 
ATOM 7523  H HE2  . PHE B 1 21 ? -6.558  -1.368  -48.783 1.00 0.00 ? 84  PHE B HE2  3 
ATOM 7524  H HZ   . PHE B 1 21 ? -4.376  -0.407  -49.376 1.00 0.00 ? 84  PHE B HZ   3 
ATOM 7525  N N    . SER B 1 22 ? -10.197 -1.686  -54.768 1.00 0.00 ? 85  SER B N    3 
ATOM 7526  C CA   . SER B 1 22 ? -11.441 -1.653  -55.529 1.00 0.00 ? 85  SER B CA   3 
ATOM 7527  C C    . SER B 1 22 ? -12.491 -0.796  -54.833 1.00 0.00 ? 85  SER B C    3 
ATOM 7528  O O    . SER B 1 22 ? -12.425 -0.580  -53.624 1.00 0.00 ? 85  SER B O    3 
ATOM 7529  C CB   . SER B 1 22 ? -11.973 -3.060  -55.725 1.00 0.00 ? 85  SER B CB   3 
ATOM 7530  O OG   . SER B 1 22 ? -11.116 -3.811  -56.542 1.00 0.00 ? 85  SER B OG   3 
ATOM 7531  H H    . SER B 1 22 ? -10.187 -2.156  -53.866 1.00 0.00 ? 85  SER B H    3 
ATOM 7532  H HA   . SER B 1 22 ? -11.215 -1.253  -56.507 1.00 0.00 ? 85  SER B HA   3 
ATOM 7533  H HB2  . SER B 1 22 ? -12.027 -3.543  -54.762 1.00 0.00 ? 85  SER B HB2  3 
ATOM 7534  H HB3  . SER B 1 22 ? -12.969 -3.026  -56.157 1.00 0.00 ? 85  SER B HB3  3 
ATOM 7535  H HG   . SER B 1 22 ? -10.221 -3.709  -56.209 1.00 0.00 ? 85  SER B HG   3 
ATOM 7536  N N    . PRO B 1 23 ? -13.458 -0.311  -55.606 1.00 0.00 ? 86  PRO B N    3 
ATOM 7537  C CA   . PRO B 1 23 ? -14.554 0.477   -55.055 1.00 0.00 ? 86  PRO B CA   3 
ATOM 7538  C C    . PRO B 1 23 ? -15.254 -0.266  -53.925 1.00 0.00 ? 86  PRO B C    3 
ATOM 7539  O O    . PRO B 1 23 ? -15.732 0.345   -52.970 1.00 0.00 ? 86  PRO B O    3 
ATOM 7540  C CB   . PRO B 1 23 ? -15.479 0.669   -56.261 1.00 0.00 ? 86  PRO B CB   3 
ATOM 7541  C CG   . PRO B 1 23 ? -14.565 0.606   -57.437 1.00 0.00 ? 86  PRO B CG   3 
ATOM 7542  C CD   . PRO B 1 23 ? -13.560 -0.454  -57.072 1.00 0.00 ? 86  PRO B CD   3 
ATOM 7543  H HA   . PRO B 1 23 ? -14.189 1.442   -54.710 1.00 0.00 ? 86  PRO B HA   3 
ATOM 7544  H HB2  . PRO B 1 23 ? -16.222 -0.133  -56.310 1.00 0.00 ? 86  PRO B HB2  3 
ATOM 7545  H HB3  . PRO B 1 23 ? -15.972 1.643   -56.219 1.00 0.00 ? 86  PRO B HB3  3 
ATOM 7546  H HG2  . PRO B 1 23 ? -15.122 0.328   -58.337 1.00 0.00 ? 86  PRO B HG2  3 
ATOM 7547  H HG3  . PRO B 1 23 ? -14.063 1.564   -57.582 1.00 0.00 ? 86  PRO B HG3  3 
ATOM 7548  H HD2  . PRO B 1 23 ? -13.938 -1.436  -57.360 1.00 0.00 ? 86  PRO B HD2  3 
ATOM 7549  H HD3  . PRO B 1 23 ? -12.618 -0.238  -57.562 1.00 0.00 ? 86  PRO B HD3  3 
ATOM 7550  N N    . GLU B 1 24 ? -15.310 -1.590  -54.039 1.00 0.00 ? 87  GLU B N    3 
ATOM 7551  C CA   . GLU B 1 24 ? -15.933 -2.422  -53.017 1.00 0.00 ? 87  GLU B CA   3 
ATOM 7552  C C    . GLU B 1 24 ? -15.008 -2.611  -51.821 1.00 0.00 ? 87  GLU B C    3 
ATOM 7553  O O    . GLU B 1 24 ? -15.458 -2.923  -50.719 1.00 0.00 ? 87  GLU B O    3 
ATOM 7554  C CB   . GLU B 1 24 ? -16.318 -3.783  -53.599 1.00 0.00 ? 87  GLU B CB   3 
ATOM 7555  C CG   . GLU B 1 24 ? -17.416 -3.730  -54.650 1.00 0.00 ? 87  GLU B CG   3 
ATOM 7556  C CD   . GLU B 1 24 ? -17.757 -5.085  -55.209 1.00 0.00 ? 87  GLU B CD   3 
ATOM 7557  O OE1  . GLU B 1 24 ? -17.086 -6.030  -54.874 1.00 0.00 ? 87  GLU B OE1  3 
ATOM 7558  O OE2  . GLU B 1 24 ? -18.689 -5.172  -55.973 1.00 0.00 ? 87  GLU B OE2  3 
ATOM 7559  H H    . GLU B 1 24 ? -14.891 -2.035  -54.855 1.00 0.00 ? 87  GLU B H    3 
ATOM 7560  H HA   . GLU B 1 24 ? -16.846 -1.932  -52.676 1.00 0.00 ? 87  GLU B HA   3 
ATOM 7561  H HB2  . GLU B 1 24 ? -15.432 -4.223  -54.057 1.00 0.00 ? 87  GLU B HB2  3 
ATOM 7562  H HB3  . GLU B 1 24 ? -16.653 -4.430  -52.788 1.00 0.00 ? 87  GLU B HB3  3 
ATOM 7563  H HG2  . GLU B 1 24 ? -18.309 -3.302  -54.193 1.00 0.00 ? 87  GLU B HG2  3 
ATOM 7564  H HG3  . GLU B 1 24 ? -17.085 -3.084  -55.463 1.00 0.00 ? 87  GLU B HG3  3 
ATOM 7565  N N    . GLU B 1 25 ? -13.714 -2.422  -52.047 1.00 0.00 ? 88  GLU B N    3 
ATOM 7566  C CA   . GLU B 1 25 ? -12.730 -2.496  -50.972 1.00 0.00 ? 88  GLU B CA   3 
ATOM 7567  C C    . GLU B 1 25 ? -12.607 -1.163  -50.245 1.00 0.00 ? 88  GLU B C    3 
ATOM 7568  O O    . GLU B 1 25 ? -12.077 -1.097  -49.136 1.00 0.00 ? 88  GLU B O    3 
ATOM 7569  C CB   . GLU B 1 25 ? -11.366 -2.916  -51.525 1.00 0.00 ? 88  GLU B CB   3 
ATOM 7570  C CG   . GLU B 1 25 ? -11.296 -4.362  -51.996 1.00 0.00 ? 88  GLU B CG   3 
ATOM 7571  C CD   . GLU B 1 25 ? -9.964  -4.715  -52.599 1.00 0.00 ? 88  GLU B CD   3 
ATOM 7572  O OE1  . GLU B 1 25 ? -9.269  -3.823  -53.021 1.00 0.00 ? 88  GLU B OE1  3 
ATOM 7573  O OE2  . GLU B 1 25 ? -9.645  -5.881  -52.637 1.00 0.00 ? 88  GLU B OE2  3 
ATOM 7574  H H    . GLU B 1 25 ? -13.403 -2.156  -52.981 1.00 0.00 ? 88  GLU B H    3 
ATOM 7575  H HA   . GLU B 1 25 ? -13.047 -3.260  -50.259 1.00 0.00 ? 88  GLU B HA   3 
ATOM 7576  H HB2  . GLU B 1 25 ? -11.154 -2.282  -52.380 1.00 0.00 ? 88  GLU B HB2  3 
ATOM 7577  H HB3  . GLU B 1 25 ? -10.608 -2.745  -50.775 1.00 0.00 ? 88  GLU B HB3  3 
ATOM 7578  H HG2  . GLU B 1 25 ? -11.460 -5.000  -51.127 1.00 0.00 ? 88  GLU B HG2  3 
ATOM 7579  H HG3  . GLU B 1 25 ? -12.086 -4.546  -52.717 1.00 0.00 ? 88  GLU B HG3  3 
ATOM 7580  N N    . LEU B 1 26 ? -13.097 -0.103  -50.877 1.00 0.00 ? 89  LEU B N    3 
ATOM 7581  C CA   . LEU B 1 26 ? -12.982 1.241   -50.322 1.00 0.00 ? 89  LEU B CA   3 
ATOM 7582  C C    . LEU B 1 26 ? -14.244 1.632   -49.563 1.00 0.00 ? 89  LEU B C    3 
ATOM 7583  O O    . LEU B 1 26 ? -15.268 1.959   -50.164 1.00 0.00 ? 89  LEU B O    3 
ATOM 7584  C CB   . LEU B 1 26 ? -12.717 2.255   -51.442 1.00 0.00 ? 89  LEU B CB   3 
ATOM 7585  C CG   . LEU B 1 26 ? -11.241 2.538   -51.746 1.00 0.00 ? 89  LEU B CG   3 
ATOM 7586  C CD1  . LEU B 1 26 ? -10.369 1.507   -51.041 1.00 0.00 ? 89  LEU B CD1  3 
ATOM 7587  C CD2  . LEU B 1 26 ? -11.016 2.507   -53.250 1.00 0.00 ? 89  LEU B CD2  3 
ATOM 7588  H H    . LEU B 1 26 ? -13.519 -0.225  -51.798 1.00 0.00 ? 89  LEU B H    3 
ATOM 7589  H HA   . LEU B 1 26 ? -12.203 1.279   -49.601 1.00 0.00 ? 89  LEU B HA   3 
ATOM 7590  H HB2  . LEU B 1 26 ? -13.191 1.852   -52.336 1.00 0.00 ? 89  LEU B HB2  3 
ATOM 7591  H HB3  . LEU B 1 26 ? -13.212 3.197   -51.208 1.00 0.00 ? 89  LEU B HB3  3 
ATOM 7592  H HG   . LEU B 1 26 ? -10.980 3.535   -51.376 1.00 0.00 ? 89  LEU B HG   3 
ATOM 7593  H HD11 . LEU B 1 26 ? -9.388  1.567   -51.443 1.00 0.00 ? 89  LEU B HD11 3 
ATOM 7594  H HD12 . LEU B 1 26 ? -10.753 0.499   -51.173 1.00 0.00 ? 89  LEU B HD12 3 
ATOM 7595  H HD13 . LEU B 1 26 ? -10.300 1.753   -49.995 1.00 0.00 ? 89  LEU B HD13 3 
ATOM 7596  H HD21 . LEU B 1 26 ? -11.814 3.047   -53.757 1.00 0.00 ? 89  LEU B HD21 3 
ATOM 7597  H HD22 . LEU B 1 26 ? -11.013 1.472   -53.590 1.00 0.00 ? 89  LEU B HD22 3 
ATOM 7598  H HD23 . LEU B 1 26 ? -10.070 2.965   -53.494 1.00 0.00 ? 89  LEU B HD23 3 
ATOM 7599  N N    . LYS B 1 27 ? -14.164 1.598   -48.236 1.00 0.00 ? 90  LYS B N    3 
ATOM 7600  C CA   . LYS B 1 27 ? -15.243 2.096   -47.392 1.00 0.00 ? 90  LYS B CA   3 
ATOM 7601  C C    . LYS B 1 27 ? -14.993 3.537   -46.968 1.00 0.00 ? 90  LYS B C    3 
ATOM 7602  O O    . LYS B 1 27 ? -14.723 3.812   -45.797 1.00 0.00 ? 90  LYS B O    3 
ATOM 7603  C CB   . LYS B 1 27 ? -15.410 1.206   -46.161 1.00 0.00 ? 90  LYS B CB   3 
ATOM 7604  C CG   . LYS B 1 27 ? -15.844 -0.221  -46.468 1.00 0.00 ? 90  LYS B CG   3 
ATOM 7605  C CD   . LYS B 1 27 ? -15.945 -1.056  -45.200 1.00 0.00 ? 90  LYS B CD   3 
ATOM 7606  C CE   . LYS B 1 27 ? -16.352 -2.489  -45.509 1.00 0.00 ? 90  LYS B CE   3 
ATOM 7607  N NZ   . LYS B 1 27 ? -16.421 -3.325  -44.280 1.00 0.00 ? 90  LYS B NZ   3 
ATOM 7608  H H    . LYS B 1 27 ? -13.276 1.346   -47.802 1.00 0.00 ? 90  LYS B H    3 
ATOM 7609  H HA   . LYS B 1 27 ? -16.180 2.059   -47.955 1.00 0.00 ? 90  LYS B HA   3 
ATOM 7610  H HB2  . LYS B 1 27 ? -14.447 1.130   -45.688 1.00 0.00 ? 90  LYS B HB2  3 
ATOM 7611  H HB3  . LYS B 1 27 ? -16.108 1.658   -45.479 1.00 0.00 ? 90  LYS B HB3  3 
ATOM 7612  H HG2  . LYS B 1 27 ? -16.822 -0.187  -46.949 1.00 0.00 ? 90  LYS B HG2  3 
ATOM 7613  H HG3  . LYS B 1 27 ? -15.125 -0.683  -47.144 1.00 0.00 ? 90  LYS B HG3  3 
ATOM 7614  H HD2  . LYS B 1 27 ? -14.974 -1.060  -44.704 1.00 0.00 ? 90  LYS B HD2  3 
ATOM 7615  H HD3  . LYS B 1 27 ? -16.686 -0.611  -44.536 1.00 0.00 ? 90  LYS B HD3  3 
ATOM 7616  H HE2  . LYS B 1 27 ? -17.332 -2.481  -45.988 1.00 0.00 ? 90  LYS B HE2  3 
ATOM 7617  H HE3  . LYS B 1 27 ? -15.623 -2.921  -46.196 1.00 0.00 ? 90  LYS B HE3  3 
ATOM 7618  H HZ1  . LYS B 1 27 ? -17.198 -2.987  -43.678 1.00 0.00 ? 90  LYS B HZ1  3 
ATOM 7619  H HZ2  . LYS B 1 27 ? -15.522 -3.247  -43.763 1.00 0.00 ? 90  LYS B HZ2  3 
ATOM 7620  H HZ3  . LYS B 1 27 ? -16.583 -4.289  -44.534 1.00 0.00 ? 90  LYS B HZ3  3 
ATOM 7621  N N    . VAL B 1 28 ? -15.080 4.454   -47.924 1.00 0.00 ? 91  VAL B N    3 
ATOM 7622  C CA   . VAL B 1 28 ? -14.792 5.861   -47.667 1.00 0.00 ? 91  VAL B CA   3 
ATOM 7623  C C    . VAL B 1 28 ? -15.911 6.512   -46.864 1.00 0.00 ? 91  VAL B C    3 
ATOM 7624  O O    . VAL B 1 28 ? -17.007 6.733   -47.374 1.00 0.00 ? 91  VAL B O    3 
ATOM 7625  C CB   . VAL B 1 28 ? -14.607 6.619   -48.994 1.00 0.00 ? 91  VAL B CB   3 
ATOM 7626  C CG1  . VAL B 1 28 ? -14.324 8.091   -48.730 1.00 0.00 ? 91  VAL B CG1  3 
ATOM 7627  C CG2  . VAL B 1 28 ? -13.480 5.990   -49.798 1.00 0.00 ? 91  VAL B CG2  3 
ATOM 7628  H H    . VAL B 1 28 ? -15.300 4.158   -48.875 1.00 0.00 ? 91  VAL B H    3 
ATOM 7629  H HA   . VAL B 1 28 ? -13.871 5.936   -47.105 1.00 0.00 ? 91  VAL B HA   3 
ATOM 7630  H HB   . VAL B 1 28 ? -15.533 6.543   -49.567 1.00 0.00 ? 91  VAL B HB   3 
ATOM 7631  H HG11 . VAL B 1 28 ? -13.535 8.173   -47.980 1.00 0.00 ? 91  VAL B HG11 3 
ATOM 7632  H HG12 . VAL B 1 28 ? -15.225 8.582   -48.364 1.00 0.00 ? 91  VAL B HG12 3 
ATOM 7633  H HG13 . VAL B 1 28 ? -13.998 8.571   -49.651 1.00 0.00 ? 91  VAL B HG13 3 
ATOM 7634  H HG21 . VAL B 1 28 ? -12.536 6.228   -49.334 1.00 0.00 ? 91  VAL B HG21 3 
ATOM 7635  H HG22 . VAL B 1 28 ? -13.494 6.374   -50.817 1.00 0.00 ? 91  VAL B HG22 3 
ATOM 7636  H HG23 . VAL B 1 28 ? -13.610 4.915   -49.812 1.00 0.00 ? 91  VAL B HG23 3 
ATOM 7637  N N    . LYS B 1 29 ? -15.625 6.820   -45.601 1.00 0.00 ? 92  LYS B N    3 
ATOM 7638  C CA   . LYS B 1 29 ? -16.656 7.260   -44.669 1.00 0.00 ? 92  LYS B CA   3 
ATOM 7639  C C    . LYS B 1 29 ? -16.295 8.599   -44.042 1.00 0.00 ? 92  LYS B C    3 
ATOM 7640  O O    . LYS B 1 29 ? -15.147 9.041   -44.115 1.00 0.00 ? 92  LYS B O    3 
ATOM 7641  C CB   . LYS B 1 29 ? -16.872 6.209   -43.578 1.00 0.00 ? 92  LYS B CB   3 
ATOM 7642  C CG   . LYS B 1 29 ? -17.495 4.909   -44.072 1.00 0.00 ? 92  LYS B CG   3 
ATOM 7643  C CD   . LYS B 1 29 ? -17.734 3.940   -42.924 1.00 0.00 ? 92  LYS B CD   3 
ATOM 7644  C CE   . LYS B 1 29 ? -18.378 2.651   -43.411 1.00 0.00 ? 92  LYS B CE   3 
ATOM 7645  N NZ   . LYS B 1 29 ? -18.658 1.710   -42.294 1.00 0.00 ? 92  LYS B NZ   3 
ATOM 7646  H H    . LYS B 1 29 ? -14.704 6.588   -45.232 1.00 0.00 ? 92  LYS B H    3 
ATOM 7647  H HA   . LYS B 1 29 ? -17.603 7.380   -45.198 1.00 0.00 ? 92  LYS B HA   3 
ATOM 7648  H HB2  . LYS B 1 29 ? -15.905 5.977   -43.134 1.00 0.00 ? 92  LYS B HB2  3 
ATOM 7649  H HB3  . LYS B 1 29 ? -17.519 6.632   -42.807 1.00 0.00 ? 92  LYS B HB3  3 
ATOM 7650  H HG2  . LYS B 1 29 ? -18.448 5.132   -44.554 1.00 0.00 ? 92  LYS B HG2  3 
ATOM 7651  H HG3  . LYS B 1 29 ? -16.823 4.447   -44.796 1.00 0.00 ? 92  LYS B HG3  3 
ATOM 7652  H HD2  . LYS B 1 29 ? -16.780 3.700   -42.457 1.00 0.00 ? 92  LYS B HD2  3 
ATOM 7653  H HD3  . LYS B 1 29 ? -18.386 4.413   -42.189 1.00 0.00 ? 92  LYS B HD3  3 
ATOM 7654  H HE2  . LYS B 1 29 ? -19.321 2.897   -43.900 1.00 0.00 ? 92  LYS B HE2  3 
ATOM 7655  H HE3  . LYS B 1 29 ? -17.728 2.174   -44.124 1.00 0.00 ? 92  LYS B HE3  3 
ATOM 7656  H HZ1  . LYS B 1 29 ? -19.081 2.232   -41.502 1.00 0.00 ? 92  LYS B HZ1  3 
ATOM 7657  H HZ2  . LYS B 1 29 ? -17.765 1.275   -41.985 1.00 0.00 ? 92  LYS B HZ2  3 
ATOM 7658  H HZ3  . LYS B 1 29 ? -19.295 0.991   -42.607 1.00 0.00 ? 92  LYS B HZ3  3 
ATOM 7659  N N    . VAL B 1 30 ? -17.279 9.241   -43.422 1.00 0.00 ? 93  VAL B N    3 
ATOM 7660  C CA   . VAL B 1 30 ? -17.024 10.405  -42.581 1.00 0.00 ? 93  VAL B CA   3 
ATOM 7661  C C    . VAL B 1 30 ? -17.642 10.236  -41.201 1.00 0.00 ? 93  VAL B C    3 
ATOM 7662  O O    . VAL B 1 30 ? -18.610 9.494   -41.031 1.00 0.00 ? 93  VAL B O    3 
ATOM 7663  C CB   . VAL B 1 30 ? -17.597 11.675  -43.243 1.00 0.00 ? 93  VAL B CB   3 
ATOM 7664  C CG1  . VAL B 1 30 ? -16.938 11.916  -44.594 1.00 0.00 ? 93  VAL B CG1  3 
ATOM 7665  C CG2  . VAL B 1 30 ? -19.104 11.545  -43.394 1.00 0.00 ? 93  VAL B CG2  3 
ATOM 7666  H H    . VAL B 1 30 ? -18.195 8.795   -43.376 1.00 0.00 ? 93  VAL B H    3 
ATOM 7667  H HA   . VAL B 1 30 ? -15.962 10.532  -42.441 1.00 0.00 ? 93  VAL B HA   3 
ATOM 7668  H HB   . VAL B 1 30 ? -17.390 12.523  -42.587 1.00 0.00 ? 93  VAL B HB   3 
ATOM 7669  H HG11 . VAL B 1 30 ? -17.637 11.678  -45.400 1.00 0.00 ? 93  VAL B HG11 3 
ATOM 7670  H HG12 . VAL B 1 30 ? -16.053 11.297  -44.712 1.00 0.00 ? 93  VAL B HG12 3 
ATOM 7671  H HG13 . VAL B 1 30 ? -16.660 12.961  -44.673 1.00 0.00 ? 93  VAL B HG13 3 
ATOM 7672  H HG21 . VAL B 1 30 ? -19.482 12.362  -44.008 1.00 0.00 ? 93  VAL B HG21 3 
ATOM 7673  H HG22 . VAL B 1 30 ? -19.575 11.583  -42.411 1.00 0.00 ? 93  VAL B HG22 3 
ATOM 7674  H HG23 . VAL B 1 30 ? -19.338 10.594  -43.870 1.00 0.00 ? 93  VAL B HG23 3 
ATOM 7675  N N    . LEU B 1 31 ? -17.075 10.923  -40.214 1.00 0.00 ? 94  LEU B N    3 
ATOM 7676  C CA   . LEU B 1 31 ? -17.596 10.882  -38.854 1.00 0.00 ? 94  LEU B CA   3 
ATOM 7677  C C    . LEU B 1 31 ? -17.828 12.286  -38.311 1.00 0.00 ? 94  LEU B C    3 
ATOM 7678  O O    . LEU B 1 31 ? -17.149 12.725  -37.382 1.00 0.00 ? 94  LEU B O    3 
ATOM 7679  C CB   . LEU B 1 31 ? -16.623 10.127  -37.938 1.00 0.00 ? 94  LEU B CB   3 
ATOM 7680  C CG   . LEU B 1 31 ? -16.385 8.655   -38.290 1.00 0.00 ? 94  LEU B CG   3 
ATOM 7681  C CD1  . LEU B 1 31 ? -15.235 8.111   -37.453 1.00 0.00 ? 94  LEU B CD1  3 
ATOM 7682  C CD2  . LEU B 1 31 ? -17.659 7.861   -38.047 1.00 0.00 ? 94  LEU B CD2  3 
ATOM 7683  H H    . LEU B 1 31 ? -16.278 11.525  -40.423 1.00 0.00 ? 94  LEU B H    3 
ATOM 7684  H HA   . LEU B 1 31 ? -18.555 10.364  -38.841 1.00 0.00 ? 94  LEU B HA   3 
ATOM 7685  H HB2  . LEU B 1 31 ? -15.685 10.623  -37.932 1.00 0.00 ? 94  LEU B HB2  3 
ATOM 7686  H HB3  . LEU B 1 31 ? -17.026 10.165  -36.927 1.00 0.00 ? 94  LEU B HB3  3 
ATOM 7687  H HG   . LEU B 1 31 ? -16.120 8.594   -39.347 1.00 0.00 ? 94  LEU B HG   3 
ATOM 7688  H HD11 . LEU B 1 31 ? -15.165 7.030   -37.579 1.00 0.00 ? 94  LEU B HD11 3 
ATOM 7689  H HD12 . LEU B 1 31 ? -15.406 8.343   -36.401 1.00 0.00 ? 94  LEU B HD12 3 
ATOM 7690  H HD13 . LEU B 1 31 ? -14.304 8.571   -37.779 1.00 0.00 ? 94  LEU B HD13 3 
ATOM 7691  H HD21 . LEU B 1 31 ? -18.085 8.126   -37.079 1.00 0.00 ? 94  LEU B HD21 3 
ATOM 7692  H HD22 . LEU B 1 31 ? -17.426 6.796   -38.056 1.00 0.00 ? 94  LEU B HD22 3 
ATOM 7693  H HD23 . LEU B 1 31 ? -18.386 8.069   -38.830 1.00 0.00 ? 94  LEU B HD23 3 
ATOM 7694  N N    . GLY B 1 32 ? -18.796 12.988  -38.895 1.00 0.00 ? 95  GLY B N    3 
ATOM 7695  C CA   . GLY B 1 32 ? -19.148 14.329  -38.444 1.00 0.00 ? 95  GLY B CA   3 
ATOM 7696  C C    . GLY B 1 32 ? -18.376 15.390  -39.216 1.00 0.00 ? 95  GLY B C    3 
ATOM 7697  O O    . GLY B 1 32 ? -18.804 15.831  -40.281 1.00 0.00 ? 95  GLY B O    3 
ATOM 7698  H H    . GLY B 1 32 ? -19.331 12.562  -39.652 1.00 0.00 ? 95  GLY B H    3 
ATOM 7699  H HA2  . GLY B 1 32 ? -20.214 14.488  -38.598 1.00 0.00 ? 95  GLY B HA2  3 
ATOM 7700  H HA3  . GLY B 1 32 ? -18.927 14.432  -37.378 1.00 0.00 ? 95  GLY B HA3  3 
ATOM 7701  N N    . ASP B 1 33 ? -17.233 15.797  -38.672 1.00 0.00 ? 96  ASP B N    3 
ATOM 7702  C CA   . ASP B 1 33 ? -16.374 16.772  -39.333 1.00 0.00 ? 96  ASP B CA   3 
ATOM 7703  C C    . ASP B 1 33 ? -15.029 16.160  -39.702 1.00 0.00 ? 96  ASP B C    3 
ATOM 7704  O O    . ASP B 1 33 ? -14.035 16.870  -39.861 1.00 0.00 ? 96  ASP B O    3 
ATOM 7705  C CB   . ASP B 1 33 ? -16.155 17.992  -38.434 1.00 0.00 ? 96  ASP B CB   3 
ATOM 7706  C CG   . ASP B 1 33 ? -15.469 17.644  -37.120 1.00 0.00 ? 96  ASP B CG   3 
ATOM 7707  O OD1  . ASP B 1 33 ? -15.364 16.479  -36.816 1.00 0.00 ? 96  ASP B OD1  3 
ATOM 7708  O OD2  . ASP B 1 33 ? -15.059 18.546  -36.430 1.00 0.00 ? 96  ASP B OD2  3 
ATOM 7709  H H    . ASP B 1 33 ? -16.931 15.385  -37.789 1.00 0.00 ? 96  ASP B H    3 
ATOM 7710  H HA   . ASP B 1 33 ? -16.847 17.113  -40.258 1.00 0.00 ? 96  ASP B HA   3 
ATOM 7711  H HB2  . ASP B 1 33 ? -15.542 18.716  -38.967 1.00 0.00 ? 96  ASP B HB2  3 
ATOM 7712  H HB3  . ASP B 1 33 ? -17.124 18.442  -38.215 1.00 0.00 ? 96  ASP B HB3  3 
ATOM 7713  N N    . VAL B 1 34 ? -15.005 14.838  -39.839 1.00 0.00 ? 97  VAL B N    3 
ATOM 7714  C CA   . VAL B 1 34 ? -13.801 14.135  -40.271 1.00 0.00 ? 97  VAL B CA   3 
ATOM 7715  C C    . VAL B 1 34 ? -14.118 13.122  -41.362 1.00 0.00 ? 97  VAL B C    3 
ATOM 7716  O O    . VAL B 1 34 ? -15.278 12.776  -41.586 1.00 0.00 ? 97  VAL B O    3 
ATOM 7717  C CB   . VAL B 1 34 ? -13.150 13.412  -39.078 1.00 0.00 ? 97  VAL B CB   3 
ATOM 7718  C CG1  . VAL B 1 34 ? -12.830 14.400  -37.964 1.00 0.00 ? 97  VAL B CG1  3 
ATOM 7719  C CG2  . VAL B 1 34 ? -14.071 12.311  -38.573 1.00 0.00 ? 97  VAL B CG2  3 
ATOM 7720  H H    . VAL B 1 34 ? -15.868 14.310  -39.709 1.00 0.00 ? 97  VAL B H    3 
ATOM 7721  H HA   . VAL B 1 34 ? -13.115 14.846  -40.687 1.00 0.00 ? 97  VAL B HA   3 
ATOM 7722  H HB   . VAL B 1 34 ? -12.228 12.975  -39.431 1.00 0.00 ? 97  VAL B HB   3 
ATOM 7723  H HG11 . VAL B 1 34 ? -12.282 15.249  -38.349 1.00 0.00 ? 97  VAL B HG11 3 
ATOM 7724  H HG12 . VAL B 1 34 ? -12.251 13.904  -37.185 1.00 0.00 ? 97  VAL B HG12 3 
ATOM 7725  H HG13 . VAL B 1 34 ? -13.772 14.749  -37.539 1.00 0.00 ? 97  VAL B HG13 3 
ATOM 7726  H HG21 . VAL B 1 34 ? -15.080 12.711  -38.496 1.00 0.00 ? 97  VAL B HG21 3 
ATOM 7727  H HG22 . VAL B 1 34 ? -14.055 11.478  -39.279 1.00 0.00 ? 97  VAL B HG22 3 
ATOM 7728  H HG23 . VAL B 1 34 ? -13.739 11.967  -37.593 1.00 0.00 ? 97  VAL B HG23 3 
ATOM 7729  N N    . ILE B 1 35 ? -13.078 12.650  -42.042 1.00 0.00 ? 98  ILE B N    3 
ATOM 7730  C CA   . ILE B 1 35 ? -13.250 11.759  -43.184 1.00 0.00 ? 98  ILE B CA   3 
ATOM 7731  C C    . ILE B 1 35 ? -12.521 10.439  -42.967 1.00 0.00 ? 98  ILE B C    3 
ATOM 7732  O O    . ILE B 1 35 ? -11.373 10.279  -43.378 1.00 0.00 ? 98  ILE B O    3 
ATOM 7733  C CB   . ILE B 1 35 ? -12.742 12.421  -44.478 1.00 0.00 ? 98  ILE B CB   3 
ATOM 7734  C CG1  . ILE B 1 35 ? -13.438 13.766  -44.698 1.00 0.00 ? 98  ILE B CG1  3 
ATOM 7735  C CG2  . ILE B 1 35 ? -12.967 11.502  -45.670 1.00 0.00 ? 98  ILE B CG2  3 
ATOM 7736  C CD1  . ILE B 1 35 ? -12.819 14.601  -45.797 1.00 0.00 ? 98  ILE B CD1  3 
ATOM 7737  H H    . ILE B 1 35 ? -12.145 12.989  -41.818 1.00 0.00 ? 98  ILE B H    3 
ATOM 7738  H HA   . ILE B 1 35 ? -14.290 11.546  -43.323 1.00 0.00 ? 98  ILE B HA   3 
ATOM 7739  H HB   . ILE B 1 35 ? -11.695 12.604  -44.378 1.00 0.00 ? 98  ILE B HB   3 
ATOM 7740  H HG12 . ILE B 1 35 ? -14.469 13.579  -44.963 1.00 0.00 ? 98  ILE B HG12 3 
ATOM 7741  H HG13 . ILE B 1 35 ? -13.411 14.322  -43.774 1.00 0.00 ? 98  ILE B HG13 3 
ATOM 7742  H HG21 . ILE B 1 35 ? -14.024 11.494  -45.925 1.00 0.00 ? 98  ILE B HG21 3 
ATOM 7743  H HG22 . ILE B 1 35 ? -12.646 10.487  -45.444 1.00 0.00 ? 98  ILE B HG22 3 
ATOM 7744  H HG23 . ILE B 1 35 ? -12.397 11.865  -46.515 1.00 0.00 ? 98  ILE B HG23 3 
ATOM 7745  H HD11 . ILE B 1 35 ? -11.750 14.698  -45.611 1.00 0.00 ? 98  ILE B HD11 3 
ATOM 7746  H HD12 . ILE B 1 35 ? -13.278 15.589  -45.807 1.00 0.00 ? 98  ILE B HD12 3 
ATOM 7747  H HD13 . ILE B 1 35 ? -12.979 14.114  -46.759 1.00 0.00 ? 98  ILE B HD13 3 
ATOM 7748  N N    . GLU B 1 36 ? -13.197 9.495   -42.322 1.00 0.00 ? 99  GLU B N    3 
ATOM 7749  C CA   . GLU B 1 36 ? -12.607 8.194   -42.032 1.00 0.00 ? 99  GLU B CA   3 
ATOM 7750  C C    . GLU B 1 36 ? -12.543 7.326   -43.282 1.00 0.00 ? 99  GLU B C    3 
ATOM 7751  O O    . GLU B 1 36 ? -13.507 6.639   -43.621 1.00 0.00 ? 99  GLU B O    3 
ATOM 7752  C CB   . GLU B 1 36 ? -13.407 7.476   -40.941 1.00 0.00 ? 99  GLU B CB   3 
ATOM 7753  C CG   . GLU B 1 36 ? -12.828 6.135   -40.514 1.00 0.00 ? 99  GLU B CG   3 
ATOM 7754  C CD   . GLU B 1 36 ? -13.695 5.412   -39.520 1.00 0.00 ? 99  GLU B CD   3 
ATOM 7755  O OE1  . GLU B 1 36 ? -14.862 5.251   -39.788 1.00 0.00 ? 99  GLU B OE1  3 
ATOM 7756  O OE2  . GLU B 1 36 ? -13.188 5.021   -38.497 1.00 0.00 ? 99  GLU B OE2  3 
ATOM 7757  H H    . GLU B 1 36 ? -14.149 9.690   -42.011 1.00 0.00 ? 99  GLU B H    3 
ATOM 7758  H HA   . GLU B 1 36 ? -11.597 8.318   -41.684 1.00 0.00 ? 99  GLU B HA   3 
ATOM 7759  H HB2  . GLU B 1 36 ? -13.454 8.123   -40.066 1.00 0.00 ? 99  GLU B HB2  3 
ATOM 7760  H HB3  . GLU B 1 36 ? -14.420 7.306   -41.309 1.00 0.00 ? 99  GLU B HB3  3 
ATOM 7761  H HG2  . GLU B 1 36 ? -12.712 5.508   -41.397 1.00 0.00 ? 99  GLU B HG2  3 
ATOM 7762  H HG3  . GLU B 1 36 ? -11.848 6.309   -40.070 1.00 0.00 ? 99  GLU B HG3  3 
ATOM 7763  N N    . VAL B 1 37 ? -11.406 7.363   -43.965 1.00 0.00 ? 100 VAL B N    3 
ATOM 7764  C CA   . VAL B 1 37 ? -11.204 6.558   -45.165 1.00 0.00 ? 100 VAL B CA   3 
ATOM 7765  C C    . VAL B 1 37 ? -10.819 5.129   -44.808 1.00 0.00 ? 100 VAL B C    3 
ATOM 7766  O O    . VAL B 1 37 ? -9.678  4.856   -44.432 1.00 0.00 ? 100 VAL B O    3 
ATOM 7767  C CB   . VAL B 1 37 ? -10.104 7.179   -46.045 1.00 0.00 ? 100 VAL B CB   3 
ATOM 7768  C CG1  . VAL B 1 37 ? -9.946  6.388   -47.336 1.00 0.00 ? 100 VAL B CG1  3 
ATOM 7769  C CG2  . VAL B 1 37 ? -10.436 8.632   -46.341 1.00 0.00 ? 100 VAL B CG2  3 
ATOM 7770  H H    . VAL B 1 37 ? -10.641 7.948   -43.624 1.00 0.00 ? 100 VAL B H    3 
ATOM 7771  H HA   . VAL B 1 37 ? -12.128 6.542   -45.732 1.00 0.00 ? 100 VAL B HA   3 
ATOM 7772  H HB   . VAL B 1 37 ? -9.177  7.130   -45.525 1.00 0.00 ? 100 VAL B HB   3 
ATOM 7773  H HG11 . VAL B 1 37 ? -10.924 6.175   -47.747 1.00 0.00 ? 100 VAL B HG11 3 
ATOM 7774  H HG12 . VAL B 1 37 ? -9.430  5.448   -47.132 1.00 0.00 ? 100 VAL B HG12 3 
ATOM 7775  H HG13 . VAL B 1 37 ? -9.367  6.968   -48.055 1.00 0.00 ? 100 VAL B HG13 3 
ATOM 7776  H HG21 . VAL B 1 37 ? -9.574  9.117   -46.799 1.00 0.00 ? 100 VAL B HG21 3 
ATOM 7777  H HG22 . VAL B 1 37 ? -10.688 9.147   -45.415 1.00 0.00 ? 100 VAL B HG22 3 
ATOM 7778  H HG23 . VAL B 1 37 ? -11.285 8.679   -47.024 1.00 0.00 ? 100 VAL B HG23 3 
ATOM 7779  N N    . HIS B 1 38 ? -11.777 4.215   -44.928 1.00 0.00 ? 101 HIS B N    3 
ATOM 7780  C CA   . HIS B 1 38 ? -11.590 2.843   -44.472 1.00 0.00 ? 101 HIS B CA   3 
ATOM 7781  C C    . HIS B 1 38 ? -11.324 1.906   -45.642 1.00 0.00 ? 101 HIS B C    3 
ATOM 7782  O O    . HIS B 1 38 ? -12.120 1.010   -45.926 1.00 0.00 ? 101 HIS B O    3 
ATOM 7783  C CB   . HIS B 1 38 ? -12.818 2.361   -43.691 1.00 0.00 ? 101 HIS B CB   3 
ATOM 7784  C CG   . HIS B 1 38 ? -12.713 0.942   -43.225 1.00 0.00 ? 101 HIS B CG   3 
ATOM 7785  N ND1  . HIS B 1 38 ? -13.642 0.368   -42.383 1.00 0.00 ? 101 HIS B ND1  3 
ATOM 7786  C CD2  . HIS B 1 38 ? -11.792 -0.015  -43.480 1.00 0.00 ? 101 HIS B CD2  3 
ATOM 7787  C CE1  . HIS B 1 38 ? -13.297 -0.886  -42.143 1.00 0.00 ? 101 HIS B CE1  3 
ATOM 7788  N NE2  . HIS B 1 38 ? -12.178 -1.142  -42.796 1.00 0.00 ? 101 HIS B NE2  3 
ATOM 7789  H H    . HIS B 1 38 ? -12.707 4.515   -45.224 1.00 0.00 ? 101 HIS B H    3 
ATOM 7790  H HA   . HIS B 1 38 ? -10.728 2.801   -43.813 1.00 0.00 ? 101 HIS B HA   3 
ATOM 7791  H HB2  . HIS B 1 38 ? -12.900 2.990   -42.804 1.00 0.00 ? 101 HIS B HB2  3 
ATOM 7792  H HB3  . HIS B 1 38 ? -13.704 2.495   -44.276 1.00 0.00 ? 101 HIS B HB3  3 
ATOM 7793  H HD2  . HIS B 1 38 ? -10.782 0.177   -43.812 1.00 0.00 ? 101 HIS B HD2  3 
ATOM 7794  H HE1  . HIS B 1 38 ? -13.840 -1.580  -41.517 1.00 0.00 ? 101 HIS B HE1  3 
ATOM 7795  H HE2  . HIS B 1 38 ? -11.685 -2.024  -42.792 1.00 0.00 ? 101 HIS B HE2  3 
ATOM 7796  N N    . GLY B 1 39 ? -10.201 2.115   -46.318 1.00 0.00 ? 102 GLY B N    3 
ATOM 7797  C CA   . GLY B 1 39 ? -9.783  1.235   -47.403 1.00 0.00 ? 102 GLY B CA   3 
ATOM 7798  C C    . GLY B 1 39 ? -9.212  -0.070  -46.864 1.00 0.00 ? 102 GLY B C    3 
ATOM 7799  O O    . GLY B 1 39 ? -8.698  -0.122  -45.747 1.00 0.00 ? 102 GLY B O    3 
ATOM 7800  H H    . GLY B 1 39 ? -9.576  2.862   -46.015 1.00 0.00 ? 102 GLY B H    3 
ATOM 7801  H HA2  . GLY B 1 39 ? -10.651 0.998   -47.995 1.00 0.00 ? 102 GLY B HA2  3 
ATOM 7802  H HA3  . GLY B 1 39 ? -9.039  1.742   -48.017 1.00 0.00 ? 102 GLY B HA3  3 
ATOM 7803  N N    . LYS B 1 40 ? -9.308  -1.126  -47.667 1.00 0.00 ? 103 LYS B N    3 
ATOM 7804  C CA   . LYS B 1 40 ? -8.982  -2.471  -47.204 1.00 0.00 ? 103 LYS B CA   3 
ATOM 7805  C C    . LYS B 1 40 ? -8.542  -3.358  -48.360 1.00 0.00 ? 103 LYS B C    3 
ATOM 7806  O O    . LYS B 1 40 ? -9.326  -3.661  -49.259 1.00 0.00 ? 103 LYS B O    3 
ATOM 7807  C CB   . LYS B 1 40 ? -10.181 -3.096  -46.489 1.00 0.00 ? 103 LYS B CB   3 
ATOM 7808  C CG   . LYS B 1 40 ? -9.949  -4.519  -45.999 1.00 0.00 ? 103 LYS B CG   3 
ATOM 7809  C CD   . LYS B 1 40 ? -11.113 -5.006  -45.146 1.00 0.00 ? 103 LYS B CD   3 
ATOM 7810  C CE   . LYS B 1 40 ? -10.881 -6.425  -44.649 1.00 0.00 ? 103 LYS B CE   3 
ATOM 7811  N NZ   . LYS B 1 40 ? -12.005 -6.911  -43.806 1.00 0.00 ? 103 LYS B NZ   3 
ATOM 7812  H H    . LYS B 1 40 ? -9.774  -1.017  -48.568 1.00 0.00 ? 103 LYS B H    3 
ATOM 7813  H HA   . LYS B 1 40 ? -8.155  -2.407  -46.527 1.00 0.00 ? 103 LYS B HA   3 
ATOM 7814  H HB2  . LYS B 1 40 ? -10.420 -2.482  -45.624 1.00 0.00 ? 103 LYS B HB2  3 
ATOM 7815  H HB3  . LYS B 1 40 ? -11.035 -3.087  -47.168 1.00 0.00 ? 103 LYS B HB3  3 
ATOM 7816  H HG2  . LYS B 1 40 ? -9.878  -5.165  -46.876 1.00 0.00 ? 103 LYS B HG2  3 
ATOM 7817  H HG3  . LYS B 1 40 ? -9.023  -4.579  -45.445 1.00 0.00 ? 103 LYS B HG3  3 
ATOM 7818  H HD2  . LYS B 1 40 ? -11.231 -4.341  -44.291 1.00 0.00 ? 103 LYS B HD2  3 
ATOM 7819  H HD3  . LYS B 1 40 ? -12.026 -4.987  -45.742 1.00 0.00 ? 103 LYS B HD3  3 
ATOM 7820  H HE2  . LYS B 1 40 ? -10.773 -7.088  -45.509 1.00 0.00 ? 103 LYS B HE2  3 
ATOM 7821  H HE3  . LYS B 1 40 ? -9.961  -6.448  -44.065 1.00 0.00 ? 103 LYS B HE3  3 
ATOM 7822  H HZ1  . LYS B 1 40 ? -12.069 -7.947  -43.863 1.00 0.00 ? 103 LYS B HZ1  3 
ATOM 7823  H HZ2  . LYS B 1 40 ? -12.893 -6.488  -44.148 1.00 0.00 ? 103 LYS B HZ2  3 
ATOM 7824  H HZ3  . LYS B 1 40 ? -11.849 -6.636  -42.846 1.00 0.00 ? 103 LYS B HZ3  3 
ATOM 7825  N N    . HIS B 1 41 ? -7.279  -3.774  -48.331 1.00 0.00 ? 104 HIS B N    3 
ATOM 7826  C CA   . HIS B 1 41 ? -6.849  -4.967  -49.052 1.00 0.00 ? 104 HIS B CA   3 
ATOM 7827  C C    . HIS B 1 41 ? -7.163  -6.232  -48.260 1.00 0.00 ? 104 HIS B C    3 
ATOM 7828  O O    . HIS B 1 41 ? -7.282  -6.195  -47.035 1.00 0.00 ? 104 HIS B O    3 
ATOM 7829  C CB   . HIS B 1 41 ? -5.349  -4.907  -49.353 1.00 0.00 ? 104 HIS B CB   3 
ATOM 7830  C CG   . HIS B 1 41 ? -5.009  -4.066  -50.547 1.00 0.00 ? 104 HIS B CG   3 
ATOM 7831  N ND1  . HIS B 1 41 ? -3.977  -3.150  -50.542 1.00 0.00 ? 104 HIS B ND1  3 
ATOM 7832  C CD2  . HIS B 1 41 ? -5.565  -4.004  -51.779 1.00 0.00 ? 104 HIS B CD2  3 
ATOM 7833  C CE1  . HIS B 1 41 ? -3.913  -2.561  -51.723 1.00 0.00 ? 104 HIS B CE1  3 
ATOM 7834  N NE2  . HIS B 1 41 ? -4.865  -3.061  -52.490 1.00 0.00 ? 104 HIS B NE2  3 
ATOM 7835  H H    . HIS B 1 41 ? -6.724  -3.517  -47.515 1.00 0.00 ? 104 HIS B H    3 
ATOM 7836  H HA   . HIS B 1 41 ? -7.399  -4.991  -49.999 1.00 0.00 ? 104 HIS B HA   3 
ATOM 7837  H HB2  . HIS B 1 41 ? -4.864  -4.508  -48.495 1.00 0.00 ? 104 HIS B HB2  3 
ATOM 7838  H HB3  . HIS B 1 41 ? -4.981  -5.920  -49.530 1.00 0.00 ? 104 HIS B HB3  3 
ATOM 7839  H HD1  . HIS B 1 41 ? -3.362  -2.960  -49.753 1.00 0.00 ? 104 HIS B HD1  3 
ATOM 7840  H HD2  . HIS B 1 41 ? -6.244  -4.733  -52.197 1.00 0.00 ? 104 HIS B HD2  3 
ATOM 7841  H HE1  . HIS B 1 41 ? -3.170  -1.839  -51.998 1.00 0.00 ? 104 HIS B HE1  3 
ATOM 7842  N N    . GLU B 1 42 ? -7.294  -7.348  -48.969 1.00 0.00 ? 105 GLU B N    3 
ATOM 7843  C CA   . GLU B 1 42 ? -7.389  -8.654  -48.328 1.00 0.00 ? 105 GLU B CA   3 
ATOM 7844  C C    . GLU B 1 42 ? -6.844  -9.753  -49.231 1.00 0.00 ? 105 GLU B C    3 
ATOM 7845  O O    . GLU B 1 42 ? -7.186  -9.824  -50.410 1.00 0.00 ? 105 GLU B O    3 
ATOM 7846  C CB   . GLU B 1 42 ? -8.841  -8.961  -47.954 1.00 0.00 ? 105 GLU B CB   3 
ATOM 7847  C CG   . GLU B 1 42 ? -9.043  -10.299 -47.256 1.00 0.00 ? 105 GLU B CG   3 
ATOM 7848  C CD   . GLU B 1 42 ? -10.460 -10.520 -46.811 1.00 0.00 ? 105 GLU B CD   3 
ATOM 7849  O OE1  . GLU B 1 42 ? -11.274 -9.652  -47.026 1.00 0.00 ? 105 GLU B OE1  3 
ATOM 7850  O OE2  . GLU B 1 42 ? -10.735 -11.558 -46.257 1.00 0.00 ? 105 GLU B OE2  3 
ATOM 7851  H H    . GLU B 1 42 ? -7.153  -7.312  -49.978 1.00 0.00 ? 105 GLU B H    3 
ATOM 7852  H HA   . GLU B 1 42 ? -6.810  -8.662  -47.421 1.00 0.00 ? 105 GLU B HA   3 
ATOM 7853  H HB2  . GLU B 1 42 ? -9.202  -8.174  -47.290 1.00 0.00 ? 105 GLU B HB2  3 
ATOM 7854  H HB3  . GLU B 1 42 ? -9.441  -8.959  -48.864 1.00 0.00 ? 105 GLU B HB3  3 
ATOM 7855  H HG2  . GLU B 1 42 ? -8.791  -11.068 -47.958 1.00 0.00 ? 105 GLU B HG2  3 
ATOM 7856  H HG3  . GLU B 1 42 ? -8.377  -10.353 -46.395 1.00 0.00 ? 105 GLU B HG3  3 
ATOM 7857  N N    . GLU B 1 43 ? -5.996  -10.607 -48.669 1.00 0.00 ? 106 GLU B N    3 
ATOM 7858  C CA   . GLU B 1 43 ? -5.329  -11.647 -49.445 1.00 0.00 ? 106 GLU B CA   3 
ATOM 7859  C C    . GLU B 1 43 ? -4.504  -11.044 -50.577 1.00 0.00 ? 106 GLU B C    3 
ATOM 7860  O O    . GLU B 1 43 ? -4.675  -11.407 -51.740 1.00 0.00 ? 106 GLU B O    3 
ATOM 7861  C CB   . GLU B 1 43 ? -6.355  -12.628 -50.015 1.00 0.00 ? 106 GLU B CB   3 
ATOM 7862  C CG   . GLU B 1 43 ? -7.115  -13.423 -48.963 1.00 0.00 ? 106 GLU B CG   3 
ATOM 7863  C CD   . GLU B 1 43 ? -8.019  -14.467 -49.559 1.00 0.00 ? 106 GLU B CD   3 
ATOM 7864  O OE1  . GLU B 1 43 ? -8.175  -14.477 -50.755 1.00 0.00 ? 106 GLU B OE1  3 
ATOM 7865  O OE2  . GLU B 1 43 ? -8.553  -15.254 -48.815 1.00 0.00 ? 106 GLU B OE2  3 
ATOM 7866  H H    . GLU B 1 43 ? -5.751  -10.485 -47.687 1.00 0.00 ? 106 GLU B H    3 
ATOM 7867  H HA   . GLU B 1 43 ? -4.681  -12.189 -48.778 1.00 0.00 ? 106 GLU B HA   3 
ATOM 7868  H HB2  . GLU B 1 43 ? -7.080  -12.082 -50.609 1.00 0.00 ? 106 GLU B HB2  3 
ATOM 7869  H HB3  . GLU B 1 43 ? -5.831  -13.329 -50.663 1.00 0.00 ? 106 GLU B HB3  3 
ATOM 7870  H HG2  . GLU B 1 43 ? -6.380  -13.931 -48.338 1.00 0.00 ? 106 GLU B HG2  3 
ATOM 7871  H HG3  . GLU B 1 43 ? -7.685  -12.760 -48.347 1.00 0.00 ? 106 GLU B HG3  3 
ATOM 7872  N N    . ARG B 1 44 ? -3.611  -10.124 -50.228 1.00 0.00 ? 107 ARG B N    3 
ATOM 7873  C CA   . ARG B 1 44 ? -2.835  -9.393  -51.222 1.00 0.00 ? 107 ARG B CA   3 
ATOM 7874  C C    . ARG B 1 44 ? -1.355  -9.735  -51.126 1.00 0.00 ? 107 ARG B C    3 
ATOM 7875  O O    . ARG B 1 44 ? -0.665  -9.297  -50.205 1.00 0.00 ? 107 ARG B O    3 
ATOM 7876  C CB   . ARG B 1 44 ? -3.020  -7.893  -51.048 1.00 0.00 ? 107 ARG B CB   3 
ATOM 7877  C CG   . ARG B 1 44 ? -2.235  -7.034  -52.025 1.00 0.00 ? 107 ARG B CG   3 
ATOM 7878  C CD   . ARG B 1 44 ? -1.873  -5.720  -51.435 1.00 0.00 ? 107 ARG B CD   3 
ATOM 7879  N NE   . ARG B 1 44 ? -1.385  -4.789  -52.442 1.00 0.00 ? 107 ARG B NE   3 
ATOM 7880  C CZ   . ARG B 1 44 ? -0.620  -3.712  -52.179 1.00 0.00 ? 107 ARG B CZ   3 
ATOM 7881  N NH1  . ARG B 1 44 ? -0.264  -3.443  -50.943 1.00 0.00 ? 107 ARG B NH1  3 
ATOM 7882  N NH2  . ARG B 1 44 ? -0.229  -2.925  -53.167 1.00 0.00 ? 107 ARG B NH2  3 
ATOM 7883  H H    . ARG B 1 44 ? -3.531  -9.858  -49.245 1.00 0.00 ? 107 ARG B H    3 
ATOM 7884  H HA   . ARG B 1 44 ? -3.175  -9.659  -52.226 1.00 0.00 ? 107 ARG B HA   3 
ATOM 7885  H HB2  . ARG B 1 44 ? -4.083  -7.682  -51.192 1.00 0.00 ? 107 ARG B HB2  3 
ATOM 7886  H HB3  . ARG B 1 44 ? -2.770  -7.634  -50.047 1.00 0.00 ? 107 ARG B HB3  3 
ATOM 7887  H HG2  . ARG B 1 44 ? -1.319  -7.545  -52.315 1.00 0.00 ? 107 ARG B HG2  3 
ATOM 7888  H HG3  . ARG B 1 44 ? -2.834  -6.853  -52.920 1.00 0.00 ? 107 ARG B HG3  3 
ATOM 7889  H HD2  . ARG B 1 44 ? -2.745  -5.295  -50.951 1.00 0.00 ? 107 ARG B HD2  3 
ATOM 7890  H HD3  . ARG B 1 44 ? -1.087  -5.875  -50.695 1.00 0.00 ? 107 ARG B HD3  3 
ATOM 7891  H HE   . ARG B 1 44 ? -1.632  -4.959  -53.376 1.00 0.00 ? 107 ARG B HE   3 
ATOM 7892  H HH11 . ARG B 1 44 ? -0.559  -4.037  -50.195 1.00 0.00 ? 107 ARG B HH11 3 
ATOM 7893  H HH12 . ARG B 1 44 ? 0.310   -2.635  -50.748 1.00 0.00 ? 107 ARG B HH12 3 
ATOM 7894  H HH21 . ARG B 1 44 ? -0.499  -3.127  -54.107 1.00 0.00 ? 107 ARG B HH21 3 
ATOM 7895  H HH22 . ARG B 1 44 ? 0.339   -2.126  -52.968 1.00 0.00 ? 107 ARG B HH22 3 
ATOM 7896  N N    . GLN B 1 45 ? -0.871  -10.521 -52.081 1.00 0.00 ? 108 GLN B N    3 
ATOM 7897  C CA   . GLN B 1 45 ? 0.537   -10.893 -52.125 1.00 0.00 ? 108 GLN B CA   3 
ATOM 7898  C C    . GLN B 1 45 ? 1.420   -9.684  -52.402 1.00 0.00 ? 108 GLN B C    3 
ATOM 7899  O O    . GLN B 1 45 ? 1.463   -9.176  -53.521 1.00 0.00 ? 108 GLN B O    3 
ATOM 7900  C CB   . GLN B 1 45 ? 0.774   -11.967 -53.192 1.00 0.00 ? 108 GLN B CB   3 
ATOM 7901  C CG   . GLN B 1 45 ? 2.230   -12.380 -53.348 1.00 0.00 ? 108 GLN B CG   3 
ATOM 7902  C CD   . GLN B 1 45 ? 2.764   -13.092 -52.121 1.00 0.00 ? 108 GLN B CD   3 
ATOM 7903  O OE1  . GLN B 1 45 ? 2.272   -14.159 -51.742 1.00 0.00 ? 108 GLN B OE1  3 
ATOM 7904  N NE2  . GLN B 1 45 ? 3.774   -12.504 -51.490 1.00 0.00 ? 108 GLN B NE2  3 
ATOM 7905  H H    . GLN B 1 45 ? -1.493  -10.841 -52.824 1.00 0.00 ? 108 GLN B H    3 
ATOM 7906  H HA   . GLN B 1 45 ? 0.810   -11.315 -51.167 1.00 0.00 ? 108 GLN B HA   3 
ATOM 7907  H HB2  . GLN B 1 45 ? 0.204   -12.849 -52.928 1.00 0.00 ? 108 GLN B HB2  3 
ATOM 7908  H HB3  . GLN B 1 45 ? 0.410   -11.588 -54.147 1.00 0.00 ? 108 GLN B HB3  3 
ATOM 7909  H HG2  . GLN B 1 45 ? 2.313   -13.056 -54.198 1.00 0.00 ? 108 GLN B HG2  3 
ATOM 7910  H HG3  . GLN B 1 45 ? 2.835   -11.498 -53.545 1.00 0.00 ? 108 GLN B HG3  3 
ATOM 7911  H HE21 . GLN B 1 45 ? 4.163   -11.626 -51.834 1.00 0.00 ? 108 GLN B HE21 3 
ATOM 7912  H HE22 . GLN B 1 45 ? 4.164   -12.942 -50.655 1.00 0.00 ? 108 GLN B HE22 3 
ATOM 7913  N N    . ASP B 1 46 ? 2.127   -9.226  -51.373 1.00 0.00 ? 109 ASP B N    3 
ATOM 7914  C CA   . ASP B 1 46 ? 3.070   -8.123  -51.520 1.00 0.00 ? 109 ASP B CA   3 
ATOM 7915  C C    . ASP B 1 46 ? 4.495   -8.575  -51.227 1.00 0.00 ? 109 ASP B C    3 
ATOM 7916  O O    . ASP B 1 46 ? 4.858   -9.721  -51.484 1.00 0.00 ? 109 ASP B O    3 
ATOM 7917  C CB   . ASP B 1 46 ? 2.691   -6.967  -50.590 1.00 0.00 ? 109 ASP B CB   3 
ATOM 7918  C CG   . ASP B 1 46 ? 2.853   -7.314  -49.117 1.00 0.00 ? 109 ASP B CG   3 
ATOM 7919  O OD1  . ASP B 1 46 ? 3.185   -8.440  -48.824 1.00 0.00 ? 109 ASP B OD1  3 
ATOM 7920  O OD2  . ASP B 1 46 ? 2.643   -6.451  -48.298 1.00 0.00 ? 109 ASP B OD2  3 
ATOM 7921  H H    . ASP B 1 46 ? 2.059   -9.704  -50.474 1.00 0.00 ? 109 ASP B H    3 
ATOM 7922  H HA   . ASP B 1 46 ? 3.045   -7.755  -52.549 1.00 0.00 ? 109 ASP B HA   3 
ATOM 7923  H HB2  . ASP B 1 46 ? 3.313   -6.104  -50.823 1.00 0.00 ? 109 ASP B HB2  3 
ATOM 7924  H HB3  . ASP B 1 46 ? 1.649   -6.706  -50.772 1.00 0.00 ? 109 ASP B HB3  3 
ATOM 7925  N N    . GLU B 1 47 ? 5.297   -7.664  -50.685 1.00 0.00 ? 110 GLU B N    3 
ATOM 7926  C CA   . GLU B 1 47 ? 6.699   -7.950  -50.403 1.00 0.00 ? 110 GLU B CA   3 
ATOM 7927  C C    . GLU B 1 47 ? 6.837   -9.002  -49.308 1.00 0.00 ? 110 GLU B C    3 
ATOM 7928  O O    . GLU B 1 47 ? 7.822   -9.738  -49.262 1.00 0.00 ? 110 GLU B O    3 
ATOM 7929  C CB   . GLU B 1 47 ? 7.432   -6.672  -49.991 1.00 0.00 ? 110 GLU B CB   3 
ATOM 7930  C CG   . GLU B 1 47 ? 6.774   -5.909  -48.850 1.00 0.00 ? 110 GLU B CG   3 
ATOM 7931  C CD   . GLU B 1 47 ? 5.777   -4.889  -49.328 1.00 0.00 ? 110 GLU B CD   3 
ATOM 7932  O OE1  . GLU B 1 47 ? 5.457   -4.899  -50.492 1.00 0.00 ? 110 GLU B OE1  3 
ATOM 7933  O OE2  . GLU B 1 47 ? 5.338   -4.099  -48.527 1.00 0.00 ? 110 GLU B OE2  3 
ATOM 7934  H H    . GLU B 1 47 ? 4.940   -6.728  -50.505 1.00 0.00 ? 110 GLU B H    3 
ATOM 7935  H HA   . GLU B 1 47 ? 7.159   -8.341  -51.310 1.00 0.00 ? 110 GLU B HA   3 
ATOM 7936  H HB2  . GLU B 1 47 ? 8.446   -6.949  -49.693 1.00 0.00 ? 110 GLU B HB2  3 
ATOM 7937  H HB3  . GLU B 1 47 ? 7.496   -6.016  -50.862 1.00 0.00 ? 110 GLU B HB3  3 
ATOM 7938  H HG2  . GLU B 1 47 ? 6.255   -6.623  -48.209 1.00 0.00 ? 110 GLU B HG2  3 
ATOM 7939  H HG3  . GLU B 1 47 ? 7.540   -5.400  -48.259 1.00 0.00 ? 110 GLU B HG3  3 
ATOM 7940  N N    . HIS B 1 48 ? 5.844   -9.065  -48.428 1.00 0.00 ? 111 HIS B N    3 
ATOM 7941  C CA   . HIS B 1 48 ? 5.878   -9.988  -47.299 1.00 0.00 ? 111 HIS B CA   3 
ATOM 7942  C C    . HIS B 1 48 ? 5.105   -11.264 -47.607 1.00 0.00 ? 111 HIS B C    3 
ATOM 7943  O O    . HIS B 1 48 ? 5.626   -12.367 -47.450 1.00 0.00 ? 111 HIS B O    3 
ATOM 7944  C CB   . HIS B 1 48 ? 5.302   -9.326  -46.043 1.00 0.00 ? 111 HIS B CB   3 
ATOM 7945  C CG   . HIS B 1 48 ? 6.117   -8.173  -45.542 1.00 0.00 ? 111 HIS B CG   3 
ATOM 7946  N ND1  . HIS B 1 48 ? 7.398   -8.323  -45.054 1.00 0.00 ? 111 HIS B ND1  3 
ATOM 7947  C CD2  . HIS B 1 48 ? 5.832   -6.854  -45.452 1.00 0.00 ? 111 HIS B CD2  3 
ATOM 7948  C CE1  . HIS B 1 48 ? 7.867   -7.144  -44.688 1.00 0.00 ? 111 HIS B CE1  3 
ATOM 7949  N NE2  . HIS B 1 48 ? 6.936   -6.236  -44.919 1.00 0.00 ? 111 HIS B NE2  3 
ATOM 7950  H H    . HIS B 1 48 ? 5.057   -8.423  -48.514 1.00 0.00 ? 111 HIS B H    3 
ATOM 7951  H HA   . HIS B 1 48 ? 6.913   -10.250 -47.087 1.00 0.00 ? 111 HIS B HA   3 
ATOM 7952  H HB2  . HIS B 1 48 ? 4.321   -8.934  -46.308 1.00 0.00 ? 111 HIS B HB2  3 
ATOM 7953  H HB3  . HIS B 1 48 ? 5.166   -10.056 -45.255 1.00 0.00 ? 111 HIS B HB3  3 
ATOM 7954  H HD2  . HIS B 1 48 ? 4.849   -6.418  -45.549 1.00 0.00 ? 111 HIS B HD2  3 
ATOM 7955  H HE1  . HIS B 1 48 ? 8.845   -6.958  -44.269 1.00 0.00 ? 111 HIS B HE1  3 
ATOM 7956  H HE2  . HIS B 1 48 ? 7.023   -5.247  -44.733 1.00 0.00 ? 111 HIS B HE2  3 
ATOM 7957  N N    . GLY B 1 49 ? 3.861   -11.106 -48.045 1.00 0.00 ? 112 GLY B N    3 
ATOM 7958  C CA   . GLY B 1 49 ? 2.924   -12.219 -48.106 1.00 0.00 ? 112 GLY B CA   3 
ATOM 7959  C C    . GLY B 1 49 ? 1.528   -11.744 -48.491 1.00 0.00 ? 112 GLY B C    3 
ATOM 7960  O O    . GLY B 1 49 ? 1.366   -10.671 -49.070 1.00 0.00 ? 112 GLY B O    3 
ATOM 7961  H H    . GLY B 1 49 ? 3.490   -10.158 -48.109 1.00 0.00 ? 112 GLY B H    3 
ATOM 7962  H HA2  . GLY B 1 49 ? 3.289   -12.887 -48.883 1.00 0.00 ? 112 GLY B HA2  3 
ATOM 7963  H HA3  . GLY B 1 49 ? 2.877   -12.746 -47.173 1.00 0.00 ? 112 GLY B HA3  3 
ATOM 7964  N N    . PHE B 1 50 ? 0.524   -12.552 -48.169 1.00 0.00 ? 113 PHE B N    3 
ATOM 7965  C CA   . PHE B 1 50 ? -0.864  -12.193 -48.437 1.00 0.00 ? 113 PHE B CA   3 
ATOM 7966  C C    . PHE B 1 50 ? -1.439  -11.333 -47.320 1.00 0.00 ? 113 PHE B C    3 
ATOM 7967  O O    . PHE B 1 50 ? -1.886  -11.848 -46.295 1.00 0.00 ? 113 PHE B O    3 
ATOM 7968  C CB   . PHE B 1 50 ? -1.717  -13.452 -48.607 1.00 0.00 ? 113 PHE B CB   3 
ATOM 7969  C CG   . PHE B 1 50 ? -1.478  -14.176 -49.902 1.00 0.00 ? 113 PHE B CG   3 
ATOM 7970  C CD1  . PHE B 1 50 ? -2.017  -13.705 -51.089 1.00 0.00 ? 113 PHE B CD1  3 
ATOM 7971  C CD2  . PHE B 1 50 ? -0.709  -15.331 -49.934 1.00 0.00 ? 113 PHE B CD2  3 
ATOM 7972  C CE1  . PHE B 1 50 ? -1.796  -14.371 -52.278 1.00 0.00 ? 113 PHE B CE1  3 
ATOM 7973  C CE2  . PHE B 1 50 ? -0.487  -15.998 -51.125 1.00 0.00 ? 113 PHE B CE2  3 
ATOM 7974  C CZ   . PHE B 1 50 ? -1.030  -15.517 -52.296 1.00 0.00 ? 113 PHE B CZ   3 
ATOM 7975  H H    . PHE B 1 50 ? 0.727   -13.435 -47.700 1.00 0.00 ? 113 PHE B H    3 
ATOM 7976  H HA   . PHE B 1 50 ? -0.906  -11.630 -49.367 1.00 0.00 ? 113 PHE B HA   3 
ATOM 7977  H HB2  . PHE B 1 50 ? -1.535  -14.127 -47.801 1.00 0.00 ? 113 PHE B HB2  3 
ATOM 7978  H HB3  . PHE B 1 50 ? -2.757  -13.173 -48.578 1.00 0.00 ? 113 PHE B HB3  3 
ATOM 7979  H HD1  . PHE B 1 50 ? -2.616  -12.809 -51.080 1.00 0.00 ? 113 PHE B HD1  3 
ATOM 7980  H HD2  . PHE B 1 50 ? -0.277  -15.703 -49.021 1.00 0.00 ? 113 PHE B HD2  3 
ATOM 7981  H HE1  . PHE B 1 50 ? -2.224  -13.993 -53.197 1.00 0.00 ? 113 PHE B HE1  3 
ATOM 7982  H HE2  . PHE B 1 50 ? 0.113   -16.897 -51.136 1.00 0.00 ? 113 PHE B HE2  3 
ATOM 7983  H HZ   . PHE B 1 50 ? -0.811  -16.007 -53.235 1.00 0.00 ? 113 PHE B HZ   3 
ATOM 7984  N N    . ILE B 1 51 ? -1.421  -10.021 -47.522 1.00 0.00 ? 114 ILE B N    3 
ATOM 7985  C CA   . ILE B 1 51 ? -1.793  -9.077  -46.473 1.00 0.00 ? 114 ILE B CA   3 
ATOM 7986  C C    . ILE B 1 51 ? -3.289  -8.789  -46.497 1.00 0.00 ? 114 ILE B C    3 
ATOM 7987  O O    . ILE B 1 51 ? -3.973  -9.089  -47.476 1.00 0.00 ? 114 ILE B O    3 
ATOM 7988  C CB   . ILE B 1 51 ? -1.013  -7.759  -46.619 1.00 0.00 ? 114 ILE B CB   3 
ATOM 7989  C CG1  . ILE B 1 51 ? -1.486  -6.991  -47.855 1.00 0.00 ? 114 ILE B CG1  3 
ATOM 7990  C CG2  . ILE B 1 51 ? 0.481   -8.030  -46.694 1.00 0.00 ? 114 ILE B CG2  3 
ATOM 7991  C CD1  . ILE B 1 51 ? -0.976  -5.569  -47.924 1.00 0.00 ? 114 ILE B CD1  3 
ATOM 7992  H H    . ILE B 1 51 ? -1.017  -9.655  -48.384 1.00 0.00 ? 114 ILE B H    3 
ATOM 7993  H HA   . ILE B 1 51 ? -1.574  -9.502  -45.508 1.00 0.00 ? 114 ILE B HA   3 
ATOM 7994  H HB   . ILE B 1 51 ? -1.203  -7.148  -45.735 1.00 0.00 ? 114 ILE B HB   3 
ATOM 7995  H HG12 . ILE B 1 51 ? -1.123  -7.517  -48.726 1.00 0.00 ? 114 ILE B HG12 3 
ATOM 7996  H HG13 . ILE B 1 51 ? -2.572  -6.957  -47.880 1.00 0.00 ? 114 ILE B HG13 3 
ATOM 7997  H HG21 . ILE B 1 51 ? 0.730   -8.377  -47.696 1.00 0.00 ? 114 ILE B HG21 3 
ATOM 7998  H HG22 . ILE B 1 51 ? 0.780   -8.774  -45.993 1.00 0.00 ? 114 ILE B HG22 3 
ATOM 7999  H HG23 . ILE B 1 51 ? 1.026   -7.106  -46.500 1.00 0.00 ? 114 ILE B HG23 3 
ATOM 8000  H HD11 . ILE B 1 51 ? -0.977  -5.146  -46.922 1.00 0.00 ? 114 ILE B HD11 3 
ATOM 8001  H HD12 . ILE B 1 51 ? -1.626  -4.979  -48.570 1.00 0.00 ? 114 ILE B HD12 3 
ATOM 8002  H HD13 . ILE B 1 51 ? 0.038   -5.563  -48.322 1.00 0.00 ? 114 ILE B HD13 3 
ATOM 8003  N N    . SER B 1 52 ? -3.792  -8.205  -45.413 1.00 0.00 ? 115 SER B N    3 
ATOM 8004  C CA   . SER B 1 52 ? -5.110  -7.585  -45.420 1.00 0.00 ? 115 SER B CA   3 
ATOM 8005  C C    . SER B 1 52 ? -5.123  -6.311  -44.584 1.00 0.00 ? 115 SER B C    3 
ATOM 8006  O O    . SER B 1 52 ? -5.360  -6.351  -43.377 1.00 0.00 ? 115 SER B O    3 
ATOM 8007  C CB   . SER B 1 52 ? -6.147  -8.557  -44.893 1.00 0.00 ? 115 SER B CB   3 
ATOM 8008  O OG   . SER B 1 52 ? -7.438  -8.018  -44.991 1.00 0.00 ? 115 SER B OG   3 
ATOM 8009  H H    . SER B 1 52 ? -3.147  -7.949  -44.666 1.00 0.00 ? 115 SER B H    3 
ATOM 8010  H HA   . SER B 1 52 ? -5.371  -7.313  -46.434 1.00 0.00 ? 115 SER B HA   3 
ATOM 8011  H HB2  . SER B 1 52 ? -6.095  -9.503  -45.419 1.00 0.00 ? 115 SER B HB2  3 
ATOM 8012  H HB3  . SER B 1 52 ? -5.945  -8.720  -43.840 1.00 0.00 ? 115 SER B HB3  3 
ATOM 8013  H HG   . SER B 1 52 ? -7.348  -7.068  -45.103 1.00 0.00 ? 115 SER B HG   3 
ATOM 8014  N N    . ARG B 1 53 ? -4.865  -5.182  -45.235 1.00 0.00 ? 116 ARG B N    3 
ATOM 8015  C CA   . ARG B 1 53 ? -4.522  -3.953  -44.529 1.00 0.00 ? 116 ARG B CA   3 
ATOM 8016  C C    . ARG B 1 53 ? -5.657  -2.940  -44.601 1.00 0.00 ? 116 ARG B C    3 
ATOM 8017  O O    . ARG B 1 53 ? -5.590  -1.969  -45.354 1.00 0.00 ? 116 ARG B O    3 
ATOM 8018  C CB   . ARG B 1 53 ? -3.259  -3.336  -45.110 1.00 0.00 ? 116 ARG B CB   3 
ATOM 8019  C CG   . ARG B 1 53 ? -3.401  -2.802  -46.527 1.00 0.00 ? 116 ARG B CG   3 
ATOM 8020  C CD   . ARG B 1 53 ? -2.153  -2.147  -46.995 1.00 0.00 ? 116 ARG B CD   3 
ATOM 8021  N NE   . ARG B 1 53 ? -2.285  -1.631  -48.348 1.00 0.00 ? 116 ARG B NE   3 
ATOM 8022  C CZ   . ARG B 1 53 ? -1.478  -0.700  -48.893 1.00 0.00 ? 116 ARG B CZ   3 
ATOM 8023  N NH1  . ARG B 1 53 ? -0.490  -0.194  -48.193 1.00 0.00 ? 116 ARG B NH1  3 
ATOM 8024  N NH2  . ARG B 1 53 ? -1.683  -0.294  -50.135 1.00 0.00 ? 116 ARG B NH2  3 
ATOM 8025  H H    . ARG B 1 53 ? -4.637  -5.244  -46.227 1.00 0.00 ? 116 ARG B H    3 
ATOM 8026  H HA   . ARG B 1 53 ? -4.335  -4.170  -43.485 1.00 0.00 ? 116 ARG B HA   3 
ATOM 8027  H HB2  . ARG B 1 53 ? -2.929  -2.525  -44.469 1.00 0.00 ? 116 ARG B HB2  3 
ATOM 8028  H HB3  . ARG B 1 53 ? -2.498  -4.111  -45.130 1.00 0.00 ? 116 ARG B HB3  3 
ATOM 8029  H HG2  . ARG B 1 53 ? -3.576  -3.636  -47.169 1.00 0.00 ? 116 ARG B HG2  3 
ATOM 8030  H HG3  . ARG B 1 53 ? -4.208  -2.100  -46.620 1.00 0.00 ? 116 ARG B HG3  3 
ATOM 8031  H HD2  . ARG B 1 53 ? -1.928  -1.317  -46.328 1.00 0.00 ? 116 ARG B HD2  3 
ATOM 8032  H HD3  . ARG B 1 53 ? -1.334  -2.861  -46.965 1.00 0.00 ? 116 ARG B HD3  3 
ATOM 8033  H HE   . ARG B 1 53 ? -3.014  -1.987  -48.900 1.00 0.00 ? 116 ARG B HE   3 
ATOM 8034  H HH11 . ARG B 1 53 ? -0.334  -0.499  -47.252 1.00 0.00 ? 116 ARG B HH11 3 
ATOM 8035  H HH12 . ARG B 1 53 ? 0.114   0.504   -48.603 1.00 0.00 ? 116 ARG B HH12 3 
ATOM 8036  H HH21 . ARG B 1 53 ? -2.435  -0.677  -50.671 1.00 0.00 ? 116 ARG B HH21 3 
ATOM 8037  H HH22 . ARG B 1 53 ? -1.082  0.397   -50.538 1.00 0.00 ? 116 ARG B HH22 3 
ATOM 8038  N N    . GLU B 1 54 ? -6.703  -3.173  -43.814 1.00 0.00 ? 117 GLU B N    3 
ATOM 8039  C CA   . GLU B 1 54 ? -7.813  -2.232  -43.718 1.00 0.00 ? 117 GLU B CA   3 
ATOM 8040  C C    . GLU B 1 54 ? -7.413  -0.986  -42.938 1.00 0.00 ? 117 GLU B C    3 
ATOM 8041  O O    . GLU B 1 54 ? -6.585  -1.050  -42.030 1.00 0.00 ? 117 GLU B O    3 
ATOM 8042  C CB   . GLU B 1 54 ? -9.019  -2.899  -43.049 1.00 0.00 ? 117 GLU B CB   3 
ATOM 8043  C CG   . GLU B 1 54 ? -8.939  -2.965  -41.531 1.00 0.00 ? 117 GLU B CG   3 
ATOM 8044  C CD   . GLU B 1 54 ? -10.221 -3.430  -40.898 1.00 0.00 ? 117 GLU B CD   3 
ATOM 8045  O OE1  . GLU B 1 54 ? -11.173 -3.634  -41.612 1.00 0.00 ? 117 GLU B OE1  3 
ATOM 8046  O OE2  . GLU B 1 54 ? -10.247 -3.583  -39.699 1.00 0.00 ? 117 GLU B OE2  3 
ATOM 8047  H H    . GLU B 1 54 ? -6.686  -3.991  -43.203 1.00 0.00 ? 117 GLU B H    3 
ATOM 8048  H HA   . GLU B 1 54 ? -8.086  -1.935  -44.695 1.00 0.00 ? 117 GLU B HA   3 
ATOM 8049  H HB2  . GLU B 1 54 ? -9.921  -2.347  -43.313 1.00 0.00 ? 117 GLU B HB2  3 
ATOM 8050  H HB3  . GLU B 1 54 ? -9.105  -3.912  -43.410 1.00 0.00 ? 117 GLU B HB3  3 
ATOM 8051  H HG2  . GLU B 1 54 ? -8.165  -3.676  -41.291 1.00 0.00 ? 117 GLU B HG2  3 
ATOM 8052  H HG3  . GLU B 1 54 ? -8.684  -1.992  -41.115 1.00 0.00 ? 117 GLU B HG3  3 
ATOM 8053  N N    . PHE B 1 55 ? -8.007  0.147   -43.298 1.00 0.00 ? 118 PHE B N    3 
ATOM 8054  C CA   . PHE B 1 55 ? -7.630  1.429   -42.715 1.00 0.00 ? 118 PHE B CA   3 
ATOM 8055  C C    . PHE B 1 55 ? -8.794  2.049   -41.951 1.00 0.00 ? 118 PHE B C    3 
ATOM 8056  O O    . PHE B 1 55 ? -9.928  1.581   -42.044 1.00 0.00 ? 118 PHE B O    3 
ATOM 8057  C CB   . PHE B 1 55 ? -7.156  2.393   -43.803 1.00 0.00 ? 118 PHE B CB   3 
ATOM 8058  C CG   . PHE B 1 55 ? -5.989  1.881   -44.598 1.00 0.00 ? 118 PHE B CG   3 
ATOM 8059  C CD1  . PHE B 1 55 ? -4.776  1.609   -43.984 1.00 0.00 ? 118 PHE B CD1  3 
ATOM 8060  C CD2  . PHE B 1 55 ? -6.102  1.671   -45.964 1.00 0.00 ? 118 PHE B CD2  3 
ATOM 8061  C CE1  . PHE B 1 55 ? -3.701  1.141   -44.714 1.00 0.00 ? 118 PHE B CE1  3 
ATOM 8062  C CE2  . PHE B 1 55 ? -5.029  1.200   -46.697 1.00 0.00 ? 118 PHE B CE2  3 
ATOM 8063  C CZ   . PHE B 1 55 ? -3.829  0.936   -46.072 1.00 0.00 ? 118 PHE B CZ   3 
ATOM 8064  H H    . PHE B 1 55 ? -8.684  0.140   -44.055 1.00 0.00 ? 118 PHE B H    3 
ATOM 8065  H HA   . PHE B 1 55 ? -6.805  1.288   -42.014 1.00 0.00 ? 118 PHE B HA   3 
ATOM 8066  H HB2  . PHE B 1 55 ? -7.989  2.624   -44.463 1.00 0.00 ? 118 PHE B HB2  3 
ATOM 8067  H HB3  . PHE B 1 55 ? -6.844  3.290   -43.299 1.00 0.00 ? 118 PHE B HB3  3 
ATOM 8068  H HD1  . PHE B 1 55 ? -4.690  1.768   -42.942 1.00 0.00 ? 118 PHE B HD1  3 
ATOM 8069  H HD2  . PHE B 1 55 ? -7.038  1.873   -46.461 1.00 0.00 ? 118 PHE B HD2  3 
ATOM 8070  H HE1  . PHE B 1 55 ? -2.764  0.934   -44.222 1.00 0.00 ? 118 PHE B HE1  3 
ATOM 8071  H HE2  . PHE B 1 55 ? -5.129  1.062   -47.745 1.00 0.00 ? 118 PHE B HE2  3 
ATOM 8072  H HZ   . PHE B 1 55 ? -2.941  0.794   -46.673 1.00 0.00 ? 118 PHE B HZ   3 
ATOM 8073  N N    . HIS B 1 56 ? -8.505  3.103   -41.197 1.00 0.00 ? 119 HIS B N    3 
ATOM 8074  C CA   . HIS B 1 56 ? -9.542  4.006   -40.710 1.00 0.00 ? 119 HIS B CA   3 
ATOM 8075  C C    . HIS B 1 56 ? -9.056  5.448   -40.697 1.00 0.00 ? 119 HIS B C    3 
ATOM 8076  O O    . HIS B 1 56 ? -9.003  6.086   -39.644 1.00 0.00 ? 119 HIS B O    3 
ATOM 8077  C CB   . HIS B 1 56 ? -9.995  3.599   -39.304 1.00 0.00 ? 119 HIS B CB   3 
ATOM 8078  C CG   . HIS B 1 56 ? -10.605 2.234   -39.240 1.00 0.00 ? 119 HIS B CG   3 
ATOM 8079  N ND1  . HIS B 1 56 ? -9.851  1.087   -39.106 1.00 0.00 ? 119 HIS B ND1  3 
ATOM 8080  C CD2  . HIS B 1 56 ? -11.897 1.831   -39.290 1.00 0.00 ? 119 HIS B CD2  3 
ATOM 8081  C CE1  . HIS B 1 56 ? -10.652 0.037   -39.077 1.00 0.00 ? 119 HIS B CE1  3 
ATOM 8082  N NE2  . HIS B 1 56 ? -11.899 0.462   -39.186 1.00 0.00 ? 119 HIS B NE2  3 
ATOM 8083  H H    . HIS B 1 56 ? -7.548  3.456   -41.215 1.00 0.00 ? 119 HIS B H    3 
ATOM 8084  H HA   . HIS B 1 56 ? -10.416 3.952   -41.367 1.00 0.00 ? 119 HIS B HA   3 
ATOM 8085  H HB2  . HIS B 1 56 ? -9.139  3.654   -38.655 1.00 0.00 ? 119 HIS B HB2  3 
ATOM 8086  H HB3  . HIS B 1 56 ? -10.735 4.323   -38.959 1.00 0.00 ? 119 HIS B HB3  3 
ATOM 8087  H HD1  . HIS B 1 56 ? -8.834  1.051   -39.035 1.00 0.00 ? 119 HIS B HD1  3 
ATOM 8088  H HD2  . HIS B 1 56 ? -12.757 2.474   -39.177 1.00 0.00 ? 119 HIS B HD2  3 
ATOM 8089  H HE1  . HIS B 1 56 ? -10.341 -0.993  -38.980 1.00 0.00 ? 119 HIS B HE1  3 
ATOM 8090  H HE2  . HIS B 1 56 ? -12.720 -0.126  -39.192 1.00 0.00 ? 119 HIS B HE2  3 
ATOM 8091  N N    . ARG B 1 57 ? -8.701  5.960   -41.871 1.00 0.00 ? 120 ARG B N    3 
ATOM 8092  C CA   . ARG B 1 57 ? -7.932  7.193   -41.968 1.00 0.00 ? 120 ARG B CA   3 
ATOM 8093  C C    . ARG B 1 57 ? -8.808  8.410   -41.696 1.00 0.00 ? 120 ARG B C    3 
ATOM 8094  O O    . ARG B 1 57 ? -9.329  9.030   -42.623 1.00 0.00 ? 120 ARG B O    3 
ATOM 8095  C CB   . ARG B 1 57 ? -7.301  7.324   -43.347 1.00 0.00 ? 120 ARG B CB   3 
ATOM 8096  C CG   . ARG B 1 57 ? -6.427  6.152   -43.763 1.00 0.00 ? 120 ARG B CG   3 
ATOM 8097  C CD   . ARG B 1 57 ? -5.928  6.304   -45.154 1.00 0.00 ? 120 ARG B CD   3 
ATOM 8098  N NE   . ARG B 1 57 ? -4.924  5.308   -45.483 1.00 0.00 ? 120 ARG B NE   3 
ATOM 8099  C CZ   . ARG B 1 57 ? -4.411  5.113   -46.714 1.00 0.00 ? 120 ARG B CZ   3 
ATOM 8100  N NH1  . ARG B 1 57 ? -4.821  5.855   -47.721 1.00 0.00 ? 120 ARG B NH1  3 
ATOM 8101  N NH2  . ARG B 1 57 ? -3.499  4.180   -46.912 1.00 0.00 ? 120 ARG B NH2  3 
ATOM 8102  H H    . ARG B 1 57 ? -8.737  5.350   -42.688 1.00 0.00 ? 120 ARG B H    3 
ATOM 8103  H HA   . ARG B 1 57 ? -7.173  7.202   -41.238 1.00 0.00 ? 120 ARG B HA   3 
ATOM 8104  H HB2  . ARG B 1 57 ? -8.057  7.488   -44.070 1.00 0.00 ? 120 ARG B HB2  3 
ATOM 8105  H HB3  . ARG B 1 57 ? -6.656  8.206   -43.326 1.00 0.00 ? 120 ARG B HB3  3 
ATOM 8106  H HG2  . ARG B 1 57 ? -5.594  6.023   -43.082 1.00 0.00 ? 120 ARG B HG2  3 
ATOM 8107  H HG3  . ARG B 1 57 ? -7.060  5.287   -43.731 1.00 0.00 ? 120 ARG B HG3  3 
ATOM 8108  H HD2  . ARG B 1 57 ? -6.758  6.209   -45.854 1.00 0.00 ? 120 ARG B HD2  3 
ATOM 8109  H HD3  . ARG B 1 57 ? -5.485  7.296   -45.256 1.00 0.00 ? 120 ARG B HD3  3 
ATOM 8110  H HE   . ARG B 1 57 ? -4.597  4.733   -44.759 1.00 0.00 ? 120 ARG B HE   3 
ATOM 8111  H HH11 . ARG B 1 57 ? -5.512  6.562   -47.574 1.00 0.00 ? 120 ARG B HH11 3 
ATOM 8112  H HH12 . ARG B 1 57 ? -4.437  5.709   -48.644 1.00 0.00 ? 120 ARG B HH12 3 
ATOM 8113  H HH21 . ARG B 1 57 ? -3.186  3.613   -46.149 1.00 0.00 ? 120 ARG B HH21 3 
ATOM 8114  H HH22 . ARG B 1 57 ? -3.118  4.040   -47.826 1.00 0.00 ? 120 ARG B HH22 3 
ATOM 8115  N N    . LYS B 1 58 ? -8.961  8.750   -40.420 1.00 0.00 ? 121 LYS B N    3 
ATOM 8116  C CA   . LYS B 1 58 ? -9.819  9.858   -40.022 1.00 0.00 ? 121 LYS B CA   3 
ATOM 8117  C C    . LYS B 1 58 ? -9.255  11.192  -40.494 1.00 0.00 ? 121 LYS B C    3 
ATOM 8118  O O    . LYS B 1 58 ? -8.679  11.945  -39.710 1.00 0.00 ? 121 LYS B O    3 
ATOM 8119  C CB   . LYS B 1 58 ? -10.003 9.872   -38.504 1.00 0.00 ? 121 LYS B CB   3 
ATOM 8120  C CG   . LYS B 1 58 ? -11.037 10.875  -38.004 1.00 0.00 ? 121 LYS B CG   3 
ATOM 8121  C CD   . LYS B 1 58 ? -11.106 10.885  -36.485 1.00 0.00 ? 121 LYS B CD   3 
ATOM 8122  C CE   . LYS B 1 58 ? -11.641 9.569   -35.943 1.00 0.00 ? 121 LYS B CE   3 
ATOM 8123  N NZ   . LYS B 1 58 ? -11.801 9.598   -34.463 1.00 0.00 ? 121 LYS B NZ   3 
ATOM 8124  H H    . LYS B 1 58 ? -8.505  8.189   -39.699 1.00 0.00 ? 121 LYS B H    3 
ATOM 8125  H HA   . LYS B 1 58 ? -10.795 9.752   -40.460 1.00 0.00 ? 121 LYS B HA   3 
ATOM 8126  H HB2  . LYS B 1 58 ? -10.284 8.873   -38.203 1.00 0.00 ? 121 LYS B HB2  3 
ATOM 8127  H HB3  . LYS B 1 58 ? -9.053  10.117  -38.081 1.00 0.00 ? 121 LYS B HB3  3 
ATOM 8128  H HG2  . LYS B 1 58 ? -10.738 11.847  -38.346 1.00 0.00 ? 121 LYS B HG2  3 
ATOM 8129  H HG3  . LYS B 1 58 ? -12.012 10.620  -38.413 1.00 0.00 ? 121 LYS B HG3  3 
ATOM 8130  H HD2  . LYS B 1 58 ? -10.107 11.052  -36.084 1.00 0.00 ? 121 LYS B HD2  3 
ATOM 8131  H HD3  . LYS B 1 58 ? -11.761 11.695  -36.161 1.00 0.00 ? 121 LYS B HD3  3 
ATOM 8132  H HE2  . LYS B 1 58 ? -12.604 9.361   -36.395 1.00 0.00 ? 121 LYS B HE2  3 
ATOM 8133  H HE3  . LYS B 1 58 ? -10.952 8.765   -36.182 1.00 0.00 ? 121 LYS B HE3  3 
ATOM 8134  H HZ1  . LYS B 1 58 ? -11.341 8.768   -34.037 1.00 0.00 ? 121 LYS B HZ1  3 
ATOM 8135  H HZ2  . LYS B 1 58 ? -12.813 9.596   -34.224 1.00 0.00 ? 121 LYS B HZ2  3 
ATOM 8136  H HZ3  . LYS B 1 58 ? -11.375 10.439  -34.099 1.00 0.00 ? 121 LYS B HZ3  3 
ATOM 8137  N N    . TYR B 1 59 ? -9.419  11.474  -41.782 1.00 0.00 ? 122 TYR B N    3 
ATOM 8138  C CA   . TYR B 1 59 ? -8.884  12.697  -42.372 1.00 0.00 ? 122 TYR B CA   3 
ATOM 8139  C C    . TYR B 1 59 ? -9.784  13.889  -42.078 1.00 0.00 ? 122 TYR B C    3 
ATOM 8140  O O    . TYR B 1 59 ? -10.850 14.036  -42.676 1.00 0.00 ? 122 TYR B O    3 
ATOM 8141  C CB   . TYR B 1 59 ? -8.703  12.527  -43.881 1.00 0.00 ? 122 TYR B CB   3 
ATOM 8142  C CG   . TYR B 1 59 ? -8.054  13.714  -44.556 1.00 0.00 ? 122 TYR B CG   3 
ATOM 8143  C CD1  . TYR B 1 59 ? -8.665  14.959  -44.506 1.00 0.00 ? 122 TYR B CD1  3 
ATOM 8144  C CD2  . TYR B 1 59 ? -6.849  13.560  -45.225 1.00 0.00 ? 122 TYR B CD2  3 
ATOM 8145  C CE1  . TYR B 1 59 ? -8.072  16.044  -45.120 1.00 0.00 ? 122 TYR B CE1  3 
ATOM 8146  C CE2  . TYR B 1 59 ? -6.256  14.644  -45.841 1.00 0.00 ? 122 TYR B CE2  3 
ATOM 8147  C CZ   . TYR B 1 59 ? -6.873  15.890  -45.787 1.00 0.00 ? 122 TYR B CZ   3 
ATOM 8148  O OH   . TYR B 1 59 ? -6.281  16.971  -46.400 1.00 0.00 ? 122 TYR B OH   3 
ATOM 8149  H H    . TYR B 1 59 ? -9.902  10.803  -42.377 1.00 0.00 ? 122 TYR B H    3 
ATOM 8150  H HA   . TYR B 1 59 ? -7.911  12.907  -41.946 1.00 0.00 ? 122 TYR B HA   3 
ATOM 8151  H HB2  . TYR B 1 59 ? -8.083  11.644  -44.038 1.00 0.00 ? 122 TYR B HB2  3 
ATOM 8152  H HB3  . TYR B 1 59 ? -9.657  12.343  -44.332 1.00 0.00 ? 122 TYR B HB3  3 
ATOM 8153  H HD1  . TYR B 1 59 ? -9.602  15.110  -44.040 1.00 0.00 ? 122 TYR B HD1  3 
ATOM 8154  H HD2  . TYR B 1 59 ? -6.382  12.608  -45.288 1.00 0.00 ? 122 TYR B HD2  3 
ATOM 8155  H HE1  . TYR B 1 59 ? -8.543  17.015  -45.080 1.00 0.00 ? 122 TYR B HE1  3 
ATOM 8156  H HE2  . TYR B 1 59 ? -5.339  14.521  -46.368 1.00 0.00 ? 122 TYR B HE2  3 
ATOM 8157  H HH   . TYR B 1 59 ? -6.071  17.619  -45.725 1.00 0.00 ? 122 TYR B HH   3 
ATOM 8158  N N    . ARG B 1 60 ? -9.348  14.738  -41.154 1.00 0.00 ? 123 ARG B N    3 
ATOM 8159  C CA   . ARG B 1 60 ? -10.258 15.632  -40.445 1.00 0.00 ? 123 ARG B CA   3 
ATOM 8160  C C    . ARG B 1 60 ? -10.467 16.929  -41.215 1.00 0.00 ? 123 ARG B C    3 
ATOM 8161  O O    . ARG B 1 60 ? -9.525  17.487  -41.777 1.00 0.00 ? 123 ARG B O    3 
ATOM 8162  C CB   . ARG B 1 60 ? -9.722  15.949  -39.057 1.00 0.00 ? 123 ARG B CB   3 
ATOM 8163  C CG   . ARG B 1 60 ? -9.471  14.738  -38.175 1.00 0.00 ? 123 ARG B CG   3 
ATOM 8164  C CD   . ARG B 1 60 ? -9.349  15.114  -36.743 1.00 0.00 ? 123 ARG B CD   3 
ATOM 8165  N NE   . ARG B 1 60 ? -8.233  16.017  -36.512 1.00 0.00 ? 123 ARG B NE   3 
ATOM 8166  C CZ   . ARG B 1 60 ? -8.034  16.711  -35.377 1.00 0.00 ? 123 ARG B CZ   3 
ATOM 8167  N NH1  . ARG B 1 60 ? -8.882  16.599  -34.380 1.00 0.00 ? 123 ARG B NH1  3 
ATOM 8168  N NH2  . ARG B 1 60 ? -6.984  17.509  -35.262 1.00 0.00 ? 123 ARG B NH2  3 
ATOM 8169  H H    . ARG B 1 60 ? -8.474  14.498  -40.686 1.00 0.00 ? 123 ARG B H    3 
ATOM 8170  H HA   . ARG B 1 60 ? -11.203 15.165  -40.318 1.00 0.00 ? 123 ARG B HA   3 
ATOM 8171  H HB2  . ARG B 1 60 ? -8.780  16.488  -39.162 1.00 0.00 ? 123 ARG B HB2  3 
ATOM 8172  H HB3  . ARG B 1 60 ? -10.437 16.603  -38.557 1.00 0.00 ? 123 ARG B HB3  3 
ATOM 8173  H HG2  . ARG B 1 60 ? -10.281 14.046  -38.314 1.00 0.00 ? 123 ARG B HG2  3 
ATOM 8174  H HG3  . ARG B 1 60 ? -8.540  14.262  -38.487 1.00 0.00 ? 123 ARG B HG3  3 
ATOM 8175  H HD2  . ARG B 1 60 ? -10.266 15.619  -36.437 1.00 0.00 ? 123 ARG B HD2  3 
ATOM 8176  H HD3  . ARG B 1 60 ? -9.217  14.220  -36.140 1.00 0.00 ? 123 ARG B HD3  3 
ATOM 8177  H HE   . ARG B 1 60 ? -7.580  16.125  -37.233 1.00 0.00 ? 123 ARG B HE   3 
ATOM 8178  H HH11 . ARG B 1 60 ? -9.678  15.997  -34.462 1.00 0.00 ? 123 ARG B HH11 3 
ATOM 8179  H HH12 . ARG B 1 60 ? -8.731  17.121  -33.528 1.00 0.00 ? 123 ARG B HH12 3 
ATOM 8180  H HH21 . ARG B 1 60 ? -6.337  17.598  -36.020 1.00 0.00 ? 123 ARG B HH21 3 
ATOM 8181  H HH22 . ARG B 1 60 ? -6.840  18.023  -34.419 1.00 0.00 ? 123 ARG B HH22 3 
ATOM 8182  N N    . ILE B 1 61 ? -11.709 17.405  -41.237 1.00 0.00 ? 124 ILE B N    3 
ATOM 8183  C CA   . ILE B 1 61 ? -12.072 18.558  -42.050 1.00 0.00 ? 124 ILE B CA   3 
ATOM 8184  C C    . ILE B 1 61 ? -11.914 19.858  -41.268 1.00 0.00 ? 124 ILE B C    3 
ATOM 8185  O O    . ILE B 1 61 ? -12.390 19.972  -40.139 1.00 0.00 ? 124 ILE B O    3 
ATOM 8186  C CB   . ILE B 1 61 ? -13.521 18.436  -42.558 1.00 0.00 ? 124 ILE B CB   3 
ATOM 8187  C CG1  . ILE B 1 61 ? -13.688 17.164  -43.393 1.00 0.00 ? 124 ILE B CG1  3 
ATOM 8188  C CG2  . ILE B 1 61 ? -13.904 19.664  -43.372 1.00 0.00 ? 124 ILE B CG2  3 
ATOM 8189  C CD1  . ILE B 1 61 ? -15.129 16.810  -43.684 1.00 0.00 ? 124 ILE B CD1  3 
ATOM 8190  H H    . ILE B 1 61 ? -12.440 16.879  -40.761 1.00 0.00 ? 124 ILE B H    3 
ATOM 8191  H HA   . ILE B 1 61 ? -11.453 18.551  -42.929 1.00 0.00 ? 124 ILE B HA   3 
ATOM 8192  H HB   . ILE B 1 61 ? -14.189 18.369  -41.700 1.00 0.00 ? 124 ILE B HB   3 
ATOM 8193  H HG12 . ILE B 1 61 ? -13.174 17.323  -44.336 1.00 0.00 ? 124 ILE B HG12 3 
ATOM 8194  H HG13 . ILE B 1 61 ? -13.211 16.344  -42.864 1.00 0.00 ? 124 ILE B HG13 3 
ATOM 8195  H HG21 . ILE B 1 61 ? -13.291 19.714  -44.268 1.00 0.00 ? 124 ILE B HG21 3 
ATOM 8196  H HG22 . ILE B 1 61 ? -13.756 20.541  -42.766 1.00 0.00 ? 124 ILE B HG22 3 
ATOM 8197  H HG23 . ILE B 1 61 ? -14.950 19.617  -43.652 1.00 0.00 ? 124 ILE B HG23 3 
ATOM 8198  H HD11 . ILE B 1 61 ? -15.627 16.621  -42.740 1.00 0.00 ? 124 ILE B HD11 3 
ATOM 8199  H HD12 . ILE B 1 61 ? -15.171 15.919  -44.309 1.00 0.00 ? 124 ILE B HD12 3 
ATOM 8200  H HD13 . ILE B 1 61 ? -15.615 17.641  -44.195 1.00 0.00 ? 124 ILE B HD13 3 
ATOM 8201  N N    . PRO B 1 62 ? -11.245 20.830  -41.876 1.00 0.00 ? 125 PRO B N    3 
ATOM 8202  C CA   . PRO B 1 62 ? -11.106 22.152  -41.278 1.00 0.00 ? 125 PRO B CA   3 
ATOM 8203  C C    . PRO B 1 62 ? -12.454 22.697  -40.826 1.00 0.00 ? 125 PRO B C    3 
ATOM 8204  O O    . PRO B 1 62 ? -13.476 22.462  -41.467 1.00 0.00 ? 125 PRO B O    3 
ATOM 8205  C CB   . PRO B 1 62 ? -10.514 22.985  -42.420 1.00 0.00 ? 125 PRO B CB   3 
ATOM 8206  C CG   . PRO B 1 62 ? -9.734  22.000  -43.225 1.00 0.00 ? 125 PRO B CG   3 
ATOM 8207  C CD   . PRO B 1 62 ? -10.569 20.749  -43.195 1.00 0.00 ? 125 PRO B CD   3 
ATOM 8208  H HA   . PRO B 1 62 ? -10.407 22.116  -40.446 1.00 0.00 ? 125 PRO B HA   3 
ATOM 8209  H HB2  . PRO B 1 62 ? -11.311 23.432  -43.023 1.00 0.00 ? 125 PRO B HB2  3 
ATOM 8210  H HB3  . PRO B 1 62 ? -9.852  23.759  -42.029 1.00 0.00 ? 125 PRO B HB3  3 
ATOM 8211  H HG2  . PRO B 1 62 ? -9.622  22.356  -44.251 1.00 0.00 ? 125 PRO B HG2  3 
ATOM 8212  H HG3  . PRO B 1 62 ? -8.757  21.822  -42.774 1.00 0.00 ? 125 PRO B HG3  3 
ATOM 8213  H HD2  . PRO B 1 62 ? -11.282 20.737  -44.018 1.00 0.00 ? 125 PRO B HD2  3 
ATOM 8214  H HD3  . PRO B 1 62 ? -9.907  19.884  -43.231 1.00 0.00 ? 125 PRO B HD3  3 
ATOM 8215  N N    . ALA B 1 63 ? -12.447 23.427  -39.716 1.00 0.00 ? 126 ALA B N    3 
ATOM 8216  C CA   . ALA B 1 63 ? -13.673 24.000  -39.168 1.00 0.00 ? 126 ALA B CA   3 
ATOM 8217  C C    . ALA B 1 63 ? -14.274 25.027  -40.119 1.00 0.00 ? 126 ALA B C    3 
ATOM 8218  O O    . ALA B 1 63 ? -15.409 25.464  -39.938 1.00 0.00 ? 126 ALA B O    3 
ATOM 8219  C CB   . ALA B 1 63 ? -13.402 24.630  -37.811 1.00 0.00 ? 126 ALA B CB   3 
ATOM 8220  H H    . ALA B 1 63 ? -11.566 23.586  -39.231 1.00 0.00 ? 126 ALA B H    3 
ATOM 8221  H HA   . ALA B 1 63 ? -14.397 23.195  -39.032 1.00 0.00 ? 126 ALA B HA   3 
ATOM 8222  H HB1  . ALA B 1 63 ? -13.034 23.870  -37.122 1.00 0.00 ? 126 ALA B HB1  3 
ATOM 8223  H HB2  . ALA B 1 63 ? -14.323 25.062  -37.419 1.00 0.00 ? 126 ALA B HB2  3 
ATOM 8224  H HB3  . ALA B 1 63 ? -12.651 25.413  -37.919 1.00 0.00 ? 126 ALA B HB3  3 
ATOM 8225  N N    . ASP B 1 64 ? -13.504 25.410  -41.134 1.00 0.00 ? 127 ASP B N    3 
ATOM 8226  C CA   . ASP B 1 64 ? -13.957 26.389  -42.112 1.00 0.00 ? 127 ASP B CA   3 
ATOM 8227  C C    . ASP B 1 64 ? -14.453 25.711  -43.382 1.00 0.00 ? 127 ASP B C    3 
ATOM 8228  O O    . ASP B 1 64 ? -14.683 26.368  -44.398 1.00 0.00 ? 127 ASP B O    3 
ATOM 8229  C CB   . ASP B 1 64 ? -12.828 27.366  -42.454 1.00 0.00 ? 127 ASP B CB   3 
ATOM 8230  C CG   . ASP B 1 64 ? -12.438 28.256  -41.279 1.00 0.00 ? 127 ASP B CG   3 
ATOM 8231  O OD1  . ASP B 1 64 ? -13.294 28.568  -40.487 1.00 0.00 ? 127 ASP B OD1  3 
ATOM 8232  O OD2  . ASP B 1 64 ? -11.287 28.611  -41.189 1.00 0.00 ? 127 ASP B OD2  3 
ATOM 8233  H H    . ASP B 1 64 ? -12.570 25.009  -41.230 1.00 0.00 ? 127 ASP B H    3 
ATOM 8234  H HA   . ASP B 1 64 ? -14.782 26.970  -41.688 1.00 0.00 ? 127 ASP B HA   3 
ATOM 8235  H HB2  . ASP B 1 64 ? -11.955 26.790  -42.760 1.00 0.00 ? 127 ASP B HB2  3 
ATOM 8236  H HB3  . ASP B 1 64 ? -13.143 27.998  -43.285 1.00 0.00 ? 127 ASP B HB3  3 
ATOM 8237  N N    . VAL B 1 65 ? -14.614 24.395  -43.320 1.00 0.00 ? 128 VAL B N    3 
ATOM 8238  C CA   . VAL B 1 65 ? -15.060 23.621  -44.472 1.00 0.00 ? 128 VAL B CA   3 
ATOM 8239  C C    . VAL B 1 65 ? -16.292 22.790  -44.136 1.00 0.00 ? 128 VAL B C    3 
ATOM 8240  O O    . VAL B 1 65 ? -16.360 22.168  -43.077 1.00 0.00 ? 128 VAL B O    3 
ATOM 8241  C CB   . VAL B 1 65 ? -13.934 22.692  -44.962 1.00 0.00 ? 128 VAL B CB   3 
ATOM 8242  C CG1  . VAL B 1 65 ? -14.439 21.778  -46.069 1.00 0.00 ? 128 VAL B CG1  3 
ATOM 8243  C CG2  . VAL B 1 65 ? -12.752 23.518  -45.442 1.00 0.00 ? 128 VAL B CG2  3 
ATOM 8244  H H    . VAL B 1 65 ? -14.405 23.911  -42.446 1.00 0.00 ? 128 VAL B H    3 
ATOM 8245  H HA   . VAL B 1 65 ? -15.325 24.285  -45.264 1.00 0.00 ? 128 VAL B HA   3 
ATOM 8246  H HB   . VAL B 1 65 ? -13.613 22.098  -44.134 1.00 0.00 ? 128 VAL B HB   3 
ATOM 8247  H HG11 . VAL B 1 65 ? -13.594 21.282  -46.524 1.00 0.00 ? 128 VAL B HG11 3 
ATOM 8248  H HG12 . VAL B 1 65 ? -14.966 22.368  -46.818 1.00 0.00 ? 128 VAL B HG12 3 
ATOM 8249  H HG13 . VAL B 1 65 ? -15.114 21.028  -45.653 1.00 0.00 ? 128 VAL B HG13 3 
ATOM 8250  H HG21 . VAL B 1 65 ? -12.862 23.726  -46.506 1.00 0.00 ? 128 VAL B HG21 3 
ATOM 8251  H HG22 . VAL B 1 65 ? -11.827 22.957  -45.289 1.00 0.00 ? 128 VAL B HG22 3 
ATOM 8252  H HG23 . VAL B 1 65 ? -12.692 24.459  -44.892 1.00 0.00 ? 128 VAL B HG23 3 
ATOM 8253  N N    . ASP B 1 66 ? -17.261 22.785  -45.044 1.00 0.00 ? 129 ASP B N    3 
ATOM 8254  C CA   . ASP B 1 66 ? -18.542 22.131  -44.793 1.00 0.00 ? 129 ASP B CA   3 
ATOM 8255  C C    . ASP B 1 66 ? -18.488 20.656  -45.173 1.00 0.00 ? 129 ASP B C    3 
ATOM 8256  O O    . ASP B 1 66 ? -18.282 20.312  -46.337 1.00 0.00 ? 129 ASP B O    3 
ATOM 8257  C CB   . ASP B 1 66 ? -19.661 22.825  -45.574 1.00 0.00 ? 129 ASP B CB   3 
ATOM 8258  C CG   . ASP B 1 66 ? -21.045 22.311  -45.207 1.00 0.00 ? 129 ASP B CG   3 
ATOM 8259  O OD1  . ASP B 1 66 ? -21.131 21.263  -44.611 1.00 0.00 ? 129 ASP B OD1  3 
ATOM 8260  O OD2  . ASP B 1 66 ? -22.006 22.971  -45.524 1.00 0.00 ? 129 ASP B OD2  3 
ATOM 8261  H H    . ASP B 1 66 ? -17.142 23.340  -45.890 1.00 0.00 ? 129 ASP B H    3 
ATOM 8262  H HA   . ASP B 1 66 ? -18.774 22.259  -43.757 1.00 0.00 ? 129 ASP B HA   3 
ATOM 8263  H HB2  . ASP B 1 66 ? -19.618 23.893  -45.368 1.00 0.00 ? 129 ASP B HB2  3 
ATOM 8264  H HB3  . ASP B 1 66 ? -19.497 22.666  -46.633 1.00 0.00 ? 129 ASP B HB3  3 
ATOM 8265  N N    . PRO B 1 67 ? -18.675 19.790  -44.183 1.00 0.00 ? 130 PRO B N    3 
ATOM 8266  C CA   . PRO B 1 67 ? -18.512 18.355  -44.381 1.00 0.00 ? 130 PRO B CA   3 
ATOM 8267  C C    . PRO B 1 67 ? -19.710 17.759  -45.112 1.00 0.00 ? 130 PRO B C    3 
ATOM 8268  O O    . PRO B 1 67 ? -19.695 16.593  -45.499 1.00 0.00 ? 130 PRO B O    3 
ATOM 8269  C CB   . PRO B 1 67 ? -18.399 17.820  -42.950 1.00 0.00 ? 130 PRO B CB   3 
ATOM 8270  C CG   . PRO B 1 67 ? -19.179 18.794  -42.134 1.00 0.00 ? 130 PRO B CG   3 
ATOM 8271  C CD   . PRO B 1 67 ? -18.872 20.130  -42.752 1.00 0.00 ? 130 PRO B CD   3 
ATOM 8272  H HA   . PRO B 1 67 ? -17.614 18.134  -44.932 1.00 0.00 ? 130 PRO B HA   3 
ATOM 8273  H HB2  . PRO B 1 67 ? -18.812 16.810  -42.865 1.00 0.00 ? 130 PRO B HB2  3 
ATOM 8274  H HB3  . PRO B 1 67 ? -17.369 17.837  -42.634 1.00 0.00 ? 130 PRO B HB3  3 
ATOM 8275  H HG2  . PRO B 1 67 ? -20.248 18.561  -42.195 1.00 0.00 ? 130 PRO B HG2  3 
ATOM 8276  H HG3  . PRO B 1 67 ? -18.848 18.779  -41.094 1.00 0.00 ? 130 PRO B HG3  3 
ATOM 8277  H HD2  . PRO B 1 67 ? -19.748 20.777  -42.636 1.00 0.00 ? 130 PRO B HD2  3 
ATOM 8278  H HD3  . PRO B 1 67 ? -17.986 20.584  -42.307 1.00 0.00 ? 130 PRO B HD3  3 
ATOM 8279  N N    . LEU B 1 68 ? -20.747 18.570  -45.295 1.00 0.00 ? 131 LEU B N    3 
ATOM 8280  C CA   . LEU B 1 68 ? -21.973 18.112  -45.937 1.00 0.00 ? 131 LEU B CA   3 
ATOM 8281  C C    . LEU B 1 68 ? -22.012 18.521  -47.402 1.00 0.00 ? 131 LEU B C    3 
ATOM 8282  O O    . LEU B 1 68 ? -23.019 18.323  -48.086 1.00 0.00 ? 131 LEU B O    3 
ATOM 8283  C CB   . LEU B 1 68 ? -23.198 18.679  -45.208 1.00 0.00 ? 131 LEU B CB   3 
ATOM 8284  C CG   . LEU B 1 68 ? -23.330 18.289  -43.730 1.00 0.00 ? 131 LEU B CG   3 
ATOM 8285  C CD1  . LEU B 1 68 ? -24.555 18.970  -43.132 1.00 0.00 ? 131 LEU B CD1  3 
ATOM 8286  C CD2  . LEU B 1 68 ? -23.437 16.775  -43.612 1.00 0.00 ? 131 LEU B CD2  3 
ATOM 8287  H H    . LEU B 1 68 ? -20.699 19.524  -44.939 1.00 0.00 ? 131 LEU B H    3 
ATOM 8288  H HA   . LEU B 1 68 ? -22.029 17.024  -45.886 1.00 0.00 ? 131 LEU B HA   3 
ATOM 8289  H HB2  . LEU B 1 68 ? -23.152 19.765  -45.266 1.00 0.00 ? 131 LEU B HB2  3 
ATOM 8290  H HB3  . LEU B 1 68 ? -24.093 18.341  -45.731 1.00 0.00 ? 131 LEU B HB3  3 
ATOM 8291  H HG   . LEU B 1 68 ? -22.439 18.629  -43.198 1.00 0.00 ? 131 LEU B HG   3 
ATOM 8292  H HD11 . LEU B 1 68 ? -25.455 18.539  -43.568 1.00 0.00 ? 131 LEU B HD11 3 
ATOM 8293  H HD12 . LEU B 1 68 ? -24.523 20.038  -43.345 1.00 0.00 ? 131 LEU B HD12 3 
ATOM 8294  H HD13 . LEU B 1 68 ? -24.566 18.814  -42.052 1.00 0.00 ? 131 LEU B HD13 3 
ATOM 8295  H HD21 . LEU B 1 68 ? -23.854 16.517  -42.639 1.00 0.00 ? 131 LEU B HD21 3 
ATOM 8296  H HD22 . LEU B 1 68 ? -22.450 16.320  -43.706 1.00 0.00 ? 131 LEU B HD22 3 
ATOM 8297  H HD23 . LEU B 1 68 ? -24.090 16.389  -44.397 1.00 0.00 ? 131 LEU B HD23 3 
ATOM 8298  N N    . THR B 1 69 ? -20.915 19.095  -47.883 1.00 0.00 ? 132 THR B N    3 
ATOM 8299  C CA   . THR B 1 69 ? -20.831 19.555  -49.263 1.00 0.00 ? 132 THR B CA   3 
ATOM 8300  C C    . THR B 1 69 ? -19.657 18.906  -49.990 1.00 0.00 ? 132 THR B C    3 
ATOM 8301  O O    . THR B 1 69 ? -19.275 19.336  -51.078 1.00 0.00 ? 132 THR B O    3 
ATOM 8302  C CB   . THR B 1 69 ? -20.698 21.087  -49.331 1.00 0.00 ? 132 THR B CB   3 
ATOM 8303  O OG1  . THR B 1 69 ? -19.518 21.498  -48.629 1.00 0.00 ? 132 THR B OG1  3 
ATOM 8304  C CG2  . THR B 1 69 ? -21.913 21.754  -48.707 1.00 0.00 ? 132 THR B CG2  3 
ATOM 8305  H H    . THR B 1 69 ? -20.114 19.232  -47.267 1.00 0.00 ? 132 THR B H    3 
ATOM 8306  H HA   . THR B 1 69 ? -21.742 19.277  -49.797 1.00 0.00 ? 132 THR B HA   3 
ATOM 8307  H HB   . THR B 1 69 ? -20.654 21.381  -50.363 1.00 0.00 ? 132 THR B HB   3 
ATOM 8308  H HG1  . THR B 1 69 ? -18.862 21.754  -49.282 1.00 0.00 ? 132 THR B HG1  3 
ATOM 8309  H HG21 . THR B 1 69 ? -21.973 21.483  -47.653 1.00 0.00 ? 132 THR B HG21 3 
ATOM 8310  H HG22 . THR B 1 69 ? -22.816 21.422  -49.220 1.00 0.00 ? 132 THR B HG22 3 
ATOM 8311  H HG23 . THR B 1 69 ? -21.822 22.837  -48.799 1.00 0.00 ? 132 THR B HG23 3 
ATOM 8312  N N    . ILE B 1 70 ? -19.090 17.870  -49.381 1.00 0.00 ? 133 ILE B N    3 
ATOM 8313  C CA   . ILE B 1 70 ? -17.953 17.169  -49.963 1.00 0.00 ? 133 ILE B CA   3 
ATOM 8314  C C    . ILE B 1 70 ? -18.402 15.919  -50.712 1.00 0.00 ? 133 ILE B C    3 
ATOM 8315  O O    . ILE B 1 70 ? -19.367 15.262  -50.319 1.00 0.00 ? 133 ILE B O    3 
ATOM 8316  C CB   . ILE B 1 70 ? -16.934 16.778  -48.878 1.00 0.00 ? 133 ILE B CB   3 
ATOM 8317  C CG1  . ILE B 1 70 ? -17.577 15.834  -47.857 1.00 0.00 ? 133 ILE B CG1  3 
ATOM 8318  C CG2  . ILE B 1 70 ? -16.387 18.017  -48.191 1.00 0.00 ? 133 ILE B CG2  3 
ATOM 8319  C CD1  . ILE B 1 70 ? -16.622 15.345  -46.792 1.00 0.00 ? 133 ILE B CD1  3 
ATOM 8320  H H    . ILE B 1 70 ? -19.459 17.563  -48.481 1.00 0.00 ? 133 ILE B H    3 
ATOM 8321  H HA   . ILE B 1 70 ? -17.466 17.812  -50.668 1.00 0.00 ? 133 ILE B HA   3 
ATOM 8322  H HB   . ILE B 1 70 ? -16.113 16.261  -49.359 1.00 0.00 ? 133 ILE B HB   3 
ATOM 8323  H HG12 . ILE B 1 70 ? -18.398 16.364  -47.385 1.00 0.00 ? 133 ILE B HG12 3 
ATOM 8324  H HG13 . ILE B 1 70 ? -17.981 14.966  -48.383 1.00 0.00 ? 133 ILE B HG13 3 
ATOM 8325  H HG21 . ILE B 1 70 ? -15.862 17.746  -47.278 1.00 0.00 ? 133 ILE B HG21 3 
ATOM 8326  H HG22 . ILE B 1 70 ? -17.212 18.686  -47.947 1.00 0.00 ? 133 ILE B HG22 3 
ATOM 8327  H HG23 . ILE B 1 70 ? -15.696 18.529  -48.859 1.00 0.00 ? 133 ILE B HG23 3 
ATOM 8328  H HD11 . ILE B 1 70 ? -16.872 14.327  -46.505 1.00 0.00 ? 133 ILE B HD11 3 
ATOM 8329  H HD12 . ILE B 1 70 ? -16.693 15.993  -45.919 1.00 0.00 ? 133 ILE B HD12 3 
ATOM 8330  H HD13 . ILE B 1 70 ? -15.604 15.371  -47.180 1.00 0.00 ? 133 ILE B HD13 3 
ATOM 8331  N N    . THR B 1 71 ? -17.700 15.598  -51.791 1.00 0.00 ? 134 THR B N    3 
ATOM 8332  C CA   . THR B 1 71 ? -18.067 14.468  -52.636 1.00 0.00 ? 134 THR B CA   3 
ATOM 8333  C C    . THR B 1 71 ? -16.834 13.692  -53.086 1.00 0.00 ? 134 THR B C    3 
ATOM 8334  O O    . THR B 1 71 ? -16.172 14.069  -54.053 1.00 0.00 ? 134 THR B O    3 
ATOM 8335  C CB   . THR B 1 71 ? -18.863 14.933  -53.870 1.00 0.00 ? 134 THR B CB   3 
ATOM 8336  O OG1  . THR B 1 71 ? -20.031 15.650  -53.447 1.00 0.00 ? 134 THR B OG1  3 
ATOM 8337  C CG2  . THR B 1 71 ? -19.284 13.739  -54.713 1.00 0.00 ? 134 THR B CG2  3 
ATOM 8338  H H    . THR B 1 71 ? -16.917 16.190  -52.069 1.00 0.00 ? 134 THR B H    3 
ATOM 8339  H HA   . THR B 1 71 ? -18.699 13.784  -52.066 1.00 0.00 ? 134 THR B HA   3 
ATOM 8340  H HB   . THR B 1 71 ? -18.238 15.591  -54.472 1.00 0.00 ? 134 THR B HB   3 
ATOM 8341  H HG1  . THR B 1 71 ? -19.910 16.575  -53.671 1.00 0.00 ? 134 THR B HG1  3 
ATOM 8342  H HG21 . THR B 1 71 ? -19.777 13.003  -54.078 1.00 0.00 ? 134 THR B HG21 3 
ATOM 8343  H HG22 . THR B 1 71 ? -18.403 13.290  -55.173 1.00 0.00 ? 134 THR B HG22 3 
ATOM 8344  H HG23 . THR B 1 71 ? -19.974 14.066  -55.491 1.00 0.00 ? 134 THR B HG23 3 
ATOM 8345  N N    . SER B 1 72 ? -16.531 12.609  -52.378 1.00 0.00 ? 135 SER B N    3 
ATOM 8346  C CA   . SER B 1 72 ? -15.465 11.703  -52.784 1.00 0.00 ? 135 SER B CA   3 
ATOM 8347  C C    . SER B 1 72 ? -15.813 10.989  -54.085 1.00 0.00 ? 135 SER B C    3 
ATOM 8348  O O    . SER B 1 72 ? -16.986 10.850  -54.432 1.00 0.00 ? 135 SER B O    3 
ATOM 8349  C CB   . SER B 1 72 ? -15.204 10.681  -51.693 1.00 0.00 ? 135 SER B CB   3 
ATOM 8350  O OG   . SER B 1 72 ? -16.258 9.764   -51.602 1.00 0.00 ? 135 SER B OG   3 
ATOM 8351  H H    . SER B 1 72 ? -17.140 12.344  -51.601 1.00 0.00 ? 135 SER B H    3 
ATOM 8352  H HA   . SER B 1 72 ? -14.577 12.260  -52.947 1.00 0.00 ? 135 SER B HA   3 
ATOM 8353  H HB2  . SER B 1 72 ? -14.282 10.167  -51.880 1.00 0.00 ? 135 SER B HB2  3 
ATOM 8354  H HB3  . SER B 1 72 ? -15.141 11.199  -50.739 1.00 0.00 ? 135 SER B HB3  3 
ATOM 8355  H HG   . SER B 1 72 ? -16.934 10.127  -51.025 1.00 0.00 ? 135 SER B HG   3 
ATOM 8356  N N    . SER B 1 73 ? -14.787 10.542  -54.802 1.00 0.00 ? 136 SER B N    3 
ATOM 8357  C CA   . SER B 1 73 ? -14.984 9.847   -56.068 1.00 0.00 ? 136 SER B CA   3 
ATOM 8358  C C    . SER B 1 73 ? -13.719 9.108   -56.492 1.00 0.00 ? 136 SER B C    3 
ATOM 8359  O O    . SER B 1 73 ? -12.619 9.444   -56.058 1.00 0.00 ? 136 SER B O    3 
ATOM 8360  C CB   . SER B 1 73 ? -15.391 10.830  -57.145 1.00 0.00 ? 136 SER B CB   3 
ATOM 8361  O OG   . SER B 1 73 ? -14.350 11.722  -57.433 1.00 0.00 ? 136 SER B OG   3 
ATOM 8362  H H    . SER B 1 73 ? -13.838 10.695  -54.460 1.00 0.00 ? 136 SER B H    3 
ATOM 8363  H HA   . SER B 1 73 ? -15.782 9.115   -55.941 1.00 0.00 ? 136 SER B HA   3 
ATOM 8364  H HB2  . SER B 1 73 ? -15.644 10.286  -58.052 1.00 0.00 ? 136 SER B HB2  3 
ATOM 8365  H HB3  . SER B 1 73 ? -16.270 11.385  -56.807 1.00 0.00 ? 136 SER B HB3  3 
ATOM 8366  H HG   . SER B 1 73 ? -14.036 12.081  -56.600 1.00 0.00 ? 136 SER B HG   3 
ATOM 8367  N N    . LEU B 1 74 ? -13.887 8.101   -57.343 1.00 0.00 ? 137 LEU B N    3 
ATOM 8368  C CA   . LEU B 1 74 ? -12.767 7.278   -57.786 1.00 0.00 ? 137 LEU B CA   3 
ATOM 8369  C C    . LEU B 1 74 ? -12.516 7.449   -59.278 1.00 0.00 ? 137 LEU B C    3 
ATOM 8370  O O    . LEU B 1 74 ? -13.432 7.763   -60.040 1.00 0.00 ? 137 LEU B O    3 
ATOM 8371  C CB   . LEU B 1 74 ? -13.035 5.802   -57.471 1.00 0.00 ? 137 LEU B CB   3 
ATOM 8372  C CG   . LEU B 1 74 ? -13.173 5.454   -55.983 1.00 0.00 ? 137 LEU B CG   3 
ATOM 8373  C CD1  . LEU B 1 74 ? -13.611 4.003   -55.839 1.00 0.00 ? 137 LEU B CD1  3 
ATOM 8374  C CD2  . LEU B 1 74 ? -11.849 5.700   -55.278 1.00 0.00 ? 137 LEU B CD2  3 
ATOM 8375  H H    . LEU B 1 74 ? -14.827 7.865   -57.658 1.00 0.00 ? 137 LEU B H    3 
ATOM 8376  H HA   . LEU B 1 74 ? -11.859 7.579   -57.274 1.00 0.00 ? 137 LEU B HA   3 
ATOM 8377  H HB2  . LEU B 1 74 ? -13.953 5.513   -57.976 1.00 0.00 ? 137 LEU B HB2  3 
ATOM 8378  H HB3  . LEU B 1 74 ? -12.214 5.212   -57.880 1.00 0.00 ? 137 LEU B HB3  3 
ATOM 8379  H HG   . LEU B 1 74 ? -13.936 6.101   -55.543 1.00 0.00 ? 137 LEU B HG   3 
ATOM 8380  H HD11 . LEU B 1 74 ? -12.812 3.350   -56.191 1.00 0.00 ? 137 LEU B HD11 3 
ATOM 8381  H HD12 . LEU B 1 74 ? -14.512 3.824   -56.427 1.00 0.00 ? 137 LEU B HD12 3 
ATOM 8382  H HD13 . LEU B 1 74 ? -13.816 3.789   -54.790 1.00 0.00 ? 137 LEU B HD13 3 
ATOM 8383  H HD21 . LEU B 1 74 ? -11.620 6.746   -55.270 1.00 0.00 ? 137 LEU B HD21 3 
ATOM 8384  H HD22 . LEU B 1 74 ? -11.063 5.165   -55.811 1.00 0.00 ? 137 LEU B HD22 3 
ATOM 8385  H HD23 . LEU B 1 74 ? -11.908 5.328   -54.258 1.00 0.00 ? 137 LEU B HD23 3 
ATOM 8386  N N    . SER B 1 75 ? -11.271 7.239   -59.693 1.00 0.00 ? 138 SER B N    3 
ATOM 8387  C CA   . SER B 1 75 ? -10.917 7.282   -61.105 1.00 0.00 ? 138 SER B CA   3 
ATOM 8388  C C    . SER B 1 75 ? -10.623 5.886   -61.643 1.00 0.00 ? 138 SER B C    3 
ATOM 8389  O O    . SER B 1 75 ? -10.709 4.900   -60.913 1.00 0.00 ? 138 SER B O    3 
ATOM 8390  C CB   . SER B 1 75 ? -9.709  8.177   -61.313 1.00 0.00 ? 138 SER B CB   3 
ATOM 8391  O OG   . SER B 1 75 ? -8.528  7.521   -60.941 1.00 0.00 ? 138 SER B OG   3 
ATOM 8392  H H    . SER B 1 75 ? -10.560 6.969   -59.013 1.00 0.00 ? 138 SER B H    3 
ATOM 8393  H HA   . SER B 1 75 ? -11.752 7.696   -61.678 1.00 0.00 ? 138 SER B HA   3 
ATOM 8394  H HB2  . SER B 1 75 ? -9.635  8.454   -62.364 1.00 0.00 ? 138 SER B HB2  3 
ATOM 8395  H HB3  . SER B 1 75 ? -9.834  9.084   -60.717 1.00 0.00 ? 138 SER B HB3  3 
ATOM 8396  H HG   . SER B 1 75 ? -8.149  7.122   -61.729 1.00 0.00 ? 138 SER B HG   3 
ATOM 8397  N N    . SER B 1 76 ? -10.276 5.812   -62.922 1.00 0.00 ? 139 SER B N    3 
ATOM 8398  C CA   . SER B 1 76 ? -9.886  4.550   -63.539 1.00 0.00 ? 139 SER B CA   3 
ATOM 8399  C C    . SER B 1 76 ? -8.544  4.068   -63.003 1.00 0.00 ? 139 SER B C    3 
ATOM 8400  O O    . SER B 1 76 ? -8.192  2.897   -63.149 1.00 0.00 ? 139 SER B O    3 
ATOM 8401  C CB   . SER B 1 76 ? -9.814  4.704   -65.047 1.00 0.00 ? 139 SER B CB   3 
ATOM 8402  O OG   . SER B 1 76 ? -8.756  5.547   -65.414 1.00 0.00 ? 139 SER B OG   3 
ATOM 8403  H H    . SER B 1 76 ? -10.213 6.670   -63.471 1.00 0.00 ? 139 SER B H    3 
ATOM 8404  H HA   . SER B 1 76 ? -10.647 3.807   -63.297 1.00 0.00 ? 139 SER B HA   3 
ATOM 8405  H HB2  . SER B 1 76 ? -9.657  3.730   -65.499 1.00 0.00 ? 139 SER B HB2  3 
ATOM 8406  H HB3  . SER B 1 76 ? -10.758 5.118   -65.410 1.00 0.00 ? 139 SER B HB3  3 
ATOM 8407  H HG   . SER B 1 76 ? -8.348  5.868   -64.607 1.00 0.00 ? 139 SER B HG   3 
ATOM 8408  N N    . ASP B 1 77 ? -7.798  4.978   -62.385 1.00 0.00 ? 140 ASP B N    3 
ATOM 8409  C CA   . ASP B 1 77 ? -6.503  4.641   -61.805 1.00 0.00 ? 140 ASP B CA   3 
ATOM 8410  C C    . ASP B 1 77 ? -6.623  4.376   -60.310 1.00 0.00 ? 140 ASP B C    3 
ATOM 8411  O O    . ASP B 1 77 ? -5.661  3.961   -59.664 1.00 0.00 ? 140 ASP B O    3 
ATOM 8412  C CB   . ASP B 1 77 ? -5.496  5.767   -62.050 1.00 0.00 ? 140 ASP B CB   3 
ATOM 8413  C CG   . ASP B 1 77 ? -5.148  5.940   -63.524 1.00 0.00 ? 140 ASP B CG   3 
ATOM 8414  O OD1  . ASP B 1 77 ? -5.213  4.974   -64.247 1.00 0.00 ? 140 ASP B OD1  3 
ATOM 8415  O OD2  . ASP B 1 77 ? -4.821  7.036   -63.909 1.00 0.00 ? 140 ASP B OD2  3 
ATOM 8416  H H    . ASP B 1 77 ? -8.148  5.931   -62.293 1.00 0.00 ? 140 ASP B H    3 
ATOM 8417  H HA   . ASP B 1 77 ? -6.118  3.738   -62.286 1.00 0.00 ? 140 ASP B HA   3 
ATOM 8418  H HB2  . ASP B 1 77 ? -5.923  6.699   -61.679 1.00 0.00 ? 140 ASP B HB2  3 
ATOM 8419  H HB3  . ASP B 1 77 ? -4.581  5.552   -61.496 1.00 0.00 ? 140 ASP B HB3  3 
ATOM 8420  N N    . GLY B 1 78 ? -7.809  4.616   -59.764 1.00 0.00 ? 141 GLY B N    3 
ATOM 8421  C CA   . GLY B 1 78 ? -8.057  4.410   -58.343 1.00 0.00 ? 141 GLY B CA   3 
ATOM 8422  C C    . GLY B 1 78 ? -7.733  5.663   -57.538 1.00 0.00 ? 141 GLY B C    3 
ATOM 8423  O O    . GLY B 1 78 ? -7.426  5.585   -56.349 1.00 0.00 ? 141 GLY B O    3 
ATOM 8424  H H    . GLY B 1 78 ? -8.565  4.958   -60.359 1.00 0.00 ? 141 GLY B H    3 
ATOM 8425  H HA2  . GLY B 1 78 ? -9.119  4.196   -58.215 1.00 0.00 ? 141 GLY B HA2  3 
ATOM 8426  H HA3  . GLY B 1 78 ? -7.498  3.557   -57.992 1.00 0.00 ? 141 GLY B HA3  3 
ATOM 8427  N N    . VAL B 1 79 ? -7.804  6.815   -58.196 1.00 0.00 ? 142 VAL B N    3 
ATOM 8428  C CA   . VAL B 1 79 ? -7.534  8.090   -57.540 1.00 0.00 ? 142 VAL B CA   3 
ATOM 8429  C C    . VAL B 1 79 ? -8.748  8.575   -56.759 1.00 0.00 ? 142 VAL B C    3 
ATOM 8430  O O    . VAL B 1 79 ? -9.715  9.066   -57.337 1.00 0.00 ? 142 VAL B O    3 
ATOM 8431  C CB   . VAL B 1 79 ? -7.137  9.153   -58.581 1.00 0.00 ? 142 VAL B CB   3 
ATOM 8432  C CG1  . VAL B 1 79 ? -6.893  10.493  -57.906 1.00 0.00 ? 142 VAL B CG1  3 
ATOM 8433  C CG2  . VAL B 1 79 ? -5.901  8.698   -59.342 1.00 0.00 ? 142 VAL B CG2  3 
ATOM 8434  H H    . VAL B 1 79 ? -8.074  6.812   -59.180 1.00 0.00 ? 142 VAL B H    3 
ATOM 8435  H HA   . VAL B 1 79 ? -6.699  7.964   -56.849 1.00 0.00 ? 142 VAL B HA   3 
ATOM 8436  H HB   . VAL B 1 79 ? -7.966  9.266   -59.281 1.00 0.00 ? 142 VAL B HB   3 
ATOM 8437  H HG11 . VAL B 1 79 ? -6.241  10.347  -57.046 1.00 0.00 ? 142 VAL B HG11 3 
ATOM 8438  H HG12 . VAL B 1 79 ? -7.841  10.918  -57.576 1.00 0.00 ? 142 VAL B HG12 3 
ATOM 8439  H HG13 . VAL B 1 79 ? -6.417  11.176  -58.612 1.00 0.00 ? 142 VAL B HG13 3 
ATOM 8440  H HG21 . VAL B 1 79 ? -5.014  8.999   -58.793 1.00 0.00 ? 142 VAL B HG21 3 
ATOM 8441  H HG22 . VAL B 1 79 ? -5.903  7.613   -59.466 1.00 0.00 ? 142 VAL B HG22 3 
ATOM 8442  H HG23 . VAL B 1 79 ? -5.886  9.168   -60.327 1.00 0.00 ? 142 VAL B HG23 3 
ATOM 8443  N N    . LEU B 1 80 ? -8.689  8.433   -55.438 1.00 0.00 ? 143 LEU B N    3 
ATOM 8444  C CA   . LEU B 1 80 ? -9.771  8.885   -54.571 1.00 0.00 ? 143 LEU B CA   3 
ATOM 8445  C C    . LEU B 1 80 ? -9.591  10.347  -54.183 1.00 0.00 ? 143 LEU B C    3 
ATOM 8446  O O    . LEU B 1 80 ? -8.580  10.721  -53.588 1.00 0.00 ? 143 LEU B O    3 
ATOM 8447  C CB   . LEU B 1 80 ? -9.837  8.017   -53.308 1.00 0.00 ? 143 LEU B CB   3 
ATOM 8448  C CG   . LEU B 1 80 ? -10.865 8.449   -52.256 1.00 0.00 ? 143 LEU B CG   3 
ATOM 8449  C CD1  . LEU B 1 80 ? -12.268 8.307   -52.831 1.00 0.00 ? 143 LEU B CD1  3 
ATOM 8450  C CD2  . LEU B 1 80 ? -10.696 7.602   -51.004 1.00 0.00 ? 143 LEU B CD2  3 
ATOM 8451  H H    . LEU B 1 80 ? -7.856  8.022   -55.017 1.00 0.00 ? 143 LEU B H    3 
ATOM 8452  H HA   . LEU B 1 80 ? -10.703 8.790   -55.099 1.00 0.00 ? 143 LEU B HA   3 
ATOM 8453  H HB2  . LEU B 1 80 ? -10.090 7.026   -53.619 1.00 0.00 ? 143 LEU B HB2  3 
ATOM 8454  H HB3  . LEU B 1 80 ? -8.852  8.005   -52.855 1.00 0.00 ? 143 LEU B HB3  3 
ATOM 8455  H HG   . LEU B 1 80 ? -10.696 9.485   -52.011 1.00 0.00 ? 143 LEU B HG   3 
ATOM 8456  H HD11 . LEU B 1 80 ? -12.383 7.333   -53.276 1.00 0.00 ? 143 LEU B HD11 3 
ATOM 8457  H HD12 . LEU B 1 80 ? -12.462 9.081   -53.572 1.00 0.00 ? 143 LEU B HD12 3 
ATOM 8458  H HD13 . LEU B 1 80 ? -12.978 8.401   -52.015 1.00 0.00 ? 143 LEU B HD13 3 
ATOM 8459  H HD21 . LEU B 1 80 ? -9.664  7.637   -50.664 1.00 0.00 ? 143 LEU B HD21 3 
ATOM 8460  H HD22 . LEU B 1 80 ? -10.971 6.570   -51.228 1.00 0.00 ? 143 LEU B HD22 3 
ATOM 8461  H HD23 . LEU B 1 80 ? -11.351 7.987   -50.228 1.00 0.00 ? 143 LEU B HD23 3 
ATOM 8462  N N    . THR B 1 81 ? -10.578 11.169  -54.520 1.00 0.00 ? 144 THR B N    3 
ATOM 8463  C CA   . THR B 1 81 ? -10.537 12.589  -54.193 1.00 0.00 ? 144 THR B CA   3 
ATOM 8464  C C    . THR B 1 81 ? -11.863 13.057  -53.602 1.00 0.00 ? 144 THR B C    3 
ATOM 8465  O O    . THR B 1 81 ? -12.901 13.005  -54.265 1.00 0.00 ? 144 THR B O    3 
ATOM 8466  C CB   . THR B 1 81 ? -10.196 13.436  -55.433 1.00 0.00 ? 144 THR B CB   3 
ATOM 8467  O OG1  . THR B 1 81 ? -8.920  13.039  -55.950 1.00 0.00 ? 144 THR B OG1  3 
ATOM 8468  C CG2  . THR B 1 81 ? -10.158 14.914  -55.075 1.00 0.00 ? 144 THR B CG2  3 
ATOM 8469  H H    . THR B 1 81 ? -11.394 10.796  -55.003 1.00 0.00 ? 144 THR B H    3 
ATOM 8470  H HA   . THR B 1 81 ? -9.767  12.758  -53.449 1.00 0.00 ? 144 THR B HA   3 
ATOM 8471  H HB   . THR B 1 81 ? -10.956 13.275  -56.196 1.00 0.00 ? 144 THR B HB   3 
ATOM 8472  H HG1  . THR B 1 81 ? -8.475  13.827  -56.272 1.00 0.00 ? 144 THR B HG1  3 
ATOM 8473  H HG21 . THR B 1 81 ? -9.568  15.050  -54.170 1.00 0.00 ? 144 THR B HG21 3 
ATOM 8474  H HG22 . THR B 1 81 ? -11.173 15.272  -54.905 1.00 0.00 ? 144 THR B HG22 3 
ATOM 8475  H HG23 . THR B 1 81 ? -9.705  15.477  -55.889 1.00 0.00 ? 144 THR B HG23 3 
ATOM 8476  N N    . VAL B 1 82 ? -11.822 13.512  -52.355 1.00 0.00 ? 145 VAL B N    3 
ATOM 8477  C CA   . VAL B 1 82 ? -12.996 14.091  -51.713 1.00 0.00 ? 145 VAL B CA   3 
ATOM 8478  C C    . VAL B 1 82 ? -12.824 15.590  -51.503 1.00 0.00 ? 145 VAL B C    3 
ATOM 8479  O O    . VAL B 1 82 ? -11.770 16.049  -51.062 1.00 0.00 ? 145 VAL B O    3 
ATOM 8480  C CB   . VAL B 1 82 ? -13.251 13.411  -50.354 1.00 0.00 ? 145 VAL B CB   3 
ATOM 8481  C CG1  . VAL B 1 82 ? -12.045 13.574  -49.442 1.00 0.00 ? 145 VAL B CG1  3 
ATOM 8482  C CG2  . VAL B 1 82 ? -14.498 13.998  -49.708 1.00 0.00 ? 145 VAL B CG2  3 
ATOM 8483  H H    . VAL B 1 82 ? -10.924 13.538  -51.871 1.00 0.00 ? 145 VAL B H    3 
ATOM 8484  H HA   . VAL B 1 82 ? -13.864 13.969  -52.339 1.00 0.00 ? 145 VAL B HA   3 
ATOM 8485  H HB   . VAL B 1 82 ? -13.393 12.358  -50.527 1.00 0.00 ? 145 VAL B HB   3 
ATOM 8486  H HG11 . VAL B 1 82 ? -11.971 14.608  -49.115 1.00 0.00 ? 145 VAL B HG11 3 
ATOM 8487  H HG12 . VAL B 1 82 ? -11.151 13.278  -49.988 1.00 0.00 ? 145 VAL B HG12 3 
ATOM 8488  H HG13 . VAL B 1 82 ? -12.159 12.925  -48.581 1.00 0.00 ? 145 VAL B HG13 3 
ATOM 8489  H HG21 . VAL B 1 82 ? -15.292 14.100  -50.449 1.00 0.00 ? 145 VAL B HG21 3 
ATOM 8490  H HG22 . VAL B 1 82 ? -14.257 14.974  -49.294 1.00 0.00 ? 145 VAL B HG22 3 
ATOM 8491  H HG23 . VAL B 1 82 ? -14.833 13.338  -48.908 1.00 0.00 ? 145 VAL B HG23 3 
ATOM 8492  N N    . ASP B 1 83 ? -13.866 16.350  -51.823 1.00 0.00 ? 146 ASP B N    3 
ATOM 8493  C CA   . ASP B 1 83 ? -13.741 17.794  -51.983 1.00 0.00 ? 146 ASP B CA   3 
ATOM 8494  C C    . ASP B 1 83 ? -15.102 18.476  -51.910 1.00 0.00 ? 146 ASP B C    3 
ATOM 8495  O O    . ASP B 1 83 ? -16.100 17.941  -52.394 1.00 0.00 ? 146 ASP B O    3 
ATOM 8496  C CB   . ASP B 1 83 ? -13.065 18.129  -53.314 1.00 0.00 ? 146 ASP B CB   3 
ATOM 8497  C CG   . ASP B 1 83 ? -13.898 17.722  -54.521 1.00 0.00 ? 146 ASP B CG   3 
ATOM 8498  O OD1  . ASP B 1 83 ? -15.102 17.751  -54.425 1.00 0.00 ? 146 ASP B OD1  3 
ATOM 8499  O OD2  . ASP B 1 83 ? -13.324 17.384  -55.529 1.00 0.00 ? 146 ASP B OD2  3 
ATOM 8500  H H    . ASP B 1 83 ? -14.682 15.893  -52.225 1.00 0.00 ? 146 ASP B H    3 
ATOM 8501  H HA   . ASP B 1 83 ? -13.118 18.166  -51.173 1.00 0.00 ? 146 ASP B HA   3 
ATOM 8502  H HB2  . ASP B 1 83 ? -12.869 19.195  -53.369 1.00 0.00 ? 146 ASP B HB2  3 
ATOM 8503  H HB3  . ASP B 1 83 ? -12.123 17.587  -53.370 1.00 0.00 ? 146 ASP B HB3  3 
ATOM 8504  N N    . GLY B 1 84 ? -15.134 19.658  -51.306 1.00 0.00 ? 147 GLY B N    3 
ATOM 8505  C CA   . GLY B 1 84 ? -16.386 20.371  -51.085 1.00 0.00 ? 147 GLY B CA   3 
ATOM 8506  C C    . GLY B 1 84 ? -16.131 21.821  -50.689 1.00 0.00 ? 147 GLY B C    3 
ATOM 8507  O O    . GLY B 1 84 ? -15.122 22.133  -50.056 1.00 0.00 ? 147 GLY B O    3 
ATOM 8508  H H    . GLY B 1 84 ? -14.273 20.032  -50.908 1.00 0.00 ? 147 GLY B H    3 
ATOM 8509  H HA2  . GLY B 1 84 ? -16.950 20.296  -51.996 1.00 0.00 ? 147 GLY B HA2  3 
ATOM 8510  H HA3  . GLY B 1 84 ? -16.949 19.909  -50.283 1.00 0.00 ? 147 GLY B HA3  3 
ATOM 8511  N N    . PRO B 1 85 ? -17.052 22.702  -51.065 1.00 0.00 ? 148 PRO B N    3 
ATOM 8512  C CA   . PRO B 1 85 ? -16.901 24.128  -50.795 1.00 0.00 ? 148 PRO B CA   3 
ATOM 8513  C C    . PRO B 1 85 ? -16.713 24.392  -49.308 1.00 0.00 ? 148 PRO B C    3 
ATOM 8514  O O    . PRO B 1 85 ? -17.262 23.678  -48.468 1.00 0.00 ? 148 PRO B O    3 
ATOM 8515  C CB   . PRO B 1 85 ? -18.218 24.716  -51.315 1.00 0.00 ? 148 PRO B CB   3 
ATOM 8516  C CG   . PRO B 1 85 ? -18.635 23.781  -52.399 1.00 0.00 ? 148 PRO B CG   3 
ATOM 8517  C CD   . PRO B 1 85 ? -18.242 22.419  -51.889 1.00 0.00 ? 148 PRO B CD   3 
ATOM 8518  H HA   . PRO B 1 85 ? -16.070 24.545  -51.359 1.00 0.00 ? 148 PRO B HA   3 
ATOM 8519  H HB2  . PRO B 1 85 ? -18.969 24.744  -50.517 1.00 0.00 ? 148 PRO B HB2  3 
ATOM 8520  H HB3  . PRO B 1 85 ? -18.057 25.717  -51.718 1.00 0.00 ? 148 PRO B HB3  3 
ATOM 8521  H HG2  . PRO B 1 85 ? -19.718 23.838  -52.551 1.00 0.00 ? 148 PRO B HG2  3 
ATOM 8522  H HG3  . PRO B 1 85 ? -18.107 24.010  -53.326 1.00 0.00 ? 148 PRO B HG3  3 
ATOM 8523  H HD2  . PRO B 1 85 ? -19.013 21.991  -51.287 1.00 0.00 ? 148 PRO B HD2  3 
ATOM 8524  H HD3  . PRO B 1 85 ? -18.007 21.787  -52.734 1.00 0.00 ? 148 PRO B HD3  3 
ATOM 8525  N N    . ARG B 1 86 ? -15.939 25.422  -48.989 1.00 0.00 ? 149 ARG B N    3 
ATOM 8526  C CA   . ARG B 1 86 ? -15.793 25.871  -47.610 1.00 0.00 ? 149 ARG B CA   3 
ATOM 8527  C C    . ARG B 1 86 ? -17.134 26.278  -47.018 1.00 0.00 ? 149 ARG B C    3 
ATOM 8528  O O    . ARG B 1 86 ? -18.139 26.355  -47.725 1.00 0.00 ? 149 ARG B O    3 
ATOM 8529  C CB   . ARG B 1 86 ? -14.829 27.046  -47.528 1.00 0.00 ? 149 ARG B CB   3 
ATOM 8530  C CG   . ARG B 1 86 ? -13.364 26.687  -47.723 1.00 0.00 ? 149 ARG B CG   3 
ATOM 8531  C CD   . ARG B 1 86 ? -12.483 27.870  -47.562 1.00 0.00 ? 149 ARG B CD   3 
ATOM 8532  N NE   . ARG B 1 86 ? -12.682 28.525  -46.278 1.00 0.00 ? 149 ARG B NE   3 
ATOM 8533  C CZ   . ARG B 1 86 ? -11.953 29.565  -45.829 1.00 0.00 ? 149 ARG B CZ   3 
ATOM 8534  N NH1  . ARG B 1 86 ? -10.980 30.056  -46.567 1.00 0.00 ? 149 ARG B NH1  3 
ATOM 8535  N NH2  . ARG B 1 86 ? -12.211 30.090  -44.644 1.00 0.00 ? 149 ARG B NH2  3 
ATOM 8536  H H    . ARG B 1 86 ? -15.534 25.987  -49.735 1.00 0.00 ? 149 ARG B H    3 
ATOM 8537  H HA   . ARG B 1 86 ? -15.373 25.053  -47.067 1.00 0.00 ? 149 ARG B HA   3 
ATOM 8538  H HB2  . ARG B 1 86 ? -15.105 27.764  -48.299 1.00 0.00 ? 149 ARG B HB2  3 
ATOM 8539  H HB3  . ARG B 1 86 ? -14.936 27.522  -46.550 1.00 0.00 ? 149 ARG B HB3  3 
ATOM 8540  H HG2  . ARG B 1 86 ? -13.091 25.954  -46.976 1.00 0.00 ? 149 ARG B HG2  3 
ATOM 8541  H HG3  . ARG B 1 86 ? -13.230 26.262  -48.717 1.00 0.00 ? 149 ARG B HG3  3 
ATOM 8542  H HD2  . ARG B 1 86 ? -11.444 27.560  -47.633 1.00 0.00 ? 149 ARG B HD2  3 
ATOM 8543  H HD3  . ARG B 1 86 ? -12.692 28.582  -48.349 1.00 0.00 ? 149 ARG B HD3  3 
ATOM 8544  H HE   . ARG B 1 86 ? -13.396 28.183  -45.700 1.00 0.00 ? 149 ARG B HE   3 
ATOM 8545  H HH11 . ARG B 1 86 ? -10.783 29.659  -47.462 1.00 0.00 ? 149 ARG B HH11 3 
ATOM 8546  H HH12 . ARG B 1 86 ? -10.433 30.834  -46.228 1.00 0.00 ? 149 ARG B HH12 3 
ATOM 8547  H HH21 . ARG B 1 86 ? -12.948 29.719  -44.080 1.00 0.00 ? 149 ARG B HH21 3 
ATOM 8548  H HH22 . ARG B 1 86 ? -11.669 30.862  -44.315 1.00 0.00 ? 149 ARG B HH22 3 
ATOM 8549  N N    . LYS B 1 87 ? -17.148 26.540  -45.714 1.00 0.00 ? 150 LYS B N    3 
ATOM 8550  C CA   . LYS B 1 87 ? -18.298 27.162  -45.069 1.00 0.00 ? 150 LYS B CA   3 
ATOM 8551  C C    . LYS B 1 87 ? -18.352 28.655  -45.359 1.00 0.00 ? 150 LYS B C    3 
ATOM 8552  O O    . LYS B 1 87 ? -19.414 29.275  -45.280 1.00 0.00 ? 150 LYS B O    3 
ATOM 8553  C CB   . LYS B 1 87 ? -18.260 26.921  -43.558 1.00 0.00 ? 150 LYS B CB   3 
ATOM 8554  C CG   . LYS B 1 87 ? -18.545 25.484  -43.142 1.00 0.00 ? 150 LYS B CG   3 
ATOM 8555  C CD   . LYS B 1 87 ? -18.371 25.297  -41.645 1.00 0.00 ? 150 LYS B CD   3 
ATOM 8556  C CE   . LYS B 1 87 ? -18.785 23.898  -41.207 1.00 0.00 ? 150 LYS B CE   3 
ATOM 8557  N NZ   . LYS B 1 87 ? -18.624 23.703  -39.741 1.00 0.00 ? 150 LYS B NZ   3 
ATOM 8558  H H    . LYS B 1 87 ? -16.273 26.491  -45.199 1.00 0.00 ? 150 LYS B H    3 
ATOM 8559  H HA   . LYS B 1 87 ? -19.199 26.688  -45.466 1.00 0.00 ? 150 LYS B HA   3 
ATOM 8560  H HB2  . LYS B 1 87 ? -17.265 27.188  -43.200 1.00 0.00 ? 150 LYS B HB2  3 
ATOM 8561  H HB3  . LYS B 1 87 ? -18.992 27.572  -43.077 1.00 0.00 ? 150 LYS B HB3  3 
ATOM 8562  H HG2  . LYS B 1 87 ? -19.571 25.237  -43.416 1.00 0.00 ? 150 LYS B HG2  3 
ATOM 8563  H HG3  . LYS B 1 87 ? -17.863 24.821  -43.667 1.00 0.00 ? 150 LYS B HG3  3 
ATOM 8564  H HD2  . LYS B 1 87 ? -17.325 25.456  -41.385 1.00 0.00 ? 150 LYS B HD2  3 
ATOM 8565  H HD3  . LYS B 1 87 ? -18.987 26.029  -41.119 1.00 0.00 ? 150 LYS B HD3  3 
ATOM 8566  H HE2  . LYS B 1 87 ? -19.827 23.733  -41.476 1.00 0.00 ? 150 LYS B HE2  3 
ATOM 8567  H HE3  . LYS B 1 87 ? -18.162 23.174  -41.725 1.00 0.00 ? 150 LYS B HE3  3 
ATOM 8568  H HZ1  . LYS B 1 87 ? -19.477 23.255  -39.352 1.00 0.00 ? 150 LYS B HZ1  3 
ATOM 8569  H HZ2  . LYS B 1 87 ? -18.481 24.630  -39.289 1.00 0.00 ? 150 LYS B HZ2  3 
ATOM 8570  H HZ3  . LYS B 1 87 ? -17.822 23.114  -39.565 1.00 0.00 ? 150 LYS B HZ3  3 
ATOM 8571  N N    . GLN B 1 88 ? -17.203 29.230  -45.695 1.00 0.00 ? 151 GLN B N    3 
ATOM 8572  C CA   . GLN B 1 88 ? -17.117 30.653  -46.004 1.00 0.00 ? 151 GLN B CA   3 
ATOM 8573  C C    . GLN B 1 88 ? -17.197 30.896  -47.505 1.00 0.00 ? 151 GLN B C    3 
ATOM 8574  O O    . GLN B 1 88 ? -17.162 32.040  -47.962 1.00 0.00 ? 151 GLN B O    3 
ATOM 8575  C CB   . GLN B 1 88 ? -15.821 31.246  -45.445 1.00 0.00 ? 151 GLN B CB   3 
ATOM 8576  C CG   . GLN B 1 88 ? -15.680 31.123  -43.938 1.00 0.00 ? 151 GLN B CG   3 
ATOM 8577  C CD   . GLN B 1 88 ? -16.791 31.841  -43.193 1.00 0.00 ? 151 GLN B CD   3 
ATOM 8578  O OE1  . GLN B 1 88 ? -17.059 33.021  -43.432 1.00 0.00 ? 151 GLN B OE1  3 
ATOM 8579  N NE2  . GLN B 1 88 ? -17.446 31.127  -42.282 1.00 0.00 ? 151 GLN B NE2  3 
ATOM 8580  H H    . GLN B 1 88 ? -16.357 28.662  -45.744 1.00 0.00 ? 151 GLN B H    3 
ATOM 8581  H HA   . GLN B 1 88 ? -17.953 31.172  -45.529 1.00 0.00 ? 151 GLN B HA   3 
ATOM 8582  H HB2  . GLN B 1 88 ? -14.980 30.742  -45.919 1.00 0.00 ? 151 GLN B HB2  3 
ATOM 8583  H HB3  . GLN B 1 88 ? -15.788 32.305  -45.709 1.00 0.00 ? 151 GLN B HB3  3 
ATOM 8584  H HG2  . GLN B 1 88 ? -15.703 30.066  -43.675 1.00 0.00 ? 151 GLN B HG2  3 
ATOM 8585  H HG3  . GLN B 1 88 ? -14.721 31.542  -43.631 1.00 0.00 ? 151 GLN B HG3  3 
ATOM 8586  H HE21 . GLN B 1 88 ? -17.196 30.153  -42.106 1.00 0.00 ? 151 GLN B HE21 3 
ATOM 8587  H HE22 . GLN B 1 88 ? -18.203 31.562  -41.757 1.00 0.00 ? 151 GLN B HE22 3 
ATOM 8588  N N    . VAL B 1 89 ? -17.303 29.815  -48.270 1.00 0.00 ? 152 VAL B N    3 
ATOM 8589  C CA   . VAL B 1 89 ? -17.426 29.912  -49.719 1.00 0.00 ? 152 VAL B CA   3 
ATOM 8590  C C    . VAL B 1 89 ? -18.326 31.074  -50.120 1.00 0.00 ? 152 VAL B C    3 
ATOM 8591  O O    . VAL B 1 89 ? -19.356 31.242  -49.488 1.00 0.00 ? 152 VAL B O    3 
ATOM 8592  C CB   . VAL B 1 89 ? -18.000 28.602  -50.295 1.00 0.00 ? 152 VAL B CB   3 
ATOM 8593  C CG1  . VAL B 1 89 ? -19.421 28.381  -49.801 1.00 0.00 ? 152 VAL B CG1  3 
ATOM 8594  C CG2  . VAL B 1 89 ? -17.959 28.644  -51.813 1.00 0.00 ? 152 VAL B CG2  3 
ATOM 8595  O OXT  . VAL B 1 89 ? -17.943 31.817  -51.010 1.00 0.00 ? 152 VAL B OXT  3 
ATOM 8596  H H    . VAL B 1 89 ? -17.337 28.896  -47.829 1.00 0.00 ? 152 VAL B H    3 
ATOM 8597  H HA   . VAL B 1 89 ? -16.434 30.074  -50.140 1.00 0.00 ? 152 VAL B HA   3 
ATOM 8598  H HB   . VAL B 1 89 ? -17.384 27.772  -49.944 1.00 0.00 ? 152 VAL B HB   3 
ATOM 8599  H HG11 . VAL B 1 89 ? -19.741 27.367  -50.045 1.00 0.00 ? 152 VAL B HG11 3 
ATOM 8600  H HG12 . VAL B 1 89 ? -20.084 29.099  -50.282 1.00 0.00 ? 152 VAL B HG12 3 
ATOM 8601  H HG13 . VAL B 1 89 ? -19.456 28.521  -48.720 1.00 0.00 ? 152 VAL B HG13 3 
ATOM 8602  H HG21 . VAL B 1 89 ? -16.976 28.334  -52.163 1.00 0.00 ? 152 VAL B HG21 3 
ATOM 8603  H HG22 . VAL B 1 89 ? -18.173 29.643  -52.185 1.00 0.00 ? 152 VAL B HG22 3 
ATOM 8604  H HG23 . VAL B 1 89 ? -18.703 27.951  -52.215 1.00 0.00 ? 152 VAL B HG23 3 
ATOM 8605  N N    . GLY A 1 1  ? 14.465  -6.083  -54.192 1.00 0.00 ? 64  GLY A N    4 
ATOM 8606  C CA   . GLY A 1 1  ? 13.461  -7.104  -53.918 1.00 0.00 ? 64  GLY A CA   4 
ATOM 8607  C C    . GLY A 1 1  ? 12.483  -6.641  -52.846 1.00 0.00 ? 64  GLY A C    4 
ATOM 8608  O O    . GLY A 1 1  ? 12.835  -5.853  -51.969 1.00 0.00 ? 64  GLY A O    4 
ATOM 8609  H H1   . GLY A 1 1  ? 14.047  -5.335  -54.726 1.00 0.00 ? 64  GLY A H1   4 
ATOM 8610  H H2   . GLY A 1 1  ? 14.830  -5.706  -53.293 1.00 0.00 ? 64  GLY A H2   4 
ATOM 8611  H H3   . GLY A 1 1  ? 15.245  -6.504  -54.735 1.00 0.00 ? 64  GLY A H3   4 
ATOM 8612  H HA2  . GLY A 1 1  ? 12.912  -7.317  -54.834 1.00 0.00 ? 64  GLY A HA2  4 
ATOM 8613  H HA3  . GLY A 1 1  ? 13.959  -8.012  -53.580 1.00 0.00 ? 64  GLY A HA3  4 
ATOM 8614  N N    . LEU A 1 2  ? 11.252  -7.135  -52.923 1.00 0.00 ? 65  LEU A N    4 
ATOM 8615  C CA   . LEU A 1 2  ? 10.220  -6.773  -51.959 1.00 0.00 ? 65  LEU A CA   4 
ATOM 8616  C C    . LEU A 1 2  ? 10.213  -7.728  -50.773 1.00 0.00 ? 65  LEU A C    4 
ATOM 8617  O O    . LEU A 1 2  ? 9.615   -7.442  -49.735 1.00 0.00 ? 65  LEU A O    4 
ATOM 8618  C CB   . LEU A 1 2  ? 8.842   -6.775  -52.632 1.00 0.00 ? 65  LEU A CB   4 
ATOM 8619  C CG   . LEU A 1 2  ? 8.661   -5.777  -53.784 1.00 0.00 ? 65  LEU A CG   4 
ATOM 8620  C CD1  . LEU A 1 2  ? 7.267   -5.928  -54.374 1.00 0.00 ? 65  LEU A CD1  4 
ATOM 8621  C CD2  . LEU A 1 2  ? 8.887   -4.363  -53.268 1.00 0.00 ? 65  LEU A CD2  4 
ATOM 8622  H H    . LEU A 1 2  ? 11.020  -7.781  -53.677 1.00 0.00 ? 65  LEU A H    4 
ATOM 8623  H HA   . LEU A 1 2  ? 10.409  -5.763  -51.592 1.00 0.00 ? 65  LEU A HA   4 
ATOM 8624  H HB2  . LEU A 1 2  ? 8.652   -7.775  -53.016 1.00 0.00 ? 65  LEU A HB2  4 
ATOM 8625  H HB3  . LEU A 1 2  ? 8.123   -6.558  -51.879 1.00 0.00 ? 65  LEU A HB3  4 
ATOM 8626  H HG   . LEU A 1 2  ? 9.396   -6.002  -54.560 1.00 0.00 ? 65  LEU A HG   4 
ATOM 8627  H HD11 . LEU A 1 2  ? 7.085   -6.972  -54.633 1.00 0.00 ? 65  LEU A HD11 4 
ATOM 8628  H HD12 . LEU A 1 2  ? 7.183   -5.311  -55.269 1.00 0.00 ? 65  LEU A HD12 4 
ATOM 8629  H HD13 . LEU A 1 2  ? 6.529   -5.605  -53.640 1.00 0.00 ? 65  LEU A HD13 4 
ATOM 8630  H HD21 . LEU A 1 2  ? 9.954   -4.140  -53.271 1.00 0.00 ? 65  LEU A HD21 4 
ATOM 8631  H HD22 . LEU A 1 2  ? 8.508   -4.260  -52.257 1.00 0.00 ? 65  LEU A HD22 4 
ATOM 8632  H HD23 . LEU A 1 2  ? 8.376   -3.652  -53.920 1.00 0.00 ? 65  LEU A HD23 4 
ATOM 8633  N N    . SER A 1 3  ? 10.882  -8.866  -50.932 1.00 0.00 ? 66  SER A N    4 
ATOM 8634  C CA   . SER A 1 3  ? 10.956  -9.866  -49.874 1.00 0.00 ? 66  SER A CA   4 
ATOM 8635  C C    . SER A 1 3  ? 11.930  -9.442  -48.783 1.00 0.00 ? 66  SER A C    4 
ATOM 8636  O O    . SER A 1 3  ? 12.790  -8.588  -49.002 1.00 0.00 ? 66  SER A O    4 
ATOM 8637  C CB   . SER A 1 3  ? 11.378  -11.203 -50.449 1.00 0.00 ? 66  SER A CB   4 
ATOM 8638  O OG   . SER A 1 3  ? 12.698  -11.155 -50.918 1.00 0.00 ? 66  SER A OG   4 
ATOM 8639  H H    . SER A 1 3  ? 11.357  -9.044  -51.817 1.00 0.00 ? 66  SER A H    4 
ATOM 8640  H HA   . SER A 1 3  ? 9.966   -9.976  -49.431 1.00 0.00 ? 66  SER A HA   4 
ATOM 8641  H HB2  . SER A 1 3  ? 11.314  -11.965 -49.680 1.00 0.00 ? 66  SER A HB2  4 
ATOM 8642  H HB3  . SER A 1 3  ? 10.707  -11.467 -51.270 1.00 0.00 ? 66  SER A HB3  4 
ATOM 8643  H HG   . SER A 1 3  ? 12.750  -10.461 -51.580 1.00 0.00 ? 66  SER A HG   4 
ATOM 8644  N N    . GLU A 1 4  ? 11.788  -10.041 -47.604 1.00 0.00 ? 67  GLU A N    4 
ATOM 8645  C CA   . GLU A 1 4  ? 12.646  -9.712  -46.470 1.00 0.00 ? 67  GLU A CA   4 
ATOM 8646  C C    . GLU A 1 4  ? 13.349  -10.953 -45.936 1.00 0.00 ? 67  GLU A C    4 
ATOM 8647  O O    . GLU A 1 4  ? 14.229  -10.859 -45.079 1.00 0.00 ? 67  GLU A O    4 
ATOM 8648  C CB   . GLU A 1 4  ? 11.827  -9.058  -45.356 1.00 0.00 ? 67  GLU A CB   4 
ATOM 8649  C CG   . GLU A 1 4  ? 11.126  -7.770  -45.766 1.00 0.00 ? 67  GLU A CG   4 
ATOM 8650  C CD   . GLU A 1 4  ? 12.085  -6.676  -46.147 1.00 0.00 ? 67  GLU A CD   4 
ATOM 8651  O OE1  . GLU A 1 4  ? 13.210  -6.723  -45.713 1.00 0.00 ? 67  GLU A OE1  4 
ATOM 8652  O OE2  . GLU A 1 4  ? 11.691  -5.794  -46.874 1.00 0.00 ? 67  GLU A OE2  4 
ATOM 8653  H H    . GLU A 1 4  ? 11.052  -10.735 -47.483 1.00 0.00 ? 67  GLU A H    4 
ATOM 8654  H HA   . GLU A 1 4  ? 13.415  -9.001  -46.782 1.00 0.00 ? 67  GLU A HA   4 
ATOM 8655  H HB2  . GLU A 1 4  ? 11.081  -9.773  -45.013 1.00 0.00 ? 67  GLU A HB2  4 
ATOM 8656  H HB3  . GLU A 1 4  ? 12.496  -8.825  -44.528 1.00 0.00 ? 67  GLU A HB3  4 
ATOM 8657  H HG2  . GLU A 1 4  ? 10.491  -7.987  -46.625 1.00 0.00 ? 67  GLU A HG2  4 
ATOM 8658  H HG3  . GLU A 1 4  ? 10.498  -7.423  -44.943 1.00 0.00 ? 67  GLU A HG3  4 
ATOM 8659  N N    . MET A 1 5  ? 12.955  -12.117 -46.442 1.00 0.00 ? 68  MET A N    4 
ATOM 8660  C CA   . MET A 1 5  ? 13.582  -13.373 -46.054 1.00 0.00 ? 68  MET A CA   4 
ATOM 8661  C C    . MET A 1 5  ? 14.973  -13.506 -46.661 1.00 0.00 ? 68  MET A C    4 
ATOM 8662  O O    . MET A 1 5  ? 15.139  -13.435 -47.878 1.00 0.00 ? 68  MET A O    4 
ATOM 8663  C CB   . MET A 1 5  ? 12.705  -14.552 -46.469 1.00 0.00 ? 68  MET A CB   4 
ATOM 8664  C CG   . MET A 1 5  ? 13.213  -15.910 -46.007 1.00 0.00 ? 68  MET A CG   4 
ATOM 8665  S SD   . MET A 1 5  ? 12.119  -17.263 -46.487 1.00 0.00 ? 68  MET A SD   4 
ATOM 8666  C CE   . MET A 1 5  ? 10.768  -17.030 -45.335 1.00 0.00 ? 68  MET A CE   4 
ATOM 8667  H H    . MET A 1 5  ? 12.227  -12.126 -47.157 1.00 0.00 ? 68  MET A H    4 
ATOM 8668  H HA   . MET A 1 5  ? 13.688  -13.400 -44.982 1.00 0.00 ? 68  MET A HA   4 
ATOM 8669  H HB2  . MET A 1 5  ? 11.690  -14.393 -46.130 1.00 0.00 ? 68  MET A HB2  4 
ATOM 8670  H HB3  . MET A 1 5  ? 12.695  -14.571 -47.560 1.00 0.00 ? 68  MET A HB3  4 
ATOM 8671  H HG2  . MET A 1 5  ? 14.204  -16.081 -46.418 1.00 0.00 ? 68  MET A HG2  4 
ATOM 8672  H HG3  . MET A 1 5  ? 13.265  -15.877 -44.921 1.00 0.00 ? 68  MET A HG3  4 
ATOM 8673  H HE1  . MET A 1 5  ? 10.854  -16.059 -44.852 1.00 0.00 ? 68  MET A HE1  4 
ATOM 8674  H HE2  . MET A 1 5  ? 10.816  -17.806 -44.573 1.00 0.00 ? 68  MET A HE2  4 
ATOM 8675  H HE3  . MET A 1 5  ? 9.816   -17.092 -45.860 1.00 0.00 ? 68  MET A HE3  4 
ATOM 8676  N N    . ARG A 1 6  ? 15.972  -13.700 -45.805 1.00 0.00 ? 69  ARG A N    4 
ATOM 8677  C CA   . ARG A 1 6  ? 17.333  -13.950 -46.260 1.00 0.00 ? 69  ARG A CA   4 
ATOM 8678  C C    . ARG A 1 6  ? 17.857  -15.279 -45.730 1.00 0.00 ? 69  ARG A C    4 
ATOM 8679  O O    . ARG A 1 6  ? 18.023  -15.453 -44.523 1.00 0.00 ? 69  ARG A O    4 
ATOM 8680  C CB   . ARG A 1 6  ? 18.261  -12.828 -45.816 1.00 0.00 ? 69  ARG A CB   4 
ATOM 8681  C CG   . ARG A 1 6  ? 19.731  -13.052 -46.133 1.00 0.00 ? 69  ARG A CG   4 
ATOM 8682  C CD   . ARG A 1 6  ? 20.570  -11.918 -45.668 1.00 0.00 ? 69  ARG A CD   4 
ATOM 8683  N NE   . ARG A 1 6  ? 21.981  -12.142 -45.939 1.00 0.00 ? 69  ARG A NE   4 
ATOM 8684  C CZ   . ARG A 1 6  ? 22.968  -11.281 -45.619 1.00 0.00 ? 69  ARG A CZ   4 
ATOM 8685  N NH1  . ARG A 1 6  ? 22.681  -10.148 -45.016 1.00 0.00 ? 69  ARG A NH1  4 
ATOM 8686  N NH2  . ARG A 1 6  ? 24.222  -11.576 -45.910 1.00 0.00 ? 69  ARG A NH2  4 
ATOM 8687  H H    . ARG A 1 6  ? 15.764  -13.766 -44.809 1.00 0.00 ? 69  ARG A H    4 
ATOM 8688  H HA   . ARG A 1 6  ? 17.359  -13.990 -47.352 1.00 0.00 ? 69  ARG A HA   4 
ATOM 8689  H HB2  . ARG A 1 6  ? 17.945  -11.903 -46.295 1.00 0.00 ? 69  ARG A HB2  4 
ATOM 8690  H HB3  . ARG A 1 6  ? 18.159  -12.714 -44.735 1.00 0.00 ? 69  ARG A HB3  4 
ATOM 8691  H HG2  . ARG A 1 6  ? 20.075  -13.960 -45.641 1.00 0.00 ? 69  ARG A HG2  4 
ATOM 8692  H HG3  . ARG A 1 6  ? 19.844  -13.157 -47.211 1.00 0.00 ? 69  ARG A HG3  4 
ATOM 8693  H HD2  . ARG A 1 6  ? 20.255  -11.011 -46.181 1.00 0.00 ? 69  ARG A HD2  4 
ATOM 8694  H HD3  . ARG A 1 6  ? 20.433  -11.792 -44.594 1.00 0.00 ? 69  ARG A HD3  4 
ATOM 8695  H HE   . ARG A 1 6  ? 22.230  -12.977 -46.384 1.00 0.00 ? 69  ARG A HE   4 
ATOM 8696  H HH11 . ARG A 1 6  ? 21.732  -9.923  -44.794 1.00 0.00 ? 69  ARG A HH11 4 
ATOM 8697  H HH12 . ARG A 1 6  ? 23.421  -9.503  -44.777 1.00 0.00 ? 69  ARG A HH12 4 
ATOM 8698  H HH21 . ARG A 1 6  ? 24.444  -12.436 -46.368 1.00 0.00 ? 69  ARG A HH21 4 
ATOM 8699  H HH22 . ARG A 1 6  ? 24.953  -10.933 -45.671 1.00 0.00 ? 69  ARG A HH22 4 
ATOM 8700  N N    . LEU A 1 7  ? 18.113  -16.213 -46.638 1.00 0.00 ? 70  LEU A N    4 
ATOM 8701  C CA   . LEU A 1 7  ? 18.642  -17.519 -46.265 1.00 0.00 ? 70  LEU A CA   4 
ATOM 8702  C C    . LEU A 1 7  ? 20.136  -17.446 -45.978 1.00 0.00 ? 70  LEU A C    4 
ATOM 8703  O O    . LEU A 1 7  ? 20.949  -17.331 -46.894 1.00 0.00 ? 70  LEU A O    4 
ATOM 8704  C CB   . LEU A 1 7  ? 18.381  -18.536 -47.385 1.00 0.00 ? 70  LEU A CB   4 
ATOM 8705  C CG   . LEU A 1 7  ? 18.888  -19.959 -47.121 1.00 0.00 ? 70  LEU A CG   4 
ATOM 8706  C CD1  . LEU A 1 7  ? 18.153  -20.547 -45.922 1.00 0.00 ? 70  LEU A CD1  4 
ATOM 8707  C CD2  . LEU A 1 7  ? 18.677  -20.812 -48.363 1.00 0.00 ? 70  LEU A CD2  4 
ATOM 8708  H H    . LEU A 1 7  ? 17.961  -16.003 -47.625 1.00 0.00 ? 70  LEU A H    4 
ATOM 8709  H HA   . LEU A 1 7  ? 18.139  -17.871 -45.387 1.00 0.00 ? 70  LEU A HA   4 
ATOM 8710  H HB2  . LEU A 1 7  ? 17.307  -18.589 -47.558 1.00 0.00 ? 70  LEU A HB2  4 
ATOM 8711  H HB3  . LEU A 1 7  ? 18.859  -18.166 -48.293 1.00 0.00 ? 70  LEU A HB3  4 
ATOM 8712  H HG   . LEU A 1 7  ? 19.953  -19.915 -46.901 1.00 0.00 ? 70  LEU A HG   4 
ATOM 8713  H HD11 . LEU A 1 7  ? 18.279  -21.631 -45.919 1.00 0.00 ? 70  LEU A HD11 4 
ATOM 8714  H HD12 . LEU A 1 7  ? 17.092  -20.307 -45.984 1.00 0.00 ? 70  LEU A HD12 4 
ATOM 8715  H HD13 . LEU A 1 7  ? 18.564  -20.140 -45.005 1.00 0.00 ? 70  LEU A HD13 4 
ATOM 8716  H HD21 . LEU A 1 7  ? 17.610  -20.892 -48.568 1.00 0.00 ? 70  LEU A HD21 4 
ATOM 8717  H HD22 . LEU A 1 7  ? 19.090  -21.808 -48.193 1.00 0.00 ? 70  LEU A HD22 4 
ATOM 8718  H HD23 . LEU A 1 7  ? 19.177  -20.352 -49.217 1.00 0.00 ? 70  LEU A HD23 4 
ATOM 8719  N N    . GLU A 1 8  ? 20.490  -17.509 -44.697 1.00 0.00 ? 71  GLU A N    4 
ATOM 8720  C CA   . GLU A 1 8  ? 21.873  -17.730 -44.295 1.00 0.00 ? 71  GLU A CA   4 
ATOM 8721  C C    . GLU A 1 8  ? 22.317  -19.154 -44.603 1.00 0.00 ? 71  GLU A C    4 
ATOM 8722  O O    . GLU A 1 8  ? 21.557  -19.943 -45.167 1.00 0.00 ? 71  GLU A O    4 
ATOM 8723  C CB   . GLU A 1 8  ? 22.050  -17.442 -42.804 1.00 0.00 ? 71  GLU A CB   4 
ATOM 8724  C CG   . GLU A 1 8  ? 21.746  -16.005 -42.402 1.00 0.00 ? 71  GLU A CG   4 
ATOM 8725  C CD   . GLU A 1 8  ? 22.729  -15.019 -42.965 1.00 0.00 ? 71  GLU A CD   4 
ATOM 8726  O OE1  . GLU A 1 8  ? 23.859  -15.389 -43.174 1.00 0.00 ? 71  GLU A OE1  4 
ATOM 8727  O OE2  . GLU A 1 8  ? 22.349  -13.894 -43.190 1.00 0.00 ? 71  GLU A OE2  4 
ATOM 8728  H H    . GLU A 1 8  ? 19.762  -17.633 -44.005 1.00 0.00 ? 71  GLU A H    4 
ATOM 8729  H HA   . GLU A 1 8  ? 22.494  -17.033 -44.862 1.00 0.00 ? 71  GLU A HA   4 
ATOM 8730  H HB2  . GLU A 1 8  ? 21.395  -18.116 -42.251 1.00 0.00 ? 71  GLU A HB2  4 
ATOM 8731  H HB3  . GLU A 1 8  ? 23.083  -17.656 -42.533 1.00 0.00 ? 71  GLU A HB3  4 
ATOM 8732  H HG2  . GLU A 1 8  ? 20.752  -15.752 -42.770 1.00 0.00 ? 71  GLU A HG2  4 
ATOM 8733  H HG3  . GLU A 1 8  ? 21.749  -15.930 -41.315 1.00 0.00 ? 71  GLU A HG3  4 
ATOM 8734  N N    . LYS A 1 9  ? 23.550  -19.480 -44.230 1.00 0.00 ? 72  LYS A N    4 
ATOM 8735  C CA   . LYS A 1 9  ? 24.125  -20.786 -44.533 1.00 0.00 ? 72  LYS A CA   4 
ATOM 8736  C C    . LYS A 1 9  ? 23.040  -21.847 -44.665 1.00 0.00 ? 72  LYS A C    4 
ATOM 8737  O O    . LYS A 1 9  ? 22.875  -22.452 -45.724 1.00 0.00 ? 72  LYS A O    4 
ATOM 8738  C CB   . LYS A 1 9  ? 25.131  -21.191 -43.455 1.00 0.00 ? 72  LYS A CB   4 
ATOM 8739  C CG   . LYS A 1 9  ? 25.810  -22.533 -43.702 1.00 0.00 ? 72  LYS A CG   4 
ATOM 8740  C CD   . LYS A 1 9  ? 26.830  -22.843 -42.618 1.00 0.00 ? 72  LYS A CD   4 
ATOM 8741  C CE   . LYS A 1 9  ? 27.484  -24.199 -42.842 1.00 0.00 ? 72  LYS A CE   4 
ATOM 8742  N NZ   . LYS A 1 9  ? 28.482  -24.518 -41.786 1.00 0.00 ? 72  LYS A NZ   4 
ATOM 8743  H H    . LYS A 1 9  ? 24.136  -18.777 -43.779 1.00 0.00 ? 72  LYS A H    4 
ATOM 8744  H HA   . LYS A 1 9  ? 24.659  -20.725 -45.480 1.00 0.00 ? 72  LYS A HA   4 
ATOM 8745  H HB2  . LYS A 1 9  ? 25.901  -20.424 -43.396 1.00 0.00 ? 72  LYS A HB2  4 
ATOM 8746  H HB3  . LYS A 1 9  ? 24.608  -21.241 -42.500 1.00 0.00 ? 72  LYS A HB3  4 
ATOM 8747  H HG2  . LYS A 1 9  ? 25.053  -23.317 -43.716 1.00 0.00 ? 72  LYS A HG2  4 
ATOM 8748  H HG3  . LYS A 1 9  ? 26.313  -22.499 -44.667 1.00 0.00 ? 72  LYS A HG3  4 
ATOM 8749  H HD2  . LYS A 1 9  ? 27.600  -22.073 -42.624 1.00 0.00 ? 72  LYS A HD2  4 
ATOM 8750  H HD3  . LYS A 1 9  ? 26.332  -22.846 -41.649 1.00 0.00 ? 72  LYS A HD3  4 
ATOM 8751  H HE2  . LYS A 1 9  ? 26.713  -24.968 -42.838 1.00 0.00 ? 72  LYS A HE2  4 
ATOM 8752  H HE3  . LYS A 1 9  ? 27.981  -24.196 -43.812 1.00 0.00 ? 72  LYS A HE3  4 
ATOM 8753  H HZ1  . LYS A 1 9  ? 28.897  -23.632 -41.433 1.00 0.00 ? 72  LYS A HZ1  4 
ATOM 8754  H HZ2  . LYS A 1 9  ? 29.234  -25.120 -42.182 1.00 0.00 ? 72  LYS A HZ2  4 
ATOM 8755  H HZ3  . LYS A 1 9  ? 28.026  -25.003 -41.026 1.00 0.00 ? 72  LYS A HZ3  4 
ATOM 8756  N N    . ASP A 1 10 ? 22.303  -22.069 -43.582 1.00 0.00 ? 73  ASP A N    4 
ATOM 8757  C CA   . ASP A 1 10 ? 21.266  -23.094 -43.559 1.00 0.00 ? 73  ASP A CA   4 
ATOM 8758  C C    . ASP A 1 10 ? 20.074  -22.656 -42.716 1.00 0.00 ? 73  ASP A C    4 
ATOM 8759  O O    . ASP A 1 10 ? 19.550  -23.431 -41.915 1.00 0.00 ? 73  ASP A O    4 
ATOM 8760  C CB   . ASP A 1 10 ? 21.829  -24.410 -43.012 1.00 0.00 ? 73  ASP A CB   4 
ATOM 8761  C CG   . ASP A 1 10 ? 22.295  -24.302 -41.567 1.00 0.00 ? 73  ASP A CG   4 
ATOM 8762  O OD1  . ASP A 1 10 ? 22.196  -23.233 -41.009 1.00 0.00 ? 73  ASP A OD1  4 
ATOM 8763  O OD2  . ASP A 1 10 ? 22.746  -25.285 -41.032 1.00 0.00 ? 73  ASP A OD2  4 
ATOM 8764  H H    . ASP A 1 10 ? 22.492  -21.534 -42.733 1.00 0.00 ? 73  ASP A H    4 
ATOM 8765  H HA   . ASP A 1 10 ? 20.920  -23.247 -44.566 1.00 0.00 ? 73  ASP A HA   4 
ATOM 8766  H HB2  . ASP A 1 10 ? 21.062  -25.179 -43.076 1.00 0.00 ? 73  ASP A HB2  4 
ATOM 8767  H HB3  . ASP A 1 10 ? 22.678  -24.699 -43.626 1.00 0.00 ? 73  ASP A HB3  4 
ATOM 8768  N N    . ARG A 1 11 ? 19.653  -21.409 -42.902 1.00 0.00 ? 74  ARG A N    4 
ATOM 8769  C CA   . ARG A 1 11 ? 18.549  -20.853 -42.130 1.00 0.00 ? 74  ARG A CA   4 
ATOM 8770  C C    . ARG A 1 11 ? 18.243  -19.424 -42.559 1.00 0.00 ? 74  ARG A C    4 
ATOM 8771  O O    . ARG A 1 11 ? 19.148  -18.660 -42.898 1.00 0.00 ? 74  ARG A O    4 
ATOM 8772  C CB   . ARG A 1 11 ? 18.869  -20.875 -40.642 1.00 0.00 ? 74  ARG A CB   4 
ATOM 8773  C CG   . ARG A 1 11 ? 20.056  -20.019 -40.232 1.00 0.00 ? 74  ARG A CG   4 
ATOM 8774  C CD   . ARG A 1 11 ? 20.468  -20.290 -38.830 1.00 0.00 ? 74  ARG A CD   4 
ATOM 8775  N NE   . ARG A 1 11 ? 21.073  -21.603 -38.686 1.00 0.00 ? 74  ARG A NE   4 
ATOM 8776  C CZ   . ARG A 1 11 ? 21.285  -22.224 -37.510 1.00 0.00 ? 74  ARG A CZ   4 
ATOM 8777  N NH1  . ARG A 1 11 ? 20.934  -21.638 -36.385 1.00 0.00 ? 74  ARG A NH1  4 
ATOM 8778  N NH2  . ARG A 1 11 ? 21.841  -23.423 -37.484 1.00 0.00 ? 74  ARG A NH2  4 
ATOM 8779  H H    . ARG A 1 11 ? 20.137  -20.820 -43.578 1.00 0.00 ? 74  ARG A H    4 
ATOM 8780  H HA   . ARG A 1 11 ? 17.678  -21.448 -42.339 1.00 0.00 ? 74  ARG A HA   4 
ATOM 8781  H HB2  . ARG A 1 11 ? 18.001  -20.498 -40.105 1.00 0.00 ? 74  ARG A HB2  4 
ATOM 8782  H HB3  . ARG A 1 11 ? 19.052  -21.899 -40.328 1.00 0.00 ? 74  ARG A HB3  4 
ATOM 8783  H HG2  . ARG A 1 11 ? 20.892  -20.253 -40.893 1.00 0.00 ? 74  ARG A HG2  4 
ATOM 8784  H HG3  . ARG A 1 11 ? 19.793  -18.966 -40.343 1.00 0.00 ? 74  ARG A HG3  4 
ATOM 8785  H HD2  . ARG A 1 11 ? 21.188  -19.534 -38.514 1.00 0.00 ? 74  ARG A HD2  4 
ATOM 8786  H HD3  . ARG A 1 11 ? 19.587  -20.235 -38.191 1.00 0.00 ? 74  ARG A HD3  4 
ATOM 8787  H HE   . ARG A 1 11 ? 21.344  -22.071 -39.505 1.00 0.00 ? 74  ARG A HE   4 
ATOM 8788  H HH11 . ARG A 1 11 ? 20.510  -20.733 -36.402 1.00 0.00 ? 74  ARG A HH11 4 
ATOM 8789  H HH12 . ARG A 1 11 ? 21.095  -22.103 -35.503 1.00 0.00 ? 74  ARG A HH12 4 
ATOM 8790  H HH21 . ARG A 1 11 ? 22.107  -23.872 -38.339 1.00 0.00 ? 74  ARG A HH21 4 
ATOM 8791  H HH22 . ARG A 1 11 ? 21.997  -23.881 -36.610 1.00 0.00 ? 74  ARG A HH22 4 
ATOM 8792  N N    . PHE A 1 12 ? 16.964  -19.066 -42.543 1.00 0.00 ? 75  PHE A N    4 
ATOM 8793  C CA   . PHE A 1 12 ? 16.519  -17.782 -43.070 1.00 0.00 ? 75  PHE A CA   4 
ATOM 8794  C C    . PHE A 1 12 ? 16.100  -16.841 -41.947 1.00 0.00 ? 75  PHE A C    4 
ATOM 8795  O O    . PHE A 1 12 ? 15.725  -17.284 -40.861 1.00 0.00 ? 75  PHE A O    4 
ATOM 8796  C CB   . PHE A 1 12 ? 15.355  -17.978 -44.041 1.00 0.00 ? 75  PHE A CB   4 
ATOM 8797  C CG   . PHE A 1 12 ? 14.088  -18.440 -43.382 1.00 0.00 ? 75  PHE A CG   4 
ATOM 8798  C CD1  . PHE A 1 12 ? 13.354  -17.582 -42.576 1.00 0.00 ? 75  PHE A CD1  4 
ATOM 8799  C CD2  . PHE A 1 12 ? 13.625  -19.734 -43.566 1.00 0.00 ? 75  PHE A CD2  4 
ATOM 8800  C CE1  . PHE A 1 12 ? 12.187  -18.007 -41.970 1.00 0.00 ? 75  PHE A CE1  4 
ATOM 8801  C CE2  . PHE A 1 12 ? 12.458  -20.162 -42.961 1.00 0.00 ? 75  PHE A CE2  4 
ATOM 8802  C CZ   . PHE A 1 12 ? 11.739  -19.297 -42.163 1.00 0.00 ? 75  PHE A CZ   4 
ATOM 8803  H H    . PHE A 1 12 ? 16.263  -19.757 -42.274 1.00 0.00 ? 75  PHE A H    4 
ATOM 8804  H HA   . PHE A 1 12 ? 17.326  -17.308 -43.580 1.00 0.00 ? 75  PHE A HA   4 
ATOM 8805  H HB2  . PHE A 1 12 ? 15.173  -17.031 -44.528 1.00 0.00 ? 75  PHE A HB2  4 
ATOM 8806  H HB3  . PHE A 1 12 ? 15.661  -18.702 -44.798 1.00 0.00 ? 75  PHE A HB3  4 
ATOM 8807  H HD1  . PHE A 1 12 ? 13.678  -16.565 -42.432 1.00 0.00 ? 75  PHE A HD1  4 
ATOM 8808  H HD2  . PHE A 1 12 ? 14.193  -20.401 -44.169 1.00 0.00 ? 75  PHE A HD2  4 
ATOM 8809  H HE1  . PHE A 1 12 ? 11.624  -17.328 -41.348 1.00 0.00 ? 75  PHE A HE1  4 
ATOM 8810  H HE2  . PHE A 1 12 ? 12.108  -21.165 -43.122 1.00 0.00 ? 75  PHE A HE2  4 
ATOM 8811  H HZ   . PHE A 1 12 ? 10.964  -19.684 -41.524 1.00 0.00 ? 75  PHE A HZ   4 
ATOM 8812  N N    . SER A 1 13 ? 16.162  -15.541 -42.216 1.00 0.00 ? 76  SER A N    4 
ATOM 8813  C CA   . SER A 1 13 ? 15.671  -14.540 -41.278 1.00 0.00 ? 76  SER A CA   4 
ATOM 8814  C C    . SER A 1 13 ? 14.909  -13.437 -41.999 1.00 0.00 ? 76  SER A C    4 
ATOM 8815  O O    . SER A 1 13 ? 15.423  -12.821 -42.933 1.00 0.00 ? 76  SER A O    4 
ATOM 8816  C CB   . SER A 1 13 ? 16.827  -13.944 -40.498 1.00 0.00 ? 76  SER A CB   4 
ATOM 8817  O OG   . SER A 1 13 ? 16.384  -12.918 -39.652 1.00 0.00 ? 76  SER A OG   4 
ATOM 8818  H H    . SER A 1 13 ? 16.462  -15.244 -43.145 1.00 0.00 ? 76  SER A H    4 
ATOM 8819  H HA   . SER A 1 13 ? 14.990  -15.004 -40.584 1.00 0.00 ? 76  SER A HA   4 
ATOM 8820  H HB2  . SER A 1 13 ? 17.293  -14.719 -39.898 1.00 0.00 ? 76  SER A HB2  4 
ATOM 8821  H HB3  . SER A 1 13 ? 17.561  -13.545 -41.203 1.00 0.00 ? 76  SER A HB3  4 
ATOM 8822  H HG   . SER A 1 13 ? 16.878  -12.122 -39.857 1.00 0.00 ? 76  SER A HG   4 
ATOM 8823  N N    . VAL A 1 14 ? 13.678  -13.190 -41.562 1.00 0.00 ? 77  VAL A N    4 
ATOM 8824  C CA   . VAL A 1 14 ? 12.800  -12.246 -42.240 1.00 0.00 ? 77  VAL A CA   4 
ATOM 8825  C C    . VAL A 1 14 ? 12.805  -10.891 -41.544 1.00 0.00 ? 77  VAL A C    4 
ATOM 8826  O O    . VAL A 1 14 ? 12.283  -10.747 -40.439 1.00 0.00 ? 77  VAL A O    4 
ATOM 8827  C CB   . VAL A 1 14 ? 11.360  -12.791 -42.281 1.00 0.00 ? 77  VAL A CB   4 
ATOM 8828  C CG1  . VAL A 1 14 ? 10.437  -11.806 -42.986 1.00 0.00 ? 77  VAL A CG1  4 
ATOM 8829  C CG2  . VAL A 1 14 ? 11.336  -14.142 -42.978 1.00 0.00 ? 77  VAL A CG2  4 
ATOM 8830  H H    . VAL A 1 14 ? 13.307  -13.749 -40.794 1.00 0.00 ? 77  VAL A H    4 
ATOM 8831  H HA   . VAL A 1 14 ? 13.128  -12.093 -43.261 1.00 0.00 ? 77  VAL A HA   4 
ATOM 8832  H HB   . VAL A 1 14 ? 11.007  -12.916 -41.256 1.00 0.00 ? 77  VAL A HB   4 
ATOM 8833  H HG11 . VAL A 1 14 ? 9.402   -12.048 -42.741 1.00 0.00 ? 77  VAL A HG11 4 
ATOM 8834  H HG12 . VAL A 1 14 ? 10.580  -11.901 -44.063 1.00 0.00 ? 77  VAL A HG12 4 
ATOM 8835  H HG13 . VAL A 1 14 ? 10.642  -10.784 -42.694 1.00 0.00 ? 77  VAL A HG13 4 
ATOM 8836  H HG21 . VAL A 1 14 ? 11.912  -14.862 -42.395 1.00 0.00 ? 77  VAL A HG21 4 
ATOM 8837  H HG22 . VAL A 1 14 ? 11.768  -14.046 -43.954 1.00 0.00 ? 77  VAL A HG22 4 
ATOM 8838  H HG23 . VAL A 1 14 ? 10.307  -14.487 -43.068 1.00 0.00 ? 77  VAL A HG23 4 
ATOM 8839  N N    . ASN A 1 15 ? 13.401  -9.899  -42.197 1.00 0.00 ? 78  ASN A N    4 
ATOM 8840  C CA   . ASN A 1 15 ? 13.498  -8.559  -41.631 1.00 0.00 ? 78  ASN A CA   4 
ATOM 8841  C C    . ASN A 1 15 ? 12.237  -7.750  -41.911 1.00 0.00 ? 78  ASN A C    4 
ATOM 8842  O O    . ASN A 1 15 ? 12.172  -7.002  -42.887 1.00 0.00 ? 78  ASN A O    4 
ATOM 8843  C CB   . ASN A 1 15 ? 14.723  -7.840  -42.166 1.00 0.00 ? 78  ASN A CB   4 
ATOM 8844  C CG   . ASN A 1 15 ? 14.949  -6.510  -41.502 1.00 0.00 ? 78  ASN A CG   4 
ATOM 8845  O OD1  . ASN A 1 15 ? 14.152  -6.079  -40.660 1.00 0.00 ? 78  ASN A OD1  4 
ATOM 8846  N ND2  . ASN A 1 15 ? 16.020  -5.851  -41.865 1.00 0.00 ? 78  ASN A ND2  4 
ATOM 8847  H H    . ASN A 1 15 ? 13.814  -10.080 -43.112 1.00 0.00 ? 78  ASN A H    4 
ATOM 8848  H HA   . ASN A 1 15 ? 13.613  -8.641  -40.548 1.00 0.00 ? 78  ASN A HA   4 
ATOM 8849  H HB2  . ASN A 1 15 ? 15.598  -8.470  -42.010 1.00 0.00 ? 78  ASN A HB2  4 
ATOM 8850  H HB3  . ASN A 1 15 ? 14.585  -7.681  -43.237 1.00 0.00 ? 78  ASN A HB3  4 
ATOM 8851  H HD21 . ASN A 1 15 ? 16.654  -6.236  -42.565 1.00 0.00 ? 78  ASN A HD21 4 
ATOM 8852  H HD22 . ASN A 1 15 ? 16.219  -4.945  -41.442 1.00 0.00 ? 78  ASN A HD22 4 
ATOM 8853  N N    . LEU A 1 16 ? 11.238  -7.903  -41.049 1.00 0.00 ? 79  LEU A N    4 
ATOM 8854  C CA   . LEU A 1 16 ? 9.928   -7.307  -41.281 1.00 0.00 ? 79  LEU A CA   4 
ATOM 8855  C C    . LEU A 1 16 ? 9.933   -5.818  -40.956 1.00 0.00 ? 79  LEU A C    4 
ATOM 8856  O O    . LEU A 1 16 ? 10.474  -5.400  -39.934 1.00 0.00 ? 79  LEU A O    4 
ATOM 8857  C CB   . LEU A 1 16 ? 8.864   -8.018  -40.434 1.00 0.00 ? 79  LEU A CB   4 
ATOM 8858  C CG   . LEU A 1 16 ? 8.629   -9.498  -40.766 1.00 0.00 ? 79  LEU A CG   4 
ATOM 8859  C CD1  . LEU A 1 16 ? 7.790   -10.137 -39.668 1.00 0.00 ? 79  LEU A CD1  4 
ATOM 8860  C CD2  . LEU A 1 16 ? 7.941   -9.611  -42.118 1.00 0.00 ? 79  LEU A CD2  4 
ATOM 8861  H H    . LEU A 1 16 ? 11.355  -8.553  -40.272 1.00 0.00 ? 79  LEU A H    4 
ATOM 8862  H HA   . LEU A 1 16 ? 9.659   -7.421  -42.327 1.00 0.00 ? 79  LEU A HA   4 
ATOM 8863  H HB2  . LEU A 1 16 ? 9.162   -7.950  -39.393 1.00 0.00 ? 79  LEU A HB2  4 
ATOM 8864  H HB3  . LEU A 1 16 ? 7.921   -7.484  -40.554 1.00 0.00 ? 79  LEU A HB3  4 
ATOM 8865  H HG   . LEU A 1 16 ? 9.595   -9.996  -40.808 1.00 0.00 ? 79  LEU A HG   4 
ATOM 8866  H HD11 . LEU A 1 16 ? 7.431   -11.104 -40.010 1.00 0.00 ? 79  LEU A HD11 4 
ATOM 8867  H HD12 . LEU A 1 16 ? 6.949   -9.500  -39.422 1.00 0.00 ? 79  LEU A HD12 4 
ATOM 8868  H HD13 . LEU A 1 16 ? 8.398   -10.288 -38.794 1.00 0.00 ? 79  LEU A HD13 4 
ATOM 8869  H HD21 . LEU A 1 16 ? 7.565   -10.624 -42.251 1.00 0.00 ? 79  LEU A HD21 4 
ATOM 8870  H HD22 . LEU A 1 16 ? 8.648   -9.393  -42.915 1.00 0.00 ? 79  LEU A HD22 4 
ATOM 8871  H HD23 . LEU A 1 16 ? 7.107   -8.909  -42.171 1.00 0.00 ? 79  LEU A HD23 4 
ATOM 8872  N N    . ASP A 1 17 ? 9.327   -5.024  -41.834 1.00 0.00 ? 80  ASP A N    4 
ATOM 8873  C CA   . ASP A 1 17 ? 9.300   -3.578  -41.663 1.00 0.00 ? 80  ASP A CA   4 
ATOM 8874  C C    . ASP A 1 17 ? 8.064   -3.138  -40.888 1.00 0.00 ? 80  ASP A C    4 
ATOM 8875  O O    . ASP A 1 17 ? 6.936   -3.340  -41.334 1.00 0.00 ? 80  ASP A O    4 
ATOM 8876  C CB   . ASP A 1 17 ? 9.331   -2.877  -43.024 1.00 0.00 ? 80  ASP A CB   4 
ATOM 8877  C CG   . ASP A 1 17 ? 9.397   -1.359  -42.908 1.00 0.00 ? 80  ASP A CG   4 
ATOM 8878  O OD1  . ASP A 1 17 ? 9.232   -0.859  -41.822 1.00 0.00 ? 80  ASP A OD1  4 
ATOM 8879  O OD2  . ASP A 1 17 ? 9.609   -0.716  -43.908 1.00 0.00 ? 80  ASP A OD2  4 
ATOM 8880  H H    . ASP A 1 17 ? 8.899   -5.435  -42.665 1.00 0.00 ? 80  ASP A H    4 
ATOM 8881  H HA   . ASP A 1 17 ? 10.185  -3.264  -41.105 1.00 0.00 ? 80  ASP A HA   4 
ATOM 8882  H HB2  . ASP A 1 17 ? 10.204  -3.225  -43.578 1.00 0.00 ? 80  ASP A HB2  4 
ATOM 8883  H HB3  . ASP A 1 17 ? 8.430   -3.149  -43.576 1.00 0.00 ? 80  ASP A HB3  4 
ATOM 8884  N N    . VAL A 1 18 ? 8.288   -2.534  -39.726 1.00 0.00 ? 81  VAL A N    4 
ATOM 8885  C CA   . VAL A 1 18 ? 7.198   -1.987  -38.925 1.00 0.00 ? 81  VAL A CA   4 
ATOM 8886  C C    . VAL A 1 18 ? 7.189   -0.467  -38.972 1.00 0.00 ? 81  VAL A C    4 
ATOM 8887  O O    . VAL A 1 18 ? 8.115   0.186   -38.491 1.00 0.00 ? 81  VAL A O    4 
ATOM 8888  C CB   . VAL A 1 18 ? 7.324   -2.452  -37.462 1.00 0.00 ? 81  VAL A CB   4 
ATOM 8889  C CG1  . VAL A 1 18 ? 6.226   -1.832  -36.610 1.00 0.00 ? 81  VAL A CG1  4 
ATOM 8890  C CG2  . VAL A 1 18 ? 7.266   -3.971  -37.394 1.00 0.00 ? 81  VAL A CG2  4 
ATOM 8891  H H    . VAL A 1 18 ? 9.248   -2.385  -39.420 1.00 0.00 ? 81  VAL A H    4 
ATOM 8892  H HA   . VAL A 1 18 ? 6.240   -2.350  -39.308 1.00 0.00 ? 81  VAL A HA   4 
ATOM 8893  H HB   . VAL A 1 18 ? 8.288   -2.123  -37.107 1.00 0.00 ? 81  VAL A HB   4 
ATOM 8894  H HG11 . VAL A 1 18 ? 6.535   -1.894  -35.568 1.00 0.00 ? 81  VAL A HG11 4 
ATOM 8895  H HG12 . VAL A 1 18 ? 5.316   -2.405  -36.756 1.00 0.00 ? 81  VAL A HG12 4 
ATOM 8896  H HG13 . VAL A 1 18 ? 6.056   -0.790  -36.859 1.00 0.00 ? 81  VAL A HG13 4 
ATOM 8897  H HG21 . VAL A 1 18 ? 6.359   -4.319  -37.889 1.00 0.00 ? 81  VAL A HG21 4 
ATOM 8898  H HG22 . VAL A 1 18 ? 7.254   -4.287  -36.351 1.00 0.00 ? 81  VAL A HG22 4 
ATOM 8899  H HG23 . VAL A 1 18 ? 8.138   -4.396  -37.894 1.00 0.00 ? 81  VAL A HG23 4 
ATOM 8900  N N    . LYS A 1 19 ? 6.138   0.095   -39.558 1.00 0.00 ? 82  LYS A N    4 
ATOM 8901  C CA   . LYS A 1 19 ? 6.068   1.534   -39.790 1.00 0.00 ? 82  LYS A CA   4 
ATOM 8902  C C    . LYS A 1 19 ? 5.088   2.200   -38.832 1.00 0.00 ? 82  LYS A C    4 
ATOM 8903  O O    . LYS A 1 19 ? 3.889   2.265   -39.100 1.00 0.00 ? 82  LYS A O    4 
ATOM 8904  C CB   . LYS A 1 19 ? 5.666   1.824   -41.236 1.00 0.00 ? 82  LYS A CB   4 
ATOM 8905  C CG   . LYS A 1 19 ? 5.617   3.305   -41.591 1.00 0.00 ? 82  LYS A CG   4 
ATOM 8906  C CD   . LYS A 1 19 ? 5.247   3.511   -43.052 1.00 0.00 ? 82  LYS A CD   4 
ATOM 8907  C CE   . LYS A 1 19 ? 5.125   4.989   -43.389 1.00 0.00 ? 82  LYS A CE   4 
ATOM 8908  N NZ   . LYS A 1 19 ? 4.739   5.208   -44.809 1.00 0.00 ? 82  LYS A NZ   4 
ATOM 8909  H H    . LYS A 1 19 ? 5.409   -0.502  -39.949 1.00 0.00 ? 82  LYS A H    4 
ATOM 8910  H HA   . LYS A 1 19 ? 7.052   1.981   -39.626 1.00 0.00 ? 82  LYS A HA   4 
ATOM 8911  H HB2  . LYS A 1 19 ? 6.383   1.338   -41.896 1.00 0.00 ? 82  LYS A HB2  4 
ATOM 8912  H HB3  . LYS A 1 19 ? 4.679   1.394   -41.415 1.00 0.00 ? 82  LYS A HB3  4 
ATOM 8913  H HG2  . LYS A 1 19 ? 4.871   3.792   -40.964 1.00 0.00 ? 82  LYS A HG2  4 
ATOM 8914  H HG3  . LYS A 1 19 ? 6.594   3.749   -41.403 1.00 0.00 ? 82  LYS A HG3  4 
ATOM 8915  H HD2  . LYS A 1 19 ? 6.021   3.066   -43.680 1.00 0.00 ? 82  LYS A HD2  4 
ATOM 8916  H HD3  . LYS A 1 19 ? 4.295   3.021   -43.253 1.00 0.00 ? 82  LYS A HD3  4 
ATOM 8917  H HE2  . LYS A 1 19 ? 4.368   5.438   -42.747 1.00 0.00 ? 82  LYS A HE2  4 
ATOM 8918  H HE3  . LYS A 1 19 ? 6.083   5.476   -43.203 1.00 0.00 ? 82  LYS A HE3  4 
ATOM 8919  H HZ1  . LYS A 1 19 ? 3.831   4.737   -44.996 1.00 0.00 ? 82  LYS A HZ1  4 
ATOM 8920  H HZ2  . LYS A 1 19 ? 5.473   4.804   -45.429 1.00 0.00 ? 82  LYS A HZ2  4 
ATOM 8921  H HZ3  . LYS A 1 19 ? 4.651   6.198   -44.989 1.00 0.00 ? 82  LYS A HZ3  4 
ATOM 8922  N N    . HIS A 1 20 ? 5.606   2.695   -37.713 1.00 0.00 ? 83  HIS A N    4 
ATOM 8923  C CA   . HIS A 1 20 ? 4.800   3.450   -36.762 1.00 0.00 ? 83  HIS A CA   4 
ATOM 8924  C C    . HIS A 1 20 ? 3.673   2.596   -36.194 1.00 0.00 ? 83  HIS A C    4 
ATOM 8925  O O    . HIS A 1 20 ? 2.514   3.008   -36.185 1.00 0.00 ? 83  HIS A O    4 
ATOM 8926  C CB   . HIS A 1 20 ? 4.215   4.703   -37.424 1.00 0.00 ? 83  HIS A CB   4 
ATOM 8927  C CG   . HIS A 1 20 ? 5.246   5.575   -38.072 1.00 0.00 ? 83  HIS A CG   4 
ATOM 8928  N ND1  . HIS A 1 20 ? 6.288   6.144   -37.370 1.00 0.00 ? 83  HIS A ND1  4 
ATOM 8929  C CD2  . HIS A 1 20 ? 5.392   5.978   -39.355 1.00 0.00 ? 83  HIS A CD2  4 
ATOM 8930  C CE1  . HIS A 1 20 ? 7.031   6.857   -38.195 1.00 0.00 ? 83  HIS A CE1  4 
ATOM 8931  N NE2  . HIS A 1 20 ? 6.509   6.774   -39.404 1.00 0.00 ? 83  HIS A NE2  4 
ATOM 8932  H H    . HIS A 1 20 ? 6.613   2.625   -37.561 1.00 0.00 ? 83  HIS A H    4 
ATOM 8933  H HA   . HIS A 1 20 ? 5.439   3.763   -35.938 1.00 0.00 ? 83  HIS A HA   4 
ATOM 8934  H HB2  . HIS A 1 20 ? 3.485   4.408   -38.174 1.00 0.00 ? 83  HIS A HB2  4 
ATOM 8935  H HB3  . HIS A 1 20 ? 3.716   5.284   -36.650 1.00 0.00 ? 83  HIS A HB3  4 
ATOM 8936  H HD2  . HIS A 1 20 ? 4.603   5.970   -40.095 1.00 0.00 ? 83  HIS A HD2  4 
ATOM 8937  H HE1  . HIS A 1 20 ? 7.915   7.417   -37.923 1.00 0.00 ? 83  HIS A HE1  4 
ATOM 8938  H HE2  . HIS A 1 20 ? 6.873   7.224   -40.232 1.00 0.00 ? 83  HIS A HE2  4 
ATOM 8939  N N    . PHE A 1 21 ? 4.021   1.403   -35.723 1.00 0.00 ? 84  PHE A N    4 
ATOM 8940  C CA   . PHE A 1 21 ? 3.076   0.557   -35.007 1.00 0.00 ? 84  PHE A CA   4 
ATOM 8941  C C    . PHE A 1 21 ? 3.559   0.261   -33.593 1.00 0.00 ? 84  PHE A C    4 
ATOM 8942  O O    . PHE A 1 21 ? 4.763   0.201   -33.340 1.00 0.00 ? 84  PHE A O    4 
ATOM 8943  C CB   . PHE A 1 21 ? 2.856   -0.756  -35.761 1.00 0.00 ? 84  PHE A CB   4 
ATOM 8944  C CG   . PHE A 1 21 ? 2.303   -0.574  -37.146 1.00 0.00 ? 84  PHE A CG   4 
ATOM 8945  C CD1  . PHE A 1 21 ? 0.957   -0.296  -37.339 1.00 0.00 ? 84  PHE A CD1  4 
ATOM 8946  C CD2  . PHE A 1 21 ? 3.126   -0.679  -38.256 1.00 0.00 ? 84  PHE A CD2  4 
ATOM 8947  C CE1  . PHE A 1 21 ? 0.447   -0.131  -38.612 1.00 0.00 ? 84  PHE A CE1  4 
ATOM 8948  C CE2  . PHE A 1 21 ? 2.617   -0.513  -39.531 1.00 0.00 ? 84  PHE A CE2  4 
ATOM 8949  C CZ   . PHE A 1 21 ? 1.278   -0.239  -39.709 1.00 0.00 ? 84  PHE A CZ   4 
ATOM 8950  H H    . PHE A 1 21 ? 5.007   1.137   -35.738 1.00 0.00 ? 84  PHE A H    4 
ATOM 8951  H HA   . PHE A 1 21 ? 2.141   1.065   -34.920 1.00 0.00 ? 84  PHE A HA   4 
ATOM 8952  H HB2  . PHE A 1 21 ? 3.791   -1.270  -35.811 1.00 0.00 ? 84  PHE A HB2  4 
ATOM 8953  H HB3  . PHE A 1 21 ? 2.155   -1.365  -35.186 1.00 0.00 ? 84  PHE A HB3  4 
ATOM 8954  H HD1  . PHE A 1 21 ? 0.307   -0.242  -36.504 1.00 0.00 ? 84  PHE A HD1  4 
ATOM 8955  H HD2  . PHE A 1 21 ? 4.169   -0.889  -38.129 1.00 0.00 ? 84  PHE A HD2  4 
ATOM 8956  H HE1  . PHE A 1 21 ? -0.602  0.086   -38.750 1.00 0.00 ? 84  PHE A HE1  4 
ATOM 8957  H HE2  . PHE A 1 21 ? 3.268   -0.597  -40.388 1.00 0.00 ? 84  PHE A HE2  4 
ATOM 8958  H HZ   . PHE A 1 21 ? 0.858   -0.239  -40.704 1.00 0.00 ? 84  PHE A HZ   4 
ATOM 8959  N N    . SER A 1 22 ? 2.617   0.078   -32.675 1.00 0.00 ? 85  SER A N    4 
ATOM 8960  C CA   . SER A 1 22 ? 2.947   -0.188  -31.279 1.00 0.00 ? 85  SER A CA   4 
ATOM 8961  C C    . SER A 1 22 ? 3.036   -1.685  -31.011 1.00 0.00 ? 85  SER A C    4 
ATOM 8962  O O    . SER A 1 22 ? 2.206   -2.460  -31.485 1.00 0.00 ? 85  SER A O    4 
ATOM 8963  C CB   . SER A 1 22 ? 1.908   0.438   -30.369 1.00 0.00 ? 85  SER A CB   4 
ATOM 8964  O OG   . SER A 1 22 ? 1.961   1.837   -30.433 1.00 0.00 ? 85  SER A OG   4 
ATOM 8965  H H    . SER A 1 22 ? 1.636   0.144   -32.949 1.00 0.00 ? 85  SER A H    4 
ATOM 8966  H HA   . SER A 1 22 ? 3.892   0.301   -31.086 1.00 0.00 ? 85  SER A HA   4 
ATOM 8967  H HB2  . SER A 1 22 ? 0.917   0.112   -30.676 1.00 0.00 ? 85  SER A HB2  4 
ATOM 8968  H HB3  . SER A 1 22 ? 2.092   0.108   -29.343 1.00 0.00 ? 85  SER A HB3  4 
ATOM 8969  H HG   . SER A 1 22 ? 1.251   2.138   -31.004 1.00 0.00 ? 85  SER A HG   4 
ATOM 8970  N N    . PRO A 1 23 ? 4.048   -2.084  -30.248 1.00 0.00 ? 86  PRO A N    4 
ATOM 8971  C CA   . PRO A 1 23 ? 4.244   -3.488  -29.911 1.00 0.00 ? 86  PRO A CA   4 
ATOM 8972  C C    . PRO A 1 23 ? 3.137   -3.996  -28.996 1.00 0.00 ? 86  PRO A C    4 
ATOM 8973  O O    . PRO A 1 23 ? 2.962   -5.203  -28.829 1.00 0.00 ? 86  PRO A O    4 
ATOM 8974  C CB   . PRO A 1 23 ? 5.604   -3.487  -29.206 1.00 0.00 ? 86  PRO A CB   4 
ATOM 8975  C CG   . PRO A 1 23 ? 5.730   -2.105  -28.658 1.00 0.00 ? 86  PRO A CG   4 
ATOM 8976  C CD   . PRO A 1 23 ? 5.104   -1.227  -29.709 1.00 0.00 ? 86  PRO A CD   4 
ATOM 8977  H HA   . PRO A 1 23 ? 4.288   -4.079  -30.788 1.00 0.00 ? 86  PRO A HA   4 
ATOM 8978  H HB2  . PRO A 1 23 ? 5.632   -4.230  -28.403 1.00 0.00 ? 86  PRO A HB2  4 
ATOM 8979  H HB3  . PRO A 1 23 ? 6.404   -3.679  -29.926 1.00 0.00 ? 86  PRO A HB3  4 
ATOM 8980  H HG2  . PRO A 1 23 ? 5.197   -2.028  -27.706 1.00 0.00 ? 86  PRO A HG2  4 
ATOM 8981  H HG3  . PRO A 1 23 ? 6.779   -1.839  -28.528 1.00 0.00 ? 86  PRO A HG3  4 
ATOM 8982  H HD2  . PRO A 1 23 ? 4.682   -0.343  -29.221 1.00 0.00 ? 86  PRO A HD2  4 
ATOM 8983  H HD3  . PRO A 1 23 ? 5.820   -0.947  -30.482 1.00 0.00 ? 86  PRO A HD3  4 
ATOM 8984  N N    . GLU A 1 24 ? 2.393   -3.067  -28.405 1.00 0.00 ? 87  GLU A N    4 
ATOM 8985  C CA   . GLU A 1 24 ? 1.202   -3.412  -27.638 1.00 0.00 ? 87  GLU A CA   4 
ATOM 8986  C C    . GLU A 1 24 ? 0.021   -3.706  -28.555 1.00 0.00 ? 87  GLU A C    4 
ATOM 8987  O O    . GLU A 1 24 ? -0.981  -4.276  -28.126 1.00 0.00 ? 87  GLU A O    4 
ATOM 8988  C CB   . GLU A 1 24 ? 0.843   -2.282  -26.671 1.00 0.00 ? 87  GLU A CB   4 
ATOM 8989  C CG   . GLU A 1 24 ? 1.868   -2.045  -25.572 1.00 0.00 ? 87  GLU A CG   4 
ATOM 8990  C CD   . GLU A 1 24 ? 1.498   -0.908  -24.661 1.00 0.00 ? 87  GLU A CD   4 
ATOM 8991  O OE1  . GLU A 1 24 ? 0.521   -0.251  -24.931 1.00 0.00 ? 87  GLU A OE1  4 
ATOM 8992  O OE2  . GLU A 1 24 ? 2.192   -0.696  -23.695 1.00 0.00 ? 87  GLU A OE2  4 
ATOM 8993  H H    . GLU A 1 24 ? 2.582   -2.084  -28.603 1.00 0.00 ? 87  GLU A H    4 
ATOM 8994  H HA   . GLU A 1 24 ? 1.423   -4.305  -27.049 1.00 0.00 ? 87  GLU A HA   4 
ATOM 8995  H HB2  . GLU A 1 24 ? 0.745   -1.361  -27.247 1.00 0.00 ? 87  GLU A HB2  4 
ATOM 8996  H HB3  . GLU A 1 24 ? -0.114  -2.512  -26.203 1.00 0.00 ? 87  GLU A HB3  4 
ATOM 8997  H HG2  . GLU A 1 24 ? 1.957   -2.956  -24.981 1.00 0.00 ? 87  GLU A HG2  4 
ATOM 8998  H HG3  . GLU A 1 24 ? 2.830   -1.828  -26.036 1.00 0.00 ? 87  GLU A HG3  4 
ATOM 8999  N N    . GLU A 1 25 ? 0.146   -3.311  -29.817 1.00 0.00 ? 88  GLU A N    4 
ATOM 9000  C CA   . GLU A 1 25 ? -0.917  -3.514  -30.792 1.00 0.00 ? 88  GLU A CA   4 
ATOM 9001  C C    . GLU A 1 25 ? -0.437  -4.363  -31.962 1.00 0.00 ? 88  GLU A C    4 
ATOM 9002  O O    . GLU A 1 25 ? -1.217  -4.713  -32.848 1.00 0.00 ? 88  GLU A O    4 
ATOM 9003  C CB   . GLU A 1 25 ? -1.435  -2.167  -31.304 1.00 0.00 ? 88  GLU A CB   4 
ATOM 9004  C CG   . GLU A 1 25 ? -2.110  -1.309  -30.245 1.00 0.00 ? 88  GLU A CG   4 
ATOM 9005  C CD   . GLU A 1 25 ? -2.676  -0.032  -30.800 1.00 0.00 ? 88  GLU A CD   4 
ATOM 9006  O OE1  . GLU A 1 25 ? -2.921  0.024   -31.981 1.00 0.00 ? 88  GLU A OE1  4 
ATOM 9007  O OE2  . GLU A 1 25 ? -2.869  0.890   -30.041 1.00 0.00 ? 88  GLU A OE2  4 
ATOM 9008  H H    . GLU A 1 25 ? 1.003   -2.838  -30.105 1.00 0.00 ? 88  GLU A H    4 
ATOM 9009  H HA   . GLU A 1 25 ? -1.757  -4.032  -30.323 1.00 0.00 ? 88  GLU A HA   4 
ATOM 9010  H HB2  . GLU A 1 25 ? -0.592  -1.604  -31.705 1.00 0.00 ? 88  GLU A HB2  4 
ATOM 9011  H HB3  . GLU A 1 25 ? -2.139  -2.347  -32.095 1.00 0.00 ? 88  GLU A HB3  4 
ATOM 9012  H HG2  . GLU A 1 25 ? -2.919  -1.889  -29.802 1.00 0.00 ? 88  GLU A HG2  4 
ATOM 9013  H HG3  . GLU A 1 25 ? -1.380  -1.067  -29.472 1.00 0.00 ? 88  GLU A HG3  4 
ATOM 9014  N N    . LEU A 1 26 ? 0.850   -4.690  -31.959 1.00 0.00 ? 89  LEU A N    4 
ATOM 9015  C CA   . LEU A 1 26 ? 1.393   -5.665  -32.899 1.00 0.00 ? 89  LEU A CA   4 
ATOM 9016  C C    . LEU A 1 26 ? 1.161   -7.089  -32.409 1.00 0.00 ? 89  LEU A C    4 
ATOM 9017  O O    . LEU A 1 26 ? 1.286   -7.375  -31.218 1.00 0.00 ? 89  LEU A O    4 
ATOM 9018  C CB   . LEU A 1 26 ? 2.895   -5.426  -33.100 1.00 0.00 ? 89  LEU A CB   4 
ATOM 9019  C CG   . LEU A 1 26 ? 3.270   -4.141  -33.850 1.00 0.00 ? 89  LEU A CG   4 
ATOM 9020  C CD1  . LEU A 1 26 ? 4.782   -3.963  -33.831 1.00 0.00 ? 89  LEU A CD1  4 
ATOM 9021  C CD2  . LEU A 1 26 ? 2.745   -4.214  -35.276 1.00 0.00 ? 89  LEU A CD2  4 
ATOM 9022  H H    . LEU A 1 26 ? 1.430   -4.388  -31.178 1.00 0.00 ? 89  LEU A H    4 
ATOM 9023  H HA   . LEU A 1 26 ? 0.910   -5.523  -33.843 1.00 0.00 ? 89  LEU A HA   4 
ATOM 9024  H HB2  . LEU A 1 26 ? 3.356   -5.417  -32.129 1.00 0.00 ? 89  LEU A HB2  4 
ATOM 9025  H HB3  . LEU A 1 26 ? 3.299   -6.275  -33.656 1.00 0.00 ? 89  LEU A HB3  4 
ATOM 9026  H HG   . LEU A 1 26 ? 2.818   -3.299  -33.352 1.00 0.00 ? 89  LEU A HG   4 
ATOM 9027  H HD11 . LEU A 1 26 ? 5.120   -3.719  -32.834 1.00 0.00 ? 89  LEU A HD11 4 
ATOM 9028  H HD12 . LEU A 1 26 ? 5.051   -3.160  -34.497 1.00 0.00 ? 89  LEU A HD12 4 
ATOM 9029  H HD13 . LEU A 1 26 ? 5.260   -4.887  -34.161 1.00 0.00 ? 89  LEU A HD13 4 
ATOM 9030  H HD21 . LEU A 1 26 ? 3.347   -3.586  -35.931 1.00 0.00 ? 89  LEU A HD21 4 
ATOM 9031  H HD22 . LEU A 1 26 ? 1.719   -3.855  -35.302 1.00 0.00 ? 89  LEU A HD22 4 
ATOM 9032  H HD23 . LEU A 1 26 ? 2.779   -5.242  -35.645 1.00 0.00 ? 89  LEU A HD23 4 
ATOM 9033  N N    . LYS A 1 27 ? 0.823   -7.979  -33.336 1.00 0.00 ? 90  LYS A N    4 
ATOM 9034  C CA   . LYS A 1 27 ? 0.557   -9.373  -32.999 1.00 0.00 ? 90  LYS A CA   4 
ATOM 9035  C C    . LYS A 1 27 ? 1.247   -10.315 -33.976 1.00 0.00 ? 90  LYS A C    4 
ATOM 9036  O O    . LYS A 1 27 ? 0.589   -11.046 -34.717 1.00 0.00 ? 90  LYS A O    4 
ATOM 9037  C CB   . LYS A 1 27 ? -0.948  -9.642  -32.977 1.00 0.00 ? 90  LYS A CB   4 
ATOM 9038  C CG   . LYS A 1 27 ? -1.718  -8.837  -31.940 1.00 0.00 ? 90  LYS A CG   4 
ATOM 9039  C CD   . LYS A 1 27 ? -3.202  -9.173  -31.968 1.00 0.00 ? 90  LYS A CD   4 
ATOM 9040  C CE   . LYS A 1 27 ? -3.974  -8.356  -30.944 1.00 0.00 ? 90  LYS A CE   4 
ATOM 9041  N NZ   . LYS A 1 27 ? -5.431  -8.664  -30.972 1.00 0.00 ? 90  LYS A NZ   4 
ATOM 9042  H H    . LYS A 1 27 ? 0.736   -7.682  -34.307 1.00 0.00 ? 90  LYS A H    4 
ATOM 9043  H HA   . LYS A 1 27 ? 0.947   -9.584  -32.000 1.00 0.00 ? 90  LYS A HA   4 
ATOM 9044  H HB2  . LYS A 1 27 ? -1.351  -9.381  -33.946 1.00 0.00 ? 90  LYS A HB2  4 
ATOM 9045  H HB3  . LYS A 1 27 ? -1.117  -10.705 -32.795 1.00 0.00 ? 90  LYS A HB3  4 
ATOM 9046  H HG2  . LYS A 1 27 ? -1.319  -9.066  -30.952 1.00 0.00 ? 90  LYS A HG2  4 
ATOM 9047  H HG3  . LYS A 1 27 ? -1.589  -7.775  -32.146 1.00 0.00 ? 90  LYS A HG3  4 
ATOM 9048  H HD2  . LYS A 1 27 ? -3.594  -8.960  -32.963 1.00 0.00 ? 90  LYS A HD2  4 
ATOM 9049  H HD3  . LYS A 1 27 ? -3.331  -10.232 -31.748 1.00 0.00 ? 90  LYS A HD3  4 
ATOM 9050  H HE2  . LYS A 1 27 ? -3.587  -8.579  -29.951 1.00 0.00 ? 90  LYS A HE2  4 
ATOM 9051  H HE3  . LYS A 1 27 ? -3.830  -7.297  -31.157 1.00 0.00 ? 90  LYS A HE3  4 
ATOM 9052  H HZ1  . LYS A 1 27 ? -5.803  -8.474  -31.925 1.00 0.00 ? 90  LYS A HZ1  4 
ATOM 9053  H HZ2  . LYS A 1 27 ? -5.930  -8.070  -30.279 1.00 0.00 ? 90  LYS A HZ2  4 
ATOM 9054  H HZ3  . LYS A 1 27 ? -5.573  -9.637  -30.744 1.00 0.00 ? 90  LYS A HZ3  4 
ATOM 9055  N N    . VAL A 1 28 ? 2.575   -10.296 -33.973 1.00 0.00 ? 91  VAL A N    4 
ATOM 9056  C CA   . VAL A 1 28 ? 3.355   -11.174 -34.836 1.00 0.00 ? 91  VAL A CA   4 
ATOM 9057  C C    . VAL A 1 28 ? 3.065   -12.640 -34.537 1.00 0.00 ? 91  VAL A C    4 
ATOM 9058  O O    . VAL A 1 28 ? 3.005   -13.047 -33.377 1.00 0.00 ? 91  VAL A O    4 
ATOM 9059  C CB   . VAL A 1 28 ? 4.861   -10.905 -34.651 1.00 0.00 ? 91  VAL A CB   4 
ATOM 9060  C CG1  . VAL A 1 28 ? 5.299   -11.277 -33.240 1.00 0.00 ? 91  VAL A CG1  4 
ATOM 9061  C CG2  . VAL A 1 28 ? 5.658   -11.684 -35.686 1.00 0.00 ? 91  VAL A CG2  4 
ATOM 9062  H H    . VAL A 1 28 ? 3.061   -9.673  -33.326 1.00 0.00 ? 91  VAL A H    4 
ATOM 9063  H HA   . VAL A 1 28 ? 3.090   -10.968 -35.872 1.00 0.00 ? 91  VAL A HA   4 
ATOM 9064  H HB   . VAL A 1 28 ? 5.046   -9.841  -34.800 1.00 0.00 ? 91  VAL A HB   4 
ATOM 9065  H HG11 . VAL A 1 28 ? 6.297   -10.883 -33.049 1.00 0.00 ? 91  VAL A HG11 4 
ATOM 9066  H HG12 . VAL A 1 28 ? 5.313   -12.363 -33.147 1.00 0.00 ? 91  VAL A HG12 4 
ATOM 9067  H HG13 . VAL A 1 28 ? 4.599   -10.858 -32.519 1.00 0.00 ? 91  VAL A HG13 4 
ATOM 9068  H HG21 . VAL A 1 28 ? 5.402   -12.739 -35.614 1.00 0.00 ? 91  VAL A HG21 4 
ATOM 9069  H HG22 . VAL A 1 28 ? 6.718   -11.576 -35.508 1.00 0.00 ? 91  VAL A HG22 4 
ATOM 9070  H HG23 . VAL A 1 28 ? 5.415   -11.325 -36.684 1.00 0.00 ? 91  VAL A HG23 4 
ATOM 9071  N N    . LYS A 1 29 ? 2.885   -13.428 -35.592 1.00 0.00 ? 92  LYS A N    4 
ATOM 9072  C CA   . LYS A 1 29 ? 2.454   -14.814 -35.448 1.00 0.00 ? 92  LYS A CA   4 
ATOM 9073  C C    . LYS A 1 29 ? 2.921   -15.661 -36.622 1.00 0.00 ? 92  LYS A C    4 
ATOM 9074  O O    . LYS A 1 29 ? 3.185   -15.143 -37.709 1.00 0.00 ? 92  LYS A O    4 
ATOM 9075  C CB   . LYS A 1 29 ? 0.931   -14.888 -35.317 1.00 0.00 ? 92  LYS A CB   4 
ATOM 9076  C CG   . LYS A 1 29 ? 0.386   -16.296 -35.118 1.00 0.00 ? 92  LYS A CG   4 
ATOM 9077  C CD   . LYS A 1 29 ? -1.106  -16.274 -34.824 1.00 0.00 ? 92  LYS A CD   4 
ATOM 9078  C CE   . LYS A 1 29 ? -1.654  -17.681 -34.627 1.00 0.00 ? 92  LYS A CE   4 
ATOM 9079  N NZ   . LYS A 1 29 ? -3.113  -17.674 -34.339 1.00 0.00 ? 92  LYS A NZ   4 
ATOM 9080  H H    . LYS A 1 29 ? 2.931   -13.024 -36.529 1.00 0.00 ? 92  LYS A H    4 
ATOM 9081  H HA   . LYS A 1 29 ? 2.894   -15.218 -34.536 1.00 0.00 ? 92  LYS A HA   4 
ATOM 9082  H HB2  . LYS A 1 29 ? 0.638   -14.296 -34.450 1.00 0.00 ? 92  LYS A HB2  4 
ATOM 9083  H HB3  . LYS A 1 29 ? 0.483   -14.444 -36.198 1.00 0.00 ? 92  LYS A HB3  4 
ATOM 9084  H HG2  . LYS A 1 29 ? 0.560   -16.870 -36.028 1.00 0.00 ? 92  LYS A HG2  4 
ATOM 9085  H HG3  . LYS A 1 29 ? 0.907   -16.771 -34.286 1.00 0.00 ? 92  LYS A HG3  4 
ATOM 9086  H HD2  . LYS A 1 29 ? -1.281  -15.695 -33.919 1.00 0.00 ? 92  LYS A HD2  4 
ATOM 9087  H HD3  . LYS A 1 29 ? -1.627  -15.804 -35.659 1.00 0.00 ? 92  LYS A HD3  4 
ATOM 9088  H HE2  . LYS A 1 29 ? -1.477  -18.259 -35.534 1.00 0.00 ? 92  LYS A HE2  4 
ATOM 9089  H HE3  . LYS A 1 29 ? -1.127  -18.150 -33.796 1.00 0.00 ? 92  LYS A HE3  4 
ATOM 9090  H HZ1  . LYS A 1 29 ? -3.639  -17.493 -35.217 1.00 0.00 ? 92  LYS A HZ1  4 
ATOM 9091  H HZ2  . LYS A 1 29 ? -3.322  -16.926 -33.646 1.00 0.00 ? 92  LYS A HZ2  4 
ATOM 9092  H HZ3  . LYS A 1 29 ? -3.387  -18.570 -33.961 1.00 0.00 ? 92  LYS A HZ3  4 
ATOM 9093  N N    . VAL A 1 30 ? 3.022   -16.967 -36.401 1.00 0.00 ? 93  VAL A N    4 
ATOM 9094  C CA   . VAL A 1 30 ? 3.197   -17.919 -37.493 1.00 0.00 ? 93  VAL A CA   4 
ATOM 9095  C C    . VAL A 1 30 ? 2.113   -18.988 -37.471 1.00 0.00 ? 93  VAL A C    4 
ATOM 9096  O O    . VAL A 1 30 ? 1.462   -19.205 -36.449 1.00 0.00 ? 93  VAL A O    4 
ATOM 9097  C CB   . VAL A 1 30 ? 4.581   -18.592 -37.398 1.00 0.00 ? 93  VAL A CB   4 
ATOM 9098  C CG1  . VAL A 1 30 ? 5.687   -17.550 -37.494 1.00 0.00 ? 93  VAL A CG1  4 
ATOM 9099  C CG2  . VAL A 1 30 ? 4.687   -19.374 -36.099 1.00 0.00 ? 93  VAL A CG2  4 
ATOM 9100  H H    . VAL A 1 30 ? 2.753   -17.326 -35.484 1.00 0.00 ? 93  VAL A H    4 
ATOM 9101  H HA   . VAL A 1 30 ? 3.115   -17.408 -38.436 1.00 0.00 ? 93  VAL A HA   4 
ATOM 9102  H HB   . VAL A 1 30 ? 4.677   -19.289 -38.235 1.00 0.00 ? 93  VAL A HB   4 
ATOM 9103  H HG11 . VAL A 1 30 ? 6.046   -17.297 -36.495 1.00 0.00 ? 93  VAL A HG11 4 
ATOM 9104  H HG12 . VAL A 1 30 ? 5.314   -16.648 -37.965 1.00 0.00 ? 93  VAL A HG12 4 
ATOM 9105  H HG13 . VAL A 1 30 ? 6.515   -17.943 -38.080 1.00 0.00 ? 93  VAL A HG13 4 
ATOM 9106  H HG21 . VAL A 1 30 ? 4.386   -18.735 -35.269 1.00 0.00 ? 93  VAL A HG21 4 
ATOM 9107  H HG22 . VAL A 1 30 ? 4.036   -20.245 -36.144 1.00 0.00 ? 93  VAL A HG22 4 
ATOM 9108  H HG23 . VAL A 1 30 ? 5.717   -19.697 -35.951 1.00 0.00 ? 93  VAL A HG23 4 
ATOM 9109  N N    . LEU A 1 31 ? 1.925   -19.656 -38.602 1.00 0.00 ? 94  LEU A N    4 
ATOM 9110  C CA   . LEU A 1 31 ? 0.950   -20.735 -38.703 1.00 0.00 ? 94  LEU A CA   4 
ATOM 9111  C C    . LEU A 1 31 ? 1.442   -21.837 -39.635 1.00 0.00 ? 94  LEU A C    4 
ATOM 9112  O O    . LEU A 1 31 ? 0.916   -22.012 -40.735 1.00 0.00 ? 94  LEU A O    4 
ATOM 9113  C CB   . LEU A 1 31 ? -0.392  -20.191 -39.207 1.00 0.00 ? 94  LEU A CB   4 
ATOM 9114  C CG   . LEU A 1 31 ? -1.584  -21.154 -39.102 1.00 0.00 ? 94  LEU A CG   4 
ATOM 9115  C CD1  . LEU A 1 31 ? -1.810  -21.522 -37.641 1.00 0.00 ? 94  LEU A CD1  4 
ATOM 9116  C CD2  . LEU A 1 31 ? -2.818  -20.501 -39.701 1.00 0.00 ? 94  LEU A CD2  4 
ATOM 9117  H H    . LEU A 1 31 ? 2.503   -19.436 -39.413 1.00 0.00 ? 94  LEU A H    4 
ATOM 9118  H HA   . LEU A 1 31 ? 0.798   -21.168 -37.716 1.00 0.00 ? 94  LEU A HA   4 
ATOM 9119  H HB2  . LEU A 1 31 ? -0.637  -19.302 -38.635 1.00 0.00 ? 94  LEU A HB2  4 
ATOM 9120  H HB3  . LEU A 1 31 ? -0.290  -19.912 -40.236 1.00 0.00 ? 94  LEU A HB3  4 
ATOM 9121  H HG   . LEU A 1 31 ? -1.348  -22.057 -39.667 1.00 0.00 ? 94  LEU A HG   4 
ATOM 9122  H HD11 . LEU A 1 31 ? -2.845  -21.847 -37.510 1.00 0.00 ? 94  LEU A HD11 4 
ATOM 9123  H HD12 . LEU A 1 31 ? -1.626  -20.658 -37.001 1.00 0.00 ? 94  LEU A HD12 4 
ATOM 9124  H HD13 . LEU A 1 31 ? -1.148  -22.338 -37.350 1.00 0.00 ? 94  LEU A HD13 4 
ATOM 9125  H HD21 . LEU A 1 31 ? -2.601  -20.161 -40.714 1.00 0.00 ? 94  LEU A HD21 4 
ATOM 9126  H HD22 . LEU A 1 31 ? -3.109  -19.649 -39.086 1.00 0.00 ? 94  LEU A HD22 4 
ATOM 9127  H HD23 . LEU A 1 31 ? -3.634  -21.225 -39.726 1.00 0.00 ? 94  LEU A HD23 4 
ATOM 9128  N N    . GLY A 1 32 ? 2.448   -22.577 -39.186 1.00 0.00 ? 95  GLY A N    4 
ATOM 9129  C CA   . GLY A 1 32 ? 3.009   -23.668 -39.976 1.00 0.00 ? 95  GLY A CA   4 
ATOM 9130  C C    . GLY A 1 32 ? 4.010   -23.149 -41.000 1.00 0.00 ? 95  GLY A C    4 
ATOM 9131  O O    . GLY A 1 32 ? 5.146   -22.820 -40.660 1.00 0.00 ? 95  GLY A O    4 
ATOM 9132  H H    . GLY A 1 32 ? 2.836   -22.384 -38.263 1.00 0.00 ? 95  GLY A H    4 
ATOM 9133  H HA2  . GLY A 1 32 ? 3.511   -24.369 -39.310 1.00 0.00 ? 95  GLY A HA2  4 
ATOM 9134  H HA3  . GLY A 1 32 ? 2.204   -24.190 -40.497 1.00 0.00 ? 95  GLY A HA3  4 
ATOM 9135  N N    . ASP A 1 33 ? 3.583   -23.081 -42.256 1.00 0.00 ? 96  ASP A N    4 
ATOM 9136  C CA   . ASP A 1 33 ? 4.459   -22.655 -43.342 1.00 0.00 ? 96  ASP A CA   4 
ATOM 9137  C C    . ASP A 1 33 ? 4.157   -21.225 -43.765 1.00 0.00 ? 96  ASP A C    4 
ATOM 9138  O O    . ASP A 1 33 ? 4.486   -20.813 -44.877 1.00 0.00 ? 96  ASP A O    4 
ATOM 9139  C CB   . ASP A 1 33 ? 4.316   -23.591 -44.545 1.00 0.00 ? 96  ASP A CB   4 
ATOM 9140  C CG   . ASP A 1 33 ? 2.909   -23.595 -45.130 1.00 0.00 ? 96  ASP A CG   4 
ATOM 9141  O OD1  . ASP A 1 33 ? 2.037   -23.018 -44.525 1.00 0.00 ? 96  ASP A OD1  4 
ATOM 9142  O OD2  . ASP A 1 33 ? 2.724   -24.174 -46.171 1.00 0.00 ? 96  ASP A OD2  4 
ATOM 9143  H H    . ASP A 1 33 ? 2.630   -23.378 -42.471 1.00 0.00 ? 96  ASP A H    4 
ATOM 9144  H HA   . ASP A 1 33 ? 5.498   -22.691 -43.004 1.00 0.00 ? 96  ASP A HA   4 
ATOM 9145  H HB2  . ASP A 1 33 ? 5.016   -23.277 -45.320 1.00 0.00 ? 96  ASP A HB2  4 
ATOM 9146  H HB3  . ASP A 1 33 ? 4.569   -24.604 -44.230 1.00 0.00 ? 96  ASP A HB3  4 
ATOM 9147  N N    . VAL A 1 34 ? 3.526   -20.469 -42.871 1.00 0.00 ? 97  VAL A N    4 
ATOM 9148  C CA   . VAL A 1 34 ? 3.334   -19.038 -43.076 1.00 0.00 ? 97  VAL A CA   4 
ATOM 9149  C C    . VAL A 1 34 ? 3.744   -18.245 -41.843 1.00 0.00 ? 97  VAL A C    4 
ATOM 9150  O O    . VAL A 1 34 ? 3.862   -18.798 -40.748 1.00 0.00 ? 97  VAL A O    4 
ATOM 9151  C CB   . VAL A 1 34 ? 1.860   -18.739 -43.409 1.00 0.00 ? 97  VAL A CB   4 
ATOM 9152  C CG1  . VAL A 1 34 ? 1.446   -19.456 -44.686 1.00 0.00 ? 97  VAL A CG1  4 
ATOM 9153  C CG2  . VAL A 1 34 ? 0.972   -19.153 -42.245 1.00 0.00 ? 97  VAL A CG2  4 
ATOM 9154  H H    . VAL A 1 34 ? 3.309   -20.867 -41.958 1.00 0.00 ? 97  VAL A H    4 
ATOM 9155  H HA   . VAL A 1 34 ? 3.946   -18.720 -43.889 1.00 0.00 ? 97  VAL A HA   4 
ATOM 9156  H HB   . VAL A 1 34 ? 1.781   -17.680 -43.542 1.00 0.00 ? 97  VAL A HB   4 
ATOM 9157  H HG11 . VAL A 1 34 ? 0.360   -19.550 -44.726 1.00 0.00 ? 97  VAL A HG11 4 
ATOM 9158  H HG12 . VAL A 1 34 ? 1.891   -20.447 -44.733 1.00 0.00 ? 97  VAL A HG12 4 
ATOM 9159  H HG13 . VAL A 1 34 ? 1.777   -18.868 -45.526 1.00 0.00 ? 97  VAL A HG13 4 
ATOM 9160  H HG21 . VAL A 1 34 ? 1.133   -20.204 -42.051 1.00 0.00 ? 97  VAL A HG21 4 
ATOM 9161  H HG22 . VAL A 1 34 ? -0.072  -18.984 -42.502 1.00 0.00 ? 97  VAL A HG22 4 
ATOM 9162  H HG23 . VAL A 1 34 ? 1.225   -18.570 -41.361 1.00 0.00 ? 97  VAL A HG23 4 
ATOM 9163  N N    . ILE A 1 35 ? 3.960   -16.948 -42.024 1.00 0.00 ? 98  ILE A N    4 
ATOM 9164  C CA   . ILE A 1 35 ? 4.207   -16.047 -40.905 1.00 0.00 ? 98  ILE A CA   4 
ATOM 9165  C C    . ILE A 1 35 ? 3.129   -14.976 -40.811 1.00 0.00 ? 98  ILE A C    4 
ATOM 9166  O O    . ILE A 1 35 ? 3.215   -13.937 -41.468 1.00 0.00 ? 98  ILE A O    4 
ATOM 9167  C CB   . ILE A 1 35 ? 5.588   -15.378 -41.031 1.00 0.00 ? 98  ILE A CB   4 
ATOM 9168  C CG1  . ILE A 1 35 ? 6.684   -16.439 -41.166 1.00 0.00 ? 98  ILE A CG1  4 
ATOM 9169  C CG2  . ILE A 1 35 ? 5.857   -14.480 -39.834 1.00 0.00 ? 98  ILE A CG2  4 
ATOM 9170  C CD1  . ILE A 1 35 ? 8.034   -15.875 -41.553 1.00 0.00 ? 98  ILE A CD1  4 
ATOM 9171  H H    . ILE A 1 35 ? 3.819   -16.549 -42.953 1.00 0.00 ? 98  ILE A H    4 
ATOM 9172  H HA   . ILE A 1 35 ? 4.208   -16.608 -39.993 1.00 0.00 ? 98  ILE A HA   4 
ATOM 9173  H HB   . ILE A 1 35 ? 5.571   -14.784 -41.917 1.00 0.00 ? 98  ILE A HB   4 
ATOM 9174  H HG12 . ILE A 1 35 ? 6.780   -16.973 -40.225 1.00 0.00 ? 98  ILE A HG12 4 
ATOM 9175  H HG13 . ILE A 1 35 ? 6.376   -17.145 -41.939 1.00 0.00 ? 98  ILE A HG13 4 
ATOM 9176  H HG21 . ILE A 1 35 ? 6.448   -15.009 -39.097 1.00 0.00 ? 98  ILE A HG21 4 
ATOM 9177  H HG22 . ILE A 1 35 ? 4.936   -14.144 -39.361 1.00 0.00 ? 98  ILE A HG22 4 
ATOM 9178  H HG23 . ILE A 1 35 ? 6.421   -13.603 -40.161 1.00 0.00 ? 98  ILE A HG23 4 
ATOM 9179  H HD11 . ILE A 1 35 ? 8.060   -15.692 -42.627 1.00 0.00 ? 98  ILE A HD11 4 
ATOM 9180  H HD12 . ILE A 1 35 ? 8.814   -16.588 -41.288 1.00 0.00 ? 98  ILE A HD12 4 
ATOM 9181  H HD13 . ILE A 1 35 ? 8.202   -14.938 -41.022 1.00 0.00 ? 98  ILE A HD13 4 
ATOM 9182  N N    . GLU A 1 36 ? 2.115   -15.230 -39.991 1.00 0.00 ? 99  GLU A N    4 
ATOM 9183  C CA   . GLU A 1 36 ? 0.979   -14.328 -39.874 1.00 0.00 ? 99  GLU A CA   4 
ATOM 9184  C C    . GLU A 1 36 ? 1.360   -13.056 -39.128 1.00 0.00 ? 99  GLU A C    4 
ATOM 9185  O O    . GLU A 1 36 ? 1.064   -12.907 -37.941 1.00 0.00 ? 99  GLU A O    4 
ATOM 9186  C CB   . GLU A 1 36 ? -0.182  -15.023 -39.157 1.00 0.00 ? 99  GLU A CB   4 
ATOM 9187  C CG   . GLU A 1 36 ? -0.781  -16.194 -39.919 1.00 0.00 ? 99  GLU A CG   4 
ATOM 9188  C CD   . GLU A 1 36 ? -2.016  -16.750 -39.266 1.00 0.00 ? 99  GLU A CD   4 
ATOM 9189  O OE1  . GLU A 1 36 ? -1.947  -17.102 -38.112 1.00 0.00 ? 99  GLU A OE1  4 
ATOM 9190  O OE2  . GLU A 1 36 ? -3.028  -16.821 -39.921 1.00 0.00 ? 99  GLU A OE2  4 
ATOM 9191  H H    . GLU A 1 36 ? 2.102   -16.114 -39.482 1.00 0.00 ? 99  GLU A H    4 
ATOM 9192  H HA   . GLU A 1 36 ? 0.623   -14.055 -40.845 1.00 0.00 ? 99  GLU A HA   4 
ATOM 9193  H HB2  . GLU A 1 36 ? 0.189   -15.413 -38.216 1.00 0.00 ? 99  GLU A HB2  4 
ATOM 9194  H HB3  . GLU A 1 36 ? -0.968  -14.296 -38.957 1.00 0.00 ? 99  GLU A HB3  4 
ATOM 9195  H HG2  . GLU A 1 36 ? -1.030  -15.828 -40.897 1.00 0.00 ? 99  GLU A HG2  4 
ATOM 9196  H HG3  . GLU A 1 36 ? -0.031  -16.983 -40.007 1.00 0.00 ? 99  GLU A HG3  4 
ATOM 9197  N N    . VAL A 1 37 ? 2.019   -12.141 -39.829 1.00 0.00 ? 100 VAL A N    4 
ATOM 9198  C CA   . VAL A 1 37 ? 2.476   -10.894 -39.223 1.00 0.00 ? 100 VAL A CA   4 
ATOM 9199  C C    . VAL A 1 37 ? 1.324   -9.913  -39.048 1.00 0.00 ? 100 VAL A C    4 
ATOM 9200  O O    . VAL A 1 37 ? 1.176   -8.970  -39.824 1.00 0.00 ? 100 VAL A O    4 
ATOM 9201  C CB   . VAL A 1 37 ? 3.570   -10.247 -40.094 1.00 0.00 ? 100 VAL A CB   4 
ATOM 9202  C CG1  . VAL A 1 37 ? 4.102   -8.985  -39.432 1.00 0.00 ? 100 VAL A CG1  4 
ATOM 9203  C CG2  . VAL A 1 37 ? 4.694   -11.242 -40.338 1.00 0.00 ? 100 VAL A CG2  4 
ATOM 9204  H H    . VAL A 1 37 ? 2.235   -12.326 -40.807 1.00 0.00 ? 100 VAL A H    4 
ATOM 9205  H HA   . VAL A 1 37 ? 2.901   -11.111 -38.244 1.00 0.00 ? 100 VAL A HA   4 
ATOM 9206  H HB   . VAL A 1 37 ? 3.131   -9.988  -41.023 1.00 0.00 ? 100 VAL A HB   4 
ATOM 9207  H HG11 . VAL A 1 37 ? 3.304   -8.399  -39.011 1.00 0.00 ? 100 VAL A HG11 4 
ATOM 9208  H HG12 . VAL A 1 37 ? 4.637   -8.387  -40.169 1.00 0.00 ? 100 VAL A HG12 4 
ATOM 9209  H HG13 . VAL A 1 37 ? 4.786   -9.267  -38.630 1.00 0.00 ? 100 VAL A HG13 4 
ATOM 9210  H HG21 . VAL A 1 37 ? 5.394   -10.817 -41.055 1.00 0.00 ? 100 VAL A HG21 4 
ATOM 9211  H HG22 . VAL A 1 37 ? 5.206   -11.450 -39.399 1.00 0.00 ? 100 VAL A HG22 4 
ATOM 9212  H HG23 . VAL A 1 37 ? 4.292   -12.158 -40.733 1.00 0.00 ? 100 VAL A HG23 4 
ATOM 9213  N N    . HIS A 1 38 ? 0.512   -10.139 -38.021 1.00 0.00 ? 101 HIS A N    4 
ATOM 9214  C CA   . HIS A 1 38 ? -0.579  -9.229  -37.691 1.00 0.00 ? 101 HIS A CA   4 
ATOM 9215  C C    . HIS A 1 38 ? -0.074  -8.038  -36.886 1.00 0.00 ? 101 HIS A C    4 
ATOM 9216  O O    . HIS A 1 38 ? 0.911   -8.142  -36.156 1.00 0.00 ? 101 HIS A O    4 
ATOM 9217  C CB   . HIS A 1 38 ? -1.672  -9.957  -36.904 1.00 0.00 ? 101 HIS A CB   4 
ATOM 9218  C CG   . HIS A 1 38 ? -2.891  -9.124  -36.655 1.00 0.00 ? 101 HIS A CG   4 
ATOM 9219  N ND1  . HIS A 1 38 ? -2.954  -8.181  -35.652 1.00 0.00 ? 101 HIS A ND1  4 
ATOM 9220  C CD2  . HIS A 1 38 ? -4.091  -9.092  -37.279 1.00 0.00 ? 101 HIS A CD2  4 
ATOM 9221  C CE1  . HIS A 1 38 ? -4.142  -7.603  -35.671 1.00 0.00 ? 101 HIS A CE1  4 
ATOM 9222  N NE2  . HIS A 1 38 ? -4.851  -8.139  -36.646 1.00 0.00 ? 101 HIS A NE2  4 
ATOM 9223  H H    . HIS A 1 38 ? 0.701   -10.927 -37.404 1.00 0.00 ? 101 HIS A H    4 
ATOM 9224  H HA   . HIS A 1 38 ? -1.009  -8.849  -38.593 1.00 0.00 ? 101 HIS A HA   4 
ATOM 9225  H HB2  . HIS A 1 38 ? -1.977  -10.831 -37.480 1.00 0.00 ? 101 HIS A HB2  4 
ATOM 9226  H HB3  . HIS A 1 38 ? -1.263  -10.294 -35.964 1.00 0.00 ? 101 HIS A HB3  4 
ATOM 9227  H HD2  . HIS A 1 38 ? -4.459  -9.842  -37.964 1.00 0.00 ? 101 HIS A HD2  4 
ATOM 9228  H HE1  . HIS A 1 38 ? -4.476  -6.825  -34.998 1.00 0.00 ? 101 HIS A HE1  4 
ATOM 9229  H HE2  . HIS A 1 38 ? -5.799  -7.889  -36.888 1.00 0.00 ? 101 HIS A HE2  4 
ATOM 9230  N N    . GLY A 1 39 ? -0.755  -6.906  -37.024 1.00 0.00 ? 102 GLY A N    4 
ATOM 9231  C CA   . GLY A 1 39 ? -0.416  -5.708  -36.265 1.00 0.00 ? 102 GLY A CA   4 
ATOM 9232  C C    . GLY A 1 39 ? -1.361  -4.562  -36.594 1.00 0.00 ? 102 GLY A C    4 
ATOM 9233  O O    . GLY A 1 39 ? -2.034  -4.574  -37.626 1.00 0.00 ? 102 GLY A O    4 
ATOM 9234  H H    . GLY A 1 39 ? -1.568  -6.892  -37.640 1.00 0.00 ? 102 GLY A H    4 
ATOM 9235  H HA2  . GLY A 1 39 ? -0.519  -5.941  -35.218 1.00 0.00 ? 102 GLY A HA2  4 
ATOM 9236  H HA3  . GLY A 1 39 ? 0.606   -5.428  -36.487 1.00 0.00 ? 102 GLY A HA3  4 
ATOM 9237  N N    . LYS A 1 40 ? -1.410  -3.567  -35.711 1.00 0.00 ? 103 LYS A N    4 
ATOM 9238  C CA   . LYS A 1 40 ? -2.215  -2.377  -35.943 1.00 0.00 ? 103 LYS A CA   4 
ATOM 9239  C C    . LYS A 1 40 ? -1.685  -1.190  -35.147 1.00 0.00 ? 103 LYS A C    4 
ATOM 9240  O O    . LYS A 1 40 ? -1.080  -1.361  -34.088 1.00 0.00 ? 103 LYS A O    4 
ATOM 9241  C CB   . LYS A 1 40 ? -3.678  -2.639  -35.581 1.00 0.00 ? 103 LYS A CB   4 
ATOM 9242  C CG   . LYS A 1 40 ? -3.933  -2.844  -34.094 1.00 0.00 ? 103 LYS A CG   4 
ATOM 9243  C CD   . LYS A 1 40 ? -5.382  -3.217  -33.827 1.00 0.00 ? 103 LYS A CD   4 
ATOM 9244  C CE   . LYS A 1 40 ? -5.656  -3.345  -32.334 1.00 0.00 ? 103 LYS A CE   4 
ATOM 9245  N NZ   . LYS A 1 40 ? -7.080  -3.679  -32.058 1.00 0.00 ? 103 LYS A NZ   4 
ATOM 9246  H H    . LYS A 1 40 ? -0.819  -3.616  -34.882 1.00 0.00 ? 103 LYS A H    4 
ATOM 9247  H HA   . LYS A 1 40 ? -2.154  -2.133  -36.989 1.00 0.00 ? 103 LYS A HA   4 
ATOM 9248  H HB2  . LYS A 1 40 ? -4.295  -1.823  -35.944 1.00 0.00 ? 103 LYS A HB2  4 
ATOM 9249  H HB3  . LYS A 1 40 ? -3.977  -3.547  -36.065 1.00 0.00 ? 103 LYS A HB3  4 
ATOM 9250  H HG2  . LYS A 1 40 ? -3.275  -3.623  -33.709 1.00 0.00 ? 103 LYS A HG2  4 
ATOM 9251  H HG3  . LYS A 1 40 ? -3.729  -1.901  -33.592 1.00 0.00 ? 103 LYS A HG3  4 
ATOM 9252  H HD2  . LYS A 1 40 ? -6.034  -2.451  -34.245 1.00 0.00 ? 103 LYS A HD2  4 
ATOM 9253  H HD3  . LYS A 1 40 ? -5.591  -4.172  -34.310 1.00 0.00 ? 103 LYS A HD3  4 
ATOM 9254  H HE2  . LYS A 1 40 ? -5.024  -4.130  -31.925 1.00 0.00 ? 103 LYS A HE2  4 
ATOM 9255  H HE3  . LYS A 1 40 ? -5.413  -2.399  -31.851 1.00 0.00 ? 103 LYS A HE3  4 
ATOM 9256  H HZ1  . LYS A 1 40 ? -7.187  -3.982  -31.069 1.00 0.00 ? 103 LYS A HZ1  4 
ATOM 9257  H HZ2  . LYS A 1 40 ? -7.380  -4.449  -32.691 1.00 0.00 ? 103 LYS A HZ2  4 
ATOM 9258  H HZ3  . LYS A 1 40 ? -7.654  -2.865  -32.225 1.00 0.00 ? 103 LYS A HZ3  4 
ATOM 9259  N N    . HIS A 1 41 ? -1.913  0.012   -35.662 1.00 0.00 ? 104 HIS A N    4 
ATOM 9260  C CA   . HIS A 1 41 ? -1.822  1.223   -34.854 1.00 0.00 ? 104 HIS A CA   4 
ATOM 9261  C C    . HIS A 1 41 ? -3.066  2.088   -35.016 1.00 0.00 ? 104 HIS A C    4 
ATOM 9262  O O    . HIS A 1 41 ? -3.342  2.600   -36.102 1.00 0.00 ? 104 HIS A O    4 
ATOM 9263  C CB   . HIS A 1 41 ? -0.578  2.032   -35.232 1.00 0.00 ? 104 HIS A CB   4 
ATOM 9264  C CG   . HIS A 1 41 ? -0.294  3.168   -34.299 1.00 0.00 ? 104 HIS A CG   4 
ATOM 9265  N ND1  . HIS A 1 41 ? -1.201  4.179   -34.059 1.00 0.00 ? 104 HIS A ND1  4 
ATOM 9266  C CD2  . HIS A 1 41 ? 0.797   3.454   -33.547 1.00 0.00 ? 104 HIS A CD2  4 
ATOM 9267  C CE1  . HIS A 1 41 ? -0.681  5.037   -33.197 1.00 0.00 ? 104 HIS A CE1  4 
ATOM 9268  N NE2  . HIS A 1 41 ? 0.529   4.619   -32.874 1.00 0.00 ? 104 HIS A NE2  4 
ATOM 9269  H H    . HIS A 1 41 ? -2.467  0.061   -36.519 1.00 0.00 ? 104 HIS A H    4 
ATOM 9270  H HA   . HIS A 1 41 ? -1.736  0.957   -33.796 1.00 0.00 ? 104 HIS A HA   4 
ATOM 9271  H HB2  . HIS A 1 41 ? 0.253   1.383   -35.212 1.00 0.00 ? 104 HIS A HB2  4 
ATOM 9272  H HB3  . HIS A 1 41 ? -0.716  2.405   -36.237 1.00 0.00 ? 104 HIS A HB3  4 
ATOM 9273  H HD1  . HIS A 1 41 ? -2.116  4.258   -34.484 1.00 0.00 ? 104 HIS A HD1  4 
ATOM 9274  H HD2  . HIS A 1 41 ? 1.602   2.766   -33.327 1.00 0.00 ? 104 HIS A HD2  4 
ATOM 9275  H HE1  . HIS A 1 41 ? -1.167  5.926   -32.825 1.00 0.00 ? 104 HIS A HE1  4 
ATOM 9276  N N    . GLU A 1 42 ? -3.815  2.246   -33.930 1.00 0.00 ? 105 GLU A N    4 
ATOM 9277  C CA   . GLU A 1 42 ? -5.061  3.006   -33.962 1.00 0.00 ? 105 GLU A CA   4 
ATOM 9278  C C    . GLU A 1 42 ? -4.801  4.480   -34.233 1.00 0.00 ? 105 GLU A C    4 
ATOM 9279  O O    . GLU A 1 42 ? -3.664  4.888   -34.474 1.00 0.00 ? 105 GLU A O    4 
ATOM 9280  C CB   . GLU A 1 42 ? -5.817  2.845   -32.641 1.00 0.00 ? 105 GLU A CB   4 
ATOM 9281  C CG   . GLU A 1 42 ? -6.342  1.439   -32.386 1.00 0.00 ? 105 GLU A CG   4 
ATOM 9282  C CD   . GLU A 1 42 ? -7.123  1.330   -31.104 1.00 0.00 ? 105 GLU A CD   4 
ATOM 9283  O OE1  . GLU A 1 42 ? -7.159  2.288   -30.370 1.00 0.00 ? 105 GLU A OE1  4 
ATOM 9284  O OE2  . GLU A 1 42 ? -7.685  0.288   -30.862 1.00 0.00 ? 105 GLU A OE2  4 
ATOM 9285  H H    . GLU A 1 42 ? -3.531  1.792   -33.063 1.00 0.00 ? 105 GLU A H    4 
ATOM 9286  H HA   . GLU A 1 42 ? -5.691  2.611   -34.754 1.00 0.00 ? 105 GLU A HA   4 
ATOM 9287  H HB2  . GLU A 1 42 ? -5.150  3.110   -31.823 1.00 0.00 ? 105 GLU A HB2  4 
ATOM 9288  H HB3  . GLU A 1 42 ? -6.666  3.529   -32.640 1.00 0.00 ? 105 GLU A HB3  4 
ATOM 9289  H HG2  . GLU A 1 42 ? -6.988  1.156   -33.216 1.00 0.00 ? 105 GLU A HG2  4 
ATOM 9290  H HG3  . GLU A 1 42 ? -5.495  0.753   -32.342 1.00 0.00 ? 105 GLU A HG3  4 
ATOM 9291  N N    . GLU A 1 43 ? -5.860  5.281   -34.192 1.00 0.00 ? 106 GLU A N    4 
ATOM 9292  C CA   . GLU A 1 43 ? -5.788  6.673   -34.620 1.00 0.00 ? 106 GLU A CA   4 
ATOM 9293  C C    . GLU A 1 43 ? -4.370  7.216   -34.489 1.00 0.00 ? 106 GLU A C    4 
ATOM 9294  O O    . GLU A 1 43 ? -3.828  7.304   -33.386 1.00 0.00 ? 106 GLU A O    4 
ATOM 9295  C CB   . GLU A 1 43 ? -6.752  7.534   -33.801 1.00 0.00 ? 106 GLU A CB   4 
ATOM 9296  C CG   . GLU A 1 43 ? -8.222  7.217   -34.025 1.00 0.00 ? 106 GLU A CG   4 
ATOM 9297  C CD   . GLU A 1 43 ? -9.140  8.079   -33.201 1.00 0.00 ? 106 GLU A CD   4 
ATOM 9298  O OE1  . GLU A 1 43 ? -8.651  8.825   -32.387 1.00 0.00 ? 106 GLU A OE1  4 
ATOM 9299  O OE2  . GLU A 1 43 ? -10.329 7.991   -33.386 1.00 0.00 ? 106 GLU A OE2  4 
ATOM 9300  H H    . GLU A 1 43 ? -6.775  4.868   -34.012 1.00 0.00 ? 106 GLU A H    4 
ATOM 9301  H HA   . GLU A 1 43 ? -6.087  6.747   -35.666 1.00 0.00 ? 106 GLU A HA   4 
ATOM 9302  H HB2  . GLU A 1 43 ? -6.533  7.381   -32.745 1.00 0.00 ? 106 GLU A HB2  4 
ATOM 9303  H HB3  . GLU A 1 43 ? -6.592  8.585   -34.045 1.00 0.00 ? 106 GLU A HB3  4 
ATOM 9304  H HG2  . GLU A 1 43 ? -8.448  7.368   -35.080 1.00 0.00 ? 106 GLU A HG2  4 
ATOM 9305  H HG3  . GLU A 1 43 ? -8.395  6.172   -33.769 1.00 0.00 ? 106 GLU A HG3  4 
ATOM 9306  N N    . ARG A 1 44 ? -3.773  7.578   -35.620 1.00 0.00 ? 107 ARG A N    4 
ATOM 9307  C CA   . ARG A 1 44 ? -2.327  7.733   -35.706 1.00 0.00 ? 107 ARG A CA   4 
ATOM 9308  C C    . ARG A 1 44 ? -1.955  9.015   -36.442 1.00 0.00 ? 107 ARG A C    4 
ATOM 9309  O O    . ARG A 1 44 ? -1.527  8.978   -37.595 1.00 0.00 ? 107 ARG A O    4 
ATOM 9310  C CB   . ARG A 1 44 ? -1.703  6.543   -36.419 1.00 0.00 ? 107 ARG A CB   4 
ATOM 9311  C CG   . ARG A 1 44 ? -0.181  6.538   -36.442 1.00 0.00 ? 107 ARG A CG   4 
ATOM 9312  C CD   . ARG A 1 44 ? 0.353   5.344   -37.145 1.00 0.00 ? 107 ARG A CD   4 
ATOM 9313  N NE   . ARG A 1 44 ? 0.184   5.443   -38.586 1.00 0.00 ? 107 ARG A NE   4 
ATOM 9314  C CZ   . ARG A 1 44 ? 0.635   4.533   -39.474 1.00 0.00 ? 107 ARG A CZ   4 
ATOM 9315  N NH1  . ARG A 1 44 ? 1.277   3.467   -39.052 1.00 0.00 ? 107 ARG A NH1  4 
ATOM 9316  N NH2  . ARG A 1 44 ? 0.430   4.715   -40.766 1.00 0.00 ? 107 ARG A NH2  4 
ATOM 9317  H H    . ARG A 1 44 ? -4.281  7.417   -36.491 1.00 0.00 ? 107 ARG A H    4 
ATOM 9318  H HA   . ARG A 1 44 ? -1.905  7.783   -34.702 1.00 0.00 ? 107 ARG A HA   4 
ATOM 9319  H HB2  . ARG A 1 44 ? -2.031  5.635   -35.928 1.00 0.00 ? 107 ARG A HB2  4 
ATOM 9320  H HB3  . ARG A 1 44 ? -2.063  6.536   -37.430 1.00 0.00 ? 107 ARG A HB3  4 
ATOM 9321  H HG2  . ARG A 1 44 ? 0.165   7.429   -36.959 1.00 0.00 ? 107 ARG A HG2  4 
ATOM 9322  H HG3  . ARG A 1 44 ? 0.186   6.550   -35.416 1.00 0.00 ? 107 ARG A HG3  4 
ATOM 9323  H HD2  . ARG A 1 44 ? 1.408   5.234   -36.925 1.00 0.00 ? 107 ARG A HD2  4 
ATOM 9324  H HD3  . ARG A 1 44 ? -0.174  4.472   -36.793 1.00 0.00 ? 107 ARG A HD3  4 
ATOM 9325  H HE   . ARG A 1 44 ? -0.292  6.225   -38.937 1.00 0.00 ? 107 ARG A HE   4 
ATOM 9326  H HH11 . ARG A 1 44 ? 1.434   3.329   -38.075 1.00 0.00 ? 107 ARG A HH11 4 
ATOM 9327  H HH12 . ARG A 1 44 ? 1.614   2.786   -39.718 1.00 0.00 ? 107 ARG A HH12 4 
ATOM 9328  H HH21 . ARG A 1 44 ? -0.059  5.525   -41.090 1.00 0.00 ? 107 ARG A HH21 4 
ATOM 9329  H HH22 . ARG A 1 44 ? 0.765   4.036   -41.422 1.00 0.00 ? 107 ARG A HH22 4 
ATOM 9330  N N    . GLN A 1 45 ? -2.118  10.147  -35.766 1.00 0.00 ? 108 GLN A N    4 
ATOM 9331  C CA   . GLN A 1 45 ? -1.765  11.440  -36.341 1.00 0.00 ? 108 GLN A CA   4 
ATOM 9332  C C    . GLN A 1 45 ? -0.404  11.386  -37.020 1.00 0.00 ? 108 GLN A C    4 
ATOM 9333  O O    . GLN A 1 45 ? 0.630   11.287  -36.358 1.00 0.00 ? 108 GLN A O    4 
ATOM 9334  C CB   . GLN A 1 45 ? -1.768  12.524  -35.261 1.00 0.00 ? 108 GLN A CB   4 
ATOM 9335  C CG   . GLN A 1 45 ? -1.437  13.914  -35.776 1.00 0.00 ? 108 GLN A CG   4 
ATOM 9336  C CD   . GLN A 1 45 ? -2.504  14.454  -36.711 1.00 0.00 ? 108 GLN A CD   4 
ATOM 9337  O OE1  . GLN A 1 45 ? -3.693  14.451  -36.387 1.00 0.00 ? 108 GLN A OE1  4 
ATOM 9338  N NE2  . GLN A 1 45 ? -2.080  14.922  -37.880 1.00 0.00 ? 108 GLN A NE2  4 
ATOM 9339  H H    . GLN A 1 45 ? -2.462  10.107  -34.807 1.00 0.00 ? 108 GLN A H    4 
ATOM 9340  H HA   . GLN A 1 45 ? -2.516  11.706  -37.074 1.00 0.00 ? 108 GLN A HA   4 
ATOM 9341  H HB2  . GLN A 1 45 ? -2.753  12.557  -34.805 1.00 0.00 ? 108 GLN A HB2  4 
ATOM 9342  H HB3  . GLN A 1 45 ? -1.039  12.246  -34.499 1.00 0.00 ? 108 GLN A HB3  4 
ATOM 9343  H HG2  . GLN A 1 45 ? -1.349  14.594  -34.928 1.00 0.00 ? 108 GLN A HG2  4 
ATOM 9344  H HG3  . GLN A 1 45 ? -0.483  13.884  -36.300 1.00 0.00 ? 108 GLN A HG3  4 
ATOM 9345  H HE21 . GLN A 1 45 ? -1.088  14.917  -38.112 1.00 0.00 ? 108 GLN A HE21 4 
ATOM 9346  H HE22 . GLN A 1 45 ? -2.760  15.293  -38.546 1.00 0.00 ? 108 GLN A HE22 4 
ATOM 9347  N N    . ASP A 1 46 ? -0.407  11.453  -38.348 1.00 0.00 ? 109 ASP A N    4 
ATOM 9348  C CA   . ASP A 1 46 ? 0.808   11.256  -39.128 1.00 0.00 ? 109 ASP A CA   4 
ATOM 9349  C C    . ASP A 1 46 ? 0.633   11.757  -40.556 1.00 0.00 ? 109 ASP A C    4 
ATOM 9350  O O    . ASP A 1 46 ? 0.076   12.830  -40.784 1.00 0.00 ? 109 ASP A O    4 
ATOM 9351  C CB   . ASP A 1 46 ? 1.200   9.776   -39.146 1.00 0.00 ? 109 ASP A CB   4 
ATOM 9352  C CG   . ASP A 1 46 ? 2.696   9.560   -39.330 1.00 0.00 ? 109 ASP A CG   4 
ATOM 9353  O OD1  . ASP A 1 46 ? 3.386   10.517  -39.594 1.00 0.00 ? 109 ASP A OD1  4 
ATOM 9354  O OD2  . ASP A 1 46 ? 3.135   8.442   -39.206 1.00 0.00 ? 109 ASP A OD2  4 
ATOM 9355  H H    . ASP A 1 46 ? -1.297  11.519  -38.836 1.00 0.00 ? 109 ASP A H    4 
ATOM 9356  H HA   . ASP A 1 46 ? 1.607   11.824  -38.655 1.00 0.00 ? 109 ASP A HA   4 
ATOM 9357  H HB2  . ASP A 1 46 ? 0.904   9.330   -38.198 1.00 0.00 ? 109 ASP A HB2  4 
ATOM 9358  H HB3  . ASP A 1 46 ? 0.677   9.268   -39.946 1.00 0.00 ? 109 ASP A HB3  4 
ATOM 9359  N N    . GLU A 1 47 ? 1.115   10.975  -41.516 1.00 0.00 ? 110 GLU A N    4 
ATOM 9360  C CA   . GLU A 1 47 ? 1.045   11.355  -42.921 1.00 0.00 ? 110 GLU A CA   4 
ATOM 9361  C C    . GLU A 1 47 ? -0.339  11.873  -43.284 1.00 0.00 ? 110 GLU A C    4 
ATOM 9362  O O    . GLU A 1 47 ? -0.505  13.042  -43.637 1.00 0.00 ? 110 GLU A O    4 
ATOM 9363  C CB   . GLU A 1 47 ? 1.405   10.166  -43.816 1.00 0.00 ? 110 GLU A CB   4 
ATOM 9364  C CG   . GLU A 1 47 ? 2.861   9.728   -43.722 1.00 0.00 ? 110 GLU A CG   4 
ATOM 9365  C CD   . GLU A 1 47 ? 3.150   8.487   -44.519 1.00 0.00 ? 110 GLU A CD   4 
ATOM 9366  O OE1  . GLU A 1 47 ? 2.221   7.880   -44.997 1.00 0.00 ? 110 GLU A OE1  4 
ATOM 9367  O OE2  . GLU A 1 47 ? 4.301   8.142   -44.649 1.00 0.00 ? 110 GLU A OE2  4 
ATOM 9368  H H    . GLU A 1 47 ? 1.580   10.104  -41.261 1.00 0.00 ? 110 GLU A H    4 
ATOM 9369  H HA   . GLU A 1 47 ? 1.752   12.145  -43.092 1.00 0.00 ? 110 GLU A HA   4 
ATOM 9370  H HB2  . GLU A 1 47 ? 0.772   9.321   -43.544 1.00 0.00 ? 110 GLU A HB2  4 
ATOM 9371  H HB3  . GLU A 1 47 ? 1.203   10.437  -44.852 1.00 0.00 ? 110 GLU A HB3  4 
ATOM 9372  H HG2  . GLU A 1 47 ? 3.490   10.512  -44.071 1.00 0.00 ? 110 GLU A HG2  4 
ATOM 9373  H HG3  . GLU A 1 47 ? 3.088   9.528   -42.675 1.00 0.00 ? 110 GLU A HG3  4 
ATOM 9374  N N    . HIS A 1 48 ? -1.337  10.998  -43.195 1.00 0.00 ? 111 HIS A N    4 
ATOM 9375  C CA   . HIS A 1 48 ? -2.695  11.340  -43.596 1.00 0.00 ? 111 HIS A CA   4 
ATOM 9376  C C    . HIS A 1 48 ? -3.623  11.410  -42.388 1.00 0.00 ? 111 HIS A C    4 
ATOM 9377  O O    . HIS A 1 48 ? -4.373  10.474  -42.113 1.00 0.00 ? 111 HIS A O    4 
ATOM 9378  C CB   . HIS A 1 48 ? -3.237  10.321  -44.603 1.00 0.00 ? 111 HIS A CB   4 
ATOM 9379  C CG   . HIS A 1 48 ? -2.400  10.193  -45.836 1.00 0.00 ? 111 HIS A CG   4 
ATOM 9380  N ND1  . HIS A 1 48 ? -1.357  9.294   -45.937 1.00 0.00 ? 111 HIS A ND1  4 
ATOM 9381  C CD2  . HIS A 1 48 ? -2.450  10.847  -47.019 1.00 0.00 ? 111 HIS A CD2  4 
ATOM 9382  C CE1  . HIS A 1 48 ? -0.801  9.404   -47.133 1.00 0.00 ? 111 HIS A CE1  4 
ATOM 9383  N NE2  . HIS A 1 48 ? -1.447  10.338  -47.807 1.00 0.00 ? 111 HIS A NE2  4 
ATOM 9384  H H    . HIS A 1 48 ? -1.135  10.039  -42.911 1.00 0.00 ? 111 HIS A H    4 
ATOM 9385  H HA   . HIS A 1 48 ? -2.687  12.310  -44.075 1.00 0.00 ? 111 HIS A HA   4 
ATOM 9386  H HB2  . HIS A 1 48 ? -3.176  9.373   -44.088 1.00 0.00 ? 111 HIS A HB2  4 
ATOM 9387  H HB3  . HIS A 1 48 ? -4.275  10.516  -44.851 1.00 0.00 ? 111 HIS A HB3  4 
ATOM 9388  H HD2  . HIS A 1 48 ? -2.935  11.788  -47.191 1.00 0.00 ? 111 HIS A HD2  4 
ATOM 9389  H HE1  . HIS A 1 48 ? 0.035   8.824   -47.494 1.00 0.00 ? 111 HIS A HE1  4 
ATOM 9390  H HE2  . HIS A 1 48 ? -1.236  10.632  -48.750 1.00 0.00 ? 111 HIS A HE2  4 
ATOM 9391  N N    . GLY A 1 49 ? -3.568  12.528  -41.671 1.00 0.00 ? 112 GLY A N    4 
ATOM 9392  C CA   . GLY A 1 49 ? -4.379  12.710  -40.473 1.00 0.00 ? 112 GLY A CA   4 
ATOM 9393  C C    . GLY A 1 49 ? -4.146  11.585  -39.474 1.00 0.00 ? 112 GLY A C    4 
ATOM 9394  O O    . GLY A 1 49 ? -3.005  11.208  -39.203 1.00 0.00 ? 112 GLY A O    4 
ATOM 9395  H H    . GLY A 1 49 ? -2.923  13.266  -41.957 1.00 0.00 ? 112 GLY A H    4 
ATOM 9396  H HA2  . GLY A 1 49 ? -4.099  13.653  -40.005 1.00 0.00 ? 112 GLY A HA2  4 
ATOM 9397  H HA3  . GLY A 1 49 ? -5.411  12.739  -40.719 1.00 0.00 ? 112 GLY A HA3  4 
ATOM 9398  N N    . PHE A 1 50 ? -5.235  11.050  -38.929 1.00 0.00 ? 113 PHE A N    4 
ATOM 9399  C CA   . PHE A 1 50 ? -5.165  9.862   -38.086 1.00 0.00 ? 113 PHE A CA   4 
ATOM 9400  C C    . PHE A 1 50 ? -5.287  8.591   -38.914 1.00 0.00 ? 113 PHE A C    4 
ATOM 9401  O O    . PHE A 1 50 ? -6.199  8.456   -39.731 1.00 0.00 ? 113 PHE A O    4 
ATOM 9402  C CB   . PHE A 1 50 ? -6.264  9.895   -37.025 1.00 0.00 ? 113 PHE A CB   4 
ATOM 9403  C CG   . PHE A 1 50 ? -6.107  11.002  -36.020 1.00 0.00 ? 113 PHE A CG   4 
ATOM 9404  C CD1  . PHE A 1 50 ? -5.287  10.842  -34.915 1.00 0.00 ? 113 PHE A CD1  4 
ATOM 9405  C CD2  . PHE A 1 50 ? -6.777  12.205  -36.181 1.00 0.00 ? 113 PHE A CD2  4 
ATOM 9406  C CE1  . PHE A 1 50 ? -5.140  11.858  -33.989 1.00 0.00 ? 113 PHE A CE1  4 
ATOM 9407  C CE2  . PHE A 1 50 ? -6.633  13.224  -35.259 1.00 0.00 ? 113 PHE A CE2  4 
ATOM 9408  C CZ   . PHE A 1 50 ? -5.815  13.050  -34.163 1.00 0.00 ? 113 PHE A CZ   4 
ATOM 9409  H H    . PHE A 1 50 ? -6.153  11.396  -39.213 1.00 0.00 ? 113 PHE A H    4 
ATOM 9410  H HA   . PHE A 1 50 ? -4.199  9.855   -37.576 1.00 0.00 ? 113 PHE A HA   4 
ATOM 9411  H HB2  . PHE A 1 50 ? -7.216  9.987   -37.501 1.00 0.00 ? 113 PHE A HB2  4 
ATOM 9412  H HB3  . PHE A 1 50 ? -6.242  8.951   -36.489 1.00 0.00 ? 113 PHE A HB3  4 
ATOM 9413  H HD1  . PHE A 1 50 ? -4.756  9.911   -34.777 1.00 0.00 ? 113 PHE A HD1  4 
ATOM 9414  H HD2  . PHE A 1 50 ? -7.417  12.344  -37.041 1.00 0.00 ? 113 PHE A HD2  4 
ATOM 9415  H HE1  . PHE A 1 50 ? -4.500  11.720  -33.131 1.00 0.00 ? 113 PHE A HE1  4 
ATOM 9416  H HE2  . PHE A 1 50 ? -7.163  14.155  -35.395 1.00 0.00 ? 113 PHE A HE2  4 
ATOM 9417  H HZ   . PHE A 1 50 ? -5.761  13.817  -33.403 1.00 0.00 ? 113 PHE A HZ   4 
ATOM 9418  N N    . ILE A 1 51 ? -4.366  7.659   -38.700 1.00 0.00 ? 114 ILE A N    4 
ATOM 9419  C CA   . ILE A 1 51 ? -4.351  6.408   -39.450 1.00 0.00 ? 114 ILE A CA   4 
ATOM 9420  C C    . ILE A 1 51 ? -4.528  5.211   -38.524 1.00 0.00 ? 114 ILE A C    4 
ATOM 9421  O O    . ILE A 1 51 ? -3.575  4.759   -37.888 1.00 0.00 ? 114 ILE A O    4 
ATOM 9422  C CB   . ILE A 1 51 ? -3.040  6.257   -40.241 1.00 0.00 ? 114 ILE A CB   4 
ATOM 9423  C CG1  . ILE A 1 51 ? -2.821  7.470   -41.147 1.00 0.00 ? 114 ILE A CG1  4 
ATOM 9424  C CG2  . ILE A 1 51 ? -3.059  4.973   -41.060 1.00 0.00 ? 114 ILE A CG2  4 
ATOM 9425  C CD1  . ILE A 1 51 ? -2.083  8.607   -40.479 1.00 0.00 ? 114 ILE A CD1  4 
ATOM 9426  H H    . ILE A 1 51 ? -3.634  7.831   -38.009 1.00 0.00 ? 114 ILE A H    4 
ATOM 9427  H HA   . ILE A 1 51 ? -5.174  6.386   -40.151 1.00 0.00 ? 114 ILE A HA   4 
ATOM 9428  H HB   . ILE A 1 51 ? -2.213  6.184   -39.549 1.00 0.00 ? 114 ILE A HB   4 
ATOM 9429  H HG12 . ILE A 1 51 ? -2.242  7.191   -42.028 1.00 0.00 ? 114 ILE A HG12 4 
ATOM 9430  H HG13 . ILE A 1 51 ? -3.782  7.857   -41.470 1.00 0.00 ? 114 ILE A HG13 4 
ATOM 9431  H HG21 . ILE A 1 51 ? -2.860  4.139   -40.393 1.00 0.00 ? 114 ILE A HG21 4 
ATOM 9432  H HG22 . ILE A 1 51 ? -2.296  4.993   -41.836 1.00 0.00 ? 114 ILE A HG22 4 
ATOM 9433  H HG23 . ILE A 1 51 ? -4.040  4.839   -41.513 1.00 0.00 ? 114 ILE A HG23 4 
ATOM 9434  H HD11 . ILE A 1 51 ? -2.729  9.056   -39.738 1.00 0.00 ? 114 ILE A HD11 4 
ATOM 9435  H HD12 . ILE A 1 51 ? -1.807  9.353   -41.224 1.00 0.00 ? 114 ILE A HD12 4 
ATOM 9436  H HD13 . ILE A 1 51 ? -1.184  8.224   -39.995 1.00 0.00 ? 114 ILE A HD13 4 
ATOM 9437  N N    . SER A 1 52 ? -5.752  4.699   -38.453 1.00 0.00 ? 115 SER A N    4 
ATOM 9438  C CA   . SER A 1 52 ? -6.034  3.489   -37.690 1.00 0.00 ? 115 SER A CA   4 
ATOM 9439  C C    . SER A 1 52 ? -5.950  2.249   -38.569 1.00 0.00 ? 115 SER A C    4 
ATOM 9440  O O    . SER A 1 52 ? -6.922  1.874   -39.225 1.00 0.00 ? 115 SER A O    4 
ATOM 9441  C CB   . SER A 1 52 ? -7.411  3.581   -37.059 1.00 0.00 ? 115 SER A CB   4 
ATOM 9442  O OG   . SER A 1 52 ? -7.711  2.415   -36.339 1.00 0.00 ? 115 SER A OG   4 
ATOM 9443  H H    . SER A 1 52 ? -6.495  5.110   -39.021 1.00 0.00 ? 115 SER A H    4 
ATOM 9444  H HA   . SER A 1 52 ? -5.302  3.404   -36.898 1.00 0.00 ? 115 SER A HA   4 
ATOM 9445  H HB2  . SER A 1 52 ? -7.433  4.421   -36.370 1.00 0.00 ? 115 SER A HB2  4 
ATOM 9446  H HB3  . SER A 1 52 ? -8.143  3.738   -37.818 1.00 0.00 ? 115 SER A HB3  4 
ATOM 9447  H HG   . SER A 1 52 ? -7.829  1.706   -36.976 1.00 0.00 ? 115 SER A HG   4 
ATOM 9448  N N    . ARG A 1 53 ? -4.782  1.616   -38.579 1.00 0.00 ? 116 ARG A N    4 
ATOM 9449  C CA   . ARG A 1 53 ? -4.438  0.661   -39.627 1.00 0.00 ? 116 ARG A CA   4 
ATOM 9450  C C    . ARG A 1 53 ? -4.130  -0.711  -39.041 1.00 0.00 ? 116 ARG A C    4 
ATOM 9451  O O    . ARG A 1 53 ? -3.062  -0.928  -38.469 1.00 0.00 ? 116 ARG A O    4 
ATOM 9452  C CB   . ARG A 1 53 ? -3.237  1.149   -40.422 1.00 0.00 ? 116 ARG A CB   4 
ATOM 9453  C CG   . ARG A 1 53 ? -2.735  0.184   -41.482 1.00 0.00 ? 116 ARG A CG   4 
ATOM 9454  C CD   . ARG A 1 53 ? -1.617  0.764   -42.271 1.00 0.00 ? 116 ARG A CD   4 
ATOM 9455  N NE   . ARG A 1 53 ? -2.060  1.860   -43.115 1.00 0.00 ? 116 ARG A NE   4 
ATOM 9456  C CZ   . ARG A 1 53 ? -1.262  2.558   -43.948 1.00 0.00 ? 116 ARG A CZ   4 
ATOM 9457  N NH1  . ARG A 1 53 ? 0.015   2.259   -44.036 1.00 0.00 ? 116 ARG A NH1  4 
ATOM 9458  N NH2  . ARG A 1 53 ? -1.763  3.540   -44.678 1.00 0.00 ? 116 ARG A NH2  4 
ATOM 9459  H H    . ARG A 1 53 ? -4.018  2.025   -38.043 1.00 0.00 ? 116 ARG A H    4 
ATOM 9460  H HA   . ARG A 1 53 ? -5.256  0.538   -40.295 1.00 0.00 ? 116 ARG A HA   4 
ATOM 9461  H HB2  . ARG A 1 53 ? -3.543  2.054   -40.936 1.00 0.00 ? 116 ARG A HB2  4 
ATOM 9462  H HB3  . ARG A 1 53 ? -2.421  1.387   -39.739 1.00 0.00 ? 116 ARG A HB3  4 
ATOM 9463  H HG2  . ARG A 1 53 ? -2.379  -0.716  -40.983 1.00 0.00 ? 116 ARG A HG2  4 
ATOM 9464  H HG3  . ARG A 1 53 ? -3.541  -0.080  -42.151 1.00 0.00 ? 116 ARG A HG3  4 
ATOM 9465  H HD2  . ARG A 1 53 ? -0.882  1.162   -41.571 1.00 0.00 ? 116 ARG A HD2  4 
ATOM 9466  H HD3  . ARG A 1 53 ? -1.144  -0.001  -42.871 1.00 0.00 ? 116 ARG A HD3  4 
ATOM 9467  H HE   . ARG A 1 53 ? -3.011  2.099   -43.087 1.00 0.00 ? 116 ARG A HE   4 
ATOM 9468  H HH11 . ARG A 1 53 ? 0.394   1.514   -43.487 1.00 0.00 ? 116 ARG A HH11 4 
ATOM 9469  H HH12 . ARG A 1 53 ? 0.614   2.782   -44.658 1.00 0.00 ? 116 ARG A HH12 4 
ATOM 9470  H HH21 . ARG A 1 53 ? -2.736  3.766   -44.616 1.00 0.00 ? 116 ARG A HH21 4 
ATOM 9471  H HH22 . ARG A 1 53 ? -1.168  4.055   -45.293 1.00 0.00 ? 116 ARG A HH22 4 
ATOM 9472  N N    . GLU A 1 54 ? -5.072  -1.636  -39.191 1.00 0.00 ? 117 GLU A N    4 
ATOM 9473  C CA   . GLU A 1 54 ? -4.866  -3.016  -38.766 1.00 0.00 ? 117 GLU A CA   4 
ATOM 9474  C C    . GLU A 1 54 ? -4.548  -3.916  -39.954 1.00 0.00 ? 117 GLU A C    4 
ATOM 9475  O O    . GLU A 1 54 ? -5.337  -4.024  -40.890 1.00 0.00 ? 117 GLU A O    4 
ATOM 9476  C CB   . GLU A 1 54 ? -6.104  -3.541  -38.033 1.00 0.00 ? 117 GLU A CB   4 
ATOM 9477  C CG   . GLU A 1 54 ? -6.009  -4.997  -37.603 1.00 0.00 ? 117 GLU A CG   4 
ATOM 9478  C CD   . GLU A 1 54 ? -7.247  -5.480  -36.900 1.00 0.00 ? 117 GLU A CD   4 
ATOM 9479  O OE1  . GLU A 1 54 ? -8.127  -4.685  -36.673 1.00 0.00 ? 117 GLU A OE1  4 
ATOM 9480  O OE2  . GLU A 1 54 ? -7.313  -6.647  -36.590 1.00 0.00 ? 117 GLU A OE2  4 
ATOM 9481  H H    . GLU A 1 54 ? -5.928  -1.394  -39.691 1.00 0.00 ? 117 GLU A H    4 
ATOM 9482  H HA   . GLU A 1 54 ? -4.020  -3.056  -38.106 1.00 0.00 ? 117 GLU A HA   4 
ATOM 9483  H HB2  . GLU A 1 54 ? -6.258  -2.936  -37.140 1.00 0.00 ? 117 GLU A HB2  4 
ATOM 9484  H HB3  . GLU A 1 54 ? -6.966  -3.427  -38.690 1.00 0.00 ? 117 GLU A HB3  4 
ATOM 9485  H HG2  . GLU A 1 54 ? -5.876  -5.608  -38.494 1.00 0.00 ? 117 GLU A HG2  4 
ATOM 9486  H HG3  . GLU A 1 54 ? -5.156  -5.139  -36.954 1.00 0.00 ? 117 GLU A HG3  4 
ATOM 9487  N N    . PHE A 1 55 ? -3.387  -4.560  -39.907 1.00 0.00 ? 118 PHE A N    4 
ATOM 9488  C CA   . PHE A 1 55 ? -2.880  -5.311  -41.047 1.00 0.00 ? 118 PHE A CA   4 
ATOM 9489  C C    . PHE A 1 55 ? -2.576  -6.754  -40.669 1.00 0.00 ? 118 PHE A C    4 
ATOM 9490  O O    . PHE A 1 55 ? -2.512  -7.096  -39.488 1.00 0.00 ? 118 PHE A O    4 
ATOM 9491  C CB   . PHE A 1 55 ? -1.618  -4.649  -41.606 1.00 0.00 ? 118 PHE A CB   4 
ATOM 9492  C CG   . PHE A 1 55 ? -0.447  -4.689  -40.667 1.00 0.00 ? 118 PHE A CG   4 
ATOM 9493  C CD1  . PHE A 1 55 ? 0.368   -5.810  -40.600 1.00 0.00 ? 118 PHE A CD1  4 
ATOM 9494  C CD2  . PHE A 1 55 ? -0.157  -3.607  -39.849 1.00 0.00 ? 118 PHE A CD2  4 
ATOM 9495  C CE1  . PHE A 1 55 ? 1.446   -5.848  -39.733 1.00 0.00 ? 118 PHE A CE1  4 
ATOM 9496  C CE2  . PHE A 1 55 ? 0.920   -3.641  -38.985 1.00 0.00 ? 118 PHE A CE2  4 
ATOM 9497  C CZ   . PHE A 1 55 ? 1.722   -4.764  -38.927 1.00 0.00 ? 118 PHE A CZ   4 
ATOM 9498  H H    . PHE A 1 55 ? -2.775  -4.403  -39.113 1.00 0.00 ? 118 PHE A H    4 
ATOM 9499  H HA   . PHE A 1 55 ? -3.620  -5.347  -41.812 1.00 0.00 ? 118 PHE A HA   4 
ATOM 9500  H HB2  . PHE A 1 55 ? -1.335  -5.149  -42.531 1.00 0.00 ? 118 PHE A HB2  4 
ATOM 9501  H HB3  . PHE A 1 55 ? -1.849  -3.614  -41.826 1.00 0.00 ? 118 PHE A HB3  4 
ATOM 9502  H HD1  . PHE A 1 55 ? 0.129   -6.663  -41.195 1.00 0.00 ? 118 PHE A HD1  4 
ATOM 9503  H HD2  . PHE A 1 55 ? -0.782  -2.727  -39.893 1.00 0.00 ? 118 PHE A HD2  4 
ATOM 9504  H HE1  . PHE A 1 55 ? 2.064   -6.716  -39.697 1.00 0.00 ? 118 PHE A HE1  4 
ATOM 9505  H HE2  . PHE A 1 55 ? 1.136   -2.792  -38.354 1.00 0.00 ? 118 PHE A HE2  4 
ATOM 9506  H HZ   . PHE A 1 55 ? 2.592   -4.775  -38.288 1.00 0.00 ? 118 PHE A HZ   4 
ATOM 9507  N N    . HIS A 1 56 ? -2.387  -7.598  -41.678 1.00 0.00 ? 119 HIS A N    4 
ATOM 9508  C CA   . HIS A 1 56 ? -2.091  -9.007  -41.451 1.00 0.00 ? 119 HIS A CA   4 
ATOM 9509  C C    . HIS A 1 56 ? -1.195  -9.565  -42.549 1.00 0.00 ? 119 HIS A C    4 
ATOM 9510  O O    . HIS A 1 56 ? -1.671  -10.203 -43.488 1.00 0.00 ? 119 HIS A O    4 
ATOM 9511  C CB   . HIS A 1 56 ? -3.383  -9.827  -41.373 1.00 0.00 ? 119 HIS A CB   4 
ATOM 9512  C CG   . HIS A 1 56 ? -3.154  -11.302 -41.244 1.00 0.00 ? 119 HIS A CG   4 
ATOM 9513  N ND1  . HIS A 1 56 ? -4.146  -12.232 -41.470 1.00 0.00 ? 119 HIS A ND1  4 
ATOM 9514  C CD2  . HIS A 1 56 ? -2.047  -12.006 -40.912 1.00 0.00 ? 119 HIS A CD2  4 
ATOM 9515  C CE1  . HIS A 1 56 ? -3.659  -13.446 -41.284 1.00 0.00 ? 119 HIS A CE1  4 
ATOM 9516  N NE2  . HIS A 1 56 ? -2.388  -13.336 -40.943 1.00 0.00 ? 119 HIS A NE2  4 
ATOM 9517  H H    . HIS A 1 56 ? -2.457  -7.252  -42.633 1.00 0.00 ? 119 HIS A H    4 
ATOM 9518  H HA   . HIS A 1 56 ? -1.567  -9.118  -40.526 1.00 0.00 ? 119 HIS A HA   4 
ATOM 9519  H HB2  . HIS A 1 56 ? -3.957  -9.489  -40.512 1.00 0.00 ? 119 HIS A HB2  4 
ATOM 9520  H HB3  . HIS A 1 56 ? -3.944  -9.634  -42.257 1.00 0.00 ? 119 HIS A HB3  4 
ATOM 9521  H HD1  . HIS A 1 56 ? -5.108  -12.020 -41.740 1.00 0.00 ? 119 HIS A HD1  4 
ATOM 9522  H HD2  . HIS A 1 56 ? -1.041  -11.613 -40.872 1.00 0.00 ? 119 HIS A HD2  4 
ATOM 9523  H HE1  . HIS A 1 56 ? -4.210  -14.369 -41.391 1.00 0.00 ? 119 HIS A HE1  4 
ATOM 9524  H HE2  . HIS A 1 56 ? -1.766  -14.105 -40.739 1.00 0.00 ? 119 HIS A HE2  4 
ATOM 9525  N N    . ARG A 1 57 ? 0.105   -9.322  -42.424 1.00 0.00 ? 120 ARG A N    4 
ATOM 9526  C CA   . ARG A 1 57 ? 1.055   -9.684  -43.471 1.00 0.00 ? 120 ARG A CA   4 
ATOM 9527  C C    . ARG A 1 57 ? 1.519   -11.126 -43.318 1.00 0.00 ? 120 ARG A C    4 
ATOM 9528  O O    . ARG A 1 57 ? 2.588   -11.389 -42.766 1.00 0.00 ? 120 ARG A O    4 
ATOM 9529  C CB   . ARG A 1 57 ? 2.264   -8.759  -43.438 1.00 0.00 ? 120 ARG A CB   4 
ATOM 9530  C CG   . ARG A 1 57 ? 1.950   -7.289  -43.661 1.00 0.00 ? 120 ARG A CG   4 
ATOM 9531  C CD   . ARG A 1 57 ? 3.175   -6.451  -43.606 1.00 0.00 ? 120 ARG A CD   4 
ATOM 9532  N NE   . ARG A 1 57 ? 3.767   -6.442  -42.279 1.00 0.00 ? 120 ARG A NE   4 
ATOM 9533  C CZ   . ARG A 1 57 ? 4.885   -5.769  -41.943 1.00 0.00 ? 120 ARG A CZ   4 
ATOM 9534  N NH1  . ARG A 1 57 ? 5.519   -5.058  -42.848 1.00 0.00 ? 120 ARG A NH1  4 
ATOM 9535  N NH2  . ARG A 1 57 ? 5.344   -5.826  -40.704 1.00 0.00 ? 120 ARG A NH2  4 
ATOM 9536  H H    . ARG A 1 57 ? 0.431   -8.775  -41.626 1.00 0.00 ? 120 ARG A H    4 
ATOM 9537  H HA   . ARG A 1 57 ? 0.594   -9.582  -44.422 1.00 0.00 ? 120 ARG A HA   4 
ATOM 9538  H HB2  . ARG A 1 57 ? 2.738   -8.827  -42.485 1.00 0.00 ? 120 ARG A HB2  4 
ATOM 9539  H HB3  . ARG A 1 57 ? 2.959   -9.087  -44.192 1.00 0.00 ? 120 ARG A HB3  4 
ATOM 9540  H HG2  . ARG A 1 57 ? 1.489   -7.169  -44.622 1.00 0.00 ? 120 ARG A HG2  4 
ATOM 9541  H HG3  . ARG A 1 57 ? 1.269   -6.956  -42.910 1.00 0.00 ? 120 ARG A HG3  4 
ATOM 9542  H HD2  . ARG A 1 57 ? 3.908   -6.822  -44.304 1.00 0.00 ? 120 ARG A HD2  4 
ATOM 9543  H HD3  . ARG A 1 57 ? 2.916   -5.426  -43.875 1.00 0.00 ? 120 ARG A HD3  4 
ATOM 9544  H HE   . ARG A 1 57 ? 3.322   -6.963  -41.579 1.00 0.00 ? 120 ARG A HE   4 
ATOM 9545  H HH11 . ARG A 1 57 ? 5.173   -5.015  -43.785 1.00 0.00 ? 120 ARG A HH11 4 
ATOM 9546  H HH12 . ARG A 1 57 ? 6.357   -4.554  -42.596 1.00 0.00 ? 120 ARG A HH12 4 
ATOM 9547  H HH21 . ARG A 1 57 ? 4.864   -6.365  -40.014 1.00 0.00 ? 120 ARG A HH21 4 
ATOM 9548  H HH22 . ARG A 1 57 ? 6.175   -5.324  -40.459 1.00 0.00 ? 120 ARG A HH22 4 
ATOM 9549  N N    . LYS A 1 58 ? 0.712   -12.058 -43.811 1.00 0.00 ? 121 LYS A N    4 
ATOM 9550  C CA   . LYS A 1 58 ? 1.028   -13.477 -43.712 1.00 0.00 ? 121 LYS A CA   4 
ATOM 9551  C C    . LYS A 1 58 ? 2.225   -13.838 -44.584 1.00 0.00 ? 121 LYS A C    4 
ATOM 9552  O O    . LYS A 1 58 ? 2.066   -14.376 -45.679 1.00 0.00 ? 121 LYS A O    4 
ATOM 9553  C CB   . LYS A 1 58 ? -0.184  -14.324 -44.104 1.00 0.00 ? 121 LYS A CB   4 
ATOM 9554  C CG   . LYS A 1 58 ? 0.005   -15.822 -43.902 1.00 0.00 ? 121 LYS A CG   4 
ATOM 9555  C CD   . LYS A 1 58 ? -1.217  -16.600 -44.368 1.00 0.00 ? 121 LYS A CD   4 
ATOM 9556  C CE   . LYS A 1 58 ? -2.433  -16.288 -43.509 1.00 0.00 ? 121 LYS A CE   4 
ATOM 9557  N NZ   . LYS A 1 58 ? -3.626  -17.076 -43.925 1.00 0.00 ? 121 LYS A NZ   4 
ATOM 9558  H H    . LYS A 1 58 ? -0.164  -11.777 -44.244 1.00 0.00 ? 121 LYS A H    4 
ATOM 9559  H HA   . LYS A 1 58 ? 1.286   -13.701 -42.707 1.00 0.00 ? 121 LYS A HA   4 
ATOM 9560  H HB2  . LYS A 1 58 ? -1.012  -13.987 -43.501 1.00 0.00 ? 121 LYS A HB2  4 
ATOM 9561  H HB3  . LYS A 1 58 ? -0.398  -14.137 -45.135 1.00 0.00 ? 121 LYS A HB3  4 
ATOM 9562  H HG2  . LYS A 1 58 ? 0.848   -16.109 -44.521 1.00 0.00 ? 121 LYS A HG2  4 
ATOM 9563  H HG3  . LYS A 1 58 ? 0.216   -16.041 -42.859 1.00 0.00 ? 121 LYS A HG3  4 
ATOM 9564  H HD2  . LYS A 1 58 ? -1.437  -16.335 -45.401 1.00 0.00 ? 121 LYS A HD2  4 
ATOM 9565  H HD3  . LYS A 1 58 ? -1.002  -17.666 -44.312 1.00 0.00 ? 121 LYS A HD3  4 
ATOM 9566  H HE2  . LYS A 1 58 ? -2.220  -16.540 -42.489 1.00 0.00 ? 121 LYS A HE2  4 
ATOM 9567  H HE3  . LYS A 1 58 ? -2.689  -15.237 -43.580 1.00 0.00 ? 121 LYS A HE3  4 
ATOM 9568  H HZ1  . LYS A 1 58 ? -3.818  -16.900 -44.930 1.00 0.00 ? 121 LYS A HZ1  4 
ATOM 9569  H HZ2  . LYS A 1 58 ? -4.453  -16.798 -43.359 1.00 0.00 ? 121 LYS A HZ2  4 
ATOM 9570  H HZ3  . LYS A 1 58 ? -3.442  -18.059 -43.787 1.00 0.00 ? 121 LYS A HZ3  4 
ATOM 9571  N N    . TYR A 1 59 ? 3.420   -13.536 -44.091 1.00 0.00 ? 122 TYR A N    4 
ATOM 9572  C CA   . TYR A 1 59 ? 4.641   -13.757 -44.857 1.00 0.00 ? 122 TYR A CA   4 
ATOM 9573  C C    . TYR A 1 59 ? 4.974   -15.240 -44.951 1.00 0.00 ? 122 TYR A C    4 
ATOM 9574  O O    . TYR A 1 59 ? 5.349   -15.866 -43.960 1.00 0.00 ? 122 TYR A O    4 
ATOM 9575  C CB   . TYR A 1 59 ? 5.810   -12.989 -44.233 1.00 0.00 ? 122 TYR A CB   4 
ATOM 9576  C CG   . TYR A 1 59 ? 7.016   -12.872 -45.141 1.00 0.00 ? 122 TYR A CG   4 
ATOM 9577  C CD1  . TYR A 1 59 ? 7.698   -14.013 -45.535 1.00 0.00 ? 122 TYR A CD1  4 
ATOM 9578  C CD2  . TYR A 1 59 ? 7.439   -11.624 -45.575 1.00 0.00 ? 122 TYR A CD2  4 
ATOM 9579  C CE1  . TYR A 1 59 ? 8.799   -13.907 -46.364 1.00 0.00 ? 122 TYR A CE1  4 
ATOM 9580  C CE2  . TYR A 1 59 ? 8.540   -11.519 -46.402 1.00 0.00 ? 122 TYR A CE2  4 
ATOM 9581  C CZ   . TYR A 1 59 ? 9.220   -12.666 -46.796 1.00 0.00 ? 122 TYR A CZ   4 
ATOM 9582  O OH   . TYR A 1 59 ? 10.317  -12.560 -47.621 1.00 0.00 ? 122 TYR A OH   4 
ATOM 9583  H H    . TYR A 1 59 ? 3.478   -13.081 -43.181 1.00 0.00 ? 122 TYR A H    4 
ATOM 9584  H HA   . TYR A 1 59 ? 4.516   -13.379 -45.854 1.00 0.00 ? 122 TYR A HA   4 
ATOM 9585  H HB2  . TYR A 1 59 ? 5.454   -11.994 -43.971 1.00 0.00 ? 122 TYR A HB2  4 
ATOM 9586  H HB3  . TYR A 1 59 ? 6.121   -13.482 -43.335 1.00 0.00 ? 122 TYR A HB3  4 
ATOM 9587  H HD1  . TYR A 1 59 ? 7.397   -14.984 -45.194 1.00 0.00 ? 122 TYR A HD1  4 
ATOM 9588  H HD2  . TYR A 1 59 ? 6.928   -10.756 -45.256 1.00 0.00 ? 122 TYR A HD2  4 
ATOM 9589  H HE1  . TYR A 1 59 ? 9.330   -14.794 -46.676 1.00 0.00 ? 122 TYR A HE1  4 
ATOM 9590  H HE2  . TYR A 1 59 ? 8.872   -10.548 -46.737 1.00 0.00 ? 122 TYR A HE2  4 
ATOM 9591  H HH   . TYR A 1 59 ? 10.049  -12.819 -48.505 1.00 0.00 ? 122 TYR A HH   4 
ATOM 9592  N N    . ARG A 1 60 ? 4.834   -15.799 -46.148 1.00 0.00 ? 123 ARG A N    4 
ATOM 9593  C CA   . ARG A 1 60 ? 4.681   -17.240 -46.309 1.00 0.00 ? 123 ARG A CA   4 
ATOM 9594  C C    . ARG A 1 60 ? 6.025   -17.909 -46.570 1.00 0.00 ? 123 ARG A C    4 
ATOM 9595  O O    . ARG A 1 60 ? 6.887   -17.351 -47.251 1.00 0.00 ? 123 ARG A O    4 
ATOM 9596  C CB   . ARG A 1 60 ? 3.733   -17.555 -47.455 1.00 0.00 ? 123 ARG A CB   4 
ATOM 9597  C CG   . ARG A 1 60 ? 3.471   -19.035 -47.681 1.00 0.00 ? 123 ARG A CG   4 
ATOM 9598  C CD   . ARG A 1 60 ? 2.144   -19.270 -48.308 1.00 0.00 ? 123 ARG A CD   4 
ATOM 9599  N NE   . ARG A 1 60 ? 1.928   -20.676 -48.608 1.00 0.00 ? 123 ARG A NE   4 
ATOM 9600  C CZ   . ARG A 1 60 ? 0.830   -21.168 -49.215 1.00 0.00 ? 123 ARG A CZ   4 
ATOM 9601  N NH1  . ARG A 1 60 ? -0.139  -20.357 -49.579 1.00 0.00 ? 123 ARG A NH1  4 
ATOM 9602  N NH2  . ARG A 1 60 ? 0.728   -22.465 -49.444 1.00 0.00 ? 123 ARG A NH2  4 
ATOM 9603  H H    . ARG A 1 60 ? 4.473   -15.206 -46.894 1.00 0.00 ? 123 ARG A H    4 
ATOM 9604  H HA   . ARG A 1 60 ? 4.266   -17.669 -45.430 1.00 0.00 ? 123 ARG A HA   4 
ATOM 9605  H HB2  . ARG A 1 60 ? 2.787   -17.064 -47.223 1.00 0.00 ? 123 ARG A HB2  4 
ATOM 9606  H HB3  . ARG A 1 60 ? 4.132   -17.123 -48.374 1.00 0.00 ? 123 ARG A HB3  4 
ATOM 9607  H HG2  . ARG A 1 60 ? 4.248   -19.433 -48.339 1.00 0.00 ? 123 ARG A HG2  4 
ATOM 9608  H HG3  . ARG A 1 60 ? 3.516   -19.558 -46.731 1.00 0.00 ? 123 ARG A HG3  4 
ATOM 9609  H HD2  . ARG A 1 60 ? 1.350   -18.912 -47.664 1.00 0.00 ? 123 ARG A HD2  4 
ATOM 9610  H HD3  . ARG A 1 60 ? 2.111   -18.717 -49.247 1.00 0.00 ? 123 ARG A HD3  4 
ATOM 9611  H HE   . ARG A 1 60 ? 2.627   -21.309 -48.344 1.00 0.00 ? 123 ARG A HE   4 
ATOM 9612  H HH11 . ARG A 1 60 ? -0.062  -19.374 -49.404 1.00 0.00 ? 123 ARG A HH11 4 
ATOM 9613  H HH12 . ARG A 1 60 ? -0.961  -20.726 -50.036 1.00 0.00 ? 123 ARG A HH12 4 
ATOM 9614  H HH21 . ARG A 1 60 ? 1.461   -23.086 -49.165 1.00 0.00 ? 123 ARG A HH21 4 
ATOM 9615  H HH22 . ARG A 1 60 ? -0.087  -22.827 -49.897 1.00 0.00 ? 123 ARG A HH22 4 
ATOM 9616  N N    . ILE A 1 61 ? 6.199   -19.108 -46.023 1.00 0.00 ? 124 ILE A N    4 
ATOM 9617  C CA   . ILE A 1 61 ? 7.467   -19.823 -46.133 1.00 0.00 ? 124 ILE A CA   4 
ATOM 9618  C C    . ILE A 1 61 ? 7.338   -21.036 -47.046 1.00 0.00 ? 124 ILE A C    4 
ATOM 9619  O O    . ILE A 1 61 ? 6.363   -21.781 -46.969 1.00 0.00 ? 124 ILE A O    4 
ATOM 9620  C CB   . ILE A 1 61 ? 7.962   -20.273 -44.746 1.00 0.00 ? 124 ILE A CB   4 
ATOM 9621  C CG1  . ILE A 1 61 ? 7.827   -19.135 -43.734 1.00 0.00 ? 124 ILE A CG1  4 
ATOM 9622  C CG2  . ILE A 1 61 ? 9.404   -20.750 -44.827 1.00 0.00 ? 124 ILE A CG2  4 
ATOM 9623  C CD1  . ILE A 1 61 ? 7.905   -19.586 -42.292 1.00 0.00 ? 124 ILE A CD1  4 
ATOM 9624  H H    . ILE A 1 61 ? 5.451   -19.506 -45.465 1.00 0.00 ? 124 ILE A H    4 
ATOM 9625  H HA   . ILE A 1 61 ? 8.208   -19.135 -46.503 1.00 0.00 ? 124 ILE A HA   4 
ATOM 9626  H HB   . ILE A 1 61 ? 7.339   -21.100 -44.419 1.00 0.00 ? 124 ILE A HB   4 
ATOM 9627  H HG12 . ILE A 1 61 ? 8.629   -18.419 -43.924 1.00 0.00 ? 124 ILE A HG12 4 
ATOM 9628  H HG13 . ILE A 1 61 ? 6.873   -18.622 -43.884 1.00 0.00 ? 124 ILE A HG13 4 
ATOM 9629  H HG21 . ILE A 1 61 ? 9.745   -21.009 -43.844 1.00 0.00 ? 124 ILE A HG21 4 
ATOM 9630  H HG22 . ILE A 1 61 ? 10.011  -19.925 -45.188 1.00 0.00 ? 124 ILE A HG22 4 
ATOM 9631  H HG23 . ILE A 1 61 ? 9.493   -21.599 -45.500 1.00 0.00 ? 124 ILE A HG23 4 
ATOM 9632  H HD11 . ILE A 1 61 ? 8.131   -20.646 -42.244 1.00 0.00 ? 124 ILE A HD11 4 
ATOM 9633  H HD12 . ILE A 1 61 ? 8.690   -19.027 -41.782 1.00 0.00 ? 124 ILE A HD12 4 
ATOM 9634  H HD13 . ILE A 1 61 ? 6.950   -19.397 -41.802 1.00 0.00 ? 124 ILE A HD13 4 
ATOM 9635  N N    . PRO A 1 62 ? 8.329   -21.226 -47.910 1.00 0.00 ? 125 PRO A N    4 
ATOM 9636  C CA   . PRO A 1 62 ? 8.494   -22.489 -48.620 1.00 0.00 ? 125 PRO A CA   4 
ATOM 9637  C C    . PRO A 1 62 ? 8.359   -23.674 -47.674 1.00 0.00 ? 125 PRO A C    4 
ATOM 9638  O O    . PRO A 1 62 ? 8.625   -23.559 -46.478 1.00 0.00 ? 125 PRO A O    4 
ATOM 9639  C CB   . PRO A 1 62 ? 9.910   -22.378 -49.192 1.00 0.00 ? 125 PRO A CB   4 
ATOM 9640  C CG   . PRO A 1 62 ? 10.131  -20.913 -49.350 1.00 0.00 ? 125 PRO A CG   4 
ATOM 9641  C CD   . PRO A 1 62 ? 9.465   -20.304 -48.144 1.00 0.00 ? 125 PRO A CD   4 
ATOM 9642  H HA   . PRO A 1 62 ? 7.763   -22.542 -49.424 1.00 0.00 ? 125 PRO A HA   4 
ATOM 9643  H HB2  . PRO A 1 62 ? 10.639  -22.803 -48.494 1.00 0.00 ? 125 PRO A HB2  4 
ATOM 9644  H HB3  . PRO A 1 62 ? 9.978   -22.878 -50.159 1.00 0.00 ? 125 PRO A HB3  4 
ATOM 9645  H HG2  . PRO A 1 62 ? 11.203  -20.688 -49.361 1.00 0.00 ? 125 PRO A HG2  4 
ATOM 9646  H HG3  . PRO A 1 62 ? 9.658   -20.553 -50.268 1.00 0.00 ? 125 PRO A HG3  4 
ATOM 9647  H HD2  . PRO A 1 62 ? 10.164  -20.247 -47.319 1.00 0.00 ? 125 PRO A HD2  4 
ATOM 9648  H HD3  . PRO A 1 62 ? 9.079   -19.320 -48.406 1.00 0.00 ? 125 PRO A HD3  4 
ATOM 9649  N N    . ALA A 1 63 ? 7.946   -24.815 -48.217 1.00 0.00 ? 126 ALA A N    4 
ATOM 9650  C CA   . ALA A 1 63 ? 7.513   -25.941 -47.397 1.00 0.00 ? 126 ALA A CA   4 
ATOM 9651  C C    . ALA A 1 63 ? 8.707   -26.682 -46.808 1.00 0.00 ? 126 ALA A C    4 
ATOM 9652  O O    . ALA A 1 63 ? 8.552   -27.743 -46.201 1.00 0.00 ? 126 ALA A O    4 
ATOM 9653  C CB   . ALA A 1 63 ? 6.652   -26.891 -48.216 1.00 0.00 ? 126 ALA A CB   4 
ATOM 9654  H H    . ALA A 1 63 ? 7.707   -24.821 -49.208 1.00 0.00 ? 126 ALA A H    4 
ATOM 9655  H HA   . ALA A 1 63 ? 6.908   -25.577 -46.568 1.00 0.00 ? 126 ALA A HA   4 
ATOM 9656  H HB1  . ALA A 1 63 ? 6.364   -27.744 -47.601 1.00 0.00 ? 126 ALA A HB1  4 
ATOM 9657  H HB2  . ALA A 1 63 ? 7.211   -27.240 -49.084 1.00 0.00 ? 126 ALA A HB2  4 
ATOM 9658  H HB3  . ALA A 1 63 ? 5.757   -26.364 -48.546 1.00 0.00 ? 126 ALA A HB3  4 
ATOM 9659  N N    . ASP A 1 64 ? 9.896   -26.118 -46.989 1.00 0.00 ? 127 ASP A N    4 
ATOM 9660  C CA   . ASP A 1 64 ? 11.119  -26.732 -46.487 1.00 0.00 ? 127 ASP A CA   4 
ATOM 9661  C C    . ASP A 1 64 ? 11.355  -26.375 -45.025 1.00 0.00 ? 127 ASP A C    4 
ATOM 9662  O O    . ASP A 1 64 ? 12.254  -26.916 -44.381 1.00 0.00 ? 127 ASP A O    4 
ATOM 9663  C CB   . ASP A 1 64 ? 12.323  -26.293 -47.326 1.00 0.00 ? 127 ASP A CB   4 
ATOM 9664  C CG   . ASP A 1 64 ? 12.302  -26.867 -48.736 1.00 0.00 ? 127 ASP A CG   4 
ATOM 9665  O OD1  . ASP A 1 64 ? 11.633  -27.851 -48.947 1.00 0.00 ? 127 ASP A OD1  4 
ATOM 9666  O OD2  . ASP A 1 64 ? 12.954  -26.315 -49.589 1.00 0.00 ? 127 ASP A OD2  4 
ATOM 9667  H H    . ASP A 1 64 ? 9.961   -25.240 -47.504 1.00 0.00 ? 127 ASP A H    4 
ATOM 9668  H HA   . ASP A 1 64 ? 11.035  -27.816 -46.573 1.00 0.00 ? 127 ASP A HA   4 
ATOM 9669  H HB2  . ASP A 1 64 ? 12.285  -25.208 -47.407 1.00 0.00 ? 127 ASP A HB2  4 
ATOM 9670  H HB3  . ASP A 1 64 ? 13.247  -26.564 -46.831 1.00 0.00 ? 127 ASP A HB3  4 
ATOM 9671  N N    . VAL A 1 65 ? 10.543  -25.459 -44.507 1.00 0.00 ? 128 VAL A N    4 
ATOM 9672  C CA   . VAL A 1 65 ? 10.772  -24.893 -43.182 1.00 0.00 ? 128 VAL A CA   4 
ATOM 9673  C C    . VAL A 1 65 ? 10.308  -25.846 -42.088 1.00 0.00 ? 128 VAL A C    4 
ATOM 9674  O O    . VAL A 1 65 ? 9.376   -26.627 -42.285 1.00 0.00 ? 128 VAL A O    4 
ATOM 9675  C CB   . VAL A 1 65 ? 10.029  -23.551 -43.039 1.00 0.00 ? 128 VAL A CB   4 
ATOM 9676  C CG1  . VAL A 1 65 ? 8.524   -23.771 -43.047 1.00 0.00 ? 128 VAL A CG1  4 
ATOM 9677  C CG2  . VAL A 1 65 ? 10.465  -22.853 -41.761 1.00 0.00 ? 128 VAL A CG2  4 
ATOM 9678  H H    . VAL A 1 65 ? 9.834   -25.033 -45.104 1.00 0.00 ? 128 VAL A H    4 
ATOM 9679  H HA   . VAL A 1 65 ? 11.819  -24.723 -43.036 1.00 0.00 ? 128 VAL A HA   4 
ATOM 9680  H HB   . VAL A 1 65 ? 10.318  -22.965 -43.888 1.00 0.00 ? 128 VAL A HB   4 
ATOM 9681  H HG11 . VAL A 1 65 ? 8.244   -24.365 -43.917 1.00 0.00 ? 128 VAL A HG11 4 
ATOM 9682  H HG12 . VAL A 1 65 ? 8.024   -22.815 -43.086 1.00 0.00 ? 128 VAL A HG12 4 
ATOM 9683  H HG13 . VAL A 1 65 ? 8.223   -24.295 -42.141 1.00 0.00 ? 128 VAL A HG13 4 
ATOM 9684  H HG21 . VAL A 1 65 ? 10.104  -21.833 -41.755 1.00 0.00 ? 128 VAL A HG21 4 
ATOM 9685  H HG22 . VAL A 1 65 ? 10.042  -23.386 -40.908 1.00 0.00 ? 128 VAL A HG22 4 
ATOM 9686  H HG23 . VAL A 1 65 ? 11.550  -22.858 -41.677 1.00 0.00 ? 128 VAL A HG23 4 
ATOM 9687  N N    . ASP A 1 66 ? 10.963  -25.779 -40.936 1.00 0.00 ? 129 ASP A N    4 
ATOM 9688  C CA   . ASP A 1 66 ? 10.462  -26.429 -39.731 1.00 0.00 ? 129 ASP A CA   4 
ATOM 9689  C C    . ASP A 1 66 ? 9.797   -25.424 -38.799 1.00 0.00 ? 129 ASP A C    4 
ATOM 9690  O O    . ASP A 1 66 ? 10.466  -24.582 -38.197 1.00 0.00 ? 129 ASP A O    4 
ATOM 9691  C CB   . ASP A 1 66 ? 11.598  -27.141 -38.993 1.00 0.00 ? 129 ASP A CB   4 
ATOM 9692  C CG   . ASP A 1 66 ? 11.118  -27.917 -37.773 1.00 0.00 ? 129 ASP A CG   4 
ATOM 9693  O OD1  . ASP A 1 66 ? 9.992   -27.727 -37.377 1.00 0.00 ? 129 ASP A OD1  4 
ATOM 9694  O OD2  . ASP A 1 66 ? 11.882  -28.690 -37.247 1.00 0.00 ? 129 ASP A OD2  4 
ATOM 9695  H H    . ASP A 1 66 ? 11.703  -25.083 -40.839 1.00 0.00 ? 129 ASP A H    4 
ATOM 9696  H HA   . ASP A 1 66 ? 9.773   -27.211 -40.024 1.00 0.00 ? 129 ASP A HA   4 
ATOM 9697  H HB2  . ASP A 1 66 ? 12.096  -27.832 -39.672 1.00 0.00 ? 129 ASP A HB2  4 
ATOM 9698  H HB3  . ASP A 1 66 ? 12.311  -26.390 -38.670 1.00 0.00 ? 129 ASP A HB3  4 
ATOM 9699  N N    . PRO A 1 67 ? 8.476   -25.515 -38.684 1.00 0.00 ? 130 PRO A N    4 
ATOM 9700  C CA   . PRO A 1 67 ? 7.702   -24.529 -37.940 1.00 0.00 ? 130 PRO A CA   4 
ATOM 9701  C C    . PRO A 1 67 ? 8.216   -24.386 -36.514 1.00 0.00 ? 130 PRO A C    4 
ATOM 9702  O O    . PRO A 1 67 ? 8.144   -23.308 -35.922 1.00 0.00 ? 130 PRO A O    4 
ATOM 9703  C CB   . PRO A 1 67 ? 6.283   -25.108 -37.976 1.00 0.00 ? 130 PRO A CB   4 
ATOM 9704  C CG   . PRO A 1 67 ? 6.223   -25.847 -39.268 1.00 0.00 ? 130 PRO A CG   4 
ATOM 9705  C CD   . PRO A 1 67 ? 7.588   -26.464 -39.412 1.00 0.00 ? 130 PRO A CD   4 
ATOM 9706  H HA   . PRO A 1 67 ? 7.708   -23.564 -38.436 1.00 0.00 ? 130 PRO A HA   4 
ATOM 9707  H HB2  . PRO A 1 67 ? 6.122   -25.788 -37.134 1.00 0.00 ? 130 PRO A HB2  4 
ATOM 9708  H HB3  . PRO A 1 67 ? 5.543   -24.305 -37.963 1.00 0.00 ? 130 PRO A HB3  4 
ATOM 9709  H HG2  . PRO A 1 67 ? 5.449   -26.622 -39.224 1.00 0.00 ? 130 PRO A HG2  4 
ATOM 9710  H HG3  . PRO A 1 67 ? 6.025   -25.161 -40.094 1.00 0.00 ? 130 PRO A HG3  4 
ATOM 9711  H HD2  . PRO A 1 67 ? 7.628   -27.448 -38.937 1.00 0.00 ? 130 PRO A HD2  4 
ATOM 9712  H HD3  . PRO A 1 67 ? 7.842   -26.526 -40.467 1.00 0.00 ? 130 PRO A HD3  4 
ATOM 9713  N N    . LEU A 1 68 ? 8.735   -25.480 -35.965 1.00 0.00 ? 131 LEU A N    4 
ATOM 9714  C CA   . LEU A 1 68 ? 9.052   -25.546 -34.544 1.00 0.00 ? 131 LEU A CA   4 
ATOM 9715  C C    . LEU A 1 68 ? 10.411  -24.922 -34.254 1.00 0.00 ? 131 LEU A C    4 
ATOM 9716  O O    . LEU A 1 68 ? 10.832  -24.835 -33.100 1.00 0.00 ? 131 LEU A O    4 
ATOM 9717  C CB   . LEU A 1 68 ? 9.040   -27.005 -34.065 1.00 0.00 ? 131 LEU A CB   4 
ATOM 9718  C CG   . LEU A 1 68 ? 7.688   -27.722 -34.156 1.00 0.00 ? 131 LEU A CG   4 
ATOM 9719  C CD1  . LEU A 1 68 ? 7.860   -29.181 -33.754 1.00 0.00 ? 131 LEU A CD1  4 
ATOM 9720  C CD2  . LEU A 1 68 ? 6.679   -27.022 -33.255 1.00 0.00 ? 131 LEU A CD2  4 
ATOM 9721  H H    . LEU A 1 68 ? 8.726   -26.345 -36.505 1.00 0.00 ? 131 LEU A H    4 
ATOM 9722  H HA   . LEU A 1 68 ? 8.303   -25.003 -33.971 1.00 0.00 ? 131 LEU A HA   4 
ATOM 9723  H HB2  . LEU A 1 68 ? 9.758   -27.565 -34.662 1.00 0.00 ? 131 LEU A HB2  4 
ATOM 9724  H HB3  . LEU A 1 68 ? 9.369   -27.026 -33.024 1.00 0.00 ? 131 LEU A HB3  4 
ATOM 9725  H HG   . LEU A 1 68 ? 7.340   -27.678 -35.190 1.00 0.00 ? 131 LEU A HG   4 
ATOM 9726  H HD11 . LEU A 1 68 ? 8.643   -29.640 -34.358 1.00 0.00 ? 131 LEU A HD11 4 
ATOM 9727  H HD12 . LEU A 1 68 ? 6.920   -29.712 -33.912 1.00 0.00 ? 131 LEU A HD12 4 
ATOM 9728  H HD13 . LEU A 1 68 ? 8.134   -29.234 -32.701 1.00 0.00 ? 131 LEU A HD13 4 
ATOM 9729  H HD21 . LEU A 1 68 ? 6.293   -26.130 -33.747 1.00 0.00 ? 131 LEU A HD21 4 
ATOM 9730  H HD22 . LEU A 1 68 ? 7.154   -26.742 -32.312 1.00 0.00 ? 131 LEU A HD22 4 
ATOM 9731  H HD23 . LEU A 1 68 ? 5.849   -27.701 -33.051 1.00 0.00 ? 131 LEU A HD23 4 
ATOM 9732  N N    . THR A 1 69 ? 11.093  -24.488 -35.307 1.00 0.00 ? 132 THR A N    4 
ATOM 9733  C CA   . THR A 1 69 ? 12.416  -23.888 -35.171 1.00 0.00 ? 132 THR A CA   4 
ATOM 9734  C C    . THR A 1 69 ? 12.392  -22.411 -35.534 1.00 0.00 ? 132 THR A C    4 
ATOM 9735  O O    . THR A 1 69 ? 13.441  -21.779 -35.673 1.00 0.00 ? 132 THR A O    4 
ATOM 9736  C CB   . THR A 1 69 ? 13.449  -24.621 -36.048 1.00 0.00 ? 132 THR A CB   4 
ATOM 9737  O OG1  . THR A 1 69 ? 13.049  -24.550 -37.421 1.00 0.00 ? 132 THR A OG1  4 
ATOM 9738  C CG2  . THR A 1 69 ? 13.563  -26.080 -35.633 1.00 0.00 ? 132 THR A CG2  4 
ATOM 9739  H H    . THR A 1 69 ? 10.691  -24.592 -36.239 1.00 0.00 ? 132 THR A H    4 
ATOM 9740  H HA   . THR A 1 69 ? 12.748  -23.972 -34.134 1.00 0.00 ? 132 THR A HA   4 
ATOM 9741  H HB   . THR A 1 69 ? 14.419  -24.162 -35.904 1.00 0.00 ? 132 THR A HB   4 
ATOM 9742  H HG1  . THR A 1 69 ? 12.900  -23.626 -37.638 1.00 0.00 ? 132 THR A HG1  4 
ATOM 9743  H HG21 . THR A 1 69 ? 12.592  -26.562 -35.739 1.00 0.00 ? 132 THR A HG21 4 
ATOM 9744  H HG22 . THR A 1 69 ? 13.887  -26.137 -34.593 1.00 0.00 ? 132 THR A HG22 4 
ATOM 9745  H HG23 . THR A 1 69 ? 14.290  -26.586 -36.269 1.00 0.00 ? 132 THR A HG23 4 
ATOM 9746  N N    . ILE A 1 70 ? 11.191  -21.863 -35.687 1.00 0.00 ? 133 ILE A N    4 
ATOM 9747  C CA   . ILE A 1 70 ? 11.029  -20.452 -36.017 1.00 0.00 ? 133 ILE A CA   4 
ATOM 9748  C C    . ILE A 1 70 ? 10.925  -19.600 -34.759 1.00 0.00 ? 133 ILE A C    4 
ATOM 9749  O O    . ILE A 1 70 ? 10.081  -19.849 -33.897 1.00 0.00 ? 133 ILE A O    4 
ATOM 9750  C CB   . ILE A 1 70 ? 9.782   -20.234 -36.892 1.00 0.00 ? 133 ILE A CB   4 
ATOM 9751  C CG1  . ILE A 1 70 ? 9.920   -20.986 -38.218 1.00 0.00 ? 133 ILE A CG1  4 
ATOM 9752  C CG2  . ILE A 1 70 ? 9.560   -18.750 -37.139 1.00 0.00 ? 133 ILE A CG2  4 
ATOM 9753  C CD1  . ILE A 1 70 ? 8.652   -21.016 -39.037 1.00 0.00 ? 133 ILE A CD1  4 
ATOM 9754  H H    . ILE A 1 70 ? 10.361  -22.438 -35.550 1.00 0.00 ? 133 ILE A H    4 
ATOM 9755  H HA   . ILE A 1 70 ? 11.891  -20.132 -36.580 1.00 0.00 ? 133 ILE A HA   4 
ATOM 9756  H HB   . ILE A 1 70 ? 8.917   -20.628 -36.359 1.00 0.00 ? 133 ILE A HB   4 
ATOM 9757  H HG12 . ILE A 1 70 ? 10.676  -20.487 -38.808 1.00 0.00 ? 133 ILE A HG12 4 
ATOM 9758  H HG13 . ILE A 1 70 ? 10.243  -22.008 -38.015 1.00 0.00 ? 133 ILE A HG13 4 
ATOM 9759  H HG21 . ILE A 1 70 ? 10.473  -18.313 -37.534 1.00 0.00 ? 133 ILE A HG21 4 
ATOM 9760  H HG22 . ILE A 1 70 ? 9.286   -18.249 -36.212 1.00 0.00 ? 133 ILE A HG22 4 
ATOM 9761  H HG23 . ILE A 1 70 ? 8.762   -18.615 -37.861 1.00 0.00 ? 133 ILE A HG23 4 
ATOM 9762  H HD11 . ILE A 1 70 ? 8.547   -20.092 -39.608 1.00 0.00 ? 133 ILE A HD11 4 
ATOM 9763  H HD12 . ILE A 1 70 ? 8.689   -21.861 -39.725 1.00 0.00 ? 133 ILE A HD12 4 
ATOM 9764  H HD13 . ILE A 1 70 ? 7.796   -21.129 -38.373 1.00 0.00 ? 133 ILE A HD13 4 
ATOM 9765  N N    . THR A 1 71 ? 11.787  -18.595 -34.657 1.00 0.00 ? 134 THR A N    4 
ATOM 9766  C CA   . THR A 1 71 ? 11.773  -17.685 -33.518 1.00 0.00 ? 134 THR A CA   4 
ATOM 9767  C C    . THR A 1 71 ? 11.656  -16.236 -33.969 1.00 0.00 ? 134 THR A C    4 
ATOM 9768  O O    . THR A 1 71 ? 12.463  -15.758 -34.771 1.00 0.00 ? 134 THR A O    4 
ATOM 9769  C CB   . THR A 1 71 ? 13.039  -17.859 -32.656 1.00 0.00 ? 134 THR A CB   4 
ATOM 9770  O OG1  . THR A 1 71 ? 13.110  -19.206 -32.173 1.00 0.00 ? 134 THR A OG1  4 
ATOM 9771  C CG2  . THR A 1 71 ? 13.015  -16.901 -31.475 1.00 0.00 ? 134 THR A CG2  4 
ATOM 9772  H H    . THR A 1 71 ? 12.459  -18.438 -35.404 1.00 0.00 ? 134 THR A H    4 
ATOM 9773  H HA   . THR A 1 71 ? 10.910  -17.904 -32.887 1.00 0.00 ? 134 THR A HA   4 
ATOM 9774  H HB   . THR A 1 71 ? 13.917  -17.649 -33.267 1.00 0.00 ? 134 THR A HB   4 
ATOM 9775  H HG1  . THR A 1 71 ? 13.938  -19.310 -31.700 1.00 0.00 ? 134 THR A HG1  4 
ATOM 9776  H HG21 . THR A 1 71 ? 12.040  -16.952 -30.989 1.00 0.00 ? 134 THR A HG21 4 
ATOM 9777  H HG22 . THR A 1 71 ? 13.193  -15.884 -31.826 1.00 0.00 ? 134 THR A HG22 4 
ATOM 9778  H HG23 . THR A 1 71 ? 13.790  -17.180 -30.762 1.00 0.00 ? 134 THR A HG23 4 
ATOM 9779  N N    . SER A 1 72 ? 10.651  -15.539 -33.454 1.00 0.00 ? 135 SER A N    4 
ATOM 9780  C CA   . SER A 1 72 ? 10.446  -14.132 -33.779 1.00 0.00 ? 135 SER A CA   4 
ATOM 9781  C C    . SER A 1 72 ? 11.085  -13.227 -32.733 1.00 0.00 ? 135 SER A C    4 
ATOM 9782  O O    . SER A 1 72 ? 11.404  -13.667 -31.628 1.00 0.00 ? 135 SER A O    4 
ATOM 9783  C CB   . SER A 1 72 ? 8.964   -13.831 -33.883 1.00 0.00 ? 135 SER A CB   4 
ATOM 9784  O OG   . SER A 1 72 ? 8.343   -13.924 -32.631 1.00 0.00 ? 135 SER A OG   4 
ATOM 9785  H H    . SER A 1 72 ? 10.021  -15.992 -32.791 1.00 0.00 ? 135 SER A H    4 
ATOM 9786  H HA   . SER A 1 72 ? 10.907  -13.912 -34.719 1.00 0.00 ? 135 SER A HA   4 
ATOM 9787  H HB2  . SER A 1 72 ? 8.825   -12.822 -34.259 1.00 0.00 ? 135 SER A HB2  4 
ATOM 9788  H HB3  . SER A 1 72 ? 8.504   -14.545 -34.570 1.00 0.00 ? 135 SER A HB3  4 
ATOM 9789  H HG   . SER A 1 72 ? 8.895   -14.473 -32.071 1.00 0.00 ? 135 SER A HG   4 
ATOM 9790  N N    . SER A 1 73 ? 11.270  -11.960 -33.089 1.00 0.00 ? 136 SER A N    4 
ATOM 9791  C CA   . SER A 1 73 ? 11.785  -10.969 -32.152 1.00 0.00 ? 136 SER A CA   4 
ATOM 9792  C C    . SER A 1 73 ? 11.321  -9.567  -32.523 1.00 0.00 ? 136 SER A C    4 
ATOM 9793  O O    . SER A 1 73 ? 11.691  -9.035  -33.568 1.00 0.00 ? 136 SER A O    4 
ATOM 9794  C CB   . SER A 1 73 ? 13.301  -11.018 -32.122 1.00 0.00 ? 136 SER A CB   4 
ATOM 9795  O OG   . SER A 1 73 ? 13.817  -10.049 -31.252 1.00 0.00 ? 136 SER A OG   4 
ATOM 9796  H H    . SER A 1 73 ? 10.970  -11.655 -34.014 1.00 0.00 ? 136 SER A H    4 
ATOM 9797  H HA   . SER A 1 73 ? 11.417  -11.194 -31.149 1.00 0.00 ? 136 SER A HA   4 
ATOM 9798  H HB2  . SER A 1 73 ? 13.624  -11.999 -31.785 1.00 0.00 ? 136 SER A HB2  4 
ATOM 9799  H HB3  . SER A 1 73 ? 13.679  -10.844 -33.132 1.00 0.00 ? 136 SER A HB3  4 
ATOM 9800  H HG   . SER A 1 73 ? 13.157  -9.356  -31.162 1.00 0.00 ? 136 SER A HG   4 
ATOM 9801  N N    . LEU A 1 74 ? 10.508  -8.971  -31.656 1.00 0.00 ? 137 LEU A N    4 
ATOM 9802  C CA   . LEU A 1 74 ? 9.917   -7.668  -31.932 1.00 0.00 ? 137 LEU A CA   4 
ATOM 9803  C C    . LEU A 1 74 ? 10.650  -6.560  -31.186 1.00 0.00 ? 137 LEU A C    4 
ATOM 9804  O O    . LEU A 1 74 ? 10.576  -6.470  -29.961 1.00 0.00 ? 137 LEU A O    4 
ATOM 9805  C CB   . LEU A 1 74 ? 8.434   -7.663  -31.538 1.00 0.00 ? 137 LEU A CB   4 
ATOM 9806  C CG   . LEU A 1 74 ? 7.721   -6.309  -31.644 1.00 0.00 ? 137 LEU A CG   4 
ATOM 9807  C CD1  . LEU A 1 74 ? 7.812   -5.800  -33.077 1.00 0.00 ? 137 LEU A CD1  4 
ATOM 9808  C CD2  . LEU A 1 74 ? 6.271   -6.463  -31.209 1.00 0.00 ? 137 LEU A CD2  4 
ATOM 9809  H H    . LEU A 1 74 ? 10.230  -9.470  -30.810 1.00 0.00 ? 137 LEU A H    4 
ATOM 9810  H HA   . LEU A 1 74 ? 9.993   -7.470  -32.986 1.00 0.00 ? 137 LEU A HA   4 
ATOM 9811  H HB2  . LEU A 1 74 ? 7.903   -8.388  -32.141 1.00 0.00 ? 137 LEU A HB2  4 
ATOM 9812  H HB3  . LEU A 1 74 ? 8.374   -7.987  -30.497 1.00 0.00 ? 137 LEU A HB3  4 
ATOM 9813  H HG   . LEU A 1 74 ? 8.215   -5.594  -30.985 1.00 0.00 ? 137 LEU A HG   4 
ATOM 9814  H HD11 . LEU A 1 74 ? 7.401   -4.789  -33.098 1.00 0.00 ? 137 LEU A HD11 4 
ATOM 9815  H HD12 . LEU A 1 74 ? 7.210   -6.428  -33.725 1.00 0.00 ? 137 LEU A HD12 4 
ATOM 9816  H HD13 . LEU A 1 74 ? 8.834   -5.768  -33.428 1.00 0.00 ? 137 LEU A HD13 4 
ATOM 9817  H HD21 . LEU A 1 74 ? 5.694   -5.631  -31.593 1.00 0.00 ? 137 LEU A HD21 4 
ATOM 9818  H HD22 . LEU A 1 74 ? 6.213   -6.473  -30.122 1.00 0.00 ? 137 LEU A HD22 4 
ATOM 9819  H HD23 . LEU A 1 74 ? 5.858   -7.395  -31.602 1.00 0.00 ? 137 LEU A HD23 4 
ATOM 9820  N N    . SER A 1 75 ? 11.358  -5.719  -31.933 1.00 0.00 ? 138 SER A N    4 
ATOM 9821  C CA   . SER A 1 75 ? 11.949  -4.509  -31.373 1.00 0.00 ? 138 SER A CA   4 
ATOM 9822  C C    . SER A 1 75 ? 10.933  -3.378  -31.307 1.00 0.00 ? 138 SER A C    4 
ATOM 9823  O O    . SER A 1 75 ? 10.093  -3.232  -32.195 1.00 0.00 ? 138 SER A O    4 
ATOM 9824  C CB   . SER A 1 75 ? 13.144  -4.080  -32.202 1.00 0.00 ? 138 SER A CB   4 
ATOM 9825  O OG   . SER A 1 75 ? 13.662  -2.862  -31.744 1.00 0.00 ? 138 SER A OG   4 
ATOM 9826  H H    . SER A 1 75 ? 11.350  -5.832  -32.946 1.00 0.00 ? 138 SER A H    4 
ATOM 9827  H HA   . SER A 1 75 ? 12.299  -4.731  -30.361 1.00 0.00 ? 138 SER A HA   4 
ATOM 9828  H HB2  . SER A 1 75 ? 13.920  -4.839  -32.184 1.00 0.00 ? 138 SER A HB2  4 
ATOM 9829  H HB3  . SER A 1 75 ? 12.778  -3.957  -33.215 1.00 0.00 ? 138 SER A HB3  4 
ATOM 9830  H HG   . SER A 1 75 ? 12.937  -2.348  -31.385 1.00 0.00 ? 138 SER A HG   4 
ATOM 9831  N N    . SER A 1 76 ? 11.011  -2.580  -30.248 1.00 0.00 ? 139 SER A N    4 
ATOM 9832  C CA   . SER A 1 76 ? 10.111  -1.446  -30.074 1.00 0.00 ? 139 SER A CA   4 
ATOM 9833  C C    . SER A 1 76 ? 10.451  -0.319  -31.041 1.00 0.00 ? 139 SER A C    4 
ATOM 9834  O O    . SER A 1 76 ? 9.689   0.637   -31.186 1.00 0.00 ? 139 SER A O    4 
ATOM 9835  C CB   . SER A 1 76 ? 10.180  -0.938  -28.647 1.00 0.00 ? 139 SER A CB   4 
ATOM 9836  O OG   . SER A 1 76 ? 11.432  -0.370  -28.376 1.00 0.00 ? 139 SER A OG   4 
ATOM 9837  H H    . SER A 1 76 ? 11.730  -2.754  -29.546 1.00 0.00 ? 139 SER A H    4 
ATOM 9838  H HA   . SER A 1 76 ? 9.095   -1.781  -30.277 1.00 0.00 ? 139 SER A HA   4 
ATOM 9839  H HB2  . SER A 1 76 ? 9.413   -0.182  -28.497 1.00 0.00 ? 139 SER A HB2  4 
ATOM 9840  H HB3  . SER A 1 76 ? 9.998   -1.770  -27.963 1.00 0.00 ? 139 SER A HB3  4 
ATOM 9841  H HG   . SER A 1 76 ? 11.991  -0.522  -29.143 1.00 0.00 ? 139 SER A HG   4 
ATOM 9842  N N    . ASP A 1 77 ? 11.599  -0.438  -31.698 1.00 0.00 ? 140 ASP A N    4 
ATOM 9843  C CA   . ASP A 1 77 ? 12.022  0.549   -32.685 1.00 0.00 ? 140 ASP A CA   4 
ATOM 9844  C C    . ASP A 1 77 ? 11.356  0.301   -34.032 1.00 0.00 ? 140 ASP A C    4 
ATOM 9845  O O    . ASP A 1 77 ? 11.310  1.188   -34.885 1.00 0.00 ? 140 ASP A O    4 
ATOM 9846  C CB   . ASP A 1 77 ? 13.544  0.523   -32.851 1.00 0.00 ? 140 ASP A CB   4 
ATOM 9847  C CG   . ASP A 1 77 ? 14.282  1.009   -31.611 1.00 0.00 ? 140 ASP A CG   4 
ATOM 9848  O OD1  . ASP A 1 77 ? 13.693  1.720   -30.832 1.00 0.00 ? 140 ASP A OD1  4 
ATOM 9849  O OD2  . ASP A 1 77 ? 15.429  0.664   -31.454 1.00 0.00 ? 140 ASP A OD2  4 
ATOM 9850  H H    . ASP A 1 77 ? 12.183  -1.258  -31.537 1.00 0.00 ? 140 ASP A H    4 
ATOM 9851  H HA   . ASP A 1 77 ? 11.738  1.542   -32.331 1.00 0.00 ? 140 ASP A HA   4 
ATOM 9852  H HB2  . ASP A 1 77 ? 13.853  -0.500  -33.064 1.00 0.00 ? 140 ASP A HB2  4 
ATOM 9853  H HB3  . ASP A 1 77 ? 13.819  1.159   -33.694 1.00 0.00 ? 140 ASP A HB3  4 
ATOM 9854  N N    . GLY A 1 78 ? 10.838  -0.908  -34.219 1.00 0.00 ? 141 GLY A N    4 
ATOM 9855  C CA   . GLY A 1 78 ? 10.161  -1.271  -35.456 1.00 0.00 ? 141 GLY A CA   4 
ATOM 9856  C C    . GLY A 1 78 ? 10.947  -2.322  -36.230 1.00 0.00 ? 141 GLY A C    4 
ATOM 9857  O O    . GLY A 1 78 ? 10.653  -2.603  -37.391 1.00 0.00 ? 141 GLY A O    4 
ATOM 9858  H H    . GLY A 1 78 ? 10.910  -1.598  -33.470 1.00 0.00 ? 141 GLY A H    4 
ATOM 9859  H HA2  . GLY A 1 78 ? 9.192   -1.681  -35.184 1.00 0.00 ? 141 GLY A HA2  4 
ATOM 9860  H HA3  . GLY A 1 78 ? 10.012  -0.391  -36.090 1.00 0.00 ? 141 GLY A HA3  4 
ATOM 9861  N N    . VAL A 1 79 ? 11.950  -2.902  -35.576 1.00 0.00 ? 142 VAL A N    4 
ATOM 9862  C CA   . VAL A 1 79 ? 12.737  -3.970  -36.177 1.00 0.00 ? 142 VAL A CA   4 
ATOM 9863  C C    . VAL A 1 79 ? 12.203  -5.340  -35.780 1.00 0.00 ? 142 VAL A C    4 
ATOM 9864  O O    . VAL A 1 79 ? 12.748  -5.995  -34.892 1.00 0.00 ? 142 VAL A O    4 
ATOM 9865  C CB   . VAL A 1 79 ? 14.213  -3.853  -35.747 1.00 0.00 ? 142 VAL A CB   4 
ATOM 9866  C CG1  . VAL A 1 79 ? 15.051  -4.928  -36.422 1.00 0.00 ? 142 VAL A CG1  4 
ATOM 9867  C CG2  . VAL A 1 79 ? 14.740  -2.467  -36.081 1.00 0.00 ? 142 VAL A CG2  4 
ATOM 9868  H H    . VAL A 1 79 ? 12.135  -2.632  -34.611 1.00 0.00 ? 142 VAL A H    4 
ATOM 9869  H HA   . VAL A 1 79 ? 12.694  -3.881  -37.265 1.00 0.00 ? 142 VAL A HA   4 
ATOM 9870  H HB   . VAL A 1 79 ? 14.294  -4.001  -34.682 1.00 0.00 ? 142 VAL A HB   4 
ATOM 9871  H HG11 . VAL A 1 79 ? 14.829  -5.901  -35.990 1.00 0.00 ? 142 VAL A HG11 4 
ATOM 9872  H HG12 . VAL A 1 79 ? 16.110  -4.705  -36.284 1.00 0.00 ? 142 VAL A HG12 4 
ATOM 9873  H HG13 . VAL A 1 79 ? 14.821  -4.941  -37.485 1.00 0.00 ? 142 VAL A HG13 4 
ATOM 9874  H HG21 . VAL A 1 79 ? 14.672  -2.309  -37.158 1.00 0.00 ? 142 VAL A HG21 4 
ATOM 9875  H HG22 . VAL A 1 79 ? 15.780  -2.383  -35.767 1.00 0.00 ? 142 VAL A HG22 4 
ATOM 9876  H HG23 . VAL A 1 79 ? 14.143  -1.713  -35.567 1.00 0.00 ? 142 VAL A HG23 4 
ATOM 9877  N N    . LEU A 1 80 ? 11.136  -5.768  -36.444 1.00 0.00 ? 143 LEU A N    4 
ATOM 9878  C CA   . LEU A 1 80 ? 10.573  -7.095  -36.217 1.00 0.00 ? 143 LEU A CA   4 
ATOM 9879  C C    . LEU A 1 80 ? 11.228  -8.132  -37.121 1.00 0.00 ? 143 LEU A C    4 
ATOM 9880  O O    . LEU A 1 80 ? 11.246  -7.982  -38.342 1.00 0.00 ? 143 LEU A O    4 
ATOM 9881  C CB   . LEU A 1 80 ? 9.059   -7.077  -36.462 1.00 0.00 ? 143 LEU A CB   4 
ATOM 9882  C CG   . LEU A 1 80 ? 8.359   -8.440  -36.402 1.00 0.00 ? 143 LEU A CG   4 
ATOM 9883  C CD1  . LEU A 1 80 ? 8.496   -9.022  -35.002 1.00 0.00 ? 143 LEU A CD1  4 
ATOM 9884  C CD2  . LEU A 1 80 ? 6.897   -8.279  -36.786 1.00 0.00 ? 143 LEU A CD2  4 
ATOM 9885  H H    . LEU A 1 80 ? 10.741  -5.181  -37.179 1.00 0.00 ? 143 LEU A H    4 
ATOM 9886  H HA   . LEU A 1 80 ? 10.747  -7.382  -35.183 1.00 0.00 ? 143 LEU A HA   4 
ATOM 9887  H HB2  . LEU A 1 80 ? 8.600   -6.428  -35.717 1.00 0.00 ? 143 LEU A HB2  4 
ATOM 9888  H HB3  . LEU A 1 80 ? 8.888   -6.643  -37.445 1.00 0.00 ? 143 LEU A HB3  4 
ATOM 9889  H HG   . LEU A 1 80 ? 8.842   -9.104  -37.097 1.00 0.00 ? 143 LEU A HG   4 
ATOM 9890  H HD11 . LEU A 1 80 ? 8.311   -8.252  -34.285 1.00 0.00 ? 143 LEU A HD11 4 
ATOM 9891  H HD12 . LEU A 1 80 ? 9.503   -9.416  -34.857 1.00 0.00 ? 143 LEU A HD12 4 
ATOM 9892  H HD13 . LEU A 1 80 ? 7.780   -9.815  -34.862 1.00 0.00 ? 143 LEU A HD13 4 
ATOM 9893  H HD21 . LEU A 1 80 ? 6.822   -7.761  -37.744 1.00 0.00 ? 143 LEU A HD21 4 
ATOM 9894  H HD22 . LEU A 1 80 ? 6.385   -7.697  -36.020 1.00 0.00 ? 143 LEU A HD22 4 
ATOM 9895  H HD23 . LEU A 1 80 ? 6.437   -9.257  -36.869 1.00 0.00 ? 143 LEU A HD23 4 
ATOM 9896  N N    . THR A 1 81 ? 11.764  -9.186  -36.513 1.00 0.00 ? 144 THR A N    4 
ATOM 9897  C CA   . THR A 1 81 ? 12.462  -10.226 -37.257 1.00 0.00 ? 144 THR A CA   4 
ATOM 9898  C C    . THR A 1 81 ? 11.909  -11.605 -36.925 1.00 0.00 ? 144 THR A C    4 
ATOM 9899  O O    . THR A 1 81 ? 11.872  -12.007 -35.762 1.00 0.00 ? 144 THR A O    4 
ATOM 9900  C CB   . THR A 1 81 ? 13.973  -10.193 -36.970 1.00 0.00 ? 144 THR A CB   4 
ATOM 9901  O OG1  . THR A 1 81 ? 14.506  -8.914  -37.342 1.00 0.00 ? 144 THR A OG1  4 
ATOM 9902  C CG2  . THR A 1 81 ? 14.689  -11.282 -37.753 1.00 0.00 ? 144 THR A CG2  4 
ATOM 9903  H H    . THR A 1 81 ? 11.716  -9.251  -35.496 1.00 0.00 ? 144 THR A H    4 
ATOM 9904  H HA   . THR A 1 81 ? 12.323  -10.060 -38.317 1.00 0.00 ? 144 THR A HA   4 
ATOM 9905  H HB   . THR A 1 81 ? 14.139  -10.354 -35.905 1.00 0.00 ? 144 THR A HB   4 
ATOM 9906  H HG1  . THR A 1 81 ? 15.071  -9.042  -38.106 1.00 0.00 ? 144 THR A HG1  4 
ATOM 9907  H HG21 . THR A 1 81 ? 15.767  -11.124 -37.700 1.00 0.00 ? 144 THR A HG21 4 
ATOM 9908  H HG22 . THR A 1 81 ? 14.368  -11.247 -38.795 1.00 0.00 ? 144 THR A HG22 4 
ATOM 9909  H HG23 . THR A 1 81 ? 14.444  -12.255 -37.330 1.00 0.00 ? 144 THR A HG23 4 
ATOM 9910  N N    . VAL A 1 82 ? 11.478  -12.329 -37.955 1.00 0.00 ? 145 VAL A N    4 
ATOM 9911  C CA   . VAL A 1 82 ? 11.031  -13.707 -37.788 1.00 0.00 ? 145 VAL A CA   4 
ATOM 9912  C C    . VAL A 1 82 ? 11.896  -14.666 -38.596 1.00 0.00 ? 145 VAL A C    4 
ATOM 9913  O O    . VAL A 1 82 ? 11.965  -14.574 -39.823 1.00 0.00 ? 145 VAL A O    4 
ATOM 9914  C CB   . VAL A 1 82 ? 9.562   -13.849 -38.229 1.00 0.00 ? 145 VAL A CB   4 
ATOM 9915  C CG1  . VAL A 1 82 ? 9.082   -15.280 -38.031 1.00 0.00 ? 145 VAL A CG1  4 
ATOM 9916  C CG2  . VAL A 1 82 ? 8.692   -12.873 -37.451 1.00 0.00 ? 145 VAL A CG2  4 
ATOM 9917  H H    . VAL A 1 82 ? 11.553  -11.942 -38.897 1.00 0.00 ? 145 VAL A H    4 
ATOM 9918  H HA   . VAL A 1 82 ? 11.102  -13.996 -36.760 1.00 0.00 ? 145 VAL A HA   4 
ATOM 9919  H HB   . VAL A 1 82 ? 9.504   -13.599 -39.293 1.00 0.00 ? 145 VAL A HB   4 
ATOM 9920  H HG11 . VAL A 1 82 ? 9.001   -15.785 -38.994 1.00 0.00 ? 145 VAL A HG11 4 
ATOM 9921  H HG12 . VAL A 1 82 ? 8.108   -15.296 -37.541 1.00 0.00 ? 145 VAL A HG12 4 
ATOM 9922  H HG13 . VAL A 1 82 ? 9.789   -15.834 -37.406 1.00 0.00 ? 145 VAL A HG13 4 
ATOM 9923  H HG21 . VAL A 1 82 ? 7.763   -12.699 -37.995 1.00 0.00 ? 145 VAL A HG21 4 
ATOM 9924  H HG22 . VAL A 1 82 ? 8.461   -13.284 -36.481 1.00 0.00 ? 145 VAL A HG22 4 
ATOM 9925  H HG23 . VAL A 1 82 ? 9.215   -11.924 -37.321 1.00 0.00 ? 145 VAL A HG23 4 
ATOM 9926  N N    . ASP A 1 83 ? 12.557  -15.588 -37.903 1.00 0.00 ? 146 ASP A N    4 
ATOM 9927  C CA   . ASP A 1 83 ? 13.575  -16.429 -38.520 1.00 0.00 ? 146 ASP A CA   4 
ATOM 9928  C C    . ASP A 1 83 ? 13.409  -17.885 -38.111 1.00 0.00 ? 146 ASP A C    4 
ATOM 9929  O O    . ASP A 1 83 ? 12.757  -18.190 -37.113 1.00 0.00 ? 146 ASP A O    4 
ATOM 9930  C CB   . ASP A 1 83 ? 14.975  -15.940 -38.136 1.00 0.00 ? 146 ASP A CB   4 
ATOM 9931  C CG   . ASP A 1 83 ? 15.296  -16.158 -36.663 1.00 0.00 ? 146 ASP A CG   4 
ATOM 9932  O OD1  . ASP A 1 83 ? 14.762  -17.080 -36.091 1.00 0.00 ? 146 ASP A OD1  4 
ATOM 9933  O OD2  . ASP A 1 83 ? 16.070  -15.404 -36.125 1.00 0.00 ? 146 ASP A OD2  4 
ATOM 9934  H H    . ASP A 1 83 ? 12.472  -15.584 -36.886 1.00 0.00 ? 146 ASP A H    4 
ATOM 9935  H HA   . ASP A 1 83 ? 13.475  -16.378 -39.602 1.00 0.00 ? 146 ASP A HA   4 
ATOM 9936  H HB2  . ASP A 1 83 ? 15.720  -16.453 -38.728 1.00 0.00 ? 146 ASP A HB2  4 
ATOM 9937  H HB3  . ASP A 1 83 ? 15.034  -14.869 -38.334 1.00 0.00 ? 146 ASP A HB3  4 
ATOM 9938  N N    . GLY A 1 84 ? 14.003  -18.783 -38.890 1.00 0.00 ? 147 GLY A N    4 
ATOM 9939  C CA   . GLY A 1 84 ? 13.887  -20.214 -38.636 1.00 0.00 ? 147 GLY A CA   4 
ATOM 9940  C C    . GLY A 1 84 ? 14.593  -21.027 -39.715 1.00 0.00 ? 147 GLY A C    4 
ATOM 9941  O O    . GLY A 1 84 ? 14.436  -20.759 -40.907 1.00 0.00 ? 147 GLY A O    4 
ATOM 9942  H H    . GLY A 1 84 ? 14.518  -18.464 -39.711 1.00 0.00 ? 147 GLY A H    4 
ATOM 9943  H HA2  . GLY A 1 84 ? 14.248  -20.402 -37.645 1.00 0.00 ? 147 GLY A HA2  4 
ATOM 9944  H HA3  . GLY A 1 84 ? 12.850  -20.480 -38.668 1.00 0.00 ? 147 GLY A HA3  4 
ATOM 9945  N N    . PRO A 1 85 ? 15.372  -22.014 -39.292 1.00 0.00 ? 148 PRO A N    4 
ATOM 9946  C CA   . PRO A 1 85 ? 16.063  -22.898 -40.221 1.00 0.00 ? 148 PRO A CA   4 
ATOM 9947  C C    . PRO A 1 85 ? 15.076  -23.617 -41.134 1.00 0.00 ? 148 PRO A C    4 
ATOM 9948  O O    . PRO A 1 85 ? 13.947  -23.908 -40.738 1.00 0.00 ? 148 PRO A O    4 
ATOM 9949  C CB   . PRO A 1 85 ? 16.789  -23.877 -39.295 1.00 0.00 ? 148 PRO A CB   4 
ATOM 9950  C CG   . PRO A 1 85 ? 16.953  -23.119 -38.020 1.00 0.00 ? 148 PRO A CG   4 
ATOM 9951  C CD   . PRO A 1 85 ? 15.686  -22.315 -37.897 1.00 0.00 ? 148 PRO A CD   4 
ATOM 9952  H HA   . PRO A 1 85 ? 16.766  -22.358 -40.796 1.00 0.00 ? 148 PRO A HA   4 
ATOM 9953  H HB2  . PRO A 1 85 ? 16.187  -24.778 -39.131 1.00 0.00 ? 148 PRO A HB2  4 
ATOM 9954  H HB3  . PRO A 1 85 ? 17.765  -24.145 -39.703 1.00 0.00 ? 148 PRO A HB3  4 
ATOM 9955  H HG2  . PRO A 1 85 ? 17.052  -23.811 -37.178 1.00 0.00 ? 148 PRO A HG2  4 
ATOM 9956  H HG3  . PRO A 1 85 ? 17.821  -22.459 -38.074 1.00 0.00 ? 148 PRO A HG3  4 
ATOM 9957  H HD2  . PRO A 1 85 ? 14.890  -22.884 -37.448 1.00 0.00 ? 148 PRO A HD2  4 
ATOM 9958  H HD3  . PRO A 1 85 ? 15.897  -21.412 -37.337 1.00 0.00 ? 148 PRO A HD3  4 
ATOM 9959  N N    . ARG A 1 86 ? 15.509  -23.901 -42.358 1.00 0.00 ? 149 ARG A N    4 
ATOM 9960  C CA   . ARG A 1 86 ? 14.720  -24.708 -43.282 1.00 0.00 ? 149 ARG A CA   4 
ATOM 9961  C C    . ARG A 1 86 ? 15.607  -25.645 -44.092 1.00 0.00 ? 149 ARG A C    4 
ATOM 9962  O O    . ARG A 1 86 ? 16.833  -25.582 -44.006 1.00 0.00 ? 149 ARG A O    4 
ATOM 9963  C CB   . ARG A 1 86 ? 13.928  -23.816 -44.227 1.00 0.00 ? 149 ARG A CB   4 
ATOM 9964  C CG   . ARG A 1 86 ? 14.774  -22.976 -45.170 1.00 0.00 ? 149 ARG A CG   4 
ATOM 9965  C CD   . ARG A 1 86 ? 13.936  -22.219 -46.135 1.00 0.00 ? 149 ARG A CD   4 
ATOM 9966  N NE   . ARG A 1 86 ? 14.735  -21.364 -46.996 1.00 0.00 ? 149 ARG A NE   4 
ATOM 9967  C CZ   . ARG A 1 86 ? 14.245  -20.347 -47.733 1.00 0.00 ? 149 ARG A CZ   4 
ATOM 9968  N NH1  . ARG A 1 86 ? 12.962  -20.071 -47.701 1.00 0.00 ? 149 ARG A NH1  4 
ATOM 9969  N NH2  . ARG A 1 86 ? 15.058  -19.626 -48.485 1.00 0.00 ? 149 ARG A NH2  4 
ATOM 9970  H H    . ARG A 1 86 ? 16.464  -23.648 -42.613 1.00 0.00 ? 149 ARG A H    4 
ATOM 9971  H HA   . ARG A 1 86 ? 14.023  -25.328 -42.715 1.00 0.00 ? 149 ARG A HA   4 
ATOM 9972  H HB2  . ARG A 1 86 ? 13.271  -24.438 -44.830 1.00 0.00 ? 149 ARG A HB2  4 
ATOM 9973  H HB3  . ARG A 1 86 ? 13.326  -23.135 -43.631 1.00 0.00 ? 149 ARG A HB3  4 
ATOM 9974  H HG2  . ARG A 1 86 ? 15.379  -22.282 -44.593 1.00 0.00 ? 149 ARG A HG2  4 
ATOM 9975  H HG3  . ARG A 1 86 ? 15.432  -23.637 -45.732 1.00 0.00 ? 149 ARG A HG3  4 
ATOM 9976  H HD2  . ARG A 1 86 ? 13.417  -22.940 -46.769 1.00 0.00 ? 149 ARG A HD2  4 
ATOM 9977  H HD3  . ARG A 1 86 ? 13.195  -21.628 -45.608 1.00 0.00 ? 149 ARG A HD3  4 
ATOM 9978  H HE   . ARG A 1 86 ? 15.701  -21.530 -47.033 1.00 0.00 ? 149 ARG A HE   4 
ATOM 9979  H HH11 . ARG A 1 86 ? 12.346  -20.613 -47.127 1.00 0.00 ? 149 ARG A HH11 4 
ATOM 9980  H HH12 . ARG A 1 86 ? 12.595  -19.310 -48.255 1.00 0.00 ? 149 ARG A HH12 4 
ATOM 9981  H HH21 . ARG A 1 86 ? 16.036  -19.830 -48.508 1.00 0.00 ? 149 ARG A HH21 4 
ATOM 9982  H HH22 . ARG A 1 86 ? 14.692  -18.874 -49.032 1.00 0.00 ? 149 ARG A HH22 4 
ATOM 9983  N N    . LYS A 1 87 ? 14.979  -26.511 -44.879 1.00 0.00 ? 150 LYS A N    4 
ATOM 9984  C CA   . LYS A 1 87 ? 15.693  -27.584 -45.561 1.00 0.00 ? 150 LYS A CA   4 
ATOM 9985  C C    . LYS A 1 87 ? 16.202  -27.131 -46.922 1.00 0.00 ? 150 LYS A C    4 
ATOM 9986  O O    . LYS A 1 87 ? 16.844  -27.897 -47.642 1.00 0.00 ? 150 LYS A O    4 
ATOM 9987  C CB   . LYS A 1 87 ? 14.795  -28.812 -45.717 1.00 0.00 ? 150 LYS A CB   4 
ATOM 9988  C CG   . LYS A 1 87 ? 14.360  -29.445 -44.400 1.00 0.00 ? 150 LYS A CG   4 
ATOM 9989  C CD   . LYS A 1 87 ? 13.261  -30.472 -44.618 1.00 0.00 ? 150 LYS A CD   4 
ATOM 9990  C CE   . LYS A 1 87 ? 12.859  -31.141 -43.311 1.00 0.00 ? 150 LYS A CE   4 
ATOM 9991  N NZ   . LYS A 1 87 ? 11.752  -32.119 -43.504 1.00 0.00 ? 150 LYS A NZ   4 
ATOM 9992  H H    . LYS A 1 87 ? 13.962  -26.524 -44.884 1.00 0.00 ? 150 LYS A H    4 
ATOM 9993  H HA   . LYS A 1 87 ? 16.555  -27.884 -44.962 1.00 0.00 ? 150 LYS A HA   4 
ATOM 9994  H HB2  . LYS A 1 87 ? 13.912  -28.549 -46.279 1.00 0.00 ? 150 LYS A HB2  4 
ATOM 9995  H HB3  . LYS A 1 87 ? 15.348  -29.564 -46.281 1.00 0.00 ? 150 LYS A HB3  4 
ATOM 9996  H HG2  . LYS A 1 87 ? 15.218  -29.929 -43.933 1.00 0.00 ? 150 LYS A HG2  4 
ATOM 9997  H HG3  . LYS A 1 87 ? 13.986  -28.658 -43.744 1.00 0.00 ? 150 LYS A HG3  4 
ATOM 9998  H HD2  . LYS A 1 87 ? 12.390  -29.979 -45.047 1.00 0.00 ? 150 LYS A HD2  4 
ATOM 9999  H HD3  . LYS A 1 87 ? 13.621  -31.234 -45.310 1.00 0.00 ? 150 LYS A HD3  4 
ATOM 10000 H HE2  . LYS A 1 87 ? 13.722  -31.660 -42.900 1.00 0.00 ? 150 LYS A HE2  4 
ATOM 10001 H HE3  . LYS A 1 87 ? 12.537  -30.371 -42.610 1.00 0.00 ? 150 LYS A HE3  4 
ATOM 10002 H HZ1  . LYS A 1 87 ? 11.568  -32.624 -42.614 1.00 0.00 ? 150 LYS A HZ1  4 
ATOM 10003 H HZ2  . LYS A 1 87 ? 12.023  -32.802 -44.240 1.00 0.00 ? 150 LYS A HZ2  4 
ATOM 10004 H HZ3  . LYS A 1 87 ? 10.917  -31.628 -43.791 1.00 0.00 ? 150 LYS A HZ3  4 
ATOM 10005 N N    . GLN A 1 88 ? 15.910  -25.883 -47.271 1.00 0.00 ? 151 GLN A N    4 
ATOM 10006 C CA   . GLN A 1 88 ? 16.271  -25.348 -48.579 1.00 0.00 ? 151 GLN A CA   4 
ATOM 10007 C C    . GLN A 1 88 ? 17.772  -25.457 -48.823 1.00 0.00 ? 151 GLN A C    4 
ATOM 10008 O O    . GLN A 1 88 ? 18.212  -25.715 -49.942 1.00 0.00 ? 151 GLN A O    4 
ATOM 10009 C CB   . GLN A 1 88 ? 15.826  -23.889 -48.704 1.00 0.00 ? 151 GLN A CB   4 
ATOM 10010 C CG   . GLN A 1 88 ? 16.092  -23.272 -50.066 1.00 0.00 ? 151 GLN A CG   4 
ATOM 10011 C CD   . GLN A 1 88 ? 15.279  -23.925 -51.166 1.00 0.00 ? 151 GLN A CD   4 
ATOM 10012 O OE1  . GLN A 1 88 ? 14.055  -24.045 -51.067 1.00 0.00 ? 151 GLN A OE1  4 
ATOM 10013 N NE2  . GLN A 1 88 ? 15.956  -24.353 -52.227 1.00 0.00 ? 151 GLN A NE2  4 
ATOM 10014 H H    . GLN A 1 88 ? 15.367  -25.302 -46.631 1.00 0.00 ? 151 GLN A H    4 
ATOM 10015 H HA   . GLN A 1 88 ? 15.761  -25.924 -49.351 1.00 0.00 ? 151 GLN A HA   4 
ATOM 10016 H HB2  . GLN A 1 88 ? 14.753  -23.846 -48.518 1.00 0.00 ? 151 GLN A HB2  4 
ATOM 10017 H HB3  . GLN A 1 88 ? 16.337  -23.303 -47.939 1.00 0.00 ? 151 GLN A HB3  4 
ATOM 10018 H HG2  . GLN A 1 88 ? 15.843  -22.211 -50.033 1.00 0.00 ? 151 GLN A HG2  4 
ATOM 10019 H HG3  . GLN A 1 88 ? 17.151  -23.377 -50.295 1.00 0.00 ? 151 GLN A HG3  4 
ATOM 10020 H HE21 . GLN A 1 88 ? 16.967  -24.233 -52.280 1.00 0.00 ? 151 GLN A HE21 4 
ATOM 10021 H HE22 . GLN A 1 88 ? 15.454  -24.802 -52.992 1.00 0.00 ? 151 GLN A HE22 4 
ATOM 10022 N N    . VAL A 1 89 ? 18.554  -25.256 -47.767 1.00 0.00 ? 152 VAL A N    4 
ATOM 10023 C CA   . VAL A 1 89 ? 20.001  -25.421 -47.840 1.00 0.00 ? 152 VAL A CA   4 
ATOM 10024 C C    . VAL A 1 89 ? 20.372  -26.618 -48.708 1.00 0.00 ? 152 VAL A C    4 
ATOM 10025 O O    . VAL A 1 89 ? 19.739  -27.651 -48.554 1.00 0.00 ? 152 VAL A O    4 
ATOM 10026 C CB   . VAL A 1 89 ? 20.589  -25.608 -46.431 1.00 0.00 ? 152 VAL A CB   4 
ATOM 10027 C CG1  . VAL A 1 89 ? 20.065  -26.889 -45.800 1.00 0.00 ? 152 VAL A CG1  4 
ATOM 10028 C CG2  . VAL A 1 89 ? 22.108  -25.627 -46.504 1.00 0.00 ? 152 VAL A CG2  4 
ATOM 10029 O OXT  . VAL A 1 89 ? 21.206  -26.455 -49.585 1.00 0.00 ? 152 VAL A OXT  4 
ATOM 10030 H H    . VAL A 1 89 ? 18.124  -25.059 -46.863 1.00 0.00 ? 152 VAL A H    4 
ATOM 10031 H HA   . VAL A 1 89 ? 20.424  -24.520 -48.281 1.00 0.00 ? 152 VAL A HA   4 
ATOM 10032 H HB   . VAL A 1 89 ? 20.266  -24.784 -45.825 1.00 0.00 ? 152 VAL A HB   4 
ATOM 10033 H HG11 . VAL A 1 89 ? 20.320  -26.904 -44.741 1.00 0.00 ? 152 VAL A HG11 4 
ATOM 10034 H HG12 . VAL A 1 89 ? 20.518  -27.746 -46.295 1.00 0.00 ? 152 VAL A HG12 4 
ATOM 10035 H HG13 . VAL A 1 89 ? 18.982  -26.936 -45.911 1.00 0.00 ? 152 VAL A HG13 4 
ATOM 10036 H HG21 . VAL A 1 89 ? 22.446  -26.281 -47.305 1.00 0.00 ? 152 VAL A HG21 4 
ATOM 10037 H HG22 . VAL A 1 89 ? 22.475  -24.617 -46.685 1.00 0.00 ? 152 VAL A HG22 4 
ATOM 10038 H HG23 . VAL A 1 89 ? 22.510  -25.990 -45.559 1.00 0.00 ? 152 VAL A HG23 4 
ATOM 10039 N N    . GLY B 1 1  ? 7.265   16.916  -47.822 1.00 0.00 ? 64  GLY B N    4 
ATOM 10040 C CA   . GLY B 1 1  ? 6.163   16.937  -46.867 1.00 0.00 ? 64  GLY B CA   4 
ATOM 10041 C C    . GLY B 1 1  ? 5.374   15.636  -46.909 1.00 0.00 ? 64  GLY B C    4 
ATOM 10042 O O    . GLY B 1 1  ? 5.295   14.977  -47.946 1.00 0.00 ? 64  GLY B O    4 
ATOM 10043 H H1   . GLY B 1 1  ? 7.973   17.575  -47.533 1.00 0.00 ? 64  GLY B H1   4 
ATOM 10044 H H2   . GLY B 1 1  ? 7.675   15.961  -47.858 1.00 0.00 ? 64  GLY B H2   4 
ATOM 10045 H H3   . GLY B 1 1  ? 6.913   17.177  -48.765 1.00 0.00 ? 64  GLY B H3   4 
ATOM 10046 H HA2  . GLY B 1 1  ? 6.564   17.081  -45.863 1.00 0.00 ? 64  GLY B HA2  4 
ATOM 10047 H HA3  . GLY B 1 1  ? 5.497   17.765  -47.107 1.00 0.00 ? 64  GLY B HA3  4 
ATOM 10048 N N    . LEU B 1 2  ? 4.789   15.268  -45.771 1.00 0.00 ? 65  LEU B N    4 
ATOM 10049 C CA   . LEU B 1 2  ? 4.004   14.043  -45.677 1.00 0.00 ? 65  LEU B CA   4 
ATOM 10050 C C    . LEU B 1 2  ? 2.539   14.300  -46.005 1.00 0.00 ? 65  LEU B C    4 
ATOM 10051 O O    . LEU B 1 2  ? 1.775   13.368  -46.248 1.00 0.00 ? 65  LEU B O    4 
ATOM 10052 C CB   . LEU B 1 2  ? 4.122   13.448  -44.268 1.00 0.00 ? 65  LEU B CB   4 
ATOM 10053 C CG   . LEU B 1 2  ? 5.534   13.034  -43.836 1.00 0.00 ? 65  LEU B CG   4 
ATOM 10054 C CD1  . LEU B 1 2  ? 5.496   12.505  -42.408 1.00 0.00 ? 65  LEU B CD1  4 
ATOM 10055 C CD2  . LEU B 1 2  ? 6.072   11.981  -44.795 1.00 0.00 ? 65  LEU B CD2  4 
ATOM 10056 H H    . LEU B 1 2  ? 4.895   15.854  -44.944 1.00 0.00 ? 65  LEU B H    4 
ATOM 10057 H HA   . LEU B 1 2  ? 4.397   13.309  -46.380 1.00 0.00 ? 65  LEU B HA   4 
ATOM 10058 H HB2  . LEU B 1 2  ? 3.751   14.182  -43.557 1.00 0.00 ? 65  LEU B HB2  4 
ATOM 10059 H HB3  . LEU B 1 2  ? 3.495   12.592  -44.234 1.00 0.00 ? 65  LEU B HB3  4 
ATOM 10060 H HG   . LEU B 1 2  ? 6.180   13.915  -43.864 1.00 0.00 ? 65  LEU B HG   4 
ATOM 10061 H HD11 . LEU B 1 2  ? 5.013   13.236  -41.758 1.00 0.00 ? 65  LEU B HD11 4 
ATOM 10062 H HD12 . LEU B 1 2  ? 6.513   12.325  -42.060 1.00 0.00 ? 65  LEU B HD12 4 
ATOM 10063 H HD13 . LEU B 1 2  ? 4.933   11.571  -42.387 1.00 0.00 ? 65  LEU B HD13 4 
ATOM 10064 H HD21 . LEU B 1 2  ? 5.278   11.320  -45.123 1.00 0.00 ? 65  LEU B HD21 4 
ATOM 10065 H HD22 . LEU B 1 2  ? 6.847   11.394  -44.297 1.00 0.00 ? 65  LEU B HD22 4 
ATOM 10066 H HD23 . LEU B 1 2  ? 6.507   12.472  -45.666 1.00 0.00 ? 65  LEU B HD23 4 
ATOM 10067 N N    . SER B 1 3  ? 2.154   15.572  -46.010 1.00 0.00 ? 66  SER B N    4 
ATOM 10068 C CA   . SER B 1 3  ? 0.780   15.954  -46.310 1.00 0.00 ? 66  SER B CA   4 
ATOM 10069 C C    . SER B 1 3  ? 0.494   15.855  -47.803 1.00 0.00 ? 66  SER B C    4 
ATOM 10070 O O    . SER B 1 3  ? 1.413   15.849  -48.621 1.00 0.00 ? 66  SER B O    4 
ATOM 10071 C CB   . SER B 1 3  ? 0.514   17.367  -45.827 1.00 0.00 ? 66  SER B CB   4 
ATOM 10072 O OG   . SER B 1 3  ? 1.260   18.299  -46.563 1.00 0.00 ? 66  SER B OG   4 
ATOM 10073 H H    . SER B 1 3  ? 2.836   16.301  -45.799 1.00 0.00 ? 66  SER B H    4 
ATOM 10074 H HA   . SER B 1 3  ? 0.109   15.276  -45.784 1.00 0.00 ? 66  SER B HA   4 
ATOM 10075 H HB2  . SER B 1 3  ? -0.539  17.597  -45.944 1.00 0.00 ? 66  SER B HB2  4 
ATOM 10076 H HB3  . SER B 1 3  ? 0.779   17.437  -44.769 1.00 0.00 ? 66  SER B HB3  4 
ATOM 10077 H HG   . SER B 1 3  ? 2.184   18.055  -46.493 1.00 0.00 ? 66  SER B HG   4 
ATOM 10078 N N    . GLU B 1 4  ? -0.787  15.782  -48.152 1.00 0.00 ? 67  GLU B N    4 
ATOM 10079 C CA   . GLU B 1 4  ? -1.195  15.666  -49.547 1.00 0.00 ? 67  GLU B CA   4 
ATOM 10080 C C    . GLU B 1 4  ? -2.151  16.788  -49.934 1.00 0.00 ? 67  GLU B C    4 
ATOM 10081 O O    . GLU B 1 4  ? -2.487  16.950  -51.108 1.00 0.00 ? 67  GLU B O    4 
ATOM 10082 C CB   . GLU B 1 4  ? -1.854  14.309  -49.799 1.00 0.00 ? 67  GLU B CB   4 
ATOM 10083 C CG   . GLU B 1 4  ? -0.964  13.112  -49.501 1.00 0.00 ? 67  GLU B CG   4 
ATOM 10084 C CD   . GLU B 1 4  ? 0.250   13.049  -50.386 1.00 0.00 ? 67  GLU B CD   4 
ATOM 10085 O OE1  . GLU B 1 4  ? 0.210   13.611  -51.453 1.00 0.00 ? 67  GLU B OE1  4 
ATOM 10086 O OE2  . GLU B 1 4  ? 1.216   12.440  -49.994 1.00 0.00 ? 67  GLU B OE2  4 
ATOM 10087 H H    . GLU B 1 4  ? -1.503  15.789  -47.424 1.00 0.00 ? 67  GLU B H    4 
ATOM 10088 H HA   . GLU B 1 4  ? -0.318  15.737  -50.196 1.00 0.00 ? 67  GLU B HA   4 
ATOM 10089 H HB2  . GLU B 1 4  ? -2.752  14.245  -49.184 1.00 0.00 ? 67  GLU B HB2  4 
ATOM 10090 H HB3  . GLU B 1 4  ? -2.146  14.257  -50.847 1.00 0.00 ? 67  GLU B HB3  4 
ATOM 10091 H HG2  . GLU B 1 4  ? -0.631  13.186  -48.467 1.00 0.00 ? 67  GLU B HG2  4 
ATOM 10092 H HG3  . GLU B 1 4  ? -1.541  12.194  -49.620 1.00 0.00 ? 67  GLU B HG3  4 
ATOM 10093 N N    . MET B 1 5  ? -2.587  17.556  -48.943 1.00 0.00 ? 68  MET B N    4 
ATOM 10094 C CA   . MET B 1 5  ? -3.465  18.693  -49.186 1.00 0.00 ? 68  MET B CA   4 
ATOM 10095 C C    . MET B 1 5  ? -2.708  19.846  -49.831 1.00 0.00 ? 68  MET B C    4 
ATOM 10096 O O    . MET B 1 5  ? -1.712  20.327  -49.292 1.00 0.00 ? 68  MET B O    4 
ATOM 10097 C CB   . MET B 1 5  ? -4.114  19.148  -47.879 1.00 0.00 ? 68  MET B CB   4 
ATOM 10098 C CG   . MET B 1 5  ? -5.141  20.260  -48.040 1.00 0.00 ? 68  MET B CG   4 
ATOM 10099 S SD   . MET B 1 5  ? -5.907  20.730  -46.476 1.00 0.00 ? 68  MET B SD   4 
ATOM 10100 C CE   . MET B 1 5  ? -6.998  19.337  -46.203 1.00 0.00 ? 68  MET B CE   4 
ATOM 10101 H H    . MET B 1 5  ? -2.262  17.375  -47.993 1.00 0.00 ? 68  MET B H    4 
ATOM 10102 H HA   . MET B 1 5  ? -4.249  18.397  -49.862 1.00 0.00 ? 68  MET B HA   4 
ATOM 10103 H HB2  . MET B 1 5  ? -4.552  18.299  -47.373 1.00 0.00 ? 68  MET B HB2  4 
ATOM 10104 H HB3  . MET B 1 5  ? -3.315  19.542  -47.248 1.00 0.00 ? 68  MET B HB3  4 
ATOM 10105 H HG2  . MET B 1 5  ? -4.663  21.130  -48.488 1.00 0.00 ? 68  MET B HG2  4 
ATOM 10106 H HG3  . MET B 1 5  ? -5.916  19.885  -48.707 1.00 0.00 ? 68  MET B HG3  4 
ATOM 10107 H HE1  . MET B 1 5  ? -6.908  18.992  -45.174 1.00 0.00 ? 68  MET B HE1  4 
ATOM 10108 H HE2  . MET B 1 5  ? -6.745  18.527  -46.879 1.00 0.00 ? 68  MET B HE2  4 
ATOM 10109 H HE3  . MET B 1 5  ? -8.024  19.649  -46.393 1.00 0.00 ? 68  MET B HE3  4 
ATOM 10110 N N    . ARG B 1 6  ? -3.186  20.288  -50.991 1.00 0.00 ? 69  ARG B N    4 
ATOM 10111 C CA   . ARG B 1 6  ? -2.621  21.452  -51.660 1.00 0.00 ? 69  ARG B CA   4 
ATOM 10112 C C    . ARG B 1 6  ? -3.676  22.528  -51.880 1.00 0.00 ? 69  ARG B C    4 
ATOM 10113 O O    . ARG B 1 6  ? -4.634  22.327  -52.626 1.00 0.00 ? 69  ARG B O    4 
ATOM 10114 C CB   . ARG B 1 6  ? -2.015  21.058  -52.999 1.00 0.00 ? 69  ARG B CB   4 
ATOM 10115 C CG   . ARG B 1 6  ? -1.505  22.221  -53.837 1.00 0.00 ? 69  ARG B CG   4 
ATOM 10116 C CD   . ARG B 1 6  ? -0.933  21.758  -55.127 1.00 0.00 ? 69  ARG B CD   4 
ATOM 10117 N NE   . ARG B 1 6  ? -0.472  22.868  -55.945 1.00 0.00 ? 69  ARG B NE   4 
ATOM 10118 C CZ   . ARG B 1 6  ? 0.084   22.742  -57.166 1.00 0.00 ? 69  ARG B CZ   4 
ATOM 10119 N NH1  . ARG B 1 6  ? 0.243   21.548  -57.695 1.00 0.00 ? 69  ARG B NH1  4 
ATOM 10120 N NH2  . ARG B 1 6  ? 0.470   23.814  -57.831 1.00 0.00 ? 69  ARG B NH2  4 
ATOM 10121 H H    . ARG B 1 6  ? -4.027  19.856  -51.376 1.00 0.00 ? 69  ARG B H    4 
ATOM 10122 H HA   . ARG B 1 6  ? -1.825  21.883  -51.046 1.00 0.00 ? 69  ARG B HA   4 
ATOM 10123 H HB2  . ARG B 1 6  ? -1.183  20.379  -52.819 1.00 0.00 ? 69  ARG B HB2  4 
ATOM 10124 H HB3  . ARG B 1 6  ? -2.778  20.531  -53.573 1.00 0.00 ? 69  ARG B HB3  4 
ATOM 10125 H HG2  . ARG B 1 6  ? -2.329  22.903  -54.050 1.00 0.00 ? 69  ARG B HG2  4 
ATOM 10126 H HG3  . ARG B 1 6  ? -0.735  22.748  -53.277 1.00 0.00 ? 69  ARG B HG3  4 
ATOM 10127 H HD2  . ARG B 1 6  ? -0.088  21.098  -54.924 1.00 0.00 ? 69  ARG B HD2  4 
ATOM 10128 H HD3  . ARG B 1 6  ? -1.696  21.207  -55.675 1.00 0.00 ? 69  ARG B HD3  4 
ATOM 10129 H HE   . ARG B 1 6  ? -0.575  23.772  -55.584 1.00 0.00 ? 69  ARG B HE   4 
ATOM 10130 H HH11 . ARG B 1 6  ? -0.050  20.733  -57.193 1.00 0.00 ? 69  ARG B HH11 4 
ATOM 10131 H HH12 . ARG B 1 6  ? 0.660   21.453  -58.609 1.00 0.00 ? 69  ARG B HH12 4 
ATOM 10132 H HH21 . ARG B 1 6  ? 0.352   24.724  -57.432 1.00 0.00 ? 69  ARG B HH21 4 
ATOM 10133 H HH22 . ARG B 1 6  ? 0.883   23.716  -58.738 1.00 0.00 ? 69  ARG B HH22 4 
ATOM 10134 N N    . LEU B 1 7  ? -3.495  23.671  -51.226 1.00 0.00 ? 70  LEU B N    4 
ATOM 10135 C CA   . LEU B 1 7  ? -4.417  24.788  -51.371 1.00 0.00 ? 70  LEU B CA   4 
ATOM 10136 C C    . LEU B 1 7  ? -4.173  25.540  -52.673 1.00 0.00 ? 70  LEU B C    4 
ATOM 10137 O O    . LEU B 1 7  ? -3.196  26.277  -52.802 1.00 0.00 ? 70  LEU B O    4 
ATOM 10138 C CB   . LEU B 1 7  ? -4.274  25.751  -50.183 1.00 0.00 ? 70  LEU B CB   4 
ATOM 10139 C CG   . LEU B 1 7  ? -5.191  26.980  -50.207 1.00 0.00 ? 70  LEU B CG   4 
ATOM 10140 C CD1  . LEU B 1 7  ? -6.644  26.527  -50.128 1.00 0.00 ? 70  LEU B CD1  4 
ATOM 10141 C CD2  . LEU B 1 7  ? -4.841  27.898  -49.046 1.00 0.00 ? 70  LEU B CD2  4 
ATOM 10142 H H    . LEU B 1 7  ? -2.674  23.777  -50.632 1.00 0.00 ? 70  LEU B H    4 
ATOM 10143 H HA   . LEU B 1 7  ? -5.425  24.422  -51.369 1.00 0.00 ? 70  LEU B HA   4 
ATOM 10144 H HB2  . LEU B 1 7  ? -4.475  25.200  -49.267 1.00 0.00 ? 70  LEU B HB2  4 
ATOM 10145 H HB3  . LEU B 1 7  ? -3.239  26.100  -50.155 1.00 0.00 ? 70  LEU B HB3  4 
ATOM 10146 H HG   . LEU B 1 7  ? -5.033  27.515  -51.140 1.00 0.00 ? 70  LEU B HG   4 
ATOM 10147 H HD11 . LEU B 1 7  ? -7.269  27.373  -49.835 1.00 0.00 ? 70  LEU B HD11 4 
ATOM 10148 H HD12 . LEU B 1 7  ? -6.748  25.731  -49.393 1.00 0.00 ? 70  LEU B HD12 4 
ATOM 10149 H HD13 . LEU B 1 7  ? -6.969  26.168  -51.098 1.00 0.00 ? 70  LEU B HD13 4 
ATOM 10150 H HD21 . LEU B 1 7  ? -5.498  28.766  -49.064 1.00 0.00 ? 70  LEU B HD21 4 
ATOM 10151 H HD22 . LEU B 1 7  ? -3.805  28.223  -49.133 1.00 0.00 ? 70  LEU B HD22 4 
ATOM 10152 H HD23 . LEU B 1 7  ? -4.978  27.361  -48.109 1.00 0.00 ? 70  LEU B HD23 4 
ATOM 10153 N N    . GLU B 1 8  ? -5.066  25.350  -53.637 1.00 0.00 ? 71  GLU B N    4 
ATOM 10154 C CA   . GLU B 1 8  ? -5.116  26.204  -54.817 1.00 0.00 ? 71  GLU B CA   4 
ATOM 10155 C C    . GLU B 1 8  ? -5.629  27.595  -54.470 1.00 0.00 ? 71  GLU B C    4 
ATOM 10156 O O    . GLU B 1 8  ? -5.898  27.895  -53.306 1.00 0.00 ? 71  GLU B O    4 
ATOM 10157 C CB   . GLU B 1 8  ? -6.004  25.577  -55.893 1.00 0.00 ? 71  GLU B CB   4 
ATOM 10158 C CG   . GLU B 1 8  ? -5.517  24.226  -56.402 1.00 0.00 ? 71  GLU B CG   4 
ATOM 10159 C CD   . GLU B 1 8  ? -4.227  24.320  -57.165 1.00 0.00 ? 71  GLU B CD   4 
ATOM 10160 O OE1  . GLU B 1 8  ? -3.981  25.343  -57.759 1.00 0.00 ? 71  GLU B OE1  4 
ATOM 10161 O OE2  . GLU B 1 8  ? -3.483  23.368  -57.155 1.00 0.00 ? 71  GLU B OE2  4 
ATOM 10162 H H    . GLU B 1 8  ? -5.859  24.753  -53.441 1.00 0.00 ? 71  GLU B H    4 
ATOM 10163 H HA   . GLU B 1 8  ? -4.099  26.282  -55.204 1.00 0.00 ? 71  GLU B HA   4 
ATOM 10164 H HB2  . GLU B 1 8  ? -7.007  25.462  -55.479 1.00 0.00 ? 71  GLU B HB2  4 
ATOM 10165 H HB3  . GLU B 1 8  ? -6.049  26.261  -56.741 1.00 0.00 ? 71  GLU B HB3  4 
ATOM 10166 H HG2  . GLU B 1 8  ? -5.364  23.574  -55.544 1.00 0.00 ? 71  GLU B HG2  4 
ATOM 10167 H HG3  . GLU B 1 8  ? -6.280  23.787  -57.047 1.00 0.00 ? 71  GLU B HG3  4 
ATOM 10168 N N    . LYS B 1 9  ? -5.761  28.443  -55.486 1.00 0.00 ? 72  LYS B N    4 
ATOM 10169 C CA   . LYS B 1 9  ? -6.167  29.827  -55.280 1.00 0.00 ? 72  LYS B CA   4 
ATOM 10170 C C    . LYS B 1 9  ? -7.014  29.971  -54.022 1.00 0.00 ? 72  LYS B C    4 
ATOM 10171 O O    . LYS B 1 9  ? -6.637  30.678  -53.087 1.00 0.00 ? 72  LYS B O    4 
ATOM 10172 C CB   . LYS B 1 9  ? -6.939  30.346  -56.494 1.00 0.00 ? 72  LYS B CB   4 
ATOM 10173 C CG   . LYS B 1 9  ? -7.379  31.800  -56.387 1.00 0.00 ? 72  LYS B CG   4 
ATOM 10174 C CD   . LYS B 1 9  ? -8.092  32.256  -57.651 1.00 0.00 ? 72  LYS B CD   4 
ATOM 10175 C CE   . LYS B 1 9  ? -8.566  33.696  -57.531 1.00 0.00 ? 72  LYS B CE   4 
ATOM 10176 N NZ   . LYS B 1 9  ? -9.268  34.157  -58.760 1.00 0.00 ? 72  LYS B NZ   4 
ATOM 10177 H H    . LYS B 1 9  ? -5.508  28.137  -56.425 1.00 0.00 ? 72  LYS B H    4 
ATOM 10178 H HA   . LYS B 1 9  ? -5.278  30.443  -55.163 1.00 0.00 ? 72  LYS B HA   4 
ATOM 10179 H HB2  . LYS B 1 9  ? -6.306  30.243  -57.374 1.00 0.00 ? 72  LYS B HB2  4 
ATOM 10180 H HB3  . LYS B 1 9  ? -7.826  29.728  -56.627 1.00 0.00 ? 72  LYS B HB3  4 
ATOM 10181 H HG2  . LYS B 1 9  ? -8.054  31.905  -55.536 1.00 0.00 ? 72  LYS B HG2  4 
ATOM 10182 H HG3  . LYS B 1 9  ? -6.499  32.422  -56.229 1.00 0.00 ? 72  LYS B HG3  4 
ATOM 10183 H HD2  . LYS B 1 9  ? -7.405  32.178  -58.495 1.00 0.00 ? 72  LYS B HD2  4 
ATOM 10184 H HD3  . LYS B 1 9  ? -8.954  31.611  -57.826 1.00 0.00 ? 72  LYS B HD3  4 
ATOM 10185 H HE2  . LYS B 1 9  ? -9.248  33.774  -56.685 1.00 0.00 ? 72  LYS B HE2  4 
ATOM 10186 H HE3  . LYS B 1 9  ? -7.703  34.338  -57.351 1.00 0.00 ? 72  LYS B HE3  4 
ATOM 10187 H HZ1  . LYS B 1 9  ? -8.567  34.386  -59.492 1.00 0.00 ? 72  LYS B HZ1  4 
ATOM 10188 H HZ2  . LYS B 1 9  ? -9.836  35.002  -58.547 1.00 0.00 ? 72  LYS B HZ2  4 
ATOM 10189 H HZ3  . LYS B 1 9  ? -9.874  33.422  -59.096 1.00 0.00 ? 72  LYS B HZ3  4 
ATOM 10190 N N    . ASP B 1 10 ? -8.161  29.299  -54.006 1.00 0.00 ? 73  ASP B N    4 
ATOM 10191 C CA   . ASP B 1 10 ? -9.087  29.393  -52.885 1.00 0.00 ? 73  ASP B CA   4 
ATOM 10192 C C    . ASP B 1 10 ? -9.780  28.062  -52.628 1.00 0.00 ? 73  ASP B C    4 
ATOM 10193 O O    . ASP B 1 10 ? -10.990 28.011  -52.416 1.00 0.00 ? 73  ASP B O    4 
ATOM 10194 C CB   . ASP B 1 10 ? -10.135 30.478  -53.147 1.00 0.00 ? 73  ASP B CB   4 
ATOM 10195 C CG   . ASP B 1 10 ? -11.018 30.172  -54.350 1.00 0.00 ? 73  ASP B CG   4 
ATOM 10196 O OD1  . ASP B 1 10 ? -10.811 29.154  -54.969 1.00 0.00 ? 73  ASP B OD1  4 
ATOM 10197 O OD2  . ASP B 1 10 ? -11.887 30.958  -54.639 1.00 0.00 ? 73  ASP B OD2  4 
ATOM 10198 H H    . ASP B 1 10 ? -8.416  28.735  -54.815 1.00 0.00 ? 73  ASP B H    4 
ATOM 10199 H HA   . ASP B 1 10 ? -8.524  29.647  -52.003 1.00 0.00 ? 73  ASP B HA   4 
ATOM 10200 H HB2  . ASP B 1 10 ? -10.766 30.584  -52.267 1.00 0.00 ? 73  ASP B HB2  4 
ATOM 10201 H HB3  . ASP B 1 10 ? -9.620  31.419  -53.328 1.00 0.00 ? 73  ASP B HB3  4 
ATOM 10202 N N    . ARG B 1 11 ? -9.003  26.984  -52.650 1.00 0.00 ? 74  ARG B N    4 
ATOM 10203 C CA   . ARG B 1 11 ? -9.547  25.644  -52.461 1.00 0.00 ? 74  ARG B CA   4 
ATOM 10204 C C    . ARG B 1 11 ? -8.445  24.592  -52.496 1.00 0.00 ? 74  ARG B C    4 
ATOM 10205 O O    . ARG B 1 11 ? -7.480  24.717  -53.248 1.00 0.00 ? 74  ARG B O    4 
ATOM 10206 C CB   . ARG B 1 11 ? -10.580 25.328  -53.531 1.00 0.00 ? 74  ARG B CB   4 
ATOM 10207 C CG   . ARG B 1 11 ? -10.038 25.293  -54.951 1.00 0.00 ? 74  ARG B CG   4 
ATOM 10208 C CD   . ARG B 1 11 ? -11.131 25.241  -55.955 1.00 0.00 ? 74  ARG B CD   4 
ATOM 10209 N NE   . ARG B 1 11 ? -11.868 26.492  -56.022 1.00 0.00 ? 74  ARG B NE   4 
ATOM 10210 C CZ   . ARG B 1 11 ? -13.063 26.645  -56.625 1.00 0.00 ? 74  ARG B CZ   4 
ATOM 10211 N NH1  . ARG B 1 11 ? -13.642 25.620  -57.207 1.00 0.00 ? 74  ARG B NH1  4 
ATOM 10212 N NH2  . ARG B 1 11 ? -13.653 27.828  -56.630 1.00 0.00 ? 74  ARG B NH2  4 
ATOM 10213 H H    . ARG B 1 11 ? -8.007  27.097  -52.838 1.00 0.00 ? 74  ARG B H    4 
ATOM 10214 H HA   . ARG B 1 11 ? -9.994  25.615  -51.483 1.00 0.00 ? 74  ARG B HA   4 
ATOM 10215 H HB2  . ARG B 1 11 ? -10.992 24.342  -53.320 1.00 0.00 ? 74  ARG B HB2  4 
ATOM 10216 H HB3  . ARG B 1 11 ? -11.383 26.057  -53.481 1.00 0.00 ? 74  ARG B HB3  4 
ATOM 10217 H HG2  . ARG B 1 11 ? -9.459  26.201  -55.117 1.00 0.00 ? 74  ARG B HG2  4 
ATOM 10218 H HG3  . ARG B 1 11 ? -9.389  24.426  -55.067 1.00 0.00 ? 74  ARG B HG3  4 
ATOM 10219 H HD2  . ARG B 1 11 ? -10.709 25.026  -56.938 1.00 0.00 ? 74  ARG B HD2  4 
ATOM 10220 H HD3  . ARG B 1 11 ? -11.820 24.441  -55.678 1.00 0.00 ? 74  ARG B HD3  4 
ATOM 10221 H HE   . ARG B 1 11 ? -11.467 27.277  -55.597 1.00 0.00 ? 74  ARG B HE   4 
ATOM 10222 H HH11 . ARG B 1 11 ? -13.197 24.723  -57.203 1.00 0.00 ? 74  ARG B HH11 4 
ATOM 10223 H HH12 . ARG B 1 11 ? -14.537 25.737  -57.660 1.00 0.00 ? 74  ARG B HH12 4 
ATOM 10224 H HH21 . ARG B 1 11 ? -13.215 28.611  -56.187 1.00 0.00 ? 74  ARG B HH21 4 
ATOM 10225 H HH22 . ARG B 1 11 ? -14.540 27.940  -57.077 1.00 0.00 ? 74  ARG B HH22 4 
ATOM 10226 N N    . PHE B 1 12 ? -8.597  23.557  -51.678 1.00 0.00 ? 75  PHE B N    4 
ATOM 10227 C CA   . PHE B 1 12 ? -7.546  22.559  -51.503 1.00 0.00 ? 75  PHE B CA   4 
ATOM 10228 C C    . PHE B 1 12 ? -7.930  21.237  -52.157 1.00 0.00 ? 75  PHE B C    4 
ATOM 10229 O O    . PHE B 1 12 ? -9.111  20.941  -52.335 1.00 0.00 ? 75  PHE B O    4 
ATOM 10230 C CB   . PHE B 1 12 ? -7.264  22.335  -50.016 1.00 0.00 ? 75  PHE B CB   4 
ATOM 10231 C CG   . PHE B 1 12 ? -8.388  21.664  -49.281 1.00 0.00 ? 75  PHE B CG   4 
ATOM 10232 C CD1  . PHE B 1 12 ? -8.672  20.322  -49.492 1.00 0.00 ? 75  PHE B CD1  4 
ATOM 10233 C CD2  . PHE B 1 12 ? -9.164  22.371  -48.374 1.00 0.00 ? 75  PHE B CD2  4 
ATOM 10234 C CE1  . PHE B 1 12 ? -9.705  19.703  -48.817 1.00 0.00 ? 75  PHE B CE1  4 
ATOM 10235 C CE2  . PHE B 1 12 ? -10.198 21.754  -47.695 1.00 0.00 ? 75  PHE B CE2  4 
ATOM 10236 C CZ   . PHE B 1 12 ? -10.468 20.419  -47.918 1.00 0.00 ? 75  PHE B CZ   4 
ATOM 10237 H H    . PHE B 1 12 ? -9.410  23.528  -51.063 1.00 0.00 ? 75  PHE B H    4 
ATOM 10238 H HA   . PHE B 1 12 ? -6.656  22.893  -51.983 1.00 0.00 ? 75  PHE B HA   4 
ATOM 10239 H HB2  . PHE B 1 12 ? -6.380  21.723  -49.941 1.00 0.00 ? 75  PHE B HB2  4 
ATOM 10240 H HB3  . PHE B 1 12 ? -7.057  23.305  -49.560 1.00 0.00 ? 75  PHE B HB3  4 
ATOM 10241 H HD1  . PHE B 1 12 ? -8.073  19.742  -50.174 1.00 0.00 ? 75  PHE B HD1  4 
ATOM 10242 H HD2  . PHE B 1 12 ? -8.961  23.402  -48.218 1.00 0.00 ? 75  PHE B HD2  4 
ATOM 10243 H HE1  . PHE B 1 12 ? -9.914  18.657  -48.987 1.00 0.00 ? 75  PHE B HE1  4 
ATOM 10244 H HE2  . PHE B 1 12 ? -10.784 22.311  -46.987 1.00 0.00 ? 75  PHE B HE2  4 
ATOM 10245 H HZ   . PHE B 1 12 ? -11.392 19.996  -47.559 1.00 0.00 ? 75  PHE B HZ   4 
ATOM 10246 N N    . SER B 1 13 ? -6.923  20.446  -52.511 1.00 0.00 ? 76  SER B N    4 
ATOM 10247 C CA   . SER B 1 13 ? -7.153  19.101  -53.029 1.00 0.00 ? 76  SER B CA   4 
ATOM 10248 C C    . SER B 1 13 ? -6.158  18.109  -52.444 1.00 0.00 ? 76  SER B C    4 
ATOM 10249 O O    . SER B 1 13 ? -4.945  18.313  -52.517 1.00 0.00 ? 76  SER B O    4 
ATOM 10250 C CB   . SER B 1 13 ? -7.050  19.101  -54.542 1.00 0.00 ? 76  SER B CB   4 
ATOM 10251 O OG   . SER B 1 13 ? -7.182  17.804  -55.056 1.00 0.00 ? 76  SER B OG   4 
ATOM 10252 H H    . SER B 1 13 ? -5.969  20.747  -52.315 1.00 0.00 ? 76  SER B H    4 
ATOM 10253 H HA   . SER B 1 13 ? -8.140  18.774  -52.750 1.00 0.00 ? 76  SER B HA   4 
ATOM 10254 H HB2  . SER B 1 13 ? -7.837  19.726  -54.955 1.00 0.00 ? 76  SER B HB2  4 
ATOM 10255 H HB3  . SER B 1 13 ? -6.078  19.512  -54.830 1.00 0.00 ? 76  SER B HB3  4 
ATOM 10256 H HG   . SER B 1 13 ? -8.119  17.617  -55.144 1.00 0.00 ? 76  SER B HG   4 
ATOM 10257 N N    . VAL B 1 14 ? -6.675  17.032  -51.861 1.00 0.00 ? 77  VAL B N    4 
ATOM 10258 C CA   . VAL B 1 14 ? -5.842  16.067  -51.157 1.00 0.00 ? 77  VAL B CA   4 
ATOM 10259 C C    . VAL B 1 14 ? -5.537  14.859  -52.035 1.00 0.00 ? 77  VAL B C    4 
ATOM 10260 O O    . VAL B 1 14 ? -6.418  14.049  -52.320 1.00 0.00 ? 77  VAL B O    4 
ATOM 10261 C CB   . VAL B 1 14 ? -6.541  15.596  -49.867 1.00 0.00 ? 77  VAL B CB   4 
ATOM 10262 C CG1  . VAL B 1 14 ? -5.675  14.585  -49.131 1.00 0.00 ? 77  VAL B CG1  4 
ATOM 10263 C CG2  . VAL B 1 14 ? -6.847  16.793  -48.979 1.00 0.00 ? 77  VAL B CG2  4 
ATOM 10264 H H    . VAL B 1 14 ? -7.687  16.935  -51.819 1.00 0.00 ? 77  VAL B H    4 
ATOM 10265 H HA   . VAL B 1 14 ? -4.896  16.518  -50.879 1.00 0.00 ? 77  VAL B HA   4 
ATOM 10266 H HB   . VAL B 1 14 ? -7.477  15.110  -50.141 1.00 0.00 ? 77  VAL B HB   4 
ATOM 10267 H HG11 . VAL B 1 14 ? -6.291  14.045  -48.409 1.00 0.00 ? 77  VAL B HG11 4 
ATOM 10268 H HG12 . VAL B 1 14 ? -4.889  15.122  -48.596 1.00 0.00 ? 77  VAL B HG12 4 
ATOM 10269 H HG13 . VAL B 1 14 ? -5.216  13.879  -49.809 1.00 0.00 ? 77  VAL B HG13 4 
ATOM 10270 H HG21 . VAL B 1 14 ? -7.281  16.447  -48.042 1.00 0.00 ? 77  VAL B HG21 4 
ATOM 10271 H HG22 . VAL B 1 14 ? -7.553  17.452  -49.486 1.00 0.00 ? 77  VAL B HG22 4 
ATOM 10272 H HG23 . VAL B 1 14 ? -5.937  17.327  -48.779 1.00 0.00 ? 77  VAL B HG23 4 
ATOM 10273 N N    . ASN B 1 15 ? -4.283  14.744  -52.459 1.00 0.00 ? 78  ASN B N    4 
ATOM 10274 C CA   . ASN B 1 15 ? -3.865  13.649  -53.325 1.00 0.00 ? 78  ASN B CA   4 
ATOM 10275 C C    . ASN B 1 15 ? -3.515  12.407  -52.515 1.00 0.00 ? 78  ASN B C    4 
ATOM 10276 O O    . ASN B 1 15 ? -2.353  12.181  -52.179 1.00 0.00 ? 78  ASN B O    4 
ATOM 10277 C CB   . ASN B 1 15 ? -2.691  14.070  -54.190 1.00 0.00 ? 78  ASN B CB   4 
ATOM 10278 C CG   . ASN B 1 15 ? -2.317  13.025  -55.205 1.00 0.00 ? 78  ASN B CG   4 
ATOM 10279 O OD1  . ASN B 1 15 ? -2.904  11.936  -55.241 1.00 0.00 ? 78  ASN B OD1  4 
ATOM 10280 N ND2  . ASN B 1 15 ? -1.349  13.333  -56.032 1.00 0.00 ? 78  ASN B ND2  4 
ATOM 10281 H H    . ASN B 1 15 ? -3.597  15.449  -52.187 1.00 0.00 ? 78  ASN B H    4 
ATOM 10282 H HA   . ASN B 1 15 ? -4.690  13.397  -53.995 1.00 0.00 ? 78  ASN B HA   4 
ATOM 10283 H HB2  . ASN B 1 15 ? -2.949  14.995  -54.709 1.00 0.00 ? 78  ASN B HB2  4 
ATOM 10284 H HB3  . ASN B 1 15 ? -1.837  14.254  -53.539 1.00 0.00 ? 78  ASN B HB3  4 
ATOM 10285 H HD21 . ASN B 1 15 ? -0.887  14.240  -55.973 1.00 0.00 ? 78  ASN B HD21 4 
ATOM 10286 H HD22 . ASN B 1 15 ? -1.061  12.657  -56.740 1.00 0.00 ? 78  ASN B HD22 4 
ATOM 10287 N N    . LEU B 1 16 ? -4.527  11.606  -52.203 1.00 0.00 ? 79  LEU B N    4 
ATOM 10288 C CA   . LEU B 1 16 ? -4.358  10.470  -51.306 1.00 0.00 ? 79  LEU B CA   4 
ATOM 10289 C C    . LEU B 1 16 ? -3.697  9.298   -52.021 1.00 0.00 ? 79  LEU B C    4 
ATOM 10290 O O    . LEU B 1 16 ? -4.053  8.965   -53.150 1.00 0.00 ? 79  LEU B O    4 
ATOM 10291 C CB   . LEU B 1 16 ? -5.715  10.032  -50.742 1.00 0.00 ? 79  LEU B CB   4 
ATOM 10292 C CG   . LEU B 1 16 ? -6.430  11.060  -49.855 1.00 0.00 ? 79  LEU B CG   4 
ATOM 10293 C CD1  . LEU B 1 16 ? -7.868  10.618  -49.625 1.00 0.00 ? 79  LEU B CD1  4 
ATOM 10294 C CD2  . LEU B 1 16 ? -5.683  11.201  -48.537 1.00 0.00 ? 79  LEU B CD2  4 
ATOM 10295 H H    . LEU B 1 16 ? -5.469  11.866  -52.497 1.00 0.00 ? 79  LEU B H    4 
ATOM 10296 H HA   . LEU B 1 16 ? -3.722  10.757  -50.474 1.00 0.00 ? 79  LEU B HA   4 
ATOM 10297 H HB2  . LEU B 1 16 ? -6.366  9.796   -51.577 1.00 0.00 ? 79  LEU B HB2  4 
ATOM 10298 H HB3  . LEU B 1 16 ? -5.564  9.122   -50.161 1.00 0.00 ? 79  LEU B HB3  4 
ATOM 10299 H HG   . LEU B 1 16 ? -6.432  12.014  -50.376 1.00 0.00 ? 79  LEU B HG   4 
ATOM 10300 H HD11 . LEU B 1 16 ? -8.442  10.788  -50.519 1.00 0.00 ? 79  LEU B HD11 4 
ATOM 10301 H HD12 . LEU B 1 16 ? -8.304  11.213  -48.827 1.00 0.00 ? 79  LEU B HD12 4 
ATOM 10302 H HD13 . LEU B 1 16 ? -7.899  9.565   -49.363 1.00 0.00 ? 79  LEU B HD13 4 
ATOM 10303 H HD21 . LEU B 1 16 ? -4.762  11.761  -48.692 1.00 0.00 ? 79  LEU B HD21 4 
ATOM 10304 H HD22 . LEU B 1 16 ? -5.446  10.215  -48.136 1.00 0.00 ? 79  LEU B HD22 4 
ATOM 10305 H HD23 . LEU B 1 16 ? -6.306  11.739  -47.824 1.00 0.00 ? 79  LEU B HD23 4 
ATOM 10306 N N    . ASP B 1 17 ? -2.729  8.676   -51.354 1.00 0.00 ? 80  ASP B N    4 
ATOM 10307 C CA   . ASP B 1 17 ? -1.985  7.569   -51.941 1.00 0.00 ? 80  ASP B CA   4 
ATOM 10308 C C    . ASP B 1 17 ? -2.639  6.231   -51.616 1.00 0.00 ? 80  ASP B C    4 
ATOM 10309 O O    . ASP B 1 17 ? -2.745  5.849   -50.451 1.00 0.00 ? 80  ASP B O    4 
ATOM 10310 C CB   . ASP B 1 17 ? -0.537  7.570   -51.443 1.00 0.00 ? 80  ASP B CB   4 
ATOM 10311 C CG   . ASP B 1 17 ? 0.314   6.489   -52.095 1.00 0.00 ? 80  ASP B CG   4 
ATOM 10312 O OD1  . ASP B 1 17 ? -0.238  5.647   -52.764 1.00 0.00 ? 80  ASP B OD1  4 
ATOM 10313 O OD2  . ASP B 1 17 ? 1.507   6.512   -51.915 1.00 0.00 ? 80  ASP B OD2  4 
ATOM 10314 H H    . ASP B 1 17 ? -2.477  9.004   -50.422 1.00 0.00 ? 80  ASP B H    4 
ATOM 10315 H HA   . ASP B 1 17 ? -1.963  7.682   -53.025 1.00 0.00 ? 80  ASP B HA   4 
ATOM 10316 H HB2  . ASP B 1 17 ? -0.093  8.542   -51.656 1.00 0.00 ? 80  ASP B HB2  4 
ATOM 10317 H HB3  . ASP B 1 17 ? -0.541  7.411   -50.366 1.00 0.00 ? 80  ASP B HB3  4 
ATOM 10318 N N    . VAL B 1 18 ? -3.080  5.525   -52.652 1.00 0.00 ? 81  VAL B N    4 
ATOM 10319 C CA   . VAL B 1 18 ? -3.646  4.192   -52.486 1.00 0.00 ? 81  VAL B CA   4 
ATOM 10320 C C    . VAL B 1 18 ? -2.690  3.120   -52.990 1.00 0.00 ? 81  VAL B C    4 
ATOM 10321 O O    . VAL B 1 18 ? -2.397  3.046   -54.184 1.00 0.00 ? 81  VAL B O    4 
ATOM 10322 C CB   . VAL B 1 18 ? -4.984  4.082   -53.241 1.00 0.00 ? 81  VAL B CB   4 
ATOM 10323 C CG1  . VAL B 1 18 ? -5.545  2.673   -53.126 1.00 0.00 ? 81  VAL B CG1  4 
ATOM 10324 C CG2  . VAL B 1 18 ? -5.970  5.105   -52.702 1.00 0.00 ? 81  VAL B CG2  4 
ATOM 10325 H H    . VAL B 1 18 ? -2.948  5.892   -53.594 1.00 0.00 ? 81  VAL B H    4 
ATOM 10326 H HA   . VAL B 1 18 ? -3.846  4.006   -51.427 1.00 0.00 ? 81  VAL B HA   4 
ATOM 10327 H HB   . VAL B 1 18 ? -4.781  4.307   -54.277 1.00 0.00 ? 81  VAL B HB   4 
ATOM 10328 H HG11 . VAL B 1 18 ? -4.780  1.916   -53.227 1.00 0.00 ? 81  VAL B HG11 4 
ATOM 10329 H HG12 . VAL B 1 18 ? -6.273  2.533   -53.921 1.00 0.00 ? 81  VAL B HG12 4 
ATOM 10330 H HG13 . VAL B 1 18 ? -6.035  2.582   -52.160 1.00 0.00 ? 81  VAL B HG13 4 
ATOM 10331 H HG21 . VAL B 1 18 ? -6.125  4.927   -51.637 1.00 0.00 ? 81  VAL B HG21 4 
ATOM 10332 H HG22 . VAL B 1 18 ? -6.921  5.006   -53.226 1.00 0.00 ? 81  VAL B HG22 4 
ATOM 10333 H HG23 . VAL B 1 18 ? -5.578  6.111   -52.847 1.00 0.00 ? 81  VAL B HG23 4 
ATOM 10334 N N    . LYS B 1 19 ? -2.205  2.290   -52.074 1.00 0.00 ? 82  LYS B N    4 
ATOM 10335 C CA   . LYS B 1 19 ? -1.179  1.304   -52.400 1.00 0.00 ? 82  LYS B CA   4 
ATOM 10336 C C    . LYS B 1 19 ? -1.761  -0.103  -52.448 1.00 0.00 ? 82  LYS B C    4 
ATOM 10337 O O    . LYS B 1 19 ? -1.854  -0.781  -51.424 1.00 0.00 ? 82  LYS B O    4 
ATOM 10338 C CB   . LYS B 1 19 ? -0.036  1.366   -51.386 1.00 0.00 ? 82  LYS B CB   4 
ATOM 10339 C CG   . LYS B 1 19 ? 1.113   0.407   -51.672 1.00 0.00 ? 82  LYS B CG   4 
ATOM 10340 C CD   . LYS B 1 19 ? 2.224   0.553   -50.645 1.00 0.00 ? 82  LYS B CD   4 
ATOM 10341 C CE   . LYS B 1 19 ? 3.338   -0.455  -50.885 1.00 0.00 ? 82  LYS B CE   4 
ATOM 10342 N NZ   . LYS B 1 19 ? 4.420   -0.342  -49.871 1.00 0.00 ? 82  LYS B NZ   4 
ATOM 10343 H H    . LYS B 1 19 ? -2.479  2.410   -51.100 1.00 0.00 ? 82  LYS B H    4 
ATOM 10344 H HA   . LYS B 1 19 ? -0.757  1.524   -53.384 1.00 0.00 ? 82  LYS B HA   4 
ATOM 10345 H HB2  . LYS B 1 19 ? 0.358   2.382   -51.376 1.00 0.00 ? 82  LYS B HB2  4 
ATOM 10346 H HB3  . LYS B 1 19 ? -0.441  1.138   -50.399 1.00 0.00 ? 82  LYS B HB3  4 
ATOM 10347 H HG2  . LYS B 1 19 ? 0.733   -0.613  -51.644 1.00 0.00 ? 82  LYS B HG2  4 
ATOM 10348 H HG3  . LYS B 1 19 ? 1.513   0.618   -52.664 1.00 0.00 ? 82  LYS B HG3  4 
ATOM 10349 H HD2  . LYS B 1 19 ? 2.636   1.560   -50.706 1.00 0.00 ? 82  LYS B HD2  4 
ATOM 10350 H HD3  . LYS B 1 19 ? 1.812   0.394   -49.648 1.00 0.00 ? 82  LYS B HD3  4 
ATOM 10351 H HE2  . LYS B 1 19 ? 2.920   -1.460  -50.841 1.00 0.00 ? 82  LYS B HE2  4 
ATOM 10352 H HE3  . LYS B 1 19 ? 3.760   -0.286  -51.875 1.00 0.00 ? 82  LYS B HE3  4 
ATOM 10353 H HZ1  . LYS B 1 19 ? 4.015   0.003   -48.977 1.00 0.00 ? 82  LYS B HZ1  4 
ATOM 10354 H HZ2  . LYS B 1 19 ? 5.142   0.330   -50.207 1.00 0.00 ? 82  LYS B HZ2  4 
ATOM 10355 H HZ3  . LYS B 1 19 ? 4.842   -1.247  -49.724 1.00 0.00 ? 82  LYS B HZ3  4 
ATOM 10356 N N    . HIS B 1 20 ? -2.153  -0.536  -53.642 1.00 0.00 ? 83  HIS B N    4 
ATOM 10357 C CA   . HIS B 1 20 ? -2.626  -1.900  -53.845 1.00 0.00 ? 83  HIS B CA   4 
ATOM 10358 C C    . HIS B 1 20 ? -3.879  -2.175  -53.024 1.00 0.00 ? 83  HIS B C    4 
ATOM 10359 O O    . HIS B 1 20 ? -3.959  -3.176  -52.311 1.00 0.00 ? 83  HIS B O    4 
ATOM 10360 C CB   . HIS B 1 20 ? -1.535  -2.910  -53.479 1.00 0.00 ? 83  HIS B CB   4 
ATOM 10361 C CG   . HIS B 1 20 ? -0.238  -2.680  -54.188 1.00 0.00 ? 83  HIS B CG   4 
ATOM 10362 N ND1  . HIS B 1 20 ? -0.126  -2.699  -55.562 1.00 0.00 ? 83  HIS B ND1  4 
ATOM 10363 C CD2  . HIS B 1 20 ? 1.005   -2.424  -53.713 1.00 0.00 ? 83  HIS B CD2  4 
ATOM 10364 C CE1  . HIS B 1 20 ? 1.129   -2.467  -55.903 1.00 0.00 ? 83  HIS B CE1  4 
ATOM 10365 N NE2  . HIS B 1 20 ? 1.835   -2.296  -54.800 1.00 0.00 ? 83  HIS B NE2  4 
ATOM 10366 H H    . HIS B 1 20 ? -2.027  0.071   -54.451 1.00 0.00 ? 83  HIS B H    4 
ATOM 10367 H HA   . HIS B 1 20 ? -2.873  -2.026  -54.898 1.00 0.00 ? 83  HIS B HA   4 
ATOM 10368 H HB2  . HIS B 1 20 ? -1.359  -2.882  -52.406 1.00 0.00 ? 83  HIS B HB2  4 
ATOM 10369 H HB3  . HIS B 1 20 ? -1.897  -3.902  -53.748 1.00 0.00 ? 83  HIS B HB3  4 
ATOM 10370 H HD2  . HIS B 1 20 ? 1.332   -2.636  -52.705 1.00 0.00 ? 83  HIS B HD2  4 
ATOM 10371 H HE1  . HIS B 1 20 ? 1.511   -2.424  -56.912 1.00 0.00 ? 83  HIS B HE1  4 
ATOM 10372 H HE2  . HIS B 1 20 ? 2.826   -2.102  -54.761 1.00 0.00 ? 83  HIS B HE2  4 
ATOM 10373 N N    . PHE B 1 21 ? -4.857  -1.281  -53.129 1.00 0.00 ? 84  PHE B N    4 
ATOM 10374 C CA   . PHE B 1 21 ? -6.167  -1.506  -52.529 1.00 0.00 ? 84  PHE B CA   4 
ATOM 10375 C C    . PHE B 1 21 ? -7.263  -1.500  -53.583 1.00 0.00 ? 84  PHE B C    4 
ATOM 10376 O O    . PHE B 1 21 ? -7.157  -0.818  -54.602 1.00 0.00 ? 84  PHE B O    4 
ATOM 10377 C CB   . PHE B 1 21 ? -6.462  -0.437  -51.473 1.00 0.00 ? 84  PHE B CB   4 
ATOM 10378 C CG   . PHE B 1 21 ? -5.472  -0.413  -50.344 1.00 0.00 ? 84  PHE B CG   4 
ATOM 10379 C CD1  . PHE B 1 21 ? -5.533  -1.357  -49.330 1.00 0.00 ? 84  PHE B CD1  4 
ATOM 10380 C CD2  . PHE B 1 21 ? -4.480  0.554   -50.291 1.00 0.00 ? 84  PHE B CD2  4 
ATOM 10381 C CE1  . PHE B 1 21 ? -4.626  -1.335  -48.288 1.00 0.00 ? 84  PHE B CE1  4 
ATOM 10382 C CE2  . PHE B 1 21 ? -3.571  0.578   -49.250 1.00 0.00 ? 84  PHE B CE2  4 
ATOM 10383 C CZ   . PHE B 1 21 ? -3.644  -0.365  -48.250 1.00 0.00 ? 84  PHE B CZ   4 
ATOM 10384 H H    . PHE B 1 21 ? -4.735  -0.489  -53.759 1.00 0.00 ? 84  PHE B H    4 
ATOM 10385 H HA   . PHE B 1 21 ? -6.184  -2.464  -52.060 1.00 0.00 ? 84  PHE B HA   4 
ATOM 10386 H HB2  . PHE B 1 21 ? -6.475  0.513   -51.962 1.00 0.00 ? 84  PHE B HB2  4 
ATOM 10387 H HB3  . PHE B 1 21 ? -7.453  -0.631  -51.061 1.00 0.00 ? 84  PHE B HB3  4 
ATOM 10388 H HD1  . PHE B 1 21 ? -6.303  -2.087  -49.338 1.00 0.00 ? 84  PHE B HD1  4 
ATOM 10389 H HD2  . PHE B 1 21 ? -4.412  1.288   -51.068 1.00 0.00 ? 84  PHE B HD2  4 
ATOM 10390 H HE1  . PHE B 1 21 ? -4.685  -2.076  -47.505 1.00 0.00 ? 84  PHE B HE1  4 
ATOM 10391 H HE2  . PHE B 1 21 ? -2.802  1.337   -49.222 1.00 0.00 ? 84  PHE B HE2  4 
ATOM 10392 H HZ   . PHE B 1 21 ? -3.020  -0.268  -47.374 1.00 0.00 ? 84  PHE B HZ   4 
ATOM 10393 N N    . SER B 1 22 ? -8.321  -2.268  -53.336 1.00 0.00 ? 85  SER B N    4 
ATOM 10394 C CA   . SER B 1 22 ? -9.430  -2.373  -54.276 1.00 0.00 ? 85  SER B CA   4 
ATOM 10395 C C    . SER B 1 22 ? -10.514 -1.347  -53.964 1.00 0.00 ? 85  SER B C    4 
ATOM 10396 O O    . SER B 1 22 ? -10.862 -1.130  -52.805 1.00 0.00 ? 85  SER B O    4 
ATOM 10397 C CB   . SER B 1 22 ? -10.017 -3.769  -54.238 1.00 0.00 ? 85  SER B CB   4 
ATOM 10398 O OG   . SER B 1 22 ? -9.107  -4.710  -54.737 1.00 0.00 ? 85  SER B OG   4 
ATOM 10399 H H    . SER B 1 22 ? -8.347  -2.812  -52.475 1.00 0.00 ? 85  SER B H    4 
ATOM 10400 H HA   . SER B 1 22 ? -9.016  -2.214  -55.262 1.00 0.00 ? 85  SER B HA   4 
ATOM 10401 H HB2  . SER B 1 22 ? -10.263 -4.031  -53.212 1.00 0.00 ? 85  SER B HB2  4 
ATOM 10402 H HB3  . SER B 1 22 ? -10.931 -3.785  -54.840 1.00 0.00 ? 85  SER B HB3  4 
ATOM 10403 H HG   . SER B 1 22 ? -8.448  -4.876  -54.057 1.00 0.00 ? 85  SER B HG   4 
ATOM 10404 N N    . PRO B 1 23 ? -11.043 -0.719  -55.008 1.00 0.00 ? 86  PRO B N    4 
ATOM 10405 C CA   . PRO B 1 23 ? -12.092 0.282   -54.850 1.00 0.00 ? 86  PRO B CA   4 
ATOM 10406 C C    . PRO B 1 23 ? -13.389 -0.352  -54.362 1.00 0.00 ? 86  PRO B C    4 
ATOM 10407 O O    . PRO B 1 23 ? -14.294 0.343   -53.900 1.00 0.00 ? 86  PRO B O    4 
ATOM 10408 C CB   . PRO B 1 23 ? -12.239 0.855   -56.263 1.00 0.00 ? 86  PRO B CB   4 
ATOM 10409 C CG   . PRO B 1 23 ? -11.775 -0.246  -57.154 1.00 0.00 ? 86  PRO B CG   4 
ATOM 10410 C CD   . PRO B 1 23 ? -10.633 -0.878  -56.404 1.00 0.00 ? 86  PRO B CD   4 
ATOM 10411 H HA   . PRO B 1 23 ? -11.785 1.040   -54.180 1.00 0.00 ? 86  PRO B HA   4 
ATOM 10412 H HB2  . PRO B 1 23 ? -13.280 1.118   -56.475 1.00 0.00 ? 86  PRO B HB2  4 
ATOM 10413 H HB3  . PRO B 1 23 ? -11.595 1.729   -56.385 1.00 0.00 ? 86  PRO B HB3  4 
ATOM 10414 H HG2  . PRO B 1 23 ? -12.585 -0.962  -57.321 1.00 0.00 ? 86  PRO B HG2  4 
ATOM 10415 H HG3  . PRO B 1 23 ? -11.420 0.153   -58.104 1.00 0.00 ? 86  PRO B HG3  4 
ATOM 10416 H HD2  . PRO B 1 23 ? -10.575 -1.935  -56.679 1.00 0.00 ? 86  PRO B HD2  4 
ATOM 10417 H HD3  . PRO B 1 23 ? -9.691  -0.368  -56.600 1.00 0.00 ? 86  PRO B HD3  4 
ATOM 10418 N N    . GLU B 1 24 ? -13.472 -1.674  -54.471 1.00 0.00 ? 87  GLU B N    4 
ATOM 10419 C CA   . GLU B 1 24 ? -14.584 -2.419  -53.895 1.00 0.00 ? 87  GLU B CA   4 
ATOM 10420 C C    . GLU B 1 24 ? -14.406 -2.605  -52.392 1.00 0.00 ? 87  GLU B C    4 
ATOM 10421 O O    . GLU B 1 24 ? -15.349 -2.957  -51.686 1.00 0.00 ? 87  GLU B O    4 
ATOM 10422 C CB   . GLU B 1 24 ? -14.719 -3.785  -54.574 1.00 0.00 ? 87  GLU B CB   4 
ATOM 10423 C CG   . GLU B 1 24 ? -15.111 -3.721  -56.042 1.00 0.00 ? 87  GLU B CG   4 
ATOM 10424 C CD   . GLU B 1 24 ? -15.202 -5.078  -56.683 1.00 0.00 ? 87  GLU B CD   4 
ATOM 10425 O OE1  . GLU B 1 24 ? -14.874 -6.043  -56.035 1.00 0.00 ? 87  GLU B OE1  4 
ATOM 10426 O OE2  . GLU B 1 24 ? -15.601 -5.150  -57.821 1.00 0.00 ? 87  GLU B OE2  4 
ATOM 10427 H H    . GLU B 1 24 ? -12.676 -2.189  -54.849 1.00 0.00 ? 87  GLU B H    4 
ATOM 10428 H HA   . GLU B 1 24 ? -15.504 -1.859  -54.077 1.00 0.00 ? 87  GLU B HA   4 
ATOM 10429 H HB2  . GLU B 1 24 ? -13.760 -4.297  -54.499 1.00 0.00 ? 87  GLU B HB2  4 
ATOM 10430 H HB3  . GLU B 1 24 ? -15.473 -4.367  -54.042 1.00 0.00 ? 87  GLU B HB3  4 
ATOM 10431 H HG2  . GLU B 1 24 ? -16.080 -3.231  -56.118 1.00 0.00 ? 87  GLU B HG2  4 
ATOM 10432 H HG3  . GLU B 1 24 ? -14.368 -3.128  -56.573 1.00 0.00 ? 87  GLU B HG3  4 
ATOM 10433 N N    . GLU B 1 25 ? -13.192 -2.363  -51.912 1.00 0.00 ? 88  GLU B N    4 
ATOM 10434 C CA   . GLU B 1 25 ? -12.884 -2.519  -50.496 1.00 0.00 ? 88  GLU B CA   4 
ATOM 10435 C C    . GLU B 1 25 ? -12.393 -1.209  -49.891 1.00 0.00 ? 88  GLU B C    4 
ATOM 10436 O O    . GLU B 1 25 ? -12.163 -1.118  -48.686 1.00 0.00 ? 88  GLU B O    4 
ATOM 10437 C CB   . GLU B 1 25 ? -11.830 -3.610  -50.297 1.00 0.00 ? 88  GLU B CB   4 
ATOM 10438 C CG   . GLU B 1 25 ? -12.285 -5.006  -50.698 1.00 0.00 ? 88  GLU B CG   4 
ATOM 10439 C CD   . GLU B 1 25 ? -11.255 -6.063  -50.411 1.00 0.00 ? 88  GLU B CD   4 
ATOM 10440 O OE1  . GLU B 1 25 ? -10.407 -5.831  -49.583 1.00 0.00 ? 88  GLU B OE1  4 
ATOM 10441 O OE2  . GLU B 1 25 ? -11.315 -7.104  -51.023 1.00 0.00 ? 88  GLU B OE2  4 
ATOM 10442 H H    . GLU B 1 25 ? -12.452 -2.077  -52.553 1.00 0.00 ? 88  GLU B H    4 
ATOM 10443 H HA   . GLU B 1 25 ? -13.782 -2.824  -49.953 1.00 0.00 ? 88  GLU B HA   4 
ATOM 10444 H HB2  . GLU B 1 25 ? -10.957 -3.357  -50.896 1.00 0.00 ? 88  GLU B HB2  4 
ATOM 10445 H HB3  . GLU B 1 25 ? -11.548 -3.629  -49.260 1.00 0.00 ? 88  GLU B HB3  4 
ATOM 10446 H HG2  . GLU B 1 25 ? -13.193 -5.241  -50.141 1.00 0.00 ? 88  GLU B HG2  4 
ATOM 10447 H HG3  . GLU B 1 25 ? -12.509 -5.009  -51.764 1.00 0.00 ? 88  GLU B HG3  4 
ATOM 10448 N N    . LEU B 1 26 ? -12.236 -0.196  -50.737 1.00 0.00 ? 89  LEU B N    4 
ATOM 10449 C CA   . LEU B 1 26 ? -11.977 1.160   -50.266 1.00 0.00 ? 89  LEU B CA   4 
ATOM 10450 C C    . LEU B 1 26 ? -13.269 1.860   -49.866 1.00 0.00 ? 89  LEU B C    4 
ATOM 10451 O O    . LEU B 1 26 ? -14.295 1.719   -50.531 1.00 0.00 ? 89  LEU B O    4 
ATOM 10452 C CB   . LEU B 1 26 ? -11.266 1.972   -51.355 1.00 0.00 ? 89  LEU B CB   4 
ATOM 10453 C CG   . LEU B 1 26 ? -9.824  1.549   -51.666 1.00 0.00 ? 89  LEU B CG   4 
ATOM 10454 C CD1  . LEU B 1 26 ? -9.311  2.333   -52.866 1.00 0.00 ? 89  LEU B CD1  4 
ATOM 10455 C CD2  . LEU B 1 26 ? -8.951  1.789   -50.442 1.00 0.00 ? 89  LEU B CD2  4 
ATOM 10456 H H    . LEU B 1 26 ? -12.475 -0.334  -51.718 1.00 0.00 ? 89  LEU B H    4 
ATOM 10457 H HA   . LEU B 1 26 ? -11.321 1.101   -49.421 1.00 0.00 ? 89  LEU B HA   4 
ATOM 10458 H HB2  . LEU B 1 26 ? -11.854 1.901   -52.251 1.00 0.00 ? 89  LEU B HB2  4 
ATOM 10459 H HB3  . LEU B 1 26 ? -11.252 3.018   -51.043 1.00 0.00 ? 89  LEU B HB3  4 
ATOM 10460 H HG   . LEU B 1 26 ? -9.809  0.500   -51.908 1.00 0.00 ? 89  LEU B HG   4 
ATOM 10461 H HD11 . LEU B 1 26 ? -9.493  3.396   -52.711 1.00 0.00 ? 89  LEU B HD11 4 
ATOM 10462 H HD12 . LEU B 1 26 ? -9.812  2.005   -53.768 1.00 0.00 ? 89  LEU B HD12 4 
ATOM 10463 H HD13 . LEU B 1 26 ? -8.252  2.162   -52.973 1.00 0.00 ? 89  LEU B HD13 4 
ATOM 10464 H HD21 . LEU B 1 26 ? -7.913  1.937   -50.743 1.00 0.00 ? 89  LEU B HD21 4 
ATOM 10465 H HD22 . LEU B 1 26 ? -8.998  0.918   -49.791 1.00 0.00 ? 89  LEU B HD22 4 
ATOM 10466 H HD23 . LEU B 1 26 ? -9.291  2.671   -49.898 1.00 0.00 ? 89  LEU B HD23 4 
ATOM 10467 N N    . LYS B 1 27 ? -13.214 2.616   -48.776 1.00 0.00 ? 90  LYS B N    4 
ATOM 10468 C CA   . LYS B 1 27 ? -14.384 3.329   -48.276 1.00 0.00 ? 90  LYS B CA   4 
ATOM 10469 C C    . LYS B 1 27 ? -14.035 4.763   -47.902 1.00 0.00 ? 90  LYS B C    4 
ATOM 10470 O O    . LYS B 1 27 ? -14.109 5.147   -46.736 1.00 0.00 ? 90  LYS B O    4 
ATOM 10471 C CB   . LYS B 1 27 ? -14.978 2.601   -47.069 1.00 0.00 ? 90  LYS B CB   4 
ATOM 10472 C CG   . LYS B 1 27 ? -15.478 1.194   -47.368 1.00 0.00 ? 90  LYS B CG   4 
ATOM 10473 C CD   . LYS B 1 27 ? -16.073 0.544   -46.128 1.00 0.00 ? 90  LYS B CD   4 
ATOM 10474 C CE   . LYS B 1 27 ? -16.556 -0.868  -46.418 1.00 0.00 ? 90  LYS B CE   4 
ATOM 10475 N NZ   . LYS B 1 27 ? -17.125 -1.525  -45.209 1.00 0.00 ? 90  LYS B NZ   4 
ATOM 10476 H H    . LYS B 1 27 ? -12.333 2.696   -48.266 1.00 0.00 ? 90  LYS B H    4 
ATOM 10477 H HA   . LYS B 1 27 ? -15.151 3.362   -49.056 1.00 0.00 ? 90  LYS B HA   4 
ATOM 10478 H HB2  . LYS B 1 27 ? -14.209 2.514   -46.316 1.00 0.00 ? 90  LYS B HB2  4 
ATOM 10479 H HB3  . LYS B 1 27 ? -15.805 3.190   -46.669 1.00 0.00 ? 90  LYS B HB3  4 
ATOM 10480 H HG2  . LYS B 1 27 ? -16.244 1.249   -48.143 1.00 0.00 ? 90  LYS B HG2  4 
ATOM 10481 H HG3  . LYS B 1 27 ? -14.646 0.587   -47.725 1.00 0.00 ? 90  LYS B HG3  4 
ATOM 10482 H HD2  . LYS B 1 27 ? -15.311 0.506   -45.348 1.00 0.00 ? 90  LYS B HD2  4 
ATOM 10483 H HD3  . LYS B 1 27 ? -16.914 1.143   -45.780 1.00 0.00 ? 90  LYS B HD3  4 
ATOM 10484 H HE2  . LYS B 1 27 ? -17.323 -0.827  -47.190 1.00 0.00 ? 90  LYS B HE2  4 
ATOM 10485 H HE3  . LYS B 1 27 ? -15.715 -1.460  -46.782 1.00 0.00 ? 90  LYS B HE3  4 
ATOM 10486 H HZ1  . LYS B 1 27 ? -17.766 -0.860  -44.731 1.00 0.00 ? 90  LYS B HZ1  4 
ATOM 10487 H HZ2  . LYS B 1 27 ? -16.350 -1.787  -44.564 1.00 0.00 ? 90  LYS B HZ2  4 
ATOM 10488 H HZ3  . LYS B 1 27 ? -17.635 -2.353  -45.481 1.00 0.00 ? 90  LYS B HZ3  4 
ATOM 10489 N N    . VAL B 1 28 ? -13.655 5.554   -48.902 1.00 0.00 ? 91  VAL B N    4 
ATOM 10490 C CA   . VAL B 1 28 ? -13.330 6.959   -48.685 1.00 0.00 ? 91  VAL B CA   4 
ATOM 10491 C C    . VAL B 1 28 ? -14.521 7.722   -48.118 1.00 0.00 ? 91  VAL B C    4 
ATOM 10492 O O    . VAL B 1 28 ? -15.650 7.564   -48.585 1.00 0.00 ? 91  VAL B O    4 
ATOM 10493 C CB   . VAL B 1 28 ? -12.887 7.614   -50.006 1.00 0.00 ? 91  VAL B CB   4 
ATOM 10494 C CG1  . VAL B 1 28 ? -14.039 7.646   -50.998 1.00 0.00 ? 91  VAL B CG1  4 
ATOM 10495 C CG2  . VAL B 1 28 ? -12.366 9.017   -49.740 1.00 0.00 ? 91  VAL B CG2  4 
ATOM 10496 H H    . VAL B 1 28 ? -13.626 5.176   -49.848 1.00 0.00 ? 91  VAL B H    4 
ATOM 10497 H HA   . VAL B 1 28 ? -12.507 7.016   -47.974 1.00 0.00 ? 91  VAL B HA   4 
ATOM 10498 H HB   . VAL B 1 28 ? -12.078 7.022   -50.436 1.00 0.00 ? 91  VAL B HB   4 
ATOM 10499 H HG11 . VAL B 1 28 ? -13.666 7.901   -51.991 1.00 0.00 ? 91  VAL B HG11 4 
ATOM 10500 H HG12 . VAL B 1 28 ? -14.764 8.397   -50.681 1.00 0.00 ? 91  VAL B HG12 4 
ATOM 10501 H HG13 . VAL B 1 28 ? -14.519 6.668   -51.032 1.00 0.00 ? 91  VAL B HG13 4 
ATOM 10502 H HG21 . VAL B 1 28 ? -12.150 9.523   -50.669 1.00 0.00 ? 91  VAL B HG21 4 
ATOM 10503 H HG22 . VAL B 1 28 ? -11.466 8.967   -49.132 1.00 0.00 ? 91  VAL B HG22 4 
ATOM 10504 H HG23 . VAL B 1 28 ? -13.125 9.584   -49.205 1.00 0.00 ? 91  VAL B HG23 4 
ATOM 10505 N N    . LYS B 1 29 ? -14.263 8.546   -47.109 1.00 0.00 ? 92  LYS B N    4 
ATOM 10506 C CA   . LYS B 1 29 ? -15.330 9.220   -46.378 1.00 0.00 ? 92  LYS B CA   4 
ATOM 10507 C C    . LYS B 1 29 ? -14.839 10.522  -45.763 1.00 0.00 ? 92  LYS B C    4 
ATOM 10508 O O    . LYS B 1 29 ? -13.642 10.700  -45.531 1.00 0.00 ? 92  LYS B O    4 
ATOM 10509 C CB   . LYS B 1 29 ? -15.895 8.304   -45.292 1.00 0.00 ? 92  LYS B CB   4 
ATOM 10510 C CG   . LYS B 1 29 ? -17.049 8.905   -44.500 1.00 0.00 ? 92  LYS B CG   4 
ATOM 10511 C CD   . LYS B 1 29 ? -17.669 7.881   -43.562 1.00 0.00 ? 92  LYS B CD   4 
ATOM 10512 C CE   . LYS B 1 29 ? -18.820 8.482   -42.768 1.00 0.00 ? 92  LYS B CE   4 
ATOM 10513 N NZ   . LYS B 1 29 ? -19.437 7.490   -41.846 1.00 0.00 ? 92  LYS B NZ   4 
ATOM 10514 H H    . LYS B 1 29 ? -13.308 8.617   -46.756 1.00 0.00 ? 92  LYS B H    4 
ATOM 10515 H HA   . LYS B 1 29 ? -16.134 9.453   -47.079 1.00 0.00 ? 92  LYS B HA   4 
ATOM 10516 H HB2  . LYS B 1 29 ? -16.262 7.397   -45.771 1.00 0.00 ? 92  LYS B HB2  4 
ATOM 10517 H HB3  . LYS B 1 29 ? -15.093 8.032   -44.617 1.00 0.00 ? 92  LYS B HB3  4 
ATOM 10518 H HG2  . LYS B 1 29 ? -16.673 9.744   -43.913 1.00 0.00 ? 92  LYS B HG2  4 
ATOM 10519 H HG3  . LYS B 1 29 ? -17.812 9.263   -45.191 1.00 0.00 ? 92  LYS B HG3  4 
ATOM 10520 H HD2  . LYS B 1 29 ? -18.039 7.043   -44.150 1.00 0.00 ? 92  LYS B HD2  4 
ATOM 10521 H HD3  . LYS B 1 29 ? -16.906 7.526   -42.868 1.00 0.00 ? 92  LYS B HD3  4 
ATOM 10522 H HE2  . LYS B 1 29 ? -18.446 9.321   -42.183 1.00 0.00 ? 92  LYS B HE2  4 
ATOM 10523 H HE3  . LYS B 1 29 ? -19.579 8.842   -43.465 1.00 0.00 ? 92  LYS B HE3  4 
ATOM 10524 H HZ1  . LYS B 1 29 ? -19.792 7.972   -40.997 1.00 0.00 ? 92  LYS B HZ1  4 
ATOM 10525 H HZ2  . LYS B 1 29 ? -18.720 6.789   -41.573 1.00 0.00 ? 92  LYS B HZ2  4 
ATOM 10526 H HZ3  . LYS B 1 29 ? -20.202 7.025   -42.314 1.00 0.00 ? 92  LYS B HZ3  4 
ATOM 10527 N N    . VAL B 1 30 ? -15.768 11.437  -45.502 1.00 0.00 ? 93  VAL B N    4 
ATOM 10528 C CA   . VAL B 1 30 ? -15.484 12.607  -44.678 1.00 0.00 ? 93  VAL B CA   4 
ATOM 10529 C C    . VAL B 1 30 ? -16.448 12.703  -43.505 1.00 0.00 ? 93  VAL B C    4 
ATOM 10530 O O    . VAL B 1 30 ? -17.522 12.101  -43.520 1.00 0.00 ? 93  VAL B O    4 
ATOM 10531 C CB   . VAL B 1 30 ? -15.577 13.889  -45.525 1.00 0.00 ? 93  VAL B CB   4 
ATOM 10532 C CG1  . VAL B 1 30 ? -14.568 13.852  -46.662 1.00 0.00 ? 93  VAL B CG1  4 
ATOM 10533 C CG2  . VAL B 1 30 ? -16.991 14.054  -46.063 1.00 0.00 ? 93  VAL B CG2  4 
ATOM 10534 H H    . VAL B 1 30 ? -16.743 11.206  -45.696 1.00 0.00 ? 93  VAL B H    4 
ATOM 10535 H HA   . VAL B 1 30 ? -14.493 12.528  -44.268 1.00 0.00 ? 93  VAL B HA   4 
ATOM 10536 H HB   . VAL B 1 30 ? -15.349 14.743  -44.883 1.00 0.00 ? 93  VAL B HB   4 
ATOM 10537 H HG11 . VAL B 1 30 ? -13.609 14.085  -46.284 1.00 0.00 ? 93  VAL B HG11 4 
ATOM 10538 H HG12 . VAL B 1 30 ? -14.836 14.582  -47.426 1.00 0.00 ? 93  VAL B HG12 4 
ATOM 10539 H HG13 . VAL B 1 30 ? -14.555 12.855  -47.106 1.00 0.00 ? 93  VAL B HG13 4 
ATOM 10540 H HG21 . VAL B 1 30 ? -17.272 13.151  -46.605 1.00 0.00 ? 93  VAL B HG21 4 
ATOM 10541 H HG22 . VAL B 1 30 ? -17.686 14.212  -45.239 1.00 0.00 ? 93  VAL B HG22 4 
ATOM 10542 H HG23 . VAL B 1 30 ? -17.034 14.910  -46.736 1.00 0.00 ? 93  VAL B HG23 4 
ATOM 10543 N N    . LEU B 1 31 ? -16.062 13.465  -42.488 1.00 0.00 ? 94  LEU B N    4 
ATOM 10544 C CA   . LEU B 1 31 ? -16.913 13.679  -41.323 1.00 0.00 ? 94  LEU B CA   4 
ATOM 10545 C C    . LEU B 1 31 ? -16.750 15.088  -40.774 1.00 0.00 ? 94  LEU B C    4 
ATOM 10546 O O    . LEU B 1 31 ? -16.182 15.285  -39.699 1.00 0.00 ? 94  LEU B O    4 
ATOM 10547 C CB   . LEU B 1 31 ? -16.580 12.654  -40.230 1.00 0.00 ? 94  LEU B CB   4 
ATOM 10548 C CG   . LEU B 1 31 ? -17.574 12.581  -39.063 1.00 0.00 ? 94  LEU B CG   4 
ATOM 10549 C CD1  . LEU B 1 31 ? -18.947 12.187  -39.590 1.00 0.00 ? 94  LEU B CD1  4 
ATOM 10550 C CD2  . LEU B 1 31 ? -17.073 11.578  -38.035 1.00 0.00 ? 94  LEU B CD2  4 
ATOM 10551 H H    . LEU B 1 31 ? -15.165 13.948  -42.541 1.00 0.00 ? 94  LEU B H    4 
ATOM 10552 H HA   . LEU B 1 31 ? -17.952 13.545  -41.616 1.00 0.00 ? 94  LEU B HA   4 
ATOM 10553 H HB2  . LEU B 1 31 ? -16.536 11.670  -40.688 1.00 0.00 ? 94  LEU B HB2  4 
ATOM 10554 H HB3  . LEU B 1 31 ? -15.614 12.881  -39.826 1.00 0.00 ? 94  LEU B HB3  4 
ATOM 10555 H HG   . LEU B 1 31 ? -17.634 13.567  -38.599 1.00 0.00 ? 94  LEU B HG   4 
ATOM 10556 H HD11 . LEU B 1 31 ? -19.476 13.066  -39.955 1.00 0.00 ? 94  LEU B HD11 4 
ATOM 10557 H HD12 . LEU B 1 31 ? -19.527 11.741  -38.779 1.00 0.00 ? 94  LEU B HD12 4 
ATOM 10558 H HD13 . LEU B 1 31 ? -18.848 11.462  -40.399 1.00 0.00 ? 94  LEU B HD13 4 
ATOM 10559 H HD21 . LEU B 1 31 ? -17.014 10.591  -38.492 1.00 0.00 ? 94  LEU B HD21 4 
ATOM 10560 H HD22 . LEU B 1 31 ? -17.764 11.548  -37.192 1.00 0.00 ? 94  LEU B HD22 4 
ATOM 10561 H HD23 . LEU B 1 31 ? -16.085 11.875  -37.682 1.00 0.00 ? 94  LEU B HD23 4 
ATOM 10562 N N    . GLY B 1 32 ? -17.253 16.070  -41.516 1.00 0.00 ? 95  GLY B N    4 
ATOM 10563 C CA   . GLY B 1 32 ? -17.171 17.465  -41.100 1.00 0.00 ? 95  GLY B CA   4 
ATOM 10564 C C    . GLY B 1 32 ? -15.816 18.065  -41.452 1.00 0.00 ? 95  GLY B C    4 
ATOM 10565 O O    . GLY B 1 32 ? -15.554 18.397  -42.607 1.00 0.00 ? 95  GLY B O    4 
ATOM 10566 H H    . GLY B 1 32 ? -17.717 15.839  -42.394 1.00 0.00 ? 95  GLY B H    4 
ATOM 10567 H HA2  . GLY B 1 32 ? -17.952 18.035  -41.605 1.00 0.00 ? 95  GLY B HA2  4 
ATOM 10568 H HA3  . GLY B 1 32 ? -17.324 17.533  -40.022 1.00 0.00 ? 95  GLY B HA3  4 
ATOM 10569 N N    . ASP B 1 33 ? -14.957 18.202  -40.447 1.00 0.00 ? 96  ASP B N    4 
ATOM 10570 C CA   . ASP B 1 33 ? -13.647 18.814  -40.638 1.00 0.00 ? 96  ASP B CA   4 
ATOM 10571 C C    . ASP B 1 33 ? -12.548 17.760  -40.679 1.00 0.00 ? 96  ASP B C    4 
ATOM 10572 O O    . ASP B 1 33 ? -11.376 18.061  -40.441 1.00 0.00 ? 96  ASP B O    4 
ATOM 10573 C CB   . ASP B 1 33 ? -13.356 19.819  -39.519 1.00 0.00 ? 96  ASP B CB   4 
ATOM 10574 C CG   . ASP B 1 33 ? -13.315 19.175  -38.141 1.00 0.00 ? 96  ASP B CG   4 
ATOM 10575 O OD1  . ASP B 1 33 ? -13.656 18.020  -38.034 1.00 0.00 ? 96  ASP B OD1  4 
ATOM 10576 O OD2  . ASP B 1 33 ? -12.940 19.844  -37.207 1.00 0.00 ? 96  ASP B OD2  4 
ATOM 10577 H H    . ASP B 1 33 ? -15.242 17.911  -39.514 1.00 0.00 ? 96  ASP B H    4 
ATOM 10578 H HA   . ASP B 1 33 ? -13.631 19.350  -41.592 1.00 0.00 ? 96  ASP B HA   4 
ATOM 10579 H HB2  . ASP B 1 33 ? -12.395 20.291  -39.716 1.00 0.00 ? 96  ASP B HB2  4 
ATOM 10580 H HB3  . ASP B 1 33 ? -14.134 20.582  -39.530 1.00 0.00 ? 96  ASP B HB3  4 
ATOM 10581 N N    . VAL B 1 34 ? -12.930 16.523  -40.981 1.00 0.00 ? 97  VAL B N    4 
ATOM 10582 C CA   . VAL B 1 34 ? -11.963 15.461  -41.228 1.00 0.00 ? 97  VAL B CA   4 
ATOM 10583 C C    . VAL B 1 34 ? -12.289 14.709  -42.511 1.00 0.00 ? 97  VAL B C    4 
ATOM 10584 O O    . VAL B 1 34 ? -13.405 14.786  -43.024 1.00 0.00 ? 97  VAL B O    4 
ATOM 10585 C CB   . VAL B 1 34 ? -11.943 14.471  -40.047 1.00 0.00 ? 97  VAL B CB   4 
ATOM 10586 C CG1  . VAL B 1 34 ? -11.541 15.182  -38.765 1.00 0.00 ? 97  VAL B CG1  4 
ATOM 10587 C CG2  . VAL B 1 34 ? -13.308 13.817  -39.897 1.00 0.00 ? 97  VAL B CG2  4 
ATOM 10588 H H    . VAL B 1 34 ? -13.912 16.352  -41.195 1.00 0.00 ? 97  VAL B H    4 
ATOM 10589 H HA   . VAL B 1 34 ? -10.994 15.893  -41.340 1.00 0.00 ? 97  VAL B HA   4 
ATOM 10590 H HB   . VAL B 1 34 ? -11.224 13.716  -40.289 1.00 0.00 ? 97  VAL B HB   4 
ATOM 10591 H HG11 . VAL B 1 34 ? -11.866 14.604  -37.899 1.00 0.00 ? 97  VAL B HG11 4 
ATOM 10592 H HG12 . VAL B 1 34 ? -11.987 16.172  -38.717 1.00 0.00 ? 97  VAL B HG12 4 
ATOM 10593 H HG13 . VAL B 1 34 ? -10.470 15.267  -38.745 1.00 0.00 ? 97  VAL B HG13 4 
ATOM 10594 H HG21 . VAL B 1 34 ? -13.544 13.244  -40.792 1.00 0.00 ? 97  VAL B HG21 4 
ATOM 10595 H HG22 . VAL B 1 34 ? -13.301 13.150  -39.034 1.00 0.00 ? 97  VAL B HG22 4 
ATOM 10596 H HG23 . VAL B 1 34 ? -14.045 14.593  -39.750 1.00 0.00 ? 97  VAL B HG23 4 
ATOM 10597 N N    . ILE B 1 35 ? -11.305 13.979  -43.030 1.00 0.00 ? 98  ILE B N    4 
ATOM 10598 C CA   . ILE B 1 35 ? -11.525 13.091  -44.165 1.00 0.00 ? 98  ILE B CA   4 
ATOM 10599 C C    . ILE B 1 35 ? -11.244 11.642  -43.795 1.00 0.00 ? 98  ILE B C    4 
ATOM 10600 O O    . ILE B 1 35 ? -10.102 11.187  -43.853 1.00 0.00 ? 98  ILE B O    4 
ATOM 10601 C CB   . ILE B 1 35 ? -10.642 13.497  -45.359 1.00 0.00 ? 98  ILE B CB   4 
ATOM 10602 C CG1  . ILE B 1 35 ? -10.879 14.965  -45.724 1.00 0.00 ? 98  ILE B CG1  4 
ATOM 10603 C CG2  . ILE B 1 35 ? -10.916 12.598  -46.555 1.00 0.00 ? 98  ILE B CG2  4 
ATOM 10604 C CD1  . ILE B 1 35 ? -9.877  15.519  -46.710 1.00 0.00 ? 98  ILE B CD1  4 
ATOM 10605 H H    . ILE B 1 35 ? -10.412 13.938  -42.539 1.00 0.00 ? 98  ILE B H    4 
ATOM 10606 H HA   . ILE B 1 35 ? -12.545 13.164  -44.483 1.00 0.00 ? 98  ILE B HA   4 
ATOM 10607 H HB   . ILE B 1 35 ? -9.626  13.369  -45.068 1.00 0.00 ? 98  ILE B HB   4 
ATOM 10608 H HG12 . ILE B 1 35 ? -11.858 15.088  -46.144 1.00 0.00 ? 98  ILE B HG12 4 
ATOM 10609 H HG13 . ILE B 1 35 ? -10.815 15.555  -44.810 1.00 0.00 ? 98  ILE B HG13 4 
ATOM 10610 H HG21 . ILE B 1 35 ? -11.917 12.772  -46.905 1.00 0.00 ? 98  ILE B HG21 4 
ATOM 10611 H HG22 . ILE B 1 35 ? -10.836 11.565  -46.272 1.00 0.00 ? 98  ILE B HG22 4 
ATOM 10612 H HG23 . ILE B 1 35 ? -10.209 12.811  -47.353 1.00 0.00 ? 98  ILE B HG23 4 
ATOM 10613 H HD11 . ILE B 1 35 ? -9.930  16.608  -46.730 1.00 0.00 ? 98  ILE B HD11 4 
ATOM 10614 H HD12 . ILE B 1 35 ? -10.097 15.129  -47.704 1.00 0.00 ? 98  ILE B HD12 4 
ATOM 10615 H HD13 . ILE B 1 35 ? -8.873  15.212  -46.416 1.00 0.00 ? 98  ILE B HD13 4 
ATOM 10616 N N    . GLU B 1 36 ? -12.293 10.919  -43.412 1.00 0.00 ? 99  GLU B N    4 
ATOM 10617 C CA   . GLU B 1 36 ? -12.147 9.545   -42.950 1.00 0.00 ? 99  GLU B CA   4 
ATOM 10618 C C    . GLU B 1 36 ? -11.825 8.607   -44.106 1.00 0.00 ? 99  GLU B C    4 
ATOM 10619 O O    . GLU B 1 36 ? -12.701 7.902   -44.608 1.00 0.00 ? 99  GLU B O    4 
ATOM 10620 C CB   . GLU B 1 36 ? -13.425 9.082   -42.245 1.00 0.00 ? 99  GLU B CB   4 
ATOM 10621 C CG   . GLU B 1 36 ? -13.733 9.824   -40.953 1.00 0.00 ? 99  GLU B CG   4 
ATOM 10622 C CD   . GLU B 1 36 ? -14.900 9.239   -40.206 1.00 0.00 ? 99  GLU B CD   4 
ATOM 10623 O OE1  . GLU B 1 36 ? -15.953 9.124   -40.783 1.00 0.00 ? 99  GLU B OE1  4 
ATOM 10624 O OE2  . GLU B 1 36 ? -14.736 8.907   -39.056 1.00 0.00 ? 99  GLU B OE2  4 
ATOM 10625 H H    . GLU B 1 36 ? -13.211 11.361  -43.378 1.00 0.00 ? 99  GLU B H    4 
ATOM 10626 H HA   . GLU B 1 36 ? -11.357 9.480   -42.232 1.00 0.00 ? 99  GLU B HA   4 
ATOM 10627 H HB2  . GLU B 1 36 ? -14.258 9.252   -42.914 1.00 0.00 ? 99  GLU B HB2  4 
ATOM 10628 H HB3  . GLU B 1 36 ? -13.352 8.016   -42.028 1.00 0.00 ? 99  GLU B HB3  4 
ATOM 10629 H HG2  . GLU B 1 36 ? -12.852 9.758   -40.343 1.00 0.00 ? 99  GLU B HG2  4 
ATOM 10630 H HG3  . GLU B 1 36 ? -13.939 10.871  -41.181 1.00 0.00 ? 99  GLU B HG3  4 
ATOM 10631 N N    . VAL B 1 37 ? -10.565 8.602   -44.524 1.00 0.00 ? 100 VAL B N    4 
ATOM 10632 C CA   . VAL B 1 37 ? -10.135 7.777   -45.648 1.00 0.00 ? 100 VAL B CA   4 
ATOM 10633 C C    . VAL B 1 37 ? -9.990  6.319   -45.237 1.00 0.00 ? 100 VAL B C    4 
ATOM 10634 O O    . VAL B 1 37 ? -8.880  5.832   -45.022 1.00 0.00 ? 100 VAL B O    4 
ATOM 10635 C CB   . VAL B 1 37 ? -8.790  8.288   -46.200 1.00 0.00 ? 100 VAL B CB   4 
ATOM 10636 C CG1  . VAL B 1 37 ? -8.371  7.477   -47.417 1.00 0.00 ? 100 VAL B CG1  4 
ATOM 10637 C CG2  . VAL B 1 37 ? -8.899  9.764   -46.547 1.00 0.00 ? 100 VAL B CG2  4 
ATOM 10638 H H    . VAL B 1 37 ? -9.888  9.212   -44.068 1.00 0.00 ? 100 VAL B H    4 
ATOM 10639 H HA   . VAL B 1 37 ? -10.878 7.842   -46.441 1.00 0.00 ? 100 VAL B HA   4 
ATOM 10640 H HB   . VAL B 1 37 ? -8.062  8.164   -45.440 1.00 0.00 ? 100 VAL B HB   4 
ATOM 10641 H HG11 . VAL B 1 37 ? -7.309  7.638   -47.610 1.00 0.00 ? 100 VAL B HG11 4 
ATOM 10642 H HG12 . VAL B 1 37 ? -8.947  7.812   -48.278 1.00 0.00 ? 100 VAL B HG12 4 
ATOM 10643 H HG13 . VAL B 1 37 ? -8.556  6.426   -47.273 1.00 0.00 ? 100 VAL B HG13 4 
ATOM 10644 H HG21 . VAL B 1 37 ? -9.655  9.911   -47.317 1.00 0.00 ? 100 VAL B HG21 4 
ATOM 10645 H HG22 . VAL B 1 37 ? -9.147  10.318  -45.660 1.00 0.00 ? 100 VAL B HG22 4 
ATOM 10646 H HG23 . VAL B 1 37 ? -7.931  10.099  -46.910 1.00 0.00 ? 100 VAL B HG23 4 
ATOM 10647 N N    . HIS B 1 38 ? -11.118 5.624   -45.130 1.00 0.00 ? 101 HIS B N    4 
ATOM 10648 C CA   . HIS B 1 38 ? -11.115 4.199   -44.827 1.00 0.00 ? 101 HIS B CA   4 
ATOM 10649 C C    . HIS B 1 38 ? -10.852 3.371   -46.079 1.00 0.00 ? 101 HIS B C    4 
ATOM 10650 O O    . HIS B 1 38 ? -11.186 3.784   -47.190 1.00 0.00 ? 101 HIS B O    4 
ATOM 10651 C CB   . HIS B 1 38 ? -12.446 3.776   -44.199 1.00 0.00 ? 101 HIS B CB   4 
ATOM 10652 C CG   . HIS B 1 38 ? -12.464 2.356   -43.725 1.00 0.00 ? 101 HIS B CG   4 
ATOM 10653 N ND1  . HIS B 1 38 ? -12.656 1.290   -44.581 1.00 0.00 ? 101 HIS B ND1  4 
ATOM 10654 C CD2  . HIS B 1 38 ? -12.313 1.824   -42.490 1.00 0.00 ? 101 HIS B CD2  4 
ATOM 10655 C CE1  . HIS B 1 38 ? -12.623 0.164   -43.888 1.00 0.00 ? 101 HIS B CE1  4 
ATOM 10656 N NE2  . HIS B 1 38 ? -12.416 0.460   -42.619 1.00 0.00 ? 101 HIS B NE2  4 
ATOM 10657 H H    . HIS B 1 38 ? -12.004 6.084   -45.343 1.00 0.00 ? 101 HIS B H    4 
ATOM 10658 H HA   . HIS B 1 38 ? -10.329 3.986   -44.131 1.00 0.00 ? 101 HIS B HA   4 
ATOM 10659 H HB2  . HIS B 1 38 ? -12.632 4.418   -43.337 1.00 0.00 ? 101 HIS B HB2  4 
ATOM 10660 H HB3  . HIS B 1 38 ? -13.235 3.931   -44.916 1.00 0.00 ? 101 HIS B HB3  4 
ATOM 10661 H HD2  . HIS B 1 38 ? -12.353 2.376   -41.562 1.00 0.00 ? 101 HIS B HD2  4 
ATOM 10662 H HE1  . HIS B 1 38 ? -12.747 -0.829  -44.295 1.00 0.00 ? 101 HIS B HE1  4 
ATOM 10663 H HE2  . HIS B 1 38 ? -12.345 -0.207  -41.864 1.00 0.00 ? 101 HIS B HE2  4 
ATOM 10664 N N    . GLY B 1 39 ? -10.253 2.200   -45.893 1.00 0.00 ? 102 GLY B N    4 
ATOM 10665 C CA   . GLY B 1 39 ? -9.997  1.285   -46.999 1.00 0.00 ? 102 GLY B CA   4 
ATOM 10666 C C    . GLY B 1 39 ? -9.318  0.010   -46.514 1.00 0.00 ? 102 GLY B C    4 
ATOM 10667 O O    . GLY B 1 39 ? -8.745  -0.024  -45.426 1.00 0.00 ? 102 GLY B O    4 
ATOM 10668 H H    . GLY B 1 39 ? -10.009 1.915   -44.945 1.00 0.00 ? 102 GLY B H    4 
ATOM 10669 H HA2  . GLY B 1 39 ? -10.947 1.016   -47.432 1.00 0.00 ? 102 GLY B HA2  4 
ATOM 10670 H HA3  . GLY B 1 39 ? -9.378  1.783   -47.734 1.00 0.00 ? 102 GLY B HA3  4 
ATOM 10671 N N    . LYS B 1 40 ? -9.388  -1.037  -47.329 1.00 0.00 ? 103 LYS B N    4 
ATOM 10672 C CA   . LYS B 1 40 ? -8.717  -2.293  -47.020 1.00 0.00 ? 103 LYS B CA   4 
ATOM 10673 C C    . LYS B 1 40 ? -8.442  -3.099  -48.285 1.00 0.00 ? 103 LYS B C    4 
ATOM 10674 O O    . LYS B 1 40 ? -9.167  -2.984  -49.272 1.00 0.00 ? 103 LYS B O    4 
ATOM 10675 C CB   . LYS B 1 40 ? -9.550  -3.122  -46.042 1.00 0.00 ? 103 LYS B CB   4 
ATOM 10676 C CG   . LYS B 1 40 ? -10.854 -3.656  -46.621 1.00 0.00 ? 103 LYS B CG   4 
ATOM 10677 C CD   . LYS B 1 40 ? -11.682 -4.363  -45.559 1.00 0.00 ? 103 LYS B CD   4 
ATOM 10678 C CE   . LYS B 1 40 ? -12.946 -4.966  -46.152 1.00 0.00 ? 103 LYS B CE   4 
ATOM 10679 N NZ   . LYS B 1 40 ? -13.750 -5.690  -45.129 1.00 0.00 ? 103 LYS B NZ   4 
ATOM 10680 H H    . LYS B 1 40 ? -9.872  -0.941  -48.220 1.00 0.00 ? 103 LYS B H    4 
ATOM 10681 H HA   . LYS B 1 40 ? -7.773  -2.060  -46.559 1.00 0.00 ? 103 LYS B HA   4 
ATOM 10682 H HB2  . LYS B 1 40 ? -8.958  -3.951  -45.665 1.00 0.00 ? 103 LYS B HB2  4 
ATOM 10683 H HB3  . LYS B 1 40 ? -9.825  -2.487  -45.222 1.00 0.00 ? 103 LYS B HB3  4 
ATOM 10684 H HG2  . LYS B 1 40 ? -11.429 -2.838  -47.053 1.00 0.00 ? 103 LYS B HG2  4 
ATOM 10685 H HG3  . LYS B 1 40 ? -10.598 -4.381  -47.389 1.00 0.00 ? 103 LYS B HG3  4 
ATOM 10686 H HD2  . LYS B 1 40 ? -11.087 -5.158  -45.107 1.00 0.00 ? 103 LYS B HD2  4 
ATOM 10687 H HD3  . LYS B 1 40 ? -11.959 -3.640  -44.793 1.00 0.00 ? 103 LYS B HD3  4 
ATOM 10688 H HE2  . LYS B 1 40 ? -13.553 -4.167  -46.576 1.00 0.00 ? 103 LYS B HE2  4 
ATOM 10689 H HE3  . LYS B 1 40 ? -12.667 -5.661  -46.944 1.00 0.00 ? 103 LYS B HE3  4 
ATOM 10690 H HZ1  . LYS B 1 40 ? -14.352 -6.399  -45.591 1.00 0.00 ? 103 LYS B HZ1  4 
ATOM 10691 H HZ2  . LYS B 1 40 ? -14.345 -5.009  -44.614 1.00 0.00 ? 103 LYS B HZ2  4 
ATOM 10692 H HZ3  . LYS B 1 40 ? -13.129 -6.150  -44.480 1.00 0.00 ? 103 LYS B HZ3  4 
ATOM 10693 N N    . HIS B 1 41 ? -7.392  -3.912  -48.246 1.00 0.00 ? 104 HIS B N    4 
ATOM 10694 C CA   . HIS B 1 41 ? -7.235  -5.004  -49.199 1.00 0.00 ? 104 HIS B CA   4 
ATOM 10695 C C    . HIS B 1 41 ? -6.935  -6.317  -48.488 1.00 0.00 ? 104 HIS B C    4 
ATOM 10696 O O    . HIS B 1 41 ? -5.892  -6.465  -47.850 1.00 0.00 ? 104 HIS B O    4 
ATOM 10697 C CB   . HIS B 1 41 ? -6.117  -4.692  -50.201 1.00 0.00 ? 104 HIS B CB   4 
ATOM 10698 C CG   . HIS B 1 41 ? -6.045  -5.658  -51.341 1.00 0.00 ? 104 HIS B CG   4 
ATOM 10699 N ND1  . HIS B 1 41 ? -5.864  -7.013  -51.159 1.00 0.00 ? 104 HIS B ND1  4 
ATOM 10700 C CD2  . HIS B 1 41 ? -6.130  -5.466  -52.679 1.00 0.00 ? 104 HIS B CD2  4 
ATOM 10701 C CE1  . HIS B 1 41 ? -5.841  -7.613  -52.336 1.00 0.00 ? 104 HIS B CE1  4 
ATOM 10702 N NE2  . HIS B 1 41 ? -5.999  -6.697  -53.275 1.00 0.00 ? 104 HIS B NE2  4 
ATOM 10703 H H    . HIS B 1 41 ? -6.881  -3.979  -47.368 1.00 0.00 ? 104 HIS B H    4 
ATOM 10704 H HA   . HIS B 1 41 ? -8.160  -5.135  -49.769 1.00 0.00 ? 104 HIS B HA   4 
ATOM 10705 H HB2  . HIS B 1 41 ? -6.293  -3.733  -50.602 1.00 0.00 ? 104 HIS B HB2  4 
ATOM 10706 H HB3  . HIS B 1 41 ? -5.180  -4.688  -49.665 1.00 0.00 ? 104 HIS B HB3  4 
ATOM 10707 H HD1  . HIS B 1 41 ? -5.753  -7.475  -50.264 1.00 0.00 ? 104 HIS B HD1  4 
ATOM 10708 H HD2  . HIS B 1 41 ? -6.483  -4.567  -53.158 1.00 0.00 ? 104 HIS B HD2  4 
ATOM 10709 H HE1  . HIS B 1 41 ? -5.713  -8.673  -52.500 1.00 0.00 ? 104 HIS B HE1  4 
ATOM 10710 N N    . GLU B 1 42 ? -7.856  -7.269  -48.601 1.00 0.00 ? 105 GLU B N    4 
ATOM 10711 C CA   . GLU B 1 42 ? -7.719  -8.553  -47.922 1.00 0.00 ? 105 GLU B CA   4 
ATOM 10712 C C    . GLU B 1 42 ? -6.550  -9.350  -48.485 1.00 0.00 ? 105 GLU B C    4 
ATOM 10713 O O    . GLU B 1 42 ? -5.808  -8.864  -49.340 1.00 0.00 ? 105 GLU B O    4 
ATOM 10714 C CB   . GLU B 1 42 ? -9.010  -9.364  -48.047 1.00 0.00 ? 105 GLU B CB   4 
ATOM 10715 C CG   . GLU B 1 42 ? -10.199 -8.771  -47.304 1.00 0.00 ? 105 GLU B CG   4 
ATOM 10716 C CD   . GLU B 1 42 ? -11.435 -9.620  -47.408 1.00 0.00 ? 105 GLU B CD   4 
ATOM 10717 O OE1  . GLU B 1 42 ? -11.411 -10.584 -48.137 1.00 0.00 ? 105 GLU B OE1  4 
ATOM 10718 O OE2  . GLU B 1 42 ? -12.404 -9.306  -46.759 1.00 0.00 ? 105 GLU B OE2  4 
ATOM 10719 H H    . GLU B 1 42 ? -8.701  -7.079  -49.141 1.00 0.00 ? 105 GLU B H    4 
ATOM 10720 H HA   . GLU B 1 42 ? -7.542  -8.373  -46.863 1.00 0.00 ? 105 GLU B HA   4 
ATOM 10721 H HB2  . GLU B 1 42 ? -9.273  -9.439  -49.103 1.00 0.00 ? 105 GLU B HB2  4 
ATOM 10722 H HB3  . GLU B 1 42 ? -8.831  -10.366 -47.658 1.00 0.00 ? 105 GLU B HB3  4 
ATOM 10723 H HG2  . GLU B 1 42 ? -9.930  -8.666  -46.253 1.00 0.00 ? 105 GLU B HG2  4 
ATOM 10724 H HG3  . GLU B 1 42 ? -10.411 -7.785  -47.719 1.00 0.00 ? 105 GLU B HG3  4 
ATOM 10725 N N    . GLU B 1 43 ? -6.389  -10.576 -48.001 1.00 0.00 ? 106 GLU B N    4 
ATOM 10726 C CA   . GLU B 1 43 ? -5.206  -11.372 -48.306 1.00 0.00 ? 106 GLU B CA   4 
ATOM 10727 C C    . GLU B 1 43 ? -4.581  -10.946 -49.628 1.00 0.00 ? 106 GLU B C    4 
ATOM 10728 O O    . GLU B 1 43 ? -5.197  -11.072 -50.687 1.00 0.00 ? 106 GLU B O    4 
ATOM 10729 C CB   . GLU B 1 43 ? -5.562  -12.860 -48.355 1.00 0.00 ? 106 GLU B CB   4 
ATOM 10730 C CG   . GLU B 1 43 ? -5.995  -13.446 -47.020 1.00 0.00 ? 106 GLU B CG   4 
ATOM 10731 C CD   . GLU B 1 43 ? -6.341  -14.909 -47.109 1.00 0.00 ? 106 GLU B CD   4 
ATOM 10732 O OE1  . GLU B 1 43 ? -6.358  -15.431 -48.196 1.00 0.00 ? 106 GLU B OE1  4 
ATOM 10733 O OE2  . GLU B 1 43 ? -6.588  -15.501 -46.084 1.00 0.00 ? 106 GLU B OE2  4 
ATOM 10734 H H    . GLU B 1 43 ? -7.028  -10.902 -47.274 1.00 0.00 ? 106 GLU B H    4 
ATOM 10735 H HA   . GLU B 1 43 ? -4.465  -11.236 -47.520 1.00 0.00 ? 106 GLU B HA   4 
ATOM 10736 H HB2  . GLU B 1 43 ? -6.382  -12.992 -49.061 1.00 0.00 ? 106 GLU B HB2  4 
ATOM 10737 H HB3  . GLU B 1 43 ? -4.700  -13.425 -48.710 1.00 0.00 ? 106 GLU B HB3  4 
ATOM 10738 H HG2  . GLU B 1 43 ? -5.179  -13.318 -46.310 1.00 0.00 ? 106 GLU B HG2  4 
ATOM 10739 H HG3  . GLU B 1 43 ? -6.867  -12.897 -46.666 1.00 0.00 ? 106 GLU B HG3  4 
ATOM 10740 N N    . ARG B 1 44 ? -3.353  -10.442 -49.560 1.00 0.00 ? 107 ARG B N    4 
ATOM 10741 C CA   . ARG B 1 44 ? -2.792  -9.646  -50.645 1.00 0.00 ? 107 ARG B CA   4 
ATOM 10742 C C    . ARG B 1 44 ? -1.365  -10.071 -50.961 1.00 0.00 ? 107 ARG B C    4 
ATOM 10743 O O    . ARG B 1 44 ? -0.409  -9.378  -50.613 1.00 0.00 ? 107 ARG B O    4 
ATOM 10744 C CB   . ARG B 1 44 ? -2.810  -8.166  -50.288 1.00 0.00 ? 107 ARG B CB   4 
ATOM 10745 C CG   . ARG B 1 44 ? -2.374  -7.232  -51.406 1.00 0.00 ? 107 ARG B CG   4 
ATOM 10746 C CD   . ARG B 1 44 ? -2.426  -5.809  -50.984 1.00 0.00 ? 107 ARG B CD   4 
ATOM 10747 N NE   . ARG B 1 44 ? -1.339  -5.472  -50.078 1.00 0.00 ? 107 ARG B NE   4 
ATOM 10748 C CZ   . ARG B 1 44 ? -1.104  -4.238  -49.592 1.00 0.00 ? 107 ARG B CZ   4 
ATOM 10749 N NH1  . ARG B 1 44 ? -1.884  -3.237  -49.932 1.00 0.00 ? 107 ARG B NH1  4 
ATOM 10750 N NH2  . ARG B 1 44 ? -0.088  -4.033  -48.771 1.00 0.00 ? 107 ARG B NH2  4 
ATOM 10751 H H    . ARG B 1 44 ? -2.941  -10.327 -48.634 1.00 0.00 ? 107 ARG B H    4 
ATOM 10752 H HA   . ARG B 1 44 ? -3.394  -9.780  -51.544 1.00 0.00 ? 107 ARG B HA   4 
ATOM 10753 H HB2  . ARG B 1 44 ? -3.818  -7.895  -50.001 1.00 0.00 ? 107 ARG B HB2  4 
ATOM 10754 H HB3  . ARG B 1 44 ? -2.161  -8.022  -49.444 1.00 0.00 ? 107 ARG B HB3  4 
ATOM 10755 H HG2  . ARG B 1 44 ? -1.352  -7.475  -51.689 1.00 0.00 ? 107 ARG B HG2  4 
ATOM 10756 H HG3  . ARG B 1 44 ? -3.028  -7.381  -52.265 1.00 0.00 ? 107 ARG B HG3  4 
ATOM 10757 H HD2  . ARG B 1 44 ? -2.364  -5.170  -51.856 1.00 0.00 ? 107 ARG B HD2  4 
ATOM 10758 H HD3  . ARG B 1 44 ? -3.363  -5.634  -50.483 1.00 0.00 ? 107 ARG B HD3  4 
ATOM 10759 H HE   . ARG B 1 44 ? -0.733  -6.192  -49.803 1.00 0.00 ? 107 ARG B HE   4 
ATOM 10760 H HH11 . ARG B 1 44 ? -2.654  -3.389  -50.553 1.00 0.00 ? 107 ARG B HH11 4 
ATOM 10761 H HH12 . ARG B 1 44 ? -1.707  -2.312  -49.567 1.00 0.00 ? 107 ARG B HH12 4 
ATOM 10762 H HH21 . ARG B 1 44 ? 0.509   -4.794  -48.510 1.00 0.00 ? 107 ARG B HH21 4 
ATOM 10763 H HH22 . ARG B 1 44 ? 0.083   -3.117  -48.412 1.00 0.00 ? 107 ARG B HH22 4 
ATOM 10764 N N    . GLN B 1 45 ? -1.226  -11.216 -51.620 1.00 0.00 ? 108 GLN B N    4 
ATOM 10765 C CA   . GLN B 1 45 ? 0.083   -11.719 -52.017 1.00 0.00 ? 108 GLN B CA   4 
ATOM 10766 C C    . GLN B 1 45 ? 0.935   -10.615 -52.629 1.00 0.00 ? 108 GLN B C    4 
ATOM 10767 O O    . GLN B 1 45 ? 0.667   -10.152 -53.736 1.00 0.00 ? 108 GLN B O    4 
ATOM 10768 C CB   . GLN B 1 45 ? -0.064  -12.877 -53.008 1.00 0.00 ? 108 GLN B CB   4 
ATOM 10769 C CG   . GLN B 1 45 ? 1.254   -13.485 -53.456 1.00 0.00 ? 108 GLN B CG   4 
ATOM 10770 C CD   . GLN B 1 45 ? 1.982   -14.183 -52.323 1.00 0.00 ? 108 GLN B CD   4 
ATOM 10771 O OE1  . GLN B 1 45 ? 1.409   -15.017 -51.619 1.00 0.00 ? 108 GLN B OE1  4 
ATOM 10772 N NE2  . GLN B 1 45 ? 3.254   -13.846 -52.142 1.00 0.00 ? 108 GLN B NE2  4 
ATOM 10773 H H    . GLN B 1 45 ? -2.061  -11.735 -51.892 1.00 0.00 ? 108 GLN B H    4 
ATOM 10774 H HA   . GLN B 1 45 ? 0.582   -12.102 -51.137 1.00 0.00 ? 108 GLN B HA   4 
ATOM 10775 H HB2  . GLN B 1 45 ? -0.655  -13.658 -52.543 1.00 0.00 ? 108 GLN B HB2  4 
ATOM 10776 H HB3  . GLN B 1 45 ? -0.600  -12.506 -53.883 1.00 0.00 ? 108 GLN B HB3  4 
ATOM 10777 H HG2  . GLN B 1 45 ? 1.060   -14.213 -54.242 1.00 0.00 ? 108 GLN B HG2  4 
ATOM 10778 H HG3  . GLN B 1 45 ? 1.890   -12.697 -53.857 1.00 0.00 ? 108 GLN B HG3  4 
ATOM 10779 H HE21 . GLN B 1 45 ? 3.701   -13.159 -52.749 1.00 0.00 ? 108 GLN B HE21 4 
ATOM 10780 H HE22 . GLN B 1 45 ? 3.785   -14.286 -51.391 1.00 0.00 ? 108 GLN B HE22 4 
ATOM 10781 N N    . ASP B 1 46 ? 1.965   -10.197 -51.899 1.00 0.00 ? 109 ASP B N    4 
ATOM 10782 C CA   . ASP B 1 46 ? 2.763   -9.041  -52.293 1.00 0.00 ? 109 ASP B CA   4 
ATOM 10783 C C    . ASP B 1 46 ? 4.083   -9.001  -51.534 1.00 0.00 ? 109 ASP B C    4 
ATOM 10784 O O    . ASP B 1 46 ? 4.747   -10.023 -51.368 1.00 0.00 ? 109 ASP B O    4 
ATOM 10785 C CB   . ASP B 1 46 ? 1.987   -7.745  -52.051 1.00 0.00 ? 109 ASP B CB   4 
ATOM 10786 C CG   . ASP B 1 46 ? 2.411   -6.619  -52.986 1.00 0.00 ? 109 ASP B CG   4 
ATOM 10787 O OD1  . ASP B 1 46 ? 3.378   -6.789  -53.689 1.00 0.00 ? 109 ASP B OD1  4 
ATOM 10788 O OD2  . ASP B 1 46 ? 1.761   -5.601  -52.988 1.00 0.00 ? 109 ASP B OD2  4 
ATOM 10789 H H    . ASP B 1 46 ? 2.121   -10.609 -50.982 1.00 0.00 ? 109 ASP B H    4 
ATOM 10790 H HA   . ASP B 1 46 ? 2.979   -9.130  -53.358 1.00 0.00 ? 109 ASP B HA   4 
ATOM 10791 H HB2  . ASP B 1 46 ? 0.929   -7.942  -52.210 1.00 0.00 ? 109 ASP B HB2  4 
ATOM 10792 H HB3  . ASP B 1 46 ? 2.132   -7.417  -51.030 1.00 0.00 ? 109 ASP B HB3  4 
ATOM 10793 N N    . GLU B 1 47 ? 4.457   -7.811  -51.072 1.00 0.00 ? 110 GLU B N    4 
ATOM 10794 C CA   . GLU B 1 47 ? 5.716   -7.627  -50.361 1.00 0.00 ? 110 GLU B CA   4 
ATOM 10795 C C    . GLU B 1 47 ? 5.916   -8.709  -49.307 1.00 0.00 ? 110 GLU B C    4 
ATOM 10796 O O    . GLU B 1 47 ? 6.841   -9.514  -49.396 1.00 0.00 ? 110 GLU B O    4 
ATOM 10797 C CB   . GLU B 1 47 ? 5.760   -6.245  -49.703 1.00 0.00 ? 110 GLU B CB   4 
ATOM 10798 C CG   . GLU B 1 47 ? 5.830   -5.084  -50.684 1.00 0.00 ? 110 GLU B CG   4 
ATOM 10799 C CD   . GLU B 1 47 ? 5.751   -3.742  -50.011 1.00 0.00 ? 110 GLU B CD   4 
ATOM 10800 O OE1  . GLU B 1 47 ? 5.483   -3.706  -48.835 1.00 0.00 ? 110 GLU B OE1  4 
ATOM 10801 O OE2  . GLU B 1 47 ? 5.958   -2.755  -50.673 1.00 0.00 ? 110 GLU B OE2  4 
ATOM 10802 H H    . GLU B 1 47 ? 3.867   -6.999  -51.256 1.00 0.00 ? 110 GLU B H    4 
ATOM 10803 H HA   . GLU B 1 47 ? 6.518   -7.702  -51.070 1.00 0.00 ? 110 GLU B HA   4 
ATOM 10804 H HB2  . GLU B 1 47 ? 4.870   -6.125  -49.086 1.00 0.00 ? 110 GLU B HB2  4 
ATOM 10805 H HB3  . GLU B 1 47 ? 6.642   -6.197  -49.062 1.00 0.00 ? 110 GLU B HB3  4 
ATOM 10806 H HG2  . GLU B 1 47 ? 6.739   -5.137  -51.235 1.00 0.00 ? 110 GLU B HG2  4 
ATOM 10807 H HG3  . GLU B 1 47 ? 4.990   -5.174  -51.373 1.00 0.00 ? 110 GLU B HG3  4 
ATOM 10808 N N    . HIS B 1 48 ? 5.043   -8.720  -48.306 1.00 0.00 ? 111 HIS B N    4 
ATOM 10809 C CA   . HIS B 1 48 ? 5.170   -9.647  -47.187 1.00 0.00 ? 111 HIS B CA   4 
ATOM 10810 C C    . HIS B 1 48 ? 4.057   -10.686 -47.204 1.00 0.00 ? 111 HIS B C    4 
ATOM 10811 O O    . HIS B 1 48 ? 3.075   -10.571 -46.469 1.00 0.00 ? 111 HIS B O    4 
ATOM 10812 C CB   . HIS B 1 48 ? 5.152   -8.894  -45.855 1.00 0.00 ? 111 HIS B CB   4 
ATOM 10813 C CG   . HIS B 1 48 ? 6.227   -7.857  -45.734 1.00 0.00 ? 111 HIS B CG   4 
ATOM 10814 N ND1  . HIS B 1 48 ? 6.046   -6.550  -46.137 1.00 0.00 ? 111 HIS B ND1  4 
ATOM 10815 C CD2  . HIS B 1 48 ? 7.492   -7.936  -45.260 1.00 0.00 ? 111 HIS B CD2  4 
ATOM 10816 C CE1  . HIS B 1 48 ? 7.158   -5.868  -45.914 1.00 0.00 ? 111 HIS B CE1  4 
ATOM 10817 N NE2  . HIS B 1 48 ? 8.048   -6.685  -45.382 1.00 0.00 ? 111 HIS B NE2  4 
ATOM 10818 H H    . HIS B 1 48 ? 4.305   -8.015  -48.277 1.00 0.00 ? 111 HIS B H    4 
ATOM 10819 H HA   . HIS B 1 48 ? 6.119   -10.162 -47.262 1.00 0.00 ? 111 HIS B HA   4 
ATOM 10820 H HB2  . HIS B 1 48 ? 4.213   -8.362  -45.856 1.00 0.00 ? 111 HIS B HB2  4 
ATOM 10821 H HB3  . HIS B 1 48 ? 5.169   -9.573  -45.009 1.00 0.00 ? 111 HIS B HB3  4 
ATOM 10822 H HD2  . HIS B 1 48 ? 8.057   -8.839  -45.132 1.00 0.00 ? 111 HIS B HD2  4 
ATOM 10823 H HE1  . HIS B 1 48 ? 7.307   -4.820  -46.129 1.00 0.00 ? 111 HIS B HE1  4 
ATOM 10824 H HE2  . HIS B 1 48 ? 8.987   -6.431  -45.109 1.00 0.00 ? 111 HIS B HE2  4 
ATOM 10825 N N    . GLY B 1 49 ? 4.215   -11.702 -48.045 1.00 0.00 ? 112 GLY B N    4 
ATOM 10826 C CA   . GLY B 1 49 ? 3.207   -12.747 -48.182 1.00 0.00 ? 112 GLY B CA   4 
ATOM 10827 C C    . GLY B 1 49 ? 1.845   -12.159 -48.523 1.00 0.00 ? 112 GLY B C    4 
ATOM 10828 O O    . GLY B 1 49 ? 1.731   -11.295 -49.393 1.00 0.00 ? 112 GLY B O    4 
ATOM 10829 H H    . GLY B 1 49 ? 5.054   -11.737 -48.626 1.00 0.00 ? 112 GLY B H    4 
ATOM 10830 H HA2  . GLY B 1 49 ? 3.509   -13.416 -48.988 1.00 0.00 ? 112 GLY B HA2  4 
ATOM 10831 H HA3  . GLY B 1 49 ? 3.122   -13.308 -47.283 1.00 0.00 ? 112 GLY B HA3  4 
ATOM 10832 N N    . PHE B 1 50 ? 0.813   -12.629 -47.830 1.00 0.00 ? 113 PHE B N    4 
ATOM 10833 C CA   . PHE B 1 50 ? -0.516  -12.041 -47.941 1.00 0.00 ? 113 PHE B CA   4 
ATOM 10834 C C    . PHE B 1 50 ? -0.703  -10.916 -46.930 1.00 0.00 ? 113 PHE B C    4 
ATOM 10835 O O    . PHE B 1 50 ? -0.429  -11.084 -45.741 1.00 0.00 ? 113 PHE B O    4 
ATOM 10836 C CB   . PHE B 1 50 ? -1.592  -13.106 -47.730 1.00 0.00 ? 113 PHE B CB   4 
ATOM 10837 C CG   . PHE B 1 50 ? -1.625  -14.153 -48.807 1.00 0.00 ? 113 PHE B CG   4 
ATOM 10838 C CD1  . PHE B 1 50 ? -2.319  -13.934 -49.988 1.00 0.00 ? 113 PHE B CD1  4 
ATOM 10839 C CD2  . PHE B 1 50 ? -0.961  -15.359 -48.643 1.00 0.00 ? 113 PHE B CD2  4 
ATOM 10840 C CE1  . PHE B 1 50 ? -2.352  -14.896 -50.977 1.00 0.00 ? 113 PHE B CE1  4 
ATOM 10841 C CE2  . PHE B 1 50 ? -0.992  -16.324 -49.631 1.00 0.00 ? 113 PHE B CE2  4 
ATOM 10842 C CZ   . PHE B 1 50 ? -1.687  -16.093 -50.799 1.00 0.00 ? 113 PHE B CZ   4 
ATOM 10843 H H    . PHE B 1 50 ? 0.980   -13.331 -47.109 1.00 0.00 ? 113 PHE B H    4 
ATOM 10844 H HA   . PHE B 1 50 ? -0.633  -11.629 -48.946 1.00 0.00 ? 113 PHE B HA   4 
ATOM 10845 H HB2  . PHE B 1 50 ? -1.446  -13.580 -46.786 1.00 0.00 ? 113 PHE B HB2  4 
ATOM 10846 H HB3  . PHE B 1 50 ? -2.560  -12.609 -47.716 1.00 0.00 ? 113 PHE B HB3  4 
ATOM 10847 H HD1  . PHE B 1 50 ? -2.841  -12.999 -50.132 1.00 0.00 ? 113 PHE B HD1  4 
ATOM 10848 H HD2  . PHE B 1 50 ? -0.414  -15.543 -47.730 1.00 0.00 ? 113 PHE B HD2  4 
ATOM 10849 H HE1  . PHE B 1 50 ? -2.896  -14.712 -51.892 1.00 0.00 ? 113 PHE B HE1  4 
ATOM 10850 H HE2  . PHE B 1 50 ? -0.473  -17.260 -49.489 1.00 0.00 ? 113 PHE B HE2  4 
ATOM 10851 H HZ   . PHE B 1 50 ? -1.749  -16.863 -51.553 1.00 0.00 ? 113 PHE B HZ   4 
ATOM 10852 N N    . ILE B 1 51 ? -1.173  -9.769  -47.408 1.00 0.00 ? 114 ILE B N    4 
ATOM 10853 C CA   . ILE B 1 51 ? -1.369  -8.605  -46.552 1.00 0.00 ? 114 ILE B CA   4 
ATOM 10854 C C    . ILE B 1 51 ? -2.834  -8.185  -46.520 1.00 0.00 ? 114 ILE B C    4 
ATOM 10855 O O    . ILE B 1 51 ? -3.317  -7.513  -47.429 1.00 0.00 ? 114 ILE B O    4 
ATOM 10856 C CB   . ILE B 1 51 ? -0.506  -7.421  -47.028 1.00 0.00 ? 114 ILE B CB   4 
ATOM 10857 C CG1  . ILE B 1 51 ? 0.965   -7.833  -47.108 1.00 0.00 ? 114 ILE B CG1  4 
ATOM 10858 C CG2  . ILE B 1 51 ? -0.679  -6.230  -46.097 1.00 0.00 ? 114 ILE B CG2  4 
ATOM 10859 C CD1  . ILE B 1 51 ? 1.361   -8.430  -48.440 1.00 0.00 ? 114 ILE B CD1  4 
ATOM 10860 H H    . ILE B 1 51 ? -1.380  -9.693  -48.403 1.00 0.00 ? 114 ILE B H    4 
ATOM 10861 H HA   . ILE B 1 51 ? -1.089  -8.839  -45.537 1.00 0.00 ? 114 ILE B HA   4 
ATOM 10862 H HB   . ILE B 1 51 ? -0.837  -7.113  -48.012 1.00 0.00 ? 114 ILE B HB   4 
ATOM 10863 H HG12 . ILE B 1 51 ? 1.613   -6.973  -46.941 1.00 0.00 ? 114 ILE B HG12 4 
ATOM 10864 H HG13 . ILE B 1 51 ? 1.172   -8.579  -46.349 1.00 0.00 ? 114 ILE B HG13 4 
ATOM 10865 H HG21 . ILE B 1 51 ? -1.626  -5.750  -46.330 1.00 0.00 ? 114 ILE B HG21 4 
ATOM 10866 H HG22 . ILE B 1 51 ? 0.124   -5.506  -46.236 1.00 0.00 ? 114 ILE B HG22 4 
ATOM 10867 H HG23 . ILE B 1 51 ? -0.695  -6.567  -45.063 1.00 0.00 ? 114 ILE B HG23 4 
ATOM 10868 H HD11 . ILE B 1 51 ? 0.898   -9.401  -48.537 1.00 0.00 ? 114 ILE B HD11 4 
ATOM 10869 H HD12 . ILE B 1 51 ? 2.445   -8.535  -48.487 1.00 0.00 ? 114 ILE B HD12 4 
ATOM 10870 H HD13 . ILE B 1 51 ? 1.021   -7.781  -49.247 1.00 0.00 ? 114 ILE B HD13 4 
ATOM 10871 N N    . SER B 1 52 ? -3.536  -8.588  -45.467 1.00 0.00 ? 115 SER B N    4 
ATOM 10872 C CA   . SER B 1 52 ? -4.917  -8.169  -45.261 1.00 0.00 ? 115 SER B CA   4 
ATOM 10873 C C    . SER B 1 52 ? -4.991  -6.923  -44.387 1.00 0.00 ? 115 SER B C    4 
ATOM 10874 O O    . SER B 1 52 ? -4.999  -7.014  -43.160 1.00 0.00 ? 115 SER B O    4 
ATOM 10875 C CB   . SER B 1 52 ? -5.714  -9.292  -44.624 1.00 0.00 ? 115 SER B CB   4 
ATOM 10876 O OG   . SER B 1 52 ? -7.040  -8.899  -44.395 1.00 0.00 ? 115 SER B OG   4 
ATOM 10877 H H    . SER B 1 52 ? -3.071  -9.131  -44.740 1.00 0.00 ? 115 SER B H    4 
ATOM 10878 H HA   . SER B 1 52 ? -5.355  -7.947  -46.222 1.00 0.00 ? 115 SER B HA   4 
ATOM 10879 H HB2  . SER B 1 52 ? -5.724  -10.145 -45.294 1.00 0.00 ? 115 SER B HB2  4 
ATOM 10880 H HB3  . SER B 1 52 ? -5.255  -9.580  -43.705 1.00 0.00 ? 115 SER B HB3  4 
ATOM 10881 H HG   . SER B 1 52 ? -7.357  -9.358  -43.613 1.00 0.00 ? 115 SER B HG   4 
ATOM 10882 N N    . ARG B 1 53 ? -5.043  -5.761  -45.027 1.00 0.00 ? 116 ARG B N    4 
ATOM 10883 C CA   . ARG B 1 53 ? -4.745  -4.500  -44.355 1.00 0.00 ? 116 ARG B CA   4 
ATOM 10884 C C    . ARG B 1 53 ? -5.928  -3.544  -44.430 1.00 0.00 ? 116 ARG B C    4 
ATOM 10885 O O    . ARG B 1 53 ? -6.191  -2.945  -45.473 1.00 0.00 ? 116 ARG B O    4 
ATOM 10886 C CB   . ARG B 1 53 ? -3.523  -3.840  -44.973 1.00 0.00 ? 116 ARG B CB   4 
ATOM 10887 C CG   . ARG B 1 53 ? -3.180  -2.473  -44.405 1.00 0.00 ? 116 ARG B CG   4 
ATOM 10888 C CD   . ARG B 1 53 ? -1.930  -1.928  -44.998 1.00 0.00 ? 116 ARG B CD   4 
ATOM 10889 N NE   . ARG B 1 53 ? -0.758  -2.680  -44.578 1.00 0.00 ? 116 ARG B NE   4 
ATOM 10890 C CZ   . ARG B 1 53 ? 0.506   -2.398  -44.950 1.00 0.00 ? 116 ARG B CZ   4 
ATOM 10891 N NH1  . ARG B 1 53 ? 0.744   -1.380  -45.746 1.00 0.00 ? 116 ARG B NH1  4 
ATOM 10892 N NH2  . ARG B 1 53 ? 1.506   -3.142  -44.510 1.00 0.00 ? 116 ARG B NH2  4 
ATOM 10893 H H    . ARG B 1 53 ? -4.984  -5.778  -46.046 1.00 0.00 ? 116 ARG B H    4 
ATOM 10894 H HA   . ARG B 1 53 ? -4.550  -4.673  -43.324 1.00 0.00 ? 116 ARG B HA   4 
ATOM 10895 H HB2  . ARG B 1 53 ? -2.677  -4.487  -44.772 1.00 0.00 ? 116 ARG B HB2  4 
ATOM 10896 H HB3  . ARG B 1 53 ? -3.661  -3.758  -46.051 1.00 0.00 ? 116 ARG B HB3  4 
ATOM 10897 H HG2  . ARG B 1 53 ? -3.998  -1.793  -44.638 1.00 0.00 ? 116 ARG B HG2  4 
ATOM 10898 H HG3  . ARG B 1 53 ? -3.067  -2.536  -43.333 1.00 0.00 ? 116 ARG B HG3  4 
ATOM 10899 H HD2  . ARG B 1 53 ? -2.004  -2.014  -46.082 1.00 0.00 ? 116 ARG B HD2  4 
ATOM 10900 H HD3  . ARG B 1 53 ? -1.815  -0.885  -44.740 1.00 0.00 ? 116 ARG B HD3  4 
ATOM 10901 H HE   . ARG B 1 53 ? -0.897  -3.440  -43.973 1.00 0.00 ? 116 ARG B HE   4 
ATOM 10902 H HH11 . ARG B 1 53 ? -0.010  -0.815  -46.077 1.00 0.00 ? 116 ARG B HH11 4 
ATOM 10903 H HH12 . ARG B 1 53 ? 1.692   -1.169  -46.025 1.00 0.00 ? 116 ARG B HH12 4 
ATOM 10904 H HH21 . ARG B 1 53 ? 1.327   -3.915  -43.902 1.00 0.00 ? 116 ARG B HH21 4 
ATOM 10905 H HH22 . ARG B 1 53 ? 2.441   -2.930  -44.790 1.00 0.00 ? 116 ARG B HH22 4 
ATOM 10906 N N    . GLU B 1 54 ? -6.640  -3.403  -43.316 1.00 0.00 ? 117 GLU B N    4 
ATOM 10907 C CA   . GLU B 1 54 ? -7.736  -2.447  -43.221 1.00 0.00 ? 117 GLU B CA   4 
ATOM 10908 C C    . GLU B 1 54 ? -7.309  -1.192  -42.470 1.00 0.00 ? 117 GLU B C    4 
ATOM 10909 O O    . GLU B 1 54 ? -6.893  -1.262  -41.314 1.00 0.00 ? 117 GLU B O    4 
ATOM 10910 C CB   . GLU B 1 54 ? -8.942  -3.082  -42.527 1.00 0.00 ? 117 GLU B CB   4 
ATOM 10911 C CG   . GLU B 1 54 ? -10.120 -2.140  -42.327 1.00 0.00 ? 117 GLU B CG   4 
ATOM 10912 C CD   . GLU B 1 54 ? -11.281 -2.796  -41.631 1.00 0.00 ? 117 GLU B CD   4 
ATOM 10913 O OE1  . GLU B 1 54 ? -11.211 -3.976  -41.384 1.00 0.00 ? 117 GLU B OE1  4 
ATOM 10914 O OE2  . GLU B 1 54 ? -12.237 -2.115  -41.344 1.00 0.00 ? 117 GLU B OE2  4 
ATOM 10915 H H    . GLU B 1 54 ? -6.355  -3.917  -42.481 1.00 0.00 ? 117 GLU B H    4 
ATOM 10916 H HA   . GLU B 1 54 ? -8.018  -2.140  -44.210 1.00 0.00 ? 117 GLU B HA   4 
ATOM 10917 H HB2  . GLU B 1 54 ? -9.284  -3.923  -43.133 1.00 0.00 ? 117 GLU B HB2  4 
ATOM 10918 H HB3  . GLU B 1 54 ? -8.624  -3.456  -41.554 1.00 0.00 ? 117 GLU B HB3  4 
ATOM 10919 H HG2  . GLU B 1 54 ? -9.790  -1.309  -41.707 1.00 0.00 ? 117 GLU B HG2  4 
ATOM 10920 H HG3  . GLU B 1 54 ? -10.454 -1.749  -43.278 1.00 0.00 ? 117 GLU B HG3  4 
ATOM 10921 N N    . PHE B 1 55 ? -7.412  -0.046  -43.135 1.00 0.00 ? 118 PHE B N    4 
ATOM 10922 C CA   . PHE B 1 55 ? -6.875  1.199   -42.600 1.00 0.00 ? 118 PHE B CA   4 
ATOM 10923 C C    . PHE B 1 55 ? -7.947  2.277   -42.531 1.00 0.00 ? 118 PHE B C    4 
ATOM 10924 O O    . PHE B 1 55 ? -9.018  2.141   -43.125 1.00 0.00 ? 118 PHE B O    4 
ATOM 10925 C CB   . PHE B 1 55 ? -5.707  1.689   -43.460 1.00 0.00 ? 118 PHE B CB   4 
ATOM 10926 C CG   . PHE B 1 55 ? -6.108  2.096   -44.849 1.00 0.00 ? 118 PHE B CG   4 
ATOM 10927 C CD1  . PHE B 1 55 ? -6.610  3.365   -45.097 1.00 0.00 ? 118 PHE B CD1  4 
ATOM 10928 C CD2  . PHE B 1 55 ? -5.981  1.213   -45.910 1.00 0.00 ? 118 PHE B CD2  4 
ATOM 10929 C CE1  . PHE B 1 55 ? -6.979  3.740   -46.377 1.00 0.00 ? 118 PHE B CE1  4 
ATOM 10930 C CE2  . PHE B 1 55 ? -6.346  1.584   -47.188 1.00 0.00 ? 118 PHE B CE2  4 
ATOM 10931 C CZ   . PHE B 1 55 ? -6.847  2.851   -47.421 1.00 0.00 ? 118 PHE B CZ   4 
ATOM 10932 H H    . PHE B 1 55 ? -7.737  -0.069  -44.093 1.00 0.00 ? 118 PHE B H    4 
ATOM 10933 H HA   . PHE B 1 55 ? -6.531  1.045   -41.603 1.00 0.00 ? 118 PHE B HA   4 
ATOM 10934 H HB2  . PHE B 1 55 ? -5.243  2.544   -42.971 1.00 0.00 ? 118 PHE B HB2  4 
ATOM 10935 H HB3  . PHE B 1 55 ? -4.980  0.888   -43.530 1.00 0.00 ? 118 PHE B HB3  4 
ATOM 10936 H HD1  . PHE B 1 55 ? -6.752  4.041   -44.280 1.00 0.00 ? 118 PHE B HD1  4 
ATOM 10937 H HD2  . PHE B 1 55 ? -5.589  0.221   -45.730 1.00 0.00 ? 118 PHE B HD2  4 
ATOM 10938 H HE1  . PHE B 1 55 ? -7.360  4.721   -46.550 1.00 0.00 ? 118 PHE B HE1  4 
ATOM 10939 H HE2  . PHE B 1 55 ? -6.242  0.888   -48.004 1.00 0.00 ? 118 PHE B HE2  4 
ATOM 10940 H HZ   . PHE B 1 55 ? -7.195  3.121   -48.407 1.00 0.00 ? 118 PHE B HZ   4 
ATOM 10941 N N    . HIS B 1 56 ? -7.657  3.349   -41.803 1.00 0.00 ? 119 HIS B N    4 
ATOM 10942 C CA   . HIS B 1 56 ? -8.598  4.453   -41.653 1.00 0.00 ? 119 HIS B CA   4 
ATOM 10943 C C    . HIS B 1 56 ? -7.869  5.782   -41.503 1.00 0.00 ? 119 HIS B C    4 
ATOM 10944 O O    . HIS B 1 56 ? -7.687  6.280   -40.392 1.00 0.00 ? 119 HIS B O    4 
ATOM 10945 C CB   . HIS B 1 56 ? -9.510  4.225   -40.443 1.00 0.00 ? 119 HIS B CB   4 
ATOM 10946 C CG   . HIS B 1 56 ? -10.438 5.370   -40.166 1.00 0.00 ? 119 HIS B CG   4 
ATOM 10947 N ND1  . HIS B 1 56 ? -11.108 5.509   -38.969 1.00 0.00 ? 119 HIS B ND1  4 
ATOM 10948 C CD2  . HIS B 1 56 ? -10.806 6.424   -40.930 1.00 0.00 ? 119 HIS B CD2  4 
ATOM 10949 C CE1  . HIS B 1 56 ? -11.849 6.604   -39.009 1.00 0.00 ? 119 HIS B CE1  4 
ATOM 10950 N NE2  . HIS B 1 56 ? -11.683 7.176   -40.188 1.00 0.00 ? 119 HIS B NE2  4 
ATOM 10951 H H    . HIS B 1 56 ? -6.752  3.401   -41.333 1.00 0.00 ? 119 HIS B H    4 
ATOM 10952 H HA   . HIS B 1 56 ? -9.209  4.522   -42.526 1.00 0.00 ? 119 HIS B HA   4 
ATOM 10953 H HB2  . HIS B 1 56 ? -10.107 3.332   -40.622 1.00 0.00 ? 119 HIS B HB2  4 
ATOM 10954 H HB3  . HIS B 1 56 ? -8.891  4.060   -39.595 1.00 0.00 ? 119 HIS B HB3  4 
ATOM 10955 H HD1  . HIS B 1 56 ? -11.044 4.871   -38.175 1.00 0.00 ? 119 HIS B HD1  4 
ATOM 10956 H HD2  . HIS B 1 56 ? -10.319 6.738   -41.843 1.00 0.00 ? 119 HIS B HD2  4 
ATOM 10957 H HE1  . HIS B 1 56 ? -12.482 6.965   -38.213 1.00 0.00 ? 119 HIS B HE1  4 
ATOM 10958 H HE2  . HIS B 1 56 ? -12.130 8.029   -40.495 1.00 0.00 ? 119 HIS B HE2  4 
ATOM 10959 N N    . ARG B 1 57 ? -7.454  6.353   -42.627 1.00 0.00 ? 120 ARG B N    4 
ATOM 10960 C CA   . ARG B 1 57 ? -6.629  7.557   -42.617 1.00 0.00 ? 120 ARG B CA   4 
ATOM 10961 C C    . ARG B 1 57 ? -7.488  8.811   -42.539 1.00 0.00 ? 120 ARG B C    4 
ATOM 10962 O O    . ARG B 1 57 ? -7.764  9.451   -43.555 1.00 0.00 ? 120 ARG B O    4 
ATOM 10963 C CB   . ARG B 1 57 ? -5.757  7.619   -43.863 1.00 0.00 ? 120 ARG B CB   4 
ATOM 10964 C CG   . ARG B 1 57 ? -4.784  6.460   -44.023 1.00 0.00 ? 120 ARG B CG   4 
ATOM 10965 C CD   . ARG B 1 57 ? -3.979  6.587   -45.264 1.00 0.00 ? 120 ARG B CD   4 
ATOM 10966 N NE   . ARG B 1 57 ? -4.798  6.470   -46.458 1.00 0.00 ? 120 ARG B NE   4 
ATOM 10967 C CZ   . ARG B 1 57 ? -4.332  6.552   -47.718 1.00 0.00 ? 120 ARG B CZ   4 
ATOM 10968 N NH1  . ARG B 1 57 ? -3.050  6.748   -47.931 1.00 0.00 ? 120 ARG B NH1  4 
ATOM 10969 N NH2  . ARG B 1 57 ? -5.161  6.432   -48.740 1.00 0.00 ? 120 ARG B NH2  4 
ATOM 10970 H H    . ARG B 1 57 ? -7.628  5.879   -43.513 1.00 0.00 ? 120 ARG B H    4 
ATOM 10971 H HA   . ARG B 1 57 ? -5.986  7.543   -41.771 1.00 0.00 ? 120 ARG B HA   4 
ATOM 10972 H HB2  . ARG B 1 57 ? -6.375  7.619   -44.730 1.00 0.00 ? 120 ARG B HB2  4 
ATOM 10973 H HB3  . ARG B 1 57 ? -5.201  8.541   -43.837 1.00 0.00 ? 120 ARG B HB3  4 
ATOM 10974 H HG2  . ARG B 1 57 ? -4.126  6.437   -43.180 1.00 0.00 ? 120 ARG B HG2  4 
ATOM 10975 H HG3  . ARG B 1 57 ? -5.333  5.544   -44.057 1.00 0.00 ? 120 ARG B HG3  4 
ATOM 10976 H HD2  . ARG B 1 57 ? -3.481  7.545   -45.283 1.00 0.00 ? 120 ARG B HD2  4 
ATOM 10977 H HD3  . ARG B 1 57 ? -3.228  5.797   -45.281 1.00 0.00 ? 120 ARG B HD3  4 
ATOM 10978 H HE   . ARG B 1 57 ? -5.760  6.325   -46.335 1.00 0.00 ? 120 ARG B HE   4 
ATOM 10979 H HH11 . ARG B 1 57 ? -2.420  6.840   -47.159 1.00 0.00 ? 120 ARG B HH11 4 
ATOM 10980 H HH12 . ARG B 1 57 ? -2.700  6.806   -48.877 1.00 0.00 ? 120 ARG B HH12 4 
ATOM 10981 H HH21 . ARG B 1 57 ? -6.137  6.281   -48.580 1.00 0.00 ? 120 ARG B HH21 4 
ATOM 10982 H HH22 . ARG B 1 57 ? -4.812  6.491   -49.675 1.00 0.00 ? 120 ARG B HH22 4 
ATOM 10983 N N    . LYS B 1 58 ? -7.910  9.159   -41.328 1.00 0.00 ? 121 LYS B N    4 
ATOM 10984 C CA   . LYS B 1 58 ? -8.757  10.328  -41.118 1.00 0.00 ? 121 LYS B CA   4 
ATOM 10985 C C    . LYS B 1 58 ? -7.995  11.617  -41.388 1.00 0.00 ? 121 LYS B C    4 
ATOM 10986 O O    . LYS B 1 58 ? -7.548  12.292  -40.460 1.00 0.00 ? 121 LYS B O    4 
ATOM 10987 C CB   . LYS B 1 58 ? -9.316  10.333  -39.693 1.00 0.00 ? 121 LYS B CB   4 
ATOM 10988 C CG   . LYS B 1 58 ? -10.322 11.445  -39.418 1.00 0.00 ? 121 LYS B CG   4 
ATOM 10989 C CD   . LYS B 1 58 ? -10.786 11.422  -37.969 1.00 0.00 ? 121 LYS B CD   4 
ATOM 10990 C CE   . LYS B 1 58 ? -11.574 10.158  -37.659 1.00 0.00 ? 121 LYS B CE   4 
ATOM 10991 N NZ   . LYS B 1 58 ? -12.073 10.144  -36.258 1.00 0.00 ? 121 LYS B NZ   4 
ATOM 10992 H H    . LYS B 1 58 ? -7.663  8.582   -40.531 1.00 0.00 ? 121 LYS B H    4 
ATOM 10993 H HA   . LYS B 1 58 ? -9.570  10.287  -41.800 1.00 0.00 ? 121 LYS B HA   4 
ATOM 10994 H HB2  . LYS B 1 58 ? -9.792  9.379   -39.538 1.00 0.00 ? 121 LYS B HB2  4 
ATOM 10995 H HB3  . LYS B 1 58 ? -8.494  10.433  -39.016 1.00 0.00 ? 121 LYS B HB3  4 
ATOM 10996 H HG2  . LYS B 1 58 ? -9.801  12.378  -39.596 1.00 0.00 ? 121 LYS B HG2  4 
ATOM 10997 H HG3  . LYS B 1 58 ? -11.172 11.358  -40.088 1.00 0.00 ? 121 LYS B HG3  4 
ATOM 10998 H HD2  . LYS B 1 58 ? -9.916  11.466  -37.313 1.00 0.00 ? 121 LYS B HD2  4 
ATOM 10999 H HD3  . LYS B 1 58 ? -11.416 12.290  -37.783 1.00 0.00 ? 121 LYS B HD3  4 
ATOM 11000 H HE2  . LYS B 1 58 ? -12.428 10.105  -38.305 1.00 0.00 ? 121 LYS B HE2  4 
ATOM 11001 H HE3  . LYS B 1 58 ? -10.954 9.281   -37.798 1.00 0.00 ? 121 LYS B HE3  4 
ATOM 11002 H HZ1  . LYS B 1 58 ? -13.083 10.388  -36.244 1.00 0.00 ? 121 LYS B HZ1  4 
ATOM 11003 H HZ2  . LYS B 1 58 ? -11.539 10.845  -35.704 1.00 0.00 ? 121 LYS B HZ2  4 
ATOM 11004 H HZ3  . LYS B 1 58 ? -11.941 9.225   -35.860 1.00 0.00 ? 121 LYS B HZ3  4 
ATOM 11005 N N    . TYR B 1 59 ? -7.846  11.954  -42.665 1.00 0.00 ? 122 TYR B N    4 
ATOM 11006 C CA   . TYR B 1 59 ? -7.071  13.123  -43.064 1.00 0.00 ? 122 TYR B CA   4 
ATOM 11007 C C    . TYR B 1 59 ? -7.807  14.414  -42.734 1.00 0.00 ? 122 TYR B C    4 
ATOM 11008 O O    . TYR B 1 59 ? -8.822  14.736  -43.352 1.00 0.00 ? 122 TYR B O    4 
ATOM 11009 C CB   . TYR B 1 59 ? -6.745  13.065  -44.559 1.00 0.00 ? 122 TYR B CB   4 
ATOM 11010 C CG   . TYR B 1 59 ? -5.665  14.033  -44.985 1.00 0.00 ? 122 TYR B CG   4 
ATOM 11011 C CD1  . TYR B 1 59 ? -5.872  15.398  -44.867 1.00 0.00 ? 122 TYR B CD1  4 
ATOM 11012 C CD2  . TYR B 1 59 ? -4.467  13.553  -45.496 1.00 0.00 ? 122 TYR B CD2  4 
ATOM 11013 C CE1  . TYR B 1 59 ? -4.885  16.283  -45.256 1.00 0.00 ? 122 TYR B CE1  4 
ATOM 11014 C CE2  . TYR B 1 59 ? -3.480  14.439  -45.888 1.00 0.00 ? 122 TYR B CE2  4 
ATOM 11015 C CZ   . TYR B 1 59 ? -3.694  15.809  -45.766 1.00 0.00 ? 122 TYR B CZ   4 
ATOM 11016 O OH   . TYR B 1 59 ? -2.711  16.688  -46.155 1.00 0.00 ? 122 TYR B OH   4 
ATOM 11017 H H    . TYR B 1 59 ? -8.232  11.344  -43.384 1.00 0.00 ? 122 TYR B H    4 
ATOM 11018 H HA   . TYR B 1 59 ? -6.132  13.129  -42.540 1.00 0.00 ? 122 TYR B HA   4 
ATOM 11019 H HB2  . TYR B 1 59 ? -6.435  12.046  -44.793 1.00 0.00 ? 122 TYR B HB2  4 
ATOM 11020 H HB3  . TYR B 1 59 ? -7.628  13.285  -45.123 1.00 0.00 ? 122 TYR B HB3  4 
ATOM 11021 H HD1  . TYR B 1 59 ? -6.797  15.787  -44.494 1.00 0.00 ? 122 TYR B HD1  4 
ATOM 11022 H HD2  . TYR B 1 59 ? -4.321  12.513  -45.604 1.00 0.00 ? 122 TYR B HD2  4 
ATOM 11023 H HE1  . TYR B 1 59 ? -5.045  17.347  -45.162 1.00 0.00 ? 122 TYR B HE1  4 
ATOM 11024 H HE2  . TYR B 1 59 ? -2.549  14.068  -46.288 1.00 0.00 ? 122 TYR B HE2  4 
ATOM 11025 H HH   . TYR B 1 59 ? -2.747  17.451  -45.574 1.00 0.00 ? 122 TYR B HH   4 
ATOM 11026 N N    . ARG B 1 60 ? -7.293  15.150  -41.755 1.00 0.00 ? 123 ARG B N    4 
ATOM 11027 C CA   . ARG B 1 60 ? -8.089  16.142  -41.043 1.00 0.00 ? 123 ARG B CA   4 
ATOM 11028 C C    . ARG B 1 60 ? -7.928  17.525  -41.659 1.00 0.00 ? 123 ARG B C    4 
ATOM 11029 O O    . ARG B 1 60 ? -6.843  17.890  -42.114 1.00 0.00 ? 123 ARG B O    4 
ATOM 11030 C CB   . ARG B 1 60 ? -7.690  16.194  -39.575 1.00 0.00 ? 123 ARG B CB   4 
ATOM 11031 C CG   . ARG B 1 60 ? -8.492  17.170  -38.729 1.00 0.00 ? 123 ARG B CG   4 
ATOM 11032 C CD   . ARG B 1 60 ? -8.535  16.756  -37.302 1.00 0.00 ? 123 ARG B CD   4 
ATOM 11033 N NE   . ARG B 1 60 ? -9.224  17.731  -36.473 1.00 0.00 ? 123 ARG B NE   4 
ATOM 11034 C CZ   . ARG B 1 60 ? -9.376  17.630  -35.139 1.00 0.00 ? 123 ARG B CZ   4 
ATOM 11035 N NH1  . ARG B 1 60 ? -8.881  16.595  -34.498 1.00 0.00 ? 123 ARG B NH1  4 
ATOM 11036 N NH2  . ARG B 1 60 ? -10.020 18.575  -34.474 1.00 0.00 ? 123 ARG B NH2  4 
ATOM 11037 H H    . ARG B 1 60 ? -6.477  14.772  -41.272 1.00 0.00 ? 123 ARG B H    4 
ATOM 11038 H HA   . ARG B 1 60 ? -9.117  15.883  -41.079 1.00 0.00 ? 123 ARG B HA   4 
ATOM 11039 H HB2  . ARG B 1 60 ? -7.829  15.189  -39.175 1.00 0.00 ? 123 ARG B HB2  4 
ATOM 11040 H HB3  . ARG B 1 60 ? -6.631  16.453  -39.502 1.00 0.00 ? 123 ARG B HB3  4 
ATOM 11041 H HG2  . ARG B 1 60 ? -8.029  18.157  -38.794 1.00 0.00 ? 123 ARG B HG2  4 
ATOM 11042 H HG3  . ARG B 1 60 ? -9.506  17.236  -39.114 1.00 0.00 ? 123 ARG B HG3  4 
ATOM 11043 H HD2  . ARG B 1 60 ? -9.019  15.792  -37.201 1.00 0.00 ? 123 ARG B HD2  4 
ATOM 11044 H HD3  . ARG B 1 60 ? -7.509  16.672  -36.942 1.00 0.00 ? 123 ARG B HD3  4 
ATOM 11045 H HE   . ARG B 1 60 ? -9.612  18.513  -36.920 1.00 0.00 ? 123 ARG B HE   4 
ATOM 11046 H HH11 . ARG B 1 60 ? -8.393  15.881  -35.001 1.00 0.00 ? 123 ARG B HH11 4 
ATOM 11047 H HH12 . ARG B 1 60 ? -8.993  16.520  -33.497 1.00 0.00 ? 123 ARG B HH12 4 
ATOM 11048 H HH21 . ARG B 1 60 ? -10.395 19.363  -34.957 1.00 0.00 ? 123 ARG B HH21 4 
ATOM 11049 H HH22 . ARG B 1 60 ? -10.130 18.497  -33.482 1.00 0.00 ? 123 ARG B HH22 4 
ATOM 11050 N N    . ILE B 1 61 ? -9.015  18.291  -41.673 1.00 0.00 ? 124 ILE B N    4 
ATOM 11051 C CA   . ILE B 1 61 ? -9.015  19.606  -42.303 1.00 0.00 ? 124 ILE B CA   4 
ATOM 11052 C C    . ILE B 1 61 ? -9.105  20.715  -41.261 1.00 0.00 ? 124 ILE B C    4 
ATOM 11053 O O    . ILE B 1 61 ? -9.886  20.628  -40.315 1.00 0.00 ? 124 ILE B O    4 
ATOM 11054 C CB   . ILE B 1 61 ? -10.184 19.739  -43.295 1.00 0.00 ? 124 ILE B CB   4 
ATOM 11055 C CG1  . ILE B 1 61 ? -10.285 18.488  -44.171 1.00 0.00 ? 124 ILE B CG1  4 
ATOM 11056 C CG2  . ILE B 1 61 ? -10.012 20.981  -44.157 1.00 0.00 ? 124 ILE B CG2  4 
ATOM 11057 C CD1  . ILE B 1 61 ? -11.610 18.346  -44.883 1.00 0.00 ? 124 ILE B CD1  4 
ATOM 11058 H H    . ILE B 1 61 ? -9.880  17.924  -41.292 1.00 0.00 ? 124 ILE B H    4 
ATOM 11059 H HA   . ILE B 1 61 ? -8.116  19.695  -42.889 1.00 0.00 ? 124 ILE B HA   4 
ATOM 11060 H HB   . ILE B 1 61 ? -11.103 19.832  -42.724 1.00 0.00 ? 124 ILE B HB   4 
ATOM 11061 H HG12 . ILE B 1 61 ? -9.488  18.531  -44.915 1.00 0.00 ? 124 ILE B HG12 4 
ATOM 11062 H HG13 . ILE B 1 61 ? -10.127 17.598  -43.559 1.00 0.00 ? 124 ILE B HG13 4 
ATOM 11063 H HG21 . ILE B 1 61 ? -9.999  21.878  -43.542 1.00 0.00 ? 124 ILE B HG21 4 
ATOM 11064 H HG22 . ILE B 1 61 ? -10.809 21.022  -44.876 1.00 0.00 ? 124 ILE B HG22 4 
ATOM 11065 H HG23 . ILE B 1 61 ? -9.078  20.893  -44.698 1.00 0.00 ? 124 ILE B HG23 4 
ATOM 11066 H HD11 . ILE B 1 61 ? -11.455 18.234  -45.958 1.00 0.00 ? 124 ILE B HD11 4 
ATOM 11067 H HD12 . ILE B 1 61 ? -12.131 17.467  -44.503 1.00 0.00 ? 124 ILE B HD12 4 
ATOM 11068 H HD13 . ILE B 1 61 ? -12.217 19.233  -44.697 1.00 0.00 ? 124 ILE B HD13 4 
ATOM 11069 N N    . PRO B 1 62 ? -8.301  21.757  -41.444 1.00 0.00 ? 125 PRO B N    4 
ATOM 11070 C CA   . PRO B 1 62 ? -8.492  23.007  -40.718 1.00 0.00 ? 125 PRO B CA   4 
ATOM 11071 C C    . PRO B 1 62 ? -9.953  23.436  -40.735 1.00 0.00 ? 125 PRO B C    4 
ATOM 11072 O O    . PRO B 1 62 ? -10.702 23.091  -41.651 1.00 0.00 ? 125 PRO B O    4 
ATOM 11073 C CB   . PRO B 1 62 ? -7.605  23.992  -41.490 1.00 0.00 ? 125 PRO B CB   4 
ATOM 11074 C CG   . PRO B 1 62 ? -6.538  23.135  -42.082 1.00 0.00 ? 125 PRO B CG   4 
ATOM 11075 C CD   . PRO B 1 62 ? -7.253  21.872  -42.485 1.00 0.00 ? 125 PRO B CD   4 
ATOM 11076 H HA   . PRO B 1 62 ? -8.128  22.887  -39.701 1.00 0.00 ? 125 PRO B HA   4 
ATOM 11077 H HB2  . PRO B 1 62 ? -8.182  24.487  -42.280 1.00 0.00 ? 125 PRO B HB2  4 
ATOM 11078 H HB3  . PRO B 1 62 ? -7.166  24.730  -40.818 1.00 0.00 ? 125 PRO B HB3  4 
ATOM 11079 H HG2  . PRO B 1 62 ? -6.098  23.629  -42.956 1.00 0.00 ? 125 PRO B HG2  4 
ATOM 11080 H HG3  . PRO B 1 62 ? -5.769  22.918  -41.341 1.00 0.00 ? 125 PRO B HG3  4 
ATOM 11081 H HD2  . PRO B 1 62 ? -7.637  21.963  -43.492 1.00 0.00 ? 125 PRO B HD2  4 
ATOM 11082 H HD3  . PRO B 1 62 ? -6.566  21.031  -42.397 1.00 0.00 ? 125 PRO B HD3  4 
ATOM 11083 N N    . ALA B 1 63 ? -10.355 24.190  -39.717 1.00 0.00 ? 126 ALA B N    4 
ATOM 11084 C CA   . ALA B 1 63 ? -11.769 24.439  -39.458 1.00 0.00 ? 126 ALA B CA   4 
ATOM 11085 C C    . ALA B 1 63 ? -12.326 25.482  -40.419 1.00 0.00 ? 126 ALA B C    4 
ATOM 11086 O O    . ALA B 1 63 ? -13.463 25.930  -40.272 1.00 0.00 ? 126 ALA B O    4 
ATOM 11087 C CB   . ALA B 1 63 ? -11.975 24.883  -38.018 1.00 0.00 ? 126 ALA B CB   4 
ATOM 11088 H H    . ALA B 1 63 ? -9.686  24.400  -38.976 1.00 0.00 ? 126 ALA B H    4 
ATOM 11089 H HA   . ALA B 1 63 ? -12.333 23.520  -39.605 1.00 0.00 ? 126 ALA B HA   4 
ATOM 11090 H HB1  . ALA B 1 63 ? -13.019 25.155  -37.864 1.00 0.00 ? 126 ALA B HB1  4 
ATOM 11091 H HB2  . ALA B 1 63 ? -11.340 25.743  -37.804 1.00 0.00 ? 126 ALA B HB2  4 
ATOM 11092 H HB3  . ALA B 1 63 ? -11.712 24.062  -37.353 1.00 0.00 ? 126 ALA B HB3  4 
ATOM 11093 N N    . ASP B 1 64 ? -11.520 25.867  -41.403 1.00 0.00 ? 127 ASP B N    4 
ATOM 11094 C CA   . ASP B 1 64 ? -11.927 26.867  -42.381 1.00 0.00 ? 127 ASP B CA   4 
ATOM 11095 C C    . ASP B 1 64 ? -12.734 26.238  -43.510 1.00 0.00 ? 127 ASP B C    4 
ATOM 11096 O O    . ASP B 1 64 ? -13.293 26.940  -44.351 1.00 0.00 ? 127 ASP B O    4 
ATOM 11097 C CB   . ASP B 1 64 ? -10.702 27.582  -42.958 1.00 0.00 ? 127 ASP B CB   4 
ATOM 11098 C CG   . ASP B 1 64 ? -10.004 28.476  -41.942 1.00 0.00 ? 127 ASP B CG   4 
ATOM 11099 O OD1  . ASP B 1 64 ? -10.629 28.847  -40.977 1.00 0.00 ? 127 ASP B OD1  4 
ATOM 11100 O OD2  . ASP B 1 64 ? -8.852  28.781  -42.142 1.00 0.00 ? 127 ASP B OD2  4 
ATOM 11101 H H    . ASP B 1 64 ? -10.586 25.461  -41.471 1.00 0.00 ? 127 ASP B H    4 
ATOM 11102 H HA   . ASP B 1 64 ? -12.544 27.618  -41.887 1.00 0.00 ? 127 ASP B HA   4 
ATOM 11103 H HB2  . ASP B 1 64 ? -9.992  26.814  -43.267 1.00 0.00 ? 127 ASP B HB2  4 
ATOM 11104 H HB3  . ASP B 1 64 ? -10.977 28.159  -43.830 1.00 0.00 ? 127 ASP B HB3  4 
ATOM 11105 N N    . VAL B 1 65 ? -12.790 24.911  -43.520 1.00 0.00 ? 128 VAL B N    4 
ATOM 11106 C CA   . VAL B 1 65 ? -13.371 24.179  -44.640 1.00 0.00 ? 128 VAL B CA   4 
ATOM 11107 C C    . VAL B 1 65 ? -14.892 24.188  -44.575 1.00 0.00 ? 128 VAL B C    4 
ATOM 11108 O O    . VAL B 1 65 ? -15.477 24.248  -43.495 1.00 0.00 ? 128 VAL B O    4 
ATOM 11109 C CB   . VAL B 1 65 ? -12.870 22.721  -44.642 1.00 0.00 ? 128 VAL B CB   4 
ATOM 11110 C CG1  . VAL B 1 65 ? -13.415 21.968  -43.439 1.00 0.00 ? 128 VAL B CG1  4 
ATOM 11111 C CG2  . VAL B 1 65 ? -13.279 22.036  -45.937 1.00 0.00 ? 128 VAL B CG2  4 
ATOM 11112 H H    . VAL B 1 65 ? -12.283 24.390  -42.807 1.00 0.00 ? 128 VAL B H    4 
ATOM 11113 H HA   . VAL B 1 65 ? -13.088 24.638  -45.564 1.00 0.00 ? 128 VAL B HA   4 
ATOM 11114 H HB   . VAL B 1 65 ? -11.802 22.778  -44.586 1.00 0.00 ? 128 VAL B HB   4 
ATOM 11115 H HG11 . VAL B 1 65 ? -14.492 21.837  -43.544 1.00 0.00 ? 128 VAL B HG11 4 
ATOM 11116 H HG12 . VAL B 1 65 ? -13.203 22.528  -42.528 1.00 0.00 ? 128 VAL B HG12 4 
ATOM 11117 H HG13 . VAL B 1 65 ? -12.943 20.998  -43.381 1.00 0.00 ? 128 VAL B HG13 4 
ATOM 11118 H HG21 . VAL B 1 65 ? -14.352 21.858  -45.914 1.00 0.00 ? 128 VAL B HG21 4 
ATOM 11119 H HG22 . VAL B 1 65 ? -13.043 22.667  -46.791 1.00 0.00 ? 128 VAL B HG22 4 
ATOM 11120 H HG23 . VAL B 1 65 ? -12.765 21.090  -46.030 1.00 0.00 ? 128 VAL B HG23 4 
ATOM 11121 N N    . ASP B 1 66 ? -15.529 24.131  -45.740 1.00 0.00 ? 129 ASP B N    4 
ATOM 11122 C CA   . ASP B 1 66 ? -16.959 23.864  -45.819 1.00 0.00 ? 129 ASP B CA   4 
ATOM 11123 C C    . ASP B 1 66 ? -17.229 22.413  -46.204 1.00 0.00 ? 129 ASP B C    4 
ATOM 11124 O O    . ASP B 1 66 ? -16.981 22.008  -47.340 1.00 0.00 ? 129 ASP B O    4 
ATOM 11125 C CB   . ASP B 1 66 ? -17.627 24.798  -46.829 1.00 0.00 ? 129 ASP B CB   4 
ATOM 11126 C CG   . ASP B 1 66 ? -19.139 24.628  -46.886 1.00 0.00 ? 129 ASP B CG   4 
ATOM 11127 O OD1  . ASP B 1 66 ? -19.630 23.671  -46.338 1.00 0.00 ? 129 ASP B OD1  4 
ATOM 11128 O OD2  . ASP B 1 66 ? -19.787 25.457  -47.480 1.00 0.00 ? 129 ASP B OD2  4 
ATOM 11129 H H    . ASP B 1 66 ? -14.972 24.049  -46.591 1.00 0.00 ? 129 ASP B H    4 
ATOM 11130 H HA   . ASP B 1 66 ? -17.406 24.106  -44.861 1.00 0.00 ? 129 ASP B HA   4 
ATOM 11131 H HB2  . ASP B 1 66 ? -17.400 25.833  -46.571 1.00 0.00 ? 129 ASP B HB2  4 
ATOM 11132 H HB3  . ASP B 1 66 ? -17.214 24.580  -47.808 1.00 0.00 ? 129 ASP B HB3  4 
ATOM 11133 N N    . PRO B 1 67 ? -17.737 21.637  -45.252 1.00 0.00 ? 130 PRO B N    4 
ATOM 11134 C CA   . PRO B 1 67 ? -17.907 20.202  -45.444 1.00 0.00 ? 130 PRO B CA   4 
ATOM 11135 C C    . PRO B 1 67 ? -18.742 19.909  -46.684 1.00 0.00 ? 130 PRO B C    4 
ATOM 11136 O O    . PRO B 1 67 ? -18.548 18.889  -47.345 1.00 0.00 ? 130 PRO B O    4 
ATOM 11137 C CB   . PRO B 1 67 ? -18.625 19.767  -44.163 1.00 0.00 ? 130 PRO B CB   4 
ATOM 11138 C CG   . PRO B 1 67 ? -18.128 20.714  -43.126 1.00 0.00 ? 130 PRO B CG   4 
ATOM 11139 C CD   . PRO B 1 67 ? -18.015 22.032  -43.843 1.00 0.00 ? 130 PRO B CD   4 
ATOM 11140 H HA   . PRO B 1 67 ? -16.951 19.695  -45.510 1.00 0.00 ? 130 PRO B HA   4 
ATOM 11141 H HB2  . PRO B 1 67 ? -19.710 19.856  -44.277 1.00 0.00 ? 130 PRO B HB2  4 
ATOM 11142 H HB3  . PRO B 1 67 ? -18.354 18.745  -43.903 1.00 0.00 ? 130 PRO B HB3  4 
ATOM 11143 H HG2  . PRO B 1 67 ? -18.843 20.781  -42.300 1.00 0.00 ? 130 PRO B HG2  4 
ATOM 11144 H HG3  . PRO B 1 67 ? -17.150 20.398  -42.757 1.00 0.00 ? 130 PRO B HG3  4 
ATOM 11145 H HD2  . PRO B 1 67 ? -18.955 22.589  -43.793 1.00 0.00 ? 130 PRO B HD2  4 
ATOM 11146 H HD3  . PRO B 1 67 ? -17.195 22.604  -43.415 1.00 0.00 ? 130 PRO B HD3  4 
ATOM 11147 N N    . LEU B 1 68 ? -19.670 20.808  -46.994 1.00 0.00 ? 131 LEU B N    4 
ATOM 11148 C CA   . LEU B 1 68 ? -20.682 20.546  -48.012 1.00 0.00 ? 131 LEU B CA   4 
ATOM 11149 C C    . LEU B 1 68 ? -20.142 20.822  -49.408 1.00 0.00 ? 131 LEU B C    4 
ATOM 11150 O O    . LEU B 1 68 ? -20.831 20.607  -50.405 1.00 0.00 ? 131 LEU B O    4 
ATOM 11151 C CB   . LEU B 1 68 ? -21.925 21.407  -47.756 1.00 0.00 ? 131 LEU B CB   4 
ATOM 11152 C CG   . LEU B 1 68 ? -22.667 21.131  -46.444 1.00 0.00 ? 131 LEU B CG   4 
ATOM 11153 C CD1  . LEU B 1 68 ? -23.805 22.131  -46.283 1.00 0.00 ? 131 LEU B CD1  4 
ATOM 11154 C CD2  . LEU B 1 68 ? -23.195 19.702  -46.450 1.00 0.00 ? 131 LEU B CD2  4 
ATOM 11155 H H    . LEU B 1 68 ? -19.796 21.612  -46.376 1.00 0.00 ? 131 LEU B H    4 
ATOM 11156 H HA   . LEU B 1 68 ? -20.987 19.503  -47.969 1.00 0.00 ? 131 LEU B HA   4 
ATOM 11157 H HB2  . LEU B 1 68 ? -21.621 22.453  -47.754 1.00 0.00 ? 131 LEU B HB2  4 
ATOM 11158 H HB3  . LEU B 1 68 ? -22.623 21.254  -48.581 1.00 0.00 ? 131 LEU B HB3  4 
ATOM 11159 H HG   . LEU B 1 68 ? -21.967 21.254  -45.617 1.00 0.00 ? 131 LEU B HG   4 
ATOM 11160 H HD11 . LEU B 1 68 ? -24.535 21.979  -47.079 1.00 0.00 ? 131 LEU B HD11 4 
ATOM 11161 H HD12 . LEU B 1 68 ? -23.413 23.148  -46.338 1.00 0.00 ? 131 LEU B HD12 4 
ATOM 11162 H HD13 . LEU B 1 68 ? -24.284 21.981  -45.315 1.00 0.00 ? 131 LEU B HD13 4 
ATOM 11163 H HD21 . LEU B 1 68 ? -22.393 19.005  -46.203 1.00 0.00 ? 131 LEU B HD21 4 
ATOM 11164 H HD22 . LEU B 1 68 ? -23.596 19.458  -47.435 1.00 0.00 ? 131 LEU B HD22 4 
ATOM 11165 H HD23 . LEU B 1 68 ? -23.988 19.606  -45.706 1.00 0.00 ? 131 LEU B HD23 4 
ATOM 11166 N N    . THR B 1 69 ? -18.902 21.299  -49.475 1.00 0.00 ? 132 THR B N    4 
ATOM 11167 C CA   . THR B 1 69 ? -18.275 21.627  -50.750 1.00 0.00 ? 132 THR B CA   4 
ATOM 11168 C C    . THR B 1 69 ? -17.114 20.687  -51.051 1.00 0.00 ? 132 THR B C    4 
ATOM 11169 O O    . THR B 1 69 ? -16.337 20.924  -51.976 1.00 0.00 ? 132 THR B O    4 
ATOM 11170 C CB   . THR B 1 69 ? -17.779 23.085  -50.764 1.00 0.00 ? 132 THR B CB   4 
ATOM 11171 O OG1  . THR B 1 69 ? -16.823 23.276  -49.715 1.00 0.00 ? 132 THR B OG1  4 
ATOM 11172 C CG2  . THR B 1 69 ? -18.941 24.046  -50.569 1.00 0.00 ? 132 THR B CG2  4 
ATOM 11173 H H    . THR B 1 69 ? -18.383 21.459  -48.613 1.00 0.00 ? 132 THR B H    4 
ATOM 11174 H HA   . THR B 1 69 ? -19.006 21.518  -51.556 1.00 0.00 ? 132 THR B HA   4 
ATOM 11175 H HB   . THR B 1 69 ? -17.339 23.292  -51.731 1.00 0.00 ? 132 THR B HB   4 
ATOM 11176 H HG1  . THR B 1 69 ? -16.518 22.411  -49.429 1.00 0.00 ? 132 THR B HG1  4 
ATOM 11177 H HG21 . THR B 1 69 ? -19.478 23.781  -49.659 1.00 0.00 ? 132 THR B HG21 4 
ATOM 11178 H HG22 . THR B 1 69 ? -19.616 23.980  -51.421 1.00 0.00 ? 132 THR B HG22 4 
ATOM 11179 H HG23 . THR B 1 69 ? -18.563 25.064  -50.482 1.00 0.00 ? 132 THR B HG23 4 
ATOM 11180 N N    . ILE B 1 70 ? -17.002 19.624  -50.262 1.00 0.00 ? 133 ILE B N    4 
ATOM 11181 C CA   . ILE B 1 70 ? -15.945 18.637  -50.454 1.00 0.00 ? 133 ILE B CA   4 
ATOM 11182 C C    . ILE B 1 70 ? -16.396 17.522  -51.388 1.00 0.00 ? 133 ILE B C    4 
ATOM 11183 O O    . ILE B 1 70 ? -17.422 16.883  -51.157 1.00 0.00 ? 133 ILE B O    4 
ATOM 11184 C CB   . ILE B 1 70 ? -15.508 18.035  -49.106 1.00 0.00 ? 133 ILE B CB   4 
ATOM 11185 C CG1  . ILE B 1 70 ? -14.938 19.123  -48.194 1.00 0.00 ? 133 ILE B CG1  4 
ATOM 11186 C CG2  . ILE B 1 70 ? -14.484 16.930  -49.326 1.00 0.00 ? 133 ILE B CG2  4 
ATOM 11187 C CD1  . ILE B 1 70 ? -14.696 18.665  -46.774 1.00 0.00 ? 133 ILE B CD1  4 
ATOM 11188 H H    . ILE B 1 70 ? -17.682 19.481  -49.518 1.00 0.00 ? 133 ILE B H    4 
ATOM 11189 H HA   . ILE B 1 70 ? -15.093 19.132  -50.890 1.00 0.00 ? 133 ILE B HA   4 
ATOM 11190 H HB   . ILE B 1 70 ? -16.383 17.604  -48.623 1.00 0.00 ? 133 ILE B HB   4 
ATOM 11191 H HG12 . ILE B 1 70 ? -13.985 19.434  -48.602 1.00 0.00 ? 133 ILE B HG12 4 
ATOM 11192 H HG13 . ILE B 1 70 ? -15.618 19.976  -48.189 1.00 0.00 ? 133 ILE B HG13 4 
ATOM 11193 H HG21 . ILE B 1 70 ? -13.672 17.312  -49.939 1.00 0.00 ? 133 ILE B HG21 4 
ATOM 11194 H HG22 . ILE B 1 70 ? -14.947 16.079  -49.823 1.00 0.00 ? 133 ILE B HG22 4 
ATOM 11195 H HG23 . ILE B 1 70 ? -14.086 16.603  -48.371 1.00 0.00 ? 133 ILE B HG23 4 
ATOM 11196 H HD11 . ILE B 1 70 ? -13.740 18.143  -46.702 1.00 0.00 ? 133 ILE B HD11 4 
ATOM 11197 H HD12 . ILE B 1 70 ? -14.683 19.532  -46.115 1.00 0.00 ? 133 ILE B HD12 4 
ATOM 11198 H HD13 . ILE B 1 70 ? -15.499 17.993  -46.470 1.00 0.00 ? 133 ILE B HD13 4 
ATOM 11199 N N    . THR B 1 71 ? -15.622 17.292  -52.444 1.00 0.00 ? 134 THR B N    4 
ATOM 11200 C CA   . THR B 1 71 ? -15.924 16.233  -53.399 1.00 0.00 ? 134 THR B CA   4 
ATOM 11201 C C    . THR B 1 71 ? -14.740 15.291  -53.570 1.00 0.00 ? 134 THR B C    4 
ATOM 11202 O O    . THR B 1 71 ? -13.630 15.721  -53.888 1.00 0.00 ? 134 THR B O    4 
ATOM 11203 C CB   . THR B 1 71 ? -16.320 16.819  -54.769 1.00 0.00 ? 134 THR B CB   4 
ATOM 11204 O OG1  . THR B 1 71 ? -17.477 17.651  -54.618 1.00 0.00 ? 134 THR B OG1  4 
ATOM 11205 C CG2  . THR B 1 71 ? -16.626 15.705  -55.756 1.00 0.00 ? 134 THR B CG2  4 
ATOM 11206 H H    . THR B 1 71 ? -14.784 17.851  -52.578 1.00 0.00 ? 134 THR B H    4 
ATOM 11207 H HA   . THR B 1 71 ? -16.768 15.641  -53.036 1.00 0.00 ? 134 THR B HA   4 
ATOM 11208 H HB   . THR B 1 71 ? -15.494 17.417  -55.151 1.00 0.00 ? 134 THR B HB   4 
ATOM 11209 H HG1  . THR B 1 71 ? -18.244 17.078  -54.544 1.00 0.00 ? 134 THR B HG1  4 
ATOM 11210 H HG21 . THR B 1 71 ? -17.102 16.121  -56.643 1.00 0.00 ? 134 THR B HG21 4 
ATOM 11211 H HG22 . THR B 1 71 ? -17.295 14.983  -55.288 1.00 0.00 ? 134 THR B HG22 4 
ATOM 11212 H HG23 . THR B 1 71 ? -15.699 15.207  -56.041 1.00 0.00 ? 134 THR B HG23 4 
ATOM 11213 N N    . SER B 1 72 ? -14.983 14.001  -53.358 1.00 0.00 ? 135 SER B N    4 
ATOM 11214 C CA   . SER B 1 72 ? -13.943 12.991  -53.520 1.00 0.00 ? 135 SER B CA   4 
ATOM 11215 C C    . SER B 1 72 ? -13.996 12.364  -54.907 1.00 0.00 ? 135 SER B C    4 
ATOM 11216 O O    . SER B 1 72 ? -14.997 12.481  -55.614 1.00 0.00 ? 135 SER B O    4 
ATOM 11217 C CB   . SER B 1 72 ? -14.095 11.913  -52.462 1.00 0.00 ? 135 SER B CB   4 
ATOM 11218 O OG   . SER B 1 72 ? -15.256 11.161  -52.674 1.00 0.00 ? 135 SER B OG   4 
ATOM 11219 H H    . SER B 1 72 ? -15.924 13.707  -53.105 1.00 0.00 ? 135 SER B H    4 
ATOM 11220 H HA   . SER B 1 72 ? -12.982 13.449  -53.410 1.00 0.00 ? 135 SER B HA   4 
ATOM 11221 H HB2  . SER B 1 72 ? -13.238 11.247  -52.500 1.00 0.00 ? 135 SER B HB2  4 
ATOM 11222 H HB3  . SER B 1 72 ? -14.144 12.388  -51.480 1.00 0.00 ? 135 SER B HB3  4 
ATOM 11223 H HG   . SER B 1 72 ? -15.978 11.774  -52.836 1.00 0.00 ? 135 SER B HG   4 
ATOM 11224 N N    . SER B 1 73 ? -12.911 11.699  -55.292 1.00 0.00 ? 136 SER B N    4 
ATOM 11225 C CA   . SER B 1 73 ? -12.865 10.975  -56.556 1.00 0.00 ? 136 SER B CA   4 
ATOM 11226 C C    . SER B 1 73 ? -11.869 9.825   -56.496 1.00 0.00 ? 136 SER B C    4 
ATOM 11227 O O    . SER B 1 73 ? -10.664 10.041  -56.369 1.00 0.00 ? 136 SER B O    4 
ATOM 11228 C CB   . SER B 1 73 ? -12.497 11.918  -57.685 1.00 0.00 ? 136 SER B CB   4 
ATOM 11229 O OG   . SER B 1 73 ? -12.414 11.233  -58.905 1.00 0.00 ? 136 SER B OG   4 
ATOM 11230 H H    . SER B 1 73 ? -12.120 11.629  -54.653 1.00 0.00 ? 136 SER B H    4 
ATOM 11231 H HA   . SER B 1 73 ? -13.851 10.560  -56.770 1.00 0.00 ? 136 SER B HA   4 
ATOM 11232 H HB2  . SER B 1 73 ? -13.252 12.695  -57.768 1.00 0.00 ? 136 SER B HB2  4 
ATOM 11233 H HB3  . SER B 1 73 ? -11.533 12.379  -57.458 1.00 0.00 ? 136 SER B HB3  4 
ATOM 11234 H HG   . SER B 1 73 ? -11.763 10.534  -58.804 1.00 0.00 ? 136 SER B HG   4 
ATOM 11235 N N    . LEU B 1 74 ? -12.380 8.601   -56.591 1.00 0.00 ? 137 LEU B N    4 
ATOM 11236 C CA   . LEU B 1 74 ? -11.546 7.411   -56.455 1.00 0.00 ? 137 LEU B CA   4 
ATOM 11237 C C    . LEU B 1 74 ? -11.226 6.804   -57.815 1.00 0.00 ? 137 LEU B C    4 
ATOM 11238 O O    . LEU B 1 74 ? -12.106 6.261   -58.485 1.00 0.00 ? 137 LEU B O    4 
ATOM 11239 C CB   . LEU B 1 74 ? -12.250 6.370   -55.575 1.00 0.00 ? 137 LEU B CB   4 
ATOM 11240 C CG   . LEU B 1 74 ? -11.547 5.011   -55.462 1.00 0.00 ? 137 LEU B CG   4 
ATOM 11241 C CD1  . LEU B 1 74 ? -10.145 5.210   -54.900 1.00 0.00 ? 137 LEU B CD1  4 
ATOM 11242 C CD2  . LEU B 1 74 ? -12.365 4.088   -54.574 1.00 0.00 ? 137 LEU B CD2  4 
ATOM 11243 H H    . LEU B 1 74 ? -13.387 8.489   -56.686 1.00 0.00 ? 137 LEU B H    4 
ATOM 11244 H HA   . LEU B 1 74 ? -10.617 7.691   -55.986 1.00 0.00 ? 137 LEU B HA   4 
ATOM 11245 H HB2  . LEU B 1 74 ? -12.388 6.778   -54.582 1.00 0.00 ? 137 LEU B HB2  4 
ATOM 11246 H HB3  . LEU B 1 74 ? -13.238 6.196   -56.003 1.00 0.00 ? 137 LEU B HB3  4 
ATOM 11247 H HG   . LEU B 1 74 ? -11.466 4.569   -56.456 1.00 0.00 ? 137 LEU B HG   4 
ATOM 11248 H HD11 . LEU B 1 74 ? -9.578  5.935   -55.469 1.00 0.00 ? 137 LEU B HD11 4 
ATOM 11249 H HD12 . LEU B 1 74 ? -9.626  4.251   -54.948 1.00 0.00 ? 137 LEU B HD12 4 
ATOM 11250 H HD13 . LEU B 1 74 ? -10.210 5.517   -53.861 1.00 0.00 ? 137 LEU B HD13 4 
ATOM 11251 H HD21 . LEU B 1 74 ? -11.736 3.282   -54.221 1.00 0.00 ? 137 LEU B HD21 4 
ATOM 11252 H HD22 . LEU B 1 74 ? -13.197 3.673   -55.145 1.00 0.00 ? 137 LEU B HD22 4 
ATOM 11253 H HD23 . LEU B 1 74 ? -12.755 4.639   -53.717 1.00 0.00 ? 137 LEU B HD23 4 
ATOM 11254 N N    . SER B 1 75 ? -9.963  6.899   -58.219 1.00 0.00 ? 138 SER B N    4 
ATOM 11255 C CA   . SER B 1 75 ? -9.485  6.199   -59.404 1.00 0.00 ? 138 SER B CA   4 
ATOM 11256 C C    . SER B 1 75 ? -9.130  4.753   -59.084 1.00 0.00 ? 138 SER B C    4 
ATOM 11257 O O    . SER B 1 75 ? -8.611  4.454   -58.007 1.00 0.00 ? 138 SER B O    4 
ATOM 11258 C CB   . SER B 1 75 ? -8.275  6.910   -59.976 1.00 0.00 ? 138 SER B CB   4 
ATOM 11259 O OG   . SER B 1 75 ? -7.733  6.195   -61.053 1.00 0.00 ? 138 SER B OG   4 
ATOM 11260 H H    . SER B 1 75 ? -9.281  7.334   -57.599 1.00 0.00 ? 138 SER B H    4 
ATOM 11261 H HA   . SER B 1 75 ? -10.274 6.212   -60.157 1.00 0.00 ? 138 SER B HA   4 
ATOM 11262 H HB2  . SER B 1 75 ? -8.535  7.915   -60.296 1.00 0.00 ? 138 SER B HB2  4 
ATOM 11263 H HB3  . SER B 1 75 ? -7.545  6.959   -59.174 1.00 0.00 ? 138 SER B HB3  4 
ATOM 11264 H HG   . SER B 1 75 ? -6.837  6.506   -61.202 1.00 0.00 ? 138 SER B HG   4 
ATOM 11265 N N    . SER B 1 76 ? -9.413  3.857   -60.023 1.00 0.00 ? 139 SER B N    4 
ATOM 11266 C CA   . SER B 1 76 ? -9.105  2.442   -59.852 1.00 0.00 ? 139 SER B CA   4 
ATOM 11267 C C    . SER B 1 76 ? -7.606  2.187   -59.958 1.00 0.00 ? 139 SER B C    4 
ATOM 11268 O O    . SER B 1 76 ? -7.129  1.097   -59.646 1.00 0.00 ? 139 SER B O    4 
ATOM 11269 C CB   . SER B 1 76 ? -9.840  1.617   -60.890 1.00 0.00 ? 139 SER B CB   4 
ATOM 11270 O OG   . SER B 1 76 ? -9.350  1.876   -62.177 1.00 0.00 ? 139 SER B OG   4 
ATOM 11271 H H    . SER B 1 76 ? -9.842  4.167   -60.895 1.00 0.00 ? 139 SER B H    4 
ATOM 11272 H HA   . SER B 1 76 ? -9.439  2.134   -58.860 1.00 0.00 ? 139 SER B HA   4 
ATOM 11273 H HB2  . SER B 1 76 ? -9.707  0.560   -60.670 1.00 0.00 ? 139 SER B HB2  4 
ATOM 11274 H HB3  . SER B 1 76 ? -10.906 1.857   -60.847 1.00 0.00 ? 139 SER B HB3  4 
ATOM 11275 H HG   . SER B 1 76 ? -9.835  1.332   -62.799 1.00 0.00 ? 139 SER B HG   4 
ATOM 11276 N N    . ASP B 1 77 ? -6.869  3.202   -60.399 1.00 0.00 ? 140 ASP B N    4 
ATOM 11277 C CA   . ASP B 1 77 ? -5.417  3.104   -60.504 1.00 0.00 ? 140 ASP B CA   4 
ATOM 11278 C C    . ASP B 1 77 ? -4.749  3.353   -59.158 1.00 0.00 ? 140 ASP B C    4 
ATOM 11279 O O    . ASP B 1 77 ? -3.589  2.995   -58.957 1.00 0.00 ? 140 ASP B O    4 
ATOM 11280 C CB   . ASP B 1 77 ? -4.888  4.103   -61.536 1.00 0.00 ? 140 ASP B CB   4 
ATOM 11281 C CG   . ASP B 1 77 ? -5.313  3.767   -62.959 1.00 0.00 ? 140 ASP B CG   4 
ATOM 11282 O OD1  . ASP B 1 77 ? -5.625  2.627   -63.212 1.00 0.00 ? 140 ASP B OD1  4 
ATOM 11283 O OD2  . ASP B 1 77 ? -5.321  4.653   -63.780 1.00 0.00 ? 140 ASP B OD2  4 
ATOM 11284 H H    . ASP B 1 77 ? -7.324  4.084   -60.633 1.00 0.00 ? 140 ASP B H    4 
ATOM 11285 H HA   . ASP B 1 77 ? -5.158  2.099   -60.843 1.00 0.00 ? 140 ASP B HA   4 
ATOM 11286 H HB2  . ASP B 1 77 ? -5.266  5.094   -61.284 1.00 0.00 ? 140 ASP B HB2  4 
ATOM 11287 H HB3  . ASP B 1 77 ? -3.798  4.117   -61.489 1.00 0.00 ? 140 ASP B HB3  4 
ATOM 11288 N N    . GLY B 1 78 ? -5.488  3.967   -58.241 1.00 0.00 ? 141 GLY B N    4 
ATOM 11289 C CA   . GLY B 1 78 ? -4.974  4.252   -56.907 1.00 0.00 ? 141 GLY B CA   4 
ATOM 11290 C C    . GLY B 1 78 ? -4.817  5.750   -56.684 1.00 0.00 ? 141 GLY B C    4 
ATOM 11291 O O    . GLY B 1 78 ? -4.203  6.182   -55.710 1.00 0.00 ? 141 GLY B O    4 
ATOM 11292 H H    . GLY B 1 78 ? -6.445  4.235   -58.474 1.00 0.00 ? 141 GLY B H    4 
ATOM 11293 H HA2  . GLY B 1 78 ? -5.693  3.860   -56.196 1.00 0.00 ? 141 GLY B HA2  4 
ATOM 11294 H HA3  . GLY B 1 78 ? -4.011  3.759   -56.751 1.00 0.00 ? 141 GLY B HA3  4 
ATOM 11295 N N    . VAL B 1 79 ? -5.377  6.540   -57.596 1.00 0.00 ? 142 VAL B N    4 
ATOM 11296 C CA   . VAL B 1 79 ? -5.358  7.992   -57.466 1.00 0.00 ? 142 VAL B CA   4 
ATOM 11297 C C    . VAL B 1 79 ? -6.633  8.503   -56.808 1.00 0.00 ? 142 VAL B C    4 
ATOM 11298 O O    . VAL B 1 79 ? -7.541  8.985   -57.484 1.00 0.00 ? 142 VAL B O    4 
ATOM 11299 C CB   . VAL B 1 79 ? -5.198  8.651   -58.849 1.00 0.00 ? 142 VAL B CB   4 
ATOM 11300 C CG1  . VAL B 1 79 ? -5.114  10.163  -58.714 1.00 0.00 ? 142 VAL B CG1  4 
ATOM 11301 C CG2  . VAL B 1 79 ? -3.961  8.101   -59.544 1.00 0.00 ? 142 VAL B CG2  4 
ATOM 11302 H H    . VAL B 1 79 ? -5.883  6.119   -58.375 1.00 0.00 ? 142 VAL B H    4 
ATOM 11303 H HA   . VAL B 1 79 ? -4.505  8.288   -56.850 1.00 0.00 ? 142 VAL B HA   4 
ATOM 11304 H HB   . VAL B 1 79 ? -6.059  8.428   -59.461 1.00 0.00 ? 142 VAL B HB   4 
ATOM 11305 H HG11 . VAL B 1 79 ? -4.398  10.409  -57.930 1.00 0.00 ? 142 VAL B HG11 4 
ATOM 11306 H HG12 . VAL B 1 79 ? -6.090  10.570  -58.452 1.00 0.00 ? 142 VAL B HG12 4 
ATOM 11307 H HG13 . VAL B 1 79 ? -4.782  10.598  -59.656 1.00 0.00 ? 142 VAL B HG13 4 
ATOM 11308 H HG21 . VAL B 1 79 ? -3.838  8.587   -60.510 1.00 0.00 ? 142 VAL B HG21 4 
ATOM 11309 H HG22 . VAL B 1 79 ? -3.087  8.299   -58.923 1.00 0.00 ? 142 VAL B HG22 4 
ATOM 11310 H HG23 . VAL B 1 79 ? -4.068  7.026   -59.688 1.00 0.00 ? 142 VAL B HG23 4 
ATOM 11311 N N    . LEU B 1 80 ? -6.694  8.395   -55.486 1.00 0.00 ? 143 LEU B N    4 
ATOM 11312 C CA   . LEU B 1 80 ? -7.824  8.918   -54.724 1.00 0.00 ? 143 LEU B CA   4 
ATOM 11313 C C    . LEU B 1 80 ? -7.597  10.373  -54.334 1.00 0.00 ? 143 LEU B C    4 
ATOM 11314 O O    . LEU B 1 80 ? -6.591  10.710  -53.712 1.00 0.00 ? 143 LEU B O    4 
ATOM 11315 C CB   . LEU B 1 80 ? -8.051  8.075   -53.465 1.00 0.00 ? 143 LEU B CB   4 
ATOM 11316 C CG   . LEU B 1 80 ? -9.115  8.601   -52.495 1.00 0.00 ? 143 LEU B CG   4 
ATOM 11317 C CD1  . LEU B 1 80 ? -10.474 8.603   -53.183 1.00 0.00 ? 143 LEU B CD1  4 
ATOM 11318 C CD2  . LEU B 1 80 ? -9.137  7.733   -51.245 1.00 0.00 ? 143 LEU B CD2  4 
ATOM 11319 H H    . LEU B 1 80 ? -5.901  7.998   -54.983 1.00 0.00 ? 143 LEU B H    4 
ATOM 11320 H HA   . LEU B 1 80 ? -8.720  8.863   -55.338 1.00 0.00 ? 143 LEU B HA   4 
ATOM 11321 H HB2  . LEU B 1 80 ? -8.339  7.071   -53.772 1.00 0.00 ? 143 LEU B HB2  4 
ATOM 11322 H HB3  . LEU B 1 80 ? -7.100  8.011   -52.936 1.00 0.00 ? 143 LEU B HB3  4 
ATOM 11323 H HG   . LEU B 1 80 ? -8.867  9.611   -52.226 1.00 0.00 ? 143 LEU B HG   4 
ATOM 11324 H HD11 . LEU B 1 80 ? -10.595 7.683   -53.712 1.00 0.00 ? 143 LEU B HD11 4 
ATOM 11325 H HD12 . LEU B 1 80 ? -10.536 9.434   -53.884 1.00 0.00 ? 143 LEU B HD12 4 
ATOM 11326 H HD13 . LEU B 1 80 ? -11.258 8.693   -52.449 1.00 0.00 ? 143 LEU B HD13 4 
ATOM 11327 H HD21 . LEU B 1 80 ? -8.127  7.617   -50.856 1.00 0.00 ? 143 LEU B HD21 4 
ATOM 11328 H HD22 . LEU B 1 80 ? -9.546  6.752   -51.493 1.00 0.00 ? 143 LEU B HD22 4 
ATOM 11329 H HD23 . LEU B 1 80 ? -9.759  8.203   -50.491 1.00 0.00 ? 143 LEU B HD23 4 
ATOM 11330 N N    . THR B 1 81 ? -8.540  11.234  -54.706 1.00 0.00 ? 144 THR B N    4 
ATOM 11331 C CA   . THR B 1 81 ? -8.423  12.663  -54.437 1.00 0.00 ? 144 THR B CA   4 
ATOM 11332 C C    . THR B 1 81 ? -9.661  13.191  -53.724 1.00 0.00 ? 144 THR B C    4 
ATOM 11333 O O    . THR B 1 81 ? -10.781 13.044  -54.212 1.00 0.00 ? 144 THR B O    4 
ATOM 11334 C CB   . THR B 1 81 ? -8.198  13.454  -55.739 1.00 0.00 ? 144 THR B CB   4 
ATOM 11335 O OG1  . THR B 1 81 ? -6.997  12.998  -56.376 1.00 0.00 ? 144 THR B OG1  4 
ATOM 11336 C CG2  . THR B 1 81 ? -8.075  14.940  -55.443 1.00 0.00 ? 144 THR B CG2  4 
ATOM 11337 H H    . THR B 1 81 ? -9.352  10.893  -55.222 1.00 0.00 ? 144 THR B H    4 
ATOM 11338 H HA   . THR B 1 81 ? -7.571  12.834  -53.795 1.00 0.00 ? 144 THR B HA   4 
ATOM 11339 H HB   . THR B 1 81 ? -9.043  13.291  -56.406 1.00 0.00 ? 144 THR B HB   4 
ATOM 11340 H HG1  . THR B 1 81 ? -7.056  12.042  -56.472 1.00 0.00 ? 144 THR B HG1  4 
ATOM 11341 H HG21 . THR B 1 81 ? -9.054  15.340  -55.179 1.00 0.00 ? 144 THR B HG21 4 
ATOM 11342 H HG22 . THR B 1 81 ? -7.696  15.459  -56.324 1.00 0.00 ? 144 THR B HG22 4 
ATOM 11343 H HG23 . THR B 1 81 ? -7.386  15.087  -54.610 1.00 0.00 ? 144 THR B HG23 4 
ATOM 11344 N N    . VAL B 1 82 ? -9.451  13.809  -52.567 1.00 0.00 ? 145 VAL B N    4 
ATOM 11345 C CA   . VAL B 1 82 ? -10.535 14.462  -51.840 1.00 0.00 ? 145 VAL B CA   4 
ATOM 11346 C C    . VAL B 1 82 ? -10.275 15.954  -51.687 1.00 0.00 ? 145 VAL B C    4 
ATOM 11347 O O    . VAL B 1 82 ? -9.286  16.363  -51.079 1.00 0.00 ? 145 VAL B O    4 
ATOM 11348 C CB   . VAL B 1 82 ? -10.700 13.827  -50.445 1.00 0.00 ? 145 VAL B CB   4 
ATOM 11349 C CG1  . VAL B 1 82 ? -11.849 14.484  -49.694 1.00 0.00 ? 145 VAL B CG1  4 
ATOM 11350 C CG2  . VAL B 1 82 ? -10.930 12.329  -50.582 1.00 0.00 ? 145 VAL B CG2  4 
ATOM 11351 H H    . VAL B 1 82 ? -8.495  13.909  -52.228 1.00 0.00 ? 145 VAL B H    4 
ATOM 11352 H HA   . VAL B 1 82 ? -11.459 14.346  -52.369 1.00 0.00 ? 145 VAL B HA   4 
ATOM 11353 H HB   . VAL B 1 82 ? -9.781  13.997  -49.880 1.00 0.00 ? 145 VAL B HB   4 
ATOM 11354 H HG11 . VAL B 1 82 ? -12.730 14.487  -50.338 1.00 0.00 ? 145 VAL B HG11 4 
ATOM 11355 H HG12 . VAL B 1 82 ? -11.589 15.511  -49.438 1.00 0.00 ? 145 VAL B HG12 4 
ATOM 11356 H HG13 . VAL B 1 82 ? -12.067 13.932  -48.794 1.00 0.00 ? 145 VAL B HG13 4 
ATOM 11357 H HG21 . VAL B 1 82 ? -10.648 11.833  -49.652 1.00 0.00 ? 145 VAL B HG21 4 
ATOM 11358 H HG22 . VAL B 1 82 ? -10.330 11.924  -51.399 1.00 0.00 ? 145 VAL B HG22 4 
ATOM 11359 H HG23 . VAL B 1 82 ? -11.976 12.140  -50.777 1.00 0.00 ? 145 VAL B HG23 4 
ATOM 11360 N N    . ASP B 1 83 ? -11.168 16.765  -52.245 1.00 0.00 ? 146 ASP B N    4 
ATOM 11361 C CA   . ASP B 1 83 ? -10.934 18.199  -52.360 1.00 0.00 ? 146 ASP B CA   4 
ATOM 11362 C C    . ASP B 1 83 ? -12.168 18.994  -51.951 1.00 0.00 ? 146 ASP B C    4 
ATOM 11363 O O    . ASP B 1 83 ? -13.278 18.461  -51.923 1.00 0.00 ? 146 ASP B O    4 
ATOM 11364 C CB   . ASP B 1 83 ? -10.536 18.566  -53.791 1.00 0.00 ? 146 ASP B CB   4 
ATOM 11365 C CG   . ASP B 1 83 ? -11.677 18.394  -54.786 1.00 0.00 ? 146 ASP B CG   4 
ATOM 11366 O OD1  . ASP B 1 83 ? -12.810 18.524  -54.386 1.00 0.00 ? 146 ASP B OD1  4 
ATOM 11367 O OD2  . ASP B 1 83 ? -11.405 18.137  -55.935 1.00 0.00 ? 146 ASP B OD2  4 
ATOM 11368 H H    . ASP B 1 83 ? -11.948 16.353  -52.759 1.00 0.00 ? 146 ASP B H    4 
ATOM 11369 H HA   . ASP B 1 83 ? -10.125 18.486  -51.692 1.00 0.00 ? 146 ASP B HA   4 
ATOM 11370 H HB2  . ASP B 1 83 ? -10.196 19.594  -53.830 1.00 0.00 ? 146 ASP B HB2  4 
ATOM 11371 H HB3  . ASP B 1 83 ? -9.722  17.909  -54.101 1.00 0.00 ? 146 ASP B HB3  4 
ATOM 11372 N N    . GLY B 1 84 ? -11.967 20.268  -51.635 1.00 0.00 ? 147 GLY B N    4 
ATOM 11373 C CA   . GLY B 1 84 ? -13.057 21.128  -51.186 1.00 0.00 ? 147 GLY B CA   4 
ATOM 11374 C C    . GLY B 1 84 ? -12.548 22.515  -50.816 1.00 0.00 ? 147 GLY B C    4 
ATOM 11375 O O    . GLY B 1 84 ? -11.543 22.651  -50.119 1.00 0.00 ? 147 GLY B O    4 
ATOM 11376 H H    . GLY B 1 84 ? -11.018 20.642  -51.670 1.00 0.00 ? 147 GLY B H    4 
ATOM 11377 H HA2  . GLY B 1 84 ? -13.809 21.129  -51.946 1.00 0.00 ? 147 GLY B HA2  4 
ATOM 11378 H HA3  . GLY B 1 84 ? -13.480 20.699  -50.300 1.00 0.00 ? 147 GLY B HA3  4 
ATOM 11379 N N    . PRO B 1 85 ? -13.247 23.541  -51.285 1.00 0.00 ? 148 PRO B N    4 
ATOM 11380 C CA   . PRO B 1 85 ? -12.899 24.919  -50.961 1.00 0.00 ? 148 PRO B CA   4 
ATOM 11381 C C    . PRO B 1 85 ? -12.929 25.154  -49.457 1.00 0.00 ? 148 PRO B C    4 
ATOM 11382 O O    . PRO B 1 85 ? -13.713 24.537  -48.737 1.00 0.00 ? 148 PRO B O    4 
ATOM 11383 C CB   . PRO B 1 85 ? -13.983 25.728  -51.681 1.00 0.00 ? 148 PRO B CB   4 
ATOM 11384 C CG   . PRO B 1 85 ? -14.426 24.837  -52.793 1.00 0.00 ? 148 PRO B CG   4 
ATOM 11385 C CD   . PRO B 1 85 ? -14.381 23.453  -52.203 1.00 0.00 ? 148 PRO B CD   4 
ATOM 11386 H HA   . PRO B 1 85 ? -11.949 25.162  -51.353 1.00 0.00 ? 148 PRO B HA   4 
ATOM 11387 H HB2  . PRO B 1 85 ? -14.817 25.948  -51.006 1.00 0.00 ? 148 PRO B HB2  4 
ATOM 11388 H HB3  . PRO B 1 85 ? -13.568 26.654  -52.083 1.00 0.00 ? 148 PRO B HB3  4 
ATOM 11389 H HG2  . PRO B 1 85 ? -15.446 25.092  -53.097 1.00 0.00 ? 148 PRO B HG2  4 
ATOM 11390 H HG3  . PRO B 1 85 ? -13.747 24.913  -53.642 1.00 0.00 ? 148 PRO B HG3  4 
ATOM 11391 H HD2  . PRO B 1 85 ? -15.282 23.216  -51.663 1.00 0.00 ? 148 PRO B HD2  4 
ATOM 11392 H HD3  . PRO B 1 85 ? -14.192 22.740  -52.998 1.00 0.00 ? 148 PRO B HD3  4 
ATOM 11393 N N    . ARG B 1 86 ? -12.069 26.053  -48.987 1.00 0.00 ? 149 ARG B N    4 
ATOM 11394 C CA   . ARG B 1 86 ? -12.087 26.475  -47.590 1.00 0.00 ? 149 ARG B CA   4 
ATOM 11395 C C    . ARG B 1 86 ? -11.807 27.966  -47.462 1.00 0.00 ? 149 ARG B C    4 
ATOM 11396 O O    . ARG B 1 86 ? -11.492 28.635  -48.447 1.00 0.00 ? 149 ARG B O    4 
ATOM 11397 C CB   . ARG B 1 86 ? -11.062 25.697  -46.782 1.00 0.00 ? 149 ARG B CB   4 
ATOM 11398 C CG   . ARG B 1 86 ? -9.616  25.942  -47.176 1.00 0.00 ? 149 ARG B CG   4 
ATOM 11399 C CD   . ARG B 1 86 ? -8.672  25.236  -46.274 1.00 0.00 ? 149 ARG B CD   4 
ATOM 11400 N NE   . ARG B 1 86 ? -7.289  25.417  -46.686 1.00 0.00 ? 149 ARG B NE   4 
ATOM 11401 C CZ   . ARG B 1 86 ? -6.260  24.657  -46.265 1.00 0.00 ? 149 ARG B CZ   4 
ATOM 11402 N NH1  . ARG B 1 86 ? -6.473  23.670  -45.423 1.00 0.00 ? 149 ARG B NH1  4 
ATOM 11403 N NH2  . ARG B 1 86 ? -5.036  24.902  -46.699 1.00 0.00 ? 149 ARG B NH2  4 
ATOM 11404 H H    . ARG B 1 86 ? -11.463 26.543  -49.645 1.00 0.00 ? 149 ARG B H    4 
ATOM 11405 H HA   . ARG B 1 86 ? -13.079 26.296  -47.174 1.00 0.00 ? 149 ARG B HA   4 
ATOM 11406 H HB2  . ARG B 1 86 ? -11.173 25.952  -45.729 1.00 0.00 ? 149 ARG B HB2  4 
ATOM 11407 H HB3  . ARG B 1 86 ? -11.263 24.634  -46.915 1.00 0.00 ? 149 ARG B HB3  4 
ATOM 11408 H HG2  . ARG B 1 86 ? -9.457  25.614  -48.200 1.00 0.00 ? 149 ARG B HG2  4 
ATOM 11409 H HG3  . ARG B 1 86 ? -9.416  27.012  -47.115 1.00 0.00 ? 149 ARG B HG3  4 
ATOM 11410 H HD2  . ARG B 1 86 ? -8.780  25.659  -45.275 1.00 0.00 ? 149 ARG B HD2  4 
ATOM 11411 H HD3  . ARG B 1 86 ? -8.911  24.180  -46.228 1.00 0.00 ? 149 ARG B HD3  4 
ATOM 11412 H HE   . ARG B 1 86 ? -7.095  26.133  -47.326 1.00 0.00 ? 149 ARG B HE   4 
ATOM 11413 H HH11 . ARG B 1 86 ? -7.398  23.481  -45.095 1.00 0.00 ? 149 ARG B HH11 4 
ATOM 11414 H HH12 . ARG B 1 86 ? -5.700  23.102  -45.106 1.00 0.00 ? 149 ARG B HH12 4 
ATOM 11415 H HH21 . ARG B 1 86 ? -4.871  25.649  -47.344 1.00 0.00 ? 149 ARG B HH21 4 
ATOM 11416 H HH22 . ARG B 1 86 ? -4.273  24.336  -46.384 1.00 0.00 ? 149 ARG B HH22 4 
ATOM 11417 N N    . LYS B 1 87 ? -11.920 28.483  -46.243 1.00 0.00 ? 150 LYS B N    4 
ATOM 11418 C CA   . LYS B 1 87 ? -11.864 29.920  -46.012 1.00 0.00 ? 150 LYS B CA   4 
ATOM 11419 C C    . LYS B 1 87 ? -10.433 30.389  -45.781 1.00 0.00 ? 150 LYS B C    4 
ATOM 11420 O O    . LYS B 1 87 ? -10.183 31.576  -45.582 1.00 0.00 ? 150 LYS B O    4 
ATOM 11421 C CB   . LYS B 1 87 ? -12.742 30.306  -44.820 1.00 0.00 ? 150 LYS B CB   4 
ATOM 11422 C CG   . LYS B 1 87 ? -14.227 30.027  -45.015 1.00 0.00 ? 150 LYS B CG   4 
ATOM 11423 C CD   . LYS B 1 87 ? -14.993 30.169  -43.709 1.00 0.00 ? 150 LYS B CD   4 
ATOM 11424 C CE   . LYS B 1 87 ? -16.484 29.939  -43.912 1.00 0.00 ? 150 LYS B CE   4 
ATOM 11425 N NZ   . LYS B 1 87 ? -17.240 30.033  -42.635 1.00 0.00 ? 150 LYS B NZ   4 
ATOM 11426 H H    . LYS B 1 87 ? -12.207 27.875  -45.477 1.00 0.00 ? 150 LYS B H    4 
ATOM 11427 H HA   . LYS B 1 87 ? -12.252 30.445  -46.886 1.00 0.00 ? 150 LYS B HA   4 
ATOM 11428 H HB2  . LYS B 1 87 ? -12.407 29.780  -43.936 1.00 0.00 ? 150 LYS B HB2  4 
ATOM 11429 H HB3  . LYS B 1 87 ? -12.625 31.376  -44.647 1.00 0.00 ? 150 LYS B HB3  4 
ATOM 11430 H HG2  . LYS B 1 87 ? -14.633 30.724  -45.747 1.00 0.00 ? 150 LYS B HG2  4 
ATOM 11431 H HG3  . LYS B 1 87 ? -14.342 29.007  -45.384 1.00 0.00 ? 150 LYS B HG3  4 
ATOM 11432 H HD2  . LYS B 1 87 ? -14.615 29.441  -42.990 1.00 0.00 ? 150 LYS B HD2  4 
ATOM 11433 H HD3  . LYS B 1 87 ? -14.840 31.175  -43.315 1.00 0.00 ? 150 LYS B HD3  4 
ATOM 11434 H HE2  . LYS B 1 87 ? -16.865 30.688  -44.605 1.00 0.00 ? 150 LYS B HE2  4 
ATOM 11435 H HE3  . LYS B 1 87 ? -16.632 28.947  -44.342 1.00 0.00 ? 150 LYS B HE3  4 
ATOM 11436 H HZ1  . LYS B 1 87 ? -16.925 29.279  -41.993 1.00 0.00 ? 150 LYS B HZ1  4 
ATOM 11437 H HZ2  . LYS B 1 87 ? -18.259 29.929  -42.820 1.00 0.00 ? 150 LYS B HZ2  4 
ATOM 11438 H HZ3  . LYS B 1 87 ? -17.067 30.932  -42.208 1.00 0.00 ? 150 LYS B HZ3  4 
ATOM 11439 N N    . GLN B 1 88 ? -9.497  29.445  -45.808 1.00 0.00 ? 151 GLN B N    4 
ATOM 11440 C CA   . GLN B 1 88 ? -8.099  29.746  -45.527 1.00 0.00 ? 151 GLN B CA   4 
ATOM 11441 C C    . GLN B 1 88 ? -7.566  30.819  -46.470 1.00 0.00 ? 151 GLN B C    4 
ATOM 11442 O O    . GLN B 1 88 ? -6.767  31.665  -46.073 1.00 0.00 ? 151 GLN B O    4 
ATOM 11443 C CB   . GLN B 1 88 ? -7.244  28.481  -45.639 1.00 0.00 ? 151 GLN B CB   4 
ATOM 11444 C CG   . GLN B 1 88 ? -5.781  28.683  -45.287 1.00 0.00 ? 151 GLN B CG   4 
ATOM 11445 C CD   . GLN B 1 88 ? -5.583  29.046  -43.828 1.00 0.00 ? 151 GLN B CD   4 
ATOM 11446 O OE1  . GLN B 1 88 ? -6.068  28.355  -42.929 1.00 0.00 ? 151 GLN B OE1  4 
ATOM 11447 N NE2  . GLN B 1 88 ? -4.864  30.136  -43.582 1.00 0.00 ? 151 GLN B NE2  4 
ATOM 11448 H H    . GLN B 1 88 ? -9.775  28.477  -45.969 1.00 0.00 ? 151 GLN B H    4 
ATOM 11449 H HA   . GLN B 1 88 ? -8.014  30.121  -44.507 1.00 0.00 ? 151 GLN B HA   4 
ATOM 11450 H HB2  . GLN B 1 88 ? -7.656  27.733  -44.963 1.00 0.00 ? 151 GLN B HB2  4 
ATOM 11451 H HB3  . GLN B 1 88 ? -7.316  28.105  -46.661 1.00 0.00 ? 151 GLN B HB3  4 
ATOM 11452 H HG2  . GLN B 1 88 ? -5.234  27.765  -45.493 1.00 0.00 ? 151 GLN B HG2  4 
ATOM 11453 H HG3  . GLN B 1 88 ? -5.377  29.480  -45.912 1.00 0.00 ? 151 GLN B HG3  4 
ATOM 11454 H HE21 . GLN B 1 88 ? -4.470  30.684  -44.347 1.00 0.00 ? 151 GLN B HE21 4 
ATOM 11455 H HE22 . GLN B 1 88 ? -4.705  30.423  -42.616 1.00 0.00 ? 151 GLN B HE22 4 
ATOM 11456 N N    . VAL B 1 89 ? -8.014  30.776  -47.720 1.00 0.00 ? 152 VAL B N    4 
ATOM 11457 C CA   . VAL B 1 89 ? -7.658  31.798  -48.696 1.00 0.00 ? 152 VAL B CA   4 
ATOM 11458 C C    . VAL B 1 89 ? -7.634  33.183  -48.060 1.00 0.00 ? 152 VAL B C    4 
ATOM 11459 O O    . VAL B 1 89 ? -8.500  33.450  -47.244 1.00 0.00 ? 152 VAL B O    4 
ATOM 11460 C CB   . VAL B 1 89 ? -8.659  31.791  -49.867 1.00 0.00 ? 152 VAL B CB   4 
ATOM 11461 C CG1  . VAL B 1 89 ? -10.052 32.161  -49.381 1.00 0.00 ? 152 VAL B CG1  4 
ATOM 11462 C CG2  . VAL B 1 89 ? -8.195  32.751  -50.951 1.00 0.00 ? 152 VAL B CG2  4 
ATOM 11463 O OXT  . VAL B 1 89 ? -6.711  33.930  -48.342 1.00 0.00 ? 152 VAL B OXT  4 
ATOM 11464 H H    . VAL B 1 89 ? -8.688  30.055  -47.979 1.00 0.00 ? 152 VAL B H    4 
ATOM 11465 H HA   . VAL B 1 89 ? -6.667  31.568  -49.082 1.00 0.00 ? 152 VAL B HA   4 
ATOM 11466 H HB   . VAL B 1 89 ? -8.702  30.793  -50.261 1.00 0.00 ? 152 VAL B HB   4 
ATOM 11467 H HG11 . VAL B 1 89 ? -10.310 31.557  -48.509 1.00 0.00 ? 152 VAL B HG11 4 
ATOM 11468 H HG12 . VAL B 1 89 ? -10.777 31.978  -50.175 1.00 0.00 ? 152 VAL B HG12 4 
ATOM 11469 H HG13 . VAL B 1 89 ? -10.070 33.216  -49.109 1.00 0.00 ? 152 VAL B HG13 4 
ATOM 11470 H HG21 . VAL B 1 89 ? -7.898  33.701  -50.519 1.00 0.00 ? 152 VAL B HG21 4 
ATOM 11471 H HG22 . VAL B 1 89 ? -7.346  32.316  -51.481 1.00 0.00 ? 152 VAL B HG22 4 
ATOM 11472 H HG23 . VAL B 1 89 ? -9.007  32.921  -51.654 1.00 0.00 ? 152 VAL B HG23 4 
ATOM 11473 N N    . GLY A 1 1  ? 9.825   1.101   -44.595 1.00 0.00 ? 64  GLY A N    5 
ATOM 11474 C CA   . GLY A 1 1  ? 10.817  0.144   -45.073 1.00 0.00 ? 64  GLY A CA   5 
ATOM 11475 C C    . GLY A 1 1  ? 10.150  -1.088  -45.670 1.00 0.00 ? 64  GLY A C    5 
ATOM 11476 O O    . GLY A 1 1  ? 9.002   -1.397  -45.357 1.00 0.00 ? 64  GLY A O    5 
ATOM 11477 H H1   . GLY A 1 1  ? 8.906   0.686   -44.642 1.00 0.00 ? 64  GLY A H1   5 
ATOM 11478 H H2   . GLY A 1 1  ? 10.043  1.356   -43.609 1.00 0.00 ? 64  GLY A H2   5 
ATOM 11479 H H3   . GLY A 1 1  ? 9.853   1.952   -45.189 1.00 0.00 ? 64  GLY A H3   5 
ATOM 11480 H HA2  . GLY A 1 1  ? 11.433  0.620   -45.835 1.00 0.00 ? 64  GLY A HA2  5 
ATOM 11481 H HA3  . GLY A 1 1  ? 11.448  -0.161  -44.241 1.00 0.00 ? 64  GLY A HA3  5 
ATOM 11482 N N    . LEU A 1 2  ? 10.878  -1.789  -46.532 1.00 0.00 ? 65  LEU A N    5 
ATOM 11483 C CA   . LEU A 1 2  ? 10.354  -2.984  -47.184 1.00 0.00 ? 65  LEU A CA   5 
ATOM 11484 C C    . LEU A 1 2  ? 10.719  -4.242  -46.405 1.00 0.00 ? 65  LEU A C    5 
ATOM 11485 O O    . LEU A 1 2  ? 11.724  -4.274  -45.695 1.00 0.00 ? 65  LEU A O    5 
ATOM 11486 C CB   . LEU A 1 2  ? 10.896  -3.087  -48.615 1.00 0.00 ? 65  LEU A CB   5 
ATOM 11487 C CG   . LEU A 1 2  ? 10.552  -1.915  -49.542 1.00 0.00 ? 65  LEU A CG   5 
ATOM 11488 C CD1  . LEU A 1 2  ? 11.224  -2.121  -50.893 1.00 0.00 ? 65  LEU A CD1  5 
ATOM 11489 C CD2  . LEU A 1 2  ? 9.041   -1.813  -49.693 1.00 0.00 ? 65  LEU A CD2  5 
ATOM 11490 H H    . LEU A 1 2  ? 11.825  -1.477  -46.754 1.00 0.00 ? 65  LEU A H    5 
ATOM 11491 H HA   . LEU A 1 2  ? 9.267   -2.920  -47.239 1.00 0.00 ? 65  LEU A HA   5 
ATOM 11492 H HB2  . LEU A 1 2  ? 11.981  -3.168  -48.562 1.00 0.00 ? 65  LEU A HB2  5 
ATOM 11493 H HB3  . LEU A 1 2  ? 10.503  -4.002  -49.062 1.00 0.00 ? 65  LEU A HB3  5 
ATOM 11494 H HG   . LEU A 1 2  ? 10.934  -0.994  -49.096 1.00 0.00 ? 65  LEU A HG   5 
ATOM 11495 H HD11 . LEU A 1 2  ? 12.303  -2.188  -50.761 1.00 0.00 ? 65  LEU A HD11 5 
ATOM 11496 H HD12 . LEU A 1 2  ? 10.988  -1.281  -51.547 1.00 0.00 ? 65  LEU A HD12 5 
ATOM 11497 H HD13 . LEU A 1 2  ? 10.854  -3.045  -51.340 1.00 0.00 ? 65  LEU A HD13 5 
ATOM 11498 H HD21 . LEU A 1 2  ? 8.807   -1.217  -50.577 1.00 0.00 ? 65  LEU A HD21 5 
ATOM 11499 H HD22 . LEU A 1 2  ? 8.608   -1.332  -48.814 1.00 0.00 ? 65  LEU A HD22 5 
ATOM 11500 H HD23 . LEU A 1 2  ? 8.614   -2.810  -49.809 1.00 0.00 ? 65  LEU A HD23 5 
ATOM 11501 N N    . SER A 1 3  ? 9.895   -5.274  -46.539 1.00 0.00 ? 66  SER A N    5 
ATOM 11502 C CA   . SER A 1 3  ? 10.136  -6.541  -45.859 1.00 0.00 ? 66  SER A CA   5 
ATOM 11503 C C    . SER A 1 3  ? 11.251  -7.327  -46.534 1.00 0.00 ? 66  SER A C    5 
ATOM 11504 O O    . SER A 1 3  ? 11.503  -7.165  -47.728 1.00 0.00 ? 66  SER A O    5 
ATOM 11505 C CB   . SER A 1 3  ? 8.865   -7.369  -45.832 1.00 0.00 ? 66  SER A CB   5 
ATOM 11506 O OG   . SER A 1 3  ? 7.877   -6.747  -45.061 1.00 0.00 ? 66  SER A OG   5 
ATOM 11507 H H    . SER A 1 3  ? 9.079   -5.185  -47.145 1.00 0.00 ? 66  SER A H    5 
ATOM 11508 H HA   . SER A 1 3  ? 10.418  -6.323  -44.838 1.00 0.00 ? 66  SER A HA   5 
ATOM 11509 H HB2  . SER A 1 3  ? 8.499   -7.476  -46.846 1.00 0.00 ? 66  SER A HB2  5 
ATOM 11510 H HB3  . SER A 1 3  ? 9.090   -8.357  -45.423 1.00 0.00 ? 66  SER A HB3  5 
ATOM 11511 H HG   . SER A 1 3  ? 7.315   -6.235  -45.649 1.00 0.00 ? 66  SER A HG   5 
ATOM 11512 N N    . GLU A 1 4  ? 11.919  -8.179  -45.764 1.00 0.00 ? 67  GLU A N    5 
ATOM 11513 C CA   . GLU A 1 4  ? 13.001  -9.003  -46.290 1.00 0.00 ? 67  GLU A CA   5 
ATOM 11514 C C    . GLU A 1 4  ? 12.786  -10.473 -45.959 1.00 0.00 ? 67  GLU A C    5 
ATOM 11515 O O    . GLU A 1 4  ? 13.630  -11.108 -45.326 1.00 0.00 ? 67  GLU A O    5 
ATOM 11516 C CB   . GLU A 1 4  ? 14.346  -8.535  -45.729 1.00 0.00 ? 67  GLU A CB   5 
ATOM 11517 C CG   . GLU A 1 4  ? 14.706  -7.097  -46.076 1.00 0.00 ? 67  GLU A CG   5 
ATOM 11518 C CD   . GLU A 1 4  ? 16.051  -6.687  -45.543 1.00 0.00 ? 67  GLU A CD   5 
ATOM 11519 O OE1  . GLU A 1 4  ? 16.299  -6.903  -44.382 1.00 0.00 ? 67  GLU A OE1  5 
ATOM 11520 O OE2  . GLU A 1 4  ? 16.830  -6.154  -46.299 1.00 0.00 ? 67  GLU A OE2  5 
ATOM 11521 H H    . GLU A 1 4  ? 11.660  -8.267  -44.780 1.00 0.00 ? 67  GLU A H    5 
ATOM 11522 H HA   . GLU A 1 4  ? 13.035  -8.910  -47.379 1.00 0.00 ? 67  GLU A HA   5 
ATOM 11523 H HB2  . GLU A 1 4  ? 14.348  -8.667  -44.669 1.00 0.00 ? 67  GLU A HB2  5 
ATOM 11524 H HB3  . GLU A 1 4  ? 15.120  -9.175  -46.154 1.00 0.00 ? 67  GLU A HB3  5 
ATOM 11525 H HG2  . GLU A 1 4  ? 14.704  -6.984  -47.161 1.00 0.00 ? 67  GLU A HG2  5 
ATOM 11526 H HG3  . GLU A 1 4  ? 13.944  -6.444  -45.648 1.00 0.00 ? 67  GLU A HG3  5 
ATOM 11527 N N    . MET A 1 5  ? 11.651  -11.013 -46.391 1.00 0.00 ? 68  MET A N    5 
ATOM 11528 C CA   . MET A 1 5  ? 11.395  -12.445 -46.289 1.00 0.00 ? 68  MET A CA   5 
ATOM 11529 C C    . MET A 1 5  ? 12.225  -13.225 -47.299 1.00 0.00 ? 68  MET A C    5 
ATOM 11530 O O    . MET A 1 5  ? 12.101  -13.021 -48.507 1.00 0.00 ? 68  MET A O    5 
ATOM 11531 C CB   . MET A 1 5  ? 9.907   -12.729 -46.486 1.00 0.00 ? 68  MET A CB   5 
ATOM 11532 C CG   . MET A 1 5  ? 9.532   -14.202 -46.396 1.00 0.00 ? 68  MET A CG   5 
ATOM 11533 S SD   . MET A 1 5  ? 7.804   -14.505 -46.815 1.00 0.00 ? 68  MET A SD   5 
ATOM 11534 C CE   . MET A 1 5  ? 7.892   -14.553 -48.603 1.00 0.00 ? 68  MET A CE   5 
ATOM 11535 H H    . MET A 1 5  ? 11.009  -10.438 -46.934 1.00 0.00 ? 68  MET A H    5 
ATOM 11536 H HA   . MET A 1 5  ? 11.676  -12.766 -45.289 1.00 0.00 ? 68  MET A HA   5 
ATOM 11537 H HB2  . MET A 1 5  ? 9.353   -12.201 -45.716 1.00 0.00 ? 68  MET A HB2  5 
ATOM 11538 H HB3  . MET A 1 5  ? 9.603   -12.351 -47.454 1.00 0.00 ? 68  MET A HB3  5 
ATOM 11539 H HG2  . MET A 1 5  ? 10.145  -14.758 -47.099 1.00 0.00 ? 68  MET A HG2  5 
ATOM 11540 H HG3  . MET A 1 5  ? 9.725   -14.568 -45.397 1.00 0.00 ? 68  MET A HG3  5 
ATOM 11541 H HE1  . MET A 1 5  ? 8.013   -15.587 -48.930 1.00 0.00 ? 68  MET A HE1  5 
ATOM 11542 H HE2  . MET A 1 5  ? 8.747   -13.965 -48.941 1.00 0.00 ? 68  MET A HE2  5 
ATOM 11543 H HE3  . MET A 1 5  ? 6.979   -14.142 -49.030 1.00 0.00 ? 68  MET A HE3  5 
ATOM 11544 N N    . ARG A 1 6  ? 13.070  -14.120 -46.799 1.00 0.00 ? 69  ARG A N    5 
ATOM 11545 C CA   . ARG A 1 6  ? 13.893  -14.961 -47.658 1.00 0.00 ? 69  ARG A CA   5 
ATOM 11546 C C    . ARG A 1 6  ? 14.460  -16.148 -46.889 1.00 0.00 ? 69  ARG A C    5 
ATOM 11547 O O    . ARG A 1 6  ? 14.638  -16.083 -45.673 1.00 0.00 ? 69  ARG A O    5 
ATOM 11548 C CB   . ARG A 1 6  ? 15.035  -14.157 -48.259 1.00 0.00 ? 69  ARG A CB   5 
ATOM 11549 C CG   . ARG A 1 6  ? 16.158  -13.819 -47.289 1.00 0.00 ? 69  ARG A CG   5 
ATOM 11550 C CD   . ARG A 1 6  ? 17.218  -13.005 -47.937 1.00 0.00 ? 69  ARG A CD   5 
ATOM 11551 N NE   . ARG A 1 6  ? 18.369  -12.821 -47.069 1.00 0.00 ? 69  ARG A NE   5 
ATOM 11552 C CZ   . ARG A 1 6  ? 19.443  -12.067 -47.371 1.00 0.00 ? 69  ARG A CZ   5 
ATOM 11553 N NH1  . ARG A 1 6  ? 19.499  -11.433 -48.522 1.00 0.00 ? 69  ARG A NH1  5 
ATOM 11554 N NH2  . ARG A 1 6  ? 20.441  -11.963 -46.511 1.00 0.00 ? 69  ARG A NH2  5 
ATOM 11555 H H    . ARG A 1 6  ? 13.115  -14.247 -45.788 1.00 0.00 ? 69  ARG A H    5 
ATOM 11556 H HA   . ARG A 1 6  ? 13.270  -15.342 -48.467 1.00 0.00 ? 69  ARG A HA   5 
ATOM 11557 H HB2  . ARG A 1 6  ? 15.462  -14.725 -49.085 1.00 0.00 ? 69  ARG A HB2  5 
ATOM 11558 H HB3  . ARG A 1 6  ? 14.630  -13.224 -48.652 1.00 0.00 ? 69  ARG A HB3  5 
ATOM 11559 H HG2  . ARG A 1 6  ? 15.744  -13.261 -46.449 1.00 0.00 ? 69  ARG A HG2  5 
ATOM 11560 H HG3  . ARG A 1 6  ? 16.609  -14.742 -46.925 1.00 0.00 ? 69  ARG A HG3  5 
ATOM 11561 H HD2  . ARG A 1 6  ? 17.541  -13.505 -48.851 1.00 0.00 ? 69  ARG A HD2  5 
ATOM 11562 H HD3  . ARG A 1 6  ? 16.806  -12.028 -48.190 1.00 0.00 ? 69  ARG A HD3  5 
ATOM 11563 H HE   . ARG A 1 6  ? 18.361  -13.279 -46.203 1.00 0.00 ? 69  ARG A HE   5 
ATOM 11564 H HH11 . ARG A 1 6  ? 18.745  -11.510 -49.174 1.00 0.00 ? 69  ARG A HH11 5 
ATOM 11565 H HH12 . ARG A 1 6  ? 20.305  -10.867 -48.748 1.00 0.00 ? 69  ARG A HH12 5 
ATOM 11566 H HH21 . ARG A 1 6  ? 20.404  -12.444 -45.635 1.00 0.00 ? 69  ARG A HH21 5 
ATOM 11567 H HH22 . ARG A 1 6  ? 21.238  -11.403 -46.738 1.00 0.00 ? 69  ARG A HH22 5 
ATOM 11568 N N    . LEU A 1 7  ? 14.742  -17.231 -47.606 1.00 0.00 ? 70  LEU A N    5 
ATOM 11569 C CA   . LEU A 1 7  ? 15.557  -18.315 -47.067 1.00 0.00 ? 70  LEU A CA   5 
ATOM 11570 C C    . LEU A 1 7  ? 16.993  -18.226 -47.566 1.00 0.00 ? 70  LEU A C    5 
ATOM 11571 O O    . LEU A 1 7  ? 17.254  -18.347 -48.761 1.00 0.00 ? 70  LEU A O    5 
ATOM 11572 C CB   . LEU A 1 7  ? 14.956  -19.671 -47.458 1.00 0.00 ? 70  LEU A CB   5 
ATOM 11573 C CG   . LEU A 1 7  ? 15.821  -20.896 -47.141 1.00 0.00 ? 70  LEU A CG   5 
ATOM 11574 C CD1  . LEU A 1 7  ? 16.037  -20.990 -45.635 1.00 0.00 ? 70  LEU A CD1  5 
ATOM 11575 C CD2  . LEU A 1 7  ? 15.142  -22.149 -47.674 1.00 0.00 ? 70  LEU A CD2  5 
ATOM 11576 H H    . LEU A 1 7  ? 14.606  -17.187 -48.616 1.00 0.00 ? 70  LEU A H    5 
ATOM 11577 H HA   . LEU A 1 7  ? 15.561  -18.239 -45.999 1.00 0.00 ? 70  LEU A HA   5 
ATOM 11578 H HB2  . LEU A 1 7  ? 14.022  -19.795 -46.927 1.00 0.00 ? 70  LEU A HB2  5 
ATOM 11579 H HB3  . LEU A 1 7  ? 14.751  -19.656 -48.529 1.00 0.00 ? 70  LEU A HB3  5 
ATOM 11580 H HG   . LEU A 1 7  ? 16.779  -20.788 -47.637 1.00 0.00 ? 70  LEU A HG   5 
ATOM 11581 H HD11 . LEU A 1 7  ? 16.538  -20.105 -45.257 1.00 0.00 ? 70  LEU A HD11 5 
ATOM 11582 H HD12 . LEU A 1 7  ? 16.657  -21.863 -45.429 1.00 0.00 ? 70  LEU A HD12 5 
ATOM 11583 H HD13 . LEU A 1 7  ? 15.100  -21.112 -45.161 1.00 0.00 ? 70  LEU A HD13 5 
ATOM 11584 H HD21 . LEU A 1 7  ? 15.643  -23.031 -47.273 1.00 0.00 ? 70  LEU A HD21 5 
ATOM 11585 H HD22 . LEU A 1 7  ? 15.197  -22.165 -48.762 1.00 0.00 ? 70  LEU A HD22 5 
ATOM 11586 H HD23 . LEU A 1 7  ? 14.098  -22.155 -47.365 1.00 0.00 ? 70  LEU A HD23 5 
ATOM 11587 N N    . GLU A 1 8  ? 17.922  -18.008 -46.639 1.00 0.00 ? 71  GLU A N    5 
ATOM 11588 C CA   . GLU A 1 8  ? 19.343  -18.032 -46.961 1.00 0.00 ? 71  GLU A CA   5 
ATOM 11589 C C    . GLU A 1 8  ? 19.822  -19.447 -47.244 1.00 0.00 ? 71  GLU A C    5 
ATOM 11590 O O    . GLU A 1 8  ? 19.032  -20.390 -47.261 1.00 0.00 ? 71  GLU A O    5 
ATOM 11591 C CB   . GLU A 1 8  ? 20.159  -17.425 -45.818 1.00 0.00 ? 71  GLU A CB   5 
ATOM 11592 C CG   . GLU A 1 8  ? 19.893  -15.947 -45.570 1.00 0.00 ? 71  GLU A CG   5 
ATOM 11593 C CD   . GLU A 1 8  ? 20.715  -15.384 -44.443 1.00 0.00 ? 71  GLU A CD   5 
ATOM 11594 O OE1  . GLU A 1 8  ? 21.287  -16.154 -43.710 1.00 0.00 ? 71  GLU A OE1  5 
ATOM 11595 O OE2  . GLU A 1 8  ? 20.770  -14.184 -44.318 1.00 0.00 ? 71  GLU A OE2  5 
ATOM 11596 H H    . GLU A 1 8  ? 17.643  -17.937 -45.663 1.00 0.00 ? 71  GLU A H    5 
ATOM 11597 H HA   . GLU A 1 8  ? 19.495  -17.421 -47.852 1.00 0.00 ? 71  GLU A HA   5 
ATOM 11598 H HB2  . GLU A 1 8  ? 19.916  -17.973 -44.934 1.00 0.00 ? 71  GLU A HB2  5 
ATOM 11599 H HB3  . GLU A 1 8  ? 21.220  -17.553 -46.036 1.00 0.00 ? 71  GLU A HB3  5 
ATOM 11600 H HG2  . GLU A 1 8  ? 20.120  -15.392 -46.481 1.00 0.00 ? 71  GLU A HG2  5 
ATOM 11601 H HG3  . GLU A 1 8  ? 18.836  -15.823 -45.334 1.00 0.00 ? 71  GLU A HG3  5 
ATOM 11602 N N    . LYS A 1 9  ? 21.124  -19.593 -47.467 1.00 0.00 ? 72  LYS A N    5 
ATOM 11603 C CA   . LYS A 1 9  ? 21.734  -20.909 -47.624 1.00 0.00 ? 72  LYS A CA   5 
ATOM 11604 C C    . LYS A 1 9  ? 20.946  -21.973 -46.871 1.00 0.00 ? 72  LYS A C    5 
ATOM 11605 O O    . LYS A 1 9  ? 20.467  -22.940 -47.465 1.00 0.00 ? 72  LYS A O    5 
ATOM 11606 C CB   . LYS A 1 9  ? 23.186  -20.889 -47.143 1.00 0.00 ? 72  LYS A CB   5 
ATOM 11607 C CG   . LYS A 1 9  ? 23.919  -22.214 -47.302 1.00 0.00 ? 72  LYS A CG   5 
ATOM 11608 C CD   . LYS A 1 9  ? 25.367  -22.100 -46.851 1.00 0.00 ? 72  LYS A CD   5 
ATOM 11609 C CE   . LYS A 1 9  ? 26.093  -23.432 -46.974 1.00 0.00 ? 72  LYS A CE   5 
ATOM 11610 N NZ   . LYS A 1 9  ? 27.509  -23.338 -46.530 1.00 0.00 ? 72  LYS A NZ   5 
ATOM 11611 H H    . LYS A 1 9  ? 21.728  -18.772 -47.421 1.00 0.00 ? 72  LYS A H    5 
ATOM 11612 H HA   . LYS A 1 9  ? 21.731  -21.155 -48.685 1.00 0.00 ? 72  LYS A HA   5 
ATOM 11613 H HB2  . LYS A 1 9  ? 23.728  -20.127 -47.702 1.00 0.00 ? 72  LYS A HB2  5 
ATOM 11614 H HB3  . LYS A 1 9  ? 23.185  -20.617 -46.089 1.00 0.00 ? 72  LYS A HB3  5 
ATOM 11615 H HG2  . LYS A 1 9  ? 23.416  -22.972 -46.702 1.00 0.00 ? 72  LYS A HG2  5 
ATOM 11616 H HG3  . LYS A 1 9  ? 23.895  -22.508 -48.351 1.00 0.00 ? 72  LYS A HG3  5 
ATOM 11617 H HD2  . LYS A 1 9  ? 25.874  -21.360 -47.467 1.00 0.00 ? 72  LYS A HD2  5 
ATOM 11618 H HD3  . LYS A 1 9  ? 25.390  -21.780 -45.809 1.00 0.00 ? 72  LYS A HD3  5 
ATOM 11619 H HE2  . LYS A 1 9  ? 25.580  -24.172 -46.362 1.00 0.00 ? 72  LYS A HE2  5 
ATOM 11620 H HE3  . LYS A 1 9  ? 26.067  -23.752 -48.017 1.00 0.00 ? 72  LYS A HE3  5 
ATOM 11621 H HZ1  . LYS A 1 9  ? 27.555  -23.437 -45.497 1.00 0.00 ? 72  LYS A HZ1  5 
ATOM 11622 H HZ2  . LYS A 1 9  ? 27.892  -22.411 -46.809 1.00 0.00 ? 72  LYS A HZ2  5 
ATOM 11623 H HZ3  . LYS A 1 9  ? 28.049  -24.072 -46.965 1.00 0.00 ? 72  LYS A HZ3  5 
ATOM 11624 N N    . ASP A 1 10 ? 20.815  -21.790 -45.563 1.00 0.00 ? 73  ASP A N    5 
ATOM 11625 C CA   . ASP A 1 10 ? 19.917  -22.610 -44.760 1.00 0.00 ? 73  ASP A CA   5 
ATOM 11626 C C    . ASP A 1 10 ? 19.430  -21.855 -43.529 1.00 0.00 ? 73  ASP A C    5 
ATOM 11627 O O    . ASP A 1 10 ? 19.608  -22.308 -42.400 1.00 0.00 ? 73  ASP A O    5 
ATOM 11628 C CB   . ASP A 1 10 ? 20.612  -23.904 -44.328 1.00 0.00 ? 73  ASP A CB   5 
ATOM 11629 C CG   . ASP A 1 10 ? 21.847  -23.655 -43.472 1.00 0.00 ? 73  ASP A CG   5 
ATOM 11630 O OD1  . ASP A 1 10 ? 22.166  -22.514 -43.241 1.00 0.00 ? 73  ASP A OD1  5 
ATOM 11631 O OD2  . ASP A 1 10 ? 22.459  -24.611 -43.057 1.00 0.00 ? 73  ASP A OD2  5 
ATOM 11632 H H    . ASP A 1 10 ? 21.208  -20.945 -45.145 1.00 0.00 ? 73  ASP A H    5 
ATOM 11633 H HA   . ASP A 1 10 ? 19.051  -22.865 -45.360 1.00 0.00 ? 73  ASP A HA   5 
ATOM 11634 H HB2  . ASP A 1 10 ? 19.922  -24.517 -43.767 1.00 0.00 ? 73  ASP A HB2  5 
ATOM 11635 H HB3  . ASP A 1 10 ? 20.917  -24.447 -45.223 1.00 0.00 ? 73  ASP A HB3  5 
ATOM 11636 N N    . ARG A 1 11 ? 18.816  -20.698 -43.756 1.00 0.00 ? 74  ARG A N    5 
ATOM 11637 C CA   . ARG A 1 11 ? 18.435  -19.806 -42.667 1.00 0.00 ? 74  ARG A CA   5 
ATOM 11638 C C    . ARG A 1 11 ? 17.355  -18.827 -43.110 1.00 0.00 ? 74  ARG A C    5 
ATOM 11639 O O    . ARG A 1 11 ? 17.622  -17.890 -43.862 1.00 0.00 ? 74  ARG A O    5 
ATOM 11640 C CB   . ARG A 1 11 ? 19.642  -19.031 -42.163 1.00 0.00 ? 74  ARG A CB   5 
ATOM 11641 C CG   . ARG A 1 11 ? 19.388  -18.184 -40.928 1.00 0.00 ? 74  ARG A CG   5 
ATOM 11642 C CD   . ARG A 1 11 ? 19.197  -19.021 -39.715 1.00 0.00 ? 74  ARG A CD   5 
ATOM 11643 N NE   . ARG A 1 11 ? 19.264  -18.234 -38.496 1.00 0.00 ? 74  ARG A NE   5 
ATOM 11644 C CZ   . ARG A 1 11 ? 18.199  -17.687 -37.879 1.00 0.00 ? 74  ARG A CZ   5 
ATOM 11645 N NH1  . ARG A 1 11 ? 16.993  -17.851 -38.381 1.00 0.00 ? 74  ARG A NH1  5 
ATOM 11646 N NH2  . ARG A 1 11 ? 18.364  -16.985 -36.771 1.00 0.00 ? 74  ARG A NH2  5 
ATOM 11647 H H    . ARG A 1 11 ? 18.722  -20.370 -44.717 1.00 0.00 ? 74  ARG A H    5 
ATOM 11648 H HA   . ARG A 1 11 ? 18.048  -20.410 -41.867 1.00 0.00 ? 74  ARG A HA   5 
ATOM 11649 H HB2  . ARG A 1 11 ? 20.425  -19.745 -41.924 1.00 0.00 ? 74  ARG A HB2  5 
ATOM 11650 H HB3  . ARG A 1 11 ? 20.003  -18.392 -42.945 1.00 0.00 ? 74  ARG A HB3  5 
ATOM 11651 H HG2  . ARG A 1 11 ? 20.236  -17.520 -40.760 1.00 0.00 ? 74  ARG A HG2  5 
ATOM 11652 H HG3  . ARG A 1 11 ? 18.494  -17.580 -41.097 1.00 0.00 ? 74  ARG A HG3  5 
ATOM 11653 H HD2  . ARG A 1 11 ? 18.220  -19.465 -39.758 1.00 0.00 ? 74  ARG A HD2  5 
ATOM 11654 H HD3  . ARG A 1 11 ? 19.951  -19.808 -39.679 1.00 0.00 ? 74  ARG A HD3  5 
ATOM 11655 H HE   . ARG A 1 11 ? 20.147  -18.078 -38.102 1.00 0.00 ? 74  ARG A HE   5 
ATOM 11656 H HH11 . ARG A 1 11 ? 16.865  -18.375 -39.221 1.00 0.00 ? 74  ARG A HH11 5 
ATOM 11657 H HH12 . ARG A 1 11 ? 16.195  -17.444 -37.915 1.00 0.00 ? 74  ARG A HH12 5 
ATOM 11658 H HH21 . ARG A 1 11 ? 19.278  -16.856 -36.387 1.00 0.00 ? 74  ARG A HH21 5 
ATOM 11659 H HH22 . ARG A 1 11 ? 17.568  -16.582 -36.315 1.00 0.00 ? 74  ARG A HH22 5 
ATOM 11660 N N    . PHE A 1 12 ? 16.132  -19.051 -42.640 1.00 0.00 ? 75  PHE A N    5 
ATOM 11661 C CA   . PHE A 1 12 ? 14.988  -18.259 -43.073 1.00 0.00 ? 75  PHE A CA   5 
ATOM 11662 C C    . PHE A 1 12 ? 14.684  -17.144 -42.082 1.00 0.00 ? 75  PHE A C    5 
ATOM 11663 O O    . PHE A 1 12 ? 14.583  -17.380 -40.877 1.00 0.00 ? 75  PHE A O    5 
ATOM 11664 C CB   . PHE A 1 12 ? 13.754  -19.148 -43.241 1.00 0.00 ? 75  PHE A CB   5 
ATOM 11665 C CG   . PHE A 1 12 ? 12.486  -18.383 -43.493 1.00 0.00 ? 75  PHE A CG   5 
ATOM 11666 C CD1  . PHE A 1 12 ? 12.198  -17.885 -44.756 1.00 0.00 ? 75  PHE A CD1  5 
ATOM 11667 C CD2  . PHE A 1 12 ? 11.578  -18.161 -42.471 1.00 0.00 ? 75  PHE A CD2  5 
ATOM 11668 C CE1  . PHE A 1 12 ? 11.034  -17.181 -44.990 1.00 0.00 ? 75  PHE A CE1  5 
ATOM 11669 C CE2  . PHE A 1 12 ? 10.411  -17.457 -42.701 1.00 0.00 ? 75  PHE A CE2  5 
ATOM 11670 C CZ   . PHE A 1 12 ? 10.139  -16.967 -43.964 1.00 0.00 ? 75  PHE A CZ   5 
ATOM 11671 H H    . PHE A 1 12 ? 15.975  -19.854 -42.032 1.00 0.00 ? 75  PHE A H    5 
ATOM 11672 H HA   . PHE A 1 12 ? 15.201  -17.791 -44.016 1.00 0.00 ? 75  PHE A HA   5 
ATOM 11673 H HB2  . PHE A 1 12 ? 13.918  -19.786 -44.083 1.00 0.00 ? 75  PHE A HB2  5 
ATOM 11674 H HB3  . PHE A 1 12 ? 13.629  -19.761 -42.357 1.00 0.00 ? 75  PHE A HB3  5 
ATOM 11675 H HD1  . PHE A 1 12 ? 12.898  -18.048 -45.563 1.00 0.00 ? 75  PHE A HD1  5 
ATOM 11676 H HD2  . PHE A 1 12 ? 11.786  -18.542 -41.483 1.00 0.00 ? 75  PHE A HD2  5 
ATOM 11677 H HE1  . PHE A 1 12 ? 10.821  -16.802 -45.977 1.00 0.00 ? 75  PHE A HE1  5 
ATOM 11678 H HE2  . PHE A 1 12 ? 9.713   -17.282 -41.898 1.00 0.00 ? 75  PHE A HE2  5 
ATOM 11679 H HZ   . PHE A 1 12 ? 9.172   -16.538 -44.176 1.00 0.00 ? 75  PHE A HZ   5 
ATOM 11680 N N    . SER A 1 13 ? 14.539  -15.926 -42.593 1.00 0.00 ? 76  SER A N    5 
ATOM 11681 C CA   . SER A 1 13 ? 14.284  -14.764 -41.751 1.00 0.00 ? 76  SER A CA   5 
ATOM 11682 C C    . SER A 1 13 ? 13.263  -13.832 -42.393 1.00 0.00 ? 76  SER A C    5 
ATOM 11683 O O    . SER A 1 13 ? 13.117  -13.803 -43.612 1.00 0.00 ? 76  SER A O    5 
ATOM 11684 C CB   . SER A 1 13 ? 15.576  -14.015 -41.490 1.00 0.00 ? 76  SER A CB   5 
ATOM 11685 O OG   . SER A 1 13 ? 16.094  -13.479 -42.677 1.00 0.00 ? 76  SER A OG   5 
ATOM 11686 H H    . SER A 1 13 ? 14.637  -15.798 -43.601 1.00 0.00 ? 76  SER A H    5 
ATOM 11687 H HA   . SER A 1 13 ? 13.874  -15.090 -40.835 1.00 0.00 ? 76  SER A HA   5 
ATOM 11688 H HB2  . SER A 1 13 ? 15.384  -13.202 -40.792 1.00 0.00 ? 76  SER A HB2  5 
ATOM 11689 H HB3  . SER A 1 13 ? 16.300  -14.700 -41.045 1.00 0.00 ? 76  SER A HB3  5 
ATOM 11690 H HG   . SER A 1 13 ? 15.961  -12.527 -42.658 1.00 0.00 ? 76  SER A HG   5 
ATOM 11691 N N    . VAL A 1 14 ? 12.562  -13.069 -41.561 1.00 0.00 ? 77  VAL A N    5 
ATOM 11692 C CA   . VAL A 1 14 ? 11.622  -12.068 -42.047 1.00 0.00 ? 77  VAL A CA   5 
ATOM 11693 C C    . VAL A 1 14 ? 11.809  -10.739 -41.326 1.00 0.00 ? 77  VAL A C    5 
ATOM 11694 O O    . VAL A 1 14 ? 11.305  -10.546 -40.219 1.00 0.00 ? 77  VAL A O    5 
ATOM 11695 C CB   . VAL A 1 14 ? 10.174  -12.555 -41.854 1.00 0.00 ? 77  VAL A CB   5 
ATOM 11696 C CG1  . VAL A 1 14 ? 9.188   -11.493 -42.320 1.00 0.00 ? 77  VAL A CG1  5 
ATOM 11697 C CG2  . VAL A 1 14 ? 9.961   -13.857 -42.610 1.00 0.00 ? 77  VAL A CG2  5 
ATOM 11698 H H    . VAL A 1 14 ? 12.745  -13.133 -40.559 1.00 0.00 ? 77  VAL A H    5 
ATOM 11699 H HA   . VAL A 1 14 ? 11.785  -11.891 -43.111 1.00 0.00 ? 77  VAL A HA   5 
ATOM 11700 H HB   . VAL A 1 14 ? 10.022  -12.720 -40.802 1.00 0.00 ? 77  VAL A HB   5 
ATOM 11701 H HG11 . VAL A 1 14 ? 8.179   -11.791 -42.032 1.00 0.00 ? 77  VAL A HG11 5 
ATOM 11702 H HG12 . VAL A 1 14 ? 9.241   -11.419 -43.405 1.00 0.00 ? 77  VAL A HG12 5 
ATOM 11703 H HG13 . VAL A 1 14 ? 9.415   -10.528 -41.885 1.00 0.00 ? 77  VAL A HG13 5 
ATOM 11704 H HG21 . VAL A 1 14 ? 8.926   -13.932 -42.954 1.00 0.00 ? 77  VAL A HG21 5 
ATOM 11705 H HG22 . VAL A 1 14 ? 10.176  -14.701 -41.951 1.00 0.00 ? 77  VAL A HG22 5 
ATOM 11706 H HG23 . VAL A 1 14 ? 10.631  -13.902 -43.466 1.00 0.00 ? 77  VAL A HG23 5 
ATOM 11707 N N    . ASN A 1 15 ? 12.535  -9.824  -41.959 1.00 0.00 ? 78  ASN A N    5 
ATOM 11708 C CA   . ASN A 1 15 ? 12.689  -8.472  -41.437 1.00 0.00 ? 78  ASN A CA   5 
ATOM 11709 C C    . ASN A 1 15 ? 11.621  -7.540  -41.994 1.00 0.00 ? 78  ASN A C    5 
ATOM 11710 O O    . ASN A 1 15 ? 11.604  -7.243  -43.189 1.00 0.00 ? 78  ASN A O    5 
ATOM 11711 C CB   . ASN A 1 15 ? 14.075  -7.935  -41.741 1.00 0.00 ? 78  ASN A CB   5 
ATOM 11712 C CG   . ASN A 1 15 ? 14.313  -6.574  -41.147 1.00 0.00 ? 78  ASN A CG   5 
ATOM 11713 O OD1  . ASN A 1 15 ? 13.635  -6.174  -40.193 1.00 0.00 ? 78  ASN A OD1  5 
ATOM 11714 N ND2  . ASN A 1 15 ? 15.260  -5.856  -41.693 1.00 0.00 ? 78  ASN A ND2  5 
ATOM 11715 H H    . ASN A 1 15 ? 12.906  -10.035 -42.885 1.00 0.00 ? 78  ASN A H    5 
ATOM 11716 H HA   . ASN A 1 15 ? 12.577  -8.505  -40.349 1.00 0.00 ? 78  ASN A HA   5 
ATOM 11717 H HB2  . ASN A 1 15 ? 14.824  -8.625  -41.356 1.00 0.00 ? 78  ASN A HB2  5 
ATOM 11718 H HB3  . ASN A 1 15 ? 14.179  -7.860  -42.805 1.00 0.00 ? 78  ASN A HB3  5 
ATOM 11719 H HD21 . ASN A 1 15 ? 15.801  -6.221  -42.478 1.00 0.00 ? 78  ASN A HD21 5 
ATOM 11720 H HD22 . ASN A 1 15 ? 15.458  -4.924  -41.329 1.00 0.00 ? 78  ASN A HD22 5 
ATOM 11721 N N    . LEU A 1 16 ? 10.727  -7.084  -41.122 1.00 0.00 ? 79  LEU A N    5 
ATOM 11722 C CA   . LEU A 1 16 ? 9.563   -6.316  -41.551 1.00 0.00 ? 79  LEU A CA   5 
ATOM 11723 C C    . LEU A 1 16 ? 9.417   -5.038  -40.735 1.00 0.00 ? 79  LEU A C    5 
ATOM 11724 O O    . LEU A 1 16 ? 9.948   -4.931  -39.628 1.00 0.00 ? 79  LEU A O    5 
ATOM 11725 C CB   . LEU A 1 16 ? 8.291   -7.164  -41.417 1.00 0.00 ? 79  LEU A CB   5 
ATOM 11726 C CG   . LEU A 1 16 ? 7.852   -7.485  -39.983 1.00 0.00 ? 79  LEU A CG   5 
ATOM 11727 C CD1  . LEU A 1 16 ? 6.331   -7.497  -39.907 1.00 0.00 ? 79  LEU A CD1  5 
ATOM 11728 C CD2  . LEU A 1 16 ? 8.431   -8.827  -39.564 1.00 0.00 ? 79  LEU A CD2  5 
ATOM 11729 H H    . LEU A 1 16 ? 10.786  -7.392  -40.152 1.00 0.00 ? 79  LEU A H    5 
ATOM 11730 H HA   . LEU A 1 16 ? 9.684   -6.027  -42.598 1.00 0.00 ? 79  LEU A HA   5 
ATOM 11731 H HB2  . LEU A 1 16 ? 7.489   -6.610  -41.914 1.00 0.00 ? 79  LEU A HB2  5 
ATOM 11732 H HB3  . LEU A 1 16 ? 8.451   -8.091  -41.971 1.00 0.00 ? 79  LEU A HB3  5 
ATOM 11733 H HG   . LEU A 1 16 ? 8.221   -6.720  -39.302 1.00 0.00 ? 79  LEU A HG   5 
ATOM 11734 H HD11 . LEU A 1 16 ? 5.933   -8.076  -40.735 1.00 0.00 ? 79  LEU A HD11 5 
ATOM 11735 H HD12 . LEU A 1 16 ? 5.952   -6.477  -39.966 1.00 0.00 ? 79  LEU A HD12 5 
ATOM 11736 H HD13 . LEU A 1 16 ? 6.018   -7.946  -38.966 1.00 0.00 ? 79  LEU A HD13 5 
ATOM 11737 H HD21 . LEU A 1 16 ? 8.118   -9.588  -40.269 1.00 0.00 ? 79  LEU A HD21 5 
ATOM 11738 H HD22 . LEU A 1 16 ? 8.046   -9.086  -38.586 1.00 0.00 ? 79  LEU A HD22 5 
ATOM 11739 H HD23 . LEU A 1 16 ? 9.519   -8.780  -39.532 1.00 0.00 ? 79  LEU A HD23 5 
ATOM 11740 N N    . ASP A 1 17 ? 8.692   -4.070  -41.286 1.00 0.00 ? 80  ASP A N    5 
ATOM 11741 C CA   . ASP A 1 17 ? 8.604   -2.743  -40.687 1.00 0.00 ? 80  ASP A CA   5 
ATOM 11742 C C    . ASP A 1 17 ? 7.440   -2.656  -39.709 1.00 0.00 ? 80  ASP A C    5 
ATOM 11743 O O    . ASP A 1 17 ? 6.287   -2.882  -40.079 1.00 0.00 ? 80  ASP A O    5 
ATOM 11744 C CB   . ASP A 1 17 ? 8.447   -1.677  -41.772 1.00 0.00 ? 80  ASP A CB   5 
ATOM 11745 C CG   . ASP A 1 17 ? 8.442   -0.259  -41.212 1.00 0.00 ? 80  ASP A CG   5 
ATOM 11746 O OD1  . ASP A 1 17 ? 8.307   -0.113  -40.021 1.00 0.00 ? 80  ASP A OD1  5 
ATOM 11747 O OD2  . ASP A 1 17 ? 8.570   0.662   -41.982 1.00 0.00 ? 80  ASP A OD2  5 
ATOM 11748 H H    . ASP A 1 17 ? 8.298   -4.219  -42.214 1.00 0.00 ? 80  ASP A H    5 
ATOM 11749 H HA   . ASP A 1 17 ? 9.523   -2.526  -40.141 1.00 0.00 ? 80  ASP A HA   5 
ATOM 11750 H HB2  . ASP A 1 17 ? 9.276   -1.772  -42.473 1.00 0.00 ? 80  ASP A HB2  5 
ATOM 11751 H HB3  . ASP A 1 17 ? 7.510   -1.850  -42.303 1.00 0.00 ? 80  ASP A HB3  5 
ATOM 11752 N N    . VAL A 1 18 ? 7.747   -2.329  -38.459 1.00 0.00 ? 81  VAL A N    5 
ATOM 11753 C CA   . VAL A 1 18 ? 6.720   -2.081  -37.457 1.00 0.00 ? 81  VAL A CA   5 
ATOM 11754 C C    . VAL A 1 18 ? 7.135   -0.967  -36.502 1.00 0.00 ? 81  VAL A C    5 
ATOM 11755 O O    . VAL A 1 18 ? 6.763   -0.970  -35.329 1.00 0.00 ? 81  VAL A O    5 
ATOM 11756 C CB   . VAL A 1 18 ? 6.433   -3.363  -36.651 1.00 0.00 ? 81  VAL A CB   5 
ATOM 11757 C CG1  . VAL A 1 18 ? 5.835   -4.434  -37.550 1.00 0.00 ? 81  VAL A CG1  5 
ATOM 11758 C CG2  . VAL A 1 18 ? 7.717   -3.859  -36.000 1.00 0.00 ? 81  VAL A CG2  5 
ATOM 11759 H H    . VAL A 1 18 ? 8.721   -2.129  -38.223 1.00 0.00 ? 81  VAL A H    5 
ATOM 11760 H HA   . VAL A 1 18 ? 5.797   -1.772  -37.954 1.00 0.00 ? 81  VAL A HA   5 
ATOM 11761 H HB   . VAL A 1 18 ? 5.712   -3.126  -35.868 1.00 0.00 ? 81  VAL A HB   5 
ATOM 11762 H HG11 . VAL A 1 18 ? 5.279   -5.150  -36.944 1.00 0.00 ? 81  VAL A HG11 5 
ATOM 11763 H HG12 . VAL A 1 18 ? 6.640   -4.956  -38.071 1.00 0.00 ? 81  VAL A HG12 5 
ATOM 11764 H HG13 . VAL A 1 18 ? 5.168   -3.997  -38.288 1.00 0.00 ? 81  VAL A HG13 5 
ATOM 11765 H HG21 . VAL A 1 18 ? 8.445   -4.094  -36.774 1.00 0.00 ? 81  VAL A HG21 5 
ATOM 11766 H HG22 . VAL A 1 18 ? 8.119   -3.094  -35.338 1.00 0.00 ? 81  VAL A HG22 5 
ATOM 11767 H HG23 . VAL A 1 18 ? 7.485   -4.747  -35.424 1.00 0.00 ? 81  VAL A HG23 5 
ATOM 11768 N N    . LYS A 1 19 ? 7.910   -0.017  -37.015 1.00 0.00 ? 82  LYS A N    5 
ATOM 11769 C CA   . LYS A 1 19 ? 8.607   0.943   -36.166 1.00 0.00 ? 82  LYS A CA   5 
ATOM 11770 C C    . LYS A 1 19 ? 7.747   2.172   -35.903 1.00 0.00 ? 82  LYS A C    5 
ATOM 11771 O O    . LYS A 1 19 ? 8.221   3.303   -35.988 1.00 0