data_2N23
# 
_entry.id   2N23 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104324   RCSB  
2N23         PDB   
25584        BMRB  
D_1000104324 WWPDB 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 6225  BMRB 'Chemical shifts of free Tfb1'                                           
unspecified 1y5o  PDB  'NMR structure of free Tfb1'                                             
unspecified 2l2i  PDB  'NMR structure of Tfb1 in complex with activation domain of EKLF (TAD2)' 
unspecified 25584 BMRB .                                                                        
unspecified 2N22  PDB  .                                                                        
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N23 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-27 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lecoq, L.'      1 
'Morse, T.'      2 
'Raiola, L.'     3 
'Arseneault, G.' 4 
'Omichinski, J.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Structural Characterization of the Complex between the N-terminal Transactivation Domain of EKLF and the p62/Tfb1 subunit of TFIIH' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Morse, T.'      1 
primary 'Lecoq, L.'      2 
primary 'Raiola, L.'     3 
primary 'Arseneault, G.' 4 
primary 'Omichinski, J.' 5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RNA polymerase II transcription factor B subunit 1' 12903.701 1 ? ? 
'Pleckstrin homology domain, UNP residues 2-115' ? 
2 polymer man 'Krueppel-like factor 1'                             2359.483  1 ? ? 'Transactivation Domain 1, UNP residues 22-40' 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;General transcription and DNA repair factor IIH subunit TFB1, TFIIH subunit TFB1, RNA polymerase II transcription factor B 73 kDa subunit, RNA polymerase II transcription factor B p73 subunit
;
2 'Erythroid krueppel-like transcription factor, EKLF' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEV
VPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
;
;PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEV
VPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
;
A ? 
2 'polypeptide(L)' no no DTQDDFLKWWRSEEAQDMG DTQDDFLKWWRSEEAQDMG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   SER n 
1 3   HIS n 
1 4   SER n 
1 5   GLY n 
1 6   ALA n 
1 7   ALA n 
1 8   ILE n 
1 9   PHE n 
1 10  GLU n 
1 11  LYS n 
1 12  VAL n 
1 13  SER n 
1 14  GLY n 
1 15  ILE n 
1 16  ILE n 
1 17  ALA n 
1 18  ILE n 
1 19  ASN n 
1 20  GLU n 
1 21  ASP n 
1 22  VAL n 
1 23  SER n 
1 24  PRO n 
1 25  ALA n 
1 26  GLU n 
1 27  LEU n 
1 28  THR n 
1 29  TRP n 
1 30  ARG n 
1 31  SER n 
1 32  THR n 
1 33  ASP n 
1 34  GLY n 
1 35  ASP n 
1 36  LYS n 
1 37  VAL n 
1 38  HIS n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  LEU n 
1 43  SER n 
1 44  THR n 
1 45  ILE n 
1 46  ASP n 
1 47  LYS n 
1 48  LEU n 
1 49  GLN n 
1 50  ALA n 
1 51  THR n 
1 52  PRO n 
1 53  ALA n 
1 54  SER n 
1 55  SER n 
1 56  GLU n 
1 57  LYS n 
1 58  MET n 
1 59  MET n 
1 60  LEU n 
1 61  ARG n 
1 62  LEU n 
1 63  ILE n 
1 64  GLY n 
1 65  LYS n 
1 66  VAL n 
1 67  ASP n 
1 68  GLU n 
1 69  SER n 
1 70  LYS n 
1 71  LYS n 
1 72  ARG n 
1 73  LYS n 
1 74  ASP n 
1 75  ASN n 
1 76  GLU n 
1 77  GLY n 
1 78  ASN n 
1 79  GLU n 
1 80  VAL n 
1 81  VAL n 
1 82  PRO n 
1 83  LYS n 
1 84  PRO n 
1 85  GLN n 
1 86  ARG n 
1 87  HIS n 
1 88  MET n 
1 89  PHE n 
1 90  SER n 
1 91  PHE n 
1 92  ASN n 
1 93  ASN n 
1 94  ARG n 
1 95  THR n 
1 96  VAL n 
1 97  MET n 
1 98  ASP n 
1 99  ASN n 
1 100 ILE n 
1 101 LYS n 
1 102 MET n 
1 103 THR n 
1 104 LEU n 
1 105 GLN n 
1 106 GLN n 
1 107 ILE n 
1 108 ILE n 
1 109 SER n 
1 110 ARG n 
1 111 TYR n 
1 112 LYS n 
1 113 ASP n 
1 114 ALA n 
1 115 ASP n 
2 1   ASP n 
2 2   THR n 
2 3   GLN n 
2 4   ASP n 
2 5   ASP n 
2 6   PHE n 
2 7   LEU n 
2 8   LYS n 
2 9   TRP n 
2 10  TRP n 
2 11  ARG n 
2 12  SER n 
2 13  GLU n 
2 14  GLU n 
2 15  ALA n 
2 16  GLN n 
2 17  ASP n 
2 18  MET n 
2 19  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;Baker's yeast
;
? 'TFB1, YDR311W, D9740.3' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae S288c' 559292 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pGEX-TEV ? ? ? ? ? 
2 1 sample ? ? ? human           ? 'KLF1, EKLF'             ? ?                     ? ? ? ? 'Homo sapiens'                   9606 
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pGEX-2T  ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TFB1_YEAST P32776 1 
;SHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVV
PKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
;
2  ? 
2 UNP KLF1_HUMAN Q13351 2 DTQDDFLKWWRSEEAQDMG 22 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2N23 A 2 ? 115 ? P32776 2  ? 115 ? 2  115 
2 2 2N23 B 1 ? 19  ? Q13351 22 ? 40  ? 22 40  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2N23 
_struct_ref_seq_dif.mon_id                       PRO 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P32776 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '3D HCCH-TOCSY'             
1 3  1 '3D CBCA(CO)NH'             
1 4  1 '3D HNCO'                   
1 5  1 '3D HNCACB'                 
1 6  1 '3D 1H-15N NOESY'           
1 7  2 '2D 1H-13C HSQC'            
1 8  2 '3D 1H-13C NOESY'           
1 9  2 '3D intermolecular NOESY'   
1 10 3 '2D 1H-15N HSQC'            
1 11 3 '3D HCCH-TOCSY'             
1 12 3 '3D CBCA(CO)NH'             
1 13 3 '3D HNCACB'                 
1 14 3 '3D 1H-15N NOESY'           
1 15 4 '2D 1H-13C HSQC aliphatic'  
1 16 4 '2D 1H-13C HSQC aromatic'   
1 17 4 '3D 1H-13C NOESY aliphatic' 
1 18 4 '3D 1H-13C NOESY aromatic'  
1 19 4 '3D intermolecular NOESY'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.8 mM [U-100% 13C; U-100% 15N] RNA polymerase II transcription factor B subunit 1, 2 mM N-terminal transactivation domain of Krueppel-like factor 1, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.8 mM [U-100% 13C; U-100% 15N] RNA polymerase II transcription factor B subunit 1, 2 mM N-terminal transactivation domain of Krueppel-like factor 1, 100% D2O
;
2 '100% D2O'        
;0.8 mM [U-100% 13C; U-100% 15N] N-terminal transactivation domain of Krueppel-like factor 1, 2 mM RNA polymerase II transcription factor B subunit 1, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
;0.8 mM [U-100% 13C; U-100% 15N] N-terminal transactivation domain of Krueppel-like factor 1, 2 mM RNA polymerase II transcription factor B subunit 1, 100% D2O
;
4 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Varian INOVA 1 'Varian INOVA' 
600 Varian INOVA 2 'Varian INOVA' 
800 Varian INOVA 3 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2N23 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            260 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N23 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N23 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.authors          ? 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N23 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N23 
_struct.title                     
;NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and the N-terminal activation domain of EKLF (TAD1)
;
_struct.pdbx_descriptor           'RNA polymerase II transcription factor B subunit 1, Krueppel-like factor 1' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N23 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;Transcription factor TFIIH, Transactivation domain, Erythroid Kr ppel-like factor 1, Transcriptional activation, p62/Tfb1 subunit, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 93 ? ALA A 114 ? ASN A 93 ALA A 114 1 ? 22 
HELX_P HELX_P2 2 THR B 2  ? MET B 18  ? THR B 23 MET B 39  1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 4  ? GLY A 5  ? SER A 4  GLY A 5  
A 2 VAL A 12 ? ASN A 19 ? VAL A 12 ASN A 19 
A 3 ILE A 8  ? PHE A 9  ? ILE A 8  PHE A 9  
B 1 SER A 4  ? GLY A 5  ? SER A 4  GLY A 5  
B 2 VAL A 12 ? ASN A 19 ? VAL A 12 ASN A 19 
B 3 GLU A 26 ? SER A 31 ? GLU A 26 SER A 31 
B 4 VAL A 37 ? VAL A 41 ? VAL A 37 VAL A 41 
C 1 ILE A 45 ? ALA A 50 ? ILE A 45 ALA A 50 
C 2 MET A 58 ? GLY A 64 ? MET A 58 GLY A 64 
C 3 GLN A 85 ? PHE A 91 ? GLN A 85 PHE A 91 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 5  ? N GLY A 5  O ILE A 16 ? O ILE A 16 
A 2 3 O VAL A 12 ? O VAL A 12 N PHE A 9  ? N PHE A 9  
B 1 2 N GLY A 5  ? N GLY A 5  O ILE A 16 ? O ILE A 16 
B 2 3 N ILE A 15 ? N ILE A 15 O ARG A 30 ? O ARG A 30 
B 3 4 N LEU A 27 ? N LEU A 27 O VAL A 40 ? O VAL A 40 
C 1 2 N ASP A 46 ? N ASP A 46 O ILE A 63 ? O ILE A 63 
C 2 3 N LEU A 60 ? N LEU A 60 O PHE A 89 ? O PHE A 89 
# 
_atom_sites.entry_id                    2N23 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PRO A 1 1   ? 18.200  3.441   4.304   1.00 2.80  ? 1   PRO A N    1  
ATOM 2     C CA   . PRO A 1 1   ? 17.652  2.180   4.855   1.00 2.09  ? 1   PRO A CA   1  
ATOM 3     C C    . PRO A 1 1   ? 16.159  2.298   5.151   1.00 1.70  ? 1   PRO A C    1  
ATOM 4     O O    . PRO A 1 1   ? 15.348  1.571   4.579   1.00 2.48  ? 1   PRO A O    1  
ATOM 5     C CB   . PRO A 1 1   ? 18.412  1.824   6.121   1.00 2.88  ? 1   PRO A CB   1  
ATOM 6     C CG   . PRO A 1 1   ? 19.623  2.679   6.043   1.00 3.60  ? 1   PRO A CG   1  
ATOM 7     C CD   . PRO A 1 1   ? 19.215  3.913   5.270   1.00 3.50  ? 1   PRO A CD   1  
ATOM 8     H H2   . PRO A 1 1   ? 18.503  3.194   3.330   1.00 2.93  ? 1   PRO A H2   1  
ATOM 9     H H3   . PRO A 1 1   ? 17.380  4.052   4.147   1.00 3.05  ? 1   PRO A H3   1  
ATOM 10    H HA   . PRO A 1 1   ? 17.800  1.399   4.124   1.00 2.07  ? 1   PRO A HA   1  
ATOM 11    H HB2  . PRO A 1 1   ? 17.809  2.059   6.987   1.00 3.16  ? 1   PRO A HB2  1  
ATOM 12    H HB3  . PRO A 1 1   ? 18.665  0.776   6.118   1.00 3.12  ? 1   PRO A HB3  1  
ATOM 13    H HG2  . PRO A 1 1   ? 19.946  2.950   7.037   1.00 4.35  ? 1   PRO A HG2  1  
ATOM 14    H HG3  . PRO A 1 1   ? 20.408  2.154   5.520   1.00 3.85  ? 1   PRO A HG3  1  
ATOM 15    H HD2  . PRO A 1 1   ? 18.790  4.646   5.938   1.00 4.20  ? 1   PRO A HD2  1  
ATOM 16    H HD3  . PRO A 1 1   ? 20.068  4.328   4.754   1.00 3.65  ? 1   PRO A HD3  1  
ATOM 17    N N    . SER A 1 2   ? 15.790  3.236   6.019   1.00 1.00  ? 2   SER A N    1  
ATOM 18    C CA   . SER A 1 2   ? 14.411  3.355   6.480   1.00 0.75  ? 2   SER A CA   1  
ATOM 19    C C    . SER A 1 2   ? 13.536  4.125   5.486   1.00 0.89  ? 2   SER A C    1  
ATOM 20    O O    . SER A 1 2   ? 12.762  5.003   5.871   1.00 1.99  ? 2   SER A O    1  
ATOM 21    C CB   . SER A 1 2   ? 14.388  4.029   7.853   1.00 1.16  ? 2   SER A CB   1  
ATOM 22    O OG   . SER A 1 2   ? 15.203  5.193   7.867   1.00 1.66  ? 2   SER A OG   1  
ATOM 23    H H    . SER A 1 2   ? 16.458  3.870   6.359   1.00 1.37  ? 2   SER A H    1  
ATOM 24    H HA   . SER A 1 2   ? 14.015  2.356   6.580   1.00 0.60  ? 2   SER A HA   1  
ATOM 25    H HB2  . SER A 1 2   ? 13.374  4.312   8.096   1.00 1.50  ? 2   SER A HB2  1  
ATOM 26    H HB3  . SER A 1 2   ? 14.757  3.338   8.597   1.00 1.23  ? 2   SER A HB3  1  
ATOM 27    H HG   . SER A 1 2   ? 14.656  5.960   8.086   1.00 1.95  ? 2   SER A HG   1  
ATOM 28    N N    . HIS A 1 3   ? 13.676  3.797   4.208   1.00 0.41  ? 3   HIS A N    1  
ATOM 29    C CA   . HIS A 1 3   ? 12.842  4.374   3.156   1.00 0.27  ? 3   HIS A CA   1  
ATOM 30    C C    . HIS A 1 3   ? 12.711  3.420   1.980   1.00 0.23  ? 3   HIS A C    1  
ATOM 31    O O    . HIS A 1 3   ? 11.935  3.668   1.069   1.00 0.33  ? 3   HIS A O    1  
ATOM 32    C CB   . HIS A 1 3   ? 13.413  5.701   2.640   1.00 0.28  ? 3   HIS A CB   1  
ATOM 33    C CG   . HIS A 1 3   ? 13.141  6.884   3.516   1.00 0.36  ? 3   HIS A CG   1  
ATOM 34    N ND1  . HIS A 1 3   ? 14.085  7.435   4.354   1.00 0.56  ? 3   HIS A ND1  1  
ATOM 35    C CD2  . HIS A 1 3   ? 12.028  7.638   3.661   1.00 0.38  ? 3   HIS A CD2  1  
ATOM 36    C CE1  . HIS A 1 3   ? 13.563  8.475   4.976   1.00 0.61  ? 3   HIS A CE1  1  
ATOM 37    N NE2  . HIS A 1 3   ? 12.316  8.622   4.572   1.00 0.49  ? 3   HIS A NE2  1  
ATOM 38    H H    . HIS A 1 3   ? 14.367  3.144   3.961   1.00 1.21  ? 3   HIS A H    1  
ATOM 39    H HA   . HIS A 1 3   ? 11.858  4.550   3.566   1.00 0.31  ? 3   HIS A HA   1  
ATOM 40    H HB2  . HIS A 1 3   ? 14.482  5.608   2.541   1.00 0.33  ? 3   HIS A HB2  1  
ATOM 41    H HB3  . HIS A 1 3   ? 12.985  5.905   1.668   1.00 0.28  ? 3   HIS A HB3  1  
ATOM 42    H HD1  . HIS A 1 3   ? 15.006  7.115   4.468   1.00 0.69  ? 3   HIS A HD1  1  
ATOM 43    H HD2  . HIS A 1 3   ? 11.085  7.493   3.153   1.00 0.44  ? 3   HIS A HD2  1  
ATOM 44    H HE1  . HIS A 1 3   ? 14.070  9.100   5.694   1.00 0.78  ? 3   HIS A HE1  1  
ATOM 45    H HE2  . HIS A 1 3   ? 11.769  9.438   4.719   1.00 0.56  ? 3   HIS A HE2  1  
ATOM 46    N N    . SER A 1 4   ? 13.454  2.326   1.996   1.00 0.21  ? 4   SER A N    1  
ATOM 47    C CA   . SER A 1 4   ? 13.502  1.459   0.832   1.00 0.17  ? 4   SER A CA   1  
ATOM 48    C C    . SER A 1 4   ? 13.758  0.008   1.199   1.00 0.18  ? 4   SER A C    1  
ATOM 49    O O    . SER A 1 4   ? 13.993  -0.326  2.361   1.00 0.24  ? 4   SER A O    1  
ATOM 50    C CB   . SER A 1 4   ? 14.560  1.963   -0.143  1.00 0.19  ? 4   SER A CB   1  
ATOM 51    O OG   . SER A 1 4   ? 15.809  2.170   0.499   1.00 0.28  ? 4   SER A OG   1  
ATOM 52    H H    . SER A 1 4   ? 13.960  2.086   2.797   1.00 0.28  ? 4   SER A H    1  
ATOM 53    H HA   . SER A 1 4   ? 12.544  1.512   0.337   1.00 0.15  ? 4   SER A HA   1  
ATOM 54    H HB2  . SER A 1 4   ? 14.685  1.243   -0.936  1.00 0.19  ? 4   SER A HB2  1  
ATOM 55    H HB3  . SER A 1 4   ? 14.226  2.896   -0.562  1.00 0.19  ? 4   SER A HB3  1  
ATOM 56    H HG   . SER A 1 4   ? 16.213  1.314   0.697   1.00 0.91  ? 4   SER A HG   1  
ATOM 57    N N    . GLY A 1 5   ? 13.684  -0.838  0.190   1.00 0.15  ? 5   GLY A N    1  
ATOM 58    C CA   . GLY A 1 5   ? 13.899  -2.253  0.359   1.00 0.15  ? 5   GLY A CA   1  
ATOM 59    C C    . GLY A 1 5   ? 13.438  -3.007  -0.853  1.00 0.13  ? 5   GLY A C    1  
ATOM 60    O O    . GLY A 1 5   ? 12.505  -2.578  -1.530  1.00 0.12  ? 5   GLY A O    1  
ATOM 61    H H    . GLY A 1 5   ? 13.465  -0.491  -0.701  1.00 0.15  ? 5   GLY A H    1  
ATOM 62    H HA2  . GLY A 1 5   ? 14.951  -2.434  0.495   1.00 0.17  ? 5   GLY A HA2  1  
ATOM 63    H HA3  . GLY A 1 5   ? 13.357  -2.599  1.224   1.00 0.17  ? 5   GLY A HA3  1  
ATOM 64    N N    . ALA A 1 6   ? 14.092  -4.113  -1.143  1.00 0.14  ? 6   ALA A N    1  
ATOM 65    C CA   . ALA A 1 6   ? 13.821  -4.852  -2.360  1.00 0.15  ? 6   ALA A CA   1  
ATOM 66    C C    . ALA A 1 6   ? 12.427  -5.465  -2.353  1.00 0.15  ? 6   ALA A C    1  
ATOM 67    O O    . ALA A 1 6   ? 12.125  -6.358  -1.560  1.00 0.19  ? 6   ALA A O    1  
ATOM 68    C CB   . ALA A 1 6   ? 14.877  -5.909  -2.590  1.00 0.17  ? 6   ALA A CB   1  
ATOM 69    H H    . ALA A 1 6   ? 14.778  -4.438  -0.524  1.00 0.16  ? 6   ALA A H    1  
ATOM 70    H HA   . ALA A 1 6   ? 13.881  -4.154  -3.176  1.00 0.14  ? 6   ALA A HA   1  
ATOM 71    H HB1  . ALA A 1 6   ? 14.683  -6.405  -3.528  1.00 1.00  ? 6   ALA A HB1  1  
ATOM 72    H HB2  . ALA A 1 6   ? 14.854  -6.627  -1.785  1.00 1.07  ? 6   ALA A HB2  1  
ATOM 73    H HB3  . ALA A 1 6   ? 15.847  -5.436  -2.629  1.00 1.03  ? 6   ALA A HB3  1  
ATOM 74    N N    . ALA A 1 7   ? 11.596  -4.976  -3.260  1.00 0.14  ? 7   ALA A N    1  
ATOM 75    C CA   . ALA A 1 7   ? 10.214  -5.397  -3.366  1.00 0.14  ? 7   ALA A CA   1  
ATOM 76    C C    . ALA A 1 7   ? 9.951   -5.931  -4.758  1.00 0.16  ? 7   ALA A C    1  
ATOM 77    O O    . ALA A 1 7   ? 10.786  -5.818  -5.640  1.00 0.15  ? 7   ALA A O    1  
ATOM 78    C CB   . ALA A 1 7   ? 9.272   -4.238  -3.062  1.00 0.14  ? 7   ALA A CB   1  
ATOM 79    H H    . ALA A 1 7   ? 11.944  -4.337  -3.917  1.00 0.14  ? 7   ALA A H    1  
ATOM 80    H HA   . ALA A 1 7   ? 10.040  -6.181  -2.644  1.00 0.16  ? 7   ALA A HA   1  
ATOM 81    H HB1  . ALA A 1 7   ? 9.348   -3.979  -2.016  1.00 1.03  ? 7   ALA A HB1  1  
ATOM 82    H HB2  . ALA A 1 7   ? 8.256   -4.537  -3.281  1.00 1.05  ? 7   ALA A HB2  1  
ATOM 83    H HB3  . ALA A 1 7   ? 9.539   -3.377  -3.665  1.00 1.00  ? 7   ALA A HB3  1  
ATOM 84    N N    . ILE A 1 8   ? 8.786   -6.496  -4.956  1.00 0.20  ? 8   ILE A N    1  
ATOM 85    C CA   . ILE A 1 8   ? 8.419   -7.064  -6.233  1.00 0.23  ? 8   ILE A CA   1  
ATOM 86    C C    . ILE A 1 8   ? 7.056   -6.534  -6.666  1.00 0.25  ? 8   ILE A C    1  
ATOM 87    O O    . ILE A 1 8   ? 6.120   -6.477  -5.861  1.00 0.28  ? 8   ILE A O    1  
ATOM 88    C CB   . ILE A 1 8   ? 8.419   -8.598  -6.143  1.00 0.28  ? 8   ILE A CB   1  
ATOM 89    C CG1  . ILE A 1 8   ? 9.858   -9.099  -6.174  1.00 0.29  ? 8   ILE A CG1  1  
ATOM 90    C CG2  . ILE A 1 8   ? 7.583   -9.241  -7.243  1.00 0.31  ? 8   ILE A CG2  1  
ATOM 91    C CD1  . ILE A 1 8   ? 10.385  -9.538  -4.839  1.00 0.36  ? 8   ILE A CD1  1  
ATOM 92    H H    . ILE A 1 8   ? 8.155   -6.557  -4.210  1.00 0.23  ? 8   ILE A H    1  
ATOM 93    H HA   . ILE A 1 8   ? 9.174   -6.769  -6.961  1.00 0.20  ? 8   ILE A HA   1  
ATOM 94    H HB   . ILE A 1 8   ? 7.986   -8.862  -5.197  1.00 0.33  ? 8   ILE A HB   1  
ATOM 95    H HG12 . ILE A 1 8   ? 9.942   -9.922  -6.859  1.00 0.31  ? 8   ILE A HG12 1  
ATOM 96    H HG13 . ILE A 1 8   ? 10.489  -8.299  -6.510  1.00 0.24  ? 8   ILE A HG13 1  
ATOM 97    H HG21 . ILE A 1 8   ? 6.550   -8.952  -7.120  1.00 0.99  ? 8   ILE A HG21 1  
ATOM 98    H HG22 . ILE A 1 8   ? 7.666   -10.315 -7.173  1.00 1.08  ? 8   ILE A HG22 1  
ATOM 99    H HG23 . ILE A 1 8   ? 7.938   -8.910  -8.209  1.00 1.02  ? 8   ILE A HG23 1  
ATOM 100   H HD11 . ILE A 1 8   ? 9.817   -10.383 -4.485  1.00 1.04  ? 8   ILE A HD11 1  
ATOM 101   H HD12 . ILE A 1 8   ? 10.297  -8.722  -4.140  1.00 1.06  ? 8   ILE A HD12 1  
ATOM 102   H HD13 . ILE A 1 8   ? 11.422  -9.814  -4.943  1.00 1.07  ? 8   ILE A HD13 1  
ATOM 103   N N    . PHE A 1 9   ? 6.956   -6.142  -7.926  1.00 0.24  ? 9   PHE A N    1  
ATOM 104   C CA   . PHE A 1 9   ? 5.775   -5.459  -8.428  1.00 0.26  ? 9   PHE A CA   1  
ATOM 105   C C    . PHE A 1 9   ? 5.582   -5.772  -9.907  1.00 0.28  ? 9   PHE A C    1  
ATOM 106   O O    . PHE A 1 9   ? 6.496   -5.583  -10.702 1.00 0.28  ? 9   PHE A O    1  
ATOM 107   C CB   . PHE A 1 9   ? 5.948   -3.954  -8.221  1.00 0.25  ? 9   PHE A CB   1  
ATOM 108   C CG   . PHE A 1 9   ? 4.697   -3.141  -8.349  1.00 0.28  ? 9   PHE A CG   1  
ATOM 109   C CD1  . PHE A 1 9   ? 3.850   -3.001  -7.271  1.00 0.31  ? 9   PHE A CD1  1  
ATOM 110   C CD2  . PHE A 1 9   ? 4.381   -2.498  -9.531  1.00 0.32  ? 9   PHE A CD2  1  
ATOM 111   C CE1  . PHE A 1 9   ? 2.705   -2.238  -7.363  1.00 0.36  ? 9   PHE A CE1  1  
ATOM 112   C CE2  . PHE A 1 9   ? 3.235   -1.735  -9.633  1.00 0.38  ? 9   PHE A CE2  1  
ATOM 113   C CZ   . PHE A 1 9   ? 2.397   -1.603  -8.547  1.00 0.39  ? 9   PHE A CZ   1  
ATOM 114   H H    . PHE A 1 9   ? 7.700   -6.329  -8.546  1.00 0.23  ? 9   PHE A H    1  
ATOM 115   H HA   . PHE A 1 9   ? 4.919   -5.803  -7.873  1.00 0.28  ? 9   PHE A HA   1  
ATOM 116   H HB2  . PHE A 1 9   ? 6.343   -3.783  -7.232  1.00 0.27  ? 9   PHE A HB2  1  
ATOM 117   H HB3  . PHE A 1 9   ? 6.654   -3.584  -8.948  1.00 0.26  ? 9   PHE A HB3  1  
ATOM 118   H HD1  . PHE A 1 9   ? 4.097   -3.496  -6.348  1.00 0.33  ? 9   PHE A HD1  1  
ATOM 119   H HD2  . PHE A 1 9   ? 5.037   -2.601  -10.383 1.00 0.34  ? 9   PHE A HD2  1  
ATOM 120   H HE1  . PHE A 1 9   ? 2.051   -2.138  -6.508  1.00 0.40  ? 9   PHE A HE1  1  
ATOM 121   H HE2  . PHE A 1 9   ? 2.997   -1.239  -10.562 1.00 0.43  ? 9   PHE A HE2  1  
ATOM 122   H HZ   . PHE A 1 9   ? 1.504   -1.004  -8.622  1.00 0.45  ? 9   PHE A HZ   1  
ATOM 123   N N    . GLU A 1 10  ? 4.394   -6.258  -10.258 1.00 0.37  ? 10  GLU A N    1  
ATOM 124   C CA   . GLU A 1 10  ? 4.055   -6.594  -11.645 1.00 0.43  ? 10  GLU A CA   1  
ATOM 125   C C    . GLU A 1 10  ? 4.940   -7.712  -12.178 1.00 0.33  ? 10  GLU A C    1  
ATOM 126   O O    . GLU A 1 10  ? 5.481   -7.630  -13.284 1.00 0.38  ? 10  GLU A O    1  
ATOM 127   C CB   . GLU A 1 10  ? 4.154   -5.366  -12.541 1.00 0.59  ? 10  GLU A CB   1  
ATOM 128   C CG   . GLU A 1 10  ? 3.218   -4.257  -12.116 1.00 0.77  ? 10  GLU A CG   1  
ATOM 129   C CD   . GLU A 1 10  ? 3.294   -3.043  -13.015 1.00 1.00  ? 10  GLU A CD   1  
ATOM 130   O OE1  . GLU A 1 10  ? 4.319   -2.329  -12.981 1.00 0.95  ? 10  GLU A OE1  1  
ATOM 131   O OE2  . GLU A 1 10  ? 2.323   -2.791  -13.758 1.00 1.33  ? 10  GLU A OE2  1  
ATOM 132   H H    . GLU A 1 10  ? 3.722   -6.399  -9.559  1.00 0.43  ? 10  GLU A H    1  
ATOM 133   H HA   . GLU A 1 10  ? 3.031   -6.942  -11.651 1.00 0.54  ? 10  GLU A HA   1  
ATOM 134   H HB2  . GLU A 1 10  ? 5.166   -4.992  -12.505 1.00 0.56  ? 10  GLU A HB2  1  
ATOM 135   H HB3  . GLU A 1 10  ? 3.914   -5.647  -13.555 1.00 0.67  ? 10  GLU A HB3  1  
ATOM 136   H HG2  . GLU A 1 10  ? 2.210   -4.640  -12.130 1.00 0.88  ? 10  GLU A HG2  1  
ATOM 137   H HG3  . GLU A 1 10  ? 3.472   -3.960  -11.109 1.00 0.70  ? 10  GLU A HG3  1  
ATOM 138   N N    . LYS A 1 11  ? 5.088   -8.743  -11.359 1.00 0.35  ? 11  LYS A N    1  
ATOM 139   C CA   . LYS A 1 11  ? 5.809   -9.968  -11.717 1.00 0.43  ? 11  LYS A CA   1  
ATOM 140   C C    . LYS A 1 11  ? 7.317   -9.762  -11.862 1.00 0.41  ? 11  LYS A C    1  
ATOM 141   O O    . LYS A 1 11  ? 8.054   -10.707 -12.147 1.00 0.59  ? 11  LYS A O    1  
ATOM 142   C CB   . LYS A 1 11  ? 5.233   -10.579 -12.984 1.00 0.54  ? 11  LYS A CB   1  
ATOM 143   C CG   . LYS A 1 11  ? 3.831   -11.117 -12.788 1.00 0.63  ? 11  LYS A CG   1  
ATOM 144   C CD   . LYS A 1 11  ? 3.747   -12.049 -11.613 1.00 1.34  ? 11  LYS A CD   1  
ATOM 145   C CE   . LYS A 1 11  ? 2.359   -12.633 -11.472 1.00 1.31  ? 11  LYS A CE   1  
ATOM 146   N NZ   . LYS A 1 11  ? 2.308   -13.708 -10.451 1.00 2.23  ? 11  LYS A NZ   1  
ATOM 147   H H    . LYS A 1 11  ? 4.688   -8.679  -10.467 1.00 0.41  ? 11  LYS A H    1  
ATOM 148   H HA   . LYS A 1 11  ? 5.641   -10.670 -10.922 1.00 0.53  ? 11  LYS A HA   1  
ATOM 149   H HB2  . LYS A 1 11  ? 5.206   -9.827  -13.756 1.00 0.51  ? 11  LYS A HB2  1  
ATOM 150   H HB3  . LYS A 1 11  ? 5.868   -11.389 -13.299 1.00 0.67  ? 11  LYS A HB3  1  
ATOM 151   H HG2  . LYS A 1 11  ? 3.161   -10.305 -12.621 1.00 1.25  ? 11  LYS A HG2  1  
ATOM 152   H HG3  . LYS A 1 11  ? 3.545   -11.647 -13.662 1.00 0.98  ? 11  LYS A HG3  1  
ATOM 153   H HD2  . LYS A 1 11  ? 4.448   -12.838 -11.750 1.00 1.86  ? 11  LYS A HD2  1  
ATOM 154   H HD3  . LYS A 1 11  ? 3.986   -11.507 -10.727 1.00 2.00  ? 11  LYS A HD3  1  
ATOM 155   H HE2  . LYS A 1 11  ? 1.678   -11.844 -11.187 1.00 1.09  ? 11  LYS A HE2  1  
ATOM 156   H HE3  . LYS A 1 11  ? 2.064   -13.033 -12.424 1.00 1.82  ? 11  LYS A HE3  1  
ATOM 157   H HZ1  . LYS A 1 11  ? 1.336   -14.060 -10.348 1.00 2.72  ? 11  LYS A HZ1  1  
ATOM 158   H HZ2  . LYS A 1 11  ? 2.632   -13.345 -9.532  1.00 2.51  ? 11  LYS A HZ2  1  
ATOM 159   H HZ3  . LYS A 1 11  ? 2.923   -14.497 -10.732 1.00 2.85  ? 11  LYS A HZ3  1  
ATOM 160   N N    . VAL A 1 12  ? 7.778   -8.541  -11.657 1.00 0.26  ? 12  VAL A N    1  
ATOM 161   C CA   . VAL A 1 12  ? 9.198   -8.245  -11.719 1.00 0.25  ? 12  VAL A CA   1  
ATOM 162   C C    . VAL A 1 12  ? 9.679   -7.758  -10.364 1.00 0.22  ? 12  VAL A C    1  
ATOM 163   O O    . VAL A 1 12  ? 8.921   -7.164  -9.599  1.00 0.20  ? 12  VAL A O    1  
ATOM 164   C CB   . VAL A 1 12  ? 9.538   -7.208  -12.820 1.00 0.25  ? 12  VAL A CB   1  
ATOM 165   C CG1  . VAL A 1 12  ? 8.587   -6.030  -12.782 1.00 0.24  ? 12  VAL A CG1  1  
ATOM 166   C CG2  . VAL A 1 12  ? 10.989  -6.746  -12.706 1.00 0.25  ? 12  VAL A CG2  1  
ATOM 167   H H    . VAL A 1 12  ? 7.151   -7.820  -11.440 1.00 0.27  ? 12  VAL A H    1  
ATOM 168   H HA   . VAL A 1 12  ? 9.713   -9.167  -11.953 1.00 0.28  ? 12  VAL A HA   1  
ATOM 169   H HB   . VAL A 1 12  ? 9.421   -7.688  -13.774 1.00 0.29  ? 12  VAL A HB   1  
ATOM 170   H HG11 . VAL A 1 12  ? 9.004   -5.212  -13.350 1.00 1.04  ? 12  VAL A HG11 1  
ATOM 171   H HG12 . VAL A 1 12  ? 8.433   -5.723  -11.760 1.00 1.04  ? 12  VAL A HG12 1  
ATOM 172   H HG13 . VAL A 1 12  ? 7.641   -6.320  -13.213 1.00 1.04  ? 12  VAL A HG13 1  
ATOM 173   H HG21 . VAL A 1 12  ? 11.144  -5.883  -13.335 1.00 0.98  ? 12  VAL A HG21 1  
ATOM 174   H HG22 . VAL A 1 12  ? 11.646  -7.546  -13.018 1.00 0.95  ? 12  VAL A HG22 1  
ATOM 175   H HG23 . VAL A 1 12  ? 11.208  -6.491  -11.674 1.00 0.99  ? 12  VAL A HG23 1  
ATOM 176   N N    . SER A 1 13  ? 10.927  -8.048  -10.062 1.00 0.23  ? 13  SER A N    1  
ATOM 177   C CA   . SER A 1 13  ? 11.503  -7.705  -8.786  1.00 0.22  ? 13  SER A CA   1  
ATOM 178   C C    . SER A 1 13  ? 12.235  -6.372  -8.851  1.00 0.19  ? 13  SER A C    1  
ATOM 179   O O    . SER A 1 13  ? 12.655  -5.933  -9.923  1.00 0.20  ? 13  SER A O    1  
ATOM 180   C CB   . SER A 1 13  ? 12.471  -8.789  -8.375  1.00 0.27  ? 13  SER A CB   1  
ATOM 181   O OG   . SER A 1 13  ? 11.892  -10.079 -8.515  1.00 1.29  ? 13  SER A OG   1  
ATOM 182   H H    . SER A 1 13  ? 11.484  -8.501  -10.727 1.00 0.26  ? 13  SER A H    1  
ATOM 183   H HA   . SER A 1 13  ? 10.710  -7.644  -8.061  1.00 0.21  ? 13  SER A HA   1  
ATOM 184   H HB2  . SER A 1 13  ? 13.343  -8.727  -9.003  1.00 1.03  ? 13  SER A HB2  1  
ATOM 185   H HB3  . SER A 1 13  ? 12.743  -8.637  -7.345  1.00 0.99  ? 13  SER A HB3  1  
ATOM 186   H HG   . SER A 1 13  ? 12.084  -10.600 -7.727  1.00 1.80  ? 13  SER A HG   1  
ATOM 187   N N    . GLY A 1 14  ? 12.388  -5.737  -7.699  1.00 0.17  ? 14  GLY A N    1  
ATOM 188   C CA   . GLY A 1 14  ? 13.084  -4.472  -7.627  1.00 0.17  ? 14  GLY A CA   1  
ATOM 189   C C    . GLY A 1 14  ? 13.219  -3.977  -6.209  1.00 0.15  ? 14  GLY A C    1  
ATOM 190   O O    . GLY A 1 14  ? 13.366  -4.769  -5.289  1.00 0.15  ? 14  GLY A O    1  
ATOM 191   H H    . GLY A 1 14  ? 12.006  -6.131  -6.874  1.00 0.18  ? 14  GLY A H    1  
ATOM 192   H HA2  . GLY A 1 14  ? 14.068  -4.586  -8.054  1.00 0.22  ? 14  GLY A HA2  1  
ATOM 193   H HA3  . GLY A 1 14  ? 12.536  -3.739  -8.198  1.00 0.18  ? 14  GLY A HA3  1  
ATOM 194   N N    . ILE A 1 15  ? 13.200  -2.667  -6.042  1.00 0.13  ? 15  ILE A N    1  
ATOM 195   C CA   . ILE A 1 15  ? 13.221  -2.040  -4.733  1.00 0.12  ? 15  ILE A CA   1  
ATOM 196   C C    . ILE A 1 15  ? 12.039  -1.085  -4.608  1.00 0.12  ? 15  ILE A C    1  
ATOM 197   O O    . ILE A 1 15  ? 11.635  -0.462  -5.588  1.00 0.13  ? 15  ILE A O    1  
ATOM 198   C CB   . ILE A 1 15  ? 14.543  -1.250  -4.494  1.00 0.14  ? 15  ILE A CB   1  
ATOM 199   C CG1  . ILE A 1 15  ? 15.690  -2.174  -4.074  1.00 0.16  ? 15  ILE A CG1  1  
ATOM 200   C CG2  . ILE A 1 15  ? 14.367  -0.149  -3.453  1.00 0.15  ? 15  ILE A CG2  1  
ATOM 201   C CD1  . ILE A 1 15  ? 16.165  -3.111  -5.153  1.00 0.18  ? 15  ILE A CD1  1  
ATOM 202   H H    . ILE A 1 15  ? 13.180  -2.089  -6.837  1.00 0.14  ? 15  ILE A H    1  
ATOM 203   H HA   . ILE A 1 15  ? 13.138  -2.815  -3.985  1.00 0.12  ? 15  ILE A HA   1  
ATOM 204   H HB   . ILE A 1 15  ? 14.809  -0.776  -5.426  1.00 0.15  ? 15  ILE A HB   1  
ATOM 205   H HG12 . ILE A 1 15  ? 16.527  -1.568  -3.781  1.00 0.18  ? 15  ILE A HG12 1  
ATOM 206   H HG13 . ILE A 1 15  ? 15.373  -2.772  -3.231  1.00 0.16  ? 15  ILE A HG13 1  
ATOM 207   H HG21 . ILE A 1 15  ? 15.325  0.295   -3.232  1.00 0.97  ? 15  ILE A HG21 1  
ATOM 208   H HG22 . ILE A 1 15  ? 13.944  -0.567  -2.548  1.00 0.94  ? 15  ILE A HG22 1  
ATOM 209   H HG23 . ILE A 1 15  ? 13.702  0.608   -3.844  1.00 0.99  ? 15  ILE A HG23 1  
ATOM 210   H HD11 . ILE A 1 15  ? 15.378  -3.809  -5.389  1.00 1.01  ? 15  ILE A HD11 1  
ATOM 211   H HD12 . ILE A 1 15  ? 17.031  -3.648  -4.800  1.00 1.05  ? 15  ILE A HD12 1  
ATOM 212   H HD13 . ILE A 1 15  ? 16.420  -2.543  -6.038  1.00 1.03  ? 15  ILE A HD13 1  
ATOM 213   N N    . ILE A 1 16  ? 11.493  -0.973  -3.411  1.00 0.11  ? 16  ILE A N    1  
ATOM 214   C CA   . ILE A 1 16  ? 10.512  0.046   -3.124  1.00 0.11  ? 16  ILE A CA   1  
ATOM 215   C C    . ILE A 1 16  ? 11.234  1.180   -2.398  1.00 0.11  ? 16  ILE A C    1  
ATOM 216   O O    . ILE A 1 16  ? 12.037  0.923   -1.510  1.00 0.13  ? 16  ILE A O    1  
ATOM 217   C CB   . ILE A 1 16  ? 9.347   -0.511  -2.274  1.00 0.12  ? 16  ILE A CB   1  
ATOM 218   C CG1  . ILE A 1 16  ? 8.019   -0.199  -2.939  1.00 0.13  ? 16  ILE A CG1  1  
ATOM 219   C CG2  . ILE A 1 16  ? 9.348   0.047   -0.864  1.00 0.14  ? 16  ILE A CG2  1  
ATOM 220   C CD1  . ILE A 1 16  ? 6.835   -0.640  -2.119  1.00 0.17  ? 16  ILE A CD1  1  
ATOM 221   H H    . ILE A 1 16  ? 11.765  -1.592  -2.696  1.00 0.12  ? 16  ILE A H    1  
ATOM 222   H HA   . ILE A 1 16  ? 10.114  0.402   -4.058  1.00 0.11  ? 16  ILE A HA   1  
ATOM 223   H HB   . ILE A 1 16  ? 9.461   -1.579  -2.212  1.00 0.14  ? 16  ILE A HB   1  
ATOM 224   H HG12 . ILE A 1 16  ? 7.940   0.863   -3.099  1.00 0.13  ? 16  ILE A HG12 1  
ATOM 225   H HG13 . ILE A 1 16  ? 7.973   -0.703  -3.884  1.00 0.14  ? 16  ILE A HG13 1  
ATOM 226   H HG21 . ILE A 1 16  ? 10.283  -0.190  -0.384  1.00 1.01  ? 16  ILE A HG21 1  
ATOM 227   H HG22 . ILE A 1 16  ? 8.533   -0.391  -0.310  1.00 1.04  ? 16  ILE A HG22 1  
ATOM 228   H HG23 . ILE A 1 16  ? 9.220   1.118   -0.910  1.00 1.01  ? 16  ILE A HG23 1  
ATOM 229   H HD11 . ILE A 1 16  ? 5.925   -0.280  -2.576  1.00 1.04  ? 16  ILE A HD11 1  
ATOM 230   H HD12 . ILE A 1 16  ? 6.920   -0.243  -1.118  1.00 1.06  ? 16  ILE A HD12 1  
ATOM 231   H HD13 . ILE A 1 16  ? 6.810   -1.718  -2.076  1.00 1.00  ? 16  ILE A HD13 1  
ATOM 232   N N    . ALA A 1 17  ? 11.002  2.412   -2.812  1.00 0.12  ? 17  ALA A N    1  
ATOM 233   C CA   . ALA A 1 17  ? 11.806  3.531   -2.331  1.00 0.13  ? 17  ALA A CA   1  
ATOM 234   C C    . ALA A 1 17  ? 10.963  4.769   -2.067  1.00 0.13  ? 17  ALA A C    1  
ATOM 235   O O    . ALA A 1 17  ? 10.492  5.421   -2.994  1.00 0.15  ? 17  ALA A O    1  
ATOM 236   C CB   . ALA A 1 17  ? 12.901  3.846   -3.341  1.00 0.15  ? 17  ALA A CB   1  
ATOM 237   H H    . ALA A 1 17  ? 10.282  2.577   -3.453  1.00 0.12  ? 17  ALA A H    1  
ATOM 238   H HA   . ALA A 1 17  ? 12.280  3.229   -1.410  1.00 0.13  ? 17  ALA A HA   1  
ATOM 239   H HB1  . ALA A 1 17  ? 12.453  4.059   -4.307  1.00 1.00  ? 17  ALA A HB1  1  
ATOM 240   H HB2  . ALA A 1 17  ? 13.564  2.996   -3.426  1.00 0.99  ? 17  ALA A HB2  1  
ATOM 241   H HB3  . ALA A 1 17  ? 13.460  4.707   -3.007  1.00 1.00  ? 17  ALA A HB3  1  
ATOM 242   N N    . ILE A 1 18  ? 10.788  5.096   -0.800  1.00 0.17  ? 18  ILE A N    1  
ATOM 243   C CA   . ILE A 1 18  ? 10.030  6.271   -0.412  1.00 0.15  ? 18  ILE A CA   1  
ATOM 244   C C    . ILE A 1 18  ? 10.944  7.484   -0.361  1.00 0.16  ? 18  ILE A C    1  
ATOM 245   O O    . ILE A 1 18  ? 11.984  7.474   0.299   1.00 0.23  ? 18  ILE A O    1  
ATOM 246   C CB   . ILE A 1 18  ? 9.313   6.083   0.948   1.00 0.18  ? 18  ILE A CB   1  
ATOM 247   C CG1  . ILE A 1 18  ? 8.241   5.002   0.850   1.00 0.21  ? 18  ILE A CG1  1  
ATOM 248   C CG2  . ILE A 1 18  ? 8.670   7.378   1.414   1.00 0.18  ? 18  ILE A CG2  1  
ATOM 249   C CD1  . ILE A 1 18  ? 8.769   3.586   0.770   1.00 0.21  ? 18  ILE A CD1  1  
ATOM 250   H H    . ILE A 1 18  ? 11.190  4.531   -0.100  1.00 0.25  ? 18  ILE A H    1  
ATOM 251   H HA   . ILE A 1 18  ? 9.278   6.441   -1.168  1.00 0.15  ? 18  ILE A HA   1  
ATOM 252   H HB   . ILE A 1 18  ? 10.045  5.788   1.683   1.00 0.20  ? 18  ILE A HB   1  
ATOM 253   H HG12 . ILE A 1 18  ? 7.603   5.068   1.717   1.00 0.27  ? 18  ILE A HG12 1  
ATOM 254   H HG13 . ILE A 1 18  ? 7.649   5.183   -0.033  1.00 0.22  ? 18  ILE A HG13 1  
ATOM 255   H HG21 . ILE A 1 18  ? 8.021   7.756   0.637   1.00 1.02  ? 18  ILE A HG21 1  
ATOM 256   H HG22 . ILE A 1 18  ? 9.438   8.106   1.632   1.00 1.03  ? 18  ILE A HG22 1  
ATOM 257   H HG23 . ILE A 1 18  ? 8.086   7.184   2.306   1.00 1.03  ? 18  ILE A HG23 1  
ATOM 258   H HD11 . ILE A 1 18  ? 9.475   3.508   -0.047  1.00 1.03  ? 18  ILE A HD11 1  
ATOM 259   H HD12 . ILE A 1 18  ? 7.941   2.914   0.596   1.00 1.03  ? 18  ILE A HD12 1  
ATOM 260   H HD13 . ILE A 1 18  ? 9.258   3.325   1.704   1.00 0.99  ? 18  ILE A HD13 1  
ATOM 261   N N    . ASN A 1 19  ? 10.550  8.518   -1.072  1.00 0.19  ? 19  ASN A N    1  
ATOM 262   C CA   . ASN A 1 19  ? 11.377  9.692   -1.252  1.00 0.33  ? 19  ASN A CA   1  
ATOM 263   C C    . ASN A 1 19  ? 10.736  10.901  -0.605  1.00 0.31  ? 19  ASN A C    1  
ATOM 264   O O    . ASN A 1 19  ? 9.610   11.265  -0.954  1.00 0.55  ? 19  ASN A O    1  
ATOM 265   C CB   . ASN A 1 19  ? 11.555  9.946   -2.755  1.00 0.54  ? 19  ASN A CB   1  
ATOM 266   C CG   . ASN A 1 19  ? 12.555  11.042  -3.085  1.00 0.83  ? 19  ASN A CG   1  
ATOM 267   O OD1  . ASN A 1 19  ? 12.726  11.999  -2.335  1.00 1.36  ? 19  ASN A OD1  1  
ATOM 268   N ND2  . ASN A 1 19  ? 13.217  10.911  -4.221  1.00 1.00  ? 19  ASN A ND2  1  
ATOM 269   H H    . ASN A 1 19  ? 9.659   8.494   -1.498  1.00 0.20  ? 19  ASN A H    1  
ATOM 270   H HA   . ASN A 1 19  ? 12.335  9.513   -0.799  1.00 0.40  ? 19  ASN A HA   1  
ATOM 271   H HB2  . ASN A 1 19  ? 11.882  9.036   -3.226  1.00 1.02  ? 19  ASN A HB2  1  
ATOM 272   H HB3  . ASN A 1 19  ? 10.598  10.227  -3.171  1.00 0.61  ? 19  ASN A HB3  1  
ATOM 273   H HD21 . ASN A 1 19  ? 13.032  10.127  -4.781  1.00 1.07  ? 19  ASN A HD21 1  
ATOM 274   H HD22 . ASN A 1 19  ? 13.867  11.608  -4.462  1.00 1.32  ? 19  ASN A HD22 1  
ATOM 275   N N    . GLU A 1 20  ? 11.429  11.527  0.340   1.00 0.36  ? 20  GLU A N    1  
ATOM 276   C CA   . GLU A 1 20  ? 10.982  12.819  0.793   1.00 0.31  ? 20  GLU A CA   1  
ATOM 277   C C    . GLU A 1 20  ? 12.097  13.834  0.549   1.00 0.67  ? 20  GLU A C    1  
ATOM 278   O O    . GLU A 1 20  ? 12.734  14.323  1.481   1.00 1.47  ? 20  GLU A O    1  
ATOM 279   C CB   . GLU A 1 20  ? 10.695  12.767  2.298   1.00 0.52  ? 20  GLU A CB   1  
ATOM 280   C CG   . GLU A 1 20  ? 10.088  11.460  2.772   1.00 0.71  ? 20  GLU A CG   1  
ATOM 281   C CD   . GLU A 1 20  ? 9.971   11.389  4.280   1.00 1.18  ? 20  GLU A CD   1  
ATOM 282   O OE1  . GLU A 1 20  ? 9.035   12.000  4.843   1.00 1.47  ? 20  GLU A OE1  1  
ATOM 283   O OE2  . GLU A 1 20  ? 10.804  10.720  4.912   1.00 1.41  ? 20  GLU A OE2  1  
ATOM 284   H H    . GLU A 1 20  ? 12.247  11.135  0.702   1.00 0.66  ? 20  GLU A H    1  
ATOM 285   H HA   . GLU A 1 20  ? 10.086  13.087  0.255   1.00 0.58  ? 20  GLU A HA   1  
ATOM 286   H HB2  . GLU A 1 20  ? 11.619  12.920  2.832   1.00 0.71  ? 20  GLU A HB2  1  
ATOM 287   H HB3  . GLU A 1 20  ? 10.013  13.561  2.548   1.00 0.70  ? 20  GLU A HB3  1  
ATOM 288   H HG2  . GLU A 1 20  ? 9.105   11.357  2.346   1.00 0.85  ? 20  GLU A HG2  1  
ATOM 289   H HG3  . GLU A 1 20  ? 10.712  10.650  2.435   1.00 0.53  ? 20  GLU A HG3  1  
ATOM 290   N N    . ASP A 1 21  ? 12.319  14.141  -0.717  1.00 0.99  ? 21  ASP A N    1  
ATOM 291   C CA   . ASP A 1 21  ? 13.038  15.320  -1.153  1.00 1.38  ? 21  ASP A CA   1  
ATOM 292   C C    . ASP A 1 21  ? 12.071  16.240  -1.862  1.00 0.91  ? 21  ASP A C    1  
ATOM 293   O O    . ASP A 1 21  ? 12.314  17.427  -2.071  1.00 0.88  ? 21  ASP A O    1  
ATOM 294   C CB   . ASP A 1 21  ? 14.169  14.925  -2.095  1.00 2.11  ? 21  ASP A CB   1  
ATOM 295   C CG   . ASP A 1 21  ? 15.367  14.353  -1.366  1.00 2.89  ? 21  ASP A CG   1  
ATOM 296   O OD1  . ASP A 1 21  ? 16.006  15.087  -0.583  1.00 2.89  ? 21  ASP A OD1  1  
ATOM 297   O OD2  . ASP A 1 21  ? 15.685  13.164  -1.580  1.00 3.67  ? 21  ASP A OD2  1  
ATOM 298   H H    . ASP A 1 21  ? 12.024  13.509  -1.406  1.00 1.43  ? 21  ASP A H    1  
ATOM 299   H HA   . ASP A 1 21  ? 13.442  15.818  -0.285  1.00 1.72  ? 21  ASP A HA   1  
ATOM 300   H HB2  . ASP A 1 21  ? 13.806  14.179  -2.785  1.00 1.95  ? 21  ASP A HB2  1  
ATOM 301   H HB3  . ASP A 1 21  ? 14.477  15.789  -2.644  1.00 2.52  ? 21  ASP A HB3  1  
ATOM 302   N N    . VAL A 1 22  ? 10.963  15.630  -2.224  1.00 0.60  ? 22  VAL A N    1  
ATOM 303   C CA   . VAL A 1 22  ? 10.044  16.133  -3.214  1.00 0.46  ? 22  VAL A CA   1  
ATOM 304   C C    . VAL A 1 22  ? 8.773   16.646  -2.572  1.00 0.40  ? 22  VAL A C    1  
ATOM 305   O O    . VAL A 1 22  ? 8.690   16.793  -1.350  1.00 0.48  ? 22  VAL A O    1  
ATOM 306   C CB   . VAL A 1 22  ? 9.689   15.031  -4.242  1.00 0.57  ? 22  VAL A CB   1  
ATOM 307   C CG1  . VAL A 1 22  ? 10.900  14.642  -5.057  1.00 0.90  ? 22  VAL A CG1  1  
ATOM 308   C CG2  . VAL A 1 22  ? 9.135   13.794  -3.558  1.00 0.41  ? 22  VAL A CG2  1  
ATOM 309   H H    . VAL A 1 22  ? 10.744  14.784  -1.793  1.00 0.53  ? 22  VAL A H    1  
ATOM 310   H HA   . VAL A 1 22  ? 10.524  16.941  -3.740  1.00 0.55  ? 22  VAL A HA   1  
ATOM 311   H HB   . VAL A 1 22  ? 8.936   15.415  -4.909  1.00 0.68  ? 22  VAL A HB   1  
ATOM 312   H HG11 . VAL A 1 22  ? 10.628  13.853  -5.740  1.00 1.47  ? 22  VAL A HG11 1  
ATOM 313   H HG12 . VAL A 1 22  ? 11.677  14.292  -4.393  1.00 1.33  ? 22  VAL A HG12 1  
ATOM 314   H HG13 . VAL A 1 22  ? 11.254  15.498  -5.612  1.00 1.36  ? 22  VAL A HG13 1  
ATOM 315   H HG21 . VAL A 1 22  ? 8.245   14.054  -3.005  1.00 1.16  ? 22  VAL A HG21 1  
ATOM 316   H HG22 . VAL A 1 22  ? 9.881   13.399  -2.885  1.00 1.06  ? 22  VAL A HG22 1  
ATOM 317   H HG23 . VAL A 1 22  ? 8.895   13.051  -4.306  1.00 1.02  ? 22  VAL A HG23 1  
ATOM 318   N N    . SER A 1 23  ? 7.795   16.913  -3.404  1.00 0.47  ? 23  SER A N    1  
ATOM 319   C CA   . SER A 1 23  ? 6.480   17.297  -2.942  1.00 0.58  ? 23  SER A CA   1  
ATOM 320   C C    . SER A 1 23  ? 5.852   16.023  -2.381  1.00 0.46  ? 23  SER A C    1  
ATOM 321   O O    . SER A 1 23  ? 6.411   14.958  -2.627  1.00 0.39  ? 23  SER A O    1  
ATOM 322   C CB   . SER A 1 23  ? 5.686   17.865  -4.114  1.00 0.77  ? 23  SER A CB   1  
ATOM 323   O OG   . SER A 1 23  ? 6.456   18.822  -4.824  1.00 1.23  ? 23  SER A OG   1  
ATOM 324   H H    . SER A 1 23  ? 7.962   16.835  -4.363  1.00 0.53  ? 23  SER A H    1  
ATOM 325   H HA   . SER A 1 23  ? 6.580   18.035  -2.165  1.00 0.66  ? 23  SER A HA   1  
ATOM 326   H HB2  . SER A 1 23  ? 5.421   17.064  -4.780  1.00 1.36  ? 23  SER A HB2  1  
ATOM 327   H HB3  . SER A 1 23  ? 4.790   18.342  -3.746  1.00 1.21  ? 23  SER A HB3  1  
ATOM 328   H HG   . SER A 1 23  ? 7.250   19.035  -4.313  1.00 1.72  ? 23  SER A HG   1  
ATOM 329   N N    . PRO A 1 24  ? 4.701   16.077  -1.665  1.00 0.46  ? 24  PRO A N    1  
ATOM 330   C CA   . PRO A 1 24  ? 4.379   15.111  -0.608  1.00 0.39  ? 24  PRO A CA   1  
ATOM 331   C C    . PRO A 1 24  ? 4.899   13.707  -0.888  1.00 0.27  ? 24  PRO A C    1  
ATOM 332   O O    . PRO A 1 24  ? 4.589   13.109  -1.921  1.00 0.24  ? 24  PRO A O    1  
ATOM 333   C CB   . PRO A 1 24  ? 2.859   15.095  -0.610  1.00 0.43  ? 24  PRO A CB   1  
ATOM 334   C CG   . PRO A 1 24  ? 2.428   16.404  -1.178  1.00 0.50  ? 24  PRO A CG   1  
ATOM 335   C CD   . PRO A 1 24  ? 3.625   17.061  -1.823  1.00 0.56  ? 24  PRO A CD   1  
ATOM 336   H HA   . PRO A 1 24  ? 4.725   15.447  0.349   1.00 0.45  ? 24  PRO A HA   1  
ATOM 337   H HB2  . PRO A 1 24  ? 2.512   14.273  -1.218  1.00 0.39  ? 24  PRO A HB2  1  
ATOM 338   H HB3  . PRO A 1 24  ? 2.501   14.970  0.401   1.00 0.48  ? 24  PRO A HB3  1  
ATOM 339   H HG2  . PRO A 1 24  ? 1.674   16.226  -1.917  1.00 0.47  ? 24  PRO A HG2  1  
ATOM 340   H HG3  . PRO A 1 24  ? 2.037   17.032  -0.390  1.00 0.58  ? 24  PRO A HG3  1  
ATOM 341   H HD2  . PRO A 1 24  ? 3.428   17.245  -2.868  1.00 0.59  ? 24  PRO A HD2  1  
ATOM 342   H HD3  . PRO A 1 24  ? 3.868   17.983  -1.315  1.00 0.69  ? 24  PRO A HD3  1  
ATOM 343   N N    . ALA A 1 25  ? 5.662   13.205  0.096   1.00 0.25  ? 25  ALA A N    1  
ATOM 344   C CA   . ALA A 1 25  ? 6.540   12.039  -0.042  1.00 0.19  ? 25  ALA A CA   1  
ATOM 345   C C    . ALA A 1 25  ? 5.955   10.974  -0.929  1.00 0.14  ? 25  ALA A C    1  
ATOM 346   O O    . ALA A 1 25  ? 4.812   10.578  -0.756  1.00 0.17  ? 25  ALA A O    1  
ATOM 347   C CB   . ALA A 1 25  ? 6.836   11.448  1.322   1.00 0.27  ? 25  ALA A CB   1  
ATOM 348   H H    . ALA A 1 25  ? 5.606   13.635  0.978   1.00 0.32  ? 25  ALA A H    1  
ATOM 349   H HA   . ALA A 1 25  ? 7.474   12.374  -0.467  1.00 0.18  ? 25  ALA A HA   1  
ATOM 350   H HB1  . ALA A 1 25  ? 7.241   12.215  1.965   1.00 1.02  ? 25  ALA A HB1  1  
ATOM 351   H HB2  . ALA A 1 25  ? 7.555   10.650  1.218   1.00 1.10  ? 25  ALA A HB2  1  
ATOM 352   H HB3  . ALA A 1 25  ? 5.919   11.057  1.750   1.00 1.05  ? 25  ALA A HB3  1  
ATOM 353   N N    . GLU A 1 26  ? 6.734   10.503  -1.877  1.00 0.14  ? 26  GLU A N    1  
ATOM 354   C CA   . GLU A 1 26  ? 6.231   9.537   -2.812  1.00 0.14  ? 26  GLU A CA   1  
ATOM 355   C C    . GLU A 1 26  ? 6.997   8.230   -2.673  1.00 0.15  ? 26  GLU A C    1  
ATOM 356   O O    . GLU A 1 26  ? 8.181   8.220   -2.333  1.00 0.19  ? 26  GLU A O    1  
ATOM 357   C CB   . GLU A 1 26  ? 6.318   10.086  -4.244  1.00 0.21  ? 26  GLU A CB   1  
ATOM 358   C CG   . GLU A 1 26  ? 6.178   11.598  -4.327  1.00 0.42  ? 26  GLU A CG   1  
ATOM 359   C CD   . GLU A 1 26  ? 6.273   12.119  -5.746  1.00 0.54  ? 26  GLU A CD   1  
ATOM 360   O OE1  . GLU A 1 26  ? 7.402   12.368  -6.215  1.00 0.69  ? 26  GLU A OE1  1  
ATOM 361   O OE2  . GLU A 1 26  ? 5.227   12.264  -6.411  1.00 0.66  ? 26  GLU A OE2  1  
ATOM 362   H H    . GLU A 1 26  ? 7.669   10.799  -1.943  1.00 0.18  ? 26  GLU A H    1  
ATOM 363   H HA   . GLU A 1 26  ? 5.196   9.354   -2.565  1.00 0.15  ? 26  GLU A HA   1  
ATOM 364   H HB2  . GLU A 1 26  ? 7.264   9.805   -4.677  1.00 0.33  ? 26  GLU A HB2  1  
ATOM 365   H HB3  . GLU A 1 26  ? 5.514   9.658   -4.828  1.00 0.37  ? 26  GLU A HB3  1  
ATOM 366   H HG2  . GLU A 1 26  ? 5.218   11.879  -3.923  1.00 0.59  ? 26  GLU A HG2  1  
ATOM 367   H HG3  . GLU A 1 26  ? 6.955   12.050  -3.737  1.00 0.58  ? 26  GLU A HG3  1  
ATOM 368   N N    . LEU A 1 27  ? 6.308   7.136   -2.926  1.00 0.15  ? 27  LEU A N    1  
ATOM 369   C CA   . LEU A 1 27  ? 6.891   5.813   -2.848  1.00 0.16  ? 27  LEU A CA   1  
ATOM 370   C C    . LEU A 1 27  ? 7.172   5.314   -4.246  1.00 0.16  ? 27  LEU A C    1  
ATOM 371   O O    . LEU A 1 27  ? 6.311   5.342   -5.109  1.00 0.19  ? 27  LEU A O    1  
ATOM 372   C CB   . LEU A 1 27  ? 5.950   4.858   -2.109  1.00 0.21  ? 27  LEU A CB   1  
ATOM 373   C CG   . LEU A 1 27  ? 6.152   3.371   -2.411  1.00 0.29  ? 27  LEU A CG   1  
ATOM 374   C CD1  . LEU A 1 27  ? 5.841   2.543   -1.193  1.00 0.53  ? 27  LEU A CD1  1  
ATOM 375   C CD2  . LEU A 1 27  ? 5.259   2.945   -3.569  1.00 0.59  ? 27  LEU A CD2  1  
ATOM 376   H H    . LEU A 1 27  ? 5.360   7.223   -3.175  1.00 0.15  ? 27  LEU A H    1  
ATOM 377   H HA   . LEU A 1 27  ? 7.820   5.882   -2.304  1.00 0.17  ? 27  LEU A HA   1  
ATOM 378   H HB2  . LEU A 1 27  ? 6.081   5.009   -1.049  1.00 0.23  ? 27  LEU A HB2  1  
ATOM 379   H HB3  . LEU A 1 27  ? 4.937   5.116   -2.364  1.00 0.24  ? 27  LEU A HB3  1  
ATOM 380   H HG   . LEU A 1 27  ? 7.183   3.193   -2.690  1.00 0.70  ? 27  LEU A HG   1  
ATOM 381   H HD11 . LEU A 1 27  ? 4.775   2.508   -1.050  1.00 1.19  ? 27  LEU A HD11 1  
ATOM 382   H HD12 . LEU A 1 27  ? 6.305   2.995   -0.331  1.00 1.10  ? 27  LEU A HD12 1  
ATOM 383   H HD13 . LEU A 1 27  ? 6.224   1.543   -1.330  1.00 1.21  ? 27  LEU A HD13 1  
ATOM 384   H HD21 . LEU A 1 27  ? 5.276   1.871   -3.663  1.00 1.11  ? 27  LEU A HD21 1  
ATOM 385   H HD22 . LEU A 1 27  ? 5.631   3.391   -4.486  1.00 1.22  ? 27  LEU A HD22 1  
ATOM 386   H HD23 . LEU A 1 27  ? 4.240   3.284   -3.384  1.00 1.17  ? 27  LEU A HD23 1  
ATOM 387   N N    . THR A 1 28  ? 8.374   4.867   -4.464  1.00 0.16  ? 28  THR A N    1  
ATOM 388   C CA   . THR A 1 28  ? 8.813   4.534   -5.793  1.00 0.17  ? 28  THR A CA   1  
ATOM 389   C C    . THR A 1 28  ? 9.284   3.093   -5.877  1.00 0.17  ? 28  THR A C    1  
ATOM 390   O O    . THR A 1 28  ? 10.336  2.754   -5.350  1.00 0.17  ? 28  THR A O    1  
ATOM 391   C CB   . THR A 1 28  ? 9.975   5.453   -6.166  1.00 0.19  ? 28  THR A CB   1  
ATOM 392   O OG1  . THR A 1 28  ? 9.671   6.800   -5.785  1.00 0.22  ? 28  THR A OG1  1  
ATOM 393   C CG2  . THR A 1 28  ? 10.269  5.402   -7.649  1.00 0.22  ? 28  THR A CG2  1  
ATOM 394   H H    . THR A 1 28  ? 9.000   4.774   -3.714  1.00 0.16  ? 28  THR A H    1  
ATOM 395   H HA   . THR A 1 28  ? 8.002   4.700   -6.484  1.00 0.18  ? 28  THR A HA   1  
ATOM 396   H HB   . THR A 1 28  ? 10.845  5.120   -5.626  1.00 0.20  ? 28  THR A HB   1  
ATOM 397   H HG1  . THR A 1 28  ? 9.822   6.905   -4.840  1.00 0.24  ? 28  THR A HG1  1  
ATOM 398   H HG21 . THR A 1 28  ? 10.352  4.373   -7.964  1.00 1.06  ? 28  THR A HG21 1  
ATOM 399   H HG22 . THR A 1 28  ? 11.200  5.912   -7.844  1.00 1.00  ? 28  THR A HG22 1  
ATOM 400   H HG23 . THR A 1 28  ? 9.466   5.888   -8.188  1.00 1.03  ? 28  THR A HG23 1  
ATOM 401   N N    . TRP A 1 29  ? 8.519   2.239   -6.533  1.00 0.19  ? 29  TRP A N    1  
ATOM 402   C CA   . TRP A 1 29  ? 9.006   0.904   -6.803  1.00 0.18  ? 29  TRP A CA   1  
ATOM 403   C C    . TRP A 1 29  ? 9.746   0.910   -8.125  1.00 0.19  ? 29  TRP A C    1  
ATOM 404   O O    . TRP A 1 29  ? 9.186   1.269   -9.163  1.00 0.22  ? 29  TRP A O    1  
ATOM 405   C CB   . TRP A 1 29  ? 7.891   -0.151  -6.826  1.00 0.20  ? 29  TRP A CB   1  
ATOM 406   C CG   . TRP A 1 29  ? 8.432   -1.541  -7.027  1.00 0.18  ? 29  TRP A CG   1  
ATOM 407   C CD1  . TRP A 1 29  ? 8.740   -2.442  -6.052  1.00 0.17  ? 29  TRP A CD1  1  
ATOM 408   C CD2  . TRP A 1 29  ? 8.751   -2.178  -8.275  1.00 0.17  ? 29  TRP A CD2  1  
ATOM 409   N NE1  . TRP A 1 29  ? 9.229   -3.600  -6.617  1.00 0.16  ? 29  TRP A NE1  1  
ATOM 410   C CE2  . TRP A 1 29  ? 9.248   -3.459  -7.977  1.00 0.15  ? 29  TRP A CE2  1  
ATOM 411   C CE3  . TRP A 1 29  ? 8.666   -1.792  -9.615  1.00 0.18  ? 29  TRP A CE3  1  
ATOM 412   C CZ2  . TRP A 1 29  ? 9.655   -4.347  -8.968  1.00 0.15  ? 29  TRP A CZ2  1  
ATOM 413   C CZ3  . TRP A 1 29  ? 9.069   -2.680  -10.593 1.00 0.18  ? 29  TRP A CZ3  1  
ATOM 414   C CH2  . TRP A 1 29  ? 9.559   -3.943  -10.262 1.00 0.17  ? 29  TRP A CH2  1  
ATOM 415   H H    . TRP A 1 29  ? 7.630   2.514   -6.844  1.00 0.21  ? 29  TRP A H    1  
ATOM 416   H HA   . TRP A 1 29  ? 9.709   0.651   -6.021  1.00 0.18  ? 29  TRP A HA   1  
ATOM 417   H HB2  . TRP A 1 29  ? 7.361   -0.128  -5.885  1.00 0.22  ? 29  TRP A HB2  1  
ATOM 418   H HB3  . TRP A 1 29  ? 7.203   0.062   -7.628  1.00 0.22  ? 29  TRP A HB3  1  
ATOM 419   H HD1  . TRP A 1 29  ? 8.611   -2.260  -4.995  1.00 0.18  ? 29  TRP A HD1  1  
ATOM 420   H HE1  . TRP A 1 29  ? 9.518   -4.405  -6.123  1.00 0.17  ? 29  TRP A HE1  1  
ATOM 421   H HE3  . TRP A 1 29  ? 8.293   -0.818  -9.892  1.00 0.20  ? 29  TRP A HE3  1  
ATOM 422   H HZ2  . TRP A 1 29  ? 10.045  -5.326  -8.739  1.00 0.16  ? 29  TRP A HZ2  1  
ATOM 423   H HZ3  . TRP A 1 29  ? 9.007   -2.399  -11.631 1.00 0.20  ? 29  TRP A HZ3  1  
ATOM 424   H HH2  . TRP A 1 29  ? 9.867   -4.608  -11.059 1.00 0.18  ? 29  TRP A HH2  1  
ATOM 425   N N    . ARG A 1 30  ? 11.004  0.540   -8.074  1.00 0.19  ? 30  ARG A N    1  
ATOM 426   C CA   . ARG A 1 30  ? 11.818  0.430   -9.263  1.00 0.21  ? 30  ARG A CA   1  
ATOM 427   C C    . ARG A 1 30  ? 12.414  -0.953  -9.354  1.00 0.18  ? 30  ARG A C    1  
ATOM 428   O O    . ARG A 1 30  ? 12.954  -1.466  -8.379  1.00 0.21  ? 30  ARG A O    1  
ATOM 429   C CB   . ARG A 1 30  ? 12.909  1.476   -9.280  1.00 0.27  ? 30  ARG A CB   1  
ATOM 430   C CG   . ARG A 1 30  ? 13.362  1.852   -7.914  1.00 0.32  ? 30  ARG A CG   1  
ATOM 431   C CD   . ARG A 1 30  ? 14.629  2.663   -7.989  1.00 0.61  ? 30  ARG A CD   1  
ATOM 432   N NE   . ARG A 1 30  ? 15.234  2.879   -6.677  1.00 0.50  ? 30  ARG A NE   1  
ATOM 433   C CZ   . ARG A 1 30  ? 15.634  4.068   -6.230  1.00 1.09  ? 30  ARG A CZ   1  
ATOM 434   N NH1  . ARG A 1 30  ? 15.507  5.149   -6.993  1.00 1.93  ? 30  ARG A NH1  1  
ATOM 435   N NH2  . ARG A 1 30  ? 16.172  4.175   -5.022  1.00 1.05  ? 30  ARG A NH2  1  
ATOM 436   H H    . ARG A 1 30  ? 11.401  0.312   -7.200  1.00 0.20  ? 30  ARG A H    1  
ATOM 437   H HA   . ARG A 1 30  ? 11.187  0.588   -10.103 1.00 0.24  ? 30  ARG A HA   1  
ATOM 438   H HB2  . ARG A 1 30  ? 13.757  1.090   -9.825  1.00 0.55  ? 30  ARG A HB2  1  
ATOM 439   H HB3  . ARG A 1 30  ? 12.549  2.358   -9.771  1.00 0.51  ? 30  ARG A HB3  1  
ATOM 440   H HG2  . ARG A 1 30  ? 12.590  2.444   -7.443  1.00 0.90  ? 30  ARG A HG2  1  
ATOM 441   H HG3  . ARG A 1 30  ? 13.524  0.951   -7.362  1.00 0.90  ? 30  ARG A HG3  1  
ATOM 442   H HD2  . ARG A 1 30  ? 15.321  2.141   -8.623  1.00 1.11  ? 30  ARG A HD2  1  
ATOM 443   H HD3  . ARG A 1 30  ? 14.395  3.619   -8.429  1.00 1.10  ? 30  ARG A HD3  1  
ATOM 444   H HE   . ARG A 1 30  ? 15.356  2.090   -6.102  1.00 0.65  ? 30  ARG A HE   1  
ATOM 445   H HH11 . ARG A 1 30  ? 15.114  5.076   -7.915  1.00 2.07  ? 30  ARG A HH11 1  
ATOM 446   H HH12 . ARG A 1 30  ? 15.802  6.046   -6.651  1.00 2.49  ? 30  ARG A HH12 1  
ATOM 447   H HH21 . ARG A 1 30  ? 16.276  3.363   -4.441  1.00 0.78  ? 30  ARG A HH21 1  
ATOM 448   H HH22 . ARG A 1 30  ? 16.482  5.067   -4.685  1.00 1.55  ? 30  ARG A HH22 1  
ATOM 449   N N    . SER A 1 31  ? 12.308  -1.548  -10.527 1.00 0.17  ? 31  SER A N    1  
ATOM 450   C CA   . SER A 1 31  ? 12.752  -2.904  -10.738 1.00 0.18  ? 31  SER A CA   1  
ATOM 451   C C    . SER A 1 31  ? 14.261  -3.016  -10.524 1.00 0.19  ? 31  SER A C    1  
ATOM 452   O O    . SER A 1 31  ? 14.955  -1.999  -10.520 1.00 0.27  ? 31  SER A O    1  
ATOM 453   C CB   . SER A 1 31  ? 12.346  -3.356  -12.138 1.00 0.21  ? 31  SER A CB   1  
ATOM 454   O OG   . SER A 1 31  ? 13.062  -2.654  -13.144 1.00 0.25  ? 31  SER A OG   1  
ATOM 455   H H    . SER A 1 31  ? 11.922  -1.052  -11.280 1.00 0.22  ? 31  SER A H    1  
ATOM 456   H HA   . SER A 1 31  ? 12.251  -3.531  -10.017 1.00 0.17  ? 31  SER A HA   1  
ATOM 457   H HB2  . SER A 1 31  ? 12.525  -4.406  -12.240 1.00 0.25  ? 31  SER A HB2  1  
ATOM 458   H HB3  . SER A 1 31  ? 11.291  -3.168  -12.273 1.00 0.22  ? 31  SER A HB3  1  
ATOM 459   H HG   . SER A 1 31  ? 12.988  -3.134  -13.980 1.00 0.97  ? 31  SER A HG   1  
ATOM 460   N N    . THR A 1 32  ? 14.766  -4.226  -10.327 1.00 0.21  ? 32  THR A N    1  
ATOM 461   C CA   . THR A 1 32  ? 16.185  -4.419  -10.041 1.00 0.22  ? 32  THR A CA   1  
ATOM 462   C C    . THR A 1 32  ? 17.063  -3.806  -11.133 1.00 0.44  ? 32  THR A C    1  
ATOM 463   O O    . THR A 1 32  ? 18.142  -3.270  -10.861 1.00 0.67  ? 32  THR A O    1  
ATOM 464   C CB   . THR A 1 32  ? 16.522  -5.912  -9.895  1.00 0.41  ? 32  THR A CB   1  
ATOM 465   O OG1  . THR A 1 32  ? 16.048  -6.633  -11.042 1.00 0.97  ? 32  THR A OG1  1  
ATOM 466   C CG2  . THR A 1 32  ? 15.902  -6.493  -8.632  1.00 0.44  ? 32  THR A CG2  1  
ATOM 467   H H    . THR A 1 32  ? 14.172  -5.010  -10.370 1.00 0.29  ? 32  THR A H    1  
ATOM 468   H HA   . THR A 1 32  ? 16.407  -3.932  -9.101  1.00 0.31  ? 32  THR A HA   1  
ATOM 469   H HB   . THR A 1 32  ? 17.593  -6.010  -9.826  1.00 0.79  ? 32  THR A HB   1  
ATOM 470   H HG1  . THR A 1 32  ? 16.793  -7.077  -11.470 1.00 1.28  ? 32  THR A HG1  1  
ATOM 471   H HG21 . THR A 1 32  ? 14.826  -6.435  -8.701  1.00 1.02  ? 32  THR A HG21 1  
ATOM 472   H HG22 . THR A 1 32  ? 16.239  -5.932  -7.773  1.00 1.14  ? 32  THR A HG22 1  
ATOM 473   H HG23 . THR A 1 32  ? 16.201  -7.526  -8.527  1.00 1.25  ? 32  THR A HG23 1  
ATOM 474   N N    . ASP A 1 33  ? 16.581  -3.876  -12.366 1.00 0.55  ? 33  ASP A N    1  
ATOM 475   C CA   . ASP A 1 33  ? 17.300  -3.319  -13.504 1.00 0.89  ? 33  ASP A CA   1  
ATOM 476   C C    . ASP A 1 33  ? 17.207  -1.794  -13.516 1.00 1.00  ? 33  ASP A C    1  
ATOM 477   O O    . ASP A 1 33  ? 18.103  -1.109  -14.011 1.00 1.43  ? 33  ASP A O    1  
ATOM 478   C CB   . ASP A 1 33  ? 16.743  -3.895  -14.804 1.00 1.09  ? 33  ASP A CB   1  
ATOM 479   C CG   . ASP A 1 33  ? 17.434  -3.339  -16.029 1.00 1.88  ? 33  ASP A CG   1  
ATOM 480   O OD1  . ASP A 1 33  ? 18.667  -3.503  -16.143 1.00 2.19  ? 33  ASP A OD1  1  
ATOM 481   O OD2  . ASP A 1 33  ? 16.749  -2.736  -16.881 1.00 2.57  ? 33  ASP A OD2  1  
ATOM 482   H H    . ASP A 1 33  ? 15.722  -4.322  -12.514 1.00 0.50  ? 33  ASP A H    1  
ATOM 483   H HA   . ASP A 1 33  ? 18.336  -3.603  -13.410 1.00 1.02  ? 33  ASP A HA   1  
ATOM 484   H HB2  . ASP A 1 33  ? 16.871  -4.967  -14.797 1.00 1.40  ? 33  ASP A HB2  1  
ATOM 485   H HB3  . ASP A 1 33  ? 15.690  -3.663  -14.870 1.00 1.33  ? 33  ASP A HB3  1  
ATOM 486   N N    . GLY A 1 34  ? 16.123  -1.269  -12.963 1.00 0.80  ? 34  GLY A N    1  
ATOM 487   C CA   . GLY A 1 34  ? 15.962  0.168   -12.861 1.00 1.07  ? 34  GLY A CA   1  
ATOM 488   C C    . GLY A 1 34  ? 15.067  0.732   -13.941 1.00 0.75  ? 34  GLY A C    1  
ATOM 489   O O    . GLY A 1 34  ? 14.710  1.908   -13.906 1.00 0.99  ? 34  GLY A O    1  
ATOM 490   H H    . GLY A 1 34  ? 15.427  -1.862  -12.608 1.00 0.67  ? 34  GLY A H    1  
ATOM 491   H HA2  . GLY A 1 34  ? 15.534  0.402   -11.897 1.00 1.36  ? 34  GLY A HA2  1  
ATOM 492   H HA3  . GLY A 1 34  ? 16.933  0.633   -12.934 1.00 1.41  ? 34  GLY A HA3  1  
ATOM 493   N N    . ASP A 1 35  ? 14.699  -0.109  -14.898 1.00 0.62  ? 35  ASP A N    1  
ATOM 494   C CA   . ASP A 1 35  ? 13.863  0.315   -16.015 1.00 1.00  ? 35  ASP A CA   1  
ATOM 495   C C    . ASP A 1 35  ? 12.474  0.713   -15.541 1.00 0.69  ? 35  ASP A C    1  
ATOM 496   O O    . ASP A 1 35  ? 11.973  1.789   -15.870 1.00 0.72  ? 35  ASP A O    1  
ATOM 497   C CB   . ASP A 1 35  ? 13.750  -0.792  -17.052 1.00 1.52  ? 35  ASP A CB   1  
ATOM 498   C CG   . ASP A 1 35  ? 12.805  -0.432  -18.182 1.00 2.13  ? 35  ASP A CG   1  
ATOM 499   O OD1  . ASP A 1 35  ? 13.180  0.401   -19.033 1.00 2.16  ? 35  ASP A OD1  1  
ATOM 500   O OD2  . ASP A 1 35  ? 11.683  -0.980  -18.223 1.00 2.64  ? 35  ASP A OD2  1  
ATOM 501   H H    . ASP A 1 35  ? 14.995  -1.041  -14.852 1.00 0.67  ? 35  ASP A H    1  
ATOM 502   H HA   . ASP A 1 35  ? 14.331  1.165   -16.471 1.00 1.44  ? 35  ASP A HA   1  
ATOM 503   H HB2  . ASP A 1 35  ? 14.726  -0.991  -17.471 1.00 1.74  ? 35  ASP A HB2  1  
ATOM 504   H HB3  . ASP A 1 35  ? 13.386  -1.677  -16.569 1.00 1.48  ? 35  ASP A HB3  1  
ATOM 505   N N    . LYS A 1 36  ? 11.861  -0.161  -14.762 1.00 0.48  ? 36  LYS A N    1  
ATOM 506   C CA   . LYS A 1 36  ? 10.529  0.081   -14.253 1.00 0.32  ? 36  LYS A CA   1  
ATOM 507   C C    . LYS A 1 36  ? 10.579  0.902   -12.974 1.00 0.23  ? 36  LYS A C    1  
ATOM 508   O O    . LYS A 1 36  ? 11.190  0.494   -11.996 1.00 0.39  ? 36  LYS A O    1  
ATOM 509   C CB   . LYS A 1 36  ? 9.823   -1.242  -13.987 1.00 0.36  ? 36  LYS A CB   1  
ATOM 510   C CG   . LYS A 1 36  ? 8.660   -1.516  -14.890 1.00 0.49  ? 36  LYS A CG   1  
ATOM 511   C CD   . LYS A 1 36  ? 8.244   -2.945  -14.720 1.00 0.56  ? 36  LYS A CD   1  
ATOM 512   C CE   . LYS A 1 36  ? 6.745   -3.112  -14.841 1.00 0.44  ? 36  LYS A CE   1  
ATOM 513   N NZ   . LYS A 1 36  ? 6.261   -2.854  -16.222 1.00 1.20  ? 36  LYS A NZ   1  
ATOM 514   H H    . LYS A 1 36  ? 12.320  -0.989  -14.520 1.00 0.50  ? 36  LYS A H    1  
ATOM 515   H HA   . LYS A 1 36  ? 9.979   0.631   -15.002 1.00 0.44  ? 36  LYS A HA   1  
ATOM 516   H HB2  . LYS A 1 36  ? 10.511  -2.048  -14.108 1.00 0.70  ? 36  LYS A HB2  1  
ATOM 517   H HB3  . LYS A 1 36  ? 9.469   -1.252  -12.973 1.00 0.69  ? 36  LYS A HB3  1  
ATOM 518   H HG2  . LYS A 1 36  ? 7.847   -0.873  -14.623 1.00 0.76  ? 36  LYS A HG2  1  
ATOM 519   H HG3  . LYS A 1 36  ? 8.945   -1.348  -15.911 1.00 0.78  ? 36  LYS A HG3  1  
ATOM 520   H HD2  . LYS A 1 36  ? 8.727   -3.543  -15.480 1.00 0.72  ? 36  LYS A HD2  1  
ATOM 521   H HD3  . LYS A 1 36  ? 8.571   -3.268  -13.744 1.00 0.78  ? 36  LYS A HD3  1  
ATOM 522   H HE2  . LYS A 1 36  ? 6.494   -4.116  -14.568 1.00 0.90  ? 36  LYS A HE2  1  
ATOM 523   H HE3  . LYS A 1 36  ? 6.261   -2.421  -14.162 1.00 0.84  ? 36  LYS A HE3  1  
ATOM 524   H HZ1  . LYS A 1 36  ? 6.716   -3.514  -16.888 1.00 1.69  ? 36  LYS A HZ1  1  
ATOM 525   H HZ2  . LYS A 1 36  ? 6.485   -1.880  -16.510 1.00 1.81  ? 36  LYS A HZ2  1  
ATOM 526   H HZ3  . LYS A 1 36  ? 5.232   -2.989  -16.272 1.00 1.72  ? 36  LYS A HZ3  1  
ATOM 527   N N    . VAL A 1 37  ? 9.939   2.054   -13.005 1.00 0.23  ? 37  VAL A N    1  
ATOM 528   C CA   . VAL A 1 37  ? 9.822   2.935   -11.844 1.00 0.23  ? 37  VAL A CA   1  
ATOM 529   C C    . VAL A 1 37  ? 8.375   3.377   -11.705 1.00 0.26  ? 37  VAL A C    1  
ATOM 530   O O    . VAL A 1 37  ? 7.775   3.861   -12.663 1.00 0.37  ? 37  VAL A O    1  
ATOM 531   C CB   . VAL A 1 37  ? 10.735  4.185   -11.990 1.00 0.27  ? 37  VAL A CB   1  
ATOM 532   C CG1  . VAL A 1 37  ? 10.198  5.367   -11.193 1.00 0.76  ? 37  VAL A CG1  1  
ATOM 533   C CG2  . VAL A 1 37  ? 12.148  3.877   -11.545 1.00 0.83  ? 37  VAL A CG2  1  
ATOM 534   H H    . VAL A 1 37  ? 9.520   2.332   -13.850 1.00 0.32  ? 37  VAL A H    1  
ATOM 535   H HA   . VAL A 1 37  ? 10.118  2.379   -10.949 1.00 0.22  ? 37  VAL A HA   1  
ATOM 536   H HB   . VAL A 1 37  ? 10.768  4.465   -13.030 1.00 0.72  ? 37  VAL A HB   1  
ATOM 537   H HG11 . VAL A 1 37  ? 10.854  6.216   -11.319 1.00 1.48  ? 37  VAL A HG11 1  
ATOM 538   H HG12 . VAL A 1 37  ? 10.148  5.103   -10.147 1.00 1.31  ? 37  VAL A HG12 1  
ATOM 539   H HG13 . VAL A 1 37  ? 9.210   5.621   -11.547 1.00 1.29  ? 37  VAL A HG13 1  
ATOM 540   H HG21 . VAL A 1 37  ? 12.826  4.581   -12.000 1.00 1.35  ? 37  VAL A HG21 1  
ATOM 541   H HG22 . VAL A 1 37  ? 12.411  2.873   -11.840 1.00 1.53  ? 37  VAL A HG22 1  
ATOM 542   H HG23 . VAL A 1 37  ? 12.208  3.968   -10.467 1.00 1.35  ? 37  VAL A HG23 1  
ATOM 543   N N    . HIS A 1 38  ? 7.802   3.177   -10.530 1.00 0.22  ? 38  HIS A N    1  
ATOM 544   C CA   . HIS A 1 38  ? 6.424   3.575   -10.285 1.00 0.25  ? 38  HIS A CA   1  
ATOM 545   C C    . HIS A 1 38  ? 6.358   4.398   -9.014  1.00 0.24  ? 38  HIS A C    1  
ATOM 546   O O    . HIS A 1 38  ? 6.660   3.894   -7.933  1.00 0.26  ? 38  HIS A O    1  
ATOM 547   C CB   . HIS A 1 38  ? 5.510   2.351   -10.159 1.00 0.27  ? 38  HIS A CB   1  
ATOM 548   C CG   . HIS A 1 38  ? 5.848   1.244   -11.111 1.00 0.28  ? 38  HIS A CG   1  
ATOM 549   N ND1  . HIS A 1 38  ? 5.844   1.382   -12.476 1.00 0.30  ? 38  HIS A ND1  1  
ATOM 550   C CD2  . HIS A 1 38  ? 6.236   -0.024  -10.876 1.00 0.30  ? 38  HIS A CD2  1  
ATOM 551   C CE1  . HIS A 1 38  ? 6.218   0.242   -13.025 1.00 0.33  ? 38  HIS A CE1  1  
ATOM 552   N NE2  . HIS A 1 38  ? 6.453   -0.631  -12.077 1.00 0.33  ? 38  HIS A NE2  1  
ATOM 553   H H    . HIS A 1 38  ? 8.317   2.749   -9.808  1.00 0.22  ? 38  HIS A H    1  
ATOM 554   H HA   . HIS A 1 38  ? 6.101   4.180   -11.116 1.00 0.27  ? 38  HIS A HA   1  
ATOM 555   H HB2  . HIS A 1 38  ? 5.584   1.961   -9.153  1.00 0.28  ? 38  HIS A HB2  1  
ATOM 556   H HB3  . HIS A 1 38  ? 4.490   2.652   -10.348 1.00 0.31  ? 38  HIS A HB3  1  
ATOM 557   H HD1  . HIS A 1 38  ? 5.602   2.197   -12.974 1.00 0.32  ? 38  HIS A HD1  1  
ATOM 558   H HD2  . HIS A 1 38  ? 6.388   -0.467  -9.920  1.00 0.32  ? 38  HIS A HD2  1  
ATOM 559   H HE1  . HIS A 1 38  ? 6.354   0.063   -14.068 1.00 0.36  ? 38  HIS A HE1  1  
ATOM 560   H HE2  . HIS A 1 38  ? 6.407   -1.603  -12.215 1.00 0.38  ? 38  HIS A HE2  1  
ATOM 561   N N    . THR A 1 39  ? 5.976   5.656   -9.143  1.00 0.23  ? 39  THR A N    1  
ATOM 562   C CA   . THR A 1 39  ? 6.019   6.570   -8.016  1.00 0.22  ? 39  THR A CA   1  
ATOM 563   C C    . THR A 1 39  ? 4.615   6.850   -7.470  1.00 0.23  ? 39  THR A C    1  
ATOM 564   O O    . THR A 1 39  ? 3.680   7.110   -8.227  1.00 0.32  ? 39  THR A O    1  
ATOM 565   C CB   . THR A 1 39  ? 6.713   7.886   -8.413  1.00 0.24  ? 39  THR A CB   1  
ATOM 566   O OG1  . THR A 1 39  ? 7.727   7.623   -9.396  1.00 0.26  ? 39  THR A OG1  1  
ATOM 567   C CG2  . THR A 1 39  ? 7.366   8.527   -7.203  1.00 0.24  ? 39  THR A CG2  1  
ATOM 568   H H    . THR A 1 39  ? 5.650   5.978   -10.010 1.00 0.25  ? 39  THR A H    1  
ATOM 569   H HA   . THR A 1 39  ? 6.605   6.103   -7.238  1.00 0.19  ? 39  THR A HA   1  
ATOM 570   H HB   . THR A 1 39  ? 5.981   8.566   -8.820  1.00 0.28  ? 39  THR A HB   1  
ATOM 571   H HG1  . THR A 1 39  ? 7.325   7.212   -10.169 1.00 0.86  ? 39  THR A HG1  1  
ATOM 572   H HG21 . THR A 1 39  ? 6.637   8.644   -6.417  1.00 1.03  ? 39  THR A HG21 1  
ATOM 573   H HG22 . THR A 1 39  ? 7.760   9.495   -7.476  1.00 1.00  ? 39  THR A HG22 1  
ATOM 574   H HG23 . THR A 1 39  ? 8.174   7.892   -6.857  1.00 0.94  ? 39  THR A HG23 1  
ATOM 575   N N    . VAL A 1 40  ? 4.489   6.770   -6.150  1.00 0.19  ? 40  VAL A N    1  
ATOM 576   C CA   . VAL A 1 40  ? 3.224   6.955   -5.446  1.00 0.20  ? 40  VAL A CA   1  
ATOM 577   C C    . VAL A 1 40  ? 3.331   8.098   -4.435  1.00 0.20  ? 40  VAL A C    1  
ATOM 578   O O    . VAL A 1 40  ? 3.877   7.915   -3.354  1.00 0.20  ? 40  VAL A O    1  
ATOM 579   C CB   . VAL A 1 40  ? 2.857   5.662   -4.669  1.00 0.21  ? 40  VAL A CB   1  
ATOM 580   C CG1  . VAL A 1 40  ? 1.705   5.893   -3.711  1.00 0.23  ? 40  VAL A CG1  1  
ATOM 581   C CG2  . VAL A 1 40  ? 2.511   4.524   -5.611  1.00 0.22  ? 40  VAL A CG2  1  
ATOM 582   H H    . VAL A 1 40  ? 5.289   6.556   -5.619  1.00 0.22  ? 40  VAL A H    1  
ATOM 583   H HA   . VAL A 1 40  ? 2.447   7.168   -6.163  1.00 0.22  ? 40  VAL A HA   1  
ATOM 584   H HB   . VAL A 1 40  ? 3.718   5.364   -4.088  1.00 0.22  ? 40  VAL A HB   1  
ATOM 585   H HG11 . VAL A 1 40  ? 1.949   6.702   -3.034  1.00 0.97  ? 40  VAL A HG11 1  
ATOM 586   H HG12 . VAL A 1 40  ? 1.536   4.989   -3.145  1.00 1.06  ? 40  VAL A HG12 1  
ATOM 587   H HG13 . VAL A 1 40  ? 0.817   6.143   -4.271  1.00 1.09  ? 40  VAL A HG13 1  
ATOM 588   H HG21 . VAL A 1 40  ? 2.357   3.619   -5.034  1.00 1.04  ? 40  VAL A HG21 1  
ATOM 589   H HG22 . VAL A 1 40  ? 3.317   4.377   -6.311  1.00 1.05  ? 40  VAL A HG22 1  
ATOM 590   H HG23 . VAL A 1 40  ? 1.605   4.767   -6.144  1.00 1.01  ? 40  VAL A HG23 1  
ATOM 591   N N    . VAL A 1 41  ? 2.803   9.266   -4.767  1.00 0.22  ? 41  VAL A N    1  
ATOM 592   C CA   . VAL A 1 41  ? 2.787   10.376  -3.816  1.00 0.22  ? 41  VAL A CA   1  
ATOM 593   C C    . VAL A 1 41  ? 1.798   10.078  -2.687  1.00 0.23  ? 41  VAL A C    1  
ATOM 594   O O    . VAL A 1 41  ? 0.596   9.903   -2.911  1.00 0.26  ? 41  VAL A O    1  
ATOM 595   C CB   . VAL A 1 41  ? 2.475   11.728  -4.500  1.00 0.26  ? 41  VAL A CB   1  
ATOM 596   C CG1  . VAL A 1 41  ? 1.546   11.514  -5.668  1.00 0.63  ? 41  VAL A CG1  1  
ATOM 597   C CG2  . VAL A 1 41  ? 1.896   12.739  -3.514  1.00 0.59  ? 41  VAL A CG2  1  
ATOM 598   H H    . VAL A 1 41  ? 2.414   9.384   -5.657  1.00 0.25  ? 41  VAL A H    1  
ATOM 599   H HA   . VAL A 1 41  ? 3.783   10.445  -3.386  1.00 0.21  ? 41  VAL A HA   1  
ATOM 600   H HB   . VAL A 1 41  ? 3.401   12.128  -4.885  1.00 0.61  ? 41  VAL A HB   1  
ATOM 601   H HG11 . VAL A 1 41  ? 2.043   10.884  -6.390  1.00 1.22  ? 41  VAL A HG11 1  
ATOM 602   H HG12 . VAL A 1 41  ? 1.304   12.464  -6.116  1.00 1.30  ? 41  VAL A HG12 1  
ATOM 603   H HG13 . VAL A 1 41  ? 0.643   11.031  -5.327  1.00 1.30  ? 41  VAL A HG13 1  
ATOM 604   H HG21 . VAL A 1 41  ? 0.935   12.392  -3.166  1.00 1.25  ? 41  VAL A HG21 1  
ATOM 605   H HG22 . VAL A 1 41  ? 1.780   13.696  -4.002  1.00 1.17  ? 41  VAL A HG22 1  
ATOM 606   H HG23 . VAL A 1 41  ? 2.565   12.846  -2.673  1.00 1.18  ? 41  VAL A HG23 1  
ATOM 607   N N    . LEU A 1 42  ? 2.330   10.025  -1.481  1.00 0.23  ? 42  LEU A N    1  
ATOM 608   C CA   . LEU A 1 42  ? 1.621   9.519   -0.311  1.00 0.26  ? 42  LEU A CA   1  
ATOM 609   C C    . LEU A 1 42  ? 0.446   10.399  0.106   1.00 0.27  ? 42  LEU A C    1  
ATOM 610   O O    . LEU A 1 42  ? -0.426  9.959   0.853   1.00 0.37  ? 42  LEU A O    1  
ATOM 611   C CB   . LEU A 1 42  ? 2.619   9.373   0.836   1.00 0.32  ? 42  LEU A CB   1  
ATOM 612   C CG   . LEU A 1 42  ? 3.578   8.195   0.691   1.00 0.43  ? 42  LEU A CG   1  
ATOM 613   C CD1  . LEU A 1 42  ? 4.661   8.272   1.745   1.00 1.24  ? 42  LEU A CD1  1  
ATOM 614   C CD2  . LEU A 1 42  ? 2.823   6.879   0.786   1.00 1.01  ? 42  LEU A CD2  1  
ATOM 615   H H    . LEU A 1 42  ? 3.259   10.338  -1.367  1.00 0.25  ? 42  LEU A H    1  
ATOM 616   H HA   . LEU A 1 42  ? 1.245   8.539   -0.565  1.00 0.31  ? 42  LEU A HA   1  
ATOM 617   H HB2  . LEU A 1 42  ? 3.206   10.280  0.885   1.00 0.27  ? 42  LEU A HB2  1  
ATOM 618   H HB3  . LEU A 1 42  ? 2.084   9.265   1.763   1.00 0.45  ? 42  LEU A HB3  1  
ATOM 619   H HG   . LEU A 1 42  ? 4.051   8.242   -0.279  1.00 1.24  ? 42  LEU A HG   1  
ATOM 620   H HD11 . LEU A 1 42  ? 5.328   7.430   1.639   1.00 1.86  ? 42  LEU A HD11 1  
ATOM 621   H HD12 . LEU A 1 42  ? 4.209   8.259   2.724   1.00 1.80  ? 42  LEU A HD12 1  
ATOM 622   H HD13 . LEU A 1 42  ? 5.214   9.190   1.615   1.00 1.75  ? 42  LEU A HD13 1  
ATOM 623   H HD21 . LEU A 1 42  ? 3.519   6.058   0.701   1.00 1.58  ? 42  LEU A HD21 1  
ATOM 624   H HD22 . LEU A 1 42  ? 2.099   6.822   -0.013  1.00 1.41  ? 42  LEU A HD22 1  
ATOM 625   H HD23 . LEU A 1 42  ? 2.313   6.824   1.735   1.00 1.79  ? 42  LEU A HD23 1  
ATOM 626   N N    . SER A 1 43  ? 0.414   11.630  -0.380  1.00 0.23  ? 43  SER A N    1  
ATOM 627   C CA   . SER A 1 43  ? -0.695  12.534  -0.083  1.00 0.28  ? 43  SER A CA   1  
ATOM 628   C C    . SER A 1 43  ? -1.999  12.011  -0.693  1.00 0.28  ? 43  SER A C    1  
ATOM 629   O O    . SER A 1 43  ? -3.092  12.359  -0.240  1.00 0.34  ? 43  SER A O    1  
ATOM 630   C CB   . SER A 1 43  ? -0.394  13.941  -0.610  1.00 0.35  ? 43  SER A CB   1  
ATOM 631   O OG   . SER A 1 43  ? -1.397  14.869  -0.224  1.00 1.08  ? 43  SER A OG   1  
ATOM 632   H H    . SER A 1 43  ? 1.154   11.940  -0.938  1.00 0.22  ? 43  SER A H    1  
ATOM 633   H HA   . SER A 1 43  ? -0.807  12.577  0.990   1.00 0.32  ? 43  SER A HA   1  
ATOM 634   H HB2  . SER A 1 43  ? 0.553   14.275  -0.216  1.00 0.86  ? 43  SER A HB2  1  
ATOM 635   H HB3  . SER A 1 43  ? -0.344  13.915  -1.689  1.00 1.04  ? 43  SER A HB3  1  
ATOM 636   H HG   . SER A 1 43  ? -1.384  14.976  0.737   1.00 1.37  ? 43  SER A HG   1  
ATOM 637   N N    . THR A 1 44  ? -1.881  11.154  -1.703  1.00 0.26  ? 44  THR A N    1  
ATOM 638   C CA   . THR A 1 44  ? -3.053  10.620  -2.382  1.00 0.28  ? 44  THR A CA   1  
ATOM 639   C C    . THR A 1 44  ? -3.461  9.285   -1.771  1.00 0.26  ? 44  THR A C    1  
ATOM 640   O O    . THR A 1 44  ? -4.398  8.634   -2.232  1.00 0.29  ? 44  THR A O    1  
ATOM 641   C CB   . THR A 1 44  ? -2.798  10.427  -3.894  1.00 0.32  ? 44  THR A CB   1  
ATOM 642   O OG1  . THR A 1 44  ? -1.788  9.431   -4.108  1.00 0.30  ? 44  THR A OG1  1  
ATOM 643   C CG2  . THR A 1 44  ? -2.367  11.734  -4.542  1.00 0.36  ? 44  THR A CG2  1  
ATOM 644   H H    . THR A 1 44  ? -0.986  10.864  -1.988  1.00 0.26  ? 44  THR A H    1  
ATOM 645   H HA   . THR A 1 44  ? -3.862  11.326  -2.259  1.00 0.31  ? 44  THR A HA   1  
ATOM 646   H HB   . THR A 1 44  ? -3.717  10.100  -4.359  1.00 0.36  ? 44  THR A HB   1  
ATOM 647   H HG1  . THR A 1 44  ? -0.934  9.761   -3.795  1.00 0.26  ? 44  THR A HG1  1  
ATOM 648   H HG21 . THR A 1 44  ? -3.150  12.469  -4.427  1.00 1.04  ? 44  THR A HG21 1  
ATOM 649   H HG22 . THR A 1 44  ? -2.180  11.570  -5.594  1.00 1.05  ? 44  THR A HG22 1  
ATOM 650   H HG23 . THR A 1 44  ? -1.465  12.091  -4.068  1.00 1.04  ? 44  THR A HG23 1  
ATOM 651   N N    . ILE A 1 45  ? -2.740  8.878   -0.738  1.00 0.24  ? 45  ILE A N    1  
ATOM 652   C CA   . ILE A 1 45  ? -2.965  7.606   -0.097  1.00 0.22  ? 45  ILE A CA   1  
ATOM 653   C C    . ILE A 1 45  ? -3.800  7.751   1.175   1.00 0.25  ? 45  ILE A C    1  
ATOM 654   O O    . ILE A 1 45  ? -3.620  8.689   1.955   1.00 0.36  ? 45  ILE A O    1  
ATOM 655   C CB   . ILE A 1 45  ? -1.609  6.980   0.231   1.00 0.25  ? 45  ILE A CB   1  
ATOM 656   C CG1  . ILE A 1 45  ? -0.760  6.930   -1.042  1.00 0.25  ? 45  ILE A CG1  1  
ATOM 657   C CG2  . ILE A 1 45  ? -1.779  5.600   0.828   1.00 0.28  ? 45  ILE A CG2  1  
ATOM 658   C CD1  . ILE A 1 45  ? -1.298  5.992   -2.111  1.00 0.27  ? 45  ILE A CD1  1  
ATOM 659   H H    . ILE A 1 45  ? -2.004  9.438   -0.411  1.00 0.26  ? 45  ILE A H    1  
ATOM 660   H HA   . ILE A 1 45  ? -3.481  6.960   -0.793  1.00 0.22  ? 45  ILE A HA   1  
ATOM 661   H HB   . ILE A 1 45  ? -1.114  7.603   0.964   1.00 0.29  ? 45  ILE A HB   1  
ATOM 662   H HG12 . ILE A 1 45  ? -0.721  7.921   -1.471  1.00 0.23  ? 45  ILE A HG12 1  
ATOM 663   H HG13 . ILE A 1 45  ? 0.235   6.621   -0.790  1.00 0.27  ? 45  ILE A HG13 1  
ATOM 664   H HG21 . ILE A 1 45  ? -0.811  5.190   1.067   1.00 1.01  ? 45  ILE A HG21 1  
ATOM 665   H HG22 . ILE A 1 45  ? -2.278  4.961   0.116   1.00 1.07  ? 45  ILE A HG22 1  
ATOM 666   H HG23 . ILE A 1 45  ? -2.372  5.671   1.727   1.00 1.04  ? 45  ILE A HG23 1  
ATOM 667   H HD11 . ILE A 1 45  ? -1.506  5.026   -1.673  1.00 1.05  ? 45  ILE A HD11 1  
ATOM 668   H HD12 . ILE A 1 45  ? -0.561  5.876   -2.895  1.00 1.05  ? 45  ILE A HD12 1  
ATOM 669   H HD13 . ILE A 1 45  ? -2.205  6.402   -2.528  1.00 1.01  ? 45  ILE A HD13 1  
ATOM 670   N N    . ASP A 1 46  ? -4.711  6.811   1.371   1.00 0.22  ? 46  ASP A N    1  
ATOM 671   C CA   . ASP A 1 46  ? -5.608  6.820   2.516   1.00 0.27  ? 46  ASP A CA   1  
ATOM 672   C C    . ASP A 1 46  ? -5.090  5.888   3.608   1.00 0.30  ? 46  ASP A C    1  
ATOM 673   O O    . ASP A 1 46  ? -5.113  6.233   4.785   1.00 0.38  ? 46  ASP A O    1  
ATOM 674   C CB   . ASP A 1 46  ? -7.014  6.389   2.088   1.00 0.33  ? 46  ASP A CB   1  
ATOM 675   C CG   . ASP A 1 46  ? -8.059  6.626   3.162   1.00 0.48  ? 46  ASP A CG   1  
ATOM 676   O OD1  . ASP A 1 46  ? -8.284  5.723   3.994   1.00 0.55  ? 46  ASP A OD1  1  
ATOM 677   O OD2  . ASP A 1 46  ? -8.669  7.718   3.169   1.00 0.70  ? 46  ASP A OD2  1  
ATOM 678   H H    . ASP A 1 46  ? -4.775  6.070   0.726   1.00 0.21  ? 46  ASP A H    1  
ATOM 679   H HA   . ASP A 1 46  ? -5.649  7.826   2.901   1.00 0.31  ? 46  ASP A HA   1  
ATOM 680   H HB2  . ASP A 1 46  ? -7.299  6.945   1.210   1.00 0.36  ? 46  ASP A HB2  1  
ATOM 681   H HB3  . ASP A 1 46  ? -7.001  5.335   1.851   1.00 0.33  ? 46  ASP A HB3  1  
ATOM 682   N N    . LYS A 1 47  ? -4.610  4.711   3.216   1.00 0.28  ? 47  LYS A N    1  
ATOM 683   C CA   . LYS A 1 47  ? -4.105  3.740   4.176   1.00 0.36  ? 47  LYS A CA   1  
ATOM 684   C C    . LYS A 1 47  ? -2.907  2.995   3.603   1.00 0.31  ? 47  LYS A C    1  
ATOM 685   O O    . LYS A 1 47  ? -2.547  3.164   2.444   1.00 0.26  ? 47  LYS A O    1  
ATOM 686   C CB   . LYS A 1 47  ? -5.194  2.721   4.507   1.00 0.42  ? 47  LYS A CB   1  
ATOM 687   C CG   . LYS A 1 47  ? -5.502  2.559   5.978   1.00 0.74  ? 47  LYS A CG   1  
ATOM 688   C CD   . LYS A 1 47  ? -4.275  2.203   6.781   1.00 0.79  ? 47  LYS A CD   1  
ATOM 689   C CE   . LYS A 1 47  ? -4.600  1.998   8.248   1.00 1.12  ? 47  LYS A CE   1  
ATOM 690   N NZ   . LYS A 1 47  ? -3.385  1.717   9.061   1.00 1.56  ? 47  LYS A NZ   1  
ATOM 691   H H    . LYS A 1 47  ? -4.605  4.480   2.257   1.00 0.25  ? 47  LYS A H    1  
ATOM 692   H HA   . LYS A 1 47  ? -3.813  4.256   5.077   1.00 0.44  ? 47  LYS A HA   1  
ATOM 693   H HB2  . LYS A 1 47  ? -6.101  3.012   4.010   1.00 0.63  ? 47  LYS A HB2  1  
ATOM 694   H HB3  . LYS A 1 47  ? -4.883  1.763   4.130   1.00 0.50  ? 47  LYS A HB3  1  
ATOM 695   H HG2  . LYS A 1 47  ? -5.891  3.480   6.352   1.00 1.36  ? 47  LYS A HG2  1  
ATOM 696   H HG3  . LYS A 1 47  ? -6.237  1.772   6.084   1.00 1.37  ? 47  LYS A HG3  1  
ATOM 697   H HD2  . LYS A 1 47  ? -3.859  1.309   6.387   1.00 1.37  ? 47  LYS A HD2  1  
ATOM 698   H HD3  . LYS A 1 47  ? -3.563  2.995   6.683   1.00 1.28  ? 47  LYS A HD3  1  
ATOM 699   H HE2  . LYS A 1 47  ? -5.072  2.888   8.621   1.00 1.79  ? 47  LYS A HE2  1  
ATOM 700   H HE3  . LYS A 1 47  ? -5.282  1.165   8.339   1.00 1.63  ? 47  LYS A HE3  1  
ATOM 701   H HZ1  . LYS A 1 47  ? -2.727  2.521   9.015   1.00 1.86  ? 47  LYS A HZ1  1  
ATOM 702   H HZ2  . LYS A 1 47  ? -2.901  0.869   8.708   1.00 2.16  ? 47  LYS A HZ2  1  
ATOM 703   H HZ3  . LYS A 1 47  ? -3.649  1.560   10.056  1.00 1.99  ? 47  LYS A HZ3  1  
ATOM 704   N N    . LEU A 1 48  ? -2.296  2.176   4.431   1.00 0.39  ? 48  LEU A N    1  
ATOM 705   C CA   . LEU A 1 48  ? -1.335  1.191   3.975   1.00 0.36  ? 48  LEU A CA   1  
ATOM 706   C C    . LEU A 1 48  ? -1.418  -0.034  4.865   1.00 0.40  ? 48  LEU A C    1  
ATOM 707   O O    . LEU A 1 48  ? -1.846  0.052   6.015   1.00 0.50  ? 48  LEU A O    1  
ATOM 708   C CB   . LEU A 1 48  ? 0.095   1.757   3.859   1.00 0.60  ? 48  LEU A CB   1  
ATOM 709   C CG   . LEU A 1 48  ? 0.906   1.989   5.133   1.00 0.64  ? 48  LEU A CG   1  
ATOM 710   C CD1  . LEU A 1 48  ? 0.068   2.624   6.212   1.00 1.37  ? 48  LEU A CD1  1  
ATOM 711   C CD2  . LEU A 1 48  ? 1.577   0.722   5.626   1.00 1.12  ? 48  LEU A CD2  1  
ATOM 712   H H    . LEU A 1 48  ? -2.496  2.237   5.385   1.00 0.51  ? 48  LEU A H    1  
ATOM 713   H HA   . LEU A 1 48  ? -1.652  0.896   2.995   1.00 0.27  ? 48  LEU A HA   1  
ATOM 714   H HB2  . LEU A 1 48  ? 0.663   1.091   3.229   1.00 1.30  ? 48  LEU A HB2  1  
ATOM 715   H HB3  . LEU A 1 48  ? 0.015   2.700   3.355   1.00 1.37  ? 48  LEU A HB3  1  
ATOM 716   H HG   . LEU A 1 48  ? 1.685   2.678   4.888   1.00 1.45  ? 48  LEU A HG   1  
ATOM 717   H HD11 . LEU A 1 48  ? 0.617   2.616   7.143   1.00 1.81  ? 48  LEU A HD11 1  
ATOM 718   H HD12 . LEU A 1 48  ? -0.853  2.065   6.317   1.00 1.98  ? 48  LEU A HD12 1  
ATOM 719   H HD13 . LEU A 1 48  ? -0.159  3.642   5.935   1.00 1.91  ? 48  LEU A HD13 1  
ATOM 720   H HD21 . LEU A 1 48  ? 2.210   0.325   4.843   1.00 1.75  ? 48  LEU A HD21 1  
ATOM 721   H HD22 . LEU A 1 48  ? 0.825   -0.005  5.887   1.00 1.68  ? 48  LEU A HD22 1  
ATOM 722   H HD23 . LEU A 1 48  ? 2.182   0.956   6.497   1.00 1.48  ? 48  LEU A HD23 1  
ATOM 723   N N    . GLN A 1 49  ? -1.029  -1.163  4.327   1.00 0.39  ? 49  GLN A N    1  
ATOM 724   C CA   . GLN A 1 49  ? -1.277  -2.447  4.979   1.00 0.45  ? 49  GLN A CA   1  
ATOM 725   C C    . GLN A 1 49  ? -0.101  -3.377  4.784   1.00 0.33  ? 49  GLN A C    1  
ATOM 726   O O    . GLN A 1 49  ? 0.716   -3.163  3.897   1.00 0.35  ? 49  GLN A O    1  
ATOM 727   C CB   . GLN A 1 49  ? -2.539  -3.118  4.424   1.00 0.55  ? 49  GLN A CB   1  
ATOM 728   C CG   . GLN A 1 49  ? -3.826  -2.374  4.711   1.00 0.79  ? 49  GLN A CG   1  
ATOM 729   C CD   . GLN A 1 49  ? -5.036  -3.068  4.115   1.00 1.36  ? 49  GLN A CD   1  
ATOM 730   O OE1  . GLN A 1 49  ? -4.942  -3.729  3.082   1.00 2.28  ? 49  GLN A OE1  1  
ATOM 731   N NE2  . GLN A 1 49  ? -6.177  -2.925  4.761   1.00 1.62  ? 49  GLN A NE2  1  
ATOM 732   H H    . GLN A 1 49  ? -0.500  -1.129  3.501   1.00 0.39  ? 49  GLN A H    1  
ATOM 733   H HA   . GLN A 1 49  ? -1.409  -2.266  6.035   1.00 0.56  ? 49  GLN A HA   1  
ATOM 734   H HB2  . GLN A 1 49  ? -2.441  -3.214  3.357   1.00 0.50  ? 49  GLN A HB2  1  
ATOM 735   H HB3  . GLN A 1 49  ? -2.623  -4.099  4.853   1.00 0.72  ? 49  GLN A HB3  1  
ATOM 736   H HG2  . GLN A 1 49  ? -3.958  -2.302  5.781   1.00 1.39  ? 49  GLN A HG2  1  
ATOM 737   H HG3  . GLN A 1 49  ? -3.750  -1.389  4.291   1.00 1.03  ? 49  GLN A HG3  1  
ATOM 738   H HE21 . GLN A 1 49  ? -6.184  -2.385  5.580   1.00 1.74  ? 49  GLN A HE21 1  
ATOM 739   H HE22 . GLN A 1 49  ? -6.976  -3.368  4.398   1.00 2.18  ? 49  GLN A HE22 1  
ATOM 740   N N    . ALA A 1 50  ? -0.039  -4.414  5.594   1.00 0.34  ? 50  ALA A N    1  
ATOM 741   C CA   . ALA A 1 50  ? 1.052   -5.369  5.533   1.00 0.28  ? 50  ALA A CA   1  
ATOM 742   C C    . ALA A 1 50  ? 0.549   -6.759  5.884   1.00 0.32  ? 50  ALA A C    1  
ATOM 743   O O    . ALA A 1 50  ? -0.553  -6.908  6.419   1.00 0.43  ? 50  ALA A O    1  
ATOM 744   C CB   . ALA A 1 50  ? 2.155   -4.939  6.479   1.00 0.38  ? 50  ALA A CB   1  
ATOM 745   H H    . ALA A 1 50  ? -0.753  -4.550  6.257   1.00 0.46  ? 50  ALA A H    1  
ATOM 746   H HA   . ALA A 1 50  ? 1.450   -5.371  4.529   1.00 0.27  ? 50  ALA A HA   1  
ATOM 747   H HB1  . ALA A 1 50  ? 2.467   -3.937  6.225   1.00 1.06  ? 50  ALA A HB1  1  
ATOM 748   H HB2  . ALA A 1 50  ? 2.999   -5.610  6.394   1.00 1.01  ? 50  ALA A HB2  1  
ATOM 749   H HB3  . ALA A 1 50  ? 1.785   -4.952  7.492   1.00 1.17  ? 50  ALA A HB3  1  
ATOM 750   N N    . THR A 1 51  ? 1.340   -7.772  5.566   1.00 0.32  ? 51  THR A N    1  
ATOM 751   C CA   . THR A 1 51  ? 0.972   -9.144  5.868   1.00 0.40  ? 51  THR A CA   1  
ATOM 752   C C    . THR A 1 51  ? 0.990   -9.413  7.367   1.00 0.53  ? 51  THR A C    1  
ATOM 753   O O    . THR A 1 51  ? 1.918   -9.010  8.073   1.00 0.55  ? 51  THR A O    1  
ATOM 754   C CB   . THR A 1 51  ? 1.901   -10.146 5.161   1.00 0.41  ? 51  THR A CB   1  
ATOM 755   O OG1  . THR A 1 51  ? 3.220   -9.600  5.028   1.00 0.43  ? 51  THR A OG1  1  
ATOM 756   C CG2  . THR A 1 51  ? 1.353   -10.516 3.797   1.00 0.46  ? 51  THR A CG2  1  
ATOM 757   H H    . THR A 1 51  ? 2.194   -7.593  5.114   1.00 0.32  ? 51  THR A H    1  
ATOM 758   H HA   . THR A 1 51  ? -0.031  -9.301  5.500   1.00 0.48  ? 51  THR A HA   1  
ATOM 759   H HB   . THR A 1 51  ? 1.955   -11.043 5.762   1.00 0.48  ? 51  THR A HB   1  
ATOM 760   H HG1  . THR A 1 51  ? 3.863   -10.322 5.046   1.00 0.54  ? 51  THR A HG1  1  
ATOM 761   H HG21 . THR A 1 51  ? 1.191   -9.619  3.219   1.00 1.07  ? 51  THR A HG21 1  
ATOM 762   H HG22 . THR A 1 51  ? 0.418   -11.043 3.915   1.00 1.05  ? 51  THR A HG22 1  
ATOM 763   H HG23 . THR A 1 51  ? 2.062   -11.149 3.284   1.00 1.15  ? 51  THR A HG23 1  
ATOM 764   N N    . PRO A 1 52  ? -0.061  -10.078 7.870   1.00 0.71  ? 52  PRO A N    1  
ATOM 765   C CA   . PRO A 1 52  ? -0.138  -10.495 9.269   1.00 0.91  ? 52  PRO A CA   1  
ATOM 766   C C    . PRO A 1 52  ? 0.998   -11.443 9.635   1.00 0.96  ? 52  PRO A C    1  
ATOM 767   O O    . PRO A 1 52  ? 1.448   -12.238 8.810   1.00 0.88  ? 52  PRO A O    1  
ATOM 768   C CB   . PRO A 1 52  ? -1.484  -11.217 9.373   1.00 1.10  ? 52  PRO A CB   1  
ATOM 769   C CG   . PRO A 1 52  ? -1.902  -11.503 7.974   1.00 1.03  ? 52  PRO A CG   1  
ATOM 770   C CD   . PRO A 1 52  ? -1.263  -10.456 7.113   1.00 0.80  ? 52  PRO A CD   1  
ATOM 771   H HA   . PRO A 1 52  ? -0.129  -9.647  9.934   1.00 0.95  ? 52  PRO A HA   1  
ATOM 772   H HB2  . PRO A 1 52  ? -1.359  -12.129 9.936   1.00 1.22  ? 52  PRO A HB2  1  
ATOM 773   H HB3  . PRO A 1 52  ? -2.198  -10.577 9.872   1.00 1.17  ? 52  PRO A HB3  1  
ATOM 774   H HG2  . PRO A 1 52  ? -1.561  -12.484 7.684   1.00 1.06  ? 52  PRO A HG2  1  
ATOM 775   H HG3  . PRO A 1 52  ? -2.975  -11.441 7.899   1.00 1.16  ? 52  PRO A HG3  1  
ATOM 776   H HD2  . PRO A 1 52  ? -0.998  -10.872 6.152   1.00 0.73  ? 52  PRO A HD2  1  
ATOM 777   H HD3  . PRO A 1 52  ? -1.923  -9.611  6.991   1.00 0.85  ? 52  PRO A HD3  1  
ATOM 778   N N    . ALA A 1 53  ? 1.438   -11.356 10.886  1.00 1.16  ? 53  ALA A N    1  
ATOM 779   C CA   . ALA A 1 53  ? 2.600   -12.098 11.371  1.00 1.29  ? 53  ALA A CA   1  
ATOM 780   C C    . ALA A 1 53  ? 2.399   -13.606 11.283  1.00 1.31  ? 53  ALA A C    1  
ATOM 781   O O    . ALA A 1 53  ? 3.366   -14.367 11.301  1.00 1.36  ? 53  ALA A O    1  
ATOM 782   C CB   . ALA A 1 53  ? 2.907   -11.703 12.805  1.00 1.58  ? 53  ALA A CB   1  
ATOM 783   H H    . ALA A 1 53  ? 0.960   -10.770 11.513  1.00 1.25  ? 53  ALA A H    1  
ATOM 784   H HA   . ALA A 1 53  ? 3.447   -11.824 10.760  1.00 1.21  ? 53  ALA A HA   1  
ATOM 785   H HB1  . ALA A 1 53  ? 2.090   -12.008 13.442  1.00 1.87  ? 53  ALA A HB1  1  
ATOM 786   H HB2  . ALA A 1 53  ? 3.033   -10.633 12.866  1.00 1.82  ? 53  ALA A HB2  1  
ATOM 787   H HB3  . ALA A 1 53  ? 3.814   -12.192 13.124  1.00 1.98  ? 53  ALA A HB3  1  
ATOM 788   N N    . SER A 1 54  ? 1.147   -14.036 11.201  1.00 1.32  ? 54  SER A N    1  
ATOM 789   C CA   . SER A 1 54  ? 0.837   -15.451 11.085  1.00 1.41  ? 54  SER A CA   1  
ATOM 790   C C    . SER A 1 54  ? 1.246   -15.979 9.711   1.00 1.26  ? 54  SER A C    1  
ATOM 791   O O    . SER A 1 54  ? 1.533   -17.166 9.544   1.00 1.35  ? 54  SER A O    1  
ATOM 792   C CB   . SER A 1 54  ? -0.654  -15.686 11.326  1.00 1.55  ? 54  SER A CB   1  
ATOM 793   O OG   . SER A 1 54  ? -1.443  -14.862 10.481  1.00 1.49  ? 54  SER A OG   1  
ATOM 794   H H    . SER A 1 54  ? 0.414   -13.387 11.222  1.00 1.32  ? 54  SER A H    1  
ATOM 795   H HA   . SER A 1 54  ? 1.403   -15.974 11.841  1.00 1.52  ? 54  SER A HA   1  
ATOM 796   H HB2  . SER A 1 54  ? -0.893  -16.720 11.126  1.00 1.60  ? 54  SER A HB2  1  
ATOM 797   H HB3  . SER A 1 54  ? -0.890  -15.455 12.355  1.00 1.70  ? 54  SER A HB3  1  
ATOM 798   H HG   . SER A 1 54  ? -1.742  -15.384 9.712   1.00 1.65  ? 54  SER A HG   1  
ATOM 799   N N    . SER A 1 55  ? 1.280   -15.084 8.734   1.00 1.09  ? 55  SER A N    1  
ATOM 800   C CA   . SER A 1 55  ? 1.676   -15.437 7.385   1.00 1.02  ? 55  SER A CA   1  
ATOM 801   C C    . SER A 1 55  ? 3.164   -15.171 7.210   1.00 0.94  ? 55  SER A C    1  
ATOM 802   O O    . SER A 1 55  ? 3.680   -14.151 7.671   1.00 0.99  ? 55  SER A O    1  
ATOM 803   C CB   . SER A 1 55  ? 0.866   -14.626 6.370   1.00 0.96  ? 55  SER A CB   1  
ATOM 804   O OG   . SER A 1 55  ? 1.117   -15.058 5.043   1.00 1.32  ? 55  SER A OG   1  
ATOM 805   H H    . SER A 1 55  ? 1.053   -14.150 8.932   1.00 1.06  ? 55  SER A H    1  
ATOM 806   H HA   . SER A 1 55  ? 1.484   -16.490 7.239   1.00 1.13  ? 55  SER A HA   1  
ATOM 807   H HB2  . SER A 1 55  ? -0.186  -14.740 6.578   1.00 1.12  ? 55  SER A HB2  1  
ATOM 808   H HB3  . SER A 1 55  ? 1.136   -13.582 6.451   1.00 1.06  ? 55  SER A HB3  1  
ATOM 809   H HG   . SER A 1 55  ? 0.442   -15.697 4.782   1.00 1.49  ? 55  SER A HG   1  
ATOM 810   N N    . GLU A 1 56  ? 3.850   -16.100 6.561   1.00 0.88  ? 56  GLU A N    1  
ATOM 811   C CA   . GLU A 1 56  ? 5.290   -16.005 6.382   1.00 0.85  ? 56  GLU A CA   1  
ATOM 812   C C    . GLU A 1 56  ? 5.652   -15.012 5.288   1.00 0.70  ? 56  GLU A C    1  
ATOM 813   O O    . GLU A 1 56  ? 6.702   -14.374 5.341   1.00 0.74  ? 56  GLU A O    1  
ATOM 814   C CB   . GLU A 1 56  ? 5.874   -17.367 6.042   1.00 0.93  ? 56  GLU A CB   1  
ATOM 815   C CG   . GLU A 1 56  ? 7.347   -17.314 5.711   1.00 1.08  ? 56  GLU A CG   1  
ATOM 816   C CD   . GLU A 1 56  ? 7.918   -18.668 5.367   1.00 1.75  ? 56  GLU A CD   1  
ATOM 817   O OE1  . GLU A 1 56  ? 8.051   -19.511 6.279   1.00 2.08  ? 56  GLU A OE1  1  
ATOM 818   O OE2  . GLU A 1 56  ? 8.235   -18.899 4.184   1.00 2.37  ? 56  GLU A OE2  1  
ATOM 819   H H    . GLU A 1 56  ? 3.372   -16.871 6.189   1.00 0.92  ? 56  GLU A H    1  
ATOM 820   H HA   . GLU A 1 56  ? 5.717   -15.671 7.309   1.00 0.96  ? 56  GLU A HA   1  
ATOM 821   H HB2  . GLU A 1 56  ? 5.732   -18.035 6.879   1.00 1.09  ? 56  GLU A HB2  1  
ATOM 822   H HB3  . GLU A 1 56  ? 5.358   -17.753 5.189   1.00 0.96  ? 56  GLU A HB3  1  
ATOM 823   H HG2  . GLU A 1 56  ? 7.476   -16.656 4.863   1.00 1.32  ? 56  GLU A HG2  1  
ATOM 824   H HG3  . GLU A 1 56  ? 7.878   -16.916 6.560   1.00 1.15  ? 56  GLU A HG3  1  
ATOM 825   N N    . LYS A 1 57  ? 4.782   -14.885 4.303   1.00 0.62  ? 57  LYS A N    1  
ATOM 826   C CA   . LYS A 1 57  ? 5.071   -14.057 3.147   1.00 0.54  ? 57  LYS A CA   1  
ATOM 827   C C    . LYS A 1 57  ? 5.096   -12.577 3.522   1.00 0.48  ? 57  LYS A C    1  
ATOM 828   O O    . LYS A 1 57  ? 4.466   -12.153 4.496   1.00 0.68  ? 57  LYS A O    1  
ATOM 829   C CB   . LYS A 1 57  ? 4.056   -14.316 2.045   1.00 0.63  ? 57  LYS A CB   1  
ATOM 830   C CG   . LYS A 1 57  ? 2.668   -14.001 2.487   1.00 1.10  ? 57  LYS A CG   1  
ATOM 831   C CD   . LYS A 1 57  ? 1.674   -14.184 1.377   1.00 1.47  ? 57  LYS A CD   1  
ATOM 832   C CE   . LYS A 1 57  ? 1.824   -15.542 0.739   1.00 1.47  ? 57  LYS A CE   1  
ATOM 833   N NZ   . LYS A 1 57  ? 0.884   -15.734 -0.396  1.00 2.29  ? 57  LYS A NZ   1  
ATOM 834   H H    . LYS A 1 57  ? 3.921   -15.350 4.359   1.00 0.68  ? 57  LYS A H    1  
ATOM 835   H HA   . LYS A 1 57  ? 6.038   -14.334 2.796   1.00 0.55  ? 57  LYS A HA   1  
ATOM 836   H HB2  . LYS A 1 57  ? 4.286   -13.713 1.185   1.00 1.00  ? 57  LYS A HB2  1  
ATOM 837   H HB3  . LYS A 1 57  ? 4.089   -15.354 1.764   1.00 1.00  ? 57  LYS A HB3  1  
ATOM 838   H HG2  . LYS A 1 57  ? 2.415   -14.658 3.294   1.00 1.61  ? 57  LYS A HG2  1  
ATOM 839   H HG3  . LYS A 1 57  ? 2.649   -12.983 2.820   1.00 1.61  ? 57  LYS A HG3  1  
ATOM 840   H HD2  . LYS A 1 57  ? 0.686   -14.098 1.783   1.00 2.16  ? 57  LYS A HD2  1  
ATOM 841   H HD3  . LYS A 1 57  ? 1.835   -13.420 0.636   1.00 1.97  ? 57  LYS A HD3  1  
ATOM 842   H HE2  . LYS A 1 57  ? 2.838   -15.628 0.389   1.00 1.55  ? 57  LYS A HE2  1  
ATOM 843   H HE3  . LYS A 1 57  ? 1.636   -16.299 1.486   1.00 1.84  ? 57  LYS A HE3  1  
ATOM 844   H HZ1  . LYS A 1 57  ? 1.004   -14.976 -1.096  1.00 2.69  ? 57  LYS A HZ1  1  
ATOM 845   H HZ2  . LYS A 1 57  ? -0.097  -15.722 -0.053  1.00 2.69  ? 57  LYS A HZ2  1  
ATOM 846   H HZ3  . LYS A 1 57  ? 1.064   -16.648 -0.858  1.00 2.71  ? 57  LYS A HZ3  1  
ATOM 847   N N    . MET A 1 58  ? 5.820   -11.797 2.738   1.00 0.38  ? 58  MET A N    1  
ATOM 848   C CA   . MET A 1 58  ? 6.056   -10.398 3.054   1.00 0.39  ? 58  MET A CA   1  
ATOM 849   C C    . MET A 1 58  ? 5.373   -9.503  2.034   1.00 0.33  ? 58  MET A C    1  
ATOM 850   O O    . MET A 1 58  ? 5.678   -9.567  0.843   1.00 0.40  ? 58  MET A O    1  
ATOM 851   C CB   . MET A 1 58  ? 7.558   -10.103 3.071   1.00 0.53  ? 58  MET A CB   1  
ATOM 852   C CG   . MET A 1 58  ? 8.378   -11.103 3.841   1.00 0.81  ? 58  MET A CG   1  
ATOM 853   S SD   . MET A 1 58  ? 8.593   -12.642 2.930   1.00 1.13  ? 58  MET A SD   1  
ATOM 854   C CE   . MET A 1 58  ? 9.532   -13.577 4.112   1.00 0.71  ? 58  MET A CE   1  
ATOM 855   H H    . MET A 1 58  ? 6.210   -12.172 1.920   1.00 0.49  ? 58  MET A H    1  
ATOM 856   H HA   . MET A 1 58  ? 5.643   -10.200 4.032   1.00 0.43  ? 58  MET A HA   1  
ATOM 857   H HB2  . MET A 1 58  ? 7.921   -10.109 2.064   1.00 1.04  ? 58  MET A HB2  1  
ATOM 858   H HB3  . MET A 1 58  ? 7.720   -9.127  3.500   1.00 1.02  ? 58  MET A HB3  1  
ATOM 859   H HG2  . MET A 1 58  ? 9.349   -10.680 4.047   1.00 1.60  ? 58  MET A HG2  1  
ATOM 860   H HG3  . MET A 1 58  ? 7.875   -11.315 4.762   1.00 1.52  ? 58  MET A HG3  1  
ATOM 861   H HE1  . MET A 1 58  ? 10.564  -13.265 4.070   1.00 1.18  ? 58  MET A HE1  1  
ATOM 862   H HE2  . MET A 1 58  ? 9.454   -14.628 3.880   1.00 1.35  ? 58  MET A HE2  1  
ATOM 863   H HE3  . MET A 1 58  ? 9.137   -13.391 5.102   1.00 1.18  ? 58  MET A HE3  1  
ATOM 864   N N    . MET A 1 59  ? 4.461   -8.666  2.495   1.00 0.29  ? 59  MET A N    1  
ATOM 865   C CA   . MET A 1 59  ? 3.693   -7.828  1.592   1.00 0.26  ? 59  MET A CA   1  
ATOM 866   C C    . MET A 1 59  ? 3.378   -6.483  2.226   1.00 0.24  ? 59  MET A C    1  
ATOM 867   O O    . MET A 1 59  ? 3.071   -6.407  3.414   1.00 0.29  ? 59  MET A O    1  
ATOM 868   C CB   . MET A 1 59  ? 2.377   -8.515  1.251   1.00 0.32  ? 59  MET A CB   1  
ATOM 869   C CG   . MET A 1 59  ? 1.925   -8.307  -0.177  1.00 0.38  ? 59  MET A CG   1  
ATOM 870   S SD   . MET A 1 59  ? 2.964   -9.162  -1.374  1.00 0.49  ? 59  MET A SD   1  
ATOM 871   C CE   . MET A 1 59  ? 2.731   -10.870 -0.880  1.00 0.63  ? 59  MET A CE   1  
ATOM 872   H H    . MET A 1 59  ? 4.295   -8.613  3.464   1.00 0.34  ? 59  MET A H    1  
ATOM 873   H HA   . MET A 1 59  ? 4.264   -7.682  0.682   1.00 0.25  ? 59  MET A HA   1  
ATOM 874   H HB2  . MET A 1 59  ? 2.476   -9.569  1.428   1.00 0.42  ? 59  MET A HB2  1  
ATOM 875   H HB3  . MET A 1 59  ? 1.611   -8.126  1.905   1.00 0.34  ? 59  MET A HB3  1  
ATOM 876   H HG2  . MET A 1 59  ? 0.919   -8.673  -0.273  1.00 0.45  ? 59  MET A HG2  1  
ATOM 877   H HG3  . MET A 1 59  ? 1.942   -7.248  -0.393  1.00 0.40  ? 59  MET A HG3  1  
ATOM 878   H HE1  . MET A 1 59  ? 1.682   -11.120 -0.930  1.00 1.24  ? 59  MET A HE1  1  
ATOM 879   H HE2  . MET A 1 59  ? 3.085   -11.004 0.130   1.00 1.09  ? 59  MET A HE2  1  
ATOM 880   H HE3  . MET A 1 59  ? 3.286   -11.515 -1.544  1.00 1.26  ? 59  MET A HE3  1  
ATOM 881   N N    . LEU A 1 60  ? 3.460   -5.434  1.431   1.00 0.20  ? 60  LEU A N    1  
ATOM 882   C CA   . LEU A 1 60  ? 2.946   -4.130  1.826   1.00 0.19  ? 60  LEU A CA   1  
ATOM 883   C C    . LEU A 1 60  ? 1.887   -3.692  0.829   1.00 0.21  ? 60  LEU A C    1  
ATOM 884   O O    . LEU A 1 60  ? 1.896   -4.120  -0.326  1.00 0.25  ? 60  LEU A O    1  
ATOM 885   C CB   . LEU A 1 60  ? 4.039   -3.052  1.892   1.00 0.21  ? 60  LEU A CB   1  
ATOM 886   C CG   . LEU A 1 60  ? 4.655   -2.778  3.271   1.00 0.26  ? 60  LEU A CG   1  
ATOM 887   C CD1  . LEU A 1 60  ? 3.583   -2.520  4.299   1.00 0.48  ? 60  LEU A CD1  1  
ATOM 888   C CD2  . LEU A 1 60  ? 5.544   -3.908  3.737   1.00 0.40  ? 60  LEU A CD2  1  
ATOM 889   H H    . LEU A 1 60  ? 3.863   -5.541  0.541   1.00 0.21  ? 60  LEU A H    1  
ATOM 890   H HA   . LEU A 1 60  ? 2.488   -4.236  2.798   1.00 0.18  ? 60  LEU A HA   1  
ATOM 891   H HB2  . LEU A 1 60  ? 4.829   -3.334  1.218   1.00 0.28  ? 60  LEU A HB2  1  
ATOM 892   H HB3  . LEU A 1 60  ? 3.606   -2.124  1.540   1.00 0.21  ? 60  LEU A HB3  1  
ATOM 893   H HG   . LEU A 1 60  ? 5.261   -1.890  3.204   1.00 0.52  ? 60  LEU A HG   1  
ATOM 894   H HD11 . LEU A 1 60  ? 3.061   -3.444  4.505   1.00 1.23  ? 60  LEU A HD11 1  
ATOM 895   H HD12 . LEU A 1 60  ? 2.886   -1.786  3.920   1.00 0.99  ? 60  LEU A HD12 1  
ATOM 896   H HD13 . LEU A 1 60  ? 4.037   -2.154  5.207   1.00 1.17  ? 60  LEU A HD13 1  
ATOM 897   H HD21 . LEU A 1 60  ? 6.439   -3.937  3.135   1.00 1.03  ? 60  LEU A HD21 1  
ATOM 898   H HD22 . LEU A 1 60  ? 5.013   -4.842  3.642   1.00 1.14  ? 60  LEU A HD22 1  
ATOM 899   H HD23 . LEU A 1 60  ? 5.807   -3.741  4.773   1.00 1.12  ? 60  LEU A HD23 1  
ATOM 900   N N    . ARG A 1 61  ? 0.970   -2.863  1.281   1.00 0.22  ? 61  ARG A N    1  
ATOM 901   C CA   . ARG A 1 61  ? -0.011  -2.260  0.387   1.00 0.25  ? 61  ARG A CA   1  
ATOM 902   C C    . ARG A 1 61  ? 0.034   -0.742  0.458   1.00 0.26  ? 61  ARG A C    1  
ATOM 903   O O    . ARG A 1 61  ? 0.404   -0.170  1.478   1.00 0.31  ? 61  ARG A O    1  
ATOM 904   C CB   . ARG A 1 61  ? -1.435  -2.682  0.725   1.00 0.31  ? 61  ARG A CB   1  
ATOM 905   C CG   . ARG A 1 61  ? -1.866  -4.022  0.153   1.00 0.40  ? 61  ARG A CG   1  
ATOM 906   C CD   . ARG A 1 61  ? -3.289  -4.341  0.582   1.00 0.56  ? 61  ARG A CD   1  
ATOM 907   N NE   . ARG A 1 61  ? -3.892  -5.425  -0.187  1.00 1.20  ? 61  ARG A NE   1  
ATOM 908   C CZ   . ARG A 1 61  ? -4.965  -6.105  0.216   1.00 1.42  ? 61  ARG A CZ   1  
ATOM 909   N NH1  . ARG A 1 61  ? -5.530  -5.826  1.385   1.00 1.03  ? 61  ARG A NH1  1  
ATOM 910   N NH2  . ARG A 1 61  ? -5.479  -7.055  -0.554  1.00 2.37  ? 61  ARG A NH2  1  
ATOM 911   H H    . ARG A 1 61  ? 0.949   -2.655  2.252   1.00 0.24  ? 61  ARG A H    1  
ATOM 912   H HA   . ARG A 1 61  ? 0.219   -2.581  -0.622  1.00 0.26  ? 61  ARG A HA   1  
ATOM 913   H HB2  . ARG A 1 61  ? -1.535  -2.726  1.796   1.00 0.33  ? 61  ARG A HB2  1  
ATOM 914   H HB3  . ARG A 1 61  ? -2.105  -1.920  0.341   1.00 0.35  ? 61  ARG A HB3  1  
ATOM 915   H HG2  . ARG A 1 61  ? -1.821  -3.979  -0.925  1.00 0.46  ? 61  ARG A HG2  1  
ATOM 916   H HG3  . ARG A 1 61  ? -1.205  -4.794  0.517   1.00 0.41  ? 61  ARG A HG3  1  
ATOM 917   H HD2  . ARG A 1 61  ? -3.279  -4.622  1.623   1.00 0.96  ? 61  ARG A HD2  1  
ATOM 918   H HD3  . ARG A 1 61  ? -3.891  -3.453  0.460   1.00 1.24  ? 61  ARG A HD3  1  
ATOM 919   H HE   . ARG A 1 61  ? -3.491  -5.640  -1.059  1.00 1.81  ? 61  ARG A HE   1  
ATOM 920   H HH11 . ARG A 1 61  ? -5.155  -5.098  1.973   1.00 1.07  ? 61  ARG A HH11 1  
ATOM 921   H HH12 . ARG A 1 61  ? -6.338  -6.336  1.691   1.00 1.28  ? 61  ARG A HH12 1  
ATOM 922   H HH21 . ARG A 1 61  ? -5.065  -7.263  -1.441  1.00 2.99  ? 61  ARG A HH21 1  
ATOM 923   H HH22 . ARG A 1 61  ? -6.288  -7.568  -0.249  1.00 2.55  ? 61  ARG A HH22 1  
ATOM 924   N N    . LEU A 1 62  ? -0.365  -0.110  -0.631  1.00 0.28  ? 62  LEU A N    1  
ATOM 925   C CA   . LEU A 1 62  ? -0.598  1.321   -0.667  1.00 0.28  ? 62  LEU A CA   1  
ATOM 926   C C    . LEU A 1 62  ? -2.060  1.577   -0.971  1.00 0.28  ? 62  LEU A C    1  
ATOM 927   O O    . LEU A 1 62  ? -2.486  1.430   -2.112  1.00 0.33  ? 62  LEU A O    1  
ATOM 928   C CB   . LEU A 1 62  ? 0.248   1.970   -1.751  1.00 0.31  ? 62  LEU A CB   1  
ATOM 929   C CG   . LEU A 1 62  ? 1.410   2.823   -1.273  1.00 0.37  ? 62  LEU A CG   1  
ATOM 930   C CD1  . LEU A 1 62  ? 0.959   3.874   -0.294  1.00 0.70  ? 62  LEU A CD1  1  
ATOM 931   C CD2  . LEU A 1 62  ? 2.477   1.970   -0.657  1.00 0.68  ? 62  LEU A CD2  1  
ATOM 932   H H    . LEU A 1 62  ? -0.503  -0.628  -1.452  1.00 0.34  ? 62  LEU A H    1  
ATOM 933   H HA   . LEU A 1 62  ? -0.344  1.741   0.293   1.00 0.27  ? 62  LEU A HA   1  
ATOM 934   H HB2  . LEU A 1 62  ? 0.650   1.180   -2.358  1.00 0.39  ? 62  LEU A HB2  1  
ATOM 935   H HB3  . LEU A 1 62  ? -0.395  2.582   -2.364  1.00 0.33  ? 62  LEU A HB3  1  
ATOM 936   H HG   . LEU A 1 62  ? 1.837   3.321   -2.121  1.00 0.72  ? 62  LEU A HG   1  
ATOM 937   H HD11 . LEU A 1 62  ? 0.556   3.394   0.584   1.00 1.29  ? 62  LEU A HD11 1  
ATOM 938   H HD12 . LEU A 1 62  ? 0.201   4.487   -0.753  1.00 1.45  ? 62  LEU A HD12 1  
ATOM 939   H HD13 . LEU A 1 62  ? 1.804   4.485   -0.018  1.00 1.20  ? 62  LEU A HD13 1  
ATOM 940   H HD21 . LEU A 1 62  ? 2.986   1.429   -1.442  1.00 1.18  ? 62  LEU A HD21 1  
ATOM 941   H HD22 . LEU A 1 62  ? 2.023   1.270   0.028   1.00 1.33  ? 62  LEU A HD22 1  
ATOM 942   H HD23 . LEU A 1 62  ? 3.178   2.593   -0.129  1.00 1.28  ? 62  LEU A HD23 1  
ATOM 943   N N    . ILE A 1 63  ? -2.826  1.956   0.029   1.00 0.26  ? 63  ILE A N    1  
ATOM 944   C CA   . ILE A 1 63  ? -4.250  2.155   -0.155  1.00 0.26  ? 63  ILE A CA   1  
ATOM 945   C C    . ILE A 1 63  ? -4.515  3.582   -0.596  1.00 0.25  ? 63  ILE A C    1  
ATOM 946   O O    . ILE A 1 63  ? -4.548  4.487   0.228   1.00 0.24  ? 63  ILE A O    1  
ATOM 947   C CB   . ILE A 1 63  ? -5.030  1.910   1.146   1.00 0.27  ? 63  ILE A CB   1  
ATOM 948   C CG1  . ILE A 1 63  ? -4.643  0.570   1.777   1.00 0.32  ? 63  ILE A CG1  1  
ATOM 949   C CG2  . ILE A 1 63  ? -6.527  1.967   0.879   1.00 0.33  ? 63  ILE A CG2  1  
ATOM 950   C CD1  . ILE A 1 63  ? -5.301  -0.617  1.133   1.00 0.41  ? 63  ILE A CD1  1  
ATOM 951   H H    . ILE A 1 63  ? -2.425  2.131   0.911   1.00 0.25  ? 63  ILE A H    1  
ATOM 952   H HA   . ILE A 1 63  ? -4.599  1.465   -0.910  1.00 0.29  ? 63  ILE A HA   1  
ATOM 953   H HB   . ILE A 1 63  ? -4.785  2.706   1.831   1.00 0.28  ? 63  ILE A HB   1  
ATOM 954   H HG12 . ILE A 1 63  ? -3.575  0.440   1.696   1.00 0.36  ? 63  ILE A HG12 1  
ATOM 955   H HG13 . ILE A 1 63  ? -4.920  0.573   2.818   1.00 0.39  ? 63  ILE A HG13 1  
ATOM 956   H HG21 . ILE A 1 63  ? -6.781  1.252   0.109   1.00 1.10  ? 63  ILE A HG21 1  
ATOM 957   H HG22 . ILE A 1 63  ? -6.797  2.960   0.550   1.00 1.02  ? 63  ILE A HG22 1  
ATOM 958   H HG23 . ILE A 1 63  ? -7.065  1.730   1.783   1.00 1.11  ? 63  ILE A HG23 1  
ATOM 959   H HD11 . ILE A 1 63  ? -5.039  -0.650  0.086   1.00 1.24  ? 63  ILE A HD11 1  
ATOM 960   H HD12 . ILE A 1 63  ? -6.372  -0.518  1.240   1.00 0.97  ? 63  ILE A HD12 1  
ATOM 961   H HD13 . ILE A 1 63  ? -4.972  -1.518  1.623   1.00 1.08  ? 63  ILE A HD13 1  
ATOM 962   N N    . GLY A 1 64  ? -4.708  3.780   -1.883  1.00 0.28  ? 64  GLY A N    1  
ATOM 963   C CA   . GLY A 1 64  ? -4.953  5.112   -2.388  1.00 0.27  ? 64  GLY A CA   1  
ATOM 964   C C    . GLY A 1 64  ? -6.335  5.601   -2.026  1.00 0.29  ? 64  GLY A C    1  
ATOM 965   O O    . GLY A 1 64  ? -7.252  4.797   -1.849  1.00 0.37  ? 64  GLY A O    1  
ATOM 966   H H    . GLY A 1 64  ? -4.705  3.015   -2.496  1.00 0.32  ? 64  GLY A H    1  
ATOM 967   H HA2  . GLY A 1 64  ? -4.223  5.782   -1.970  1.00 0.26  ? 64  GLY A HA2  1  
ATOM 968   H HA3  . GLY A 1 64  ? -4.849  5.111   -3.458  1.00 0.33  ? 64  GLY A HA3  1  
ATOM 969   N N    . LYS A 1 65  ? -6.486  6.914   -1.913  1.00 0.34  ? 65  LYS A N    1  
ATOM 970   C CA   . LYS A 1 65  ? -7.745  7.505   -1.524  1.00 0.41  ? 65  LYS A CA   1  
ATOM 971   C C    . LYS A 1 65  ? -8.823  7.236   -2.542  1.00 0.60  ? 65  LYS A C    1  
ATOM 972   O O    . LYS A 1 65  ? -8.559  6.902   -3.703  1.00 0.80  ? 65  LYS A O    1  
ATOM 973   C CB   . LYS A 1 65  ? -7.595  8.995   -1.335  1.00 0.53  ? 65  LYS A CB   1  
ATOM 974   C CG   . LYS A 1 65  ? -6.711  9.337   -0.188  1.00 0.50  ? 65  LYS A CG   1  
ATOM 975   C CD   . LYS A 1 65  ? -6.445  10.813  -0.133  1.00 0.68  ? 65  LYS A CD   1  
ATOM 976   C CE   . LYS A 1 65  ? -5.868  11.157  1.202   1.00 0.91  ? 65  LYS A CE   1  
ATOM 977   N NZ   . LYS A 1 65  ? -5.813  12.622  1.434   1.00 1.16  ? 65  LYS A NZ   1  
ATOM 978   H H    . LYS A 1 65  ? -5.727  7.506   -2.101  1.00 0.41  ? 65  LYS A H    1  
ATOM 979   H HA   . LYS A 1 65  ? -8.035  7.073   -0.579  1.00 0.37  ? 65  LYS A HA   1  
ATOM 980   H HB2  . LYS A 1 65  ? -7.183  9.425   -2.218  1.00 0.66  ? 65  LYS A HB2  1  
ATOM 981   H HB3  . LYS A 1 65  ? -8.557  9.425   -1.152  1.00 0.67  ? 65  LYS A HB3  1  
ATOM 982   H HG2  . LYS A 1 65  ? -7.192  9.033   0.730   1.00 0.58  ? 65  LYS A HG2  1  
ATOM 983   H HG3  . LYS A 1 65  ? -5.782  8.810   -0.301  1.00 0.52  ? 65  LYS A HG3  1  
ATOM 984   H HD2  . LYS A 1 65  ? -5.743  11.080  -0.909  1.00 0.90  ? 65  LYS A HD2  1  
ATOM 985   H HD3  . LYS A 1 65  ? -7.374  11.346  -0.272  1.00 0.68  ? 65  LYS A HD3  1  
ATOM 986   H HE2  . LYS A 1 65  ? -6.495  10.692  1.941   1.00 0.98  ? 65  LYS A HE2  1  
ATOM 987   H HE3  . LYS A 1 65  ? -4.870  10.747  1.268   1.00 1.08  ? 65  LYS A HE3  1  
ATOM 988   H HZ1  . LYS A 1 65  ? -6.773  13.018  1.464   1.00 1.67  ? 65  LYS A HZ1  1  
ATOM 989   H HZ2  . LYS A 1 65  ? -5.282  13.087  0.669   1.00 1.54  ? 65  LYS A HZ2  1  
ATOM 990   H HZ3  . LYS A 1 65  ? -5.341  12.823  2.338   1.00 1.48  ? 65  LYS A HZ3  1  
ATOM 991   N N    . VAL A 1 66  ? -10.033 7.415   -2.091  1.00 0.67  ? 66  VAL A N    1  
ATOM 992   C CA   . VAL A 1 66  ? -11.201 7.094   -2.874  1.00 1.01  ? 66  VAL A CA   1  
ATOM 993   C C    . VAL A 1 66  ? -12.011 8.326   -3.202  1.00 1.29  ? 66  VAL A C    1  
ATOM 994   O O    . VAL A 1 66  ? -11.755 9.421   -2.693  1.00 1.39  ? 66  VAL A O    1  
ATOM 995   C CB   . VAL A 1 66  ? -12.115 6.082   -2.157  1.00 1.12  ? 66  VAL A CB   1  
ATOM 996   C CG1  . VAL A 1 66  ? -11.486 4.710   -2.154  1.00 1.26  ? 66  VAL A CG1  1  
ATOM 997   C CG2  . VAL A 1 66  ? -12.405 6.524   -0.738  1.00 1.48  ? 66  VAL A CG2  1  
ATOM 998   H H    . VAL A 1 66  ? -10.141 7.816   -1.205  1.00 0.65  ? 66  VAL A H    1  
ATOM 999   H HA   . VAL A 1 66  ? -10.866 6.644   -3.797  1.00 1.28  ? 66  VAL A HA   1  
ATOM 1000  H HB   . VAL A 1 66  ? -13.050 6.026   -2.692  1.00 1.58  ? 66  VAL A HB   1  
ATOM 1001  H HG11 . VAL A 1 66  ? -10.509 4.760   -1.695  1.00 1.62  ? 66  VAL A HG11 1  
ATOM 1002  H HG12 . VAL A 1 66  ? -11.389 4.359   -3.171  1.00 1.87  ? 66  VAL A HG12 1  
ATOM 1003  H HG13 . VAL A 1 66  ? -12.108 4.025   -1.595  1.00 1.61  ? 66  VAL A HG13 1  
ATOM 1004  H HG21 . VAL A 1 66  ? -13.061 5.807   -0.270  1.00 1.91  ? 66  VAL A HG21 1  
ATOM 1005  H HG22 . VAL A 1 66  ? -12.880 7.495   -0.753  1.00 2.10  ? 66  VAL A HG22 1  
ATOM 1006  H HG23 . VAL A 1 66  ? -11.481 6.579   -0.186  1.00 1.76  ? 66  VAL A HG23 1  
ATOM 1007  N N    . ASP A 1 67  ? -12.975 8.121   -4.069  1.00 1.84  ? 67  ASP A N    1  
ATOM 1008  C CA   . ASP A 1 67  ? -13.989 9.111   -4.371  1.00 2.24  ? 67  ASP A CA   1  
ATOM 1009  C C    . ASP A 1 67  ? -14.743 9.487   -3.105  1.00 2.23  ? 67  ASP A C    1  
ATOM 1010  O O    . ASP A 1 67  ? -14.845 8.692   -2.167  1.00 2.60  ? 67  ASP A O    1  
ATOM 1011  C CB   . ASP A 1 67  ? -14.974 8.572   -5.414  1.00 3.07  ? 67  ASP A CB   1  
ATOM 1012  C CG   . ASP A 1 67  ? -14.369 8.457   -6.797  1.00 3.61  ? 67  ASP A CG   1  
ATOM 1013  O OD1  . ASP A 1 67  ? -13.454 7.629   -6.987  1.00 4.14  ? 67  ASP A OD1  1  
ATOM 1014  O OD2  . ASP A 1 67  ? -14.814 9.186   -7.707  1.00 3.94  ? 67  ASP A OD2  1  
ATOM 1015  H H    . ASP A 1 67  ? -13.010 7.256   -4.525  1.00 2.14  ? 67  ASP A H    1  
ATOM 1016  H HA   . ASP A 1 67  ? -13.499 9.989   -4.765  1.00 2.38  ? 67  ASP A HA   1  
ATOM 1017  H HB2  . ASP A 1 67  ? -15.308 7.591   -5.109  1.00 3.41  ? 67  ASP A HB2  1  
ATOM 1018  H HB3  . ASP A 1 67  ? -15.825 9.234   -5.468  1.00 3.48  ? 67  ASP A HB3  1  
ATOM 1019  N N    . GLU A 1 68  ? -15.220 10.720  -3.069  1.00 2.48  ? 68  GLU A N    1  
ATOM 1020  C CA   . GLU A 1 68  ? -16.027 11.236  -1.961  1.00 2.96  ? 68  GLU A CA   1  
ATOM 1021  C C    . GLU A 1 68  ? -17.298 10.407  -1.718  1.00 3.03  ? 68  GLU A C    1  
ATOM 1022  O O    . GLU A 1 68  ? -18.117 10.757  -0.868  1.00 3.47  ? 68  GLU A O    1  
ATOM 1023  C CB   . GLU A 1 68  ? -16.379 12.701  -2.197  1.00 3.79  ? 68  GLU A CB   1  
ATOM 1024  C CG   . GLU A 1 68  ? -15.304 13.670  -1.755  1.00 4.24  ? 68  GLU A CG   1  
ATOM 1025  C CD   . GLU A 1 68  ? -13.935 13.351  -2.319  1.00 4.33  ? 68  GLU A CD   1  
ATOM 1026  O OE1  . GLU A 1 68  ? -13.712 13.581  -3.526  1.00 4.61  ? 68  GLU A OE1  1  
ATOM 1027  O OE2  . GLU A 1 68  ? -13.071 12.870  -1.558  1.00 4.54  ? 68  GLU A OE2  1  
ATOM 1028  H H    . GLU A 1 68  ? -15.025 11.318  -3.821  1.00 2.75  ? 68  GLU A H    1  
ATOM 1029  H HA   . GLU A 1 68  ? -15.416 11.177  -1.078  1.00 3.16  ? 68  GLU A HA   1  
ATOM 1030  H HB2  . GLU A 1 68  ? -16.538 12.848  -3.241  1.00 4.05  ? 68  GLU A HB2  1  
ATOM 1031  H HB3  . GLU A 1 68  ? -17.285 12.936  -1.663  1.00 4.24  ? 68  GLU A HB3  1  
ATOM 1032  H HG2  . GLU A 1 68  ? -15.587 14.658  -2.078  1.00 4.79  ? 68  GLU A HG2  1  
ATOM 1033  H HG3  . GLU A 1 68  ? -15.252 13.648  -0.683  1.00 4.43  ? 68  GLU A HG3  1  
ATOM 1034  N N    . SER A 1 69  ? -17.464 9.333   -2.493  1.00 3.10  ? 69  SER A N    1  
ATOM 1035  C CA   . SER A 1 69  ? -18.554 8.369   -2.337  1.00 3.63  ? 69  SER A CA   1  
ATOM 1036  C C    . SER A 1 69  ? -18.604 7.733   -0.933  1.00 3.71  ? 69  SER A C    1  
ATOM 1037  O O    . SER A 1 69  ? -19.402 6.832   -0.688  1.00 4.40  ? 69  SER A O    1  
ATOM 1038  C CB   . SER A 1 69  ? -18.435 7.286   -3.409  1.00 4.49  ? 69  SER A CB   1  
ATOM 1039  O OG   . SER A 1 69  ? -17.099 6.829   -3.527  1.00 4.68  ? 69  SER A OG   1  
ATOM 1040  H H    . SER A 1 69  ? -16.812 9.173   -3.205  1.00 3.14  ? 69  SER A H    1  
ATOM 1041  H HA   . SER A 1 69  ? -19.478 8.904   -2.496  1.00 3.90  ? 69  SER A HA   1  
ATOM 1042  H HB2  . SER A 1 69  ? -19.065 6.455   -3.148  1.00 4.89  ? 69  SER A HB2  1  
ATOM 1043  H HB3  . SER A 1 69  ? -18.752 7.683   -4.356  1.00 4.96  ? 69  SER A HB3  1  
ATOM 1044  H HG   . SER A 1 69  ? -17.064 6.111   -4.169  1.00 4.92  ? 69  SER A HG   1  
ATOM 1045  N N    . LYS A 1 70  ? -17.739 8.195   -0.021  1.00 3.46  ? 70  LYS A N    1  
ATOM 1046  C CA   . LYS A 1 70  ? -17.869 7.878   1.407   1.00 4.25  ? 70  LYS A CA   1  
ATOM 1047  C C    . LYS A 1 70  ? -19.140 8.519   1.958   1.00 4.39  ? 70  LYS A C    1  
ATOM 1048  O O    . LYS A 1 70  ? -19.454 8.412   3.144   1.00 5.30  ? 70  LYS A O    1  
ATOM 1049  C CB   . LYS A 1 70  ? -16.688 8.427   2.202   1.00 4.65  ? 70  LYS A CB   1  
ATOM 1050  C CG   . LYS A 1 70  ? -15.335 7.873   1.827   1.00 5.30  ? 70  LYS A CG   1  
ATOM 1051  C CD   . LYS A 1 70  ? -14.304 8.335   2.831   1.00 5.73  ? 70  LYS A CD   1  
ATOM 1052  C CE   . LYS A 1 70  ? -12.921 8.354   2.232   1.00 6.36  ? 70  LYS A CE   1  
ATOM 1053  N NZ   . LYS A 1 70  ? -11.925 8.971   3.149   1.00 6.99  ? 70  LYS A NZ   1  
ATOM 1054  H H    . LYS A 1 70  ? -16.996 8.760   -0.318  1.00 3.05  ? 70  LYS A H    1  
ATOM 1055  H HA   . LYS A 1 70  ? -17.922 6.805   1.522   1.00 4.88  ? 70  LYS A HA   1  
ATOM 1056  H HB2  . LYS A 1 70  ? -16.647 9.494   2.051   1.00 4.40  ? 70  LYS A HB2  1  
ATOM 1057  H HB3  . LYS A 1 70  ? -16.856 8.228   3.249   1.00 5.12  ? 70  LYS A HB3  1  
ATOM 1058  H HG2  . LYS A 1 70  ? -15.373 6.796   1.825   1.00 5.74  ? 70  LYS A HG2  1  
ATOM 1059  H HG3  . LYS A 1 70  ? -15.061 8.235   0.846   1.00 5.41  ? 70  LYS A HG3  1  
ATOM 1060  H HD2  . LYS A 1 70  ? -14.558 9.329   3.161   1.00 5.78  ? 70  LYS A HD2  1  
ATOM 1061  H HD3  . LYS A 1 70  ? -14.313 7.660   3.674   1.00 5.93  ? 70  LYS A HD3  1  
ATOM 1062  H HE2  . LYS A 1 70  ? -12.620 7.341   2.011   1.00 6.60  ? 70  LYS A HE2  1  
ATOM 1063  H HE3  . LYS A 1 70  ? -12.967 8.924   1.320   1.00 6.43  ? 70  LYS A HE3  1  
ATOM 1064  H HZ1  . LYS A 1 70  ? -12.177 9.964   3.334   1.00 6.98  ? 70  LYS A HZ1  1  
ATOM 1065  H HZ2  . LYS A 1 70  ? -10.977 8.939   2.723   1.00 7.36  ? 70  LYS A HZ2  1  
ATOM 1066  H HZ3  . LYS A 1 70  ? -11.905 8.457   4.052   1.00 7.35  ? 70  LYS A HZ3  1  
ATOM 1067  N N    . LYS A 1 71  ? -19.818 9.223   1.068   1.00 3.86  ? 71  LYS A N    1  
ATOM 1068  C CA   . LYS A 1 71  ? -21.099 9.855   1.320   1.00 4.42  ? 71  LYS A CA   1  
ATOM 1069  C C    . LYS A 1 71  ? -22.100 8.889   1.944   1.00 4.63  ? 71  LYS A C    1  
ATOM 1070  O O    . LYS A 1 71  ? -21.936 7.669   1.882   1.00 4.42  ? 71  LYS A O    1  
ATOM 1071  C CB   . LYS A 1 71  ? -21.638 10.400  0.010   1.00 4.55  ? 71  LYS A CB   1  
ATOM 1072  C CG   . LYS A 1 71  ? -22.827 11.301  0.159   1.00 5.51  ? 71  LYS A CG   1  
ATOM 1073  C CD   . LYS A 1 71  ? -22.863 12.285  -0.969  1.00 6.15  ? 71  LYS A CD   1  
ATOM 1074  C CE   . LYS A 1 71  ? -24.152 13.077  -0.994  1.00 7.31  ? 71  LYS A CE   1  
ATOM 1075  N NZ   . LYS A 1 71  ? -24.090 14.196  -1.969  1.00 8.20  ? 71  LYS A NZ   1  
ATOM 1076  H H    . LYS A 1 71  ? -19.417 9.336   0.183   1.00 3.38  ? 71  LYS A H    1  
ATOM 1077  H HA   . LYS A 1 71  ? -20.946 10.686  1.986   1.00 5.06  ? 71  LYS A HA   1  
ATOM 1078  H HB2  . LYS A 1 71  ? -20.867 10.968  -0.461  1.00 4.44  ? 71  LYS A HB2  1  
ATOM 1079  H HB3  . LYS A 1 71  ? -21.914 9.575   -0.628  1.00 4.51  ? 71  LYS A HB3  1  
ATOM 1080  H HG2  . LYS A 1 71  ? -23.726 10.714  0.165   1.00 5.66  ? 71  LYS A HG2  1  
ATOM 1081  H HG3  . LYS A 1 71  ? -22.731 11.843  1.078   1.00 5.91  ? 71  LYS A HG3  1  
ATOM 1082  H HD2  . LYS A 1 71  ? -22.039 12.959  -0.827  1.00 6.23  ? 71  LYS A HD2  1  
ATOM 1083  H HD3  . LYS A 1 71  ? -22.753 11.757  -1.902  1.00 5.97  ? 71  LYS A HD3  1  
ATOM 1084  H HE2  . LYS A 1 71  ? -24.951 12.412  -1.276  1.00 7.38  ? 71  LYS A HE2  1  
ATOM 1085  H HE3  . LYS A 1 71  ? -24.340 13.473  -0.008  1.00 7.65  ? 71  LYS A HE3  1  
ATOM 1086  H HZ1  . LYS A 1 71  ? -23.322 14.849  -1.716  1.00 8.38  ? 71  LYS A HZ1  1  
ATOM 1087  H HZ2  . LYS A 1 71  ? -24.988 14.719  -1.971  1.00 8.58  ? 71  LYS A HZ2  1  
ATOM 1088  H HZ3  . LYS A 1 71  ? -23.918 13.828  -2.926  1.00 8.49  ? 71  LYS A HZ3  1  
ATOM 1089  N N    . ARG A 1 72  ? -23.126 9.461   2.546   1.00 5.41  ? 72  ARG A N    1  
ATOM 1090  C CA   . ARG A 1 72  ? -24.145 8.706   3.268   1.00 5.92  ? 72  ARG A CA   1  
ATOM 1091  C C    . ARG A 1 72  ? -24.805 7.638   2.394   1.00 5.77  ? 72  ARG A C    1  
ATOM 1092  O O    . ARG A 1 72  ? -24.634 7.615   1.172   1.00 5.54  ? 72  ARG A O    1  
ATOM 1093  C CB   . ARG A 1 72  ? -25.197 9.659   3.823   1.00 6.97  ? 72  ARG A CB   1  
ATOM 1094  C CG   . ARG A 1 72  ? -24.699 10.499  4.986   1.00 7.56  ? 72  ARG A CG   1  
ATOM 1095  C CD   . ARG A 1 72  ? -25.599 11.691  5.226   1.00 8.44  ? 72  ARG A CD   1  
ATOM 1096  N NE   . ARG A 1 72  ? -27.000 11.306  5.379   1.00 9.04  ? 72  ARG A NE   1  
ATOM 1097  C CZ   . ARG A 1 72  ? -28.016 11.949  4.803   1.00 10.00 ? 72  ARG A CZ   1  
ATOM 1098  N NH1  . ARG A 1 72  ? -27.793 13.019  4.049   1.00 10.44 ? 72  ARG A NH1  1  
ATOM 1099  N NH2  . ARG A 1 72  ? -29.257 11.522  4.988   1.00 10.67 ? 72  ARG A NH2  1  
ATOM 1100  H H    . ARG A 1 72  ? -23.207 10.437  2.491   1.00 5.81  ? 72  ARG A H    1  
ATOM 1101  H HA   . ARG A 1 72  ? -23.658 8.219   4.096   1.00 5.94  ? 72  ARG A HA   1  
ATOM 1102  H HB2  . ARG A 1 72  ? -25.510 10.324  3.036   1.00 7.23  ? 72  ARG A HB2  1  
ATOM 1103  H HB3  . ARG A 1 72  ? -26.048 9.085   4.158   1.00 7.35  ? 72  ARG A HB3  1  
ATOM 1104  H HG2  . ARG A 1 72  ? -24.683 9.895   5.875   1.00 7.62  ? 72  ARG A HG2  1  
ATOM 1105  H HG3  . ARG A 1 72  ? -23.702 10.849  4.765   1.00 7.57  ? 72  ARG A HG3  1  
ATOM 1106  H HD2  . ARG A 1 72  ? -25.274 12.198  6.121   1.00 8.79  ? 72  ARG A HD2  1  
ATOM 1107  H HD3  . ARG A 1 72  ? -25.508 12.352  4.386   1.00 8.51  ? 72  ARG A HD3  1  
ATOM 1108  H HE   . ARG A 1 72  ? -27.195 10.521  5.943   1.00 8.87  ? 72  ARG A HE   1  
ATOM 1109  H HH11 . ARG A 1 72  ? -26.859 13.353  3.912   1.00 10.10 ? 72  ARG A HH11 1  
ATOM 1110  H HH12 . ARG A 1 72  ? -28.559 13.492  3.606   1.00 11.22 ? 72  ARG A HH12 1  
ATOM 1111  H HH21 . ARG A 1 72  ? -29.432 10.715  5.559   1.00 10.52 ? 72  ARG A HH21 1  
ATOM 1112  H HH22 . ARG A 1 72  ? -30.027 12.005  4.564   1.00 11.45 ? 72  ARG A HH22 1  
ATOM 1113  N N    . LYS A 1 73  ? -25.585 6.776   3.030   1.00 6.20  ? 73  LYS A N    1  
ATOM 1114  C CA   . LYS A 1 73  ? -26.131 5.594   2.377   1.00 6.28  ? 73  LYS A CA   1  
ATOM 1115  C C    . LYS A 1 73  ? -27.125 5.960   1.282   1.00 6.69  ? 73  LYS A C    1  
ATOM 1116  O O    . LYS A 1 73  ? -27.582 7.101   1.180   1.00 7.13  ? 73  LYS A O    1  
ATOM 1117  C CB   . LYS A 1 73  ? -26.818 4.708   3.407   1.00 6.89  ? 73  LYS A CB   1  
ATOM 1118  C CG   . LYS A 1 73  ? -25.877 4.165   4.469   1.00 6.88  ? 73  LYS A CG   1  
ATOM 1119  C CD   . LYS A 1 73  ? -26.580 3.190   5.397   1.00 7.64  ? 73  LYS A CD   1  
ATOM 1120  C CE   . LYS A 1 73  ? -27.465 3.886   6.435   1.00 8.45  ? 73  LYS A CE   1  
ATOM 1121  N NZ   . LYS A 1 73  ? -28.672 4.526   5.841   1.00 8.97  ? 73  LYS A NZ   1  
ATOM 1122  H H    . LYS A 1 73  ? -25.808 6.944   3.970   1.00 6.62  ? 73  LYS A H    1  
ATOM 1123  H HA   . LYS A 1 73  ? -25.312 5.041   1.940   1.00 5.84  ? 73  LYS A HA   1  
ATOM 1124  H HB2  . LYS A 1 73  ? -27.589 5.280   3.898   1.00 7.51  ? 73  LYS A HB2  1  
ATOM 1125  H HB3  . LYS A 1 73  ? -27.272 3.871   2.898   1.00 7.00  ? 73  LYS A HB3  1  
ATOM 1126  H HG2  . LYS A 1 73  ? -25.060 3.654   3.982   1.00 6.63  ? 73  LYS A HG2  1  
ATOM 1127  H HG3  . LYS A 1 73  ? -25.490 4.988   5.049   1.00 6.84  ? 73  LYS A HG3  1  
ATOM 1128  H HD2  . LYS A 1 73  ? -27.196 2.542   4.795   1.00 7.77  ? 73  LYS A HD2  1  
ATOM 1129  H HD3  . LYS A 1 73  ? -25.834 2.601   5.910   1.00 7.70  ? 73  LYS A HD3  1  
ATOM 1130  H HE2  . LYS A 1 73  ? -27.785 3.152   7.160   1.00 8.78  ? 73  LYS A HE2  1  
ATOM 1131  H HE3  . LYS A 1 73  ? -26.879 4.643   6.934   1.00 8.56  ? 73  LYS A HE3  1  
ATOM 1132  H HZ1  . LYS A 1 73  ? -29.340 4.796   6.591   1.00 9.28  ? 73  LYS A HZ1  1  
ATOM 1133  H HZ2  . LYS A 1 73  ? -29.149 3.868   5.193   1.00 9.21  ? 73  LYS A HZ2  1  
ATOM 1134  H HZ3  . LYS A 1 73  ? -28.405 5.382   5.315   1.00 9.02  ? 73  LYS A HZ3  1  
ATOM 1135  N N    . ASP A 1 74  ? -27.457 4.968   0.473   1.00 6.78  ? 74  ASP A N    1  
ATOM 1136  C CA   . ASP A 1 74  ? -28.312 5.165   -0.688  1.00 7.38  ? 74  ASP A CA   1  
ATOM 1137  C C    . ASP A 1 74  ? -29.789 5.112   -0.295  1.00 8.21  ? 74  ASP A C    1  
ATOM 1138  O O    . ASP A 1 74  ? -30.114 4.751   0.837   1.00 8.34  ? 74  ASP A O    1  
ATOM 1139  C CB   . ASP A 1 74  ? -27.996 4.097   -1.732  1.00 7.38  ? 74  ASP A CB   1  
ATOM 1140  C CG   . ASP A 1 74  ? -28.817 4.247   -2.992  1.00 8.19  ? 74  ASP A CG   1  
ATOM 1141  O OD1  . ASP A 1 74  ? -28.614 5.230   -3.731  1.00 8.40  ? 74  ASP A OD1  1  
ATOM 1142  O OD2  . ASP A 1 74  ? -29.687 3.389   -3.233  1.00 8.74  ? 74  ASP A OD2  1  
ATOM 1143  H H    . ASP A 1 74  ? -27.124 4.067   0.670   1.00 6.59  ? 74  ASP A H    1  
ATOM 1144  H HA   . ASP A 1 74  ? -28.094 6.131   -1.103  1.00 7.42  ? 74  ASP A HA   1  
ATOM 1145  H HB2  . ASP A 1 74  ? -26.946 4.142   -1.991  1.00 6.84  ? 74  ASP A HB2  1  
ATOM 1146  H HB3  . ASP A 1 74  ? -28.212 3.136   -1.305  1.00 7.53  ? 74  ASP A HB3  1  
ATOM 1147  N N    . ASN A 1 75  ? -30.680 5.459   -1.223  1.00 8.89  ? 75  ASN A N    1  
ATOM 1148  C CA   . ASN A 1 75  ? -32.118 5.445   -0.956  1.00 9.75  ? 75  ASN A CA   1  
ATOM 1149  C C    . ASN A 1 75  ? -32.610 4.030   -0.665  1.00 9.91  ? 75  ASN A C    1  
ATOM 1150  O O    . ASN A 1 75  ? -33.569 3.843   0.079   1.00 10.47 ? 75  ASN A O    1  
ATOM 1151  C CB   . ASN A 1 75  ? -32.906 6.031   -2.133  1.00 10.48 ? 75  ASN A CB   1  
ATOM 1152  C CG   . ASN A 1 75  ? -32.615 7.501   -2.363  1.00 10.99 ? 75  ASN A CG   1  
ATOM 1153  O OD1  . ASN A 1 75  ? -33.207 8.373   -1.724  1.00 11.25 ? 75  ASN A OD1  1  
ATOM 1154  N ND2  . ASN A 1 75  ? -31.727 7.788   -3.300  1.00 11.37 ? 75  ASN A ND2  1  
ATOM 1155  H H    . ASN A 1 75  ? -30.362 5.724   -2.112  1.00 8.89  ? 75  ASN A H    1  
ATOM 1156  H HA   . ASN A 1 75  ? -32.292 6.055   -0.082  1.00 9.91  ? 75  ASN A HA   1  
ATOM 1157  H HB2  . ASN A 1 75  ? -32.653 5.491   -3.032  1.00 10.54 ? 75  ASN A HB2  1  
ATOM 1158  H HB3  . ASN A 1 75  ? -33.963 5.919   -1.939  1.00 10.77 ? 75  ASN A HB3  1  
ATOM 1159  H HD21 . ASN A 1 75  ? -31.312 7.046   -3.792  1.00 11.28 ? 75  ASN A HD21 1  
ATOM 1160  H HD22 . ASN A 1 75  ? -31.522 8.732   -3.473  1.00 11.84 ? 75  ASN A HD22 1  
ATOM 1161  N N    . GLU A 1 76  ? -31.933 3.032   -1.226  1.00 9.56  ? 76  GLU A N    1  
ATOM 1162  C CA   . GLU A 1 76  ? -32.308 1.645   -1.007  1.00 9.89  ? 76  GLU A CA   1  
ATOM 1163  C C    . GLU A 1 76  ? -31.498 1.094   0.150   1.00 9.42  ? 76  GLU A C    1  
ATOM 1164  O O    . GLU A 1 76  ? -31.388 -0.115  0.346   1.00 9.74  ? 76  GLU A O    1  
ATOM 1165  C CB   . GLU A 1 76  ? -32.065 0.819   -2.270  1.00 10.10 ? 76  GLU A CB   1  
ATOM 1166  C CG   . GLU A 1 76  ? -32.874 1.291   -3.465  1.00 10.22 ? 76  GLU A CG   1  
ATOM 1167  C CD   . GLU A 1 76  ? -32.615 0.461   -4.701  1.00 10.82 ? 76  GLU A CD   1  
ATOM 1168  O OE1  . GLU A 1 76  ? -31.698 0.811   -5.476  1.00 11.06 ? 76  GLU A OE1  1  
ATOM 1169  O OE2  . GLU A 1 76  ? -33.328 -0.541  -4.908  1.00 11.20 ? 76  GLU A OE2  1  
ATOM 1170  H H    . GLU A 1 76  ? -31.144 3.226   -1.781  1.00 9.17  ? 76  GLU A H    1  
ATOM 1171  H HA   . GLU A 1 76  ? -33.356 1.615   -0.752  1.00 10.50 ? 76  GLU A HA   1  
ATOM 1172  H HB2  . GLU A 1 76  ? -31.017 0.875   -2.527  1.00 9.97  ? 76  GLU A HB2  1  
ATOM 1173  H HB3  . GLU A 1 76  ? -32.323 -0.210  -2.071  1.00 10.53 ? 76  GLU A HB3  1  
ATOM 1174  H HG2  . GLU A 1 76  ? -33.924 1.229   -3.222  1.00 10.34 ? 76  GLU A HG2  1  
ATOM 1175  H HG3  . GLU A 1 76  ? -32.615 2.319   -3.677  1.00 9.99  ? 76  GLU A HG3  1  
ATOM 1176  N N    . GLY A 1 77  ? -30.909 2.014   0.892   1.00 8.81  ? 77  GLY A N    1  
ATOM 1177  C CA   . GLY A 1 77  ? -30.049 1.672   1.987   1.00 8.45  ? 77  GLY A CA   1  
ATOM 1178  C C    . GLY A 1 77  ? -28.644 1.479   1.498   1.00 7.87  ? 77  GLY A C    1  
ATOM 1179  O O    . GLY A 1 77  ? -27.761 2.278   1.796   1.00 7.68  ? 77  GLY A O    1  
ATOM 1180  H H    . GLY A 1 77  ? -31.048 2.950   0.671   1.00 8.72  ? 77  GLY A H    1  
ATOM 1181  H HA2  . GLY A 1 77  ? -30.070 2.466   2.717   1.00 8.21  ? 77  GLY A HA2  1  
ATOM 1182  H HA3  . GLY A 1 77  ? -30.395 0.757   2.442   1.00 8.99  ? 77  GLY A HA3  1  
ATOM 1183  N N    . ASN A 1 78  ? -28.514 0.501   0.615   1.00 7.80  ? 78  ASN A N    1  
ATOM 1184  C CA   . ASN A 1 78  ? -27.235 -0.044  0.137   1.00 7.46  ? 78  ASN A CA   1  
ATOM 1185  C C    . ASN A 1 78  ? -26.198 -0.314  1.235   1.00 6.97  ? 78  ASN A C    1  
ATOM 1186  O O    . ASN A 1 78  ? -25.733 -1.444  1.364   1.00 7.29  ? 78  ASN A O    1  
ATOM 1187  C CB   . ASN A 1 78  ? -26.633 0.845   -0.942  1.00 7.23  ? 78  ASN A CB   1  
ATOM 1188  C CG   . ASN A 1 78  ? -27.065 0.426   -2.335  1.00 8.06  ? 78  ASN A CG   1  
ATOM 1189  O OD1  . ASN A 1 78  ? -26.404 -0.392  -2.975  1.00 8.60  ? 78  ASN A OD1  1  
ATOM 1190  N ND2  . ASN A 1 78  ? -28.169 0.972   -2.817  1.00 8.39  ? 78  ASN A ND2  1  
ATOM 1191  H H    . ASN A 1 78  ? -29.336 0.165   0.211   1.00 8.12  ? 78  ASN A H    1  
ATOM 1192  H HA   . ASN A 1 78  ? -27.467 -0.994  -0.321  1.00 7.96  ? 78  ASN A HA   1  
ATOM 1193  H HB2  . ASN A 1 78  ? -26.928 1.868   -0.775  1.00 7.05  ? 78  ASN A HB2  1  
ATOM 1194  H HB3  . ASN A 1 78  ? -25.565 0.774   -0.885  1.00 6.85  ? 78  ASN A HB3  1  
ATOM 1195  H HD21 . ASN A 1 78  ? -28.653 1.618   -2.260  1.00 8.13  ? 78  ASN A HD21 1  
ATOM 1196  H HD22 . ASN A 1 78  ? -28.459 0.714   -3.719  1.00 9.00  ? 78  ASN A HD22 1  
ATOM 1197  N N    . GLU A 1 79  ? -25.848 0.709   2.014   1.00 6.44  ? 79  GLU A N    1  
ATOM 1198  C CA   . GLU A 1 79  ? -24.749 0.643   2.964   1.00 6.06  ? 79  GLU A CA   1  
ATOM 1199  C C    . GLU A 1 79  ? -23.462 0.344   2.208   1.00 5.51  ? 79  GLU A C    1  
ATOM 1200  O O    . GLU A 1 79  ? -23.026 -0.805  2.116   1.00 5.77  ? 79  GLU A O    1  
ATOM 1201  C CB   . GLU A 1 79  ? -25.025 -0.409  4.045   1.00 6.75  ? 79  GLU A CB   1  
ATOM 1202  C CG   . GLU A 1 79  ? -24.274 -0.165  5.341   1.00 7.16  ? 79  GLU A CG   1  
ATOM 1203  C CD   . GLU A 1 79  ? -22.798 -0.504  5.254   1.00 7.94  ? 79  GLU A CD   1  
ATOM 1204  O OE1  . GLU A 1 79  ? -22.466 -1.698  5.109   1.00 8.32  ? 79  GLU A OE1  1  
ATOM 1205  O OE2  . GLU A 1 79  ? -21.960 0.419   5.340   1.00 8.38  ? 79  GLU A OE2  1  
ATOM 1206  H H    . GLU A 1 79  ? -26.373 1.534   1.967   1.00 6.47  ? 79  GLU A H    1  
ATOM 1207  H HA   . GLU A 1 79  ? -24.660 1.615   3.429   1.00 5.88  ? 79  GLU A HA   1  
ATOM 1208  H HB2  . GLU A 1 79  ? -26.083 -0.415  4.263   1.00 7.10  ? 79  GLU A HB2  1  
ATOM 1209  H HB3  . GLU A 1 79  ? -24.740 -1.379  3.667   1.00 6.91  ? 79  GLU A HB3  1  
ATOM 1210  H HG2  . GLU A 1 79  ? -24.371 0.881   5.589   1.00 6.94  ? 79  GLU A HG2  1  
ATOM 1211  H HG3  . GLU A 1 79  ? -24.723 -0.761  6.122   1.00 7.42  ? 79  GLU A HG3  1  
ATOM 1212  N N    . VAL A 1 80  ? -22.872 1.385   1.641   1.00 4.98  ? 80  VAL A N    1  
ATOM 1213  C CA   . VAL A 1 80  ? -21.728 1.209   0.768   1.00 4.58  ? 80  VAL A CA   1  
ATOM 1214  C C    . VAL A 1 80  ? -20.459 1.756   1.401   1.00 3.98  ? 80  VAL A C    1  
ATOM 1215  O O    . VAL A 1 80  ? -20.482 2.746   2.143   1.00 3.86  ? 80  VAL A O    1  
ATOM 1216  C CB   . VAL A 1 80  ? -21.938 1.879   -0.620  1.00 4.62  ? 80  VAL A CB   1  
ATOM 1217  C CG1  . VAL A 1 80  ? -23.354 1.660   -1.119  1.00 5.39  ? 80  VAL A CG1  1  
ATOM 1218  C CG2  . VAL A 1 80  ? -21.611 3.366   -0.594  1.00 4.28  ? 80  VAL A CG2  1  
ATOM 1219  H H    . VAL A 1 80  ? -23.199 2.288   1.829   1.00 5.01  ? 80  VAL A H    1  
ATOM 1220  H HA   . VAL A 1 80  ? -21.601 0.149   0.610   1.00 5.01  ? 80  VAL A HA   1  
ATOM 1221  H HB   . VAL A 1 80  ? -21.265 1.403   -1.321  1.00 4.65  ? 80  VAL A HB   1  
ATOM 1222  H HG11 . VAL A 1 80  ? -24.053 2.141   -0.445  1.00 5.49  ? 80  VAL A HG11 1  
ATOM 1223  H HG12 . VAL A 1 80  ? -23.558 0.602   -1.158  1.00 5.78  ? 80  VAL A HG12 1  
ATOM 1224  H HG13 . VAL A 1 80  ? -23.459 2.086   -2.106  1.00 5.71  ? 80  VAL A HG13 1  
ATOM 1225  H HG21 . VAL A 1 80  ? -20.553 3.500   -0.404  1.00 4.44  ? 80  VAL A HG21 1  
ATOM 1226  H HG22 . VAL A 1 80  ? -22.185 3.845   0.187   1.00 4.33  ? 80  VAL A HG22 1  
ATOM 1227  H HG23 . VAL A 1 80  ? -21.865 3.806   -1.547  1.00 4.29  ? 80  VAL A HG23 1  
ATOM 1228  N N    . VAL A 1 81  ? -19.367 1.076   1.132   1.00 3.91  ? 81  VAL A N    1  
ATOM 1229  C CA   . VAL A 1 81  ? -18.050 1.581   1.435   1.00 3.49  ? 81  VAL A CA   1  
ATOM 1230  C C    . VAL A 1 81  ? -17.271 1.667   0.135   1.00 2.81  ? 81  VAL A C    1  
ATOM 1231  O O    . VAL A 1 81  ? -17.168 0.677   -0.594  1.00 2.88  ? 81  VAL A O    1  
ATOM 1232  C CB   . VAL A 1 81  ? -17.299 0.686   2.439   1.00 4.02  ? 81  VAL A CB   1  
ATOM 1233  C CG1  . VAL A 1 81  ? -15.899 1.222   2.667   1.00 4.27  ? 81  VAL A CG1  1  
ATOM 1234  C CG2  . VAL A 1 81  ? -18.059 0.595   3.754   1.00 4.20  ? 81  VAL A CG2  1  
ATOM 1235  H H    . VAL A 1 81  ? -19.447 0.195   0.714   1.00 4.34  ? 81  VAL A H    1  
ATOM 1236  H HA   . VAL A 1 81  ? -18.155 2.571   1.856   1.00 3.57  ? 81  VAL A HA   1  
ATOM 1237  H HB   . VAL A 1 81  ? -17.220 -0.306  2.021   1.00 4.55  ? 81  VAL A HB   1  
ATOM 1238  H HG11 . VAL A 1 81  ? -15.961 2.254   2.982   1.00 4.42  ? 81  VAL A HG11 1  
ATOM 1239  H HG12 . VAL A 1 81  ? -15.341 1.160   1.745   1.00 4.47  ? 81  VAL A HG12 1  
ATOM 1240  H HG13 . VAL A 1 81  ? -15.406 0.639   3.431   1.00 4.58  ? 81  VAL A HG13 1  
ATOM 1241  H HG21 . VAL A 1 81  ? -19.042 0.188   3.575   1.00 4.50  ? 81  VAL A HG21 1  
ATOM 1242  H HG22 . VAL A 1 81  ? -18.149 1.581   4.187   1.00 4.41  ? 81  VAL A HG22 1  
ATOM 1243  H HG23 . VAL A 1 81  ? -17.522 -0.049  4.437   1.00 4.31  ? 81  VAL A HG23 1  
ATOM 1244  N N    . PRO A 1 82  ? -16.737 2.847   -0.195  1.00 2.49  ? 82  PRO A N    1  
ATOM 1245  C CA   . PRO A 1 82  ? -16.086 3.065   -1.477  1.00 2.15  ? 82  PRO A CA   1  
ATOM 1246  C C    . PRO A 1 82  ? -14.806 2.257   -1.614  1.00 1.66  ? 82  PRO A C    1  
ATOM 1247  O O    . PRO A 1 82  ? -13.918 2.332   -0.765  1.00 1.69  ? 82  PRO A O    1  
ATOM 1248  C CB   . PRO A 1 82  ? -15.798 4.555   -1.499  1.00 2.57  ? 82  PRO A CB   1  
ATOM 1249  C CG   . PRO A 1 82  ? -15.786 4.972   -0.091  1.00 2.91  ? 82  PRO A CG   1  
ATOM 1250  C CD   . PRO A 1 82  ? -16.704 4.044   0.655   1.00 2.92  ? 82  PRO A CD   1  
ATOM 1251  H HA   . PRO A 1 82  ? -16.746 2.826   -2.284  1.00 2.39  ? 82  PRO A HA   1  
ATOM 1252  H HB2  . PRO A 1 82  ? -14.851 4.734   -1.967  1.00 2.53  ? 82  PRO A HB2  1  
ATOM 1253  H HB3  . PRO A 1 82  ? -16.569 5.061   -2.041  1.00 2.99  ? 82  PRO A HB3  1  
ATOM 1254  H HG2  . PRO A 1 82  ? -14.789 4.895   0.290   1.00 2.90  ? 82  PRO A HG2  1  
ATOM 1255  H HG3  . PRO A 1 82  ? -16.137 5.981   -0.029  1.00 3.42  ? 82  PRO A HG3  1  
ATOM 1256  H HD2  . PRO A 1 82  ? -16.295 3.813   1.627   1.00 3.15  ? 82  PRO A HD2  1  
ATOM 1257  H HD3  . PRO A 1 82  ? -17.686 4.474   0.754   1.00 3.30  ? 82  PRO A HD3  1  
ATOM 1258  N N    . LYS A 1 83  ? -14.727 1.480   -2.680  1.00 1.57  ? 83  LYS A N    1  
ATOM 1259  C CA   . LYS A 1 83  ? -13.586 0.609   -2.906  1.00 1.32  ? 83  LYS A CA   1  
ATOM 1260  C C    . LYS A 1 83  ? -12.345 1.405   -3.273  1.00 1.05  ? 83  LYS A C    1  
ATOM 1261  O O    . LYS A 1 83  ? -12.312 2.105   -4.285  1.00 1.19  ? 83  LYS A O    1  
ATOM 1262  C CB   . LYS A 1 83  ? -13.886 -0.401  -3.997  1.00 1.66  ? 83  LYS A CB   1  
ATOM 1263  C CG   . LYS A 1 83  ? -15.083 -1.282  -3.702  1.00 2.23  ? 83  LYS A CG   1  
ATOM 1264  C CD   . LYS A 1 83  ? -14.890 -2.104  -2.433  1.00 2.76  ? 83  LYS A CD   1  
ATOM 1265  C CE   . LYS A 1 83  ? -13.657 -2.990  -2.517  1.00 3.60  ? 83  LYS A CE   1  
ATOM 1266  N NZ   . LYS A 1 83  ? -13.507 -3.849  -1.314  1.00 4.42  ? 83  LYS A NZ   1  
ATOM 1267  H H    . LYS A 1 83  ? -15.460 1.493   -3.331  1.00 1.91  ? 83  LYS A H    1  
ATOM 1268  H HA   . LYS A 1 83  ? -13.393 0.075   -1.990  1.00 1.32  ? 83  LYS A HA   1  
ATOM 1269  H HB2  . LYS A 1 83  ? -14.063 0.124   -4.915  1.00 1.85  ? 83  LYS A HB2  1  
ATOM 1270  H HB3  . LYS A 1 83  ? -13.031 -1.034  -4.118  1.00 1.86  ? 83  LYS A HB3  1  
ATOM 1271  H HG2  . LYS A 1 83  ? -15.948 -0.656  -3.582  1.00 2.38  ? 83  LYS A HG2  1  
ATOM 1272  H HG3  . LYS A 1 83  ? -15.234 -1.950  -4.531  1.00 2.76  ? 83  LYS A HG3  1  
ATOM 1273  H HD2  . LYS A 1 83  ? -14.783 -1.433  -1.594  1.00 2.93  ? 83  LYS A HD2  1  
ATOM 1274  H HD3  . LYS A 1 83  ? -15.761 -2.728  -2.287  1.00 3.05  ? 83  LYS A HD3  1  
ATOM 1275  H HE2  . LYS A 1 83  ? -13.740 -3.621  -3.389  1.00 3.67  ? 83  LYS A HE2  1  
ATOM 1276  H HE3  . LYS A 1 83  ? -12.784 -2.362  -2.610  1.00 4.07  ? 83  LYS A HE3  1  
ATOM 1277  H HZ1  . LYS A 1 83  ? -13.512 -3.267  -0.454  1.00 4.83  ? 83  LYS A HZ1  1  
ATOM 1278  H HZ2  . LYS A 1 83  ? -12.607 -4.371  -1.357  1.00 4.81  ? 83  LYS A HZ2  1  
ATOM 1279  H HZ3  . LYS A 1 83  ? -14.287 -4.534  -1.262  1.00 4.64  ? 83  LYS A HZ3  1  
ATOM 1280  N N    . PRO A 1 84  ? -11.324 1.302   -2.423  1.00 0.80  ? 84  PRO A N    1  
ATOM 1281  C CA   . PRO A 1 84  ? -10.028 1.965   -2.597  1.00 0.60  ? 84  PRO A CA   1  
ATOM 1282  C C    . PRO A 1 84  ? -9.194  1.376   -3.729  1.00 0.62  ? 84  PRO A C    1  
ATOM 1283  O O    . PRO A 1 84  ? -9.215  0.165   -3.963  1.00 0.78  ? 84  PRO A O    1  
ATOM 1284  C CB   . PRO A 1 84  ? -9.321  1.710   -1.263  1.00 0.60  ? 84  PRO A CB   1  
ATOM 1285  C CG   . PRO A 1 84  ? -10.396 1.291   -0.340  1.00 0.84  ? 84  PRO A CG   1  
ATOM 1286  C CD   . PRO A 1 84  ? -11.364 0.548   -1.178  1.00 0.94  ? 84  PRO A CD   1  
ATOM 1287  H HA   . PRO A 1 84  ? -10.142 3.024   -2.734  1.00 0.63  ? 84  PRO A HA   1  
ATOM 1288  H HB2  . PRO A 1 84  ? -8.596  0.925   -1.387  1.00 0.66  ? 84  PRO A HB2  1  
ATOM 1289  H HB3  . PRO A 1 84  ? -8.835  2.612   -0.925  1.00 0.60  ? 84  PRO A HB3  1  
ATOM 1290  H HG2  . PRO A 1 84  ? -10.000 0.658   0.414   1.00 1.06  ? 84  PRO A HG2  1  
ATOM 1291  H HG3  . PRO A 1 84  ? -10.870 2.152   0.096   1.00 0.88  ? 84  PRO A HG3  1  
ATOM 1292  H HD2  . PRO A 1 84  ? -11.052 -0.471  -1.333  1.00 1.13  ? 84  PRO A HD2  1  
ATOM 1293  H HD3  . PRO A 1 84  ? -12.334 0.587   -0.730  1.00 1.08  ? 84  PRO A HD3  1  
ATOM 1294  N N    . GLN A 1 85  ? -8.457  2.233   -4.424  1.00 0.61  ? 85  GLN A N    1  
ATOM 1295  C CA   . GLN A 1 85  ? -7.464  1.768   -5.376  1.00 0.63  ? 85  GLN A CA   1  
ATOM 1296  C C    . GLN A 1 85  ? -6.129  1.609   -4.662  1.00 0.51  ? 85  GLN A C    1  
ATOM 1297  O O    . GLN A 1 85  ? -5.542  2.584   -4.197  1.00 0.51  ? 85  GLN A O    1  
ATOM 1298  C CB   . GLN A 1 85  ? -7.334  2.730   -6.547  1.00 0.77  ? 85  GLN A CB   1  
ATOM 1299  C CG   . GLN A 1 85  ? -7.285  4.154   -6.097  1.00 1.26  ? 85  GLN A CG   1  
ATOM 1300  C CD   . GLN A 1 85  ? -7.018  5.139   -7.219  1.00 1.44  ? 85  GLN A CD   1  
ATOM 1301  O OE1  . GLN A 1 85  ? -6.440  6.203   -6.998  1.00 1.73  ? 85  GLN A OE1  1  
ATOM 1302  N NE2  . GLN A 1 85  ? -7.429  4.794   -8.429  1.00 2.01  ? 85  GLN A NE2  1  
ATOM 1303  H H    . GLN A 1 85  ? -8.578  3.194   -4.284  1.00 0.66  ? 85  GLN A H    1  
ATOM 1304  H HA   . GLN A 1 85  ? -7.783  0.829   -5.740  1.00 0.70  ? 85  GLN A HA   1  
ATOM 1305  H HB2  . GLN A 1 85  ? -6.430  2.508   -7.091  1.00 0.90  ? 85  GLN A HB2  1  
ATOM 1306  H HB3  . GLN A 1 85  ? -8.182  2.611   -7.198  1.00 1.01  ? 85  GLN A HB3  1  
ATOM 1307  H HG2  . GLN A 1 85  ? -8.230  4.380   -5.641  1.00 1.59  ? 85  GLN A HG2  1  
ATOM 1308  H HG3  . GLN A 1 85  ? -6.509  4.236   -5.362  1.00 1.51  ? 85  GLN A HG3  1  
ATOM 1309  H HE21 . GLN A 1 85  ? -7.881  3.929   -8.538  1.00 2.53  ? 85  GLN A HE21 1  
ATOM 1310  H HE22 . GLN A 1 85  ? -7.266  5.416   -9.169  1.00 2.15  ? 85  GLN A HE22 1  
ATOM 1311  N N    . ARG A 1 86  ? -5.646  0.387   -4.571  1.00 0.50  ? 86  ARG A N    1  
ATOM 1312  C CA   . ARG A 1 86  ? -4.478  0.110   -3.768  1.00 0.48  ? 86  ARG A CA   1  
ATOM 1313  C C    . ARG A 1 86  ? -3.384  -0.584  -4.564  1.00 0.43  ? 86  ARG A C    1  
ATOM 1314  O O    . ARG A 1 86  ? -3.628  -1.159  -5.622  1.00 0.51  ? 86  ARG A O    1  
ATOM 1315  C CB   . ARG A 1 86  ? -4.873  -0.715  -2.569  1.00 0.62  ? 86  ARG A CB   1  
ATOM 1316  C CG   . ARG A 1 86  ? -5.530  -1.994  -2.923  1.00 0.85  ? 86  ARG A CG   1  
ATOM 1317  C CD   . ARG A 1 86  ? -6.421  -2.437  -1.805  1.00 0.65  ? 86  ARG A CD   1  
ATOM 1318  N NE   . ARG A 1 86  ? -6.953  -3.779  -2.012  1.00 1.27  ? 86  ARG A NE   1  
ATOM 1319  C CZ   . ARG A 1 86  ? -7.903  -4.327  -1.257  1.00 1.38  ? 86  ARG A CZ   1  
ATOM 1320  N NH1  . ARG A 1 86  ? -8.386  -3.670  -0.211  1.00 1.19  ? 86  ARG A NH1  1  
ATOM 1321  N NH2  . ARG A 1 86  ? -8.362  -5.536  -1.547  1.00 2.24  ? 86  ARG A NH2  1  
ATOM 1322  H H    . ARG A 1 86  ? -6.079  -0.346  -5.054  1.00 0.55  ? 86  ARG A H    1  
ATOM 1323  H HA   . ARG A 1 86  ? -4.107  1.043   -3.403  1.00 0.50  ? 86  ARG A HA   1  
ATOM 1324  H HB2  . ARG A 1 86  ? -4.001  -0.937  -1.997  1.00 1.45  ? 86  ARG A HB2  1  
ATOM 1325  H HB3  . ARG A 1 86  ? -5.560  -0.148  -1.970  1.00 1.30  ? 86  ARG A HB3  1  
ATOM 1326  H HG2  . ARG A 1 86  ? -6.107  -1.823  -3.788  1.00 1.55  ? 86  ARG A HG2  1  
ATOM 1327  H HG3  . ARG A 1 86  ? -4.780  -2.746  -3.107  1.00 1.67  ? 86  ARG A HG3  1  
ATOM 1328  H HD2  . ARG A 1 86  ? -5.842  -2.407  -0.910  1.00 1.04  ? 86  ARG A HD2  1  
ATOM 1329  H HD3  . ARG A 1 86  ? -7.244  -1.742  -1.722  1.00 1.07  ? 86  ARG A HD3  1  
ATOM 1330  H HE   . ARG A 1 86  ? -6.593  -4.295  -2.770  1.00 1.95  ? 86  ARG A HE   1  
ATOM 1331  H HH11 . ARG A 1 86  ? -8.042  -2.759  0.020   1.00 1.35  ? 86  ARG A HH11 1  
ATOM 1332  H HH12 . ARG A 1 86  ? -9.107  -4.081  0.355   1.00 1.49  ? 86  ARG A HH12 1  
ATOM 1333  H HH21 . ARG A 1 86  ? -7.995  -6.038  -2.333  1.00 2.89  ? 86  ARG A HH21 1  
ATOM 1334  H HH22 . ARG A 1 86  ? -9.084  -5.951  -0.985  1.00 2.35  ? 86  ARG A HH22 1  
ATOM 1335  N N    . HIS A 1 87  ? -2.180  -0.513  -4.032  1.00 0.37  ? 87  HIS A N    1  
ATOM 1336  C CA   . HIS A 1 87  ? -1.008  -1.127  -4.645  1.00 0.35  ? 87  HIS A CA   1  
ATOM 1337  C C    . HIS A 1 87  ? -0.497  -2.229  -3.734  1.00 0.34  ? 87  HIS A C    1  
ATOM 1338  O O    . HIS A 1 87  ? -0.675  -2.144  -2.519  1.00 0.47  ? 87  HIS A O    1  
ATOM 1339  C CB   . HIS A 1 87  ? 0.099   -0.088  -4.851  1.00 0.36  ? 87  HIS A CB   1  
ATOM 1340  C CG   . HIS A 1 87  ? -0.295  1.076   -5.698  1.00 0.41  ? 87  HIS A CG   1  
ATOM 1341  N ND1  . HIS A 1 87  ? -0.430  1.016   -7.068  1.00 0.52  ? 87  HIS A ND1  1  
ATOM 1342  C CD2  . HIS A 1 87  ? -0.571  2.348   -5.348  1.00 0.45  ? 87  HIS A CD2  1  
ATOM 1343  C CE1  . HIS A 1 87  ? -0.771  2.206   -7.525  1.00 0.60  ? 87  HIS A CE1  1  
ATOM 1344  N NE2  . HIS A 1 87  ? -0.863  3.032   -6.499  1.00 0.55  ? 87  HIS A NE2  1  
ATOM 1345  H H    . HIS A 1 87  ? -2.080  -0.041  -3.181  1.00 0.40  ? 87  HIS A H    1  
ATOM 1346  H HA   . HIS A 1 87  ? -1.297  -1.542  -5.594  1.00 0.39  ? 87  HIS A HA   1  
ATOM 1347  H HB2  . HIS A 1 87  ? 0.387   0.298   -3.891  1.00 0.32  ? 87  HIS A HB2  1  
ATOM 1348  H HB3  . HIS A 1 87  ? 0.957   -0.558  -5.304  1.00 0.41  ? 87  HIS A HB3  1  
ATOM 1349  H HD1  . HIS A 1 87  ? -0.311  0.212   -7.626  1.00 0.57  ? 87  HIS A HD1  1  
ATOM 1350  H HD2  . HIS A 1 87  ? -0.557  2.746   -4.342  1.00 0.46  ? 87  HIS A HD2  1  
ATOM 1351  H HE1  . HIS A 1 87  ? -0.946  2.461   -8.559  1.00 0.71  ? 87  HIS A HE1  1  
ATOM 1352  H HE2  . HIS A 1 87  ? -1.190  3.961   -6.547  1.00 0.63  ? 87  HIS A HE2  1  
ATOM 1353  N N    . MET A 1 88  ? 0.133   -3.252  -4.292  1.00 0.29  ? 88  MET A N    1  
ATOM 1354  C CA   . MET A 1 88  ? 0.658   -4.330  -3.465  1.00 0.25  ? 88  MET A CA   1  
ATOM 1355  C C    . MET A 1 88  ? 2.089   -4.690  -3.855  1.00 0.25  ? 88  MET A C    1  
ATOM 1356  O O    . MET A 1 88  ? 2.397   -4.882  -5.030  1.00 0.29  ? 88  MET A O    1  
ATOM 1357  C CB   . MET A 1 88  ? -0.228  -5.564  -3.550  1.00 0.27  ? 88  MET A CB   1  
ATOM 1358  C CG   . MET A 1 88  ? -0.024  -6.494  -2.375  1.00 0.44  ? 88  MET A CG   1  
ATOM 1359  S SD   . MET A 1 88  ? -0.715  -8.139  -2.637  1.00 0.62  ? 88  MET A SD   1  
ATOM 1360  C CE   . MET A 1 88  ? -2.455  -7.755  -2.777  1.00 0.73  ? 88  MET A CE   1  
ATOM 1361  H H    . MET A 1 88  ? 0.245   -3.288  -5.266  1.00 0.35  ? 88  MET A H    1  
ATOM 1362  H HA   . MET A 1 88  ? 0.661   -3.979  -2.443  1.00 0.24  ? 88  MET A HA   1  
ATOM 1363  H HB2  . MET A 1 88  ? -1.263  -5.256  -3.570  1.00 0.47  ? 88  MET A HB2  1  
ATOM 1364  H HB3  . MET A 1 88  ? 0.001   -6.103  -4.457  1.00 0.51  ? 88  MET A HB3  1  
ATOM 1365  H HG2  . MET A 1 88  ? 1.034   -6.581  -2.186  1.00 0.63  ? 88  MET A HG2  1  
ATOM 1366  H HG3  . MET A 1 88  ? -0.500  -6.054  -1.511  1.00 0.61  ? 88  MET A HG3  1  
ATOM 1367  H HE1  . MET A 1 88  ? -2.646  -7.284  -3.730  1.00 1.16  ? 88  MET A HE1  1  
ATOM 1368  H HE2  . MET A 1 88  ? -2.738  -7.081  -1.983  1.00 1.33  ? 88  MET A HE2  1  
ATOM 1369  H HE3  . MET A 1 88  ? -3.032  -8.662  -2.698  1.00 1.26  ? 88  MET A HE3  1  
ATOM 1370  N N    . PHE A 1 89  ? 2.954   -4.769  -2.852  1.00 0.25  ? 89  PHE A N    1  
ATOM 1371  C CA   . PHE A 1 89  ? 4.375   -5.014  -3.052  1.00 0.26  ? 89  PHE A CA   1  
ATOM 1372  C C    . PHE A 1 89  ? 4.832   -6.243  -2.294  1.00 0.26  ? 89  PHE A C    1  
ATOM 1373  O O    . PHE A 1 89  ? 4.545   -6.389  -1.105  1.00 0.30  ? 89  PHE A O    1  
ATOM 1374  C CB   . PHE A 1 89  ? 5.142   -3.811  -2.541  1.00 0.31  ? 89  PHE A CB   1  
ATOM 1375  C CG   . PHE A 1 89  ? 4.372   -2.554  -2.743  1.00 0.48  ? 89  PHE A CG   1  
ATOM 1376  C CD1  . PHE A 1 89  ? 4.296   -1.972  -3.988  1.00 0.55  ? 89  PHE A CD1  1  
ATOM 1377  C CD2  . PHE A 1 89  ? 3.745   -1.949  -1.681  1.00 0.76  ? 89  PHE A CD2  1  
ATOM 1378  C CE1  . PHE A 1 89  ? 3.604   -0.804  -4.170  1.00 0.77  ? 89  PHE A CE1  1  
ATOM 1379  C CE2  . PHE A 1 89  ? 3.045   -0.776  -1.851  1.00 0.94  ? 89  PHE A CE2  1  
ATOM 1380  C CZ   . PHE A 1 89  ? 2.910   -0.247  -3.134  1.00 0.91  ? 89  PHE A CZ   1  
ATOM 1381  H H    . PHE A 1 89  ? 2.632   -4.622  -1.943  1.00 0.26  ? 89  PHE A H    1  
ATOM 1382  H HA   . PHE A 1 89  ? 4.563   -5.141  -4.107  1.00 0.27  ? 89  PHE A HA   1  
ATOM 1383  H HB2  . PHE A 1 89  ? 5.329   -3.928  -1.484  1.00 0.44  ? 89  PHE A HB2  1  
ATOM 1384  H HB3  . PHE A 1 89  ? 6.080   -3.723  -3.067  1.00 0.22  ? 89  PHE A HB3  1  
ATOM 1385  H HD1  . PHE A 1 89  ? 4.790   -2.443  -4.827  1.00 0.60  ? 89  PHE A HD1  1  
ATOM 1386  H HD2  . PHE A 1 89  ? 3.817   -2.401  -0.711  1.00 0.91  ? 89  PHE A HD2  1  
ATOM 1387  H HE1  . PHE A 1 89  ? 3.555   -0.355  -5.150  1.00 0.92  ? 89  PHE A HE1  1  
ATOM 1388  H HE2  . PHE A 1 89  ? 2.558   -0.306  -1.012  1.00 1.18  ? 89  PHE A HE2  1  
ATOM 1389  H HZ   . PHE A 1 89  ? 2.342   0.657   -3.285  1.00 1.10  ? 89  PHE A HZ   1  
ATOM 1390  N N    . SER A 1 90  ? 5.562   -7.104  -2.975  1.00 0.26  ? 90  SER A N    1  
ATOM 1391  C CA   . SER A 1 90  ? 6.063   -8.323  -2.370  1.00 0.27  ? 90  SER A CA   1  
ATOM 1392  C C    . SER A 1 90  ? 7.526   -8.169  -1.947  1.00 0.27  ? 90  SER A C    1  
ATOM 1393  O O    . SER A 1 90  ? 8.382   -7.861  -2.760  1.00 0.37  ? 90  SER A O    1  
ATOM 1394  C CB   . SER A 1 90  ? 5.921   -9.471  -3.369  1.00 0.32  ? 90  SER A CB   1  
ATOM 1395  O OG   . SER A 1 90  ? 4.574   -9.635  -3.784  1.00 1.30  ? 90  SER A OG   1  
ATOM 1396  H H    . SER A 1 90  ? 5.762   -6.922  -3.918  1.00 0.28  ? 90  SER A H    1  
ATOM 1397  H HA   . SER A 1 90  ? 5.465   -8.535  -1.496  1.00 0.30  ? 90  SER A HA   1  
ATOM 1398  H HB2  . SER A 1 90  ? 6.518   -9.258  -4.235  1.00 0.87  ? 90  SER A HB2  1  
ATOM 1399  H HB3  . SER A 1 90  ? 6.261   -10.384 -2.916  1.00 0.66  ? 90  SER A HB3  1  
ATOM 1400  H HG   . SER A 1 90  ? 3.982   -9.354  -3.069  1.00 1.50  ? 90  SER A HG   1  
ATOM 1401  N N    . PHE A 1 91  ? 7.796   -8.375  -0.669  1.00 0.22  ? 91  PHE A N    1  
ATOM 1402  C CA   . PHE A 1 91  ? 9.169   -8.416  -0.168  1.00 0.24  ? 91  PHE A CA   1  
ATOM 1403  C C    . PHE A 1 91  ? 9.496   -9.825  0.290   1.00 0.29  ? 91  PHE A C    1  
ATOM 1404  O O    . PHE A 1 91  ? 8.656   -10.723 0.220   1.00 0.32  ? 91  PHE A O    1  
ATOM 1405  C CB   . PHE A 1 91  ? 9.386   -7.479  1.027   1.00 0.22  ? 91  PHE A CB   1  
ATOM 1406  C CG   . PHE A 1 91  ? 9.093   -6.037  0.769   1.00 0.20  ? 91  PHE A CG   1  
ATOM 1407  C CD1  . PHE A 1 91  ? 10.031  -5.202  0.196   1.00 0.25  ? 91  PHE A CD1  1  
ATOM 1408  C CD2  . PHE A 1 91  ? 7.874   -5.522  1.115   1.00 0.22  ? 91  PHE A CD2  1  
ATOM 1409  C CE1  . PHE A 1 91  ? 9.746   -3.868  -0.021  1.00 0.31  ? 91  PHE A CE1  1  
ATOM 1410  C CE2  . PHE A 1 91  ? 7.576   -4.197  0.899   1.00 0.28  ? 91  PHE A CE2  1  
ATOM 1411  C CZ   . PHE A 1 91  ? 8.513   -3.365  0.331   1.00 0.32  ? 91  PHE A CZ   1  
ATOM 1412  H H    . PHE A 1 91  ? 7.056   -8.493  -0.043  1.00 0.22  ? 91  PHE A H    1  
ATOM 1413  H HA   . PHE A 1 91  ? 9.832   -8.133  -0.973  1.00 0.26  ? 91  PHE A HA   1  
ATOM 1414  H HB2  . PHE A 1 91  ? 8.749   -7.798  1.838   1.00 0.25  ? 91  PHE A HB2  1  
ATOM 1415  H HB3  . PHE A 1 91  ? 10.417  -7.554  1.343   1.00 0.28  ? 91  PHE A HB3  1  
ATOM 1416  H HD1  . PHE A 1 91  ? 10.996  -5.599  -0.080  1.00 0.31  ? 91  PHE A HD1  1  
ATOM 1417  H HD2  . PHE A 1 91  ? 7.155   -6.169  1.568   1.00 0.25  ? 91  PHE A HD2  1  
ATOM 1418  H HE1  . PHE A 1 91  ? 10.487  -3.222  -0.467  1.00 0.38  ? 91  PHE A HE1  1  
ATOM 1419  H HE2  . PHE A 1 91  ? 6.611   -3.814  1.173   1.00 0.35  ? 91  PHE A HE2  1  
ATOM 1420  H HZ   . PHE A 1 91  ? 8.282   -2.325  0.160   1.00 0.40  ? 91  PHE A HZ   1  
ATOM 1421  N N    . ASN A 1 92  ? 10.719  -10.007 0.746   1.00 0.35  ? 92  ASN A N    1  
ATOM 1422  C CA   . ASN A 1 92  ? 11.146  -11.275 1.327   1.00 0.43  ? 92  ASN A CA   1  
ATOM 1423  C C    . ASN A 1 92  ? 12.083  -11.027 2.499   1.00 0.38  ? 92  ASN A C    1  
ATOM 1424  O O    . ASN A 1 92  ? 13.042  -11.766 2.723   1.00 0.46  ? 92  ASN A O    1  
ATOM 1425  C CB   . ASN A 1 92  ? 11.811  -12.176 0.278   1.00 0.62  ? 92  ASN A CB   1  
ATOM 1426  C CG   . ASN A 1 92  ? 13.019  -11.544 -0.399  1.00 0.70  ? 92  ASN A CG   1  
ATOM 1427  O OD1  . ASN A 1 92  ? 13.157  -10.321 -0.462  1.00 1.17  ? 92  ASN A OD1  1  
ATOM 1428  N ND2  . ASN A 1 92  ? 13.894  -12.382 -0.932  1.00 1.11  ? 92  ASN A ND2  1  
ATOM 1429  H H    . ASN A 1 92  ? 11.360  -9.267  0.690   1.00 0.36  ? 92  ASN A H    1  
ATOM 1430  H HA   . ASN A 1 92  ? 10.262  -11.772 1.699   1.00 0.47  ? 92  ASN A HA   1  
ATOM 1431  H HB2  . ASN A 1 92  ? 12.136  -13.085 0.759   1.00 0.67  ? 92  ASN A HB2  1  
ATOM 1432  H HB3  . ASN A 1 92  ? 11.082  -12.424 -0.478  1.00 0.71  ? 92  ASN A HB3  1  
ATOM 1433  H HD21 . ASN A 1 92  ? 13.716  -13.347 -0.861  1.00 1.58  ? 92  ASN A HD21 1  
ATOM 1434  H HD22 . ASN A 1 92  ? 14.680  -12.008 -1.381  1.00 1.21  ? 92  ASN A HD22 1  
ATOM 1435  N N    . ASN A 1 93  ? 11.790  -9.970  3.246   1.00 0.32  ? 93  ASN A N    1  
ATOM 1436  C CA   . ASN A 1 93  ? 12.575  -9.603  4.413   1.00 0.34  ? 93  ASN A CA   1  
ATOM 1437  C C    . ASN A 1 93  ? 11.693  -8.848  5.400   1.00 0.32  ? 93  ASN A C    1  
ATOM 1438  O O    . ASN A 1 93  ? 11.011  -7.889  5.027   1.00 0.29  ? 93  ASN A O    1  
ATOM 1439  C CB   . ASN A 1 93  ? 13.770  -8.743  3.991   1.00 0.38  ? 93  ASN A CB   1  
ATOM 1440  C CG   . ASN A 1 93  ? 14.641  -8.339  5.162   1.00 0.87  ? 93  ASN A CG   1  
ATOM 1441  O OD1  . ASN A 1 93  ? 14.419  -7.300  5.780   1.00 1.62  ? 93  ASN A OD1  1  
ATOM 1442  N ND2  . ASN A 1 93  ? 15.640  -9.151  5.470   1.00 0.98  ? 93  ASN A ND2  1  
ATOM 1443  H H    . ASN A 1 93  ? 11.016  -9.417  3.007   1.00 0.33  ? 93  ASN A H    1  
ATOM 1444  H HA   . ASN A 1 93  ? 12.932  -10.510 4.878   1.00 0.40  ? 93  ASN A HA   1  
ATOM 1445  H HB2  . ASN A 1 93  ? 14.376  -9.300  3.294   1.00 0.79  ? 93  ASN A HB2  1  
ATOM 1446  H HB3  . ASN A 1 93  ? 13.407  -7.848  3.510   1.00 0.72  ? 93  ASN A HB3  1  
ATOM 1447  H HD21 . ASN A 1 93  ? 15.762  -9.965  4.935   1.00 1.05  ? 93  ASN A HD21 1  
ATOM 1448  H HD22 . ASN A 1 93  ? 16.221  -8.905  6.222   1.00 1.41  ? 93  ASN A HD22 1  
ATOM 1449  N N    . ARG A 1 94  ? 11.692  -9.299  6.651   1.00 0.42  ? 94  ARG A N    1  
ATOM 1450  C CA   . ARG A 1 94  ? 10.816  -8.731  7.673   1.00 0.45  ? 94  ARG A CA   1  
ATOM 1451  C C    . ARG A 1 94  ? 11.273  -7.340  8.092   1.00 0.35  ? 94  ARG A C    1  
ATOM 1452  O O    . ARG A 1 94  ? 10.451  -6.475  8.384   1.00 0.36  ? 94  ARG A O    1  
ATOM 1453  C CB   . ARG A 1 94  ? 10.749  -9.636  8.903   1.00 0.64  ? 94  ARG A CB   1  
ATOM 1454  C CG   . ARG A 1 94  ? 10.177  -11.014 8.632   1.00 1.15  ? 94  ARG A CG   1  
ATOM 1455  C CD   . ARG A 1 94  ? 8.780   -10.931 8.046   1.00 1.32  ? 94  ARG A CD   1  
ATOM 1456  N NE   . ARG A 1 94  ? 8.087   -12.214 8.106   1.00 2.12  ? 94  ARG A NE   1  
ATOM 1457  C CZ   . ARG A 1 94  ? 6.766   -12.354 8.022   1.00 2.84  ? 94  ARG A CZ   1  
ATOM 1458  N NH1  . ARG A 1 94  ? 5.989   -11.305 7.775   1.00 3.14  ? 94  ARG A NH1  1  
ATOM 1459  N NH2  . ARG A 1 94  ? 6.223   -13.549 8.183   1.00 3.68  ? 94  ARG A NH2  1  
ATOM 1460  H H    . ARG A 1 94  ? 12.302  -10.031 6.897   1.00 0.50  ? 94  ARG A H    1  
ATOM 1461  H HA   . ARG A 1 94  ? 9.827   -8.654  7.248   1.00 0.49  ? 94  ARG A HA   1  
ATOM 1462  H HB2  . ARG A 1 94  ? 11.742  -9.753  9.305   1.00 0.98  ? 94  ARG A HB2  1  
ATOM 1463  H HB3  . ARG A 1 94  ? 10.126  -9.158  9.642   1.00 0.78  ? 94  ARG A HB3  1  
ATOM 1464  H HG2  . ARG A 1 94  ? 10.819  -11.527 7.934   1.00 1.71  ? 94  ARG A HG2  1  
ATOM 1465  H HG3  . ARG A 1 94  ? 10.137  -11.565 9.559   1.00 1.82  ? 94  ARG A HG3  1  
ATOM 1466  H HD2  . ARG A 1 94  ? 8.212   -10.203 8.597   1.00 1.72  ? 94  ARG A HD2  1  
ATOM 1467  H HD3  . ARG A 1 94  ? 8.856   -10.620 7.018   1.00 1.56  ? 94  ARG A HD3  1  
ATOM 1468  H HE   . ARG A 1 94  ? 8.640   -13.016 8.251   1.00 2.50  ? 94  ARG A HE   1  
ATOM 1469  H HH11 . ARG A 1 94  ? 6.390   -10.398 7.650   1.00 2.91  ? 94  ARG A HH11 1  
ATOM 1470  H HH12 . ARG A 1 94  ? 4.995   -11.419 7.713   1.00 3.89  ? 94  ARG A HH12 1  
ATOM 1471  H HH21 . ARG A 1 94  ? 6.806   -14.343 8.371   1.00 3.93  ? 94  ARG A HH21 1  
ATOM 1472  H HH22 . ARG A 1 94  ? 5.225   -13.669 8.109   1.00 4.27  ? 94  ARG A HH22 1  
ATOM 1473  N N    . THR A 1 95  ? 12.582  -7.134  8.125   1.00 0.34  ? 95  THR A N    1  
ATOM 1474  C CA   . THR A 1 95  ? 13.146  -5.835  8.457   1.00 0.31  ? 95  THR A CA   1  
ATOM 1475  C C    . THR A 1 95  ? 12.668  -4.780  7.467   1.00 0.26  ? 95  THR A C    1  
ATOM 1476  O O    . THR A 1 95  ? 12.175  -3.719  7.861   1.00 0.27  ? 95  THR A O    1  
ATOM 1477  C CB   . THR A 1 95  ? 14.680  -5.894  8.460   1.00 0.40  ? 95  THR A CB   1  
ATOM 1478  O OG1  . THR A 1 95  ? 15.130  -6.782  9.493   1.00 0.50  ? 95  THR A OG1  1  
ATOM 1479  C CG2  . THR A 1 95  ? 15.290  -4.516  8.654   1.00 0.44  ? 95  THR A CG2  1  
ATOM 1480  H H    . THR A 1 95  ? 13.190  -7.879  7.918   1.00 0.40  ? 95  THR A H    1  
ATOM 1481  H HA   . THR A 1 95  ? 12.814  -5.567  9.442   1.00 0.33  ? 95  THR A HA   1  
ATOM 1482  H HB   . THR A 1 95  ? 14.998  -6.279  7.509   1.00 0.42  ? 95  THR A HB   1  
ATOM 1483  H HG1  . THR A 1 95  ? 14.482  -6.793  10.208  1.00 0.94  ? 95  THR A HG1  1  
ATOM 1484  H HG21 . THR A 1 95  ? 16.366  -4.595  8.654   1.00 1.02  ? 95  THR A HG21 1  
ATOM 1485  H HG22 . THR A 1 95  ? 14.957  -4.103  9.595   1.00 1.07  ? 95  THR A HG22 1  
ATOM 1486  H HG23 . THR A 1 95  ? 14.975  -3.872  7.846   1.00 1.10  ? 95  THR A HG23 1  
ATOM 1487  N N    . VAL A 1 96  ? 12.822  -5.085  6.184   1.00 0.24  ? 96  VAL A N    1  
ATOM 1488  C CA   . VAL A 1 96  ? 12.276  -4.257  5.120   1.00 0.22  ? 96  VAL A CA   1  
ATOM 1489  C C    . VAL A 1 96  ? 10.793  -4.008  5.343   1.00 0.21  ? 96  VAL A C    1  
ATOM 1490  O O    . VAL A 1 96  ? 10.360  -2.861  5.385   1.00 0.22  ? 96  VAL A O    1  
ATOM 1491  C CB   . VAL A 1 96  ? 12.477  -4.914  3.737   1.00 0.22  ? 96  VAL A CB   1  
ATOM 1492  C CG1  . VAL A 1 96  ? 11.662  -4.208  2.669   1.00 0.22  ? 96  VAL A CG1  1  
ATOM 1493  C CG2  . VAL A 1 96  ? 13.942  -4.915  3.350   1.00 0.27  ? 96  VAL A CG2  1  
ATOM 1494  H H    . VAL A 1 96  ? 13.340  -5.887  5.949   1.00 0.26  ? 96  VAL A H    1  
ATOM 1495  H HA   . VAL A 1 96  ? 12.795  -3.307  5.129   1.00 0.25  ? 96  VAL A HA   1  
ATOM 1496  H HB   . VAL A 1 96  ? 12.142  -5.938  3.795   1.00 0.23  ? 96  VAL A HB   1  
ATOM 1497  H HG11 . VAL A 1 96  ? 10.620  -4.527  2.723   1.00 1.01  ? 96  VAL A HG11 1  
ATOM 1498  H HG12 . VAL A 1 96  ? 12.066  -4.455  1.698   1.00 1.03  ? 96  VAL A HG12 1  
ATOM 1499  H HG13 . VAL A 1 96  ? 11.720  -3.140  2.819   1.00 1.03  ? 96  VAL A HG13 1  
ATOM 1500  H HG21 . VAL A 1 96  ? 14.494  -5.553  4.023   1.00 1.03  ? 96  VAL A HG21 1  
ATOM 1501  H HG22 . VAL A 1 96  ? 14.328  -3.908  3.409   1.00 1.07  ? 96  VAL A HG22 1  
ATOM 1502  H HG23 . VAL A 1 96  ? 14.042  -5.280  2.339   1.00 1.05  ? 96  VAL A HG23 1  
ATOM 1503  N N    . MET A 1 97  ? 10.026  -5.088  5.489   1.00 0.26  ? 97  MET A N    1  
ATOM 1504  C CA   . MET A 1 97  ? 8.598   -4.985  5.760   1.00 0.39  ? 97  MET A CA   1  
ATOM 1505  C C    . MET A 1 97  ? 8.287   -3.971  6.839   1.00 0.34  ? 97  MET A C    1  
ATOM 1506  O O    . MET A 1 97  ? 7.520   -3.045  6.616   1.00 0.34  ? 97  MET A O    1  
ATOM 1507  C CB   . MET A 1 97  ? 8.027   -6.321  6.197   1.00 0.62  ? 97  MET A CB   1  
ATOM 1508  C CG   . MET A 1 97  ? 7.657   -7.230  5.057   1.00 0.62  ? 97  MET A CG   1  
ATOM 1509  S SD   . MET A 1 97  ? 6.223   -8.249  5.453   1.00 0.84  ? 97  MET A SD   1  
ATOM 1510  C CE   . MET A 1 97  ? 5.005   -6.992  5.857   1.00 0.37  ? 97  MET A CE   1  
ATOM 1511  H H    . MET A 1 97  ? 10.429  -5.982  5.394   1.00 0.24  ? 97  MET A H    1  
ATOM 1512  H HA   . MET A 1 97  ? 8.109   -4.682  4.847   1.00 0.47  ? 97  MET A HA   1  
ATOM 1513  H HB2  . MET A 1 97  ? 8.758   -6.828  6.809   1.00 1.36  ? 97  MET A HB2  1  
ATOM 1514  H HB3  . MET A 1 97  ? 7.143   -6.142  6.788   1.00 1.35  ? 97  MET A HB3  1  
ATOM 1515  H HG2  . MET A 1 97  ? 7.438   -6.630  4.188   1.00 1.26  ? 97  MET A HG2  1  
ATOM 1516  H HG3  . MET A 1 97  ? 8.495   -7.878  4.847   1.00 1.33  ? 97  MET A HG3  1  
ATOM 1517  H HE1  . MET A 1 97  ? 4.044   -7.459  6.004   1.00 1.03  ? 97  MET A HE1  1  
ATOM 1518  H HE2  . MET A 1 97  ? 4.937   -6.274  5.050   1.00 0.97  ? 97  MET A HE2  1  
ATOM 1519  H HE3  . MET A 1 97  ? 5.296   -6.483  6.763   1.00 1.05  ? 97  MET A HE3  1  
ATOM 1520  N N    . ASP A 1 98  ? 8.878   -4.156  8.006   1.00 0.36  ? 98  ASP A N    1  
ATOM 1521  C CA   . ASP A 1 98  ? 8.567   -3.321  9.157   1.00 0.36  ? 98  ASP A CA   1  
ATOM 1522  C C    . ASP A 1 98  ? 8.969   -1.869  8.911   1.00 0.28  ? 98  ASP A C    1  
ATOM 1523  O O    . ASP A 1 98  ? 8.249   -0.944  9.284   1.00 0.29  ? 98  ASP A O    1  
ATOM 1524  C CB   . ASP A 1 98  ? 9.269   -3.859  10.405  1.00 0.45  ? 98  ASP A CB   1  
ATOM 1525  C CG   . ASP A 1 98  ? 8.746   -3.232  11.679  1.00 0.55  ? 98  ASP A CG   1  
ATOM 1526  O OD1  . ASP A 1 98  ? 7.645   -3.618  12.128  1.00 0.67  ? 98  ASP A OD1  1  
ATOM 1527  O OD2  . ASP A 1 98  ? 9.429   -2.357  12.242  1.00 0.61  ? 98  ASP A OD2  1  
ATOM 1528  H H    . ASP A 1 98  ? 9.536   -4.885  8.101   1.00 0.41  ? 98  ASP A H    1  
ATOM 1529  H HA   . ASP A 1 98  ? 7.494   -3.364  9.306   1.00 0.39  ? 98  ASP A HA   1  
ATOM 1530  H HB2  . ASP A 1 98  ? 9.126   -4.927  10.462  1.00 0.51  ? 98  ASP A HB2  1  
ATOM 1531  H HB3  . ASP A 1 98  ? 10.327  -3.648  10.331  1.00 0.44  ? 98  ASP A HB3  1  
ATOM 1532  N N    . ASN A 1 99  ? 10.110  -1.680  8.262   1.00 0.22  ? 99  ASN A N    1  
ATOM 1533  C CA   . ASN A 1 99  ? 10.604  -0.350  7.937   1.00 0.21  ? 99  ASN A CA   1  
ATOM 1534  C C    . ASN A 1 99  ? 9.711   0.325   6.907   1.00 0.15  ? 99  ASN A C    1  
ATOM 1535  O O    . ASN A 1 99  ? 9.292   1.459   7.102   1.00 0.18  ? 99  ASN A O    1  
ATOM 1536  C CB   . ASN A 1 99  ? 12.038  -0.443  7.413   1.00 0.26  ? 99  ASN A CB   1  
ATOM 1537  C CG   . ASN A 1 99  ? 13.071  -0.379  8.519   1.00 0.77  ? 99  ASN A CG   1  
ATOM 1538  O OD1  . ASN A 1 99  ? 13.542  0.698   8.887   1.00 1.55  ? 99  ASN A OD1  1  
ATOM 1539  N ND2  . ASN A 1 99  ? 13.437  -1.530  9.055   1.00 1.17  ? 99  ASN A ND2  1  
ATOM 1540  H H    . ASN A 1 99  ? 10.637  -2.459  7.985   1.00 0.21  ? 99  ASN A H    1  
ATOM 1541  H HA   . ASN A 1 99  ? 10.592  0.247   8.843   1.00 0.28  ? 99  ASN A HA   1  
ATOM 1542  H HB2  . ASN A 1 99  ? 12.157  -1.382  6.895   1.00 0.64  ? 99  ASN A HB2  1  
ATOM 1543  H HB3  . ASN A 1 99  ? 12.217  0.362   6.725   1.00 0.50  ? 99  ASN A HB3  1  
ATOM 1544  H HD21 . ASN A 1 99  ? 13.024  -2.356  8.711   1.00 1.55  ? 99  ASN A HD21 1  
ATOM 1545  H HD22 . ASN A 1 99  ? 14.107  -1.518  9.772   1.00 1.51  ? 99  ASN A HD22 1  
ATOM 1546  N N    . ILE A 1 100 ? 9.420   -0.377  5.820   1.00 0.12  ? 100 ILE A N    1  
ATOM 1547  C CA   . ILE A 1 100 ? 8.502   0.126   4.803   1.00 0.14  ? 100 ILE A CA   1  
ATOM 1548  C C    . ILE A 1 100 ? 7.117   0.333   5.420   1.00 0.16  ? 100 ILE A C    1  
ATOM 1549  O O    . ILE A 1 100 ? 6.471   1.341   5.168   1.00 0.20  ? 100 ILE A O    1  
ATOM 1550  C CB   . ILE A 1 100 ? 8.427   -0.834  3.593   1.00 0.18  ? 100 ILE A CB   1  
ATOM 1551  C CG1  . ILE A 1 100 ? 9.821   -1.044  2.972   1.00 0.18  ? 100 ILE A CG1  1  
ATOM 1552  C CG2  . ILE A 1 100 ? 7.462   -0.301  2.549   1.00 0.22  ? 100 ILE A CG2  1  
ATOM 1553  C CD1  . ILE A 1 100 ? 10.501  0.227   2.487   1.00 0.18  ? 100 ILE A CD1  1  
ATOM 1554  H H    . ILE A 1 100 ? 9.830   -1.264  5.697   1.00 0.14  ? 100 ILE A H    1  
ATOM 1555  H HA   . ILE A 1 100 ? 8.865   1.086   4.448   1.00 0.16  ? 100 ILE A HA   1  
ATOM 1556  H HB   . ILE A 1 100 ? 8.051   -1.784  3.940   1.00 0.20  ? 100 ILE A HB   1  
ATOM 1557  H HG12 . ILE A 1 100 ? 10.468  -1.498  3.705   1.00 0.19  ? 100 ILE A HG12 1  
ATOM 1558  H HG13 . ILE A 1 100 ? 9.728   -1.710  2.127   1.00 0.21  ? 100 ILE A HG13 1  
ATOM 1559  H HG21 . ILE A 1 100 ? 7.770   0.691   2.251   1.00 1.03  ? 100 ILE A HG21 1  
ATOM 1560  H HG22 . ILE A 1 100 ? 6.469   -0.258  2.969   1.00 1.05  ? 100 ILE A HG22 1  
ATOM 1561  H HG23 . ILE A 1 100 ? 7.462   -0.954  1.690   1.00 1.01  ? 100 ILE A HG23 1  
ATOM 1562  H HD11 . ILE A 1 100 ? 10.701  0.874   3.328   1.00 1.02  ? 100 ILE A HD11 1  
ATOM 1563  H HD12 . ILE A 1 100 ? 9.858   0.736   1.786   1.00 1.07  ? 100 ILE A HD12 1  
ATOM 1564  H HD13 . ILE A 1 100 ? 11.438  -0.025  1.997   1.00 1.01  ? 100 ILE A HD13 1  
ATOM 1565  N N    . LYS A 1 101 ? 6.681   -0.599  6.263   1.00 0.17  ? 101 LYS A N    1  
ATOM 1566  C CA   . LYS A 1 101 ? 5.434   -0.430  7.004   1.00 0.22  ? 101 LYS A CA   1  
ATOM 1567  C C    . LYS A 1 101 ? 5.416   0.920   7.697   1.00 0.21  ? 101 LYS A C    1  
ATOM 1568  O O    . LYS A 1 101 ? 4.565   1.766   7.433   1.00 0.25  ? 101 LYS A O    1  
ATOM 1569  C CB   . LYS A 1 101 ? 5.258   -1.521  8.068   1.00 0.28  ? 101 LYS A CB   1  
ATOM 1570  C CG   . LYS A 1 101 ? 4.423   -2.680  7.614   1.00 0.49  ? 101 LYS A CG   1  
ATOM 1571  C CD   . LYS A 1 101 ? 4.060   -3.585  8.760   1.00 0.65  ? 101 LYS A CD   1  
ATOM 1572  C CE   . LYS A 1 101 ? 5.250   -4.301  9.331   1.00 0.63  ? 101 LYS A CE   1  
ATOM 1573  N NZ   . LYS A 1 101 ? 4.857   -5.346  10.313  1.00 0.92  ? 101 LYS A NZ   1  
ATOM 1574  H H    . LYS A 1 101 ? 7.208   -1.422  6.387   1.00 0.19  ? 101 LYS A H    1  
ATOM 1575  H HA   . LYS A 1 101 ? 4.619   -0.486  6.297   1.00 0.26  ? 101 LYS A HA   1  
ATOM 1576  H HB2  . LYS A 1 101 ? 6.223   -1.907  8.341   1.00 0.54  ? 101 LYS A HB2  1  
ATOM 1577  H HB3  . LYS A 1 101 ? 4.794   -1.091  8.940   1.00 0.49  ? 101 LYS A HB3  1  
ATOM 1578  H HG2  . LYS A 1 101 ? 3.517   -2.310  7.169   1.00 0.71  ? 101 LYS A HG2  1  
ATOM 1579  H HG3  . LYS A 1 101 ? 4.979   -3.244  6.892   1.00 0.73  ? 101 LYS A HG3  1  
ATOM 1580  H HD2  . LYS A 1 101 ? 3.606   -2.998  9.523   1.00 1.34  ? 101 LYS A HD2  1  
ATOM 1581  H HD3  . LYS A 1 101 ? 3.374   -4.310  8.408   1.00 1.33  ? 101 LYS A HD3  1  
ATOM 1582  H HE2  . LYS A 1 101 ? 5.777   -4.765  8.514   1.00 1.36  ? 101 LYS A HE2  1  
ATOM 1583  H HE3  . LYS A 1 101 ? 5.882   -3.582  9.821   1.00 1.37  ? 101 LYS A HE3  1  
ATOM 1584  H HZ1  . LYS A 1 101 ? 4.396   -4.911  11.137  1.00 1.30  ? 101 LYS A HZ1  1  
ATOM 1585  H HZ2  . LYS A 1 101 ? 5.696   -5.869  10.636  1.00 1.45  ? 101 LYS A HZ2  1  
ATOM 1586  H HZ3  . LYS A 1 101 ? 4.195   -6.018  9.877   1.00 1.55  ? 101 LYS A HZ3  1  
ATOM 1587  N N    . MET A 1 102 ? 6.396   1.102   8.565   1.00 0.20  ? 102 MET A N    1  
ATOM 1588  C CA   . MET A 1 102 ? 6.537   2.302   9.362   1.00 0.23  ? 102 MET A CA   1  
ATOM 1589  C C    . MET A 1 102 ? 6.688   3.554   8.506   1.00 0.20  ? 102 MET A C    1  
ATOM 1590  O O    . MET A 1 102 ? 5.982   4.540   8.712   1.00 0.26  ? 102 MET A O    1  
ATOM 1591  C CB   . MET A 1 102 ? 7.750   2.143   10.265  1.00 0.25  ? 102 MET A CB   1  
ATOM 1592  C CG   . MET A 1 102 ? 7.464   1.428   11.574  1.00 0.79  ? 102 MET A CG   1  
ATOM 1593  S SD   . MET A 1 102 ? 8.870   1.469   12.703  1.00 0.83  ? 102 MET A SD   1  
ATOM 1594  C CE   . MET A 1 102 ? 10.143  0.712   11.695  1.00 1.41  ? 102 MET A CE   1  
ATOM 1595  H H    . MET A 1 102 ? 7.063   0.388   8.678   1.00 0.19  ? 102 MET A H    1  
ATOM 1596  H HA   . MET A 1 102 ? 5.656   2.399   9.969   1.00 0.28  ? 102 MET A HA   1  
ATOM 1597  H HB2  . MET A 1 102 ? 8.478   1.563   9.730   1.00 0.59  ? 102 MET A HB2  1  
ATOM 1598  H HB3  . MET A 1 102 ? 8.167   3.103   10.476  1.00 0.57  ? 102 MET A HB3  1  
ATOM 1599  H HG2  . MET A 1 102 ? 6.623   1.905   12.052  1.00 1.14  ? 102 MET A HG2  1  
ATOM 1600  H HG3  . MET A 1 102 ? 7.220   0.397   11.361  1.00 1.13  ? 102 MET A HG3  1  
ATOM 1601  H HE1  . MET A 1 102 ? 9.821   -0.271  11.386  1.00 1.87  ? 102 MET A HE1  1  
ATOM 1602  H HE2  . MET A 1 102 ? 11.054  0.627   12.270  1.00 1.92  ? 102 MET A HE2  1  
ATOM 1603  H HE3  . MET A 1 102 ? 10.324  1.323   10.823  1.00 1.78  ? 102 MET A HE3  1  
ATOM 1604  N N    . THR A 1 103 ? 7.606   3.502   7.546   1.00 0.15  ? 103 THR A N    1  
ATOM 1605  C CA   . THR A 1 103 ? 7.906   4.640   6.693   1.00 0.16  ? 103 THR A CA   1  
ATOM 1606  C C    . THR A 1 103 ? 6.649   5.177   6.021   1.00 0.18  ? 103 THR A C    1  
ATOM 1607  O O    . THR A 1 103 ? 6.371   6.373   6.064   1.00 0.24  ? 103 THR A O    1  
ATOM 1608  C CB   . THR A 1 103 ? 8.937   4.251   5.617   1.00 0.18  ? 103 THR A CB   1  
ATOM 1609  O OG1  . THR A 1 103 ? 10.140  3.791   6.243   1.00 0.23  ? 103 THR A OG1  1  
ATOM 1610  C CG2  . THR A 1 103 ? 9.261   5.427   4.713   1.00 0.27  ? 103 THR A CG2  1  
ATOM 1611  H H    . THR A 1 103 ? 8.097   2.664   7.402   1.00 0.14  ? 103 THR A H    1  
ATOM 1612  H HA   . THR A 1 103 ? 8.335   5.415   7.307   1.00 0.19  ? 103 THR A HA   1  
ATOM 1613  H HB   . THR A 1 103 ? 8.524   3.452   5.014   1.00 0.19  ? 103 THR A HB   1  
ATOM 1614  H HG1  . THR A 1 103 ? 9.968   2.950   6.686   1.00 0.47  ? 103 THR A HG1  1  
ATOM 1615  H HG21 . THR A 1 103 ? 9.695   6.221   5.300   1.00 1.04  ? 103 THR A HG21 1  
ATOM 1616  H HG22 . THR A 1 103 ? 8.354   5.778   4.245   1.00 1.00  ? 103 THR A HG22 1  
ATOM 1617  H HG23 . THR A 1 103 ? 9.960   5.113   3.954   1.00 1.07  ? 103 THR A HG23 1  
ATOM 1618  N N    . LEU A 1 104 ? 5.877   4.280   5.434   1.00 0.16  ? 104 LEU A N    1  
ATOM 1619  C CA   . LEU A 1 104 ? 4.690   4.666   4.691   1.00 0.20  ? 104 LEU A CA   1  
ATOM 1620  C C    . LEU A 1 104 ? 3.628   5.147   5.666   1.00 0.22  ? 104 LEU A C    1  
ATOM 1621  O O    . LEU A 1 104 ? 3.088   6.243   5.530   1.00 0.26  ? 104 LEU A O    1  
ATOM 1622  C CB   . LEU A 1 104 ? 4.155   3.472   3.882   1.00 0.23  ? 104 LEU A CB   1  
ATOM 1623  C CG   . LEU A 1 104 ? 4.979   3.040   2.650   1.00 0.25  ? 104 LEU A CG   1  
ATOM 1624  C CD1  . LEU A 1 104 ? 6.460   3.059   2.939   1.00 0.99  ? 104 LEU A CD1  1  
ATOM 1625  C CD2  . LEU A 1 104 ? 4.572   1.643   2.229   1.00 1.03  ? 104 LEU A CD2  1  
ATOM 1626  H H    . LEU A 1 104 ? 6.099   3.323   5.513   1.00 0.16  ? 104 LEU A H    1  
ATOM 1627  H HA   . LEU A 1 104 ? 4.961   5.472   4.016   1.00 0.23  ? 104 LEU A HA   1  
ATOM 1628  H HB2  . LEU A 1 104 ? 4.089   2.623   4.551   1.00 0.22  ? 104 LEU A HB2  1  
ATOM 1629  H HB3  . LEU A 1 104 ? 3.155   3.716   3.550   1.00 0.26  ? 104 LEU A HB3  1  
ATOM 1630  H HG   . LEU A 1 104 ? 4.799   3.709   1.823   1.00 0.76  ? 104 LEU A HG   1  
ATOM 1631  H HD11 . LEU A 1 104 ? 6.773   4.070   3.150   1.00 1.58  ? 104 LEU A HD11 1  
ATOM 1632  H HD12 . LEU A 1 104 ? 6.996   2.683   2.087   1.00 1.46  ? 104 LEU A HD12 1  
ATOM 1633  H HD13 . LEU A 1 104 ? 6.666   2.435   3.795   1.00 1.67  ? 104 LEU A HD13 1  
ATOM 1634  H HD21 . LEU A 1 104 ? 5.072   1.386   1.307   1.00 1.69  ? 104 LEU A HD21 1  
ATOM 1635  H HD22 . LEU A 1 104 ? 3.502   1.603   2.086   1.00 1.54  ? 104 LEU A HD22 1  
ATOM 1636  H HD23 . LEU A 1 104 ? 4.864   0.943   3.001   1.00 1.59  ? 104 LEU A HD23 1  
ATOM 1637  N N    . GLN A 1 105 ? 3.377   4.311   6.669   1.00 0.22  ? 105 GLN A N    1  
ATOM 1638  C CA   . GLN A 1 105 ? 2.387   4.562   7.698   1.00 0.27  ? 105 GLN A CA   1  
ATOM 1639  C C    . GLN A 1 105 ? 2.550   5.949   8.319   1.00 0.25  ? 105 GLN A C    1  
ATOM 1640  O O    . GLN A 1 105 ? 1.590   6.715   8.397   1.00 0.27  ? 105 GLN A O    1  
ATOM 1641  C CB   . GLN A 1 105 ? 2.531   3.477   8.761   1.00 0.33  ? 105 GLN A CB   1  
ATOM 1642  C CG   . GLN A 1 105 ? 1.249   3.154   9.489   1.00 0.55  ? 105 GLN A CG   1  
ATOM 1643  C CD   . GLN A 1 105 ? 1.038   4.002   10.723  1.00 1.00  ? 105 GLN A CD   1  
ATOM 1644  O OE1  . GLN A 1 105 ? 0.425   5.066   10.662  1.00 1.72  ? 105 GLN A OE1  1  
ATOM 1645  N NE2  . GLN A 1 105 ? 1.546   3.535   11.851  1.00 1.60  ? 105 GLN A NE2  1  
ATOM 1646  H H    . GLN A 1 105 ? 3.878   3.468   6.717   1.00 0.21  ? 105 GLN A H    1  
ATOM 1647  H HA   . GLN A 1 105 ? 1.408   4.489   7.254   1.00 0.34  ? 105 GLN A HA   1  
ATOM 1648  H HB2  . GLN A 1 105 ? 2.902   2.572   8.300   1.00 0.29  ? 105 GLN A HB2  1  
ATOM 1649  H HB3  . GLN A 1 105 ? 3.249   3.801   9.482   1.00 0.36  ? 105 GLN A HB3  1  
ATOM 1650  H HG2  . GLN A 1 105 ? 0.428   3.321   8.816   1.00 0.67  ? 105 GLN A HG2  1  
ATOM 1651  H HG3  . GLN A 1 105 ? 1.271   2.118   9.776   1.00 0.76  ? 105 GLN A HG3  1  
ATOM 1652  H HE21 . GLN A 1 105 ? 2.024   2.678   11.821  1.00 2.10  ? 105 GLN A HE21 1  
ATOM 1653  H HE22 . GLN A 1 105 ? 1.427   4.063   12.671  1.00 1.93  ? 105 GLN A HE22 1  
ATOM 1654  N N    . GLN A 1 106 ? 3.764   6.272   8.742   1.00 0.23  ? 106 GLN A N    1  
ATOM 1655  C CA   . GLN A 1 106 ? 4.026   7.528   9.424   1.00 0.25  ? 106 GLN A CA   1  
ATOM 1656  C C    . GLN A 1 106 ? 3.832   8.731   8.514   1.00 0.22  ? 106 GLN A C    1  
ATOM 1657  O O    . GLN A 1 106 ? 3.135   9.667   8.886   1.00 0.25  ? 106 GLN A O    1  
ATOM 1658  C CB   . GLN A 1 106 ? 5.435   7.524   10.000  1.00 0.31  ? 106 GLN A CB   1  
ATOM 1659  C CG   . GLN A 1 106 ? 5.572   6.679   11.255  1.00 0.37  ? 106 GLN A CG   1  
ATOM 1660  C CD   . GLN A 1 106 ? 4.739   7.206   12.408  1.00 1.40  ? 106 GLN A CD   1  
ATOM 1661  O OE1  . GLN A 1 106 ? 4.513   8.413   12.531  1.00 2.15  ? 106 GLN A OE1  1  
ATOM 1662  N NE2  . GLN A 1 106 ? 4.275   6.308   13.260  1.00 2.21  ? 106 GLN A NE2  1  
ATOM 1663  H H    . GLN A 1 106 ? 4.509   5.650   8.593   1.00 0.23  ? 106 GLN A H    1  
ATOM 1664  H HA   . GLN A 1 106 ? 3.322   7.607   10.240  1.00 0.28  ? 106 GLN A HA   1  
ATOM 1665  H HB2  . GLN A 1 106 ? 6.110   7.137   9.256   1.00 0.34  ? 106 GLN A HB2  1  
ATOM 1666  H HB3  . GLN A 1 106 ? 5.716   8.533   10.237  1.00 0.36  ? 106 GLN A HB3  1  
ATOM 1667  H HG2  . GLN A 1 106 ? 5.253   5.671   11.033  1.00 0.87  ? 106 GLN A HG2  1  
ATOM 1668  H HG3  . GLN A 1 106 ? 6.607   6.670   11.554  1.00 0.89  ? 106 GLN A HG3  1  
ATOM 1669  H HE21 . GLN A 1 106 ? 4.492   5.364   13.103  1.00 2.44  ? 106 GLN A HE21 1  
ATOM 1670  H HE22 . GLN A 1 106 ? 3.728   6.621   14.013  1.00 2.91  ? 106 GLN A HE22 1  
ATOM 1671  N N    . ILE A 1 107 ? 4.430   8.714   7.324   1.00 0.21  ? 107 ILE A N    1  
ATOM 1672  C CA   . ILE A 1 107 ? 4.319   9.857   6.419   1.00 0.23  ? 107 ILE A CA   1  
ATOM 1673  C C    . ILE A 1 107 ? 2.865   10.077  6.021   1.00 0.26  ? 107 ILE A C    1  
ATOM 1674  O O    . ILE A 1 107 ? 2.376   11.205  6.017   1.00 0.31  ? 107 ILE A O    1  
ATOM 1675  C CB   . ILE A 1 107 ? 5.173   9.699   5.145   1.00 0.25  ? 107 ILE A CB   1  
ATOM 1676  C CG1  . ILE A 1 107 ? 6.618   9.338   5.488   1.00 0.22  ? 107 ILE A CG1  1  
ATOM 1677  C CG2  . ILE A 1 107 ? 5.142   10.991  4.348   1.00 0.39  ? 107 ILE A CG2  1  
ATOM 1678  C CD1  . ILE A 1 107 ? 7.472   9.039   4.275   1.00 0.25  ? 107 ILE A CD1  1  
ATOM 1679  H H    . ILE A 1 107 ? 4.945   7.923   7.049   1.00 0.21  ? 107 ILE A H    1  
ATOM 1680  H HA   . ILE A 1 107 ? 4.662   10.732  6.953   1.00 0.25  ? 107 ILE A HA   1  
ATOM 1681  H HB   . ILE A 1 107 ? 4.742   8.917   4.541   1.00 0.27  ? 107 ILE A HB   1  
ATOM 1682  H HG12 . ILE A 1 107 ? 7.074   10.158  6.022   1.00 0.27  ? 107 ILE A HG12 1  
ATOM 1683  H HG13 . ILE A 1 107 ? 6.620   8.464   6.112   1.00 0.20  ? 107 ILE A HG13 1  
ATOM 1684  H HG21 . ILE A 1 107 ? 5.364   11.823  5.001   1.00 1.16  ? 107 ILE A HG21 1  
ATOM 1685  H HG22 . ILE A 1 107 ? 4.163   11.125  3.913   1.00 0.94  ? 107 ILE A HG22 1  
ATOM 1686  H HG23 . ILE A 1 107 ? 5.881   10.945  3.566   1.00 1.11  ? 107 ILE A HG23 1  
ATOM 1687  H HD11 . ILE A 1 107 ? 7.492   9.904   3.629   1.00 1.05  ? 107 ILE A HD11 1  
ATOM 1688  H HD12 . ILE A 1 107 ? 7.056   8.198   3.740   1.00 1.08  ? 107 ILE A HD12 1  
ATOM 1689  H HD13 . ILE A 1 107 ? 8.477   8.802   4.592   1.00 0.99  ? 107 ILE A HD13 1  
ATOM 1690  N N    . ILE A 1 108 ? 2.180   8.985   5.710   1.00 0.26  ? 108 ILE A N    1  
ATOM 1691  C CA   . ILE A 1 108 ? 0.750   9.013   5.436   1.00 0.30  ? 108 ILE A CA   1  
ATOM 1692  C C    . ILE A 1 108 ? 0.007   9.684   6.586   1.00 0.33  ? 108 ILE A C    1  
ATOM 1693  O O    . ILE A 1 108 ? -0.800  10.592  6.381   1.00 0.40  ? 108 ILE A O    1  
ATOM 1694  C CB   . ILE A 1 108 ? 0.217   7.577   5.239   1.00 0.32  ? 108 ILE A CB   1  
ATOM 1695  C CG1  . ILE A 1 108 ? 0.619   7.048   3.861   1.00 0.35  ? 108 ILE A CG1  1  
ATOM 1696  C CG2  . ILE A 1 108 ? -1.290  7.509   5.431   1.00 0.32  ? 108 ILE A CG2  1  
ATOM 1697  C CD1  . ILE A 1 108 ? 0.301   5.582   3.659   1.00 0.39  ? 108 ILE A CD1  1  
ATOM 1698  H H    . ILE A 1 108 ? 2.654   8.122   5.665   1.00 0.24  ? 108 ILE A H    1  
ATOM 1699  H HA   . ILE A 1 108 ? 0.583   9.578   4.527   1.00 0.33  ? 108 ILE A HA   1  
ATOM 1700  H HB   . ILE A 1 108 ? 0.671   6.951   5.994   1.00 0.35  ? 108 ILE A HB   1  
ATOM 1701  H HG12 . ILE A 1 108 ? 0.095   7.607   3.102   1.00 0.35  ? 108 ILE A HG12 1  
ATOM 1702  H HG13 . ILE A 1 108 ? 1.683   7.179   3.729   1.00 0.41  ? 108 ILE A HG13 1  
ATOM 1703  H HG21 . ILE A 1 108 ? -1.778  8.080   4.654   1.00 1.09  ? 108 ILE A HG21 1  
ATOM 1704  H HG22 . ILE A 1 108 ? -1.549  7.921   6.403   1.00 0.95  ? 108 ILE A HG22 1  
ATOM 1705  H HG23 . ILE A 1 108 ? -1.612  6.480   5.382   1.00 1.05  ? 108 ILE A HG23 1  
ATOM 1706  H HD11 . ILE A 1 108 ? 0.812   4.997   4.409   1.00 1.14  ? 108 ILE A HD11 1  
ATOM 1707  H HD12 . ILE A 1 108 ? 0.631   5.275   2.677   1.00 1.06  ? 108 ILE A HD12 1  
ATOM 1708  H HD13 . ILE A 1 108 ? -0.765  5.429   3.746   1.00 1.08  ? 108 ILE A HD13 1  
ATOM 1709  N N    . SER A 1 109 ? 0.308   9.246   7.794   1.00 0.31  ? 109 SER A N    1  
ATOM 1710  C CA   . SER A 1 109 ? -0.316  9.765   8.980   1.00 0.35  ? 109 SER A CA   1  
ATOM 1711  C C    . SER A 1 109 ? 0.121   11.205  9.277   1.00 0.39  ? 109 SER A C    1  
ATOM 1712  O O    . SER A 1 109 ? -0.589  11.937  9.961   1.00 0.46  ? 109 SER A O    1  
ATOM 1713  C CB   . SER A 1 109 ? 0.014   8.834   10.132  1.00 0.36  ? 109 SER A CB   1  
ATOM 1714  O OG   . SER A 1 109 ? -0.536  7.548   9.901   1.00 1.32  ? 109 SER A OG   1  
ATOM 1715  H H    . SER A 1 109 ? 0.971   8.531   7.897   1.00 0.28  ? 109 SER A H    1  
ATOM 1716  H HA   . SER A 1 109 ? -1.390  9.754   8.822   1.00 0.41  ? 109 SER A HA   1  
ATOM 1717  H HB2  . SER A 1 109 ? 1.092   8.742   10.234  1.00 0.81  ? 109 SER A HB2  1  
ATOM 1718  H HB3  . SER A 1 109 ? -0.401  9.231   11.024  1.00 1.05  ? 109 SER A HB3  1  
ATOM 1719  H HG   . SER A 1 109 ? 0.181   6.920   9.723   1.00 1.90  ? 109 SER A HG   1  
ATOM 1720  N N    . ARG A 1 110 ? 1.271   11.621  8.747   1.00 0.38  ? 110 ARG A N    1  
ATOM 1721  C CA   . ARG A 1 110 ? 1.708   13.013  8.876   1.00 0.43  ? 110 ARG A CA   1  
ATOM 1722  C C    . ARG A 1 110 ? 0.796   13.926  8.070   1.00 0.48  ? 110 ARG A C    1  
ATOM 1723  O O    . ARG A 1 110 ? 0.678   15.113  8.355   1.00 0.62  ? 110 ARG A O    1  
ATOM 1724  C CB   . ARG A 1 110 ? 3.147   13.207  8.412   1.00 0.45  ? 110 ARG A CB   1  
ATOM 1725  C CG   . ARG A 1 110 ? 4.176   12.488  9.239   1.00 0.97  ? 110 ARG A CG   1  
ATOM 1726  C CD   . ARG A 1 110 ? 5.531   12.615  8.586   1.00 0.88  ? 110 ARG A CD   1  
ATOM 1727  N NE   . ARG A 1 110 ? 6.547   11.789  9.233   1.00 1.78  ? 110 ARG A NE   1  
ATOM 1728  C CZ   . ARG A 1 110 ? 7.650   11.363  8.620   1.00 1.98  ? 110 ARG A CZ   1  
ATOM 1729  N NH1  . ARG A 1 110 ? 7.918   11.763  7.382   1.00 1.39  ? 110 ARG A NH1  1  
ATOM 1730  N NH2  . ARG A 1 110 ? 8.496   10.562  9.249   1.00 2.87  ? 110 ARG A NH2  1  
ATOM 1731  H H    . ARG A 1 110 ? 1.844   10.978  8.270   1.00 0.36  ? 110 ARG A H    1  
ATOM 1732  H HA   . ARG A 1 110 ? 1.644   13.282  9.913   1.00 0.48  ? 110 ARG A HA   1  
ATOM 1733  H HB2  . ARG A 1 110 ? 3.243   12.869  7.402   1.00 0.98  ? 110 ARG A HB2  1  
ATOM 1734  H HB3  . ARG A 1 110 ? 3.380   14.256  8.448   1.00 1.02  ? 110 ARG A HB3  1  
ATOM 1735  H HG2  . ARG A 1 110 ? 4.209   12.938  10.217  1.00 1.52  ? 110 ARG A HG2  1  
ATOM 1736  H HG3  . ARG A 1 110 ? 3.912   11.444  9.317   1.00 1.51  ? 110 ARG A HG3  1  
ATOM 1737  H HD2  . ARG A 1 110 ? 5.440   12.317  7.557   1.00 0.91  ? 110 ARG A HD2  1  
ATOM 1738  H HD3  . ARG A 1 110 ? 5.830   13.647  8.628   1.00 0.92  ? 110 ARG A HD3  1  
ATOM 1739  H HE   . ARG A 1 110 ? 6.384   11.521  10.168  1.00 2.33  ? 110 ARG A HE   1  
ATOM 1740  H HH11 . ARG A 1 110 ? 7.295   12.389  6.909   1.00 0.94  ? 110 ARG A HH11 1  
ATOM 1741  H HH12 . ARG A 1 110 ? 8.740   11.437  6.907   1.00 1.59  ? 110 ARG A HH12 1  
ATOM 1742  H HH21 . ARG A 1 110 ? 8.310   10.273  10.192  1.00 3.42  ? 110 ARG A HH21 1  
ATOM 1743  H HH22 . ARG A 1 110 ? 9.322   10.234  8.785   1.00 3.03  ? 110 ARG A HH22 1  
ATOM 1744  N N    . TYR A 1 111 ? 0.158   13.356  7.058   1.00 0.44  ? 111 TYR A N    1  
ATOM 1745  C CA   . TYR A 1 111 ? -0.795  14.085  6.235   1.00 0.51  ? 111 TYR A CA   1  
ATOM 1746  C C    . TYR A 1 111 ? -2.184  14.007  6.857   1.00 0.61  ? 111 TYR A C    1  
ATOM 1747  O O    . TYR A 1 111 ? -3.078  14.784  6.525   1.00 0.75  ? 111 TYR A O    1  
ATOM 1748  C CB   . TYR A 1 111 ? -0.804  13.505  4.818   1.00 0.51  ? 111 TYR A CB   1  
ATOM 1749  C CG   . TYR A 1 111 ? 0.533   13.607  4.136   1.00 0.76  ? 111 TYR A CG   1  
ATOM 1750  C CD1  . TYR A 1 111 ? 1.233   14.803  4.124   1.00 1.67  ? 111 TYR A CD1  1  
ATOM 1751  C CD2  . TYR A 1 111 ? 1.104   12.504  3.520   1.00 0.79  ? 111 TYR A CD2  1  
ATOM 1752  C CE1  . TYR A 1 111 ? 2.466   14.900  3.517   1.00 2.33  ? 111 TYR A CE1  1  
ATOM 1753  C CE2  . TYR A 1 111 ? 2.337   12.591  2.914   1.00 1.30  ? 111 TYR A CE2  1  
ATOM 1754  C CZ   . TYR A 1 111 ? 3.014   13.793  2.914   1.00 2.05  ? 111 TYR A CZ   1  
ATOM 1755  O OH   . TYR A 1 111 ? 4.246   13.887  2.321   1.00 2.75  ? 111 TYR A OH   1  
ATOM 1756  H H    . TYR A 1 111 ? 0.344   12.414  6.848   1.00 0.38  ? 111 TYR A H    1  
ATOM 1757  H HA   . TYR A 1 111 ? -0.485  15.119  6.197   1.00 0.58  ? 111 TYR A HA   1  
ATOM 1758  H HB2  . TYR A 1 111 ? -1.073  12.461  4.865   1.00 0.92  ? 111 TYR A HB2  1  
ATOM 1759  H HB3  . TYR A 1 111 ? -1.524  14.028  4.216   1.00 0.90  ? 111 TYR A HB3  1  
ATOM 1760  H HD1  . TYR A 1 111 ? 0.798   15.671  4.599   1.00 1.98  ? 111 TYR A HD1  1  
ATOM 1761  H HD2  . TYR A 1 111 ? 0.572   11.566  3.519   1.00 1.04  ? 111 TYR A HD2  1  
ATOM 1762  H HE1  . TYR A 1 111 ? 2.994   15.841  3.517   1.00 3.10  ? 111 TYR A HE1  1  
ATOM 1763  H HE2  . TYR A 1 111 ? 2.764   11.720  2.440   1.00 1.39  ? 111 TYR A HE2  1  
ATOM 1764  H HH   . TYR A 1 111 ? 4.847   14.366  2.910   1.00 2.95  ? 111 TYR A HH   1  
ATOM 1765  N N    . LYS A 1 112 ? -2.336  13.072  7.779   1.00 0.60  ? 112 LYS A N    1  
ATOM 1766  C CA   . LYS A 1 112 ? -3.585  12.874  8.493   1.00 0.72  ? 112 LYS A CA   1  
ATOM 1767  C C    . LYS A 1 112 ? -3.635  13.725  9.753   1.00 0.82  ? 112 LYS A C    1  
ATOM 1768  O O    . LYS A 1 112 ? -4.594  14.463  9.983   1.00 1.00  ? 112 LYS A O    1  
ATOM 1769  C CB   . LYS A 1 112 ? -3.744  11.406  8.834   1.00 0.65  ? 112 LYS A CB   1  
ATOM 1770  C CG   . LYS A 1 112 ? -4.353  10.637  7.714   1.00 0.66  ? 112 LYS A CG   1  
ATOM 1771  C CD   . LYS A 1 112 ? -3.561  9.415   7.397   1.00 0.79  ? 112 LYS A CD   1  
ATOM 1772  C CE   . LYS A 1 112 ? -4.361  8.542   6.498   1.00 1.06  ? 112 LYS A CE   1  
ATOM 1773  N NZ   . LYS A 1 112 ? -4.466  9.084   5.116   1.00 1.63  ? 112 LYS A NZ   1  
ATOM 1774  H H    . LYS A 1 112 ? -1.575  12.491  7.988   1.00 0.53  ? 112 LYS A H    1  
ATOM 1775  H HA   . LYS A 1 112 ? -4.395  13.156  7.836   1.00 0.83  ? 112 LYS A HA   1  
ATOM 1776  H HB2  . LYS A 1 112 ? -2.780  10.981  9.041   1.00 1.01  ? 112 LYS A HB2  1  
ATOM 1777  H HB3  . LYS A 1 112 ? -4.368  11.300  9.695   1.00 0.83  ? 112 LYS A HB3  1  
ATOM 1778  H HG2  . LYS A 1 112 ? -5.357  10.350  7.980   1.00 0.90  ? 112 LYS A HG2  1  
ATOM 1779  H HG3  . LYS A 1 112 ? -4.372  11.259  6.847   1.00 1.12  ? 112 LYS A HG3  1  
ATOM 1780  H HD2  . LYS A 1 112 ? -2.665  9.715   6.890   1.00 0.91  ? 112 LYS A HD2  1  
ATOM 1781  H HD3  . LYS A 1 112 ? -3.324  8.884   8.306   1.00 0.95  ? 112 LYS A HD3  1  
ATOM 1782  H HE2  . LYS A 1 112 ? -3.923  7.561   6.470   1.00 1.20  ? 112 LYS A HE2  1  
ATOM 1783  H HE3  . LYS A 1 112 ? -5.335  8.496   6.925   1.00 1.67  ? 112 LYS A HE3  1  
ATOM 1784  H HZ1  . LYS A 1 112 ? -3.524  9.194   4.696   1.00 2.18  ? 112 LYS A HZ1  1  
ATOM 1785  H HZ2  . LYS A 1 112 ? -4.937  10.012  5.127   1.00 2.02  ? 112 LYS A HZ2  1  
ATOM 1786  H HZ3  . LYS A 1 112 ? -5.026  8.438   4.524   1.00 2.08  ? 112 LYS A HZ3  1  
ATOM 1787  N N    . ASP A 1 113 ? -2.594  13.612  10.563  1.00 0.77  ? 113 ASP A N    1  
ATOM 1788  C CA   . ASP A 1 113 ? -2.476  14.396  11.784  1.00 0.91  ? 113 ASP A CA   1  
ATOM 1789  C C    . ASP A 1 113 ? -2.099  15.825  11.435  1.00 0.99  ? 113 ASP A C    1  
ATOM 1790  O O    . ASP A 1 113 ? -2.534  16.786  12.073  1.00 1.15  ? 113 ASP A O    1  
ATOM 1791  C CB   . ASP A 1 113 ? -1.418  13.782  12.696  1.00 0.91  ? 113 ASP A CB   1  
ATOM 1792  C CG   . ASP A 1 113 ? -1.394  14.401  14.076  1.00 1.31  ? 113 ASP A CG   1  
ATOM 1793  O OD1  . ASP A 1 113 ? -2.408  14.298  14.797  1.00 1.55  ? 113 ASP A OD1  1  
ATOM 1794  O OD2  . ASP A 1 113 ? -0.354  14.980  14.456  1.00 1.60  ? 113 ASP A OD2  1  
ATOM 1795  H H    . ASP A 1 113 ? -1.880  12.975  10.335  1.00 0.66  ? 113 ASP A H    1  
ATOM 1796  H HA   . ASP A 1 113 ? -3.432  14.392  12.286  1.00 1.01  ? 113 ASP A HA   1  
ATOM 1797  H HB2  . ASP A 1 113 ? -1.607  12.733  12.792  1.00 0.88  ? 113 ASP A HB2  1  
ATOM 1798  H HB3  . ASP A 1 113 ? -0.449  13.916  12.246  1.00 0.93  ? 113 ASP A HB3  1  
ATOM 1799  N N    . ALA A 1 114 ? -1.276  15.922  10.392  1.00 0.91  ? 114 ALA A N    1  
ATOM 1800  C CA   . ALA A 1 114 ? -0.916  17.189  9.757   1.00 0.99  ? 114 ALA A CA   1  
ATOM 1801  C C    . ALA A 1 114 ? -0.164  18.111  10.702  1.00 1.16  ? 114 ALA A C    1  
ATOM 1802  O O    . ALA A 1 114 ? -0.264  19.336  10.602  1.00 1.33  ? 114 ALA A O    1  
ATOM 1803  C CB   . ALA A 1 114 ? -2.151  17.877  9.202   1.00 1.07  ? 114 ALA A CB   1  
ATOM 1804  H H    . ALA A 1 114 ? -0.886  15.094  10.038  1.00 0.81  ? 114 ALA A H    1  
ATOM 1805  H HA   . ALA A 1 114 ? -0.269  16.958  8.922   1.00 0.95  ? 114 ALA A HA   1  
ATOM 1806  H HB1  . ALA A 1 114 ? -1.858  18.780  8.690   1.00 1.53  ? 114 ALA A HB1  1  
ATOM 1807  H HB2  . ALA A 1 114 ? -2.816  18.122  10.014  1.00 1.53  ? 114 ALA A HB2  1  
ATOM 1808  H HB3  . ALA A 1 114 ? -2.651  17.214  8.512   1.00 1.42  ? 114 ALA A HB3  1  
ATOM 1809  N N    . ASP A 1 115 ? 0.590   17.520  11.607  1.00 1.20  ? 115 ASP A N    1  
ATOM 1810  C CA   . ASP A 1 115 ? 1.404   18.282  12.540  1.00 1.43  ? 115 ASP A CA   1  
ATOM 1811  C C    . ASP A 1 115 ? 2.874   18.046  12.253  1.00 1.61  ? 115 ASP A C    1  
ATOM 1812  O O    . ASP A 1 115 ? 3.509   18.916  11.624  1.00 2.01  ? 115 ASP A O    1  
ATOM 1813  C CB   . ASP A 1 115 ? 1.083   17.893  13.981  1.00 1.66  ? 115 ASP A CB   1  
ATOM 1814  C CG   . ASP A 1 115 ? 1.837   18.739  14.987  1.00 1.90  ? 115 ASP A CG   1  
ATOM 1815  O OD1  . ASP A 1 115 ? 1.417   19.886  15.246  1.00 2.23  ? 115 ASP A OD1  1  
ATOM 1816  O OD2  . ASP A 1 115 ? 2.864   18.264  15.514  1.00 1.96  ? 115 ASP A OD2  1  
ATOM 1817  O OXT  . ASP A 1 115 ? 3.386   16.971  12.622  1.00 2.09  ? 115 ASP A OXT  1  
ATOM 1818  H H    . ASP A 1 115 ? 0.606   16.544  11.647  1.00 1.12  ? 115 ASP A H    1  
ATOM 1819  H HA   . ASP A 1 115 ? 1.182   19.329  12.396  1.00 1.58  ? 115 ASP A HA   1  
ATOM 1820  H HB2  . ASP A 1 115 ? 0.027   18.017  14.154  1.00 1.77  ? 115 ASP A HB2  1  
ATOM 1821  H HB3  . ASP A 1 115 ? 1.351   16.859  14.136  1.00 1.74  ? 115 ASP A HB3  1  
ATOM 1822  N N    . ASP B 2 1   ? -7.269  -12.287 -12.710 1.00 2.92  ? 22  ASP B N    1  
ATOM 1823  C CA   . ASP B 2 1   ? -7.467  -13.688 -12.270 1.00 2.59  ? 22  ASP B CA   1  
ATOM 1824  C C    . ASP B 2 1   ? -6.635  -13.984 -11.024 1.00 2.27  ? 22  ASP B C    1  
ATOM 1825  O O    . ASP B 2 1   ? -7.142  -14.540 -10.051 1.00 2.08  ? 22  ASP B O    1  
ATOM 1826  C CB   . ASP B 2 1   ? -7.096  -14.665 -13.395 1.00 2.80  ? 22  ASP B CB   1  
ATOM 1827  C CG   . ASP B 2 1   ? -5.632  -14.595 -13.775 1.00 3.30  ? 22  ASP B CG   1  
ATOM 1828  O OD1  . ASP B 2 1   ? -5.168  -13.514 -14.190 1.00 3.79  ? 22  ASP B OD1  1  
ATOM 1829  O OD2  . ASP B 2 1   ? -4.944  -15.633 -13.678 1.00 3.65  ? 22  ASP B OD2  1  
ATOM 1830  H H1   . ASP B 2 1   ? -7.849  -12.090 -13.546 1.00 3.10  ? 22  ASP B H1   1  
ATOM 1831  H H2   . ASP B 2 1   ? -6.271  -12.123 -12.949 1.00 3.28  ? 22  ASP B H2   1  
ATOM 1832  H H3   . ASP B 2 1   ? -7.548  -11.632 -11.945 1.00 3.12  ? 22  ASP B H3   1  
ATOM 1833  H HA   . ASP B 2 1   ? -8.511  -13.816 -12.023 1.00 2.62  ? 22  ASP B HA   1  
ATOM 1834  H HB2  . ASP B 2 1   ? -7.315  -15.672 -13.076 1.00 2.95  ? 22  ASP B HB2  1  
ATOM 1835  H HB3  . ASP B 2 1   ? -7.687  -14.435 -14.271 1.00 3.06  ? 22  ASP B HB3  1  
ATOM 1836  N N    . THR B 2 2   ? -5.371  -13.577 -11.040 1.00 2.32  ? 23  THR B N    1  
ATOM 1837  C CA   . THR B 2 2   ? -4.470  -13.838 -9.930  1.00 2.14  ? 23  THR B CA   1  
ATOM 1838  C C    . THR B 2 2   ? -4.610  -12.784 -8.843  1.00 1.87  ? 23  THR B C    1  
ATOM 1839  O O    . THR B 2 2   ? -4.684  -13.113 -7.658  1.00 1.65  ? 23  THR B O    1  
ATOM 1840  C CB   . THR B 2 2   ? -3.016  -13.886 -10.409 1.00 2.44  ? 23  THR B CB   1  
ATOM 1841  O OG1  . THR B 2 2   ? -2.777  -12.808 -11.321 1.00 2.75  ? 23  THR B OG1  1  
ATOM 1842  C CG2  . THR B 2 2   ? -2.703  -15.212 -11.084 1.00 2.78  ? 23  THR B CG2  1  
ATOM 1843  H H    . THR B 2 2   ? -5.027  -13.097 -11.825 1.00 2.56  ? 23  THR B H    1  
ATOM 1844  H HA   . THR B 2 2   ? -4.719  -14.803 -9.515  1.00 2.12  ? 23  THR B HA   1  
ATOM 1845  H HB   . THR B 2 2   ? -2.374  -13.772 -9.551  1.00 2.61  ? 23  THR B HB   1  
ATOM 1846  H HG1  . THR B 2 2   ? -1.943  -12.959 -11.784 1.00 3.07  ? 23  THR B HG1  1  
ATOM 1847  H HG21 . THR B 2 2   ? -2.850  -16.018 -10.380 1.00 3.18  ? 23  THR B HG21 1  
ATOM 1848  H HG22 . THR B 2 2   ? -1.677  -15.212 -11.421 1.00 3.12  ? 23  THR B HG22 1  
ATOM 1849  H HG23 . THR B 2 2   ? -3.360  -15.348 -11.930 1.00 2.90  ? 23  THR B HG23 1  
ATOM 1850  N N    . GLN B 2 3   ? -4.664  -11.518 -9.257  1.00 1.97  ? 24  GLN B N    1  
ATOM 1851  C CA   . GLN B 2 3   ? -4.844  -10.401 -8.331  1.00 1.86  ? 24  GLN B CA   1  
ATOM 1852  C C    . GLN B 2 3   ? -6.114  -10.591 -7.515  1.00 1.69  ? 24  GLN B C    1  
ATOM 1853  O O    . GLN B 2 3   ? -6.207  -10.163 -6.364  1.00 1.59  ? 24  GLN B O    1  
ATOM 1854  C CB   . GLN B 2 3   ? -4.925  -9.085  -9.104  1.00 2.14  ? 24  GLN B CB   1  
ATOM 1855  C CG   . GLN B 2 3   ? -3.660  -8.750  -9.876  1.00 2.53  ? 24  GLN B CG   1  
ATOM 1856  C CD   . GLN B 2 3   ? -3.853  -7.592  -10.839 1.00 3.01  ? 24  GLN B CD   1  
ATOM 1857  O OE1  . GLN B 2 3   ? -4.671  -6.700  -10.609 1.00 3.39  ? 24  GLN B OE1  1  
ATOM 1858  N NE2  . GLN B 2 3   ? -3.101  -7.602  -11.928 1.00 3.58  ? 24  GLN B NE2  1  
ATOM 1859  H H    . GLN B 2 3   ? -4.573  -11.329 -10.217 1.00 2.18  ? 24  GLN B H    1  
ATOM 1860  H HA   . GLN B 2 3   ? -3.994  -10.372 -7.665  1.00 1.79  ? 24  GLN B HA   1  
ATOM 1861  H HB2  . GLN B 2 3   ? -5.743  -9.144  -9.805  1.00 2.52  ? 24  GLN B HB2  1  
ATOM 1862  H HB3  . GLN B 2 3   ? -5.118  -8.284  -8.406  1.00 2.37  ? 24  GLN B HB3  1  
ATOM 1863  H HG2  . GLN B 2 3   ? -2.883  -8.487  -9.174  1.00 2.85  ? 24  GLN B HG2  1  
ATOM 1864  H HG3  . GLN B 2 3   ? -3.358  -9.619  -10.438 1.00 2.92  ? 24  GLN B HG3  1  
ATOM 1865  H HE21 . GLN B 2 3   ? -2.469  -8.346  -12.046 1.00 3.72  ? 24  GLN B HE21 1  
ATOM 1866  H HE22 . GLN B 2 3   ? -3.206  -6.871  -12.572 1.00 4.10  ? 24  GLN B HE22 1  
ATOM 1867  N N    . ASP B 2 4   ? -7.077  -11.264 -8.126  1.00 1.74  ? 25  ASP B N    1  
ATOM 1868  C CA   . ASP B 2 4   ? -8.361  -11.540 -7.498  1.00 1.67  ? 25  ASP B CA   1  
ATOM 1869  C C    . ASP B 2 4   ? -8.180  -12.440 -6.285  1.00 1.46  ? 25  ASP B C    1  
ATOM 1870  O O    . ASP B 2 4   ? -8.845  -12.266 -5.267  1.00 1.37  ? 25  ASP B O    1  
ATOM 1871  C CB   . ASP B 2 4   ? -9.303  -12.203 -8.504  1.00 1.88  ? 25  ASP B CB   1  
ATOM 1872  C CG   . ASP B 2 4   ? -9.476  -11.375 -9.760  1.00 2.23  ? 25  ASP B CG   1  
ATOM 1873  O OD1  . ASP B 2 4   ? -8.525  -11.319 -10.571 1.00 2.67  ? 25  ASP B OD1  1  
ATOM 1874  O OD2  . ASP B 2 4   ? -10.555 -10.775 -9.942  1.00 2.56  ? 25  ASP B OD2  1  
ATOM 1875  H H    . ASP B 2 4   ? -6.918  -11.586 -9.040  1.00 1.88  ? 25  ASP B H    1  
ATOM 1876  H HA   . ASP B 2 4   ? -8.788  -10.600 -7.179  1.00 1.70  ? 25  ASP B HA   1  
ATOM 1877  H HB2  . ASP B 2 4   ? -8.901  -13.165 -8.783  1.00 2.16  ? 25  ASP B HB2  1  
ATOM 1878  H HB3  . ASP B 2 4   ? -10.272 -12.339 -8.048  1.00 2.05  ? 25  ASP B HB3  1  
ATOM 1879  N N    . ASP B 2 5   ? -7.264  -13.396 -6.396  1.00 1.48  ? 26  ASP B N    1  
ATOM 1880  C CA   . ASP B 2 5   ? -6.964  -14.304 -5.292  1.00 1.38  ? 26  ASP B CA   1  
ATOM 1881  C C    . ASP B 2 5   ? -6.130  -13.607 -4.229  1.00 1.16  ? 26  ASP B C    1  
ATOM 1882  O O    . ASP B 2 5   ? -6.173  -13.974 -3.058  1.00 1.08  ? 26  ASP B O    1  
ATOM 1883  C CB   . ASP B 2 5   ? -6.223  -15.547 -5.789  1.00 1.61  ? 26  ASP B CB   1  
ATOM 1884  C CG   . ASP B 2 5   ? -7.151  -16.578 -6.394  1.00 1.69  ? 26  ASP B CG   1  
ATOM 1885  O OD1  . ASP B 2 5   ? -7.650  -17.448 -5.652  1.00 1.79  ? 26  ASP B OD1  1  
ATOM 1886  O OD2  . ASP B 2 5   ? -7.392  -16.522 -7.615  1.00 2.16  ? 26  ASP B OD2  1  
ATOM 1887  H H    . ASP B 2 5   ? -6.775  -13.494 -7.241  1.00 1.64  ? 26  ASP B H    1  
ATOM 1888  H HA   . ASP B 2 5   ? -7.902  -14.608 -4.853  1.00 1.41  ? 26  ASP B HA   1  
ATOM 1889  H HB2  . ASP B 2 5   ? -5.507  -15.254 -6.542  1.00 2.03  ? 26  ASP B HB2  1  
ATOM 1890  H HB3  . ASP B 2 5   ? -5.701  -16.001 -4.961  1.00 1.90  ? 26  ASP B HB3  1  
ATOM 1891  N N    . PHE B 2 6   ? -5.380  -12.592 -4.643  1.00 1.18  ? 27  PHE B N    1  
ATOM 1892  C CA   . PHE B 2 6   ? -4.530  -11.845 -3.723  1.00 1.13  ? 27  PHE B CA   1  
ATOM 1893  C C    . PHE B 2 6   ? -5.350  -11.123 -2.657  1.00 1.08  ? 27  PHE B C    1  
ATOM 1894  O O    . PHE B 2 6   ? -4.919  -10.993 -1.514  1.00 1.20  ? 27  PHE B O    1  
ATOM 1895  C CB   . PHE B 2 6   ? -3.655  -10.847 -4.485  1.00 1.30  ? 27  PHE B CB   1  
ATOM 1896  C CG   . PHE B 2 6   ? -2.356  -11.424 -4.971  1.00 1.11  ? 27  PHE B CG   1  
ATOM 1897  C CD1  . PHE B 2 6   ? -2.275  -12.059 -6.198  1.00 1.45  ? 27  PHE B CD1  1  
ATOM 1898  C CD2  . PHE B 2 6   ? -1.213  -11.325 -4.197  1.00 1.14  ? 27  PHE B CD2  1  
ATOM 1899  C CE1  . PHE B 2 6   ? -1.078  -12.588 -6.643  1.00 1.84  ? 27  PHE B CE1  1  
ATOM 1900  C CE2  . PHE B 2 6   ? -0.014  -11.852 -4.635  1.00 1.16  ? 27  PHE B CE2  1  
ATOM 1901  C CZ   . PHE B 2 6   ? 0.053   -12.483 -5.860  1.00 1.59  ? 27  PHE B CZ   1  
ATOM 1902  H H    . PHE B 2 6   ? -5.396  -12.344 -5.591  1.00 1.30  ? 27  PHE B H    1  
ATOM 1903  H HA   . PHE B 2 6   ? -3.890  -12.561 -3.225  1.00 1.14  ? 27  PHE B HA   1  
ATOM 1904  H HB2  . PHE B 2 6   ? -4.200  -10.488 -5.345  1.00 1.57  ? 27  PHE B HB2  1  
ATOM 1905  H HB3  . PHE B 2 6   ? -3.429  -10.016 -3.840  1.00 1.63  ? 27  PHE B HB3  1  
ATOM 1906  H HD1  . PHE B 2 6   ? -3.160  -12.142 -6.812  1.00 1.68  ? 27  PHE B HD1  1  
ATOM 1907  H HD2  . PHE B 2 6   ? -1.263  -10.833 -3.237  1.00 1.49  ? 27  PHE B HD2  1  
ATOM 1908  H HE1  . PHE B 2 6   ? -1.028  -13.081 -7.603  1.00 2.44  ? 27  PHE B HE1  1  
ATOM 1909  H HE2  . PHE B 2 6   ? 0.870   -11.768 -4.021  1.00 1.20  ? 27  PHE B HE2  1  
ATOM 1910  H HZ   . PHE B 2 6   ? 0.989   -12.895 -6.205  1.00 1.95  ? 27  PHE B HZ   1  
ATOM 1911  N N    . LEU B 2 7   ? -6.536  -10.664 -3.023  1.00 1.07  ? 28  LEU B N    1  
ATOM 1912  C CA   . LEU B 2 7   ? -7.413  -10.022 -2.057  1.00 1.16  ? 28  LEU B CA   1  
ATOM 1913  C C    . LEU B 2 7   ? -8.180  -11.076 -1.263  1.00 1.10  ? 28  LEU B C    1  
ATOM 1914  O O    . LEU B 2 7   ? -8.751  -10.789 -0.214  1.00 1.17  ? 28  LEU B O    1  
ATOM 1915  C CB   . LEU B 2 7   ? -8.362  -9.031  -2.753  1.00 1.40  ? 28  LEU B CB   1  
ATOM 1916  C CG   . LEU B 2 7   ? -9.309  -9.615  -3.807  1.00 1.80  ? 28  LEU B CG   1  
ATOM 1917  C CD1  . LEU B 2 7   ? -10.562 -10.191 -3.162  1.00 2.39  ? 28  LEU B CD1  1  
ATOM 1918  C CD2  . LEU B 2 7   ? -9.676  -8.554  -4.832  1.00 2.28  ? 28  LEU B CD2  1  
ATOM 1919  H H    . LEU B 2 7   ? -6.825  -10.755 -3.956  1.00 1.12  ? 28  LEU B H    1  
ATOM 1920  H HA   . LEU B 2 7   ? -6.785  -9.474  -1.369  1.00 1.23  ? 28  LEU B HA   1  
ATOM 1921  H HB2  . LEU B 2 7   ? -8.963  -8.557  -1.993  1.00 1.64  ? 28  LEU B HB2  1  
ATOM 1922  H HB3  . LEU B 2 7   ? -7.759  -8.272  -3.230  1.00 2.04  ? 28  LEU B HB3  1  
ATOM 1923  H HG   . LEU B 2 7   ? -8.806  -10.418 -4.325  1.00 2.36  ? 28  LEU B HG   1  
ATOM 1924  H HD11 . LEU B 2 7   ? -10.287 -11.003 -2.506  1.00 2.97  ? 28  LEU B HD11 1  
ATOM 1925  H HD12 . LEU B 2 7   ? -11.226 -10.557 -3.929  1.00 2.48  ? 28  LEU B HD12 1  
ATOM 1926  H HD13 . LEU B 2 7   ? -11.059 -9.422  -2.592  1.00 2.89  ? 28  LEU B HD13 1  
ATOM 1927  H HD21 . LEU B 2 7   ? -8.784  -8.211  -5.331  1.00 2.77  ? 28  LEU B HD21 1  
ATOM 1928  H HD22 . LEU B 2 7   ? -10.153 -7.723  -4.334  1.00 2.61  ? 28  LEU B HD22 1  
ATOM 1929  H HD23 . LEU B 2 7   ? -10.356 -8.975  -5.558  1.00 2.57  ? 28  LEU B HD23 1  
ATOM 1930  N N    . LYS B 2 8   ? -8.172  -12.306 -1.766  1.00 1.07  ? 29  LYS B N    1  
ATOM 1931  C CA   . LYS B 2 8   ? -8.856  -13.403 -1.098  1.00 1.14  ? 29  LYS B CA   1  
ATOM 1932  C C    . LYS B 2 8   ? -8.007  -13.959 0.036   1.00 1.04  ? 29  LYS B C    1  
ATOM 1933  O O    . LYS B 2 8   ? -8.492  -14.120 1.155   1.00 1.06  ? 29  LYS B O    1  
ATOM 1934  C CB   . LYS B 2 8   ? -9.183  -14.525 -2.088  1.00 1.33  ? 29  LYS B CB   1  
ATOM 1935  C CG   . LYS B 2 8   ? -10.196 -14.148 -3.162  1.00 1.71  ? 29  LYS B CG   1  
ATOM 1936  C CD   . LYS B 2 8   ? -11.639 -14.378 -2.717  1.00 1.99  ? 29  LYS B CD   1  
ATOM 1937  C CE   . LYS B 2 8   ? -12.058 -13.445 -1.591  1.00 2.39  ? 29  LYS B CE   1  
ATOM 1938  N NZ   . LYS B 2 8   ? -13.512 -13.543 -1.308  1.00 2.91  ? 29  LYS B NZ   1  
ATOM 1939  H H    . LYS B 2 8   ? -7.690  -12.480 -2.602  1.00 1.09  ? 29  LYS B H    1  
ATOM 1940  H HA   . LYS B 2 8   ? -9.773  -13.015 -0.687  1.00 1.24  ? 29  LYS B HA   1  
ATOM 1941  H HB2  . LYS B 2 8   ? -8.271  -14.824 -2.581  1.00 1.79  ? 29  LYS B HB2  1  
ATOM 1942  H HB3  . LYS B 2 8   ? -9.574  -15.367 -1.537  1.00 1.82  ? 29  LYS B HB3  1  
ATOM 1943  H HG2  . LYS B 2 8   ? -10.073 -13.103 -3.402  1.00 2.29  ? 29  LYS B HG2  1  
ATOM 1944  H HG3  . LYS B 2 8   ? -10.004 -14.743 -4.043  1.00 2.15  ? 29  LYS B HG3  1  
ATOM 1945  H HD2  . LYS B 2 8   ? -12.290 -14.216 -3.560  1.00 2.21  ? 29  LYS B HD2  1  
ATOM 1946  H HD3  . LYS B 2 8   ? -11.738 -15.399 -2.380  1.00 2.44  ? 29  LYS B HD3  1  
ATOM 1947  H HE2  . LYS B 2 8   ? -11.513 -13.711 -0.700  1.00 2.72  ? 29  LYS B HE2  1  
ATOM 1948  H HE3  . LYS B 2 8   ? -11.821 -12.430 -1.873  1.00 2.71  ? 29  LYS B HE3  1  
ATOM 1949  H HZ1  . LYS B 2 8   ? -13.778 -12.873 -0.559  1.00 3.26  ? 29  LYS B HZ1  1  
ATOM 1950  H HZ2  . LYS B 2 8   ? -13.756 -14.504 -0.998  1.00 3.28  ? 29  LYS B HZ2  1  
ATOM 1951  H HZ3  . LYS B 2 8   ? -14.061 -13.317 -2.165  1.00 3.20  ? 29  LYS B HZ3  1  
ATOM 1952  N N    . TRP B 2 9   ? -6.732  -14.225 -0.241  1.00 0.99  ? 30  TRP B N    1  
ATOM 1953  C CA   . TRP B 2 9   ? -5.867  -14.835 0.761   1.00 1.00  ? 30  TRP B CA   1  
ATOM 1954  C C    . TRP B 2 9   ? -5.588  -13.863 1.902   1.00 0.90  ? 30  TRP B C    1  
ATOM 1955  O O    . TRP B 2 9   ? -5.327  -14.278 3.028   1.00 1.00  ? 30  TRP B O    1  
ATOM 1956  C CB   . TRP B 2 9   ? -4.556  -15.370 0.143   1.00 1.03  ? 30  TRP B CB   1  
ATOM 1957  C CG   . TRP B 2 9   ? -3.576  -14.332 -0.327  1.00 0.95  ? 30  TRP B CG   1  
ATOM 1958  C CD1  . TRP B 2 9   ? -3.372  -13.943 -1.614  1.00 1.06  ? 30  TRP B CD1  1  
ATOM 1959  C CD2  . TRP B 2 9   ? -2.638  -13.589 0.470   1.00 0.86  ? 30  TRP B CD2  1  
ATOM 1960  N NE1  . TRP B 2 9   ? -2.387  -12.989 -1.671  1.00 1.00  ? 30  TRP B NE1  1  
ATOM 1961  C CE2  . TRP B 2 9   ? -1.921  -12.755 -0.408  1.00 0.85  ? 30  TRP B CE2  1  
ATOM 1962  C CE3  . TRP B 2 9   ? -2.341  -13.538 1.836   1.00 0.94  ? 30  TRP B CE3  1  
ATOM 1963  C CZ2  . TRP B 2 9   ? -0.930  -11.884 0.032   1.00 0.83  ? 30  TRP B CZ2  1  
ATOM 1964  C CZ3  . TRP B 2 9   ? -1.354  -12.673 2.270   1.00 1.00  ? 30  TRP B CZ3  1  
ATOM 1965  C CH2  . TRP B 2 9   ? -0.661  -11.856 1.370   1.00 0.90  ? 30  TRP B CH2  1  
ATOM 1966  H H    . TRP B 2 9   ? -6.374  -14.022 -1.134  1.00 1.00  ? 30  TRP B H    1  
ATOM 1967  H HA   . TRP B 2 9   ? -6.411  -15.674 1.171   1.00 1.11  ? 30  TRP B HA   1  
ATOM 1968  H HB2  . TRP B 2 9   ? -4.052  -15.983 0.871   1.00 1.09  ? 30  TRP B HB2  1  
ATOM 1969  H HB3  . TRP B 2 9   ? -4.809  -15.982 -0.712  1.00 1.11  ? 30  TRP B HB3  1  
ATOM 1970  H HD1  . TRP B 2 9   ? -3.921  -14.333 -2.459  1.00 1.24  ? 30  TRP B HD1  1  
ATOM 1971  H HE1  . TRP B 2 9   ? -2.067  -12.544 -2.486  1.00 1.11  ? 30  TRP B HE1  1  
ATOM 1972  H HE3  . TRP B 2 9   ? -2.867  -14.159 2.546   1.00 1.05  ? 30  TRP B HE3  1  
ATOM 1973  H HZ2  . TRP B 2 9   ? -0.384  -11.251 -0.648  1.00 0.86  ? 30  TRP B HZ2  1  
ATOM 1974  H HZ3  . TRP B 2 9   ? -1.106  -12.624 3.322   1.00 1.18  ? 30  TRP B HZ3  1  
ATOM 1975  H HH2  . TRP B 2 9   ? 0.102   -11.197 1.754   1.00 0.99  ? 30  TRP B HH2  1  
ATOM 1976  N N    . TRP B 2 10  ? -5.670  -12.567 1.610   1.00 0.76  ? 31  TRP B N    1  
ATOM 1977  C CA   . TRP B 2 10  ? -5.470  -11.548 2.629   1.00 0.73  ? 31  TRP B CA   1  
ATOM 1978  C C    . TRP B 2 10  ? -6.583  -11.627 3.666   1.00 0.86  ? 31  TRP B C    1  
ATOM 1979  O O    . TRP B 2 10  ? -6.349  -11.495 4.867   1.00 1.02  ? 31  TRP B O    1  
ATOM 1980  C CB   . TRP B 2 10  ? -5.446  -10.153 2.003   1.00 0.61  ? 31  TRP B CB   1  
ATOM 1981  C CG   . TRP B 2 10  ? -4.491  -9.223  2.684   1.00 0.56  ? 31  TRP B CG   1  
ATOM 1982  C CD1  . TRP B 2 10  ? -4.582  -8.716  3.949   1.00 0.66  ? 31  TRP B CD1  1  
ATOM 1983  C CD2  . TRP B 2 10  ? -3.292  -8.688  2.126   1.00 0.46  ? 31  TRP B CD2  1  
ATOM 1984  N NE1  . TRP B 2 10  ? -3.501  -7.909  4.213   1.00 0.65  ? 31  TRP B NE1  1  
ATOM 1985  C CE2  . TRP B 2 10  ? -2.697  -7.874  3.104   1.00 0.50  ? 31  TRP B CE2  1  
ATOM 1986  C CE3  . TRP B 2 10  ? -2.665  -8.824  0.890   1.00 0.42  ? 31  TRP B CE3  1  
ATOM 1987  C CZ2  . TRP B 2 10  ? -1.498  -7.201  2.878   1.00 0.45  ? 31  TRP B CZ2  1  
ATOM 1988  C CZ3  . TRP B 2 10  ? -1.482  -8.156  0.668   1.00 0.38  ? 31  TRP B CZ3  1  
ATOM 1989  C CH2  . TRP B 2 10  ? -0.907  -7.354  1.659   1.00 0.36  ? 31  TRP B CH2  1  
ATOM 1990  H H    . TRP B 2 10  ? -5.859  -12.295 0.689   1.00 0.76  ? 31  TRP B H    1  
ATOM 1991  H HA   . TRP B 2 10  ? -4.522  -11.736 3.113   1.00 0.76  ? 31  TRP B HA   1  
ATOM 1992  H HB2  . TRP B 2 10  ? -5.153  -10.234 0.967   1.00 0.59  ? 31  TRP B HB2  1  
ATOM 1993  H HB3  . TRP B 2 10  ? -6.434  -9.722  2.062   1.00 0.67  ? 31  TRP B HB3  1  
ATOM 1994  H HD1  . TRP B 2 10  ? -5.388  -8.935  4.633   1.00 0.78  ? 31  TRP B HD1  1  
ATOM 1995  H HE1  . TRP B 2 10  ? -3.336  -7.432  5.057   1.00 0.75  ? 31  TRP B HE1  1  
ATOM 1996  H HE3  . TRP B 2 10  ? -3.093  -9.436  0.112   1.00 0.49  ? 31  TRP B HE3  1  
ATOM 1997  H HZ2  . TRP B 2 10  ? -1.037  -6.585  3.628   1.00 0.54  ? 31  TRP B HZ2  1  
ATOM 1998  H HZ3  . TRP B 2 10  ? -0.986  -8.252  -0.284  1.00 0.43  ? 31  TRP B HZ3  1  
ATOM 1999  H HH2  . TRP B 2 10  ? 0.021   -6.844  1.440   1.00 0.36  ? 31  TRP B HH2  1  
ATOM 2000  N N    . ARG B 2 11  ? -7.801  -11.854 3.188   1.00 0.87  ? 32  ARG B N    1  
ATOM 2001  C CA   . ARG B 2 11  ? -8.952  -11.980 4.068   1.00 1.03  ? 32  ARG B CA   1  
ATOM 2002  C C    . ARG B 2 11  ? -9.000  -13.370 4.685   1.00 1.15  ? 32  ARG B C    1  
ATOM 2003  O O    . ARG B 2 11  ? -9.392  -13.531 5.835   1.00 1.33  ? 32  ARG B O    1  
ATOM 2004  C CB   . ARG B 2 11  ? -10.252 -11.693 3.314   1.00 1.08  ? 32  ARG B CB   1  
ATOM 2005  C CG   . ARG B 2 11  ? -10.387 -10.253 2.836   1.00 1.34  ? 32  ARG B CG   1  
ATOM 2006  C CD   . ARG B 2 11  ? -10.165 -9.256  3.969   1.00 1.58  ? 32  ARG B CD   1  
ATOM 2007  N NE   . ARG B 2 11  ? -10.945 -9.587  5.162   1.00 2.01  ? 32  ARG B NE   1  
ATOM 2008  C CZ   . ARG B 2 11  ? -10.939 -8.867  6.281   1.00 2.63  ? 32  ARG B CZ   1  
ATOM 2009  N NH1  . ARG B 2 11  ? -10.243 -7.739  6.351   1.00 3.04  ? 32  ARG B NH1  1  
ATOM 2010  N NH2  . ARG B 2 11  ? -11.633 -9.275  7.333   1.00 3.37  ? 32  ARG B NH2  1  
ATOM 2011  H H    . ARG B 2 11  ? -7.925  -11.944 2.218   1.00 0.82  ? 32  ARG B H    1  
ATOM 2012  H HA   . ARG B 2 11  ? -8.840  -11.255 4.861   1.00 1.12  ? 32  ARG B HA   1  
ATOM 2013  H HB2  . ARG B 2 11  ? -10.302 -12.339 2.450   1.00 1.33  ? 32  ARG B HB2  1  
ATOM 2014  H HB3  . ARG B 2 11  ? -11.085 -11.912 3.963   1.00 1.39  ? 32  ARG B HB3  1  
ATOM 2015  H HG2  . ARG B 2 11  ? -9.654  -10.071 2.065   1.00 1.84  ? 32  ARG B HG2  1  
ATOM 2016  H HG3  . ARG B 2 11  ? -11.379 -10.110 2.433   1.00 1.90  ? 32  ARG B HG3  1  
ATOM 2017  H HD2  . ARG B 2 11  ? -9.116  -9.251  4.227   1.00 2.09  ? 32  ARG B HD2  1  
ATOM 2018  H HD3  . ARG B 2 11  ? -10.452 -8.274  3.625   1.00 2.02  ? 32  ARG B HD3  1  
ATOM 2019  H HE   . ARG B 2 11  ? -11.492 -10.409 5.131   1.00 2.35  ? 32  ARG B HE   1  
ATOM 2020  H HH11 . ARG B 2 11  ? -9.715  -7.420  5.561   1.00 2.99  ? 32  ARG B HH11 1  
ATOM 2021  H HH12 . ARG B 2 11  ? -10.245 -7.195  7.196   1.00 3.72  ? 32  ARG B HH12 1  
ATOM 2022  H HH21 . ARG B 2 11  ? -12.164 -10.128 7.289   1.00 3.63  ? 32  ARG B HH21 1  
ATOM 2023  H HH22 . ARG B 2 11  ? -11.627 -8.738  8.181   1.00 3.92  ? 32  ARG B HH22 1  
ATOM 2024  N N    . SER B 2 12  ? -8.585  -14.365 3.913   1.00 1.13  ? 33  SER B N    1  
ATOM 2025  C CA   . SER B 2 12  ? -8.529  -15.741 4.387   1.00 1.30  ? 33  SER B CA   1  
ATOM 2026  C C    . SER B 2 12  ? -7.574  -15.854 5.577   1.00 1.45  ? 33  SER B C    1  
ATOM 2027  O O    . SER B 2 12  ? -7.888  -16.490 6.585   1.00 1.65  ? 33  SER B O    1  
ATOM 2028  C CB   . SER B 2 12  ? -8.084  -16.662 3.244   1.00 1.33  ? 33  SER B CB   1  
ATOM 2029  O OG   . SER B 2 12  ? -8.056  -18.024 3.636   1.00 1.90  ? 33  SER B OG   1  
ATOM 2030  H H    . SER B 2 12  ? -8.317  -14.171 2.987   1.00 1.04  ? 33  SER B H    1  
ATOM 2031  H HA   . SER B 2 12  ? -9.519  -16.024 4.705   1.00 1.37  ? 33  SER B HA   1  
ATOM 2032  H HB2  . SER B 2 12  ? -8.769  -16.557 2.416   1.00 1.77  ? 33  SER B HB2  1  
ATOM 2033  H HB3  . SER B 2 12  ? -7.094  -16.373 2.924   1.00 1.58  ? 33  SER B HB3  1  
ATOM 2034  H HG   . SER B 2 12  ? -8.895  -18.256 4.055   1.00 2.15  ? 33  SER B HG   1  
ATOM 2035  N N    . GLU B 2 13  ? -6.419  -15.208 5.461   1.00 1.40  ? 34  GLU B N    1  
ATOM 2036  C CA   . GLU B 2 13  ? -5.430  -15.195 6.533   1.00 1.57  ? 34  GLU B CA   1  
ATOM 2037  C C    . GLU B 2 13  ? -5.955  -14.404 7.733   1.00 1.63  ? 34  GLU B C    1  
ATOM 2038  O O    . GLU B 2 13  ? -5.609  -14.685 8.882   1.00 1.85  ? 34  GLU B O    1  
ATOM 2039  C CB   . GLU B 2 13  ? -4.123  -14.586 6.019   1.00 1.57  ? 34  GLU B CB   1  
ATOM 2040  C CG   . GLU B 2 13  ? -2.958  -14.687 6.991   1.00 1.84  ? 34  GLU B CG   1  
ATOM 2041  C CD   . GLU B 2 13  ? -2.542  -16.117 7.275   1.00 1.90  ? 34  GLU B CD   1  
ATOM 2042  O OE1  . GLU B 2 13  ? -2.637  -16.965 6.360   1.00 2.15  ? 34  GLU B OE1  1  
ATOM 2043  O OE2  . GLU B 2 13  ? -2.095  -16.393 8.408   1.00 2.32  ? 34  GLU B OE2  1  
ATOM 2044  H H    . GLU B 2 13  ? -6.219  -14.732 4.624   1.00 1.27  ? 34  GLU B H    1  
ATOM 2045  H HA   . GLU B 2 13  ? -5.252  -16.216 6.835   1.00 1.73  ? 34  GLU B HA   1  
ATOM 2046  H HB2  . GLU B 2 13  ? -3.843  -15.089 5.107   1.00 1.70  ? 34  GLU B HB2  1  
ATOM 2047  H HB3  . GLU B 2 13  ? -4.290  -13.541 5.802   1.00 1.80  ? 34  GLU B HB3  1  
ATOM 2048  H HG2  . GLU B 2 13  ? -2.113  -14.162 6.573   1.00 2.25  ? 34  GLU B HG2  1  
ATOM 2049  H HG3  . GLU B 2 13  ? -3.244  -14.220 7.923   1.00 2.41  ? 34  GLU B HG3  1  
ATOM 2050  N N    . GLU B 2 14  ? -6.802  -13.420 7.461   1.00 1.50  ? 35  GLU B N    1  
ATOM 2051  C CA   . GLU B 2 14  ? -7.381  -12.604 8.517   1.00 1.65  ? 35  GLU B CA   1  
ATOM 2052  C C    . GLU B 2 14  ? -8.483  -13.377 9.240   1.00 1.86  ? 35  GLU B C    1  
ATOM 2053  O O    . GLU B 2 14  ? -8.593  -13.322 10.467  1.00 2.10  ? 35  GLU B O    1  
ATOM 2054  C CB   . GLU B 2 14  ? -7.937  -11.300 7.941   1.00 1.57  ? 35  GLU B CB   1  
ATOM 2055  C CG   . GLU B 2 14  ? -8.153  -10.224 8.991   1.00 2.12  ? 35  GLU B CG   1  
ATOM 2056  C CD   . GLU B 2 14  ? -6.861  -9.827  9.679   1.00 2.43  ? 35  GLU B CD   1  
ATOM 2057  O OE1  . GLU B 2 14  ? -6.474  -10.495 10.660  1.00 3.14  ? 35  GLU B OE1  1  
ATOM 2058  O OE2  . GLU B 2 14  ? -6.230  -8.839  9.248   1.00 2.46  ? 35  GLU B OE2  1  
ATOM 2059  H H    . GLU B 2 14  ? -7.038  -13.235 6.528   1.00 1.35  ? 35  GLU B H    1  
ATOM 2060  H HA   . GLU B 2 14  ? -6.600  -12.371 9.222   1.00 1.76  ? 35  GLU B HA   1  
ATOM 2061  H HB2  . GLU B 2 14  ? -7.246  -10.920 7.203   1.00 1.55  ? 35  GLU B HB2  1  
ATOM 2062  H HB3  . GLU B 2 14  ? -8.885  -11.504 7.465   1.00 1.87  ? 35  GLU B HB3  1  
ATOM 2063  H HG2  . GLU B 2 14  ? -8.573  -9.351  8.516   1.00 2.69  ? 35  GLU B HG2  1  
ATOM 2064  H HG3  . GLU B 2 14  ? -8.841  -10.596 9.736   1.00 2.55  ? 35  GLU B HG3  1  
ATOM 2065  N N    . ALA B 2 15  ? -9.281  -14.115 8.475   1.00 1.84  ? 36  ALA B N    1  
ATOM 2066  C CA   . ALA B 2 15  ? -10.355 -14.928 9.034   1.00 2.10  ? 36  ALA B CA   1  
ATOM 2067  C C    . ALA B 2 15  ? -9.793  -16.078 9.862   1.00 2.31  ? 36  ALA B C    1  
ATOM 2068  O O    . ALA B 2 15  ? -10.480 -16.639 10.713  1.00 2.58  ? 36  ALA B O    1  
ATOM 2069  C CB   . ALA B 2 15  ? -11.250 -15.461 7.925   1.00 2.10  ? 36  ALA B CB   1  
ATOM 2070  H H    . ALA B 2 15  ? -9.150  -14.105 7.499   1.00 1.67  ? 36  ALA B H    1  
ATOM 2071  H HA   . ALA B 2 15  ? -10.953 -14.296 9.675   1.00 2.20  ? 36  ALA B HA   1  
ATOM 2072  H HB1  . ALA B 2 15  ? -10.676 -16.108 7.279   1.00 2.33  ? 36  ALA B HB1  1  
ATOM 2073  H HB2  . ALA B 2 15  ? -11.644 -14.636 7.350   1.00 2.25  ? 36  ALA B HB2  1  
ATOM 2074  H HB3  . ALA B 2 15  ? -12.067 -16.019 8.358   1.00 2.42  ? 36  ALA B HB3  1  
ATOM 2075  N N    . GLN B 2 16  ? -8.538  -16.425 9.598   1.00 2.24  ? 37  GLN B N    1  
ATOM 2076  C CA   . GLN B 2 16  ? -7.838  -17.440 10.372  1.00 2.49  ? 37  GLN B CA   1  
ATOM 2077  C C    . GLN B 2 16  ? -7.626  -16.958 11.804  1.00 2.66  ? 37  GLN B C    1  
ATOM 2078  O O    . GLN B 2 16  ? -7.872  -17.691 12.764  1.00 2.93  ? 37  GLN B O    1  
ATOM 2079  C CB   . GLN B 2 16  ? -6.492  -17.755 9.720   1.00 2.39  ? 37  GLN B CB   1  
ATOM 2080  C CG   . GLN B 2 16  ? -5.703  -18.840 10.432  1.00 2.54  ? 37  GLN B CG   1  
ATOM 2081  C CD   . GLN B 2 16  ? -4.316  -19.012 9.852   1.00 3.04  ? 37  GLN B CD   1  
ATOM 2082  O OE1  . GLN B 2 16  ? -4.113  -19.791 8.921   1.00 3.65  ? 37  GLN B OE1  1  
ATOM 2083  N NE2  . GLN B 2 16  ? -3.353  -18.291 10.398  1.00 3.38  ? 37  GLN B NE2  1  
ATOM 2084  H H    . GLN B 2 16  ? -8.074  -15.991 8.851   1.00 2.05  ? 37  GLN B H    1  
ATOM 2085  H HA   . GLN B 2 16  ? -8.447  -18.333 10.386  1.00 2.69  ? 37  GLN B HA   1  
ATOM 2086  H HB2  . GLN B 2 16  ? -6.665  -18.076 8.705   1.00 2.65  ? 37  GLN B HB2  1  
ATOM 2087  H HB3  . GLN B 2 16  ? -5.894  -16.856 9.707   1.00 2.45  ? 37  GLN B HB3  1  
ATOM 2088  H HG2  . GLN B 2 16  ? -5.611  -18.576 11.476  1.00 2.72  ? 37  GLN B HG2  1  
ATOM 2089  H HG3  . GLN B 2 16  ? -6.235  -19.775 10.341  1.00 2.94  ? 37  GLN B HG3  1  
ATOM 2090  H HE21 . GLN B 2 16  ? -3.584  -17.693 11.142  1.00 3.31  ? 37  GLN B HE21 1  
ATOM 2091  H HE22 . GLN B 2 16  ? -2.447  -18.374 10.032  1.00 4.00  ? 37  GLN B HE22 1  
ATOM 2092  N N    . ASP B 2 17  ? -7.174  -15.714 11.935  1.00 2.57  ? 38  ASP B N    1  
ATOM 2093  C CA   . ASP B 2 17  ? -6.960  -15.109 13.244  1.00 2.80  ? 38  ASP B CA   1  
ATOM 2094  C C    . ASP B 2 17  ? -8.296  -14.759 13.885  1.00 2.96  ? 38  ASP B C    1  
ATOM 2095  O O    . ASP B 2 17  ? -8.470  -14.886 15.094  1.00 3.22  ? 38  ASP B O    1  
ATOM 2096  C CB   . ASP B 2 17  ? -6.087  -13.856 13.123  1.00 2.80  ? 38  ASP B CB   1  
ATOM 2097  C CG   . ASP B 2 17  ? -5.859  -13.167 14.455  1.00 2.83  ? 38  ASP B CG   1  
ATOM 2098  O OD1  . ASP B 2 17  ? -4.959  -13.597 15.208  1.00 3.06  ? 38  ASP B OD1  1  
ATOM 2099  O OD2  . ASP B 2 17  ? -6.584  -12.199 14.764  1.00 3.03  ? 38  ASP B OD2  1  
ATOM 2100  H H    . ASP B 2 17  ? -6.983  -15.189 11.129  1.00 2.38  ? 38  ASP B H    1  
ATOM 2101  H HA   . ASP B 2 17  ? -6.454  -15.833 13.866  1.00 2.97  ? 38  ASP B HA   1  
ATOM 2102  H HB2  . ASP B 2 17  ? -5.127  -14.134 12.715  1.00 3.09  ? 38  ASP B HB2  1  
ATOM 2103  H HB3  . ASP B 2 17  ? -6.568  -13.157 12.455  1.00 2.90  ? 38  ASP B HB3  1  
ATOM 2104  N N    . MET B 2 18  ? -9.239  -14.324 13.062  1.00 2.89  ? 39  MET B N    1  
ATOM 2105  C CA   . MET B 2 18  ? -10.582 -14.018 13.532  1.00 3.13  ? 39  MET B CA   1  
ATOM 2106  C C    . MET B 2 18  ? -11.420 -15.295 13.583  1.00 3.86  ? 39  MET B C    1  
ATOM 2107  O O    . MET B 2 18  ? -12.308 -15.512 12.756  1.00 4.43  ? 39  MET B O    1  
ATOM 2108  C CB   . MET B 2 18  ? -11.244 -12.974 12.625  1.00 3.09  ? 39  MET B CB   1  
ATOM 2109  C CG   . MET B 2 18  ? -12.607 -12.506 13.115  1.00 3.39  ? 39  MET B CG   1  
ATOM 2110  S SD   . MET B 2 18  ? -13.342 -11.266 12.032  1.00 3.72  ? 39  MET B SD   1  
ATOM 2111  C CE   . MET B 2 18  ? -14.893 -10.959 12.875  1.00 4.34  ? 39  MET B CE   1  
ATOM 2112  H H    . MET B 2 18  ? -9.026  -14.202 12.110  1.00 2.73  ? 39  MET B H    1  
ATOM 2113  H HA   . MET B 2 18  ? -10.499 -13.618 14.531  1.00 3.23  ? 39  MET B HA   1  
ATOM 2114  H HB2  . MET B 2 18  ? -10.596 -12.113 12.557  1.00 3.27  ? 39  MET B HB2  1  
ATOM 2115  H HB3  . MET B 2 18  ? -11.367 -13.400 11.641  1.00 3.33  ? 39  MET B HB3  1  
ATOM 2116  H HG2  . MET B 2 18  ? -13.268 -13.358 13.165  1.00 3.53  ? 39  MET B HG2  1  
ATOM 2117  H HG3  . MET B 2 18  ? -12.494 -12.082 14.102  1.00 3.93  ? 39  MET B HG3  1  
ATOM 2118  H HE1  . MET B 2 18  ? -14.694 -10.587 13.869  1.00 4.48  ? 39  MET B HE1  1  
ATOM 2119  H HE2  . MET B 2 18  ? -15.456 -11.878 12.941  1.00 4.79  ? 39  MET B HE2  1  
ATOM 2120  H HE3  . MET B 2 18  ? -15.464 -10.226 12.324  1.00 4.64  ? 39  MET B HE3  1  
ATOM 2121  N N    . GLY B 2 19  ? -11.112 -16.144 14.552  1.00 4.23  ? 40  GLY B N    1  
ATOM 2122  C CA   . GLY B 2 19  ? -11.816 -17.399 14.695  1.00 5.19  ? 40  GLY B CA   1  
ATOM 2123  C C    . GLY B 2 19  ? -12.974 -17.295 15.663  1.00 5.68  ? 40  GLY B C    1  
ATOM 2124  O O    . GLY B 2 19  ? -13.300 -18.308 16.322  1.00 6.18  ? 40  GLY B O    1  
ATOM 2125  O OXT  . GLY B 2 19  ? -13.566 -16.200 15.772  1.00 5.90  ? 40  GLY B OXT  1  
ATOM 2126  H H    . GLY B 2 19  ? -10.395 -15.913 15.180  1.00 4.07  ? 40  GLY B H    1  
ATOM 2127  H HA2  . GLY B 2 19  ? -12.193 -17.702 13.730  1.00 5.50  ? 40  GLY B HA2  1  
ATOM 2128  H HA3  . GLY B 2 19  ? -11.127 -18.149 15.054  1.00 5.60  ? 40  GLY B HA3  1  
ATOM 2129  N N    . PRO A 1 1   ? 18.314  2.145   6.181   1.00 2.80  ? 1   PRO A N    2  
ATOM 2130  C CA   . PRO A 1 1   ? 17.311  2.262   7.261   1.00 2.09  ? 1   PRO A CA   2  
ATOM 2131  C C    . PRO A 1 1   ? 16.060  2.982   6.770   1.00 1.70  ? 1   PRO A C    2  
ATOM 2132  O O    . PRO A 1 1   ? 16.126  4.144   6.371   1.00 2.48  ? 1   PRO A O    2  
ATOM 2133  C CB   . PRO A 1 1   ? 17.927  3.018   8.429   1.00 2.88  ? 1   PRO A CB   2  
ATOM 2134  C CG   . PRO A 1 1   ? 19.355  3.175   8.032   1.00 3.60  ? 1   PRO A CG   2  
ATOM 2135  C CD   . PRO A 1 1   ? 19.384  3.098   6.522   1.00 3.50  ? 1   PRO A CD   2  
ATOM 2136  H H2   . PRO A 1 1   ? 18.537  1.122   6.135   1.00 2.93  ? 1   PRO A H2   2  
ATOM 2137  H H3   . PRO A 1 1   ? 17.796  2.313   5.304   1.00 3.05  ? 1   PRO A H3   2  
ATOM 2138  H HA   . PRO A 1 1   ? 17.039  1.269   7.584   1.00 2.07  ? 1   PRO A HA   2  
ATOM 2139  H HB2  . PRO A 1 1   ? 17.437  3.974   8.544   1.00 3.16  ? 1   PRO A HB2  2  
ATOM 2140  H HB3  . PRO A 1 1   ? 17.830  2.439   9.335   1.00 3.12  ? 1   PRO A HB3  2  
ATOM 2141  H HG2  . PRO A 1 1   ? 19.724  4.135   8.364   1.00 4.35  ? 1   PRO A HG2  2  
ATOM 2142  H HG3  . PRO A 1 1   ? 19.944  2.377   8.459   1.00 3.85  ? 1   PRO A HG3  2  
ATOM 2143  H HD2  . PRO A 1 1   ? 19.179  4.067   6.094   1.00 4.20  ? 1   PRO A HD2  2  
ATOM 2144  H HD3  . PRO A 1 1   ? 20.341  2.732   6.185   1.00 3.65  ? 1   PRO A HD3  2  
ATOM 2145  N N    . SER A 1 2   ? 14.931  2.268   6.801   1.00 1.00  ? 2   SER A N    2  
ATOM 2146  C CA   . SER A 1 2   ? 13.617  2.789   6.403   1.00 0.75  ? 2   SER A CA   2  
ATOM 2147  C C    . SER A 1 2   ? 13.592  3.282   4.950   1.00 0.89  ? 2   SER A C    2  
ATOM 2148  O O    . SER A 1 2   ? 14.602  3.247   4.248   1.00 1.99  ? 2   SER A O    2  
ATOM 2149  C CB   . SER A 1 2   ? 13.149  3.904   7.358   1.00 1.16  ? 2   SER A CB   2  
ATOM 2150  O OG   . SER A 1 2   ? 13.911  5.093   7.212   1.00 1.66  ? 2   SER A OG   2  
ATOM 2151  H H    . SER A 1 2   ? 14.982  1.338   7.114   1.00 1.37  ? 2   SER A H    2  
ATOM 2152  H HA   . SER A 1 2   ? 12.921  1.968   6.482   1.00 0.60  ? 2   SER A HA   2  
ATOM 2153  H HB2  . SER A 1 2   ? 12.114  4.133   7.155   1.00 1.50  ? 2   SER A HB2  2  
ATOM 2154  H HB3  . SER A 1 2   ? 13.243  3.557   8.377   1.00 1.23  ? 2   SER A HB3  2  
ATOM 2155  H HG   . SER A 1 2   ? 14.818  4.860   6.961   1.00 1.95  ? 2   SER A HG   2  
ATOM 2156  N N    . HIS A 1 3   ? 12.404  3.695   4.509   1.00 0.41  ? 3   HIS A N    2  
ATOM 2157  C CA   . HIS A 1 3   ? 12.184  4.310   3.192   1.00 0.27  ? 3   HIS A CA   2  
ATOM 2158  C C    . HIS A 1 3   ? 12.319  3.344   2.021   1.00 0.23  ? 3   HIS A C    2  
ATOM 2159  O O    . HIS A 1 3   ? 11.499  3.367   1.114   1.00 0.33  ? 3   HIS A O    2  
ATOM 2160  C CB   . HIS A 1 3   ? 13.090  5.522   2.957   1.00 0.28  ? 3   HIS A CB   2  
ATOM 2161  C CG   . HIS A 1 3   ? 12.776  6.704   3.824   1.00 0.36  ? 3   HIS A CG   2  
ATOM 2162  N ND1  . HIS A 1 3   ? 13.600  7.133   4.842   1.00 0.56  ? 3   HIS A ND1  2  
ATOM 2163  C CD2  . HIS A 1 3   ? 11.724  7.558   3.812   1.00 0.38  ? 3   HIS A CD2  2  
ATOM 2164  C CE1  . HIS A 1 3   ? 13.067  8.195   5.419   1.00 0.61  ? 3   HIS A CE1  2  
ATOM 2165  N NE2  . HIS A 1 3   ? 11.931  8.471   4.813   1.00 0.49  ? 3   HIS A NE2  2  
ATOM 2166  H H    . HIS A 1 3   ? 11.625  3.584   5.103   1.00 1.21  ? 3   HIS A H    2  
ATOM 2167  H HA   . HIS A 1 3   ? 11.175  4.655   3.188   1.00 0.31  ? 3   HIS A HA   2  
ATOM 2168  H HB2  . HIS A 1 3   ? 14.114  5.238   3.138   1.00 0.33  ? 3   HIS A HB2  2  
ATOM 2169  H HB3  . HIS A 1 3   ? 12.982  5.830   1.927   1.00 0.28  ? 3   HIS A HB3  2  
ATOM 2170  H HD1  . HIS A 1 3   ? 14.460  6.729   5.095   1.00 0.69  ? 3   HIS A HD1  2  
ATOM 2171  H HD2  . HIS A 1 3   ? 10.880  7.527   3.138   1.00 0.44  ? 3   HIS A HD2  2  
ATOM 2172  H HE1  . HIS A 1 3   ? 13.490  8.743   6.245   1.00 0.78  ? 3   HIS A HE1  2  
ATOM 2173  H HE2  . HIS A 1 3   ? 11.378  9.279   4.980   1.00 0.56  ? 3   HIS A HE2  2  
ATOM 2174  N N    . SER A 1 4   ? 13.330  2.514   2.018   1.00 0.21  ? 4   SER A N    2  
ATOM 2175  C CA   . SER A 1 4   ? 13.574  1.668   0.861   1.00 0.17  ? 4   SER A CA   2  
ATOM 2176  C C    . SER A 1 4   ? 14.006  0.255   1.214   1.00 0.18  ? 4   SER A C    2  
ATOM 2177  O O    . SER A 1 4   ? 14.520  -0.023  2.303   1.00 0.24  ? 4   SER A O    2  
ATOM 2178  C CB   . SER A 1 4   ? 14.593  2.321   -0.060  1.00 0.19  ? 4   SER A CB   2  
ATOM 2179  O OG   . SER A 1 4   ? 15.698  2.838   0.668   1.00 0.28  ? 4   SER A OG   2  
ATOM 2180  H H    . SER A 1 4   ? 13.920  2.472   2.796   1.00 0.28  ? 4   SER A H    2  
ATOM 2181  H HA   . SER A 1 4   ? 12.644  1.595   0.314   1.00 0.15  ? 4   SER A HA   2  
ATOM 2182  H HB2  . SER A 1 4   ? 14.944  1.590   -0.766  1.00 0.19  ? 4   SER A HB2  2  
ATOM 2183  H HB3  . SER A 1 4   ? 14.116  3.123   -0.592  1.00 0.19  ? 4   SER A HB3  2  
ATOM 2184  H HG   . SER A 1 4   ? 15.551  3.777   0.842   1.00 0.91  ? 4   SER A HG   2  
ATOM 2185  N N    . GLY A 1 5   ? 13.777  -0.624  0.253   1.00 0.15  ? 5   GLY A N    2  
ATOM 2186  C CA   . GLY A 1 5   ? 14.098  -2.022  0.379   1.00 0.15  ? 5   GLY A CA   2  
ATOM 2187  C C    . GLY A 1 5   ? 13.588  -2.779  -0.815  1.00 0.13  ? 5   GLY A C    2  
ATOM 2188  O O    . GLY A 1 5   ? 12.647  -2.336  -1.473  1.00 0.12  ? 5   GLY A O    2  
ATOM 2189  H H    . GLY A 1 5   ? 13.371  -0.306  -0.583  1.00 0.15  ? 5   GLY A H    2  
ATOM 2190  H HA2  . GLY A 1 5   ? 15.169  -2.136  0.425   1.00 0.17  ? 5   GLY A HA2  2  
ATOM 2191  H HA3  . GLY A 1 5   ? 13.648  -2.420  1.274   1.00 0.17  ? 5   GLY A HA3  2  
ATOM 2192  N N    . ALA A 1 6   ? 14.208  -3.902  -1.106  1.00 0.14  ? 6   ALA A N    2  
ATOM 2193  C CA   . ALA A 1 6   ? 13.906  -4.641  -2.318  1.00 0.15  ? 6   ALA A CA   2  
ATOM 2194  C C    . ALA A 1 6   ? 12.499  -5.228  -2.296  1.00 0.15  ? 6   ALA A C    2  
ATOM 2195  O O    . ALA A 1 6   ? 12.173  -6.079  -1.467  1.00 0.19  ? 6   ALA A O    2  
ATOM 2196  C CB   . ALA A 1 6   ? 14.944  -5.716  -2.557  1.00 0.17  ? 6   ALA A CB   2  
ATOM 2197  H H    . ALA A 1 6   ? 14.886  -4.244  -0.490  1.00 0.16  ? 6   ALA A H    2  
ATOM 2198  H HA   . ALA A 1 6   ? 13.970  -3.947  -3.138  1.00 0.14  ? 6   ALA A HA   2  
ATOM 2199  H HB1  . ALA A 1 6   ? 14.899  -6.447  -1.765  1.00 1.00  ? 6   ALA A HB1  2  
ATOM 2200  H HB2  . ALA A 1 6   ? 15.923  -5.261  -2.580  1.00 1.07  ? 6   ALA A HB2  2  
ATOM 2201  H HB3  . ALA A 1 6   ? 14.748  -6.193  -3.504  1.00 1.03  ? 6   ALA A HB3  2  
ATOM 2202  N N    . ALA A 1 7   ? 11.680  -4.761  -3.231  1.00 0.14  ? 7   ALA A N    2  
ATOM 2203  C CA   . ALA A 1 7   ? 10.294  -5.174  -3.327  1.00 0.14  ? 7   ALA A CA   2  
ATOM 2204  C C    . ALA A 1 7   ? 10.018  -5.767  -4.699  1.00 0.16  ? 7   ALA A C    2  
ATOM 2205  O O    . ALA A 1 7   ? 10.861  -5.736  -5.582  1.00 0.15  ? 7   ALA A O    2  
ATOM 2206  C CB   . ALA A 1 7   ? 9.357   -3.997  -3.060  1.00 0.14  ? 7   ALA A CB   2  
ATOM 2207  H H    . ALA A 1 7   ? 12.036  -4.143  -3.902  1.00 0.14  ? 7   ALA A H    2  
ATOM 2208  H HA   . ALA A 1 7   ? 10.116  -5.927  -2.576  1.00 0.16  ? 7   ALA A HA   2  
ATOM 2209  H HB1  . ALA A 1 7   ? 9.588   -3.184  -3.732  1.00 1.03  ? 7   ALA A HB1  2  
ATOM 2210  H HB2  . ALA A 1 7   ? 9.482   -3.666  -2.039  1.00 1.05  ? 7   ALA A HB2  2  
ATOM 2211  H HB3  . ALA A 1 7   ? 8.329   -4.312  -3.206  1.00 1.00  ? 7   ALA A HB3  2  
ATOM 2212  N N    . ILE A 1 8   ? 8.835   -6.305  -4.866  1.00 0.20  ? 8   ILE A N    2  
ATOM 2213  C CA   . ILE A 1 8   ? 8.422   -6.930  -6.103  1.00 0.23  ? 8   ILE A CA   2  
ATOM 2214  C C    . ILE A 1 8   ? 7.043   -6.420  -6.507  1.00 0.25  ? 8   ILE A C    2  
ATOM 2215  O O    . ILE A 1 8   ? 6.145   -6.306  -5.669  1.00 0.28  ? 8   ILE A O    2  
ATOM 2216  C CB   . ILE A 1 8   ? 8.426   -8.459  -5.941  1.00 0.28  ? 8   ILE A CB   2  
ATOM 2217  C CG1  . ILE A 1 8   ? 9.867   -8.954  -5.969  1.00 0.29  ? 8   ILE A CG1  2  
ATOM 2218  C CG2  . ILE A 1 8   ? 7.580   -9.152  -6.998  1.00 0.31  ? 8   ILE A CG2  2  
ATOM 2219  C CD1  . ILE A 1 8   ? 10.411  -9.339  -4.622  1.00 0.36  ? 8   ILE A CD1  2  
ATOM 2220  H H    . ILE A 1 8   ? 8.202   -6.290  -4.111  1.00 0.23  ? 8   ILE A H    2  
ATOM 2221  H HA   . ILE A 1 8   ? 9.146   -6.672  -6.874  1.00 0.20  ? 8   ILE A HA   2  
ATOM 2222  H HB   . ILE A 1 8   ? 8.006   -8.686  -4.977  1.00 0.33  ? 8   ILE A HB   2  
ATOM 2223  H HG12 . ILE A 1 8   ? 9.949   -9.798  -6.624  1.00 0.31  ? 8   ILE A HG12 2  
ATOM 2224  H HG13 . ILE A 1 8   ? 10.490  -8.163  -6.342  1.00 0.24  ? 8   ILE A HG13 2  
ATOM 2225  H HG21 . ILE A 1 8   ? 7.618   -10.219 -6.842  1.00 0.99  ? 8   ILE A HG21 2  
ATOM 2226  H HG22 . ILE A 1 8   ? 7.963   -8.915  -7.980  1.00 1.08  ? 8   ILE A HG22 2  
ATOM 2227  H HG23 . ILE A 1 8   ? 6.558   -8.814  -6.917  1.00 1.02  ? 8   ILE A HG23 2  
ATOM 2228  H HD11 . ILE A 1 8   ? 9.839   -10.160 -4.220  1.00 1.04  ? 8   ILE A HD11 2  
ATOM 2229  H HD12 . ILE A 1 8   ? 10.345  -8.490  -3.960  1.00 1.06  ? 8   ILE A HD12 2  
ATOM 2230  H HD13 . ILE A 1 8   ? 11.444  -9.631  -4.730  1.00 1.07  ? 8   ILE A HD13 2  
ATOM 2231  N N    . PHE A 1 9   ? 6.893   -6.104  -7.781  1.00 0.24  ? 9   PHE A N    2  
ATOM 2232  C CA   . PHE A 1 9   ? 5.667   -5.513  -8.297  1.00 0.26  ? 9   PHE A CA   2  
ATOM 2233  C C    . PHE A 1 9   ? 5.479   -5.955  -9.741  1.00 0.28  ? 9   PHE A C    2  
ATOM 2234  O O    . PHE A 1 9   ? 6.420   -5.892  -10.523 1.00 0.28  ? 9   PHE A O    2  
ATOM 2235  C CB   . PHE A 1 9   ? 5.757   -3.983  -8.212  1.00 0.25  ? 9   PHE A CB   2  
ATOM 2236  C CG   . PHE A 1 9   ? 4.462   -3.264  -8.466  1.00 0.28  ? 9   PHE A CG   2  
ATOM 2237  C CD1  . PHE A 1 9   ? 3.599   -2.998  -7.424  1.00 0.31  ? 9   PHE A CD1  2  
ATOM 2238  C CD2  . PHE A 1 9   ? 4.110   -2.858  -9.740  1.00 0.32  ? 9   PHE A CD2  2  
ATOM 2239  C CE1  . PHE A 1 9   ? 2.405   -2.340  -7.639  1.00 0.36  ? 9   PHE A CE1  2  
ATOM 2240  C CE2  . PHE A 1 9   ? 2.917   -2.197  -9.965  1.00 0.38  ? 9   PHE A CE2  2  
ATOM 2241  C CZ   . PHE A 1 9   ? 2.063   -1.940  -8.913  1.00 0.39  ? 9   PHE A CZ   2  
ATOM 2242  H H    . PHE A 1 9   ? 7.630   -6.295  -8.407  1.00 0.23  ? 9   PHE A H    2  
ATOM 2243  H HA   . PHE A 1 9   ? 4.838   -5.863  -7.701  1.00 0.28  ? 9   PHE A HA   2  
ATOM 2244  H HB2  . PHE A 1 9   ? 6.094   -3.707  -7.223  1.00 0.27  ? 9   PHE A HB2  2  
ATOM 2245  H HB3  . PHE A 1 9   ? 6.477   -3.634  -8.936  1.00 0.26  ? 9   PHE A HB3  2  
ATOM 2246  H HD1  . PHE A 1 9   ? 3.875   -3.302  -6.426  1.00 0.33  ? 9   PHE A HD1  2  
ATOM 2247  H HD2  . PHE A 1 9   ? 4.779   -3.058  -10.564 1.00 0.34  ? 9   PHE A HD2  2  
ATOM 2248  H HE1  . PHE A 1 9   ? 1.740   -2.141  -6.812  1.00 0.40  ? 9   PHE A HE1  2  
ATOM 2249  H HE2  . PHE A 1 9   ? 2.651   -1.886  -10.964 1.00 0.43  ? 9   PHE A HE2  2  
ATOM 2250  H HZ   . PHE A 1 9   ? 1.130   -1.424  -9.086  1.00 0.45  ? 9   PHE A HZ   2  
ATOM 2251  N N    . GLU A 1 10  ? 4.277   -6.418  -10.083 1.00 0.37  ? 10  GLU A N    2  
ATOM 2252  C CA   . GLU A 1 10  ? 3.996   -6.949  -11.425 1.00 0.43  ? 10  GLU A CA   2  
ATOM 2253  C C    . GLU A 1 10  ? 4.820   -8.200  -11.683 1.00 0.33  ? 10  GLU A C    2  
ATOM 2254  O O    . GLU A 1 10  ? 5.240   -8.476  -12.811 1.00 0.38  ? 10  GLU A O    2  
ATOM 2255  C CB   . GLU A 1 10  ? 4.276   -5.903  -12.501 1.00 0.59  ? 10  GLU A CB   2  
ATOM 2256  C CG   . GLU A 1 10  ? 3.374   -4.699  -12.395 1.00 0.77  ? 10  GLU A CG   2  
ATOM 2257  C CD   . GLU A 1 10  ? 3.706   -3.634  -13.417 1.00 1.00  ? 10  GLU A CD   2  
ATOM 2258  O OE1  . GLU A 1 10  ? 4.640   -2.844  -13.177 1.00 0.95  ? 10  GLU A OE1  2  
ATOM 2259  O OE2  . GLU A 1 10  ? 3.031   -3.584  -14.470 1.00 1.33  ? 10  GLU A OE2  2  
ATOM 2260  H H    . GLU A 1 10  ? 3.557   -6.408  -9.415  1.00 0.43  ? 10  GLU A H    2  
ATOM 2261  H HA   . GLU A 1 10  ? 2.949   -7.215  -11.458 1.00 0.54  ? 10  GLU A HA   2  
ATOM 2262  H HB2  . GLU A 1 10  ? 5.301   -5.572  -12.409 1.00 0.56  ? 10  GLU A HB2  2  
ATOM 2263  H HB3  . GLU A 1 10  ? 4.135   -6.351  -13.472 1.00 0.67  ? 10  GLU A HB3  2  
ATOM 2264  H HG2  . GLU A 1 10  ? 2.359   -5.027  -12.539 1.00 0.88  ? 10  GLU A HG2  2  
ATOM 2265  H HG3  . GLU A 1 10  ? 3.476   -4.276  -11.407 1.00 0.70  ? 10  GLU A HG3  2  
ATOM 2266  N N    . LYS A 1 11  ? 5.057   -8.933  -10.609 1.00 0.35  ? 11  LYS A N    2  
ATOM 2267  C CA   . LYS A 1 11  ? 5.825   -10.175 -10.633 1.00 0.43  ? 11  LYS A CA   2  
ATOM 2268  C C    . LYS A 1 11  ? 7.294   -9.963  -11.015 1.00 0.41  ? 11  LYS A C    2  
ATOM 2269  O O    . LYS A 1 11  ? 8.053   -10.924 -11.135 1.00 0.59  ? 11  LYS A O    2  
ATOM 2270  C CB   . LYS A 1 11  ? 5.167   -11.194 -11.547 1.00 0.54  ? 11  LYS A CB   2  
ATOM 2271  C CG   . LYS A 1 11  ? 3.833   -11.676 -11.011 1.00 0.63  ? 11  LYS A CG   2  
ATOM 2272  C CD   . LYS A 1 11  ? 3.953   -12.207 -9.609  1.00 1.34  ? 11  LYS A CD   2  
ATOM 2273  C CE   . LYS A 1 11  ? 2.636   -12.760 -9.110  1.00 1.31  ? 11  LYS A CE   2  
ATOM 2274  N NZ   . LYS A 1 11  ? 2.796   -13.541 -7.855  1.00 2.23  ? 11  LYS A NZ   2  
ATOM 2275  H H    . LYS A 1 11  ? 4.680   -8.628  -9.756  1.00 0.41  ? 11  LYS A H    2  
ATOM 2276  H HA   . LYS A 1 11  ? 5.795   -10.578 -9.636  1.00 0.53  ? 11  LYS A HA   2  
ATOM 2277  H HB2  . LYS A 1 11  ? 5.005   -10.745 -12.514 1.00 0.51  ? 11  LYS A HB2  2  
ATOM 2278  H HB3  . LYS A 1 11  ? 5.819   -12.045 -11.654 1.00 0.67  ? 11  LYS A HB3  2  
ATOM 2279  H HG2  . LYS A 1 11  ? 3.139   -10.865 -11.005 1.00 1.25  ? 11  LYS A HG2  2  
ATOM 2280  H HG3  . LYS A 1 11  ? 3.475   -12.453 -11.638 1.00 0.98  ? 11  LYS A HG3  2  
ATOM 2281  H HD2  . LYS A 1 11  ? 4.684   -12.979 -9.600  1.00 1.86  ? 11  LYS A HD2  2  
ATOM 2282  H HD3  . LYS A 1 11  ? 4.262   -11.414 -8.968  1.00 2.00  ? 11  LYS A HD3  2  
ATOM 2283  H HE2  . LYS A 1 11  ? 1.961   -11.939 -8.929  1.00 1.09  ? 11  LYS A HE2  2  
ATOM 2284  H HE3  . LYS A 1 11  ? 2.230   -13.398 -9.874  1.00 1.82  ? 11  LYS A HE3  2  
ATOM 2285  H HZ1  . LYS A 1 11  ? 3.223   -12.950 -7.114  1.00 2.72  ? 11  LYS A HZ1  2  
ATOM 2286  H HZ2  . LYS A 1 11  ? 3.411   -14.364 -8.021  1.00 2.51  ? 11  LYS A HZ2  2  
ATOM 2287  H HZ3  . LYS A 1 11  ? 1.871   -13.878 -7.523  1.00 2.85  ? 11  LYS A HZ3  2  
ATOM 2288  N N    . VAL A 1 12  ? 7.693   -8.712  -11.205 1.00 0.26  ? 12  VAL A N    2  
ATOM 2289  C CA   . VAL A 1 12  ? 9.097   -8.381  -11.394 1.00 0.25  ? 12  VAL A CA   2  
ATOM 2290  C C    . VAL A 1 12  ? 9.638   -7.779  -10.109 1.00 0.22  ? 12  VAL A C    2  
ATOM 2291  O O    . VAL A 1 12  ? 8.902   -7.158  -9.347  1.00 0.20  ? 12  VAL A O    2  
ATOM 2292  C CB   . VAL A 1 12  ? 9.350   -7.429  -12.603 1.00 0.25  ? 12  VAL A CB   2  
ATOM 2293  C CG1  . VAL A 1 12  ? 8.328   -6.309  -12.669 1.00 0.24  ? 12  VAL A CG1  2  
ATOM 2294  C CG2  . VAL A 1 12  ? 10.768  -6.862  -12.561 1.00 0.25  ? 12  VAL A CG2  2  
ATOM 2295  H H    . VAL A 1 12  ? 7.033   -7.989  -11.195 1.00 0.27  ? 12  VAL A H    2  
ATOM 2296  H HA   . VAL A 1 12  ? 9.622   -9.308  -11.582 1.00 0.28  ? 12  VAL A HA   2  
ATOM 2297  H HB   . VAL A 1 12  ? 9.256   -8.005  -13.505 1.00 0.29  ? 12  VAL A HB   2  
ATOM 2298  H HG11 . VAL A 1 12  ? 8.285   -5.804  -11.718 1.00 1.04  ? 12  VAL A HG11 2  
ATOM 2299  H HG12 . VAL A 1 12  ? 7.357   -6.723  -12.898 1.00 1.04  ? 12  VAL A HG12 2  
ATOM 2300  H HG13 . VAL A 1 12  ? 8.607   -5.602  -13.442 1.00 1.04  ? 12  VAL A HG13 2  
ATOM 2301  H HG21 . VAL A 1 12  ? 10.941  -6.249  -13.432 1.00 0.98  ? 12  VAL A HG21 2  
ATOM 2302  H HG22 . VAL A 1 12  ? 11.481  -7.677  -12.541 1.00 0.95  ? 12  VAL A HG22 2  
ATOM 2303  H HG23 . VAL A 1 12  ? 10.892  -6.265  -11.667 1.00 0.99  ? 12  VAL A HG23 2  
ATOM 2304  N N    . SER A 1 13  ? 10.907  -8.006  -9.858  1.00 0.23  ? 13  SER A N    2  
ATOM 2305  C CA   . SER A 1 13  ? 11.532  -7.601  -8.620  1.00 0.22  ? 13  SER A CA   2  
ATOM 2306  C C    . SER A 1 13  ? 12.291  -6.294  -8.768  1.00 0.19  ? 13  SER A C    2  
ATOM 2307  O O    . SER A 1 13  ? 12.734  -5.931  -9.858  1.00 0.20  ? 13  SER A O    2  
ATOM 2308  C CB   . SER A 1 13  ? 12.459  -8.710  -8.161  1.00 0.27  ? 13  SER A CB   2  
ATOM 2309  O OG   . SER A 1 13  ? 13.311  -8.302  -7.102  1.00 1.29  ? 13  SER A OG   2  
ATOM 2310  H H    . SER A 1 13  ? 11.448  -8.453  -10.540 1.00 0.26  ? 13  SER A H    2  
ATOM 2311  H HA   . SER A 1 13  ? 10.758  -7.472  -7.883  1.00 0.21  ? 13  SER A HA   2  
ATOM 2312  H HB2  . SER A 1 13  ? 11.855  -9.525  -7.812  1.00 1.03  ? 13  SER A HB2  2  
ATOM 2313  H HB3  . SER A 1 13  ? 13.057  -9.032  -9.000  1.00 0.99  ? 13  SER A HB3  2  
ATOM 2314  H HG   . SER A 1 13  ? 12.784  -8.136  -6.312  1.00 1.80  ? 13  SER A HG   2  
ATOM 2315  N N    . GLY A 1 14  ? 12.421  -5.598  -7.655  1.00 0.17  ? 14  GLY A N    2  
ATOM 2316  C CA   . GLY A 1 14  ? 13.124  -4.336  -7.623  1.00 0.17  ? 14  GLY A CA   2  
ATOM 2317  C C    . GLY A 1 14  ? 13.281  -3.818  -6.215  1.00 0.15  ? 14  GLY A C    2  
ATOM 2318  O O    . GLY A 1 14  ? 13.419  -4.598  -5.284  1.00 0.15  ? 14  GLY A O    2  
ATOM 2319  H H    . GLY A 1 14  ? 12.023  -5.956  -6.822  1.00 0.18  ? 14  GLY A H    2  
ATOM 2320  H HA2  . GLY A 1 14  ? 14.102  -4.464  -8.062  1.00 0.22  ? 14  GLY A HA2  2  
ATOM 2321  H HA3  . GLY A 1 14  ? 12.572  -3.611  -8.198  1.00 0.18  ? 14  GLY A HA3  2  
ATOM 2322  N N    . ILE A 1 15  ? 13.284  -2.504  -6.066  1.00 0.13  ? 15  ILE A N    2  
ATOM 2323  C CA   . ILE A 1 15  ? 13.307  -1.866  -4.760  1.00 0.12  ? 15  ILE A CA   2  
ATOM 2324  C C    . ILE A 1 15  ? 12.114  -0.928  -4.628  1.00 0.12  ? 15  ILE A C    2  
ATOM 2325  O O    . ILE A 1 15  ? 11.699  -0.306  -5.603  1.00 0.13  ? 15  ILE A O    2  
ATOM 2326  C CB   . ILE A 1 15  ? 14.624  -1.063  -4.527  1.00 0.14  ? 15  ILE A CB   2  
ATOM 2327  C CG1  . ILE A 1 15  ? 15.778  -1.980  -4.114  1.00 0.16  ? 15  ILE A CG1  2  
ATOM 2328  C CG2  . ILE A 1 15  ? 14.442  0.034   -3.481  1.00 0.15  ? 15  ILE A CG2  2  
ATOM 2329  C CD1  . ILE A 1 15  ? 16.252  -2.911  -5.200  1.00 0.18  ? 15  ILE A CD1  2  
ATOM 2330  H H    . ILE A 1 15  ? 13.281  -1.935  -6.867  1.00 0.14  ? 15  ILE A H    2  
ATOM 2331  H HA   . ILE A 1 15  ? 13.237  -2.638  -4.009  1.00 0.12  ? 15  ILE A HA   2  
ATOM 2332  H HB   . ILE A 1 15  ? 14.882  -0.582  -5.460  1.00 0.15  ? 15  ILE A HB   2  
ATOM 2333  H HG12 . ILE A 1 15  ? 16.616  -1.372  -3.822  1.00 0.18  ? 15  ILE A HG12 2  
ATOM 2334  H HG13 . ILE A 1 15  ? 15.467  -2.585  -3.273  1.00 0.16  ? 15  ILE A HG13 2  
ATOM 2335  H HG21 . ILE A 1 15  ? 13.733  0.764   -3.846  1.00 0.97  ? 15  ILE A HG21 2  
ATOM 2336  H HG22 . ILE A 1 15  ? 15.389  0.516   -3.294  1.00 0.94  ? 15  ILE A HG22 2  
ATOM 2337  H HG23 . ILE A 1 15  ? 14.068  -0.398  -2.561  1.00 0.99  ? 15  ILE A HG23 2  
ATOM 2338  H HD11 . ILE A 1 15  ? 16.501  -2.340  -6.084  1.00 1.01  ? 15  ILE A HD11 2  
ATOM 2339  H HD12 . ILE A 1 15  ? 15.467  -3.614  -5.432  1.00 1.05  ? 15  ILE A HD12 2  
ATOM 2340  H HD13 . ILE A 1 15  ? 17.123  -3.444  -4.854  1.00 1.03  ? 15  ILE A HD13 2  
ATOM 2341  N N    . ILE A 1 16  ? 11.571  -0.834  -3.428  1.00 0.11  ? 16  ILE A N    2  
ATOM 2342  C CA   . ILE A 1 16  ? 10.577  0.171   -3.119  1.00 0.11  ? 16  ILE A CA   2  
ATOM 2343  C C    . ILE A 1 16  ? 11.298  1.295   -2.378  1.00 0.11  ? 16  ILE A C    2  
ATOM 2344  O O    . ILE A 1 16  ? 12.112  1.028   -1.496  1.00 0.13  ? 16  ILE A O    2  
ATOM 2345  C CB   . ILE A 1 16  ? 9.425   -0.413  -2.265  1.00 0.12  ? 16  ILE A CB   2  
ATOM 2346  C CG1  . ILE A 1 16  ? 8.085   -0.208  -2.957  1.00 0.13  ? 16  ILE A CG1  2  
ATOM 2347  C CG2  . ILE A 1 16  ? 9.375   0.200   -0.879  1.00 0.14  ? 16  ILE A CG2  2  
ATOM 2348  C CD1  . ILE A 1 16  ? 6.914   -0.690  -2.131  1.00 0.17  ? 16  ILE A CD1  2  
ATOM 2349  H H    . ILE A 1 16  ? 11.858  -1.456  -2.720  1.00 0.12  ? 16  ILE A H    2  
ATOM 2350  H HA   . ILE A 1 16  ? 10.169  0.542   -4.048  1.00 0.11  ? 16  ILE A HA   2  
ATOM 2351  H HB   . ILE A 1 16  ? 9.599   -1.468  -2.156  1.00 0.14  ? 16  ILE A HB   2  
ATOM 2352  H HG12 . ILE A 1 16  ? 7.945   0.841   -3.159  1.00 0.13  ? 16  ILE A HG12 2  
ATOM 2353  H HG13 . ILE A 1 16  ? 8.081   -0.750  -3.884  1.00 0.14  ? 16  ILE A HG13 2  
ATOM 2354  H HG21 . ILE A 1 16  ? 9.295   1.273   -0.967  1.00 1.01  ? 16  ILE A HG21 2  
ATOM 2355  H HG22 . ILE A 1 16  ? 10.273  -0.055  -0.340  1.00 1.04  ? 16  ILE A HG22 2  
ATOM 2356  H HG23 . ILE A 1 16  ? 8.514   -0.182  -0.353  1.00 1.01  ? 16  ILE A HG23 2  
ATOM 2357  H HD11 . ILE A 1 16  ? 6.978   -1.760  -2.005  1.00 1.04  ? 16  ILE A HD11 2  
ATOM 2358  H HD12 . ILE A 1 16  ? 5.991   -0.441  -2.633  1.00 1.06  ? 16  ILE A HD12 2  
ATOM 2359  H HD13 . ILE A 1 16  ? 6.937   -0.213  -1.162  1.00 1.00  ? 16  ILE A HD13 2  
ATOM 2360  N N    . ALA A 1 17  ? 11.059  2.532   -2.770  1.00 0.12  ? 17  ALA A N    2  
ATOM 2361  C CA   . ALA A 1 17  ? 11.847  3.648   -2.261  1.00 0.13  ? 17  ALA A CA   2  
ATOM 2362  C C    . ALA A 1 17  ? 10.994  4.879   -1.994  1.00 0.13  ? 17  ALA A C    2  
ATOM 2363  O O    . ALA A 1 17  ? 10.544  5.544   -2.923  1.00 0.15  ? 17  ALA A O    2  
ATOM 2364  C CB   . ALA A 1 17  ? 12.960  3.979   -3.247  1.00 0.15  ? 17  ALA A CB   2  
ATOM 2365  H H    . ALA A 1 17  ? 10.340  2.699   -3.412  1.00 0.12  ? 17  ALA A H    2  
ATOM 2366  H HA   . ALA A 1 17  ? 12.306  3.333   -1.336  1.00 0.13  ? 17  ALA A HA   2  
ATOM 2367  H HB1  . ALA A 1 17  ? 12.534  4.164   -4.228  1.00 1.00  ? 17  ALA A HB1  2  
ATOM 2368  H HB2  . ALA A 1 17  ? 13.651  3.149   -3.300  1.00 0.99  ? 17  ALA A HB2  2  
ATOM 2369  H HB3  . ALA A 1 17  ? 13.484  4.862   -2.912  1.00 1.00  ? 17  ALA A HB3  2  
ATOM 2370  N N    . ILE A 1 18  ? 10.778  5.183   -0.725  1.00 0.17  ? 18  ILE A N    2  
ATOM 2371  C CA   . ILE A 1 18  ? 10.017  6.363   -0.343  1.00 0.15  ? 18  ILE A CA   2  
ATOM 2372  C C    . ILE A 1 18  ? 10.955  7.543   -0.122  1.00 0.16  ? 18  ILE A C    2  
ATOM 2373  O O    . ILE A 1 18  ? 11.967  7.425   0.569   1.00 0.23  ? 18  ILE A O    2  
ATOM 2374  C CB   . ILE A 1 18  ? 9.162   6.131   0.931   1.00 0.18  ? 18  ILE A CB   2  
ATOM 2375  C CG1  . ILE A 1 18  ? 8.099   5.066   0.687   1.00 0.21  ? 18  ILE A CG1  2  
ATOM 2376  C CG2  . ILE A 1 18  ? 8.482   7.415   1.376   1.00 0.18  ? 18  ILE A CG2  2  
ATOM 2377  C CD1  . ILE A 1 18  ? 8.609   3.645   0.731   1.00 0.21  ? 18  ILE A CD1  2  
ATOM 2378  H H    . ILE A 1 18  ? 11.145  4.597   -0.024  1.00 0.25  ? 18  ILE A H    2  
ATOM 2379  H HA   . ILE A 1 18  ? 9.350   6.602   -1.159  1.00 0.15  ? 18  ILE A HA   2  
ATOM 2380  H HB   . ILE A 1 18  ? 9.817   5.802   1.724   1.00 0.20  ? 18  ILE A HB   2  
ATOM 2381  H HG12 . ILE A 1 18  ? 7.331   5.164   1.440   1.00 0.27  ? 18  ILE A HG12 2  
ATOM 2382  H HG13 . ILE A 1 18  ? 7.661   5.230   -0.285  1.00 0.22  ? 18  ILE A HG13 2  
ATOM 2383  H HG21 . ILE A 1 18  ? 9.229   8.148   1.641   1.00 1.02  ? 18  ILE A HG21 2  
ATOM 2384  H HG22 . ILE A 1 18  ? 7.854   7.209   2.234   1.00 1.03  ? 18  ILE A HG22 2  
ATOM 2385  H HG23 . ILE A 1 18  ? 7.872   7.794   0.569   1.00 1.03  ? 18  ILE A HG23 2  
ATOM 2386  H HD11 . ILE A 1 18  ? 9.362   3.505   -0.035  1.00 1.03  ? 18  ILE A HD11 2  
ATOM 2387  H HD12 . ILE A 1 18  ? 7.784   2.970   0.559   1.00 1.03  ? 18  ILE A HD12 2  
ATOM 2388  H HD13 . ILE A 1 18  ? 9.042   3.444   1.709   1.00 0.99  ? 18  ILE A HD13 2  
ATOM 2389  N N    . ASN A 1 19  ? 10.617  8.668   -0.725  1.00 0.19  ? 19  ASN A N    2  
ATOM 2390  C CA   . ASN A 1 19  ? 11.445  9.861   -0.646  1.00 0.33  ? 19  ASN A CA   2  
ATOM 2391  C C    . ASN A 1 19  ? 10.686  10.998  -0.002  1.00 0.31  ? 19  ASN A C    2  
ATOM 2392  O O    . ASN A 1 19  ? 9.569   11.309  -0.414  1.00 0.55  ? 19  ASN A O    2  
ATOM 2393  C CB   . ASN A 1 19  ? 11.873  10.299  -2.049  1.00 0.54  ? 19  ASN A CB   2  
ATOM 2394  C CG   . ASN A 1 19  ? 12.833  11.477  -2.031  1.00 0.83  ? 19  ASN A CG   2  
ATOM 2395  O OD1  . ASN A 1 19  ? 13.609  11.653  -1.093  1.00 1.36  ? 19  ASN A OD1  2  
ATOM 2396  N ND2  . ASN A 1 19  ? 12.785  12.297  -3.070  1.00 1.00  ? 19  ASN A ND2  2  
ATOM 2397  H H    . ASN A 1 19  ? 9.779   8.700   -1.241  1.00 0.20  ? 19  ASN A H    2  
ATOM 2398  H HA   . ASN A 1 19  ? 12.318  9.640   -0.057  1.00 0.40  ? 19  ASN A HA   2  
ATOM 2399  H HB2  . ASN A 1 19  ? 12.349  9.477   -2.549  1.00 1.02  ? 19  ASN A HB2  2  
ATOM 2400  H HB3  . ASN A 1 19  ? 10.995  10.588  -2.608  1.00 0.61  ? 19  ASN A HB3  2  
ATOM 2401  H HD21 . ASN A 1 19  ? 12.139  12.099  -3.788  1.00 1.07  ? 19  ASN A HD21 2  
ATOM 2402  H HD22 . ASN A 1 19  ? 13.397  13.060  -3.089  1.00 1.32  ? 19  ASN A HD22 2  
ATOM 2403  N N    . GLU A 1 20  ? 11.282  11.628  0.997   1.00 0.36  ? 20  GLU A N    2  
ATOM 2404  C CA   . GLU A 1 20  ? 10.739  12.869  1.477   1.00 0.31  ? 20  GLU A CA   2  
ATOM 2405  C C    . GLU A 1 20  ? 11.809  13.940  1.309   1.00 0.67  ? 20  GLU A C    2  
ATOM 2406  O O    . GLU A 1 20  ? 12.432  14.386  2.274   1.00 1.47  ? 20  GLU A O    2  
ATOM 2407  C CB   . GLU A 1 20  ? 10.395  12.747  2.966   1.00 0.52  ? 20  GLU A CB   2  
ATOM 2408  C CG   . GLU A 1 20  ? 9.738   11.437  3.353   1.00 0.71  ? 20  GLU A CG   2  
ATOM 2409  C CD   . GLU A 1 20  ? 9.618   11.270  4.855   1.00 1.18  ? 20  GLU A CD   2  
ATOM 2410  O OE1  . GLU A 1 20  ? 8.752   11.935  5.463   1.00 1.47  ? 20  GLU A OE1  2  
ATOM 2411  O OE2  . GLU A 1 20  ? 10.381  10.475  5.434   1.00 1.41  ? 20  GLU A OE2  2  
ATOM 2412  H H    . GLU A 1 20  ? 12.107  11.278  1.376   1.00 0.66  ? 20  GLU A H    2  
ATOM 2413  H HA   . GLU A 1 20  ? 9.855   13.109  0.907   1.00 0.58  ? 20  GLU A HA   2  
ATOM 2414  H HB2  . GLU A 1 20  ? 11.302  12.849  3.539   1.00 0.71  ? 20  GLU A HB2  2  
ATOM 2415  H HB3  . GLU A 1 20  ? 9.724   13.547  3.231   1.00 0.70  ? 20  GLU A HB3  2  
ATOM 2416  H HG2  . GLU A 1 20  ? 8.753   11.397  2.922   1.00 0.85  ? 20  GLU A HG2  2  
ATOM 2417  H HG3  . GLU A 1 20  ? 10.333  10.629  2.963   1.00 0.53  ? 20  GLU A HG3  2  
ATOM 2418  N N    . ASP A 1 21  ? 12.025  14.320  0.066   1.00 0.99  ? 21  ASP A N    2  
ATOM 2419  C CA   . ASP A 1 21  ? 12.753  15.532  -0.291  1.00 1.38  ? 21  ASP A CA   2  
ATOM 2420  C C    . ASP A 1 21  ? 11.789  16.499  -0.937  1.00 0.91  ? 21  ASP A C    2  
ATOM 2421  O O    . ASP A 1 21  ? 11.968  17.717  -0.948  1.00 0.88  ? 21  ASP A O    2  
ATOM 2422  C CB   . ASP A 1 21  ? 13.891  15.204  -1.253  1.00 2.11  ? 21  ASP A CB   2  
ATOM 2423  C CG   . ASP A 1 21  ? 14.708  16.423  -1.627  1.00 2.89  ? 21  ASP A CG   2  
ATOM 2424  O OD1  . ASP A 1 21  ? 15.314  17.037  -0.726  1.00 2.89  ? 21  ASP A OD1  2  
ATOM 2425  O OD2  . ASP A 1 21  ? 14.756  16.764  -2.827  1.00 3.67  ? 21  ASP A OD2  2  
ATOM 2426  H H    . ASP A 1 21  ? 11.694  13.743  -0.651  1.00 1.43  ? 21  ASP A H    2  
ATOM 2427  H HA   . ASP A 1 21  ? 13.152  15.969  0.610   1.00 1.72  ? 21  ASP A HA   2  
ATOM 2428  H HB2  . ASP A 1 21  ? 14.541  14.482  -0.792  1.00 1.95  ? 21  ASP A HB2  2  
ATOM 2429  H HB3  . ASP A 1 21  ? 13.477  14.781  -2.157  1.00 2.52  ? 21  ASP A HB3  2  
ATOM 2430  N N    . VAL A 1 22  ? 10.746  15.887  -1.452  1.00 0.60  ? 22  VAL A N    2  
ATOM 2431  C CA   . VAL A 1 22  ? 9.845   16.474  -2.415  1.00 0.46  ? 22  VAL A CA   2  
ATOM 2432  C C    . VAL A 1 22  ? 8.506   16.815  -1.790  1.00 0.40  ? 22  VAL A C    2  
ATOM 2433  O O    . VAL A 1 22  ? 8.340   16.776  -0.569  1.00 0.48  ? 22  VAL A O    2  
ATOM 2434  C CB   . VAL A 1 22  ? 9.614   15.512  -3.608  1.00 0.57  ? 22  VAL A CB   2  
ATOM 2435  C CG1  . VAL A 1 22  ? 10.854  15.412  -4.469  1.00 0.90  ? 22  VAL A CG1  2  
ATOM 2436  C CG2  . VAL A 1 22  ? 9.234   14.120  -3.127  1.00 0.41  ? 22  VAL A CG2  2  
ATOM 2437  H H    . VAL A 1 22  ? 10.563  14.972  -1.158  1.00 0.53  ? 22  VAL A H    2  
ATOM 2438  H HA   . VAL A 1 22  ? 10.298  17.373  -2.793  1.00 0.55  ? 22  VAL A HA   2  
ATOM 2439  H HB   . VAL A 1 22  ? 8.807   15.895  -4.211  1.00 0.68  ? 22  VAL A HB   2  
ATOM 2440  H HG11 . VAL A 1 22  ? 11.673  15.049  -3.870  1.00 1.47  ? 22  VAL A HG11 2  
ATOM 2441  H HG12 . VAL A 1 22  ? 11.098  16.385  -4.870  1.00 1.33  ? 22  VAL A HG12 2  
ATOM 2442  H HG13 . VAL A 1 22  ? 10.667  14.722  -5.278  1.00 1.36  ? 22  VAL A HG13 2  
ATOM 2443  H HG21 . VAL A 1 22  ? 10.068  13.691  -2.591  1.00 1.16  ? 22  VAL A HG21 2  
ATOM 2444  H HG22 . VAL A 1 22  ? 8.996   13.497  -3.980  1.00 1.06  ? 22  VAL A HG22 2  
ATOM 2445  H HG23 . VAL A 1 22  ? 8.376   14.182  -2.475  1.00 1.02  ? 22  VAL A HG23 2  
ATOM 2446  N N    . SER A 1 23  ? 7.568   17.150  -2.648  1.00 0.47  ? 23  SER A N    2  
ATOM 2447  C CA   . SER A 1 23  ? 6.194   17.365  -2.246  1.00 0.58  ? 23  SER A CA   2  
ATOM 2448  C C    . SER A 1 23  ? 5.635   15.976  -1.953  1.00 0.46  ? 23  SER A C    2  
ATOM 2449  O O    . SER A 1 23  ? 6.280   15.006  -2.350  1.00 0.39  ? 23  SER A O    2  
ATOM 2450  C CB   . SER A 1 23  ? 5.441   18.071  -3.382  1.00 0.77  ? 23  SER A CB   2  
ATOM 2451  O OG   . SER A 1 23  ? 5.560   17.353  -4.601  1.00 1.23  ? 23  SER A OG   2  
ATOM 2452  H H    . SER A 1 23  ? 7.806   17.243  -3.590  1.00 0.53  ? 23  SER A H    2  
ATOM 2453  H HA   . SER A 1 23  ? 6.180   17.966  -1.348  1.00 0.66  ? 23  SER A HA   2  
ATOM 2454  H HB2  . SER A 1 23  ? 4.398   18.155  -3.127  1.00 1.36  ? 23  SER A HB2  2  
ATOM 2455  H HB3  . SER A 1 23  ? 5.855   19.059  -3.521  1.00 1.21  ? 23  SER A HB3  2  
ATOM 2456  H HG   . SER A 1 23  ? 5.432   16.409  -4.433  1.00 1.72  ? 23  SER A HG   2  
ATOM 2457  N N    . PRO A 1 24  ? 4.439   15.830  -1.331  1.00 0.46  ? 24  PRO A N    2  
ATOM 2458  C CA   . PRO A 1 24  ? 4.156   14.723  -0.416  1.00 0.39  ? 24  PRO A CA   2  
ATOM 2459  C C    . PRO A 1 24  ? 4.854   13.429  -0.783  1.00 0.27  ? 24  PRO A C    2  
ATOM 2460  O O    . PRO A 1 24  ? 4.701   12.918  -1.896  1.00 0.24  ? 24  PRO A O    2  
ATOM 2461  C CB   . PRO A 1 24  ? 2.667   14.521  -0.581  1.00 0.43  ? 24  PRO A CB   2  
ATOM 2462  C CG   . PRO A 1 24  ? 2.118   15.841  -1.004  1.00 0.50  ? 24  PRO A CG   2  
ATOM 2463  C CD   . PRO A 1 24  ? 3.267   16.700  -1.476  1.00 0.56  ? 24  PRO A CD   2  
ATOM 2464  H HA   . PRO A 1 24  ? 4.366   14.984  0.600   1.00 0.45  ? 24  PRO A HA   2  
ATOM 2465  H HB2  . PRO A 1 24  ? 2.495   13.768  -1.338  1.00 0.39  ? 24  PRO A HB2  2  
ATOM 2466  H HB3  . PRO A 1 24  ? 2.239   14.191  0.355   1.00 0.48  ? 24  PRO A HB3  2  
ATOM 2467  H HG2  . PRO A 1 24  ? 1.434   15.681  -1.814  1.00 0.47  ? 24  PRO A HG2  2  
ATOM 2468  H HG3  . PRO A 1 24  ? 1.613   16.312  -0.174  1.00 0.58  ? 24  PRO A HG3  2  
ATOM 2469  H HD2  . PRO A 1 24  ? 3.120   16.976  -2.509  1.00 0.59  ? 24  PRO A HD2  2  
ATOM 2470  H HD3  . PRO A 1 24  ? 3.361   17.580  -0.858  1.00 0.69  ? 24  PRO A HD3  2  
ATOM 2471  N N    . ALA A 1 25  ? 5.585   12.916  0.215   1.00 0.25  ? 25  ALA A N    2  
ATOM 2472  C CA   . ALA A 1 25  ? 6.522   11.805  0.066   1.00 0.19  ? 25  ALA A CA   2  
ATOM 2473  C C    . ALA A 1 25  ? 6.056   10.796  -0.953  1.00 0.14  ? 25  ALA A C    2  
ATOM 2474  O O    . ALA A 1 25  ? 4.921   10.343  -0.905  1.00 0.17  ? 25  ALA A O    2  
ATOM 2475  C CB   . ALA A 1 25  ? 6.715   11.127  1.407   1.00 0.27  ? 25  ALA A CB   2  
ATOM 2476  H H    . ALA A 1 25  ? 5.476   13.305  1.107   1.00 0.32  ? 25  ALA A H    2  
ATOM 2477  H HA   . ALA A 1 25  ? 7.474   12.207  -0.247  1.00 0.18  ? 25  ALA A HA   2  
ATOM 2478  H HB1  . ALA A 1 25  ? 7.019   11.861  2.140   1.00 1.02  ? 25  ALA A HB1  2  
ATOM 2479  H HB2  . ALA A 1 25  ? 7.479   10.366  1.322   1.00 1.10  ? 25  ALA A HB2  2  
ATOM 2480  H HB3  . ALA A 1 25  ? 5.780   10.671  1.715   1.00 1.05  ? 25  ALA A HB3  2  
ATOM 2481  N N    . GLU A 1 26  ? 6.919   10.434  -1.875  1.00 0.14  ? 26  GLU A N    2  
ATOM 2482  C CA   . GLU A 1 26  ? 6.517   9.523   -2.915  1.00 0.14  ? 26  GLU A CA   2  
ATOM 2483  C C    . GLU A 1 26  ? 7.279   8.217   -2.787  1.00 0.15  ? 26  GLU A C    2  
ATOM 2484  O O    . GLU A 1 26  ? 8.445   8.190   -2.392  1.00 0.19  ? 26  GLU A O    2  
ATOM 2485  C CB   . GLU A 1 26  ? 6.712   10.142  -4.311  1.00 0.21  ? 26  GLU A CB   2  
ATOM 2486  C CG   . GLU A 1 26  ? 7.143   11.596  -4.291  1.00 0.42  ? 26  GLU A CG   2  
ATOM 2487  C CD   . GLU A 1 26  ? 7.399   12.142  -5.681  1.00 0.54  ? 26  GLU A CD   2  
ATOM 2488  O OE1  . GLU A 1 26  ? 6.432   12.561  -6.350  1.00 0.66  ? 26  GLU A OE1  2  
ATOM 2489  O OE2  . GLU A 1 26  ? 8.571   12.158  -6.111  1.00 0.69  ? 26  GLU A OE2  2  
ATOM 2490  H H    . GLU A 1 26  ? 7.841   10.775  -1.850  1.00 0.18  ? 26  GLU A H    2  
ATOM 2491  H HA   . GLU A 1 26  ? 5.468   9.315   -2.768  1.00 0.15  ? 26  GLU A HA   2  
ATOM 2492  H HB2  . GLU A 1 26  ? 7.465   9.580   -4.840  1.00 0.33  ? 26  GLU A HB2  2  
ATOM 2493  H HB3  . GLU A 1 26  ? 5.773   10.081  -4.857  1.00 0.37  ? 26  GLU A HB3  2  
ATOM 2494  H HG2  . GLU A 1 26  ? 6.370   12.186  -3.823  1.00 0.59  ? 26  GLU A HG2  2  
ATOM 2495  H HG3  . GLU A 1 26  ? 8.047   11.675  -3.716  1.00 0.58  ? 26  GLU A HG3  2  
ATOM 2496  N N    . LEU A 1 27  ? 6.593   7.146   -3.117  1.00 0.15  ? 27  LEU A N    2  
ATOM 2497  C CA   . LEU A 1 27  ? 7.135   5.812   -3.048  1.00 0.16  ? 27  LEU A CA   2  
ATOM 2498  C C    . LEU A 1 27  ? 7.478   5.351   -4.445  1.00 0.16  ? 27  LEU A C    2  
ATOM 2499  O O    . LEU A 1 27  ? 6.672   5.451   -5.352  1.00 0.19  ? 27  LEU A O    2  
ATOM 2500  C CB   . LEU A 1 27  ? 6.112   4.872   -2.404  1.00 0.21  ? 27  LEU A CB   2  
ATOM 2501  C CG   . LEU A 1 27  ? 6.325   3.380   -2.661  1.00 0.29  ? 27  LEU A CG   2  
ATOM 2502  C CD1  . LEU A 1 27  ? 5.867   2.584   -1.465  1.00 0.53  ? 27  LEU A CD1  2  
ATOM 2503  C CD2  . LEU A 1 27  ? 5.560   2.937   -3.903  1.00 0.59  ? 27  LEU A CD2  2  
ATOM 2504  H H    . LEU A 1 27  ? 5.663   7.261   -3.419  1.00 0.15  ? 27  LEU A H    2  
ATOM 2505  H HA   . LEU A 1 27  ? 8.029   5.832   -2.446  1.00 0.17  ? 27  LEU A HA   2  
ATOM 2506  H HB2  . LEU A 1 27  ? 6.129   5.037   -1.337  1.00 0.23  ? 27  LEU A HB2  2  
ATOM 2507  H HB3  . LEU A 1 27  ? 5.135   5.138   -2.769  1.00 0.24  ? 27  LEU A HB3  2  
ATOM 2508  H HG   . LEU A 1 27  ? 7.376   3.187   -2.820  1.00 0.70  ? 27  LEU A HG   2  
ATOM 2509  H HD11 . LEU A 1 27  ? 6.171   1.555   -1.583  1.00 1.19  ? 27  LEU A HD11 2  
ATOM 2510  H HD12 . LEU A 1 27  ? 4.792   2.638   -1.387  1.00 1.10  ? 27  LEU A HD12 2  
ATOM 2511  H HD13 . LEU A 1 27  ? 6.315   2.994   -0.575  1.00 1.21  ? 27  LEU A HD13 2  
ATOM 2512  H HD21 . LEU A 1 27  ? 5.628   1.864   -4.007  1.00 1.11  ? 27  LEU A HD21 2  
ATOM 2513  H HD22 . LEU A 1 27  ? 5.994   3.409   -4.777  1.00 1.22  ? 27  LEU A HD22 2  
ATOM 2514  H HD23 . LEU A 1 27  ? 4.520   3.229   -3.813  1.00 1.17  ? 27  LEU A HD23 2  
ATOM 2515  N N    . THR A 1 28  ? 8.670   4.863   -4.622  1.00 0.16  ? 28  THR A N    2  
ATOM 2516  C CA   . THR A 1 28  ? 9.125   4.484   -5.934  1.00 0.17  ? 28  THR A CA   2  
ATOM 2517  C C    . THR A 1 28  ? 9.494   3.016   -5.971  1.00 0.17  ? 28  THR A C    2  
ATOM 2518  O O    . THR A 1 28  ? 10.507  2.621   -5.406  1.00 0.17  ? 28  THR A O    2  
ATOM 2519  C CB   . THR A 1 28  ? 10.362  5.306   -6.318  1.00 0.19  ? 28  THR A CB   2  
ATOM 2520  O OG1  . THR A 1 28  ? 10.160  6.684   -5.978  1.00 0.22  ? 28  THR A OG1  2  
ATOM 2521  C CG2  . THR A 1 28  ? 10.660  5.187   -7.802  1.00 0.22  ? 28  THR A CG2  2  
ATOM 2522  H H    . THR A 1 28  ? 9.270   4.759   -3.851  1.00 0.16  ? 28  THR A H    2  
ATOM 2523  H HA   . THR A 1 28  ? 8.341   4.681   -6.647  1.00 0.18  ? 28  THR A HA   2  
ATOM 2524  H HB   . THR A 1 28  ? 11.204  4.926   -5.763  1.00 0.20  ? 28  THR A HB   2  
ATOM 2525  H HG1  . THR A 1 28  ? 9.788   6.739   -5.090  1.00 0.24  ? 28  THR A HG1  2  
ATOM 2526  H HG21 . THR A 1 28  ? 9.831   5.600   -8.365  1.00 1.06  ? 28  THR A HG21 2  
ATOM 2527  H HG22 . THR A 1 28  ? 10.800  4.144   -8.063  1.00 1.00  ? 28  THR A HG22 2  
ATOM 2528  H HG23 . THR A 1 28  ? 11.561  5.734   -8.031  1.00 1.03  ? 28  THR A HG23 2  
ATOM 2529  N N    . TRP A 1 29  ? 8.686   2.201   -6.621  1.00 0.19  ? 29  TRP A N    2  
ATOM 2530  C CA   . TRP A 1 29  ? 9.111   0.847   -6.875  1.00 0.18  ? 29  TRP A CA   2  
ATOM 2531  C C    . TRP A 1 29  ? 9.845   0.821   -8.193  1.00 0.19  ? 29  TRP A C    2  
ATOM 2532  O O    . TRP A 1 29  ? 9.273   1.102   -9.247  1.00 0.22  ? 29  TRP A O    2  
ATOM 2533  C CB   . TRP A 1 29  ? 7.967   -0.169  -6.888  1.00 0.20  ? 29  TRP A CB   2  
ATOM 2534  C CG   . TRP A 1 29  ? 8.480   -1.563  -7.095  1.00 0.18  ? 29  TRP A CG   2  
ATOM 2535  C CD1  . TRP A 1 29  ? 8.812   -2.452  -6.122  1.00 0.17  ? 29  TRP A CD1  2  
ATOM 2536  C CD2  . TRP A 1 29  ? 8.758   -2.216  -8.345  1.00 0.17  ? 29  TRP A CD2  2  
ATOM 2537  N NE1  . TRP A 1 29  ? 9.280   -3.615  -6.686  1.00 0.16  ? 29  TRP A NE1  2  
ATOM 2538  C CE2  . TRP A 1 29  ? 9.253   -3.494  -8.045  1.00 0.15  ? 29  TRP A CE2  2  
ATOM 2539  C CE3  . TRP A 1 29  ? 8.632   -1.848  -9.685  1.00 0.18  ? 29  TRP A CE3  2  
ATOM 2540  C CZ2  . TRP A 1 29  ? 9.626   -4.396  -9.034  1.00 0.15  ? 29  TRP A CZ2  2  
ATOM 2541  C CZ3  . TRP A 1 29  ? 9.001   -2.751  -10.662 1.00 0.18  ? 29  TRP A CZ3  2  
ATOM 2542  C CH2  . TRP A 1 29  ? 9.492   -4.012  -10.328 1.00 0.17  ? 29  TRP A CH2  2  
ATOM 2543  H H    . TRP A 1 29  ? 7.812   2.517   -6.943  1.00 0.21  ? 29  TRP A H    2  
ATOM 2544  H HA   . TRP A 1 29  ? 9.808   0.578   -6.093  1.00 0.18  ? 29  TRP A HA   2  
ATOM 2545  H HB2  . TRP A 1 29  ? 7.452   -0.137  -5.938  1.00 0.22  ? 29  TRP A HB2  2  
ATOM 2546  H HB3  . TRP A 1 29  ? 7.275   0.058   -7.679  1.00 0.22  ? 29  TRP A HB3  2  
ATOM 2547  H HD1  . TRP A 1 29  ? 8.717   -2.253  -5.065  1.00 0.18  ? 29  TRP A HD1  2  
ATOM 2548  H HE1  . TRP A 1 29  ? 9.582   -4.411  -6.190  1.00 0.17  ? 29  TRP A HE1  2  
ATOM 2549  H HE3  . TRP A 1 29  ? 8.259   -0.875  -9.962  1.00 0.20  ? 29  TRP A HE3  2  
ATOM 2550  H HZ2  . TRP A 1 29  ? 10.016  -5.375  -8.801  1.00 0.16  ? 29  TRP A HZ2  2  
ATOM 2551  H HZ3  . TRP A 1 29  ? 8.907   -2.484  -11.702 1.00 0.20  ? 29  TRP A HZ3  2  
ATOM 2552  H HH2  . TRP A 1 29  ? 9.769   -4.693  -11.121 1.00 0.18  ? 29  TRP A HH2  2  
ATOM 2553  N N    . ARG A 1 30  ? 11.114  0.515   -8.122  1.00 0.19  ? 30  ARG A N    2  
ATOM 2554  C CA   . ARG A 1 30  ? 11.941  0.460   -9.293  1.00 0.21  ? 30  ARG A CA   2  
ATOM 2555  C C    . ARG A 1 30  ? 12.610  -0.897  -9.401  1.00 0.18  ? 30  ARG A C    2  
ATOM 2556  O O    . ARG A 1 30  ? 13.307  -1.337  -8.490  1.00 0.21  ? 30  ARG A O    2  
ATOM 2557  C CB   . ARG A 1 30  ? 12.953  1.590   -9.266  1.00 0.27  ? 30  ARG A CB   2  
ATOM 2558  C CG   . ARG A 1 30  ? 13.546  1.817   -7.915  1.00 0.32  ? 30  ARG A CG   2  
ATOM 2559  C CD   . ARG A 1 30  ? 15.032  2.088   -7.999  1.00 0.61  ? 30  ARG A CD   2  
ATOM 2560  N NE   . ARG A 1 30  ? 15.636  2.272   -6.680  1.00 0.50  ? 30  ARG A NE   2  
ATOM 2561  C CZ   . ARG A 1 30  ? 16.725  1.630   -6.257  1.00 1.09  ? 30  ARG A CZ   2  
ATOM 2562  N NH1  . ARG A 1 30  ? 17.316  0.727   -7.032  1.00 1.93  ? 30  ARG A NH1  2  
ATOM 2563  N NH2  . ARG A 1 30  ? 17.220  1.890   -5.055  1.00 1.05  ? 30  ARG A NH2  2  
ATOM 2564  H H    . ARG A 1 30  ? 11.512  0.313   -7.245  1.00 0.20  ? 30  ARG A H    2  
ATOM 2565  H HA   . ARG A 1 30  ? 11.305  0.592   -10.142 1.00 0.24  ? 30  ARG A HA   2  
ATOM 2566  H HB2  . ARG A 1 30  ? 13.744  1.377   -9.947  1.00 0.55  ? 30  ARG A HB2  2  
ATOM 2567  H HB3  . ARG A 1 30  ? 12.460  2.494   -9.567  1.00 0.51  ? 30  ARG A HB3  2  
ATOM 2568  H HG2  . ARG A 1 30  ? 13.062  2.669   -7.481  1.00 0.90  ? 30  ARG A HG2  2  
ATOM 2569  H HG3  . ARG A 1 30  ? 13.366  0.940   -7.319  1.00 0.90  ? 30  ARG A HG3  2  
ATOM 2570  H HD2  . ARG A 1 30  ? 15.503  1.255   -8.491  1.00 1.11  ? 30  ARG A HD2  2  
ATOM 2571  H HD3  . ARG A 1 30  ? 15.189  2.983   -8.583  1.00 1.10  ? 30  ARG A HD3  2  
ATOM 2572  H HE   . ARG A 1 30  ? 15.211  2.929   -6.081  1.00 0.65  ? 30  ARG A HE   2  
ATOM 2573  H HH11 . ARG A 1 30  ? 16.947  0.519   -7.940  1.00 2.07  ? 30  ARG A HH11 2  
ATOM 2574  H HH12 . ARG A 1 30  ? 18.139  0.250   -6.713  1.00 2.49  ? 30  ARG A HH12 2  
ATOM 2575  H HH21 . ARG A 1 30  ? 16.780  2.569   -4.460  1.00 0.78  ? 30  ARG A HH21 2  
ATOM 2576  H HH22 . ARG A 1 30  ? 18.041  1.411   -4.731  1.00 1.55  ? 30  ARG A HH22 2  
ATOM 2577  N N    . SER A 1 31  ? 12.365  -1.550  -10.526 1.00 0.17  ? 31  SER A N    2  
ATOM 2578  C CA   . SER A 1 31  ? 12.804  -2.911  -10.764 1.00 0.18  ? 31  SER A CA   2  
ATOM 2579  C C    . SER A 1 31  ? 14.322  -3.035  -10.642 1.00 0.19  ? 31  SER A C    2  
ATOM 2580  O O    . SER A 1 31  ? 15.031  -2.045  -10.849 1.00 0.27  ? 31  SER A O    2  
ATOM 2581  C CB   . SER A 1 31  ? 12.333  -3.338  -12.148 1.00 0.21  ? 31  SER A CB   2  
ATOM 2582  O OG   . SER A 1 31  ? 12.987  -2.585  -13.158 1.00 0.25  ? 31  SER A OG   2  
ATOM 2583  H H    . SER A 1 31  ? 11.867  -1.087  -11.235 1.00 0.22  ? 31  SER A H    2  
ATOM 2584  H HA   . SER A 1 31  ? 12.338  -3.547  -10.029 1.00 0.17  ? 31  SER A HA   2  
ATOM 2585  H HB2  . SER A 1 31  ? 12.529  -4.382  -12.288 1.00 0.25  ? 31  SER A HB2  2  
ATOM 2586  H HB3  . SER A 1 31  ? 11.272  -3.166  -12.226 1.00 0.22  ? 31  SER A HB3  2  
ATOM 2587  H HG   . SER A 1 31  ? 13.228  -1.722  -12.801 1.00 0.97  ? 31  SER A HG   2  
ATOM 2588  N N    . THR A 1 32  ? 14.817  -4.223  -10.309 1.00 0.21  ? 32  THR A N    2  
ATOM 2589  C CA   . THR A 1 32  ? 16.244  -4.419  -10.049 1.00 0.22  ? 32  THR A CA   2  
ATOM 2590  C C    . THR A 1 32  ? 17.099  -3.882  -11.198 1.00 0.44  ? 32  THR A C    2  
ATOM 2591  O O    . THR A 1 32  ? 18.141  -3.257  -10.977 1.00 0.67  ? 32  THR A O    2  
ATOM 2592  C CB   . THR A 1 32  ? 16.579  -5.909  -9.827  1.00 0.41  ? 32  THR A CB   2  
ATOM 2593  O OG1  . THR A 1 32  ? 16.215  -6.671  -10.986 1.00 0.97  ? 32  THR A OG1  2  
ATOM 2594  C CG2  . THR A 1 32  ? 15.856  -6.465  -8.610  1.00 0.44  ? 32  THR A CG2  2  
ATOM 2595  H H    . THR A 1 32  ? 14.208  -4.995  -10.237 1.00 0.29  ? 32  THR A H    2  
ATOM 2596  H HA   . THR A 1 32  ? 16.493  -3.879  -9.143  1.00 0.31  ? 32  THR A HA   2  
ATOM 2597  H HB   . THR A 1 32  ? 17.643  -5.998  -9.666  1.00 0.79  ? 32  THR A HB   2  
ATOM 2598  H HG1  . THR A 1 32  ? 17.019  -6.971  -11.432 1.00 1.28  ? 32  THR A HG1  2  
ATOM 2599  H HG21 . THR A 1 32  ? 14.790  -6.415  -8.769  1.00 1.02  ? 32  THR A HG21 2  
ATOM 2600  H HG22 . THR A 1 32  ? 16.117  -5.883  -7.739  1.00 1.14  ? 32  THR A HG22 2  
ATOM 2601  H HG23 . THR A 1 32  ? 16.149  -7.494  -8.457  1.00 1.25  ? 32  THR A HG23 2  
ATOM 2602  N N    . ASP A 1 33  ? 16.622  -4.098  -12.421 1.00 0.55  ? 33  ASP A N    2  
ATOM 2603  C CA   . ASP A 1 33  ? 17.339  -3.702  -13.625 1.00 0.89  ? 33  ASP A CA   2  
ATOM 2604  C C    . ASP A 1 33  ? 17.427  -2.186  -13.752 1.00 1.00  ? 33  ASP A C    2  
ATOM 2605  O O    . ASP A 1 33  ? 18.348  -1.653  -14.372 1.00 1.43  ? 33  ASP A O    2  
ATOM 2606  C CB   . ASP A 1 33  ? 16.634  -4.269  -14.856 1.00 1.09  ? 33  ASP A CB   2  
ATOM 2607  C CG   . ASP A 1 33  ? 16.530  -5.780  -14.835 1.00 1.88  ? 33  ASP A CG   2  
ATOM 2608  O OD1  . ASP A 1 33  ? 17.544  -6.454  -15.098 1.00 2.19  ? 33  ASP A OD1  2  
ATOM 2609  O OD2  . ASP A 1 33  ? 15.427  -6.300  -14.565 1.00 2.57  ? 33  ASP A OD2  2  
ATOM 2610  H H    . ASP A 1 33  ? 15.757  -4.547  -12.519 1.00 0.50  ? 33  ASP A H    2  
ATOM 2611  H HA   . ASP A 1 33  ? 18.336  -4.110  -13.572 1.00 1.02  ? 33  ASP A HA   2  
ATOM 2612  H HB2  . ASP A 1 33  ? 15.636  -3.862  -14.909 1.00 1.40  ? 33  ASP A HB2  2  
ATOM 2613  H HB3  . ASP A 1 33  ? 17.179  -3.978  -15.735 1.00 1.33  ? 33  ASP A HB3  2  
ATOM 2614  N N    . GLY A 1 34  ? 16.463  -1.498  -13.158 1.00 0.80  ? 34  GLY A N    2  
ATOM 2615  C CA   . GLY A 1 34  ? 16.405  -0.052  -13.261 1.00 1.07  ? 34  GLY A CA   2  
ATOM 2616  C C    . GLY A 1 34  ? 15.511  0.401   -14.394 1.00 0.75  ? 34  GLY A C    2  
ATOM 2617  O O    . GLY A 1 34  ? 15.393  1.595   -14.668 1.00 0.99  ? 34  GLY A O    2  
ATOM 2618  H H    . GLY A 1 34  ? 15.791  -1.976  -12.626 1.00 0.67  ? 34  GLY A H    2  
ATOM 2619  H HA2  . GLY A 1 34  ? 16.026  0.350   -12.334 1.00 1.36  ? 34  GLY A HA2  2  
ATOM 2620  H HA3  . GLY A 1 34  ? 17.401  0.329   -13.428 1.00 1.41  ? 34  GLY A HA3  2  
ATOM 2621  N N    . ASP A 1 35  ? 14.877  -0.559  -15.051 1.00 0.62  ? 35  ASP A N    2  
ATOM 2622  C CA   . ASP A 1 35  ? 13.981  -0.267  -16.160 1.00 1.00  ? 35  ASP A CA   2  
ATOM 2623  C C    . ASP A 1 35  ? 12.652  0.271   -15.651 1.00 0.69  ? 35  ASP A C    2  
ATOM 2624  O O    . ASP A 1 35  ? 12.277  1.408   -15.931 1.00 0.72  ? 35  ASP A O    2  
ATOM 2625  C CB   . ASP A 1 35  ? 13.754  -1.517  -16.997 1.00 1.52  ? 35  ASP A CB   2  
ATOM 2626  C CG   . ASP A 1 35  ? 12.681  -1.327  -18.049 1.00 2.13  ? 35  ASP A CG   2  
ATOM 2627  O OD1  . ASP A 1 35  ? 12.984  -0.766  -19.122 1.00 2.16  ? 35  ASP A OD1  2  
ATOM 2628  O OD2  . ASP A 1 35  ? 11.532  -1.750  -17.814 1.00 2.64  ? 35  ASP A OD2  2  
ATOM 2629  H H    . ASP A 1 35  ? 15.019  -1.491  -14.785 1.00 0.67  ? 35  ASP A H    2  
ATOM 2630  H HA   . ASP A 1 35  ? 14.447  0.478   -16.772 1.00 1.44  ? 35  ASP A HA   2  
ATOM 2631  H HB2  . ASP A 1 35  ? 14.674  -1.786  -17.491 1.00 1.74  ? 35  ASP A HB2  2  
ATOM 2632  H HB3  . ASP A 1 35  ? 13.456  -2.315  -16.346 1.00 1.48  ? 35  ASP A HB3  2  
ATOM 2633  N N    . LYS A 1 36  ? 11.954  -0.549  -14.887 1.00 0.48  ? 36  LYS A N    2  
ATOM 2634  C CA   . LYS A 1 36  ? 10.655  -0.179  -14.353 1.00 0.32  ? 36  LYS A CA   2  
ATOM 2635  C C    . LYS A 1 36  ? 10.790  0.705   -13.125 1.00 0.23  ? 36  LYS A C    2  
ATOM 2636  O O    . LYS A 1 36  ? 11.517  0.378   -12.195 1.00 0.39  ? 36  LYS A O    2  
ATOM 2637  C CB   . LYS A 1 36  ? 9.858   -1.431  -14.004 1.00 0.36  ? 36  LYS A CB   2  
ATOM 2638  C CG   . LYS A 1 36  ? 8.804   -1.793  -15.004 1.00 0.49  ? 36  LYS A CG   2  
ATOM 2639  C CD   . LYS A 1 36  ? 8.418   -3.229  -14.787 1.00 0.56  ? 36  LYS A CD   2  
ATOM 2640  C CE   . LYS A 1 36  ? 6.968   -3.484  -15.137 1.00 0.44  ? 36  LYS A CE   2  
ATOM 2641  N NZ   . LYS A 1 36  ? 6.628   -4.928  -15.109 1.00 1.20  ? 36  LYS A NZ   2  
ATOM 2642  H H    . LYS A 1 36  ? 12.324  -1.435  -14.675 1.00 0.50  ? 36  LYS A H    2  
ATOM 2643  H HA   . LYS A 1 36  ? 10.127  0.368   -15.119 1.00 0.44  ? 36  LYS A HA   2  
ATOM 2644  H HB2  . LYS A 1 36  ? 10.521  -2.266  -13.933 1.00 0.70  ? 36  LYS A HB2  2  
ATOM 2645  H HB3  . LYS A 1 36  ? 9.383   -1.298  -13.049 1.00 0.69  ? 36  LYS A HB3  2  
ATOM 2646  H HG2  . LYS A 1 36  ? 7.941   -1.161  -14.862 1.00 0.76  ? 36  LYS A HG2  2  
ATOM 2647  H HG3  . LYS A 1 36  ? 9.196   -1.670  -16.001 1.00 0.78  ? 36  LYS A HG3  2  
ATOM 2648  H HD2  . LYS A 1 36  ? 9.045   -3.856  -15.403 1.00 0.72  ? 36  LYS A HD2  2  
ATOM 2649  H HD3  . LYS A 1 36  ? 8.588   -3.458  -13.745 1.00 0.78  ? 36  LYS A HD3  2  
ATOM 2650  H HE2  . LYS A 1 36  ? 6.344   -2.961  -14.424 1.00 0.90  ? 36  LYS A HE2  2  
ATOM 2651  H HE3  . LYS A 1 36  ? 6.784   -3.103  -16.123 1.00 0.84  ? 36  LYS A HE3  2  
ATOM 2652  H HZ1  . LYS A 1 36  ? 6.693   -5.296  -14.143 1.00 1.69  ? 36  LYS A HZ1  2  
ATOM 2653  H HZ2  . LYS A 1 36  ? 7.283   -5.463  -15.716 1.00 1.81  ? 36  LYS A HZ2  2  
ATOM 2654  H HZ3  . LYS A 1 36  ? 5.660   -5.075  -15.462 1.00 1.72  ? 36  LYS A HZ3  2  
ATOM 2655  N N    . VAL A 1 37  ? 10.091  1.823   -13.148 1.00 0.23  ? 37  VAL A N    2  
ATOM 2656  C CA   . VAL A 1 37  ? 10.014  2.735   -12.012 1.00 0.23  ? 37  VAL A CA   2  
ATOM 2657  C C    . VAL A 1 37  ? 8.588   3.242   -11.884 1.00 0.26  ? 37  VAL A C    2  
ATOM 2658  O O    . VAL A 1 37  ? 8.060   3.883   -12.790 1.00 0.37  ? 37  VAL A O    2  
ATOM 2659  C CB   . VAL A 1 37  ? 10.979  3.948   -12.169 1.00 0.27  ? 37  VAL A CB   2  
ATOM 2660  C CG1  . VAL A 1 37  ? 10.533  5.122   -11.309 1.00 0.76  ? 37  VAL A CG1  2  
ATOM 2661  C CG2  . VAL A 1 37  ? 12.403  3.575   -11.804 1.00 0.83  ? 37  VAL A CG2  2  
ATOM 2662  H H    . VAL A 1 37  ? 9.601   2.053   -13.970 1.00 0.32  ? 37  VAL A H    2  
ATOM 2663  H HA   . VAL A 1 37  ? 10.272  2.182   -11.108 1.00 0.22  ? 37  VAL A HA   2  
ATOM 2664  H HB   . VAL A 1 37  ? 10.971  4.260   -13.201 1.00 0.72  ? 37  VAL A HB   2  
ATOM 2665  H HG11 . VAL A 1 37  ? 10.512  4.822   -10.272 1.00 1.48  ? 37  VAL A HG11 2  
ATOM 2666  H HG12 . VAL A 1 37  ? 9.545   5.435   -11.614 1.00 1.31  ? 37  VAL A HG12 2  
ATOM 2667  H HG13 . VAL A 1 37  ? 11.226  5.941   -11.433 1.00 1.29  ? 37  VAL A HG13 2  
ATOM 2668  H HG21 . VAL A 1 37  ? 13.087  4.180   -12.378 1.00 1.35  ? 37  VAL A HG21 2  
ATOM 2669  H HG22 . VAL A 1 37  ? 12.574  2.531   -12.015 1.00 1.53  ? 37  VAL A HG22 2  
ATOM 2670  H HG23 . VAL A 1 37  ? 12.562  3.765   -10.747 1.00 1.35  ? 37  VAL A HG23 2  
ATOM 2671  N N    . HIS A 1 38  ? 7.959   2.928   -10.770 1.00 0.22  ? 38  HIS A N    2  
ATOM 2672  C CA   . HIS A 1 38  ? 6.588   3.339   -10.537 1.00 0.25  ? 38  HIS A CA   2  
ATOM 2673  C C    . HIS A 1 38  ? 6.532   4.180   -9.277  1.00 0.24  ? 38  HIS A C    2  
ATOM 2674  O O    . HIS A 1 38  ? 6.835   3.693   -8.186  1.00 0.26  ? 38  HIS A O    2  
ATOM 2675  C CB   . HIS A 1 38  ? 5.670   2.122   -10.409 1.00 0.27  ? 38  HIS A CB   2  
ATOM 2676  C CG   . HIS A 1 38  ? 5.970   1.030   -11.395 1.00 0.28  ? 38  HIS A CG   2  
ATOM 2677  N ND1  . HIS A 1 38  ? 6.000   1.209   -12.755 1.00 0.30  ? 38  HIS A ND1  2  
ATOM 2678  C CD2  . HIS A 1 38  ? 6.278   -0.266  -11.196 1.00 0.30  ? 38  HIS A CD2  2  
ATOM 2679  C CE1  . HIS A 1 38  ? 6.309   0.064   -13.335 1.00 0.33  ? 38  HIS A CE1  2  
ATOM 2680  N NE2  . HIS A 1 38  ? 6.474   -0.851  -12.413 1.00 0.33  ? 38  HIS A NE2  2  
ATOM 2681  H H    . HIS A 1 38  ? 8.431   2.407   -10.078 1.00 0.22  ? 38  HIS A H    2  
ATOM 2682  H HA   . HIS A 1 38  ? 6.274   3.939   -11.377 1.00 0.27  ? 38  HIS A HA   2  
ATOM 2683  H HB2  . HIS A 1 38  ? 5.770   1.711   -9.415  1.00 0.28  ? 38  HIS A HB2  2  
ATOM 2684  H HB3  . HIS A 1 38  ? 4.648   2.436   -10.562 1.00 0.31  ? 38  HIS A HB3  2  
ATOM 2685  H HD1  . HIS A 1 38  ? 5.827   2.053   -13.231 1.00 0.32  ? 38  HIS A HD1  2  
ATOM 2686  H HD2  . HIS A 1 38  ? 6.414   -0.737  -10.256 1.00 0.32  ? 38  HIS A HD2  2  
ATOM 2687  H HE1  . HIS A 1 38  ? 6.460   -0.090  -14.381 1.00 0.36  ? 38  HIS A HE1  2  
ATOM 2688  H HE2  . HIS A 1 38  ? 6.342   -1.812  -12.580 1.00 0.38  ? 38  HIS A HE2  2  
ATOM 2689  N N    . THR A 1 39  ? 6.162   5.438   -9.426  1.00 0.23  ? 39  THR A N    2  
ATOM 2690  C CA   . THR A 1 39  ? 6.243   6.375   -8.326  1.00 0.22  ? 39  THR A CA   2  
ATOM 2691  C C    . THR A 1 39  ? 4.858   6.744   -7.789  1.00 0.23  ? 39  THR A C    2  
ATOM 2692  O O    . THR A 1 39  ? 4.005   7.270   -8.507  1.00 0.32  ? 39  THR A O    2  
ATOM 2693  C CB   . THR A 1 39  ? 7.006   7.643   -8.748  1.00 0.24  ? 39  THR A CB   2  
ATOM 2694  O OG1  . THR A 1 39  ? 7.995   7.305   -9.732  1.00 0.26  ? 39  THR A OG1  2  
ATOM 2695  C CG2  . THR A 1 39  ? 7.695   8.274   -7.549  1.00 0.24  ? 39  THR A CG2  2  
ATOM 2696  H H    . THR A 1 39  ? 5.825   5.743   -10.295 1.00 0.25  ? 39  THR A H    2  
ATOM 2697  H HA   . THR A 1 39  ? 6.802   5.899   -7.533  1.00 0.19  ? 39  THR A HA   2  
ATOM 2698  H HB   . THR A 1 39  ? 6.313   8.349   -9.166  1.00 0.28  ? 39  THR A HB   2  
ATOM 2699  H HG1  . THR A 1 39  ? 7.557   6.949   -10.516 1.00 0.86  ? 39  THR A HG1  2  
ATOM 2700  H HG21 . THR A 1 39  ? 6.972   8.449   -6.767  1.00 1.03  ? 39  THR A HG21 2  
ATOM 2701  H HG22 . THR A 1 39  ? 8.142   9.211   -7.843  1.00 1.00  ? 39  THR A HG22 2  
ATOM 2702  H HG23 . THR A 1 39  ? 8.466   7.604   -7.188  1.00 0.94  ? 39  THR A HG23 2  
ATOM 2703  N N    . VAL A 1 40  ? 4.657   6.439   -6.521  1.00 0.19  ? 40  VAL A N    2  
ATOM 2704  C CA   . VAL A 1 40  ? 3.414   6.693   -5.814  1.00 0.20  ? 40  VAL A CA   2  
ATOM 2705  C C    . VAL A 1 40  ? 3.585   7.859   -4.839  1.00 0.20  ? 40  VAL A C    2  
ATOM 2706  O O    . VAL A 1 40  ? 4.156   7.689   -3.768  1.00 0.20  ? 40  VAL A O    2  
ATOM 2707  C CB   . VAL A 1 40  ? 3.009   5.423   -5.012  1.00 0.21  ? 40  VAL A CB   2  
ATOM 2708  C CG1  . VAL A 1 40  ? 1.933   5.700   -3.981  1.00 0.23  ? 40  VAL A CG1  2  
ATOM 2709  C CG2  . VAL A 1 40  ? 2.544   4.316   -5.936  1.00 0.22  ? 40  VAL A CG2  2  
ATOM 2710  H H    . VAL A 1 40  ? 5.394   6.016   -6.025  1.00 0.22  ? 40  VAL A H    2  
ATOM 2711  H HA   . VAL A 1 40  ? 2.639   6.919   -6.529  1.00 0.22  ? 40  VAL A HA   2  
ATOM 2712  H HB   . VAL A 1 40  ? 3.885   5.067   -4.489  1.00 0.22  ? 40  VAL A HB   2  
ATOM 2713  H HG11 . VAL A 1 40  ? 1.792   4.811   -3.376  1.00 0.97  ? 40  VAL A HG11 2  
ATOM 2714  H HG12 . VAL A 1 40  ? 1.010   5.951   -4.480  1.00 1.06  ? 40  VAL A HG12 2  
ATOM 2715  H HG13 . VAL A 1 40  ? 2.242   6.520   -3.349  1.00 1.09  ? 40  VAL A HG13 2  
ATOM 2716  H HG21 . VAL A 1 40  ? 2.293   3.444   -5.344  1.00 1.04  ? 40  VAL A HG21 2  
ATOM 2717  H HG22 . VAL A 1 40  ? 3.331   4.069   -6.631  1.00 1.05  ? 40  VAL A HG22 2  
ATOM 2718  H HG23 . VAL A 1 40  ? 1.670   4.645   -6.477  1.00 1.01  ? 40  VAL A HG23 2  
ATOM 2719  N N    . VAL A 1 41  ? 3.106   9.040   -5.200  1.00 0.22  ? 41  VAL A N    2  
ATOM 2720  C CA   . VAL A 1 41  ? 3.075   10.142  -4.248  1.00 0.22  ? 41  VAL A CA   2  
ATOM 2721  C C    . VAL A 1 41  ? 2.052   9.817   -3.173  1.00 0.23  ? 41  VAL A C    2  
ATOM 2722  O O    . VAL A 1 41  ? 0.856   9.666   -3.447  1.00 0.26  ? 41  VAL A O    2  
ATOM 2723  C CB   . VAL A 1 41  ? 2.766   11.505  -4.914  1.00 0.26  ? 41  VAL A CB   2  
ATOM 2724  C CG1  . VAL A 1 41  ? 1.836   11.307  -6.087  1.00 0.63  ? 41  VAL A CG1  2  
ATOM 2725  C CG2  . VAL A 1 41  ? 2.174   12.498  -3.910  1.00 0.59  ? 41  VAL A CG2  2  
ATOM 2726  H H    . VAL A 1 41  ? 2.767   9.171   -6.108  1.00 0.25  ? 41  VAL A H    2  
ATOM 2727  H HA   . VAL A 1 41  ? 4.055   10.206  -3.786  1.00 0.21  ? 41  VAL A HA   2  
ATOM 2728  H HB   . VAL A 1 41  ? 3.693   11.914  -5.287  1.00 0.61  ? 41  VAL A HB   2  
ATOM 2729  H HG11 . VAL A 1 41  ? 2.343   10.715  -6.835  1.00 1.22  ? 41  VAL A HG11 2  
ATOM 2730  H HG12 . VAL A 1 41  ? 1.566   12.264  -6.502  1.00 1.30  ? 41  VAL A HG12 2  
ATOM 2731  H HG13 . VAL A 1 41  ? 0.949   10.787  -5.759  1.00 1.30  ? 41  VAL A HG13 2  
ATOM 2732  H HG21 . VAL A 1 41  ? 2.845   12.612  -3.071  1.00 1.25  ? 41  VAL A HG21 2  
ATOM 2733  H HG22 . VAL A 1 41  ? 1.223   12.128  -3.558  1.00 1.17  ? 41  VAL A HG22 2  
ATOM 2734  H HG23 . VAL A 1 41  ? 2.032   13.456  -4.387  1.00 1.18  ? 41  VAL A HG23 2  
ATOM 2735  N N    . LEU A 1 42  ? 2.541   9.689   -1.961  1.00 0.23  ? 42  LEU A N    2  
ATOM 2736  C CA   . LEU A 1 42  ? 1.767   9.157   -0.859  1.00 0.26  ? 42  LEU A CA   2  
ATOM 2737  C C    . LEU A 1 42  ? 0.530   9.998   -0.552  1.00 0.27  ? 42  LEU A C    2  
ATOM 2738  O O    . LEU A 1 42  ? -0.450  9.478   -0.039  1.00 0.37  ? 42  LEU A O    2  
ATOM 2739  C CB   . LEU A 1 42  ? 2.672   9.010   0.365   1.00 0.32  ? 42  LEU A CB   2  
ATOM 2740  C CG   . LEU A 1 42  ? 3.655   7.840   0.292   1.00 0.43  ? 42  LEU A CG   2  
ATOM 2741  C CD1  . LEU A 1 42  ? 4.660   7.914   1.426   1.00 1.24  ? 42  LEU A CD1  2  
ATOM 2742  C CD2  . LEU A 1 42  ? 2.910   6.517   0.330   1.00 1.01  ? 42  LEU A CD2  2  
ATOM 2743  H H    . LEU A 1 42  ? 3.473   9.966   -1.794  1.00 0.25  ? 42  LEU A H    2  
ATOM 2744  H HA   . LEU A 1 42  ? 1.434   8.173   -1.151  1.00 0.31  ? 42  LEU A HA   2  
ATOM 2745  H HB2  . LEU A 1 42  ? 3.239   9.923   0.477   1.00 0.27  ? 42  LEU A HB2  2  
ATOM 2746  H HB3  . LEU A 1 42  ? 2.059   8.881   1.240   1.00 0.45  ? 42  LEU A HB3  2  
ATOM 2747  H HG   . LEU A 1 42  ? 4.199   7.893   -0.640  1.00 1.24  ? 42  LEU A HG   2  
ATOM 2748  H HD11 . LEU A 1 42  ? 5.289   7.038   1.407   1.00 1.86  ? 42  LEU A HD11 2  
ATOM 2749  H HD12 . LEU A 1 42  ? 4.137   7.966   2.370   1.00 1.80  ? 42  LEU A HD12 2  
ATOM 2750  H HD13 . LEU A 1 42  ? 5.270   8.796   1.303   1.00 1.75  ? 42  LEU A HD13 2  
ATOM 2751  H HD21 . LEU A 1 42  ? 2.305   6.469   1.224   1.00 1.58  ? 42  LEU A HD21 2  
ATOM 2752  H HD22 . LEU A 1 42  ? 3.621   5.703   0.333   1.00 1.41  ? 42  LEU A HD22 2  
ATOM 2753  H HD23 . LEU A 1 42  ? 2.275   6.436   -0.539  1.00 1.79  ? 42  LEU A HD23 2  
ATOM 2754  N N    . SER A 1 43  ? 0.551   11.276  -0.907  1.00 0.23  ? 43  SER A N    2  
ATOM 2755  C CA   . SER A 1 43  ? -0.601  12.159  -0.679  1.00 0.28  ? 43  SER A CA   2  
ATOM 2756  C C    . SER A 1 43  ? -1.896  11.563  -1.255  1.00 0.28  ? 43  SER A C    2  
ATOM 2757  O O    . SER A 1 43  ? -2.992  11.896  -0.808  1.00 0.34  ? 43  SER A O    2  
ATOM 2758  C CB   . SER A 1 43  ? -0.353  13.527  -1.314  1.00 0.35  ? 43  SER A CB   2  
ATOM 2759  O OG   . SER A 1 43  ? -1.440  14.412  -1.098  1.00 1.08  ? 43  SER A OG   2  
ATOM 2760  H H    . SER A 1 43  ? 1.358   11.640  -1.326  1.00 0.22  ? 43  SER A H    2  
ATOM 2761  H HA   . SER A 1 43  ? -0.714  12.286  0.395   1.00 0.32  ? 43  SER A HA   2  
ATOM 2762  H HB2  . SER A 1 43  ? 0.534   13.962  -0.884  1.00 0.86  ? 43  SER A HB2  2  
ATOM 2763  H HB3  . SER A 1 43  ? -0.213  13.406  -2.379  1.00 1.04  ? 43  SER A HB3  2  
ATOM 2764  H HG   . SER A 1 43  ? -1.775  14.297  -0.198  1.00 1.37  ? 43  SER A HG   2  
ATOM 2765  N N    . THR A 1 44  ? -1.763  10.671  -2.238  1.00 0.26  ? 44  THR A N    2  
ATOM 2766  C CA   . THR A 1 44  ? -2.920  10.082  -2.900  1.00 0.28  ? 44  THR A CA   2  
ATOM 2767  C C    . THR A 1 44  ? -3.388  8.829   -2.164  1.00 0.26  ? 44  THR A C    2  
ATOM 2768  O O    . THR A 1 44  ? -4.382  8.204   -2.536  1.00 0.29  ? 44  THR A O    2  
ATOM 2769  C CB   . THR A 1 44  ? -2.597  9.730   -4.368  1.00 0.32  ? 44  THR A CB   2  
ATOM 2770  O OG1  . THR A 1 44  ? -1.502  8.799   -4.435  1.00 0.30  ? 44  THR A OG1  2  
ATOM 2771  C CG2  . THR A 1 44  ? -2.242  10.984  -5.156  1.00 0.36  ? 44  THR A CG2  2  
ATOM 2772  H H    . THR A 1 44  ? -0.862  10.389  -2.510  1.00 0.26  ? 44  THR A H    2  
ATOM 2773  H HA   . THR A 1 44  ? -3.716  10.811  -2.891  1.00 0.31  ? 44  THR A HA   2  
ATOM 2774  H HB   . THR A 1 44  ? -3.471  9.278   -4.816  1.00 0.36  ? 44  THR A HB   2  
ATOM 2775  H HG1  . THR A 1 44  ? -0.697  9.220   -4.098  1.00 0.26  ? 44  THR A HG1  2  
ATOM 2776  H HG21 . THR A 1 44  ? -2.016  10.715  -6.176  1.00 1.04  ? 44  THR A HG21 2  
ATOM 2777  H HG22 . THR A 1 44  ? -1.379  11.457  -4.708  1.00 1.05  ? 44  THR A HG22 2  
ATOM 2778  H HG23 . THR A 1 44  ? -3.078  11.667  -5.139  1.00 1.04  ? 44  THR A HG23 2  
ATOM 2779  N N    . ILE A 1 45  ? -2.657  8.473   -1.119  1.00 0.24  ? 45  ILE A N    2  
ATOM 2780  C CA   . ILE A 1 45  ? -2.937  7.297   -0.322  1.00 0.22  ? 45  ILE A CA   2  
ATOM 2781  C C    . ILE A 1 45  ? -3.657  7.696   0.964   1.00 0.25  ? 45  ILE A C    2  
ATOM 2782  O O    . ILE A 1 45  ? -3.402  8.764   1.518   1.00 0.36  ? 45  ILE A O    2  
ATOM 2783  C CB   . ILE A 1 45  ? -1.611  6.601   0.036   1.00 0.25  ? 45  ILE A CB   2  
ATOM 2784  C CG1  . ILE A 1 45  ? -0.705  6.534   -1.200  1.00 0.25  ? 45  ILE A CG1  2  
ATOM 2785  C CG2  . ILE A 1 45  ? -1.859  5.214   0.585   1.00 0.28  ? 45  ILE A CG2  2  
ATOM 2786  C CD1  . ILE A 1 45  ? -1.190  5.580   -2.275  1.00 0.27  ? 45  ILE A CD1  2  
ATOM 2787  H H    . ILE A 1 45  ? -1.881  9.020   -0.872  1.00 0.26  ? 45  ILE A H    2  
ATOM 2788  H HA   . ILE A 1 45  ? -3.551  6.620   -0.898  1.00 0.22  ? 45  ILE A HA   2  
ATOM 2789  H HB   . ILE A 1 45  ? -1.124  7.177   0.809   1.00 0.29  ? 45  ILE A HB   2  
ATOM 2790  H HG12 . ILE A 1 45  ? -0.650  7.518   -1.642  1.00 0.23  ? 45  ILE A HG12 2  
ATOM 2791  H HG13 . ILE A 1 45  ? 0.281   6.232   -0.901  1.00 0.27  ? 45  ILE A HG13 2  
ATOM 2792  H HG21 . ILE A 1 45  ? -2.367  4.620   -0.160  1.00 1.01  ? 45  ILE A HG21 2  
ATOM 2793  H HG22 . ILE A 1 45  ? -2.473  5.284   1.469   1.00 1.07  ? 45  ILE A HG22 2  
ATOM 2794  H HG23 . ILE A 1 45  ? -0.917  4.752   0.834   1.00 1.04  ? 45  ILE A HG23 2  
ATOM 2795  H HD11 . ILE A 1 45  ? -2.128  5.934   -2.675  1.00 1.05  ? 45  ILE A HD11 2  
ATOM 2796  H HD12 . ILE A 1 45  ? -1.329  4.599   -1.848  1.00 1.05  ? 45  ILE A HD12 2  
ATOM 2797  H HD13 . ILE A 1 45  ? -0.456  5.526   -3.070  1.00 1.01  ? 45  ILE A HD13 2  
ATOM 2798  N N    . ASP A 1 46  ? -4.565  6.847   1.420   1.00 0.22  ? 46  ASP A N    2  
ATOM 2799  C CA   . ASP A 1 46  ? -5.293  7.088   2.658   1.00 0.27  ? 46  ASP A CA   2  
ATOM 2800  C C    . ASP A 1 46  ? -4.774  6.174   3.756   1.00 0.30  ? 46  ASP A C    2  
ATOM 2801  O O    . ASP A 1 46  ? -4.573  6.599   4.890   1.00 0.38  ? 46  ASP A O    2  
ATOM 2802  C CB   . ASP A 1 46  ? -6.791  6.841   2.468   1.00 0.33  ? 46  ASP A CB   2  
ATOM 2803  C CG   . ASP A 1 46  ? -7.612  7.285   3.668   1.00 0.48  ? 46  ASP A CG   2  
ATOM 2804  O OD1  . ASP A 1 46  ? -7.717  6.502   4.638   1.00 0.55  ? 46  ASP A OD1  2  
ATOM 2805  O OD2  . ASP A 1 46  ? -8.151  8.412   3.655   1.00 0.70  ? 46  ASP A OD2  2  
ATOM 2806  H H    . ASP A 1 46  ? -4.750  6.028   0.908   1.00 0.21  ? 46  ASP A H    2  
ATOM 2807  H HA   . ASP A 1 46  ? -5.135  8.116   2.948   1.00 0.31  ? 46  ASP A HA   2  
ATOM 2808  H HB2  . ASP A 1 46  ? -7.133  7.384   1.602   1.00 0.36  ? 46  ASP A HB2  2  
ATOM 2809  H HB3  . ASP A 1 46  ? -6.958  5.784   2.313   1.00 0.33  ? 46  ASP A HB3  2  
ATOM 2810  N N    . LYS A 1 47  ? -4.552  4.912   3.410   1.00 0.28  ? 47  LYS A N    2  
ATOM 2811  C CA   . LYS A 1 47  ? -4.142  3.921   4.382   1.00 0.36  ? 47  LYS A CA   2  
ATOM 2812  C C    . LYS A 1 47  ? -3.011  3.075   3.824   1.00 0.31  ? 47  LYS A C    2  
ATOM 2813  O O    . LYS A 1 47  ? -2.630  3.205   2.665   1.00 0.26  ? 47  LYS A O    2  
ATOM 2814  C CB   . LYS A 1 47  ? -5.328  3.017   4.716   1.00 0.42  ? 47  LYS A CB   2  
ATOM 2815  C CG   . LYS A 1 47  ? -5.665  2.913   6.184   1.00 0.74  ? 47  LYS A CG   2  
ATOM 2816  C CD   . LYS A 1 47  ? -4.496  2.421   6.994   1.00 0.79  ? 47  LYS A CD   2  
ATOM 2817  C CE   . LYS A 1 47  ? -4.861  2.224   8.451   1.00 1.12  ? 47  LYS A CE   2  
ATOM 2818  N NZ   . LYS A 1 47  ? -5.880  1.155   8.636   1.00 1.56  ? 47  LYS A NZ   2  
ATOM 2819  H H    . LYS A 1 47  ? -4.666  4.634   2.470   1.00 0.25  ? 47  LYS A H    2  
ATOM 2820  H HA   . LYS A 1 47  ? -3.810  4.423   5.278   1.00 0.44  ? 47  LYS A HA   2  
ATOM 2821  H HB2  . LYS A 1 47  ? -6.196  3.388   4.204   1.00 0.63  ? 47  LYS A HB2  2  
ATOM 2822  H HB3  . LYS A 1 47  ? -5.110  2.029   4.359   1.00 0.50  ? 47  LYS A HB3  2  
ATOM 2823  H HG2  . LYS A 1 47  ? -5.941  3.879   6.546   1.00 1.36  ? 47  LYS A HG2  2  
ATOM 2824  H HG3  . LYS A 1 47  ? -6.488  2.223   6.297   1.00 1.37  ? 47  LYS A HG3  2  
ATOM 2825  H HD2  . LYS A 1 47  ? -4.168  1.496   6.589   1.00 1.37  ? 47  LYS A HD2  2  
ATOM 2826  H HD3  . LYS A 1 47  ? -3.705  3.137   6.921   1.00 1.28  ? 47  LYS A HD3  2  
ATOM 2827  H HE2  . LYS A 1 47  ? -3.972  1.959   9.000   1.00 1.79  ? 47  LYS A HE2  2  
ATOM 2828  H HE3  . LYS A 1 47  ? -5.254  3.151   8.832   1.00 1.63  ? 47  LYS A HE3  2  
ATOM 2829  H HZ1  . LYS A 1 47  ? -6.739  1.376   8.093   1.00 1.86  ? 47  LYS A HZ1  2  
ATOM 2830  H HZ2  . LYS A 1 47  ? -6.131  1.076   9.642   1.00 2.16  ? 47  LYS A HZ2  2  
ATOM 2831  H HZ3  . LYS A 1 47  ? -5.502  0.239   8.313   1.00 1.99  ? 47  LYS A HZ3  2  
ATOM 2832  N N    . LEU A 1 48  ? -2.486  2.209   4.654   1.00 0.39  ? 48  LEU A N    2  
ATOM 2833  C CA   . LEU A 1 48  ? -1.555  1.190   4.215   1.00 0.36  ? 48  LEU A CA   2  
ATOM 2834  C C    . LEU A 1 48  ? -1.828  -0.078  4.996   1.00 0.40  ? 48  LEU A C    2  
ATOM 2835  O O    . LEU A 1 48  ? -2.358  -0.022  6.106   1.00 0.50  ? 48  LEU A O    2  
ATOM 2836  C CB   . LEU A 1 48  ? -0.112  1.605   4.390   1.00 0.60  ? 48  LEU A CB   2  
ATOM 2837  C CG   . LEU A 1 48  ? 0.413   1.499   5.794   1.00 0.64  ? 48  LEU A CG   2  
ATOM 2838  C CD1  . LEU A 1 48  ? 1.916   1.509   5.748   1.00 1.37  ? 48  LEU A CD1  2  
ATOM 2839  C CD2  . LEU A 1 48  ? -0.140  2.633   6.619   1.00 1.12  ? 48  LEU A CD2  2  
ATOM 2840  H H    . LEU A 1 48  ? -2.742  2.246   5.602   1.00 0.51  ? 48  LEU A H    2  
ATOM 2841  H HA   . LEU A 1 48  ? -1.724  1.010   3.184   1.00 0.27  ? 48  LEU A HA   2  
ATOM 2842  H HB2  . LEU A 1 48  ? 0.500   0.987   3.748   1.00 1.30  ? 48  LEU A HB2  2  
ATOM 2843  H HB3  . LEU A 1 48  ? -0.017  2.630   4.071   1.00 1.37  ? 48  LEU A HB3  2  
ATOM 2844  H HG   . LEU A 1 48  ? 0.091   0.569   6.229   1.00 1.45  ? 48  LEU A HG   2  
ATOM 2845  H HD11 . LEU A 1 48  ? 2.247   2.437   5.313   1.00 1.81  ? 48  LEU A HD11 2  
ATOM 2846  H HD12 . LEU A 1 48  ? 2.244   0.682   5.128   1.00 1.98  ? 48  LEU A HD12 2  
ATOM 2847  H HD13 . LEU A 1 48  ? 2.314   1.408   6.746   1.00 1.91  ? 48  LEU A HD13 2  
ATOM 2848  H HD21 . LEU A 1 48  ? 0.025   2.435   7.664   1.00 1.75  ? 48  LEU A HD21 2  
ATOM 2849  H HD22 . LEU A 1 48  ? -1.200  2.716   6.419   1.00 1.68  ? 48  LEU A HD22 2  
ATOM 2850  H HD23 . LEU A 1 48  ? 0.351   3.549   6.338   1.00 1.48  ? 48  LEU A HD23 2  
ATOM 2851  N N    . GLN A 1 49  ? -1.491  -1.211  4.425   1.00 0.39  ? 49  GLN A N    2  
ATOM 2852  C CA   . GLN A 1 49  ? -1.739  -2.484  5.085   1.00 0.45  ? 49  GLN A CA   2  
ATOM 2853  C C    . GLN A 1 49  ? -0.526  -3.380  4.968   1.00 0.33  ? 49  GLN A C    2  
ATOM 2854  O O    . GLN A 1 49  ? 0.182   -3.347  3.967   1.00 0.35  ? 49  GLN A O    2  
ATOM 2855  C CB   . GLN A 1 49  ? -2.977  -3.174  4.508   1.00 0.55  ? 49  GLN A CB   2  
ATOM 2856  C CG   . GLN A 1 49  ? -4.271  -2.447  4.814   1.00 0.79  ? 49  GLN A CG   2  
ATOM 2857  C CD   . GLN A 1 49  ? -5.487  -3.155  4.260   1.00 1.36  ? 49  GLN A CD   2  
ATOM 2858  O OE1  . GLN A 1 49  ? -5.415  -3.831  3.234   1.00 2.28  ? 49  GLN A OE1  2  
ATOM 2859  N NE2  . GLN A 1 49  ? -6.615  -3.001  4.934   1.00 1.62  ? 49  GLN A NE2  2  
ATOM 2860  H H    . GLN A 1 49  ? -1.030  -1.193  3.558   1.00 0.39  ? 49  GLN A H    2  
ATOM 2861  H HA   . GLN A 1 49  ? -1.912  -2.278  6.131   1.00 0.56  ? 49  GLN A HA   2  
ATOM 2862  H HB2  . GLN A 1 49  ? -2.875  -3.245  3.438   1.00 0.50  ? 49  GLN A HB2  2  
ATOM 2863  H HB3  . GLN A 1 49  ? -3.048  -4.163  4.917   1.00 0.72  ? 49  GLN A HB3  2  
ATOM 2864  H HG2  . GLN A 1 49  ? -4.379  -2.365  5.885   1.00 1.39  ? 49  GLN A HG2  2  
ATOM 2865  H HG3  . GLN A 1 49  ? -4.218  -1.465  4.384   1.00 1.03  ? 49  GLN A HG3  2  
ATOM 2866  H HE21 . GLN A 1 49  ? -6.598  -2.444  5.743   1.00 1.74  ? 49  GLN A HE21 2  
ATOM 2867  H HE22 . GLN A 1 49  ? -7.420  -3.454  4.602   1.00 2.18  ? 49  GLN A HE22 2  
ATOM 2868  N N    . ALA A 1 50  ? -0.289  -4.171  5.993   1.00 0.34  ? 50  ALA A N    2  
ATOM 2869  C CA   . ALA A 1 50  ? 0.895   -5.002  6.048   1.00 0.28  ? 50  ALA A CA   2  
ATOM 2870  C C    . ALA A 1 50  ? 0.545   -6.408  6.510   1.00 0.32  ? 50  ALA A C    2  
ATOM 2871  O O    . ALA A 1 50  ? -0.362  -6.598  7.324   1.00 0.43  ? 50  ALA A O    2  
ATOM 2872  C CB   . ALA A 1 50  ? 1.918   -4.360  6.960   1.00 0.38  ? 50  ALA A CB   2  
ATOM 2873  H H    . ALA A 1 50  ? -0.932  -4.208  6.732   1.00 0.46  ? 50  ALA A H    2  
ATOM 2874  H HA   . ALA A 1 50  ? 1.321   -5.049  5.057   1.00 0.27  ? 50  ALA A HA   2  
ATOM 2875  H HB1  . ALA A 1 50  ? 2.135   -3.363  6.600   1.00 1.06  ? 50  ALA A HB1  2  
ATOM 2876  H HB2  . ALA A 1 50  ? 2.821   -4.950  6.948   1.00 1.01  ? 50  ALA A HB2  2  
ATOM 2877  H HB3  . ALA A 1 50  ? 1.533   -4.306  7.968   1.00 1.17  ? 50  ALA A HB3  2  
ATOM 2878  N N    . THR A 1 51  ? 1.261   -7.385  5.976   1.00 0.32  ? 51  THR A N    2  
ATOM 2879  C CA   . THR A 1 51  ? 0.982   -8.787  6.250   1.00 0.40  ? 51  THR A CA   2  
ATOM 2880  C C    . THR A 1 51  ? 1.497   -9.229  7.616   1.00 0.53  ? 51  THR A C    2  
ATOM 2881  O O    . THR A 1 51  ? 2.455   -8.665  8.148   1.00 0.55  ? 51  THR A O    2  
ATOM 2882  C CB   . THR A 1 51  ? 1.602   -9.681  5.168   1.00 0.41  ? 51  THR A CB   2  
ATOM 2883  O OG1  . THR A 1 51  ? 2.910   -9.207  4.831   1.00 0.43  ? 51  THR A OG1  2  
ATOM 2884  C CG2  . THR A 1 51  ? 0.724   -9.715  3.931   1.00 0.46  ? 51  THR A CG2  2  
ATOM 2885  H H    . THR A 1 51  ? 2.003   -7.159  5.374   1.00 0.32  ? 51  THR A H    2  
ATOM 2886  H HA   . THR A 1 51  ? -0.088  -8.922  6.221   1.00 0.48  ? 51  THR A HA   2  
ATOM 2887  H HB   . THR A 1 51  ? 1.683   -10.685 5.559   1.00 0.48  ? 51  THR A HB   2  
ATOM 2888  H HG1  . THR A 1 51  ? 3.523   -9.957  4.817   1.00 0.54  ? 51  THR A HG1  2  
ATOM 2889  H HG21 . THR A 1 51  ? -0.219  -10.183 4.172   1.00 1.07  ? 51  THR A HG21 2  
ATOM 2890  H HG22 . THR A 1 51  ? 1.219   -10.277 3.154   1.00 1.05  ? 51  THR A HG22 2  
ATOM 2891  H HG23 . THR A 1 51  ? 0.546   -8.707  3.588   1.00 1.15  ? 51  THR A HG23 2  
ATOM 2892  N N    . PRO A 1 52  ? 0.846   -10.256 8.189   1.00 0.71  ? 52  PRO A N    2  
ATOM 2893  C CA   . PRO A 1 52  ? 1.201   -10.828 9.494   1.00 0.91  ? 52  PRO A CA   2  
ATOM 2894  C C    . PRO A 1 52  ? 2.667   -11.248 9.591   1.00 0.96  ? 52  PRO A C    2  
ATOM 2895  O O    . PRO A 1 52  ? 3.231   -11.815 8.651   1.00 0.88  ? 52  PRO A O    2  
ATOM 2896  C CB   . PRO A 1 52  ? 0.299   -12.068 9.607   1.00 1.10  ? 52  PRO A CB   2  
ATOM 2897  C CG   . PRO A 1 52  ? -0.247  -12.293 8.238   1.00 1.03  ? 52  PRO A CG   2  
ATOM 2898  C CD   . PRO A 1 52  ? -0.315  -10.942 7.604   1.00 0.80  ? 52  PRO A CD   2  
ATOM 2899  H HA   . PRO A 1 52  ? 0.972   -10.146 10.295  1.00 0.95  ? 52  PRO A HA   2  
ATOM 2900  H HB2  . PRO A 1 52  ? 0.888   -12.911 9.939   1.00 1.22  ? 52  PRO A HB2  2  
ATOM 2901  H HB3  . PRO A 1 52  ? -0.489  -11.875 10.318  1.00 1.17  ? 52  PRO A HB3  2  
ATOM 2902  H HG2  . PRO A 1 52  ? 0.412   -12.939 7.677   1.00 1.06  ? 52  PRO A HG2  2  
ATOM 2903  H HG3  . PRO A 1 52  ? -1.233  -12.725 8.300   1.00 1.16  ? 52  PRO A HG3  2  
ATOM 2904  H HD2  . PRO A 1 52  ? -0.219  -11.023 6.530   1.00 0.73  ? 52  PRO A HD2  2  
ATOM 2905  H HD3  . PRO A 1 52  ? -1.234  -10.442 7.869   1.00 0.85  ? 52  PRO A HD3  2  
ATOM 2906  N N    . ALA A 1 53  ? 3.277   -10.969 10.741  1.00 1.16  ? 53  ALA A N    2  
ATOM 2907  C CA   . ALA A 1 53  ? 4.640   -11.405 11.021  1.00 1.29  ? 53  ALA A CA   2  
ATOM 2908  C C    . ALA A 1 53  ? 4.664   -12.898 11.296  1.00 1.31  ? 53  ALA A C    2  
ATOM 2909  O O    . ALA A 1 53  ? 5.704   -13.552 11.189  1.00 1.36  ? 53  ALA A O    2  
ATOM 2910  C CB   . ALA A 1 53  ? 5.208   -10.649 12.210  1.00 1.58  ? 53  ALA A CB   2  
ATOM 2911  H H    . ALA A 1 53  ? 2.792   -10.452 11.423  1.00 1.25  ? 53  ALA A H    2  
ATOM 2912  H HA   . ALA A 1 53  ? 5.249   -11.192 10.155  1.00 1.21  ? 53  ALA A HA   2  
ATOM 2913  H HB1  . ALA A 1 53  ? 4.619   -10.871 13.088  1.00 1.87  ? 53  ALA A HB1  2  
ATOM 2914  H HB2  . ALA A 1 53  ? 5.177   -9.589  12.012  1.00 1.82  ? 53  ALA A HB2  2  
ATOM 2915  H HB3  . ALA A 1 53  ? 6.231   -10.956 12.375  1.00 1.98  ? 53  ALA A HB3  2  
ATOM 2916  N N    . SER A 1 54  ? 3.501   -13.423 11.645  1.00 1.32  ? 54  SER A N    2  
ATOM 2917  C CA   . SER A 1 54  ? 3.333   -14.840 11.899  1.00 1.41  ? 54  SER A CA   2  
ATOM 2918  C C    . SER A 1 54  ? 3.357   -15.627 10.588  1.00 1.26  ? 54  SER A C    2  
ATOM 2919  O O    . SER A 1 54  ? 3.450   -16.855 10.580  1.00 1.35  ? 54  SER A O    2  
ATOM 2920  C CB   . SER A 1 54  ? 2.016   -15.055 12.634  1.00 1.55  ? 54  SER A CB   2  
ATOM 2921  O OG   . SER A 1 54  ? 1.009   -14.211 12.098  1.00 1.49  ? 54  SER A OG   2  
ATOM 2922  H H    . SER A 1 54  ? 2.721   -12.834 11.739  1.00 1.32  ? 54  SER A H    2  
ATOM 2923  H HA   . SER A 1 54  ? 4.149   -15.165 12.525  1.00 1.52  ? 54  SER A HA   2  
ATOM 2924  H HB2  . SER A 1 54  ? 1.705   -16.082 12.527  1.00 1.60  ? 54  SER A HB2  2  
ATOM 2925  H HB3  . SER A 1 54  ? 2.145   -14.822 13.681  1.00 1.70  ? 54  SER A HB3  2  
ATOM 2926  H HG   . SER A 1 54  ? 0.181   -14.706 12.026  1.00 1.65  ? 54  SER A HG   2  
ATOM 2927  N N    . SER A 1 55  ? 3.267   -14.905 9.483   1.00 1.09  ? 55  SER A N    2  
ATOM 2928  C CA   . SER A 1 55  ? 3.355   -15.501 8.167   1.00 1.02  ? 55  SER A CA   2  
ATOM 2929  C C    . SER A 1 55  ? 4.733   -15.249 7.584   1.00 0.94  ? 55  SER A C    2  
ATOM 2930  O O    . SER A 1 55  ? 5.498   -14.437 8.112   1.00 0.99  ? 55  SER A O    2  
ATOM 2931  C CB   . SER A 1 55  ? 2.278   -14.920 7.248   1.00 0.96  ? 55  SER A CB   2  
ATOM 2932  O OG   . SER A 1 55  ? 2.329   -15.486 5.951   1.00 1.32  ? 55  SER A OG   2  
ATOM 2933  H H    . SER A 1 55  ? 3.151   -13.935 9.557   1.00 1.06  ? 55  SER A H    2  
ATOM 2934  H HA   . SER A 1 55  ? 3.201   -16.562 8.265   1.00 1.13  ? 55  SER A HA   2  
ATOM 2935  H HB2  . SER A 1 55  ? 1.313   -15.121 7.671   1.00 1.12  ? 55  SER A HB2  2  
ATOM 2936  H HB3  . SER A 1 55  ? 2.420   -13.855 7.169   1.00 1.06  ? 55  SER A HB3  2  
ATOM 2937  H HG   . SER A 1 55  ? 1.469   -15.870 5.737   1.00 1.49  ? 55  SER A HG   2  
ATOM 2938  N N    . GLU A 1 56  ? 5.059   -15.948 6.516   1.00 0.88  ? 56  GLU A N    2  
ATOM 2939  C CA   . GLU A 1 56  ? 6.297   -15.699 5.818   1.00 0.85  ? 56  GLU A CA   2  
ATOM 2940  C C    . GLU A 1 56  ? 6.158   -14.484 4.926   1.00 0.70  ? 56  GLU A C    2  
ATOM 2941  O O    . GLU A 1 56  ? 7.062   -13.660 4.837   1.00 0.74  ? 56  GLU A O    2  
ATOM 2942  C CB   . GLU A 1 56  ? 6.708   -16.870 4.966   1.00 0.93  ? 56  GLU A CB   2  
ATOM 2943  C CG   . GLU A 1 56  ? 8.066   -16.643 4.357   1.00 1.08  ? 56  GLU A CG   2  
ATOM 2944  C CD   . GLU A 1 56  ? 9.151   -16.490 5.406   1.00 1.75  ? 56  GLU A CD   2  
ATOM 2945  O OE1  . GLU A 1 56  ? 9.352   -15.365 5.916   1.00 2.08  ? 56  GLU A OE1  2  
ATOM 2946  O OE2  . GLU A 1 56  ? 9.794   -17.504 5.748   1.00 2.37  ? 56  GLU A OE2  2  
ATOM 2947  H H    . GLU A 1 56  ? 4.446   -16.640 6.186   1.00 0.92  ? 56  GLU A H    2  
ATOM 2948  H HA   . GLU A 1 56  ? 7.069   -15.522 6.533   1.00 0.96  ? 56  GLU A HA   2  
ATOM 2949  H HB2  . GLU A 1 56  ? 6.734   -17.765 5.570   1.00 1.09  ? 56  GLU A HB2  2  
ATOM 2950  H HB3  . GLU A 1 56  ? 5.998   -16.988 4.175   1.00 0.96  ? 56  GLU A HB3  2  
ATOM 2951  H HG2  . GLU A 1 56  ? 8.304   -17.476 3.737   1.00 1.32  ? 56  GLU A HG2  2  
ATOM 2952  H HG3  . GLU A 1 56  ? 8.021   -15.741 3.758   1.00 1.15  ? 56  GLU A HG3  2  
ATOM 2953  N N    . LYS A 1 57  ? 5.000   -14.364 4.303   1.00 0.62  ? 57  LYS A N    2  
ATOM 2954  C CA   . LYS A 1 57  ? 4.814   -13.407 3.230   1.00 0.54  ? 57  LYS A CA   2  
ATOM 2955  C C    . LYS A 1 57  ? 4.964   -11.973 3.717   1.00 0.48  ? 57  LYS A C    2  
ATOM 2956  O O    . LYS A 1 57  ? 4.216   -11.516 4.582   1.00 0.68  ? 57  LYS A O    2  
ATOM 2957  C CB   . LYS A 1 57  ? 3.449   -13.603 2.588   1.00 0.63  ? 57  LYS A CB   2  
ATOM 2958  C CG   . LYS A 1 57  ? 3.247   -14.993 2.019   1.00 1.10  ? 57  LYS A CG   2  
ATOM 2959  C CD   . LYS A 1 57  ? 4.301   -15.329 0.991   1.00 1.47  ? 57  LYS A CD   2  
ATOM 2960  C CE   . LYS A 1 57  ? 4.109   -14.549 -0.280  1.00 1.47  ? 57  LYS A CE   2  
ATOM 2961  N NZ   . LYS A 1 57  ? 5.210   -14.781 -1.252  1.00 2.29  ? 57  LYS A NZ   2  
ATOM 2962  H H    . LYS A 1 57  ? 4.238   -14.924 4.587   1.00 0.68  ? 57  LYS A H    2  
ATOM 2963  H HA   . LYS A 1 57  ? 5.574   -13.610 2.490   1.00 0.55  ? 57  LYS A HA   2  
ATOM 2964  H HB2  . LYS A 1 57  ? 2.695   -13.430 3.331   1.00 1.00  ? 57  LYS A HB2  2  
ATOM 2965  H HB3  . LYS A 1 57  ? 3.329   -12.886 1.789   1.00 1.00  ? 57  LYS A HB3  2  
ATOM 2966  H HG2  . LYS A 1 57  ? 3.302   -15.716 2.816   1.00 1.61  ? 57  LYS A HG2  2  
ATOM 2967  H HG3  . LYS A 1 57  ? 2.285   -15.040 1.553   1.00 1.61  ? 57  LYS A HG3  2  
ATOM 2968  H HD2  . LYS A 1 57  ? 5.265   -15.097 1.401   1.00 2.16  ? 57  LYS A HD2  2  
ATOM 2969  H HD3  . LYS A 1 57  ? 4.242   -16.361 0.766   1.00 1.97  ? 57  LYS A HD3  2  
ATOM 2970  H HE2  . LYS A 1 57  ? 3.171   -14.838 -0.731  1.00 1.55  ? 57  LYS A HE2  2  
ATOM 2971  H HE3  . LYS A 1 57  ? 4.078   -13.521 -0.022  1.00 1.84  ? 57  LYS A HE3  2  
ATOM 2972  H HZ1  . LYS A 1 57  ? 6.117   -14.469 -0.852  1.00 2.69  ? 57  LYS A HZ1  2  
ATOM 2973  H HZ2  . LYS A 1 57  ? 5.031   -14.251 -2.129  1.00 2.69  ? 57  LYS A HZ2  2  
ATOM 2974  H HZ3  . LYS A 1 57  ? 5.276   -15.792 -1.483  1.00 2.71  ? 57  LYS A HZ3  2  
ATOM 2975  N N    . MET A 1 58  ? 5.945   -11.276 3.166   1.00 0.38  ? 58  MET A N    2  
ATOM 2976  C CA   . MET A 1 58  ? 6.166   -9.870  3.472   1.00 0.39  ? 58  MET A CA   2  
ATOM 2977  C C    . MET A 1 58  ? 5.554   -8.997  2.385   1.00 0.33  ? 58  MET A C    2  
ATOM 2978  O O    . MET A 1 58  ? 6.011   -8.999  1.240   1.00 0.40  ? 58  MET A O    2  
ATOM 2979  C CB   . MET A 1 58  ? 7.664   -9.565  3.627   1.00 0.53  ? 58  MET A CB   2  
ATOM 2980  C CG   . MET A 1 58  ? 8.564   -10.419 2.768   1.00 0.81  ? 58  MET A CG   2  
ATOM 2981  S SD   . MET A 1 58  ? 9.132   -11.883 3.650   1.00 1.13  ? 58  MET A SD   2  
ATOM 2982  C CE   . MET A 1 58  ? 9.567   -12.959 2.297   1.00 0.71  ? 58  MET A CE   2  
ATOM 2983  H H    . MET A 1 58  ? 6.536   -11.722 2.525   1.00 0.49  ? 58  MET A H    2  
ATOM 2984  H HA   . MET A 1 58  ? 5.665   -9.656  4.406   1.00 0.43  ? 58  MET A HA   2  
ATOM 2985  H HB2  . MET A 1 58  ? 7.841   -8.532  3.379   1.00 1.04  ? 58  MET A HB2  2  
ATOM 2986  H HB3  . MET A 1 58  ? 7.942   -9.733  4.649   1.00 1.02  ? 58  MET A HB3  2  
ATOM 2987  H HG2  . MET A 1 58  ? 8.015   -10.726 1.899   1.00 1.60  ? 58  MET A HG2  2  
ATOM 2988  H HG3  . MET A 1 58  ? 9.423   -9.837  2.469   1.00 1.52  ? 58  MET A HG3  2  
ATOM 2989  H HE1  . MET A 1 58  ? 10.415  -12.547 1.774   1.00 1.18  ? 58  MET A HE1  2  
ATOM 2990  H HE2  . MET A 1 58  ? 8.727   -13.039 1.623   1.00 1.35  ? 58  MET A HE2  2  
ATOM 2991  H HE3  . MET A 1 58  ? 9.817   -13.937 2.682   1.00 1.18  ? 58  MET A HE3  2  
ATOM 2992  N N    . MET A 1 59  ? 4.521   -8.257  2.751   1.00 0.29  ? 59  MET A N    2  
ATOM 2993  C CA   . MET A 1 59  ? 3.766   -7.463  1.796   1.00 0.26  ? 59  MET A CA   2  
ATOM 2994  C C    . MET A 1 59  ? 3.406   -6.108  2.383   1.00 0.24  ? 59  MET A C    2  
ATOM 2995  O O    . MET A 1 59  ? 3.144   -5.998  3.581   1.00 0.29  ? 59  MET A O    2  
ATOM 2996  C CB   . MET A 1 59  ? 2.466   -8.175  1.442   1.00 0.32  ? 59  MET A CB   2  
ATOM 2997  C CG   . MET A 1 59  ? 1.969   -7.872  0.046   1.00 0.38  ? 59  MET A CG   2  
ATOM 2998  S SD   . MET A 1 59  ? 2.776   -8.870  -1.215  1.00 0.49  ? 59  MET A SD   2  
ATOM 2999  C CE   . MET A 1 59  ? 2.176   -10.506 -0.798  1.00 0.63  ? 59  MET A CE   2  
ATOM 3000  H H    . MET A 1 59  ? 4.250   -8.245  3.697   1.00 0.34  ? 59  MET A H    2  
ATOM 3001  H HA   . MET A 1 59  ? 4.355   -7.332  0.903   1.00 0.25  ? 59  MET A HA   2  
ATOM 3002  H HB2  . MET A 1 59  ? 2.607   -9.236  1.536   1.00 0.42  ? 59  MET A HB2  2  
ATOM 3003  H HB3  . MET A 1 59  ? 1.705   -7.864  2.142   1.00 0.34  ? 59  MET A HB3  2  
ATOM 3004  H HG2  . MET A 1 59  ? 0.912   -8.063  0.011   1.00 0.45  ? 59  MET A HG2  2  
ATOM 3005  H HG3  . MET A 1 59  ? 2.152   -6.830  -0.168  1.00 0.40  ? 59  MET A HG3  2  
ATOM 3006  H HE1  . MET A 1 59  ? 2.525   -10.777 0.186   1.00 1.24  ? 59  MET A HE1  2  
ATOM 3007  H HE2  . MET A 1 59  ? 2.545   -11.219 -1.520  1.00 1.09  ? 59  MET A HE2  2  
ATOM 3008  H HE3  . MET A 1 59  ? 1.097   -10.506 -0.811  1.00 1.26  ? 59  MET A HE3  2  
ATOM 3009  N N    . LEU A 1 60  ? 3.382   -5.084  1.542   1.00 0.20  ? 60  LEU A N    2  
ATOM 3010  C CA   . LEU A 1 60  ? 2.818   -3.803  1.935   1.00 0.19  ? 60  LEU A CA   2  
ATOM 3011  C C    . LEU A 1 60  ? 1.769   -3.376  0.935   1.00 0.21  ? 60  LEU A C    2  
ATOM 3012  O O    . LEU A 1 60  ? 1.894   -3.623  -0.266  1.00 0.25  ? 60  LEU A O    2  
ATOM 3013  C CB   . LEU A 1 60  ? 3.869   -2.693  2.056   1.00 0.21  ? 60  LEU A CB   2  
ATOM 3014  C CG   . LEU A 1 60  ? 4.441   -2.467  3.456   1.00 0.26  ? 60  LEU A CG   2  
ATOM 3015  C CD1  . LEU A 1 60  ? 3.323   -2.349  4.473   1.00 0.48  ? 60  LEU A CD1  2  
ATOM 3016  C CD2  . LEU A 1 60  ? 5.392   -3.576  3.847   1.00 0.40  ? 60  LEU A CD2  2  
ATOM 3017  H H    . LEU A 1 60  ? 3.738   -5.194  0.628   1.00 0.21  ? 60  LEU A H    2  
ATOM 3018  H HA   . LEU A 1 60  ? 2.340   -3.943  2.894   1.00 0.18  ? 60  LEU A HA   2  
ATOM 3019  H HB2  . LEU A 1 60  ? 4.681   -2.921  1.387   1.00 0.28  ? 60  LEU A HB2  2  
ATOM 3020  H HB3  . LEU A 1 60  ? 3.412   -1.765  1.735   1.00 0.21  ? 60  LEU A HB3  2  
ATOM 3021  H HG   . LEU A 1 60  ? 4.992   -1.539  3.460   1.00 0.52  ? 60  LEU A HG   2  
ATOM 3022  H HD11 . LEU A 1 60  ? 3.667   -1.780  5.322   1.00 1.23  ? 60  LEU A HD11 2  
ATOM 3023  H HD12 . LEU A 1 60  ? 3.037   -3.342  4.800   1.00 0.99  ? 60  LEU A HD12 2  
ATOM 3024  H HD13 . LEU A 1 60  ? 2.473   -1.855  4.025   1.00 1.17  ? 60  LEU A HD13 2  
ATOM 3025  H HD21 . LEU A 1 60  ? 4.997   -4.524  3.515   1.00 1.03  ? 60  LEU A HD21 2  
ATOM 3026  H HD22 . LEU A 1 60  ? 5.498   -3.588  4.922   1.00 1.14  ? 60  LEU A HD22 2  
ATOM 3027  H HD23 . LEU A 1 60  ? 6.356   -3.403  3.397   1.00 1.12  ? 60  LEU A HD23 2  
ATOM 3028  N N    . ARG A 1 61  ? 0.731   -2.753  1.438   1.00 0.22  ? 61  ARG A N    2  
ATOM 3029  C CA   . ARG A 1 61  ? -0.303  -2.206  0.579   1.00 0.25  ? 61  ARG A CA   2  
ATOM 3030  C C    . ARG A 1 61  ? -0.311  -0.694  0.622   1.00 0.26  ? 61  ARG A C    2  
ATOM 3031  O O    . ARG A 1 61  ? -0.009  -0.082  1.644   1.00 0.31  ? 61  ARG A O    2  
ATOM 3032  C CB   . ARG A 1 61  ? -1.694  -2.683  0.968   1.00 0.31  ? 61  ARG A CB   2  
ATOM 3033  C CG   . ARG A 1 61  ? -2.127  -3.986  0.321   1.00 0.40  ? 61  ARG A CG   2  
ATOM 3034  C CD   . ARG A 1 61  ? -3.546  -4.334  0.737   1.00 0.56  ? 61  ARG A CD   2  
ATOM 3035  N NE   . ARG A 1 61  ? -4.141  -5.382  -0.090  1.00 1.20  ? 61  ARG A NE   2  
ATOM 3036  C CZ   . ARG A 1 61  ? -5.197  -6.108  0.279   1.00 1.42  ? 61  ARG A CZ   2  
ATOM 3037  N NH1  . ARG A 1 61  ? -5.765  -5.907  1.462   1.00 1.03  ? 61  ARG A NH1  2  
ATOM 3038  N NH2  . ARG A 1 61  ? -5.694  -7.024  -0.541  1.00 2.37  ? 61  ARG A NH2  2  
ATOM 3039  H H    . ARG A 1 61  ? 0.662   -2.657  2.425   1.00 0.24  ? 61  ARG A H    2  
ATOM 3040  H HA   . ARG A 1 61  ? -0.093  -2.528  -0.433  1.00 0.26  ? 61  ARG A HA   2  
ATOM 3041  H HB2  . ARG A 1 61  ? -1.727  -2.810  2.037   1.00 0.33  ? 61  ARG A HB2  2  
ATOM 3042  H HB3  . ARG A 1 61  ? -2.401  -1.914  0.681   1.00 0.35  ? 61  ARG A HB3  2  
ATOM 3043  H HG2  . ARG A 1 61  ? -2.087  -3.881  -0.753  1.00 0.46  ? 61  ARG A HG2  2  
ATOM 3044  H HG3  . ARG A 1 61  ? -1.462  -4.777  0.637   1.00 0.41  ? 61  ARG A HG3  2  
ATOM 3045  H HD2  . ARG A 1 61  ? -3.532  -4.670  1.762   1.00 0.96  ? 61  ARG A HD2  2  
ATOM 3046  H HD3  . ARG A 1 61  ? -4.154  -3.444  0.663   1.00 1.24  ? 61  ARG A HD3  2  
ATOM 3047  H HE   . ARG A 1 61  ? -3.742  -5.541  -0.976  1.00 1.81  ? 61  ARG A HE   2  
ATOM 3048  H HH11 . ARG A 1 61  ? -5.407  -5.203  2.087   1.00 1.07  ? 61  ARG A HH11 2  
ATOM 3049  H HH12 . ARG A 1 61  ? -6.556  -6.459  1.742   1.00 1.28  ? 61  ARG A HH12 2  
ATOM 3050  H HH21 . ARG A 1 61  ? -5.281  -7.167  -1.447  1.00 2.99  ? 61  ARG A HH21 2  
ATOM 3051  H HH22 . ARG A 1 61  ? -6.476  -7.580  -0.260  1.00 2.55  ? 61  ARG A HH22 2  
ATOM 3052  N N    . LEU A 1 62  ? -0.685  -0.115  -0.494  1.00 0.28  ? 62  LEU A N    2  
ATOM 3053  C CA   . LEU A 1 62  ? -0.910  1.309   -0.601  1.00 0.28  ? 62  LEU A CA   2  
ATOM 3054  C C    . LEU A 1 62  ? -2.390  1.557   -0.810  1.00 0.28  ? 62  LEU A C    2  
ATOM 3055  O O    . LEU A 1 62  ? -2.894  1.364   -1.912  1.00 0.33  ? 62  LEU A O    2  
ATOM 3056  C CB   . LEU A 1 62  ? -0.151  1.869   -1.792  1.00 0.31  ? 62  LEU A CB   2  
ATOM 3057  C CG   . LEU A 1 62  ? 1.293   2.293   -1.557  1.00 0.37  ? 62  LEU A CG   2  
ATOM 3058  C CD1  . LEU A 1 62  ? 1.408   3.264   -0.397  1.00 0.70  ? 62  LEU A CD1  2  
ATOM 3059  C CD2  . LEU A 1 62  ? 2.178   1.085   -1.348  1.00 0.68  ? 62  LEU A CD2  2  
ATOM 3060  H H    . LEU A 1 62  ? -0.820  -0.677  -1.290  1.00 0.34  ? 62  LEU A H    2  
ATOM 3061  H HA   . LEU A 1 62  ? -0.578  1.786   0.310   1.00 0.27  ? 62  LEU A HA   2  
ATOM 3062  H HB2  . LEU A 1 62  ? -0.140  1.101   -2.538  1.00 0.39  ? 62  LEU A HB2  2  
ATOM 3063  H HB3  . LEU A 1 62  ? -0.695  2.715   -2.183  1.00 0.33  ? 62  LEU A HB3  2  
ATOM 3064  H HG   . LEU A 1 62  ? 1.636   2.799   -2.437  1.00 0.72  ? 62  LEU A HG   2  
ATOM 3065  H HD11 . LEU A 1 62  ? 0.752   4.104   -0.568  1.00 1.29  ? 62  LEU A HD11 2  
ATOM 3066  H HD12 . LEU A 1 62  ? 2.427   3.614   -0.326  1.00 1.45  ? 62  LEU A HD12 2  
ATOM 3067  H HD13 . LEU A 1 62  ? 1.131   2.768   0.521   1.00 1.20  ? 62  LEU A HD13 2  
ATOM 3068  H HD21 . LEU A 1 62  ? 3.202   1.406   -1.231  1.00 1.18  ? 62  LEU A HD21 2  
ATOM 3069  H HD22 . LEU A 1 62  ? 2.097   0.436   -2.209  1.00 1.33  ? 62  LEU A HD22 2  
ATOM 3070  H HD23 . LEU A 1 62  ? 1.861   0.554   -0.464  1.00 1.28  ? 62  LEU A HD23 2  
ATOM 3071  N N    . ILE A 1 63  ? -3.083  1.982   0.222   1.00 0.26  ? 63  ILE A N    2  
ATOM 3072  C CA   . ILE A 1 63  ? -4.521  2.155   0.135   1.00 0.26  ? 63  ILE A CA   2  
ATOM 3073  C C    . ILE A 1 63  ? -4.836  3.549   -0.379  1.00 0.25  ? 63  ILE A C    2  
ATOM 3074  O O    . ILE A 1 63  ? -4.836  4.505   0.385   1.00 0.24  ? 63  ILE A O    2  
ATOM 3075  C CB   . ILE A 1 63  ? -5.172  1.983   1.519   1.00 0.27  ? 63  ILE A CB   2  
ATOM 3076  C CG1  . ILE A 1 63  ? -4.734  0.665   2.160   1.00 0.32  ? 63  ILE A CG1  2  
ATOM 3077  C CG2  . ILE A 1 63  ? -6.686  2.051   1.415   1.00 0.33  ? 63  ILE A CG2  2  
ATOM 3078  C CD1  . ILE A 1 63  ? -5.446  -0.541  1.613   1.00 0.41  ? 63  ILE A CD1  2  
ATOM 3079  H H    . ILE A 1 63  ? -2.619  2.208   1.061   1.00 0.25  ? 63  ILE A H    2  
ATOM 3080  H HA   . ILE A 1 63  ? -4.923  1.414   -0.539  1.00 0.29  ? 63  ILE A HA   2  
ATOM 3081  H HB   . ILE A 1 63  ? -4.846  2.800   2.137   1.00 0.28  ? 63  ILE A HB   2  
ATOM 3082  H HG12 . ILE A 1 63  ? -3.677  0.532   1.994   1.00 0.36  ? 63  ILE A HG12 2  
ATOM 3083  H HG13 . ILE A 1 63  ? -4.920  0.704   3.219   1.00 0.39  ? 63  ILE A HG13 2  
ATOM 3084  H HG21 . ILE A 1 63  ? -7.120  1.933   2.396   1.00 1.10  ? 63  ILE A HG21 2  
ATOM 3085  H HG22 . ILE A 1 63  ? -7.035  1.259   0.769   1.00 1.02  ? 63  ILE A HG22 2  
ATOM 3086  H HG23 . ILE A 1 63  ? -6.976  3.007   1.003   1.00 1.11  ? 63  ILE A HG23 2  
ATOM 3087  H HD11 . ILE A 1 63  ? -5.260  -0.621  0.553   1.00 1.24  ? 63  ILE A HD11 2  
ATOM 3088  H HD12 . ILE A 1 63  ? -6.505  -0.427  1.790   1.00 0.97  ? 63  ILE A HD12 2  
ATOM 3089  H HD13 . ILE A 1 63  ? -5.089  -1.426  2.116   1.00 1.08  ? 63  ILE A HD13 2  
ATOM 3090  N N    . GLY A 1 64  ? -5.109  3.652   -1.667  1.00 0.28  ? 64  GLY A N    2  
ATOM 3091  C CA   . GLY A 1 64  ? -5.346  4.946   -2.278  1.00 0.27  ? 64  GLY A CA   2  
ATOM 3092  C C    . GLY A 1 64  ? -6.637  5.572   -1.808  1.00 0.29  ? 64  GLY A C    2  
ATOM 3093  O O    . GLY A 1 64  ? -7.592  4.866   -1.484  1.00 0.37  ? 64  GLY A O    2  
ATOM 3094  H H    . GLY A 1 64  ? -5.167  2.840   -2.211  1.00 0.32  ? 64  GLY A H    2  
ATOM 3095  H HA2  . GLY A 1 64  ? -4.528  5.601   -2.030  1.00 0.26  ? 64  GLY A HA2  2  
ATOM 3096  H HA3  . GLY A 1 64  ? -5.380  4.831   -3.346  1.00 0.33  ? 64  GLY A HA3  2  
ATOM 3097  N N    . LYS A 1 65  ? -6.667  6.894   -1.773  1.00 0.34  ? 65  LYS A N    2  
ATOM 3098  C CA   . LYS A 1 65  ? -7.802  7.620   -1.252  1.00 0.41  ? 65  LYS A CA   2  
ATOM 3099  C C    . LYS A 1 65  ? -9.037  7.441   -2.100  1.00 0.60  ? 65  LYS A C    2  
ATOM 3100  O O    . LYS A 1 65  ? -8.985  7.064   -3.276  1.00 0.80  ? 65  LYS A O    2  
ATOM 3101  C CB   . LYS A 1 65  ? -7.495  9.094   -1.161  1.00 0.53  ? 65  LYS A CB   2  
ATOM 3102  C CG   . LYS A 1 65  ? -6.441  9.408   -0.150  1.00 0.50  ? 65  LYS A CG   2  
ATOM 3103  C CD   . LYS A 1 65  ? -6.026  10.850  -0.232  1.00 0.68  ? 65  LYS A CD   2  
ATOM 3104  C CE   . LYS A 1 65  ? -5.454  11.282  1.086   1.00 0.91  ? 65  LYS A CE   2  
ATOM 3105  N NZ   . LYS A 1 65  ? -5.169  12.741  1.123   1.00 1.16  ? 65  LYS A NZ   2  
ATOM 3106  H H    . LYS A 1 65  ? -5.898  7.404   -2.110  1.00 0.41  ? 65  LYS A H    2  
ATOM 3107  H HA   . LYS A 1 65  ? -7.999  7.258   -0.255  1.00 0.37  ? 65  LYS A HA   2  
ATOM 3108  H HB2  . LYS A 1 65  ? -7.169  9.447   -2.111  1.00 0.66  ? 65  LYS A HB2  2  
ATOM 3109  H HB3  . LYS A 1 65  ? -8.388  9.619   -0.885  1.00 0.67  ? 65  LYS A HB3  2  
ATOM 3110  H HG2  . LYS A 1 65  ? -6.833  9.211   0.837   1.00 0.58  ? 65  LYS A HG2  2  
ATOM 3111  H HG3  . LYS A 1 65  ? -5.590  8.778   -0.333  1.00 0.52  ? 65  LYS A HG3  2  
ATOM 3112  H HD2  . LYS A 1 65  ? -5.277  10.962  -1.003  1.00 0.90  ? 65  LYS A HD2  2  
ATOM 3113  H HD3  . LYS A 1 65  ? -6.890  11.454  -0.463  1.00 0.68  ? 65  LYS A HD3  2  
ATOM 3114  H HE2  . LYS A 1 65  ? -6.175  11.030  1.844   1.00 0.98  ? 65  LYS A HE2  2  
ATOM 3115  H HE3  . LYS A 1 65  ? -4.538  10.737  1.264   1.00 1.08  ? 65  LYS A HE3  2  
ATOM 3116  H HZ1  . LYS A 1 65  ? -6.033  13.281  0.914   1.00 1.67  ? 65  LYS A HZ1  2  
ATOM 3117  H HZ2  . LYS A 1 65  ? -4.445  12.984  0.415   1.00 1.54  ? 65  LYS A HZ2  2  
ATOM 3118  H HZ3  . LYS A 1 65  ? -4.824  13.017  2.062   1.00 1.48  ? 65  LYS A HZ3  2  
ATOM 3119  N N    . VAL A 1 66  ? -10.140 7.740   -1.474  1.00 0.67  ? 66  VAL A N    2  
ATOM 3120  C CA   . VAL A 1 66  ? -11.431 7.722   -2.120  1.00 1.01  ? 66  VAL A CA   2  
ATOM 3121  C C    . VAL A 1 66  ? -12.010 9.122   -2.128  1.00 1.29  ? 66  VAL A C    2  
ATOM 3122  O O    . VAL A 1 66  ? -11.932 9.845   -1.134  1.00 1.39  ? 66  VAL A O    2  
ATOM 3123  C CB   . VAL A 1 66  ? -12.422 6.745   -1.448  1.00 1.12  ? 66  VAL A CB   2  
ATOM 3124  C CG1  . VAL A 1 66  ? -11.994 5.309   -1.685  1.00 1.26  ? 66  VAL A CG1  2  
ATOM 3125  C CG2  . VAL A 1 66  ? -12.541 7.020   0.040   1.00 1.48  ? 66  VAL A CG2  2  
ATOM 3126  H H    . VAL A 1 66  ? -10.068 8.040   -0.546  1.00 0.65  ? 66  VAL A H    2  
ATOM 3127  H HA   . VAL A 1 66  ? -11.283 7.404   -3.142  1.00 1.28  ? 66  VAL A HA   2  
ATOM 3128  H HB   . VAL A 1 66  ? -13.394 6.886   -1.896  1.00 1.58  ? 66  VAL A HB   2  
ATOM 3129  H HG11 . VAL A 1 66  ? -12.702 4.639   -1.220  1.00 1.62  ? 66  VAL A HG11 2  
ATOM 3130  H HG12 . VAL A 1 66  ? -11.015 5.152   -1.258  1.00 1.87  ? 66  VAL A HG12 2  
ATOM 3131  H HG13 . VAL A 1 66  ? -11.959 5.114   -2.747  1.00 1.61  ? 66  VAL A HG13 2  
ATOM 3132  H HG21 . VAL A 1 66  ? -11.573 6.911   0.503   1.00 1.91  ? 66  VAL A HG21 2  
ATOM 3133  H HG22 . VAL A 1 66  ? -13.233 6.317   0.479   1.00 2.10  ? 66  VAL A HG22 2  
ATOM 3134  H HG23 . VAL A 1 66  ? -12.906 8.027   0.190   1.00 1.76  ? 66  VAL A HG23 2  
ATOM 3135  N N    . ASP A 1 67  ? -12.551 9.517   -3.257  1.00 1.84  ? 67  ASP A N    2  
ATOM 3136  C CA   . ASP A 1 67  ? -13.184 10.815  -3.372  1.00 2.24  ? 67  ASP A CA   2  
ATOM 3137  C C    . ASP A 1 67  ? -14.553 10.768  -2.726  1.00 2.23  ? 67  ASP A C    2  
ATOM 3138  O O    . ASP A 1 67  ? -15.319 9.833   -2.954  1.00 2.60  ? 67  ASP A O    2  
ATOM 3139  C CB   . ASP A 1 67  ? -13.308 11.224  -4.839  1.00 3.07  ? 67  ASP A CB   2  
ATOM 3140  C CG   . ASP A 1 67  ? -11.963 11.344  -5.516  1.00 3.61  ? 67  ASP A CG   2  
ATOM 3141  O OD1  . ASP A 1 67  ? -11.309 12.395  -5.365  1.00 4.14  ? 67  ASP A OD1  2  
ATOM 3142  O OD2  . ASP A 1 67  ? -11.547 10.381  -6.198  1.00 3.94  ? 67  ASP A OD2  2  
ATOM 3143  H H    . ASP A 1 67  ? -12.525 8.921   -4.034  1.00 2.14  ? 67  ASP A H    2  
ATOM 3144  H HA   . ASP A 1 67  ? -12.572 11.536  -2.850  1.00 2.38  ? 67  ASP A HA   2  
ATOM 3145  H HB2  . ASP A 1 67  ? -13.891 10.484  -5.364  1.00 3.41  ? 67  ASP A HB2  2  
ATOM 3146  H HB3  . ASP A 1 67  ? -13.809 12.181  -4.899  1.00 3.48  ? 67  ASP A HB3  2  
ATOM 3147  N N    . GLU A 1 68  ? -14.852 11.762  -1.900  1.00 2.48  ? 68  GLU A N    2  
ATOM 3148  C CA   . GLU A 1 68  ? -16.152 11.844  -1.253  1.00 2.96  ? 68  GLU A CA   2  
ATOM 3149  C C    . GLU A 1 68  ? -17.259 12.073  -2.281  1.00 3.03  ? 68  GLU A C    2  
ATOM 3150  O O    . GLU A 1 68  ? -18.438 11.883  -1.992  1.00 3.47  ? 68  GLU A O    2  
ATOM 3151  C CB   . GLU A 1 68  ? -16.164 12.949  -0.199  1.00 3.79  ? 68  GLU A CB   2  
ATOM 3152  C CG   . GLU A 1 68  ? -15.600 12.542  1.148   1.00 4.24  ? 68  GLU A CG   2  
ATOM 3153  C CD   . GLU A 1 68  ? -14.161 12.065  1.097   1.00 4.33  ? 68  GLU A CD   2  
ATOM 3154  O OE1  . GLU A 1 68  ? -13.250 12.919  1.043   1.00 4.54  ? 68  GLU A OE1  2  
ATOM 3155  O OE2  . GLU A 1 68  ? -13.932 10.838  1.127   1.00 4.61  ? 68  GLU A OE2  2  
ATOM 3156  H H    . GLU A 1 68  ? -14.178 12.448  -1.708  1.00 2.75  ? 68  GLU A H    2  
ATOM 3157  H HA   . GLU A 1 68  ? -16.325 10.903  -0.764  1.00 3.16  ? 68  GLU A HA   2  
ATOM 3158  H HB2  . GLU A 1 68  ? -15.581 13.765  -0.557  1.00 4.05  ? 68  GLU A HB2  2  
ATOM 3159  H HB3  . GLU A 1 68  ? -17.181 13.279  -0.053  1.00 4.24  ? 68  GLU A HB3  2  
ATOM 3160  H HG2  . GLU A 1 68  ? -15.646 13.396  1.800   1.00 4.79  ? 68  GLU A HG2  2  
ATOM 3161  H HG3  . GLU A 1 68  ? -16.211 11.754  1.547   1.00 4.43  ? 68  GLU A HG3  2  
ATOM 3162  N N    . SER A 1 69  ? -16.869 12.478  -3.484  1.00 3.10  ? 69  SER A N    2  
ATOM 3163  C CA   . SER A 1 69  ? -17.809 12.639  -4.584  1.00 3.63  ? 69  SER A CA   2  
ATOM 3164  C C    . SER A 1 69  ? -18.079 11.294  -5.259  1.00 3.71  ? 69  SER A C    2  
ATOM 3165  O O    . SER A 1 69  ? -19.116 11.097  -5.894  1.00 4.40  ? 69  SER A O    2  
ATOM 3166  C CB   . SER A 1 69  ? -17.248 13.641  -5.594  1.00 4.49  ? 69  SER A CB   2  
ATOM 3167  O OG   . SER A 1 69  ? -15.890 13.355  -5.889  1.00 4.68  ? 69  SER A OG   2  
ATOM 3168  H H    . SER A 1 69  ? -15.923 12.686  -3.636  1.00 3.14  ? 69  SER A H    2  
ATOM 3169  H HA   . SER A 1 69  ? -18.734 13.022  -4.182  1.00 3.90  ? 69  SER A HA   2  
ATOM 3170  H HB2  . SER A 1 69  ? -17.818 13.591  -6.502  1.00 4.89  ? 69  SER A HB2  2  
ATOM 3171  H HB3  . SER A 1 69  ? -17.314 14.634  -5.190  1.00 4.96  ? 69  SER A HB3  2  
ATOM 3172  H HG   . SER A 1 69  ? -15.684 13.669  -6.778  1.00 4.92  ? 69  SER A HG   2  
ATOM 3173  N N    . LYS A 1 70  ? -17.133 10.375  -5.106  1.00 3.46  ? 70  LYS A N    2  
ATOM 3174  C CA   . LYS A 1 70  ? -17.231 9.043   -5.659  1.00 4.25  ? 70  LYS A CA   2  
ATOM 3175  C C    . LYS A 1 70  ? -17.966 8.126   -4.685  1.00 4.39  ? 70  LYS A C    2  
ATOM 3176  O O    . LYS A 1 70  ? -18.242 6.961   -4.981  1.00 5.30  ? 70  LYS A O    2  
ATOM 3177  C CB   . LYS A 1 70  ? -15.822 8.523   -5.910  1.00 4.65  ? 70  LYS A CB   2  
ATOM 3178  C CG   . LYS A 1 70  ? -15.768 7.328   -6.812  1.00 5.30  ? 70  LYS A CG   2  
ATOM 3179  C CD   . LYS A 1 70  ? -14.338 6.897   -7.054  1.00 5.73  ? 70  LYS A CD   2  
ATOM 3180  C CE   . LYS A 1 70  ? -14.293 5.463   -7.513  1.00 6.36  ? 70  LYS A CE   2  
ATOM 3181  N NZ   . LYS A 1 70  ? -12.902 4.972   -7.702  1.00 6.99  ? 70  LYS A NZ   2  
ATOM 3182  H H    . LYS A 1 70  ? -16.326 10.602  -4.609  1.00 3.05  ? 70  LYS A H    2  
ATOM 3183  H HA   . LYS A 1 70  ? -17.772 9.092   -6.591  1.00 4.88  ? 70  LYS A HA   2  
ATOM 3184  H HB2  . LYS A 1 70  ? -15.226 9.306   -6.350  1.00 4.40  ? 70  LYS A HB2  2  
ATOM 3185  H HB3  . LYS A 1 70  ? -15.388 8.235   -4.964  1.00 5.12  ? 70  LYS A HB3  2  
ATOM 3186  H HG2  . LYS A 1 70  ? -16.307 6.523   -6.344  1.00 5.74  ? 70  LYS A HG2  2  
ATOM 3187  H HG3  . LYS A 1 70  ? -16.227 7.581   -7.750  1.00 5.41  ? 70  LYS A HG3  2  
ATOM 3188  H HD2  . LYS A 1 70  ? -13.901 7.527   -7.815  1.00 5.78  ? 70  LYS A HD2  2  
ATOM 3189  H HD3  . LYS A 1 70  ? -13.779 6.992   -6.135  1.00 5.93  ? 70  LYS A HD3  2  
ATOM 3190  H HE2  . LYS A 1 70  ? -14.782 4.867   -6.760  1.00 6.60  ? 70  LYS A HE2  2  
ATOM 3191  H HE3  . LYS A 1 70  ? -14.831 5.378   -8.446  1.00 6.43  ? 70  LYS A HE3  2  
ATOM 3192  H HZ1  . LYS A 1 70  ? -12.401 5.568   -8.391  1.00 6.98  ? 70  LYS A HZ1  2  
ATOM 3193  H HZ2  . LYS A 1 70  ? -12.915 3.995   -8.057  1.00 7.36  ? 70  LYS A HZ2  2  
ATOM 3194  H HZ3  . LYS A 1 70  ? -12.387 4.992   -6.800  1.00 7.35  ? 70  LYS A HZ3  2  
ATOM 3195  N N    . LYS A 1 71  ? -18.251 8.670   -3.510  1.00 3.86  ? 71  LYS A N    2  
ATOM 3196  C CA   . LYS A 1 71  ? -18.963 7.951   -2.462  1.00 4.42  ? 71  LYS A CA   2  
ATOM 3197  C C    . LYS A 1 71  ? -20.329 7.488   -2.937  1.00 4.63  ? 71  LYS A C    2  
ATOM 3198  O O    . LYS A 1 71  ? -20.947 8.099   -3.813  1.00 4.42  ? 71  LYS A O    2  
ATOM 3199  C CB   . LYS A 1 71  ? -19.104 8.833   -1.240  1.00 4.55  ? 71  LYS A CB   2  
ATOM 3200  C CG   . LYS A 1 71  ? -19.579 8.108   -0.016  1.00 5.51  ? 71  LYS A CG   2  
ATOM 3201  C CD   . LYS A 1 71  ? -19.066 8.802   1.205   1.00 6.15  ? 71  LYS A CD   2  
ATOM 3202  C CE   . LYS A 1 71  ? -19.641 8.228   2.477   1.00 7.31  ? 71  LYS A CE   2  
ATOM 3203  N NZ   . LYS A 1 71  ? -19.046 8.863   3.681   1.00 8.20  ? 71  LYS A NZ   2  
ATOM 3204  H H    . LYS A 1 71  ? -17.965 9.588   -3.343  1.00 3.38  ? 71  LYS A H    2  
ATOM 3205  H HA   . LYS A 1 71  ? -18.377 7.090   -2.186  1.00 5.06  ? 71  LYS A HA   2  
ATOM 3206  H HB2  . LYS A 1 71  ? -18.149 9.243   -1.011  1.00 4.44  ? 71  LYS A HB2  2  
ATOM 3207  H HB3  . LYS A 1 71  ? -19.795 9.631   -1.452  1.00 4.51  ? 71  LYS A HB3  2  
ATOM 3208  H HG2  . LYS A 1 71  ? -20.653 8.083   -0.003  1.00 5.66  ? 71  LYS A HG2  2  
ATOM 3209  H HG3  . LYS A 1 71  ? -19.183 7.112   -0.032  1.00 5.91  ? 71  LYS A HG3  2  
ATOM 3210  H HD2  . LYS A 1 71  ? -18.000 8.675   1.213   1.00 6.23  ? 71  LYS A HD2  2  
ATOM 3211  H HD3  . LYS A 1 71  ? -19.312 9.848   1.145   1.00 5.97  ? 71  LYS A HD3  2  
ATOM 3212  H HE2  . LYS A 1 71  ? -20.703 8.408   2.475   1.00 7.38  ? 71  LYS A HE2  2  
ATOM 3213  H HE3  . LYS A 1 71  ? -19.451 7.167   2.501   1.00 7.65  ? 71  LYS A HE3  2  
ATOM 3214  H HZ1  . LYS A 1 71  ? -18.015 8.711   3.696   1.00 8.38  ? 71  LYS A HZ1  2  
ATOM 3215  H HZ2  . LYS A 1 71  ? -19.455 8.457   4.543   1.00 8.58  ? 71  LYS A HZ2  2  
ATOM 3216  H HZ3  . LYS A 1 71  ? -19.231 9.888   3.673   1.00 8.49  ? 71  LYS A HZ3  2  
ATOM 3217  N N    . ARG A 1 72  ? -20.802 6.418   -2.335  1.00 5.41  ? 72  ARG A N    2  
ATOM 3218  C CA   . ARG A 1 72  ? -22.031 5.781   -2.781  1.00 5.92  ? 72  ARG A CA   2  
ATOM 3219  C C    . ARG A 1 72  ? -23.020 5.617   -1.644  1.00 5.77  ? 72  ARG A C    2  
ATOM 3220  O O    . ARG A 1 72  ? -22.654 5.605   -0.468  1.00 5.54  ? 72  ARG A O    2  
ATOM 3221  C CB   . ARG A 1 72  ? -21.748 4.405   -3.380  1.00 6.97  ? 72  ARG A CB   2  
ATOM 3222  C CG   . ARG A 1 72  ? -20.717 4.411   -4.486  1.00 7.56  ? 72  ARG A CG   2  
ATOM 3223  C CD   . ARG A 1 72  ? -20.546 3.026   -5.092  1.00 8.44  ? 72  ARG A CD   2  
ATOM 3224  N NE   . ARG A 1 72  ? -20.468 1.989   -4.062  1.00 9.04  ? 72  ARG A NE   2  
ATOM 3225  C CZ   . ARG A 1 72  ? -19.477 1.109   -3.945  1.00 10.00 ? 72  ARG A CZ   2  
ATOM 3226  N NH1  . ARG A 1 72  ? -18.452 1.130   -4.787  1.00 10.44 ? 72  ARG A NH1  2  
ATOM 3227  N NH2  . ARG A 1 72  ? -19.519 0.202   -2.977  1.00 10.67 ? 72  ARG A NH2  2  
ATOM 3228  H H    . ARG A 1 72  ? -20.324 6.065   -1.555  1.00 5.81  ? 72  ARG A H    2  
ATOM 3229  H HA   . ARG A 1 72  ? -22.472 6.406   -3.539  1.00 5.94  ? 72  ARG A HA   2  
ATOM 3230  H HB2  . ARG A 1 72  ? -21.400 3.753   -2.597  1.00 7.23  ? 72  ARG A HB2  2  
ATOM 3231  H HB3  . ARG A 1 72  ? -22.667 4.010   -3.783  1.00 7.35  ? 72  ARG A HB3  2  
ATOM 3232  H HG2  . ARG A 1 72  ? -21.048 5.091   -5.251  1.00 7.62  ? 72  ARG A HG2  2  
ATOM 3233  H HG3  . ARG A 1 72  ? -19.770 4.744   -4.086  1.00 7.57  ? 72  ARG A HG3  2  
ATOM 3234  H HD2  . ARG A 1 72  ? -21.391 2.820   -5.733  1.00 8.79  ? 72  ARG A HD2  2  
ATOM 3235  H HD3  . ARG A 1 72  ? -19.639 3.011   -5.677  1.00 8.51  ? 72  ARG A HD3  2  
ATOM 3236  H HE   . ARG A 1 72  ? -21.214 1.943   -3.422  1.00 8.87  ? 72  ARG A HE   2  
ATOM 3237  H HH11 . ARG A 1 72  ? -18.413 1.809   -5.521  1.00 10.10 ? 72  ARG A HH11 2  
ATOM 3238  H HH12 . ARG A 1 72  ? -17.706 0.464   -4.688  1.00 11.22 ? 72  ARG A HH12 2  
ATOM 3239  H HH21 . ARG A 1 72  ? -20.294 0.182   -2.340  1.00 10.52 ? 72  ARG A HH21 2  
ATOM 3240  H HH22 . ARG A 1 72  ? -18.776 -0.466  -2.877  1.00 11.45 ? 72  ARG A HH22 2  
ATOM 3241  N N    . LYS A 1 73  ? -24.276 5.486   -2.013  1.00 6.20  ? 73  LYS A N    2  
ATOM 3242  C CA   . LYS A 1 73  ? -25.322 5.144   -1.072  1.00 6.28  ? 73  LYS A CA   2  
ATOM 3243  C C    . LYS A 1 73  ? -25.942 3.827   -1.490  1.00 6.69  ? 73  LYS A C    2  
ATOM 3244  O O    . LYS A 1 73  ? -25.963 3.495   -2.672  1.00 7.13  ? 73  LYS A O    2  
ATOM 3245  C CB   . LYS A 1 73  ? -26.398 6.231   -1.023  1.00 6.89  ? 73  LYS A CB   2  
ATOM 3246  C CG   . LYS A 1 73  ? -25.880 7.591   -0.600  1.00 6.88  ? 73  LYS A CG   2  
ATOM 3247  C CD   . LYS A 1 73  ? -27.018 8.523   -0.224  1.00 7.64  ? 73  LYS A CD   2  
ATOM 3248  C CE   . LYS A 1 73  ? -27.885 8.878   -1.420  1.00 8.45  ? 73  LYS A CE   2  
ATOM 3249  N NZ   . LYS A 1 73  ? -29.062 9.692   -1.022  1.00 8.97  ? 73  LYS A NZ   2  
ATOM 3250  H H    . LYS A 1 73  ? -24.508 5.613   -2.959  1.00 6.62  ? 73  LYS A H    2  
ATOM 3251  H HA   . LYS A 1 73  ? -24.876 5.033   -0.094  1.00 5.84  ? 73  LYS A HA   2  
ATOM 3252  H HB2  . LYS A 1 73  ? -26.840 6.327   -2.001  1.00 7.51  ? 73  LYS A HB2  2  
ATOM 3253  H HB3  . LYS A 1 73  ? -27.163 5.931   -0.319  1.00 7.00  ? 73  LYS A HB3  2  
ATOM 3254  H HG2  . LYS A 1 73  ? -25.235 7.466   0.254   1.00 6.63  ? 73  LYS A HG2  2  
ATOM 3255  H HG3  . LYS A 1 73  ? -25.322 8.025   -1.416  1.00 6.84  ? 73  LYS A HG3  2  
ATOM 3256  H HD2  . LYS A 1 73  ? -27.633 8.031   0.517   1.00 7.77  ? 73  LYS A HD2  2  
ATOM 3257  H HD3  . LYS A 1 73  ? -26.606 9.430   0.194   1.00 7.70  ? 73  LYS A HD3  2  
ATOM 3258  H HE2  . LYS A 1 73  ? -27.290 9.439   -2.126  1.00 8.78  ? 73  LYS A HE2  2  
ATOM 3259  H HE3  . LYS A 1 73  ? -28.228 7.966   -1.883  1.00 8.56  ? 73  LYS A HE3  2  
ATOM 3260  H HZ1  . LYS A 1 73  ? -29.611 9.967   -1.862  1.00 9.28  ? 73  LYS A HZ1  2  
ATOM 3261  H HZ2  . LYS A 1 73  ? -28.754 10.552  -0.528  1.00 9.21  ? 73  LYS A HZ2  2  
ATOM 3262  H HZ3  . LYS A 1 73  ? -29.676 9.145   -0.387  1.00 9.02  ? 73  LYS A HZ3  2  
ATOM 3263  N N    . ASP A 1 74  ? -26.424 3.071   -0.524  1.00 6.78  ? 74  ASP A N    2  
ATOM 3264  C CA   . ASP A 1 74  ? -27.060 1.797   -0.814  1.00 7.38  ? 74  ASP A CA   2  
ATOM 3265  C C    . ASP A 1 74  ? -28.576 1.993   -0.812  1.00 8.21  ? 74  ASP A C    2  
ATOM 3266  O O    . ASP A 1 74  ? -29.031 3.131   -0.699  1.00 8.34  ? 74  ASP A O    2  
ATOM 3267  C CB   . ASP A 1 74  ? -26.626 0.741   0.200   1.00 7.38  ? 74  ASP A CB   2  
ATOM 3268  C CG   . ASP A 1 74  ? -26.742 -0.672  -0.342  1.00 8.19  ? 74  ASP A CG   2  
ATOM 3269  O OD1  . ASP A 1 74  ? -27.835 -1.263  -0.247  1.00 8.74  ? 74  ASP A OD1  2  
ATOM 3270  O OD2  . ASP A 1 74  ? -25.736 -1.201  -0.862  1.00 8.40  ? 74  ASP A OD2  2  
ATOM 3271  H H    . ASP A 1 74  ? -26.364 3.378   0.401   1.00 6.59  ? 74  ASP A H    2  
ATOM 3272  H HA   . ASP A 1 74  ? -26.752 1.487   -1.798  1.00 7.42  ? 74  ASP A HA   2  
ATOM 3273  H HB2  . ASP A 1 74  ? -25.596 0.917   0.474   1.00 6.84  ? 74  ASP A HB2  2  
ATOM 3274  H HB3  . ASP A 1 74  ? -27.243 0.825   1.073   1.00 7.53  ? 74  ASP A HB3  2  
ATOM 3275  N N    . ASN A 1 75  ? -29.357 0.922   -0.912  1.00 8.89  ? 75  ASN A N    2  
ATOM 3276  C CA   . ASN A 1 75  ? -30.806 1.063   -1.102  1.00 9.75  ? 75  ASN A CA   2  
ATOM 3277  C C    . ASN A 1 75  ? -31.468 1.813   0.058   1.00 9.91  ? 75  ASN A C    2  
ATOM 3278  O O    . ASN A 1 75  ? -32.456 2.520   -0.140  1.00 10.47 ? 75  ASN A O    2  
ATOM 3279  C CB   . ASN A 1 75  ? -31.487 -0.300  -1.325  1.00 10.48 ? 75  ASN A CB   2  
ATOM 3280  C CG   . ASN A 1 75  ? -31.504 -1.193  -0.098  1.00 10.99 ? 75  ASN A CG   2  
ATOM 3281  O OD1  . ASN A 1 75  ? -30.578 -1.967  0.134   1.00 11.25 ? 75  ASN A OD1  2  
ATOM 3282  N ND2  . ASN A 1 75  ? -32.572 -1.115  0.681   1.00 11.37 ? 75  ASN A ND2  2  
ATOM 3283  H H    . ASN A 1 75  ? -28.959 0.022   -0.847  1.00 8.89  ? 75  ASN A H    2  
ATOM 3284  H HA   . ASN A 1 75  ? -30.943 1.657   -1.996  1.00 9.91  ? 75  ASN A HA   2  
ATOM 3285  H HB2  . ASN A 1 75  ? -32.508 -0.133  -1.630  1.00 10.54 ? 75  ASN A HB2  2  
ATOM 3286  H HB3  . ASN A 1 75  ? -30.966 -0.822  -2.116  1.00 10.77 ? 75  ASN A HB3  2  
ATOM 3287  H HD21 . ASN A 1 75  ? -33.288 -0.491  0.429   1.00 11.28 ? 75  ASN A HD21 2  
ATOM 3288  H HD22 . ASN A 1 75  ? -32.606 -1.685  1.479   1.00 11.84 ? 75  ASN A HD22 2  
ATOM 3289  N N    . GLU A 1 76  ? -30.909 1.691   1.258   1.00 9.56  ? 76  GLU A N    2  
ATOM 3290  C CA   . GLU A 1 76  ? -31.453 2.386   2.423   1.00 9.89  ? 76  GLU A CA   2  
ATOM 3291  C C    . GLU A 1 76  ? -30.779 3.743   2.629   1.00 9.42  ? 76  GLU A C    2  
ATOM 3292  O O    . GLU A 1 76  ? -30.933 4.366   3.678   1.00 9.74  ? 76  GLU A O    2  
ATOM 3293  C CB   . GLU A 1 76  ? -31.302 1.527   3.682   1.00 10.10 ? 76  GLU A CB   2  
ATOM 3294  C CG   . GLU A 1 76  ? -32.088 0.227   3.629   1.00 10.22 ? 76  GLU A CG   2  
ATOM 3295  C CD   . GLU A 1 76  ? -31.929 -0.612  4.879   1.00 10.82 ? 76  GLU A CD   2  
ATOM 3296  O OE1  . GLU A 1 76  ? -30.907 -1.319  5.003   1.00 11.06 ? 76  GLU A OE1  2  
ATOM 3297  O OE2  . GLU A 1 76  ? -32.834 -0.587  5.738   1.00 11.20 ? 76  GLU A OE2  2  
ATOM 3298  H H    . GLU A 1 76  ? -30.122 1.113   1.367   1.00 9.17  ? 76  GLU A H    2  
ATOM 3299  H HA   . GLU A 1 76  ? -32.504 2.552   2.240   1.00 10.50 ? 76  GLU A HA   2  
ATOM 3300  H HB2  . GLU A 1 76  ? -30.258 1.287   3.816   1.00 9.97  ? 76  GLU A HB2  2  
ATOM 3301  H HB3  . GLU A 1 76  ? -31.644 2.095   4.534   1.00 10.53 ? 76  GLU A HB3  2  
ATOM 3302  H HG2  . GLU A 1 76  ? -33.134 0.460   3.505   1.00 10.34 ? 76  GLU A HG2  2  
ATOM 3303  H HG3  . GLU A 1 76  ? -31.746 -0.349  2.781   1.00 9.99  ? 76  GLU A HG3  2  
ATOM 3304  N N    . GLY A 1 77  ? -30.035 4.198   1.621   1.00 8.81  ? 77  GLY A N    2  
ATOM 3305  C CA   . GLY A 1 77  ? -29.343 5.476   1.709   1.00 8.45  ? 77  GLY A CA   2  
ATOM 3306  C C    . GLY A 1 77  ? -28.315 5.495   2.821   1.00 7.87  ? 77  GLY A C    2  
ATOM 3307  O O    . GLY A 1 77  ? -28.153 6.495   3.518   1.00 7.68  ? 77  GLY A O    2  
ATOM 3308  H H    . GLY A 1 77  ? -29.962 3.662   0.799   1.00 8.72  ? 77  GLY A H    2  
ATOM 3309  H HA2  . GLY A 1 77  ? -28.845 5.668   0.771   1.00 8.21  ? 77  GLY A HA2  2  
ATOM 3310  H HA3  . GLY A 1 77  ? -30.063 6.257   1.885   1.00 8.99  ? 77  GLY A HA3  2  
ATOM 3311  N N    . ASN A 1 78  ? -27.624 4.375   2.972   1.00 7.80  ? 78  ASN A N    2  
ATOM 3312  C CA   . ASN A 1 78  ? -26.651 4.185   4.046   1.00 7.46  ? 78  ASN A CA   2  
ATOM 3313  C C    . ASN A 1 78  ? -25.509 5.194   3.994   1.00 6.97  ? 78  ASN A C    2  
ATOM 3314  O O    . ASN A 1 78  ? -24.974 5.579   5.033   1.00 7.29  ? 78  ASN A O    2  
ATOM 3315  C CB   . ASN A 1 78  ? -26.076 2.772   3.977   1.00 7.23  ? 78  ASN A CB   2  
ATOM 3316  C CG   . ASN A 1 78  ? -27.044 1.723   4.489   1.00 8.06  ? 78  ASN A CG   2  
ATOM 3317  O OD1  . ASN A 1 78  ? -27.918 2.013   5.307   1.00 8.60  ? 78  ASN A OD1  2  
ATOM 3318  N ND2  . ASN A 1 78  ? -26.893 0.495   4.021   1.00 8.39  ? 78  ASN A ND2  2  
ATOM 3319  H H    . ASN A 1 78  ? -27.788 3.638   2.351   1.00 8.12  ? 78  ASN A H    2  
ATOM 3320  H HA   . ASN A 1 78  ? -27.171 4.300   4.985   1.00 7.96  ? 78  ASN A HA   2  
ATOM 3321  H HB2  . ASN A 1 78  ? -25.842 2.541   2.948   1.00 7.05  ? 78  ASN A HB2  2  
ATOM 3322  H HB3  . ASN A 1 78  ? -25.173 2.732   4.560   1.00 6.85  ? 78  ASN A HB3  2  
ATOM 3323  H HD21 . ASN A 1 78  ? -26.171 0.324   3.377   1.00 8.13  ? 78  ASN A HD21 2  
ATOM 3324  H HD22 . ASN A 1 78  ? -27.510 -0.200  4.337   1.00 9.00  ? 78  ASN A HD22 2  
ATOM 3325  N N    . GLU A 1 79  ? -25.144 5.613   2.789   1.00 6.44  ? 79  GLU A N    2  
ATOM 3326  C CA   . GLU A 1 79  ? -23.997 6.502   2.585   1.00 6.06  ? 79  GLU A CA   2  
ATOM 3327  C C    . GLU A 1 79  ? -22.728 5.810   3.059   1.00 5.51  ? 79  GLU A C    2  
ATOM 3328  O O    . GLU A 1 79  ? -22.202 6.101   4.137   1.00 5.77  ? 79  GLU A O    2  
ATOM 3329  C CB   . GLU A 1 79  ? -24.164 7.843   3.315   1.00 6.75  ? 79  GLU A CB   2  
ATOM 3330  C CG   . GLU A 1 79  ? -25.369 8.645   2.874   1.00 7.16  ? 79  GLU A CG   2  
ATOM 3331  C CD   . GLU A 1 79  ? -25.417 10.015  3.515   1.00 7.94  ? 79  GLU A CD   2  
ATOM 3332  O OE1  . GLU A 1 79  ? -26.003 10.140  4.609   1.00 8.32  ? 79  GLU A OE1  2  
ATOM 3333  O OE2  . GLU A 1 79  ? -24.877 10.976  2.929   1.00 8.38  ? 79  GLU A OE2  2  
ATOM 3334  H H    . GLU A 1 79  ? -25.649 5.306   2.018   1.00 6.47  ? 79  GLU A H    2  
ATOM 3335  H HA   . GLU A 1 79  ? -23.910 6.685   1.523   1.00 5.88  ? 79  GLU A HA   2  
ATOM 3336  H HB2  . GLU A 1 79  ? -24.251 7.657   4.374   1.00 7.10  ? 79  GLU A HB2  2  
ATOM 3337  H HB3  . GLU A 1 79  ? -23.286 8.442   3.135   1.00 6.91  ? 79  GLU A HB3  2  
ATOM 3338  H HG2  . GLU A 1 79  ? -25.320 8.768   1.806   1.00 6.94  ? 79  GLU A HG2  2  
ATOM 3339  H HG3  . GLU A 1 79  ? -26.266 8.104   3.136   1.00 7.42  ? 79  GLU A HG3  2  
ATOM 3340  N N    . VAL A 1 80  ? -22.247 4.890   2.247   1.00 4.98  ? 80  VAL A N    2  
ATOM 3341  C CA   . VAL A 1 80  ? -21.119 4.057   2.616   1.00 4.58  ? 80  VAL A CA   2  
ATOM 3342  C C    . VAL A 1 80  ? -19.852 4.538   1.929   1.00 3.98  ? 80  VAL A C    2  
ATOM 3343  O O    . VAL A 1 80  ? -19.895 5.042   0.804   1.00 3.86  ? 80  VAL A O    2  
ATOM 3344  C CB   . VAL A 1 80  ? -21.373 2.577   2.251   1.00 4.62  ? 80  VAL A CB   2  
ATOM 3345  C CG1  . VAL A 1 80  ? -22.602 2.053   2.975   1.00 5.39  ? 80  VAL A CG1  2  
ATOM 3346  C CG2  . VAL A 1 80  ? -21.535 2.404   0.747   1.00 4.28  ? 80  VAL A CG2  2  
ATOM 3347  H H    . VAL A 1 80  ? -22.642 4.786   1.354   1.00 5.01  ? 80  VAL A H    2  
ATOM 3348  H HA   . VAL A 1 80  ? -20.987 4.127   3.686   1.00 5.01  ? 80  VAL A HA   2  
ATOM 3349  H HB   . VAL A 1 80  ? -20.520 1.996   2.569   1.00 4.65  ? 80  VAL A HB   2  
ATOM 3350  H HG11 . VAL A 1 80  ? -22.455 2.135   4.041   1.00 5.49  ? 80  VAL A HG11 2  
ATOM 3351  H HG12 . VAL A 1 80  ? -22.760 1.018   2.712   1.00 5.78  ? 80  VAL A HG12 2  
ATOM 3352  H HG13 . VAL A 1 80  ? -23.466 2.633   2.685   1.00 5.71  ? 80  VAL A HG13 2  
ATOM 3353  H HG21 . VAL A 1 80  ? -20.653 2.774   0.246   1.00 4.44  ? 80  VAL A HG21 2  
ATOM 3354  H HG22 . VAL A 1 80  ? -22.401 2.957   0.413   1.00 4.33  ? 80  VAL A HG22 2  
ATOM 3355  H HG23 . VAL A 1 80  ? -21.666 1.356   0.520   1.00 4.29  ? 80  VAL A HG23 2  
ATOM 3356  N N    . VAL A 1 81  ? -18.732 4.412   2.616   1.00 3.91  ? 81  VAL A N    2  
ATOM 3357  C CA   . VAL A 1 81  ? -17.455 4.740   2.027   1.00 3.49  ? 81  VAL A CA   2  
ATOM 3358  C C    . VAL A 1 81  ? -17.027 3.617   1.084   1.00 2.81  ? 81  VAL A C    2  
ATOM 3359  O O    . VAL A 1 81  ? -17.048 2.442   1.455   1.00 2.88  ? 81  VAL A O    2  
ATOM 3360  C CB   . VAL A 1 81  ? -16.374 4.991   3.110   1.00 4.02  ? 81  VAL A CB   2  
ATOM 3361  C CG1  . VAL A 1 81  ? -16.248 3.811   4.060   1.00 4.27  ? 81  VAL A CG1  2  
ATOM 3362  C CG2  . VAL A 1 81  ? -15.036 5.303   2.465   1.00 4.20  ? 81  VAL A CG2  2  
ATOM 3363  H H    . VAL A 1 81  ? -18.763 4.080   3.537   1.00 4.34  ? 81  VAL A H    2  
ATOM 3364  H HA   . VAL A 1 81  ? -17.579 5.648   1.454   1.00 3.57  ? 81  VAL A HA   2  
ATOM 3365  H HB   . VAL A 1 81  ? -16.674 5.853   3.689   1.00 4.55  ? 81  VAL A HB   2  
ATOM 3366  H HG11 . VAL A 1 81  ? -15.450 3.997   4.763   1.00 4.42  ? 81  VAL A HG11 2  
ATOM 3367  H HG12 . VAL A 1 81  ? -16.032 2.916   3.497   1.00 4.47  ? 81  VAL A HG12 2  
ATOM 3368  H HG13 . VAL A 1 81  ? -17.176 3.681   4.597   1.00 4.58  ? 81  VAL A HG13 2  
ATOM 3369  H HG21 . VAL A 1 81  ? -14.309 5.523   3.231   1.00 4.50  ? 81  VAL A HG21 2  
ATOM 3370  H HG22 . VAL A 1 81  ? -15.145 6.156   1.811   1.00 4.41  ? 81  VAL A HG22 2  
ATOM 3371  H HG23 . VAL A 1 81  ? -14.709 4.451   1.890   1.00 4.31  ? 81  VAL A HG23 2  
ATOM 3372  N N    . PRO A 1 82  ? -16.673 3.960   -0.159  1.00 2.49  ? 82  PRO A N    2  
ATOM 3373  C CA   . PRO A 1 82  ? -16.288 2.974   -1.162  1.00 2.15  ? 82  PRO A CA   2  
ATOM 3374  C C    . PRO A 1 82  ? -14.925 2.377   -0.852  1.00 1.66  ? 82  PRO A C    2  
ATOM 3375  O O    . PRO A 1 82  ? -14.087 3.025   -0.222  1.00 1.69  ? 82  PRO A O    2  
ATOM 3376  C CB   . PRO A 1 82  ? -16.257 3.776   -2.455  1.00 2.57  ? 82  PRO A CB   2  
ATOM 3377  C CG   . PRO A 1 82  ? -15.974 5.154   -2.039  1.00 2.91  ? 82  PRO A CG   2  
ATOM 3378  C CD   . PRO A 1 82  ? -16.590 5.334   -0.679  1.00 2.92  ? 82  PRO A CD   2  
ATOM 3379  H HA   . PRO A 1 82  ? -17.013 2.193   -1.245  1.00 2.39  ? 82  PRO A HA   2  
ATOM 3380  H HB2  . PRO A 1 82  ? -15.489 3.398   -3.101  1.00 2.53  ? 82  PRO A HB2  2  
ATOM 3381  H HB3  . PRO A 1 82  ? -17.208 3.718   -2.946  1.00 2.99  ? 82  PRO A HB3  2  
ATOM 3382  H HG2  . PRO A 1 82  ? -14.914 5.298   -1.992  1.00 2.90  ? 82  PRO A HG2  2  
ATOM 3383  H HG3  . PRO A 1 82  ? -16.417 5.823   -2.746  1.00 3.42  ? 82  PRO A HG3  2  
ATOM 3384  H HD2  . PRO A 1 82  ? -15.953 5.942   -0.055  1.00 3.15  ? 82  PRO A HD2  2  
ATOM 3385  H HD3  . PRO A 1 82  ? -17.569 5.775   -0.759  1.00 3.30  ? 82  PRO A HD3  2  
ATOM 3386  N N    . LYS A 1 83  ? -14.715 1.136   -1.269  1.00 1.57  ? 83  LYS A N    2  
ATOM 3387  C CA   . LYS A 1 83  ? -13.456 0.463   -1.023  1.00 1.32  ? 83  LYS A CA   2  
ATOM 3388  C C    . LYS A 1 83  ? -12.329 1.169   -1.746  1.00 1.05  ? 83  LYS A C    2  
ATOM 3389  O O    . LYS A 1 83  ? -12.320 1.274   -2.975  1.00 1.19  ? 83  LYS A O    2  
ATOM 3390  C CB   . LYS A 1 83  ? -13.525 -0.995  -1.453  1.00 1.66  ? 83  LYS A CB   2  
ATOM 3391  C CG   . LYS A 1 83  ? -14.567 -1.802  -0.708  1.00 2.23  ? 83  LYS A CG   2  
ATOM 3392  C CD   . LYS A 1 83  ? -14.311 -1.816  0.791   1.00 2.76  ? 83  LYS A CD   2  
ATOM 3393  C CE   . LYS A 1 83  ? -15.306 -2.710  1.515   1.00 3.60  ? 83  LYS A CE   2  
ATOM 3394  N NZ   . LYS A 1 83  ? -15.119 -2.669  2.989   1.00 4.42  ? 83  LYS A NZ   2  
ATOM 3395  H H    . LYS A 1 83  ? -15.418 0.666   -1.762  1.00 1.91  ? 83  LYS A H    2  
ATOM 3396  H HA   . LYS A 1 83  ? -13.257 0.505   0.039   1.00 1.32  ? 83  LYS A HA   2  
ATOM 3397  H HB2  . LYS A 1 83  ? -13.748 -1.037  -2.504  1.00 1.85  ? 83  LYS A HB2  2  
ATOM 3398  H HB3  . LYS A 1 83  ? -12.570 -1.447  -1.282  1.00 1.86  ? 83  LYS A HB3  2  
ATOM 3399  H HG2  . LYS A 1 83  ? -15.531 -1.368  -0.892  1.00 2.38  ? 83  LYS A HG2  2  
ATOM 3400  H HG3  . LYS A 1 83  ? -14.550 -2.812  -1.076  1.00 2.76  ? 83  LYS A HG3  2  
ATOM 3401  H HD2  . LYS A 1 83  ? -13.313 -2.184  0.973   1.00 2.93  ? 83  LYS A HD2  2  
ATOM 3402  H HD3  . LYS A 1 83  ? -14.401 -0.810  1.172   1.00 3.05  ? 83  LYS A HD3  2  
ATOM 3403  H HE2  . LYS A 1 83  ? -16.307 -2.378  1.280   1.00 3.67  ? 83  LYS A HE2  2  
ATOM 3404  H HE3  . LYS A 1 83  ? -15.175 -3.725  1.172   1.00 4.07  ? 83  LYS A HE3  2  
ATOM 3405  H HZ1  . LYS A 1 83  ? -14.143 -2.929  3.236   1.00 4.83  ? 83  LYS A HZ1  2  
ATOM 3406  H HZ2  . LYS A 1 83  ? -15.769 -3.336  3.451   1.00 4.81  ? 83  LYS A HZ2  2  
ATOM 3407  H HZ3  . LYS A 1 83  ? -15.314 -1.714  3.348   1.00 4.64  ? 83  LYS A HZ3  2  
ATOM 3408  N N    . PRO A 1 84  ? -11.380 1.674   -0.968  1.00 0.80  ? 84  PRO A N    2  
ATOM 3409  C CA   . PRO A 1 84  ? -10.230 2.416   -1.473  1.00 0.60  ? 84  PRO A CA   2  
ATOM 3410  C C    . PRO A 1 84  ? -9.388  1.581   -2.430  1.00 0.62  ? 84  PRO A C    2  
ATOM 3411  O O    . PRO A 1 84  ? -9.135  0.401   -2.175  1.00 0.78  ? 84  PRO A O    2  
ATOM 3412  C CB   . PRO A 1 84  ? -9.446  2.738   -0.205  1.00 0.60  ? 84  PRO A CB   2  
ATOM 3413  C CG   . PRO A 1 84  ? -10.450 2.667   0.878   1.00 0.84  ? 84  PRO A CG   2  
ATOM 3414  C CD   . PRO A 1 84  ? -11.353 1.560   0.492   1.00 0.94  ? 84  PRO A CD   2  
ATOM 3415  H HA   . PRO A 1 84  ? -10.530 3.335   -1.949  1.00 0.63  ? 84  PRO A HA   2  
ATOM 3416  H HB2  . PRO A 1 84  ? -8.677  2.002   -0.067  1.00 0.66  ? 84  PRO A HB2  2  
ATOM 3417  H HB3  . PRO A 1 84  ? -9.011  3.724   -0.280  1.00 0.60  ? 84  PRO A HB3  2  
ATOM 3418  H HG2  . PRO A 1 84  ? -9.972  2.444   1.806   1.00 1.06  ? 84  PRO A HG2  2  
ATOM 3419  H HG3  . PRO A 1 84  ? -11.001 3.587   0.941   1.00 0.88  ? 84  PRO A HG3  2  
ATOM 3420  H HD2  . PRO A 1 84  ? -10.951 0.609   0.801   1.00 1.13  ? 84  PRO A HD2  2  
ATOM 3421  H HD3  . PRO A 1 84  ? -12.327 1.719   0.911   1.00 1.08  ? 84  PRO A HD3  2  
ATOM 3422  N N    . GLN A 1 85  ? -8.964  2.195   -3.525  1.00 0.61  ? 85  GLN A N    2  
ATOM 3423  C CA   . GLN A 1 85  ? -8.189  1.500   -4.542  1.00 0.63  ? 85  GLN A CA   2  
ATOM 3424  C C    . GLN A 1 85  ? -6.752  1.352   -4.075  1.00 0.51  ? 85  GLN A C    2  
ATOM 3425  O O    . GLN A 1 85  ? -6.039  2.339   -3.907  1.00 0.51  ? 85  GLN A O    2  
ATOM 3426  C CB   . GLN A 1 85  ? -8.254  2.271   -5.857  1.00 0.77  ? 85  GLN A CB   2  
ATOM 3427  C CG   . GLN A 1 85  ? -9.672  2.503   -6.333  1.00 1.26  ? 85  GLN A CG   2  
ATOM 3428  C CD   . GLN A 1 85  ? -9.752  3.407   -7.542  1.00 1.44  ? 85  GLN A CD   2  
ATOM 3429  O OE1  . GLN A 1 85  ? -9.854  4.628   -7.413  1.00 1.73  ? 85  GLN A OE1  2  
ATOM 3430  N NE2  . GLN A 1 85  ? -9.712  2.820   -8.726  1.00 2.01  ? 85  GLN A NE2  2  
ATOM 3431  H H    . GLN A 1 85  ? -9.159  3.144   -3.644  1.00 0.66  ? 85  GLN A H    2  
ATOM 3432  H HA   . GLN A 1 85  ? -8.619  0.523   -4.684  1.00 0.70  ? 85  GLN A HA   2  
ATOM 3433  H HB2  . GLN A 1 85  ? -7.785  3.227   -5.723  1.00 0.90  ? 85  GLN A HB2  2  
ATOM 3434  H HB3  . GLN A 1 85  ? -7.724  1.719   -6.618  1.00 1.01  ? 85  GLN A HB3  2  
ATOM 3435  H HG2  . GLN A 1 85  ? -10.105 1.553   -6.587  1.00 1.59  ? 85  GLN A HG2  2  
ATOM 3436  H HG3  . GLN A 1 85  ? -10.237 2.951   -5.529  1.00 1.51  ? 85  GLN A HG3  2  
ATOM 3437  H HE21 . GLN A 1 85  ? -9.630  1.840   -8.756  1.00 2.53  ? 85  GLN A HE21 2  
ATOM 3438  H HE22 . GLN A 1 85  ? -9.783  3.383   -9.526  1.00 2.15  ? 85  GLN A HE22 2  
ATOM 3439  N N    . ARG A 1 86  ? -6.326  0.122   -3.872  1.00 0.50  ? 86  ARG A N    2  
ATOM 3440  C CA   . ARG A 1 86  ? -5.059  -0.128  -3.225  1.00 0.48  ? 86  ARG A CA   2  
ATOM 3441  C C    . ARG A 1 86  ? -4.036  -0.763  -4.157  1.00 0.43  ? 86  ARG A C    2  
ATOM 3442  O O    . ARG A 1 86  ? -4.376  -1.462  -5.113  1.00 0.51  ? 86  ARG A O    2  
ATOM 3443  C CB   . ARG A 1 86  ? -5.278  -0.997  -2.004  1.00 0.62  ? 86  ARG A CB   2  
ATOM 3444  C CG   . ARG A 1 86  ? -5.685  -2.390  -2.326  1.00 0.85  ? 86  ARG A CG   2  
ATOM 3445  C CD   . ARG A 1 86  ? -6.559  -2.947  -1.238  1.00 0.65  ? 86  ARG A CD   2  
ATOM 3446  N NE   . ARG A 1 86  ? -7.940  -2.492  -1.363  1.00 1.27  ? 86  ARG A NE   2  
ATOM 3447  C CZ   . ARG A 1 86  ? -8.963  -2.987  -0.672  1.00 1.38  ? 86  ARG A CZ   2  
ATOM 3448  N NH1  . ARG A 1 86  ? -8.768  -3.932  0.242   1.00 1.19  ? 86  ARG A NH1  2  
ATOM 3449  N NH2  . ARG A 1 86  ? -10.187 -2.530  -0.894  1.00 2.24  ? 86  ARG A NH2  2  
ATOM 3450  H H    . ARG A 1 86  ? -6.879  -0.633  -4.156  1.00 0.55  ? 86  ARG A H    2  
ATOM 3451  H HA   . ARG A 1 86  ? -4.680  0.811   -2.889  1.00 0.50  ? 86  ARG A HA   2  
ATOM 3452  H HB2  . ARG A 1 86  ? -4.375  -1.037  -1.438  1.00 1.45  ? 86  ARG A HB2  2  
ATOM 3453  H HB3  . ARG A 1 86  ? -6.056  -0.559  -1.406  1.00 1.30  ? 86  ARG A HB3  2  
ATOM 3454  H HG2  . ARG A 1 86  ? -6.230  -2.355  -3.228  1.00 1.55  ? 86  ARG A HG2  2  
ATOM 3455  H HG3  . ARG A 1 86  ? -4.808  -3.006  -2.437  1.00 1.67  ? 86  ARG A HG3  2  
ATOM 3456  H HD2  . ARG A 1 86  ? -6.528  -4.026  -1.268  1.00 1.04  ? 86  ARG A HD2  2  
ATOM 3457  H HD3  . ARG A 1 86  ? -6.163  -2.594  -0.307  1.00 1.07  ? 86  ARG A HD3  2  
ATOM 3458  H HE   . ARG A 1 86  ? -8.120  -1.784  -2.026  1.00 1.95  ? 86  ARG A HE   2  
ATOM 3459  H HH11 . ARG A 1 86  ? -7.847  -4.278  0.418   1.00 1.35  ? 86  ARG A HH11 2  
ATOM 3460  H HH12 . ARG A 1 86  ? -9.545  -4.303  0.758   1.00 1.49  ? 86  ARG A HH12 2  
ATOM 3461  H HH21 . ARG A 1 86  ? -10.338 -1.813  -1.578  1.00 2.89  ? 86  ARG A HH21 2  
ATOM 3462  H HH22 . ARG A 1 86  ? -10.969 -2.912  -0.392  1.00 2.35  ? 86  ARG A HH22 2  
ATOM 3463  N N    . HIS A 1 87  ? -2.777  -0.492  -3.860  1.00 0.37  ? 87  HIS A N    2  
ATOM 3464  C CA   . HIS A 1 87  ? -1.655  -1.102  -4.558  1.00 0.35  ? 87  HIS A CA   2  
ATOM 3465  C C    . HIS A 1 87  ? -1.020  -2.114  -3.623  1.00 0.34  ? 87  HIS A C    2  
ATOM 3466  O O    . HIS A 1 87  ? -1.149  -1.988  -2.405  1.00 0.47  ? 87  HIS A O    2  
ATOM 3467  C CB   . HIS A 1 87  ? -0.605  -0.053  -4.951  1.00 0.36  ? 87  HIS A CB   2  
ATOM 3468  C CG   . HIS A 1 87  ? -1.156  1.151   -5.649  1.00 0.41  ? 87  HIS A CG   2  
ATOM 3469  N ND1  . HIS A 1 87  ? -1.372  1.218   -7.008  1.00 0.52  ? 87  HIS A ND1  2  
ATOM 3470  C CD2  . HIS A 1 87  ? -1.525  2.350   -5.151  1.00 0.45  ? 87  HIS A CD2  2  
ATOM 3471  C CE1  . HIS A 1 87  ? -1.851  2.410   -7.314  1.00 0.60  ? 87  HIS A CE1  2  
ATOM 3472  N NE2  . HIS A 1 87  ? -1.956  3.118   -6.204  1.00 0.55  ? 87  HIS A NE2  2  
ATOM 3473  H H    . HIS A 1 87  ? -2.598  0.134   -3.126  1.00 0.40  ? 87  HIS A H    2  
ATOM 3474  H HA   . HIS A 1 87  ? -2.025  -1.598  -5.438  1.00 0.39  ? 87  HIS A HA   2  
ATOM 3475  H HB2  . HIS A 1 87  ? -0.110  0.288   -4.064  1.00 0.32  ? 87  HIS A HB2  2  
ATOM 3476  H HB3  . HIS A 1 87  ? 0.125   -0.506  -5.596  1.00 0.41  ? 87  HIS A HB3  2  
ATOM 3477  H HD1  . HIS A 1 87  ? -1.203  0.498   -7.656  1.00 0.57  ? 87  HIS A HD1  2  
ATOM 3478  H HD2  . HIS A 1 87  ? -1.474  2.649   -4.113  1.00 0.46  ? 87  HIS A HD2  2  
ATOM 3479  H HE1  . HIS A 1 87  ? -2.112  2.749   -8.306  1.00 0.71  ? 87  HIS A HE1  2  
ATOM 3480  H HE2  . HIS A 1 87  ? -2.470  3.955   -6.120  1.00 0.63  ? 87  HIS A HE2  2  
ATOM 3481  N N    . MET A 1 88  ? -0.343  -3.109  -4.162  1.00 0.29  ? 88  MET A N    2  
ATOM 3482  C CA   . MET A 1 88  ? 0.302   -4.105  -3.324  1.00 0.25  ? 88  MET A CA   2  
ATOM 3483  C C    . MET A 1 88  ? 1.721   -4.371  -3.804  1.00 0.25  ? 88  MET A C    2  
ATOM 3484  O O    . MET A 1 88  ? 1.947   -4.613  -4.989  1.00 0.29  ? 88  MET A O    2  
ATOM 3485  C CB   . MET A 1 88  ? -0.490  -5.409  -3.332  1.00 0.27  ? 88  MET A CB   2  
ATOM 3486  C CG   . MET A 1 88  ? -0.051  -6.376  -2.249  1.00 0.44  ? 88  MET A CG   2  
ATOM 3487  S SD   . MET A 1 88  ? -0.549  -8.078  -2.583  1.00 0.62  ? 88  MET A SD   2  
ATOM 3488  C CE   . MET A 1 88  ? -2.328  -7.904  -2.682  1.00 0.73  ? 88  MET A CE   2  
ATOM 3489  H H    . MET A 1 88  ? -0.281  -3.186  -5.139  1.00 0.35  ? 88  MET A H    2  
ATOM 3490  H HA   . MET A 1 88  ? 0.339   -3.721  -2.316  1.00 0.24  ? 88  MET A HA   2  
ATOM 3491  H HB2  . MET A 1 88  ? -1.536  -5.184  -3.184  1.00 0.47  ? 88  MET A HB2  2  
ATOM 3492  H HB3  . MET A 1 88  ? -0.363  -5.891  -4.289  1.00 0.51  ? 88  MET A HB3  2  
ATOM 3493  H HG2  . MET A 1 88  ? 1.024   -6.336  -2.166  1.00 0.63  ? 88  MET A HG2  2  
ATOM 3494  H HG3  . MET A 1 88  ? -0.492  -6.066  -1.314  1.00 0.61  ? 88  MET A HG3  2  
ATOM 3495  H HE1  . MET A 1 88  ? -2.702  -7.491  -1.756  1.00 1.16  ? 88  MET A HE1  2  
ATOM 3496  H HE2  . MET A 1 88  ? -2.773  -8.873  -2.848  1.00 1.33  ? 88  MET A HE2  2  
ATOM 3497  H HE3  . MET A 1 88  ? -2.581  -7.246  -3.499  1.00 1.26  ? 88  MET A HE3  2  
ATOM 3498  N N    . PHE A 1 89  ? 2.673   -4.316  -2.884  1.00 0.25  ? 89  PHE A N    2  
ATOM 3499  C CA   . PHE A 1 89  ? 4.060   -4.585  -3.217  1.00 0.26  ? 89  PHE A CA   2  
ATOM 3500  C C    . PHE A 1 89  ? 4.597   -5.691  -2.326  1.00 0.26  ? 89  PHE A C    2  
ATOM 3501  O O    . PHE A 1 89  ? 4.396   -5.682  -1.109  1.00 0.30  ? 89  PHE A O    2  
ATOM 3502  C CB   . PHE A 1 89  ? 4.935   -3.336  -3.060  1.00 0.31  ? 89  PHE A CB   2  
ATOM 3503  C CG   . PHE A 1 89  ? 4.498   -2.153  -3.887  1.00 0.48  ? 89  PHE A CG   2  
ATOM 3504  C CD1  . PHE A 1 89  ? 3.314   -1.495  -3.612  1.00 0.76  ? 89  PHE A CD1  2  
ATOM 3505  C CD2  . PHE A 1 89  ? 5.286   -1.691  -4.929  1.00 0.55  ? 89  PHE A CD2  2  
ATOM 3506  C CE1  . PHE A 1 89  ? 2.919   -0.403  -4.358  1.00 0.94  ? 89  PHE A CE1  2  
ATOM 3507  C CE2  . PHE A 1 89  ? 4.894   -0.597  -5.679  1.00 0.77  ? 89  PHE A CE2  2  
ATOM 3508  C CZ   . PHE A 1 89  ? 3.710   0.047   -5.393  1.00 0.91  ? 89  PHE A CZ   2  
ATOM 3509  H H    . PHE A 1 89  ? 2.437   -4.101  -1.951  1.00 0.26  ? 89  PHE A H    2  
ATOM 3510  H HA   . PHE A 1 89  ? 4.096   -4.914  -4.243  1.00 0.27  ? 89  PHE A HA   2  
ATOM 3511  H HB2  . PHE A 1 89  ? 4.939   -3.036  -2.029  1.00 0.44  ? 89  PHE A HB2  2  
ATOM 3512  H HB3  . PHE A 1 89  ? 5.946   -3.585  -3.350  1.00 0.22  ? 89  PHE A HB3  2  
ATOM 3513  H HD1  . PHE A 1 89  ? 2.690   -1.847  -2.805  1.00 0.91  ? 89  PHE A HD1  2  
ATOM 3514  H HD2  . PHE A 1 89  ? 6.215   -2.193  -5.155  1.00 0.60  ? 89  PHE A HD2  2  
ATOM 3515  H HE1  . PHE A 1 89  ? 1.993   0.097   -4.131  1.00 1.18  ? 89  PHE A HE1  2  
ATOM 3516  H HE2  . PHE A 1 89  ? 5.515   -0.247  -6.490  1.00 0.92  ? 89  PHE A HE2  2  
ATOM 3517  H HZ   . PHE A 1 89  ? 3.402   0.900   -5.978  1.00 1.10  ? 89  PHE A HZ   2  
ATOM 3518  N N    . SER A 1 90  ? 5.267   -6.637  -2.944  1.00 0.26  ? 90  SER A N    2  
ATOM 3519  C CA   . SER A 1 90  ? 5.857   -7.756  -2.235  1.00 0.27  ? 90  SER A CA   2  
ATOM 3520  C C    . SER A 1 90  ? 7.296   -7.433  -1.861  1.00 0.27  ? 90  SER A C    2  
ATOM 3521  O O    . SER A 1 90  ? 7.946   -6.680  -2.549  1.00 0.37  ? 90  SER A O    2  
ATOM 3522  C CB   . SER A 1 90  ? 5.819   -8.995  -3.135  1.00 0.32  ? 90  SER A CB   2  
ATOM 3523  O OG   . SER A 1 90  ? 4.486   -9.352  -3.460  1.00 1.30  ? 90  SER A OG   2  
ATOM 3524  H H    . SER A 1 90  ? 5.379   -6.579  -3.919  1.00 0.28  ? 90  SER A H    2  
ATOM 3525  H HA   . SER A 1 90  ? 5.283   -7.939  -1.339  1.00 0.30  ? 90  SER A HA   2  
ATOM 3526  H HB2  . SER A 1 90  ? 6.347   -8.782  -4.050  1.00 0.87  ? 90  SER A HB2  2  
ATOM 3527  H HB3  . SER A 1 90  ? 6.293   -9.823  -2.634  1.00 0.66  ? 90  SER A HB3  2  
ATOM 3528  H HG   . SER A 1 90  ? 3.878   -8.894  -2.858  1.00 1.50  ? 90  SER A HG   2  
ATOM 3529  N N    . PHE A 1 91  ? 7.768   -7.949  -0.747  1.00 0.22  ? 91  PHE A N    2  
ATOM 3530  C CA   . PHE A 1 91  ? 9.194   -7.915  -0.443  1.00 0.24  ? 91  PHE A CA   2  
ATOM 3531  C C    . PHE A 1 91  ? 9.727   -9.321  -0.283  1.00 0.29  ? 91  PHE A C    2  
ATOM 3532  O O    . PHE A 1 91  ? 8.982   -10.301 -0.359  1.00 0.32  ? 91  PHE A O    2  
ATOM 3533  C CB   . PHE A 1 91  ? 9.496   -7.125  0.828   1.00 0.22  ? 91  PHE A CB   2  
ATOM 3534  C CG   . PHE A 1 91  ? 9.142   -5.680  0.737   1.00 0.20  ? 91  PHE A CG   2  
ATOM 3535  C CD1  . PHE A 1 91  ? 9.974   -4.773  0.113   1.00 0.25  ? 91  PHE A CD1  2  
ATOM 3536  C CD2  . PHE A 1 91  ? 7.967   -5.239  1.271   1.00 0.22  ? 91  PHE A CD2  2  
ATOM 3537  C CE1  . PHE A 1 91  ? 9.628   -3.440  0.034   1.00 0.31  ? 91  PHE A CE1  2  
ATOM 3538  C CE2  . PHE A 1 91  ? 7.609   -3.916  1.196   1.00 0.28  ? 91  PHE A CE2  2  
ATOM 3539  C CZ   . PHE A 1 91  ? 8.439   -3.013  0.577   1.00 0.32  ? 91  PHE A CZ   2  
ATOM 3540  H H    . PHE A 1 91  ? 7.150   -8.332  -0.098  1.00 0.22  ? 91  PHE A H    2  
ATOM 3541  H HA   . PHE A 1 91  ? 9.697   -7.447  -1.276  1.00 0.26  ? 91  PHE A HA   2  
ATOM 3542  H HB2  . PHE A 1 91  ? 8.939   -7.550  1.648   1.00 0.25  ? 91  PHE A HB2  2  
ATOM 3543  H HB3  . PHE A 1 91  ? 10.553  -7.196  1.043   1.00 0.28  ? 91  PHE A HB3  2  
ATOM 3544  H HD1  . PHE A 1 91  ? 10.906  -5.114  -0.313  1.00 0.31  ? 91  PHE A HD1  2  
ATOM 3545  H HD2  . PHE A 1 91  ? 7.329   -5.945  1.763   1.00 0.25  ? 91  PHE A HD2  2  
ATOM 3546  H HE1  . PHE A 1 91  ? 10.287  -2.735  -0.451  1.00 0.38  ? 91  PHE A HE1  2  
ATOM 3547  H HE2  . PHE A 1 91  ? 6.685   -3.590  1.616   1.00 0.35  ? 91  PHE A HE2  2  
ATOM 3548  H HZ   . PHE A 1 91  ? 8.156   -1.974  0.517   1.00 0.40  ? 91  PHE A HZ   2  
ATOM 3549  N N    . ASN A 1 92  ? 11.020  -9.405  -0.061  1.00 0.35  ? 92  ASN A N    2  
ATOM 3550  C CA   . ASN A 1 92  ? 11.678  -10.681 0.149   1.00 0.43  ? 92  ASN A CA   2  
ATOM 3551  C C    . ASN A 1 92  ? 12.496  -10.653 1.437   1.00 0.38  ? 92  ASN A C    2  
ATOM 3552  O O    . ASN A 1 92  ? 13.481  -11.380 1.577   1.00 0.46  ? 92  ASN A O    2  
ATOM 3553  C CB   . ASN A 1 92  ? 12.564  -11.038 -1.052  1.00 0.62  ? 92  ASN A CB   2  
ATOM 3554  C CG   . ASN A 1 92  ? 13.561  -9.948  -1.399  1.00 0.70  ? 92  ASN A CG   2  
ATOM 3555  O OD1  . ASN A 1 92  ? 13.260  -9.041  -2.174  1.00 1.17  ? 92  ASN A OD1  2  
ATOM 3556  N ND2  . ASN A 1 92  ? 14.757  -10.034 -0.840  1.00 1.11  ? 92  ASN A ND2  2  
ATOM 3557  H H    . ASN A 1 92  ? 11.552  -8.579  -0.042  1.00 0.36  ? 92  ASN A H    2  
ATOM 3558  H HA   . ASN A 1 92  ? 10.908  -11.430 0.247   1.00 0.47  ? 92  ASN A HA   2  
ATOM 3559  H HB2  . ASN A 1 92  ? 13.115  -11.940 -0.829  1.00 0.67  ? 92  ASN A HB2  2  
ATOM 3560  H HB3  . ASN A 1 92  ? 11.935  -11.212 -1.913  1.00 0.71  ? 92  ASN A HB3  2  
ATOM 3561  H HD21 . ASN A 1 92  ? 14.938  -10.789 -0.238  1.00 1.58  ? 92  ASN A HD21 2  
ATOM 3562  H HD22 . ASN A 1 92  ? 15.414  -9.338  -1.048  1.00 1.21  ? 92  ASN A HD22 2  
ATOM 3563  N N    . ASN A 1 93  ? 12.079  -9.809  2.380   1.00 0.32  ? 93  ASN A N    2  
ATOM 3564  C CA   . ASN A 1 93  ? 12.757  -9.697  3.663   1.00 0.34  ? 93  ASN A CA   2  
ATOM 3565  C C    . ASN A 1 93  ? 11.802  -9.119  4.704   1.00 0.32  ? 93  ASN A C    2  
ATOM 3566  O O    . ASN A 1 93  ? 11.084  -8.151  4.434   1.00 0.29  ? 93  ASN A O    2  
ATOM 3567  C CB   . ASN A 1 93  ? 13.999  -8.814  3.522   1.00 0.38  ? 93  ASN A CB   2  
ATOM 3568  C CG   . ASN A 1 93  ? 14.775  -8.674  4.816   1.00 0.87  ? 93  ASN A CG   2  
ATOM 3569  O OD1  . ASN A 1 93  ? 14.514  -7.774  5.615   1.00 1.62  ? 93  ASN A OD1  2  
ATOM 3570  N ND2  . ASN A 1 93  ? 15.743  -9.549  5.027   1.00 0.98  ? 93  ASN A ND2  2  
ATOM 3571  H H    . ASN A 1 93  ? 11.295  -9.241  2.209   1.00 0.33  ? 93  ASN A H    2  
ATOM 3572  H HA   . ASN A 1 93  ? 13.054  -10.689 3.969   1.00 0.40  ? 93  ASN A HA   2  
ATOM 3573  H HB2  . ASN A 1 93  ? 14.653  -9.242  2.780   1.00 0.79  ? 93  ASN A HB2  2  
ATOM 3574  H HB3  . ASN A 1 93  ? 13.694  -7.829  3.198   1.00 0.72  ? 93  ASN A HB3  2  
ATOM 3575  H HD21 . ASN A 1 93  ? 15.910  -10.234 4.343   1.00 1.05  ? 93  ASN A HD21 2  
ATOM 3576  H HD22 . ASN A 1 93  ? 16.261  -9.480  5.859   1.00 1.41  ? 93  ASN A HD22 2  
ATOM 3577  N N    . ARG A 1 94  ? 11.793  -9.725  5.890   1.00 0.42  ? 94  ARG A N    2  
ATOM 3578  C CA   . ARG A 1 94  ? 10.835  -9.372  6.937   1.00 0.45  ? 94  ARG A CA   2  
ATOM 3579  C C    . ARG A 1 94  ? 11.153  -8.017  7.563   1.00 0.35  ? 94  ARG A C    2  
ATOM 3580  O O    . ARG A 1 94  ? 10.246  -7.273  7.935   1.00 0.36  ? 94  ARG A O    2  
ATOM 3581  C CB   . ARG A 1 94  ? 10.798  -10.447 8.022   1.00 0.64  ? 94  ARG A CB   2  
ATOM 3582  C CG   . ARG A 1 94  ? 10.371  -11.805 7.527   1.00 1.15  ? 94  ARG A CG   2  
ATOM 3583  C CD   . ARG A 1 94  ? 8.972   -11.752 6.952   1.00 1.32  ? 94  ARG A CD   2  
ATOM 3584  N NE   . ARG A 1 94  ? 8.048   -10.983 7.790   1.00 2.12  ? 94  ARG A NE   2  
ATOM 3585  C CZ   . ARG A 1 94  ? 6.723   -11.007 7.652   1.00 2.84  ? 94  ARG A CZ   2  
ATOM 3586  N NH1  . ARG A 1 94  ? 6.159   -11.790 6.744   1.00 3.14  ? 94  ARG A NH1  2  
ATOM 3587  N NH2  . ARG A 1 94  ? 5.966   -10.239 8.424   1.00 3.68  ? 94  ARG A NH2  2  
ATOM 3588  H H    . ARG A 1 94  ? 12.455  -10.430 6.072   1.00 0.50  ? 94  ARG A H    2  
ATOM 3589  H HA   . ARG A 1 94  ? 9.861   -9.316  6.476   1.00 0.49  ? 94  ARG A HA   2  
ATOM 3590  H HB2  . ARG A 1 94  ? 11.774  -10.537 8.468   1.00 0.98  ? 94  ARG A HB2  2  
ATOM 3591  H HB3  . ARG A 1 94  ? 10.090  -10.148 8.775   1.00 0.78  ? 94  ARG A HB3  2  
ATOM 3592  H HG2  . ARG A 1 94  ? 11.056  -12.133 6.758   1.00 1.71  ? 94  ARG A HG2  2  
ATOM 3593  H HG3  . ARG A 1 94  ? 10.387  -12.502 8.349   1.00 1.82  ? 94  ARG A HG3  2  
ATOM 3594  H HD2  . ARG A 1 94  ? 9.014   -11.303 5.973   1.00 1.72  ? 94  ARG A HD2  2  
ATOM 3595  H HD3  . ARG A 1 94  ? 8.607   -12.752 6.871   1.00 1.56  ? 94  ARG A HD3  2  
ATOM 3596  H HE   . ARG A 1 94  ? 8.440   -10.403 8.481   1.00 2.50  ? 94  ARG A HE   2  
ATOM 3597  H HH11 . ARG A 1 94  ? 6.729   -12.370 6.150   1.00 2.91  ? 94  ARG A HH11 2  
ATOM 3598  H HH12 . ARG A 1 94  ? 5.161   -11.808 6.642   1.00 3.89  ? 94  ARG A HH12 2  
ATOM 3599  H HH21 . ARG A 1 94  ? 6.391   -9.638  9.107   1.00 3.93  ? 94  ARG A HH21 2  
ATOM 3600  H HH22 . ARG A 1 94  ? 4.968   -10.250 8.324   1.00 4.27  ? 94  ARG A HH22 2  
ATOM 3601  N N    . THR A 1 95  ? 12.434  -7.706  7.684   1.00 0.34  ? 95  THR A N    2  
ATOM 3602  C CA   . THR A 1 95  ? 12.857  -6.418  8.213   1.00 0.31  ? 95  THR A CA   2  
ATOM 3603  C C    . THR A 1 95  ? 12.476  -5.294  7.249   1.00 0.26  ? 95  THR A C    2  
ATOM 3604  O O    . THR A 1 95  ? 11.898  -4.281  7.651   1.00 0.27  ? 95  THR A O    2  
ATOM 3605  C CB   . THR A 1 95  ? 14.373  -6.397  8.455   1.00 0.40  ? 95  THR A CB   2  
ATOM 3606  O OG1  . THR A 1 95  ? 14.726  -7.333  9.485   1.00 0.50  ? 95  THR A OG1  2  
ATOM 3607  C CG2  . THR A 1 95  ? 14.850  -5.001  8.824   1.00 0.44  ? 95  THR A CG2  2  
ATOM 3608  H H    . THR A 1 95  ? 13.115  -8.357  7.413   1.00 0.40  ? 95  THR A H    2  
ATOM 3609  H HA   . THR A 1 95  ? 12.361  -6.260  9.153   1.00 0.33  ? 95  THR A HA   2  
ATOM 3610  H HB   . THR A 1 95  ? 14.856  -6.691  7.542   1.00 0.42  ? 95  THR A HB   2  
ATOM 3611  H HG1  . THR A 1 95  ? 15.541  -7.036  9.918   1.00 0.94  ? 95  THR A HG1  2  
ATOM 3612  H HG21 . THR A 1 95  ? 15.918  -5.013  8.981   1.00 1.02  ? 95  THR A HG21 2  
ATOM 3613  H HG22 . THR A 1 95  ? 14.354  -4.678  9.728   1.00 1.07  ? 95  THR A HG22 2  
ATOM 3614  H HG23 . THR A 1 95  ? 14.611  -4.322  8.018   1.00 1.10  ? 95  THR A HG23 2  
ATOM 3615  N N    . VAL A 1 96  ? 12.811  -5.498  5.978   1.00 0.24  ? 96  VAL A N    2  
ATOM 3616  C CA   . VAL A 1 96  ? 12.467  -4.561  4.913   1.00 0.22  ? 96  VAL A CA   2  
ATOM 3617  C C    . VAL A 1 96  ? 11.017  -4.124  4.989   1.00 0.21  ? 96  VAL A C    2  
ATOM 3618  O O    . VAL A 1 96  ? 10.738  -2.928  5.082   1.00 0.22  ? 96  VAL A O    2  
ATOM 3619  C CB   . VAL A 1 96  ? 12.717  -5.171  3.517   1.00 0.22  ? 96  VAL A CB   2  
ATOM 3620  C CG1  . VAL A 1 96  ? 12.019  -4.366  2.433   1.00 0.22  ? 96  VAL A CG1  2  
ATOM 3621  C CG2  . VAL A 1 96  ? 14.200  -5.248  3.223   1.00 0.27  ? 96  VAL A CG2  2  
ATOM 3622  H H    . VAL A 1 96  ? 13.328  -6.300  5.755   1.00 0.26  ? 96  VAL A H    2  
ATOM 3623  H HA   . VAL A 1 96  ? 13.099  -3.689  5.018   1.00 0.25  ? 96  VAL A HA   2  
ATOM 3624  H HB   . VAL A 1 96  ? 12.316  -6.173  3.506   1.00 0.23  ? 96  VAL A HB   2  
ATOM 3625  H HG11 . VAL A 1 96  ? 12.222  -3.317  2.577   1.00 1.01  ? 96  VAL A HG11 2  
ATOM 3626  H HG12 . VAL A 1 96  ? 10.939  -4.540  2.475   1.00 1.03  ? 96  VAL A HG12 2  
ATOM 3627  H HG13 . VAL A 1 96  ? 12.394  -4.675  1.469   1.00 1.03  ? 96  VAL A HG13 2  
ATOM 3628  H HG21 . VAL A 1 96  ? 14.672  -5.924  3.920   1.00 1.03  ? 96  VAL A HG21 2  
ATOM 3629  H HG22 . VAL A 1 96  ? 14.635  -4.265  3.319   1.00 1.07  ? 96  VAL A HG22 2  
ATOM 3630  H HG23 . VAL A 1 96  ? 14.342  -5.607  2.214   1.00 1.05  ? 96  VAL A HG23 2  
ATOM 3631  N N    . MET A 1 97  ? 10.096  -5.085  4.944   1.00 0.26  ? 97  MET A N    2  
ATOM 3632  C CA   . MET A 1 97  ? 8.685   -4.749  4.936   1.00 0.39  ? 97  MET A CA   2  
ATOM 3633  C C    . MET A 1 97  ? 8.323   -3.873  6.122   1.00 0.34  ? 97  MET A C    2  
ATOM 3634  O O    . MET A 1 97  ? 7.740   -2.821  5.949   1.00 0.34  ? 97  MET A O    2  
ATOM 3635  C CB   . MET A 1 97  ? 7.800   -5.978  4.898   1.00 0.62  ? 97  MET A CB   2  
ATOM 3636  C CG   . MET A 1 97  ? 7.815   -6.813  6.143   1.00 0.62  ? 97  MET A CG   2  
ATOM 3637  S SD   . MET A 1 97  ? 6.350   -7.852  6.275   1.00 0.84  ? 97  MET A SD   2  
ATOM 3638  C CE   . MET A 1 97  ? 5.056   -6.614  6.146   1.00 0.37  ? 97  MET A CE   2  
ATOM 3639  H H    . MET A 1 97  ? 10.376  -6.030  4.901   1.00 0.24  ? 97  MET A H    2  
ATOM 3640  H HA   . MET A 1 97  ? 8.499   -4.193  4.048   1.00 0.47  ? 97  MET A HA   2  
ATOM 3641  H HB2  . MET A 1 97  ? 6.793   -5.659  4.732   1.00 1.36  ? 97  MET A HB2  2  
ATOM 3642  H HB3  . MET A 1 97  ? 8.114   -6.596  4.080   1.00 1.35  ? 97  MET A HB3  2  
ATOM 3643  H HG2  . MET A 1 97  ? 8.692   -7.429  6.115   1.00 1.26  ? 97  MET A HG2  2  
ATOM 3644  H HG3  . MET A 1 97  ? 7.860   -6.159  6.997   1.00 1.33  ? 97  MET A HG3  2  
ATOM 3645  H HE1  . MET A 1 97  ? 5.099   -6.141  5.174   1.00 1.03  ? 97  MET A HE1  2  
ATOM 3646  H HE2  . MET A 1 97  ? 5.198   -5.864  6.910   1.00 0.97  ? 97  MET A HE2  2  
ATOM 3647  H HE3  . MET A 1 97  ? 4.093   -7.082  6.278   1.00 1.05  ? 97  MET A HE3  2  
ATOM 3648  N N    . ASP A 1 98  ? 8.705   -4.310  7.307   1.00 0.36  ? 98  ASP A N    2  
ATOM 3649  C CA   . ASP A 1 98  ? 8.428   -3.577  8.553   1.00 0.36  ? 98  ASP A CA   2  
ATOM 3650  C C    . ASP A 1 98  ? 8.975   -2.149  8.506   1.00 0.28  ? 98  ASP A C    2  
ATOM 3651  O O    . ASP A 1 98  ? 8.319   -1.208  8.959   1.00 0.29  ? 98  ASP A O    2  
ATOM 3652  C CB   . ASP A 1 98  ? 9.028   -4.322  9.745   1.00 0.45  ? 98  ASP A CB   2  
ATOM 3653  C CG   . ASP A 1 98  ? 8.681   -3.666  11.067  1.00 0.55  ? 98  ASP A CG   2  
ATOM 3654  O OD1  . ASP A 1 98  ? 7.504   -3.721  11.472  1.00 0.67  ? 98  ASP A OD1  2  
ATOM 3655  O OD2  . ASP A 1 98  ? 9.585   -3.075  11.694  1.00 0.61  ? 98  ASP A OD2  2  
ATOM 3656  H H    . ASP A 1 98  ? 9.170   -5.172  7.348   1.00 0.41  ? 98  ASP A H    2  
ATOM 3657  H HA   . ASP A 1 98  ? 7.350   -3.523  8.678   1.00 0.39  ? 98  ASP A HA   2  
ATOM 3658  H HB2  . ASP A 1 98  ? 8.657   -5.336  9.757   1.00 0.51  ? 98  ASP A HB2  2  
ATOM 3659  H HB3  . ASP A 1 98  ? 10.104  -4.339  9.646   1.00 0.44  ? 98  ASP A HB3  2  
ATOM 3660  N N    . ASN A 1 99  ? 10.172  -1.991  7.959   1.00 0.22  ? 99  ASN A N    2  
ATOM 3661  C CA   . ASN A 1 99  ? 10.764  -0.672  7.771   1.00 0.21  ? 99  ASN A CA   2  
ATOM 3662  C C    . ASN A 1 99  ? 9.893   0.179   6.855   1.00 0.15  ? 99  ASN A C    2  
ATOM 3663  O O    . ASN A 1 99  ? 9.557   1.318   7.178   1.00 0.18  ? 99  ASN A O    2  
ATOM 3664  C CB   . ASN A 1 99  ? 12.171  -0.813  7.186   1.00 0.26  ? 99  ASN A CB   2  
ATOM 3665  C CG   . ASN A 1 99  ? 13.261  -0.773  8.239   1.00 0.77  ? 99  ASN A CG   2  
ATOM 3666  O OD1  . ASN A 1 99  ? 14.370  -0.297  7.980   1.00 1.55  ? 99  ASN A OD1  2  
ATOM 3667  N ND2  . ASN A 1 99  ? 12.969  -1.285  9.423   1.00 1.17  ? 99  ASN A ND2  2  
ATOM 3668  H H    . ASN A 1 99  ? 10.673  -2.785  7.667   1.00 0.21  ? 99  ASN A H    2  
ATOM 3669  H HA   . ASN A 1 99  ? 10.825  -0.188  8.739   1.00 0.28  ? 99  ASN A HA   2  
ATOM 3670  H HB2  . ASN A 1 99  ? 12.239  -1.759  6.670   1.00 0.64  ? 99  ASN A HB2  2  
ATOM 3671  H HB3  . ASN A 1 99  ? 12.341  -0.019  6.481   1.00 0.50  ? 99  ASN A HB3  2  
ATOM 3672  H HD21 . ASN A 1 99  ? 12.076  -1.667  9.557   1.00 1.55  ? 99  ASN A HD21 2  
ATOM 3673  H HD22 . ASN A 1 99  ? 13.654  -1.255  10.125  1.00 1.51  ? 99  ASN A HD22 2  
ATOM 3674  N N    . ILE A 1 100 ? 9.529   -0.391  5.713   1.00 0.12  ? 100 ILE A N    2  
ATOM 3675  C CA   . ILE A 1 100 ? 8.609   0.247   4.778   1.00 0.14  ? 100 ILE A CA   2  
ATOM 3676  C C    . ILE A 1 100 ? 7.260   0.509   5.459   1.00 0.16  ? 100 ILE A C    2  
ATOM 3677  O O    . ILE A 1 100 ? 6.697   1.587   5.318   1.00 0.20  ? 100 ILE A O    2  
ATOM 3678  C CB   . ILE A 1 100 ? 8.425   -0.630  3.522   1.00 0.18  ? 100 ILE A CB   2  
ATOM 3679  C CG1  . ILE A 1 100 ? 9.787   -0.932  2.865   1.00 0.18  ? 100 ILE A CG1  2  
ATOM 3680  C CG2  . ILE A 1 100 ? 7.487   0.039   2.535   1.00 0.22  ? 100 ILE A CG2  2  
ATOM 3681  C CD1  . ILE A 1 100 ? 10.575  0.295   2.434   1.00 0.18  ? 100 ILE A CD1  2  
ATOM 3682  H H    . ILE A 1 100 ? 9.888   -1.282  5.492   1.00 0.14  ? 100 ILE A H    2  
ATOM 3683  H HA   . ILE A 1 100 ? 9.026   1.199   4.463   1.00 0.16  ? 100 ILE A HA   2  
ATOM 3684  H HB   . ILE A 1 100 ? 7.971   -1.561  3.831   1.00 0.20  ? 100 ILE A HB   2  
ATOM 3685  H HG12 . ILE A 1 100 ? 10.397  -1.481  3.566   1.00 0.19  ? 100 ILE A HG12 2  
ATOM 3686  H HG13 . ILE A 1 100 ? 9.623   -1.544  1.990   1.00 0.21  ? 100 ILE A HG13 2  
ATOM 3687  H HG21 . ILE A 1 100 ? 6.509   0.135   2.981   1.00 1.03  ? 100 ILE A HG21 2  
ATOM 3688  H HG22 . ILE A 1 100 ? 7.417   -0.558  1.640   1.00 1.05  ? 100 ILE A HG22 2  
ATOM 3689  H HG23 . ILE A 1 100 ? 7.867   1.022   2.288   1.00 1.01  ? 100 ILE A HG23 2  
ATOM 3690  H HD11 . ILE A 1 100 ? 10.822  0.889   3.301   1.00 1.02  ? 100 ILE A HD11 2  
ATOM 3691  H HD12 . ILE A 1 100 ? 9.981   0.884   1.752   1.00 1.07  ? 100 ILE A HD12 2  
ATOM 3692  H HD13 . ILE A 1 100 ? 11.490  -0.014  1.937   1.00 1.01  ? 100 ILE A HD13 2  
ATOM 3693  N N    . LYS A 1 101 ? 6.772   -0.468  6.226   1.00 0.17  ? 101 LYS A N    2  
ATOM 3694  C CA   . LYS A 1 101 ? 5.540   -0.308  6.998   1.00 0.22  ? 101 LYS A CA   2  
ATOM 3695  C C    . LYS A 1 101 ? 5.580   0.991   7.783   1.00 0.21  ? 101 LYS A C    2  
ATOM 3696  O O    . LYS A 1 101 ? 4.792   1.904   7.551   1.00 0.25  ? 101 LYS A O    2  
ATOM 3697  C CB   . LYS A 1 101 ? 5.352   -1.449  8.002   1.00 0.28  ? 101 LYS A CB   2  
ATOM 3698  C CG   . LYS A 1 101 ? 5.223   -2.823  7.404   1.00 0.49  ? 101 LYS A CG   2  
ATOM 3699  C CD   . LYS A 1 101 ? 4.900   -3.863  8.460   1.00 0.65  ? 101 LYS A CD   2  
ATOM 3700  C CE   . LYS A 1 101 ? 4.786   -3.265  9.841   1.00 0.63  ? 101 LYS A CE   2  
ATOM 3701  N NZ   . LYS A 1 101 ? 4.407   -4.267  10.870  1.00 0.92  ? 101 LYS A NZ   2  
ATOM 3702  H H    . LYS A 1 101 ? 7.253   -1.325  6.269   1.00 0.19  ? 101 LYS A H    2  
ATOM 3703  H HA   . LYS A 1 101 ? 4.708   -0.300  6.314   1.00 0.26  ? 101 LYS A HA   2  
ATOM 3704  H HB2  . LYS A 1 101 ? 6.195   -1.463  8.670   1.00 0.54  ? 101 LYS A HB2  2  
ATOM 3705  H HB3  . LYS A 1 101 ? 4.467   -1.263  8.574   1.00 0.49  ? 101 LYS A HB3  2  
ATOM 3706  H HG2  . LYS A 1 101 ? 4.438   -2.818  6.667   1.00 0.71  ? 101 LYS A HG2  2  
ATOM 3707  H HG3  . LYS A 1 101 ? 6.151   -3.082  6.943   1.00 0.73  ? 101 LYS A HG3  2  
ATOM 3708  H HD2  . LYS A 1 101 ? 3.962   -4.304  8.213   1.00 1.34  ? 101 LYS A HD2  2  
ATOM 3709  H HD3  . LYS A 1 101 ? 5.671   -4.610  8.458   1.00 1.33  ? 101 LYS A HD3  2  
ATOM 3710  H HE2  . LYS A 1 101 ? 5.731   -2.821  10.111  1.00 1.36  ? 101 LYS A HE2  2  
ATOM 3711  H HE3  . LYS A 1 101 ? 4.031   -2.507  9.795   1.00 1.37  ? 101 LYS A HE3  2  
ATOM 3712  H HZ1  . LYS A 1 101 ? 3.455   -4.639  10.673  1.00 1.30  ? 101 LYS A HZ1  2  
ATOM 3713  H HZ2  . LYS A 1 101 ? 4.407   -3.829  11.813  1.00 1.45  ? 101 LYS A HZ2  2  
ATOM 3714  H HZ3  . LYS A 1 101 ? 5.082   -5.055  10.869  1.00 1.55  ? 101 LYS A HZ3  2  
ATOM 3715  N N    . MET A 1 102 ? 6.541   1.055   8.693   1.00 0.20  ? 102 MET A N    2  
ATOM 3716  C CA   . MET A 1 102 ? 6.695   2.174   9.605   1.00 0.23  ? 102 MET A CA   2  
ATOM 3717  C C    . MET A 1 102 ? 6.896   3.490   8.867   1.00 0.20  ? 102 MET A C    2  
ATOM 3718  O O    . MET A 1 102 ? 6.295   4.504   9.225   1.00 0.26  ? 102 MET A O    2  
ATOM 3719  C CB   . MET A 1 102 ? 7.881   1.909   10.521  1.00 0.25  ? 102 MET A CB   2  
ATOM 3720  C CG   . MET A 1 102 ? 7.508   1.776   11.984  1.00 0.79  ? 102 MET A CG   2  
ATOM 3721  S SD   . MET A 1 102 ? 8.954   1.632   13.051  1.00 0.83  ? 102 MET A SD   2  
ATOM 3722  C CE   . MET A 1 102 ? 9.781   0.226   12.305  1.00 1.41  ? 102 MET A CE   2  
ATOM 3723  H H    . MET A 1 102 ? 7.177   0.308   8.758   1.00 0.19  ? 102 MET A H    2  
ATOM 3724  H HA   . MET A 1 102 ? 5.799   2.242   10.199  1.00 0.28  ? 102 MET A HA   2  
ATOM 3725  H HB2  . MET A 1 102 ? 8.348   0.987   10.212  1.00 0.59  ? 102 MET A HB2  2  
ATOM 3726  H HB3  . MET A 1 102 ? 8.593   2.710   10.419  1.00 0.57  ? 102 MET A HB3  2  
ATOM 3727  H HG2  . MET A 1 102 ? 6.944   2.646   12.277  1.00 1.14  ? 102 MET A HG2  2  
ATOM 3728  H HG3  . MET A 1 102 ? 6.897   0.893   12.107  1.00 1.13  ? 102 MET A HG3  2  
ATOM 3729  H HE1  . MET A 1 102 ? 9.128   -0.633  12.335  1.00 1.87  ? 102 MET A HE1  2  
ATOM 3730  H HE2  . MET A 1 102 ? 10.688  0.010   12.851  1.00 1.92  ? 102 MET A HE2  2  
ATOM 3731  H HE3  . MET A 1 102 ? 10.026  0.457   11.279  1.00 1.78  ? 102 MET A HE3  2  
ATOM 3732  N N    . THR A 1 103 ? 7.746   3.469   7.843   1.00 0.15  ? 103 THR A N    2  
ATOM 3733  C CA   . THR A 1 103 ? 8.019   4.656   7.049   1.00 0.16  ? 103 THR A CA   2  
ATOM 3734  C C    . THR A 1 103 ? 6.727   5.255   6.506   1.00 0.18  ? 103 THR A C    2  
ATOM 3735  O O    . THR A 1 103 ? 6.394   6.409   6.777   1.00 0.24  ? 103 THR A O    2  
ATOM 3736  C CB   . THR A 1 103 ? 8.948   4.335   5.862   1.00 0.18  ? 103 THR A CB   2  
ATOM 3737  O OG1  . THR A 1 103 ? 10.168  3.738   6.322   1.00 0.23  ? 103 THR A OG1  2  
ATOM 3738  C CG2  . THR A 1 103 ? 9.264   5.596   5.083   1.00 0.27  ? 103 THR A CG2  2  
ATOM 3739  H H    . THR A 1 103 ? 8.202   2.629   7.618   1.00 0.14  ? 103 THR A H    2  
ATOM 3740  H HA   . THR A 1 103 ? 8.507   5.381   7.680   1.00 0.19  ? 103 THR A HA   2  
ATOM 3741  H HB   . THR A 1 103 ? 8.442   3.641   5.201   1.00 0.19  ? 103 THR A HB   2  
ATOM 3742  H HG1  . THR A 1 103 ? 9.960   2.997   6.911   1.00 0.47  ? 103 THR A HG1  2  
ATOM 3743  H HG21 . THR A 1 103 ? 9.855   5.344   4.221   1.00 1.04  ? 103 THR A HG21 2  
ATOM 3744  H HG22 . THR A 1 103 ? 9.816   6.275   5.713   1.00 1.00  ? 103 THR A HG22 2  
ATOM 3745  H HG23 . THR A 1 103 ? 8.343   6.062   4.768   1.00 1.07  ? 103 THR A HG23 2  
ATOM 3746  N N    . LEU A 1 104 ? 5.998   4.441   5.760   1.00 0.16  ? 104 LEU A N    2  
ATOM 3747  C CA   . LEU A 1 104 ? 4.799   4.885   5.067   1.00 0.20  ? 104 LEU A CA   2  
ATOM 3748  C C    . LEU A 1 104 ? 3.732   5.256   6.081   1.00 0.22  ? 104 LEU A C    2  
ATOM 3749  O O    . LEU A 1 104 ? 3.169   6.344   6.032   1.00 0.26  ? 104 LEU A O    2  
ATOM 3750  C CB   . LEU A 1 104 ? 4.271   3.771   4.145   1.00 0.23  ? 104 LEU A CB   2  
ATOM 3751  C CG   . LEU A 1 104 ? 5.095   3.461   2.879   1.00 0.25  ? 104 LEU A CG   2  
ATOM 3752  C CD1  . LEU A 1 104 ? 6.577   3.470   3.167   1.00 0.99  ? 104 LEU A CD1  2  
ATOM 3753  C CD2  . LEU A 1 104 ? 4.702   2.103   2.332   1.00 1.03  ? 104 LEU A CD2  2  
ATOM 3754  H H    . LEU A 1 104 ? 6.270   3.498   5.680   1.00 0.16  ? 104 LEU A H    2  
ATOM 3755  H HA   . LEU A 1 104 ? 5.053   5.755   4.473   1.00 0.23  ? 104 LEU A HA   2  
ATOM 3756  H HB2  . LEU A 1 104 ? 4.211   2.864   4.729   1.00 0.22  ? 104 LEU A HB2  2  
ATOM 3757  H HB3  . LEU A 1 104 ? 3.269   4.040   3.839   1.00 0.26  ? 104 LEU A HB3  2  
ATOM 3758  H HG   . LEU A 1 104 ? 4.904   4.200   2.116   1.00 0.76  ? 104 LEU A HG   2  
ATOM 3759  H HD11 . LEU A 1 104 ? 6.794   2.765   3.955   1.00 1.58  ? 104 LEU A HD11 2  
ATOM 3760  H HD12 . LEU A 1 104 ? 6.878   4.460   3.478   1.00 1.46  ? 104 LEU A HD12 2  
ATOM 3761  H HD13 . LEU A 1 104 ? 7.116   3.192   2.280   1.00 1.67  ? 104 LEU A HD13 2  
ATOM 3762  H HD21 . LEU A 1 104 ? 3.640   2.081   2.139   1.00 1.69  ? 104 LEU A HD21 2  
ATOM 3763  H HD22 . LEU A 1 104 ? 4.956   1.343   3.058   1.00 1.54  ? 104 LEU A HD22 2  
ATOM 3764  H HD23 . LEU A 1 104 ? 5.242   1.916   1.415   1.00 1.59  ? 104 LEU A HD23 2  
ATOM 3765  N N    . GLN A 1 105 ? 3.500   4.333   7.012   1.00 0.22  ? 105 GLN A N    2  
ATOM 3766  C CA   . GLN A 1 105 ? 2.496   4.464   8.057   1.00 0.27  ? 105 GLN A CA   2  
ATOM 3767  C C    . GLN A 1 105 ? 2.488   5.858   8.673   1.00 0.25  ? 105 GLN A C    2  
ATOM 3768  O O    . GLN A 1 105 ? 1.440   6.497   8.755   1.00 0.27  ? 105 GLN A O    2  
ATOM 3769  C CB   . GLN A 1 105 ? 2.789   3.407   9.125   1.00 0.33  ? 105 GLN A CB   2  
ATOM 3770  C CG   . GLN A 1 105 ? 1.588   2.953   9.903   1.00 0.55  ? 105 GLN A CG   2  
ATOM 3771  C CD   . GLN A 1 105 ? 1.403   3.698   11.209  1.00 1.00  ? 105 GLN A CD   2  
ATOM 3772  O OE1  . GLN A 1 105 ? 1.945   3.302   12.242  1.00 1.72  ? 105 GLN A OE1  2  
ATOM 3773  N NE2  . GLN A 1 105 ? 0.620   4.758   11.183  1.00 1.60  ? 105 GLN A NE2  2  
ATOM 3774  H H    . GLN A 1 105 ? 4.030   3.506   6.992   1.00 0.21  ? 105 GLN A H    2  
ATOM 3775  H HA   . GLN A 1 105 ? 1.526   4.269   7.623   1.00 0.34  ? 105 GLN A HA   2  
ATOM 3776  H HB2  . GLN A 1 105 ? 3.234   2.544   8.656   1.00 0.29  ? 105 GLN A HB2  2  
ATOM 3777  H HB3  . GLN A 1 105 ? 3.487   3.810   9.819   1.00 0.36  ? 105 GLN A HB3  2  
ATOM 3778  H HG2  . GLN A 1 105 ? 0.723   3.107   9.293   1.00 0.67  ? 105 GLN A HG2  2  
ATOM 3779  H HG3  . GLN A 1 105 ? 1.703   1.908   10.112  1.00 0.76  ? 105 GLN A HG3  2  
ATOM 3780  H HE21 . GLN A 1 105 ? 0.197   5.004   10.333  1.00 2.10  ? 105 GLN A HE21 2  
ATOM 3781  H HE22 . GLN A 1 105 ? 0.494   5.262   12.017  1.00 1.93  ? 105 GLN A HE22 2  
ATOM 3782  N N    . GLN A 1 106 ? 3.654   6.337   9.080   1.00 0.23  ? 106 GLN A N    2  
ATOM 3783  C CA   . GLN A 1 106 ? 3.758   7.631   9.723   1.00 0.25  ? 106 GLN A CA   2  
ATOM 3784  C C    . GLN A 1 106 ? 3.528   8.771   8.739   1.00 0.22  ? 106 GLN A C    2  
ATOM 3785  O O    . GLN A 1 106 ? 2.697   9.633   9.001   1.00 0.25  ? 106 GLN A O    2  
ATOM 3786  C CB   . GLN A 1 106 ? 5.117   7.765   10.394  1.00 0.31  ? 106 GLN A CB   2  
ATOM 3787  C CG   . GLN A 1 106 ? 5.275   6.869   11.602  1.00 0.37  ? 106 GLN A CG   2  
ATOM 3788  C CD   . GLN A 1 106 ? 6.635   6.995   12.253  1.00 1.40  ? 106 GLN A CD   2  
ATOM 3789  O OE1  . GLN A 1 106 ? 7.568   6.269   11.912  1.00 2.15  ? 106 GLN A OE1  2  
ATOM 3790  N NE2  . GLN A 1 106 ? 6.758   7.916   13.192  1.00 2.21  ? 106 GLN A NE2  2  
ATOM 3791  H H    . GLN A 1 106 ? 4.468   5.806   8.944   1.00 0.23  ? 106 GLN A H    2  
ATOM 3792  H HA   . GLN A 1 106 ? 2.989   7.683   10.481  1.00 0.28  ? 106 GLN A HA   2  
ATOM 3793  H HB2  . GLN A 1 106 ? 5.879   7.506   9.684   1.00 0.34  ? 106 GLN A HB2  2  
ATOM 3794  H HB3  . GLN A 1 106 ? 5.253   8.783   10.704  1.00 0.36  ? 106 GLN A HB3  2  
ATOM 3795  H HG2  . GLN A 1 106 ? 4.525   7.135   12.323  1.00 0.87  ? 106 GLN A HG2  2  
ATOM 3796  H HG3  . GLN A 1 106 ? 5.132   5.843   11.296  1.00 0.89  ? 106 GLN A HG3  2  
ATOM 3797  H HE21 . GLN A 1 106 ? 5.972   8.463   13.413  1.00 2.44  ? 106 GLN A HE21 2  
ATOM 3798  H HE22 . GLN A 1 106 ? 7.629   8.016   13.632  1.00 2.91  ? 106 GLN A HE22 2  
ATOM 3799  N N    . ILE A 1 107 ? 4.243   8.769   7.612   1.00 0.21  ? 107 ILE A N    2  
ATOM 3800  C CA   . ILE A 1 107 ? 4.069   9.813   6.592   1.00 0.23  ? 107 ILE A CA   2  
ATOM 3801  C C    . ILE A 1 107 ? 2.601   9.941   6.222   1.00 0.26  ? 107 ILE A C    2  
ATOM 3802  O O    . ILE A 1 107 ? 2.044   11.038  6.178   1.00 0.31  ? 107 ILE A O    2  
ATOM 3803  C CB   . ILE A 1 107 ? 4.858   9.505   5.302   1.00 0.25  ? 107 ILE A CB   2  
ATOM 3804  C CG1  . ILE A 1 107 ? 6.346   9.304   5.590   1.00 0.22  ? 107 ILE A CG1  2  
ATOM 3805  C CG2  . ILE A 1 107 ? 4.666   10.629  4.298   1.00 0.39  ? 107 ILE A CG2  2  
ATOM 3806  C CD1  . ILE A 1 107 ? 7.136   8.832   4.387   1.00 0.25  ? 107 ILE A CD1  2  
ATOM 3807  H H    . ILE A 1 107 ? 4.895   8.050   7.457   1.00 0.21  ? 107 ILE A H    2  
ATOM 3808  H HA   . ILE A 1 107 ? 4.412   10.753  7.000   1.00 0.25  ? 107 ILE A HA   2  
ATOM 3809  H HB   . ILE A 1 107 ? 4.456   8.599   4.870   1.00 0.27  ? 107 ILE A HB   2  
ATOM 3810  H HG12 . ILE A 1 107 ? 6.774   10.239  5.920   1.00 0.27  ? 107 ILE A HG12 2  
ATOM 3811  H HG13 . ILE A 1 107 ? 6.459   8.569   6.366   1.00 0.20  ? 107 ILE A HG13 2  
ATOM 3812  H HG21 . ILE A 1 107 ? 5.211   10.401  3.400   1.00 1.16  ? 107 ILE A HG21 2  
ATOM 3813  H HG22 . ILE A 1 107 ? 5.033   11.554  4.718   1.00 0.94  ? 107 ILE A HG22 2  
ATOM 3814  H HG23 . ILE A 1 107 ? 3.615   10.731  4.067   1.00 1.11  ? 107 ILE A HG23 2  
ATOM 3815  H HD11 . ILE A 1 107 ? 6.748   7.882   4.049   1.00 1.05  ? 107 ILE A HD11 2  
ATOM 3816  H HD12 . ILE A 1 107 ? 8.175   8.718   4.661   1.00 1.08  ? 107 ILE A HD12 2  
ATOM 3817  H HD13 . ILE A 1 107 ? 7.051   9.558   3.593   1.00 0.99  ? 107 ILE A HD13 2  
ATOM 3818  N N    . ILE A 1 108 ? 1.992   8.801   5.969   1.00 0.26  ? 108 ILE A N    2  
ATOM 3819  C CA   . ILE A 1 108 ? 0.578   8.717   5.669   1.00 0.30  ? 108 ILE A CA   2  
ATOM 3820  C C    . ILE A 1 108 ? -0.235  9.348   6.772   1.00 0.33  ? 108 ILE A C    2  
ATOM 3821  O O    . ILE A 1 108 ? -0.989  10.271  6.527   1.00 0.40  ? 108 ILE A O    2  
ATOM 3822  C CB   . ILE A 1 108 ? 0.155   7.233   5.512   1.00 0.32  ? 108 ILE A CB   2  
ATOM 3823  C CG1  . ILE A 1 108 ? 0.777   6.610   4.258   1.00 0.35  ? 108 ILE A CG1  2  
ATOM 3824  C CG2  . ILE A 1 108 ? -1.354  7.084   5.505   1.00 0.32  ? 108 ILE A CG2  2  
ATOM 3825  C CD1  . ILE A 1 108 ? 0.453   5.144   4.068   1.00 0.39  ? 108 ILE A CD1  2  
ATOM 3826  H H    . ILE A 1 108 ? 2.520   7.968   5.986   1.00 0.24  ? 108 ILE A H    2  
ATOM 3827  H HA   . ILE A 1 108 ? 0.383   9.271   4.741   1.00 0.33  ? 108 ILE A HA   2  
ATOM 3828  H HB   . ILE A 1 108 ? 0.525   6.699   6.375   1.00 0.35  ? 108 ILE A HB   2  
ATOM 3829  H HG12 . ILE A 1 108 ? 0.419   7.139   3.389   1.00 0.35  ? 108 ILE A HG12 2  
ATOM 3830  H HG13 . ILE A 1 108 ? 1.851   6.707   4.314   1.00 0.41  ? 108 ILE A HG13 2  
ATOM 3831  H HG21 . ILE A 1 108 ? -1.605  6.034   5.561   1.00 1.09  ? 108 ILE A HG21 2  
ATOM 3832  H HG22 . ILE A 1 108 ? -1.753  7.504   4.589   1.00 0.95  ? 108 ILE A HG22 2  
ATOM 3833  H HG23 . ILE A 1 108 ? -1.769  7.601   6.364   1.00 1.05  ? 108 ILE A HG23 2  
ATOM 3834  H HD11 . ILE A 1 108 ? 0.836   4.810   3.115   1.00 1.14  ? 108 ILE A HD11 2  
ATOM 3835  H HD12 . ILE A 1 108 ? -0.617  5.003   4.096   1.00 1.06  ? 108 ILE A HD12 2  
ATOM 3836  H HD13 . ILE A 1 108 ? 0.911   4.568   4.858   1.00 1.08  ? 108 ILE A HD13 2  
ATOM 3837  N N    . SER A 1 109 ? -0.058  8.873   7.986   1.00 0.31  ? 109 SER A N    2  
ATOM 3838  C CA   . SER A 1 109 ? -0.805  9.370   9.111   1.00 0.35  ? 109 SER A CA   2  
ATOM 3839  C C    . SER A 1 109 ? -0.558  10.870  9.325   1.00 0.39  ? 109 SER A C    2  
ATOM 3840  O O    . SER A 1 109 ? -1.386  11.568  9.916   1.00 0.46  ? 109 SER A O    2  
ATOM 3841  C CB   . SER A 1 109 ? -0.414  8.556   10.332  1.00 0.36  ? 109 SER A CB   2  
ATOM 3842  O OG   . SER A 1 109 ? -0.670  7.179   10.118  1.00 1.32  ? 109 SER A OG   2  
ATOM 3843  H H    . SER A 1 109 ? 0.596   8.161   8.139   1.00 0.28  ? 109 SER A H    2  
ATOM 3844  H HA   . SER A 1 109 ? -1.860  9.213   8.906   1.00 0.41  ? 109 SER A HA   2  
ATOM 3845  H HB2  . SER A 1 109 ? 0.646   8.685   10.539  1.00 0.81  ? 109 SER A HB2  2  
ATOM 3846  H HB3  . SER A 1 109 ? -0.990  8.885   11.159  1.00 1.05  ? 109 SER A HB3  2  
ATOM 3847  H HG   . SER A 1 109 ? 0.032   6.809   9.563   1.00 1.90  ? 109 SER A HG   2  
ATOM 3848  N N    . ARG A 1 110 ? 0.571   11.366  8.822   1.00 0.38  ? 110 ARG A N    2  
ATOM 3849  C CA   . ARG A 1 110 ? 0.869   12.792  8.865   1.00 0.43  ? 110 ARG A CA   2  
ATOM 3850  C C    . ARG A 1 110 ? -0.071  13.567  7.944   1.00 0.48  ? 110 ARG A C    2  
ATOM 3851  O O    . ARG A 1 110 ? -0.591  14.619  8.319   1.00 0.62  ? 110 ARG A O    2  
ATOM 3852  C CB   . ARG A 1 110 ? 2.315   13.070  8.460   1.00 0.45  ? 110 ARG A CB   2  
ATOM 3853  C CG   . ARG A 1 110 ? 3.353   12.481  9.375   1.00 0.97  ? 110 ARG A CG   2  
ATOM 3854  C CD   . ARG A 1 110 ? 4.724   12.695  8.779   1.00 0.88  ? 110 ARG A CD   2  
ATOM 3855  N NE   . ARG A 1 110 ? 5.778   11.969  9.489   1.00 1.78  ? 110 ARG A NE   2  
ATOM 3856  C CZ   . ARG A 1 110 ? 6.890   11.520  8.901   1.00 1.98  ? 110 ARG A CZ   2  
ATOM 3857  N NH1  . ARG A 1 110 ? 7.109   11.775  7.616   1.00 1.39  ? 110 ARG A NH1  2  
ATOM 3858  N NH2  . ARG A 1 110 ? 7.789   10.840  9.601   1.00 2.87  ? 110 ARG A NH2  2  
ATOM 3859  H H    . ARG A 1 110 ? 1.224   10.752  8.417   1.00 0.36  ? 110 ARG A H    2  
ATOM 3860  H HA   . ARG A 1 110 ? 0.723   13.129  9.872   1.00 0.48  ? 110 ARG A HA   2  
ATOM 3861  H HB2  . ARG A 1 110 ? 2.487   12.677  7.480   1.00 0.98  ? 110 ARG A HB2  2  
ATOM 3862  H HB3  . ARG A 1 110 ? 2.472   14.129  8.435   1.00 1.02  ? 110 ARG A HB3  2  
ATOM 3863  H HG2  . ARG A 1 110 ? 3.296   12.979  10.328  1.00 1.52  ? 110 ARG A HG2  2  
ATOM 3864  H HG3  . ARG A 1 110 ? 3.173   11.423  9.494   1.00 1.51  ? 110 ARG A HG3  2  
ATOM 3865  H HD2  . ARG A 1 110 ? 4.700   12.366  7.757   1.00 0.91  ? 110 ARG A HD2  2  
ATOM 3866  H HD3  . ARG A 1 110 ? 4.939   13.747  8.802   1.00 0.92  ? 110 ARG A HD3  2  
ATOM 3867  H HE   . ARG A 1 110 ? 5.640   11.797  10.449  1.00 2.33  ? 110 ARG A HE   2  
ATOM 3868  H HH11 . ARG A 1 110 ? 6.443   12.302  7.087   1.00 0.94  ? 110 ARG A HH11 2  
ATOM 3869  H HH12 . ARG A 1 110 ? 7.949   11.442  7.163   1.00 1.59  ? 110 ARG A HH12 2  
ATOM 3870  H HH21 . ARG A 1 110 ? 7.641   10.663  10.577  1.00 3.42  ? 110 ARG A HH21 2  
ATOM 3871  H HH22 . ARG A 1 110 ? 8.617   10.488  9.151   1.00 3.03  ? 110 ARG A HH22 2  
ATOM 3872  N N    . TYR A 1 111 ? -0.305  13.037  6.744   1.00 0.44  ? 111 TYR A N    2  
ATOM 3873  C CA   . TYR A 1 111 ? -1.166  13.710  5.777   1.00 0.51  ? 111 TYR A CA   2  
ATOM 3874  C C    . TYR A 1 111 ? -2.599  13.219  5.901   1.00 0.61  ? 111 TYR A C    2  
ATOM 3875  O O    . TYR A 1 111 ? -3.534  13.836  5.387   1.00 0.75  ? 111 TYR A O    2  
ATOM 3876  C CB   . TYR A 1 111 ? -0.645  13.558  4.333   1.00 0.51  ? 111 TYR A CB   2  
ATOM 3877  C CG   . TYR A 1 111 ? -0.408  12.178  3.812   1.00 0.76  ? 111 TYR A CG   2  
ATOM 3878  C CD1  . TYR A 1 111 ? -1.462  11.287  3.780   1.00 0.79  ? 111 TYR A CD1  2  
ATOM 3879  C CD2  . TYR A 1 111 ? 0.844   11.743  3.417   1.00 1.67  ? 111 TYR A CD2  2  
ATOM 3880  C CE1  . TYR A 1 111 ? -1.287  10.000  3.366   1.00 1.30  ? 111 TYR A CE1  2  
ATOM 3881  C CE2  . TYR A 1 111 ? 1.031   10.451  2.987   1.00 2.33  ? 111 TYR A CE2  2  
ATOM 3882  C CZ   . TYR A 1 111 ? 0.093   9.692   2.739   1.00 2.05  ? 111 TYR A CZ   2  
ATOM 3883  O OH   . TYR A 1 111 ? 0.149   8.293   2.563   1.00 2.75  ? 111 TYR A OH   2  
ATOM 3884  H H    . TYR A 1 111 ? 0.096   12.168  6.515   1.00 0.38  ? 111 TYR A H    2  
ATOM 3885  H HA   . TYR A 1 111 ? -1.158  14.761  6.031   1.00 0.58  ? 111 TYR A HA   2  
ATOM 3886  H HB2  . TYR A 1 111 ? -1.341  14.006  3.667   1.00 0.92  ? 111 TYR A HB2  2  
ATOM 3887  H HB3  . TYR A 1 111 ? 0.293   14.069  4.253   1.00 0.90  ? 111 TYR A HB3  2  
ATOM 3888  H HD1  . TYR A 1 111 ? -2.440  11.620  4.090   1.00 1.04  ? 111 TYR A HD1  2  
ATOM 3889  H HD2  . TYR A 1 111 ? 1.675   12.431  3.439   1.00 1.98  ? 111 TYR A HD2  2  
ATOM 3890  H HE1  . TYR A 1 111 ? -2.129  9.323   3.359   1.00 1.39  ? 111 TYR A HE1  2  
ATOM 3891  H HE2  . TYR A 1 111 ? 2.009   10.121  2.671   1.00 3.10  ? 111 TYR A HE2  2  
ATOM 3892  H HH   . TYR A 1 111 ? 0.834   7.895   3.106   1.00 2.95  ? 111 TYR A HH   2  
ATOM 3893  N N    . LYS A 1 112 ? -2.749  12.110  6.595   1.00 0.60  ? 112 LYS A N    2  
ATOM 3894  C CA   . LYS A 1 112 ? -4.042  11.544  6.906   1.00 0.72  ? 112 LYS A CA   2  
ATOM 3895  C C    . LYS A 1 112 ? -4.777  12.455  7.868   1.00 0.82  ? 112 LYS A C    2  
ATOM 3896  O O    . LYS A 1 112 ? -5.939  12.802  7.669   1.00 1.00  ? 112 LYS A O    2  
ATOM 3897  C CB   . LYS A 1 112 ? -3.851  10.184  7.537   1.00 0.65  ? 112 LYS A CB   2  
ATOM 3898  C CG   . LYS A 1 112 ? -5.048  9.322   7.417   1.00 0.66  ? 112 LYS A CG   2  
ATOM 3899  C CD   . LYS A 1 112 ? -4.949  8.148   8.320   1.00 0.79  ? 112 LYS A CD   2  
ATOM 3900  C CE   . LYS A 1 112 ? -5.604  6.974   7.675   1.00 1.06  ? 112 LYS A CE   2  
ATOM 3901  N NZ   . LYS A 1 112 ? -7.009  7.254   7.275   1.00 1.63  ? 112 LYS A NZ   2  
ATOM 3902  H H    . LYS A 1 112 ? -1.944  11.633  6.898   1.00 0.53  ? 112 LYS A H    2  
ATOM 3903  H HA   . LYS A 1 112 ? -4.613  11.428  6.000   1.00 0.83  ? 112 LYS A HA   2  
ATOM 3904  H HB2  . LYS A 1 112 ? -3.038  9.689   7.054   1.00 1.01  ? 112 LYS A HB2  2  
ATOM 3905  H HB3  . LYS A 1 112 ? -3.625  10.293  8.579   1.00 0.83  ? 112 LYS A HB3  2  
ATOM 3906  H HG2  . LYS A 1 112 ? -5.898  9.887   7.701   1.00 0.90  ? 112 LYS A HG2  2  
ATOM 3907  H HG3  . LYS A 1 112 ? -5.150  8.983   6.398   1.00 1.12  ? 112 LYS A HG3  2  
ATOM 3908  H HD2  . LYS A 1 112 ? -3.909  7.925   8.510   1.00 0.91  ? 112 LYS A HD2  2  
ATOM 3909  H HD3  . LYS A 1 112 ? -5.450  8.384   9.231   1.00 0.95  ? 112 LYS A HD3  2  
ATOM 3910  H HE2  . LYS A 1 112 ? -5.033  6.752   6.799   1.00 1.20  ? 112 LYS A HE2  2  
ATOM 3911  H HE3  . LYS A 1 112 ? -5.582  6.144   8.355   1.00 1.67  ? 112 LYS A HE3  2  
ATOM 3912  H HZ1  . LYS A 1 112 ? -7.429  6.411   6.833   1.00 2.18  ? 112 LYS A HZ1  2  
ATOM 3913  H HZ2  . LYS A 1 112 ? -7.037  8.033   6.590   1.00 2.02  ? 112 LYS A HZ2  2  
ATOM 3914  H HZ3  . LYS A 1 112 ? -7.578  7.516   8.105   1.00 2.08  ? 112 LYS A HZ3  2  
ATOM 3915  N N    . ASP A 1 113 ? -4.072  12.830  8.923   1.00 0.77  ? 113 ASP A N    2  
ATOM 3916  C CA   . ASP A 1 113 ? -4.599  13.763  9.907   1.00 0.91  ? 113 ASP A CA   2  
ATOM 3917  C C    . ASP A 1 113 ? -4.479  15.184  9.382   1.00 0.99  ? 113 ASP A C    2  
ATOM 3918  O O    . ASP A 1 113 ? -5.278  16.063  9.713   1.00 1.15  ? 113 ASP A O    2  
ATOM 3919  C CB   . ASP A 1 113 ? -3.830  13.634  11.218  1.00 0.91  ? 113 ASP A CB   2  
ATOM 3920  C CG   . ASP A 1 113 ? -4.638  14.094  12.412  1.00 1.31  ? 113 ASP A CG   2  
ATOM 3921  O OD1  . ASP A 1 113 ? -5.586  13.386  12.807  1.00 1.55  ? 113 ASP A OD1  2  
ATOM 3922  O OD2  . ASP A 1 113 ? -4.330  15.172  12.961  1.00 1.60  ? 113 ASP A OD2  2  
ATOM 3923  H H    . ASP A 1 113 ? -3.173  12.451  9.051   1.00 0.66  ? 113 ASP A H    2  
ATOM 3924  H HA   . ASP A 1 113 ? -5.639  13.530  10.076  1.00 1.01  ? 113 ASP A HA   2  
ATOM 3925  H HB2  . ASP A 1 113 ? -3.545  12.610  11.361  1.00 0.88  ? 113 ASP A HB2  2  
ATOM 3926  H HB3  . ASP A 1 113 ? -2.939  14.234  11.160  1.00 0.93  ? 113 ASP A HB3  2  
ATOM 3927  N N    . ALA A 1 114 ? -3.448  15.376  8.555   1.00 0.91  ? 114 ALA A N    2  
ATOM 3928  C CA   . ALA A 1 114 ? -3.168  16.647  7.881   1.00 0.99  ? 114 ALA A CA   2  
ATOM 3929  C C    . ALA A 1 114 ? -2.672  17.702  8.863   1.00 1.16  ? 114 ALA A C    2  
ATOM 3930  O O    . ALA A 1 114 ? -2.677  18.900  8.569   1.00 1.33  ? 114 ALA A O    2  
ATOM 3931  C CB   . ALA A 1 114 ? -4.382  17.142  7.104   1.00 1.07  ? 114 ALA A CB   2  
ATOM 3932  H H    . ALA A 1 114 ? -2.838  14.625  8.399   1.00 0.81  ? 114 ALA A H    2  
ATOM 3933  H HA   . ALA A 1 114 ? -2.379  16.459  7.168   1.00 0.95  ? 114 ALA A HA   2  
ATOM 3934  H HB1  . ALA A 1 114 ? -4.680  16.387  6.389   1.00 1.53  ? 114 ALA A HB1  2  
ATOM 3935  H HB2  . ALA A 1 114 ? -4.129  18.052  6.582   1.00 1.53  ? 114 ALA A HB2  2  
ATOM 3936  H HB3  . ALA A 1 114 ? -5.195  17.330  7.787   1.00 1.42  ? 114 ALA A HB3  2  
ATOM 3937  N N    . ASP A 1 115 ? -2.240  17.246  10.027  1.00 1.20  ? 115 ASP A N    2  
ATOM 3938  C CA   . ASP A 1 115 ? -1.651  18.120  11.023  1.00 1.43  ? 115 ASP A CA   2  
ATOM 3939  C C    . ASP A 1 115 ? -0.299  17.571  11.452  1.00 1.61  ? 115 ASP A C    2  
ATOM 3940  O O    . ASP A 1 115 ? -0.268  16.641  12.283  1.00 2.01  ? 115 ASP A O    2  
ATOM 3941  C CB   . ASP A 1 115 ? -2.572  18.251  12.233  1.00 1.66  ? 115 ASP A CB   2  
ATOM 3942  C CG   . ASP A 1 115 ? -2.071  19.272  13.237  1.00 1.90  ? 115 ASP A CG   2  
ATOM 3943  O OD1  . ASP A 1 115 ? -2.228  20.488  12.991  1.00 2.23  ? 115 ASP A OD1  2  
ATOM 3944  O OD2  . ASP A 1 115 ? -1.504  18.865  14.272  1.00 1.96  ? 115 ASP A OD2  2  
ATOM 3945  O OXT  . ASP A 1 115 ? 0.727   18.051  10.932  1.00 2.09  ? 115 ASP A OXT  2  
ATOM 3946  H H    . ASP A 1 115 ? -2.329  16.296  10.227  1.00 1.12  ? 115 ASP A H    2  
ATOM 3947  H HA   . ASP A 1 115 ? -1.509  19.092  10.576  1.00 1.58  ? 115 ASP A HA   2  
ATOM 3948  H HB2  . ASP A 1 115 ? -3.552  18.548  11.894  1.00 1.77  ? 115 ASP A HB2  2  
ATOM 3949  H HB3  . ASP A 1 115 ? -2.644  17.293  12.725  1.00 1.74  ? 115 ASP A HB3  2  
ATOM 3950  N N    . ASP B 2 1   ? -8.442  -16.788 -10.342 1.00 2.92  ? 22  ASP B N    2  
ATOM 3951  C CA   . ASP B 2 1   ? -8.630  -17.118 -8.908  1.00 2.59  ? 22  ASP B CA   2  
ATOM 3952  C C    . ASP B 2 1   ? -7.692  -16.301 -8.028  1.00 2.27  ? 22  ASP B C    2  
ATOM 3953  O O    . ASP B 2 1   ? -8.111  -15.738 -7.019  1.00 2.08  ? 22  ASP B O    2  
ATOM 3954  C CB   . ASP B 2 1   ? -8.390  -18.613 -8.673  1.00 2.80  ? 22  ASP B CB   2  
ATOM 3955  C CG   . ASP B 2 1   ? -8.415  -18.986 -7.201  1.00 3.30  ? 22  ASP B CG   2  
ATOM 3956  O OD1  . ASP B 2 1   ? -9.520  -19.125 -6.634  1.00 3.65  ? 22  ASP B OD1  2  
ATOM 3957  O OD2  . ASP B 2 1   ? -7.329  -19.144 -6.607  1.00 3.79  ? 22  ASP B OD2  2  
ATOM 3958  H H1   . ASP B 2 1   ? -9.125  -17.315 -10.921 1.00 3.10  ? 22  ASP B H1   2  
ATOM 3959  H H2   . ASP B 2 1   ? -7.482  -17.042 -10.647 1.00 3.28  ? 22  ASP B H2   2  
ATOM 3960  H H3   . ASP B 2 1   ? -8.584  -15.770 -10.496 1.00 3.12  ? 22  ASP B H3   2  
ATOM 3961  H HA   . ASP B 2 1   ? -9.648  -16.880 -8.640  1.00 2.62  ? 22  ASP B HA   2  
ATOM 3962  H HB2  . ASP B 2 1   ? -9.158  -19.177 -9.180  1.00 2.95  ? 22  ASP B HB2  2  
ATOM 3963  H HB3  . ASP B 2 1   ? -7.426  -18.883 -9.077  1.00 3.06  ? 22  ASP B HB3  2  
ATOM 3964  N N    . THR B 2 2   ? -6.430  -16.215 -8.426  1.00 2.32  ? 23  THR B N    2  
ATOM 3965  C CA   . THR B 2 2   ? -5.416  -15.553 -7.622  1.00 2.14  ? 23  THR B CA   2  
ATOM 3966  C C    . THR B 2 2   ? -5.641  -14.050 -7.514  1.00 1.87  ? 23  THR B C    2  
ATOM 3967  O O    . THR B 2 2   ? -5.398  -13.456 -6.463  1.00 1.65  ? 23  THR B O    2  
ATOM 3968  C CB   . THR B 2 2   ? -4.025  -15.806 -8.195  1.00 2.44  ? 23  THR B CB   2  
ATOM 3969  O OG1  . THR B 2 2   ? -4.080  -15.773 -9.625  1.00 2.75  ? 23  THR B OG1  2  
ATOM 3970  C CG2  . THR B 2 2   ? -3.475  -17.144 -7.725  1.00 2.78  ? 23  THR B CG2  2  
ATOM 3971  H H    . THR B 2 2   ? -6.167  -16.609 -9.285  1.00 2.56  ? 23  THR B H    2  
ATOM 3972  H HA   . THR B 2 2   ? -5.446  -15.977 -6.632  1.00 2.12  ? 23  THR B HA   2  
ATOM 3973  H HB   . THR B 2 2   ? -3.381  -15.020 -7.847  1.00 2.61  ? 23  THR B HB   2  
ATOM 3974  H HG1  . THR B 2 2   ? -3.544  -15.039 -9.949  1.00 3.07  ? 23  THR B HG1  2  
ATOM 3975  H HG21 . THR B 2 2   ? -3.365  -17.131 -6.651  1.00 3.18  ? 23  THR B HG21 2  
ATOM 3976  H HG22 . THR B 2 2   ? -2.515  -17.318 -8.185  1.00 3.12  ? 23  THR B HG22 2  
ATOM 3977  H HG23 . THR B 2 2   ? -4.158  -17.932 -8.007  1.00 2.90  ? 23  THR B HG23 2  
ATOM 3978  N N    . GLN B 2 3   ? -6.104  -13.438 -8.598  1.00 1.97  ? 24  GLN B N    2  
ATOM 3979  C CA   . GLN B 2 3   ? -6.378  -12.006 -8.604  1.00 1.86  ? 24  GLN B CA   2  
ATOM 3980  C C    . GLN B 2 3   ? -7.401  -11.669 -7.528  1.00 1.69  ? 24  GLN B C    2  
ATOM 3981  O O    . GLN B 2 3   ? -7.344  -10.614 -6.896  1.00 1.59  ? 24  GLN B O    2  
ATOM 3982  C CB   . GLN B 2 3   ? -6.886  -11.565 -9.979  1.00 2.14  ? 24  GLN B CB   2  
ATOM 3983  C CG   . GLN B 2 3   ? -7.078  -10.062 -10.114 1.00 2.53  ? 24  GLN B CG   2  
ATOM 3984  C CD   . GLN B 2 3   ? -5.801  -9.287  -9.848  1.00 3.01  ? 24  GLN B CD   2  
ATOM 3985  O OE1  . GLN B 2 3   ? -5.006  -9.048  -10.756 1.00 3.39  ? 24  GLN B OE1  2  
ATOM 3986  N NE2  . GLN B 2 3   ? -5.596  -8.890  -8.601  1.00 3.58  ? 24  GLN B NE2  2  
ATOM 3987  H H    . GLN B 2 3   ? -6.262  -13.961 -9.414  1.00 2.18  ? 24  GLN B H    2  
ATOM 3988  H HA   . GLN B 2 3   ? -5.454  -11.490 -8.385  1.00 1.79  ? 24  GLN B HA   2  
ATOM 3989  H HB2  . GLN B 2 3   ? -6.179  -11.883 -10.730 1.00 2.52  ? 24  GLN B HB2  2  
ATOM 3990  H HB3  . GLN B 2 3   ? -7.835  -12.043 -10.167 1.00 2.37  ? 24  GLN B HB3  2  
ATOM 3991  H HG2  . GLN B 2 3   ? -7.411  -9.842  -11.118 1.00 2.85  ? 24  GLN B HG2  2  
ATOM 3992  H HG3  . GLN B 2 3   ? -7.829  -9.742  -9.408  1.00 2.92  ? 24  GLN B HG3  2  
ATOM 3993  H HE21 . GLN B 2 3   ? -6.272  -9.117  -7.925  1.00 3.72  ? 24  GLN B HE21 2  
ATOM 3994  H HE22 . GLN B 2 3   ? -4.780  -8.385  -8.404  1.00 4.10  ? 24  GLN B HE22 2  
ATOM 3995  N N    . ASP B 2 4   ? -8.326  -12.591 -7.321  1.00 1.74  ? 25  ASP B N    2  
ATOM 3996  C CA   . ASP B 2 4   ? -9.348  -12.439 -6.293  1.00 1.67  ? 25  ASP B CA   2  
ATOM 3997  C C    . ASP B 2 4   ? -8.790  -12.828 -4.935  1.00 1.46  ? 25  ASP B C    2  
ATOM 3998  O O    . ASP B 2 4   ? -9.087  -12.197 -3.917  1.00 1.37  ? 25  ASP B O    2  
ATOM 3999  C CB   . ASP B 2 4   ? -10.568 -13.300 -6.614  1.00 1.88  ? 25  ASP B CB   2  
ATOM 4000  C CG   . ASP B 2 4   ? -11.664 -13.155 -5.578  1.00 2.23  ? 25  ASP B CG   2  
ATOM 4001  O OD1  . ASP B 2 4   ? -12.497 -12.232 -5.705  1.00 2.56  ? 25  ASP B OD1  2  
ATOM 4002  O OD2  . ASP B 2 4   ? -11.701 -13.967 -4.631  1.00 2.67  ? 25  ASP B OD2  2  
ATOM 4003  H H    . ASP B 2 4   ? -8.304  -13.414 -7.861  1.00 1.88  ? 25  ASP B H    2  
ATOM 4004  H HA   . ASP B 2 4   ? -9.643  -11.402 -6.268  1.00 1.70  ? 25  ASP B HA   2  
ATOM 4005  H HB2  . ASP B 2 4   ? -10.964 -13.007 -7.574  1.00 2.16  ? 25  ASP B HB2  2  
ATOM 4006  H HB3  . ASP B 2 4   ? -10.268 -14.337 -6.653  1.00 2.05  ? 25  ASP B HB3  2  
ATOM 4007  N N    . ASP B 2 5   ? -7.962  -13.867 -4.943  1.00 1.48  ? 26  ASP B N    2  
ATOM 4008  C CA   . ASP B 2 5   ? -7.386  -14.428 -3.725  1.00 1.38  ? 26  ASP B CA   2  
ATOM 4009  C C    . ASP B 2 5   ? -6.582  -13.382 -2.962  1.00 1.16  ? 26  ASP B C    2  
ATOM 4010  O O    . ASP B 2 5   ? -6.493  -13.433 -1.742  1.00 1.08  ? 26  ASP B O    2  
ATOM 4011  C CB   . ASP B 2 5   ? -6.491  -15.622 -4.063  1.00 1.61  ? 26  ASP B CB   2  
ATOM 4012  C CG   . ASP B 2 5   ? -6.253  -16.530 -2.874  1.00 1.69  ? 26  ASP B CG   2  
ATOM 4013  O OD1  . ASP B 2 5   ? -5.390  -16.191 -2.037  1.00 2.16  ? 26  ASP B OD1  2  
ATOM 4014  O OD2  . ASP B 2 5   ? -6.925  -17.575 -2.759  1.00 1.79  ? 26  ASP B OD2  2  
ATOM 4015  H H    . ASP B 2 5   ? -7.737  -14.283 -5.803  1.00 1.64  ? 26  ASP B H    2  
ATOM 4016  H HA   . ASP B 2 5   ? -8.199  -14.766 -3.102  1.00 1.41  ? 26  ASP B HA   2  
ATOM 4017  H HB2  . ASP B 2 5   ? -6.958  -16.201 -4.845  1.00 2.03  ? 26  ASP B HB2  2  
ATOM 4018  H HB3  . ASP B 2 5   ? -5.536  -15.258 -4.413  1.00 1.90  ? 26  ASP B HB3  2  
ATOM 4019  N N    . PHE B 2 6   ? -6.014  -12.424 -3.691  1.00 1.18  ? 27  PHE B N    2  
ATOM 4020  C CA   . PHE B 2 6   ? -5.246  -11.338 -3.080  1.00 1.13  ? 27  PHE B CA   2  
ATOM 4021  C C    . PHE B 2 6   ? -6.089  -10.528 -2.095  1.00 1.08  ? 27  PHE B C    2  
ATOM 4022  O O    . PHE B 2 6   ? -5.555  -9.891  -1.188  1.00 1.20  ? 27  PHE B O    2  
ATOM 4023  C CB   . PHE B 2 6   ? -4.674  -10.409 -4.151  1.00 1.30  ? 27  PHE B CB   2  
ATOM 4024  C CG   . PHE B 2 6   ? -3.402  -10.913 -4.775  1.00 1.11  ? 27  PHE B CG   2  
ATOM 4025  C CD1  . PHE B 2 6   ? -2.306  -11.220 -3.984  1.00 1.14  ? 27  PHE B CD1  2  
ATOM 4026  C CD2  . PHE B 2 6   ? -3.296  -11.062 -6.149  1.00 1.45  ? 27  PHE B CD2  2  
ATOM 4027  C CE1  . PHE B 2 6   ? -1.130  -11.668 -4.549  1.00 1.16  ? 27  PHE B CE1  2  
ATOM 4028  C CE2  . PHE B 2 6   ? -2.121  -11.513 -6.720  1.00 1.84  ? 27  PHE B CE2  2  
ATOM 4029  C CZ   . PHE B 2 6   ? -1.037  -11.814 -5.918  1.00 1.59  ? 27  PHE B CZ   2  
ATOM 4030  H H    . PHE B 2 6   ? -6.099  -12.458 -4.668  1.00 1.30  ? 27  PHE B H    2  
ATOM 4031  H HA   . PHE B 2 6   ? -4.428  -11.789 -2.538  1.00 1.14  ? 27  PHE B HA   2  
ATOM 4032  H HB2  . PHE B 2 6   ? -5.402  -10.288 -4.938  1.00 1.57  ? 27  PHE B HB2  2  
ATOM 4033  H HB3  . PHE B 2 6   ? -4.470  -9.446  -3.709  1.00 1.63  ? 27  PHE B HB3  2  
ATOM 4034  H HD1  . PHE B 2 6   ? -2.378  -11.107 -2.912  1.00 1.49  ? 27  PHE B HD1  2  
ATOM 4035  H HD2  . PHE B 2 6   ? -4.143  -10.826 -6.775  1.00 1.68  ? 27  PHE B HD2  2  
ATOM 4036  H HE1  . PHE B 2 6   ? -0.282  -11.902 -3.922  1.00 1.20  ? 27  PHE B HE1  2  
ATOM 4037  H HE2  . PHE B 2 6   ? -2.049  -11.627 -7.791  1.00 2.44  ? 27  PHE B HE2  2  
ATOM 4038  H HZ   . PHE B 2 6   ? -0.116  -12.163 -6.362  1.00 1.95  ? 27  PHE B HZ   2  
ATOM 4039  N N    . LEU B 2 7   ? -7.398  -10.546 -2.278  1.00 1.07  ? 28  LEU B N    2  
ATOM 4040  C CA   . LEU B 2 7   ? -8.303  -9.886  -1.364  1.00 1.16  ? 28  LEU B CA   2  
ATOM 4041  C C    . LEU B 2 7   ? -8.771  -10.879 -0.304  1.00 1.10  ? 28  LEU B C    2  
ATOM 4042  O O    . LEU B 2 7   ? -8.864  -10.557 0.880   1.00 1.17  ? 28  LEU B O    2  
ATOM 4043  C CB   . LEU B 2 7   ? -9.494  -9.324  -2.145  1.00 1.40  ? 28  LEU B CB   2  
ATOM 4044  C CG   . LEU B 2 7   ? -10.682 -8.893  -1.295  1.00 1.80  ? 28  LEU B CG   2  
ATOM 4045  C CD1  . LEU B 2 7   ? -10.324 -7.699  -0.424  1.00 2.39  ? 28  LEU B CD1  2  
ATOM 4046  C CD2  . LEU B 2 7   ? -11.882 -8.578  -2.171  1.00 2.28  ? 28  LEU B CD2  2  
ATOM 4047  H H    . LEU B 2 7   ? -7.773  -11.026 -3.045  1.00 1.12  ? 28  LEU B H    2  
ATOM 4048  H HA   . LEU B 2 7   ? -7.773  -9.078  -0.884  1.00 1.23  ? 28  LEU B HA   2  
ATOM 4049  H HB2  . LEU B 2 7   ? -9.154  -8.468  -2.711  1.00 1.64  ? 28  LEU B HB2  2  
ATOM 4050  H HB3  . LEU B 2 7   ? -9.831  -10.080 -2.837  1.00 2.04  ? 28  LEU B HB3  2  
ATOM 4051  H HG   . LEU B 2 7   ? -10.945 -9.714  -0.649  1.00 2.36  ? 28  LEU B HG   2  
ATOM 4052  H HD11 . LEU B 2 7   ? -11.184 -7.412  0.163   1.00 2.97  ? 28  LEU B HD11 2  
ATOM 4053  H HD12 . LEU B 2 7   ? -10.023 -6.873  -1.051  1.00 2.48  ? 28  LEU B HD12 2  
ATOM 4054  H HD13 . LEU B 2 7   ? -9.512  -7.967  0.235   1.00 2.89  ? 28  LEU B HD13 2  
ATOM 4055  H HD21 . LEU B 2 7   ? -12.715 -8.287  -1.549  1.00 2.77  ? 28  LEU B HD21 2  
ATOM 4056  H HD22 . LEU B 2 7   ? -12.149 -9.453  -2.746  1.00 2.61  ? 28  LEU B HD22 2  
ATOM 4057  H HD23 . LEU B 2 7   ? -11.636 -7.769  -2.844  1.00 2.57  ? 28  LEU B HD23 2  
ATOM 4058  N N    . LYS B 2 8   ? -9.025  -12.100 -0.751  1.00 1.07  ? 29  LYS B N    2  
ATOM 4059  C CA   . LYS B 2 8   ? -9.532  -13.161 0.106   1.00 1.14  ? 29  LYS B CA   2  
ATOM 4060  C C    . LYS B 2 8   ? -8.533  -13.537 1.200   1.00 1.04  ? 29  LYS B C    2  
ATOM 4061  O O    . LYS B 2 8   ? -8.887  -13.597 2.379   1.00 1.06  ? 29  LYS B O    2  
ATOM 4062  C CB   . LYS B 2 8   ? -9.841  -14.385 -0.755  1.00 1.33  ? 29  LYS B CB   2  
ATOM 4063  C CG   . LYS B 2 8   ? -10.138 -15.647 0.031   1.00 1.71  ? 29  LYS B CG   2  
ATOM 4064  C CD   . LYS B 2 8   ? -10.270 -16.842 -0.893  1.00 1.99  ? 29  LYS B CD   2  
ATOM 4065  C CE   . LYS B 2 8   ? -10.461 -18.129 -0.115  1.00 2.39  ? 29  LYS B CE   2  
ATOM 4066  N NZ   . LYS B 2 8   ? -10.657 -19.294 -1.017  1.00 2.91  ? 29  LYS B NZ   2  
ATOM 4067  H H    . LYS B 2 8   ? -8.866  -12.296 -1.699  1.00 1.09  ? 29  LYS B H    2  
ATOM 4068  H HA   . LYS B 2 8   ? -10.444 -12.816 0.567   1.00 1.24  ? 29  LYS B HA   2  
ATOM 4069  H HB2  . LYS B 2 8   ? -10.699 -14.167 -1.372  1.00 1.79  ? 29  LYS B HB2  2  
ATOM 4070  H HB3  . LYS B 2 8   ? -8.993  -14.579 -1.392  1.00 1.82  ? 29  LYS B HB3  2  
ATOM 4071  H HG2  . LYS B 2 8   ? -9.332  -15.827 0.729   1.00 2.29  ? 29  LYS B HG2  2  
ATOM 4072  H HG3  . LYS B 2 8   ? -11.064 -15.515 0.572   1.00 2.15  ? 29  LYS B HG3  2  
ATOM 4073  H HD2  . LYS B 2 8   ? -11.121 -16.693 -1.540  1.00 2.21  ? 29  LYS B HD2  2  
ATOM 4074  H HD3  . LYS B 2 8   ? -9.373  -16.924 -1.490  1.00 2.44  ? 29  LYS B HD3  2  
ATOM 4075  H HE2  . LYS B 2 8   ? -9.585  -18.298 0.495   1.00 2.72  ? 29  LYS B HE2  2  
ATOM 4076  H HE3  . LYS B 2 8   ? -11.327 -18.026 0.522   1.00 2.71  ? 29  LYS B HE3  2  
ATOM 4077  H HZ1  . LYS B 2 8   ? -11.493 -19.147 -1.618  1.00 3.26  ? 29  LYS B HZ1  2  
ATOM 4078  H HZ2  . LYS B 2 8   ? -10.798 -20.161 -0.458  1.00 3.28  ? 29  LYS B HZ2  2  
ATOM 4079  H HZ3  . LYS B 2 8   ? -9.824  -19.421 -1.625  1.00 3.20  ? 29  LYS B HZ3  2  
ATOM 4080  N N    . TRP B 2 9   ? -7.283  -13.763 0.807   1.00 0.99  ? 30  TRP B N    2  
ATOM 4081  C CA   . TRP B 2 9   ? -6.268  -14.257 1.730   1.00 1.00  ? 30  TRP B CA   2  
ATOM 4082  C C    . TRP B 2 9   ? -5.943  -13.223 2.794   1.00 0.90  ? 30  TRP B C    2  
ATOM 4083  O O    . TRP B 2 9   ? -5.562  -13.570 3.904   1.00 1.00  ? 30  TRP B O    2  
ATOM 4084  C CB   . TRP B 2 9   ? -4.992  -14.671 0.975   1.00 1.03  ? 30  TRP B CB   2  
ATOM 4085  C CG   . TRP B 2 9   ? -3.998  -13.565 0.755   1.00 0.95  ? 30  TRP B CG   2  
ATOM 4086  C CD1  . TRP B 2 9   ? -4.114  -12.522 -0.112  1.00 1.06  ? 30  TRP B CD1  2  
ATOM 4087  C CD2  . TRP B 2 9   ? -2.723  -13.412 1.396   1.00 0.86  ? 30  TRP B CD2  2  
ATOM 4088  N NE1  . TRP B 2 9   ? -2.999  -11.727 -0.052  1.00 1.00  ? 30  TRP B NE1  2  
ATOM 4089  C CE2  . TRP B 2 9   ? -2.129  -12.251 0.865   1.00 0.85  ? 30  TRP B CE2  2  
ATOM 4090  C CE3  . TRP B 2 9   ? -2.025  -14.139 2.369   1.00 0.94  ? 30  TRP B CE3  2  
ATOM 4091  C CZ2  . TRP B 2 9   ? -0.877  -11.804 1.271   1.00 0.83  ? 30  TRP B CZ2  2  
ATOM 4092  C CZ3  . TRP B 2 9   ? -0.780  -13.691 2.768   1.00 1.00  ? 30  TRP B CZ3  2  
ATOM 4093  C CH2  . TRP B 2 9   ? -0.218  -12.535 2.219   1.00 0.90  ? 30  TRP B CH2  2  
ATOM 4094  H H    . TRP B 2 9   ? -7.041  -13.614 -0.135  1.00 1.00  ? 30  TRP B H    2  
ATOM 4095  H HA   . TRP B 2 9   ? -6.675  -15.128 2.219   1.00 1.11  ? 30  TRP B HA   2  
ATOM 4096  H HB2  . TRP B 2 9   ? -4.495  -15.451 1.529   1.00 1.09  ? 30  TRP B HB2  2  
ATOM 4097  H HB3  . TRP B 2 9   ? -5.274  -15.053 0.004   1.00 1.11  ? 30  TRP B HB3  2  
ATOM 4098  H HD1  . TRP B 2 9   ? -4.971  -12.358 -0.749  1.00 1.24  ? 30  TRP B HD1  2  
ATOM 4099  H HE1  . TRP B 2 9   ? -2.850  -10.914 -0.580  1.00 1.11  ? 30  TRP B HE1  2  
ATOM 4100  H HE3  . TRP B 2 9   ? -2.442  -15.032 2.812   1.00 1.05  ? 30  TRP B HE3  2  
ATOM 4101  H HZ2  . TRP B 2 9   ? -0.427  -10.913 0.858   1.00 0.86  ? 30  TRP B HZ2  2  
ATOM 4102  H HZ3  . TRP B 2 9   ? -0.225  -14.240 3.513   1.00 1.18  ? 30  TRP B HZ3  2  
ATOM 4103  H HH2  . TRP B 2 9   ? 0.758   -12.224 2.561   1.00 0.99  ? 30  TRP B HH2  2  
ATOM 4104  N N    . TRP B 2 10  ? -6.108  -11.954 2.455   1.00 0.76  ? 31  TRP B N    2  
ATOM 4105  C CA   . TRP B 2 10  ? -5.779  -10.881 3.375   1.00 0.73  ? 31  TRP B CA   2  
ATOM 4106  C C    . TRP B 2 10  ? -6.847  -10.774 4.456   1.00 0.86  ? 31  TRP B C    2  
ATOM 4107  O O    . TRP B 2 10  ? -6.544  -10.673 5.646   1.00 1.02  ? 31  TRP B O    2  
ATOM 4108  C CB   . TRP B 2 10  ? -5.666  -9.557  2.621   1.00 0.61  ? 31  TRP B CB   2  
ATOM 4109  C CG   . TRP B 2 10  ? -4.606  -8.655  3.168   1.00 0.56  ? 31  TRP B CG   2  
ATOM 4110  C CD1  . TRP B 2 10  ? -4.602  -8.028  4.380   1.00 0.66  ? 31  TRP B CD1  2  
ATOM 4111  C CD2  . TRP B 2 10  ? -3.393  -8.275  2.514   1.00 0.46  ? 31  TRP B CD2  2  
ATOM 4112  N NE1  . TRP B 2 10  ? -3.456  -7.285  4.521   1.00 0.65  ? 31  TRP B NE1  2  
ATOM 4113  C CE2  . TRP B 2 10  ? -2.697  -7.421  3.386   1.00 0.50  ? 31  TRP B CE2  2  
ATOM 4114  C CE3  . TRP B 2 10  ? -2.828  -8.578  1.274   1.00 0.42  ? 31  TRP B CE3  2  
ATOM 4115  C CZ2  . TRP B 2 10  ? -1.464  -6.868  3.055   1.00 0.45  ? 31  TRP B CZ2  2  
ATOM 4116  C CZ3  . TRP B 2 10  ? -1.605  -8.025  0.948   1.00 0.38  ? 31  TRP B CZ3  2  
ATOM 4117  C CH2  . TRP B 2 10  ? -0.934  -7.178  1.838   1.00 0.36  ? 31  TRP B CH2  2  
ATOM 4118  H H    . TRP B 2 10  ? -6.459  -11.736 1.568   1.00 0.76  ? 31  TRP B H    2  
ATOM 4119  H HA   . TRP B 2 10  ? -4.829  -11.110 3.833   1.00 0.76  ? 31  TRP B HA   2  
ATOM 4120  H HB2  . TRP B 2 10  ? -5.431  -9.759  1.586   1.00 0.59  ? 31  TRP B HB2  2  
ATOM 4121  H HB3  . TRP B 2 10  ? -6.611  -9.038  2.676   1.00 0.67  ? 31  TRP B HB3  2  
ATOM 4122  H HD1  . TRP B 2 10  ? -5.392  -8.113  5.113   1.00 0.78  ? 31  TRP B HD1  2  
ATOM 4123  H HE1  . TRP B 2 10  ? -3.221  -6.743  5.310   1.00 0.75  ? 31  TRP B HE1  2  
ATOM 4124  H HE3  . TRP B 2 10  ? -3.330  -9.229  0.574   1.00 0.49  ? 31  TRP B HE3  2  
ATOM 4125  H HZ2  . TRP B 2 10  ? -0.931  -6.221  3.723   1.00 0.54  ? 31  TRP B HZ2  2  
ATOM 4126  H HZ3  . TRP B 2 10  ? -1.155  -8.248  -0.006  1.00 0.43  ? 31  TRP B HZ3  2  
ATOM 4127  H HH2  . TRP B 2 10  ? 0.022   -6.763  1.542   1.00 0.36  ? 31  TRP B HH2  2  
ATOM 4128  N N    . ARG B 2 11  ? -8.101  -10.832 4.029   1.00 0.87  ? 32  ARG B N    2  
ATOM 4129  C CA   . ARG B 2 11  ? -9.232  -10.680 4.933   1.00 1.03  ? 32  ARG B CA   2  
ATOM 4130  C C    . ARG B 2 11  ? -9.340  -11.848 5.908   1.00 1.15  ? 32  ARG B C    2  
ATOM 4131  O O    . ARG B 2 11  ? -9.798  -11.677 7.039   1.00 1.33  ? 32  ARG B O    2  
ATOM 4132  C CB   . ARG B 2 11  ? -10.528 -10.532 4.137   1.00 1.08  ? 32  ARG B CB   2  
ATOM 4133  C CG   . ARG B 2 11  ? -10.653 -9.193  3.427   1.00 1.34  ? 32  ARG B CG   2  
ATOM 4134  C CD   . ARG B 2 11  ? -10.735 -8.044  4.422   1.00 1.58  ? 32  ARG B CD   2  
ATOM 4135  N NE   . ARG B 2 11  ? -11.909 -8.155  5.286   1.00 2.01  ? 32  ARG B NE   2  
ATOM 4136  C CZ   . ARG B 2 11  ? -11.937 -7.804  6.571   1.00 2.63  ? 32  ARG B CZ   2  
ATOM 4137  N NH1  . ARG B 2 11  ? -10.845 -7.339  7.170   1.00 3.04  ? 32  ARG B NH1  2  
ATOM 4138  N NH2  . ARG B 2 11  ? -13.063 -7.926  7.262   1.00 3.37  ? 32  ARG B NH2  2  
ATOM 4139  H H    . ARG B 2 11  ? -8.271  -10.983 3.074   1.00 0.82  ? 32  ARG B H    2  
ATOM 4140  H HA   . ARG B 2 11  ? -9.072  -9.777  5.502   1.00 1.12  ? 32  ARG B HA   2  
ATOM 4141  H HB2  . ARG B 2 11  ? -10.573 -11.316 3.395   1.00 1.33  ? 32  ARG B HB2  2  
ATOM 4142  H HB3  . ARG B 2 11  ? -11.364 -10.637 4.810   1.00 1.39  ? 32  ARG B HB3  2  
ATOM 4143  H HG2  . ARG B 2 11  ? -9.788  -9.049  2.796   1.00 1.84  ? 32  ARG B HG2  2  
ATOM 4144  H HG3  . ARG B 2 11  ? -11.547 -9.198  2.821   1.00 1.90  ? 32  ARG B HG3  2  
ATOM 4145  H HD2  . ARG B 2 11  ? -9.847  -8.047  5.034   1.00 2.09  ? 32  ARG B HD2  2  
ATOM 4146  H HD3  . ARG B 2 11  ? -10.791 -7.115  3.875   1.00 2.02  ? 32  ARG B HD3  2  
ATOM 4147  H HE   . ARG B 2 11  ? -12.732 -8.510  4.876   1.00 2.35  ? 32  ARG B HE   2  
ATOM 4148  H HH11 . ARG B 2 11  ? -9.977  -7.248  6.660   1.00 2.99  ? 32  ARG B HH11 2  
ATOM 4149  H HH12 . ARG B 2 11  ? -10.882 -7.070  8.136   1.00 3.72  ? 32  ARG B HH12 2  
ATOM 4150  H HH21 . ARG B 2 11  ? -13.894 -8.280  6.822   1.00 3.63  ? 32  ARG B HH21 2  
ATOM 4151  H HH22 . ARG B 2 11  ? -13.087 -7.667  8.233   1.00 3.92  ? 32  ARG B HH22 2  
ATOM 4152  N N    . SER B 2 12  ? -8.908  -13.026 5.481   1.00 1.13  ? 33  SER B N    2  
ATOM 4153  C CA   . SER B 2 12  ? -8.964  -14.201 6.338   1.00 1.30  ? 33  SER B CA   2  
ATOM 4154  C C    . SER B 2 12  ? -7.863  -14.156 7.399   1.00 1.45  ? 33  SER B C    2  
ATOM 4155  O O    . SER B 2 12  ? -7.997  -14.742 8.474   1.00 1.65  ? 33  SER B O    2  
ATOM 4156  C CB   . SER B 2 12  ? -8.862  -15.471 5.496   1.00 1.33  ? 33  SER B CB   2  
ATOM 4157  O OG   . SER B 2 12  ? -7.785  -15.391 4.581   1.00 1.90  ? 33  SER B OG   2  
ATOM 4158  H H    . SER B 2 12  ? -8.543  -13.111 4.573   1.00 1.04  ? 33  SER B H    2  
ATOM 4159  H HA   . SER B 2 12  ? -9.920  -14.193 6.839   1.00 1.37  ? 33  SER B HA   2  
ATOM 4160  H HB2  . SER B 2 12  ? -8.704  -16.320 6.144   1.00 1.77  ? 33  SER B HB2  2  
ATOM 4161  H HB3  . SER B 2 12  ? -9.779  -15.608 4.943   1.00 1.58  ? 33  SER B HB3  2  
ATOM 4162  H HG   . SER B 2 12  ? -7.218  -16.164 4.687   1.00 2.15  ? 33  SER B HG   2  
ATOM 4163  N N    . GLU B 2 13  ? -6.777  -13.451 7.100   1.00 1.40  ? 34  GLU B N    2  
ATOM 4164  C CA   . GLU B 2 13  ? -5.713  -13.244 8.075   1.00 1.57  ? 34  GLU B CA   2  
ATOM 4165  C C    . GLU B 2 13  ? -6.174  -12.258 9.136   1.00 1.63  ? 34  GLU B C    2  
ATOM 4166  O O    . GLU B 2 13  ? -5.997  -12.482 10.335  1.00 1.85  ? 34  GLU B O    2  
ATOM 4167  C CB   . GLU B 2 13  ? -4.446  -12.717 7.398   1.00 1.57  ? 34  GLU B CB   2  
ATOM 4168  C CG   . GLU B 2 13  ? -3.914  -13.629 6.309   1.00 1.84  ? 34  GLU B CG   2  
ATOM 4169  C CD   . GLU B 2 13  ? -3.563  -15.011 6.817   1.00 1.90  ? 34  GLU B CD   2  
ATOM 4170  O OE1  . GLU B 2 13  ? -2.426  -15.207 7.286   1.00 2.32  ? 34  GLU B OE1  2  
ATOM 4171  O OE2  . GLU B 2 13  ? -4.424  -15.916 6.738   1.00 2.15  ? 34  GLU B OE2  2  
ATOM 4172  H H    . GLU B 2 13  ? -6.686  -13.068 6.200   1.00 1.27  ? 34  GLU B H    2  
ATOM 4173  H HA   . GLU B 2 13  ? -5.500  -14.192 8.544   1.00 1.73  ? 34  GLU B HA   2  
ATOM 4174  H HB2  . GLU B 2 13  ? -4.661  -11.755 6.958   1.00 1.70  ? 34  GLU B HB2  2  
ATOM 4175  H HB3  . GLU B 2 13  ? -3.676  -12.597 8.146   1.00 1.80  ? 34  GLU B HB3  2  
ATOM 4176  H HG2  . GLU B 2 13  ? -4.670  -13.727 5.544   1.00 2.25  ? 34  GLU B HG2  2  
ATOM 4177  H HG3  . GLU B 2 13  ? -3.032  -13.179 5.880   1.00 2.41  ? 34  GLU B HG3  2  
ATOM 4178  N N    . GLU B 2 14  ? -6.793  -11.175 8.682   1.00 1.50  ? 35  GLU B N    2  
ATOM 4179  C CA   . GLU B 2 14  ? -7.295  -10.147 9.580   1.00 1.65  ? 35  GLU B CA   2  
ATOM 4180  C C    . GLU B 2 14  ? -8.402  -10.698 10.466  1.00 1.86  ? 35  GLU B C    2  
ATOM 4181  O O    . GLU B 2 14  ? -8.519  -10.321 11.626  1.00 2.10  ? 35  GLU B O    2  
ATOM 4182  C CB   . GLU B 2 14  ? -7.816  -8.950  8.791   1.00 1.57  ? 35  GLU B CB   2  
ATOM 4183  C CG   . GLU B 2 14  ? -6.789  -8.352  7.850   1.00 2.12  ? 35  GLU B CG   2  
ATOM 4184  C CD   . GLU B 2 14  ? -7.216  -7.006  7.322   1.00 2.43  ? 35  GLU B CD   2  
ATOM 4185  O OE1  . GLU B 2 14  ? -8.225  -6.947  6.592   1.00 3.14  ? 35  GLU B OE1  2  
ATOM 4186  O OE2  . GLU B 2 14  ? -6.545  -5.997  7.629   1.00 2.46  ? 35  GLU B OE2  2  
ATOM 4187  H H    . GLU B 2 14  ? -6.906  -11.061 7.712   1.00 1.35  ? 35  GLU B H    2  
ATOM 4188  H HA   . GLU B 2 14  ? -6.476  -9.825  10.205  1.00 1.76  ? 35  GLU B HA   2  
ATOM 4189  H HB2  . GLU B 2 14  ? -8.669  -9.262  8.207   1.00 1.55  ? 35  GLU B HB2  2  
ATOM 4190  H HB3  . GLU B 2 14  ? -8.127  -8.183  9.484   1.00 1.87  ? 35  GLU B HB3  2  
ATOM 4191  H HG2  . GLU B 2 14  ? -5.856  -8.236  8.380   1.00 2.69  ? 35  GLU B HG2  2  
ATOM 4192  H HG3  . GLU B 2 14  ? -6.649  -9.024  7.016   1.00 2.55  ? 35  GLU B HG3  2  
ATOM 4193  N N    . ALA B 2 15  ? -9.210  -11.592 9.910   1.00 1.84  ? 36  ALA B N    2  
ATOM 4194  C CA   . ALA B 2 15  ? -10.288 -12.221 10.664  1.00 2.10  ? 36  ALA B CA   2  
ATOM 4195  C C    . ALA B 2 15  ? -9.733  -13.142 11.742  1.00 2.31  ? 36  ALA B C    2  
ATOM 4196  O O    . ALA B 2 15  ? -10.352 -13.338 12.787  1.00 2.58  ? 36  ALA B O    2  
ATOM 4197  C CB   . ALA B 2 15  ? -11.202 -12.995 9.729   1.00 2.10  ? 36  ALA B CB   2  
ATOM 4198  H H    . ALA B 2 15  ? -9.085  -11.829 8.966   1.00 1.67  ? 36  ALA B H    2  
ATOM 4199  H HA   . ALA B 2 15  ? -10.868 -11.439 11.133  1.00 2.20  ? 36  ALA B HA   2  
ATOM 4200  H HB1  . ALA B 2 15  ? -11.610 -12.325 8.987   1.00 2.33  ? 36  ALA B HB1  2  
ATOM 4201  H HB2  . ALA B 2 15  ? -12.007 -13.436 10.298  1.00 2.25  ? 36  ALA B HB2  2  
ATOM 4202  H HB3  . ALA B 2 15  ? -10.638 -13.774 9.238   1.00 2.42  ? 36  ALA B HB3  2  
ATOM 4203  N N    . GLN B 2 16  ? -8.560  -13.704 11.483  1.00 2.24  ? 37  GLN B N    2  
ATOM 4204  C CA   . GLN B 2 16  ? -7.915  -14.593 12.434  1.00 2.49  ? 37  GLN B CA   2  
ATOM 4205  C C    . GLN B 2 16  ? -7.364  -13.782 13.604  1.00 2.66  ? 37  GLN B C    2  
ATOM 4206  O O    . GLN B 2 16  ? -7.462  -14.194 14.761  1.00 2.93  ? 37  GLN B O    2  
ATOM 4207  C CB   . GLN B 2 16  ? -6.801  -15.384 11.734  1.00 2.39  ? 37  GLN B CB   2  
ATOM 4208  C CG   . GLN B 2 16  ? -6.260  -16.563 12.538  1.00 2.54  ? 37  GLN B CG   2  
ATOM 4209  C CD   . GLN B 2 16  ? -5.211  -16.175 13.565  1.00 3.04  ? 37  GLN B CD   2  
ATOM 4210  O OE1  . GLN B 2 16  ? -5.121  -16.784 14.629  1.00 3.65  ? 37  GLN B OE1  2  
ATOM 4211  N NE2  . GLN B 2 16  ? -4.384  -15.192 13.244  1.00 3.38  ? 37  GLN B NE2  2  
ATOM 4212  H H    . GLN B 2 16  ? -8.120  -13.520 10.627  1.00 2.05  ? 37  GLN B H    2  
ATOM 4213  H HA   . GLN B 2 16  ? -8.660  -15.281 12.805  1.00 2.69  ? 37  GLN B HA   2  
ATOM 4214  H HB2  . GLN B 2 16  ? -7.186  -15.766 10.800  1.00 2.65  ? 37  GLN B HB2  2  
ATOM 4215  H HB3  . GLN B 2 16  ? -5.981  -14.714 11.524  1.00 2.45  ? 37  GLN B HB3  2  
ATOM 4216  H HG2  . GLN B 2 16  ? -7.084  -17.031 13.055  1.00 2.72  ? 37  GLN B HG2  2  
ATOM 4217  H HG3  . GLN B 2 16  ? -5.822  -17.274 11.851  1.00 2.94  ? 37  GLN B HG3  2  
ATOM 4218  H HE21 . GLN B 2 16  ? -4.482  -14.766 12.365  1.00 3.31  ? 37  GLN B HE21 2  
ATOM 4219  H HE22 . GLN B 2 16  ? -3.698  -14.931 13.899  1.00 4.00  ? 37  GLN B HE22 2  
ATOM 4220  N N    . ASP B 2 17  ? -6.806  -12.619 13.297  1.00 2.57  ? 38  ASP B N    2  
ATOM 4221  C CA   . ASP B 2 17  ? -6.242  -11.746 14.320  1.00 2.80  ? 38  ASP B CA   2  
ATOM 4222  C C    . ASP B 2 17  ? -7.336  -10.956 15.032  1.00 2.96  ? 38  ASP B C    2  
ATOM 4223  O O    . ASP B 2 17  ? -7.468  -11.022 16.255  1.00 3.22  ? 38  ASP B O    2  
ATOM 4224  C CB   . ASP B 2 17  ? -5.227  -10.788 13.699  1.00 2.80  ? 38  ASP B CB   2  
ATOM 4225  C CG   . ASP B 2 17  ? -4.641  -9.831  14.715  1.00 2.83  ? 38  ASP B CG   2  
ATOM 4226  O OD1  . ASP B 2 17  ? -3.810  -10.266 15.537  1.00 3.06  ? 38  ASP B OD1  2  
ATOM 4227  O OD2  . ASP B 2 17  ? -5.018  -8.643  14.703  1.00 3.03  ? 38  ASP B OD2  2  
ATOM 4228  H H    . ASP B 2 17  ? -6.767  -12.342 12.355  1.00 2.38  ? 38  ASP B H    2  
ATOM 4229  H HA   . ASP B 2 17  ? -5.738  -12.370 15.042  1.00 2.97  ? 38  ASP B HA   2  
ATOM 4230  H HB2  . ASP B 2 17  ? -4.421  -11.360 13.264  1.00 3.09  ? 38  ASP B HB2  2  
ATOM 4231  H HB3  . ASP B 2 17  ? -5.713  -10.211 12.926  1.00 2.90  ? 38  ASP B HB3  2  
ATOM 4232  N N    . MET B 2 18  ? -8.125  -10.219 14.266  1.00 2.89  ? 39  MET B N    2  
ATOM 4233  C CA   . MET B 2 18  ? -9.210  -9.420  14.820  1.00 3.13  ? 39  MET B CA   2  
ATOM 4234  C C    . MET B 2 18  ? -10.492 -10.240 14.878  1.00 3.86  ? 39  MET B C    2  
ATOM 4235  O O    . MET B 2 18  ? -11.424 -10.016 14.100  1.00 4.43  ? 39  MET B O    2  
ATOM 4236  C CB   . MET B 2 18  ? -9.435  -8.154  13.986  1.00 3.09  ? 39  MET B CB   2  
ATOM 4237  C CG   . MET B 2 18  ? -8.288  -7.159  14.052  1.00 3.39  ? 39  MET B CG   2  
ATOM 4238  S SD   . MET B 2 18  ? -8.571  -5.694  13.037  1.00 3.72  ? 39  MET B SD   2  
ATOM 4239  C CE   . MET B 2 18  ? -8.578  -6.413  11.396  1.00 4.34  ? 39  MET B CE   2  
ATOM 4240  H H    . MET B 2 18  ? -7.986  -10.223 13.290  1.00 2.73  ? 39  MET B H    2  
ATOM 4241  H HA   . MET B 2 18  ? -8.933  -9.136  15.824  1.00 3.23  ? 39  MET B HA   2  
ATOM 4242  H HB2  . MET B 2 18  ? -9.574  -8.440  12.953  1.00 3.27  ? 39  MET B HB2  2  
ATOM 4243  H HB3  . MET B 2 18  ? -10.331 -7.662  14.335  1.00 3.33  ? 39  MET B HB3  2  
ATOM 4244  H HG2  . MET B 2 18  ? -8.160  -6.846  15.078  1.00 3.53  ? 39  MET B HG2  2  
ATOM 4245  H HG3  . MET B 2 18  ? -7.386  -7.647  13.713  1.00 3.93  ? 39  MET B HG3  2  
ATOM 4246  H HE1  . MET B 2 18  ? -9.383  -7.128  11.319  1.00 4.48  ? 39  MET B HE1  2  
ATOM 4247  H HE2  . MET B 2 18  ? -7.637  -6.910  11.219  1.00 4.79  ? 39  MET B HE2  2  
ATOM 4248  H HE3  . MET B 2 18  ? -8.717  -5.633  10.662  1.00 4.64  ? 39  MET B HE3  2  
ATOM 4249  N N    . GLY B 2 19  ? -10.527 -11.192 15.793  1.00 4.23  ? 40  GLY B N    2  
ATOM 4250  C CA   . GLY B 2 19  ? -11.688 -12.042 15.938  1.00 5.19  ? 40  GLY B CA   2  
ATOM 4251  C C    . GLY B 2 19  ? -12.521 -11.653 17.138  1.00 5.68  ? 40  GLY B C    2  
ATOM 4252  O O    . GLY B 2 19  ? -13.471 -10.859 16.975  1.00 6.18  ? 40  GLY B O    2  
ATOM 4253  O OXT  . GLY B 2 19  ? -12.222 -12.133 18.253  1.00 5.90  ? 40  GLY B OXT  2  
ATOM 4254  H H    . GLY B 2 19  ? -9.757  -11.315 16.388  1.00 4.07  ? 40  GLY B H    2  
ATOM 4255  H HA2  . GLY B 2 19  ? -12.295 -11.962 15.048  1.00 5.50  ? 40  GLY B HA2  2  
ATOM 4256  H HA3  . GLY B 2 19  ? -11.364 -13.064 16.052  1.00 5.60  ? 40  GLY B HA3  2  
ATOM 4257  N N    . PRO A 1 1   ? 17.541  -1.281  6.000   1.00 2.80  ? 1   PRO A N    3  
ATOM 4258  C CA   . PRO A 1 1   ? 16.743  -0.895  4.817   1.00 2.09  ? 1   PRO A CA   3  
ATOM 4259  C C    . PRO A 1 1   ? 15.697  0.153   5.188   1.00 1.70  ? 1   PRO A C    3  
ATOM 4260  O O    . PRO A 1 1   ? 14.524  -0.162  5.377   1.00 2.48  ? 1   PRO A O    3  
ATOM 4261  C CB   . PRO A 1 1   ? 16.073  -2.138  4.252   1.00 2.88  ? 1   PRO A CB   3  
ATOM 4262  C CG   . PRO A 1 1   ? 16.635  -3.247  5.072   1.00 3.60  ? 1   PRO A CG   3  
ATOM 4263  C CD   . PRO A 1 1   ? 17.074  -2.626  6.377   1.00 3.50  ? 1   PRO A CD   3  
ATOM 4264  H H2   . PRO A 1 1   ? 18.537  -1.153  5.703   1.00 2.93  ? 1   PRO A H2   3  
ATOM 4265  H H3   . PRO A 1 1   ? 17.400  -0.524  6.689   1.00 3.05  ? 1   PRO A H3   3  
ATOM 4266  H HA   . PRO A 1 1   ? 17.408  -0.479  4.074   1.00 2.07  ? 1   PRO A HA   3  
ATOM 4267  H HB2  . PRO A 1 1   ? 15.001  -2.059  4.365   1.00 3.16  ? 1   PRO A HB2  3  
ATOM 4268  H HB3  . PRO A 1 1   ? 16.327  -2.249  3.208   1.00 3.12  ? 1   PRO A HB3  3  
ATOM 4269  H HG2  . PRO A 1 1   ? 15.876  -3.994  5.251   1.00 4.35  ? 1   PRO A HG2  3  
ATOM 4270  H HG3  . PRO A 1 1   ? 17.481  -3.687  4.564   1.00 3.85  ? 1   PRO A HG3  3  
ATOM 4271  H HD2  . PRO A 1 1   ? 16.241  -2.562  7.062   1.00 4.20  ? 1   PRO A HD2  3  
ATOM 4272  H HD3  . PRO A 1 1   ? 17.878  -3.198  6.813   1.00 3.65  ? 1   PRO A HD3  3  
ATOM 4273  N N    . SER A 1 2   ? 16.132  1.397   5.305   1.00 1.00  ? 2   SER A N    3  
ATOM 4274  C CA   . SER A 1 2   ? 15.243  2.487   5.666   1.00 0.75  ? 2   SER A CA   3  
ATOM 4275  C C    . SER A 1 2   ? 14.707  3.177   4.415   1.00 0.89  ? 2   SER A C    3  
ATOM 4276  O O    . SER A 1 2   ? 15.457  3.422   3.466   1.00 1.99  ? 2   SER A O    3  
ATOM 4277  C CB   . SER A 1 2   ? 15.989  3.483   6.552   1.00 1.16  ? 2   SER A CB   3  
ATOM 4278  O OG   . SER A 1 2   ? 17.225  3.852   5.962   1.00 1.66  ? 2   SER A OG   3  
ATOM 4279  H H    . SER A 1 2   ? 17.081  1.593   5.147   1.00 1.37  ? 2   SER A H    3  
ATOM 4280  H HA   . SER A 1 2   ? 14.414  2.071   6.220   1.00 0.60  ? 2   SER A HA   3  
ATOM 4281  H HB2  . SER A 1 2   ? 15.387  4.369   6.681   1.00 1.50  ? 2   SER A HB2  3  
ATOM 4282  H HB3  . SER A 1 2   ? 16.182  3.034   7.515   1.00 1.23  ? 2   SER A HB3  3  
ATOM 4283  H HG   . SER A 1 2   ? 17.053  4.359   5.156   1.00 1.95  ? 2   SER A HG   3  
ATOM 4284  N N    . HIS A 1 3   ? 13.402  3.457   4.413   1.00 0.41  ? 3   HIS A N    3  
ATOM 4285  C CA   . HIS A 1 3   ? 12.722  4.123   3.291   1.00 0.27  ? 3   HIS A CA   3  
ATOM 4286  C C    . HIS A 1 3   ? 12.713  3.275   2.023   1.00 0.23  ? 3   HIS A C    3  
ATOM 4287  O O    . HIS A 1 3   ? 12.051  3.629   1.056   1.00 0.33  ? 3   HIS A O    3  
ATOM 4288  C CB   . HIS A 1 3   ? 13.352  5.486   2.972   1.00 0.28  ? 3   HIS A CB   3  
ATOM 4289  C CG   . HIS A 1 3   ? 12.970  6.581   3.917   1.00 0.36  ? 3   HIS A CG   3  
ATOM 4290  N ND1  . HIS A 1 3   ? 13.654  6.846   5.081   1.00 0.56  ? 3   HIS A ND1  3  
ATOM 4291  C CD2  . HIS A 1 3   ? 11.972  7.494   3.857   1.00 0.38  ? 3   HIS A CD2  3  
ATOM 4292  C CE1  . HIS A 1 3   ? 13.096  7.869   5.695   1.00 0.61  ? 3   HIS A CE1  3  
ATOM 4293  N NE2  . HIS A 1 3   ? 12.073  8.282   4.973   1.00 0.49  ? 3   HIS A NE2  3  
ATOM 4294  H H    . HIS A 1 3   ? 12.870  3.216   5.203   1.00 1.21  ? 3   HIS A H    3  
ATOM 4295  H HA   . HIS A 1 3   ? 11.699  4.288   3.589   1.00 0.31  ? 3   HIS A HA   3  
ATOM 4296  H HB2  . HIS A 1 3   ? 14.427  5.389   2.998   1.00 0.33  ? 3   HIS A HB2  3  
ATOM 4297  H HB3  . HIS A 1 3   ? 13.049  5.783   1.978   1.00 0.28  ? 3   HIS A HB3  3  
ATOM 4298  H HD1  . HIS A 1 3   ? 14.445  6.360   5.406   1.00 0.69  ? 3   HIS A HD1  3  
ATOM 4299  H HD2  . HIS A 1 3   ? 11.236  7.592   3.070   1.00 0.44  ? 3   HIS A HD2  3  
ATOM 4300  H HE1  . HIS A 1 3   ? 13.421  8.296   6.631   1.00 0.78  ? 3   HIS A HE1  3  
ATOM 4301  H HE2  . HIS A 1 3   ? 11.603  9.149   5.102   1.00 0.56  ? 3   HIS A HE2  3  
ATOM 4302  N N    . SER A 1 4   ? 13.428  2.165   2.019   1.00 0.21  ? 4   SER A N    3  
ATOM 4303  C CA   . SER A 1 4   ? 13.543  1.359   0.818   1.00 0.17  ? 4   SER A CA   3  
ATOM 4304  C C    . SER A 1 4   ? 13.837  -0.092  1.130   1.00 0.18  ? 4   SER A C    3  
ATOM 4305  O O    . SER A 1 4   ? 14.213  -0.446  2.248   1.00 0.24  ? 4   SER A O    3  
ATOM 4306  C CB   . SER A 1 4   ? 14.615  1.929   -0.105  1.00 0.19  ? 4   SER A CB   3  
ATOM 4307  O OG   . SER A 1 4   ? 15.827  2.178   0.594   1.00 0.28  ? 4   SER A OG   3  
ATOM 4308  H H    . SER A 1 4   ? 13.879  1.875   2.838   1.00 0.28  ? 4   SER A H    3  
ATOM 4309  H HA   . SER A 1 4   ? 12.597  1.403   0.297   1.00 0.15  ? 4   SER A HA   3  
ATOM 4310  H HB2  . SER A 1 4   ? 14.804  1.226   -0.901  1.00 0.19  ? 4   SER A HB2  3  
ATOM 4311  H HB3  . SER A 1 4   ? 14.257  2.848   -0.528  1.00 0.19  ? 4   SER A HB3  3  
ATOM 4312  H HG   . SER A 1 4   ? 15.625  2.577   1.450   1.00 0.91  ? 4   SER A HG   3  
ATOM 4313  N N    . GLY A 1 5   ? 13.649  -0.916  0.120   1.00 0.15  ? 5   GLY A N    3  
ATOM 4314  C CA   . GLY A 1 5   ? 13.868  -2.333  0.238   1.00 0.15  ? 5   GLY A CA   3  
ATOM 4315  C C    . GLY A 1 5   ? 13.358  -3.049  -0.978  1.00 0.13  ? 5   GLY A C    3  
ATOM 4316  O O    . GLY A 1 5   ? 12.414  -2.590  -1.619  1.00 0.12  ? 5   GLY A O    3  
ATOM 4317  H H    . GLY A 1 5   ? 13.347  -0.546  -0.738  1.00 0.15  ? 5   GLY A H    3  
ATOM 4318  H HA2  . GLY A 1 5   ? 14.924  -2.518  0.328   1.00 0.17  ? 5   GLY A HA2  3  
ATOM 4319  H HA3  . GLY A 1 5   ? 13.358  -2.706  1.112   1.00 0.17  ? 5   GLY A HA3  3  
ATOM 4320  N N    . ALA A 1 6   ? 13.984  -4.159  -1.310  1.00 0.14  ? 6   ALA A N    3  
ATOM 4321  C CA   . ALA A 1 6   ? 13.661  -4.868  -2.532  1.00 0.15  ? 6   ALA A CA   3  
ATOM 4322  C C    . ALA A 1 6   ? 12.259  -5.461  -2.481  1.00 0.15  ? 6   ALA A C    3  
ATOM 4323  O O    . ALA A 1 6   ? 11.975  -6.366  -1.695  1.00 0.19  ? 6   ALA A O    3  
ATOM 4324  C CB   . ALA A 1 6   ? 14.695  -5.934  -2.822  1.00 0.17  ? 6   ALA A CB   3  
ATOM 4325  H H    . ALA A 1 6   ? 14.681  -4.509  -0.716  1.00 0.16  ? 6   ALA A H    3  
ATOM 4326  H HA   . ALA A 1 6   ? 13.699  -4.152  -3.335  1.00 0.14  ? 6   ALA A HA   3  
ATOM 4327  H HB1  . ALA A 1 6   ? 14.695  -6.666  -2.029  1.00 1.00  ? 6   ALA A HB1  3  
ATOM 4328  H HB2  . ALA A 1 6   ? 15.667  -5.470  -2.892  1.00 1.07  ? 6   ALA A HB2  3  
ATOM 4329  H HB3  . ALA A 1 6   ? 14.457  -6.412  -3.758  1.00 1.03  ? 6   ALA A HB3  3  
ATOM 4330  N N    . ALA A 1 7   ? 11.399  -4.945  -3.345  1.00 0.14  ? 7   ALA A N    3  
ATOM 4331  C CA   . ALA A 1 7   ? 10.002  -5.331  -3.384  1.00 0.14  ? 7   ALA A CA   3  
ATOM 4332  C C    . ALA A 1 7   ? 9.640   -5.841  -4.772  1.00 0.16  ? 7   ALA A C    3  
ATOM 4333  O O    . ALA A 1 7   ? 10.463  -5.830  -5.672  1.00 0.15  ? 7   ALA A O    3  
ATOM 4334  C CB   . ALA A 1 7   ? 9.119   -4.152  -3.002  1.00 0.14  ? 7   ALA A CB   3  
ATOM 4335  H H    . ALA A 1 7   ? 11.729  -4.304  -4.010  1.00 0.14  ? 7   ALA A H    3  
ATOM 4336  H HA   . ALA A 1 7   ? 9.849   -6.123  -2.664  1.00 0.16  ? 7   ALA A HA   3  
ATOM 4337  H HB1  . ALA A 1 7   ? 9.248   -3.933  -1.950  1.00 1.03  ? 7   ALA A HB1  3  
ATOM 4338  H HB2  . ALA A 1 7   ? 8.088   -4.402  -3.190  1.00 1.05  ? 7   ALA A HB2  3  
ATOM 4339  H HB3  . ALA A 1 7   ? 9.396   -3.279  -3.584  1.00 1.00  ? 7   ALA A HB3  3  
ATOM 4340  N N    . ILE A 1 8   ? 8.409   -6.283  -4.944  1.00 0.20  ? 8   ILE A N    3  
ATOM 4341  C CA   . ILE A 1 8   ? 7.944   -6.785  -6.230  1.00 0.23  ? 8   ILE A CA   3  
ATOM 4342  C C    . ILE A 1 8   ? 6.607   -6.143  -6.595  1.00 0.25  ? 8   ILE A C    3  
ATOM 4343  O O    . ILE A 1 8   ? 5.726   -6.012  -5.744  1.00 0.28  ? 8   ILE A O    3  
ATOM 4344  C CB   . ILE A 1 8   ? 7.814   -8.319  -6.208  1.00 0.28  ? 8   ILE A CB   3  
ATOM 4345  C CG1  . ILE A 1 8   ? 9.201   -8.930  -6.323  1.00 0.29  ? 8   ILE A CG1  3  
ATOM 4346  C CG2  . ILE A 1 8   ? 6.904   -8.832  -7.320  1.00 0.31  ? 8   ILE A CG2  3  
ATOM 4347  C CD1  . ILE A 1 8   ? 9.636   -9.684  -5.108  1.00 0.36  ? 8   ILE A CD1  3  
ATOM 4348  H H    . ILE A 1 8   ? 7.792   -6.278  -4.184  1.00 0.23  ? 8   ILE A H    3  
ATOM 4349  H HA   . ILE A 1 8   ? 8.696   -6.527  -6.977  1.00 0.20  ? 8   ILE A HA   3  
ATOM 4350  H HB   . ILE A 1 8   ? 7.384   -8.603  -5.264  1.00 0.33  ? 8   ILE A HB   3  
ATOM 4351  H HG12 . ILE A 1 8   ? 9.233   -9.601  -7.163  1.00 0.31  ? 8   ILE A HG12 3  
ATOM 4352  H HG13 . ILE A 1 8   ? 9.915   -8.137  -6.478  1.00 0.24  ? 8   ILE A HG13 3  
ATOM 4353  H HG21 . ILE A 1 8   ? 7.313   -8.549  -8.279  1.00 0.99  ? 8   ILE A HG21 3  
ATOM 4354  H HG22 . ILE A 1 8   ? 5.920   -8.403  -7.206  1.00 1.08  ? 8   ILE A HG22 3  
ATOM 4355  H HG23 . ILE A 1 8   ? 6.837   -9.909  -7.261  1.00 1.02  ? 8   ILE A HG23 3  
ATOM 4356  H HD11 . ILE A 1 8   ? 10.636  -10.055 -5.266  1.00 1.04  ? 8   ILE A HD11 3  
ATOM 4357  H HD12 . ILE A 1 8   ? 8.963   -10.508 -4.933  1.00 1.06  ? 8   ILE A HD12 3  
ATOM 4358  H HD13 . ILE A 1 8   ? 9.627   -9.017  -4.263  1.00 1.07  ? 8   ILE A HD13 3  
ATOM 4359  N N    . PHE A 1 9   ? 6.473   -5.744  -7.849  1.00 0.24  ? 9   PHE A N    3  
ATOM 4360  C CA   . PHE A 1 9   ? 5.277   -5.069  -8.332  1.00 0.26  ? 9   PHE A CA   3  
ATOM 4361  C C    . PHE A 1 9   ? 5.092   -5.398  -9.810  1.00 0.28  ? 9   PHE A C    3  
ATOM 4362  O O    . PHE A 1 9   ? 6.064   -5.398  -10.554 1.00 0.28  ? 9   PHE A O    3  
ATOM 4363  C CB   . PHE A 1 9   ? 5.425   -3.557  -8.118  1.00 0.25  ? 9   PHE A CB   3  
ATOM 4364  C CG   . PHE A 1 9   ? 4.208   -2.746  -8.451  1.00 0.28  ? 9   PHE A CG   3  
ATOM 4365  C CD1  . PHE A 1 9   ? 3.217   -2.561  -7.510  1.00 0.31  ? 9   PHE A CD1  3  
ATOM 4366  C CD2  . PHE A 1 9   ? 4.058   -2.165  -9.697  1.00 0.32  ? 9   PHE A CD2  3  
ATOM 4367  C CE1  . PHE A 1 9   ? 2.093   -1.815  -7.801  1.00 0.36  ? 9   PHE A CE1  3  
ATOM 4368  C CE2  . PHE A 1 9   ? 2.938   -1.416  -9.997  1.00 0.38  ? 9   PHE A CE2  3  
ATOM 4369  C CZ   . PHE A 1 9   ? 1.953   -1.241  -9.047  1.00 0.39  ? 9   PHE A CZ   3  
ATOM 4370  H H    . PHE A 1 9   ? 7.202   -5.920  -8.486  1.00 0.23  ? 9   PHE A H    3  
ATOM 4371  H HA   . PHE A 1 9   ? 4.429   -5.434  -7.772  1.00 0.28  ? 9   PHE A HA   3  
ATOM 4372  H HB2  . PHE A 1 9   ? 5.664   -3.372  -7.082  1.00 0.27  ? 9   PHE A HB2  3  
ATOM 4373  H HB3  . PHE A 1 9   ? 6.238   -3.198  -8.733  1.00 0.26  ? 9   PHE A HB3  3  
ATOM 4374  H HD1  . PHE A 1 9   ? 3.334   -3.005  -6.535  1.00 0.33  ? 9   PHE A HD1  3  
ATOM 4375  H HD2  . PHE A 1 9   ? 4.830   -2.301  -10.441 1.00 0.34  ? 9   PHE A HD2  3  
ATOM 4376  H HE1  . PHE A 1 9   ? 1.325   -1.682  -7.057  1.00 0.40  ? 9   PHE A HE1  3  
ATOM 4377  H HE2  . PHE A 1 9   ? 2.833   -0.970  -10.975 1.00 0.43  ? 9   PHE A HE2  3  
ATOM 4378  H HZ   . PHE A 1 9   ? 1.075   -0.657  -9.280  1.00 0.45  ? 9   PHE A HZ   3  
ATOM 4379  N N    . GLU A 1 10  ? 3.859   -5.702  -10.220 1.00 0.37  ? 10  GLU A N    3  
ATOM 4380  C CA   . GLU A 1 10  ? 3.568   -6.098  -11.606 1.00 0.43  ? 10  GLU A CA   3  
ATOM 4381  C C    . GLU A 1 10  ? 4.265   -7.404  -11.954 1.00 0.33  ? 10  GLU A C    3  
ATOM 4382  O O    . GLU A 1 10  ? 4.670   -7.634  -13.096 1.00 0.38  ? 10  GLU A O    3  
ATOM 4383  C CB   . GLU A 1 10  ? 3.978   -5.008  -12.593 1.00 0.59  ? 10  GLU A CB   3  
ATOM 4384  C CG   . GLU A 1 10  ? 3.161   -3.748  -12.447 1.00 0.77  ? 10  GLU A CG   3  
ATOM 4385  C CD   . GLU A 1 10  ? 3.592   -2.663  -13.408 1.00 1.00  ? 10  GLU A CD   3  
ATOM 4386  O OE1  . GLU A 1 10  ? 4.683   -2.094  -13.214 1.00 0.95  ? 10  GLU A OE1  3  
ATOM 4387  O OE2  . GLU A 1 10  ? 2.845   -2.376  -14.368 1.00 1.33  ? 10  GLU A OE2  3  
ATOM 4388  H H    . GLU A 1 10  ? 3.123   -5.664  -9.572  1.00 0.43  ? 10  GLU A H    3  
ATOM 4389  H HA   . GLU A 1 10  ? 2.501   -6.251  -11.682 1.00 0.54  ? 10  GLU A HA   3  
ATOM 4390  H HB2  . GLU A 1 10  ? 5.016   -4.762  -12.431 1.00 0.56  ? 10  GLU A HB2  3  
ATOM 4391  H HB3  . GLU A 1 10  ? 3.854   -5.379  -13.599 1.00 0.67  ? 10  GLU A HB3  3  
ATOM 4392  H HG2  . GLU A 1 10  ? 2.128   -3.993  -12.627 1.00 0.88  ? 10  GLU A HG2  3  
ATOM 4393  H HG3  . GLU A 1 10  ? 3.271   -3.379  -11.437 1.00 0.70  ? 10  GLU A HG3  3  
ATOM 4394  N N    . LYS A 1 11  ? 4.403   -8.243  -10.939 1.00 0.35  ? 11  LYS A N    3  
ATOM 4395  C CA   . LYS A 1 11  ? 5.037   -9.558  -11.052 1.00 0.43  ? 11  LYS A CA   3  
ATOM 4396  C C    . LYS A 1 11  ? 6.524   -9.480  -11.416 1.00 0.41  ? 11  LYS A C    3  
ATOM 4397  O O    . LYS A 1 11  ? 7.170   -10.507 -11.635 1.00 0.59  ? 11  LYS A O    3  
ATOM 4398  C CB   . LYS A 1 11  ? 4.285   -10.441 -12.034 1.00 0.54  ? 11  LYS A CB   3  
ATOM 4399  C CG   . LYS A 1 11  ? 2.896   -10.801 -11.545 1.00 0.63  ? 11  LYS A CG   3  
ATOM 4400  C CD   . LYS A 1 11  ? 2.908   -11.355 -10.146 1.00 1.34  ? 11  LYS A CD   3  
ATOM 4401  C CE   . LYS A 1 11  ? 1.511   -11.718 -9.689  1.00 1.31  ? 11  LYS A CE   3  
ATOM 4402  N NZ   . LYS A 1 11  ? 1.510   -12.355 -8.344  1.00 2.23  ? 11  LYS A NZ   3  
ATOM 4403  H H    . LYS A 1 11  ? 4.044   -7.965  -10.069 1.00 0.41  ? 11  LYS A H    3  
ATOM 4404  H HA   . LYS A 1 11  ? 4.956   -10.022 -10.086 1.00 0.53  ? 11  LYS A HA   3  
ATOM 4405  H HB2  . LYS A 1 11  ? 4.193   -9.921  -12.975 1.00 0.51  ? 11  LYS A HB2  3  
ATOM 4406  H HB3  . LYS A 1 11  ? 4.841   -11.353 -12.184 1.00 0.67  ? 11  LYS A HB3  3  
ATOM 4407  H HG2  . LYS A 1 11  ? 2.283   -9.929  -11.550 1.00 1.25  ? 11  LYS A HG2  3  
ATOM 4408  H HG3  . LYS A 1 11  ? 2.486   -11.535 -12.194 1.00 0.98  ? 11  LYS A HG3  3  
ATOM 4409  H HD2  . LYS A 1 11  ? 3.523   -12.225 -10.128 1.00 1.86  ? 11  LYS A HD2  3  
ATOM 4410  H HD3  . LYS A 1 11  ? 3.307   -10.618 -9.488  1.00 2.00  ? 11  LYS A HD3  3  
ATOM 4411  H HE2  . LYS A 1 11  ? 0.916   -10.817 -9.650  1.00 1.09  ? 11  LYS A HE2  3  
ATOM 4412  H HE3  . LYS A 1 11  ? 1.087   -12.396 -10.407 1.00 1.82  ? 11  LYS A HE3  3  
ATOM 4413  H HZ1  . LYS A 1 11  ? 2.060   -13.239 -8.364  1.00 2.72  ? 11  LYS A HZ1  3  
ATOM 4414  H HZ2  . LYS A 1 11  ? 0.537   -12.573 -8.053  1.00 2.51  ? 11  LYS A HZ2  3  
ATOM 4415  H HZ3  . LYS A 1 11  ? 1.932   -11.714 -7.643  1.00 2.85  ? 11  LYS A HZ3  3  
ATOM 4416  N N    . VAL A 1 12  ? 7.062   -8.271  -11.477 1.00 0.26  ? 12  VAL A N    3  
ATOM 4417  C CA   . VAL A 1 12  ? 8.493   -8.073  -11.641 1.00 0.25  ? 12  VAL A CA   3  
ATOM 4418  C C    . VAL A 1 12  ? 9.076   -7.591  -10.325 1.00 0.22  ? 12  VAL A C    3  
ATOM 4419  O O    . VAL A 1 12  ? 8.393   -6.948  -9.530  1.00 0.20  ? 12  VAL A O    3  
ATOM 4420  C CB   . VAL A 1 12  ? 8.839   -7.078  -12.786 1.00 0.25  ? 12  VAL A CB   3  
ATOM 4421  C CG1  . VAL A 1 12  ? 7.937   -5.860  -12.756 1.00 0.24  ? 12  VAL A CG1  3  
ATOM 4422  C CG2  . VAL A 1 12  ? 10.309  -6.659  -12.725 1.00 0.25  ? 12  VAL A CG2  3  
ATOM 4423  H H    . VAL A 1 12  ? 6.482   -7.485  -11.394 1.00 0.27  ? 12  VAL A H    3  
ATOM 4424  H HA   . VAL A 1 12  ? 8.930   -9.034  -11.881 1.00 0.28  ? 12  VAL A HA   3  
ATOM 4425  H HB   . VAL A 1 12  ? 8.679   -7.578  -13.723 1.00 0.29  ? 12  VAL A HB   3  
ATOM 4426  H HG11 . VAL A 1 12  ? 8.350   -5.088  -13.387 1.00 1.04  ? 12  VAL A HG11 3  
ATOM 4427  H HG12 . VAL A 1 12  ? 7.853   -5.499  -11.744 1.00 1.04  ? 12  VAL A HG12 3  
ATOM 4428  H HG13 . VAL A 1 12  ? 6.957   -6.132  -13.120 1.00 1.04  ? 12  VAL A HG13 3  
ATOM 4429  H HG21 . VAL A 1 12  ? 10.485  -5.853  -13.421 1.00 0.98  ? 12  VAL A HG21 3  
ATOM 4430  H HG22 . VAL A 1 12  ? 10.933  -7.502  -12.982 1.00 0.95  ? 12  VAL A HG22 3  
ATOM 4431  H HG23 . VAL A 1 12  ? 10.553  -6.332  -11.720 1.00 0.99  ? 12  VAL A HG23 3  
ATOM 4432  N N    . SER A 1 13  ? 10.315  -7.947  -10.078 1.00 0.23  ? 13  SER A N    3  
ATOM 4433  C CA   . SER A 1 13  ? 10.974  -7.608  -8.840  1.00 0.22  ? 13  SER A CA   3  
ATOM 4434  C C    . SER A 1 13  ? 11.756  -6.300  -8.952  1.00 0.19  ? 13  SER A C    3  
ATOM 4435  O O    . SER A 1 13  ? 12.244  -5.938  -10.027 1.00 0.20  ? 13  SER A O    3  
ATOM 4436  C CB   . SER A 1 13  ? 11.914  -8.722  -8.457  1.00 0.27  ? 13  SER A CB   3  
ATOM 4437  O OG   . SER A 1 13  ? 11.275  -9.989  -8.537  1.00 1.29  ? 13  SER A OG   3  
ATOM 4438  H H    . SER A 1 13  ? 10.806  -8.452  -10.757 1.00 0.26  ? 13  SER A H    3  
ATOM 4439  H HA   . SER A 1 13  ? 10.220  -7.509  -8.074  1.00 0.21  ? 13  SER A HA   3  
ATOM 4440  H HB2  . SER A 1 13  ? 12.757  -8.709  -9.128  1.00 1.03  ? 13  SER A HB2  3  
ATOM 4441  H HB3  . SER A 1 13  ? 12.240  -8.558  -7.444  1.00 0.99  ? 13  SER A HB3  3  
ATOM 4442  H HG   . SER A 1 13  ? 11.723  -10.609 -7.950  1.00 1.80  ? 13  SER A HG   3  
ATOM 4443  N N    . GLY A 1 14  ? 11.881  -5.608  -7.831  1.00 0.17  ? 14  GLY A N    3  
ATOM 4444  C CA   . GLY A 1 14  ? 12.582  -4.341  -7.794  1.00 0.17  ? 14  GLY A CA   3  
ATOM 4445  C C    . GLY A 1 14  ? 12.852  -3.890  -6.377  1.00 0.15  ? 14  GLY A C    3  
ATOM 4446  O O    . GLY A 1 14  ? 13.016  -4.714  -5.486  1.00 0.15  ? 14  GLY A O    3  
ATOM 4447  H H    . GLY A 1 14  ? 11.480  -5.964  -7.002  1.00 0.18  ? 14  GLY A H    3  
ATOM 4448  H HA2  . GLY A 1 14  ? 13.517  -4.437  -8.321  1.00 0.22  ? 14  GLY A HA2  3  
ATOM 4449  H HA3  . GLY A 1 14  ? 11.977  -3.594  -8.285  1.00 0.18  ? 14  GLY A HA3  3  
ATOM 4450  N N    . ILE A 1 15  ? 12.932  -2.585  -6.180  1.00 0.13  ? 15  ILE A N    3  
ATOM 4451  C CA   . ILE A 1 15  ? 13.026  -1.995  -4.854  1.00 0.12  ? 15  ILE A CA   3  
ATOM 4452  C C    . ILE A 1 15  ? 11.869  -1.028  -4.655  1.00 0.12  ? 15  ILE A C    3  
ATOM 4453  O O    . ILE A 1 15  ? 11.429  -0.383  -5.603  1.00 0.13  ? 15  ILE A O    3  
ATOM 4454  C CB   . ILE A 1 15  ? 14.373  -1.232  -4.641  1.00 0.14  ? 15  ILE A CB   3  
ATOM 4455  C CG1  . ILE A 1 15  ? 15.508  -2.185  -4.268  1.00 0.16  ? 15  ILE A CG1  3  
ATOM 4456  C CG2  . ILE A 1 15  ? 14.248  -0.146  -3.577  1.00 0.15  ? 15  ILE A CG2  3  
ATOM 4457  C CD1  . ILE A 1 15  ? 15.898  -3.139  -5.362  1.00 0.18  ? 15  ILE A CD1  3  
ATOM 4458  H H    . ILE A 1 15  ? 12.933  -1.987  -6.961  1.00 0.14  ? 15  ILE A H    3  
ATOM 4459  H HA   . ILE A 1 15  ? 12.958  -2.789  -4.126  1.00 0.12  ? 15  ILE A HA   3  
ATOM 4460  H HB   . ILE A 1 15  ? 14.623  -0.747  -5.573  1.00 0.15  ? 15  ILE A HB   3  
ATOM 4461  H HG12 . ILE A 1 15  ? 16.379  -1.605  -4.019  1.00 0.18  ? 15  ILE A HG12 3  
ATOM 4462  H HG13 . ILE A 1 15  ? 15.214  -2.770  -3.406  1.00 0.16  ? 15  ILE A HG13 3  
ATOM 4463  H HG21 . ILE A 1 15  ? 13.561  0.615   -3.920  1.00 0.97  ? 15  ILE A HG21 3  
ATOM 4464  H HG22 . ILE A 1 15  ? 15.215  0.298   -3.397  1.00 0.94  ? 15  ILE A HG22 3  
ATOM 4465  H HG23 . ILE A 1 15  ? 13.873  -0.580  -2.657  1.00 0.99  ? 15  ILE A HG23 3  
ATOM 4466  H HD11 . ILE A 1 15  ? 16.773  -3.690  -5.057  1.00 1.01  ? 15  ILE A HD11 3  
ATOM 4467  H HD12 . ILE A 1 15  ? 16.107  -2.584  -6.267  1.00 1.05  ? 15  ILE A HD12 3  
ATOM 4468  H HD13 . ILE A 1 15  ? 15.084  -3.824  -5.538  1.00 1.03  ? 15  ILE A HD13 3  
ATOM 4469  N N    . ILE A 1 16  ? 11.379  -0.935  -3.435  1.00 0.11  ? 16  ILE A N    3  
ATOM 4470  C CA   . ILE A 1 16  ? 10.428  0.093   -3.085  1.00 0.11  ? 16  ILE A CA   3  
ATOM 4471  C C    . ILE A 1 16  ? 11.199  1.196   -2.360  1.00 0.11  ? 16  ILE A C    3  
ATOM 4472  O O    . ILE A 1 16  ? 12.001  0.909   -1.479  1.00 0.13  ? 16  ILE A O    3  
ATOM 4473  C CB   . ILE A 1 16  ? 9.283   -0.467  -2.210  1.00 0.12  ? 16  ILE A CB   3  
ATOM 4474  C CG1  . ILE A 1 16  ? 7.940   -0.194  -2.870  1.00 0.13  ? 16  ILE A CG1  3  
ATOM 4475  C CG2  . ILE A 1 16  ? 9.291   0.109   -0.807  1.00 0.14  ? 16  ILE A CG2  3  
ATOM 4476  C CD1  . ILE A 1 16  ? 6.771   -0.621  -2.022  1.00 0.17  ? 16  ILE A CD1  3  
ATOM 4477  H H    . ILE A 1 16  ? 11.675  -1.572  -2.746  1.00 0.12  ? 16  ILE A H    3  
ATOM 4478  H HA   . ILE A 1 16  ? 10.004  0.481   -3.998  1.00 0.11  ? 16  ILE A HA   3  
ATOM 4479  H HB   . ILE A 1 16  ? 9.418   -1.531  -2.132  1.00 0.14  ? 16  ILE A HB   3  
ATOM 4480  H HG12 . ILE A 1 16  ? 7.845   0.861   -3.065  1.00 0.13  ? 16  ILE A HG12 3  
ATOM 4481  H HG13 . ILE A 1 16  ? 7.888   -0.730  -3.798  1.00 0.14  ? 16  ILE A HG13 3  
ATOM 4482  H HG21 . ILE A 1 16  ? 10.202  -0.178  -0.305  1.00 1.01  ? 16  ILE A HG21 3  
ATOM 4483  H HG22 . ILE A 1 16  ? 8.442   -0.270  -0.262  1.00 1.04  ? 16  ILE A HG22 3  
ATOM 4484  H HG23 . ILE A 1 16  ? 9.232   1.186   -0.866  1.00 1.01  ? 16  ILE A HG23 3  
ATOM 4485  H HD11 . ILE A 1 16  ? 6.774   -1.697  -1.922  1.00 1.04  ? 16  ILE A HD11 3  
ATOM 4486  H HD12 . ILE A 1 16  ? 5.850   -0.304  -2.490  1.00 1.06  ? 16  ILE A HD12 3  
ATOM 4487  H HD13 . ILE A 1 16  ? 6.851   -0.171  -1.044  1.00 1.00  ? 16  ILE A HD13 3  
ATOM 4488  N N    . ALA A 1 17  ? 11.012  2.436   -2.772  1.00 0.12  ? 17  ALA A N    3  
ATOM 4489  C CA   . ALA A 1 17  ? 11.852  3.528   -2.289  1.00 0.13  ? 17  ALA A CA   3  
ATOM 4490  C C    . ALA A 1 17  ? 11.047  4.792   -2.017  1.00 0.13  ? 17  ALA A C    3  
ATOM 4491  O O    . ALA A 1 17  ? 10.557  5.436   -2.938  1.00 0.15  ? 17  ALA A O    3  
ATOM 4492  C CB   . ALA A 1 17  ? 12.951  3.812   -3.301  1.00 0.15  ? 17  ALA A CB   3  
ATOM 4493  H H    . ALA A 1 17  ? 10.303  2.622   -3.421  1.00 0.12  ? 17  ALA A H    3  
ATOM 4494  H HA   . ALA A 1 17  ? 12.319  3.207   -1.370  1.00 0.13  ? 17  ALA A HA   3  
ATOM 4495  H HB1  . ALA A 1 17  ? 12.508  4.024   -4.269  1.00 1.00  ? 17  ALA A HB1  3  
ATOM 4496  H HB2  . ALA A 1 17  ? 13.600  2.949   -3.378  1.00 0.99  ? 17  ALA A HB2  3  
ATOM 4497  H HB3  . ALA A 1 17  ? 13.528  4.666   -2.975  1.00 1.00  ? 17  ALA A HB3  3  
ATOM 4498  N N    . ILE A 1 18  ? 10.924  5.146   -0.752  1.00 0.17  ? 18  ILE A N    3  
ATOM 4499  C CA   . ILE A 1 18  ? 10.191  6.338   -0.356  1.00 0.15  ? 18  ILE A CA   3  
ATOM 4500  C C    . ILE A 1 18  ? 11.146  7.513   -0.202  1.00 0.16  ? 18  ILE A C    3  
ATOM 4501  O O    . ILE A 1 18  ? 12.160  7.421   0.496   1.00 0.23  ? 18  ILE A O    3  
ATOM 4502  C CB   . ILE A 1 18  ? 9.393   6.123   0.957   1.00 0.18  ? 18  ILE A CB   3  
ATOM 4503  C CG1  . ILE A 1 18  ? 8.317   5.059   0.767   1.00 0.21  ? 18  ILE A CG1  3  
ATOM 4504  C CG2  . ILE A 1 18  ? 8.744   7.414   1.426   1.00 0.18  ? 18  ILE A CG2  3  
ATOM 4505  C CD1  . ILE A 1 18  ? 8.829   3.634   0.723   1.00 0.21  ? 18  ILE A CD1  3  
ATOM 4506  H H    . ILE A 1 18  ? 11.344  4.590   -0.057  1.00 0.25  ? 18  ILE A H    3  
ATOM 4507  H HA   . ILE A 1 18  ? 9.488   6.567   -1.143  1.00 0.15  ? 18  ILE A HA   3  
ATOM 4508  H HB   . ILE A 1 18  ? 10.077  5.799   1.727   1.00 0.20  ? 18  ILE A HB   3  
ATOM 4509  H HG12 . ILE A 1 18  ? 7.613   5.130   1.582   1.00 0.27  ? 18  ILE A HG12 3  
ATOM 4510  H HG13 . ILE A 1 18  ? 7.800   5.251   -0.161  1.00 0.22  ? 18  ILE A HG13 3  
ATOM 4511  H HG21 . ILE A 1 18  ? 8.121   7.205   2.286   1.00 1.02  ? 18  ILE A HG21 3  
ATOM 4512  H HG22 . ILE A 1 18  ? 8.135   7.819   0.631   1.00 1.03  ? 18  ILE A HG22 3  
ATOM 4513  H HG23 . ILE A 1 18  ? 9.510   8.124   1.696   1.00 1.03  ? 18  ILE A HG23 3  
ATOM 4514  H HD11 . ILE A 1 18  ? 9.618   3.554   -0.010  1.00 1.03  ? 18  ILE A HD11 3  
ATOM 4515  H HD12 . ILE A 1 18  ? 8.014   2.978   0.451   1.00 1.03  ? 18  ILE A HD12 3  
ATOM 4516  H HD13 . ILE A 1 18  ? 9.205   3.352   1.701   1.00 0.99  ? 18  ILE A HD13 3  
ATOM 4517  N N    . ASN A 1 19  ? 10.819  8.606   -0.866  1.00 0.19  ? 19  ASN A N    3  
ATOM 4518  C CA   . ASN A 1 19  ? 11.680  9.776   -0.904  1.00 0.33  ? 19  ASN A CA   3  
ATOM 4519  C C    . ASN A 1 19  ? 10.991  10.958  -0.257  1.00 0.31  ? 19  ASN A C    3  
ATOM 4520  O O    . ASN A 1 19  ? 9.838   11.252  -0.575  1.00 0.55  ? 19  ASN A O    3  
ATOM 4521  C CB   . ASN A 1 19  ? 12.006  10.133  -2.359  1.00 0.54  ? 19  ASN A CB   3  
ATOM 4522  C CG   . ASN A 1 19  ? 13.187  11.081  -2.496  1.00 0.83  ? 19  ASN A CG   3  
ATOM 4523  O OD1  . ASN A 1 19  ? 13.494  11.855  -1.592  1.00 1.36  ? 19  ASN A OD1  3  
ATOM 4524  N ND2  . ASN A 1 19  ? 13.845  11.043  -3.642  1.00 1.00  ? 19  ASN A ND2  3  
ATOM 4525  H H    . ASN A 1 19  ? 9.961   8.631   -1.350  1.00 0.20  ? 19  ASN A H    3  
ATOM 4526  H HA   . ASN A 1 19  ? 12.590  9.559   -0.372  1.00 0.40  ? 19  ASN A HA   3  
ATOM 4527  H HB2  . ASN A 1 19  ? 12.226  9.231   -2.903  1.00 1.02  ? 19  ASN A HB2  3  
ATOM 4528  H HB3  . ASN A 1 19  ? 11.141  10.605  -2.803  1.00 0.61  ? 19  ASN A HB3  3  
ATOM 4529  H HD21 . ASN A 1 19  ? 13.537  10.418  -4.333  1.00 1.07  ? 19  ASN A HD21 3  
ATOM 4530  H HD22 . ASN A 1 19  ? 14.618  11.638  -3.753  1.00 1.32  ? 19  ASN A HD22 3  
ATOM 4531  N N    . GLU A 1 20  ? 11.679  11.641  0.647   1.00 0.36  ? 20  GLU A N    3  
ATOM 4532  C CA   . GLU A 1 20  ? 11.182  12.911  1.107   1.00 0.31  ? 20  GLU A CA   3  
ATOM 4533  C C    . GLU A 1 20  ? 12.269  13.957  0.882   1.00 0.67  ? 20  GLU A C    3  
ATOM 4534  O O    . GLU A 1 20  ? 12.921  14.419  1.819   1.00 1.47  ? 20  GLU A O    3  
ATOM 4535  C CB   . GLU A 1 20  ? 10.873  12.831  2.606   1.00 0.52  ? 20  GLU A CB   3  
ATOM 4536  C CG   . GLU A 1 20  ? 10.192  11.545  3.034   1.00 0.71  ? 20  GLU A CG   3  
ATOM 4537  C CD   . GLU A 1 20  ? 10.112  11.404  4.539   1.00 1.18  ? 20  GLU A CD   3  
ATOM 4538  O OE1  . GLU A 1 20  ? 9.412   12.208  5.183   1.00 1.47  ? 20  GLU A OE1  3  
ATOM 4539  O OE2  . GLU A 1 20  ? 10.748  10.481  5.085   1.00 1.41  ? 20  GLU A OE2  3  
ATOM 4540  H H    . GLU A 1 20  ? 12.538  11.308  0.967   1.00 0.66  ? 20  GLU A H    3  
ATOM 4541  H HA   . GLU A 1 20  ? 10.286  13.155  0.556   1.00 0.58  ? 20  GLU A HA   3  
ATOM 4542  H HB2  . GLU A 1 20  ? 11.797  12.920  3.153   1.00 0.71  ? 20  GLU A HB2  3  
ATOM 4543  H HB3  . GLU A 1 20  ? 10.230  13.654  2.870   1.00 0.70  ? 20  GLU A HB3  3  
ATOM 4544  H HG2  . GLU A 1 20  ? 9.192   11.524  2.631   1.00 0.85  ? 20  GLU A HG2  3  
ATOM 4545  H HG3  . GLU A 1 20  ? 10.753  10.717  2.640   1.00 0.53  ? 20  GLU A HG3  3  
ATOM 4546  N N    . ASP A 1 21  ? 12.461  14.304  -0.376  1.00 0.99  ? 21  ASP A N    3  
ATOM 4547  C CA   . ASP A 1 21  ? 13.218  15.483  -0.785  1.00 1.38  ? 21  ASP A CA   3  
ATOM 4548  C C    . ASP A 1 21  ? 12.262  16.464  -1.425  1.00 0.91  ? 21  ASP A C    3  
ATOM 4549  O O    . ASP A 1 21  ? 12.489  17.673  -1.506  1.00 0.88  ? 21  ASP A O    3  
ATOM 4550  C CB   . ASP A 1 21  ? 14.302  15.087  -1.786  1.00 2.11  ? 21  ASP A CB   3  
ATOM 4551  C CG   . ASP A 1 21  ? 15.253  16.223  -2.101  1.00 2.89  ? 21  ASP A CG   3  
ATOM 4552  O OD1  . ASP A 1 21  ? 14.952  17.029  -3.005  1.00 3.67  ? 21  ASP A OD1  3  
ATOM 4553  O OD2  . ASP A 1 21  ? 16.312  16.310  -1.447  1.00 2.89  ? 21  ASP A OD2  3  
ATOM 4554  H H    . ASP A 1 21  ? 12.097  13.719  -1.072  1.00 1.43  ? 21  ASP A H    3  
ATOM 4555  H HA   . ASP A 1 21  ? 13.669  15.929  0.089   1.00 1.72  ? 21  ASP A HA   3  
ATOM 4556  H HB2  . ASP A 1 21  ? 14.868  14.266  -1.381  1.00 1.95  ? 21  ASP A HB2  3  
ATOM 4557  H HB3  . ASP A 1 21  ? 13.831  14.771  -2.706  1.00 2.52  ? 21  ASP A HB3  3  
ATOM 4558  N N    . VAL A 1 22  ? 11.173  15.873  -1.857  1.00 0.60  ? 22  VAL A N    3  
ATOM 4559  C CA   . VAL A 1 22  ? 10.279  16.427  -2.842  1.00 0.46  ? 22  VAL A CA   3  
ATOM 4560  C C    . VAL A 1 22  ? 8.976   16.893  -2.223  1.00 0.40  ? 22  VAL A C    3  
ATOM 4561  O O    . VAL A 1 22  ? 8.841   16.994  -1.001  1.00 0.48  ? 22  VAL A O    3  
ATOM 4562  C CB   . VAL A 1 22  ? 9.978   15.388  -3.949  1.00 0.57  ? 22  VAL A CB   3  
ATOM 4563  C CG1  . VAL A 1 22  ? 11.208  15.127  -4.791  1.00 0.90  ? 22  VAL A CG1  3  
ATOM 4564  C CG2  . VAL A 1 22  ? 9.503   14.075  -3.355  1.00 0.41  ? 22  VAL A CG2  3  
ATOM 4565  H H    . VAL A 1 22  ? 10.949  14.999  -1.482  1.00 0.53  ? 22  VAL A H    3  
ATOM 4566  H HA   . VAL A 1 22  ? 10.769  17.267  -3.299  1.00 0.55  ? 22  VAL A HA   3  
ATOM 4567  H HB   . VAL A 1 22  ? 9.200   15.776  -4.588  1.00 0.68  ? 22  VAL A HB   3  
ATOM 4568  H HG11 . VAL A 1 22  ? 10.964  14.414  -5.564  1.00 1.47  ? 22  VAL A HG11 3  
ATOM 4569  H HG12 . VAL A 1 22  ? 11.985  14.719  -4.161  1.00 1.33  ? 22  VAL A HG12 3  
ATOM 4570  H HG13 . VAL A 1 22  ? 11.547  16.048  -5.238  1.00 1.36  ? 22  VAL A HG13 3  
ATOM 4571  H HG21 . VAL A 1 22  ? 9.216   13.401  -4.151  1.00 1.16  ? 22  VAL A HG21 3  
ATOM 4572  H HG22 . VAL A 1 22  ? 8.656   14.253  -2.709  1.00 1.06  ? 22  VAL A HG22 3  
ATOM 4573  H HG23 . VAL A 1 22  ? 10.309  13.634  -2.787  1.00 1.02  ? 22  VAL A HG23 3  
ATOM 4574  N N    . SER A 1 23  ? 8.035   17.183  -3.093  1.00 0.47  ? 23  SER A N    3  
ATOM 4575  C CA   . SER A 1 23  ? 6.681   17.503  -2.696  1.00 0.58  ? 23  SER A CA   3  
ATOM 4576  C C    . SER A 1 23  ? 6.060   16.181  -2.241  1.00 0.46  ? 23  SER A C    3  
ATOM 4577  O O    . SER A 1 23  ? 6.664   15.145  -2.515  1.00 0.39  ? 23  SER A O    3  
ATOM 4578  C CB   . SER A 1 23  ? 5.945   18.114  -3.896  1.00 0.77  ? 23  SER A CB   3  
ATOM 4579  O OG   . SER A 1 23  ? 6.023   17.263  -5.031  1.00 1.23  ? 23  SER A OG   3  
ATOM 4580  H H    . SER A 1 23  ? 8.260   17.176  -4.042  1.00 0.53  ? 23  SER A H    3  
ATOM 4581  H HA   . SER A 1 23  ? 6.710   18.200  -1.873  1.00 0.66  ? 23  SER A HA   3  
ATOM 4582  H HB2  . SER A 1 23  ? 4.909   18.267  -3.646  1.00 1.36  ? 23  SER A HB2  3  
ATOM 4583  H HB3  . SER A 1 23  ? 6.397   19.062  -4.144  1.00 1.21  ? 23  SER A HB3  3  
ATOM 4584  H HG   . SER A 1 23  ? 6.110   16.345  -4.738  1.00 1.72  ? 23  SER A HG   3  
ATOM 4585  N N    . PRO A 1 24  ? 4.863   16.161  -1.601  1.00 0.46  ? 24  PRO A N    3  
ATOM 4586  C CA   . PRO A 1 24  ? 4.522   15.151  -0.595  1.00 0.39  ? 24  PRO A CA   3  
ATOM 4587  C C    . PRO A 1 24  ? 5.114   13.780  -0.882  1.00 0.27  ? 24  PRO A C    3  
ATOM 4588  O O    . PRO A 1 24  ? 4.919   13.218  -1.965  1.00 0.24  ? 24  PRO A O    3  
ATOM 4589  C CB   . PRO A 1 24  ? 3.008   15.071  -0.681  1.00 0.43  ? 24  PRO A CB   3  
ATOM 4590  C CG   . PRO A 1 24  ? 2.554   16.377  -1.229  1.00 0.50  ? 24  PRO A CG   3  
ATOM 4591  C CD   . PRO A 1 24  ? 3.747   17.087  -1.820  1.00 0.56  ? 24  PRO A CD   3  
ATOM 4592  H HA   . PRO A 1 24  ? 4.799   15.471  0.391   1.00 0.45  ? 24  PRO A HA   3  
ATOM 4593  H HB2  . PRO A 1 24  ? 2.731   14.256  -1.333  1.00 0.39  ? 24  PRO A HB2  3  
ATOM 4594  H HB3  . PRO A 1 24  ? 2.604   14.897  0.304   1.00 0.48  ? 24  PRO A HB3  3  
ATOM 4595  H HG2  . PRO A 1 24  ? 1.829   16.192  -1.994  1.00 0.47  ? 24  PRO A HG2  3  
ATOM 4596  H HG3  . PRO A 1 24  ? 2.118   16.973  -0.440  1.00 0.58  ? 24  PRO A HG3  3  
ATOM 4597  H HD2  . PRO A 1 24  ? 3.591   17.252  -2.874  1.00 0.59  ? 24  PRO A HD2  3  
ATOM 4598  H HD3  . PRO A 1 24  ? 3.917   18.023  -1.311  1.00 0.69  ? 24  PRO A HD3  3  
ATOM 4599  N N    . ALA A 1 25  ? 5.819   13.267  0.137   1.00 0.25  ? 25  ALA A N    3  
ATOM 4600  C CA   . ALA A 1 25  ? 6.710   12.112  0.024   1.00 0.19  ? 25  ALA A CA   3  
ATOM 4601  C C    . ALA A 1 25  ? 6.149   11.042  -0.877  1.00 0.14  ? 25  ALA A C    3  
ATOM 4602  O O    . ALA A 1 25  ? 4.990   10.665  -0.761  1.00 0.17  ? 25  ALA A O    3  
ATOM 4603  C CB   . ALA A 1 25  ? 6.988   11.530  1.395   1.00 0.27  ? 25  ALA A CB   3  
ATOM 4604  H H    . ALA A 1 25  ? 5.716   13.683  1.017   1.00 0.32  ? 25  ALA A H    3  
ATOM 4605  H HA   . ALA A 1 25  ? 7.647   12.456  -0.387  1.00 0.18  ? 25  ALA A HA   3  
ATOM 4606  H HB1  . ALA A 1 25  ? 6.076   11.100  1.793   1.00 1.02  ? 25  ALA A HB1  3  
ATOM 4607  H HB2  . ALA A 1 25  ? 7.341   12.311  2.053   1.00 1.10  ? 25  ALA A HB2  3  
ATOM 4608  H HB3  . ALA A 1 25  ? 7.742   10.762  1.314   1.00 1.05  ? 25  ALA A HB3  3  
ATOM 4609  N N    . GLU A 1 26  ? 6.974   10.550  -1.772  1.00 0.14  ? 26  GLU A N    3  
ATOM 4610  C CA   . GLU A 1 26  ? 6.511   9.608   -2.757  1.00 0.14  ? 26  GLU A CA   3  
ATOM 4611  C C    . GLU A 1 26  ? 7.236   8.283   -2.600  1.00 0.15  ? 26  GLU A C    3  
ATOM 4612  O O    . GLU A 1 26  ? 8.407   8.235   -2.220  1.00 0.19  ? 26  GLU A O    3  
ATOM 4613  C CB   . GLU A 1 26  ? 6.700   10.180  -4.169  1.00 0.21  ? 26  GLU A CB   3  
ATOM 4614  C CG   . GLU A 1 26  ? 7.241   11.599  -4.178  1.00 0.42  ? 26  GLU A CG   3  
ATOM 4615  C CD   . GLU A 1 26  ? 7.511   12.121  -5.570  1.00 0.54  ? 26  GLU A CD   3  
ATOM 4616  O OE1  . GLU A 1 26  ? 8.597   11.829  -6.112  1.00 0.69  ? 26  GLU A OE1  3  
ATOM 4617  O OE2  . GLU A 1 26  ? 6.637   12.810  -6.140  1.00 0.66  ? 26  GLU A OE2  3  
ATOM 4618  H H    . GLU A 1 26  ? 7.922   10.815  -1.762  1.00 0.18  ? 26  GLU A H    3  
ATOM 4619  H HA   . GLU A 1 26  ? 5.459   9.445   -2.583  1.00 0.15  ? 26  GLU A HA   3  
ATOM 4620  H HB2  . GLU A 1 26  ? 7.394   9.556   -4.708  1.00 0.33  ? 26  GLU A HB2  3  
ATOM 4621  H HB3  . GLU A 1 26  ? 5.743   10.182  -4.684  1.00 0.37  ? 26  GLU A HB3  3  
ATOM 4622  H HG2  . GLU A 1 26  ? 6.523   12.250  -3.702  1.00 0.59  ? 26  GLU A HG2  3  
ATOM 4623  H HG3  . GLU A 1 26  ? 8.155   11.614  -3.617  1.00 0.58  ? 26  GLU A HG3  3  
ATOM 4624  N N    . LEU A 1 27  ? 6.520   7.218   -2.891  1.00 0.15  ? 27  LEU A N    3  
ATOM 4625  C CA   . LEU A 1 27  ? 7.049   5.876   -2.828  1.00 0.16  ? 27  LEU A CA   3  
ATOM 4626  C C    . LEU A 1 27  ? 7.330   5.397   -4.230  1.00 0.16  ? 27  LEU A C    3  
ATOM 4627  O O    . LEU A 1 27  ? 6.479   5.466   -5.098  1.00 0.19  ? 27  LEU A O    3  
ATOM 4628  C CB   . LEU A 1 27  ? 6.051   4.944   -2.141  1.00 0.21  ? 27  LEU A CB   3  
ATOM 4629  C CG   . LEU A 1 27  ? 6.233   3.452   -2.441  1.00 0.29  ? 27  LEU A CG   3  
ATOM 4630  C CD1  . LEU A 1 27  ? 5.862   2.637   -1.232  1.00 0.53  ? 27  LEU A CD1  3  
ATOM 4631  C CD2  . LEU A 1 27  ? 5.374   3.031   -3.629  1.00 0.59  ? 27  LEU A CD2  3  
ATOM 4632  H H    . LEU A 1 27  ? 5.583   7.343   -3.162  1.00 0.15  ? 27  LEU A H    3  
ATOM 4633  H HA   . LEU A 1 27  ? 7.970   5.893   -2.266  1.00 0.17  ? 27  LEU A HA   3  
ATOM 4634  H HB2  . LEU A 1 27  ? 6.135   5.089   -1.075  1.00 0.23  ? 27  LEU A HB2  3  
ATOM 4635  H HB3  . LEU A 1 27  ? 5.059   5.228   -2.446  1.00 0.24  ? 27  LEU A HB3  3  
ATOM 4636  H HG   . LEU A 1 27  ? 7.268   3.254   -2.679  1.00 0.70  ? 27  LEU A HG   3  
ATOM 4637  H HD11 . LEU A 1 27  ? 6.201   1.621   -1.369  1.00 1.19  ? 27  LEU A HD11 3  
ATOM 4638  H HD12 . LEU A 1 27  ? 4.791   2.647   -1.116  1.00 1.10  ? 27  LEU A HD12 3  
ATOM 4639  H HD13 . LEU A 1 27  ? 6.327   3.060   -0.358  1.00 1.21  ? 27  LEU A HD13 3  
ATOM 4640  H HD21 . LEU A 1 27  ? 5.761   3.492   -4.534  1.00 1.11  ? 27  LEU A HD21 3  
ATOM 4641  H HD22 . LEU A 1 27  ? 4.350   3.356   -3.468  1.00 1.22  ? 27  LEU A HD22 3  
ATOM 4642  H HD23 . LEU A 1 27  ? 5.401   1.957   -3.733  1.00 1.17  ? 27  LEU A HD23 3  
ATOM 4643  N N    . THR A 1 28  ? 8.516   4.920   -4.450  1.00 0.16  ? 28  THR A N    3  
ATOM 4644  C CA   . THR A 1 28  ? 8.917   4.538   -5.773  1.00 0.17  ? 28  THR A CA   3  
ATOM 4645  C C    . THR A 1 28  ? 9.266   3.067   -5.828  1.00 0.17  ? 28  THR A C    3  
ATOM 4646  O O    . THR A 1 28  ? 10.298  2.656   -5.310  1.00 0.17  ? 28  THR A O    3  
ATOM 4647  C CB   . THR A 1 28  ? 10.150  5.344   -6.188  1.00 0.19  ? 28  THR A CB   3  
ATOM 4648  O OG1  . THR A 1 28  ? 9.989   6.716   -5.805  1.00 0.22  ? 28  THR A OG1  3  
ATOM 4649  C CG2  . THR A 1 28  ? 10.385  5.259   -7.683  1.00 0.22  ? 28  THR A CG2  3  
ATOM 4650  H H    . THR A 1 28  ? 9.149   4.829   -3.704  1.00 0.16  ? 28  THR A H    3  
ATOM 4651  H HA   . THR A 1 28  ? 8.113   4.752   -6.459  1.00 0.18  ? 28  THR A HA   3  
ATOM 4652  H HB   . THR A 1 28  ? 11.004  4.932   -5.678  1.00 0.20  ? 28  THR A HB   3  
ATOM 4653  H HG1  . THR A 1 28  ? 9.846   6.763   -4.851  1.00 0.24  ? 28  THR A HG1  3  
ATOM 4654  H HG21 . THR A 1 28  ? 9.580   5.765   -8.202  1.00 1.06  ? 28  THR A HG21 3  
ATOM 4655  H HG22 . THR A 1 28  ? 10.421  4.221   -7.985  1.00 1.00  ? 28  THR A HG22 3  
ATOM 4656  H HG23 . THR A 1 28  ? 11.323  5.732   -7.925  1.00 1.03  ? 28  THR A HG23 3  
ATOM 4657  N N    . TRP A 1 29  ? 8.422   2.265   -6.446  1.00 0.19  ? 29  TRP A N    3  
ATOM 4658  C CA   . TRP A 1 29  ? 8.822   0.911   -6.735  1.00 0.18  ? 29  TRP A CA   3  
ATOM 4659  C C    . TRP A 1 29  ? 9.509   0.907   -8.079  1.00 0.19  ? 29  TRP A C    3  
ATOM 4660  O O    . TRP A 1 29  ? 8.921   1.296   -9.090  1.00 0.22  ? 29  TRP A O    3  
ATOM 4661  C CB   . TRP A 1 29  ? 7.664   -0.093  -6.731  1.00 0.20  ? 29  TRP A CB   3  
ATOM 4662  C CG   . TRP A 1 29  ? 8.156   -1.485  -6.996  1.00 0.18  ? 29  TRP A CG   3  
ATOM 4663  C CD1  . TRP A 1 29  ? 8.480   -2.422  -6.063  1.00 0.17  ? 29  TRP A CD1  3  
ATOM 4664  C CD2  . TRP A 1 29  ? 8.424   -2.082  -8.275  1.00 0.17  ? 29  TRP A CD2  3  
ATOM 4665  N NE1  . TRP A 1 29  ? 8.929   -3.565  -6.681  1.00 0.16  ? 29  TRP A NE1  3  
ATOM 4666  C CE2  . TRP A 1 29  ? 8.901   -3.379  -8.036  1.00 0.15  ? 29  TRP A CE2  3  
ATOM 4667  C CE3  . TRP A 1 29  ? 8.303   -1.648  -9.600  1.00 0.18  ? 29  TRP A CE3  3  
ATOM 4668  C CZ2  . TRP A 1 29  ? 9.259   -4.238  -9.067  1.00 0.15  ? 29  TRP A CZ2  3  
ATOM 4669  C CZ3  . TRP A 1 29  ? 8.656   -2.508  -10.619 1.00 0.18  ? 29  TRP A CZ3  3  
ATOM 4670  C CH2  . TRP A 1 29  ? 9.129   -3.791  -10.344 1.00 0.17  ? 29  TRP A CH2  3  
ATOM 4671  H H    . TRP A 1 29  ? 7.540   2.594   -6.722  1.00 0.21  ? 29  TRP A H    3  
ATOM 4672  H HA   . TRP A 1 29  ? 9.543   0.618   -5.984  1.00 0.18  ? 29  TRP A HA   3  
ATOM 4673  H HB2  . TRP A 1 29  ? 7.182   -0.080  -5.764  1.00 0.22  ? 29  TRP A HB2  3  
ATOM 4674  H HB3  . TRP A 1 29  ? 6.949   0.164   -7.494  1.00 0.22  ? 29  TRP A HB3  3  
ATOM 4675  H HD1  . TRP A 1 29  ? 8.391   -2.271  -4.996  1.00 0.18  ? 29  TRP A HD1  3  
ATOM 4676  H HE1  . TRP A 1 29  ? 9.221   -4.387  -6.224  1.00 0.17  ? 29  TRP A HE1  3  
ATOM 4677  H HE3  . TRP A 1 29  ? 7.943   -0.659  -9.828  1.00 0.20  ? 29  TRP A HE3  3  
ATOM 4678  H HZ2  . TRP A 1 29  ? 9.632   -5.232  -8.882  1.00 0.16  ? 29  TRP A HZ2  3  
ATOM 4679  H HZ3  . TRP A 1 29  ? 8.568   -2.189  -11.648 1.00 0.20  ? 29  TRP A HZ3  3  
ATOM 4680  H HH2  . TRP A 1 29  ? 9.396   -4.437  -11.169 1.00 0.18  ? 29  TRP A HH2  3  
ATOM 4681  N N    . ARG A 1 30  ? 10.757  0.508   -8.082  1.00 0.19  ? 30  ARG A N    3  
ATOM 4682  C CA   . ARG A 1 30  ? 11.528  0.482   -9.285  1.00 0.21  ? 30  ARG A CA   3  
ATOM 4683  C C    . ARG A 1 30  ? 12.191  -0.878  -9.452  1.00 0.18  ? 30  ARG A C    3  
ATOM 4684  O O    . ARG A 1 30  ? 12.833  -1.388  -8.537  1.00 0.21  ? 30  ARG A O    3  
ATOM 4685  C CB   . ARG A 1 30  ? 12.523  1.621   -9.248  1.00 0.27  ? 30  ARG A CB   3  
ATOM 4686  C CG   . ARG A 1 30  ? 13.616  1.452   -8.261  1.00 0.32  ? 30  ARG A CG   3  
ATOM 4687  C CD   . ARG A 1 30  ? 14.249  2.791   -7.954  1.00 0.61  ? 30  ARG A CD   3  
ATOM 4688  N NE   . ARG A 1 30  ? 15.111  2.748   -6.776  1.00 0.50  ? 30  ARG A NE   3  
ATOM 4689  C CZ   . ARG A 1 30  ? 15.385  3.810   -6.016  1.00 1.09  ? 30  ARG A CZ   3  
ATOM 4690  N NH1  . ARG A 1 30  ? 14.913  5.009   -6.348  1.00 1.93  ? 30  ARG A NH1  3  
ATOM 4691  N NH2  . ARG A 1 30  ? 16.140  3.674   -4.932  1.00 1.05  ? 30  ARG A NH2  3  
ATOM 4692  H H    . ARG A 1 30  ? 11.179  0.229   -7.243  1.00 0.20  ? 30  ARG A H    3  
ATOM 4693  H HA   . ARG A 1 30  ? 10.862  0.644   -10.101 1.00 0.24  ? 30  ARG A HA   3  
ATOM 4694  H HB2  . ARG A 1 30  ? 12.970  1.728   -10.209 1.00 0.55  ? 30  ARG A HB2  3  
ATOM 4695  H HB3  . ARG A 1 30  ? 11.992  2.529   -9.004  1.00 0.51  ? 30  ARG A HB3  3  
ATOM 4696  H HG2  . ARG A 1 30  ? 13.215  1.004   -7.370  1.00 0.90  ? 30  ARG A HG2  3  
ATOM 4697  H HG3  . ARG A 1 30  ? 14.351  0.814   -8.702  1.00 0.90  ? 30  ARG A HG3  3  
ATOM 4698  H HD2  . ARG A 1 30  ? 14.834  3.090   -8.809  1.00 1.11  ? 30  ARG A HD2  3  
ATOM 4699  H HD3  . ARG A 1 30  ? 13.462  3.508   -7.794  1.00 1.10  ? 30  ARG A HD3  3  
ATOM 4700  H HE   . ARG A 1 30  ? 15.501  1.875   -6.533  1.00 0.65  ? 30  ARG A HE   3  
ATOM 4701  H HH11 . ARG A 1 30  ? 14.354  5.123   -7.175  1.00 2.07  ? 30  ARG A HH11 3  
ATOM 4702  H HH12 . ARG A 1 30  ? 15.116  5.810   -5.777  1.00 2.49  ? 30  ARG A HH12 3  
ATOM 4703  H HH21 . ARG A 1 30  ? 16.509  2.774   -4.682  1.00 0.78  ? 30  ARG A HH21 3  
ATOM 4704  H HH22 . ARG A 1 30  ? 16.350  4.469   -4.356  1.00 1.55  ? 30  ARG A HH22 3  
ATOM 4705  N N    . SER A 1 31  ? 11.995  -1.466  -10.620 1.00 0.17  ? 31  SER A N    3  
ATOM 4706  C CA   . SER A 1 31  ? 12.431  -2.820  -10.896 1.00 0.18  ? 31  SER A CA   3  
ATOM 4707  C C    . SER A 1 31  ? 13.954  -2.923  -10.803 1.00 0.19  ? 31  SER A C    3  
ATOM 4708  O O    . SER A 1 31  ? 14.671  -1.955  -11.067 1.00 0.27  ? 31  SER A O    3  
ATOM 4709  C CB   . SER A 1 31  ? 11.921  -3.222  -12.280 1.00 0.21  ? 31  SER A CB   3  
ATOM 4710  O OG   . SER A 1 31  ? 12.592  -2.514  -13.313 1.00 0.25  ? 31  SER A OG   3  
ATOM 4711  H H    . SER A 1 31  ? 11.555  -0.959  -11.337 1.00 0.22  ? 31  SER A H    3  
ATOM 4712  H HA   . SER A 1 31  ? 11.988  -3.473  -10.160 1.00 0.17  ? 31  SER A HA   3  
ATOM 4713  H HB2  . SER A 1 31  ? 12.059  -4.275  -12.420 1.00 0.25  ? 31  SER A HB2  3  
ATOM 4714  H HB3  . SER A 1 31  ? 10.867  -2.994  -12.342 1.00 0.22  ? 31  SER A HB3  3  
ATOM 4715  H HG   . SER A 1 31  ? 12.898  -3.143  -13.986 1.00 0.97  ? 31  SER A HG   3  
ATOM 4716  N N    . THR A 1 32  ? 14.439  -4.103  -10.407 1.00 0.21  ? 32  THR A N    3  
ATOM 4717  C CA   . THR A 1 32  ? 15.865  -4.319  -10.167 1.00 0.22  ? 32  THR A CA   3  
ATOM 4718  C C    . THR A 1 32  ? 16.693  -4.049  -11.418 1.00 0.44  ? 32  THR A C    3  
ATOM 4719  O O    . THR A 1 32  ? 17.853  -3.651  -11.329 1.00 0.67  ? 32  THR A O    3  
ATOM 4720  C CB   . THR A 1 32  ? 16.150  -5.751  -9.680  1.00 0.41  ? 32  THR A CB   3  
ATOM 4721  O OG1  . THR A 1 32  ? 15.450  -6.699  -10.496 1.00 0.97  ? 32  THR A OG1  3  
ATOM 4722  C CG2  . THR A 1 32  ? 15.750  -5.933  -8.224  1.00 0.44  ? 32  THR A CG2  3  
ATOM 4723  H H    . THR A 1 32  ? 13.816  -4.855  -10.279 1.00 0.29  ? 32  THR A H    3  
ATOM 4724  H HA   . THR A 1 32  ? 16.179  -3.637  -9.390  1.00 0.31  ? 32  THR A HA   3  
ATOM 4725  H HB   . THR A 1 32  ? 17.210  -5.927  -9.767  1.00 0.79  ? 32  THR A HB   3  
ATOM 4726  H HG1  . THR A 1 32  ? 16.005  -7.481  -10.621 1.00 1.28  ? 32  THR A HG1  3  
ATOM 4727  H HG21 . THR A 1 32  ? 16.184  -5.143  -7.629  1.00 1.02  ? 32  THR A HG21 3  
ATOM 4728  H HG22 . THR A 1 32  ? 16.112  -6.887  -7.870  1.00 1.14  ? 32  THR A HG22 3  
ATOM 4729  H HG23 . THR A 1 32  ? 14.676  -5.904  -8.138  1.00 1.25  ? 32  THR A HG23 3  
ATOM 4730  N N    . ASP A 1 33  ? 16.083  -4.262  -12.578 1.00 0.55  ? 33  ASP A N    3  
ATOM 4731  C CA   . ASP A 1 33  ? 16.736  -4.026  -13.855 1.00 0.89  ? 33  ASP A CA   3  
ATOM 4732  C C    . ASP A 1 33  ? 16.912  -2.532  -14.122 1.00 1.00  ? 33  ASP A C    3  
ATOM 4733  O O    . ASP A 1 33  ? 17.734  -2.135  -14.946 1.00 1.43  ? 33  ASP A O    3  
ATOM 4734  C CB   . ASP A 1 33  ? 15.936  -4.688  -14.980 1.00 1.09  ? 33  ASP A CB   3  
ATOM 4735  C CG   . ASP A 1 33  ? 14.446  -4.448  -14.860 1.00 1.88  ? 33  ASP A CG   3  
ATOM 4736  O OD1  . ASP A 1 33  ? 13.784  -5.185  -14.098 1.00 2.19  ? 33  ASP A OD1  3  
ATOM 4737  O OD2  . ASP A 1 33  ? 13.928  -3.521  -15.514 1.00 2.57  ? 33  ASP A OD2  3  
ATOM 4738  H H    . ASP A 1 33  ? 15.161  -4.596  -12.578 1.00 0.50  ? 33  ASP A H    3  
ATOM 4739  H HA   . ASP A 1 33  ? 17.712  -4.482  -13.811 1.00 1.02  ? 33  ASP A HA   3  
ATOM 4740  H HB2  . ASP A 1 33  ? 16.267  -4.292  -15.924 1.00 1.40  ? 33  ASP A HB2  3  
ATOM 4741  H HB3  . ASP A 1 33  ? 16.113  -5.754  -14.960 1.00 1.33  ? 33  ASP A HB3  3  
ATOM 4742  N N    . GLY A 1 34  ? 16.140  -1.706  -13.421 1.00 0.80  ? 34  GLY A N    3  
ATOM 4743  C CA   . GLY A 1 34  ? 16.320  -0.265  -13.501 1.00 1.07  ? 34  GLY A CA   3  
ATOM 4744  C C    . GLY A 1 34  ? 15.493  0.378   -14.596 1.00 0.75  ? 34  GLY A C    3  
ATOM 4745  O O    . GLY A 1 34  ? 15.632  1.572   -14.867 1.00 0.99  ? 34  GLY A O    3  
ATOM 4746  H H    . GLY A 1 34  ? 15.441  -2.079  -12.839 1.00 0.67  ? 34  GLY A H    3  
ATOM 4747  H HA2  . GLY A 1 34  ? 16.041  0.172   -12.555 1.00 1.36  ? 34  GLY A HA2  3  
ATOM 4748  H HA3  . GLY A 1 34  ? 17.364  -0.057  -13.687 1.00 1.41  ? 34  GLY A HA3  3  
ATOM 4749  N N    . ASP A 1 35  ? 14.635  -0.410  -15.225 1.00 0.62  ? 35  ASP A N    3  
ATOM 4750  C CA   . ASP A 1 35  ? 13.786  0.082   -16.305 1.00 1.00  ? 35  ASP A CA   3  
ATOM 4751  C C    . ASP A 1 35  ? 12.474  0.634   -15.763 1.00 0.69  ? 35  ASP A C    3  
ATOM 4752  O O    . ASP A 1 35  ? 12.083  1.761   -16.076 1.00 0.72  ? 35  ASP A O    3  
ATOM 4753  C CB   . ASP A 1 35  ? 13.518  -1.038  -17.303 1.00 1.52  ? 35  ASP A CB   3  
ATOM 4754  C CG   . ASP A 1 35  ? 12.349  -0.758  -18.230 1.00 2.13  ? 35  ASP A CG   3  
ATOM 4755  O OD1  . ASP A 1 35  ? 12.489  0.089   -19.136 1.00 2.16  ? 35  ASP A OD1  3  
ATOM 4756  O OD2  . ASP A 1 35  ? 11.293  -1.413  -18.074 1.00 2.64  ? 35  ASP A OD2  3  
ATOM 4757  H H    . ASP A 1 35  ? 14.571  -1.353  -14.961 1.00 0.67  ? 35  ASP A H    3  
ATOM 4758  H HA   . ASP A 1 35  ? 14.314  0.869   -16.805 1.00 1.44  ? 35  ASP A HA   3  
ATOM 4759  H HB2  . ASP A 1 35  ? 14.399  -1.185  -17.909 1.00 1.74  ? 35  ASP A HB2  3  
ATOM 4760  H HB3  . ASP A 1 35  ? 13.315  -1.938  -16.757 1.00 1.48  ? 35  ASP A HB3  3  
ATOM 4761  N N    . LYS A 1 36  ? 11.809  -0.157  -14.939 1.00 0.48  ? 36  LYS A N    3  
ATOM 4762  C CA   . LYS A 1 36  ? 10.519  0.221   -14.400 1.00 0.32  ? 36  LYS A CA   3  
ATOM 4763  C C    . LYS A 1 36  ? 10.662  1.006   -13.109 1.00 0.23  ? 36  LYS A C    3  
ATOM 4764  O O    . LYS A 1 36  ? 11.325  0.572   -12.180 1.00 0.39  ? 36  LYS A O    3  
ATOM 4765  C CB   . LYS A 1 36  ? 9.665   -1.022  -14.165 1.00 0.36  ? 36  LYS A CB   3  
ATOM 4766  C CG   . LYS A 1 36  ? 8.603   -1.226  -15.201 1.00 0.49  ? 36  LYS A CG   3  
ATOM 4767  C CD   . LYS A 1 36  ? 8.093   -2.629  -15.112 1.00 0.56  ? 36  LYS A CD   3  
ATOM 4768  C CE   . LYS A 1 36  ? 6.614   -2.693  -15.419 1.00 0.44  ? 36  LYS A CE   3  
ATOM 4769  N NZ   . LYS A 1 36  ? 6.293   -2.104  -16.748 1.00 1.20  ? 36  LYS A NZ   3  
ATOM 4770  H H    . LYS A 1 36  ? 12.200  -1.018  -14.679 1.00 0.50  ? 36  LYS A H    3  
ATOM 4771  H HA   . LYS A 1 36  ? 10.028  0.845   -15.130 1.00 0.44  ? 36  LYS A HA   3  
ATOM 4772  H HB2  . LYS A 1 36  ? 10.287  -1.891  -14.176 1.00 0.70  ? 36  LYS A HB2  3  
ATOM 4773  H HB3  . LYS A 1 36  ? 9.188   -0.957  -13.203 1.00 0.69  ? 36  LYS A HB3  3  
ATOM 4774  H HG2  . LYS A 1 36  ? 7.793   -0.543  -15.021 1.00 0.76  ? 36  LYS A HG2  3  
ATOM 4775  H HG3  . LYS A 1 36  ? 9.018   -1.058  -16.179 1.00 0.78  ? 36  LYS A HG3  3  
ATOM 4776  H HD2  . LYS A 1 36  ? 8.630   -3.244  -15.820 1.00 0.72  ? 36  LYS A HD2  3  
ATOM 4777  H HD3  . LYS A 1 36  ? 8.276   -2.983  -14.108 1.00 0.78  ? 36  LYS A HD3  3  
ATOM 4778  H HE2  . LYS A 1 36  ? 6.310   -3.722  -15.412 1.00 0.90  ? 36  LYS A HE2  3  
ATOM 4779  H HE3  . LYS A 1 36  ? 6.076   -2.151  -14.650 1.00 0.84  ? 36  LYS A HE3  3  
ATOM 4780  H HZ1  . LYS A 1 36  ? 6.778   -2.632  -17.502 1.00 1.69  ? 36  LYS A HZ1  3  
ATOM 4781  H HZ2  . LYS A 1 36  ? 6.601   -1.112  -16.784 1.00 1.81  ? 36  LYS A HZ2  3  
ATOM 4782  H HZ3  . LYS A 1 36  ? 5.268   -2.140  -16.918 1.00 1.72  ? 36  LYS A HZ3  3  
ATOM 4783  N N    . VAL A 1 37  ? 10.036  2.165   -13.080 1.00 0.23  ? 37  VAL A N    3  
ATOM 4784  C CA   . VAL A 1 37  ? 9.988   3.012   -11.896 1.00 0.23  ? 37  VAL A CA   3  
ATOM 4785  C C    . VAL A 1 37  ? 8.585   3.579   -11.758 1.00 0.26  ? 37  VAL A C    3  
ATOM 4786  O O    . VAL A 1 37  ? 8.046   4.159   -12.699 1.00 0.37  ? 37  VAL A O    3  
ATOM 4787  C CB   . VAL A 1 37  ? 11.019  4.170   -11.982 1.00 0.27  ? 37  VAL A CB   3  
ATOM 4788  C CG1  . VAL A 1 37  ? 10.617  5.342   -11.099 1.00 0.76  ? 37  VAL A CG1  3  
ATOM 4789  C CG2  . VAL A 1 37  ? 12.403  3.689   -11.593 1.00 0.83  ? 37  VAL A CG2  3  
ATOM 4790  H H    . VAL A 1 37  ? 9.580   2.472   -13.895 1.00 0.32  ? 37  VAL A H    3  
ATOM 4791  H HA   . VAL A 1 37  ? 10.214  2.397   -11.023 1.00 0.22  ? 37  VAL A HA   3  
ATOM 4792  H HB   . VAL A 1 37  ? 11.062  4.513   -13.002 1.00 0.72  ? 37  VAL A HB   3  
ATOM 4793  H HG11 . VAL A 1 37  ? 9.658   5.722   -11.421 1.00 1.48  ? 37  VAL A HG11 3  
ATOM 4794  H HG12 . VAL A 1 37  ? 11.359  6.123   -11.178 1.00 1.31  ? 37  VAL A HG12 3  
ATOM 4795  H HG13 . VAL A 1 37  ? 10.548  5.013   -10.074 1.00 1.29  ? 37  VAL A HG13 3  
ATOM 4796  H HG21 . VAL A 1 37  ? 12.439  3.527   -10.520 1.00 1.35  ? 37  VAL A HG21 3  
ATOM 4797  H HG22 . VAL A 1 37  ? 13.132  4.430   -11.872 1.00 1.53  ? 37  VAL A HG22 3  
ATOM 4798  H HG23 . VAL A 1 37  ? 12.617  2.761   -12.098 1.00 1.35  ? 37  VAL A HG23 3  
ATOM 4799  N N    . HIS A 1 38  ? 7.974   3.370   -10.606 1.00 0.22  ? 38  HIS A N    3  
ATOM 4800  C CA   . HIS A 1 38  ? 6.616   3.834   -10.382 1.00 0.25  ? 38  HIS A CA   3  
ATOM 4801  C C    . HIS A 1 38  ? 6.553   4.634   -9.098  1.00 0.24  ? 38  HIS A C    3  
ATOM 4802  O O    . HIS A 1 38  ? 6.819   4.102   -8.018  1.00 0.26  ? 38  HIS A O    3  
ATOM 4803  C CB   . HIS A 1 38  ? 5.646   2.654   -10.316 1.00 0.27  ? 38  HIS A CB   3  
ATOM 4804  C CG   . HIS A 1 38  ? 5.905   1.611   -11.364 1.00 0.28  ? 38  HIS A CG   3  
ATOM 4805  N ND1  . HIS A 1 38  ? 5.981   1.884   -12.709 1.00 0.30  ? 38  HIS A ND1  3  
ATOM 4806  C CD2  . HIS A 1 38  ? 6.147   0.292   -11.249 1.00 0.30  ? 38  HIS A CD2  3  
ATOM 4807  C CE1  . HIS A 1 38  ? 6.259   0.769   -13.357 1.00 0.33  ? 38  HIS A CE1  3  
ATOM 4808  N NE2  . HIS A 1 38  ? 6.355   -0.215  -12.499 1.00 0.33  ? 38  HIS A NE2  3  
ATOM 4809  H H    . HIS A 1 38  ? 8.445   2.887   -9.888  1.00 0.22  ? 38  HIS A H    3  
ATOM 4810  H HA   . HIS A 1 38  ? 6.346   4.472   -11.207 1.00 0.27  ? 38  HIS A HA   3  
ATOM 4811  H HB2  . HIS A 1 38  ? 5.725   2.186   -9.341  1.00 0.28  ? 38  HIS A HB2  3  
ATOM 4812  H HB3  . HIS A 1 38  ? 4.639   3.020   -10.451 1.00 0.31  ? 38  HIS A HB3  3  
ATOM 4813  H HD1  . HIS A 1 38  ? 5.844   2.765   -13.127 1.00 0.32  ? 38  HIS A HD1  3  
ATOM 4814  H HD2  . HIS A 1 38  ? 6.209   -0.256  -10.342 1.00 0.32  ? 38  HIS A HD2  3  
ATOM 4815  H HE1  . HIS A 1 38  ? 6.435   0.681   -14.408 1.00 0.36  ? 38  HIS A HE1  3  
ATOM 4816  H HE2  . HIS A 1 38  ? 6.165   -1.156  -12.738 1.00 0.38  ? 38  HIS A HE2  3  
ATOM 4817  N N    . THR A 1 39  ? 6.211   5.904   -9.213  1.00 0.23  ? 39  THR A N    3  
ATOM 4818  C CA   . THR A 1 39  ? 6.256   6.793   -8.073  1.00 0.22  ? 39  THR A CA   3  
ATOM 4819  C C    . THR A 1 39  ? 4.856   7.115   -7.539  1.00 0.23  ? 39  THR A C    3  
ATOM 4820  O O    . THR A 1 39  ? 4.025   7.717   -8.221  1.00 0.32  ? 39  THR A O    3  
ATOM 4821  C CB   . THR A 1 39  ? 6.998   8.089   -8.424  1.00 0.24  ? 39  THR A CB   3  
ATOM 4822  O OG1  . THR A 1 39  ? 7.914   7.854   -9.506  1.00 0.26  ? 39  THR A OG1  3  
ATOM 4823  C CG2  . THR A 1 39  ? 7.765   8.591   -7.217  1.00 0.24  ? 39  THR A CG2  3  
ATOM 4824  H H    . THR A 1 39  ? 5.933   6.254   -10.084 1.00 0.25  ? 39  THR A H    3  
ATOM 4825  H HA   . THR A 1 39  ? 6.812   6.293   -7.292  1.00 0.19  ? 39  THR A HA   3  
ATOM 4826  H HB   . THR A 1 39  ? 6.282   8.835   -8.718  1.00 0.28  ? 39  THR A HB   3  
ATOM 4827  H HG1  . THR A 1 39  ? 8.800   8.134   -9.244  1.00 0.86  ? 39  THR A HG1  3  
ATOM 4828  H HG21 . THR A 1 39  ? 8.524   7.866   -6.949  1.00 1.03  ? 39  THR A HG21 3  
ATOM 4829  H HG22 . THR A 1 39  ? 7.083   8.720   -6.390  1.00 1.00  ? 39  THR A HG22 3  
ATOM 4830  H HG23 . THR A 1 39  ? 8.233   9.534   -7.449  1.00 0.94  ? 39  THR A HG23 3  
ATOM 4831  N N    . VAL A 1 40  ? 4.623   6.690   -6.309  1.00 0.19  ? 40  VAL A N    3  
ATOM 4832  C CA   . VAL A 1 40  ? 3.374   6.908   -5.598  1.00 0.20  ? 40  VAL A CA   3  
ATOM 4833  C C    . VAL A 1 40  ? 3.529   8.047   -4.591  1.00 0.20  ? 40  VAL A C    3  
ATOM 4834  O O    . VAL A 1 40  ? 4.099   7.853   -3.524  1.00 0.20  ? 40  VAL A O    3  
ATOM 4835  C CB   . VAL A 1 40  ? 2.978   5.626   -4.820  1.00 0.21  ? 40  VAL A CB   3  
ATOM 4836  C CG1  . VAL A 1 40  ? 1.821   5.874   -3.875  1.00 0.23  ? 40  VAL A CG1  3  
ATOM 4837  C CG2  . VAL A 1 40  ? 2.633   4.488   -5.761  1.00 0.22  ? 40  VAL A CG2  3  
ATOM 4838  H H    . VAL A 1 40  ? 5.338   6.197   -5.847  1.00 0.22  ? 40  VAL A H    3  
ATOM 4839  H HA   . VAL A 1 40  ? 2.598   7.145   -6.309  1.00 0.22  ? 40  VAL A HA   3  
ATOM 4840  H HB   . VAL A 1 40  ? 3.829   5.320   -4.230  1.00 0.22  ? 40  VAL A HB   3  
ATOM 4841  H HG11 . VAL A 1 40  ? 1.642   4.980   -3.294  1.00 0.97  ? 40  VAL A HG11 3  
ATOM 4842  H HG12 . VAL A 1 40  ? 0.937   6.120   -4.444  1.00 1.06  ? 40  VAL A HG12 3  
ATOM 4843  H HG13 . VAL A 1 40  ? 2.064   6.692   -3.212  1.00 1.09  ? 40  VAL A HG13 3  
ATOM 4844  H HG21 . VAL A 1 40  ? 2.409   3.602   -5.177  1.00 1.04  ? 40  VAL A HG21 3  
ATOM 4845  H HG22 . VAL A 1 40  ? 3.470   4.291   -6.412  1.00 1.05  ? 40  VAL A HG22 3  
ATOM 4846  H HG23 . VAL A 1 40  ? 1.770   4.760   -6.349  1.00 1.01  ? 40  VAL A HG23 3  
ATOM 4847  N N    . VAL A 1 41  ? 3.025   9.226   -4.913  1.00 0.22  ? 41  VAL A N    3  
ATOM 4848  C CA   . VAL A 1 41  ? 3.045   10.325  -3.953  1.00 0.22  ? 41  VAL A CA   3  
ATOM 4849  C C    . VAL A 1 41  ? 2.054   10.023  -2.829  1.00 0.23  ? 41  VAL A C    3  
ATOM 4850  O O    . VAL A 1 41  ? 0.848   9.887   -3.053  1.00 0.26  ? 41  VAL A O    3  
ATOM 4851  C CB   . VAL A 1 41  ? 2.758   11.697  -4.615  1.00 0.26  ? 41  VAL A CB   3  
ATOM 4852  C CG1  . VAL A 1 41  ? 1.822   11.526  -5.790  1.00 0.63  ? 41  VAL A CG1  3  
ATOM 4853  C CG2  . VAL A 1 41  ? 2.190   12.701  -3.612  1.00 0.59  ? 41  VAL A CG2  3  
ATOM 4854  H H    . VAL A 1 41  ? 2.617   9.354   -5.794  1.00 0.25  ? 41  VAL A H    3  
ATOM 4855  H HA   . VAL A 1 41  ? 4.046   10.364  -3.526  1.00 0.21  ? 41  VAL A HA   3  
ATOM 4856  H HB   . VAL A 1 41  ? 3.693   12.090  -4.991  1.00 0.61  ? 41  VAL A HB   3  
ATOM 4857  H HG11 . VAL A 1 41  ? 1.582   12.492  -6.204  1.00 1.22  ? 41  VAL A HG11 3  
ATOM 4858  H HG12 . VAL A 1 41  ? 0.922   11.032  -5.461  1.00 1.30  ? 41  VAL A HG12 3  
ATOM 4859  H HG13 . VAL A 1 41  ? 2.315   10.924  -6.539  1.00 1.30  ? 41  VAL A HG13 3  
ATOM 4860  H HG21 . VAL A 1 41  ? 1.243   12.341  -3.242  1.00 1.25  ? 41  VAL A HG21 3  
ATOM 4861  H HG22 . VAL A 1 41  ? 2.049   13.657  -4.094  1.00 1.17  ? 41  VAL A HG22 3  
ATOM 4862  H HG23 . VAL A 1 41  ? 2.878   12.815  -2.786  1.00 1.18  ? 41  VAL A HG23 3  
ATOM 4863  N N    . LEU A 1 42  ? 2.589   9.913   -1.628  1.00 0.23  ? 42  LEU A N    3  
ATOM 4864  C CA   . LEU A 1 42  ? 1.872   9.379   -0.474  1.00 0.26  ? 42  LEU A CA   3  
ATOM 4865  C C    . LEU A 1 42  ? 0.679   10.230  -0.057  1.00 0.27  ? 42  LEU A C    3  
ATOM 4866  O O    . LEU A 1 42  ? -0.203  9.759   0.654   1.00 0.37  ? 42  LEU A O    3  
ATOM 4867  C CB   . LEU A 1 42  ? 2.857   9.224   0.681   1.00 0.32  ? 42  LEU A CB   3  
ATOM 4868  C CG   . LEU A 1 42  ? 3.777   8.011   0.564   1.00 0.43  ? 42  LEU A CG   3  
ATOM 4869  C CD1  . LEU A 1 42  ? 4.871   8.089   1.605   1.00 1.24  ? 42  LEU A CD1  3  
ATOM 4870  C CD2  . LEU A 1 42  ? 2.985   6.722   0.719   1.00 1.01  ? 42  LEU A CD2  3  
ATOM 4871  H H    . LEU A 1 42  ? 3.521   10.206  -1.503  1.00 0.25  ? 42  LEU A H    3  
ATOM 4872  H HA   . LEU A 1 42  ? 1.512   8.399   -0.745  1.00 0.31  ? 42  LEU A HA   3  
ATOM 4873  H HB2  . LEU A 1 42  ? 3.473   10.110  0.712   1.00 0.27  ? 42  LEU A HB2  3  
ATOM 4874  H HB3  . LEU A 1 42  ? 2.316   9.157   1.606   1.00 0.45  ? 42  LEU A HB3  3  
ATOM 4875  H HG   . LEU A 1 42  ? 4.242   8.009   -0.411  1.00 1.24  ? 42  LEU A HG   3  
ATOM 4876  H HD11 . LEU A 1 42  ? 5.450   8.987   1.444   1.00 1.86  ? 42  LEU A HD11 3  
ATOM 4877  H HD12 . LEU A 1 42  ? 5.511   7.224   1.523   1.00 1.80  ? 42  LEU A HD12 3  
ATOM 4878  H HD13 . LEU A 1 42  ? 4.426   8.122   2.587   1.00 1.75  ? 42  LEU A HD13 3  
ATOM 4879  H HD21 . LEU A 1 42  ? 2.502   6.711   1.685   1.00 1.58  ? 42  LEU A HD21 3  
ATOM 4880  H HD22 . LEU A 1 42  ? 3.653   5.877   0.641   1.00 1.41  ? 42  LEU A HD22 3  
ATOM 4881  H HD23 . LEU A 1 42  ? 2.237   6.663   -0.057  1.00 1.79  ? 42  LEU A HD23 3  
ATOM 4882  N N    . SER A 1 43  ? 0.637   11.471  -0.512  1.00 0.23  ? 43  SER A N    3  
ATOM 4883  C CA   . SER A 1 43  ? -0.477  12.353  -0.188  1.00 0.28  ? 43  SER A CA   3  
ATOM 4884  C C    . SER A 1 43  ? -1.750  11.929  -0.923  1.00 0.28  ? 43  SER A C    3  
ATOM 4885  O O    . SER A 1 43  ? -2.833  12.446  -0.651  1.00 0.34  ? 43  SER A O    3  
ATOM 4886  C CB   . SER A 1 43  ? -0.130  13.803  -0.529  1.00 0.35  ? 43  SER A CB   3  
ATOM 4887  O OG   . SER A 1 43  ? -1.116  14.698  -0.042  1.00 1.08  ? 43  SER A OG   3  
ATOM 4888  H H    . SER A 1 43  ? 1.374   11.803  -1.063  1.00 0.22  ? 43  SER A H    3  
ATOM 4889  H HA   . SER A 1 43  ? -0.653  12.280  0.875   1.00 0.32  ? 43  SER A HA   3  
ATOM 4890  H HB2  . SER A 1 43  ? 0.818   14.057  -0.082  1.00 0.86  ? 43  SER A HB2  3  
ATOM 4891  H HB3  . SER A 1 43  ? -0.062  13.912  -1.602  1.00 1.04  ? 43  SER A HB3  3  
ATOM 4892  H HG   . SER A 1 43  ? -1.981  14.262  -0.064  1.00 1.37  ? 43  SER A HG   3  
ATOM 4893  N N    . THR A 1 44  ? -1.620  10.990  -1.854  1.00 0.26  ? 44  THR A N    3  
ATOM 4894  C CA   . THR A 1 44  ? -2.776  10.491  -2.583  1.00 0.28  ? 44  THR A CA   3  
ATOM 4895  C C    . THR A 1 44  ? -3.229  9.152   -2.012  1.00 0.26  ? 44  THR A C    3  
ATOM 4896  O O    . THR A 1 44  ? -4.151  8.521   -2.528  1.00 0.29  ? 44  THR A O    3  
ATOM 4897  C CB   . THR A 1 44  ? -2.477  10.331  -4.092  1.00 0.32  ? 44  THR A CB   3  
ATOM 4898  O OG1  . THR A 1 44  ? -1.414  9.390   -4.302  1.00 0.30  ? 44  THR A OG1  3  
ATOM 4899  C CG2  . THR A 1 44  ? -2.102  11.668  -4.714  1.00 0.36  ? 44  THR A CG2  3  
ATOM 4900  H H    . THR A 1 44  ? -0.732  10.623  -2.048  1.00 0.26  ? 44  THR A H    3  
ATOM 4901  H HA   . THR A 1 44  ? -3.576  11.207  -2.469  1.00 0.31  ? 44  THR A HA   3  
ATOM 4902  H HB   . THR A 1 44  ? -3.369  9.966   -4.580  1.00 0.36  ? 44  THR A HB   3  
ATOM 4903  H HG1  . THR A 1 44  ? -0.620  9.686   -3.837  1.00 0.26  ? 44  THR A HG1  3  
ATOM 4904  H HG21 . THR A 1 44  ? -2.921  12.361  -4.599  1.00 1.04  ? 44  THR A HG21 3  
ATOM 4905  H HG22 . THR A 1 44  ? -1.891  11.530  -5.765  1.00 1.05  ? 44  THR A HG22 3  
ATOM 4906  H HG23 . THR A 1 44  ? -1.225  12.061  -4.219  1.00 1.04  ? 44  THR A HG23 3  
ATOM 4907  N N    . ILE A 1 45  ? -2.561  8.721   -0.949  1.00 0.24  ? 45  ILE A N    3  
ATOM 4908  C CA   . ILE A 1 45  ? -2.837  7.446   -0.323  1.00 0.22  ? 45  ILE A CA   3  
ATOM 4909  C C    . ILE A 1 45  ? -3.705  7.600   0.929   1.00 0.25  ? 45  ILE A C    3  
ATOM 4910  O O    . ILE A 1 45  ? -3.599  8.583   1.660   1.00 0.36  ? 45  ILE A O    3  
ATOM 4911  C CB   . ILE A 1 45  ? -1.502  6.791   0.040   1.00 0.25  ? 45  ILE A CB   3  
ATOM 4912  C CG1  . ILE A 1 45  ? -0.639  6.691   -1.218  1.00 0.25  ? 45  ILE A CG1  3  
ATOM 4913  C CG2  . ILE A 1 45  ? -1.712  5.429   0.675   1.00 0.28  ? 45  ILE A CG2  3  
ATOM 4914  C CD1  . ILE A 1 45  ? -1.201  5.765   -2.282  1.00 0.27  ? 45  ILE A CD1  3  
ATOM 4915  H H    . ILE A 1 45  ? -1.827  9.262   -0.588  1.00 0.26  ? 45  ILE A H    3  
ATOM 4916  H HA   . ILE A 1 45  ? -3.346  6.815   -1.040  1.00 0.22  ? 45  ILE A HA   3  
ATOM 4917  H HB   . ILE A 1 45  ? -1.001  7.421   0.758   1.00 0.29  ? 45  ILE A HB   3  
ATOM 4918  H HG12 . ILE A 1 45  ? -0.552  7.675   -1.658  1.00 0.23  ? 45  ILE A HG12 3  
ATOM 4919  H HG13 . ILE A 1 45  ? 0.337   6.345   -0.947  1.00 0.27  ? 45  ILE A HG13 3  
ATOM 4920  H HG21 . ILE A 1 45  ? -2.328  5.536   1.555   1.00 1.01  ? 45  ILE A HG21 3  
ATOM 4921  H HG22 . ILE A 1 45  ? -0.758  5.011   0.952   1.00 1.07  ? 45  ILE A HG22 3  
ATOM 4922  H HG23 . ILE A 1 45  ? -2.201  4.775   -0.030  1.00 1.04  ? 45  ILE A HG23 3  
ATOM 4923  H HD11 . ILE A 1 45  ? -1.446  4.813   -1.838  1.00 1.05  ? 45  ILE A HD11 3  
ATOM 4924  H HD12 . ILE A 1 45  ? -0.463  5.619   -3.059  1.00 1.05  ? 45  ILE A HD12 3  
ATOM 4925  H HD13 . ILE A 1 45  ? -2.090  6.203   -2.709  1.00 1.01  ? 45  ILE A HD13 3  
ATOM 4926  N N    . ASP A 1 46  ? -4.569  6.616   1.148   1.00 0.22  ? 46  ASP A N    3  
ATOM 4927  C CA   . ASP A 1 46  ? -5.504  6.614   2.268   1.00 0.27  ? 46  ASP A CA   3  
ATOM 4928  C C    . ASP A 1 46  ? -5.036  5.675   3.372   1.00 0.30  ? 46  ASP A C    3  
ATOM 4929  O O    . ASP A 1 46  ? -5.020  6.036   4.548   1.00 0.38  ? 46  ASP A O    3  
ATOM 4930  C CB   . ASP A 1 46  ? -6.886  6.157   1.799   1.00 0.33  ? 46  ASP A CB   3  
ATOM 4931  C CG   . ASP A 1 46  ? -7.889  6.088   2.934   1.00 0.48  ? 46  ASP A CG   3  
ATOM 4932  O OD1  . ASP A 1 46  ? -8.562  7.104   3.208   1.00 0.70  ? 46  ASP A OD1  3  
ATOM 4933  O OD2  . ASP A 1 46  ? -8.008  5.017   3.565   1.00 0.55  ? 46  ASP A OD2  3  
ATOM 4934  H H    . ASP A 1 46  ? -4.574  5.848   0.532   1.00 0.21  ? 46  ASP A H    3  
ATOM 4935  H HA   . ASP A 1 46  ? -5.574  7.619   2.656   1.00 0.31  ? 46  ASP A HA   3  
ATOM 4936  H HB2  . ASP A 1 46  ? -7.256  6.841   1.057   1.00 0.36  ? 46  ASP A HB2  3  
ATOM 4937  H HB3  . ASP A 1 46  ? -6.800  5.175   1.360   1.00 0.33  ? 46  ASP A HB3  3  
ATOM 4938  N N    . LYS A 1 47  ? -4.679  4.457   2.988   1.00 0.28  ? 47  LYS A N    3  
ATOM 4939  C CA   . LYS A 1 47  ? -4.324  3.428   3.951   1.00 0.36  ? 47  LYS A CA   3  
ATOM 4940  C C    . LYS A 1 47  ? -3.088  2.679   3.479   1.00 0.31  ? 47  LYS A C    3  
ATOM 4941  O O    . LYS A 1 47  ? -2.609  2.886   2.365   1.00 0.26  ? 47  LYS A O    3  
ATOM 4942  C CB   . LYS A 1 47  ? -5.495  2.447   4.100   1.00 0.42  ? 47  LYS A CB   3  
ATOM 4943  C CG   . LYS A 1 47  ? -5.453  1.566   5.300   1.00 0.74  ? 47  LYS A CG   3  
ATOM 4944  C CD   . LYS A 1 47  ? -6.152  2.242   6.420   1.00 0.79  ? 47  LYS A CD   3  
ATOM 4945  C CE   . LYS A 1 47  ? -7.616  2.441   6.094   1.00 1.12  ? 47  LYS A CE   3  
ATOM 4946  N NZ   . LYS A 1 47  ? -8.006  3.874   5.991   1.00 1.56  ? 47  LYS A NZ   3  
ATOM 4947  H H    . LYS A 1 47  ? -4.650  4.241   2.027   1.00 0.25  ? 47  LYS A H    3  
ATOM 4948  H HA   . LYS A 1 47  ? -4.128  3.896   4.903   1.00 0.44  ? 47  LYS A HA   3  
ATOM 4949  H HB2  . LYS A 1 47  ? -6.393  3.001   4.172   1.00 0.63  ? 47  LYS A HB2  3  
ATOM 4950  H HB3  . LYS A 1 47  ? -5.550  1.823   3.248   1.00 0.50  ? 47  LYS A HB3  3  
ATOM 4951  H HG2  . LYS A 1 47  ? -5.953  0.638   5.078   1.00 1.36  ? 47  LYS A HG2  3  
ATOM 4952  H HG3  . LYS A 1 47  ? -4.443  1.378   5.577   1.00 1.37  ? 47  LYS A HG3  3  
ATOM 4953  H HD2  . LYS A 1 47  ? -6.065  1.630   7.259   1.00 1.37  ? 47  LYS A HD2  3  
ATOM 4954  H HD3  . LYS A 1 47  ? -5.688  3.187   6.606   1.00 1.28  ? 47  LYS A HD3  3  
ATOM 4955  H HE2  . LYS A 1 47  ? -7.797  1.966   5.146   1.00 1.79  ? 47  LYS A HE2  3  
ATOM 4956  H HE3  . LYS A 1 47  ? -8.214  1.964   6.856   1.00 1.63  ? 47  LYS A HE3  3  
ATOM 4957  H HZ1  . LYS A 1 47  ? -7.668  4.401   6.817   1.00 1.86  ? 47  LYS A HZ1  3  
ATOM 4958  H HZ2  . LYS A 1 47  ? -9.042  3.955   5.951   1.00 2.16  ? 47  LYS A HZ2  3  
ATOM 4959  H HZ3  . LYS A 1 47  ? -7.608  4.301   5.124   1.00 1.99  ? 47  LYS A HZ3  3  
ATOM 4960  N N    . LEU A 1 48  ? -2.575  1.819   4.329   1.00 0.39  ? 48  LEU A N    3  
ATOM 4961  C CA   . LEU A 1 48  ? -1.586  0.838   3.914   1.00 0.36  ? 48  LEU A CA   3  
ATOM 4962  C C    . LEU A 1 48  ? -1.790  -0.455  4.694   1.00 0.40  ? 48  LEU A C    3  
ATOM 4963  O O    . LEU A 1 48  ? -2.269  -0.433  5.829   1.00 0.50  ? 48  LEU A O    3  
ATOM 4964  C CB   . LEU A 1 48  ? -0.165  1.342   4.065   1.00 0.60  ? 48  LEU A CB   3  
ATOM 4965  C CG   . LEU A 1 48  ? 0.420   1.235   5.446   1.00 0.64  ? 48  LEU A CG   3  
ATOM 4966  C CD1  . LEU A 1 48  ? 1.922   1.234   5.342   1.00 1.37  ? 48  LEU A CD1  3  
ATOM 4967  C CD2  . LEU A 1 48  ? -0.080  2.374   6.291   1.00 1.12  ? 48  LEU A CD2  3  
ATOM 4968  H H    . LEU A 1 48  ? -2.876  1.841   5.263   1.00 0.51  ? 48  LEU A H    3  
ATOM 4969  H HA   . LEU A 1 48  ? -1.746  0.642   2.885   1.00 0.27  ? 48  LEU A HA   3  
ATOM 4970  H HB2  . LEU A 1 48  ? 0.465   0.786   3.386   1.00 1.30  ? 48  LEU A HB2  3  
ATOM 4971  H HB3  . LEU A 1 48  ? -0.148  2.381   3.774   1.00 1.37  ? 48  LEU A HB3  3  
ATOM 4972  H HG   . LEU A 1 48  ? 0.108   0.312   5.897   1.00 1.45  ? 48  LEU A HG   3  
ATOM 4973  H HD11 . LEU A 1 48  ? 2.355   1.099   6.322   1.00 1.81  ? 48  LEU A HD11 3  
ATOM 4974  H HD12 . LEU A 1 48  ? 2.246   2.174   4.926   1.00 1.98  ? 48  LEU A HD12 3  
ATOM 4975  H HD13 . LEU A 1 48  ? 2.223   0.424   4.690   1.00 1.91  ? 48  LEU A HD13 3  
ATOM 4976  H HD21 . LEU A 1 48  ? 0.251   2.243   7.312   1.00 1.75  ? 48  LEU A HD21 3  
ATOM 4977  H HD22 . LEU A 1 48  ? -1.160  2.387   6.246   1.00 1.68  ? 48  LEU A HD22 3  
ATOM 4978  H HD23 . LEU A 1 48  ? 0.305   3.301   5.903   1.00 1.48  ? 48  LEU A HD23 3  
ATOM 4979  N N    . GLN A 1 49  ? -1.444  -1.577  4.088   1.00 0.39  ? 49  GLN A N    3  
ATOM 4980  C CA   . GLN A 1 49  ? -1.639  -2.875  4.724   1.00 0.45  ? 49  GLN A CA   3  
ATOM 4981  C C    . GLN A 1 49  ? -0.333  -3.646  4.740   1.00 0.33  ? 49  GLN A C    3  
ATOM 4982  O O    . GLN A 1 49  ? 0.484   -3.508  3.833   1.00 0.35  ? 49  GLN A O    3  
ATOM 4983  C CB   . GLN A 1 49  ? -2.719  -3.694  4.011   1.00 0.55  ? 49  GLN A CB   3  
ATOM 4984  C CG   . GLN A 1 49  ? -4.103  -3.078  4.067   1.00 0.79  ? 49  GLN A CG   3  
ATOM 4985  C CD   . GLN A 1 49  ? -5.140  -3.917  3.345   1.00 1.36  ? 49  GLN A CD   3  
ATOM 4986  O OE1  . GLN A 1 49  ? -5.356  -3.759  2.147   1.00 2.28  ? 49  GLN A OE1  3  
ATOM 4987  N NE2  . GLN A 1 49  ? -5.788  -4.818  4.062   1.00 1.62  ? 49  GLN A NE2  3  
ATOM 4988  H H    . GLN A 1 49  ? -1.013  -1.531  3.207   1.00 0.39  ? 49  GLN A H    3  
ATOM 4989  H HA   . GLN A 1 49  ? -1.948  -2.697  5.744   1.00 0.56  ? 49  GLN A HA   3  
ATOM 4990  H HB2  . GLN A 1 49  ? -2.444  -3.809  2.977   1.00 0.50  ? 49  GLN A HB2  3  
ATOM 4991  H HB3  . GLN A 1 49  ? -2.771  -4.665  4.465   1.00 0.72  ? 49  GLN A HB3  3  
ATOM 4992  H HG2  . GLN A 1 49  ? -4.398  -2.975  5.100   1.00 1.39  ? 49  GLN A HG2  3  
ATOM 4993  H HG3  . GLN A 1 49  ? -4.061  -2.109  3.607   1.00 1.03  ? 49  GLN A HG3  3  
ATOM 4994  H HE21 . GLN A 1 49  ? -5.569  -4.902  5.021   1.00 1.74  ? 49  GLN A HE21 3  
ATOM 4995  H HE22 . GLN A 1 49  ? -6.463  -5.369  3.613   1.00 2.18  ? 49  GLN A HE22 3  
ATOM 4996  N N    . ALA A 1 50  ? -0.148  -4.459  5.765   1.00 0.34  ? 50  ALA A N    3  
ATOM 4997  C CA   . ALA A 1 50  ? 1.096   -5.184  5.959   1.00 0.28  ? 50  ALA A CA   3  
ATOM 4998  C C    . ALA A 1 50  ? 0.816   -6.561  6.548   1.00 0.32  ? 50  ALA A C    3  
ATOM 4999  O O    . ALA A 1 50  ? 0.011   -6.696  7.470   1.00 0.43  ? 50  ALA A O    3  
ATOM 5000  C CB   . ALA A 1 50  ? 2.007   -4.370  6.861   1.00 0.38  ? 50  ALA A CB   3  
ATOM 5001  H H    . ALA A 1 50  ? -0.875  -4.581  6.415   1.00 0.46  ? 50  ALA A H    3  
ATOM 5002  H HA   . ALA A 1 50  ? 1.584   -5.298  5.001   1.00 0.27  ? 50  ALA A HA   3  
ATOM 5003  H HB1  . ALA A 1 50  ? 2.951   -4.881  6.991   1.00 1.06  ? 50  ALA A HB1  3  
ATOM 5004  H HB2  . ALA A 1 50  ? 1.539   -4.228  7.824   1.00 1.01  ? 50  ALA A HB2  3  
ATOM 5005  H HB3  . ALA A 1 50  ? 2.182   -3.405  6.402   1.00 1.17  ? 50  ALA A HB3  3  
ATOM 5006  N N    . THR A 1 51  ? 1.466   -7.580  5.997   1.00 0.32  ? 51  THR A N    3  
ATOM 5007  C CA   . THR A 1 51  ? 1.256   -8.953  6.436   1.00 0.40  ? 51  THR A CA   3  
ATOM 5008  C C    . THR A 1 51  ? 1.770   -9.178  7.857   1.00 0.53  ? 51  THR A C    3  
ATOM 5009  O O    . THR A 1 51  ? 2.693   -8.499  8.312   1.00 0.55  ? 51  THR A O    3  
ATOM 5010  C CB   . THR A 1 51  ? 1.934   -9.952  5.479   1.00 0.41  ? 51  THR A CB   3  
ATOM 5011  O OG1  . THR A 1 51  ? 3.219   -9.466  5.077   1.00 0.43  ? 51  THR A OG1  3  
ATOM 5012  C CG2  . THR A 1 51  ? 1.067   -10.197 4.255   1.00 0.46  ? 51  THR A CG2  3  
ATOM 5013  H H    . THR A 1 51  ? 2.108   -7.407  5.275   1.00 0.32  ? 51  THR A H    3  
ATOM 5014  H HA   . THR A 1 51  ? 0.194   -9.144  6.419   1.00 0.48  ? 51  THR A HA   3  
ATOM 5015  H HB   . THR A 1 51  ? 2.063   -10.890 5.999   1.00 0.48  ? 51  THR A HB   3  
ATOM 5016  H HG1  . THR A 1 51  ? 3.873   -10.177 5.172   1.00 0.54  ? 51  THR A HG1  3  
ATOM 5017  H HG21 . THR A 1 51  ? 0.879   -9.259  3.754   1.00 1.07  ? 51  THR A HG21 3  
ATOM 5018  H HG22 . THR A 1 51  ? 0.129   -10.637 4.561   1.00 1.05  ? 51  THR A HG22 3  
ATOM 5019  H HG23 . THR A 1 51  ? 1.577   -10.870 3.583   1.00 1.15  ? 51  THR A HG23 3  
ATOM 5020  N N    . PRO A 1 52  ? 1.161   -10.137 8.574   1.00 0.71  ? 52  PRO A N    3  
ATOM 5021  C CA   . PRO A 1 52  ? 1.517   -10.453 9.963   1.00 0.91  ? 52  PRO A CA   3  
ATOM 5022  C C    . PRO A 1 52  ? 2.912   -11.051 10.077  1.00 0.96  ? 52  PRO A C    3  
ATOM 5023  O O    . PRO A 1 52  ? 3.352   -11.798 9.203   1.00 0.88  ? 52  PRO A O    3  
ATOM 5024  C CB   . PRO A 1 52  ? 0.468   -11.494 10.359  1.00 1.10  ? 52  PRO A CB   3  
ATOM 5025  C CG   . PRO A 1 52  ? 0.108   -12.138 9.074   1.00 1.03  ? 52  PRO A CG   3  
ATOM 5026  C CD   . PRO A 1 52  ? 0.084   -11.017 8.081   1.00 0.80  ? 52  PRO A CD   3  
ATOM 5027  H HA   . PRO A 1 52  ? 1.434   -9.589  10.605  1.00 0.95  ? 52  PRO A HA   3  
ATOM 5028  H HB2  . PRO A 1 52  ? 0.895   -12.202 11.052  1.00 1.22  ? 52  PRO A HB2  3  
ATOM 5029  H HB3  . PRO A 1 52  ? -0.383  -11.005 10.808  1.00 1.17  ? 52  PRO A HB3  3  
ATOM 5030  H HG2  . PRO A 1 52  ? 0.859   -12.867 8.805   1.00 1.06  ? 52  PRO A HG2  3  
ATOM 5031  H HG3  . PRO A 1 52  ? -0.859  -12.602 9.150   1.00 1.16  ? 52  PRO A HG3  3  
ATOM 5032  H HD2  . PRO A 1 52  ? 0.302   -11.384 7.088   1.00 0.73  ? 52  PRO A HD2  3  
ATOM 5033  H HD3  . PRO A 1 52  ? -0.870  -10.510 8.101   1.00 0.85  ? 52  PRO A HD3  3  
ATOM 5034  N N    . ALA A 1 53  ? 3.590   -10.737 11.172  1.00 1.16  ? 53  ALA A N    3  
ATOM 5035  C CA   . ALA A 1 53  ? 4.938   -11.234 11.416  1.00 1.29  ? 53  ALA A CA   3  
ATOM 5036  C C    . ALA A 1 53  ? 4.932   -12.733 11.674  1.00 1.31  ? 53  ALA A C    3  
ATOM 5037  O O    . ALA A 1 53  ? 5.982   -13.376 11.676  1.00 1.36  ? 53  ALA A O    3  
ATOM 5038  C CB   . ALA A 1 53  ? 5.568   -10.512 12.593  1.00 1.58  ? 53  ALA A CB   3  
ATOM 5039  H H    . ALA A 1 53  ? 3.169   -10.151 11.839  1.00 1.25  ? 53  ALA A H    3  
ATOM 5040  H HA   . ALA A 1 53  ? 5.533   -11.032 10.538  1.00 1.21  ? 53  ALA A HA   3  
ATOM 5041  H HB1  . ALA A 1 53  ? 6.596   -10.825 12.697  1.00 1.87  ? 53  ALA A HB1  3  
ATOM 5042  H HB2  . ALA A 1 53  ? 5.025   -10.759 13.494  1.00 1.82  ? 53  ALA A HB2  3  
ATOM 5043  H HB3  . ALA A 1 53  ? 5.528   -9.446  12.427  1.00 1.98  ? 53  ALA A HB3  3  
ATOM 5044  N N    . SER A 1 54  ? 3.749   -13.278 11.920  1.00 1.32  ? 54  SER A N    3  
ATOM 5045  C CA   . SER A 1 54  ? 3.595   -14.706 12.117  1.00 1.41  ? 54  SER A CA   3  
ATOM 5046  C C    . SER A 1 54  ? 3.784   -15.439 10.794  1.00 1.26  ? 54  SER A C    3  
ATOM 5047  O O    . SER A 1 54  ? 4.274   -16.570 10.753  1.00 1.35  ? 54  SER A O    3  
ATOM 5048  C CB   . SER A 1 54  ? 2.212   -15.006 12.694  1.00 1.55  ? 54  SER A CB   3  
ATOM 5049  O OG   . SER A 1 54  ? 1.193   -14.459 11.873  1.00 1.49  ? 54  SER A OG   3  
ATOM 5050  H H    . SER A 1 54  ? 2.958   -12.700 11.975  1.00 1.32  ? 54  SER A H    3  
ATOM 5051  H HA   . SER A 1 54  ? 4.353   -15.027 12.815  1.00 1.52  ? 54  SER A HA   3  
ATOM 5052  H HB2  . SER A 1 54  ? 2.074   -16.075 12.754  1.00 1.60  ? 54  SER A HB2  3  
ATOM 5053  H HB3  . SER A 1 54  ? 2.135   -14.574 13.680  1.00 1.70  ? 54  SER A HB3  3  
ATOM 5054  H HG   . SER A 1 54  ? 0.415   -14.269 12.413  1.00 1.65  ? 54  SER A HG   3  
ATOM 5055  N N    . SER A 1 55  ? 3.399   -14.777 9.711   1.00 1.09  ? 55  SER A N    3  
ATOM 5056  C CA   . SER A 1 55  ? 3.539   -15.334 8.380   1.00 1.02  ? 55  SER A CA   3  
ATOM 5057  C C    . SER A 1 55  ? 4.980   -15.199 7.911   1.00 0.94  ? 55  SER A C    3  
ATOM 5058  O O    . SER A 1 55  ? 5.743   -14.377 8.429   1.00 0.99  ? 55  SER A O    3  
ATOM 5059  C CB   . SER A 1 55  ? 2.600   -14.612 7.403   1.00 0.96  ? 55  SER A CB   3  
ATOM 5060  O OG   . SER A 1 55  ? 2.589   -15.247 6.134   1.00 1.32  ? 55  SER A OG   3  
ATOM 5061  H H    . SER A 1 55  ? 3.017   -13.877 9.812   1.00 1.06  ? 55  SER A H    3  
ATOM 5062  H HA   . SER A 1 55  ? 3.275   -16.381 8.422   1.00 1.13  ? 55  SER A HA   3  
ATOM 5063  H HB2  . SER A 1 55  ? 1.596   -14.614 7.799   1.00 1.12  ? 55  SER A HB2  3  
ATOM 5064  H HB3  . SER A 1 55  ? 2.933   -13.593 7.277   1.00 1.06  ? 55  SER A HB3  3  
ATOM 5065  H HG   . SER A 1 55  ? 1.725   -15.653 5.988   1.00 1.49  ? 55  SER A HG   3  
ATOM 5066  N N    . GLU A 1 56  ? 5.357   -16.022 6.950   1.00 0.88  ? 56  GLU A N    3  
ATOM 5067  C CA   . GLU A 1 56  ? 6.652   -15.893 6.321   1.00 0.85  ? 56  GLU A CA   3  
ATOM 5068  C C    . GLU A 1 56  ? 6.621   -14.773 5.310   1.00 0.70  ? 56  GLU A C    3  
ATOM 5069  O O    . GLU A 1 56  ? 7.570   -14.005 5.187   1.00 0.74  ? 56  GLU A O    3  
ATOM 5070  C CB   . GLU A 1 56  ? 7.059   -17.192 5.641   1.00 0.93  ? 56  GLU A CB   3  
ATOM 5071  C CG   . GLU A 1 56  ? 7.677   -16.982 4.282   1.00 1.08  ? 56  GLU A CG   3  
ATOM 5072  C CD   . GLU A 1 56  ? 8.229   -18.254 3.681   1.00 1.75  ? 56  GLU A CD   3  
ATOM 5073  O OE1  . GLU A 1 56  ? 9.369   -18.634 4.017   1.00 2.08  ? 56  GLU A OE1  3  
ATOM 5074  O OE2  . GLU A 1 56  ? 7.523   -18.884 2.869   1.00 2.37  ? 56  GLU A OE2  3  
ATOM 5075  H H    . GLU A 1 56  ? 4.741   -16.723 6.647   1.00 0.92  ? 56  GLU A H    3  
ATOM 5076  H HA   . GLU A 1 56  ? 7.373   -15.656 7.073   1.00 0.96  ? 56  GLU A HA   3  
ATOM 5077  H HB2  . GLU A 1 56  ? 7.781   -17.688 6.255   1.00 1.09  ? 56  GLU A HB2  3  
ATOM 5078  H HB3  . GLU A 1 56  ? 6.192   -17.820 5.530   1.00 0.96  ? 56  GLU A HB3  3  
ATOM 5079  H HG2  . GLU A 1 56  ? 6.921   -16.585 3.636   1.00 1.32  ? 56  GLU A HG2  3  
ATOM 5080  H HG3  . GLU A 1 56  ? 8.471   -16.258 4.372   1.00 1.15  ? 56  GLU A HG3  3  
ATOM 5081  N N    . LYS A 1 57  ? 5.512   -14.690 4.602   1.00 0.62  ? 57  LYS A N    3  
ATOM 5082  C CA   . LYS A 1 57  ? 5.400   -13.800 3.470   1.00 0.54  ? 57  LYS A CA   3  
ATOM 5083  C C    . LYS A 1 57  ? 5.442   -12.337 3.886   1.00 0.48  ? 57  LYS A C    3  
ATOM 5084  O O    . LYS A 1 57  ? 4.683   -11.894 4.750   1.00 0.68  ? 57  LYS A O    3  
ATOM 5085  C CB   . LYS A 1 57  ? 4.120   -14.091 2.705   1.00 0.63  ? 57  LYS A CB   3  
ATOM 5086  C CG   . LYS A 1 57  ? 4.062   -15.504 2.156   1.00 1.10  ? 57  LYS A CG   3  
ATOM 5087  C CD   . LYS A 1 57  ? 5.225   -15.789 1.237   1.00 1.47  ? 57  LYS A CD   3  
ATOM 5088  C CE   . LYS A 1 57  ? 5.106   -15.047 -0.065  1.00 1.47  ? 57  LYS A CE   3  
ATOM 5089  N NZ   . LYS A 1 57  ? 6.327   -15.186 -0.903  1.00 2.29  ? 57  LYS A NZ   3  
ATOM 5090  H H    . LYS A 1 57  ? 4.744   -15.248 4.852   1.00 0.68  ? 57  LYS A H    3  
ATOM 5091  H HA   . LYS A 1 57  ? 6.240   -14.008 2.824   1.00 0.55  ? 57  LYS A HA   3  
ATOM 5092  H HB2  . LYS A 1 57  ? 3.289   -13.953 3.370   1.00 1.00  ? 57  LYS A HB2  3  
ATOM 5093  H HB3  . LYS A 1 57  ? 4.035   -13.400 1.882   1.00 1.00  ? 57  LYS A HB3  3  
ATOM 5094  H HG2  . LYS A 1 57  ? 4.090   -16.206 2.973   1.00 1.61  ? 57  LYS A HG2  3  
ATOM 5095  H HG3  . LYS A 1 57  ? 3.151   -15.624 1.608   1.00 1.61  ? 57  LYS A HG3  3  
ATOM 5096  H HD2  . LYS A 1 57  ? 6.132   -15.492 1.728   1.00 2.16  ? 57  LYS A HD2  3  
ATOM 5097  H HD3  . LYS A 1 57  ? 5.249   -16.827 1.032   1.00 1.97  ? 57  LYS A HD3  3  
ATOM 5098  H HE2  . LYS A 1 57  ? 4.256   -15.429 -0.611  1.00 1.55  ? 57  LYS A HE2  3  
ATOM 5099  H HE3  . LYS A 1 57  ? 4.950   -14.024 0.162   1.00 1.84  ? 57  LYS A HE3  3  
ATOM 5100  H HZ1  . LYS A 1 57  ? 6.537   -16.190 -1.071  1.00 2.69  ? 57  LYS A HZ1  3  
ATOM 5101  H HZ2  . LYS A 1 57  ? 7.142   -14.751 -0.427  1.00 2.69  ? 57  LYS A HZ2  3  
ATOM 5102  H HZ3  . LYS A 1 57  ? 6.187   -14.718 -1.821  1.00 2.71  ? 57  LYS A HZ3  3  
ATOM 5103  N N    . MET A 1 58  ? 6.328   -11.597 3.250   1.00 0.38  ? 58  MET A N    3  
ATOM 5104  C CA   . MET A 1 58  ? 6.488   -10.178 3.521   1.00 0.39  ? 58  MET A CA   3  
ATOM 5105  C C    . MET A 1 58  ? 5.827   -9.350  2.427   1.00 0.33  ? 58  MET A C    3  
ATOM 5106  O O    . MET A 1 58  ? 6.278   -9.347  1.280   1.00 0.40  ? 58  MET A O    3  
ATOM 5107  C CB   . MET A 1 58  ? 7.974   -9.811  3.653   1.00 0.53  ? 58  MET A CB   3  
ATOM 5108  C CG   . MET A 1 58  ? 8.914   -10.733 2.919   1.00 0.81  ? 58  MET A CG   3  
ATOM 5109  S SD   . MET A 1 58  ? 9.388   -12.146 3.927   1.00 1.13  ? 58  MET A SD   3  
ATOM 5110  C CE   . MET A 1 58  ? 10.082  -13.233 2.698   1.00 0.71  ? 58  MET A CE   3  
ATOM 5111  H H    . MET A 1 58  ? 6.890   -12.018 2.568   1.00 0.49  ? 58  MET A H    3  
ATOM 5112  H HA   . MET A 1 58  ? 5.993   -9.967  4.458   1.00 0.43  ? 58  MET A HA   3  
ATOM 5113  H HB2  . MET A 1 58  ? 8.124   -8.811  3.281   1.00 1.04  ? 58  MET A HB2  3  
ATOM 5114  H HB3  . MET A 1 58  ? 8.242   -9.843  4.690   1.00 1.02  ? 58  MET A HB3  3  
ATOM 5115  H HG2  . MET A 1 58  ? 8.424   -11.085 2.034   1.00 1.60  ? 58  MET A HG2  3  
ATOM 5116  H HG3  . MET A 1 58  ? 9.803   -10.185 2.648   1.00 1.52  ? 58  MET A HG3  3  
ATOM 5117  H HE1  . MET A 1 58  ? 10.991  -12.799 2.312   1.00 1.18  ? 58  MET A HE1  3  
ATOM 5118  H HE2  . MET A 1 58  ? 9.370   -13.360 1.897   1.00 1.35  ? 58  MET A HE2  3  
ATOM 5119  H HE3  . MET A 1 58  ? 10.295  -14.191 3.148   1.00 1.18  ? 58  MET A HE3  3  
ATOM 5120  N N    . MET A 1 59  ? 4.763   -8.641  2.791   1.00 0.29  ? 59  MET A N    3  
ATOM 5121  C CA   . MET A 1 59  ? 3.966   -7.898  1.824   1.00 0.26  ? 59  MET A CA   3  
ATOM 5122  C C    . MET A 1 59  ? 3.513   -6.556  2.387   1.00 0.24  ? 59  MET A C    3  
ATOM 5123  O O    . MET A 1 59  ? 3.114   -6.458  3.549   1.00 0.29  ? 59  MET A O    3  
ATOM 5124  C CB   . MET A 1 59  ? 2.723   -8.700  1.448   1.00 0.32  ? 59  MET A CB   3  
ATOM 5125  C CG   . MET A 1 59  ? 2.434   -8.740  -0.041  1.00 0.38  ? 59  MET A CG   3  
ATOM 5126  S SD   . MET A 1 59  ? 3.607   -9.735  -0.979  1.00 0.49  ? 59  MET A SD   3  
ATOM 5127  C CE   . MET A 1 59  ? 3.291   -11.371 -0.323  1.00 0.63  ? 59  MET A CE   3  
ATOM 5128  H H    . MET A 1 59  ? 4.502   -8.621  3.740   1.00 0.34  ? 59  MET A H    3  
ATOM 5129  H HA   . MET A 1 59  ? 4.563   -7.733  0.939   1.00 0.25  ? 59  MET A HA   3  
ATOM 5130  H HB2  . MET A 1 59  ? 2.836   -9.705  1.803   1.00 0.42  ? 59  MET A HB2  3  
ATOM 5131  H HB3  . MET A 1 59  ? 1.871   -8.256  1.940   1.00 0.34  ? 59  MET A HB3  3  
ATOM 5132  H HG2  . MET A 1 59  ? 1.450   -9.151  -0.186  1.00 0.45  ? 59  MET A HG2  3  
ATOM 5133  H HG3  . MET A 1 59  ? 2.456   -7.732  -0.422  1.00 0.40  ? 59  MET A HG3  3  
ATOM 5134  H HE1  . MET A 1 59  ? 3.499   -11.382 0.736   1.00 1.24  ? 59  MET A HE1  3  
ATOM 5135  H HE2  . MET A 1 59  ? 3.926   -12.089 -0.823  1.00 1.09  ? 59  MET A HE2  3  
ATOM 5136  H HE3  . MET A 1 59  ? 2.255   -11.631 -0.489  1.00 1.26  ? 59  MET A HE3  3  
ATOM 5137  N N    . LEU A 1 60  ? 3.567   -5.532  1.551   1.00 0.20  ? 60  LEU A N    3  
ATOM 5138  C CA   . LEU A 1 60  ? 2.978   -4.233  1.872   1.00 0.19  ? 60  LEU A CA   3  
ATOM 5139  C C    . LEU A 1 60  ? 1.936   -3.873  0.826   1.00 0.21  ? 60  LEU A C    3  
ATOM 5140  O O    . LEU A 1 60  ? 1.987   -4.360  -0.307  1.00 0.25  ? 60  LEU A O    3  
ATOM 5141  C CB   . LEU A 1 60  ? 4.027   -3.111  1.927   1.00 0.21  ? 60  LEU A CB   3  
ATOM 5142  C CG   . LEU A 1 60  ? 4.588   -2.769  3.311   1.00 0.26  ? 60  LEU A CG   3  
ATOM 5143  C CD1  . LEU A 1 60  ? 3.466   -2.515  4.297   1.00 0.48  ? 60  LEU A CD1  3  
ATOM 5144  C CD2  . LEU A 1 60  ? 5.505   -3.858  3.831   1.00 0.40  ? 60  LEU A CD2  3  
ATOM 5145  H H    . LEU A 1 60  ? 4.003   -5.655  0.681   1.00 0.21  ? 60  LEU A H    3  
ATOM 5146  H HA   . LEU A 1 60  ? 2.497   -4.313  2.834   1.00 0.18  ? 60  LEU A HA   3  
ATOM 5147  H HB2  . LEU A 1 60  ? 4.849   -3.387  1.287   1.00 0.28  ? 60  LEU A HB2  3  
ATOM 5148  H HB3  . LEU A 1 60  ? 3.571   -2.212  1.529   1.00 0.21  ? 60  LEU A HB3  3  
ATOM 5149  H HG   . LEU A 1 60  ? 5.164   -1.861  3.235   1.00 0.52  ? 60  LEU A HG   3  
ATOM 5150  H HD11 . LEU A 1 60  ? 3.016   -3.458  4.576   1.00 1.23  ? 60  LEU A HD11 3  
ATOM 5151  H HD12 . LEU A 1 60  ? 2.720   -1.880  3.840   1.00 0.99  ? 60  LEU A HD12 3  
ATOM 5152  H HD13 . LEU A 1 60  ? 3.861   -2.031  5.176   1.00 1.17  ? 60  LEU A HD13 3  
ATOM 5153  H HD21 . LEU A 1 60  ? 4.987   -4.805  3.805   1.00 1.03  ? 60  LEU A HD21 3  
ATOM 5154  H HD22 . LEU A 1 60  ? 5.785   -3.626  4.849   1.00 1.14  ? 60  LEU A HD22 3  
ATOM 5155  H HD23 . LEU A 1 60  ? 6.389   -3.910  3.217   1.00 1.12  ? 60  LEU A HD23 3  
ATOM 5156  N N    . ARG A 1 61  ? 0.985   -3.041  1.213   1.00 0.22  ? 61  ARG A N    3  
ATOM 5157  C CA   . ARG A 1 61  ? 0.037   -2.473  0.257   1.00 0.25  ? 61  ARG A CA   3  
ATOM 5158  C C    . ARG A 1 61  ? 0.014   -0.957  0.346   1.00 0.26  ? 61  ARG A C    3  
ATOM 5159  O O    . ARG A 1 61  ? 0.242   -0.382  1.406   1.00 0.31  ? 61  ARG A O    3  
ATOM 5160  C CB   . ARG A 1 61  ? -1.393  -2.956  0.484   1.00 0.31  ? 61  ARG A CB   3  
ATOM 5161  C CG   . ARG A 1 61  ? -1.703  -4.337  -0.070  1.00 0.40  ? 61  ARG A CG   3  
ATOM 5162  C CD   . ARG A 1 61  ? -3.144  -4.723  0.226   1.00 0.56  ? 61  ARG A CD   3  
ATOM 5163  N NE   . ARG A 1 61  ? -3.568  -5.924  -0.488  1.00 1.20  ? 61  ARG A NE   3  
ATOM 5164  C CZ   . ARG A 1 61  ? -4.519  -6.752  -0.047  1.00 1.42  ? 61  ARG A CZ   3  
ATOM 5165  N NH1  . ARG A 1 61  ? -5.157  -6.490  1.090   1.00 1.03  ? 61  ARG A NH1  3  
ATOM 5166  N NH2  . ARG A 1 61  ? -4.853  -7.820  -0.761  1.00 2.37  ? 61  ARG A NH2  3  
ATOM 5167  H H    . ARG A 1 61  ? 0.918   -2.805  2.176   1.00 0.24  ? 61  ARG A H    3  
ATOM 5168  H HA   . ARG A 1 61  ? 0.353   -2.771  -0.738  1.00 0.26  ? 61  ARG A HA   3  
ATOM 5169  H HB2  . ARG A 1 61  ? -1.589  -2.966  1.543   1.00 0.33  ? 61  ARG A HB2  3  
ATOM 5170  H HB3  . ARG A 1 61  ? -2.065  -2.242  0.010   1.00 0.35  ? 61  ARG A HB3  3  
ATOM 5171  H HG2  . ARG A 1 61  ? -1.550  -4.334  -1.140  1.00 0.46  ? 61  ARG A HG2  3  
ATOM 5172  H HG3  . ARG A 1 61  ? -1.043  -5.058  0.391   1.00 0.41  ? 61  ARG A HG3  3  
ATOM 5173  H HD2  . ARG A 1 61  ? -3.243  -4.897  1.285   1.00 0.96  ? 61  ARG A HD2  3  
ATOM 5174  H HD3  . ARG A 1 61  ? -3.784  -3.905  -0.061  1.00 1.24  ? 61  ARG A HD3  3  
ATOM 5175  H HE   . ARG A 1 61  ? -3.129  -6.116  -1.347  1.00 1.81  ? 61  ARG A HE   3  
ATOM 5176  H HH11 . ARG A 1 61  ? -4.929  -5.666  1.618   1.00 1.07  ? 61  ARG A HH11 3  
ATOM 5177  H HH12 . ARG A 1 61  ? -5.869  -7.112  1.428   1.00 1.28  ? 61  ARG A HH12 3  
ATOM 5178  H HH21 . ARG A 1 61  ? -4.398  -8.002  -1.637  1.00 2.99  ? 61  ARG A HH21 3  
ATOM 5179  H HH22 . ARG A 1 61  ? -5.551  -8.453  -0.426  1.00 2.55  ? 61  ARG A HH22 3  
ATOM 5180  N N    . LEU A 1 62  ? -0.286  -0.329  -0.774  1.00 0.28  ? 62  LEU A N    3  
ATOM 5181  C CA   . LEU A 1 62  ? -0.580  1.087   -0.818  1.00 0.28  ? 62  LEU A CA   3  
ATOM 5182  C C    . LEU A 1 62  ? -2.047  1.259   -1.145  1.00 0.28  ? 62  LEU A C    3  
ATOM 5183  O O    . LEU A 1 62  ? -2.489  0.883   -2.230  1.00 0.33  ? 62  LEU A O    3  
ATOM 5184  C CB   . LEU A 1 62  ? 0.251   1.777   -1.891  1.00 0.31  ? 62  LEU A CB   3  
ATOM 5185  C CG   . LEU A 1 62  ? 1.419   2.621   -1.405  1.00 0.37  ? 62  LEU A CG   3  
ATOM 5186  C CD1  . LEU A 1 62  ? 0.980   3.649   -0.396  1.00 0.70  ? 62  LEU A CD1  3  
ATOM 5187  C CD2  . LEU A 1 62  ? 2.498   1.756   -0.827  1.00 0.68  ? 62  LEU A CD2  3  
ATOM 5188  H H    . LEU A 1 62  ? -0.316  -0.840  -1.609  1.00 0.34  ? 62  LEU A H    3  
ATOM 5189  H HA   . LEU A 1 62  ? -0.368  1.517   0.149   1.00 0.27  ? 62  LEU A HA   3  
ATOM 5190  H HB2  . LEU A 1 62  ? 0.647   1.012   -2.532  1.00 0.39  ? 62  LEU A HB2  3  
ATOM 5191  H HB3  . LEU A 1 62  ? -0.403  2.407   -2.471  1.00 0.33  ? 62  LEU A HB3  3  
ATOM 5192  H HG   . LEU A 1 62  ? 1.831   3.142   -2.247  1.00 0.72  ? 62  LEU A HG   3  
ATOM 5193  H HD11 . LEU A 1 62  ? 0.584   3.152   0.476   1.00 1.29  ? 62  LEU A HD11 3  
ATOM 5194  H HD12 . LEU A 1 62  ? 0.217   4.274   -0.833  1.00 1.45  ? 62  LEU A HD12 3  
ATOM 5195  H HD13 . LEU A 1 62  ? 1.827   4.256   -0.116  1.00 1.20  ? 62  LEU A HD13 3  
ATOM 5196  H HD21 . LEU A 1 62  ? 3.027   1.273   -1.635  1.00 1.18  ? 62  LEU A HD21 3  
ATOM 5197  H HD22 . LEU A 1 62  ? 2.053   1.010   -0.188  1.00 1.33  ? 62  LEU A HD22 3  
ATOM 5198  H HD23 . LEU A 1 62  ? 3.180   2.363   -0.256  1.00 1.28  ? 62  LEU A HD23 3  
ATOM 5199  N N    . ILE A 1 63  ? -2.801  1.791   -0.215  1.00 0.26  ? 63  ILE A N    3  
ATOM 5200  C CA   . ILE A 1 63  ? -4.223  1.962   -0.417  1.00 0.26  ? 63  ILE A CA   3  
ATOM 5201  C C    . ILE A 1 63  ? -4.510  3.395   -0.827  1.00 0.25  ? 63  ILE A C    3  
ATOM 5202  O O    . ILE A 1 63  ? -4.550  4.276   0.021   1.00 0.24  ? 63  ILE A O    3  
ATOM 5203  C CB   . ILE A 1 63  ? -5.007  1.669   0.869   1.00 0.27  ? 63  ILE A CB   3  
ATOM 5204  C CG1  . ILE A 1 63  ? -4.474  0.402   1.549   1.00 0.32  ? 63  ILE A CG1  3  
ATOM 5205  C CG2  . ILE A 1 63  ? -6.492  1.538   0.551   1.00 0.33  ? 63  ILE A CG2  3  
ATOM 5206  C CD1  . ILE A 1 63  ? -5.009  -0.865  0.967   1.00 0.41  ? 63  ILE A CD1  3  
ATOM 5207  H H    . ILE A 1 63  ? -2.395  2.091   0.631   1.00 0.25  ? 63  ILE A H    3  
ATOM 5208  H HA   . ILE A 1 63  ? -4.544  1.277   -1.189  1.00 0.29  ? 63  ILE A HA   3  
ATOM 5209  H HB   . ILE A 1 63  ? -4.880  2.510   1.531   1.00 0.28  ? 63  ILE A HB   3  
ATOM 5210  H HG12 . ILE A 1 63  ? -3.400  0.377   1.452   1.00 0.36  ? 63  ILE A HG12 3  
ATOM 5211  H HG13 . ILE A 1 63  ? -4.731  0.418   2.596   1.00 0.39  ? 63  ILE A HG13 3  
ATOM 5212  H HG21 . ILE A 1 63  ? -6.849  2.458   0.104   1.00 1.10  ? 63  ILE A HG21 3  
ATOM 5213  H HG22 . ILE A 1 63  ? -7.039  1.344   1.461   1.00 1.02  ? 63  ILE A HG22 3  
ATOM 5214  H HG23 . ILE A 1 63  ? -6.640  0.720   -0.142  1.00 1.11  ? 63  ILE A HG23 3  
ATOM 5215  H HD11 . ILE A 1 63  ? -4.648  -0.974  -0.041  1.00 1.24  ? 63  ILE A HD11 3  
ATOM 5216  H HD12 . ILE A 1 63  ? -6.087  -0.816  0.966   1.00 0.97  ? 63  ILE A HD12 3  
ATOM 5217  H HD13 . ILE A 1 63  ? -4.684  -1.700  1.565   1.00 1.08  ? 63  ILE A HD13 3  
ATOM 5218  N N    . GLY A 1 64  ? -4.704  3.633   -2.112  1.00 0.28  ? 64  GLY A N    3  
ATOM 5219  C CA   . GLY A 1 64  ? -4.916  4.993   -2.578  1.00 0.27  ? 64  GLY A CA   3  
ATOM 5220  C C    . GLY A 1 64  ? -6.245  5.571   -2.123  1.00 0.29  ? 64  GLY A C    3  
ATOM 5221  O O    . GLY A 1 64  ? -7.178  4.830   -1.823  1.00 0.37  ? 64  GLY A O    3  
ATOM 5222  H H    . GLY A 1 64  ? -4.712  2.887   -2.749  1.00 0.32  ? 64  GLY A H    3  
ATOM 5223  H HA2  . GLY A 1 64  ? -4.121  5.613   -2.198  1.00 0.26  ? 64  GLY A HA2  3  
ATOM 5224  H HA3  . GLY A 1 64  ? -4.876  5.006   -3.651  1.00 0.33  ? 64  GLY A HA3  3  
ATOM 5225  N N    . LYS A 1 65  ? -6.327  6.896   -2.066  1.00 0.34  ? 65  LYS A N    3  
ATOM 5226  C CA   . LYS A 1 65  ? -7.544  7.570   -1.633  1.00 0.41  ? 65  LYS A CA   3  
ATOM 5227  C C    . LYS A 1 65  ? -8.615  7.512   -2.707  1.00 0.60  ? 65  LYS A C    3  
ATOM 5228  O O    . LYS A 1 65  ? -8.321  7.512   -3.905  1.00 0.80  ? 65  LYS A O    3  
ATOM 5229  C CB   . LYS A 1 65  ? -7.279  9.034   -1.288  1.00 0.53  ? 65  LYS A CB   3  
ATOM 5230  C CG   . LYS A 1 65  ? -6.348  9.243   -0.126  1.00 0.50  ? 65  LYS A CG   3  
ATOM 5231  C CD   . LYS A 1 65  ? -6.367  10.683  0.292   1.00 0.68  ? 65  LYS A CD   3  
ATOM 5232  C CE   . LYS A 1 65  ? -7.300  10.888  1.461   1.00 0.91  ? 65  LYS A CE   3  
ATOM 5233  N NZ   . LYS A 1 65  ? -7.538  12.327  1.747   1.00 1.16  ? 65  LYS A NZ   3  
ATOM 5234  H H    . LYS A 1 65  ? -5.550  7.436   -2.322  1.00 0.41  ? 65  LYS A H    3  
ATOM 5235  H HA   . LYS A 1 65  ? -7.908  7.066   -0.755  1.00 0.37  ? 65  LYS A HA   3  
ATOM 5236  H HB2  . LYS A 1 65  ? -6.852  9.520   -2.147  1.00 0.66  ? 65  LYS A HB2  3  
ATOM 5237  H HB3  . LYS A 1 65  ? -8.209  9.517   -1.046  1.00 0.67  ? 65  LYS A HB3  3  
ATOM 5238  H HG2  . LYS A 1 65  ? -6.672  8.637   0.703   1.00 0.58  ? 65  LYS A HG2  3  
ATOM 5239  H HG3  . LYS A 1 65  ? -5.352  8.969   -0.407  1.00 0.52  ? 65  LYS A HG3  3  
ATOM 5240  H HD2  . LYS A 1 65  ? -5.379  10.973  0.570   1.00 0.90  ? 65  LYS A HD2  3  
ATOM 5241  H HD3  . LYS A 1 65  ? -6.706  11.280  -0.539  1.00 0.68  ? 65  LYS A HD3  3  
ATOM 5242  H HE2  . LYS A 1 65  ? -8.236  10.407  1.235   1.00 0.98  ? 65  LYS A HE2  3  
ATOM 5243  H HE3  . LYS A 1 65  ? -6.861  10.423  2.332   1.00 1.08  ? 65  LYS A HE3  3  
ATOM 5244  H HZ1  . LYS A 1 65  ? -6.634  12.814  1.911   1.00 1.67  ? 65  LYS A HZ1  3  
ATOM 5245  H HZ2  . LYS A 1 65  ? -8.128  12.430  2.596   1.00 1.54  ? 65  LYS A HZ2  3  
ATOM 5246  H HZ3  . LYS A 1 65  ? -8.021  12.779  0.946   1.00 1.48  ? 65  LYS A HZ3  3  
ATOM 5247  N N    . VAL A 1 66  ? -9.850  7.453   -2.258  1.00 0.67  ? 66  VAL A N    3  
ATOM 5248  C CA   . VAL A 1 66  ? -11.001 7.515   -3.129  1.00 1.01  ? 66  VAL A CA   3  
ATOM 5249  C C    . VAL A 1 66  ? -11.785 8.781   -2.825  1.00 1.29  ? 66  VAL A C    3  
ATOM 5250  O O    . VAL A 1 66  ? -11.808 9.241   -1.680  1.00 1.39  ? 66  VAL A O    3  
ATOM 5251  C CB   . VAL A 1 66  ? -11.915 6.283   -2.965  1.00 1.12  ? 66  VAL A CB   3  
ATOM 5252  C CG1  . VAL A 1 66  ? -11.208 5.029   -3.447  1.00 1.26  ? 66  VAL A CG1  3  
ATOM 5253  C CG2  . VAL A 1 66  ? -12.356 6.116   -1.520  1.00 1.48  ? 66  VAL A CG2  3  
ATOM 5254  H H    . VAL A 1 66  ? -9.996  7.395   -1.295  1.00 0.65  ? 66  VAL A H    3  
ATOM 5255  H HA   . VAL A 1 66  ? -10.649 7.553   -4.151  1.00 1.28  ? 66  VAL A HA   3  
ATOM 5256  H HB   . VAL A 1 66  ? -12.794 6.431   -3.572  1.00 1.58  ? 66  VAL A HB   3  
ATOM 5257  H HG11 . VAL A 1 66  ? -11.860 4.176   -3.319  1.00 1.62  ? 66  VAL A HG11 3  
ATOM 5258  H HG12 . VAL A 1 66  ? -10.306 4.882   -2.871  1.00 1.87  ? 66  VAL A HG12 3  
ATOM 5259  H HG13 . VAL A 1 66  ? -10.957 5.136   -4.491  1.00 1.61  ? 66  VAL A HG13 3  
ATOM 5260  H HG21 . VAL A 1 66  ? -11.488 5.983   -0.892  1.00 1.91  ? 66  VAL A HG21 3  
ATOM 5261  H HG22 . VAL A 1 66  ? -12.996 5.251   -1.437  1.00 2.10  ? 66  VAL A HG22 3  
ATOM 5262  H HG23 . VAL A 1 66  ? -12.897 6.996   -1.206  1.00 1.76  ? 66  VAL A HG23 3  
ATOM 5263  N N    . ASP A 1 67  ? -12.402 9.354   -3.839  1.00 1.84  ? 67  ASP A N    3  
ATOM 5264  C CA   . ASP A 1 67  ? -13.169 10.575  -3.655  1.00 2.24  ? 67  ASP A CA   3  
ATOM 5265  C C    . ASP A 1 67  ? -14.488 10.262  -2.961  1.00 2.23  ? 67  ASP A C    3  
ATOM 5266  O O    . ASP A 1 67  ? -15.344 9.563   -3.506  1.00 2.60  ? 67  ASP A O    3  
ATOM 5267  C CB   . ASP A 1 67  ? -13.431 11.276  -4.989  1.00 3.07  ? 67  ASP A CB   3  
ATOM 5268  C CG   . ASP A 1 67  ? -13.924 12.698  -4.797  1.00 3.61  ? 67  ASP A CG   3  
ATOM 5269  O OD1  . ASP A 1 67  ? -15.033 12.886  -4.254  1.00 3.94  ? 67  ASP A OD1  3  
ATOM 5270  O OD2  . ASP A 1 67  ? -13.195 13.641  -5.168  1.00 4.14  ? 67  ASP A OD2  3  
ATOM 5271  H H    . ASP A 1 67  ? -12.341 8.945   -4.726  1.00 2.14  ? 67  ASP A H    3  
ATOM 5272  H HA   . ASP A 1 67  ? -12.593 11.232  -3.020  1.00 2.38  ? 67  ASP A HA   3  
ATOM 5273  H HB2  . ASP A 1 67  ? -12.516 11.305  -5.561  1.00 3.41  ? 67  ASP A HB2  3  
ATOM 5274  H HB3  . ASP A 1 67  ? -14.179 10.725  -5.538  1.00 3.48  ? 67  ASP A HB3  3  
ATOM 5275  N N    . GLU A 1 68  ? -14.639 10.788  -1.757  1.00 2.48  ? 68  GLU A N    3  
ATOM 5276  C CA   . GLU A 1 68  ? -15.783 10.514  -0.924  1.00 2.96  ? 68  GLU A CA   3  
ATOM 5277  C C    . GLU A 1 68  ? -17.051 11.185  -1.441  1.00 3.03  ? 68  GLU A C    3  
ATOM 5278  O O    . GLU A 1 68  ? -18.153 10.675  -1.241  1.00 3.47  ? 68  GLU A O    3  
ATOM 5279  C CB   . GLU A 1 68  ? -15.475 11.009  0.476   1.00 3.79  ? 68  GLU A CB   3  
ATOM 5280  C CG   . GLU A 1 68  ? -14.594 10.084  1.278   1.00 4.24  ? 68  GLU A CG   3  
ATOM 5281  C CD   . GLU A 1 68  ? -15.273 8.772   1.596   1.00 4.33  ? 68  GLU A CD   3  
ATOM 5282  O OE1  . GLU A 1 68  ? -16.042 8.714   2.575   1.00 4.54  ? 68  GLU A OE1  3  
ATOM 5283  O OE2  . GLU A 1 68  ? -15.044 7.789   0.860   1.00 4.61  ? 68  GLU A OE2  3  
ATOM 5284  H H    . GLU A 1 68  ? -13.952 11.386  -1.405  1.00 2.75  ? 68  GLU A H    3  
ATOM 5285  H HA   . GLU A 1 68  ? -15.931 9.451   -0.891  1.00 3.16  ? 68  GLU A HA   3  
ATOM 5286  H HB2  . GLU A 1 68  ? -14.979 11.958  0.400   1.00 4.05  ? 68  GLU A HB2  3  
ATOM 5287  H HB3  . GLU A 1 68  ? -16.381 11.138  1.003   1.00 4.24  ? 68  GLU A HB3  3  
ATOM 5288  H HG2  . GLU A 1 68  ? -13.701 9.887   0.716   1.00 4.79  ? 68  GLU A HG2  3  
ATOM 5289  H HG3  . GLU A 1 68  ? -14.341 10.575  2.202   1.00 4.43  ? 68  GLU A HG3  3  
ATOM 5290  N N    . SER A 1 69  ? -16.889 12.315  -2.109  1.00 3.10  ? 69  SER A N    3  
ATOM 5291  C CA   . SER A 1 69  ? -18.023 13.143  -2.487  1.00 3.63  ? 69  SER A CA   3  
ATOM 5292  C C    . SER A 1 69  ? -18.566 12.801  -3.872  1.00 3.71  ? 69  SER A C    3  
ATOM 5293  O O    . SER A 1 69  ? -19.750 13.009  -4.143  1.00 4.40  ? 69  SER A O    3  
ATOM 5294  C CB   . SER A 1 69  ? -17.634 14.607  -2.424  1.00 4.49  ? 69  SER A CB   3  
ATOM 5295  O OG   . SER A 1 69  ? -17.117 14.940  -1.144  1.00 4.68  ? 69  SER A OG   3  
ATOM 5296  H H    . SER A 1 69  ? -15.984 12.597  -2.365  1.00 3.14  ? 69  SER A H    3  
ATOM 5297  H HA   . SER A 1 69  ? -18.794 12.979  -1.771  1.00 3.90  ? 69  SER A HA   3  
ATOM 5298  H HB2  . SER A 1 69  ? -16.890 14.792  -3.158  1.00 4.89  ? 69  SER A HB2  3  
ATOM 5299  H HB3  . SER A 1 69  ? -18.493 15.220  -2.624  1.00 4.96  ? 69  SER A HB3  3  
ATOM 5300  H HG   . SER A 1 69  ? -17.388 14.265  -0.506  1.00 4.92  ? 69  SER A HG   3  
ATOM 5301  N N    . LYS A 1 70  ? -17.715 12.282  -4.751  1.00 3.46  ? 70  LYS A N    3  
ATOM 5302  C CA   . LYS A 1 70  ? -18.146 11.964  -6.110  1.00 4.25  ? 70  LYS A CA   3  
ATOM 5303  C C    . LYS A 1 70  ? -19.150 10.821  -6.128  1.00 4.39  ? 70  LYS A C    3  
ATOM 5304  O O    . LYS A 1 70  ? -20.057 10.804  -6.958  1.00 5.30  ? 70  LYS A O    3  
ATOM 5305  C CB   . LYS A 1 70  ? -16.961 11.623  -7.011  1.00 4.65  ? 70  LYS A CB   3  
ATOM 5306  C CG   . LYS A 1 70  ? -16.166 12.824  -7.453  1.00 5.30  ? 70  LYS A CG   3  
ATOM 5307  C CD   . LYS A 1 70  ? -15.127 12.423  -8.471  1.00 5.73  ? 70  LYS A CD   3  
ATOM 5308  C CE   . LYS A 1 70  ? -14.028 13.448  -8.527  1.00 6.36  ? 70  LYS A CE   3  
ATOM 5309  N NZ   . LYS A 1 70  ? -12.977 13.086  -9.509  1.00 6.99  ? 70  LYS A NZ   3  
ATOM 5310  H H    . LYS A 1 70  ? -16.777 12.130  -4.489  1.00 3.05  ? 70  LYS A H    3  
ATOM 5311  H HA   . LYS A 1 70  ? -18.633 12.843  -6.504  1.00 4.88  ? 70  LYS A HA   3  
ATOM 5312  H HB2  . LYS A 1 70  ? -16.285 10.974  -6.476  1.00 4.40  ? 70  LYS A HB2  3  
ATOM 5313  H HB3  . LYS A 1 70  ? -17.323 11.111  -7.890  1.00 5.12  ? 70  LYS A HB3  3  
ATOM 5314  H HG2  . LYS A 1 70  ? -16.829 13.549  -7.896  1.00 5.74  ? 70  LYS A HG2  3  
ATOM 5315  H HG3  . LYS A 1 70  ? -15.672 13.257  -6.596  1.00 5.41  ? 70  LYS A HG3  3  
ATOM 5316  H HD2  . LYS A 1 70  ? -14.709 11.469  -8.191  1.00 5.78  ? 70  LYS A HD2  3  
ATOM 5317  H HD3  . LYS A 1 70  ? -15.592 12.349  -9.443  1.00 5.93  ? 70  LYS A HD3  3  
ATOM 5318  H HE2  . LYS A 1 70  ? -14.453 14.403  -8.796  1.00 6.60  ? 70  LYS A HE2  3  
ATOM 5319  H HE3  . LYS A 1 70  ? -13.593 13.511  -7.542  1.00 6.43  ? 70  LYS A HE3  3  
ATOM 5320  H HZ1  . LYS A 1 70  ? -12.514 12.197  -9.228  1.00 6.98  ? 70  LYS A HZ1  3  
ATOM 5321  H HZ2  . LYS A 1 70  ? -12.260 13.837  -9.561  1.00 7.36  ? 70  LYS A HZ2  3  
ATOM 5322  H HZ3  . LYS A 1 70  ? -13.400 12.959  -10.452 1.00 7.35  ? 70  LYS A HZ3  3  
ATOM 5323  N N    . LYS A 1 71  ? -19.007 9.873   -5.214  1.00 3.86  ? 71  LYS A N    3  
ATOM 5324  C CA   . LYS A 1 71  ? -19.957 8.779   -5.137  1.00 4.42  ? 71  LYS A CA   3  
ATOM 5325  C C    . LYS A 1 71  ? -21.064 9.109   -4.149  1.00 4.63  ? 71  LYS A C    3  
ATOM 5326  O O    . LYS A 1 71  ? -20.898 9.948   -3.260  1.00 4.42  ? 71  LYS A O    3  
ATOM 5327  C CB   . LYS A 1 71  ? -19.277 7.464   -4.779  1.00 4.55  ? 71  LYS A CB   3  
ATOM 5328  C CG   . LYS A 1 71  ? -20.163 6.273   -5.018  1.00 5.51  ? 71  LYS A CG   3  
ATOM 5329  C CD   . LYS A 1 71  ? -19.365 5.073   -5.441  1.00 6.15  ? 71  LYS A CD   3  
ATOM 5330  C CE   . LYS A 1 71  ? -20.230 3.833   -5.502  1.00 7.31  ? 71  LYS A CE   3  
ATOM 5331  N NZ   . LYS A 1 71  ? -19.535 2.687   -6.148  1.00 8.20  ? 71  LYS A NZ   3  
ATOM 5332  H H    . LYS A 1 71  ? -18.259 9.916   -4.581  1.00 3.38  ? 71  LYS A H    3  
ATOM 5333  H HA   . LYS A 1 71  ? -20.402 8.668   -6.113  1.00 5.06  ? 71  LYS A HA   3  
ATOM 5334  H HB2  . LYS A 1 71  ? -18.411 7.348   -5.391  1.00 4.44  ? 71  LYS A HB2  3  
ATOM 5335  H HB3  . LYS A 1 71  ? -18.990 7.474   -3.740  1.00 4.51  ? 71  LYS A HB3  3  
ATOM 5336  H HG2  . LYS A 1 71  ? -20.710 6.048   -4.121  1.00 5.66  ? 71  LYS A HG2  3  
ATOM 5337  H HG3  . LYS A 1 71  ? -20.842 6.518   -5.810  1.00 5.91  ? 71  LYS A HG3  3  
ATOM 5338  H HD2  . LYS A 1 71  ? -18.971 5.275   -6.419  1.00 6.23  ? 71  LYS A HD2  3  
ATOM 5339  H HD3  . LYS A 1 71  ? -18.562 4.914   -4.740  1.00 5.97  ? 71  LYS A HD3  3  
ATOM 5340  H HE2  . LYS A 1 71  ? -20.491 3.561   -4.494  1.00 7.38  ? 71  LYS A HE2  3  
ATOM 5341  H HE3  . LYS A 1 71  ? -21.127 4.062   -6.058  1.00 7.65  ? 71  LYS A HE3  3  
ATOM 5342  H HZ1  . LYS A 1 71  ? -18.693 2.418   -5.598  1.00 8.38  ? 71  LYS A HZ1  3  
ATOM 5343  H HZ2  . LYS A 1 71  ? -19.237 2.943   -7.111  1.00 8.58  ? 71  LYS A HZ2  3  
ATOM 5344  H HZ3  . LYS A 1 71  ? -20.175 1.868   -6.204  1.00 8.49  ? 71  LYS A HZ3  3  
ATOM 5345  N N    . ARG A 1 72  ? -22.181 8.433   -4.314  1.00 5.41  ? 72  ARG A N    3  
ATOM 5346  C CA   . ARG A 1 72  ? -23.377 8.707   -3.534  1.00 5.92  ? 72  ARG A CA   3  
ATOM 5347  C C    . ARG A 1 72  ? -23.931 7.417   -2.950  1.00 5.77  ? 72  ARG A C    3  
ATOM 5348  O O    . ARG A 1 72  ? -23.476 6.327   -3.300  1.00 5.54  ? 72  ARG A O    3  
ATOM 5349  C CB   . ARG A 1 72  ? -24.451 9.409   -4.378  1.00 6.97  ? 72  ARG A CB   3  
ATOM 5350  C CG   . ARG A 1 72  ? -25.198 8.493   -5.325  1.00 7.56  ? 72  ARG A CG   3  
ATOM 5351  C CD   . ARG A 1 72  ? -24.336 8.006   -6.480  1.00 8.44  ? 72  ARG A CD   3  
ATOM 5352  N NE   . ARG A 1 72  ? -25.037 7.028   -7.309  1.00 9.04  ? 72  ARG A NE   3  
ATOM 5353  C CZ   . ARG A 1 72  ? -24.493 6.408   -8.357  1.00 10.00 ? 72  ARG A CZ   3  
ATOM 5354  N NH1  . ARG A 1 72  ? -23.260 6.704   -8.747  1.00 10.44 ? 72  ARG A NH1  3  
ATOM 5355  N NH2  . ARG A 1 72  ? -25.194 5.504   -9.028  1.00 10.67 ? 72  ARG A NH2  3  
ATOM 5356  H H    . ARG A 1 72  ? -22.190 7.702   -4.965  1.00 5.81  ? 72  ARG A H    3  
ATOM 5357  H HA   . ARG A 1 72  ? -23.099 9.353   -2.723  1.00 5.94  ? 72  ARG A HA   3  
ATOM 5358  H HB2  . ARG A 1 72  ? -25.175 9.848   -3.714  1.00 7.23  ? 72  ARG A HB2  3  
ATOM 5359  H HB3  . ARG A 1 72  ? -23.986 10.189  -4.956  1.00 7.35  ? 72  ARG A HB3  3  
ATOM 5360  H HG2  . ARG A 1 72  ? -25.533 7.643   -4.760  1.00 7.62  ? 72  ARG A HG2  3  
ATOM 5361  H HG3  . ARG A 1 72  ? -26.053 9.022   -5.722  1.00 7.57  ? 72  ARG A HG3  3  
ATOM 5362  H HD2  . ARG A 1 72  ? -24.064 8.852   -7.091  1.00 8.79  ? 72  ARG A HD2  3  
ATOM 5363  H HD3  . ARG A 1 72  ? -23.445 7.550   -6.079  1.00 8.51  ? 72  ARG A HD3  3  
ATOM 5364  H HE   . ARG A 1 72  ? -25.965 6.811   -7.059  1.00 8.87  ? 72  ARG A HE   3  
ATOM 5365  H HH11 . ARG A 1 72  ? -22.730 7.398   -8.256  1.00 10.10 ? 72  ARG A HH11 3  
ATOM 5366  H HH12 . ARG A 1 72  ? -22.855 6.238   -9.537  1.00 11.22 ? 72  ARG A HH12 3  
ATOM 5367  H HH21 . ARG A 1 72  ? -26.133 5.287   -8.753  1.00 10.52 ? 72  ARG A HH21 3  
ATOM 5368  H HH22 . ARG A 1 72  ? -24.787 5.030   -9.813  1.00 11.45 ? 72  ARG A HH22 3  
ATOM 5369  N N    . LYS A 1 73  ? -24.900 7.551   -2.059  1.00 6.20  ? 73  LYS A N    3  
ATOM 5370  C CA   . LYS A 1 73  ? -25.506 6.400   -1.398  1.00 6.28  ? 73  LYS A CA   3  
ATOM 5371  C C    . LYS A 1 73  ? -26.335 5.576   -2.375  1.00 6.69  ? 73  LYS A C    3  
ATOM 5372  O O    . LYS A 1 73  ? -26.632 6.012   -3.493  1.00 7.13  ? 73  LYS A O    3  
ATOM 5373  C CB   . LYS A 1 73  ? -26.379 6.858   -0.243  1.00 6.89  ? 73  LYS A CB   3  
ATOM 5374  C CG   . LYS A 1 73  ? -25.633 7.677   0.796   1.00 6.88  ? 73  LYS A CG   3  
ATOM 5375  C CD   . LYS A 1 73  ? -26.507 7.987   1.997   1.00 7.64  ? 73  LYS A CD   3  
ATOM 5376  C CE   . LYS A 1 73  ? -27.361 9.238   1.795   1.00 8.45  ? 73  LYS A CE   3  
ATOM 5377  N NZ   . LYS A 1 73  ? -28.341 9.100   0.684   1.00 8.97  ? 73  LYS A NZ   3  
ATOM 5378  H H    . LYS A 1 73  ? -25.225 8.454   -1.845  1.00 6.62  ? 73  LYS A H    3  
ATOM 5379  H HA   . LYS A 1 73  ? -24.718 5.782   -1.005  1.00 5.84  ? 73  LYS A HA   3  
ATOM 5380  H HB2  . LYS A 1 73  ? -27.183 7.443   -0.636  1.00 7.51  ? 73  LYS A HB2  3  
ATOM 5381  H HB3  . LYS A 1 73  ? -26.790 5.986   0.247   1.00 7.00  ? 73  LYS A HB3  3  
ATOM 5382  H HG2  . LYS A 1 73  ? -24.769 7.121   1.127   1.00 6.63  ? 73  LYS A HG2  3  
ATOM 5383  H HG3  . LYS A 1 73  ? -25.313 8.605   0.345   1.00 6.84  ? 73  LYS A HG3  3  
ATOM 5384  H HD2  . LYS A 1 73  ? -27.159 7.145   2.166   1.00 7.77  ? 73  LYS A HD2  3  
ATOM 5385  H HD3  . LYS A 1 73  ? -25.874 8.130   2.861   1.00 7.70  ? 73  LYS A HD3  3  
ATOM 5386  H HE2  . LYS A 1 73  ? -27.899 9.438   2.709   1.00 8.78  ? 73  LYS A HE2  3  
ATOM 5387  H HE3  . LYS A 1 73  ? -26.704 10.069  1.581   1.00 8.56  ? 73  LYS A HE3  3  
ATOM 5388  H HZ1  . LYS A 1 73  ? -28.958 9.936   0.645   1.00 9.28  ? 73  LYS A HZ1  3  
ATOM 5389  H HZ2  . LYS A 1 73  ? -28.931 8.256   0.826   1.00 9.21  ? 73  LYS A HZ2  3  
ATOM 5390  H HZ3  . LYS A 1 73  ? -27.843 9.010   -0.222  1.00 9.02  ? 73  LYS A HZ3  3  
ATOM 5391  N N    . ASP A 1 74  ? -26.704 4.385   -1.941  1.00 6.78  ? 74  ASP A N    3  
ATOM 5392  C CA   . ASP A 1 74  ? -27.402 3.435   -2.798  1.00 7.38  ? 74  ASP A CA   3  
ATOM 5393  C C    . ASP A 1 74  ? -28.891 3.377   -2.450  1.00 8.21  ? 74  ASP A C    3  
ATOM 5394  O O    . ASP A 1 74  ? -29.405 4.261   -1.759  1.00 8.34  ? 74  ASP A O    3  
ATOM 5395  C CB   . ASP A 1 74  ? -26.765 2.050   -2.678  1.00 7.38  ? 74  ASP A CB   3  
ATOM 5396  C CG   . ASP A 1 74  ? -26.965 1.196   -3.916  1.00 8.19  ? 74  ASP A CG   3  
ATOM 5397  O OD1  . ASP A 1 74  ? -27.998 0.500   -4.001  1.00 8.74  ? 74  ASP A OD1  3  
ATOM 5398  O OD2  . ASP A 1 74  ? -26.094 1.215   -4.812  1.00 8.40  ? 74  ASP A OD2  3  
ATOM 5399  H H    . ASP A 1 74  ? -26.520 4.145   -1.006  1.00 6.59  ? 74  ASP A H    3  
ATOM 5400  H HA   . ASP A 1 74  ? -27.300 3.773   -3.813  1.00 7.42  ? 74  ASP A HA   3  
ATOM 5401  H HB2  . ASP A 1 74  ? -25.705 2.161   -2.507  1.00 6.84  ? 74  ASP A HB2  3  
ATOM 5402  H HB3  . ASP A 1 74  ? -27.207 1.540   -1.839  1.00 7.53  ? 74  ASP A HB3  3  
ATOM 5403  N N    . ASN A 1 75  ? -29.571 2.330   -2.895  1.00 8.89  ? 75  ASN A N    3  
ATOM 5404  C CA   . ASN A 1 75  ? -31.023 2.226   -2.752  1.00 9.75  ? 75  ASN A CA   3  
ATOM 5405  C C    . ASN A 1 75  ? -31.454 2.106   -1.293  1.00 9.91  ? 75  ASN A C    3  
ATOM 5406  O O    . ASN A 1 75  ? -32.510 2.607   -0.908  1.00 10.47 ? 75  ASN A O    3  
ATOM 5407  C CB   . ASN A 1 75  ? -31.549 1.026   -3.542  1.00 10.48 ? 75  ASN A CB   3  
ATOM 5408  C CG   . ASN A 1 75  ? -31.399 1.197   -5.040  1.00 10.99 ? 75  ASN A CG   3  
ATOM 5409  O OD1  . ASN A 1 75  ? -32.295 1.708   -5.709  1.00 11.25 ? 75  ASN A OD1  3  
ATOM 5410  N ND2  . ASN A 1 75  ? -30.265 0.782   -5.580  1.00 11.37 ? 75  ASN A ND2  3  
ATOM 5411  H H    . ASN A 1 75  ? -29.080 1.594   -3.336  1.00 8.89  ? 75  ASN A H    3  
ATOM 5412  H HA   . ASN A 1 75  ? -31.456 3.124   -3.165  1.00 9.91  ? 75  ASN A HA   3  
ATOM 5413  H HB2  . ASN A 1 75  ? -31.006 0.142   -3.245  1.00 10.54 ? 75  ASN A HB2  3  
ATOM 5414  H HB3  . ASN A 1 75  ? -32.597 0.890   -3.318  1.00 10.77 ? 75  ASN A HB3  3  
ATOM 5415  H HD21 . ASN A 1 75  ? -29.579 0.391   -4.987  1.00 11.28 ? 75  ASN A HD21 3  
ATOM 5416  H HD22 . ASN A 1 75  ? -30.152 0.874   -6.548  1.00 11.84 ? 75  ASN A HD22 3  
ATOM 5417  N N    . GLU A 1 76  ? -30.629 1.471   -0.474  1.00 9.56  ? 76  GLU A N    3  
ATOM 5418  C CA   . GLU A 1 76  ? -30.954 1.278   0.934   1.00 9.89  ? 76  GLU A CA   3  
ATOM 5419  C C    . GLU A 1 76  ? -30.130 2.231   1.778   1.00 9.42  ? 76  GLU A C    3  
ATOM 5420  O O    . GLU A 1 76  ? -29.988 2.060   2.989   1.00 9.74  ? 76  GLU A O    3  
ATOM 5421  C CB   . GLU A 1 76  ? -30.662 -0.164  1.349   1.00 10.10 ? 76  GLU A CB   3  
ATOM 5422  C CG   . GLU A 1 76  ? -31.474 -1.202  0.598   1.00 10.22 ? 76  GLU A CG   3  
ATOM 5423  C CD   . GLU A 1 76  ? -32.952 -1.108  0.901   1.00 10.82 ? 76  GLU A CD   3  
ATOM 5424  O OE1  . GLU A 1 76  ? -33.338 -1.287  2.075   1.00 11.20 ? 76  GLU A OE1  3  
ATOM 5425  O OE2  . GLU A 1 76  ? -33.736 -0.841  -0.031  1.00 11.06 ? 76  GLU A OE2  3  
ATOM 5426  H H    . GLU A 1 76  ? -29.770 1.133   -0.813  1.00 9.17  ? 76  GLU A H    3  
ATOM 5427  H HA   . GLU A 1 76  ? -32.003 1.489   1.074   1.00 10.50 ? 76  GLU A HA   3  
ATOM 5428  H HB2  . GLU A 1 76  ? -29.615 -0.367  1.180   1.00 9.97  ? 76  GLU A HB2  3  
ATOM 5429  H HB3  . GLU A 1 76  ? -30.872 -0.269  2.402   1.00 10.53 ? 76  GLU A HB3  3  
ATOM 5430  H HG2  . GLU A 1 76  ? -31.329 -1.058  -0.463  1.00 10.34 ? 76  GLU A HG2  3  
ATOM 5431  H HG3  . GLU A 1 76  ? -31.126 -2.185  0.879   1.00 9.99  ? 76  GLU A HG3  3  
ATOM 5432  N N    . GLY A 1 77  ? -29.574 3.225   1.113   1.00 8.81  ? 77  GLY A N    3  
ATOM 5433  C CA   . GLY A 1 77  ? -28.620 4.104   1.729   1.00 8.45  ? 77  GLY A CA   3  
ATOM 5434  C C    . GLY A 1 77  ? -27.249 3.529   1.533   1.00 7.87  ? 77  GLY A C    3  
ATOM 5435  O O    . GLY A 1 77  ? -26.432 4.085   0.806   1.00 7.68  ? 77  GLY A O    3  
ATOM 5436  H H    . GLY A 1 77  ? -29.789 3.338   0.174   1.00 8.72  ? 77  GLY A H    3  
ATOM 5437  H HA2  . GLY A 1 77  ? -28.676 5.081   1.269   1.00 8.21  ? 77  GLY A HA2  3  
ATOM 5438  H HA3  . GLY A 1 77  ? -28.826 4.184   2.786   1.00 8.99  ? 77  GLY A HA3  3  
ATOM 5439  N N    . ASN A 1 78  ? -27.080 2.340   2.094   1.00 7.80  ? 78  ASN A N    3  
ATOM 5440  C CA   . ASN A 1 78  ? -25.863 1.531   2.009   1.00 7.46  ? 78  ASN A CA   3  
ATOM 5441  C C    . ASN A 1 78  ? -24.564 2.226   2.463   1.00 6.97  ? 78  ASN A C    3  
ATOM 5442  O O    . ASN A 1 78  ? -23.727 1.579   3.091   1.00 7.29  ? 78  ASN A O    3  
ATOM 5443  C CB   . ASN A 1 78  ? -25.719 1.040   0.584   1.00 7.23  ? 78  ASN A CB   3  
ATOM 5444  C CG   . ASN A 1 78  ? -26.732 -0.034  0.230   1.00 8.06  ? 78  ASN A CG   3  
ATOM 5445  O OD1  . ASN A 1 78  ? -27.831 0.262   -0.242  1.00 8.60  ? 78  ASN A OD1  3  
ATOM 5446  N ND2  . ASN A 1 78  ? -26.371 -1.288  0.456   1.00 8.39  ? 78  ASN A ND2  3  
ATOM 5447  H H    . ASN A 1 78  ? -27.852 1.946   2.526   1.00 8.12  ? 78  ASN A H    3  
ATOM 5448  H HA   . ASN A 1 78  ? -26.013 0.669   2.639   1.00 7.96  ? 78  ASN A HA   3  
ATOM 5449  H HB2  . ASN A 1 78  ? -25.870 1.875   -0.080  1.00 7.05  ? 78  ASN A HB2  3  
ATOM 5450  H HB3  . ASN A 1 78  ? -24.733 0.647   0.448   1.00 6.85  ? 78  ASN A HB3  3  
ATOM 5451  H HD21 . ASN A 1 78  ? -25.480 -1.456  0.835   1.00 8.13  ? 78  ASN A HD21 3  
ATOM 5452  H HD22 . ASN A 1 78  ? -27.010 -1.999  0.236   1.00 9.00  ? 78  ASN A HD22 3  
ATOM 5453  N N    . GLU A 1 79  ? -24.405 3.510   2.144   1.00 6.44  ? 79  GLU A N    3  
ATOM 5454  C CA   . GLU A 1 79  ? -23.167 4.268   2.371   1.00 6.06  ? 79  GLU A CA   3  
ATOM 5455  C C    . GLU A 1 79  ? -21.951 3.447   1.949   1.00 5.51  ? 79  GLU A C    3  
ATOM 5456  O O    . GLU A 1 79  ? -21.049 3.153   2.741   1.00 5.77  ? 79  GLU A O    3  
ATOM 5457  C CB   . GLU A 1 79  ? -23.040 4.783   3.821   1.00 6.75  ? 79  GLU A CB   3  
ATOM 5458  C CG   . GLU A 1 79  ? -22.888 3.712   4.879   1.00 7.16  ? 79  GLU A CG   3  
ATOM 5459  C CD   . GLU A 1 79  ? -22.627 4.284   6.252   1.00 7.94  ? 79  GLU A CD   3  
ATOM 5460  O OE1  . GLU A 1 79  ? -21.476 4.673   6.527   1.00 8.32  ? 79  GLU A OE1  3  
ATOM 5461  O OE2  . GLU A 1 79  ? -23.573 4.339   7.068   1.00 8.38  ? 79  GLU A OE2  3  
ATOM 5462  H H    . GLU A 1 79  ? -25.157 3.971   1.716   1.00 6.47  ? 79  GLU A H    3  
ATOM 5463  H HA   . GLU A 1 79  ? -23.213 5.125   1.719   1.00 5.88  ? 79  GLU A HA   3  
ATOM 5464  H HB2  . GLU A 1 79  ? -22.174 5.418   3.880   1.00 7.10  ? 79  GLU A HB2  3  
ATOM 5465  H HB3  . GLU A 1 79  ? -23.917 5.368   4.057   1.00 6.91  ? 79  GLU A HB3  3  
ATOM 5466  H HG2  . GLU A 1 79  ? -23.790 3.121   4.912   1.00 6.94  ? 79  GLU A HG2  3  
ATOM 5467  H HG3  . GLU A 1 79  ? -22.056 3.088   4.600   1.00 7.42  ? 79  GLU A HG3  3  
ATOM 5468  N N    . VAL A 1 80  ? -21.937 3.083   0.676   1.00 4.98  ? 80  VAL A N    3  
ATOM 5469  C CA   . VAL A 1 80  ? -20.887 2.241   0.141   1.00 4.58  ? 80  VAL A CA   3  
ATOM 5470  C C    . VAL A 1 80  ? -19.632 3.064   -0.077  1.00 3.98  ? 80  VAL A C    3  
ATOM 5471  O O    . VAL A 1 80  ? -19.699 4.265   -0.356  1.00 3.86  ? 80  VAL A O    3  
ATOM 5472  C CB   . VAL A 1 80  ? -21.300 1.568   -1.193  1.00 4.62  ? 80  VAL A CB   3  
ATOM 5473  C CG1  . VAL A 1 80  ? -22.750 1.127   -1.139  1.00 5.39  ? 80  VAL A CG1  3  
ATOM 5474  C CG2  . VAL A 1 80  ? -21.058 2.477   -2.389  1.00 4.28  ? 80  VAL A CG2  3  
ATOM 5475  H H    . VAL A 1 80  ? -22.641 3.407   0.079   1.00 5.01  ? 80  VAL A H    3  
ATOM 5476  H HA   . VAL A 1 80  ? -20.677 1.467   0.864   1.00 5.01  ? 80  VAL A HA   3  
ATOM 5477  H HB   . VAL A 1 80  ? -20.693 0.683   -1.319  1.00 4.65  ? 80  VAL A HB   3  
ATOM 5478  H HG11 . VAL A 1 80  ? -23.385 1.996   -1.001  1.00 5.49  ? 80  VAL A HG11 3  
ATOM 5479  H HG12 . VAL A 1 80  ? -22.884 0.446   -0.313  1.00 5.78  ? 80  VAL A HG12 3  
ATOM 5480  H HG13 . VAL A 1 80  ? -23.011 0.632   -2.062  1.00 5.71  ? 80  VAL A HG13 3  
ATOM 5481  H HG21 . VAL A 1 80  ? -21.390 1.982   -3.290  1.00 4.44  ? 80  VAL A HG21 3  
ATOM 5482  H HG22 . VAL A 1 80  ? -20.000 2.693   -2.469  1.00 4.33  ? 80  VAL A HG22 3  
ATOM 5483  H HG23 . VAL A 1 80  ? -21.605 3.398   -2.260  1.00 4.29  ? 80  VAL A HG23 3  
ATOM 5484  N N    . VAL A 1 81  ? -18.496 2.430   0.076   1.00 3.91  ? 81  VAL A N    3  
ATOM 5485  C CA   . VAL A 1 81  ? -17.238 3.083   -0.179  1.00 3.49  ? 81  VAL A CA   3  
ATOM 5486  C C    . VAL A 1 81  ? -16.598 2.483   -1.423  1.00 2.81  ? 81  VAL A C    3  
ATOM 5487  O O    . VAL A 1 81  ? -16.525 1.259   -1.568  1.00 2.88  ? 81  VAL A O    3  
ATOM 5488  C CB   . VAL A 1 81  ? -16.286 2.983   1.037   1.00 4.02  ? 81  VAL A CB   3  
ATOM 5489  C CG1  . VAL A 1 81  ? -16.055 1.538   1.454   1.00 4.27  ? 81  VAL A CG1  3  
ATOM 5490  C CG2  . VAL A 1 81  ? -14.970 3.671   0.727   1.00 4.20  ? 81  VAL A CG2  3  
ATOM 5491  H H    . VAL A 1 81  ? -18.501 1.492   0.360   1.00 4.34  ? 81  VAL A H    3  
ATOM 5492  H HA   . VAL A 1 81  ? -17.442 4.127   -0.365  1.00 3.57  ? 81  VAL A HA   3  
ATOM 5493  H HB   . VAL A 1 81  ? -16.744 3.501   1.867   1.00 4.55  ? 81  VAL A HB   3  
ATOM 5494  H HG11 . VAL A 1 81  ? -17.002 1.077   1.694   1.00 4.42  ? 81  VAL A HG11 3  
ATOM 5495  H HG12 . VAL A 1 81  ? -15.412 1.511   2.321   1.00 4.47  ? 81  VAL A HG12 3  
ATOM 5496  H HG13 . VAL A 1 81  ? -15.589 1.001   0.643   1.00 4.58  ? 81  VAL A HG13 3  
ATOM 5497  H HG21 . VAL A 1 81  ? -15.158 4.707   0.490   1.00 4.50  ? 81  VAL A HG21 3  
ATOM 5498  H HG22 . VAL A 1 81  ? -14.508 3.187   -0.119  1.00 4.41  ? 81  VAL A HG22 3  
ATOM 5499  H HG23 . VAL A 1 81  ? -14.318 3.607   1.584   1.00 4.31  ? 81  VAL A HG23 3  
ATOM 5500  N N    . PRO A 1 82  ? -16.172 3.332   -2.363  1.00 2.49  ? 82  PRO A N    3  
ATOM 5501  C CA   . PRO A 1 82  ? -15.534 2.876   -3.586  1.00 2.15  ? 82  PRO A CA   3  
ATOM 5502  C C    . PRO A 1 82  ? -14.188 2.244   -3.293  1.00 1.66  ? 82  PRO A C    3  
ATOM 5503  O O    . PRO A 1 82  ? -13.393 2.790   -2.527  1.00 1.69  ? 82  PRO A O    3  
ATOM 5504  C CB   . PRO A 1 82  ? -15.383 4.138   -4.423  1.00 2.57  ? 82  PRO A CB   3  
ATOM 5505  C CG   . PRO A 1 82  ? -15.426 5.249   -3.465  1.00 2.91  ? 82  PRO A CG   3  
ATOM 5506  C CD   . PRO A 1 82  ? -16.261 4.797   -2.300  1.00 2.92  ? 82  PRO A CD   3  
ATOM 5507  H HA   . PRO A 1 82  ? -16.149 2.176   -4.110  1.00 2.39  ? 82  PRO A HA   3  
ATOM 5508  H HB2  . PRO A 1 82  ? -14.451 4.115   -4.950  1.00 2.53  ? 82  PRO A HB2  3  
ATOM 5509  H HB3  . PRO A 1 82  ? -16.192 4.206   -5.123  1.00 2.99  ? 82  PRO A HB3  3  
ATOM 5510  H HG2  . PRO A 1 82  ? -14.431 5.472   -3.144  1.00 2.90  ? 82  PRO A HG2  3  
ATOM 5511  H HG3  . PRO A 1 82  ? -15.870 6.097   -3.943  1.00 3.42  ? 82  PRO A HG3  3  
ATOM 5512  H HD2  . PRO A 1 82  ? -15.843 5.166   -1.376  1.00 3.15  ? 82  PRO A HD2  3  
ATOM 5513  H HD3  . PRO A 1 82  ? -17.279 5.126   -2.409  1.00 3.30  ? 82  PRO A HD3  3  
ATOM 5514  N N    . LYS A 1 83  ? -13.957 1.077   -3.873  1.00 1.57  ? 83  LYS A N    3  
ATOM 5515  C CA   . LYS A 1 83  ? -12.735 0.335   -3.629  1.00 1.32  ? 83  LYS A CA   3  
ATOM 5516  C C    . LYS A 1 83  ? -11.519 1.132   -4.059  1.00 1.05  ? 83  LYS A C    3  
ATOM 5517  O O    . LYS A 1 83  ? -11.367 1.494   -5.227  1.00 1.19  ? 83  LYS A O    3  
ATOM 5518  C CB   . LYS A 1 83  ? -12.754 -1.004  -4.350  1.00 1.66  ? 83  LYS A CB   3  
ATOM 5519  C CG   . LYS A 1 83  ? -13.855 -1.941  -3.897  1.00 2.23  ? 83  LYS A CG   3  
ATOM 5520  C CD   . LYS A 1 83  ? -13.747 -2.265  -2.415  1.00 2.76  ? 83  LYS A CD   3  
ATOM 5521  C CE   . LYS A 1 83  ? -14.584 -3.483  -2.047  1.00 3.60  ? 83  LYS A CE   3  
ATOM 5522  N NZ   . LYS A 1 83  ? -16.014 -3.331  -2.433  1.00 4.42  ? 83  LYS A NZ   3  
ATOM 5523  H H    . LYS A 1 83  ? -14.624 0.710   -4.490  1.00 1.91  ? 83  LYS A H    3  
ATOM 5524  H HA   . LYS A 1 83  ? -12.662 0.154   -2.566  1.00 1.32  ? 83  LYS A HA   3  
ATOM 5525  H HB2  . LYS A 1 83  ? -12.872 -0.827  -5.403  1.00 1.85  ? 83  LYS A HB2  3  
ATOM 5526  H HB3  . LYS A 1 83  ? -11.818 -1.492  -4.185  1.00 1.86  ? 83  LYS A HB3  3  
ATOM 5527  H HG2  . LYS A 1 83  ? -14.804 -1.472  -4.083  1.00 2.38  ? 83  LYS A HG2  3  
ATOM 5528  H HG3  . LYS A 1 83  ? -13.787 -2.853  -4.461  1.00 2.76  ? 83  LYS A HG3  3  
ATOM 5529  H HD2  . LYS A 1 83  ? -12.714 -2.465  -2.176  1.00 2.93  ? 83  LYS A HD2  3  
ATOM 5530  H HD3  . LYS A 1 83  ? -14.094 -1.415  -1.844  1.00 3.05  ? 83  LYS A HD3  3  
ATOM 5531  H HE2  . LYS A 1 83  ? -14.176 -4.346  -2.552  1.00 3.67  ? 83  LYS A HE2  3  
ATOM 5532  H HE3  . LYS A 1 83  ? -14.522 -3.633  -0.980  1.00 4.07  ? 83  LYS A HE3  3  
ATOM 5533  H HZ1  . LYS A 1 83  ? -16.545 -4.188  -2.178  1.00 4.83  ? 83  LYS A HZ1  3  
ATOM 5534  H HZ2  . LYS A 1 83  ? -16.095 -3.182  -3.457  1.00 4.81  ? 83  LYS A HZ2  3  
ATOM 5535  H HZ3  . LYS A 1 83  ? -16.437 -2.518  -1.942  1.00 4.64  ? 83  LYS A HZ3  3  
ATOM 5536  N N    . PRO A 1 84  ? -10.657 1.424   -3.095  1.00 0.80  ? 84  PRO A N    3  
ATOM 5537  C CA   . PRO A 1 84  ? -9.415  2.159   -3.311  1.00 0.60  ? 84  PRO A CA   3  
ATOM 5538  C C    . PRO A 1 84  ? -8.465  1.404   -4.223  1.00 0.62  ? 84  PRO A C    3  
ATOM 5539  O O    . PRO A 1 84  ? -8.314  0.185   -4.094  1.00 0.78  ? 84  PRO A O    3  
ATOM 5540  C CB   . PRO A 1 84  ? -8.827  2.261   -1.906  1.00 0.60  ? 84  PRO A CB   3  
ATOM 5541  C CG   . PRO A 1 84  ? -9.982  2.065   -1.008  1.00 0.84  ? 84  PRO A CG   3  
ATOM 5542  C CD   . PRO A 1 84  ? -10.832 1.063   -1.690  1.00 0.94  ? 84  PRO A CD   3  
ATOM 5543  H HA   . PRO A 1 84  ? -9.594  3.144   -3.695  1.00 0.63  ? 84  PRO A HA   3  
ATOM 5544  H HB2  . PRO A 1 84  ? -8.093  1.487   -1.769  1.00 0.66  ? 84  PRO A HB2  3  
ATOM 5545  H HB3  . PRO A 1 84  ? -8.374  3.231   -1.766  1.00 0.60  ? 84  PRO A HB3  3  
ATOM 5546  H HG2  . PRO A 1 84  ? -9.654  1.691   -0.068  1.00 1.06  ? 84  PRO A HG2  3  
ATOM 5547  H HG3  . PRO A 1 84  ? -10.526 2.985   -0.887  1.00 0.88  ? 84  PRO A HG3  3  
ATOM 5548  H HD2  . PRO A 1 84  ? -10.479 0.063   -1.500  1.00 1.13  ? 84  PRO A HD2  3  
ATOM 5549  H HD3  . PRO A 1 84  ? -11.851 1.176   -1.384  1.00 1.08  ? 84  PRO A HD3  3  
ATOM 5550  N N    . GLN A 1 85  ? -7.834  2.113   -5.148  1.00 0.61  ? 85  GLN A N    3  
ATOM 5551  C CA   . GLN A 1 85  ? -6.850  1.491   -6.015  1.00 0.63  ? 85  GLN A CA   3  
ATOM 5552  C C    . GLN A 1 85  ? -5.621  1.142   -5.202  1.00 0.51  ? 85  GLN A C    3  
ATOM 5553  O O    . GLN A 1 85  ? -4.938  2.018   -4.670  1.00 0.51  ? 85  GLN A O    3  
ATOM 5554  C CB   . GLN A 1 85  ? -6.479  2.406   -7.177  1.00 0.77  ? 85  GLN A CB   3  
ATOM 5555  C CG   . GLN A 1 85  ? -7.618  2.653   -8.140  1.00 1.26  ? 85  GLN A CG   3  
ATOM 5556  C CD   . GLN A 1 85  ? -7.195  3.475   -9.335  1.00 1.44  ? 85  GLN A CD   3  
ATOM 5557  O OE1  . GLN A 1 85  ? -7.254  4.705   -9.313  1.00 1.73  ? 85  GLN A OE1  3  
ATOM 5558  N NE2  . GLN A 1 85  ? -6.773  2.802   -10.391 1.00 2.01  ? 85  GLN A NE2  3  
ATOM 5559  H H    . GLN A 1 85  ? -8.027  3.068   -5.239  1.00 0.66  ? 85  GLN A H    3  
ATOM 5560  H HA   . GLN A 1 85  ? -7.281  0.583   -6.403  1.00 0.70  ? 85  GLN A HA   3  
ATOM 5561  H HB2  . GLN A 1 85  ? -6.166  3.354   -6.784  1.00 0.90  ? 85  GLN A HB2  3  
ATOM 5562  H HB3  . GLN A 1 85  ? -5.662  1.962   -7.725  1.00 1.01  ? 85  GLN A HB3  3  
ATOM 5563  H HG2  . GLN A 1 85  ? -7.984  1.703   -8.487  1.00 1.59  ? 85  GLN A HG2  3  
ATOM 5564  H HG3  . GLN A 1 85  ? -8.407  3.176   -7.621  1.00 1.51  ? 85  GLN A HG3  3  
ATOM 5565  H HE21 . GLN A 1 85  ? -6.761  1.821   -10.342 1.00 2.53  ? 85  GLN A HE21 3  
ATOM 5566  H HE22 . GLN A 1 85  ? -6.483  3.309   -11.179 1.00 2.15  ? 85  GLN A HE22 3  
ATOM 5567  N N    . ARG A 1 86  ? -5.356  -0.141  -5.087  1.00 0.50  ? 86  ARG A N    3  
ATOM 5568  C CA   . ARG A 1 86  ? -4.289  -0.611  -4.246  1.00 0.48  ? 86  ARG A CA   3  
ATOM 5569  C C    . ARG A 1 86  ? -3.067  -1.018  -5.034  1.00 0.43  ? 86  ARG A C    3  
ATOM 5570  O O    . ARG A 1 86  ? -3.113  -1.216  -6.250  1.00 0.51  ? 86  ARG A O    3  
ATOM 5571  C CB   . ARG A 1 86  ? -4.789  -1.760  -3.400  1.00 0.62  ? 86  ARG A CB   3  
ATOM 5572  C CG   . ARG A 1 86  ? -5.860  -1.320  -2.465  1.00 0.85  ? 86  ARG A CG   3  
ATOM 5573  C CD   . ARG A 1 86  ? -6.570  -2.492  -1.850  1.00 0.65  ? 86  ARG A CD   3  
ATOM 5574  N NE   . ARG A 1 86  ? -7.472  -2.102  -0.765  1.00 1.27  ? 86  ARG A NE   3  
ATOM 5575  C CZ   . ARG A 1 86  ? -8.297  -2.947  -0.143  1.00 1.38  ? 86  ARG A CZ   3  
ATOM 5576  N NH1  . ARG A 1 86  ? -8.355  -4.219  -0.515  1.00 1.19  ? 86  ARG A NH1  3  
ATOM 5577  N NH2  . ARG A 1 86  ? -9.068  -2.517  0.850   1.00 2.24  ? 86  ARG A NH2  3  
ATOM 5578  H H    . ARG A 1 86  ? -5.916  -0.792  -5.556  1.00 0.55  ? 86  ARG A H    3  
ATOM 5579  H HA   . ARG A 1 86  ? -4.016  0.195   -3.587  1.00 0.50  ? 86  ARG A HA   3  
ATOM 5580  H HB2  . ARG A 1 86  ? -5.191  -2.528  -4.034  1.00 1.45  ? 86  ARG A HB2  3  
ATOM 5581  H HB3  . ARG A 1 86  ? -3.980  -2.156  -2.820  1.00 1.30  ? 86  ARG A HB3  3  
ATOM 5582  H HG2  . ARG A 1 86  ? -5.421  -0.714  -1.695  1.00 1.55  ? 86  ARG A HG2  3  
ATOM 5583  H HG3  . ARG A 1 86  ? -6.551  -0.750  -3.021  1.00 1.67  ? 86  ARG A HG3  3  
ATOM 5584  H HD2  . ARG A 1 86  ? -7.140  -2.993  -2.617  1.00 1.04  ? 86  ARG A HD2  3  
ATOM 5585  H HD3  . ARG A 1 86  ? -5.825  -3.151  -1.473  1.00 1.07  ? 86  ARG A HD3  3  
ATOM 5586  H HE   . ARG A 1 86  ? -7.458  -1.162  -0.485  1.00 1.95  ? 86  ARG A HE   3  
ATOM 5587  H HH11 . ARG A 1 86  ? -7.783  -4.553  -1.269  1.00 1.35  ? 86  ARG A HH11 3  
ATOM 5588  H HH12 . ARG A 1 86  ? -8.979  -4.851  -0.049  1.00 1.49  ? 86  ARG A HH12 3  
ATOM 5589  H HH21 . ARG A 1 86  ? -9.037  -1.556  1.139   1.00 2.89  ? 86  ARG A HH21 3  
ATOM 5590  H HH22 . ARG A 1 86  ? -9.695  -3.151  1.310   1.00 2.35  ? 86  ARG A HH22 3  
ATOM 5591  N N    . HIS A 1 87  ? -1.975  -1.112  -4.312  1.00 0.37  ? 87  HIS A N    3  
ATOM 5592  C CA   . HIS A 1 87  ? -0.690  -1.498  -4.866  1.00 0.35  ? 87  HIS A CA   3  
ATOM 5593  C C    . HIS A 1 87  ? -0.047  -2.494  -3.917  1.00 0.34  ? 87  HIS A C    3  
ATOM 5594  O O    . HIS A 1 87  ? 0.048   -2.216  -2.727  1.00 0.47  ? 87  HIS A O    3  
ATOM 5595  C CB   . HIS A 1 87  ? 0.224   -0.278  -5.021  1.00 0.36  ? 87  HIS A CB   3  
ATOM 5596  C CG   . HIS A 1 87  ? -0.395  0.863   -5.758  1.00 0.41  ? 87  HIS A CG   3  
ATOM 5597  N ND1  . HIS A 1 87  ? -0.580  0.889   -7.123  1.00 0.52  ? 87  HIS A ND1  3  
ATOM 5598  C CD2  . HIS A 1 87  ? -0.888  2.024   -5.290  1.00 0.45  ? 87  HIS A CD2  3  
ATOM 5599  C CE1  . HIS A 1 87  ? -1.164  2.025   -7.460  1.00 0.60  ? 87  HIS A CE1  3  
ATOM 5600  N NE2  . HIS A 1 87  ? -1.362  2.731   -6.363  1.00 0.55  ? 87  HIS A NE2  3  
ATOM 5601  H H    . HIS A 1 87  ? -2.044  -0.922  -3.350  1.00 0.40  ? 87  HIS A H    3  
ATOM 5602  H HA   . HIS A 1 87  ? -0.854  -1.955  -5.823  1.00 0.39  ? 87  HIS A HA   3  
ATOM 5603  H HB2  . HIS A 1 87  ? 0.487   0.076   -4.043  1.00 0.32  ? 87  HIS A HB2  3  
ATOM 5604  H HB3  . HIS A 1 87  ? 1.123   -0.563  -5.540  1.00 0.41  ? 87  HIS A HB3  3  
ATOM 5605  H HD1  . HIS A 1 87  ? -0.332  0.177   -7.753  1.00 0.57  ? 87  HIS A HD1  3  
ATOM 5606  H HD2  . HIS A 1 87  ? -0.897  2.334   -4.257  1.00 0.46  ? 87  HIS A HD2  3  
ATOM 5607  H HE1  . HIS A 1 87  ? -1.433  2.324   -8.462  1.00 0.71  ? 87  HIS A HE1  3  
ATOM 5608  H HE2  . HIS A 1 87  ? -1.890  3.563   -6.313  1.00 0.63  ? 87  HIS A HE2  3  
ATOM 5609  N N    . MET A 1 88  ? 0.378   -3.646  -4.410  1.00 0.29  ? 88  MET A N    3  
ATOM 5610  C CA   . MET A 1 88  ? 0.923   -4.663  -3.521  1.00 0.25  ? 88  MET A CA   3  
ATOM 5611  C C    . MET A 1 88  ? 2.374   -4.980  -3.854  1.00 0.25  ? 88  MET A C    3  
ATOM 5612  O O    . MET A 1 88  ? 2.747   -5.103  -5.020  1.00 0.29  ? 88  MET A O    3  
ATOM 5613  C CB   . MET A 1 88  ? 0.094   -5.935  -3.578  1.00 0.27  ? 88  MET A CB   3  
ATOM 5614  C CG   . MET A 1 88  ? 0.309   -6.826  -2.373  1.00 0.44  ? 88  MET A CG   3  
ATOM 5615  S SD   . MET A 1 88  ? -0.168  -8.535  -2.680  1.00 0.62  ? 88  MET A SD   3  
ATOM 5616  C CE   . MET A 1 88  ? -1.873  -8.315  -3.172  1.00 0.73  ? 88  MET A CE   3  
ATOM 5617  H H    . MET A 1 88  ? 0.326   -3.818  -5.374  1.00 0.35  ? 88  MET A H    3  
ATOM 5618  H HA   . MET A 1 88  ? 0.883   -4.271  -2.515  1.00 0.24  ? 88  MET A HA   3  
ATOM 5619  H HB2  . MET A 1 88  ? -0.950  -5.666  -3.622  1.00 0.47  ? 88  MET A HB2  3  
ATOM 5620  H HB3  . MET A 1 88  ? 0.358   -6.489  -4.465  1.00 0.51  ? 88  MET A HB3  3  
ATOM 5621  H HG2  . MET A 1 88  ? 1.351   -6.792  -2.099  1.00 0.63  ? 88  MET A HG2  3  
ATOM 5622  H HG3  . MET A 1 88  ? -0.286  -6.444  -1.554  1.00 0.61  ? 88  MET A HG3  3  
ATOM 5623  H HE1  . MET A 1 88  ? -2.420  -7.837  -2.371  1.00 1.16  ? 88  MET A HE1  3  
ATOM 5624  H HE2  . MET A 1 88  ? -2.314  -9.277  -3.386  1.00 1.33  ? 88  MET A HE2  3  
ATOM 5625  H HE3  . MET A 1 88  ? -1.917  -7.695  -4.056  1.00 1.26  ? 88  MET A HE3  3  
ATOM 5626  N N    . PHE A 1 89  ? 3.182   -5.100  -2.810  1.00 0.25  ? 89  PHE A N    3  
ATOM 5627  C CA   . PHE A 1 89  ? 4.614   -5.296  -2.944  1.00 0.26  ? 89  PHE A CA   3  
ATOM 5628  C C    . PHE A 1 89  ? 5.095   -6.481  -2.126  1.00 0.26  ? 89  PHE A C    3  
ATOM 5629  O O    . PHE A 1 89  ? 4.792   -6.583  -0.937  1.00 0.30  ? 89  PHE A O    3  
ATOM 5630  C CB   . PHE A 1 89  ? 5.310   -4.043  -2.445  1.00 0.31  ? 89  PHE A CB   3  
ATOM 5631  C CG   . PHE A 1 89  ? 4.522   -2.817  -2.749  1.00 0.48  ? 89  PHE A CG   3  
ATOM 5632  C CD1  . PHE A 1 89  ? 4.456   -2.329  -4.036  1.00 0.55  ? 89  PHE A CD1  3  
ATOM 5633  C CD2  . PHE A 1 89  ? 3.861   -2.149  -1.744  1.00 0.76  ? 89  PHE A CD2  3  
ATOM 5634  C CE1  . PHE A 1 89  ? 3.742   -1.193  -4.313  1.00 0.77  ? 89  PHE A CE1  3  
ATOM 5635  C CE2  . PHE A 1 89  ? 3.138   -1.007  -2.014  1.00 0.94  ? 89  PHE A CE2  3  
ATOM 5636  C CZ   . PHE A 1 89  ? 3.040   -0.557  -3.322  1.00 0.91  ? 89  PHE A CZ   3  
ATOM 5637  H H    . PHE A 1 89  ? 2.807   -5.012  -1.915  1.00 0.26  ? 89  PHE A H    3  
ATOM 5638  H HA   . PHE A 1 89  ? 4.850   -5.449  -3.985  1.00 0.27  ? 89  PHE A HA   3  
ATOM 5639  H HB2  . PHE A 1 89  ? 5.436   -4.107  -1.375  1.00 0.44  ? 89  PHE A HB2  3  
ATOM 5640  H HB3  . PHE A 1 89  ? 6.275   -3.951  -2.914  1.00 0.22  ? 89  PHE A HB3  3  
ATOM 5641  H HD1  . PHE A 1 89  ? 4.975   -2.849  -4.828  1.00 0.60  ? 89  PHE A HD1  3  
ATOM 5642  H HD2  . PHE A 1 89  ? 3.926   -2.525  -0.741  1.00 0.91  ? 89  PHE A HD2  3  
ATOM 5643  H HE1  . PHE A 1 89  ? 3.701   -0.819  -5.324  1.00 0.92  ? 89  PHE A HE1  3  
ATOM 5644  H HE2  . PHE A 1 89  ? 2.624   -0.488  -1.220  1.00 1.18  ? 89  PHE A HE2  3  
ATOM 5645  H HZ   . PHE A 1 89  ? 2.463   0.328   -3.543  1.00 1.10  ? 89  PHE A HZ   3  
ATOM 5646  N N    . SER A 1 90  ? 5.851   -7.361  -2.759  1.00 0.26  ? 90  SER A N    3  
ATOM 5647  C CA   . SER A 1 90  ? 6.466   -8.470  -2.055  1.00 0.27  ? 90  SER A CA   3  
ATOM 5648  C C    . SER A 1 90  ? 7.931   -8.158  -1.768  1.00 0.27  ? 90  SER A C    3  
ATOM 5649  O O    . SER A 1 90  ? 8.678   -7.787  -2.662  1.00 0.37  ? 90  SER A O    3  
ATOM 5650  C CB   . SER A 1 90  ? 6.353   -9.760  -2.874  1.00 0.32  ? 90  SER A CB   3  
ATOM 5651  O OG   . SER A 1 90  ? 6.736   -10.891 -2.108  1.00 1.30  ? 90  SER A OG   3  
ATOM 5652  H H    . SER A 1 90  ? 5.988   -7.269  -3.725  1.00 0.28  ? 90  SER A H    3  
ATOM 5653  H HA   . SER A 1 90  ? 5.946   -8.599  -1.117  1.00 0.30  ? 90  SER A HA   3  
ATOM 5654  H HB2  . SER A 1 90  ? 5.334   -9.889  -3.201  1.00 0.87  ? 90  SER A HB2  3  
ATOM 5655  H HB3  . SER A 1 90  ? 6.999   -9.692  -3.734  1.00 0.66  ? 90  SER A HB3  3  
ATOM 5656  H HG   . SER A 1 90  ? 7.459   -11.351 -2.552  1.00 1.50  ? 90  SER A HG   3  
ATOM 5657  N N    . PHE A 1 91  ? 8.333   -8.324  -0.527  1.00 0.22  ? 91  PHE A N    3  
ATOM 5658  C CA   . PHE A 1 91  ? 9.721   -8.122  -0.130  1.00 0.24  ? 91  PHE A CA   3  
ATOM 5659  C C    . PHE A 1 91  ? 10.348  -9.454  0.202   1.00 0.29  ? 91  PHE A C    3  
ATOM 5660  O O    . PHE A 1 91  ? 9.710   -10.498 0.090   1.00 0.32  ? 91  PHE A O    3  
ATOM 5661  C CB   . PHE A 1 91  ? 9.839   -7.211  1.094   1.00 0.22  ? 91  PHE A CB   3  
ATOM 5662  C CG   . PHE A 1 91  ? 9.406   -5.800  0.859   1.00 0.20  ? 91  PHE A CG   3  
ATOM 5663  C CD1  . PHE A 1 91  ? 10.248  -4.884  0.258   1.00 0.25  ? 91  PHE A CD1  3  
ATOM 5664  C CD2  . PHE A 1 91  ? 8.154   -5.397  1.243   1.00 0.22  ? 91  PHE A CD2  3  
ATOM 5665  C CE1  . PHE A 1 91  ? 9.838   -3.584  0.049   1.00 0.31  ? 91  PHE A CE1  3  
ATOM 5666  C CE2  . PHE A 1 91  ? 7.734   -4.102  1.036   1.00 0.28  ? 91  PHE A CE2  3  
ATOM 5667  C CZ   . PHE A 1 91  ? 8.576   -3.193  0.439   1.00 0.32  ? 91  PHE A CZ   3  
ATOM 5668  H H    . PHE A 1 91  ? 7.676   -8.578  0.150   1.00 0.22  ? 91  PHE A H    3  
ATOM 5669  H HA   . PHE A 1 91  ? 10.248  -7.677  -0.961  1.00 0.26  ? 91  PHE A HA   3  
ATOM 5670  H HB2  . PHE A 1 91  ? 9.230   -7.612  1.889   1.00 0.25  ? 91  PHE A HB2  3  
ATOM 5671  H HB3  . PHE A 1 91  ? 10.870  -7.193  1.418   1.00 0.28  ? 91  PHE A HB3  3  
ATOM 5672  H HD1  . PHE A 1 91  ? 11.237  -5.194  -0.048  1.00 0.31  ? 91  PHE A HD1  3  
ATOM 5673  H HD2  . PHE A 1 91  ? 7.505   -6.107  1.718   1.00 0.25  ? 91  PHE A HD2  3  
ATOM 5674  H HE1  . PHE A 1 91  ? 10.505  -2.875  -0.420  1.00 0.38  ? 91  PHE A HE1  3  
ATOM 5675  H HE2  . PHE A 1 91  ? 6.749   -3.804  1.338   1.00 0.35  ? 91  PHE A HE2  3  
ATOM 5676  H HZ   . PHE A 1 91  ? 8.248   -2.179  0.275   1.00 0.40  ? 91  PHE A HZ   3  
ATOM 5677  N N    . ASN A 1 92  ? 11.607  -9.418  0.573   1.00 0.35  ? 92  ASN A N    3  
ATOM 5678  C CA   . ASN A 1 92  ? 12.328  -10.633 0.903   1.00 0.43  ? 92  ASN A CA   3  
ATOM 5679  C C    . ASN A 1 92  ? 12.841  -10.599 2.341   1.00 0.38  ? 92  ASN A C    3  
ATOM 5680  O O    . ASN A 1 92  ? 13.766  -11.334 2.690   1.00 0.46  ? 92  ASN A O    3  
ATOM 5681  C CB   . ASN A 1 92  ? 13.487  -10.854 -0.082  1.00 0.62  ? 92  ASN A CB   3  
ATOM 5682  C CG   . ASN A 1 92  ? 14.435  -9.668  -0.178  1.00 0.70  ? 92  ASN A CG   3  
ATOM 5683  O OD1  . ASN A 1 92  ? 14.615  -8.914  0.776   1.00 1.17  ? 92  ASN A OD1  3  
ATOM 5684  N ND2  . ASN A 1 92  ? 15.044  -9.490  -1.341  1.00 1.11  ? 92  ASN A ND2  3  
ATOM 5685  H H    . ASN A 1 92  ? 12.064  -8.551  0.631   1.00 0.36  ? 92  ASN A H    3  
ATOM 5686  H HA   . ASN A 1 92  ? 11.636  -11.455 0.808   1.00 0.47  ? 92  ASN A HA   3  
ATOM 5687  H HB2  . ASN A 1 92  ? 14.056  -11.713 0.235   1.00 0.67  ? 92  ASN A HB2  3  
ATOM 5688  H HB3  . ASN A 1 92  ? 13.081  -11.044 -1.063  1.00 0.71  ? 92  ASN A HB3  3  
ATOM 5689  H HD21 . ASN A 1 92  ? 14.850  -10.121 -2.069  1.00 1.58  ? 92  ASN A HD21 3  
ATOM 5690  H HD22 . ASN A 1 92  ? 15.671  -8.738  -1.426  1.00 1.21  ? 92  ASN A HD22 3  
ATOM 5691  N N    . ASN A 1 93  ? 12.233  -9.752  3.182   1.00 0.32  ? 93  ASN A N    3  
ATOM 5692  C CA   . ASN A 1 93  ? 12.667  -9.616  4.565   1.00 0.34  ? 93  ASN A CA   3  
ATOM 5693  C C    . ASN A 1 93  ? 11.625  -8.846  5.382   1.00 0.32  ? 93  ASN A C    3  
ATOM 5694  O O    . ASN A 1 93  ? 11.052  -7.864  4.903   1.00 0.29  ? 93  ASN A O    3  
ATOM 5695  C CB   . ASN A 1 93  ? 14.022  -8.902  4.589   1.00 0.38  ? 93  ASN A CB   3  
ATOM 5696  C CG   . ASN A 1 93  ? 14.530  -8.626  5.985   1.00 0.87  ? 93  ASN A CG   3  
ATOM 5697  O OD1  . ASN A 1 93  ? 14.296  -7.557  6.531   1.00 1.62  ? 93  ASN A OD1  3  
ATOM 5698  N ND2  . ASN A 1 93  ? 15.226  -9.585  6.568   1.00 0.98  ? 93  ASN A ND2  3  
ATOM 5699  H H    . ASN A 1 93  ? 11.485  -9.198  2.866   1.00 0.33  ? 93  ASN A H    3  
ATOM 5700  H HA   . ASN A 1 93  ? 12.778  -10.607 4.978   1.00 0.40  ? 93  ASN A HA   3  
ATOM 5701  H HB2  . ASN A 1 93  ? 14.749  -9.518  4.081   1.00 0.79  ? 93  ASN A HB2  3  
ATOM 5702  H HB3  . ASN A 1 93  ? 13.929  -7.961  4.067   1.00 0.72  ? 93  ASN A HB3  3  
ATOM 5703  H HD21 . ASN A 1 93  ? 15.377  -10.418 6.071   1.00 1.05  ? 93  ASN A HD21 3  
ATOM 5704  H HD22 . ASN A 1 93  ? 15.567  -9.424  7.474   1.00 1.41  ? 93  ASN A HD22 3  
ATOM 5705  N N    . ARG A 1 94  ? 11.369  -9.309  6.608   1.00 0.42  ? 94  ARG A N    3  
ATOM 5706  C CA   . ARG A 1 94  ? 10.342  -8.705  7.464   1.00 0.45  ? 94  ARG A CA   3  
ATOM 5707  C C    . ARG A 1 94  ? 10.843  -7.436  8.149   1.00 0.35  ? 94  ARG A C    3  
ATOM 5708  O O    . ARG A 1 94  ? 10.044  -6.588  8.546   1.00 0.36  ? 94  ARG A O    3  
ATOM 5709  C CB   . ARG A 1 94  ? 9.832   -9.690  8.522   1.00 0.64  ? 94  ARG A CB   3  
ATOM 5710  C CG   . ARG A 1 94  ? 8.742   -10.613 8.040   1.00 1.15  ? 94  ARG A CG   3  
ATOM 5711  C CD   . ARG A 1 94  ? 9.304   -11.704 7.156   1.00 1.32  ? 94  ARG A CD   3  
ATOM 5712  N NE   . ARG A 1 94  ? 10.345  -12.476 7.830   1.00 2.12  ? 94  ARG A NE   3  
ATOM 5713  C CZ   . ARG A 1 94  ? 10.649  -13.738 7.533   1.00 2.84  ? 94  ARG A CZ   3  
ATOM 5714  N NH1  . ARG A 1 94  ? 10.004  -14.376 6.564   1.00 3.14  ? 94  ARG A NH1  3  
ATOM 5715  N NH2  . ARG A 1 94  ? 11.603  -14.362 8.209   1.00 3.68  ? 94  ARG A NH2  3  
ATOM 5716  H H    . ARG A 1 94  ? 11.884  -10.073 6.948   1.00 0.50  ? 94  ARG A H    3  
ATOM 5717  H HA   . ARG A 1 94  ? 9.516   -8.437  6.824   1.00 0.49  ? 94  ARG A HA   3  
ATOM 5718  H HB2  . ARG A 1 94  ? 10.647  -10.312 8.839   1.00 0.98  ? 94  ARG A HB2  3  
ATOM 5719  H HB3  . ARG A 1 94  ? 9.458   -9.134  9.367   1.00 0.78  ? 94  ARG A HB3  3  
ATOM 5720  H HG2  . ARG A 1 94  ? 8.269   -11.065 8.896   1.00 1.71  ? 94  ARG A HG2  3  
ATOM 5721  H HG3  . ARG A 1 94  ? 8.018   -10.040 7.481   1.00 1.82  ? 94  ARG A HG3  3  
ATOM 5722  H HD2  . ARG A 1 94  ? 8.508   -12.361 6.890   1.00 1.72  ? 94  ARG A HD2  3  
ATOM 5723  H HD3  . ARG A 1 94  ? 9.717   -11.257 6.264   1.00 1.56  ? 94  ARG A HD3  3  
ATOM 5724  H HE   . ARG A 1 94  ? 10.845  -12.028 8.548   1.00 2.50  ? 94  ARG A HE   3  
ATOM 5725  H HH11 . ARG A 1 94  ? 9.278   -13.911 6.042   1.00 2.91  ? 94  ARG A HH11 3  
ATOM 5726  H HH12 . ARG A 1 94  ? 10.238  -15.329 6.346   1.00 3.89  ? 94  ARG A HH12 3  
ATOM 5727  H HH21 . ARG A 1 94  ? 12.100  -13.888 8.942   1.00 3.93  ? 94  ARG A HH21 3  
ATOM 5728  H HH22 . ARG A 1 94  ? 11.831  -15.318 7.995   1.00 4.27  ? 94  ARG A HH22 3  
ATOM 5729  N N    . THR A 1 95  ? 12.151  -7.313  8.310   1.00 0.34  ? 95  THR A N    3  
ATOM 5730  C CA   . THR A 1 95  ? 12.735  -6.074  8.802   1.00 0.31  ? 95  THR A CA   3  
ATOM 5731  C C    . THR A 1 95  ? 12.483  -4.958  7.789   1.00 0.26  ? 95  THR A C    3  
ATOM 5732  O O    . THR A 1 95  ? 12.099  -3.844  8.154   1.00 0.27  ? 95  THR A O    3  
ATOM 5733  C CB   . THR A 1 95  ? 14.241  -6.230  9.075   1.00 0.40  ? 95  THR A CB   3  
ATOM 5734  O OG1  . THR A 1 95  ? 14.451  -7.066  10.223  1.00 0.50  ? 95  THR A OG1  3  
ATOM 5735  C CG2  . THR A 1 95  ? 14.914  -4.883  9.281   1.00 0.44  ? 95  THR A CG2  3  
ATOM 5736  H H    . THR A 1 95  ? 12.738  -8.070  8.095   1.00 0.40  ? 95  THR A H    3  
ATOM 5737  H HA   . THR A 1 95  ? 12.248  -5.823  9.727   1.00 0.33  ? 95  THR A HA   3  
ATOM 5738  H HB   . THR A 1 95  ? 14.683  -6.706  8.219   1.00 0.42  ? 95  THR A HB   3  
ATOM 5739  H HG1  . THR A 1 95  ? 14.601  -6.509  11.001  1.00 0.94  ? 95  THR A HG1  3  
ATOM 5740  H HG21 . THR A 1 95  ? 14.791  -4.284  8.389   1.00 1.02  ? 95  THR A HG21 3  
ATOM 5741  H HG22 . THR A 1 95  ? 15.967  -5.031  9.472   1.00 1.07  ? 95  THR A HG22 3  
ATOM 5742  H HG23 . THR A 1 95  ? 14.462  -4.378  10.120  1.00 1.10  ? 95  THR A HG23 3  
ATOM 5743  N N    . VAL A 1 96  ? 12.699  -5.276  6.512   1.00 0.24  ? 96  VAL A N    3  
ATOM 5744  C CA   . VAL A 1 96  ? 12.290  -4.402  5.418   1.00 0.22  ? 96  VAL A CA   3  
ATOM 5745  C C    . VAL A 1 96  ? 10.827  -4.028  5.572   1.00 0.21  ? 96  VAL A C    3  
ATOM 5746  O O    . VAL A 1 96  ? 10.488  -2.848  5.556   1.00 0.22  ? 96  VAL A O    3  
ATOM 5747  C CB   . VAL A 1 96  ? 12.495  -5.067  4.038   1.00 0.22  ? 96  VAL A CB   3  
ATOM 5748  C CG1  . VAL A 1 96  ? 11.845  -4.251  2.936   1.00 0.22  ? 96  VAL A CG1  3  
ATOM 5749  C CG2  . VAL A 1 96  ? 13.967  -5.249  3.737   1.00 0.27  ? 96  VAL A CG2  3  
ATOM 5750  H H    . VAL A 1 96  ? 13.160  -6.119  6.307   1.00 0.26  ? 96  VAL A H    3  
ATOM 5751  H HA   . VAL A 1 96  ? 12.890  -3.500  5.461   1.00 0.25  ? 96  VAL A HA   3  
ATOM 5752  H HB   . VAL A 1 96  ? 12.029  -6.042  4.057   1.00 0.23  ? 96  VAL A HB   3  
ATOM 5753  H HG11 . VAL A 1 96  ? 12.236  -4.574  1.981   1.00 1.01  ? 96  VAL A HG11 3  
ATOM 5754  H HG12 . VAL A 1 96  ? 12.070  -3.206  3.080   1.00 1.03  ? 96  VAL A HG12 3  
ATOM 5755  H HG13 . VAL A 1 96  ? 10.767  -4.401  2.951   1.00 1.03  ? 96  VAL A HG13 3  
ATOM 5756  H HG21 . VAL A 1 96  ? 14.077  -5.680  2.752   1.00 1.03  ? 96  VAL A HG21 3  
ATOM 5757  H HG22 . VAL A 1 96  ? 14.410  -5.904  4.472   1.00 1.07  ? 96  VAL A HG22 3  
ATOM 5758  H HG23 . VAL A 1 96  ? 14.458  -4.289  3.764   1.00 1.05  ? 96  VAL A HG23 3  
ATOM 5759  N N    . MET A 1 97  ? 9.967   -5.044  5.713   1.00 0.26  ? 97  MET A N    3  
ATOM 5760  C CA   . MET A 1 97  ? 8.557   -4.809  6.008   1.00 0.39  ? 97  MET A CA   3  
ATOM 5761  C C    . MET A 1 97  ? 8.361   -3.744  7.070   1.00 0.34  ? 97  MET A C    3  
ATOM 5762  O O    . MET A 1 97  ? 7.826   -2.695  6.778   1.00 0.34  ? 97  MET A O    3  
ATOM 5763  C CB   . MET A 1 97  ? 7.862   -6.075  6.477   1.00 0.62  ? 97  MET A CB   3  
ATOM 5764  C CG   . MET A 1 97  ? 7.459   -7.001  5.360   1.00 0.62  ? 97  MET A CG   3  
ATOM 5765  S SD   . MET A 1 97  ? 6.070   -8.048  5.826   1.00 0.84  ? 97  MET A SD   3  
ATOM 5766  C CE   . MET A 1 97  ? 4.836   -6.812  6.223   1.00 0.37  ? 97  MET A CE   3  
ATOM 5767  H H    . MET A 1 97  ? 10.281  -5.971  5.571   1.00 0.24  ? 97  MET A H    3  
ATOM 5768  H HA   . MET A 1 97  ? 8.083   -4.475  5.096   1.00 0.47  ? 97  MET A HA   3  
ATOM 5769  H HB2  . MET A 1 97  ? 8.528   -6.613  7.137   1.00 1.36  ? 97  MET A HB2  3  
ATOM 5770  H HB3  . MET A 1 97  ? 6.976   -5.800  7.026   1.00 1.35  ? 97  MET A HB3  3  
ATOM 5771  H HG2  . MET A 1 97  ? 7.185   -6.409  4.501   1.00 1.26  ? 97  MET A HG2  3  
ATOM 5772  H HG3  . MET A 1 97  ? 8.299   -7.630  5.109   1.00 1.33  ? 97  MET A HG3  3  
ATOM 5773  H HE1  . MET A 1 97  ? 5.137   -6.276  7.108   1.00 1.03  ? 97  MET A HE1  3  
ATOM 5774  H HE2  . MET A 1 97  ? 3.885   -7.292  6.401   1.00 0.97  ? 97  MET A HE2  3  
ATOM 5775  H HE3  . MET A 1 97  ? 4.739   -6.116  5.400   1.00 1.05  ? 97  MET A HE3  3  
ATOM 5776  N N    . ASP A 1 98  ? 8.812   -4.013  8.293   1.00 0.36  ? 98  ASP A N    3  
ATOM 5777  C CA   . ASP A 1 98  ? 8.565   -3.112  9.428   1.00 0.36  ? 98  ASP A CA   3  
ATOM 5778  C C    . ASP A 1 98  ? 9.052   -1.694  9.137   1.00 0.28  ? 98  ASP A C    3  
ATOM 5779  O O    . ASP A 1 98  ? 8.424   -0.717  9.545   1.00 0.29  ? 98  ASP A O    3  
ATOM 5780  C CB   . ASP A 1 98  ? 9.240   -3.655  10.691  1.00 0.45  ? 98  ASP A CB   3  
ATOM 5781  C CG   . ASP A 1 98  ? 8.975   -2.798  11.915  1.00 0.55  ? 98  ASP A CG   3  
ATOM 5782  O OD1  . ASP A 1 98  ? 7.797   -2.663  12.310  1.00 0.67  ? 98  ASP A OD1  3  
ATOM 5783  O OD2  . ASP A 1 98  ? 9.938   -2.231  12.473  1.00 0.61  ? 98  ASP A OD2  3  
ATOM 5784  H H    . ASP A 1 98  ? 9.328   -4.839  8.440   1.00 0.41  ? 98  ASP A H    3  
ATOM 5785  H HA   . ASP A 1 98  ? 7.494   -3.075  9.594   1.00 0.39  ? 98  ASP A HA   3  
ATOM 5786  H HB2  . ASP A 1 98  ? 8.872   -4.650  10.887  1.00 0.51  ? 98  ASP A HB2  3  
ATOM 5787  H HB3  . ASP A 1 98  ? 10.307  -3.697  10.528  1.00 0.44  ? 98  ASP A HB3  3  
ATOM 5788  N N    . ASN A 1 99  ? 10.154  -1.590  8.406   1.00 0.22  ? 99  ASN A N    3  
ATOM 5789  C CA   . ASN A 1 99  ? 10.705  -0.300  8.022   1.00 0.21  ? 99  ASN A CA   3  
ATOM 5790  C C    . ASN A 1 99  ? 9.802   0.398   7.010   1.00 0.15  ? 99  ASN A C    3  
ATOM 5791  O O    . ASN A 1 99  ? 9.340   1.508   7.253   1.00 0.18  ? 99  ASN A O    3  
ATOM 5792  C CB   . ASN A 1 99  ? 12.109  -0.492  7.448   1.00 0.26  ? 99  ASN A CB   3  
ATOM 5793  C CG   . ASN A 1 99  ? 13.187  -0.485  8.516   1.00 0.77  ? 99  ASN A CG   3  
ATOM 5794  O OD1  . ASN A 1 99  ? 13.748  0.563   8.842   1.00 1.55  ? 99  ASN A OD1  3  
ATOM 5795  N ND2  . ASN A 1 99  ? 13.486  -1.650  9.067   1.00 1.17  ? 99  ASN A ND2  3  
ATOM 5796  H H    . ASN A 1 99  ? 10.606  -2.405  8.103   1.00 0.21  ? 99  ASN A H    3  
ATOM 5797  H HA   . ASN A 1 99  ? 10.766  0.314   8.910   1.00 0.28  ? 99  ASN A HA   3  
ATOM 5798  H HB2  . ASN A 1 99  ? 12.150  -1.441  6.935   1.00 0.64  ? 99  ASN A HB2  3  
ATOM 5799  H HB3  . ASN A 1 99  ? 12.315  0.292   6.745   1.00 0.50  ? 99  ASN A HB3  3  
ATOM 5800  H HD21 . ASN A 1 99  ? 12.999  -2.449  8.758   1.00 1.55  ? 99  ASN A HD21 3  
ATOM 5801  H HD22 . ASN A 1 99  ? 14.176  -1.671  9.766   1.00 1.51  ? 99  ASN A HD22 3  
ATOM 5802  N N    . ILE A 1 100 ? 9.548   -0.266  5.885   1.00 0.12  ? 100 ILE A N    3  
ATOM 5803  C CA   . ILE A 1 100 ? 8.632   0.245   4.863   1.00 0.14  ? 100 ILE A CA   3  
ATOM 5804  C C    . ILE A 1 100 ? 7.256   0.512   5.479   1.00 0.16  ? 100 ILE A C    3  
ATOM 5805  O O    . ILE A 1 100 ? 6.675   1.570   5.274   1.00 0.20  ? 100 ILE A O    3  
ATOM 5806  C CB   . ILE A 1 100 ? 8.505   -0.758  3.692   1.00 0.18  ? 100 ILE A CB   3  
ATOM 5807  C CG1  . ILE A 1 100 ? 9.878   -1.032  3.048   1.00 0.18  ? 100 ILE A CG1  3  
ATOM 5808  C CG2  . ILE A 1 100 ? 7.524   -0.246  2.652   1.00 0.22  ? 100 ILE A CG2  3  
ATOM 5809  C CD1  . ILE A 1 100 ? 10.582  0.197   2.503   1.00 0.18  ? 100 ILE A CD1  3  
ATOM 5810  H H    . ILE A 1 100 ? 9.983   -1.137  5.740   1.00 0.14  ? 100 ILE A H    3  
ATOM 5811  H HA   . ILE A 1 100 ? 9.021   1.179   4.467   1.00 0.16  ? 100 ILE A HA   3  
ATOM 5812  H HB   . ILE A 1 100 ? 8.114   -1.683  4.088   1.00 0.20  ? 100 ILE A HB   3  
ATOM 5813  H HG12 . ILE A 1 100 ? 10.526  -1.478  3.786   1.00 0.19  ? 100 ILE A HG12 3  
ATOM 5814  H HG13 . ILE A 1 100 ? 9.747   -1.727  2.231   1.00 0.21  ? 100 ILE A HG13 3  
ATOM 5815  H HG21 . ILE A 1 100 ? 6.542   -0.176  3.093   1.00 1.03  ? 100 ILE A HG21 3  
ATOM 5816  H HG22 . ILE A 1 100 ? 7.496   -0.927  1.816   1.00 1.05  ? 100 ILE A HG22 3  
ATOM 5817  H HG23 . ILE A 1 100 ? 7.837   0.733   2.316   1.00 1.01  ? 100 ILE A HG23 3  
ATOM 5818  H HD11 . ILE A 1 100 ? 11.510  -0.097  2.020   1.00 1.02  ? 100 ILE A HD11 3  
ATOM 5819  H HD12 . ILE A 1 100 ? 10.802  0.878   3.311   1.00 1.07  ? 100 ILE A HD12 3  
ATOM 5820  H HD13 . ILE A 1 100 ? 9.946   0.688   1.782   1.00 1.01  ? 100 ILE A HD13 3  
ATOM 5821  N N    . LYS A 1 101 ? 6.768   -0.440  6.264   1.00 0.17  ? 101 LYS A N    3  
ATOM 5822  C CA   . LYS A 1 101 ? 5.508   -0.289  6.992   1.00 0.22  ? 101 LYS A CA   3  
ATOM 5823  C C    . LYS A 1 101 ? 5.453   1.054   7.695   1.00 0.21  ? 101 LYS A C    3  
ATOM 5824  O O    . LYS A 1 101 ? 4.624   1.907   7.384   1.00 0.25  ? 101 LYS A O    3  
ATOM 5825  C CB   . LYS A 1 101 ? 5.373   -1.390  8.047   1.00 0.28  ? 101 LYS A CB   3  
ATOM 5826  C CG   . LYS A 1 101 ? 4.933   -2.719  7.498   1.00 0.49  ? 101 LYS A CG   3  
ATOM 5827  C CD   . LYS A 1 101 ? 4.884   -3.763  8.581   1.00 0.65  ? 101 LYS A CD   3  
ATOM 5828  C CE   . LYS A 1 101 ? 3.832   -3.454  9.629   1.00 0.63  ? 101 LYS A CE   3  
ATOM 5829  N NZ   . LYS A 1 101 ? 4.059   -4.205  10.889  1.00 0.92  ? 101 LYS A NZ   3  
ATOM 5830  H H    . LYS A 1 101 ? 7.277   -1.275  6.367   1.00 0.19  ? 101 LYS A H    3  
ATOM 5831  H HA   . LYS A 1 101 ? 4.696   -0.369  6.284   1.00 0.26  ? 101 LYS A HA   3  
ATOM 5832  H HB2  . LYS A 1 101 ? 6.328   -1.533  8.525   1.00 0.54  ? 101 LYS A HB2  3  
ATOM 5833  H HB3  . LYS A 1 101 ? 4.659   -1.083  8.787   1.00 0.49  ? 101 LYS A HB3  3  
ATOM 5834  H HG2  . LYS A 1 101 ? 3.961   -2.609  7.078   1.00 0.71  ? 101 LYS A HG2  3  
ATOM 5835  H HG3  . LYS A 1 101 ? 5.631   -3.035  6.740   1.00 0.73  ? 101 LYS A HG3  3  
ATOM 5836  H HD2  . LYS A 1 101 ? 4.663   -4.710  8.137   1.00 1.34  ? 101 LYS A HD2  3  
ATOM 5837  H HD3  . LYS A 1 101 ? 5.837   -3.801  9.044   1.00 1.33  ? 101 LYS A HD3  3  
ATOM 5838  H HE2  . LYS A 1 101 ? 3.857   -2.403  9.837   1.00 1.36  ? 101 LYS A HE2  3  
ATOM 5839  H HE3  . LYS A 1 101 ? 2.863   -3.717  9.235   1.00 1.37  ? 101 LYS A HE3  3  
ATOM 5840  H HZ1  . LYS A 1 101 ? 4.131   -5.222  10.695  1.00 1.30  ? 101 LYS A HZ1  3  
ATOM 5841  H HZ2  . LYS A 1 101 ? 3.271   -4.046  11.544  1.00 1.45  ? 101 LYS A HZ2  3  
ATOM 5842  H HZ3  . LYS A 1 101 ? 4.939   -3.887  11.345  1.00 1.55  ? 101 LYS A HZ3  3  
ATOM 5843  N N    . MET A 1 102 ? 6.367   1.221   8.634   1.00 0.20  ? 102 MET A N    3  
ATOM 5844  C CA   . MET A 1 102 ? 6.470   2.438   9.426   1.00 0.23  ? 102 MET A CA   3  
ATOM 5845  C C    . MET A 1 102 ? 6.688   3.671   8.554   1.00 0.20  ? 102 MET A C    3  
ATOM 5846  O O    . MET A 1 102 ? 5.982   4.670   8.706   1.00 0.26  ? 102 MET A O    3  
ATOM 5847  C CB   . MET A 1 102 ? 7.618   2.307   10.423  1.00 0.25  ? 102 MET A CB   3  
ATOM 5848  C CG   . MET A 1 102 ? 7.169   2.269   11.873  1.00 0.79  ? 102 MET A CG   3  
ATOM 5849  S SD   . MET A 1 102 ? 8.554   2.304   13.030  1.00 0.83  ? 102 MET A SD   3  
ATOM 5850  C CE   . MET A 1 102 ? 9.517   0.910   12.449  1.00 1.41  ? 102 MET A CE   3  
ATOM 5851  H H    . MET A 1 102 ? 6.991   0.482   8.812   1.00 0.19  ? 102 MET A H    3  
ATOM 5852  H HA   . MET A 1 102 ? 5.545   2.554   9.967   1.00 0.28  ? 102 MET A HA   3  
ATOM 5853  H HB2  . MET A 1 102 ? 8.144   1.390   10.214  1.00 0.59  ? 102 MET A HB2  3  
ATOM 5854  H HB3  . MET A 1 102 ? 8.294   3.135   10.293  1.00 0.57  ? 102 MET A HB3  3  
ATOM 5855  H HG2  . MET A 1 102 ? 6.539   3.123   12.061  1.00 1.14  ? 102 MET A HG2  3  
ATOM 5856  H HG3  . MET A 1 102 ? 6.604   1.363   12.038  1.00 1.13  ? 102 MET A HG3  3  
ATOM 5857  H HE1  . MET A 1 102 ? 10.382  0.781   13.082  1.00 1.87  ? 102 MET A HE1  3  
ATOM 5858  H HE2  . MET A 1 102 ? 9.839   1.093   11.435  1.00 1.92  ? 102 MET A HE2  3  
ATOM 5859  H HE3  . MET A 1 102 ? 8.912   0.016   12.480  1.00 1.78  ? 102 MET A HE3  3  
ATOM 5860  N N    . THR A 1 103 ? 7.661   3.590   7.647   1.00 0.15  ? 103 THR A N    3  
ATOM 5861  C CA   . THR A 1 103 ? 7.999   4.697   6.764   1.00 0.16  ? 103 THR A CA   3  
ATOM 5862  C C    . THR A 1 103 ? 6.756   5.256   6.085   1.00 0.18  ? 103 THR A C    3  
ATOM 5863  O O    . THR A 1 103 ? 6.483   6.455   6.144   1.00 0.24  ? 103 THR A O    3  
ATOM 5864  C CB   . THR A 1 103 ? 9.007   4.255   5.682   1.00 0.18  ? 103 THR A CB   3  
ATOM 5865  O OG1  . THR A 1 103 ? 10.231  3.824   6.288   1.00 0.23  ? 103 THR A OG1  3  
ATOM 5866  C CG2  . THR A 1 103 ? 9.297   5.388   4.716   1.00 0.27  ? 103 THR A CG2  3  
ATOM 5867  H H    . THR A 1 103 ? 8.168   2.750   7.566   1.00 0.14  ? 103 THR A H    3  
ATOM 5868  H HA   . THR A 1 103 ? 8.456   5.472   7.357   1.00 0.19  ? 103 THR A HA   3  
ATOM 5869  H HB   . THR A 1 103 ? 8.579   3.431   5.126   1.00 0.19  ? 103 THR A HB   3  
ATOM 5870  H HG1  . THR A 1 103 ? 10.031  3.255   7.046   1.00 0.47  ? 103 THR A HG1  3  
ATOM 5871  H HG21 . THR A 1 103 ? 9.952   5.034   3.935   1.00 1.04  ? 103 THR A HG21 3  
ATOM 5872  H HG22 . THR A 1 103 ? 9.773   6.198   5.246   1.00 1.00  ? 103 THR A HG22 3  
ATOM 5873  H HG23 . THR A 1 103 ? 8.372   5.734   4.281   1.00 1.07  ? 103 THR A HG23 3  
ATOM 5874  N N    . LEU A 1 104 ? 5.997   4.369   5.470   1.00 0.16  ? 104 LEU A N    3  
ATOM 5875  C CA   . LEU A 1 104 ? 4.815   4.754   4.718   1.00 0.20  ? 104 LEU A CA   3  
ATOM 5876  C C    . LEU A 1 104 ? 3.724   5.210   5.676   1.00 0.22  ? 104 LEU A C    3  
ATOM 5877  O O    . LEU A 1 104 ? 3.201   6.313   5.552   1.00 0.26  ? 104 LEU A O    3  
ATOM 5878  C CB   . LEU A 1 104 ? 4.305   3.571   3.880   1.00 0.23  ? 104 LEU A CB   3  
ATOM 5879  C CG   . LEU A 1 104 ? 5.141   3.174   2.647   1.00 0.25  ? 104 LEU A CG   3  
ATOM 5880  C CD1  . LEU A 1 104 ? 6.618   3.186   2.953   1.00 0.99  ? 104 LEU A CD1  3  
ATOM 5881  C CD2  . LEU A 1 104 ? 4.742   1.787   2.187   1.00 1.03  ? 104 LEU A CD2  3  
ATOM 5882  H H    . LEU A 1 104 ? 6.235   3.414   5.526   1.00 0.16  ? 104 LEU A H    3  
ATOM 5883  H HA   . LEU A 1 104 ? 5.084   5.572   4.062   1.00 0.23  ? 104 LEU A HA   3  
ATOM 5884  H HB2  . LEU A 1 104 ? 4.246   2.710   4.529   1.00 0.22  ? 104 LEU A HB2  3  
ATOM 5885  H HB3  . LEU A 1 104 ? 3.306   3.808   3.544   1.00 0.26  ? 104 LEU A HB3  3  
ATOM 5886  H HG   . LEU A 1 104 ? 4.966   3.863   1.836   1.00 0.76  ? 104 LEU A HG   3  
ATOM 5887  H HD11 . LEU A 1 104 ? 7.167   2.883   2.078   1.00 1.58  ? 104 LEU A HD11 3  
ATOM 5888  H HD12 . LEU A 1 104 ? 6.823   2.500   3.761   1.00 1.46  ? 104 LEU A HD12 3  
ATOM 5889  H HD13 . LEU A 1 104 ? 6.919   4.182   3.240   1.00 1.67  ? 104 LEU A HD13 3  
ATOM 5890  H HD21 . LEU A 1 104 ? 3.676   1.752   2.024   1.00 1.69  ? 104 LEU A HD21 3  
ATOM 5891  H HD22 . LEU A 1 104 ? 5.020   1.069   2.946   1.00 1.54  ? 104 LEU A HD22 3  
ATOM 5892  H HD23 . LEU A 1 104 ? 5.258   1.552   1.267   1.00 1.59  ? 104 LEU A HD23 3  
ATOM 5893  N N    . GLN A 1 105 ? 3.420   4.351   6.647   1.00 0.22  ? 105 GLN A N    3  
ATOM 5894  C CA   . GLN A 1 105 ? 2.364   4.581   7.617   1.00 0.27  ? 105 GLN A CA   3  
ATOM 5895  C C    . GLN A 1 105 ? 2.462   5.965   8.250   1.00 0.25  ? 105 GLN A C    3  
ATOM 5896  O O    . GLN A 1 105 ? 1.471   6.683   8.328   1.00 0.27  ? 105 GLN A O    3  
ATOM 5897  C CB   . GLN A 1 105 ? 2.445   3.504   8.701   1.00 0.33  ? 105 GLN A CB   3  
ATOM 5898  C CG   . GLN A 1 105 ? 1.112   3.176   9.330   1.00 0.55  ? 105 GLN A CG   3  
ATOM 5899  C CD   . GLN A 1 105 ? 0.913   3.793   10.704  1.00 1.00  ? 105 GLN A CD   3  
ATOM 5900  O OE1  . GLN A 1 105 ? 0.202   3.239   11.538  1.00 1.72  ? 105 GLN A OE1  3  
ATOM 5901  N NE2  . GLN A 1 105 ? 1.534   4.935   10.953  1.00 1.60  ? 105 GLN A NE2  3  
ATOM 5902  H H    . GLN A 1 105 ? 3.921   3.508   6.708   1.00 0.21  ? 105 GLN A H    3  
ATOM 5903  H HA   . GLN A 1 105 ? 1.415   4.496   7.108   1.00 0.34  ? 105 GLN A HA   3  
ATOM 5904  H HB2  . GLN A 1 105 ? 2.859   2.602   8.276   1.00 0.29  ? 105 GLN A HB2  3  
ATOM 5905  H HB3  . GLN A 1 105 ? 3.099   3.846   9.473   1.00 0.36  ? 105 GLN A HB3  3  
ATOM 5906  H HG2  . GLN A 1 105 ? 0.341   3.539   8.676   1.00 0.67  ? 105 GLN A HG2  3  
ATOM 5907  H HG3  . GLN A 1 105 ? 1.031   2.104   9.418   1.00 0.76  ? 105 GLN A HG3  3  
ATOM 5908  H HE21 . GLN A 1 105 ? 2.085   5.326   10.246  1.00 2.10  ? 105 GLN A HE21 3  
ATOM 5909  H HE22 . GLN A 1 105 ? 1.418   5.342   11.839  1.00 1.93  ? 105 GLN A HE22 3  
ATOM 5910  N N    . GLN A 1 106 ? 3.651   6.328   8.712   1.00 0.23  ? 106 GLN A N    3  
ATOM 5911  C CA   . GLN A 1 106 ? 3.853   7.604   9.378   1.00 0.25  ? 106 GLN A CA   3  
ATOM 5912  C C    . GLN A 1 106 ? 3.602   8.769   8.430   1.00 0.22  ? 106 GLN A C    3  
ATOM 5913  O O    . GLN A 1 106 ? 2.911   9.721   8.786   1.00 0.25  ? 106 GLN A O    3  
ATOM 5914  C CB   . GLN A 1 106 ? 5.265   7.674   9.941   1.00 0.31  ? 106 GLN A CB   3  
ATOM 5915  C CG   . GLN A 1 106 ? 5.511   6.721   11.092  1.00 0.37  ? 106 GLN A CG   3  
ATOM 5916  C CD   . GLN A 1 106 ? 6.927   6.803   11.620  1.00 1.40  ? 106 GLN A CD   3  
ATOM 5917  O OE1  . GLN A 1 106 ? 7.816   6.078   11.168  1.00 2.15  ? 106 GLN A OE1  3  
ATOM 5918  N NE2  . GLN A 1 106 ? 7.150   7.688   12.578  1.00 2.21  ? 106 GLN A NE2  3  
ATOM 5919  H H    . GLN A 1 106 ? 4.420   5.726   8.601   1.00 0.23  ? 106 GLN A H    3  
ATOM 5920  H HA   . GLN A 1 106 ? 3.148   7.668   10.192  1.00 0.28  ? 106 GLN A HA   3  
ATOM 5921  H HB2  . GLN A 1 106 ? 5.958   7.434   9.159   1.00 0.34  ? 106 GLN A HB2  3  
ATOM 5922  H HB3  . GLN A 1 106 ? 5.452   8.673   10.281  1.00 0.36  ? 106 GLN A HB3  3  
ATOM 5923  H HG2  . GLN A 1 106 ? 4.831   6.965   11.887  1.00 0.87  ? 106 GLN A HG2  3  
ATOM 5924  H HG3  . GLN A 1 106 ? 5.325   5.713   10.755  1.00 0.89  ? 106 GLN A HG3  3  
ATOM 5925  H HE21 . GLN A 1 106 ? 6.395   8.235   12.888  1.00 2.44  ? 106 GLN A HE21 3  
ATOM 5926  H HE22 . GLN A 1 106 ? 8.060   7.769   12.934  1.00 2.91  ? 106 GLN A HE22 3  
ATOM 5927  N N    . ILE A 1 107 ? 4.147   8.688   7.224   1.00 0.21  ? 107 ILE A N    3  
ATOM 5928  C CA   . ILE A 1 107 ? 3.949   9.736   6.231   1.00 0.23  ? 107 ILE A CA   3  
ATOM 5929  C C    . ILE A 1 107 ? 2.477   9.810   5.821   1.00 0.26  ? 107 ILE A C    3  
ATOM 5930  O O    . ILE A 1 107 ? 1.910   10.895  5.706   1.00 0.31  ? 107 ILE A O    3  
ATOM 5931  C CB   . ILE A 1 107 ? 4.823   9.507   4.982   1.00 0.25  ? 107 ILE A CB   3  
ATOM 5932  C CG1  . ILE A 1 107 ? 6.305   9.419   5.364   1.00 0.22  ? 107 ILE A CG1  3  
ATOM 5933  C CG2  . ILE A 1 107 ? 4.606   10.630  3.989   1.00 0.39  ? 107 ILE A CG2  3  
ATOM 5934  C CD1  . ILE A 1 107 ? 7.219   9.049   4.211   1.00 0.25  ? 107 ILE A CD1  3  
ATOM 5935  H H    . ILE A 1 107 ? 4.692   7.904   6.994   1.00 0.21  ? 107 ILE A H    3  
ATOM 5936  H HA   . ILE A 1 107 ? 4.229   10.682  6.680   1.00 0.25  ? 107 ILE A HA   3  
ATOM 5937  H HB   . ILE A 1 107 ? 4.519   8.581   4.520   1.00 0.27  ? 107 ILE A HB   3  
ATOM 5938  H HG12 . ILE A 1 107 ? 6.628   10.375  5.745   1.00 0.27  ? 107 ILE A HG12 3  
ATOM 5939  H HG13 . ILE A 1 107 ? 6.427   8.675   6.132   1.00 0.20  ? 107 ILE A HG13 3  
ATOM 5940  H HG21 . ILE A 1 107 ? 5.030   10.352  3.039   1.00 1.16  ? 107 ILE A HG21 3  
ATOM 5941  H HG22 . ILE A 1 107 ? 5.087   11.527  4.348   1.00 0.94  ? 107 ILE A HG22 3  
ATOM 5942  H HG23 . ILE A 1 107 ? 3.548   10.809  3.874   1.00 1.11  ? 107 ILE A HG23 3  
ATOM 5943  H HD11 . ILE A 1 107 ? 8.240   9.007   4.560   1.00 1.05  ? 107 ILE A HD11 3  
ATOM 5944  H HD12 . ILE A 1 107 ? 7.134   9.791   3.432   1.00 1.08  ? 107 ILE A HD12 3  
ATOM 5945  H HD13 . ILE A 1 107 ? 6.934   8.082   3.820   1.00 0.99  ? 107 ILE A HD13 3  
ATOM 5946  N N    . ILE A 1 108 ? 1.867   8.648   5.617   1.00 0.26  ? 108 ILE A N    3  
ATOM 5947  C CA   . ILE A 1 108 ? 0.435   8.560   5.347   1.00 0.30  ? 108 ILE A CA   3  
ATOM 5948  C C    . ILE A 1 108 ? -0.351  9.202   6.492   1.00 0.33  ? 108 ILE A C    3  
ATOM 5949  O O    . ILE A 1 108 ? -1.271  9.987   6.268   1.00 0.40  ? 108 ILE A O    3  
ATOM 5950  C CB   . ILE A 1 108 ? -0.008  7.085   5.168   1.00 0.32  ? 108 ILE A CB   3  
ATOM 5951  C CG1  . ILE A 1 108 ? 0.627   6.484   3.909   1.00 0.35  ? 108 ILE A CG1  3  
ATOM 5952  C CG2  . ILE A 1 108 ? -1.524  6.970   5.104   1.00 0.32  ? 108 ILE A CG2  3  
ATOM 5953  C CD1  . ILE A 1 108 ? 0.403   4.991   3.766   1.00 0.39  ? 108 ILE A CD1  3  
ATOM 5954  H H    . ILE A 1 108 ? 2.397   7.819   5.644   1.00 0.24  ? 108 ILE A H    3  
ATOM 5955  H HA   . ILE A 1 108 ? 0.228   9.099   4.431   1.00 0.33  ? 108 ILE A HA   3  
ATOM 5956  H HB   . ILE A 1 108 ? 0.332   6.528   6.028   1.00 0.35  ? 108 ILE A HB   3  
ATOM 5957  H HG12 . ILE A 1 108 ? 0.208   6.965   3.037   1.00 0.35  ? 108 ILE A HG12 3  
ATOM 5958  H HG13 . ILE A 1 108 ? 1.693   6.659   3.933   1.00 0.41  ? 108 ILE A HG13 3  
ATOM 5959  H HG21 . ILE A 1 108 ? -1.893  7.516   4.250   1.00 1.09  ? 108 ILE A HG21 3  
ATOM 5960  H HG22 . ILE A 1 108 ? -1.954  7.378   6.007   1.00 0.95  ? 108 ILE A HG22 3  
ATOM 5961  H HG23 . ILE A 1 108 ? -1.800  5.929   5.014   1.00 1.05  ? 108 ILE A HG23 3  
ATOM 5962  H HD11 . ILE A 1 108 ? 0.921   4.469   4.558   1.00 1.14  ? 108 ILE A HD11 3  
ATOM 5963  H HD12 . ILE A 1 108 ? 0.780   4.657   2.810   1.00 1.06  ? 108 ILE A HD12 3  
ATOM 5964  H HD13 . ILE A 1 108 ? -0.654  4.776   3.830   1.00 1.08  ? 108 ILE A HD13 3  
ATOM 5965  N N    . SER A 1 109 ? 0.049   8.882   7.717   1.00 0.31  ? 109 SER A N    3  
ATOM 5966  C CA   . SER A 1 109 ? -0.552  9.453   8.915   1.00 0.35  ? 109 SER A CA   3  
ATOM 5967  C C    . SER A 1 109 ? -0.400  10.977  8.924   1.00 0.39  ? 109 SER A C    3  
ATOM 5968  O O    . SER A 1 109 ? -1.292  11.696  9.382   1.00 0.46  ? 109 SER A O    3  
ATOM 5969  C CB   . SER A 1 109 ? 0.093   8.827   10.162  1.00 0.36  ? 109 SER A CB   3  
ATOM 5970  O OG   . SER A 1 109 ? -0.527  9.277   11.354  1.00 1.32  ? 109 SER A OG   3  
ATOM 5971  H H    . SER A 1 109 ? 0.774   8.224   7.819   1.00 0.28  ? 109 SER A H    3  
ATOM 5972  H HA   . SER A 1 109 ? -1.606  9.213   8.907   1.00 0.41  ? 109 SER A HA   3  
ATOM 5973  H HB2  . SER A 1 109 ? -0.008  7.754   10.109  1.00 0.81  ? 109 SER A HB2  3  
ATOM 5974  H HB3  . SER A 1 109 ? 1.145   9.085   10.193  1.00 1.05  ? 109 SER A HB3  3  
ATOM 5975  H HG   . SER A 1 109 ? 0.141   9.671   11.932  1.00 1.90  ? 109 SER A HG   3  
ATOM 5976  N N    . ARG A 1 110 ? 0.715   11.467  8.388   1.00 0.38  ? 110 ARG A N    3  
ATOM 5977  C CA   . ARG A 1 110 ? 0.944   12.905  8.281   1.00 0.43  ? 110 ARG A CA   3  
ATOM 5978  C C    . ARG A 1 110 ? -0.126  13.562  7.419   1.00 0.48  ? 110 ARG A C    3  
ATOM 5979  O O    . ARG A 1 110 ? -0.584  14.665  7.715   1.00 0.62  ? 110 ARG A O    3  
ATOM 5980  C CB   . ARG A 1 110 ? 2.313   13.208  7.689   1.00 0.45  ? 110 ARG A CB   3  
ATOM 5981  C CG   . ARG A 1 110 ? 3.473   12.738  8.518   1.00 0.97  ? 110 ARG A CG   3  
ATOM 5982  C CD   . ARG A 1 110 ? 4.750   12.967  7.755   1.00 0.88  ? 110 ARG A CD   3  
ATOM 5983  N NE   . ARG A 1 110 ? 5.918   12.401  8.419   1.00 1.78  ? 110 ARG A NE   3  
ATOM 5984  C CZ   . ARG A 1 110 ? 7.080   12.195  7.805   1.00 1.98  ? 110 ARG A CZ   3  
ATOM 5985  N NH1  . ARG A 1 110 ? 7.223   12.540  6.531   1.00 1.39  ? 110 ARG A NH1  3  
ATOM 5986  N NH2  . ARG A 1 110 ? 8.095   11.646  8.459   1.00 2.87  ? 110 ARG A NH2  3  
ATOM 5987  H H    . ARG A 1 110 ? 1.404   10.846  8.065   1.00 0.36  ? 110 ARG A H    3  
ATOM 5988  H HA   . ARG A 1 110 ? 0.899   13.319  9.269   1.00 0.48  ? 110 ARG A HA   3  
ATOM 5989  H HB2  . ARG A 1 110 ? 2.390   12.746  6.726   1.00 0.98  ? 110 ARG A HB2  3  
ATOM 5990  H HB3  . ARG A 1 110 ? 2.411   14.269  7.571   1.00 1.02  ? 110 ARG A HB3  3  
ATOM 5991  H HG2  . ARG A 1 110 ? 3.496   13.306  9.433   1.00 1.52  ? 110 ARG A HG2  3  
ATOM 5992  H HG3  . ARG A 1 110 ? 3.365   11.685  8.732   1.00 1.51  ? 110 ARG A HG3  3  
ATOM 5993  H HD2  . ARG A 1 110 ? 4.647   12.517  6.783   1.00 0.91  ? 110 ARG A HD2  3  
ATOM 5994  H HD3  . ARG A 1 110 ? 4.887   14.029  7.637   1.00 0.92  ? 110 ARG A HD3  3  
ATOM 5995  H HE   . ARG A 1 110 ? 5.823   12.150  9.369   1.00 2.33  ? 110 ARG A HE   3  
ATOM 5996  H HH11 . ARG A 1 110 ? 6.461   12.958  6.032   1.00 0.94  ? 110 ARG A HH11 3  
ATOM 5997  H HH12 . ARG A 1 110 ? 8.106   12.384  6.054   1.00 1.59  ? 110 ARG A HH12 3  
ATOM 5998  H HH21 . ARG A 1 110 ? 7.990   11.382  9.422   1.00 3.42  ? 110 ARG A HH21 3  
ATOM 5999  H HH22 . ARG A 1 110 ? 8.971   11.491  7.995   1.00 3.03  ? 110 ARG A HH22 3  
ATOM 6000  N N    . TYR A 1 111 ? -0.530  12.875  6.358   1.00 0.44  ? 111 TYR A N    3  
ATOM 6001  C CA   . TYR A 1 111 ? -1.526  13.411  5.438   1.00 0.51  ? 111 TYR A CA   3  
ATOM 6002  C C    . TYR A 1 111 ? -2.926  13.074  5.928   1.00 0.61  ? 111 TYR A C    3  
ATOM 6003  O O    . TYR A 1 111 ? -3.913  13.675  5.504   1.00 0.75  ? 111 TYR A O    3  
ATOM 6004  C CB   . TYR A 1 111 ? -1.296  12.853  4.033   1.00 0.51  ? 111 TYR A CB   3  
ATOM 6005  C CG   . TYR A 1 111 ? 0.104   13.098  3.529   1.00 0.76  ? 111 TYR A CG   3  
ATOM 6006  C CD1  . TYR A 1 111 ? 0.673   14.364  3.591   1.00 1.67  ? 111 TYR A CD1  3  
ATOM 6007  C CD2  . TYR A 1 111 ? 0.862   12.062  3.012   1.00 0.79  ? 111 TYR A CD2  3  
ATOM 6008  C CE1  . TYR A 1 111 ? 1.960   14.587  3.148   1.00 2.33  ? 111 TYR A CE1  3  
ATOM 6009  C CE2  . TYR A 1 111 ? 2.149   12.275  2.572   1.00 1.30  ? 111 TYR A CE2  3  
ATOM 6010  C CZ   . TYR A 1 111 ? 2.694   13.539  2.641   1.00 2.05  ? 111 TYR A CZ   3  
ATOM 6011  O OH   . TYR A 1 111 ? 3.984   13.753  2.217   1.00 2.75  ? 111 TYR A OH   3  
ATOM 6012  H H    . TYR A 1 111 ? -0.147  11.986  6.187   1.00 0.38  ? 111 TYR A H    3  
ATOM 6013  H HA   . TYR A 1 111 ? -1.414  14.486  5.416   1.00 0.58  ? 111 TYR A HA   3  
ATOM 6014  H HB2  . TYR A 1 111 ? -1.464  11.787  4.043   1.00 0.92  ? 111 TYR A HB2  3  
ATOM 6015  H HB3  . TYR A 1 111 ? -1.981  13.315  3.344   1.00 0.90  ? 111 TYR A HB3  3  
ATOM 6016  H HD1  . TYR A 1 111 ? 0.093   15.182  3.991   1.00 1.98  ? 111 TYR A HD1  3  
ATOM 6017  H HD2  . TYR A 1 111 ? 0.433   11.072  2.956   1.00 1.04  ? 111 TYR A HD2  3  
ATOM 6018  H HE1  . TYR A 1 111 ? 2.386   15.577  3.202   1.00 3.10  ? 111 TYR A HE1  3  
ATOM 6019  H HE2  . TYR A 1 111 ? 2.720   11.451  2.172   1.00 1.39  ? 111 TYR A HE2  3  
ATOM 6020  H HH   . TYR A 1 111 ? 4.488   14.166  2.932   1.00 2.95  ? 111 TYR A HH   3  
ATOM 6021  N N    . LYS A 1 112 ? -2.995  12.117  6.838   1.00 0.60  ? 112 LYS A N    3  
ATOM 6022  C CA   . LYS A 1 112 ? -4.242  11.772  7.496   1.00 0.72  ? 112 LYS A CA   3  
ATOM 6023  C C    . LYS A 1 112 ? -4.654  12.874  8.456   1.00 0.82  ? 112 LYS A C    3  
ATOM 6024  O O    . LYS A 1 112 ? -5.820  13.263  8.516   1.00 1.00  ? 112 LYS A O    3  
ATOM 6025  C CB   . LYS A 1 112 ? -4.093  10.455  8.237   1.00 0.65  ? 112 LYS A CB   3  
ATOM 6026  C CG   . LYS A 1 112 ? -4.243  9.279   7.361   1.00 0.66  ? 112 LYS A CG   3  
ATOM 6027  C CD   . LYS A 1 112 ? -3.902  8.042   8.116   1.00 0.79  ? 112 LYS A CD   3  
ATOM 6028  C CE   . LYS A 1 112 ? -4.453  6.869   7.398   1.00 1.06  ? 112 LYS A CE   3  
ATOM 6029  N NZ   . LYS A 1 112 ? -5.902  6.694   7.646   1.00 1.63  ? 112 LYS A NZ   3  
ATOM 6030  H H    . LYS A 1 112 ? -2.182  11.617  7.065   1.00 0.53  ? 112 LYS A H    3  
ATOM 6031  H HA   . LYS A 1 112 ? -4.997  11.655  6.736   1.00 0.83  ? 112 LYS A HA   3  
ATOM 6032  H HB2  . LYS A 1 112 ? -3.121  10.398  8.682   1.00 1.01  ? 112 LYS A HB2  3  
ATOM 6033  H HB3  . LYS A 1 112 ? -4.831  10.382  8.996   1.00 0.83  ? 112 LYS A HB3  3  
ATOM 6034  H HG2  . LYS A 1 112 ? -5.260  9.217   7.005   1.00 0.90  ? 112 LYS A HG2  3  
ATOM 6035  H HG3  . LYS A 1 112 ? -3.568  9.376   6.541   1.00 1.12  ? 112 LYS A HG3  3  
ATOM 6036  H HD2  . LYS A 1 112 ? -2.834  7.965   8.164   1.00 0.91  ? 112 LYS A HD2  3  
ATOM 6037  H HD3  . LYS A 1 112 ? -4.321  8.094   9.104   1.00 0.95  ? 112 LYS A HD3  3  
ATOM 6038  H HE2  . LYS A 1 112 ? -4.304  7.068   6.362   1.00 1.20  ? 112 LYS A HE2  3  
ATOM 6039  H HE3  . LYS A 1 112 ? -3.921  5.980   7.690   1.00 1.67  ? 112 LYS A HE3  3  
ATOM 6040  H HZ1  . LYS A 1 112 ? -6.278  5.937   7.047   1.00 2.18  ? 112 LYS A HZ1  3  
ATOM 6041  H HZ2  . LYS A 1 112 ? -6.414  7.574   7.430   1.00 2.02  ? 112 LYS A HZ2  3  
ATOM 6042  H HZ3  . LYS A 1 112 ? -6.070  6.449   8.641   1.00 2.08  ? 112 LYS A HZ3  3  
ATOM 6043  N N    . ASP A 1 113 ? -3.681  13.373  9.202   1.00 0.77  ? 113 ASP A N    3  
ATOM 6044  C CA   . ASP A 1 113 ? -3.912  14.472  10.129  1.00 0.91  ? 113 ASP A CA   3  
ATOM 6045  C C    . ASP A 1 113 ? -3.882  15.795  9.378   1.00 0.99  ? 113 ASP A C    3  
ATOM 6046  O O    . ASP A 1 113 ? -4.592  16.742  9.716   1.00 1.15  ? 113 ASP A O    3  
ATOM 6047  C CB   . ASP A 1 113 ? -2.846  14.470  11.220  1.00 0.91  ? 113 ASP A CB   3  
ATOM 6048  C CG   . ASP A 1 113 ? -3.226  15.329  12.407  1.00 1.31  ? 113 ASP A CG   3  
ATOM 6049  O OD1  . ASP A 1 113 ? -4.016  14.864  13.252  1.00 1.55  ? 113 ASP A OD1  3  
ATOM 6050  O OD2  . ASP A 1 113 ? -2.737  16.475  12.494  1.00 1.60  ? 113 ASP A OD2  3  
ATOM 6051  H H    . ASP A 1 113 ? -2.783  12.981  9.140   1.00 0.66  ? 113 ASP A H    3  
ATOM 6052  H HA   . ASP A 1 113 ? -4.884  14.339  10.577  1.00 1.01  ? 113 ASP A HA   3  
ATOM 6053  H HB2  . ASP A 1 113 ? -2.689  13.465  11.556  1.00 0.88  ? 113 ASP A HB2  3  
ATOM 6054  H HB3  . ASP A 1 113 ? -1.924  14.846  10.811  1.00 0.93  ? 113 ASP A HB3  3  
ATOM 6055  N N    . ALA A 1 114 ? -3.026  15.827  8.357   1.00 0.91  ? 114 ALA A N    3  
ATOM 6056  C CA   . ALA A 1 114 ? -2.932  16.940  7.407   1.00 0.99  ? 114 ALA A CA   3  
ATOM 6057  C C    . ALA A 1 114 ? -2.378  18.201  8.056   1.00 1.16  ? 114 ALA A C    3  
ATOM 6058  O O    . ALA A 1 114 ? -2.534  19.302  7.531   1.00 1.33  ? 114 ALA A O    3  
ATOM 6059  C CB   . ALA A 1 114 ? -4.283  17.218  6.761   1.00 1.07  ? 114 ALA A CB   3  
ATOM 6060  H H    . ALA A 1 114 ? -2.415  15.065  8.245   1.00 0.81  ? 114 ALA A H    3  
ATOM 6061  H HA   . ALA A 1 114 ? -2.252  16.637  6.625   1.00 0.95  ? 114 ALA A HA   3  
ATOM 6062  H HB1  . ALA A 1 114 ? -4.982  17.545  7.516   1.00 1.53  ? 114 ALA A HB1  3  
ATOM 6063  H HB2  . ALA A 1 114 ? -4.650  16.317  6.295   1.00 1.53  ? 114 ALA A HB2  3  
ATOM 6064  H HB3  . ALA A 1 114 ? -4.173  17.990  6.014   1.00 1.42  ? 114 ALA A HB3  3  
ATOM 6065  N N    . ASP A 1 115 ? -1.729  18.038  9.192   1.00 1.20  ? 115 ASP A N    3  
ATOM 6066  C CA   . ASP A 1 115 ? -1.120  19.158  9.883   1.00 1.43  ? 115 ASP A CA   3  
ATOM 6067  C C    . ASP A 1 115 ? 0.389   19.003  9.899   1.00 1.61  ? 115 ASP A C    3  
ATOM 6068  O O    . ASP A 1 115 ? 1.072   19.746  9.169   1.00 2.01  ? 115 ASP A O    3  
ATOM 6069  C CB   . ASP A 1 115 ? -1.651  19.268  11.308  1.00 1.66  ? 115 ASP A CB   3  
ATOM 6070  C CG   . ASP A 1 115 ? -1.069  20.454  12.045  1.00 1.90  ? 115 ASP A CG   3  
ATOM 6071  O OD1  . ASP A 1 115 ? -1.517  21.593  11.790  1.00 2.23  ? 115 ASP A OD1  3  
ATOM 6072  O OD2  . ASP A 1 115 ? -0.168  20.260  12.885  1.00 1.96  ? 115 ASP A OD2  3  
ATOM 6073  O OXT  . ASP A 1 115 ? 0.886   18.110  10.614  1.00 2.09  ? 115 ASP A OXT  3  
ATOM 6074  H H    . ASP A 1 115 ? -1.662  17.144  9.581   1.00 1.12  ? 115 ASP A H    3  
ATOM 6075  H HA   . ASP A 1 115 ? -1.372  20.059  9.344   1.00 1.58  ? 115 ASP A HA   3  
ATOM 6076  H HB2  . ASP A 1 115 ? -2.724  19.374  11.277  1.00 1.77  ? 115 ASP A HB2  3  
ATOM 6077  H HB3  . ASP A 1 115 ? -1.398  18.370  11.852  1.00 1.74  ? 115 ASP A HB3  3  
ATOM 6078  N N    . ASP B 2 1   ? -10.053 -15.005 -9.568  1.00 2.92  ? 22  ASP B N    3  
ATOM 6079  C CA   . ASP B 2 1   ? -9.679  -16.062 -8.604  1.00 2.59  ? 22  ASP B CA   3  
ATOM 6080  C C    . ASP B 2 1   ? -8.316  -15.781 -7.969  1.00 2.27  ? 22  ASP B C    3  
ATOM 6081  O O    . ASP B 2 1   ? -8.106  -16.078 -6.792  1.00 2.08  ? 22  ASP B O    3  
ATOM 6082  C CB   . ASP B 2 1   ? -9.663  -17.435 -9.289  1.00 2.80  ? 22  ASP B CB   3  
ATOM 6083  C CG   . ASP B 2 1   ? -8.578  -17.555 -10.338 1.00 3.30  ? 22  ASP B CG   3  
ATOM 6084  O OD1  . ASP B 2 1   ? -8.675  -16.883 -11.383 1.00 3.79  ? 22  ASP B OD1  3  
ATOM 6085  O OD2  . ASP B 2 1   ? -7.623  -18.331 -10.125 1.00 3.65  ? 22  ASP B OD2  3  
ATOM 6086  H H1   . ASP B 2 1   ? -9.337  -14.926 -10.316 1.00 3.10  ? 22  ASP B H1   3  
ATOM 6087  H H2   . ASP B 2 1   ? -10.130 -14.084 -9.075  1.00 3.28  ? 22  ASP B H2   3  
ATOM 6088  H H3   . ASP B 2 1   ? -10.971 -15.225 -10.003 1.00 3.12  ? 22  ASP B H3   3  
ATOM 6089  H HA   . ASP B 2 1   ? -10.423 -16.074 -7.821  1.00 2.62  ? 22  ASP B HA   3  
ATOM 6090  H HB2  . ASP B 2 1   ? -9.501  -18.198 -8.544  1.00 2.95  ? 22  ASP B HB2  3  
ATOM 6091  H HB3  . ASP B 2 1   ? -10.619 -17.602 -9.765  1.00 3.06  ? 22  ASP B HB3  3  
ATOM 6092  N N    . THR B 2 2   ? -7.395  -15.190 -8.730  1.00 2.32  ? 23  THR B N    3  
ATOM 6093  C CA   . THR B 2 2   ? -6.041  -14.968 -8.239  1.00 2.14  ? 23  THR B CA   3  
ATOM 6094  C C    . THR B 2 2   ? -5.982  -13.831 -7.229  1.00 1.87  ? 23  THR B C    3  
ATOM 6095  O O    . THR B 2 2   ? -5.532  -14.021 -6.098  1.00 1.65  ? 23  THR B O    3  
ATOM 6096  C CB   . THR B 2 2   ? -5.073  -14.666 -9.391  1.00 2.44  ? 23  THR B CB   3  
ATOM 6097  O OG1  . THR B 2 2   ? -5.669  -13.739 -10.306 1.00 2.75  ? 23  THR B OG1  3  
ATOM 6098  C CG2  . THR B 2 2   ? -4.683  -15.936 -10.127 1.00 2.78  ? 23  THR B CG2  3  
ATOM 6099  H H    . THR B 2 2   ? -7.626  -14.893 -9.637  1.00 2.56  ? 23  THR B H    3  
ATOM 6100  H HA   . THR B 2 2   ? -5.711  -15.876 -7.758  1.00 2.12  ? 23  THR B HA   3  
ATOM 6101  H HB   . THR B 2 2   ? -4.185  -14.223 -8.973  1.00 2.61  ? 23  THR B HB   3  
ATOM 6102  H HG1  . THR B 2 2   ? -5.051  -13.562 -11.028 1.00 3.07  ? 23  THR B HG1  3  
ATOM 6103  H HG21 . THR B 2 2   ? -4.049  -15.687 -10.964 1.00 3.18  ? 23  THR B HG21 3  
ATOM 6104  H HG22 . THR B 2 2   ? -5.573  -16.433 -10.483 1.00 3.12  ? 23  THR B HG22 3  
ATOM 6105  H HG23 . THR B 2 2   ? -4.150  -16.591 -9.454  1.00 2.90  ? 23  THR B HG23 3  
ATOM 6106  N N    . GLN B 2 3   ? -6.460  -12.656 -7.626  1.00 1.97  ? 24  GLN B N    3  
ATOM 6107  C CA   . GLN B 2 3   ? -6.448  -11.498 -6.741  1.00 1.86  ? 24  GLN B CA   3  
ATOM 6108  C C    . GLN B 2 3   ? -7.441  -11.707 -5.605  1.00 1.69  ? 24  GLN B C    3  
ATOM 6109  O O    . GLN B 2 3   ? -7.264  -11.189 -4.507  1.00 1.59  ? 24  GLN B O    3  
ATOM 6110  C CB   . GLN B 2 3   ? -6.771  -10.211 -7.509  1.00 2.14  ? 24  GLN B CB   3  
ATOM 6111  C CG   . GLN B 2 3   ? -8.205  -10.124 -8.007  1.00 2.53  ? 24  GLN B CG   3  
ATOM 6112  C CD   . GLN B 2 3   ? -8.463  -8.878  -8.829  1.00 3.01  ? 24  GLN B CD   3  
ATOM 6113  O OE1  . GLN B 2 3   ? -7.825  -7.842  -8.635  1.00 3.39  ? 24  GLN B OE1  3  
ATOM 6114  N NE2  . GLN B 2 3   ? -9.409  -8.965  -9.750  1.00 3.58  ? 24  GLN B NE2  3  
ATOM 6115  H H    . GLN B 2 3   ? -6.817  -12.564 -8.536  1.00 2.18  ? 24  GLN B H    3  
ATOM 6116  H HA   . GLN B 2 3   ? -5.457  -11.418 -6.320  1.00 1.79  ? 24  GLN B HA   3  
ATOM 6117  H HB2  . GLN B 2 3   ? -6.589  -9.367  -6.860  1.00 2.52  ? 24  GLN B HB2  3  
ATOM 6118  H HB3  . GLN B 2 3   ? -6.113  -10.143 -8.362  1.00 2.37  ? 24  GLN B HB3  3  
ATOM 6119  H HG2  . GLN B 2 3   ? -8.413  -10.990 -8.618  1.00 2.85  ? 24  GLN B HG2  3  
ATOM 6120  H HG3  . GLN B 2 3   ? -8.869  -10.120 -7.154  1.00 2.92  ? 24  GLN B HG3  3  
ATOM 6121  H HE21 . GLN B 2 3   ? -9.887  -9.819  -9.846  1.00 3.72  ? 24  GLN B HE21 3  
ATOM 6122  H HE22 . GLN B 2 3   ? -9.599  -8.174  -10.299 1.00 4.10  ? 24  GLN B HE22 3  
ATOM 6123  N N    . ASP B 2 4   ? -8.472  -12.497 -5.883  1.00 1.74  ? 25  ASP B N    3  
ATOM 6124  C CA   . ASP B 2 4   ? -9.487  -12.824 -4.889  1.00 1.67  ? 25  ASP B CA   3  
ATOM 6125  C C    . ASP B 2 4   ? -8.846  -13.523 -3.705  1.00 1.46  ? 25  ASP B C    3  
ATOM 6126  O O    . ASP B 2 4   ? -9.154  -13.230 -2.548  1.00 1.37  ? 25  ASP B O    3  
ATOM 6127  C CB   . ASP B 2 4   ? -10.561 -13.734 -5.492  1.00 1.88  ? 25  ASP B CB   3  
ATOM 6128  C CG   . ASP B 2 4   ? -11.224 -13.135 -6.712  1.00 2.23  ? 25  ASP B CG   3  
ATOM 6129  O OD1  . ASP B 2 4   ? -10.587 -13.125 -7.790  1.00 2.67  ? 25  ASP B OD1  3  
ATOM 6130  O OD2  . ASP B 2 4   ? -12.382 -12.676 -6.608  1.00 2.56  ? 25  ASP B OD2  3  
ATOM 6131  H H    . ASP B 2 4   ? -8.553  -12.868 -6.788  1.00 1.88  ? 25  ASP B H    3  
ATOM 6132  H HA   . ASP B 2 4   ? -9.943  -11.904 -4.557  1.00 1.70  ? 25  ASP B HA   3  
ATOM 6133  H HB2  . ASP B 2 4   ? -10.108 -14.672 -5.777  1.00 2.16  ? 25  ASP B HB2  3  
ATOM 6134  H HB3  . ASP B 2 4   ? -11.322 -13.922 -4.748  1.00 2.05  ? 25  ASP B HB3  3  
ATOM 6135  N N    . ASP B 2 5   ? -7.933  -14.437 -4.010  1.00 1.48  ? 26  ASP B N    3  
ATOM 6136  C CA   . ASP B 2 5   ? -7.222  -15.188 -2.987  1.00 1.38  ? 26  ASP B CA   3  
ATOM 6137  C C    . ASP B 2 5   ? -6.333  -14.260 -2.171  1.00 1.16  ? 26  ASP B C    3  
ATOM 6138  O O    . ASP B 2 5   ? -6.202  -14.420 -0.959  1.00 1.08  ? 26  ASP B O    3  
ATOM 6139  C CB   . ASP B 2 5   ? -6.378  -16.291 -3.625  1.00 1.61  ? 26  ASP B CB   3  
ATOM 6140  C CG   . ASP B 2 5   ? -5.719  -17.183 -2.594  1.00 1.69  ? 26  ASP B CG   3  
ATOM 6141  O OD1  . ASP B 2 5   ? -6.340  -18.189 -2.195  1.00 1.79  ? 26  ASP B OD1  3  
ATOM 6142  O OD2  . ASP B 2 5   ? -4.580  -16.888 -2.181  1.00 2.16  ? 26  ASP B OD2  3  
ATOM 6143  H H    . ASP B 2 5   ? -7.732  -14.612 -4.955  1.00 1.64  ? 26  ASP B H    3  
ATOM 6144  H HA   . ASP B 2 5   ? -7.955  -15.636 -2.333  1.00 1.41  ? 26  ASP B HA   3  
ATOM 6145  H HB2  . ASP B 2 5   ? -7.009  -16.904 -4.252  1.00 2.03  ? 26  ASP B HB2  3  
ATOM 6146  H HB3  . ASP B 2 5   ? -5.606  -15.839 -4.230  1.00 1.90  ? 26  ASP B HB3  3  
ATOM 6147  N N    . PHE B 2 6   ? -5.758  -13.266 -2.844  1.00 1.18  ? 27  PHE B N    3  
ATOM 6148  C CA   . PHE B 2 6   ? -4.864  -12.310 -2.197  1.00 1.13  ? 27  PHE B CA   3  
ATOM 6149  C C    . PHE B 2 6   ? -5.589  -11.473 -1.147  1.00 1.08  ? 27  PHE B C    3  
ATOM 6150  O O    . PHE B 2 6   ? -4.964  -10.931 -0.240  1.00 1.20  ? 27  PHE B O    3  
ATOM 6151  C CB   . PHE B 2 6   ? -4.203  -11.390 -3.228  1.00 1.30  ? 27  PHE B CB   3  
ATOM 6152  C CG   . PHE B 2 6   ? -2.953  -11.959 -3.838  1.00 1.11  ? 27  PHE B CG   3  
ATOM 6153  C CD1  . PHE B 2 6   ? -1.719  -11.772 -3.238  1.00 1.14  ? 27  PHE B CD1  3  
ATOM 6154  C CD2  . PHE B 2 6   ? -3.015  -12.686 -5.016  1.00 1.45  ? 27  PHE B CD2  3  
ATOM 6155  C CE1  . PHE B 2 6   ? -0.572  -12.299 -3.801  1.00 1.16  ? 27  PHE B CE1  3  
ATOM 6156  C CE2  . PHE B 2 6   ? -1.874  -13.214 -5.584  1.00 1.84  ? 27  PHE B CE2  3  
ATOM 6157  C CZ   . PHE B 2 6   ? -0.631  -12.999 -4.957  1.00 1.59  ? 27  PHE B CZ   3  
ATOM 6158  H H    . PHE B 2 6   ? -5.941  -13.175 -3.804  1.00 1.30  ? 27  PHE B H    3  
ATOM 6159  H HA   . PHE B 2 6   ? -4.092  -12.882 -1.698  1.00 1.14  ? 27  PHE B HA   3  
ATOM 6160  H HB2  . PHE B 2 6   ? -4.902  -11.198 -4.026  1.00 1.57  ? 27  PHE B HB2  3  
ATOM 6161  H HB3  . PHE B 2 6   ? -3.946  -10.456 -2.749  1.00 1.63  ? 27  PHE B HB3  3  
ATOM 6162  H HD1  . PHE B 2 6   ? -1.657  -11.207 -2.320  1.00 1.49  ? 27  PHE B HD1  3  
ATOM 6163  H HD2  . PHE B 2 6   ? -3.973  -12.841 -5.491  1.00 1.68  ? 27  PHE B HD2  3  
ATOM 6164  H HE1  . PHE B 2 6   ? 0.383   -12.147 -3.324  1.00 1.20  ? 27  PHE B HE1  3  
ATOM 6165  H HE2  . PHE B 2 6   ? -1.938  -13.779 -6.503  1.00 2.44  ? 27  PHE B HE2  3  
ATOM 6166  H HZ   . PHE B 2 6   ? 0.273   -13.403 -5.390  1.00 1.95  ? 27  PHE B HZ   3  
ATOM 6167  N N    . LEU B 2 7   ? -6.901  -11.349 -1.275  1.00 1.07  ? 28  LEU B N    3  
ATOM 6168  C CA   . LEU B 2 7   ? -7.691  -10.671 -0.259  1.00 1.16  ? 28  LEU B CA   3  
ATOM 6169  C C    . LEU B 2 7   ? -8.057  -11.641 0.857   1.00 1.10  ? 28  LEU B C    3  
ATOM 6170  O O    . LEU B 2 7   ? -8.204  -11.246 2.013   1.00 1.17  ? 28  LEU B O    3  
ATOM 6171  C CB   . LEU B 2 7   ? -8.962  -10.055 -0.860  1.00 1.40  ? 28  LEU B CB   3  
ATOM 6172  C CG   . LEU B 2 7   ? -8.788  -8.684  -1.528  1.00 1.80  ? 28  LEU B CG   3  
ATOM 6173  C CD1  . LEU B 2 7   ? -7.876  -8.771  -2.740  1.00 2.39  ? 28  LEU B CD1  3  
ATOM 6174  C CD2  . LEU B 2 7   ? -10.140 -8.112  -1.923  1.00 2.28  ? 28  LEU B CD2  3  
ATOM 6175  H H    . LEU B 2 7   ? -7.345  -11.709 -2.074  1.00 1.12  ? 28  LEU B H    3  
ATOM 6176  H HA   . LEU B 2 7   ? -7.083  -9.881  0.157   1.00 1.23  ? 28  LEU B HA   3  
ATOM 6177  H HB2  . LEU B 2 7   ? -9.350  -10.741 -1.598  1.00 1.64  ? 28  LEU B HB2  3  
ATOM 6178  H HB3  . LEU B 2 7   ? -9.693  -9.953  -0.071  1.00 2.04  ? 28  LEU B HB3  3  
ATOM 6179  H HG   . LEU B 2 7   ? -8.334  -8.006  -0.822  1.00 2.36  ? 28  LEU B HG   3  
ATOM 6180  H HD11 . LEU B 2 7   ? -7.776  -7.794  -3.188  1.00 2.97  ? 28  LEU B HD11 3  
ATOM 6181  H HD12 . LEU B 2 7   ? -8.301  -9.455  -3.460  1.00 2.48  ? 28  LEU B HD12 3  
ATOM 6182  H HD13 . LEU B 2 7   ? -6.905  -9.130  -2.434  1.00 2.89  ? 28  LEU B HD13 3  
ATOM 6183  H HD21 . LEU B 2 7   ? -10.627 -8.784  -2.614  1.00 2.77  ? 28  LEU B HD21 3  
ATOM 6184  H HD22 . LEU B 2 7   ? -10.000 -7.150  -2.394  1.00 2.61  ? 28  LEU B HD22 3  
ATOM 6185  H HD23 . LEU B 2 7   ? -10.754 -7.996  -1.043  1.00 2.57  ? 28  LEU B HD23 3  
ATOM 6186  N N    . LYS B 2 8   ? -8.169  -12.917 0.510   1.00 1.07  ? 29  LYS B N    3  
ATOM 6187  C CA   . LYS B 2 8   ? -8.587  -13.934 1.463   1.00 1.14  ? 29  LYS B CA   3  
ATOM 6188  C C    . LYS B 2 8   ? -7.469  -14.279 2.443   1.00 1.04  ? 29  LYS B C    3  
ATOM 6189  O O    . LYS B 2 8   ? -7.689  -14.299 3.652   1.00 1.06  ? 29  LYS B O    3  
ATOM 6190  C CB   . LYS B 2 8   ? -9.053  -15.195 0.734   1.00 1.33  ? 29  LYS B CB   3  
ATOM 6191  C CG   . LYS B 2 8   ? -10.294 -14.982 -0.119  1.00 1.71  ? 29  LYS B CG   3  
ATOM 6192  C CD   . LYS B 2 8   ? -10.721 -16.257 -0.831  1.00 1.99  ? 29  LYS B CD   3  
ATOM 6193  C CE   . LYS B 2 8   ? -11.098 -17.359 0.149   1.00 2.39  ? 29  LYS B CE   3  
ATOM 6194  N NZ   . LYS B 2 8   ? -12.225 -16.965 1.038   1.00 2.91  ? 29  LYS B NZ   3  
ATOM 6195  H H    . LYS B 2 8   ? -7.960  -13.182 -0.412  1.00 1.09  ? 29  LYS B H    3  
ATOM 6196  H HA   . LYS B 2 8   ? -9.418  -13.531 2.022   1.00 1.24  ? 29  LYS B HA   3  
ATOM 6197  H HB2  . LYS B 2 8   ? -8.256  -15.543 0.093   1.00 1.79  ? 29  LYS B HB2  3  
ATOM 6198  H HB3  . LYS B 2 8   ? -9.273  -15.958 1.466   1.00 1.82  ? 29  LYS B HB3  3  
ATOM 6199  H HG2  . LYS B 2 8   ? -11.102 -14.651 0.516   1.00 2.29  ? 29  LYS B HG2  3  
ATOM 6200  H HG3  . LYS B 2 8   ? -10.084 -14.221 -0.858  1.00 2.15  ? 29  LYS B HG3  3  
ATOM 6201  H HD2  . LYS B 2 8   ? -11.575 -16.039 -1.456  1.00 2.21  ? 29  LYS B HD2  3  
ATOM 6202  H HD3  . LYS B 2 8   ? -9.903  -16.601 -1.447  1.00 2.44  ? 29  LYS B HD3  3  
ATOM 6203  H HE2  . LYS B 2 8   ? -11.385 -18.236 -0.412  1.00 2.72  ? 29  LYS B HE2  3  
ATOM 6204  H HE3  . LYS B 2 8   ? -10.236 -17.591 0.757   1.00 2.71  ? 29  LYS B HE3  3  
ATOM 6205  H HZ1  . LYS B 2 8   ? -13.057 -16.707 0.472   1.00 3.26  ? 29  LYS B HZ1  3  
ATOM 6206  H HZ2  . LYS B 2 8   ? -11.955 -16.152 1.627   1.00 3.28  ? 29  LYS B HZ2  3  
ATOM 6207  H HZ3  . LYS B 2 8   ? -12.479 -17.759 1.662   1.00 3.20  ? 29  LYS B HZ3  3  
ATOM 6208  N N    . TRP B 2 9   ? -6.263  -14.521 1.934   1.00 0.99  ? 30  TRP B N    3  
ATOM 6209  C CA   . TRP B 2 9   ? -5.146  -14.896 2.801   1.00 1.00  ? 30  TRP B CA   3  
ATOM 6210  C C    . TRP B 2 9   ? -4.658  -13.689 3.590   1.00 0.90  ? 30  TRP B C    3  
ATOM 6211  O O    . TRP B 2 9   ? -3.950  -13.825 4.588   1.00 1.00  ? 30  TRP B O    3  
ATOM 6212  C CB   . TRP B 2 9   ? -3.990  -15.513 1.996   1.00 1.03  ? 30  TRP B CB   3  
ATOM 6213  C CG   . TRP B 2 9   ? -3.131  -14.529 1.268   1.00 0.95  ? 30  TRP B CG   3  
ATOM 6214  C CD1  . TRP B 2 9   ? -3.414  -13.971 0.071   1.00 1.06  ? 30  TRP B CD1  3  
ATOM 6215  C CD2  . TRP B 2 9   ? -1.846  -14.017 1.659   1.00 0.86  ? 30  TRP B CD2  3  
ATOM 6216  N NE1  . TRP B 2 9   ? -2.405  -13.127 -0.313  1.00 1.00  ? 30  TRP B NE1  3  
ATOM 6217  C CE2  . TRP B 2 9   ? -1.430  -13.139 0.642   1.00 0.85  ? 30  TRP B CE2  3  
ATOM 6218  C CE3  . TRP B 2 9   ? -1.009  -14.207 2.766   1.00 0.94  ? 30  TRP B CE3  3  
ATOM 6219  C CZ2  . TRP B 2 9   ? -0.222  -12.452 0.694   1.00 0.83  ? 30  TRP B CZ2  3  
ATOM 6220  C CZ3  . TRP B 2 9   ? 0.194   -13.524 2.813   1.00 1.00  ? 30  TRP B CZ3  3  
ATOM 6221  C CH2  . TRP B 2 9   ? 0.577   -12.657 1.781   1.00 0.90  ? 30  TRP B CH2  3  
ATOM 6222  H H    . TRP B 2 9   ? -6.123  -14.457 0.961   1.00 1.00  ? 30  TRP B H    3  
ATOM 6223  H HA   . TRP B 2 9   ? -5.514  -15.633 3.500   1.00 1.11  ? 30  TRP B HA   3  
ATOM 6224  H HB2  . TRP B 2 9   ? -3.355  -16.076 2.657   1.00 1.09  ? 30  TRP B HB2  3  
ATOM 6225  H HB3  . TRP B 2 9   ? -4.408  -16.178 1.254   1.00 1.11  ? 30  TRP B HB3  3  
ATOM 6226  H HD1  . TRP B 2 9   ? -4.317  -14.170 -0.485  1.00 1.24  ? 30  TRP B HD1  3  
ATOM 6227  H HE1  . TRP B 2 9   ? -2.386  -12.607 -1.140  1.00 1.11  ? 30  TRP B HE1  3  
ATOM 6228  H HE3  . TRP B 2 9   ? -1.286  -14.869 3.572   1.00 1.05  ? 30  TRP B HE3  3  
ATOM 6229  H HZ2  . TRP B 2 9   ? 0.087   -11.780 -0.092  1.00 0.86  ? 30  TRP B HZ2  3  
ATOM 6230  H HZ3  . TRP B 2 9   ? 0.857   -13.660 3.654   1.00 1.18  ? 30  TRP B HZ3  3  
ATOM 6231  H HH2  . TRP B 2 9   ? 1.525   -12.143 1.858   1.00 0.99  ? 30  TRP B HH2  3  
ATOM 6232  N N    . TRP B 2 10  ? -5.055  -12.509 3.140   1.00 0.76  ? 31  TRP B N    3  
ATOM 6233  C CA   . TRP B 2 10  ? -4.638  -11.279 3.779   1.00 0.73  ? 31  TRP B CA   3  
ATOM 6234  C C    . TRP B 2 10  ? -5.587  -10.915 4.913   1.00 0.86  ? 31  TRP B C    3  
ATOM 6235  O O    . TRP B 2 10  ? -5.162  -10.652 6.038   1.00 1.02  ? 31  TRP B O    3  
ATOM 6236  C CB   . TRP B 2 10  ? -4.632  -10.147 2.758   1.00 0.61  ? 31  TRP B CB   3  
ATOM 6237  C CG   . TRP B 2 10  ? -3.733  -9.017  3.136   1.00 0.56  ? 31  TRP B CG   3  
ATOM 6238  C CD1  . TRP B 2 10  ? -3.828  -8.213  4.234   1.00 0.66  ? 31  TRP B CD1  3  
ATOM 6239  C CD2  . TRP B 2 10  ? -2.602  -8.567  2.404   1.00 0.46  ? 31  TRP B CD2  3  
ATOM 6240  N NE1  . TRP B 2 10  ? -2.807  -7.297  4.234   1.00 0.65  ? 31  TRP B NE1  3  
ATOM 6241  C CE2  . TRP B 2 10  ? -2.040  -7.494  3.114   1.00 0.50  ? 31  TRP B CE2  3  
ATOM 6242  C CE3  . TRP B 2 10  ? -2.007  -8.973  1.212   1.00 0.42  ? 31  TRP B CE3  3  
ATOM 6243  C CZ2  . TRP B 2 10  ? -0.907  -6.827  2.666   1.00 0.45  ? 31  TRP B CZ2  3  
ATOM 6244  C CZ3  . TRP B 2 10  ? -0.888  -8.311  0.772   1.00 0.38  ? 31  TRP B CZ3  3  
ATOM 6245  C CH2  . TRP B 2 10  ? -0.346  -7.246  1.498   1.00 0.36  ? 31  TRP B CH2  3  
ATOM 6246  H H    . TRP B 2 10  ? -5.639  -12.468 2.355   1.00 0.76  ? 31  TRP B H    3  
ATOM 6247  H HA   . TRP B 2 10  ? -3.640  -11.412 4.167   1.00 0.76  ? 31  TRP B HA   3  
ATOM 6248  H HB2  . TRP B 2 10  ? -4.299  -10.531 1.805   1.00 0.59  ? 31  TRP B HB2  3  
ATOM 6249  H HB3  . TRP B 2 10  ? -5.633  -9.757  2.655   1.00 0.67  ? 31  TRP B HB3  3  
ATOM 6250  H HD1  . TRP B 2 10  ? -4.597  -8.301  4.990   1.00 0.78  ? 31  TRP B HD1  3  
ATOM 6251  H HE1  . TRP B 2 10  ? -2.654  -6.614  4.923   1.00 0.75  ? 31  TRP B HE1  3  
ATOM 6252  H HE3  . TRP B 2 10  ? -2.414  -9.788  0.636   1.00 0.49  ? 31  TRP B HE3  3  
ATOM 6253  H HZ2  . TRP B 2 10  ? -0.476  -6.012  3.207   1.00 0.54  ? 31  TRP B HZ2  3  
ATOM 6254  H HZ3  . TRP B 2 10  ? -0.417  -8.614  -0.147  1.00 0.43  ? 31  TRP B HZ3  3  
ATOM 6255  H HH2  . TRP B 2 10  ? 0.537   -6.751  1.119   1.00 0.36  ? 31  TRP B HH2  3  
ATOM 6256  N N    . ARG B 2 11  ? -6.880  -10.950 4.621   1.00 0.87  ? 32  ARG B N    3  
ATOM 6257  C CA   . ARG B 2 11  ? -7.880  -10.457 5.555   1.00 1.03  ? 32  ARG B CA   3  
ATOM 6258  C C    . ARG B 2 11  ? -8.138  -11.466 6.664   1.00 1.15  ? 32  ARG B C    3  
ATOM 6259  O O    . ARG B 2 11  ? -8.531  -11.096 7.768   1.00 1.33  ? 32  ARG B O    3  
ATOM 6260  C CB   . ARG B 2 11  ? -9.174  -10.118 4.821   1.00 1.08  ? 32  ARG B CB   3  
ATOM 6261  C CG   . ARG B 2 11  ? -10.174 -9.352  5.668   1.00 1.34  ? 32  ARG B CG   3  
ATOM 6262  C CD   . ARG B 2 11  ? -11.325 -8.842  4.826   1.00 1.58  ? 32  ARG B CD   3  
ATOM 6263  N NE   . ARG B 2 11  ? -12.293 -8.090  5.619   1.00 2.01  ? 32  ARG B NE   3  
ATOM 6264  C CZ   . ARG B 2 11  ? -13.235 -7.311  5.096   1.00 2.63  ? 32  ARG B CZ   3  
ATOM 6265  N NH1  . ARG B 2 11  ? -13.327 -7.171  3.781   1.00 3.04  ? 32  ARG B NH1  3  
ATOM 6266  N NH2  . ARG B 2 11  ? -14.084 -6.670  5.891   1.00 3.37  ? 32  ARG B NH2  3  
ATOM 6267  H H    . ARG B 2 11  ? -7.169  -11.315 3.756   1.00 0.82  ? 32  ARG B H    3  
ATOM 6268  H HA   . ARG B 2 11  ? -7.488  -9.555  6.001   1.00 1.12  ? 32  ARG B HA   3  
ATOM 6269  H HB2  . ARG B 2 11  ? -8.937  -9.521  3.953   1.00 1.33  ? 32  ARG B HB2  3  
ATOM 6270  H HB3  . ARG B 2 11  ? -9.640  -11.037 4.498   1.00 1.39  ? 32  ARG B HB3  3  
ATOM 6271  H HG2  . ARG B 2 11  ? -10.563 -10.007 6.433   1.00 1.84  ? 32  ARG B HG2  3  
ATOM 6272  H HG3  . ARG B 2 11  ? -9.675  -8.512  6.128   1.00 1.90  ? 32  ARG B HG3  3  
ATOM 6273  H HD2  . ARG B 2 11  ? -10.930 -8.197  4.055   1.00 2.09  ? 32  ARG B HD2  3  
ATOM 6274  H HD3  . ARG B 2 11  ? -11.823 -9.685  4.370   1.00 2.02  ? 32  ARG B HD3  3  
ATOM 6275  H HE   . ARG B 2 11  ? -12.239 -8.179  6.597   1.00 2.35  ? 32  ARG B HE   3  
ATOM 6276  H HH11 . ARG B 2 11  ? -12.687 -7.652  3.177   1.00 2.99  ? 32  ARG B HH11 3  
ATOM 6277  H HH12 . ARG B 2 11  ? -14.034 -6.583  3.384   1.00 3.72  ? 32  ARG B HH12 3  
ATOM 6278  H HH21 . ARG B 2 11  ? -14.018 -6.771  6.887   1.00 3.63  ? 32  ARG B HH21 3  
ATOM 6279  H HH22 . ARG B 2 11  ? -14.802 -6.087  5.499   1.00 3.92  ? 32  ARG B HH22 3  
ATOM 6280  N N    . SER B 2 12  ? -7.898  -12.738 6.379   1.00 1.13  ? 33  SER B N    3  
ATOM 6281  C CA   . SER B 2 12  ? -8.023  -13.774 7.392   1.00 1.30  ? 33  SER B CA   3  
ATOM 6282  C C    . SER B 2 12  ? -7.028  -13.522 8.519   1.00 1.45  ? 33  SER B C    3  
ATOM 6283  O O    . SER B 2 12  ? -7.305  -13.789 9.689   1.00 1.65  ? 33  SER B O    3  
ATOM 6284  C CB   . SER B 2 12  ? -7.794  -15.151 6.769   1.00 1.33  ? 33  SER B CB   3  
ATOM 6285  O OG   . SER B 2 12  ? -6.623  -15.156 5.973   1.00 1.90  ? 33  SER B OG   3  
ATOM 6286  H H    . SER B 2 12  ? -7.634  -12.988 5.468   1.00 1.04  ? 33  SER B H    3  
ATOM 6287  H HA   . SER B 2 12  ? -9.024  -13.728 7.795   1.00 1.37  ? 33  SER B HA   3  
ATOM 6288  H HB2  . SER B 2 12  ? -7.687  -15.885 7.554   1.00 1.77  ? 33  SER B HB2  3  
ATOM 6289  H HB3  . SER B 2 12  ? -8.639  -15.408 6.148   1.00 1.58  ? 33  SER B HB3  3  
ATOM 6290  H HG   . SER B 2 12  ? -6.872  -15.124 5.041   1.00 2.15  ? 33  SER B HG   3  
ATOM 6291  N N    . GLU B 2 13  ? -5.866  -12.998 8.152   1.00 1.40  ? 34  GLU B N    3  
ATOM 6292  C CA   . GLU B 2 13  ? -4.843  -12.642 9.122   1.00 1.57  ? 34  GLU B CA   3  
ATOM 6293  C C    . GLU B 2 13  ? -5.195  -11.336 9.820   1.00 1.63  ? 34  GLU B C    3  
ATOM 6294  O O    . GLU B 2 13  ? -4.898  -11.150 10.999  1.00 1.85  ? 34  GLU B O    3  
ATOM 6295  C CB   . GLU B 2 13  ? -3.485  -12.516 8.438   1.00 1.57  ? 34  GLU B CB   3  
ATOM 6296  C CG   . GLU B 2 13  ? -2.971  -13.828 7.873   1.00 1.84  ? 34  GLU B CG   3  
ATOM 6297  C CD   . GLU B 2 13  ? -2.813  -14.890 8.940   1.00 1.90  ? 34  GLU B CD   3  
ATOM 6298  O OE1  . GLU B 2 13  ? -1.904  -14.760 9.781   1.00 2.32  ? 34  GLU B OE1  3  
ATOM 6299  O OE2  . GLU B 2 13  ? -3.603  -15.856 8.947   1.00 2.15  ? 34  GLU B OE2  3  
ATOM 6300  H H    . GLU B 2 13  ? -5.689  -12.855 7.196   1.00 1.27  ? 34  GLU B H    3  
ATOM 6301  H HA   . GLU B 2 13  ? -4.794  -13.429 9.858   1.00 1.73  ? 34  GLU B HA   3  
ATOM 6302  H HB2  . GLU B 2 13  ? -3.566  -11.806 7.627   1.00 1.70  ? 34  GLU B HB2  3  
ATOM 6303  H HB3  . GLU B 2 13  ? -2.767  -12.149 9.155   1.00 1.80  ? 34  GLU B HB3  3  
ATOM 6304  H HG2  . GLU B 2 13  ? -3.668  -14.185 7.131   1.00 2.25  ? 34  GLU B HG2  3  
ATOM 6305  H HG3  . GLU B 2 13  ? -2.009  -13.656 7.410   1.00 2.41  ? 34  GLU B HG3  3  
ATOM 6306  N N    . GLU B 2 14  ? -5.828  -10.431 9.084   1.00 1.50  ? 35  GLU B N    3  
ATOM 6307  C CA   . GLU B 2 14  ? -6.251  -9.155  9.643   1.00 1.65  ? 35  GLU B CA   3  
ATOM 6308  C C    . GLU B 2 14  ? -7.343  -9.360  10.682  1.00 1.86  ? 35  GLU B C    3  
ATOM 6309  O O    . GLU B 2 14  ? -7.315  -8.749  11.746  1.00 2.10  ? 35  GLU B O    3  
ATOM 6310  C CB   . GLU B 2 14  ? -6.759  -8.218  8.546   1.00 1.57  ? 35  GLU B CB   3  
ATOM 6311  C CG   . GLU B 2 14  ? -5.722  -7.893  7.487   1.00 2.12  ? 35  GLU B CG   3  
ATOM 6312  C CD   . GLU B 2 14  ? -6.197  -6.835  6.515   1.00 2.43  ? 35  GLU B CD   3  
ATOM 6313  O OE1  . GLU B 2 14  ? -6.918  -7.190  5.553   1.00 3.14  ? 35  GLU B OE1  3  
ATOM 6314  O OE2  . GLU B 2 14  ? -5.859  -5.646  6.700   1.00 2.46  ? 35  GLU B OE2  3  
ATOM 6315  H H    . GLU B 2 14  ? -6.007  -10.624 8.139   1.00 1.35  ? 35  GLU B H    3  
ATOM 6316  H HA   . GLU B 2 14  ? -5.396  -8.703  10.123  1.00 1.76  ? 35  GLU B HA   3  
ATOM 6317  H HB2  . GLU B 2 14  ? -7.605  -8.680  8.059   1.00 1.55  ? 35  GLU B HB2  3  
ATOM 6318  H HB3  . GLU B 2 14  ? -7.080  -7.293  9.001   1.00 1.87  ? 35  GLU B HB3  3  
ATOM 6319  H HG2  . GLU B 2 14  ? -4.827  -7.536  7.975   1.00 2.69  ? 35  GLU B HG2  3  
ATOM 6320  H HG3  . GLU B 2 14  ? -5.494  -8.794  6.935   1.00 2.55  ? 35  GLU B HG3  3  
ATOM 6321  N N    . ALA B 2 15  ? -8.287  -10.242 10.373  1.00 1.84  ? 36  ALA B N    3  
ATOM 6322  C CA   . ALA B 2 15  ? -9.441  -10.487 11.236  1.00 2.10  ? 36  ALA B CA   3  
ATOM 6323  C C    . ALA B 2 15  ? -9.034  -11.083 12.583  1.00 2.31  ? 36  ALA B C    3  
ATOM 6324  O O    . ALA B 2 15  ? -9.789  -11.014 13.552  1.00 2.58  ? 36  ALA B O    3  
ATOM 6325  C CB   . ALA B 2 15  ? -10.430 -11.403 10.534  1.00 2.10  ? 36  ALA B CB   3  
ATOM 6326  H H    . ALA B 2 15  ? -8.214  -10.740 9.526   1.00 1.67  ? 36  ALA B H    3  
ATOM 6327  H HA   . ALA B 2 15  ? -9.929  -9.539  11.410  1.00 2.20  ? 36  ALA B HA   3  
ATOM 6328  H HB1  . ALA B 2 15  ? -9.972  -12.367 10.368  1.00 2.33  ? 36  ALA B HB1  3  
ATOM 6329  H HB2  . ALA B 2 15  ? -10.710 -10.970 9.584   1.00 2.25  ? 36  ALA B HB2  3  
ATOM 6330  H HB3  . ALA B 2 15  ? -11.309 -11.522 11.148  1.00 2.42  ? 36  ALA B HB3  3  
ATOM 6331  N N    . GLN B 2 16  ? -7.842  -11.670 12.642  1.00 2.24  ? 37  GLN B N    3  
ATOM 6332  C CA   . GLN B 2 16  ? -7.344  -12.259 13.880  1.00 2.49  ? 37  GLN B CA   3  
ATOM 6333  C C    . GLN B 2 16  ? -7.125  -11.184 14.937  1.00 2.66  ? 37  GLN B C    3  
ATOM 6334  O O    . GLN B 2 16  ? -7.414  -11.387 16.116  1.00 2.93  ? 37  GLN B O    3  
ATOM 6335  C CB   . GLN B 2 16  ? -6.041  -13.023 13.637  1.00 2.39  ? 37  GLN B CB   3  
ATOM 6336  C CG   . GLN B 2 16  ? -6.194  -14.203 12.694  1.00 2.54  ? 37  GLN B CG   3  
ATOM 6337  C CD   . GLN B 2 16  ? -7.248  -15.193 13.156  1.00 3.04  ? 37  GLN B CD   3  
ATOM 6338  O OE1  . GLN B 2 16  ? -7.492  -15.356 14.353  1.00 3.65  ? 37  GLN B OE1  3  
ATOM 6339  N NE2  . GLN B 2 16  ? -7.883  -15.858 12.206  1.00 3.38  ? 37  GLN B NE2  3  
ATOM 6340  H H    . GLN B 2 16  ? -7.287  -11.706 11.834  1.00 2.05  ? 37  GLN B H    3  
ATOM 6341  H HA   . GLN B 2 16  ? -8.093  -12.950 14.239  1.00 2.69  ? 37  GLN B HA   3  
ATOM 6342  H HB2  . GLN B 2 16  ? -5.314  -12.344 13.215  1.00 2.65  ? 37  GLN B HB2  3  
ATOM 6343  H HB3  . GLN B 2 16  ? -5.671  -13.390 14.583  1.00 2.45  ? 37  GLN B HB3  3  
ATOM 6344  H HG2  . GLN B 2 16  ? -6.474  -13.834 11.719  1.00 2.72  ? 37  GLN B HG2  3  
ATOM 6345  H HG3  . GLN B 2 16  ? -5.246  -14.716 12.624  1.00 2.94  ? 37  GLN B HG3  3  
ATOM 6346  H HE21 . GLN B 2 16  ? -7.643  -15.676 11.273  1.00 3.31  ? 37  GLN B HE21 3  
ATOM 6347  H HE22 . GLN B 2 16  ? -8.566  -16.509 12.474  1.00 4.00  ? 37  GLN B HE22 3  
ATOM 6348  N N    . ASP B 2 17  ? -6.615  -10.041 14.507  1.00 2.57  ? 38  ASP B N    3  
ATOM 6349  C CA   . ASP B 2 17  ? -6.403  -8.914  15.406  1.00 2.80  ? 38  ASP B CA   3  
ATOM 6350  C C    . ASP B 2 17  ? -7.547  -7.922  15.286  1.00 2.96  ? 38  ASP B C    3  
ATOM 6351  O O    . ASP B 2 17  ? -8.125  -7.495  16.285  1.00 3.22  ? 38  ASP B O    3  
ATOM 6352  C CB   . ASP B 2 17  ? -5.078  -8.213  15.100  1.00 2.80  ? 38  ASP B CB   3  
ATOM 6353  C CG   . ASP B 2 17  ? -3.874  -9.004  15.565  1.00 2.83  ? 38  ASP B CG   3  
ATOM 6354  O OD1  . ASP B 2 17  ? -3.549  -8.956  16.767  1.00 3.06  ? 38  ASP B OD1  3  
ATOM 6355  O OD2  . ASP B 2 17  ? -3.254  -9.694  14.729  1.00 3.03  ? 38  ASP B OD2  3  
ATOM 6356  H H    . ASP B 2 17  ? -6.375  -9.953  13.561  1.00 2.38  ? 38  ASP B H    3  
ATOM 6357  H HA   . ASP B 2 17  ? -6.376  -9.295  16.415  1.00 2.97  ? 38  ASP B HA   3  
ATOM 6358  H HB2  . ASP B 2 17  ? -4.996  -8.065  14.034  1.00 3.09  ? 38  ASP B HB2  3  
ATOM 6359  H HB3  . ASP B 2 17  ? -5.067  -7.252  15.593  1.00 2.90  ? 38  ASP B HB3  3  
ATOM 6360  N N    . MET B 2 18  ? -7.885  -7.579  14.053  1.00 2.89  ? 39  MET B N    3  
ATOM 6361  C CA   . MET B 2 18  ? -8.938  -6.614  13.780  1.00 3.13  ? 39  MET B CA   3  
ATOM 6362  C C    . MET B 2 18  ? -10.280 -7.327  13.664  1.00 3.86  ? 39  MET B C    3  
ATOM 6363  O O    . MET B 2 18  ? -10.860 -7.424  12.580  1.00 4.43  ? 39  MET B O    3  
ATOM 6364  C CB   . MET B 2 18  ? -8.640  -5.848  12.488  1.00 3.09  ? 39  MET B CB   3  
ATOM 6365  C CG   . MET B 2 18  ? -7.266  -5.197  12.461  1.00 3.39  ? 39  MET B CG   3  
ATOM 6366  S SD   . MET B 2 18  ? -7.007  -4.031  13.812  1.00 3.72  ? 39  MET B SD   3  
ATOM 6367  C CE   . MET B 2 18  ? -8.288  -2.828  13.472  1.00 4.34  ? 39  MET B CE   3  
ATOM 6368  H H    . MET B 2 18  ? -7.419  -8.000  13.296  1.00 2.73  ? 39  MET B H    3  
ATOM 6369  H HA   . MET B 2 18  ? -8.978  -5.919  14.604  1.00 3.23  ? 39  MET B HA   3  
ATOM 6370  H HB2  . MET B 2 18  ? -8.704  -6.534  11.656  1.00 3.27  ? 39  MET B HB2  3  
ATOM 6371  H HB3  . MET B 2 18  ? -9.384  -5.075  12.363  1.00 3.33  ? 39  MET B HB3  3  
ATOM 6372  H HG2  . MET B 2 18  ? -6.515  -5.970  12.528  1.00 3.53  ? 39  MET B HG2  3  
ATOM 6373  H HG3  . MET B 2 18  ? -7.152  -4.671  11.525  1.00 3.93  ? 39  MET B HG3  3  
ATOM 6374  H HE1  . MET B 2 18  ? -9.256  -3.305  13.532  1.00 4.48  ? 39  MET B HE1  3  
ATOM 6375  H HE2  . MET B 2 18  ? -8.147  -2.425  12.480  1.00 4.79  ? 39  MET B HE2  3  
ATOM 6376  H HE3  . MET B 2 18  ? -8.235  -2.029  14.196  1.00 4.64  ? 39  MET B HE3  3  
ATOM 6377  N N    . GLY B 2 19  ? -10.755 -7.838  14.786  1.00 4.23  ? 40  GLY B N    3  
ATOM 6378  C CA   . GLY B 2 19  ? -12.008 -8.554  14.809  1.00 5.19  ? 40  GLY B CA   3  
ATOM 6379  C C    . GLY B 2 19  ? -12.261 -9.172  16.162  1.00 5.68  ? 40  GLY B C    3  
ATOM 6380  O O    . GLY B 2 19  ? -11.774 -8.610  17.167  1.00 6.18  ? 40  GLY B O    3  
ATOM 6381  O OXT  . GLY B 2 19  ? -12.924 -10.225 16.229  1.00 5.90  ? 40  GLY B OXT  3  
ATOM 6382  H H    . GLY B 2 19  ? -10.244 -7.731  15.616  1.00 4.07  ? 40  GLY B H    3  
ATOM 6383  H HA2  . GLY B 2 19  ? -12.810 -7.870  14.575  1.00 5.50  ? 40  GLY B HA2  3  
ATOM 6384  H HA3  . GLY B 2 19  ? -11.983 -9.336  14.065  1.00 5.60  ? 40  GLY B HA3  3  
ATOM 6385  N N    . PRO A 1 1   ? 18.893  4.849   6.771   1.00 2.80  ? 1   PRO A N    4  
ATOM 6386  C CA   . PRO A 1 1   ? 18.063  3.679   7.120   1.00 2.09  ? 1   PRO A CA   4  
ATOM 6387  C C    . PRO A 1 1   ? 16.648  3.846   6.588   1.00 1.70  ? 1   PRO A C    4  
ATOM 6388  O O    . PRO A 1 1   ? 16.254  4.946   6.204   1.00 2.48  ? 1   PRO A O    4  
ATOM 6389  C CB   . PRO A 1 1   ? 18.040  3.525   8.633   1.00 2.88  ? 1   PRO A CB   4  
ATOM 6390  C CG   . PRO A 1 1   ? 18.812  4.702   9.123   1.00 3.60  ? 1   PRO A CG   4  
ATOM 6391  C CD   . PRO A 1 1   ? 19.688  5.144   7.974   1.00 3.50  ? 1   PRO A CD   4  
ATOM 6392  H H2   . PRO A 1 1   ? 19.385  4.570   5.889   1.00 2.93  ? 1   PRO A H2   4  
ATOM 6393  H H3   . PRO A 1 1   ? 18.227  5.575   6.454   1.00 3.05  ? 1   PRO A H3   4  
ATOM 6394  H HA   . PRO A 1 1   ? 18.503  2.799   6.679   1.00 2.07  ? 1   PRO A HA   4  
ATOM 6395  H HB2  . PRO A 1 1   ? 17.018  3.542   8.986   1.00 3.16  ? 1   PRO A HB2  4  
ATOM 6396  H HB3  . PRO A 1 1   ? 18.511  2.597   8.915   1.00 3.12  ? 1   PRO A HB3  4  
ATOM 6397  H HG2  . PRO A 1 1   ? 18.135  5.495   9.404   1.00 4.35  ? 1   PRO A HG2  4  
ATOM 6398  H HG3  . PRO A 1 1   ? 19.421  4.414   9.967   1.00 3.85  ? 1   PRO A HG3  4  
ATOM 6399  H HD2  . PRO A 1 1   ? 19.895  6.201   8.046   1.00 4.20  ? 1   PRO A HD2  4  
ATOM 6400  H HD3  . PRO A 1 1   ? 20.610  4.582   7.968   1.00 3.65  ? 1   PRO A HD3  4  
ATOM 6401  N N    . SER A 1 2   ? 15.904  2.739   6.565   1.00 1.00  ? 2   SER A N    4  
ATOM 6402  C CA   . SER A 1 2   ? 14.507  2.704   6.124   1.00 0.75  ? 2   SER A CA   4  
ATOM 6403  C C    . SER A 1 2   ? 14.330  3.278   4.715   1.00 0.89  ? 2   SER A C    4  
ATOM 6404  O O    . SER A 1 2   ? 15.299  3.425   3.964   1.00 1.99  ? 2   SER A O    4  
ATOM 6405  C CB   . SER A 1 2   ? 13.594  3.438   7.125   1.00 1.16  ? 2   SER A CB   4  
ATOM 6406  O OG   . SER A 1 2   ? 13.833  4.835   7.150   1.00 1.66  ? 2   SER A OG   4  
ATOM 6407  H H    . SER A 1 2   ? 16.318  1.896   6.855   1.00 1.37  ? 2   SER A H    4  
ATOM 6408  H HA   . SER A 1 2   ? 14.213  1.666   6.101   1.00 0.60  ? 2   SER A HA   4  
ATOM 6409  H HB2  . SER A 1 2   ? 12.563  3.274   6.849   1.00 1.50  ? 2   SER A HB2  4  
ATOM 6410  H HB3  . SER A 1 2   ? 13.763  3.040   8.115   1.00 1.23  ? 2   SER A HB3  4  
ATOM 6411  H HG   . SER A 1 2   ? 14.750  5.000   7.410   1.00 1.95  ? 2   SER A HG   4  
ATOM 6412  N N    . HIS A 1 3   ? 13.073  3.553   4.359   1.00 0.41  ? 3   HIS A N    4  
ATOM 6413  C CA   . HIS A 1 3   ? 12.706  4.214   3.100   1.00 0.27  ? 3   HIS A CA   4  
ATOM 6414  C C    . HIS A 1 3   ? 12.789  3.295   1.891   1.00 0.23  ? 3   HIS A C    4  
ATOM 6415  O O    . HIS A 1 3   ? 12.011  3.439   0.960   1.00 0.33  ? 3   HIS A O    4  
ATOM 6416  C CB   . HIS A 1 3   ? 13.534  5.478   2.841   1.00 0.28  ? 3   HIS A CB   4  
ATOM 6417  C CG   . HIS A 1 3   ? 13.235  6.615   3.774   1.00 0.36  ? 3   HIS A CG   4  
ATOM 6418  N ND1  . HIS A 1 3   ? 14.027  6.932   4.856   1.00 0.56  ? 3   HIS A ND1  4  
ATOM 6419  C CD2  . HIS A 1 3   ? 12.230  7.523   3.770   1.00 0.38  ? 3   HIS A CD2  4  
ATOM 6420  C CE1  . HIS A 1 3   ? 13.520  7.982   5.476   1.00 0.61  ? 3   HIS A CE1  4  
ATOM 6421  N NE2  . HIS A 1 3   ? 12.430  8.362   4.836   1.00 0.49  ? 3   HIS A NE2  4  
ATOM 6422  H H    . HIS A 1 3   ? 12.352  3.292   4.972   1.00 1.21  ? 3   HIS A H    4  
ATOM 6423  H HA   . HIS A 1 3   ? 11.681  4.506   3.202   1.00 0.31  ? 3   HIS A HA   4  
ATOM 6424  H HB2  . HIS A 1 3   ? 14.580  5.239   2.938   1.00 0.33  ? 3   HIS A HB2  4  
ATOM 6425  H HB3  . HIS A 1 3   ? 13.338  5.817   1.834   1.00 0.28  ? 3   HIS A HB3  4  
ATOM 6426  H HD1  . HIS A 1 3   ? 14.853  6.467   5.121   1.00 0.69  ? 3   HIS A HD1  4  
ATOM 6427  H HD2  . HIS A 1 3   ? 11.423  7.584   3.052   1.00 0.44  ? 3   HIS A HD2  4  
ATOM 6428  H HE1  . HIS A 1 3   ? 13.929  8.451   6.358   1.00 0.78  ? 3   HIS A HE1  4  
ATOM 6429  H HE2  . HIS A 1 3   ? 11.989  9.243   4.951   1.00 0.56  ? 3   HIS A HE2  4  
ATOM 6430  N N    . SER A 1 4   ? 13.705  2.359   1.887   1.00 0.21  ? 4   SER A N    4  
ATOM 6431  C CA   . SER A 1 4   ? 13.871  1.505   0.719   1.00 0.17  ? 4   SER A CA   4  
ATOM 6432  C C    . SER A 1 4   ? 14.188  0.062   1.072   1.00 0.18  ? 4   SER A C    4  
ATOM 6433  O O    . SER A 1 4   ? 14.575  -0.262  2.197   1.00 0.24  ? 4   SER A O    4  
ATOM 6434  C CB   . SER A 1 4   ? 14.930  2.075   -0.215  1.00 0.19  ? 4   SER A CB   4  
ATOM 6435  O OG   . SER A 1 4   ? 16.148  2.329   0.467   1.00 0.28  ? 4   SER A OG   4  
ATOM 6436  H H    . SER A 1 4   ? 14.270  2.238   2.674   1.00 0.28  ? 4   SER A H    4  
ATOM 6437  H HA   . SER A 1 4   ? 12.931  1.506   0.184   1.00 0.15  ? 4   SER A HA   4  
ATOM 6438  H HB2  . SER A 1 4   ? 15.108  1.374   -1.012  1.00 0.19  ? 4   SER A HB2  4  
ATOM 6439  H HB3  . SER A 1 4   ? 14.565  2.990   -0.637  1.00 0.19  ? 4   SER A HB3  4  
ATOM 6440  H HG   . SER A 1 4   ? 16.475  3.202   0.216   1.00 0.91  ? 4   SER A HG   4  
ATOM 6441  N N    . GLY A 1 5   ? 13.994  -0.790  0.081   1.00 0.15  ? 5   GLY A N    4  
ATOM 6442  C CA   . GLY A 1 5   ? 14.215  -2.208  0.224   1.00 0.15  ? 5   GLY A CA   4  
ATOM 6443  C C    . GLY A 1 5   ? 13.597  -2.967  -0.918  1.00 0.13  ? 5   GLY A C    4  
ATOM 6444  O O    . GLY A 1 5   ? 12.633  -2.505  -1.522  1.00 0.12  ? 5   GLY A O    4  
ATOM 6445  H H    . GLY A 1 5   ? 13.686  -0.441  -0.783  1.00 0.15  ? 5   GLY A H    4  
ATOM 6446  H HA2  . GLY A 1 5   ? 15.276  -2.398  0.220   1.00 0.17  ? 5   GLY A HA2  4  
ATOM 6447  H HA3  . GLY A 1 5   ? 13.788  -2.550  1.153   1.00 0.17  ? 5   GLY A HA3  4  
ATOM 6448  N N    . ALA A 1 6   ? 14.157  -4.120  -1.219  1.00 0.14  ? 6   ALA A N    4  
ATOM 6449  C CA   . ALA A 1 6   ? 13.773  -4.868  -2.402  1.00 0.15  ? 6   ALA A CA   4  
ATOM 6450  C C    . ALA A 1 6   ? 12.344  -5.398  -2.320  1.00 0.15  ? 6   ALA A C    4  
ATOM 6451  O O    . ALA A 1 6   ? 12.014  -6.222  -1.464  1.00 0.19  ? 6   ALA A O    4  
ATOM 6452  C CB   . ALA A 1 6   ? 14.761  -5.988  -2.656  1.00 0.17  ? 6   ALA A CB   4  
ATOM 6453  H H    . ALA A 1 6   ? 14.855  -4.475  -0.631  1.00 0.16  ? 6   ALA A H    4  
ATOM 6454  H HA   . ALA A 1 6   ? 13.835  -4.192  -3.236  1.00 0.14  ? 6   ALA A HA   4  
ATOM 6455  H HB1  . ALA A 1 6   ? 15.745  -5.563  -2.789  1.00 1.00  ? 6   ALA A HB1  4  
ATOM 6456  H HB2  . ALA A 1 6   ? 14.474  -6.519  -3.550  1.00 1.07  ? 6   ALA A HB2  4  
ATOM 6457  H HB3  . ALA A 1 6   ? 14.768  -6.664  -1.815  1.00 1.03  ? 6   ALA A HB3  4  
ATOM 6458  N N    . ALA A 1 7   ? 11.515  -4.915  -3.238  1.00 0.14  ? 7   ALA A N    4  
ATOM 6459  C CA   . ALA A 1 7   ? 10.111  -5.275  -3.308  1.00 0.14  ? 7   ALA A CA   4  
ATOM 6460  C C    . ALA A 1 7   ? 9.770   -5.779  -4.706  1.00 0.16  ? 7   ALA A C    4  
ATOM 6461  O O    . ALA A 1 7   ? 10.603  -5.754  -5.599  1.00 0.15  ? 7   ALA A O    4  
ATOM 6462  C CB   . ALA A 1 7   ? 9.239   -4.079  -2.954  1.00 0.14  ? 7   ALA A CB   4  
ATOM 6463  H H    . ALA A 1 7   ? 11.878  -4.313  -3.923  1.00 0.14  ? 7   ALA A H    4  
ATOM 6464  H HA   . ALA A 1 7   ? 9.925   -6.061  -2.590  1.00 0.16  ? 7   ALA A HA   4  
ATOM 6465  H HB1  . ALA A 1 7   ? 8.213   -4.296  -3.209  1.00 1.03  ? 7   ALA A HB1  4  
ATOM 6466  H HB2  . ALA A 1 7   ? 9.575   -3.202  -3.496  1.00 1.05  ? 7   ALA A HB2  4  
ATOM 6467  H HB3  . ALA A 1 7   ? 9.307   -3.891  -1.892  1.00 1.00  ? 7   ALA A HB3  4  
ATOM 6468  N N    . ILE A 1 8   ? 8.540   -6.219  -4.898  1.00 0.20  ? 8   ILE A N    4  
ATOM 6469  C CA   . ILE A 1 8   ? 8.096   -6.745  -6.183  1.00 0.23  ? 8   ILE A CA   4  
ATOM 6470  C C    . ILE A 1 8   ? 6.771   -6.112  -6.596  1.00 0.25  ? 8   ILE A C    4  
ATOM 6471  O O    . ILE A 1 8   ? 5.867   -5.956  -5.772  1.00 0.28  ? 8   ILE A O    4  
ATOM 6472  C CB   . ILE A 1 8   ? 7.957   -8.275  -6.126  1.00 0.28  ? 8   ILE A CB   4  
ATOM 6473  C CG1  . ILE A 1 8   ? 9.346   -8.897  -6.103  1.00 0.29  ? 8   ILE A CG1  4  
ATOM 6474  C CG2  . ILE A 1 8   ? 7.133   -8.823  -7.285  1.00 0.31  ? 8   ILE A CG2  4  
ATOM 6475  C CD1  . ILE A 1 8   ? 9.777   -9.367  -4.746  1.00 0.36  ? 8   ILE A CD1  4  
ATOM 6476  H H    . ILE A 1 8   ? 7.913   -6.207  -4.147  1.00 0.23  ? 8   ILE A H    4  
ATOM 6477  H HA   . ILE A 1 8   ? 8.856   -6.509  -6.925  1.00 0.20  ? 8   ILE A HA   4  
ATOM 6478  H HB   . ILE A 1 8   ? 7.451   -8.524  -5.210  1.00 0.33  ? 8   ILE A HB   4  
ATOM 6479  H HG12 . ILE A 1 8   ? 9.382   -9.728  -6.780  1.00 0.31  ? 8   ILE A HG12 4  
ATOM 6480  H HG13 . ILE A 1 8   ? 10.058  -8.158  -6.422  1.00 0.24  ? 8   ILE A HG13 4  
ATOM 6481  H HG21 . ILE A 1 8   ? 7.062   -9.897  -7.200  1.00 0.99  ? 8   ILE A HG21 4  
ATOM 6482  H HG22 . ILE A 1 8   ? 7.610   -8.565  -8.220  1.00 1.08  ? 8   ILE A HG22 4  
ATOM 6483  H HG23 . ILE A 1 8   ? 6.142   -8.392  -7.256  1.00 1.02  ? 8   ILE A HG23 4  
ATOM 6484  H HD11 . ILE A 1 8   ? 9.068   -10.085 -4.368  1.00 1.04  ? 8   ILE A HD11 4  
ATOM 6485  H HD12 . ILE A 1 8   ? 9.827   -8.518  -4.083  1.00 1.06  ? 8   ILE A HD12 4  
ATOM 6486  H HD13 . ILE A 1 8   ? 10.751  -9.820  -4.825  1.00 1.07  ? 8   ILE A HD13 4  
ATOM 6487  N N    . PHE A 1 9   ? 6.669   -5.755  -7.867  1.00 0.24  ? 9   PHE A N    4  
ATOM 6488  C CA   . PHE A 1 9   ? 5.488   -5.092  -8.402  1.00 0.26  ? 9   PHE A CA   4  
ATOM 6489  C C    . PHE A 1 9   ? 5.330   -5.464  -9.872  1.00 0.28  ? 9   PHE A C    4  
ATOM 6490  O O    . PHE A 1 9   ? 6.303   -5.428  -10.617 1.00 0.28  ? 9   PHE A O    4  
ATOM 6491  C CB   . PHE A 1 9   ? 5.632   -3.571  -8.244  1.00 0.25  ? 9   PHE A CB   4  
ATOM 6492  C CG   . PHE A 1 9   ? 4.373   -2.792  -8.502  1.00 0.28  ? 9   PHE A CG   4  
ATOM 6493  C CD1  . PHE A 1 9   ? 3.495   -2.529  -7.471  1.00 0.31  ? 9   PHE A CD1  4  
ATOM 6494  C CD2  . PHE A 1 9   ? 4.071   -2.323  -9.768  1.00 0.32  ? 9   PHE A CD2  4  
ATOM 6495  C CE1  . PHE A 1 9   ? 2.335   -1.812  -7.691  1.00 0.36  ? 9   PHE A CE1  4  
ATOM 6496  C CE2  . PHE A 1 9   ? 2.913   -1.604  -9.997  1.00 0.38  ? 9   PHE A CE2  4  
ATOM 6497  C CZ   . PHE A 1 9   ? 2.043   -1.349  -8.957  1.00 0.39  ? 9   PHE A CZ   4  
ATOM 6498  H H    . PHE A 1 9   ? 7.415   -5.963  -8.480  1.00 0.23  ? 9   PHE A H    4  
ATOM 6499  H HA   . PHE A 1 9   ? 4.626   -5.433  -7.850  1.00 0.28  ? 9   PHE A HA   4  
ATOM 6500  H HB2  . PHE A 1 9   ? 5.949   -3.354  -7.235  1.00 0.27  ? 9   PHE A HB2  4  
ATOM 6501  H HB3  . PHE A 1 9   ? 6.387   -3.219  -8.932  1.00 0.26  ? 9   PHE A HB3  4  
ATOM 6502  H HD1  . PHE A 1 9   ? 3.731   -2.882  -6.479  1.00 0.33  ? 9   PHE A HD1  4  
ATOM 6503  H HD2  . PHE A 1 9   ? 4.752   -2.523  -10.583 1.00 0.34  ? 9   PHE A HD2  4  
ATOM 6504  H HE1  . PHE A 1 9   ? 1.658   -1.615  -6.873  1.00 0.40  ? 9   PHE A HE1  4  
ATOM 6505  H HE2  . PHE A 1 9   ? 2.688   -1.243  -10.991 1.00 0.43  ? 9   PHE A HE2  4  
ATOM 6506  H HZ   . PHE A 1 9   ? 1.137   -0.788  -9.132  1.00 0.45  ? 9   PHE A HZ   4  
ATOM 6507  N N    . GLU A 1 10  ? 4.116   -5.838  -10.274 1.00 0.37  ? 10  GLU A N    4  
ATOM 6508  C CA   . GLU A 1 10  ? 3.832   -6.240  -11.660 1.00 0.43  ? 10  GLU A CA   4  
ATOM 6509  C C    . GLU A 1 10  ? 4.606   -7.487  -12.055 1.00 0.33  ? 10  GLU A C    4  
ATOM 6510  O O    . GLU A 1 10  ? 5.121   -7.591  -13.171 1.00 0.38  ? 10  GLU A O    4  
ATOM 6511  C CB   . GLU A 1 10  ? 4.149   -5.115  -12.633 1.00 0.59  ? 10  GLU A CB   4  
ATOM 6512  C CG   . GLU A 1 10  ? 3.218   -3.939  -12.496 1.00 0.77  ? 10  GLU A CG   4  
ATOM 6513  C CD   . GLU A 1 10  ? 3.575   -2.815  -13.442 1.00 1.00  ? 10  GLU A CD   4  
ATOM 6514  O OE1  . GLU A 1 10  ? 4.675   -2.239  -13.304 1.00 0.95  ? 10  GLU A OE1  4  
ATOM 6515  O OE2  . GLU A 1 10  ? 2.756   -2.499  -14.324 1.00 1.33  ? 10  GLU A OE2  4  
ATOM 6516  H H    . GLU A 1 10  ? 3.381   -5.840  -9.621  1.00 0.43  ? 10  GLU A H    4  
ATOM 6517  H HA   . GLU A 1 10  ? 2.777   -6.461  -11.721 1.00 0.54  ? 10  GLU A HA   4  
ATOM 6518  H HB2  . GLU A 1 10  ? 5.158   -4.775  -12.456 1.00 0.56  ? 10  GLU A HB2  4  
ATOM 6519  H HB3  . GLU A 1 10  ? 4.075   -5.491  -13.642 1.00 0.67  ? 10  GLU A HB3  4  
ATOM 6520  H HG2  . GLU A 1 10  ? 2.216   -4.273  -12.706 1.00 0.88  ? 10  GLU A HG2  4  
ATOM 6521  H HG3  . GLU A 1 10  ? 3.270   -3.572  -11.483 1.00 0.70  ? 10  GLU A HG3  4  
ATOM 6522  N N    . LYS A 1 11  ? 4.673   -8.421  -11.121 1.00 0.35  ? 11  LYS A N    4  
ATOM 6523  C CA   . LYS A 1 11  ? 5.345   -9.705  -11.314 1.00 0.43  ? 11  LYS A CA   4  
ATOM 6524  C C    . LYS A 1 11  ? 6.847   -9.572  -11.577 1.00 0.41  ? 11  LYS A C    4  
ATOM 6525  O O    . LYS A 1 11  ? 7.524   -10.562 -11.848 1.00 0.59  ? 11  LYS A O    4  
ATOM 6526  C CB   . LYS A 1 11  ? 4.672   -10.506 -12.416 1.00 0.54  ? 11  LYS A CB   4  
ATOM 6527  C CG   . LYS A 1 11  ? 3.432   -11.205 -11.912 1.00 0.63  ? 11  LYS A CG   4  
ATOM 6528  C CD   . LYS A 1 11  ? 2.279   -10.259 -11.708 1.00 1.34  ? 11  LYS A CD   4  
ATOM 6529  C CE   . LYS A 1 11  ? 1.236   -10.864 -10.788 1.00 1.31  ? 11  LYS A CE   4  
ATOM 6530  N NZ   . LYS A 1 11  ? 1.768   -11.099 -9.417  1.00 2.23  ? 11  LYS A NZ   4  
ATOM 6531  H H    . LYS A 1 11  ? 4.230   -8.249  -10.267 1.00 0.41  ? 11  LYS A H    4  
ATOM 6532  H HA   . LYS A 1 11  ? 5.214   -10.260 -10.396 1.00 0.53  ? 11  LYS A HA   4  
ATOM 6533  H HB2  . LYS A 1 11  ? 4.393   -9.841  -13.222 1.00 0.51  ? 11  LYS A HB2  4  
ATOM 6534  H HB3  . LYS A 1 11  ? 5.359   -11.251 -12.787 1.00 0.67  ? 11  LYS A HB3  4  
ATOM 6535  H HG2  . LYS A 1 11  ? 3.142   -11.955 -12.610 1.00 1.25  ? 11  LYS A HG2  4  
ATOM 6536  H HG3  . LYS A 1 11  ? 3.661   -11.657 -10.968 1.00 0.98  ? 11  LYS A HG3  4  
ATOM 6537  H HD2  . LYS A 1 11  ? 2.648   -9.353  -11.280 1.00 1.86  ? 11  LYS A HD2  4  
ATOM 6538  H HD3  . LYS A 1 11  ? 1.835   -10.052 -12.655 1.00 2.00  ? 11  LYS A HD3  4  
ATOM 6539  H HE2  . LYS A 1 11  ? 0.389   -10.197 -10.730 1.00 1.09  ? 11  LYS A HE2  4  
ATOM 6540  H HE3  . LYS A 1 11  ? 0.926   -11.805 -11.206 1.00 1.82  ? 11  LYS A HE3  4  
ATOM 6541  H HZ1  . LYS A 1 11  ? 2.561   -11.770 -9.450  1.00 2.72  ? 11  LYS A HZ1  4  
ATOM 6542  H HZ2  . LYS A 1 11  ? 1.023   -11.494 -8.806  1.00 2.51  ? 11  LYS A HZ2  4  
ATOM 6543  H HZ3  . LYS A 1 11  ? 2.100   -10.206 -9.001  1.00 2.85  ? 11  LYS A HZ3  4  
ATOM 6544  N N    . VAL A 1 12  ? 7.363   -8.357  -11.491 1.00 0.26  ? 12  VAL A N    4  
ATOM 6545  C CA   . VAL A 1 12  ? 8.791   -8.131  -11.590 1.00 0.25  ? 12  VAL A CA   4  
ATOM 6546  C C    . VAL A 1 12  ? 9.316   -7.626  -10.254 1.00 0.22  ? 12  VAL A C    4  
ATOM 6547  O O    . VAL A 1 12  ? 8.597   -6.977  -9.498  1.00 0.20  ? 12  VAL A O    4  
ATOM 6548  C CB   . VAL A 1 12  ? 9.161   -7.152  -12.738 1.00 0.25  ? 12  VAL A CB   4  
ATOM 6549  C CG1  . VAL A 1 12  ? 8.260   -5.928  -12.749 1.00 0.24  ? 12  VAL A CG1  4  
ATOM 6550  C CG2  . VAL A 1 12  ? 10.628  -6.746  -12.652 1.00 0.25  ? 12  VAL A CG2  4  
ATOM 6551  H H    . VAL A 1 12  ? 6.770   -7.590  -11.345 1.00 0.27  ? 12  VAL A H    4  
ATOM 6552  H HA   . VAL A 1 12  ? 9.255   -9.085  -11.800 1.00 0.28  ? 12  VAL A HA   4  
ATOM 6553  H HB   . VAL A 1 12  ? 9.019   -7.667  -13.671 1.00 0.29  ? 12  VAL A HB   4  
ATOM 6554  H HG11 . VAL A 1 12  ? 7.287   -6.202  -13.131 1.00 1.04  ? 12  VAL A HG11 4  
ATOM 6555  H HG12 . VAL A 1 12  ? 8.690   -5.161  -13.377 1.00 1.04  ? 12  VAL A HG12 4  
ATOM 6556  H HG13 . VAL A 1 12  ? 8.154   -5.553  -11.743 1.00 1.04  ? 12  VAL A HG13 4  
ATOM 6557  H HG21 . VAL A 1 12  ? 10.813  -6.274  -11.696 1.00 0.98  ? 12  VAL A HG21 4  
ATOM 6558  H HG22 . VAL A 1 12  ? 10.862  -6.057  -13.448 1.00 0.95  ? 12  VAL A HG22 4  
ATOM 6559  H HG23 . VAL A 1 12  ? 11.251  -7.627  -12.737 1.00 0.99  ? 12  VAL A HG23 4  
ATOM 6560  N N    . SER A 1 13  ? 10.551  -7.972  -9.956  1.00 0.23  ? 13  SER A N    4  
ATOM 6561  C CA   . SER A 1 13  ? 11.166  -7.641  -8.688  1.00 0.22  ? 13  SER A CA   4  
ATOM 6562  C C    . SER A 1 13  ? 12.021  -6.388  -8.793  1.00 0.19  ? 13  SER A C    4  
ATOM 6563  O O    . SER A 1 13  ? 12.488  -6.021  -9.874  1.00 0.20  ? 13  SER A O    4  
ATOM 6564  C CB   . SER A 1 13  ? 11.998  -8.826  -8.232  1.00 0.27  ? 13  SER A CB   4  
ATOM 6565  O OG   . SER A 1 13  ? 12.878  -8.498  -7.170  1.00 1.29  ? 13  SER A OG   4  
ATOM 6566  H H    . SER A 1 13  ? 11.076  -8.464  -10.621 1.00 0.26  ? 13  SER A H    4  
ATOM 6567  H HA   . SER A 1 13  ? 10.381  -7.472  -7.968  1.00 0.21  ? 13  SER A HA   4  
ATOM 6568  H HB2  . SER A 1 13  ? 11.327  -9.589  -7.890  1.00 1.03  ? 13  SER A HB2  4  
ATOM 6569  H HB3  . SER A 1 13  ? 12.567  -9.192  -9.071  1.00 0.99  ? 13  SER A HB3  4  
ATOM 6570  H HG   . SER A 1 13  ? 12.611  -8.975  -6.372  1.00 1.80  ? 13  SER A HG   4  
ATOM 6571  N N    . GLY A 1 14  ? 12.211  -5.736  -7.663  1.00 0.17  ? 14  GLY A N    4  
ATOM 6572  C CA   . GLY A 1 14  ? 12.988  -4.520  -7.619  1.00 0.17  ? 14  GLY A CA   4  
ATOM 6573  C C    . GLY A 1 14  ? 13.152  -3.987  -6.224  1.00 0.15  ? 14  GLY A C    4  
ATOM 6574  O O    . GLY A 1 14  ? 13.212  -4.750  -5.275  1.00 0.15  ? 14  GLY A O    4  
ATOM 6575  H H    . GLY A 1 14  ? 11.808  -6.095  -6.830  1.00 0.18  ? 14  GLY A H    4  
ATOM 6576  H HA2  . GLY A 1 14  ? 13.966  -4.714  -8.026  1.00 0.22  ? 14  GLY A HA2  4  
ATOM 6577  H HA3  . GLY A 1 14  ? 12.501  -3.770  -8.217  1.00 0.18  ? 14  GLY A HA3  4  
ATOM 6578  N N    . ILE A 1 15  ? 13.257  -2.675  -6.112  1.00 0.13  ? 15  ILE A N    4  
ATOM 6579  C CA   . ILE A 1 15  ? 13.375  -2.014  -4.827  1.00 0.12  ? 15  ILE A CA   4  
ATOM 6580  C C    . ILE A 1 15  ? 12.240  -1.016  -4.660  1.00 0.12  ? 15  ILE A C    4  
ATOM 6581  O O    . ILE A 1 15  ? 11.836  -0.360  -5.617  1.00 0.13  ? 15  ILE A O    4  
ATOM 6582  C CB   . ILE A 1 15  ? 14.740  -1.277  -4.670  1.00 0.14  ? 15  ILE A CB   4  
ATOM 6583  C CG1  . ILE A 1 15  ? 15.881  -2.264  -4.386  1.00 0.16  ? 15  ILE A CG1  4  
ATOM 6584  C CG2  . ILE A 1 15  ? 14.682  -0.218  -3.567  1.00 0.15  ? 15  ILE A CG2  4  
ATOM 6585  C CD1  . ILE A 1 15  ? 16.207  -3.193  -5.532  1.00 0.18  ? 15  ILE A CD1  4  
ATOM 6586  H H    . ILE A 1 15  ? 13.256  -2.127  -6.929  1.00 0.14  ? 15  ILE A H    4  
ATOM 6587  H HA   . ILE A 1 15  ? 13.301  -2.766  -4.058  1.00 0.12  ? 15  ILE A HA   4  
ATOM 6588  H HB   . ILE A 1 15  ? 14.947  -0.769  -5.600  1.00 0.15  ? 15  ILE A HB   4  
ATOM 6589  H HG12 . ILE A 1 15  ? 16.774  -1.707  -4.153  1.00 0.18  ? 15  ILE A HG12 4  
ATOM 6590  H HG13 . ILE A 1 15  ? 15.613  -2.875  -3.533  1.00 0.16  ? 15  ILE A HG13 4  
ATOM 6591  H HG21 . ILE A 1 15  ? 14.011  0.576   -3.866  1.00 0.97  ? 15  ILE A HG21 4  
ATOM 6592  H HG22 . ILE A 1 15  ? 15.668  0.188   -3.400  1.00 0.94  ? 15  ILE A HG22 4  
ATOM 6593  H HG23 . ILE A 1 15  ? 14.318  -0.666  -2.651  1.00 0.99  ? 15  ILE A HG23 4  
ATOM 6594  H HD11 . ILE A 1 15  ? 17.090  -3.759  -5.288  1.00 1.01  ? 15  ILE A HD11 4  
ATOM 6595  H HD12 . ILE A 1 15  ? 16.373  -2.620  -6.439  1.00 1.05  ? 15  ILE A HD12 4  
ATOM 6596  H HD13 . ILE A 1 15  ? 15.379  -3.869  -5.683  1.00 1.03  ? 15  ILE A HD13 4  
ATOM 6597  N N    . ILE A 1 16  ? 11.738  -0.903  -3.448  1.00 0.11  ? 16  ILE A N    4  
ATOM 6598  C CA   . ILE A 1 16  ? 10.767  0.111   -3.113  1.00 0.11  ? 16  ILE A CA   4  
ATOM 6599  C C    . ILE A 1 16  ? 11.516  1.240   -2.412  1.00 0.11  ? 16  ILE A C    4  
ATOM 6600  O O    . ILE A 1 16  ? 12.377  0.978   -1.579  1.00 0.13  ? 16  ILE A O    4  
ATOM 6601  C CB   . ILE A 1 16  ? 9.655   -0.473  -2.211  1.00 0.12  ? 16  ILE A CB   4  
ATOM 6602  C CG1  . ILE A 1 16  ? 8.283   -0.256  -2.829  1.00 0.13  ? 16  ILE A CG1  4  
ATOM 6603  C CG2  . ILE A 1 16  ? 9.679   0.121   -0.820  1.00 0.14  ? 16  ILE A CG2  4  
ATOM 6604  C CD1  . ILE A 1 16  ? 7.164   -0.793  -1.965  1.00 0.17  ? 16  ILE A CD1  4  
ATOM 6605  H H    . ILE A 1 16  ? 12.039  -1.525  -2.744  1.00 0.12  ? 16  ILE A H    4  
ATOM 6606  H HA   . ILE A 1 16  ? 10.321  0.471   -4.025  1.00 0.11  ? 16  ILE A HA   4  
ATOM 6607  H HB   . ILE A 1 16  ? 9.829   -1.529  -2.127  1.00 0.14  ? 16  ILE A HB   4  
ATOM 6608  H HG12 . ILE A 1 16  ? 8.118   0.801   -2.971  1.00 0.13  ? 16  ILE A HG12 4  
ATOM 6609  H HG13 . ILE A 1 16  ? 8.239   -0.755  -3.780  1.00 0.14  ? 16  ILE A HG13 4  
ATOM 6610  H HG21 . ILE A 1 16  ? 10.667  0.015   -0.399  1.00 1.01  ? 16  ILE A HG21 4  
ATOM 6611  H HG22 . ILE A 1 16  ? 8.964   -0.397  -0.203  1.00 1.04  ? 16  ILE A HG22 4  
ATOM 6612  H HG23 . ILE A 1 16  ? 9.418   1.168   -0.876  1.00 1.01  ? 16  ILE A HG23 4  
ATOM 6613  H HD11 . ILE A 1 16  ? 7.181   -0.299  -1.006  1.00 1.04  ? 16  ILE A HD11 4  
ATOM 6614  H HD12 . ILE A 1 16  ? 7.300   -1.856  -1.823  1.00 1.06  ? 16  ILE A HD12 4  
ATOM 6615  H HD13 . ILE A 1 16  ? 6.217   -0.613  -2.449  1.00 1.00  ? 16  ILE A HD13 4  
ATOM 6616  N N    . ALA A 1 17  ? 11.251  2.475   -2.791  1.00 0.12  ? 17  ALA A N    4  
ATOM 6617  C CA   . ALA A 1 17  ? 12.038  3.600   -2.303  1.00 0.13  ? 17  ALA A CA   4  
ATOM 6618  C C    . ALA A 1 17  ? 11.166  4.814   -2.010  1.00 0.13  ? 17  ALA A C    4  
ATOM 6619  O O    . ALA A 1 17  ? 10.671  5.470   -2.923  1.00 0.15  ? 17  ALA A O    4  
ATOM 6620  C CB   . ALA A 1 17  ? 13.117  3.953   -3.318  1.00 0.15  ? 17  ALA A CB   4  
ATOM 6621  H H    . ALA A 1 17  ? 10.512  2.638   -3.413  1.00 0.12  ? 17  ALA A H    4  
ATOM 6622  H HA   . ALA A 1 17  ? 12.529  3.292   -1.390  1.00 0.13  ? 17  ALA A HA   4  
ATOM 6623  H HB1  . ALA A 1 17  ? 12.656  4.176   -4.275  1.00 1.00  ? 17  ALA A HB1  4  
ATOM 6624  H HB2  . ALA A 1 17  ? 13.796  3.118   -3.426  1.00 0.99  ? 17  ALA A HB2  4  
ATOM 6625  H HB3  . ALA A 1 17  ? 13.664  4.819   -2.975  1.00 1.00  ? 17  ALA A HB3  4  
ATOM 6626  N N    . ILE A 1 18  ? 10.980  5.112   -0.738  1.00 0.17  ? 18  ILE A N    4  
ATOM 6627  C CA   . ILE A 1 18  ? 10.202  6.273   -0.334  1.00 0.15  ? 18  ILE A CA   4  
ATOM 6628  C C    . ILE A 1 18  ? 11.100  7.499   -0.270  1.00 0.16  ? 18  ILE A C    4  
ATOM 6629  O O    . ILE A 1 18  ? 12.100  7.519   0.453   1.00 0.23  ? 18  ILE A O    4  
ATOM 6630  C CB   . ILE A 1 18  ? 9.480   6.086   1.028   1.00 0.18  ? 18  ILE A CB   4  
ATOM 6631  C CG1  . ILE A 1 18  ? 8.435   4.971   0.967   1.00 0.21  ? 18  ILE A CG1  4  
ATOM 6632  C CG2  . ILE A 1 18  ? 8.786   7.371   1.440   1.00 0.18  ? 18  ILE A CG2  4  
ATOM 6633  C CD1  . ILE A 1 18  ? 8.993   3.570   0.860   1.00 0.21  ? 18  ILE A CD1  4  
ATOM 6634  H H    . ILE A 1 18  ? 11.388  4.535   -0.049  1.00 0.25  ? 18  ILE A H    4  
ATOM 6635  H HA   . ILE A 1 18  ? 9.452   6.440   -1.093  1.00 0.15  ? 18  ILE A HA   4  
ATOM 6636  H HB   . ILE A 1 18  ? 10.214  5.846   1.781   1.00 0.20  ? 18  ILE A HB   4  
ATOM 6637  H HG12 . ILE A 1 18  ? 7.831   5.018   1.860   1.00 0.27  ? 18  ILE A HG12 4  
ATOM 6638  H HG13 . ILE A 1 18  ? 7.802   5.140   0.108   1.00 0.22  ? 18  ILE A HG13 4  
ATOM 6639  H HG21 . ILE A 1 18  ? 8.266   7.211   2.374   1.00 1.02  ? 18  ILE A HG21 4  
ATOM 6640  H HG22 . ILE A 1 18  ? 8.073   7.651   0.676   1.00 1.03  ? 18  ILE A HG22 4  
ATOM 6641  H HG23 . ILE A 1 18  ? 9.518   8.156   1.560   1.00 1.03  ? 18  ILE A HG23 4  
ATOM 6642  H HD11 . ILE A 1 18  ? 8.180   2.860   0.863   1.00 1.03  ? 18  ILE A HD11 4  
ATOM 6643  H HD12 . ILE A 1 18  ? 9.648   3.376   1.699   1.00 1.03  ? 18  ILE A HD12 4  
ATOM 6644  H HD13 . ILE A 1 18  ? 9.549   3.476   -0.064  1.00 0.99  ? 18  ILE A HD13 4  
ATOM 6645  N N    . ASN A 1 19  ? 10.735  8.511   -1.033  1.00 0.19  ? 19  ASN A N    4  
ATOM 6646  C CA   . ASN A 1 19  ? 11.536  9.713   -1.165  1.00 0.33  ? 19  ASN A CA   4  
ATOM 6647  C C    . ASN A 1 19  ? 10.856  10.890  -0.507  1.00 0.31  ? 19  ASN A C    4  
ATOM 6648  O O    . ASN A 1 19  ? 9.690   11.166  -0.785  1.00 0.55  ? 19  ASN A O    4  
ATOM 6649  C CB   . ASN A 1 19  ? 11.748  10.050  -2.642  1.00 0.54  ? 19  ASN A CB   4  
ATOM 6650  C CG   . ASN A 1 19  ? 12.697  11.216  -2.843  1.00 0.83  ? 19  ASN A CG   4  
ATOM 6651  O OD1  . ASN A 1 19  ? 13.609  11.433  -2.048  1.00 1.36  ? 19  ASN A OD1  4  
ATOM 6652  N ND2  . ASN A 1 19  ? 12.482  11.981  -3.900  1.00 1.00  ? 19  ASN A ND2  4  
ATOM 6653  H H    . ASN A 1 19  ? 9.880   8.453   -1.519  1.00 0.20  ? 19  ASN A H    4  
ATOM 6654  H HA   . ASN A 1 19  ? 12.488  9.546   -0.696  1.00 0.40  ? 19  ASN A HA   4  
ATOM 6655  H HB2  . ASN A 1 19  ? 12.146  9.193   -3.151  1.00 1.02  ? 19  ASN A HB2  4  
ATOM 6656  H HB3  . ASN A 1 19  ? 10.795  10.309  -3.081  1.00 0.61  ? 19  ASN A HB3  4  
ATOM 6657  H HD21 . ASN A 1 19  ? 11.728  11.758  -4.490  1.00 1.07  ? 19  ASN A HD21 4  
ATOM 6658  H HD22 . ASN A 1 19  ? 13.093  12.732  -4.064  1.00 1.32  ? 19  ASN A HD22 4  
ATOM 6659  N N    . GLU A 1 20  ? 11.576  11.597  0.349   1.00 0.36  ? 20  GLU A N    4  
ATOM 6660  C CA   . GLU A 1 20  ? 11.088  12.866  0.809   1.00 0.31  ? 20  GLU A CA   4  
ATOM 6661  C C    . GLU A 1 20  ? 12.139  13.917  0.473   1.00 0.67  ? 20  GLU A C    4  
ATOM 6662  O O    . GLU A 1 20  ? 12.837  14.435  1.344   1.00 1.47  ? 20  GLU A O    4  
ATOM 6663  C CB   . GLU A 1 20  ? 10.885  12.820  2.329   1.00 0.52  ? 20  GLU A CB   4  
ATOM 6664  C CG   . GLU A 1 20  ? 10.296  11.514  2.838   1.00 0.71  ? 20  GLU A CG   4  
ATOM 6665  C CD   . GLU A 1 20  ? 10.331  11.405  4.348   1.00 1.18  ? 20  GLU A CD   4  
ATOM 6666  O OE1  . GLU A 1 20  ? 9.504   12.053  5.018   1.00 1.47  ? 20  GLU A OE1  4  
ATOM 6667  O OE2  . GLU A 1 20  ? 11.192  10.669  4.877   1.00 1.41  ? 20  GLU A OE2  4  
ATOM 6668  H H    . GLU A 1 20  ? 12.452  11.278  0.636   1.00 0.66  ? 20  GLU A H    4  
ATOM 6669  H HA   . GLU A 1 20  ? 10.154  13.085  0.314   1.00 0.58  ? 20  GLU A HA   4  
ATOM 6670  H HB2  . GLU A 1 20  ? 11.840  12.966  2.809   1.00 0.71  ? 20  GLU A HB2  4  
ATOM 6671  H HB3  . GLU A 1 20  ? 10.225  13.620  2.616   1.00 0.70  ? 20  GLU A HB3  4  
ATOM 6672  H HG2  . GLU A 1 20  ? 9.272   11.440  2.510   1.00 0.85  ? 20  GLU A HG2  4  
ATOM 6673  H HG3  . GLU A 1 20  ? 10.864  10.702  2.421   1.00 0.53  ? 20  GLU A HG3  4  
ATOM 6674  N N    . ASP A 1 21  ? 12.230  14.214  -0.809  1.00 0.99  ? 21  ASP A N    4  
ATOM 6675  C CA   . ASP A 1 21  ? 12.961  15.368  -1.329  1.00 1.38  ? 21  ASP A CA   4  
ATOM 6676  C C    . ASP A 1 21  ? 11.962  16.349  -1.890  1.00 0.91  ? 21  ASP A C    4  
ATOM 6677  O O    . ASP A 1 21  ? 12.189  17.553  -1.993  1.00 0.88  ? 21  ASP A O    4  
ATOM 6678  C CB   . ASP A 1 21  ? 13.926  14.920  -2.427  1.00 2.11  ? 21  ASP A CB   4  
ATOM 6679  C CG   . ASP A 1 21  ? 14.728  16.064  -3.020  1.00 2.89  ? 21  ASP A CG   4  
ATOM 6680  O OD1  . ASP A 1 21  ? 15.749  16.458  -2.413  1.00 2.89  ? 21  ASP A OD1  4  
ATOM 6681  O OD2  . ASP A 1 21  ? 14.333  16.586  -4.081  1.00 3.67  ? 21  ASP A OD2  4  
ATOM 6682  H H    . ASP A 1 21  ? 11.802  13.608  -1.448  1.00 1.43  ? 21  ASP A H    4  
ATOM 6683  H HA   . ASP A 1 21  ? 13.509  15.826  -0.520  1.00 1.72  ? 21  ASP A HA   4  
ATOM 6684  H HB2  . ASP A 1 21  ? 14.611  14.200  -2.016  1.00 1.95  ? 21  ASP A HB2  4  
ATOM 6685  H HB3  . ASP A 1 21  ? 13.362  14.454  -3.222  1.00 2.52  ? 21  ASP A HB3  4  
ATOM 6686  N N    . VAL A 1 22  ? 10.835  15.768  -2.224  1.00 0.60  ? 22  VAL A N    4  
ATOM 6687  C CA   . VAL A 1 22  ? 9.842   16.362  -3.084  1.00 0.46  ? 22  VAL A CA   4  
ATOM 6688  C C    . VAL A 1 22  ? 8.613   16.792  -2.309  1.00 0.40  ? 22  VAL A C    4  
ATOM 6689  O O    . VAL A 1 22  ? 8.600   16.809  -1.076  1.00 0.48  ? 22  VAL A O    4  
ATOM 6690  C CB   . VAL A 1 22  ? 9.425   15.373  -4.203  1.00 0.57  ? 22  VAL A CB   4  
ATOM 6691  C CG1  . VAL A 1 22  ? 10.522  15.247  -5.237  1.00 0.90  ? 22  VAL A CG1  4  
ATOM 6692  C CG2  . VAL A 1 22  ? 9.120   13.993  -3.635  1.00 0.41  ? 22  VAL A CG2  4  
ATOM 6693  H H    . VAL A 1 22  ? 10.653  14.878  -1.862  1.00 0.53  ? 22  VAL A H    4  
ATOM 6694  H HA   . VAL A 1 22  ? 10.282  17.227  -3.551  1.00 0.55  ? 22  VAL A HA   4  
ATOM 6695  H HB   . VAL A 1 22  ? 8.537   15.749  -4.687  1.00 0.68  ? 22  VAL A HB   4  
ATOM 6696  H HG11 . VAL A 1 22  ? 10.774  16.222  -5.619  1.00 1.47  ? 22  VAL A HG11 4  
ATOM 6697  H HG12 . VAL A 1 22  ? 10.177  14.618  -6.043  1.00 1.33  ? 22  VAL A HG12 4  
ATOM 6698  H HG13 . VAL A 1 22  ? 11.389  14.798  -4.776  1.00 1.36  ? 22  VAL A HG13 4  
ATOM 6699  H HG21 . VAL A 1 22  ? 10.045  13.525  -3.328  1.00 1.16  ? 22  VAL A HG21 4  
ATOM 6700  H HG22 . VAL A 1 22  ? 8.644   13.384  -4.395  1.00 1.06  ? 22  VAL A HG22 4  
ATOM 6701  H HG23 . VAL A 1 22  ? 8.462   14.088  -2.786  1.00 1.02  ? 22  VAL A HG23 4  
ATOM 6702  N N    . SER A 1 23  ? 7.595   17.146  -3.061  1.00 0.47  ? 23  SER A N    4  
ATOM 6703  C CA   . SER A 1 23  ? 6.287   17.441  -2.516  1.00 0.58  ? 23  SER A CA   4  
ATOM 6704  C C    . SER A 1 23  ? 5.707   16.080  -2.133  1.00 0.46  ? 23  SER A C    4  
ATOM 6705  O O    . SER A 1 23  ? 6.296   15.080  -2.538  1.00 0.39  ? 23  SER A O    4  
ATOM 6706  C CB   . SER A 1 23  ? 5.440   18.163  -3.574  1.00 0.77  ? 23  SER A CB   4  
ATOM 6707  O OG   . SER A 1 23  ? 4.596   19.145  -2.991  1.00 1.23  ? 23  SER A OG   4  
ATOM 6708  H H    . SER A 1 23  ? 7.727   17.194  -4.026  1.00 0.53  ? 23  SER A H    4  
ATOM 6709  H HA   . SER A 1 23  ? 6.401   18.054  -1.638  1.00 0.66  ? 23  SER A HA   4  
ATOM 6710  H HB2  . SER A 1 23  ? 6.092   18.646  -4.284  1.00 1.36  ? 23  SER A HB2  4  
ATOM 6711  H HB3  . SER A 1 23  ? 4.828   17.440  -4.084  1.00 1.21  ? 23  SER A HB3  4  
ATOM 6712  H HG   . SER A 1 23  ? 5.022   19.506  -2.203  1.00 1.72  ? 23  SER A HG   4  
ATOM 6713  N N    . PRO A 1 24  ? 4.560   15.988  -1.415  1.00 0.46  ? 24  PRO A N    4  
ATOM 6714  C CA   . PRO A 1 24  ? 4.305   14.910  -0.457  1.00 0.39  ? 24  PRO A CA   4  
ATOM 6715  C C    . PRO A 1 24  ? 4.949   13.586  -0.828  1.00 0.27  ? 24  PRO A C    4  
ATOM 6716  O O    . PRO A 1 24  ? 4.735   13.051  -1.919  1.00 0.24  ? 24  PRO A O    4  
ATOM 6717  C CB   . PRO A 1 24  ? 2.797   14.755  -0.524  1.00 0.43  ? 24  PRO A CB   4  
ATOM 6718  C CG   . PRO A 1 24  ? 2.264   16.075  -0.966  1.00 0.50  ? 24  PRO A CG   4  
ATOM 6719  C CD   . PRO A 1 24  ? 3.417   16.899  -1.479  1.00 0.56  ? 24  PRO A CD   4  
ATOM 6720  H HA   . PRO A 1 24  ? 4.584   15.192  0.539   1.00 0.45  ? 24  PRO A HA   4  
ATOM 6721  H HB2  . PRO A 1 24  ? 2.549   13.979  -1.233  1.00 0.39  ? 24  PRO A HB2  4  
ATOM 6722  H HB3  . PRO A 1 24  ? 2.419   14.485  0.448   1.00 0.48  ? 24  PRO A HB3  4  
ATOM 6723  H HG2  . PRO A 1 24  ? 1.557   15.914  -1.754  1.00 0.47  ? 24  PRO A HG2  4  
ATOM 6724  H HG3  . PRO A 1 24  ? 1.788   16.576  -0.133  1.00 0.58  ? 24  PRO A HG3  4  
ATOM 6725  H HD2  . PRO A 1 24  ? 3.232   17.203  -2.498  1.00 0.59  ? 24  PRO A HD2  4  
ATOM 6726  H HD3  . PRO A 1 24  ? 3.575   17.761  -0.850  1.00 0.69  ? 24  PRO A HD3  4  
ATOM 6727  N N    . ALA A 1 25  ? 5.712   13.075  0.146   1.00 0.25  ? 25  ALA A N    4  
ATOM 6728  C CA   . ALA A 1 25  ? 6.655   11.978  -0.036  1.00 0.19  ? 25  ALA A CA   4  
ATOM 6729  C C    . ALA A 1 25  ? 6.111   10.898  -0.935  1.00 0.14  ? 25  ALA A C    4  
ATOM 6730  O O    . ALA A 1 25  ? 4.946   10.531  -0.845  1.00 0.17  ? 25  ALA A O    4  
ATOM 6731  C CB   . ALA A 1 25  ? 7.031   11.384  1.310   1.00 0.27  ? 25  ALA A CB   4  
ATOM 6732  H H    . ALA A 1 25  ? 5.617   13.456  1.048   1.00 0.32  ? 25  ALA A H    4  
ATOM 6733  H HA   . ALA A 1 25  ? 7.552   12.383  -0.481  1.00 0.18  ? 25  ALA A HA   4  
ATOM 6734  H HB1  . ALA A 1 25  ? 7.834   10.673  1.179   1.00 1.02  ? 25  ALA A HB1  4  
ATOM 6735  H HB2  . ALA A 1 25  ? 6.172   10.881  1.731   1.00 1.10  ? 25  ALA A HB2  4  
ATOM 6736  H HB3  . ALA A 1 25  ? 7.354   12.172  1.975   1.00 1.05  ? 25  ALA A HB3  4  
ATOM 6737  N N    . GLU A 1 26  ? 6.956   10.381  -1.791  1.00 0.14  ? 26  GLU A N    4  
ATOM 6738  C CA   . GLU A 1 26  ? 6.519   9.398   -2.743  1.00 0.14  ? 26  GLU A CA   4  
ATOM 6739  C C    . GLU A 1 26  ? 7.178   8.070   -2.455  1.00 0.15  ? 26  GLU A C    4  
ATOM 6740  O O    . GLU A 1 26  ? 8.288   8.012   -1.934  1.00 0.19  ? 26  GLU A O    4  
ATOM 6741  C CB   . GLU A 1 26  ? 6.885   9.815   -4.162  1.00 0.21  ? 26  GLU A CB   4  
ATOM 6742  C CG   . GLU A 1 26  ? 6.632   11.271  -4.497  1.00 0.42  ? 26  GLU A CG   4  
ATOM 6743  C CD   . GLU A 1 26  ? 7.315   11.669  -5.791  1.00 0.54  ? 26  GLU A CD   4  
ATOM 6744  O OE1  . GLU A 1 26  ? 8.535   11.424  -5.921  1.00 0.69  ? 26  GLU A OE1  4  
ATOM 6745  O OE2  . GLU A 1 26  ? 6.639   12.197  -6.699  1.00 0.66  ? 26  GLU A OE2  4  
ATOM 6746  H H    . GLU A 1 26  ? 7.897   10.659  -1.778  1.00 0.18  ? 26  GLU A H    4  
ATOM 6747  H HA   . GLU A 1 26  ? 5.448   9.294   -2.661  1.00 0.15  ? 26  GLU A HA   4  
ATOM 6748  H HB2  . GLU A 1 26  ? 7.925   9.612   -4.317  1.00 0.33  ? 26  GLU A HB2  4  
ATOM 6749  H HB3  . GLU A 1 26  ? 6.314   9.218   -4.846  1.00 0.37  ? 26  GLU A HB3  4  
ATOM 6750  H HG2  . GLU A 1 26  ? 5.570   11.428  -4.604  1.00 0.59  ? 26  GLU A HG2  4  
ATOM 6751  H HG3  . GLU A 1 26  ? 7.003   11.887  -3.697  1.00 0.58  ? 26  GLU A HG3  4  
ATOM 6752  N N    . LEU A 1 27  ? 6.496   7.012   -2.811  1.00 0.15  ? 27  LEU A N    4  
ATOM 6753  C CA   . LEU A 1 27  ? 7.071   5.692   -2.780  1.00 0.16  ? 27  LEU A CA   4  
ATOM 6754  C C    . LEU A 1 27  ? 7.384   5.290   -4.199  1.00 0.16  ? 27  LEU A C    4  
ATOM 6755  O O    . LEU A 1 27  ? 6.546   5.401   -5.083  1.00 0.19  ? 27  LEU A O    4  
ATOM 6756  C CB   . LEU A 1 27  ? 6.128   4.693   -2.110  1.00 0.21  ? 27  LEU A CB   4  
ATOM 6757  C CG   . LEU A 1 27  ? 6.360   3.226   -2.478  1.00 0.29  ? 27  LEU A CG   4  
ATOM 6758  C CD1  . LEU A 1 27  ? 6.016   2.335   -1.309  1.00 0.53  ? 27  LEU A CD1  4  
ATOM 6759  C CD2  . LEU A 1 27  ? 5.529   2.841   -3.695  1.00 0.59  ? 27  LEU A CD2  4  
ATOM 6760  H H    . LEU A 1 27  ? 5.570   7.127   -3.116  1.00 0.15  ? 27  LEU A H    4  
ATOM 6761  H HA   . LEU A 1 27  ? 7.990   5.738   -2.217  1.00 0.17  ? 27  LEU A HA   4  
ATOM 6762  H HB2  . LEU A 1 27  ? 6.238   4.798   -1.040  1.00 0.23  ? 27  LEU A HB2  4  
ATOM 6763  H HB3  . LEU A 1 27  ? 5.119   4.951   -2.372  1.00 0.24  ? 27  LEU A HB3  4  
ATOM 6764  H HG   . LEU A 1 27  ? 7.402   3.077   -2.719  1.00 0.70  ? 27  LEU A HG   4  
ATOM 6765  H HD11 . LEU A 1 27  ? 6.047   1.304   -1.622  1.00 1.19  ? 27  LEU A HD11 4  
ATOM 6766  H HD12 . LEU A 1 27  ? 5.027   2.578   -0.950  1.00 1.10  ? 27  LEU A HD12 4  
ATOM 6767  H HD13 . LEU A 1 27  ? 6.738   2.494   -0.522  1.00 1.21  ? 27  LEU A HD13 4  
ATOM 6768  H HD21 . LEU A 1 27  ? 5.590   1.774   -3.852  1.00 1.11  ? 27  LEU A HD21 4  
ATOM 6769  H HD22 . LEU A 1 27  ? 5.918   3.355   -4.567  1.00 1.22  ? 27  LEU A HD22 4  
ATOM 6770  H HD23 . LEU A 1 27  ? 4.495   3.129   -3.534  1.00 1.17  ? 27  LEU A HD23 4  
ATOM 6771  N N    . THR A 1 28  ? 8.595   4.866   -4.421  1.00 0.16  ? 28  THR A N    4  
ATOM 6772  C CA   . THR A 1 28  ? 9.058   4.604   -5.758  1.00 0.17  ? 28  THR A CA   4  
ATOM 6773  C C    . THR A 1 28  ? 9.566   3.180   -5.879  1.00 0.17  ? 28  THR A C    4  
ATOM 6774  O O    . THR A 1 28  ? 10.627  2.850   -5.360  1.00 0.17  ? 28  THR A O    4  
ATOM 6775  C CB   . THR A 1 28  ? 10.194  5.576   -6.088  1.00 0.19  ? 28  THR A CB   4  
ATOM 6776  O OG1  . THR A 1 28  ? 9.849   6.897   -5.645  1.00 0.22  ? 28  THR A OG1  4  
ATOM 6777  C CG2  . THR A 1 28  ? 10.492  5.600   -7.573  1.00 0.22  ? 28  THR A CG2  4  
ATOM 6778  H H    . THR A 1 28  ? 9.211   4.740   -3.666  1.00 0.16  ? 28  THR A H    4  
ATOM 6779  H HA   . THR A 1 28  ? 8.246   4.767   -6.449  1.00 0.18  ? 28  THR A HA   4  
ATOM 6780  H HB   . THR A 1 28  ? 11.072  5.248   -5.561  1.00 0.20  ? 28  THR A HB   4  
ATOM 6781  H HG1  . THR A 1 28  ? 9.834   6.910   -4.680  1.00 0.24  ? 28  THR A HG1  4  
ATOM 6782  H HG21 . THR A 1 28  ? 9.627   5.973   -8.106  1.00 1.06  ? 28  THR A HG21 4  
ATOM 6783  H HG22 . THR A 1 28  ? 10.725  4.599   -7.907  1.00 1.00  ? 28  THR A HG22 4  
ATOM 6784  H HG23 . THR A 1 28  ? 11.337  6.245   -7.757  1.00 1.03  ? 28  THR A HG23 4  
ATOM 6785  N N    . TRP A 1 29  ? 8.818   2.336   -6.559  1.00 0.19  ? 29  TRP A N    4  
ATOM 6786  C CA   . TRP A 1 29  ? 9.279   0.989   -6.810  1.00 0.18  ? 29  TRP A CA   4  
ATOM 6787  C C    . TRP A 1 29  ? 10.005  0.957   -8.141  1.00 0.19  ? 29  TRP A C    4  
ATOM 6788  O O    . TRP A 1 29  ? 9.457   1.367   -9.163  1.00 0.22  ? 29  TRP A O    4  
ATOM 6789  C CB   . TRP A 1 29  ? 8.123   -0.017  -6.800  1.00 0.20  ? 29  TRP A CB   4  
ATOM 6790  C CG   . TRP A 1 29  ? 8.575   -1.430  -7.022  1.00 0.18  ? 29  TRP A CG   4  
ATOM 6791  C CD1  . TRP A 1 29  ? 8.845   -2.359  -6.063  1.00 0.17  ? 29  TRP A CD1  4  
ATOM 6792  C CD2  . TRP A 1 29  ? 8.822   -2.076  -8.279  1.00 0.17  ? 29  TRP A CD2  4  
ATOM 6793  N NE1  . TRP A 1 29  ? 9.237   -3.537  -6.645  1.00 0.16  ? 29  TRP A NE1  4  
ATOM 6794  C CE2  . TRP A 1 29  ? 9.232   -3.386  -7.999  1.00 0.15  ? 29  TRP A CE2  4  
ATOM 6795  C CE3  . TRP A 1 29  ? 8.734   -1.675  -9.612  1.00 0.18  ? 29  TRP A CE3  4  
ATOM 6796  C CZ2  . TRP A 1 29  ? 9.553   -4.293  -8.997  1.00 0.15  ? 29  TRP A CZ2  4  
ATOM 6797  C CZ3  . TRP A 1 29  ? 9.053   -2.580  -10.604 1.00 0.18  ? 29  TRP A CZ3  4  
ATOM 6798  C CH2  . TRP A 1 29  ? 9.459   -3.877  -10.289 1.00 0.17  ? 29  TRP A CH2  4  
ATOM 6799  H H    . TRP A 1 29  ? 7.946   2.628   -6.908  1.00 0.21  ? 29  TRP A H    4  
ATOM 6800  H HA   . TRP A 1 29  ? 9.978   0.727   -6.023  1.00 0.18  ? 29  TRP A HA   4  
ATOM 6801  H HB2  . TRP A 1 29  ? 7.635   0.026   -5.838  1.00 0.22  ? 29  TRP A HB2  4  
ATOM 6802  H HB3  . TRP A 1 29  ? 7.410   0.233   -7.571  1.00 0.22  ? 29  TRP A HB3  4  
ATOM 6803  H HD1  . TRP A 1 29  ? 8.756   -2.180  -5.003  1.00 0.18  ? 29  TRP A HD1  4  
ATOM 6804  H HE1  . TRP A 1 29  ? 9.485   -4.360  -6.165  1.00 0.17  ? 29  TRP A HE1  4  
ATOM 6805  H HE3  . TRP A 1 29  ? 8.423   -0.674  -9.874  1.00 0.20  ? 29  TRP A HE3  4  
ATOM 6806  H HZ2  . TRP A 1 29  ? 9.871   -5.300  -8.773  1.00 0.16  ? 29  TRP A HZ2  4  
ATOM 6807  H HZ3  . TRP A 1 29  ? 8.991   -2.285  -11.641 1.00 0.20  ? 29  TRP A HZ3  4  
ATOM 6808  H HH2  . TRP A 1 29  ? 9.704   -4.558  -11.094 1.00 0.18  ? 29  TRP A HH2  4  
ATOM 6809  N N    . ARG A 1 30  ? 11.238  0.497   -8.113  1.00 0.19  ? 30  ARG A N    4  
ATOM 6810  C CA   . ARG A 1 30  ? 12.044  0.373   -9.315  1.00 0.21  ? 30  ARG A CA   4  
ATOM 6811  C C    . ARG A 1 30  ? 12.618  -1.023  -9.428  1.00 0.18  ? 30  ARG A C    4  
ATOM 6812  O O    . ARG A 1 30  ? 13.298  -1.498  -8.520  1.00 0.21  ? 30  ARG A O    4  
ATOM 6813  C CB   . ARG A 1 30  ? 13.152  1.400   -9.340  1.00 0.27  ? 30  ARG A CB   4  
ATOM 6814  C CG   . ARG A 1 30  ? 13.499  1.913   -7.981  1.00 0.32  ? 30  ARG A CG   4  
ATOM 6815  C CD   . ARG A 1 30  ? 14.769  2.716   -8.043  1.00 0.61  ? 30  ARG A CD   4  
ATOM 6816  N NE   . ARG A 1 30  ? 15.249  3.119   -6.723  1.00 0.50  ? 30  ARG A NE   4  
ATOM 6817  C CZ   . ARG A 1 30  ? 16.525  3.397   -6.456  1.00 1.09  ? 30  ARG A CZ   4  
ATOM 6818  N NH1  . ARG A 1 30  ? 17.450  3.263   -7.397  1.00 1.93  ? 30  ARG A NH1  4  
ATOM 6819  N NH2  . ARG A 1 30  ? 16.877  3.804   -5.243  1.00 1.05  ? 30  ARG A NH2  4  
ATOM 6820  H H    . ARG A 1 30  ? 11.622  0.219   -7.250  1.00 0.20  ? 30  ARG A H    4  
ATOM 6821  H HA   . ARG A 1 30  ? 11.408  0.554   -10.146 1.00 0.24  ? 30  ARG A HA   4  
ATOM 6822  H HB2  . ARG A 1 30  ? 14.034  0.948   -9.767  1.00 0.55  ? 30  ARG A HB2  4  
ATOM 6823  H HB3  . ARG A 1 30  ? 12.856  2.231   -9.949  1.00 0.51  ? 30  ARG A HB3  4  
ATOM 6824  H HG2  . ARG A 1 30  ? 12.695  2.540   -7.625  1.00 0.90  ? 30  ARG A HG2  4  
ATOM 6825  H HG3  . ARG A 1 30  ? 13.621  1.069   -7.334  1.00 0.90  ? 30  ARG A HG3  4  
ATOM 6826  H HD2  . ARG A 1 30  ? 15.513  2.116   -8.529  1.00 1.11  ? 30  ARG A HD2  4  
ATOM 6827  H HD3  . ARG A 1 30  ? 14.585  3.602   -8.633  1.00 1.10  ? 30  ARG A HD3  4  
ATOM 6828  H HE   . ARG A 1 30  ? 14.582  3.208   -6.011  1.00 0.65  ? 30  ARG A HE   4  
ATOM 6829  H HH11 . ARG A 1 30  ? 17.194  2.953   -8.317  1.00 2.07  ? 30  ARG A HH11 4  
ATOM 6830  H HH12 . ARG A 1 30  ? 18.411  3.465   -7.193  1.00 2.49  ? 30  ARG A HH12 4  
ATOM 6831  H HH21 . ARG A 1 30  ? 16.191  3.905   -4.524  1.00 0.78  ? 30  ARG A HH21 4  
ATOM 6832  H HH22 . ARG A 1 30  ? 17.840  4.016   -5.044  1.00 1.55  ? 30  ARG A HH22 4  
ATOM 6833  N N    . SER A 1 31  ? 12.332  -1.675  -10.544 1.00 0.17  ? 31  SER A N    4  
ATOM 6834  C CA   . SER A 1 31  ? 12.744  -3.047  -10.763 1.00 0.18  ? 31  SER A CA   4  
ATOM 6835  C C    . SER A 1 31  ? 14.258  -3.190  -10.675 1.00 0.19  ? 31  SER A C    4  
ATOM 6836  O O    . SER A 1 31  ? 15.013  -2.316  -11.107 1.00 0.27  ? 31  SER A O    4  
ATOM 6837  C CB   . SER A 1 31  ? 12.250  -3.534  -12.124 1.00 0.21  ? 31  SER A CB   4  
ATOM 6838  O OG   . SER A 1 31  ? 12.962  -2.922  -13.183 1.00 0.25  ? 31  SER A OG   4  
ATOM 6839  H H    . SER A 1 31  ? 11.815  -1.219  -11.240 1.00 0.22  ? 31  SER A H    4  
ATOM 6840  H HA   . SER A 1 31  ? 12.292  -3.654  -9.997  1.00 0.17  ? 31  SER A HA   4  
ATOM 6841  H HB2  . SER A 1 31  ? 12.377  -4.600  -12.187 1.00 0.25  ? 31  SER A HB2  4  
ATOM 6842  H HB3  . SER A 1 31  ? 11.202  -3.293  -12.227 1.00 0.22  ? 31  SER A HB3  4  
ATOM 6843  H HG   . SER A 1 31  ? 12.662  -3.288  -14.028 1.00 0.97  ? 31  SER A HG   4  
ATOM 6844  N N    . THR A 1 32  ? 14.689  -4.307  -10.117 1.00 0.21  ? 32  THR A N    4  
ATOM 6845  C CA   . THR A 1 32  ? 16.098  -4.638  -10.043 1.00 0.22  ? 32  THR A CA   4  
ATOM 6846  C C    . THR A 1 32  ? 16.527  -5.164  -11.414 1.00 0.44  ? 32  THR A C    4  
ATOM 6847  O O    . THR A 1 32  ? 17.702  -5.384  -11.702 1.00 0.67  ? 32  THR A O    4  
ATOM 6848  C CB   . THR A 1 32  ? 16.361  -5.676  -8.935  1.00 0.41  ? 32  THR A CB   4  
ATOM 6849  O OG1  . THR A 1 32  ? 17.741  -6.058  -8.900  1.00 0.97  ? 32  THR A OG1  4  
ATOM 6850  C CG2  . THR A 1 32  ? 15.494  -6.899  -9.127  1.00 0.44  ? 32  THR A CG2  4  
ATOM 6851  H H    . THR A 1 32  ? 14.031  -4.949  -9.767  1.00 0.29  ? 32  THR A H    4  
ATOM 6852  H HA   . THR A 1 32  ? 16.641  -3.740  -9.799  1.00 0.31  ? 32  THR A HA   4  
ATOM 6853  H HB   . THR A 1 32  ? 16.100  -5.226  -7.994  1.00 0.79  ? 32  THR A HB   4  
ATOM 6854  H HG1  . THR A 1 32  ? 18.041  -6.090  -7.980  1.00 1.28  ? 32  THR A HG1  4  
ATOM 6855  H HG21 . THR A 1 32  ? 14.460  -6.625  -8.988  1.00 1.02  ? 32  THR A HG21 4  
ATOM 6856  H HG22 . THR A 1 32  ? 15.769  -7.654  -8.409  1.00 1.14  ? 32  THR A HG22 4  
ATOM 6857  H HG23 . THR A 1 32  ? 15.633  -7.275  -10.125 1.00 1.25  ? 32  THR A HG23 4  
ATOM 6858  N N    . ASP A 1 33  ? 15.511  -5.335  -12.250 1.00 0.55  ? 33  ASP A N    4  
ATOM 6859  C CA   . ASP A 1 33  ? 15.643  -5.827  -13.620 1.00 0.89  ? 33  ASP A CA   4  
ATOM 6860  C C    . ASP A 1 33  ? 15.981  -4.720  -14.620 1.00 1.00  ? 33  ASP A C    4  
ATOM 6861  O O    . ASP A 1 33  ? 15.738  -4.875  -15.815 1.00 1.43  ? 33  ASP A O    4  
ATOM 6862  C CB   . ASP A 1 33  ? 14.352  -6.514  -14.064 1.00 1.09  ? 33  ASP A CB   4  
ATOM 6863  C CG   . ASP A 1 33  ? 14.360  -7.999  -13.788 1.00 1.88  ? 33  ASP A CG   4  
ATOM 6864  O OD1  . ASP A 1 33  ? 15.093  -8.731  -14.486 1.00 2.19  ? 33  ASP A OD1  4  
ATOM 6865  O OD2  . ASP A 1 33  ? 13.630  -8.450  -12.881 1.00 2.57  ? 33  ASP A OD2  4  
ATOM 6866  H H    . ASP A 1 33  ? 14.614  -5.128  -11.917 1.00 0.50  ? 33  ASP A H    4  
ATOM 6867  H HA   . ASP A 1 33  ? 16.440  -6.553  -13.631 1.00 1.02  ? 33  ASP A HA   4  
ATOM 6868  H HB2  . ASP A 1 33  ? 13.519  -6.075  -13.537 1.00 1.40  ? 33  ASP A HB2  4  
ATOM 6869  H HB3  . ASP A 1 33  ? 14.223  -6.361  -15.123 1.00 1.33  ? 33  ASP A HB3  4  
ATOM 6870  N N    . GLY A 1 34  ? 16.527  -3.610  -14.146 1.00 0.80  ? 34  GLY A N    4  
ATOM 6871  C CA   . GLY A 1 34  ? 16.872  -2.530  -15.053 1.00 1.07  ? 34  GLY A CA   4  
ATOM 6872  C C    . GLY A 1 34  ? 16.033  -1.280  -14.863 1.00 0.75  ? 34  GLY A C    4  
ATOM 6873  O O    . GLY A 1 34  ? 15.862  -0.493  -15.797 1.00 0.99  ? 34  GLY A O    4  
ATOM 6874  H H    . GLY A 1 34  ? 16.698  -3.523  -13.189 1.00 0.67  ? 34  GLY A H    4  
ATOM 6875  H HA2  . GLY A 1 34  ? 17.909  -2.273  -14.905 1.00 1.36  ? 34  GLY A HA2  4  
ATOM 6876  H HA3  . GLY A 1 34  ? 16.745  -2.879  -16.069 1.00 1.41  ? 34  GLY A HA3  4  
ATOM 6877  N N    . ASP A 1 35  ? 15.483  -1.124  -13.664 1.00 0.62  ? 35  ASP A N    4  
ATOM 6878  C CA   . ASP A 1 35  ? 14.923  0.140   -13.210 1.00 1.00  ? 35  ASP A CA   4  
ATOM 6879  C C    . ASP A 1 35  ? 13.611  0.490   -13.909 1.00 0.69  ? 35  ASP A C    4  
ATOM 6880  O O    . ASP A 1 35  ? 13.526  1.422   -14.712 1.00 0.72  ? 35  ASP A O    4  
ATOM 6881  C CB   . ASP A 1 35  ? 15.965  1.229   -13.374 1.00 1.52  ? 35  ASP A CB   4  
ATOM 6882  C CG   . ASP A 1 35  ? 15.507  2.599   -12.905 1.00 2.13  ? 35  ASP A CG   4  
ATOM 6883  O OD1  . ASP A 1 35  ? 15.350  2.788   -11.682 1.00 2.64  ? 35  ASP A OD1  4  
ATOM 6884  O OD2  . ASP A 1 35  ? 15.319  3.499   -13.756 1.00 2.16  ? 35  ASP A OD2  4  
ATOM 6885  H H    . ASP A 1 35  ? 15.445  -1.881  -13.066 1.00 0.67  ? 35  ASP A H    4  
ATOM 6886  H HA   . ASP A 1 35  ? 14.723  0.038   -12.165 1.00 1.44  ? 35  ASP A HA   4  
ATOM 6887  H HB2  . ASP A 1 35  ? 16.846  0.953   -12.813 1.00 1.74  ? 35  ASP A HB2  4  
ATOM 6888  H HB3  . ASP A 1 35  ? 16.213  1.275   -14.404 1.00 1.48  ? 35  ASP A HB3  4  
ATOM 6889  N N    . LYS A 1 36  ? 12.601  -0.311  -13.629 1.00 0.48  ? 36  LYS A N    4  
ATOM 6890  C CA   . LYS A 1 36  ? 11.231  0.021   -13.943 1.00 0.32  ? 36  LYS A CA   4  
ATOM 6891  C C    . LYS A 1 36  ? 10.650  0.749   -12.746 1.00 0.23  ? 36  LYS A C    4  
ATOM 6892  O O    . LYS A 1 36  ? 10.531  0.173   -11.673 1.00 0.39  ? 36  LYS A O    4  
ATOM 6893  C CB   . LYS A 1 36  ? 10.463  -1.264  -14.175 1.00 0.36  ? 36  LYS A CB   4  
ATOM 6894  C CG   . LYS A 1 36  ? 9.052   -1.118  -14.574 1.00 0.49  ? 36  LYS A CG   4  
ATOM 6895  C CD   . LYS A 1 36  ? 8.440   -2.484  -14.519 1.00 0.56  ? 36  LYS A CD   4  
ATOM 6896  C CE   . LYS A 1 36  ? 7.132   -2.552  -15.254 1.00 0.44  ? 36  LYS A CE   4  
ATOM 6897  N NZ   . LYS A 1 36  ? 7.186   -1.900  -16.592 1.00 1.20  ? 36  LYS A NZ   4  
ATOM 6898  H H    . LYS A 1 36  ? 12.784  -1.177  -13.212 1.00 0.50  ? 36  LYS A H    4  
ATOM 6899  H HA   . LYS A 1 36  ? 11.201  0.648   -14.821 1.00 0.44  ? 36  LYS A HA   4  
ATOM 6900  H HB2  . LYS A 1 36  ? 10.941  -1.843  -14.932 1.00 0.70  ? 36  LYS A HB2  4  
ATOM 6901  H HB3  . LYS A 1 36  ? 10.458  -1.817  -13.268 1.00 0.69  ? 36  LYS A HB3  4  
ATOM 6902  H HG2  . LYS A 1 36  ? 8.563   -0.465  -13.878 1.00 0.76  ? 36  LYS A HG2  4  
ATOM 6903  H HG3  . LYS A 1 36  ? 8.991   -0.736  -15.574 1.00 0.78  ? 36  LYS A HG3  4  
ATOM 6904  H HD2  . LYS A 1 36  ? 9.131   -3.172  -14.945 1.00 0.72  ? 36  LYS A HD2  4  
ATOM 6905  H HD3  . LYS A 1 36  ? 8.271   -2.745  -13.484 1.00 0.78  ? 36  LYS A HD3  4  
ATOM 6906  H HE2  . LYS A 1 36  ? 6.870   -3.585  -15.381 1.00 0.90  ? 36  LYS A HE2  4  
ATOM 6907  H HE3  . LYS A 1 36  ? 6.398   -2.070  -14.645 1.00 0.84  ? 36  LYS A HE3  4  
ATOM 6908  H HZ1  . LYS A 1 36  ? 7.909   -2.358  -17.186 1.00 1.69  ? 36  LYS A HZ1  4  
ATOM 6909  H HZ2  . LYS A 1 36  ? 7.418   -0.892  -16.495 1.00 1.81  ? 36  LYS A HZ2  4  
ATOM 6910  H HZ3  . LYS A 1 36  ? 6.262   -1.984  -17.067 1.00 1.72  ? 36  LYS A HZ3  4  
ATOM 6911  N N    . VAL A 1 37  ? 10.255  1.977   -12.943 1.00 0.23  ? 37  VAL A N    4  
ATOM 6912  C CA   . VAL A 1 37  ? 9.932   2.866   -11.829 1.00 0.23  ? 37  VAL A CA   4  
ATOM 6913  C C    . VAL A 1 37  ? 8.453   3.205   -11.791 1.00 0.26  ? 37  VAL A C    4  
ATOM 6914  O O    . VAL A 1 37  ? 7.857   3.584   -12.800 1.00 0.37  ? 37  VAL A O    4  
ATOM 6915  C CB   . VAL A 1 37  ? 10.755  4.177   -11.912 1.00 0.27  ? 37  VAL A CB   4  
ATOM 6916  C CG1  . VAL A 1 37  ? 10.144  5.278   -11.056 1.00 0.76  ? 37  VAL A CG1  4  
ATOM 6917  C CG2  . VAL A 1 37  ? 12.185  3.934   -11.485 1.00 0.83  ? 37  VAL A CG2  4  
ATOM 6918  H H    . VAL A 1 37  ? 10.158  2.295   -13.861 1.00 0.32  ? 37  VAL A H    4  
ATOM 6919  H HA   . VAL A 1 37  ? 10.198  2.348   -10.903 1.00 0.22  ? 37  VAL A HA   4  
ATOM 6920  H HB   . VAL A 1 37  ? 10.766  4.511   -12.936 1.00 0.72  ? 37  VAL A HB   4  
ATOM 6921  H HG11 . VAL A 1 37  ? 9.141   5.484   -11.396 1.00 1.48  ? 37  VAL A HG11 4  
ATOM 6922  H HG12 . VAL A 1 37  ? 10.743  6.173   -11.137 1.00 1.31  ? 37  VAL A HG12 4  
ATOM 6923  H HG13 . VAL A 1 37  ? 10.115  4.958   -10.025 1.00 1.29  ? 37  VAL A HG13 4  
ATOM 6924  H HG21 . VAL A 1 37  ? 12.528  2.995   -11.892 1.00 1.35  ? 37  VAL A HG21 4  
ATOM 6925  H HG22 . VAL A 1 37  ? 12.237  3.908   -10.406 1.00 1.53  ? 37  VAL A HG22 4  
ATOM 6926  H HG23 . VAL A 1 37  ? 12.806  4.734   -11.857 1.00 1.35  ? 37  VAL A HG23 4  
ATOM 6927  N N    . HIS A 1 38  ? 7.867   3.045   -10.617 1.00 0.22  ? 38  HIS A N    4  
ATOM 6928  C CA   . HIS A 1 38  ? 6.483   3.415   -10.389 1.00 0.25  ? 38  HIS A CA   4  
ATOM 6929  C C    . HIS A 1 38  ? 6.411   4.228   -9.111  1.00 0.24  ? 38  HIS A C    4  
ATOM 6930  O O    . HIS A 1 38  ? 6.825   3.760   -8.050  1.00 0.26  ? 38  HIS A O    4  
ATOM 6931  C CB   . HIS A 1 38  ? 5.596   2.172   -10.285 1.00 0.27  ? 38  HIS A CB   4  
ATOM 6932  C CG   . HIS A 1 38  ? 5.980   1.094   -11.254 1.00 0.28  ? 38  HIS A CG   4  
ATOM 6933  N ND1  . HIS A 1 38  ? 6.087   1.287   -12.609 1.00 0.30  ? 38  HIS A ND1  4  
ATOM 6934  C CD2  . HIS A 1 38  ? 6.354   -0.177  -11.039 1.00 0.30  ? 38  HIS A CD2  4  
ATOM 6935  C CE1  . HIS A 1 38  ? 6.516   0.172   -13.166 1.00 0.33  ? 38  HIS A CE1  4  
ATOM 6936  N NE2  . HIS A 1 38  ? 6.673   -0.735  -12.237 1.00 0.33  ? 38  HIS A NE2  4  
ATOM 6937  H H    . HIS A 1 38  ? 8.388   2.663   -9.873  1.00 0.22  ? 38  HIS A H    4  
ATOM 6938  H HA   . HIS A 1 38  ? 6.159   4.023   -11.219 1.00 0.27  ? 38  HIS A HA   4  
ATOM 6939  H HB2  . HIS A 1 38  ? 5.668   1.769   -9.284  1.00 0.28  ? 38  HIS A HB2  4  
ATOM 6940  H HB3  . HIS A 1 38  ? 4.570   2.450   -10.484 1.00 0.31  ? 38  HIS A HB3  4  
ATOM 6941  H HD1  . HIS A 1 38  ? 5.875   2.118   -13.093 1.00 0.32  ? 38  HIS A HD1  4  
ATOM 6942  H HD2  . HIS A 1 38  ? 6.447   -0.652  -10.097 1.00 0.32  ? 38  HIS A HD2  4  
ATOM 6943  H HE1  . HIS A 1 38  ? 6.789   0.040   -14.196 1.00 0.36  ? 38  HIS A HE1  4  
ATOM 6944  H HE2  . HIS A 1 38  ? 6.620   -1.700  -12.417 1.00 0.38  ? 38  HIS A HE2  4  
ATOM 6945  N N    . THR A 1 39  ? 5.914   5.446   -9.215  1.00 0.23  ? 39  THR A N    4  
ATOM 6946  C CA   . THR A 1 39  ? 5.991   6.382   -8.113  1.00 0.22  ? 39  THR A CA   4  
ATOM 6947  C C    . THR A 1 39  ? 4.612   6.665   -7.513  1.00 0.23  ? 39  THR A C    4  
ATOM 6948  O O    . THR A 1 39  ? 3.632   6.873   -8.231  1.00 0.32  ? 39  THR A O    4  
ATOM 6949  C CB   . THR A 1 39  ? 6.656   7.688   -8.575  1.00 0.24  ? 39  THR A CB   4  
ATOM 6950  O OG1  . THR A 1 39  ? 7.674   7.392   -9.544  1.00 0.26  ? 39  THR A OG1  4  
ATOM 6951  C CG2  . THR A 1 39  ? 7.289   8.412   -7.401  1.00 0.24  ? 39  THR A CG2  4  
ATOM 6952  H H    . THR A 1 39  ? 5.483   5.723   -10.050 1.00 0.25  ? 39  THR A H    4  
ATOM 6953  H HA   . THR A 1 39  ? 6.616   5.941   -7.350  1.00 0.19  ? 39  THR A HA   4  
ATOM 6954  H HB   . THR A 1 39  ? 5.912   8.325   -9.021  1.00 0.28  ? 39  THR A HB   4  
ATOM 6955  H HG1  . THR A 1 39  ? 8.206   8.182   -9.702  1.00 0.86  ? 39  THR A HG1  4  
ATOM 6956  H HG21 . THR A 1 39  ? 6.543   8.580   -6.641  1.00 1.03  ? 39  THR A HG21 4  
ATOM 6957  H HG22 . THR A 1 39  ? 7.683   9.360   -7.734  1.00 1.00  ? 39  THR A HG22 4  
ATOM 6958  H HG23 . THR A 1 39  ? 8.090   7.810   -6.997  1.00 0.94  ? 39  THR A HG23 4  
ATOM 6959  N N    . VAL A 1 40  ? 4.557   6.648   -6.189  1.00 0.19  ? 40  VAL A N    4  
ATOM 6960  C CA   . VAL A 1 40  ? 3.321   6.798   -5.435  1.00 0.20  ? 40  VAL A CA   4  
ATOM 6961  C C    . VAL A 1 40  ? 3.403   7.989   -4.473  1.00 0.20  ? 40  VAL A C    4  
ATOM 6962  O O    . VAL A 1 40  ? 4.062   7.903   -3.440  1.00 0.20  ? 40  VAL A O    4  
ATOM 6963  C CB   . VAL A 1 40  ? 3.050   5.499   -4.627  1.00 0.21  ? 40  VAL A CB   4  
ATOM 6964  C CG1  . VAL A 1 40  ? 1.983   5.692   -3.568  1.00 0.23  ? 40  VAL A CG1  4  
ATOM 6965  C CG2  . VAL A 1 40  ? 2.654   4.359   -5.550  1.00 0.22  ? 40  VAL A CG2  4  
ATOM 6966  H H    . VAL A 1 40  ? 5.394   6.507   -5.691  1.00 0.22  ? 40  VAL A H    4  
ATOM 6967  H HA   . VAL A 1 40  ? 2.510   6.948   -6.129  1.00 0.22  ? 40  VAL A HA   4  
ATOM 6968  H HB   . VAL A 1 40  ? 3.966   5.219   -4.129  1.00 0.22  ? 40  VAL A HB   4  
ATOM 6969  H HG11 . VAL A 1 40  ? 1.045   5.936   -4.042  1.00 0.97  ? 40  VAL A HG11 4  
ATOM 6970  H HG12 . VAL A 1 40  ? 2.273   6.494   -2.903  1.00 1.06  ? 40  VAL A HG12 4  
ATOM 6971  H HG13 . VAL A 1 40  ? 1.878   4.775   -3.002  1.00 1.09  ? 40  VAL A HG13 4  
ATOM 6972  H HG21 . VAL A 1 40  ? 3.437   4.191   -6.274  1.00 1.04  ? 40  VAL A HG21 4  
ATOM 6973  H HG22 . VAL A 1 40  ? 1.736   4.613   -6.060  1.00 1.05  ? 40  VAL A HG22 4  
ATOM 6974  H HG23 . VAL A 1 40  ? 2.505   3.462   -4.964  1.00 1.01  ? 40  VAL A HG23 4  
ATOM 6975  N N    . VAL A 1 41  ? 2.753   9.100   -4.813  1.00 0.22  ? 41  VAL A N    4  
ATOM 6976  C CA   . VAL A 1 41  ? 2.698   10.250  -3.917  1.00 0.22  ? 41  VAL A CA   4  
ATOM 6977  C C    . VAL A 1 41  ? 1.825   9.906   -2.707  1.00 0.23  ? 41  VAL A C    4  
ATOM 6978  O O    . VAL A 1 41  ? 0.622   9.674   -2.842  1.00 0.26  ? 41  VAL A O    4  
ATOM 6979  C CB   . VAL A 1 41  ? 2.122   11.497  -4.626  1.00 0.26  ? 41  VAL A CB   4  
ATOM 6980  C CG1  . VAL A 1 41  ? 2.123   12.700  -3.692  1.00 0.63  ? 41  VAL A CG1  4  
ATOM 6981  C CG2  . VAL A 1 41  ? 2.906   11.799  -5.892  1.00 0.59  ? 41  VAL A CG2  4  
ATOM 6982  H H    . VAL A 1 41  ? 2.295   9.148   -5.677  1.00 0.25  ? 41  VAL A H    4  
ATOM 6983  H HA   . VAL A 1 41  ? 3.713   10.472  -3.586  1.00 0.21  ? 41  VAL A HA   4  
ATOM 6984  H HB   . VAL A 1 41  ? 1.100   11.286  -4.905  1.00 0.61  ? 41  VAL A HB   4  
ATOM 6985  H HG11 . VAL A 1 41  ? 1.726   13.561  -4.209  1.00 1.22  ? 41  VAL A HG11 4  
ATOM 6986  H HG12 . VAL A 1 41  ? 3.133   12.908  -3.372  1.00 1.30  ? 41  VAL A HG12 4  
ATOM 6987  H HG13 . VAL A 1 41  ? 1.510   12.486  -2.829  1.00 1.30  ? 41  VAL A HG13 4  
ATOM 6988  H HG21 . VAL A 1 41  ? 2.870   10.944  -6.550  1.00 1.25  ? 41  VAL A HG21 4  
ATOM 6989  H HG22 . VAL A 1 41  ? 3.933   12.015  -5.638  1.00 1.17  ? 41  VAL A HG22 4  
ATOM 6990  H HG23 . VAL A 1 41  ? 2.471   12.653  -6.388  1.00 1.18  ? 41  VAL A HG23 4  
ATOM 6991  N N    . LEU A 1 42  ? 2.434   9.882   -1.534  1.00 0.23  ? 42  LEU A N    4  
ATOM 6992  C CA   . LEU A 1 42  ? 1.799   9.355   -0.327  1.00 0.26  ? 42  LEU A CA   4  
ATOM 6993  C C    . LEU A 1 42  ? 0.590   10.162  0.138   1.00 0.27  ? 42  LEU A C    4  
ATOM 6994  O O    . LEU A 1 42  ? -0.259  9.641   0.859   1.00 0.37  ? 42  LEU A O    4  
ATOM 6995  C CB   . LEU A 1 42  ? 2.836   9.268   0.786   1.00 0.32  ? 42  LEU A CB   4  
ATOM 6996  C CG   . LEU A 1 42  ? 3.739   8.043   0.704   1.00 0.43  ? 42  LEU A CG   4  
ATOM 6997  C CD1  . LEU A 1 42  ? 4.899   8.190   1.665   1.00 1.24  ? 42  LEU A CD1  4  
ATOM 6998  C CD2  . LEU A 1 42  ? 2.942   6.785   1.009   1.00 1.01  ? 42  LEU A CD2  4  
ATOM 6999  H H    . LEU A 1 42  ? 3.357   10.226  -1.471  1.00 0.25  ? 42  LEU A H    4  
ATOM 7000  H HA   . LEU A 1 42  ? 1.467   8.355   -0.558  1.00 0.31  ? 42  LEU A HA   4  
ATOM 7001  H HB2  . LEU A 1 42  ? 3.458   10.150  0.735   1.00 0.27  ? 42  LEU A HB2  4  
ATOM 7002  H HB3  . LEU A 1 42  ? 2.333   9.259   1.737   1.00 0.45  ? 42  LEU A HB3  4  
ATOM 7003  H HG   . LEU A 1 42  ? 4.138   7.959   -0.296  1.00 1.24  ? 42  LEU A HG   4  
ATOM 7004  H HD11 . LEU A 1 42  ? 5.527   7.316   1.610   1.00 1.86  ? 42  LEU A HD11 4  
ATOM 7005  H HD12 . LEU A 1 42  ? 4.520   8.305   2.668   1.00 1.80  ? 42  LEU A HD12 4  
ATOM 7006  H HD13 . LEU A 1 42  ? 5.472   9.065   1.395   1.00 1.75  ? 42  LEU A HD13 4  
ATOM 7007  H HD21 . LEU A 1 42  ? 2.550   6.841   2.013   1.00 1.58  ? 42  LEU A HD21 4  
ATOM 7008  H HD22 . LEU A 1 42  ? 3.584   5.924   0.919   1.00 1.41  ? 42  LEU A HD22 4  
ATOM 7009  H HD23 . LEU A 1 42  ? 2.124   6.700   0.309   1.00 1.79  ? 42  LEU A HD23 4  
ATOM 7010  N N    . SER A 1 43  ? 0.495   11.415  -0.275  1.00 0.23  ? 43  SER A N    4  
ATOM 7011  C CA   . SER A 1 43  ? -0.640  12.247  0.112   1.00 0.28  ? 43  SER A CA   4  
ATOM 7012  C C    . SER A 1 43  ? -1.929  11.745  -0.528  1.00 0.28  ? 43  SER A C    4  
ATOM 7013  O O    . SER A 1 43  ? -3.027  12.070  -0.077  1.00 0.34  ? 43  SER A O    4  
ATOM 7014  C CB   . SER A 1 43  ? -0.398  13.699  -0.285  1.00 0.35  ? 43  SER A CB   4  
ATOM 7015  O OG   . SER A 1 43  ? -0.063  13.796  -1.659  1.00 1.08  ? 43  SER A OG   4  
ATOM 7016  H H    . SER A 1 43  ? 1.197   11.790  -0.847  1.00 0.22  ? 43  SER A H    4  
ATOM 7017  H HA   . SER A 1 43  ? -0.741  12.189  1.185   1.00 0.32  ? 43  SER A HA   4  
ATOM 7018  H HB2  . SER A 1 43  ? -1.294  14.274  -0.105  1.00 0.86  ? 43  SER A HB2  4  
ATOM 7019  H HB3  . SER A 1 43  ? 0.414   14.102  0.301   1.00 1.04  ? 43  SER A HB3  4  
ATOM 7020  H HG   . SER A 1 43  ? -0.642  14.439  -2.085  1.00 1.37  ? 43  SER A HG   4  
ATOM 7021  N N    . THR A 1 44  ? -1.789  10.938  -1.574  1.00 0.26  ? 44  THR A N    4  
ATOM 7022  C CA   . THR A 1 44  ? -2.941  10.437  -2.302  1.00 0.28  ? 44  THR A CA   4  
ATOM 7023  C C    . THR A 1 44  ? -3.301  9.038   -1.824  1.00 0.26  ? 44  THR A C    4  
ATOM 7024  O O    . THR A 1 44  ? -4.115  8.355   -2.433  1.00 0.29  ? 44  THR A O    4  
ATOM 7025  C CB   . THR A 1 44  ? -2.686  10.412  -3.826  1.00 0.32  ? 44  THR A CB   4  
ATOM 7026  O OG1  . THR A 1 44  ? -1.664  9.457   -4.150  1.00 0.30  ? 44  THR A OG1  4  
ATOM 7027  C CG2  . THR A 1 44  ? -2.264  11.785  -4.332  1.00 0.36  ? 44  THR A CG2  4  
ATOM 7028  H H    . THR A 1 44  ? -0.888  10.661  -1.850  1.00 0.26  ? 44  THR A H    4  
ATOM 7029  H HA   . THR A 1 44  ? -3.776  11.098  -2.103  1.00 0.31  ? 44  THR A HA   4  
ATOM 7030  H HB   . THR A 1 44  ? -3.601  10.128  -4.324  1.00 0.36  ? 44  THR A HB   4  
ATOM 7031  H HG1  . THR A 1 44  ? -0.870  9.639   -3.626  1.00 0.26  ? 44  THR A HG1  4  
ATOM 7032  H HG21 . THR A 1 44  ? -1.348  12.082  -3.842  1.00 1.04  ? 44  THR A HG21 4  
ATOM 7033  H HG22 . THR A 1 44  ? -3.039  12.504  -4.113  1.00 1.05  ? 44  THR A HG22 4  
ATOM 7034  H HG23 . THR A 1 44  ? -2.104  11.740  -5.399  1.00 1.04  ? 44  THR A HG23 4  
ATOM 7035  N N    . ILE A 1 45  ? -2.660  8.608   -0.748  1.00 0.24  ? 45  ILE A N    4  
ATOM 7036  C CA   . ILE A 1 45  ? -2.940  7.327   -0.141  1.00 0.22  ? 45  ILE A CA   4  
ATOM 7037  C C    . ILE A 1 45  ? -3.755  7.518   1.141   1.00 0.25  ? 45  ILE A C    4  
ATOM 7038  O O    . ILE A 1 45  ? -3.497  8.436   1.919   1.00 0.36  ? 45  ILE A O    4  
ATOM 7039  C CB   . ILE A 1 45  ? -1.611  6.630   0.177   1.00 0.25  ? 45  ILE A CB   4  
ATOM 7040  C CG1  . ILE A 1 45  ? -0.738  6.611   -1.080  1.00 0.25  ? 45  ILE A CG1  4  
ATOM 7041  C CG2  . ILE A 1 45  ? -1.846  5.224   0.697   1.00 0.28  ? 45  ILE A CG2  4  
ATOM 7042  C CD1  . ILE A 1 45  ? -1.224  5.660   -2.156  1.00 0.27  ? 45  ILE A CD1  4  
ATOM 7043  H H    . ILE A 1 45  ? -1.946  9.157   -0.358  1.00 0.26  ? 45  ILE A H    4  
ATOM 7044  H HA   . ILE A 1 45  ? -3.498  6.720   -0.846  1.00 0.22  ? 45  ILE A HA   4  
ATOM 7045  H HB   . ILE A 1 45  ? -1.108  7.194   0.947   1.00 0.29  ? 45  ILE A HB   4  
ATOM 7046  H HG12 . ILE A 1 45  ? -0.723  7.604   -1.505  1.00 0.23  ? 45  ILE A HG12 4  
ATOM 7047  H HG13 . ILE A 1 45  ? 0.263   6.336   -0.808  1.00 0.27  ? 45  ILE A HG13 4  
ATOM 7048  H HG21 . ILE A 1 45  ? -0.898  4.755   0.907   1.00 1.01  ? 45  ILE A HG21 4  
ATOM 7049  H HG22 . ILE A 1 45  ? -2.376  4.651   -0.048  1.00 1.07  ? 45  ILE A HG22 4  
ATOM 7050  H HG23 . ILE A 1 45  ? -2.433  5.272   1.600   1.00 1.04  ? 45  ILE A HG23 4  
ATOM 7051  H HD11 . ILE A 1 45  ? -0.503  5.622   -2.959  1.00 1.05  ? 45  ILE A HD11 4  
ATOM 7052  H HD12 . ILE A 1 45  ? -2.172  6.006   -2.540  1.00 1.05  ? 45  ILE A HD12 4  
ATOM 7053  H HD13 . ILE A 1 45  ? -1.346  4.673   -1.736  1.00 1.01  ? 45  ILE A HD13 4  
ATOM 7054  N N    . ASP A 1 46  ? -4.746  6.659   1.343   1.00 0.22  ? 46  ASP A N    4  
ATOM 7055  C CA   . ASP A 1 46  ? -5.652  6.772   2.481   1.00 0.27  ? 46  ASP A CA   4  
ATOM 7056  C C    . ASP A 1 46  ? -5.239  5.824   3.598   1.00 0.30  ? 46  ASP A C    4  
ATOM 7057  O O    . ASP A 1 46  ? -5.182  6.207   4.765   1.00 0.38  ? 46  ASP A O    4  
ATOM 7058  C CB   . ASP A 1 46  ? -7.087  6.447   2.053   1.00 0.33  ? 46  ASP A CB   4  
ATOM 7059  C CG   . ASP A 1 46  ? -8.115  6.878   3.083   1.00 0.48  ? 46  ASP A CG   4  
ATOM 7060  O OD1  . ASP A 1 46  ? -8.227  6.226   4.143   1.00 0.55  ? 46  ASP A OD1  4  
ATOM 7061  O OD2  . ASP A 1 46  ? -8.828  7.874   2.832   1.00 0.70  ? 46  ASP A OD2  4  
ATOM 7062  H H    . ASP A 1 46  ? -4.867  5.915   0.711   1.00 0.21  ? 46  ASP A H    4  
ATOM 7063  H HA   . ASP A 1 46  ? -5.613  7.787   2.845   1.00 0.31  ? 46  ASP A HA   4  
ATOM 7064  H HB2  . ASP A 1 46  ? -7.303  6.949   1.124   1.00 0.36  ? 46  ASP A HB2  4  
ATOM 7065  H HB3  . ASP A 1 46  ? -7.178  5.380   1.909   1.00 0.33  ? 46  ASP A HB3  4  
ATOM 7066  N N    . LYS A 1 47  ? -4.935  4.588   3.241   1.00 0.28  ? 47  LYS A N    4  
ATOM 7067  C CA   . LYS A 1 47  ? -4.609  3.577   4.231   1.00 0.36  ? 47  LYS A CA   4  
ATOM 7068  C C    . LYS A 1 47  ? -3.373  2.810   3.819   1.00 0.31  ? 47  LYS A C    4  
ATOM 7069  O O    . LYS A 1 47  ? -2.840  2.993   2.726   1.00 0.26  ? 47  LYS A O    4  
ATOM 7070  C CB   . LYS A 1 47  ? -5.758  2.587   4.389   1.00 0.42  ? 47  LYS A CB   4  
ATOM 7071  C CG   . LYS A 1 47  ? -6.369  2.528   5.766   1.00 0.74  ? 47  LYS A CG   4  
ATOM 7072  C CD   . LYS A 1 47  ? -5.353  2.178   6.825   1.00 0.79  ? 47  LYS A CD   4  
ATOM 7073  C CE   . LYS A 1 47  ? -5.981  2.116   8.206   1.00 1.12  ? 47  LYS A CE   4  
ATOM 7074  N NZ   . LYS A 1 47  ? -4.987  1.792   9.264   1.00 1.56  ? 47  LYS A NZ   4  
ATOM 7075  H H    . LYS A 1 47  ? -4.926  4.344   2.286   1.00 0.25  ? 47  LYS A H    4  
ATOM 7076  H HA   . LYS A 1 47  ? -4.427  4.067   5.174   1.00 0.44  ? 47  LYS A HA   4  
ATOM 7077  H HB2  . LYS A 1 47  ? -6.534  2.842   3.693   1.00 0.63  ? 47  LYS A HB2  4  
ATOM 7078  H HB3  . LYS A 1 47  ? -5.388  1.606   4.155   1.00 0.50  ? 47  LYS A HB3  4  
ATOM 7079  H HG2  . LYS A 1 47  ? -6.782  3.480   6.000   1.00 1.36  ? 47  LYS A HG2  4  
ATOM 7080  H HG3  . LYS A 1 47  ? -7.144  1.773   5.759   1.00 1.37  ? 47  LYS A HG3  4  
ATOM 7081  H HD2  . LYS A 1 47  ? -4.927  1.233   6.594   1.00 1.37  ? 47  LYS A HD2  4  
ATOM 7082  H HD3  . LYS A 1 47  ? -4.584  2.923   6.822   1.00 1.28  ? 47  LYS A HD3  4  
ATOM 7083  H HE2  . LYS A 1 47  ? -6.422  3.073   8.422   1.00 1.79  ? 47  LYS A HE2  4  
ATOM 7084  H HE3  . LYS A 1 47  ? -6.750  1.359   8.203   1.00 1.63  ? 47  LYS A HE3  4  
ATOM 7085  H HZ1  . LYS A 1 47  ? -4.216  2.492   9.260   1.00 1.86  ? 47  LYS A HZ1  4  
ATOM 7086  H HZ2  . LYS A 1 47  ? -4.583  0.849   9.101   1.00 2.16  ? 47  LYS A HZ2  4  
ATOM 7087  H HZ3  . LYS A 1 47  ? -5.444  1.805   10.199  1.00 1.99  ? 47  LYS A HZ3  4  
ATOM 7088  N N    . LEU A 1 48  ? -2.942  1.936   4.698   1.00 0.39  ? 48  LEU A N    4  
ATOM 7089  C CA   . LEU A 1 48  ? -1.801  1.085   4.430   1.00 0.36  ? 48  LEU A CA   4  
ATOM 7090  C C    . LEU A 1 48  ? -2.010  -0.261  5.097   1.00 0.40  ? 48  LEU A C    4  
ATOM 7091  O O    . LEU A 1 48  ? -2.433  -0.337  6.250   1.00 0.50  ? 48  LEU A O    4  
ATOM 7092  C CB   . LEU A 1 48  ? -0.527  1.754   4.930   1.00 0.60  ? 48  LEU A CB   4  
ATOM 7093  C CG   . LEU A 1 48  ? 0.774   1.200   4.385   1.00 0.64  ? 48  LEU A CG   4  
ATOM 7094  C CD1  . LEU A 1 48  ? 1.527   2.317   3.729   1.00 1.37  ? 48  LEU A CD1  4  
ATOM 7095  C CD2  . LEU A 1 48  ? 1.620   0.602   5.485   1.00 1.12  ? 48  LEU A CD2  4  
ATOM 7096  H H    . LEU A 1 48  ? -3.415  1.853   5.557   1.00 0.51  ? 48  LEU A H    4  
ATOM 7097  H HA   . LEU A 1 48  ? -1.727  0.943   3.357   1.00 0.27  ? 48  LEU A HA   4  
ATOM 7098  H HB2  . LEU A 1 48  ? -0.577  2.784   4.648   1.00 1.30  ? 48  LEU A HB2  4  
ATOM 7099  H HB3  . LEU A 1 48  ? -0.495  1.694   6.002   1.00 1.37  ? 48  LEU A HB3  4  
ATOM 7100  H HG   . LEU A 1 48  ? 0.569   0.441   3.646   1.00 1.45  ? 48  LEU A HG   4  
ATOM 7101  H HD11 . LEU A 1 48  ? 1.776   3.054   4.485   1.00 1.81  ? 48  LEU A HD11 4  
ATOM 7102  H HD12 . LEU A 1 48  ? 0.912   2.770   2.969   1.00 1.98  ? 48  LEU A HD12 4  
ATOM 7103  H HD13 . LEU A 1 48  ? 2.433   1.934   3.287   1.00 1.91  ? 48  LEU A HD13 4  
ATOM 7104  H HD21 . LEU A 1 48  ? 1.857   1.371   6.209   1.00 1.75  ? 48  LEU A HD21 4  
ATOM 7105  H HD22 . LEU A 1 48  ? 2.538   0.217   5.060   1.00 1.68  ? 48  LEU A HD22 4  
ATOM 7106  H HD23 . LEU A 1 48  ? 1.077   -0.195  5.965   1.00 1.48  ? 48  LEU A HD23 4  
ATOM 7107  N N    . GLN A 1 49  ? -1.737  -1.313  4.361   1.00 0.39  ? 49  GLN A N    4  
ATOM 7108  C CA   . GLN A 1 49  ? -1.965  -2.670  4.845   1.00 0.45  ? 49  GLN A CA   4  
ATOM 7109  C C    . GLN A 1 49  ? -0.682  -3.479  4.780   1.00 0.33  ? 49  GLN A C    4  
ATOM 7110  O O    . GLN A 1 49  ? 0.072   -3.374  3.820   1.00 0.35  ? 49  GLN A O    4  
ATOM 7111  C CB   . GLN A 1 49  ? -3.064  -3.358  4.030   1.00 0.55  ? 49  GLN A CB   4  
ATOM 7112  C CG   . GLN A 1 49  ? -4.471  -3.045  4.491   1.00 0.79  ? 49  GLN A CG   4  
ATOM 7113  C CD   . GLN A 1 49  ? -5.524  -3.669  3.593   1.00 1.36  ? 49  GLN A CD   4  
ATOM 7114  O OE1  . GLN A 1 49  ? -5.291  -4.695  2.956   1.00 2.28  ? 49  GLN A OE1  4  
ATOM 7115  N NE2  . GLN A 1 49  ? -6.694  -3.058  3.539   1.00 1.62  ? 49  GLN A NE2  4  
ATOM 7116  H H    . GLN A 1 49  ? -1.341  -1.175  3.474   1.00 0.39  ? 49  GLN A H    4  
ATOM 7117  H HA   . GLN A 1 49  ? -2.281  -2.603  5.875   1.00 0.56  ? 49  GLN A HA   4  
ATOM 7118  H HB2  . GLN A 1 49  ? -2.981  -3.049  3.005   1.00 0.50  ? 49  GLN A HB2  4  
ATOM 7119  H HB3  . GLN A 1 49  ? -2.925  -4.423  4.088   1.00 0.72  ? 49  GLN A HB3  4  
ATOM 7120  H HG2  . GLN A 1 49  ? -4.603  -3.422  5.494   1.00 1.39  ? 49  GLN A HG2  4  
ATOM 7121  H HG3  . GLN A 1 49  ? -4.599  -1.980  4.487   1.00 1.03  ? 49  GLN A HG3  4  
ATOM 7122  H HE21 . GLN A 1 49  ? -6.818  -2.245  4.075   1.00 1.74  ? 49  GLN A HE21 4  
ATOM 7123  H HE22 . GLN A 1 49  ? -7.394  -3.444  2.973   1.00 2.18  ? 49  GLN A HE22 4  
ATOM 7124  N N    . ALA A 1 50  ? -0.444  -4.287  5.797   1.00 0.34  ? 50  ALA A N    4  
ATOM 7125  C CA   . ALA A 1 50  ? 0.777   -5.069  5.889   1.00 0.28  ? 50  ALA A CA   4  
ATOM 7126  C C    . ALA A 1 50  ? 0.474   -6.470  6.396   1.00 0.32  ? 50  ALA A C    4  
ATOM 7127  O O    . ALA A 1 50  ? -0.531  -6.683  7.076   1.00 0.43  ? 50  ALA A O    4  
ATOM 7128  C CB   . ALA A 1 50  ? 1.762   -4.365  6.802   1.00 0.38  ? 50  ALA A CB   4  
ATOM 7129  H H    . ALA A 1 50  ? -1.114  -4.365  6.509   1.00 0.46  ? 50  ALA A H    4  
ATOM 7130  H HA   . ALA A 1 50  ? 1.218   -5.132  4.905   1.00 0.27  ? 50  ALA A HA   4  
ATOM 7131  H HB1  . ALA A 1 50  ? 2.724   -4.852  6.744   1.00 1.06  ? 50  ALA A HB1  4  
ATOM 7132  H HB2  . ALA A 1 50  ? 1.404   -4.397  7.820   1.00 1.01  ? 50  ALA A HB2  4  
ATOM 7133  H HB3  . ALA A 1 50  ? 1.864   -3.335  6.489   1.00 1.17  ? 50  ALA A HB3  4  
ATOM 7134  N N    . THR A 1 51  ? 1.326   -7.421  6.052   1.00 0.32  ? 51  THR A N    4  
ATOM 7135  C CA   . THR A 1 51  ? 1.131   -8.799  6.470   1.00 0.40  ? 51  THR A CA   4  
ATOM 7136  C C    . THR A 1 51  ? 1.405   -8.982  7.961   1.00 0.53  ? 51  THR A C    4  
ATOM 7137  O O    . THR A 1 51  ? 2.398   -8.476  8.491   1.00 0.55  ? 51  THR A O    4  
ATOM 7138  C CB   . THR A 1 51  ? 2.026   -9.755  5.662   1.00 0.41  ? 51  THR A CB   4  
ATOM 7139  O OG1  . THR A 1 51  ? 3.313   -9.166  5.438   1.00 0.43  ? 51  THR A OG1  4  
ATOM 7140  C CG2  . THR A 1 51  ? 1.380   -10.102 4.334   1.00 0.46  ? 51  THR A CG2  4  
ATOM 7141  H H    . THR A 1 51  ? 2.105   -7.194  5.501   1.00 0.32  ? 51  THR A H    4  
ATOM 7142  H HA   . THR A 1 51  ? 0.102   -9.057  6.272   1.00 0.48  ? 51  THR A HA   4  
ATOM 7143  H HB   . THR A 1 51  ? 2.152   -10.666 6.228   1.00 0.48  ? 51  THR A HB   4  
ATOM 7144  H HG1  . THR A 1 51  ? 3.994   -9.840  5.564   1.00 0.54  ? 51  THR A HG1  4  
ATOM 7145  H HG21 . THR A 1 51  ? 2.046   -10.732 3.762   1.00 1.07  ? 51  THR A HG21 4  
ATOM 7146  H HG22 . THR A 1 51  ? 1.180   -9.196  3.782   1.00 1.05  ? 51  THR A HG22 4  
ATOM 7147  H HG23 . THR A 1 51  ? 0.453   -10.628 4.511   1.00 1.15  ? 51  THR A HG23 4  
ATOM 7148  N N    . PRO A 1 52  ? 0.503   -9.697  8.654   1.00 0.71  ? 52  PRO A N    4  
ATOM 7149  C CA   . PRO A 1 52  ? 0.645   -10.005 10.080  1.00 0.91  ? 52  PRO A CA   4  
ATOM 7150  C C    . PRO A 1 52  ? 1.922   -10.785 10.380  1.00 0.96  ? 52  PRO A C    4  
ATOM 7151  O O    . PRO A 1 52  ? 2.451   -11.496 9.521   1.00 0.88  ? 52  PRO A O    4  
ATOM 7152  C CB   . PRO A 1 52  ? -0.586  -10.861 10.399  1.00 1.10  ? 52  PRO A CB   4  
ATOM 7153  C CG   . PRO A 1 52  ? -1.111  -11.310 9.084   1.00 1.03  ? 52  PRO A CG   4  
ATOM 7154  C CD   . PRO A 1 52  ? -0.739  -10.249 8.096   1.00 0.80  ? 52  PRO A CD   4  
ATOM 7155  H HA   . PRO A 1 52  ? 0.623   -9.109  10.677  1.00 0.95  ? 52  PRO A HA   4  
ATOM 7156  H HB2  . PRO A 1 52  ? -0.292  -11.701 11.009  1.00 1.22  ? 52  PRO A HB2  4  
ATOM 7157  H HB3  . PRO A 1 52  ? -1.314  -10.265 10.930  1.00 1.17  ? 52  PRO A HB3  4  
ATOM 7158  H HG2  . PRO A 1 52  ? -0.659  -12.252 8.809   1.00 1.06  ? 52  PRO A HG2  4  
ATOM 7159  H HG3  . PRO A 1 52  ? -2.183  -11.410 9.136   1.00 1.16  ? 52  PRO A HG3  4  
ATOM 7160  H HD2  . PRO A 1 52  ? -0.565  -10.684 7.124   1.00 0.73  ? 52  PRO A HD2  4  
ATOM 7161  H HD3  . PRO A 1 52  ? -1.508  -9.493  8.044   1.00 0.85  ? 52  PRO A HD3  4  
ATOM 7162  N N    . ALA A 1 53  ? 2.407   -10.648 11.608  1.00 1.16  ? 53  ALA A N    4  
ATOM 7163  C CA   . ALA A 1 53  ? 3.677   -11.243 12.020  1.00 1.29  ? 53  ALA A CA   4  
ATOM 7164  C C    . ALA A 1 53  ? 3.588   -12.760 12.112  1.00 1.31  ? 53  ALA A C    4  
ATOM 7165  O O    . ALA A 1 53  ? 4.606   -13.449 12.166  1.00 1.36  ? 53  ALA A O    4  
ATOM 7166  C CB   . ALA A 1 53  ? 4.115   -10.674 13.355  1.00 1.58  ? 53  ALA A CB   4  
ATOM 7167  H H    . ALA A 1 53  ? 1.889   -10.133 12.268  1.00 1.25  ? 53  ALA A H    4  
ATOM 7168  H HA   . ALA A 1 53  ? 4.422   -10.981 11.283  1.00 1.21  ? 53  ALA A HA   4  
ATOM 7169  H HB1  . ALA A 1 53  ? 4.166   -9.597  13.291  1.00 1.87  ? 53  ALA A HB1  4  
ATOM 7170  H HB2  . ALA A 1 53  ? 5.088   -11.067 13.610  1.00 1.82  ? 53  ALA A HB2  4  
ATOM 7171  H HB3  . ALA A 1 53  ? 3.403   -10.957 14.116  1.00 1.98  ? 53  ALA A HB3  4  
ATOM 7172  N N    . SER A 1 54  ? 2.370   -13.270 12.131  1.00 1.32  ? 54  SER A N    4  
ATOM 7173  C CA   . SER A 1 54  ? 2.136   -14.699 12.223  1.00 1.41  ? 54  SER A CA   4  
ATOM 7174  C C    . SER A 1 54  ? 2.315   -15.373 10.864  1.00 1.26  ? 54  SER A C    4  
ATOM 7175  O O    . SER A 1 54  ? 2.329   -16.602 10.758  1.00 1.35  ? 54  SER A O    4  
ATOM 7176  C CB   . SER A 1 54  ? 0.729   -14.944 12.760  1.00 1.55  ? 54  SER A CB   4  
ATOM 7177  O OG   . SER A 1 54  ? -0.203  -14.076 12.134  1.00 1.49  ? 54  SER A OG   4  
ATOM 7178  H H    . SER A 1 54  ? 1.599   -12.665 12.092  1.00 1.32  ? 54  SER A H    4  
ATOM 7179  H HA   . SER A 1 54  ? 2.855   -15.106 12.916  1.00 1.52  ? 54  SER A HA   4  
ATOM 7180  H HB2  . SER A 1 54  ? 0.443   -15.966 12.562  1.00 1.60  ? 54  SER A HB2  4  
ATOM 7181  H HB3  . SER A 1 54  ? 0.714   -14.764 13.825  1.00 1.70  ? 54  SER A HB3  4  
ATOM 7182  H HG   . SER A 1 54  ? -0.994  -14.576 11.891  1.00 1.65  ? 54  SER A HG   4  
ATOM 7183  N N    . SER A 1 55  ? 2.453   -14.564 9.825   1.00 1.09  ? 55  SER A N    4  
ATOM 7184  C CA   . SER A 1 55  ? 2.633   -15.073 8.478   1.00 1.02  ? 55  SER A CA   4  
ATOM 7185  C C    . SER A 1 55  ? 4.038   -14.738 7.994   1.00 0.94  ? 55  SER A C    4  
ATOM 7186  O O    . SER A 1 55  ? 4.513   -13.618 8.181   1.00 0.99  ? 55  SER A O    4  
ATOM 7187  C CB   . SER A 1 55  ? 1.593   -14.453 7.542   1.00 0.96  ? 55  SER A CB   4  
ATOM 7188  O OG   . SER A 1 55  ? 1.439   -15.218 6.358   1.00 1.32  ? 55  SER A OG   4  
ATOM 7189  H H    . SER A 1 55  ? 2.444   -13.593 9.970   1.00 1.06  ? 55  SER A H    4  
ATOM 7190  H HA   . SER A 1 55  ? 2.507   -16.145 8.499   1.00 1.13  ? 55  SER A HA   4  
ATOM 7191  H HB2  . SER A 1 55  ? 0.643   -14.405 8.046   1.00 1.12  ? 55  SER A HB2  4  
ATOM 7192  H HB3  . SER A 1 55  ? 1.905   -13.455 7.273   1.00 1.06  ? 55  SER A HB3  4  
ATOM 7193  H HG   . SER A 1 55  ? 0.505   -15.476 6.268   1.00 1.49  ? 55  SER A HG   4  
ATOM 7194  N N    . GLU A 1 56  ? 4.700   -15.723 7.395   1.00 0.88  ? 56  GLU A N    4  
ATOM 7195  C CA   . GLU A 1 56  ? 6.030   -15.529 6.829   1.00 0.85  ? 56  GLU A CA   4  
ATOM 7196  C C    . GLU A 1 56  ? 6.020   -14.475 5.740   1.00 0.70  ? 56  GLU A C    4  
ATOM 7197  O O    . GLU A 1 56  ? 6.905   -13.619 5.684   1.00 0.74  ? 56  GLU A O    4  
ATOM 7198  C CB   . GLU A 1 56  ? 6.572   -16.836 6.255   1.00 0.93  ? 56  GLU A CB   4  
ATOM 7199  C CG   . GLU A 1 56  ? 7.263   -16.656 4.920   1.00 1.08  ? 56  GLU A CG   4  
ATOM 7200  C CD   . GLU A 1 56  ? 7.809   -17.943 4.344   1.00 1.75  ? 56  GLU A CD   4  
ATOM 7201  O OE1  . GLU A 1 56  ? 7.058   -18.647 3.638   1.00 2.37  ? 56  GLU A OE1  4  
ATOM 7202  O OE2  . GLU A 1 56  ? 8.997   -18.251 4.583   1.00 2.08  ? 56  GLU A OE2  4  
ATOM 7203  H H    . GLU A 1 56  ? 4.281   -16.609 7.333   1.00 0.92  ? 56  GLU A H    4  
ATOM 7204  H HA   . GLU A 1 56  ? 6.683   -15.204 7.610   1.00 0.96  ? 56  GLU A HA   4  
ATOM 7205  H HB2  . GLU A 1 56  ? 7.284   -17.245 6.944   1.00 1.09  ? 56  GLU A HB2  4  
ATOM 7206  H HB3  . GLU A 1 56  ? 5.758   -17.529 6.129   1.00 0.96  ? 56  GLU A HB3  4  
ATOM 7207  H HG2  . GLU A 1 56  ? 6.548   -16.246 4.236   1.00 1.32  ? 56  GLU A HG2  4  
ATOM 7208  H HG3  . GLU A 1 56  ? 8.071   -15.951 5.041   1.00 1.15  ? 56  GLU A HG3  4  
ATOM 7209  N N    . LYS A 1 57  ? 5.019   -14.549 4.879   1.00 0.62  ? 57  LYS A N    4  
ATOM 7210  C CA   . LYS A 1 57  ? 5.001   -13.742 3.677   1.00 0.54  ? 57  LYS A CA   4  
ATOM 7211  C C    . LYS A 1 57  ? 5.013   -12.256 4.012   1.00 0.48  ? 57  LYS A C    4  
ATOM 7212  O O    . LYS A 1 57  ? 4.405   -11.815 4.992   1.00 0.68  ? 57  LYS A O    4  
ATOM 7213  C CB   . LYS A 1 57  ? 3.811   -14.103 2.801   1.00 0.63  ? 57  LYS A CB   4  
ATOM 7214  C CG   . LYS A 1 57  ? 2.509   -13.936 3.508   1.00 1.10  ? 57  LYS A CG   4  
ATOM 7215  C CD   . LYS A 1 57  ? 1.343   -14.210 2.593   1.00 1.47  ? 57  LYS A CD   4  
ATOM 7216  C CE   . LYS A 1 57  ? 1.506   -15.533 1.880   1.00 1.47  ? 57  LYS A CE   4  
ATOM 7217  N NZ   . LYS A 1 57  ? 0.475   -15.740 0.827   1.00 2.29  ? 57  LYS A NZ   4  
ATOM 7218  H H    . LYS A 1 57  ? 4.274   -15.161 5.064   1.00 0.68  ? 57  LYS A H    4  
ATOM 7219  H HA   . LYS A 1 57  ? 5.891   -13.973 3.145   1.00 0.55  ? 57  LYS A HA   4  
ATOM 7220  H HB2  . LYS A 1 57  ? 3.805   -13.482 1.925   1.00 1.00  ? 57  LYS A HB2  4  
ATOM 7221  H HB3  . LYS A 1 57  ? 3.897   -15.134 2.497   1.00 1.00  ? 57  LYS A HB3  4  
ATOM 7222  H HG2  . LYS A 1 57  ? 2.480   -14.618 4.333   1.00 1.61  ? 57  LYS A HG2  4  
ATOM 7223  H HG3  . LYS A 1 57  ? 2.454   -12.926 3.862   1.00 1.61  ? 57  LYS A HG3  4  
ATOM 7224  H HD2  . LYS A 1 57  ? 0.447   -14.242 3.181   1.00 2.16  ? 57  LYS A HD2  4  
ATOM 7225  H HD3  . LYS A 1 57  ? 1.278   -13.416 1.867   1.00 1.97  ? 57  LYS A HD3  4  
ATOM 7226  H HE2  . LYS A 1 57  ? 2.483   -15.545 1.429   1.00 1.55  ? 57  LYS A HE2  4  
ATOM 7227  H HE3  . LYS A 1 57  ? 1.436   -16.329 2.605   1.00 1.84  ? 57  LYS A HE3  4  
ATOM 7228  H HZ1  . LYS A 1 57  ? -0.475  -15.745 1.249   1.00 2.69  ? 57  LYS A HZ1  4  
ATOM 7229  H HZ2  . LYS A 1 57  ? 0.633   -16.648 0.349   1.00 2.69  ? 57  LYS A HZ2  4  
ATOM 7230  H HZ3  . LYS A 1 57  ? 0.527   -14.979 0.119   1.00 2.71  ? 57  LYS A HZ3  4  
ATOM 7231  N N    . MET A 1 58  ? 5.718   -11.492 3.198   1.00 0.38  ? 58  MET A N    4  
ATOM 7232  C CA   . MET A 1 58  ? 5.961   -10.092 3.487   1.00 0.39  ? 58  MET A CA   4  
ATOM 7233  C C    . MET A 1 58  ? 5.371   -9.206  2.409   1.00 0.33  ? 58  MET A C    4  
ATOM 7234  O O    . MET A 1 58  ? 5.834   -9.200  1.267   1.00 0.40  ? 58  MET A O    4  
ATOM 7235  C CB   . MET A 1 58  ? 7.460   -9.863  3.624   1.00 0.53  ? 58  MET A CB   4  
ATOM 7236  C CG   . MET A 1 58  ? 8.014   -10.422 4.921   1.00 0.81  ? 58  MET A CG   4  
ATOM 7237  S SD   . MET A 1 58  ? 9.747   -10.882 4.808   1.00 1.13  ? 58  MET A SD   4  
ATOM 7238  C CE   . MET A 1 58  ? 9.619   -12.454 3.962   1.00 0.71  ? 58  MET A CE   4  
ATOM 7239  H H    . MET A 1 58  ? 6.079   -11.879 2.370   1.00 0.49  ? 58  MET A H    4  
ATOM 7240  H HA   . MET A 1 58  ? 5.484   -9.861  4.427   1.00 0.43  ? 58  MET A HA   4  
ATOM 7241  H HB2  . MET A 1 58  ? 7.968   -10.341 2.800   1.00 1.04  ? 58  MET A HB2  4  
ATOM 7242  H HB3  . MET A 1 58  ? 7.660   -8.802  3.599   1.00 1.02  ? 58  MET A HB3  4  
ATOM 7243  H HG2  . MET A 1 58  ? 7.906   -9.674  5.691   1.00 1.60  ? 58  MET A HG2  4  
ATOM 7244  H HG3  . MET A 1 58  ? 7.440   -11.297 5.191   1.00 1.52  ? 58  MET A HG3  4  
ATOM 7245  H HE1  . MET A 1 58  ? 9.029   -13.137 4.558   1.00 1.18  ? 58  MET A HE1  4  
ATOM 7246  H HE2  . MET A 1 58  ? 10.609  -12.862 3.816   1.00 1.35  ? 58  MET A HE2  4  
ATOM 7247  H HE3  . MET A 1 58  ? 9.144   -12.310 3.002   1.00 1.18  ? 58  MET A HE3  4  
ATOM 7248  N N    . MET A 1 59  ? 4.357   -8.446  2.786   1.00 0.29  ? 59  MET A N    4  
ATOM 7249  C CA   . MET A 1 59  ? 3.616   -7.645  1.833   1.00 0.26  ? 59  MET A CA   4  
ATOM 7250  C C    . MET A 1 59  ? 3.252   -6.292  2.418   1.00 0.24  ? 59  MET A C    4  
ATOM 7251  O O    . MET A 1 59  ? 2.927   -6.182  3.603   1.00 0.29  ? 59  MET A O    4  
ATOM 7252  C CB   . MET A 1 59  ? 2.330   -8.364  1.445   1.00 0.32  ? 59  MET A CB   4  
ATOM 7253  C CG   . MET A 1 59  ? 2.080   -8.423  -0.047  1.00 0.38  ? 59  MET A CG   4  
ATOM 7254  S SD   . MET A 1 59  ? 3.204   -9.541  -0.900  1.00 0.49  ? 59  MET A SD   4  
ATOM 7255  C CE   . MET A 1 59  ? 2.774   -11.101 -0.133  1.00 0.63  ? 59  MET A CE   4  
ATOM 7256  H H    . MET A 1 59  ? 4.095   -8.426  3.734   1.00 0.34  ? 59  MET A H    4  
ATOM 7257  H HA   . MET A 1 59  ? 4.224   -7.504  0.954   1.00 0.25  ? 59  MET A HA   4  
ATOM 7258  H HB2  . MET A 1 59  ? 2.367   -9.371  1.823   1.00 0.42  ? 59  MET A HB2  4  
ATOM 7259  H HB3  . MET A 1 59  ? 1.498   -7.851  1.904   1.00 0.34  ? 59  MET A HB3  4  
ATOM 7260  H HG2  . MET A 1 59  ? 1.072   -8.759  -0.215  1.00 0.45  ? 59  MET A HG2  4  
ATOM 7261  H HG3  . MET A 1 59  ? 2.200   -7.431  -0.454  1.00 0.40  ? 59  MET A HG3  4  
ATOM 7262  H HE1  . MET A 1 59  ? 1.722   -11.296 -0.280  1.00 1.24  ? 59  MET A HE1  4  
ATOM 7263  H HE2  . MET A 1 59  ? 2.988   -11.055 0.924   1.00 1.09  ? 59  MET A HE2  4  
ATOM 7264  H HE3  . MET A 1 59  ? 3.352   -11.894 -0.581  1.00 1.26  ? 59  MET A HE3  4  
ATOM 7265  N N    . LEU A 1 60  ? 3.310   -5.273  1.582   1.00 0.20  ? 60  LEU A N    4  
ATOM 7266  C CA   . LEU A 1 60  ? 2.770   -3.972  1.927   1.00 0.19  ? 60  LEU A CA   4  
ATOM 7267  C C    . LEU A 1 60  ? 1.758   -3.552  0.879   1.00 0.21  ? 60  LEU A C    4  
ATOM 7268  O O    . LEU A 1 60  ? 1.918   -3.839  -0.309  1.00 0.25  ? 60  LEU A O    4  
ATOM 7269  C CB   . LEU A 1 60  ? 3.855   -2.893  2.036   1.00 0.21  ? 60  LEU A CB   4  
ATOM 7270  C CG   . LEU A 1 60  ? 4.211   -2.434  3.456   1.00 0.26  ? 60  LEU A CG   4  
ATOM 7271  C CD1  . LEU A 1 60  ? 2.978   -2.361  4.322   1.00 0.48  ? 60  LEU A CD1  4  
ATOM 7272  C CD2  . LEU A 1 60  ? 5.229   -3.340  4.104   1.00 0.40  ? 60  LEU A CD2  4  
ATOM 7273  H H    . LEU A 1 60  ? 3.718   -5.404  0.696   1.00 0.21  ? 60  LEU A H    4  
ATOM 7274  H HA   . LEU A 1 60  ? 2.267   -4.068  2.879   1.00 0.18  ? 60  LEU A HA   4  
ATOM 7275  H HB2  . LEU A 1 60  ? 4.745   -3.267  1.568   1.00 0.28  ? 60  LEU A HB2  4  
ATOM 7276  H HB3  . LEU A 1 60  ? 3.518   -2.026  1.486   1.00 0.21  ? 60  LEU A HB3  4  
ATOM 7277  H HG   . LEU A 1 60  ? 4.640   -1.442  3.402   1.00 0.52  ? 60  LEU A HG   4  
ATOM 7278  H HD11 . LEU A 1 60  ? 2.155   -1.961  3.752   1.00 1.23  ? 60  LEU A HD11 4  
ATOM 7279  H HD12 . LEU A 1 60  ? 3.173   -1.721  5.170   1.00 0.99  ? 60  LEU A HD12 4  
ATOM 7280  H HD13 . LEU A 1 60  ? 2.732   -3.357  4.673   1.00 1.17  ? 60  LEU A HD13 4  
ATOM 7281  H HD21 . LEU A 1 60  ? 4.954   -4.369  3.934   1.00 1.03  ? 60  LEU A HD21 4  
ATOM 7282  H HD22 . LEU A 1 60  ? 5.244   -3.141  5.172   1.00 1.14  ? 60  LEU A HD22 4  
ATOM 7283  H HD23 . LEU A 1 60  ? 6.205   -3.146  3.687   1.00 1.12  ? 60  LEU A HD23 4  
ATOM 7284  N N    . ARG A 1 61  ? 0.716   -2.892  1.328   1.00 0.22  ? 61  ARG A N    4  
ATOM 7285  C CA   . ARG A 1 61  ? -0.282  -2.335  0.427   1.00 0.25  ? 61  ARG A CA   4  
ATOM 7286  C C    . ARG A 1 61  ? -0.377  -0.836  0.586   1.00 0.26  ? 61  ARG A C    4  
ATOM 7287  O O    . ARG A 1 61  ? -0.245  -0.298  1.684   1.00 0.31  ? 61  ARG A O    4  
ATOM 7288  C CB   . ARG A 1 61  ? -1.677  -2.898  0.666   1.00 0.31  ? 61  ARG A CB   4  
ATOM 7289  C CG   . ARG A 1 61  ? -2.046  -4.108  -0.174  1.00 0.40  ? 61  ARG A CG   4  
ATOM 7290  C CD   . ARG A 1 61  ? -3.472  -4.542  0.130   1.00 0.56  ? 61  ARG A CD   4  
ATOM 7291  N NE   . ARG A 1 61  ? -3.975  -5.558  -0.796  1.00 1.20  ? 61  ARG A NE   4  
ATOM 7292  C CZ   . ARG A 1 61  ? -5.013  -6.354  -0.524  1.00 1.42  ? 61  ARG A CZ   4  
ATOM 7293  N NH1  . ARG A 1 61  ? -5.621  -6.278  0.653   1.00 1.03  ? 61  ARG A NH1  4  
ATOM 7294  N NH2  . ARG A 1 61  ? -5.441  -7.225  -1.429  1.00 2.37  ? 61  ARG A NH2  4  
ATOM 7295  H H    . ARG A 1 61  ? 0.622   -2.765  2.305   1.00 0.24  ? 61  ARG A H    4  
ATOM 7296  H HA   . ARG A 1 61  ? 0.021   -2.568  -0.586  1.00 0.26  ? 61  ARG A HA   4  
ATOM 7297  H HB2  . ARG A 1 61  ? -1.761  -3.174  1.702   1.00 0.33  ? 61  ARG A HB2  4  
ATOM 7298  H HB3  . ARG A 1 61  ? -2.396  -2.108  0.448   1.00 0.35  ? 61  ARG A HB3  4  
ATOM 7299  H HG2  . ARG A 1 61  ? -1.967  -3.851  -1.220  1.00 0.46  ? 61  ARG A HG2  4  
ATOM 7300  H HG3  . ARG A 1 61  ? -1.372  -4.920  0.056   1.00 0.41  ? 61  ARG A HG3  4  
ATOM 7301  H HD2  . ARG A 1 61  ? -3.503  -4.943  1.132   1.00 0.96  ? 61  ARG A HD2  4  
ATOM 7302  H HD3  . ARG A 1 61  ? -4.114  -3.674  0.076   1.00 1.24  ? 61  ARG A HD3  4  
ATOM 7303  H HE   . ARG A 1 61  ? -3.529  -5.639  -1.669  1.00 1.81  ? 61  ARG A HE   4  
ATOM 7304  H HH11 . ARG A 1 61  ? -5.306  -5.624  1.351   1.00 1.07  ? 61  ARG A HH11 4  
ATOM 7305  H HH12 . ARG A 1 61  ? -6.404  -6.873  0.855   1.00 1.28  ? 61  ARG A HH12 4  
ATOM 7306  H HH21 . ARG A 1 61  ? -4.991  -7.287  -2.325  1.00 2.99  ? 61  ARG A HH21 4  
ATOM 7307  H HH22 . ARG A 1 61  ? -6.213  -7.828  -1.220  1.00 2.55  ? 61  ARG A HH22 4  
ATOM 7308  N N    . LEU A 1 62  ? -0.646  -0.191  -0.518  1.00 0.28  ? 62  LEU A N    4  
ATOM 7309  C CA   . LEU A 1 62  ? -0.923  1.224   -0.556  1.00 0.28  ? 62  LEU A CA   4  
ATOM 7310  C C    . LEU A 1 62  ? -2.392  1.407   -0.875  1.00 0.28  ? 62  LEU A C    4  
ATOM 7311  O O    . LEU A 1 62  ? -2.811  1.152   -2.006  1.00 0.33  ? 62  LEU A O    4  
ATOM 7312  C CB   . LEU A 1 62  ? -0.098  1.874   -1.656  1.00 0.31  ? 62  LEU A CB   4  
ATOM 7313  C CG   . LEU A 1 62  ? 1.333   2.273   -1.313  1.00 0.37  ? 62  LEU A CG   4  
ATOM 7314  C CD1  . LEU A 1 62  ? 1.381   3.219   -0.128  1.00 0.70  ? 62  LEU A CD1  4  
ATOM 7315  C CD2  . LEU A 1 62  ? 2.195   1.051   -1.069  1.00 0.68  ? 62  LEU A CD2  4  
ATOM 7316  H H    . LEU A 1 62  ? -0.666  -0.697  -1.362  1.00 0.34  ? 62  LEU A H    4  
ATOM 7317  H HA   . LEU A 1 62  ? -0.684  1.665   0.405   1.00 0.27  ? 62  LEU A HA   4  
ATOM 7318  H HB2  . LEU A 1 62  ? -0.049  1.165   -2.459  1.00 0.39  ? 62  LEU A HB2  4  
ATOM 7319  H HB3  . LEU A 1 62  ? -0.621  2.748   -2.010  1.00 0.33  ? 62  LEU A HB3  4  
ATOM 7320  H HG   . LEU A 1 62  ? 1.739   2.794   -2.154  1.00 0.72  ? 62  LEU A HG   4  
ATOM 7321  H HD11 . LEU A 1 62  ? 0.996   2.722   0.748   1.00 1.29  ? 62  LEU A HD11 4  
ATOM 7322  H HD12 . LEU A 1 62  ? 0.780   4.091   -0.343  1.00 1.45  ? 62  LEU A HD12 4  
ATOM 7323  H HD13 . LEU A 1 62  ? 2.403   3.521   0.045   1.00 1.20  ? 62  LEU A HD13 4  
ATOM 7324  H HD21 . LEU A 1 62  ? 2.166   0.416   -1.943  1.00 1.18  ? 62  LEU A HD21 4  
ATOM 7325  H HD22 . LEU A 1 62  ? 1.818   0.507   -0.216  1.00 1.33  ? 62  LEU A HD22 4  
ATOM 7326  H HD23 . LEU A 1 62  ? 3.212   1.360   -0.882  1.00 1.28  ? 62  LEU A HD23 4  
ATOM 7327  N N    . ILE A 1 63  ? -3.182  1.811   0.095   1.00 0.26  ? 63  ILE A N    4  
ATOM 7328  C CA   . ILE A 1 63  ? -4.597  2.001   -0.151  1.00 0.26  ? 63  ILE A CA   4  
ATOM 7329  C C    . ILE A 1 63  ? -4.822  3.424   -0.628  1.00 0.25  ? 63  ILE A C    4  
ATOM 7330  O O    . ILE A 1 63  ? -4.868  4.340   0.182   1.00 0.24  ? 63  ILE A O    4  
ATOM 7331  C CB   . ILE A 1 63  ? -5.445  1.777   1.113   1.00 0.27  ? 63  ILE A CB   4  
ATOM 7332  C CG1  . ILE A 1 63  ? -4.986  0.526   1.868   1.00 0.32  ? 63  ILE A CG1  4  
ATOM 7333  C CG2  . ILE A 1 63  ? -6.919  1.673   0.741   1.00 0.33  ? 63  ILE A CG2  4  
ATOM 7334  C CD1  . ILE A 1 63  ? -5.319  -0.765  1.189   1.00 0.41  ? 63  ILE A CD1  4  
ATOM 7335  H H    . ILE A 1 63  ? -2.809  2.008   0.984   1.00 0.25  ? 63  ILE A H    4  
ATOM 7336  H HA   . ILE A 1 63  ? -4.905  1.297   -0.909  1.00 0.29  ? 63  ILE A HA   4  
ATOM 7337  H HB   . ILE A 1 63  ? -5.323  2.639   1.750   1.00 0.28  ? 63  ILE A HB   4  
ATOM 7338  H HG12 . ILE A 1 63  ? -3.916  0.564   1.986   1.00 0.36  ? 63  ILE A HG12 4  
ATOM 7339  H HG13 . ILE A 1 63  ? -5.450  0.509   2.838   1.00 0.39  ? 63  ILE A HG13 4  
ATOM 7340  H HG21 . ILE A 1 63  ? -7.228  2.579   0.237   1.00 1.10  ? 63  ILE A HG21 4  
ATOM 7341  H HG22 . ILE A 1 63  ? -7.508  1.541   1.636   1.00 1.02  ? 63  ILE A HG22 4  
ATOM 7342  H HG23 . ILE A 1 63  ? -7.066  0.827   0.084   1.00 1.11  ? 63  ILE A HG23 4  
ATOM 7343  H HD11 . ILE A 1 63  ? -4.734  -0.859  0.290   1.00 1.24  ? 63  ILE A HD11 4  
ATOM 7344  H HD12 . ILE A 1 63  ? -6.370  -0.767  0.942   1.00 0.97  ? 63  ILE A HD12 4  
ATOM 7345  H HD13 . ILE A 1 63  ? -5.103  -1.583  1.856   1.00 1.08  ? 63  ILE A HD13 4  
ATOM 7346  N N    . GLY A 1 64  ? -4.951  3.610   -1.931  1.00 0.28  ? 64  GLY A N    4  
ATOM 7347  C CA   . GLY A 1 64  ? -5.050  4.953   -2.471  1.00 0.27  ? 64  GLY A CA   4  
ATOM 7348  C C    . GLY A 1 64  ? -6.342  5.648   -2.093  1.00 0.29  ? 64  GLY A C    4  
ATOM 7349  O O    . GLY A 1 64  ? -7.360  4.999   -1.859  1.00 0.37  ? 64  GLY A O    4  
ATOM 7350  H H    . GLY A 1 64  ? -4.988  2.837   -2.532  1.00 0.32  ? 64  GLY A H    4  
ATOM 7351  H HA2  . GLY A 1 64  ? -4.224  5.534   -2.097  1.00 0.26  ? 64  GLY A HA2  4  
ATOM 7352  H HA3  . GLY A 1 64  ? -4.977  4.909   -3.542  1.00 0.33  ? 64  GLY A HA3  4  
ATOM 7353  N N    . LYS A 1 65  ? -6.292  6.971   -2.030  1.00 0.34  ? 65  LYS A N    4  
ATOM 7354  C CA   . LYS A 1 65  ? -7.442  7.771   -1.659  1.00 0.41  ? 65  LYS A CA   4  
ATOM 7355  C C    . LYS A 1 65  ? -8.478  7.809   -2.749  1.00 0.60  ? 65  LYS A C    4  
ATOM 7356  O O    . LYS A 1 65  ? -8.179  7.644   -3.934  1.00 0.80  ? 65  LYS A O    4  
ATOM 7357  C CB   . LYS A 1 65  ? -7.040  9.191   -1.335  1.00 0.53  ? 65  LYS A CB   4  
ATOM 7358  C CG   . LYS A 1 65  ? -6.615  9.377   0.070   1.00 0.50  ? 65  LYS A CG   4  
ATOM 7359  C CD   . LYS A 1 65  ? -6.065  10.753  0.241   1.00 0.68  ? 65  LYS A CD   4  
ATOM 7360  C CE   . LYS A 1 65  ? -5.549  10.910  1.630   1.00 0.91  ? 65  LYS A CE   4  
ATOM 7361  N NZ   . LYS A 1 65  ? -5.534  12.328  2.069   1.00 1.16  ? 65  LYS A NZ   4  
ATOM 7362  H H    . LYS A 1 65  ? -5.450  7.427   -2.251  1.00 0.41  ? 65  LYS A H    4  
ATOM 7363  H HA   . LYS A 1 65  ? -7.876  7.337   -0.773  1.00 0.37  ? 65  LYS A HA   4  
ATOM 7364  H HB2  . LYS A 1 65  ? -6.216  9.478   -1.949  1.00 0.66  ? 65  LYS A HB2  4  
ATOM 7365  H HB3  . LYS A 1 65  ? -7.874  9.848   -1.528  1.00 0.67  ? 65  LYS A HB3  4  
ATOM 7366  H HG2  . LYS A 1 65  ? -7.465  9.246   0.723   1.00 0.58  ? 65  LYS A HG2  4  
ATOM 7367  H HG3  . LYS A 1 65  ? -5.848  8.656   0.311   1.00 0.52  ? 65  LYS A HG3  4  
ATOM 7368  H HD2  . LYS A 1 65  ? -5.270  10.887  -0.465  1.00 0.90  ? 65  LYS A HD2  4  
ATOM 7369  H HD3  . LYS A 1 65  ? -6.842  11.477  0.058   1.00 0.68  ? 65  LYS A HD3  4  
ATOM 7370  H HE2  . LYS A 1 65  ? -6.191  10.334  2.264   1.00 0.98  ? 65  LYS A HE2  4  
ATOM 7371  H HE3  . LYS A 1 65  ? -4.546  10.511  1.676   1.00 1.08  ? 65  LYS A HE3  4  
ATOM 7372  H HZ1  . LYS A 1 65  ? -5.209  12.397  3.054   1.00 1.67  ? 65  LYS A HZ1  4  
ATOM 7373  H HZ2  . LYS A 1 65  ? -6.489  12.733  2.004   1.00 1.54  ? 65  LYS A HZ2  4  
ATOM 7374  H HZ3  . LYS A 1 65  ? -4.895  12.883  1.464   1.00 1.48  ? 65  LYS A HZ3  4  
ATOM 7375  N N    . VAL A 1 66  ? -9.695  8.028   -2.326  1.00 0.67  ? 66  VAL A N    4  
ATOM 7376  C CA   . VAL A 1 66  ? -10.816 8.129   -3.230  1.00 1.01  ? 66  VAL A CA   4  
ATOM 7377  C C    . VAL A 1 66  ? -11.459 9.500   -3.135  1.00 1.29  ? 66  VAL A C    4  
ATOM 7378  O O    . VAL A 1 66  ? -11.618 10.050  -2.043  1.00 1.39  ? 66  VAL A O    4  
ATOM 7379  C CB   . VAL A 1 66  ? -11.871 7.038   -2.970  1.00 1.12  ? 66  VAL A CB   4  
ATOM 7380  C CG1  . VAL A 1 66  ? -11.354 5.689   -3.429  1.00 1.26  ? 66  VAL A CG1  4  
ATOM 7381  C CG2  . VAL A 1 66  ? -12.256 6.981   -1.502  1.00 1.48  ? 66  VAL A CG2  4  
ATOM 7382  H H    . VAL A 1 66  ? -9.835  8.182   -1.368  1.00 0.65  ? 66  VAL A H    4  
ATOM 7383  H HA   . VAL A 1 66  ? -10.438 7.996   -4.234  1.00 1.28  ? 66  VAL A HA   4  
ATOM 7384  H HB   . VAL A 1 66  ? -12.751 7.275   -3.542  1.00 1.58  ? 66  VAL A HB   4  
ATOM 7385  H HG11 . VAL A 1 66  ? -11.152 5.721   -4.489  1.00 1.62  ? 66  VAL A HG11 4  
ATOM 7386  H HG12 . VAL A 1 66  ? -12.096 4.931   -3.227  1.00 1.87  ? 66  VAL A HG12 4  
ATOM 7387  H HG13 . VAL A 1 66  ? -10.444 5.454   -2.896  1.00 1.61  ? 66  VAL A HG13 4  
ATOM 7388  H HG21 . VAL A 1 66  ? -12.625 7.947   -1.190  1.00 1.91  ? 66  VAL A HG21 4  
ATOM 7389  H HG22 . VAL A 1 66  ? -11.390 6.715   -0.913  1.00 2.10  ? 66  VAL A HG22 4  
ATOM 7390  H HG23 . VAL A 1 66  ? -13.028 6.239   -1.363  1.00 1.76  ? 66  VAL A HG23 4  
ATOM 7391  N N    . ASP A 1 67  ? -11.814 10.058  -4.273  1.00 1.84  ? 67  ASP A N    4  
ATOM 7392  C CA   . ASP A 1 67  ? -12.579 11.288  -4.297  1.00 2.24  ? 67  ASP A CA   4  
ATOM 7393  C C    . ASP A 1 67  ? -14.065 10.943  -4.348  1.00 2.23  ? 67  ASP A C    4  
ATOM 7394  O O    . ASP A 1 67  ? -14.721 11.036  -5.385  1.00 2.60  ? 67  ASP A O    4  
ATOM 7395  C CB   . ASP A 1 67  ? -12.153 12.184  -5.477  1.00 3.07  ? 67  ASP A CB   4  
ATOM 7396  C CG   . ASP A 1 67  ? -12.269 11.514  -6.839  1.00 3.61  ? 67  ASP A CG   4  
ATOM 7397  O OD1  . ASP A 1 67  ? -11.920 10.321  -6.963  1.00 4.14  ? 67  ASP A OD1  4  
ATOM 7398  O OD2  . ASP A 1 67  ? -12.682 12.189  -7.805  1.00 3.94  ? 67  ASP A OD2  4  
ATOM 7399  H H    . ASP A 1 67  ? -11.558 9.633   -5.120  1.00 2.14  ? 67  ASP A H    4  
ATOM 7400  H HA   . ASP A 1 67  ? -12.383 11.810  -3.371  1.00 2.38  ? 67  ASP A HA   4  
ATOM 7401  H HB2  . ASP A 1 67  ? -12.773 13.066  -5.485  1.00 3.41  ? 67  ASP A HB2  4  
ATOM 7402  H HB3  . ASP A 1 67  ? -11.124 12.481  -5.332  1.00 3.48  ? 67  ASP A HB3  4  
ATOM 7403  N N    . GLU A 1 68  ? -14.594 10.577  -3.191  1.00 2.48  ? 68  GLU A N    4  
ATOM 7404  C CA   . GLU A 1 68  ? -15.949 10.078  -3.074  1.00 2.96  ? 68  GLU A CA   4  
ATOM 7405  C C    . GLU A 1 68  ? -16.951 11.218  -3.143  1.00 3.03  ? 68  GLU A C    4  
ATOM 7406  O O    . GLU A 1 68  ? -18.097 11.040  -3.548  1.00 3.47  ? 68  GLU A O    4  
ATOM 7407  C CB   . GLU A 1 68  ? -16.117 9.296   -1.767  1.00 3.79  ? 68  GLU A CB   4  
ATOM 7408  C CG   . GLU A 1 68  ? -15.101 9.616   -0.693  1.00 4.24  ? 68  GLU A CG   4  
ATOM 7409  C CD   . GLU A 1 68  ? -15.185 11.045  -0.185  1.00 4.33  ? 68  GLU A CD   4  
ATOM 7410  O OE1  . GLU A 1 68  ? -14.578 11.943  -0.806  1.00 4.61  ? 68  GLU A OE1  4  
ATOM 7411  O OE2  . GLU A 1 68  ? -15.866 11.276  0.835   1.00 4.54  ? 68  GLU A OE2  4  
ATOM 7412  H H    . GLU A 1 68  ? -14.064 10.671  -2.374  1.00 2.75  ? 68  GLU A H    4  
ATOM 7413  H HA   . GLU A 1 68  ? -16.120 9.410   -3.897  1.00 3.16  ? 68  GLU A HA   4  
ATOM 7414  H HB2  . GLU A 1 68  ? -17.072 9.522   -1.362  1.00 4.05  ? 68  GLU A HB2  4  
ATOM 7415  H HB3  . GLU A 1 68  ? -16.063 8.239   -1.979  1.00 4.24  ? 68  GLU A HB3  4  
ATOM 7416  H HG2  . GLU A 1 68  ? -15.267 8.950   0.136   1.00 4.79  ? 68  GLU A HG2  4  
ATOM 7417  H HG3  . GLU A 1 68  ? -14.124 9.446   -1.100  1.00 4.43  ? 68  GLU A HG3  4  
ATOM 7418  N N    . SER A 1 69  ? -16.498 12.387  -2.740  1.00 3.10  ? 69  SER A N    4  
ATOM 7419  C CA   . SER A 1 69  ? -17.314 13.582  -2.766  1.00 3.63  ? 69  SER A CA   4  
ATOM 7420  C C    . SER A 1 69  ? -17.292 14.229  -4.149  1.00 3.71  ? 69  SER A C    4  
ATOM 7421  O O    . SER A 1 69  ? -18.015 15.191  -4.407  1.00 4.40  ? 69  SER A O    4  
ATOM 7422  C CB   . SER A 1 69  ? -16.804 14.550  -1.701  1.00 4.49  ? 69  SER A CB   4  
ATOM 7423  O OG   . SER A 1 69  ? -15.391 14.459  -1.582  1.00 4.68  ? 69  SER A OG   4  
ATOM 7424  H H    . SER A 1 69  ? -15.580 12.447  -2.389  1.00 3.14  ? 69  SER A H    4  
ATOM 7425  H HA   . SER A 1 69  ? -18.326 13.299  -2.528  1.00 3.90  ? 69  SER A HA   4  
ATOM 7426  H HB2  . SER A 1 69  ? -17.068 15.555  -1.972  1.00 4.89  ? 69  SER A HB2  4  
ATOM 7427  H HB3  . SER A 1 69  ? -17.249 14.309  -0.754  1.00 4.96  ? 69  SER A HB3  4  
ATOM 7428  H HG   . SER A 1 69  ? -15.163 13.681  -1.044  1.00 4.92  ? 69  SER A HG   4  
ATOM 7429  N N    . LYS A 1 70  ? -16.466 13.693  -5.041  1.00 3.46  ? 70  LYS A N    4  
ATOM 7430  C CA   . LYS A 1 70  ? -16.373 14.221  -6.395  1.00 4.25  ? 70  LYS A CA   4  
ATOM 7431  C C    . LYS A 1 70  ? -16.953 13.240  -7.405  1.00 4.39  ? 70  LYS A C    4  
ATOM 7432  O O    . LYS A 1 70  ? -17.317 13.629  -8.516  1.00 5.30  ? 70  LYS A O    4  
ATOM 7433  C CB   . LYS A 1 70  ? -14.924 14.549  -6.752  1.00 4.65  ? 70  LYS A CB   4  
ATOM 7434  C CG   . LYS A 1 70  ? -14.287 15.573  -5.847  1.00 5.30  ? 70  LYS A CG   4  
ATOM 7435  C CD   . LYS A 1 70  ? -12.907 15.941  -6.339  1.00 5.73  ? 70  LYS A CD   4  
ATOM 7436  C CE   . LYS A 1 70  ? -12.078 16.490  -5.208  1.00 6.36  ? 70  LYS A CE   4  
ATOM 7437  N NZ   . LYS A 1 70  ? -10.701 16.848  -5.638  1.00 6.99  ? 70  LYS A NZ   4  
ATOM 7438  H H    . LYS A 1 70  ? -15.912 12.928  -4.782  1.00 3.05  ? 70  LYS A H    4  
ATOM 7439  H HA   . LYS A 1 70  ? -16.953 15.132  -6.429  1.00 4.88  ? 70  LYS A HA   4  
ATOM 7440  H HB2  . LYS A 1 70  ? -14.332 13.649  -6.686  1.00 4.40  ? 70  LYS A HB2  4  
ATOM 7441  H HB3  . LYS A 1 70  ? -14.890 14.921  -7.766  1.00 5.12  ? 70  LYS A HB3  4  
ATOM 7442  H HG2  . LYS A 1 70  ? -14.899 16.459  -5.824  1.00 5.74  ? 70  LYS A HG2  4  
ATOM 7443  H HG3  . LYS A 1 70  ? -14.207 15.161  -4.852  1.00 5.41  ? 70  LYS A HG3  4  
ATOM 7444  H HD2  . LYS A 1 70  ? -12.426 15.059  -6.735  1.00 5.78  ? 70  LYS A HD2  4  
ATOM 7445  H HD3  . LYS A 1 70  ? -12.994 16.690  -7.112  1.00 5.93  ? 70  LYS A HD3  4  
ATOM 7446  H HE2  . LYS A 1 70  ? -12.565 17.370  -4.813  1.00 6.60  ? 70  LYS A HE2  4  
ATOM 7447  H HE3  . LYS A 1 70  ? -12.031 15.733  -4.445  1.00 6.43  ? 70  LYS A HE3  4  
ATOM 7448  H HZ1  . LYS A 1 70  ? -10.228 16.019  -6.047  1.00 6.98  ? 70  LYS A HZ1  4  
ATOM 7449  H HZ2  . LYS A 1 70  ? -10.149 17.180  -4.823  1.00 7.36  ? 70  LYS A HZ2  4  
ATOM 7450  H HZ3  . LYS A 1 70  ? -10.732 17.605  -6.352  1.00 7.35  ? 70  LYS A HZ3  4  
ATOM 7451  N N    . LYS A 1 71  ? -17.033 11.971  -7.022  1.00 3.86  ? 71  LYS A N    4  
ATOM 7452  C CA   . LYS A 1 71  ? -17.612 10.955  -7.888  1.00 4.42  ? 71  LYS A CA   4  
ATOM 7453  C C    . LYS A 1 71  ? -19.099 11.175  -8.070  1.00 4.63  ? 71  LYS A C    4  
ATOM 7454  O O    . LYS A 1 71  ? -19.754 11.842  -7.270  1.00 4.42  ? 71  LYS A O    4  
ATOM 7455  C CB   . LYS A 1 71  ? -17.351 9.558   -7.372  1.00 4.55  ? 71  LYS A CB   4  
ATOM 7456  C CG   . LYS A 1 71  ? -16.383 8.812   -8.214  1.00 5.51  ? 71  LYS A CG   4  
ATOM 7457  C CD   . LYS A 1 71  ? -15.046 9.453   -8.140  1.00 6.15  ? 71  LYS A CD   4  
ATOM 7458  C CE   . LYS A 1 71  ? -14.210 9.021   -9.300  1.00 7.31  ? 71  LYS A CE   4  
ATOM 7459  N NZ   . LYS A 1 71  ? -12.936 9.776   -9.391  1.00 8.20  ? 71  LYS A NZ   4  
ATOM 7460  H H    . LYS A 1 71  ? -16.696 11.712  -6.139  1.00 3.38  ? 71  LYS A H    4  
ATOM 7461  H HA   . LYS A 1 71  ? -17.134 11.042  -8.851  1.00 5.06  ? 71  LYS A HA   4  
ATOM 7462  H HB2  . LYS A 1 71  ? -16.939 9.625   -6.395  1.00 4.44  ? 71  LYS A HB2  4  
ATOM 7463  H HB3  . LYS A 1 71  ? -18.263 9.004   -7.354  1.00 4.51  ? 71  LYS A HB3  4  
ATOM 7464  H HG2  . LYS A 1 71  ? -16.306 7.813   -7.853  1.00 5.66  ? 71  LYS A HG2  4  
ATOM 7465  H HG3  . LYS A 1 71  ? -16.724 8.813   -9.236  1.00 5.91  ? 71  LYS A HG3  4  
ATOM 7466  H HD2  . LYS A 1 71  ? -15.172 10.519  -8.164  1.00 6.23  ? 71  LYS A HD2  4  
ATOM 7467  H HD3  . LYS A 1 71  ? -14.578 9.154   -7.222  1.00 5.97  ? 71  LYS A HD3  4  
ATOM 7468  H HE2  . LYS A 1 71  ? -14.003 7.968   -9.203  1.00 7.38  ? 71  LYS A HE2  4  
ATOM 7469  H HE3  . LYS A 1 71  ? -14.795 9.196   -10.184 1.00 7.65  ? 71  LYS A HE3  4  
ATOM 7470  H HZ1  . LYS A 1 71  ? -13.126 10.765  -9.655  1.00 8.38  ? 71  LYS A HZ1  4  
ATOM 7471  H HZ2  . LYS A 1 71  ? -12.312 9.351   -10.105 1.00 8.58  ? 71  LYS A HZ2  4  
ATOM 7472  H HZ3  . LYS A 1 71  ? -12.446 9.770   -8.466  1.00 8.49  ? 71  LYS A HZ3  4  
ATOM 7473  N N    . ARG A 1 72  ? -19.612 10.600  -9.130  1.00 5.41  ? 72  ARG A N    4  
ATOM 7474  C CA   . ARG A 1 72  ? -20.971 10.854  -9.570  1.00 5.92  ? 72  ARG A CA   4  
ATOM 7475  C C    . ARG A 1 72  ? -21.710 9.553   -9.837  1.00 5.77  ? 72  ARG A C    4  
ATOM 7476  O O    . ARG A 1 72  ? -21.105 8.481   -9.895  1.00 5.54  ? 72  ARG A O    4  
ATOM 7477  C CB   . ARG A 1 72  ? -20.936 11.698  -10.841 1.00 6.97  ? 72  ARG A CB   4  
ATOM 7478  C CG   . ARG A 1 72  ? -20.132 12.971  -10.684 1.00 7.56  ? 72  ARG A CG   4  
ATOM 7479  C CD   . ARG A 1 72  ? -19.982 13.716  -12.000 1.00 8.44  ? 72  ARG A CD   4  
ATOM 7480  N NE   . ARG A 1 72  ? -19.252 12.930  -12.995 1.00 9.04  ? 72  ARG A NE   4  
ATOM 7481  C CZ   . ARG A 1 72  ? -18.401 13.445  -13.881 1.00 10.00 ? 72  ARG A CZ   4  
ATOM 7482  N NH1  . ARG A 1 72  ? -18.155 14.749  -13.901 1.00 10.44 ? 72  ARG A NH1  4  
ATOM 7483  N NH2  . ARG A 1 72  ? -17.794 12.651  -14.752 1.00 10.67 ? 72  ARG A NH2  4  
ATOM 7484  H H    . ARG A 1 72  ? -19.059 9.967   -9.627  1.00 5.81  ? 72  ARG A H    4  
ATOM 7485  H HA   . ARG A 1 72  ? -21.481 11.400  -8.796  1.00 5.94  ? 72  ARG A HA   4  
ATOM 7486  H HB2  . ARG A 1 72  ? -20.502 11.115  -11.636 1.00 7.23  ? 72  ARG A HB2  4  
ATOM 7487  H HB3  . ARG A 1 72  ? -21.946 11.968  -11.110 1.00 7.35  ? 72  ARG A HB3  4  
ATOM 7488  H HG2  . ARG A 1 72  ? -20.633 13.603  -9.974  1.00 7.62  ? 72  ARG A HG2  4  
ATOM 7489  H HG3  . ARG A 1 72  ? -19.150 12.719  -10.310 1.00 7.57  ? 72  ARG A HG3  4  
ATOM 7490  H HD2  . ARG A 1 72  ? -20.965 13.942  -12.384 1.00 8.79  ? 72  ARG A HD2  4  
ATOM 7491  H HD3  . ARG A 1 72  ? -19.447 14.637  -11.818 1.00 8.51  ? 72  ARG A HD3  4  
ATOM 7492  H HE   . ARG A 1 72  ? -19.413 11.959  -13.005 1.00 8.87  ? 72  ARG A HE   4  
ATOM 7493  H HH11 . ARG A 1 72  ? -18.610 15.361  -13.249 1.00 10.10 ? 72  ARG A HH11 4  
ATOM 7494  H HH12 . ARG A 1 72  ? -17.507 15.129  -14.567 1.00 11.22 ? 72  ARG A HH12 4  
ATOM 7495  H HH21 . ARG A 1 72  ? -17.976 11.663  -14.747 1.00 10.52 ? 72  ARG A HH21 4  
ATOM 7496  H HH22 . ARG A 1 72  ? -17.151 13.034  -15.420 1.00 11.45 ? 72  ARG A HH22 4  
ATOM 7497  N N    . LYS A 1 73  ? -23.018 9.656   -10.002 1.00 6.20  ? 73  LYS A N    4  
ATOM 7498  C CA   . LYS A 1 73  ? -23.836 8.500   -10.338 1.00 6.28  ? 73  LYS A CA   4  
ATOM 7499  C C    . LYS A 1 73  ? -23.723 8.172   -11.820 1.00 6.69  ? 73  LYS A C    4  
ATOM 7500  O O    . LYS A 1 73  ? -23.479 9.050   -12.644 1.00 7.13  ? 73  LYS A O    4  
ATOM 7501  C CB   . LYS A 1 73  ? -25.297 8.691   -9.919  1.00 6.89  ? 73  LYS A CB   4  
ATOM 7502  C CG   . LYS A 1 73  ? -25.844 10.097  -10.047 1.00 6.88  ? 73  LYS A CG   4  
ATOM 7503  C CD   . LYS A 1 73  ? -25.868 10.564  -11.488 1.00 7.64  ? 73  LYS A CD   4  
ATOM 7504  C CE   . LYS A 1 73  ? -26.638 11.863  -11.644 1.00 8.45  ? 73  LYS A CE   4  
ATOM 7505  N NZ   . LYS A 1 73  ? -26.682 12.315  -13.058 1.00 8.97  ? 73  LYS A NZ   4  
ATOM 7506  H H    . LYS A 1 73  ? -23.439 10.537  -9.907  1.00 6.62  ? 73  LYS A H    4  
ATOM 7507  H HA   . LYS A 1 73  ? -23.443 7.668   -9.789  1.00 5.84  ? 73  LYS A HA   4  
ATOM 7508  H HB2  . LYS A 1 73  ? -25.911 8.045   -10.526 1.00 7.51  ? 73  LYS A HB2  4  
ATOM 7509  H HB3  . LYS A 1 73  ? -25.398 8.388   -8.888  1.00 7.00  ? 73  LYS A HB3  4  
ATOM 7510  H HG2  . LYS A 1 73  ? -26.846 10.105  -9.662  1.00 6.63  ? 73  LYS A HG2  4  
ATOM 7511  H HG3  . LYS A 1 73  ? -25.230 10.763  -9.464  1.00 6.84  ? 73  LYS A HG3  4  
ATOM 7512  H HD2  . LYS A 1 73  ? -24.852 10.716  -11.821 1.00 7.77  ? 73  LYS A HD2  4  
ATOM 7513  H HD3  . LYS A 1 73  ? -26.333 9.796   -12.087 1.00 7.70  ? 73  LYS A HD3  4  
ATOM 7514  H HE2  . LYS A 1 73  ? -27.647 11.714  -11.292 1.00 8.78  ? 73  LYS A HE2  4  
ATOM 7515  H HE3  . LYS A 1 73  ? -26.159 12.625  -11.047 1.00 8.56  ? 73  LYS A HE3  4  
ATOM 7516  H HZ1  . LYS A 1 73  ? -25.717 12.476  -13.414 1.00 9.28  ? 73  LYS A HZ1  4  
ATOM 7517  H HZ2  . LYS A 1 73  ? -27.217 13.203  -13.133 1.00 9.21  ? 73  LYS A HZ2  4  
ATOM 7518  H HZ3  . LYS A 1 73  ? -27.143 11.597  -13.651 1.00 9.02  ? 73  LYS A HZ3  4  
ATOM 7519  N N    . ASP A 1 74  ? -23.884 6.898   -12.143 1.00 6.78  ? 74  ASP A N    4  
ATOM 7520  C CA   . ASP A 1 74  ? -23.676 6.425   -13.502 1.00 7.38  ? 74  ASP A CA   4  
ATOM 7521  C C    . ASP A 1 74  ? -25.001 6.388   -14.272 1.00 8.21  ? 74  ASP A C    4  
ATOM 7522  O O    . ASP A 1 74  ? -25.958 7.057   -13.880 1.00 8.34  ? 74  ASP A O    4  
ATOM 7523  C CB   . ASP A 1 74  ? -23.011 5.047   -13.471 1.00 7.38  ? 74  ASP A CB   4  
ATOM 7524  C CG   . ASP A 1 74  ? -22.291 4.706   -14.763 1.00 8.19  ? 74  ASP A CG   4  
ATOM 7525  O OD1  . ASP A 1 74  ? -21.121 5.109   -14.922 1.00 8.40  ? 74  ASP A OD1  4  
ATOM 7526  O OD2  . ASP A 1 74  ? -22.891 4.027   -15.622 1.00 8.74  ? 74  ASP A OD2  4  
ATOM 7527  H H    . ASP A 1 74  ? -24.151 6.261   -11.455 1.00 6.59  ? 74  ASP A H    4  
ATOM 7528  H HA   . ASP A 1 74  ? -23.013 7.116   -13.992 1.00 7.42  ? 74  ASP A HA   4  
ATOM 7529  H HB2  . ASP A 1 74  ? -22.294 5.017   -12.663 1.00 6.84  ? 74  ASP A HB2  4  
ATOM 7530  H HB3  . ASP A 1 74  ? -23.769 4.304   -13.299 1.00 7.53  ? 74  ASP A HB3  4  
ATOM 7531  N N    . ASN A 1 75  ? -25.065 5.588   -15.327 1.00 8.89  ? 75  ASN A N    4  
ATOM 7532  C CA   . ASN A 1 75  ? -26.172 5.623   -16.290 1.00 9.75  ? 75  ASN A CA   4  
ATOM 7533  C C    . ASN A 1 75  ? -27.555 5.444   -15.650 1.00 9.91  ? 75  ASN A C    4  
ATOM 7534  O O    . ASN A 1 75  ? -28.535 6.026   -16.118 1.00 10.47 ? 75  ASN A O    4  
ATOM 7535  C CB   . ASN A 1 75  ? -25.958 4.547   -17.363 1.00 10.48 ? 75  ASN A CB   4  
ATOM 7536  C CG   . ASN A 1 75  ? -26.114 3.131   -16.830 1.00 10.99 ? 75  ASN A CG   4  
ATOM 7537  O OD1  . ASN A 1 75  ? -27.195 2.547   -16.905 1.00 11.25 ? 75  ASN A OD1  4  
ATOM 7538  N ND2  . ASN A 1 75  ? -25.045 2.572   -16.288 1.00 11.37 ? 75  ASN A ND2  4  
ATOM 7539  H H    . ASN A 1 75  ? -24.336 4.940   -15.472 1.00 8.89  ? 75  ASN A H    4  
ATOM 7540  H HA   . ASN A 1 75  ? -26.146 6.586   -16.770 1.00 9.91  ? 75  ASN A HA   4  
ATOM 7541  H HB2  . ASN A 1 75  ? -26.677 4.692   -18.154 1.00 10.54 ? 75  ASN A HB2  4  
ATOM 7542  H HB3  . ASN A 1 75  ? -24.961 4.650   -17.769 1.00 10.77 ? 75  ASN A HB3  4  
ATOM 7543  H HD21 . ASN A 1 75  ? -24.207 3.093   -16.258 1.00 11.28 ? 75  ASN A HD21 4  
ATOM 7544  H HD22 . ASN A 1 75  ? -25.130 1.662   -15.928 1.00 11.84 ? 75  ASN A HD22 4  
ATOM 7545  N N    . GLU A 1 76  ? -27.646 4.670   -14.577 1.00 9.56  ? 76  GLU A N    4  
ATOM 7546  C CA   . GLU A 1 76  ? -28.946 4.371   -13.986 1.00 9.89  ? 76  GLU A CA   4  
ATOM 7547  C C    . GLU A 1 76  ? -29.114 5.076   -12.650 1.00 9.42  ? 76  GLU A C    4  
ATOM 7548  O O    . GLU A 1 76  ? -29.936 4.685   -11.820 1.00 9.74  ? 76  GLU A O    4  
ATOM 7549  C CB   . GLU A 1 76  ? -29.117 2.860   -13.824 1.00 10.10 ? 76  GLU A CB   4  
ATOM 7550  C CG   . GLU A 1 76  ? -28.295 2.242   -12.709 1.00 10.22 ? 76  GLU A CG   4  
ATOM 7551  C CD   . GLU A 1 76  ? -28.446 0.738   -12.645 1.00 10.82 ? 76  GLU A CD   4  
ATOM 7552  O OE1  . GLU A 1 76  ? -29.366 0.258   -11.952 1.00 11.20 ? 76  GLU A OE1  4  
ATOM 7553  O OE2  . GLU A 1 76  ? -27.644 0.028   -13.290 1.00 11.06 ? 76  GLU A OE2  4  
ATOM 7554  H H    . GLU A 1 76  ? -26.831 4.290   -14.181 1.00 9.17  ? 76  GLU A H    4  
ATOM 7555  H HA   . GLU A 1 76  ? -29.703 4.736   -14.664 1.00 10.50 ? 76  GLU A HA   4  
ATOM 7556  H HB2  . GLU A 1 76  ? -30.158 2.642   -13.637 1.00 9.97  ? 76  GLU A HB2  4  
ATOM 7557  H HB3  . GLU A 1 76  ? -28.821 2.393   -14.744 1.00 10.53 ? 76  GLU A HB3  4  
ATOM 7558  H HG2  . GLU A 1 76  ? -27.254 2.478   -12.874 1.00 10.34 ? 76  GLU A HG2  4  
ATOM 7559  H HG3  . GLU A 1 76  ? -28.614 2.663   -11.766 1.00 9.99  ? 76  GLU A HG3  4  
ATOM 7560  N N    . GLY A 1 77  ? -28.336 6.129   -12.451 1.00 8.81  ? 77  GLY A N    4  
ATOM 7561  C CA   . GLY A 1 77  ? -28.330 6.809   -11.175 1.00 8.45  ? 77  GLY A CA   4  
ATOM 7562  C C    . GLY A 1 77  ? -27.770 5.921   -10.091 1.00 7.87  ? 77  GLY A C    4  
ATOM 7563  O O    . GLY A 1 77  ? -28.159 6.012   -8.928  1.00 7.68  ? 77  GLY A O    4  
ATOM 7564  H H    . GLY A 1 77  ? -27.765 6.455   -13.185 1.00 8.72  ? 77  GLY A H    4  
ATOM 7565  H HA2  . GLY A 1 77  ? -27.717 7.691   -11.256 1.00 8.21  ? 77  GLY A HA2  4  
ATOM 7566  H HA3  . GLY A 1 77  ? -29.337 7.095   -10.916 1.00 8.99  ? 77  GLY A HA3  4  
ATOM 7567  N N    . ASN A 1 78  ? -26.873 5.041   -10.519 1.00 7.80  ? 78  ASN A N    4  
ATOM 7568  C CA   . ASN A 1 78  ? -26.145 4.115   -9.640  1.00 7.46  ? 78  ASN A CA   4  
ATOM 7569  C C    . ASN A 1 78  ? -25.715 4.761   -8.324  1.00 6.97  ? 78  ASN A C    4  
ATOM 7570  O O    . ASN A 1 78  ? -25.908 4.181   -7.258  1.00 7.29  ? 78  ASN A O    4  
ATOM 7571  C CB   . ASN A 1 78  ? -24.899 3.611   -10.366 1.00 7.23  ? 78  ASN A CB   4  
ATOM 7572  C CG   . ASN A 1 78  ? -25.223 2.861   -11.640 1.00 8.06  ? 78  ASN A CG   4  
ATOM 7573  O OD1  . ASN A 1 78  ? -25.460 3.472   -12.682 1.00 8.60  ? 78  ASN A OD1  4  
ATOM 7574  N ND2  . ASN A 1 78  ? -25.214 1.542   -11.575 1.00 8.39  ? 78  ASN A ND2  4  
ATOM 7575  H H    . ASN A 1 78  ? -26.719 4.982   -11.492 1.00 8.12  ? 78  ASN A H    4  
ATOM 7576  H HA   . ASN A 1 78  ? -26.790 3.276   -9.428  1.00 7.96  ? 78  ASN A HA   4  
ATOM 7577  H HB2  . ASN A 1 78  ? -24.275 4.455   -10.620 1.00 7.05  ? 78  ASN A HB2  4  
ATOM 7578  H HB3  . ASN A 1 78  ? -24.352 2.952   -9.709  1.00 6.85  ? 78  ASN A HB3  4  
ATOM 7579  H HD21 . ASN A 1 78  ? -25.000 1.118   -10.715 1.00 8.13  ? 78  ASN A HD21 4  
ATOM 7580  H HD22 . ASN A 1 78  ? -25.420 1.037   -12.392 1.00 9.00  ? 78  ASN A HD22 4  
ATOM 7581  N N    . GLU A 1 79  ? -25.136 5.958   -8.412  1.00 6.44  ? 79  GLU A N    4  
ATOM 7582  C CA   . GLU A 1 79  ? -24.574 6.643   -7.244  1.00 6.06  ? 79  GLU A CA   4  
ATOM 7583  C C    . GLU A 1 79  ? -23.550 5.743   -6.563  1.00 5.51  ? 79  GLU A C    4  
ATOM 7584  O O    . GLU A 1 79  ? -23.799 5.190   -5.490  1.00 5.77  ? 79  GLU A O    4  
ATOM 7585  C CB   . GLU A 1 79  ? -25.669 7.054   -6.250  1.00 6.75  ? 79  GLU A CB   4  
ATOM 7586  C CG   . GLU A 1 79  ? -26.595 8.135   -6.773  1.00 7.16  ? 79  GLU A CG   4  
ATOM 7587  C CD   . GLU A 1 79  ? -27.630 8.562   -5.756  1.00 7.94  ? 79  GLU A CD   4  
ATOM 7588  O OE1  . GLU A 1 79  ? -27.251 9.187   -4.744  1.00 8.32  ? 79  GLU A OE1  4  
ATOM 7589  O OE2  . GLU A 1 79  ? -28.826 8.277   -5.959  1.00 8.38  ? 79  GLU A OE2  4  
ATOM 7590  H H    . GLU A 1 79  ? -25.087 6.390   -9.281  1.00 6.47  ? 79  GLU A H    4  
ATOM 7591  H HA   . GLU A 1 79  ? -24.071 7.535   -7.600  1.00 5.88  ? 79  GLU A HA   4  
ATOM 7592  H HB2  . GLU A 1 79  ? -26.263 6.187   -6.004  1.00 7.10  ? 79  GLU A HB2  4  
ATOM 7593  H HB3  . GLU A 1 79  ? -25.200 7.424   -5.354  1.00 6.91  ? 79  GLU A HB3  4  
ATOM 7594  H HG2  . GLU A 1 79  ? -26.000 8.992   -7.035  1.00 6.94  ? 79  GLU A HG2  4  
ATOM 7595  H HG3  . GLU A 1 79  ? -27.103 7.766   -7.652  1.00 7.42  ? 79  GLU A HG3  4  
ATOM 7596  N N    . VAL A 1 80  ? -22.403 5.585   -7.204  1.00 4.98  ? 80  VAL A N    4  
ATOM 7597  C CA   . VAL A 1 80  ? -21.402 4.639   -6.745  1.00 4.58  ? 80  VAL A CA   4  
ATOM 7598  C C    . VAL A 1 80  ? -20.354 5.318   -5.876  1.00 3.98  ? 80  VAL A C    4  
ATOM 7599  O O    . VAL A 1 80  ? -19.902 6.426   -6.176  1.00 3.86  ? 80  VAL A O    4  
ATOM 7600  C CB   . VAL A 1 80  ? -20.705 3.933   -7.934  1.00 4.62  ? 80  VAL A CB   4  
ATOM 7601  C CG1  . VAL A 1 80  ? -21.725 3.219   -8.802  1.00 5.39  ? 80  VAL A CG1  4  
ATOM 7602  C CG2  . VAL A 1 80  ? -19.900 4.919   -8.773  1.00 4.28  ? 80  VAL A CG2  4  
ATOM 7603  H H    . VAL A 1 80  ? -22.216 6.132   -7.994  1.00 5.01  ? 80  VAL A H    4  
ATOM 7604  H HA   . VAL A 1 80  ? -21.906 3.886   -6.157  1.00 5.01  ? 80  VAL A HA   4  
ATOM 7605  H HB   . VAL A 1 80  ? -20.024 3.193   -7.536  1.00 4.65  ? 80  VAL A HB   4  
ATOM 7606  H HG11 . VAL A 1 80  ? -22.246 2.479   -8.214  1.00 5.49  ? 80  VAL A HG11 4  
ATOM 7607  H HG12 . VAL A 1 80  ? -21.221 2.737   -9.626  1.00 5.78  ? 80  VAL A HG12 4  
ATOM 7608  H HG13 . VAL A 1 80  ? -22.434 3.939   -9.187  1.00 5.71  ? 80  VAL A HG13 4  
ATOM 7609  H HG21 . VAL A 1 80  ? -20.559 5.680   -9.163  1.00 4.44  ? 80  VAL A HG21 4  
ATOM 7610  H HG22 . VAL A 1 80  ? -19.431 4.394   -9.593  1.00 4.33  ? 80  VAL A HG22 4  
ATOM 7611  H HG23 . VAL A 1 80  ? -19.141 5.379   -8.157  1.00 4.29  ? 80  VAL A HG23 4  
ATOM 7612  N N    . VAL A 1 81  ? -19.997 4.673   -4.779  1.00 3.91  ? 81  VAL A N    4  
ATOM 7613  C CA   . VAL A 1 81  ? -18.878 5.119   -3.985  1.00 3.49  ? 81  VAL A CA   4  
ATOM 7614  C C    . VAL A 1 81  ? -17.609 4.432   -4.481  1.00 2.81  ? 81  VAL A C    4  
ATOM 7615  O O    . VAL A 1 81  ? -17.560 3.206   -4.602  1.00 2.88  ? 81  VAL A O    4  
ATOM 7616  C CB   . VAL A 1 81  ? -19.091 4.856   -2.475  1.00 4.02  ? 81  VAL A CB   4  
ATOM 7617  C CG1  . VAL A 1 81  ? -19.285 3.376   -2.183  1.00 4.27  ? 81  VAL A CG1  4  
ATOM 7618  C CG2  . VAL A 1 81  ? -17.928 5.416   -1.680  1.00 4.20  ? 81  VAL A CG2  4  
ATOM 7619  H H    . VAL A 1 81  ? -20.500 3.884   -4.493  1.00 4.34  ? 81  VAL A H    4  
ATOM 7620  H HA   . VAL A 1 81  ? -18.775 6.184   -4.133  1.00 3.57  ? 81  VAL A HA   4  
ATOM 7621  H HB   . VAL A 1 81  ? -19.985 5.376   -2.166  1.00 4.55  ? 81  VAL A HB   4  
ATOM 7622  H HG11 . VAL A 1 81  ? -18.406 2.829   -2.493  1.00 4.42  ? 81  VAL A HG11 4  
ATOM 7623  H HG12 . VAL A 1 81  ? -20.144 3.014   -2.726  1.00 4.47  ? 81  VAL A HG12 4  
ATOM 7624  H HG13 . VAL A 1 81  ? -19.443 3.234   -1.124  1.00 4.58  ? 81  VAL A HG13 4  
ATOM 7625  H HG21 . VAL A 1 81  ? -17.837 6.472   -1.881  1.00 4.50  ? 81  VAL A HG21 4  
ATOM 7626  H HG22 . VAL A 1 81  ? -17.020 4.914   -1.977  1.00 4.41  ? 81  VAL A HG22 4  
ATOM 7627  H HG23 . VAL A 1 81  ? -18.101 5.260   -0.628  1.00 4.31  ? 81  VAL A HG23 4  
ATOM 7628  N N    . PRO A 1 82  ? -16.584 5.216   -4.817  1.00 2.49  ? 82  PRO A N    4  
ATOM 7629  C CA   . PRO A 1 82  ? -15.358 4.689   -5.403  1.00 2.15  ? 82  PRO A CA   4  
ATOM 7630  C C    . PRO A 1 82  ? -14.567 3.818   -4.438  1.00 1.66  ? 82  PRO A C    4  
ATOM 7631  O O    . PRO A 1 82  ? -14.347 4.183   -3.280  1.00 1.69  ? 82  PRO A O    4  
ATOM 7632  C CB   . PRO A 1 82  ? -14.568 5.932   -5.781  1.00 2.57  ? 82  PRO A CB   4  
ATOM 7633  C CG   . PRO A 1 82  ? -15.094 7.001   -4.920  1.00 2.91  ? 82  PRO A CG   4  
ATOM 7634  C CD   . PRO A 1 82  ? -16.533 6.674   -4.646  1.00 2.92  ? 82  PRO A CD   4  
ATOM 7635  H HA   . PRO A 1 82  ? -15.565 4.129   -6.290  1.00 2.39  ? 82  PRO A HA   4  
ATOM 7636  H HB2  . PRO A 1 82  ? -13.526 5.767   -5.603  1.00 2.53  ? 82  PRO A HB2  4  
ATOM 7637  H HB3  . PRO A 1 82  ? -14.727 6.162   -6.814  1.00 2.99  ? 82  PRO A HB3  4  
ATOM 7638  H HG2  . PRO A 1 82  ? -14.539 7.021   -4.008  1.00 2.90  ? 82  PRO A HG2  4  
ATOM 7639  H HG3  . PRO A 1 82  ? -15.010 7.933   -5.437  1.00 3.42  ? 82  PRO A HG3  4  
ATOM 7640  H HD2  . PRO A 1 82  ? -16.795 6.952   -3.637  1.00 3.15  ? 82  PRO A HD2  4  
ATOM 7641  H HD3  . PRO A 1 82  ? -17.179 7.168   -5.352  1.00 3.30  ? 82  PRO A HD3  4  
ATOM 7642  N N    . LYS A 1 83  ? -14.168 2.654   -4.921  1.00 1.57  ? 83  LYS A N    4  
ATOM 7643  C CA   . LYS A 1 83  ? -13.343 1.742   -4.154  1.00 1.32  ? 83  LYS A CA   4  
ATOM 7644  C C    . LYS A 1 83  ? -11.881 2.081   -4.354  1.00 1.05  ? 83  LYS A C    4  
ATOM 7645  O O    . LYS A 1 83  ? -11.402 2.184   -5.486  1.00 1.19  ? 83  LYS A O    4  
ATOM 7646  C CB   . LYS A 1 83  ? -13.617 0.300   -4.575  1.00 1.66  ? 83  LYS A CB   4  
ATOM 7647  C CG   . LYS A 1 83  ? -15.022 -0.168  -4.267  1.00 2.23  ? 83  LYS A CG   4  
ATOM 7648  C CD   . LYS A 1 83  ? -15.216 -1.634  -4.622  1.00 2.76  ? 83  LYS A CD   4  
ATOM 7649  C CE   . LYS A 1 83  ? -16.613 -2.113  -4.263  1.00 3.60  ? 83  LYS A CE   4  
ATOM 7650  N NZ   . LYS A 1 83  ? -16.806 -3.555  -4.574  1.00 4.42  ? 83  LYS A NZ   4  
ATOM 7651  H H    . LYS A 1 83  ? -14.434 2.399   -5.828  1.00 1.91  ? 83  LYS A H    4  
ATOM 7652  H HA   . LYS A 1 83  ? -13.580 1.862   -3.104  1.00 1.32  ? 83  LYS A HA   4  
ATOM 7653  H HB2  . LYS A 1 83  ? -13.457 0.208   -5.636  1.00 1.85  ? 83  LYS A HB2  4  
ATOM 7654  H HB3  . LYS A 1 83  ? -12.932 -0.344  -4.064  1.00 1.86  ? 83  LYS A HB3  4  
ATOM 7655  H HG2  . LYS A 1 83  ? -15.212 -0.034  -3.216  1.00 2.38  ? 83  LYS A HG2  4  
ATOM 7656  H HG3  . LYS A 1 83  ? -15.713 0.425   -4.839  1.00 2.76  ? 83  LYS A HG3  4  
ATOM 7657  H HD2  . LYS A 1 83  ? -15.063 -1.761  -5.684  1.00 2.93  ? 83  LYS A HD2  4  
ATOM 7658  H HD3  . LYS A 1 83  ? -14.491 -2.224  -4.079  1.00 3.05  ? 83  LYS A HD3  4  
ATOM 7659  H HE2  . LYS A 1 83  ? -16.771 -1.958  -3.207  1.00 3.67  ? 83  LYS A HE2  4  
ATOM 7660  H HE3  . LYS A 1 83  ? -17.331 -1.534  -4.823  1.00 4.07  ? 83  LYS A HE3  4  
ATOM 7661  H HZ1  . LYS A 1 83  ? -17.754 -3.862  -4.273  1.00 4.83  ? 83  LYS A HZ1  4  
ATOM 7662  H HZ2  . LYS A 1 83  ? -16.096 -4.130  -4.075  1.00 4.81  ? 83  LYS A HZ2  4  
ATOM 7663  H HZ3  . LYS A 1 83  ? -16.709 -3.718  -5.595  1.00 4.64  ? 83  LYS A HZ3  4  
ATOM 7664  N N    . PRO A 1 84  ? -11.171 2.262   -3.239  1.00 0.80  ? 84  PRO A N    4  
ATOM 7665  C CA   . PRO A 1 84  ? -9.769  2.680   -3.227  1.00 0.60  ? 84  PRO A CA   4  
ATOM 7666  C C    . PRO A 1 84  ? -8.883  1.778   -4.070  1.00 0.62  ? 84  PRO A C    4  
ATOM 7667  O O    . PRO A 1 84  ? -8.948  0.549   -3.966  1.00 0.78  ? 84  PRO A O    4  
ATOM 7668  C CB   . PRO A 1 84  ? -9.390  2.569   -1.758  1.00 0.60  ? 84  PRO A CB   4  
ATOM 7669  C CG   . PRO A 1 84  ? -10.672 2.737   -1.037  1.00 0.84  ? 84  PRO A CG   4  
ATOM 7670  C CD   . PRO A 1 84  ? -11.690 2.065   -1.880  1.00 0.94  ? 84  PRO A CD   4  
ATOM 7671  H HA   . PRO A 1 84  ? -9.659  3.702   -3.546  1.00 0.63  ? 84  PRO A HA   4  
ATOM 7672  H HB2  . PRO A 1 84  ? -8.965  1.602   -1.577  1.00 0.66  ? 84  PRO A HB2  4  
ATOM 7673  H HB3  . PRO A 1 84  ? -8.684  3.342   -1.498  1.00 0.60  ? 84  PRO A HB3  4  
ATOM 7674  H HG2  . PRO A 1 84  ? -10.621 2.265   -0.084  1.00 1.06  ? 84  PRO A HG2  4  
ATOM 7675  H HG3  . PRO A 1 84  ? -10.912 3.781   -0.937  1.00 0.88  ? 84  PRO A HG3  4  
ATOM 7676  H HD2  . PRO A 1 84  ? -11.754 1.019   -1.633  1.00 1.13  ? 84  PRO A HD2  4  
ATOM 7677  H HD3  . PRO A 1 84  ? -12.639 2.545   -1.757  1.00 1.08  ? 84  PRO A HD3  4  
ATOM 7678  N N    . GLN A 1 85  ? -8.069  2.391   -4.906  1.00 0.61  ? 85  GLN A N    4  
ATOM 7679  C CA   . GLN A 1 85  ? -7.151  1.646   -5.748  1.00 0.63  ? 85  GLN A CA   4  
ATOM 7680  C C    . GLN A 1 85  ? -5.917  1.277   -4.946  1.00 0.51  ? 85  GLN A C    4  
ATOM 7681  O O    . GLN A 1 85  ? -5.168  2.146   -4.495  1.00 0.51  ? 85  GLN A O    4  
ATOM 7682  C CB   . GLN A 1 85  ? -6.755  2.456   -6.980  1.00 0.77  ? 85  GLN A CB   4  
ATOM 7683  C CG   . GLN A 1 85  ? -7.918  2.807   -7.884  1.00 1.26  ? 85  GLN A CG   4  
ATOM 7684  C CD   . GLN A 1 85  ? -7.476  3.531   -9.138  1.00 1.44  ? 85  GLN A CD   4  
ATOM 7685  O OE1  . GLN A 1 85  ? -7.392  4.760   -9.165  1.00 1.73  ? 85  GLN A OE1  4  
ATOM 7686  N NE2  . GLN A 1 85  ? -7.185  2.776   -10.185 1.00 2.01  ? 85  GLN A NE2  4  
ATOM 7687  H H    . GLN A 1 85  ? -8.074  3.370   -4.945  1.00 0.66  ? 85  GLN A H    4  
ATOM 7688  H HA   . GLN A 1 85  ? -7.647  0.742   -6.063  1.00 0.70  ? 85  GLN A HA   4  
ATOM 7689  H HB2  . GLN A 1 85  ? -6.299  3.371   -6.657  1.00 0.90  ? 85  GLN A HB2  4  
ATOM 7690  H HB3  . GLN A 1 85  ? -6.038  1.889   -7.556  1.00 1.01  ? 85  GLN A HB3  4  
ATOM 7691  H HG2  . GLN A 1 85  ? -8.417  1.899   -8.168  1.00 1.59  ? 85  GLN A HG2  4  
ATOM 7692  H HG3  . GLN A 1 85  ? -8.604  3.441   -7.341  1.00 1.51  ? 85  GLN A HG3  4  
ATOM 7693  H HE21 . GLN A 1 85  ? -7.271  1.803   -10.092 1.00 2.53  ? 85  GLN A HE21 4  
ATOM 7694  H HE22 . GLN A 1 85  ? -6.893  3.221   -11.011 1.00 2.15  ? 85  GLN A HE22 4  
ATOM 7695  N N    . ARG A 1 86  ? -5.716  -0.010  -4.753  1.00 0.50  ? 86  ARG A N    4  
ATOM 7696  C CA   . ARG A 1 86  ? -4.626  -0.481  -3.935  1.00 0.48  ? 86  ARG A CA   4  
ATOM 7697  C C    . ARG A 1 86  ? -3.426  -0.875  -4.757  1.00 0.43  ? 86  ARG A C    4  
ATOM 7698  O O    . ARG A 1 86  ? -3.537  -1.294  -5.907  1.00 0.51  ? 86  ARG A O    4  
ATOM 7699  C CB   . ARG A 1 86  ? -5.082  -1.640  -3.081  1.00 0.62  ? 86  ARG A CB   4  
ATOM 7700  C CG   . ARG A 1 86  ? -6.169  -1.237  -2.158  1.00 0.85  ? 86  ARG A CG   4  
ATOM 7701  C CD   . ARG A 1 86  ? -6.892  -2.438  -1.626  1.00 0.65  ? 86  ARG A CD   4  
ATOM 7702  N NE   . ARG A 1 86  ? -7.985  -2.085  -0.715  1.00 1.27  ? 86  ARG A NE   4  
ATOM 7703  C CZ   . ARG A 1 86  ? -9.275  -2.323  -0.971  1.00 1.38  ? 86  ARG A CZ   4  
ATOM 7704  N NH1  . ARG A 1 86  ? -9.640  -2.878  -2.120  1.00 1.19  ? 86  ARG A NH1  4  
ATOM 7705  N NH2  . ARG A 1 86  ? -10.201 -1.995  -0.079  1.00 2.24  ? 86  ARG A NH2  4  
ATOM 7706  H H    . ARG A 1 86  ? -6.329  -0.660  -5.152  1.00 0.55  ? 86  ARG A H    4  
ATOM 7707  H HA   . ARG A 1 86  ? -4.341  0.325   -3.279  1.00 0.50  ? 86  ARG A HA   4  
ATOM 7708  H HB2  . ARG A 1 86  ? -5.453  -2.429  -3.707  1.00 1.45  ? 86  ARG A HB2  4  
ATOM 7709  H HB3  . ARG A 1 86  ? -4.260  -1.999  -2.496  1.00 1.30  ? 86  ARG A HB3  4  
ATOM 7710  H HG2  . ARG A 1 86  ? -5.746  -0.676  -1.343  1.00 1.55  ? 86  ARG A HG2  4  
ATOM 7711  H HG3  . ARG A 1 86  ? -6.839  -0.635  -2.701  1.00 1.67  ? 86  ARG A HG3  4  
ATOM 7712  H HD2  . ARG A 1 86  ? -7.291  -3.001  -2.456  1.00 1.04  ? 86  ARG A HD2  4  
ATOM 7713  H HD3  . ARG A 1 86  ? -6.173  -3.030  -1.110  1.00 1.07  ? 86  ARG A HD3  4  
ATOM 7714  H HE   . ARG A 1 86  ? -7.742  -1.657  0.138   1.00 1.95  ? 86  ARG A HE   4  
ATOM 7715  H HH11 . ARG A 1 86  ? -8.953  -3.124  -2.805  1.00 1.35  ? 86  ARG A HH11 4  
ATOM 7716  H HH12 . ARG A 1 86  ? -10.612 -3.053  -2.307  1.00 1.49  ? 86  ARG A HH12 4  
ATOM 7717  H HH21 . ARG A 1 86  ? -9.939  -1.568  0.791   1.00 2.89  ? 86  ARG A HH21 4  
ATOM 7718  H HH22 . ARG A 1 86  ? -11.171 -2.177  -0.270  1.00 2.35  ? 86  ARG A HH22 4  
ATOM 7719  N N    . HIS A 1 87  ? -2.283  -0.718  -4.139  1.00 0.37  ? 87  HIS A N    4  
ATOM 7720  C CA   . HIS A 1 87  ? -1.013  -1.099  -4.738  1.00 0.35  ? 87  HIS A CA   4  
ATOM 7721  C C    . HIS A 1 87  ? -0.327  -2.080  -3.807  1.00 0.34  ? 87  HIS A C    4  
ATOM 7722  O O    . HIS A 1 87  ? -0.174  -1.792  -2.623  1.00 0.47  ? 87  HIS A O    4  
ATOM 7723  C CB   . HIS A 1 87  ? -0.115  0.122   -4.959  1.00 0.36  ? 87  HIS A CB   4  
ATOM 7724  C CG   . HIS A 1 87  ? -0.809  1.282   -5.592  1.00 0.41  ? 87  HIS A CG   4  
ATOM 7725  N ND1  . HIS A 1 87  ? -1.057  1.383   -6.942  1.00 0.52  ? 87  HIS A ND1  4  
ATOM 7726  C CD2  . HIS A 1 87  ? -1.321  2.396   -5.033  1.00 0.45  ? 87  HIS A CD2  4  
ATOM 7727  C CE1  . HIS A 1 87  ? -1.692  2.513   -7.186  1.00 0.60  ? 87  HIS A CE1  4  
ATOM 7728  N NE2  . HIS A 1 87  ? -1.865  3.147   -6.041  1.00 0.55  ? 87  HIS A NE2  4  
ATOM 7729  H H    . HIS A 1 87  ? -2.298  -0.342  -3.231  1.00 0.40  ? 87  HIS A H    4  
ATOM 7730  H HA   . HIS A 1 87  ? -1.216  -1.575  -5.680  1.00 0.39  ? 87  HIS A HA   4  
ATOM 7731  H HB2  . HIS A 1 87  ? 0.270   0.448   -4.012  1.00 0.32  ? 87  HIS A HB2  4  
ATOM 7732  H HB3  . HIS A 1 87  ? 0.710   -0.153  -5.589  1.00 0.41  ? 87  HIS A HB3  4  
ATOM 7733  H HD1  . HIS A 1 87  ? -0.804  0.722   -7.626  1.00 0.57  ? 87  HIS A HD1  4  
ATOM 7734  H HD2  . HIS A 1 87  ? -1.300  2.640   -3.983  1.00 0.46  ? 87  HIS A HD2  4  
ATOM 7735  H HE1  . HIS A 1 87  ? -2.018  2.858   -8.156  1.00 0.71  ? 87  HIS A HE1  4  
ATOM 7736  H HE2  . HIS A 1 87  ? -2.438  3.937   -5.918  1.00 0.63  ? 87  HIS A HE2  4  
ATOM 7737  N N    . MET A 1 88  ? 0.058   -3.236  -4.312  1.00 0.29  ? 88  MET A N    4  
ATOM 7738  C CA   . MET A 1 88  ? 0.641   -4.253  -3.451  1.00 0.25  ? 88  MET A CA   4  
ATOM 7739  C C    . MET A 1 88  ? 2.082   -4.543  -3.835  1.00 0.25  ? 88  MET A C    4  
ATOM 7740  O O    . MET A 1 88  ? 2.391   -4.789  -5.003  1.00 0.29  ? 88  MET A O    4  
ATOM 7741  C CB   . MET A 1 88  ? -0.167  -5.541  -3.508  1.00 0.27  ? 88  MET A CB   4  
ATOM 7742  C CG   . MET A 1 88  ? 0.159   -6.482  -2.364  1.00 0.44  ? 88  MET A CG   4  
ATOM 7743  S SD   . MET A 1 88  ? -0.270  -8.193  -2.724  1.00 0.62  ? 88  MET A SD   4  
ATOM 7744  C CE   . MET A 1 88  ? -2.012  -8.031  -3.091  1.00 0.73  ? 88  MET A CE   4  
ATOM 7745  H H    . MET A 1 88  ? -0.041  -3.410  -5.276  1.00 0.35  ? 88  MET A H    4  
ATOM 7746  H HA   . MET A 1 88  ? 0.623   -3.876  -2.440  1.00 0.24  ? 88  MET A HA   4  
ATOM 7747  H HB2  . MET A 1 88  ? -1.219  -5.300  -3.465  1.00 0.47  ? 88  MET A HB2  4  
ATOM 7748  H HB3  . MET A 1 88  ? 0.043   -6.049  -4.437  1.00 0.51  ? 88  MET A HB3  4  
ATOM 7749  H HG2  . MET A 1 88  ? 1.215   -6.421  -2.157  1.00 0.63  ? 88  MET A HG2  4  
ATOM 7750  H HG3  . MET A 1 88  ? -0.394  -6.163  -1.493  1.00 0.61  ? 88  MET A HG3  4  
ATOM 7751  H HE1  . MET A 1 88  ? -2.146  -7.335  -3.907  1.00 1.16  ? 88  MET A HE1  4  
ATOM 7752  H HE2  . MET A 1 88  ? -2.532  -7.668  -2.217  1.00 1.33  ? 88  MET A HE2  4  
ATOM 7753  H HE3  . MET A 1 88  ? -2.408  -8.994  -3.372  1.00 1.26  ? 88  MET A HE3  4  
ATOM 7754  N N    . PHE A 1 89  ? 2.959   -4.523  -2.843  1.00 0.25  ? 89  PHE A N    4  
ATOM 7755  C CA   . PHE A 1 89  ? 4.372   -4.769  -3.065  1.00 0.26  ? 89  PHE A CA   4  
ATOM 7756  C C    . PHE A 1 89  ? 4.856   -5.900  -2.164  1.00 0.26  ? 89  PHE A C    4  
ATOM 7757  O O    . PHE A 1 89  ? 4.479   -5.972  -0.992  1.00 0.30  ? 89  PHE A O    4  
ATOM 7758  C CB   . PHE A 1 89  ? 5.181   -3.504  -2.790  1.00 0.31  ? 89  PHE A CB   4  
ATOM 7759  C CG   . PHE A 1 89  ? 4.774   -2.322  -3.632  1.00 0.48  ? 89  PHE A CG   4  
ATOM 7760  C CD1  . PHE A 1 89  ? 3.605   -1.640  -3.361  1.00 0.76  ? 89  PHE A CD1  4  
ATOM 7761  C CD2  . PHE A 1 89  ? 5.570   -1.883  -4.676  1.00 0.55  ? 89  PHE A CD2  4  
ATOM 7762  C CE1  . PHE A 1 89  ? 3.231   -0.543  -4.109  1.00 0.94  ? 89  PHE A CE1  4  
ATOM 7763  C CE2  . PHE A 1 89  ? 5.200   -0.786  -5.431  1.00 0.77  ? 89  PHE A CE2  4  
ATOM 7764  C CZ   . PHE A 1 89  ? 4.029   -0.116  -5.147  1.00 0.91  ? 89  PHE A CZ   4  
ATOM 7765  H H    . PHE A 1 89  ? 2.645   -4.337  -1.927  1.00 0.26  ? 89  PHE A H    4  
ATOM 7766  H HA   . PHE A 1 89  ? 4.500   -5.052  -4.095  1.00 0.27  ? 89  PHE A HA   4  
ATOM 7767  H HB2  . PHE A 1 89  ? 5.057   -3.229  -1.754  1.00 0.44  ? 89  PHE A HB2  4  
ATOM 7768  H HB3  . PHE A 1 89  ? 6.224   -3.705  -2.979  1.00 0.22  ? 89  PHE A HB3  4  
ATOM 7769  H HD1  . PHE A 1 89  ? 2.978   -1.982  -2.555  1.00 0.91  ? 89  PHE A HD1  4  
ATOM 7770  H HD2  . PHE A 1 89  ? 6.488   -2.407  -4.901  1.00 0.60  ? 89  PHE A HD2  4  
ATOM 7771  H HE1  . PHE A 1 89  ? 2.313   -0.022  -3.885  1.00 1.18  ? 89  PHE A HE1  4  
ATOM 7772  H HE2  . PHE A 1 89  ? 5.825   -0.455  -6.245  1.00 0.92  ? 89  PHE A HE2  4  
ATOM 7773  H HZ   . PHE A 1 89  ? 3.738   0.743   -5.736  1.00 1.10  ? 89  PHE A HZ   4  
ATOM 7774  N N    . SER A 1 90  ? 5.686   -6.775  -2.711  1.00 0.26  ? 90  SER A N    4  
ATOM 7775  C CA   . SER A 1 90  ? 6.172   -7.935  -1.972  1.00 0.27  ? 90  SER A CA   4  
ATOM 7776  C C    . SER A 1 90  ? 7.657   -7.800  -1.661  1.00 0.27  ? 90  SER A C    4  
ATOM 7777  O O    . SER A 1 90  ? 8.438   -7.443  -2.524  1.00 0.37  ? 90  SER A O    4  
ATOM 7778  C CB   . SER A 1 90  ? 5.947   -9.207  -2.791  1.00 0.32  ? 90  SER A CB   4  
ATOM 7779  O OG   . SER A 1 90  ? 5.985   -10.361 -1.971  1.00 1.30  ? 90  SER A OG   4  
ATOM 7780  H H    . SER A 1 90  ? 5.974   -6.645  -3.637  1.00 0.28  ? 90  SER A H    4  
ATOM 7781  H HA   . SER A 1 90  ? 5.619   -8.004  -1.048  1.00 0.30  ? 90  SER A HA   4  
ATOM 7782  H HB2  . SER A 1 90  ? 4.991   -9.156  -3.279  1.00 0.87  ? 90  SER A HB2  4  
ATOM 7783  H HB3  . SER A 1 90  ? 6.724   -9.289  -3.536  1.00 0.66  ? 90  SER A HB3  4  
ATOM 7784  H HG   . SER A 1 90  ? 5.256   -10.319 -1.335  1.00 1.50  ? 90  SER A HG   4  
ATOM 7785  N N    . PHE A 1 91  ? 8.039   -8.089  -0.432  1.00 0.22  ? 91  PHE A N    4  
ATOM 7786  C CA   . PHE A 1 91  ? 9.450   -8.135  -0.062  1.00 0.24  ? 91  PHE A CA   4  
ATOM 7787  C C    . PHE A 1 91  ? 9.841   -9.557  0.299   1.00 0.29  ? 91  PHE A C    4  
ATOM 7788  O O    . PHE A 1 91  ? 9.010   -10.467 0.297   1.00 0.32  ? 91  PHE A O    4  
ATOM 7789  C CB   . PHE A 1 91  ? 9.770   -7.234  1.133   1.00 0.22  ? 91  PHE A CB   4  
ATOM 7790  C CG   . PHE A 1 91  ? 9.289   -5.824  1.001   1.00 0.20  ? 91  PHE A CG   4  
ATOM 7791  C CD1  . PHE A 1 91  ? 9.999   -4.881  0.284   1.00 0.25  ? 91  PHE A CD1  4  
ATOM 7792  C CD2  . PHE A 1 91  ? 8.122   -5.451  1.609   1.00 0.22  ? 91  PHE A CD2  4  
ATOM 7793  C CE1  . PHE A 1 91  ? 9.537   -3.583  0.182   1.00 0.31  ? 91  PHE A CE1  4  
ATOM 7794  C CE2  . PHE A 1 91  ? 7.652   -4.164  1.511   1.00 0.28  ? 91  PHE A CE2  4  
ATOM 7795  C CZ   . PHE A 1 91  ? 8.360   -3.226  0.798   1.00 0.32  ? 91  PHE A CZ   4  
ATOM 7796  H H    . PHE A 1 91  ? 7.358   -8.279  0.244   1.00 0.22  ? 91  PHE A H    4  
ATOM 7797  H HA   . PHE A 1 91  ? 10.031  -7.816  -0.915  1.00 0.26  ? 91  PHE A HA   4  
ATOM 7798  H HB2  . PHE A 1 91  ? 9.316   -7.653  2.017   1.00 0.25  ? 91  PHE A HB2  4  
ATOM 7799  H HB3  . PHE A 1 91  ? 10.842  -7.206  1.270   1.00 0.28  ? 91  PHE A HB3  4  
ATOM 7800  H HD1  . PHE A 1 91  ? 10.922  -5.164  -0.199  1.00 0.31  ? 91  PHE A HD1  4  
ATOM 7801  H HD2  . PHE A 1 91  ? 7.578   -6.182  2.173   1.00 0.25  ? 91  PHE A HD2  4  
ATOM 7802  H HE1  . PHE A 1 91  ? 10.099  -2.850  -0.378  1.00 0.38  ? 91  PHE A HE1  4  
ATOM 7803  H HE2  . PHE A 1 91  ? 6.736   -3.892  1.994   1.00 0.35  ? 91  PHE A HE2  4  
ATOM 7804  H HZ   . PHE A 1 91  ? 7.989   -2.218  0.720   1.00 0.40  ? 91  PHE A HZ   4  
ATOM 7805  N N    . ASN A 1 92  ? 11.113  -9.738  0.599   1.00 0.35  ? 92  ASN A N    4  
ATOM 7806  C CA   . ASN A 1 92  ? 11.624  -11.026 1.047   1.00 0.43  ? 92  ASN A CA   4  
ATOM 7807  C C    . ASN A 1 92  ? 12.541  -10.841 2.248   1.00 0.38  ? 92  ASN A C    4  
ATOM 7808  O O    . ASN A 1 92  ? 13.382  -11.691 2.548   1.00 0.46  ? 92  ASN A O    4  
ATOM 7809  C CB   . ASN A 1 92  ? 12.349  -11.760 -0.091  1.00 0.62  ? 92  ASN A CB   4  
ATOM 7810  C CG   . ASN A 1 92  ? 13.419  -10.922 -0.771  1.00 0.70  ? 92  ASN A CG   4  
ATOM 7811  O OD1  . ASN A 1 92  ? 14.046  -10.056 -0.158  1.00 1.17  ? 92  ASN A OD1  4  
ATOM 7812  N ND2  . ASN A 1 92  ? 13.626  -11.172 -2.053  1.00 1.11  ? 92  ASN A ND2  4  
ATOM 7813  H H    . ASN A 1 92  ? 11.729  -8.980  0.518   1.00 0.36  ? 92  ASN A H    4  
ATOM 7814  H HA   . ASN A 1 92  ? 10.774  -11.620 1.356   1.00 0.47  ? 92  ASN A HA   4  
ATOM 7815  H HB2  . ASN A 1 92  ? 12.819  -12.646 0.306   1.00 0.67  ? 92  ASN A HB2  4  
ATOM 7816  H HB3  . ASN A 1 92  ? 11.621  -12.052 -0.835  1.00 0.71  ? 92  ASN A HB3  4  
ATOM 7817  H HD21 . ASN A 1 92  ? 13.085  -11.870 -2.483  1.00 1.58  ? 92  ASN A HD21 4  
ATOM 7818  H HD22 . ASN A 1 92  ? 14.308  -10.648 -2.527  1.00 1.21  ? 92  ASN A HD22 4  
ATOM 7819  N N    . ASN A 1 93  ? 12.370  -9.714  2.930   1.00 0.32  ? 93  ASN A N    4  
ATOM 7820  C CA   . ASN A 1 93  ? 13.108  -9.411  4.142   1.00 0.34  ? 93  ASN A CA   4  
ATOM 7821  C C    . ASN A 1 93  ? 12.169  -8.740  5.131   1.00 0.32  ? 93  ASN A C    4  
ATOM 7822  O O    . ASN A 1 93  ? 11.528  -7.734  4.810   1.00 0.29  ? 93  ASN A O    4  
ATOM 7823  C CB   . ASN A 1 93  ? 14.294  -8.498  3.831   1.00 0.38  ? 93  ASN A CB   4  
ATOM 7824  C CG   . ASN A 1 93  ? 15.544  -9.260  3.427   1.00 0.87  ? 93  ASN A CG   4  
ATOM 7825  O OD1  . ASN A 1 93  ? 16.362  -9.627  4.270   1.00 1.62  ? 93  ASN A OD1  4  
ATOM 7826  N ND2  . ASN A 1 93  ? 15.704  -9.503  2.136   1.00 0.98  ? 93  ASN A ND2  4  
ATOM 7827  H H    . ASN A 1 93  ? 11.711  -9.062  2.617   1.00 0.33  ? 93  ASN A H    4  
ATOM 7828  H HA   . ASN A 1 93  ? 13.463  -10.342 4.562   1.00 0.40  ? 93  ASN A HA   4  
ATOM 7829  H HB2  . ASN A 1 93  ? 14.024  -7.839  3.021   1.00 0.79  ? 93  ASN A HB2  4  
ATOM 7830  H HB3  . ASN A 1 93  ? 14.516  -7.910  4.703   1.00 0.72  ? 93  ASN A HB3  4  
ATOM 7831  H HD21 . ASN A 1 93  ? 15.015  -9.186  1.512   1.00 1.05  ? 93  ASN A HD21 4  
ATOM 7832  H HD22 . ASN A 1 93  ? 16.509  -9.989  1.853   1.00 1.41  ? 93  ASN A HD22 4  
ATOM 7833  N N    . ARG A 1 94  ? 12.081  -9.310  6.328   1.00 0.42  ? 94  ARG A N    4  
ATOM 7834  C CA   . ARG A 1 94  ? 11.052  -8.925  7.283   1.00 0.45  ? 94  ARG A CA   4  
ATOM 7835  C C    . ARG A 1 94  ? 11.305  -7.536  7.843   1.00 0.35  ? 94  ARG A C    4  
ATOM 7836  O O    . ARG A 1 94  ? 10.369  -6.759  8.035   1.00 0.36  ? 94  ARG A O    4  
ATOM 7837  C CB   . ARG A 1 94  ? 10.953  -9.941  8.423   1.00 0.64  ? 94  ARG A CB   4  
ATOM 7838  C CG   . ARG A 1 94  ? 9.676   -9.797  9.234   1.00 1.15  ? 94  ARG A CG   4  
ATOM 7839  C CD   . ARG A 1 94  ? 8.454   -10.021 8.359   1.00 1.32  ? 94  ARG A CD   4  
ATOM 7840  N NE   . ARG A 1 94  ? 7.199   -9.784  9.062   1.00 2.12  ? 94  ARG A NE   4  
ATOM 7841  C CZ   . ARG A 1 94  ? 6.071   -10.434 8.795   1.00 2.84  ? 94  ARG A CZ   4  
ATOM 7842  N NH1  . ARG A 1 94  ? 6.067   -11.425 7.910   1.00 3.14  ? 94  ARG A NH1  4  
ATOM 7843  N NH2  . ARG A 1 94  ? 4.951   -10.094 9.414   1.00 3.68  ? 94  ARG A NH2  4  
ATOM 7844  H H    . ARG A 1 94  ? 12.728  -10.007 6.575   1.00 0.50  ? 94  ARG A H    4  
ATOM 7845  H HA   . ARG A 1 94  ? 10.117  -8.910  6.751   1.00 0.49  ? 94  ARG A HA   4  
ATOM 7846  H HB2  . ARG A 1 94  ? 10.983  -10.938 8.009   1.00 0.98  ? 94  ARG A HB2  4  
ATOM 7847  H HB3  . ARG A 1 94  ? 11.794  -9.808  9.087   1.00 0.78  ? 94  ARG A HB3  4  
ATOM 7848  H HG2  . ARG A 1 94  ? 9.679   -10.527 10.030  1.00 1.71  ? 94  ARG A HG2  4  
ATOM 7849  H HG3  . ARG A 1 94  ? 9.633   -8.803  9.652   1.00 1.82  ? 94  ARG A HG3  4  
ATOM 7850  H HD2  . ARG A 1 94  ? 8.504   -9.344  7.523   1.00 1.72  ? 94  ARG A HD2  4  
ATOM 7851  H HD3  . ARG A 1 94  ? 8.468   -11.038 7.993   1.00 1.56  ? 94  ARG A HD3  4  
ATOM 7852  H HE   . ARG A 1 94  ? 7.192   -9.075  9.746   1.00 2.50  ? 94  ARG A HE   4  
ATOM 7853  H HH11 . ARG A 1 94  ? 6.912   -11.685 7.438   1.00 2.91  ? 94  ARG A HH11 4  
ATOM 7854  H HH12 . ARG A 1 94  ? 5.219   -11.931 7.720   1.00 3.89  ? 94  ARG A HH12 4  
ATOM 7855  H HH21 . ARG A 1 94  ? 4.951   -9.344  10.083  1.00 3.93  ? 94  ARG A HH21 4  
ATOM 7856  H HH22 . ARG A 1 94  ? 4.094   -10.579 9.215   1.00 4.27  ? 94  ARG A HH22 4  
ATOM 7857  N N    . THR A 1 95  ? 12.564  -7.229  8.103   1.00 0.34  ? 95  THR A N    4  
ATOM 7858  C CA   . THR A 1 95  ? 12.938  -5.908  8.567   1.00 0.31  ? 95  THR A CA   4  
ATOM 7859  C C    . THR A 1 95  ? 12.575  -4.860  7.522   1.00 0.26  ? 95  THR A C    4  
ATOM 7860  O O    . THR A 1 95  ? 11.989  -3.827  7.846   1.00 0.27  ? 95  THR A O    4  
ATOM 7861  C CB   . THR A 1 95  ? 14.436  -5.844  8.879   1.00 0.40  ? 95  THR A CB   4  
ATOM 7862  O OG1  . THR A 1 95  ? 14.740  -6.697  9.991   1.00 0.50  ? 95  THR A OG1  4  
ATOM 7863  C CG2  . THR A 1 95  ? 14.873  -4.421  9.173   1.00 0.44  ? 95  THR A CG2  4  
ATOM 7864  H H    . THR A 1 95  ? 13.259  -7.911  7.980   1.00 0.40  ? 95  THR A H    4  
ATOM 7865  H HA   . THR A 1 95  ? 12.396  -5.705  9.472   1.00 0.33  ? 95  THR A HA   4  
ATOM 7866  H HB   . THR A 1 95  ? 14.971  -6.195  8.017   1.00 0.42  ? 95  THR A HB   4  
ATOM 7867  H HG1  . THR A 1 95  ? 13.935  -7.159  10.268  1.00 0.94  ? 95  THR A HG1  4  
ATOM 7868  H HG21 . THR A 1 95  ? 14.700  -3.813  8.295   1.00 1.02  ? 95  THR A HG21 4  
ATOM 7869  H HG22 . THR A 1 95  ? 15.923  -4.409  9.421   1.00 1.07  ? 95  THR A HG22 4  
ATOM 7870  H HG23 . THR A 1 95  ? 14.299  -4.031  9.999   1.00 1.10  ? 95  THR A HG23 4  
ATOM 7871  N N    . VAL A 1 96  ? 12.921  -5.148  6.271   1.00 0.24  ? 96  VAL A N    4  
ATOM 7872  C CA   . VAL A 1 96  ? 12.538  -4.306  5.144   1.00 0.22  ? 96  VAL A CA   4  
ATOM 7873  C C    . VAL A 1 96  ? 11.062  -3.948  5.191   1.00 0.21  ? 96  VAL A C    4  
ATOM 7874  O O    . VAL A 1 96  ? 10.715  -2.772  5.279   1.00 0.22  ? 96  VAL A O    4  
ATOM 7875  C CB   . VAL A 1 96  ? 12.838  -4.986  3.789   1.00 0.22  ? 96  VAL A CB   4  
ATOM 7876  C CG1  . VAL A 1 96  ? 12.124  -4.283  2.642   1.00 0.22  ? 96  VAL A CG1  4  
ATOM 7877  C CG2  . VAL A 1 96  ? 14.328  -5.009  3.524   1.00 0.27  ? 96  VAL A CG2  4  
ATOM 7878  H H    . VAL A 1 96  ? 13.468  -5.941  6.109   1.00 0.26  ? 96  VAL A H    4  
ATOM 7879  H HA   . VAL A 1 96  ? 13.117  -3.397  5.199   1.00 0.25  ? 96  VAL A HA   4  
ATOM 7880  H HB   . VAL A 1 96  ? 12.487  -6.006  3.833   1.00 0.23  ? 96  VAL A HB   4  
ATOM 7881  H HG11 . VAL A 1 96  ? 11.052  -4.496  2.685   1.00 1.01  ? 96  VAL A HG11 4  
ATOM 7882  H HG12 . VAL A 1 96  ? 12.527  -4.635  1.704   1.00 1.03  ? 96  VAL A HG12 4  
ATOM 7883  H HG13 . VAL A 1 96  ? 12.282  -3.218  2.721   1.00 1.03  ? 96  VAL A HG13 4  
ATOM 7884  H HG21 . VAL A 1 96  ? 14.817  -5.625  4.262   1.00 1.03  ? 96  VAL A HG21 4  
ATOM 7885  H HG22 . VAL A 1 96  ? 14.715  -4.003  3.577   1.00 1.07  ? 96  VAL A HG22 4  
ATOM 7886  H HG23 . VAL A 1 96  ? 14.505  -5.412  2.538   1.00 1.05  ? 96  VAL A HG23 4  
ATOM 7887  N N    . MET A 1 97  ? 10.193  -4.958  5.146   1.00 0.26  ? 97  MET A N    4  
ATOM 7888  C CA   . MET A 1 97  ? 8.766   -4.696  5.063   1.00 0.39  ? 97  MET A CA   4  
ATOM 7889  C C    . MET A 1 97  ? 8.282   -3.872  6.240   1.00 0.34  ? 97  MET A C    4  
ATOM 7890  O O    . MET A 1 97  ? 7.589   -2.892  6.063   1.00 0.34  ? 97  MET A O    4  
ATOM 7891  C CB   . MET A 1 97  ? 7.946   -5.968  4.957   1.00 0.62  ? 97  MET A CB   4  
ATOM 7892  C CG   . MET A 1 97  ? 7.862   -6.777  6.215   1.00 0.62  ? 97  MET A CG   4  
ATOM 7893  S SD   . MET A 1 97  ? 6.367   -7.782  6.271   1.00 0.84  ? 97  MET A SD   4  
ATOM 7894  C CE   . MET A 1 97  ? 5.114   -6.531  5.962   1.00 0.37  ? 97  MET A CE   4  
ATOM 7895  H H    . MET A 1 97  ? 10.522  -5.887  5.159   1.00 0.24  ? 97  MET A H    4  
ATOM 7896  H HA   . MET A 1 97  ? 8.603   -4.132  4.174   1.00 0.47  ? 97  MET A HA   4  
ATOM 7897  H HB2  . MET A 1 97  ? 6.951   -5.695  4.681   1.00 1.36  ? 97  MET A HB2  4  
ATOM 7898  H HB3  . MET A 1 97  ? 8.371   -6.585  4.189   1.00 1.35  ? 97  MET A HB3  4  
ATOM 7899  H HG2  . MET A 1 97  ? 8.724   -7.412  6.252   1.00 1.26  ? 97  MET A HG2  4  
ATOM 7900  H HG3  . MET A 1 97  ? 7.868   -6.109  7.060   1.00 1.33  ? 97  MET A HG3  4  
ATOM 7901  H HE1  . MET A 1 97  ? 5.278   -5.685  6.613   1.00 1.03  ? 97  MET A HE1  4  
ATOM 7902  H HE2  . MET A 1 97  ? 4.135   -6.944  6.153   1.00 0.97  ? 97  MET A HE2  4  
ATOM 7903  H HE3  . MET A 1 97  ? 5.168   -6.203  4.933   1.00 1.05  ? 97  MET A HE3  4  
ATOM 7904  N N    . ASP A 1 98  ? 8.658   -4.285  7.431   1.00 0.36  ? 98  ASP A N    4  
ATOM 7905  C CA   . ASP A 1 98  ? 8.267   -3.593  8.665   1.00 0.36  ? 98  ASP A CA   4  
ATOM 7906  C C    . ASP A 1 98  ? 8.744   -2.140  8.678   1.00 0.28  ? 98  ASP A C    4  
ATOM 7907  O O    . ASP A 1 98  ? 8.043   -1.252  9.165   1.00 0.29  ? 98  ASP A O    4  
ATOM 7908  C CB   . ASP A 1 98  ? 8.821   -4.330  9.885   1.00 0.45  ? 98  ASP A CB   4  
ATOM 7909  C CG   . ASP A 1 98  ? 8.247   -3.801  11.183  1.00 0.55  ? 98  ASP A CG   4  
ATOM 7910  O OD1  . ASP A 1 98  ? 7.008   -3.790  11.335  1.00 0.67  ? 98  ASP A OD1  4  
ATOM 7911  O OD2  . ASP A 1 98  ? 9.038   -3.374  12.052  1.00 0.61  ? 98  ASP A OD2  4  
ATOM 7912  H H    . ASP A 1 98  ? 9.192   -5.106  7.484   1.00 0.41  ? 98  ASP A H    4  
ATOM 7913  H HA   . ASP A 1 98  ? 7.183   -3.598  8.720   1.00 0.39  ? 98  ASP A HA   4  
ATOM 7914  H HB2  . ASP A 1 98  ? 8.580   -5.379  9.805   1.00 0.51  ? 98  ASP A HB2  4  
ATOM 7915  H HB3  . ASP A 1 98  ? 9.894   -4.213  9.912   1.00 0.44  ? 98  ASP A HB3  4  
ATOM 7916  N N    . ASN A 1 99  ? 9.927   -1.898  8.130   1.00 0.22  ? 99  ASN A N    4  
ATOM 7917  C CA   . ASN A 1 99  ? 10.486  -0.551  8.091   1.00 0.21  ? 99  ASN A CA   4  
ATOM 7918  C C    . ASN A 1 99  ? 9.782   0.285   7.023   1.00 0.15  ? 99  ASN A C    4  
ATOM 7919  O O    . ASN A 1 99  ? 9.355   1.408   7.290   1.00 0.18  ? 99  ASN A O    4  
ATOM 7920  C CB   . ASN A 1 99  ? 11.985  -0.608  7.806   1.00 0.26  ? 99  ASN A CB   4  
ATOM 7921  C CG   . ASN A 1 99  ? 12.771  0.412   8.605   1.00 0.77  ? 99  ASN A CG   4  
ATOM 7922  O OD1  . ASN A 1 99  ? 12.241  1.446   9.021   1.00 1.55  ? 99  ASN A OD1  4  
ATOM 7923  N ND2  . ASN A 1 99  ? 14.049  0.135   8.812   1.00 1.17  ? 99  ASN A ND2  4  
ATOM 7924  H H    . ASN A 1 99  ? 10.443  -2.645  7.749   1.00 0.21  ? 99  ASN A H    4  
ATOM 7925  H HA   . ASN A 1 99  ? 10.323  -0.090  9.056   1.00 0.28  ? 99  ASN A HA   4  
ATOM 7926  H HB2  . ASN A 1 99  ? 12.355  -1.592  8.053   1.00 0.64  ? 99  ASN A HB2  4  
ATOM 7927  H HB3  . ASN A 1 99  ? 12.152  -0.420  6.756   1.00 0.50  ? 99  ASN A HB3  4  
ATOM 7928  H HD21 . ASN A 1 99  ? 14.409  -0.700  8.442   1.00 1.55  ? 99  ASN A HD21 4  
ATOM 7929  H HD22 . ASN A 1 99  ? 14.585  0.772   9.331   1.00 1.51  ? 99  ASN A HD22 4  
ATOM 7930  N N    . ILE A 1 100 ? 9.666   -0.274  5.818   1.00 0.12  ? 100 ILE A N    4  
ATOM 7931  C CA   . ILE A 1 100 ? 8.886   0.336   4.737   1.00 0.14  ? 100 ILE A CA   4  
ATOM 7932  C C    . ILE A 1 100 ? 7.464   0.597   5.217   1.00 0.16  ? 100 ILE A C    4  
ATOM 7933  O O    . ILE A 1 100 ? 6.901   1.668   4.993   1.00 0.20  ? 100 ILE A O    4  
ATOM 7934  C CB   . ILE A 1 100 ? 8.842   -0.590  3.499   1.00 0.18  ? 100 ILE A CB   4  
ATOM 7935  C CG1  . ILE A 1 100 ? 10.251  -0.857  2.947   1.00 0.18  ? 100 ILE A CG1  4  
ATOM 7936  C CG2  . ILE A 1 100 ? 7.947   -0.002  2.423   1.00 0.22  ? 100 ILE A CG2  4  
ATOM 7937  C CD1  . ILE A 1 100 ? 10.973  0.373   2.438   1.00 0.18  ? 100 ILE A CD1  4  
ATOM 7938  H H    . ILE A 1 100 ? 10.122  -1.131  5.648   1.00 0.14  ? 100 ILE A H    4  
ATOM 7939  H HA   . ILE A 1 100 ? 9.339   1.274   4.451   1.00 0.16  ? 100 ILE A HA   4  
ATOM 7940  H HB   . ILE A 1 100 ? 8.407   -1.530  3.807   1.00 0.20  ? 100 ILE A HB   4  
ATOM 7941  H HG12 . ILE A 1 100 ? 10.857  -1.289  3.729   1.00 0.19  ? 100 ILE A HG12 4  
ATOM 7942  H HG13 . ILE A 1 100 ? 10.179  -1.560  2.130   1.00 0.21  ? 100 ILE A HG13 4  
ATOM 7943  H HG21 . ILE A 1 100 ? 6.920   -0.034  2.756   1.00 1.03  ? 100 ILE A HG21 4  
ATOM 7944  H HG22 . ILE A 1 100 ? 8.049   -0.574  1.518   1.00 1.05  ? 100 ILE A HG22 4  
ATOM 7945  H HG23 . ILE A 1 100 ? 8.233   1.022   2.238   1.00 1.01  ? 100 ILE A HG23 4  
ATOM 7946  H HD11 . ILE A 1 100 ? 10.370  0.860   1.686   1.00 1.02  ? 100 ILE A HD11 4  
ATOM 7947  H HD12 . ILE A 1 100 ? 11.923  0.080   2.000   1.00 1.07  ? 100 ILE A HD12 4  
ATOM 7948  H HD13 . ILE A 1 100 ? 11.150  1.055   3.257   1.00 1.01  ? 100 ILE A HD13 4  
ATOM 7949  N N    . LYS A 1 101 ? 6.921   -0.402  5.897   1.00 0.17  ? 101 LYS A N    4  
ATOM 7950  C CA   . LYS A 1 101 ? 5.601   -0.348  6.510   1.00 0.22  ? 101 LYS A CA   4  
ATOM 7951  C C    . LYS A 1 101 ? 5.434   0.946   7.293   1.00 0.21  ? 101 LYS A C    4  
ATOM 7952  O O    . LYS A 1 101 ? 4.597   1.789   6.971   1.00 0.25  ? 101 LYS A O    4  
ATOM 7953  C CB   . LYS A 1 101 ? 5.471   -1.524  7.478   1.00 0.28  ? 101 LYS A CB   4  
ATOM 7954  C CG   . LYS A 1 101 ? 4.076   -2.032  7.687   1.00 0.49  ? 101 LYS A CG   4  
ATOM 7955  C CD   . LYS A 1 101 ? 4.030   -2.953  8.876   1.00 0.65  ? 101 LYS A CD   4  
ATOM 7956  C CE   . LYS A 1 101 ? 4.701   -4.292  8.614   1.00 0.63  ? 101 LYS A CE   4  
ATOM 7957  N NZ   . LYS A 1 101 ? 5.043   -5.001  9.877   1.00 0.92  ? 101 LYS A NZ   4  
ATOM 7958  H H    . LYS A 1 101 ? 7.439   -1.234  5.990   1.00 0.19  ? 101 LYS A H    4  
ATOM 7959  H HA   . LYS A 1 101 ? 4.849   -0.418  5.742   1.00 0.26  ? 101 LYS A HA   4  
ATOM 7960  H HB2  . LYS A 1 101 ? 6.060   -2.347  7.116   1.00 0.54  ? 101 LYS A HB2  4  
ATOM 7961  H HB3  . LYS A 1 101 ? 5.862   -1.220  8.437   1.00 0.49  ? 101 LYS A HB3  4  
ATOM 7962  H HG2  . LYS A 1 101 ? 3.421   -1.205  7.851   1.00 0.71  ? 101 LYS A HG2  4  
ATOM 7963  H HG3  . LYS A 1 101 ? 3.772   -2.572  6.819   1.00 0.73  ? 101 LYS A HG3  4  
ATOM 7964  H HD2  . LYS A 1 101 ? 4.526   -2.470  9.675   1.00 1.34  ? 101 LYS A HD2  4  
ATOM 7965  H HD3  . LYS A 1 101 ? 3.011   -3.124  9.139   1.00 1.33  ? 101 LYS A HD3  4  
ATOM 7966  H HE2  . LYS A 1 101 ? 4.022   -4.910  8.049   1.00 1.36  ? 101 LYS A HE2  4  
ATOM 7967  H HE3  . LYS A 1 101 ? 5.594   -4.132  8.039   1.00 1.37  ? 101 LYS A HE3  4  
ATOM 7968  H HZ1  . LYS A 1 101 ? 5.730   -4.441  10.433  1.00 1.30  ? 101 LYS A HZ1  4  
ATOM 7969  H HZ2  . LYS A 1 101 ? 5.459   -5.930  9.672   1.00 1.45  ? 101 LYS A HZ2  4  
ATOM 7970  H HZ3  . LYS A 1 101 ? 4.185   -5.139  10.450  1.00 1.55  ? 101 LYS A HZ3  4  
ATOM 7971  N N    . MET A 1 102 ? 6.258   1.076   8.321   1.00 0.20  ? 102 MET A N    4  
ATOM 7972  C CA   . MET A 1 102 ? 6.268   2.247   9.183   1.00 0.23  ? 102 MET A CA   4  
ATOM 7973  C C    . MET A 1 102 ? 6.542   3.524   8.398   1.00 0.20  ? 102 MET A C    4  
ATOM 7974  O O    . MET A 1 102 ? 5.835   4.517   8.564   1.00 0.26  ? 102 MET A O    4  
ATOM 7975  C CB   . MET A 1 102 ? 7.333   2.068   10.260  1.00 0.25  ? 102 MET A CB   4  
ATOM 7976  C CG   . MET A 1 102 ? 6.778   1.910   11.662  1.00 0.79  ? 102 MET A CG   4  
ATOM 7977  S SD   . MET A 1 102 ? 8.077   1.820   12.915  1.00 0.83  ? 102 MET A SD   4  
ATOM 7978  C CE   . MET A 1 102 ? 9.026   0.416   12.325  1.00 1.41  ? 102 MET A CE   4  
ATOM 7979  H H    . MET A 1 102 ? 6.878   0.341   8.516   1.00 0.19  ? 102 MET A H    4  
ATOM 7980  H HA   . MET A 1 102 ? 5.298   2.322   9.649   1.00 0.28  ? 102 MET A HA   4  
ATOM 7981  H HB2  . MET A 1 102 ? 7.902   1.184   10.027  1.00 0.59  ? 102 MET A HB2  4  
ATOM 7982  H HB3  . MET A 1 102 ? 7.993   2.920   10.246  1.00 0.57  ? 102 MET A HB3  4  
ATOM 7983  H HG2  . MET A 1 102 ? 6.142   2.754   11.880  1.00 1.14  ? 102 MET A HG2  4  
ATOM 7984  H HG3  . MET A 1 102 ? 6.195   1.001   11.703  1.00 1.13  ? 102 MET A HG3  4  
ATOM 7985  H HE1  . MET A 1 102 ? 9.434   0.640   11.351  1.00 1.87  ? 102 MET A HE1  4  
ATOM 7986  H HE2  . MET A 1 102 ? 8.384   -0.450  12.255  1.00 1.92  ? 102 MET A HE2  4  
ATOM 7987  H HE3  . MET A 1 102 ? 9.832   0.211   13.014  1.00 1.78  ? 102 MET A HE3  4  
ATOM 7988  N N    . THR A 1 103 ? 7.566   3.484   7.548   1.00 0.15  ? 103 THR A N    4  
ATOM 7989  C CA   . THR A 1 103 ? 7.951   4.628   6.735   1.00 0.16  ? 103 THR A CA   4  
ATOM 7990  C C    . THR A 1 103 ? 6.742   5.214   6.010   1.00 0.18  ? 103 THR A C    4  
ATOM 7991  O O    . THR A 1 103 ? 6.470   6.409   6.095   1.00 0.24  ? 103 THR A O    4  
ATOM 7992  C CB   . THR A 1 103 ? 9.021   4.222   5.700   1.00 0.18  ? 103 THR A CB   4  
ATOM 7993  O OG1  . THR A 1 103 ? 10.202  3.750   6.366   1.00 0.23  ? 103 THR A OG1  4  
ATOM 7994  C CG2  . THR A 1 103 ? 9.382   5.385   4.795   1.00 0.27  ? 103 THR A CG2  4  
ATOM 7995  H H    . THR A 1 103 ? 8.080   2.652   7.462   1.00 0.14  ? 103 THR A H    4  
ATOM 7996  H HA   . THR A 1 103 ? 8.371   5.379   7.385   1.00 0.19  ? 103 THR A HA   4  
ATOM 7997  H HB   . THR A 1 103 ? 8.620   3.427   5.092   1.00 0.19  ? 103 THR A HB   4  
ATOM 7998  H HG1  . THR A 1 103 ? 9.982   2.962   6.886   1.00 0.47  ? 103 THR A HG1  4  
ATOM 7999  H HG21 . THR A 1 103 ? 8.506   5.700   4.251   1.00 1.04  ? 103 THR A HG21 4  
ATOM 8000  H HG22 . THR A 1 103 ? 10.146  5.072   4.100   1.00 1.00  ? 103 THR A HG22 4  
ATOM 8001  H HG23 . THR A 1 103 ? 9.750   6.205   5.392   1.00 1.07  ? 103 THR A HG23 4  
ATOM 8002  N N    . LEU A 1 104 ? 6.005   4.353   5.333   1.00 0.16  ? 104 LEU A N    4  
ATOM 8003  C CA   . LEU A 1 104 ? 4.850   4.762   4.569   1.00 0.20  ? 104 LEU A CA   4  
ATOM 8004  C C    . LEU A 1 104 ? 3.720   5.207   5.484   1.00 0.22  ? 104 LEU A C    4  
ATOM 8005  O O    . LEU A 1 104 ? 3.221   6.326   5.381   1.00 0.26  ? 104 LEU A O    4  
ATOM 8006  C CB   . LEU A 1 104 ? 4.399   3.579   3.735   1.00 0.23  ? 104 LEU A CB   4  
ATOM 8007  C CG   . LEU A 1 104 ? 5.372   3.164   2.648   1.00 0.25  ? 104 LEU A CG   4  
ATOM 8008  C CD1  . LEU A 1 104 ? 5.086   1.747   2.185   1.00 0.99  ? 104 LEU A CD1  4  
ATOM 8009  C CD2  . LEU A 1 104 ? 5.275   4.137   1.500   1.00 1.03  ? 104 LEU A CD2  4  
ATOM 8010  H H    . LEU A 1 104 ? 6.239   3.395   5.354   1.00 0.16  ? 104 LEU A H    4  
ATOM 8011  H HA   . LEU A 1 104 ? 5.135   5.575   3.918   1.00 0.23  ? 104 LEU A HA   4  
ATOM 8012  H HB2  . LEU A 1 104 ? 4.245   2.739   4.395   1.00 0.22  ? 104 LEU A HB2  4  
ATOM 8013  H HB3  . LEU A 1 104 ? 3.457   3.827   3.270   1.00 0.26  ? 104 LEU A HB3  4  
ATOM 8014  H HG   . LEU A 1 104 ? 6.380   3.197   3.036   1.00 0.76  ? 104 LEU A HG   4  
ATOM 8015  H HD11 . LEU A 1 104 ? 4.074   1.683   1.817   1.00 1.58  ? 104 LEU A HD11 4  
ATOM 8016  H HD12 . LEU A 1 104 ? 5.216   1.068   3.017   1.00 1.46  ? 104 LEU A HD12 4  
ATOM 8017  H HD13 . LEU A 1 104 ? 5.775   1.480   1.398   1.00 1.67  ? 104 LEU A HD13 4  
ATOM 8018  H HD21 . LEU A 1 104 ? 4.296   4.067   1.054   1.00 1.69  ? 104 LEU A HD21 4  
ATOM 8019  H HD22 . LEU A 1 104 ? 6.027   3.903   0.764   1.00 1.54  ? 104 LEU A HD22 4  
ATOM 8020  H HD23 . LEU A 1 104 ? 5.430   5.138   1.872   1.00 1.59  ? 104 LEU A HD23 4  
ATOM 8021  N N    . GLN A 1 105 ? 3.350   4.307   6.382   1.00 0.22  ? 105 GLN A N    4  
ATOM 8022  C CA   . GLN A 1 105 ? 2.238   4.500   7.306   1.00 0.27  ? 105 GLN A CA   4  
ATOM 8023  C C    . GLN A 1 105 ? 2.334   5.840   8.042   1.00 0.25  ? 105 GLN A C    4  
ATOM 8024  O O    . GLN A 1 105 ? 1.358   6.585   8.124   1.00 0.27  ? 105 GLN A O    4  
ATOM 8025  C CB   . GLN A 1 105 ? 2.240   3.350   8.307   1.00 0.33  ? 105 GLN A CB   4  
ATOM 8026  C CG   . GLN A 1 105 ? 0.867   2.858   8.691   1.00 0.55  ? 105 GLN A CG   4  
ATOM 8027  C CD   . GLN A 1 105 ? 0.224   3.673   9.798   1.00 1.00  ? 105 GLN A CD   4  
ATOM 8028  O OE1  . GLN A 1 105 ? 0.410   3.386   10.981  1.00 1.72  ? 105 GLN A OE1  4  
ATOM 8029  N NE2  . GLN A 1 105 ? -0.547  4.682   9.427   1.00 1.60  ? 105 GLN A NE2  4  
ATOM 8030  H H    . GLN A 1 105 ? 3.849   3.460   6.422   1.00 0.21  ? 105 GLN A H    4  
ATOM 8031  H HA   . GLN A 1 105 ? 1.315   4.473   6.744   1.00 0.34  ? 105 GLN A HA   4  
ATOM 8032  H HB2  . GLN A 1 105 ? 2.802   2.522   7.899   1.00 0.29  ? 105 GLN A HB2  4  
ATOM 8033  H HB3  . GLN A 1 105 ? 2.723   3.678   9.194   1.00 0.36  ? 105 GLN A HB3  4  
ATOM 8034  H HG2  . GLN A 1 105 ? 0.239   2.904   7.825   1.00 0.67  ? 105 GLN A HG2  4  
ATOM 8035  H HG3  . GLN A 1 105 ? 0.955   1.842   9.017   1.00 0.76  ? 105 GLN A HG3  4  
ATOM 8036  H HE21 . GLN A 1 105 ? -0.663  4.848   8.470   1.00 2.10  ? 105 GLN A HE21 4  
ATOM 8037  H HE22 . GLN A 1 105 ? -0.970  5.224   10.127  1.00 1.93  ? 105 GLN A HE22 4  
ATOM 8038  N N    . GLN A 1 106 ? 3.517   6.146   8.561   1.00 0.23  ? 106 GLN A N    4  
ATOM 8039  C CA   . GLN A 1 106 ? 3.724   7.356   9.336   1.00 0.25  ? 106 GLN A CA   4  
ATOM 8040  C C    . GLN A 1 106 ? 3.631   8.604   8.470   1.00 0.22  ? 106 GLN A C    4  
ATOM 8041  O O    . GLN A 1 106 ? 3.020   9.590   8.874   1.00 0.25  ? 106 GLN A O    4  
ATOM 8042  C CB   . GLN A 1 106 ? 5.068   7.289   10.041  1.00 0.31  ? 106 GLN A CB   4  
ATOM 8043  C CG   . GLN A 1 106 ? 5.085   6.287   11.182  1.00 0.37  ? 106 GLN A CG   4  
ATOM 8044  C CD   . GLN A 1 106 ? 4.128   6.663   12.296  1.00 1.40  ? 106 GLN A CD   4  
ATOM 8045  O OE1  . GLN A 1 106 ? 3.886   7.843   12.555  1.00 2.15  ? 106 GLN A OE1  4  
ATOM 8046  N NE2  . GLN A 1 106 ? 3.567   5.666   12.958  1.00 2.21  ? 106 GLN A NE2  4  
ATOM 8047  H H    . GLN A 1 106 ? 4.278   5.541   8.418   1.00 0.23  ? 106 GLN A H    4  
ATOM 8048  H HA   . GLN A 1 106 ? 2.949   7.402   10.084  1.00 0.28  ? 106 GLN A HA   4  
ATOM 8049  H HB2  . GLN A 1 106 ? 5.822   7.006   9.326   1.00 0.34  ? 106 GLN A HB2  4  
ATOM 8050  H HB3  . GLN A 1 106 ? 5.303   8.259   10.436  1.00 0.36  ? 106 GLN A HB3  4  
ATOM 8051  H HG2  . GLN A 1 106 ? 4.805   5.318   10.798  1.00 0.87  ? 106 GLN A HG2  4  
ATOM 8052  H HG3  . GLN A 1 106 ? 6.083   6.240   11.584  1.00 0.89  ? 106 GLN A HG3  4  
ATOM 8053  H HE21 . GLN A 1 106 ? 3.792   4.746   12.696  1.00 2.44  ? 106 GLN A HE21 4  
ATOM 8054  H HE22 . GLN A 1 106 ? 2.948   5.884   13.686  1.00 2.91  ? 106 GLN A HE22 4  
ATOM 8055  N N    . ILE A 1 107 ? 4.223   8.566   7.281   1.00 0.21  ? 107 ILE A N    4  
ATOM 8056  C CA   . ILE A 1 107 ? 4.128   9.696   6.365   1.00 0.23  ? 107 ILE A CA   4  
ATOM 8057  C C    . ILE A 1 107 ? 2.671   9.921   5.960   1.00 0.26  ? 107 ILE A C    4  
ATOM 8058  O O    . ILE A 1 107 ? 2.206   11.059  5.890   1.00 0.31  ? 107 ILE A O    4  
ATOM 8059  C CB   . ILE A 1 107 ? 4.997   9.498   5.104   1.00 0.25  ? 107 ILE A CB   4  
ATOM 8060  C CG1  . ILE A 1 107 ? 6.474   9.339   5.476   1.00 0.22  ? 107 ILE A CG1  4  
ATOM 8061  C CG2  . ILE A 1 107 ? 4.826   10.675  4.166   1.00 0.39  ? 107 ILE A CG2  4  
ATOM 8062  C CD1  . ILE A 1 107 ? 7.382   9.075   4.291   1.00 0.25  ? 107 ILE A CD1  4  
ATOM 8063  H H    . ILE A 1 107 ? 4.734   7.769   7.017   1.00 0.21  ? 107 ILE A H    4  
ATOM 8064  H HA   . ILE A 1 107 ? 4.478   10.574  6.887   1.00 0.25  ? 107 ILE A HA   4  
ATOM 8065  H HB   . ILE A 1 107 ? 4.660   8.608   4.597   1.00 0.27  ? 107 ILE A HB   4  
ATOM 8066  H HG12 . ILE A 1 107 ? 6.816   10.238  5.962   1.00 0.27  ? 107 ILE A HG12 4  
ATOM 8067  H HG13 . ILE A 1 107 ? 6.575   8.512   6.155   1.00 0.20  ? 107 ILE A HG13 4  
ATOM 8068  H HG21 . ILE A 1 107 ? 5.186   11.573  4.646   1.00 1.16  ? 107 ILE A HG21 4  
ATOM 8069  H HG22 . ILE A 1 107 ? 3.781   10.792  3.921   1.00 0.94  ? 107 ILE A HG22 4  
ATOM 8070  H HG23 . ILE A 1 107 ? 5.388   10.499  3.269   1.00 1.11  ? 107 ILE A HG23 4  
ATOM 8071  H HD11 . ILE A 1 107 ? 7.089   8.152   3.808   1.00 1.05  ? 107 ILE A HD11 4  
ATOM 8072  H HD12 . ILE A 1 107 ? 8.404   8.992   4.631   1.00 1.08  ? 107 ILE A HD12 4  
ATOM 8073  H HD13 . ILE A 1 107 ? 7.303   9.889   3.588   1.00 0.99  ? 107 ILE A HD13 4  
ATOM 8074  N N    . ILE A 1 108 ? 1.956   8.827   5.717   1.00 0.26  ? 108 ILE A N    4  
ATOM 8075  C CA   . ILE A 1 108 ? 0.519   8.880   5.460   1.00 0.30  ? 108 ILE A CA   4  
ATOM 8076  C C    . ILE A 1 108 ? -0.197  9.573   6.617   1.00 0.33  ? 108 ILE A C    4  
ATOM 8077  O O    . ILE A 1 108 ? -1.012  10.471  6.413   1.00 0.40  ? 108 ILE A O    4  
ATOM 8078  C CB   . ILE A 1 108 ? -0.058  7.456   5.275   1.00 0.32  ? 108 ILE A CB   4  
ATOM 8079  C CG1  . ILE A 1 108 ? 0.464   6.831   3.980   1.00 0.35  ? 108 ILE A CG1  4  
ATOM 8080  C CG2  . ILE A 1 108 ? -1.580  7.466   5.284   1.00 0.32  ? 108 ILE A CG2  4  
ATOM 8081  C CD1  . ILE A 1 108 ? -0.006  5.409   3.764   1.00 0.39  ? 108 ILE A CD1  4  
ATOM 8082  H H    . ILE A 1 108 ? 2.411   7.953   5.703   1.00 0.24  ? 108 ILE A H    4  
ATOM 8083  H HA   . ILE A 1 108 ? 0.356   9.444   4.553   1.00 0.33  ? 108 ILE A HA   4  
ATOM 8084  H HB   . ILE A 1 108 ? 0.271   6.853   6.107   1.00 0.35  ? 108 ILE A HB   4  
ATOM 8085  H HG12 . ILE A 1 108 ? 0.129   7.421   3.141   1.00 0.35  ? 108 ILE A HG12 4  
ATOM 8086  H HG13 . ILE A 1 108 ? 1.544   6.824   4.003   1.00 0.41  ? 108 ILE A HG13 4  
ATOM 8087  H HG21 . ILE A 1 108 ? -1.932  7.901   6.208   1.00 1.09  ? 108 ILE A HG21 4  
ATOM 8088  H HG22 . ILE A 1 108 ? -1.942  6.451   5.205   1.00 0.95  ? 108 ILE A HG22 4  
ATOM 8089  H HG23 . ILE A 1 108 ? -1.944  8.046   4.448   1.00 1.05  ? 108 ILE A HG23 4  
ATOM 8090  H HD11 . ILE A 1 108 ? 0.391   5.035   2.832   1.00 1.14  ? 108 ILE A HD11 4  
ATOM 8091  H HD12 . ILE A 1 108 ? -1.086  5.386   3.731   1.00 1.06  ? 108 ILE A HD12 4  
ATOM 8092  H HD13 . ILE A 1 108 ? 0.340   4.786   4.577   1.00 1.08  ? 108 ILE A HD13 4  
ATOM 8093  N N    . SER A 1 109 ? 0.138   9.157   7.831   1.00 0.31  ? 109 SER A N    4  
ATOM 8094  C CA   . SER A 1 109 ? -0.441  9.727   9.040   1.00 0.35  ? 109 SER A CA   4  
ATOM 8095  C C    . SER A 1 109 ? -0.081  11.215  9.174   1.00 0.39  ? 109 SER A C    4  
ATOM 8096  O O    . SER A 1 109 ? -0.866  12.006  9.703   1.00 0.46  ? 109 SER A O    4  
ATOM 8097  C CB   . SER A 1 109 ? 0.049   8.935   10.262  1.00 0.36  ? 109 SER A CB   4  
ATOM 8098  O OG   . SER A 1 109 ? -0.501  9.436   11.468  1.00 1.32  ? 109 SER A OG   4  
ATOM 8099  H H    . SER A 1 109 ? 0.797   8.431   7.917   1.00 0.28  ? 109 SER A H    4  
ATOM 8100  H HA   . SER A 1 109 ? -1.522  9.636   8.967   1.00 0.41  ? 109 SER A HA   4  
ATOM 8101  H HB2  . SER A 1 109 ? -0.246  7.902   10.154  1.00 0.81  ? 109 SER A HB2  4  
ATOM 8102  H HB3  . SER A 1 109 ? 1.128   8.992   10.318  1.00 1.05  ? 109 SER A HB3  4  
ATOM 8103  H HG   . SER A 1 109 ? -0.617  8.706   12.091  1.00 1.90  ? 109 SER A HG   4  
ATOM 8104  N N    . ARG A 1 110 ? 1.099   11.594  8.678   1.00 0.38  ? 110 ARG A N    4  
ATOM 8105  C CA   . ARG A 1 110 ? 1.521   12.994  8.691   1.00 0.43  ? 110 ARG A CA   4  
ATOM 8106  C C    . ARG A 1 110 ? 0.590   13.846  7.836   1.00 0.48  ? 110 ARG A C    4  
ATOM 8107  O O    . ARG A 1 110 ? 0.260   14.977  8.194   1.00 0.62  ? 110 ARG A O    4  
ATOM 8108  C CB   . ARG A 1 110 ? 2.953   13.155  8.191   1.00 0.45  ? 110 ARG A CB   4  
ATOM 8109  C CG   . ARG A 1 110 ? 3.999   12.527  9.074   1.00 0.97  ? 110 ARG A CG   4  
ATOM 8110  C CD   . ARG A 1 110 ? 5.354   12.609  8.407   1.00 0.88  ? 110 ARG A CD   4  
ATOM 8111  N NE   . ARG A 1 110 ? 6.400   11.935  9.175   1.00 1.78  ? 110 ARG A NE   4  
ATOM 8112  C CZ   . ARG A 1 110 ? 7.639   11.729  8.726   1.00 1.98  ? 110 ARG A CZ   4  
ATOM 8113  N NH1  . ARG A 1 110 ? 8.005   12.188  7.533   1.00 1.39  ? 110 ARG A NH1  4  
ATOM 8114  N NH2  . ARG A 1 110 ? 8.514   11.069  9.471   1.00 2.87  ? 110 ARG A NH2  4  
ATOM 8115  H H    . ARG A 1 110 ? 1.702   10.914  8.304   1.00 0.36  ? 110 ARG A H    4  
ATOM 8116  H HA   . ARG A 1 110 ? 1.475   13.340  9.706   1.00 0.48  ? 110 ARG A HA   4  
ATOM 8117  H HB2  . ARG A 1 110 ? 3.038   12.716  7.217   1.00 0.98  ? 110 ARG A HB2  4  
ATOM 8118  H HB3  . ARG A 1 110 ? 3.177   14.203  8.119   1.00 1.02  ? 110 ARG A HB3  4  
ATOM 8119  H HG2  . ARG A 1 110 ? 4.030   13.065  10.006  1.00 1.52  ? 110 ARG A HG2  4  
ATOM 8120  H HG3  . ARG A 1 110 ? 3.749   11.491  9.249   1.00 1.51  ? 110 ARG A HG3  4  
ATOM 8121  H HD2  . ARG A 1 110 ? 5.280   12.153  7.436   1.00 0.91  ? 110 ARG A HD2  4  
ATOM 8122  H HD3  . ARG A 1 110 ? 5.611   13.647  8.289   1.00 0.92  ? 110 ARG A HD3  4  
ATOM 8123  H HE   . ARG A 1 110 ? 6.156   11.602  10.071  1.00 2.33  ? 110 ARG A HE   4  
ATOM 8124  H HH11 . ARG A 1 110 ? 7.354   12.696  6.966   1.00 0.94  ? 110 ARG A HH11 4  
ATOM 8125  H HH12 . ARG A 1 110 ? 8.936   12.025  7.192   1.00 1.59  ? 110 ARG A HH12 4  
ATOM 8126  H HH21 . ARG A 1 110 ? 8.249   10.718  10.374  1.00 3.42  ? 110 ARG A HH21 4  
ATOM 8127  H HH22 . ARG A 1 110 ? 9.447   10.916  9.135   1.00 3.03  ? 110 ARG A HH22 4  
ATOM 8128  N N    . TYR A 1 111 ? 0.142   13.279  6.721   1.00 0.44  ? 111 TYR A N    4  
ATOM 8129  C CA   . TYR A 1 111 ? -0.742  13.987  5.802   1.00 0.51  ? 111 TYR A CA   4  
ATOM 8130  C C    . TYR A 1 111 ? -2.185  13.832  6.246   1.00 0.61  ? 111 TYR A C    4  
ATOM 8131  O O    . TYR A 1 111 ? -3.070  14.563  5.804   1.00 0.75  ? 111 TYR A O    4  
ATOM 8132  C CB   . TYR A 1 111 ? -0.572  13.454  4.376   1.00 0.51  ? 111 TYR A CB   4  
ATOM 8133  C CG   . TYR A 1 111 ? 0.830   13.605  3.847   1.00 0.76  ? 111 TYR A CG   4  
ATOM 8134  C CD1  . TYR A 1 111 ? 1.525   14.795  4.011   1.00 1.67  ? 111 TYR A CD1  4  
ATOM 8135  C CD2  . TYR A 1 111 ? 1.464   12.557  3.201   1.00 0.79  ? 111 TYR A CD2  4  
ATOM 8136  C CE1  . TYR A 1 111 ? 2.813   14.935  3.543   1.00 2.33  ? 111 TYR A CE1  4  
ATOM 8137  C CE2  . TYR A 1 111 ? 2.752   12.687  2.733   1.00 1.30  ? 111 TYR A CE2  4  
ATOM 8138  C CZ   . TYR A 1 111 ? 3.424   13.880  2.908   1.00 2.05  ? 111 TYR A CZ   4  
ATOM 8139  O OH   . TYR A 1 111 ? 4.712   14.016  2.453   1.00 2.75  ? 111 TYR A OH   4  
ATOM 8140  H H    . TYR A 1 111 ? 0.417   12.360  6.508   1.00 0.38  ? 111 TYR A H    4  
ATOM 8141  H HA   . TYR A 1 111 ? -0.479  15.034  5.825   1.00 0.58  ? 111 TYR A HA   4  
ATOM 8142  H HB2  . TYR A 1 111 ? -0.820  12.404  4.361   1.00 0.92  ? 111 TYR A HB2  4  
ATOM 8143  H HB3  . TYR A 1 111 ? -1.236  13.983  3.715   1.00 0.90  ? 111 TYR A HB3  4  
ATOM 8144  H HD1  . TYR A 1 111 ? 1.042   15.622  4.511   1.00 1.98  ? 111 TYR A HD1  4  
ATOM 8145  H HD2  . TYR A 1 111 ? 0.936   11.625  3.066   1.00 1.04  ? 111 TYR A HD2  4  
ATOM 8146  H HE1  . TYR A 1 111 ? 3.339   15.868  3.681   1.00 3.10  ? 111 TYR A HE1  4  
ATOM 8147  H HE2  . TYR A 1 111 ? 3.228   11.856  2.233   1.00 1.39  ? 111 TYR A HE2  4  
ATOM 8148  H HH   . TYR A 1 111 ? 5.236   14.476  3.120   1.00 2.95  ? 111 TYR A HH   4  
ATOM 8149  N N    . LYS A 1 112 ? -2.412  12.874  7.125   1.00 0.60  ? 112 LYS A N    4  
ATOM 8150  C CA   . LYS A 1 112 ? -3.718  12.677  7.716   1.00 0.72  ? 112 LYS A CA   4  
ATOM 8151  C C    . LYS A 1 112 ? -3.992  13.721  8.783   1.00 0.82  ? 112 LYS A C    4  
ATOM 8152  O O    . LYS A 1 112 ? -5.069  14.312  8.826   1.00 1.00  ? 112 LYS A O    4  
ATOM 8153  C CB   . LYS A 1 112 ? -3.830  11.283  8.300   1.00 0.65  ? 112 LYS A CB   4  
ATOM 8154  C CG   . LYS A 1 112 ? -4.209  10.275  7.302   1.00 0.66  ? 112 LYS A CG   4  
ATOM 8155  C CD   . LYS A 1 112 ? -4.362  8.959   7.967   1.00 0.79  ? 112 LYS A CD   4  
ATOM 8156  C CE   . LYS A 1 112 ? -5.207  8.095   7.110   1.00 1.06  ? 112 LYS A CE   4  
ATOM 8157  N NZ   . LYS A 1 112 ? -5.198  6.672   7.522   1.00 1.63  ? 112 LYS A NZ   4  
ATOM 8158  H H    . LYS A 1 112 ? -1.678  12.274  7.374   1.00 0.53  ? 112 LYS A H    4  
ATOM 8159  H HA   . LYS A 1 112 ? -4.450  12.771  6.931   1.00 0.83  ? 112 LYS A HA   4  
ATOM 8160  H HB2  . LYS A 1 112 ? -2.893  10.979  8.713   1.00 1.01  ? 112 LYS A HB2  4  
ATOM 8161  H HB3  . LYS A 1 112 ? -4.568  11.266  9.063   1.00 0.83  ? 112 LYS A HB3  4  
ATOM 8162  H HG2  . LYS A 1 112 ? -5.139  10.555  6.833   1.00 0.90  ? 112 LYS A HG2  4  
ATOM 8163  H HG3  . LYS A 1 112 ? -3.431  10.203  6.574   1.00 1.12  ? 112 LYS A HG3  4  
ATOM 8164  H HD2  . LYS A 1 112 ? -3.387  8.522   8.074   1.00 0.91  ? 112 LYS A HD2  4  
ATOM 8165  H HD3  . LYS A 1 112 ? -4.823  9.092   8.924   1.00 0.95  ? 112 LYS A HD3  4  
ATOM 8166  H HE2  . LYS A 1 112 ? -6.222  8.466   7.137   1.00 1.20  ? 112 LYS A HE2  4  
ATOM 8167  H HE3  . LYS A 1 112 ? -4.817  8.195   6.128   1.00 1.67  ? 112 LYS A HE3  4  
ATOM 8168  H HZ1  . LYS A 1 112 ? -4.226  6.312   7.561   1.00 2.18  ? 112 LYS A HZ1  4  
ATOM 8169  H HZ2  . LYS A 1 112 ? -5.738  6.103   6.838   1.00 2.02  ? 112 LYS A HZ2  4  
ATOM 8170  H HZ3  . LYS A 1 112 ? -5.634  6.566   8.460   1.00 2.08  ? 112 LYS A HZ3  4  
ATOM 8171  N N    . ASP A 1 113 ? -3.006  13.952  9.637   1.00 0.77  ? 113 ASP A N    4  
ATOM 8172  C CA   . ASP A 1 113 ? -3.154  14.918  10.714  1.00 0.91  ? 113 ASP A CA   4  
ATOM 8173  C C    . ASP A 1 113 ? -3.050  16.334  10.167  1.00 0.99  ? 113 ASP A C    4  
ATOM 8174  O O    . ASP A 1 113 ? -3.796  17.229  10.564  1.00 1.15  ? 113 ASP A O    4  
ATOM 8175  C CB   . ASP A 1 113 ? -2.078  14.691  11.772  1.00 0.91  ? 113 ASP A CB   4  
ATOM 8176  C CG   . ASP A 1 113 ? -2.349  15.450  13.054  1.00 1.31  ? 113 ASP A CG   4  
ATOM 8177  O OD1  . ASP A 1 113 ? -3.161  14.971  13.873  1.00 1.55  ? 113 ASP A OD1  4  
ATOM 8178  O OD2  . ASP A 1 113 ? -1.742  16.520  13.258  1.00 1.60  ? 113 ASP A OD2  4  
ATOM 8179  H H    . ASP A 1 113 ? -2.164  13.454  9.545   1.00 0.66  ? 113 ASP A H    4  
ATOM 8180  H HA   . ASP A 1 113 ? -4.128  14.782  11.159  1.00 1.01  ? 113 ASP A HA   4  
ATOM 8181  H HB2  . ASP A 1 113 ? -2.023  13.644  11.996  1.00 0.88  ? 113 ASP A HB2  4  
ATOM 8182  H HB3  . ASP A 1 113 ? -1.129  15.012  11.381  1.00 0.93  ? 113 ASP A HB3  4  
ATOM 8183  N N    . ALA A 1 114 ? -2.121  16.492  9.220   1.00 0.91  ? 114 ALA A N    4  
ATOM 8184  C CA   . ALA A 1 114 ? -1.978  17.709  8.412   1.00 0.99  ? 114 ALA A CA   4  
ATOM 8185  C C    . ALA A 1 114 ? -1.834  18.976  9.253   1.00 1.16  ? 114 ALA A C    4  
ATOM 8186  O O    . ALA A 1 114 ? -2.130  20.075  8.781   1.00 1.33  ? 114 ALA A O    4  
ATOM 8187  C CB   . ALA A 1 114 ? -3.157  17.840  7.462   1.00 1.07  ? 114 ALA A CB   4  
ATOM 8188  H H    . ALA A 1 114 ? -1.497  15.751  9.056   1.00 0.81  ? 114 ALA A H    4  
ATOM 8189  H HA   . ALA A 1 114 ? -1.086  17.596  7.812   1.00 0.95  ? 114 ALA A HA   4  
ATOM 8190  H HB1  . ALA A 1 114 ? -4.061  17.990  8.034   1.00 1.53  ? 114 ALA A HB1  4  
ATOM 8191  H HB2  . ALA A 1 114 ? -3.247  16.939  6.874   1.00 1.53  ? 114 ALA A HB2  4  
ATOM 8192  H HB3  . ALA A 1 114 ? -2.999  18.683  6.808   1.00 1.42  ? 114 ALA A HB3  4  
ATOM 8193  N N    . ASP A 1 115 ? -1.370  18.824  10.482  1.00 1.20  ? 115 ASP A N    4  
ATOM 8194  C CA   . ASP A 1 115 ? -1.222  19.954  11.389  1.00 1.43  ? 115 ASP A CA   4  
ATOM 8195  C C    . ASP A 1 115 ? 0.248   20.245  11.645  1.00 1.61  ? 115 ASP A C    4  
ATOM 8196  O O    . ASP A 1 115 ? 0.898   19.450  12.357  1.00 2.01  ? 115 ASP A O    4  
ATOM 8197  C CB   . ASP A 1 115 ? -1.939  19.685  12.711  1.00 1.66  ? 115 ASP A CB   4  
ATOM 8198  C CG   . ASP A 1 115 ? -1.878  20.869  13.653  1.00 1.90  ? 115 ASP A CG   4  
ATOM 8199  O OD1  . ASP A 1 115 ? -2.728  21.779  13.538  1.00 2.23  ? 115 ASP A OD1  4  
ATOM 8200  O OD2  . ASP A 1 115 ? -0.972  20.909  14.506  1.00 1.96  ? 115 ASP A OD2  4  
ATOM 8201  O OXT  . ASP A 1 115 ? 0.754   21.262  11.132  1.00 2.09  ? 115 ASP A OXT  4  
ATOM 8202  H H    . ASP A 1 115 ? -1.122  17.927  10.789  1.00 1.12  ? 115 ASP A H    4  
ATOM 8203  H HA   . ASP A 1 115 ? -1.669  20.816  10.916  1.00 1.58  ? 115 ASP A HA   4  
ATOM 8204  H HB2  . ASP A 1 115 ? -2.976  19.460  12.512  1.00 1.77  ? 115 ASP A HB2  4  
ATOM 8205  H HB3  . ASP A 1 115 ? -1.479  18.836  13.196  1.00 1.74  ? 115 ASP A HB3  4  
ATOM 8206  N N    . ASP B 2 1   ? -9.228  -15.036 -10.386 1.00 2.92  ? 22  ASP B N    4  
ATOM 8207  C CA   . ASP B 2 1   ? -8.972  -16.046 -9.331  1.00 2.59  ? 22  ASP B CA   4  
ATOM 8208  C C    . ASP B 2 1   ? -7.702  -15.728 -8.557  1.00 2.27  ? 22  ASP B C    4  
ATOM 8209  O O    . ASP B 2 1   ? -7.698  -15.746 -7.326  1.00 2.08  ? 22  ASP B O    4  
ATOM 8210  C CB   . ASP B 2 1   ? -8.854  -17.445 -9.941  1.00 2.80  ? 22  ASP B CB   4  
ATOM 8211  C CG   . ASP B 2 1   ? -10.182 -17.980 -10.423 1.00 3.30  ? 22  ASP B CG   4  
ATOM 8212  O OD1  . ASP B 2 1   ? -10.702 -17.467 -11.436 1.00 3.79  ? 22  ASP B OD1  4  
ATOM 8213  O OD2  . ASP B 2 1   ? -10.712 -18.919 -9.795  1.00 3.65  ? 22  ASP B OD2  4  
ATOM 8214  H H1   . ASP B 2 1   ? -8.396  -14.932 -10.998 1.00 3.10  ? 22  ASP B H1   4  
ATOM 8215  H H2   . ASP B 2 1   ? -9.445  -14.111 -9.951  1.00 3.28  ? 22  ASP B H2   4  
ATOM 8216  H H3   . ASP B 2 1   ? -10.039 -15.325 -10.969 1.00 3.12  ? 22  ASP B H3   4  
ATOM 8217  H HA   . ASP B 2 1   ? -9.806  -16.034 -8.645  1.00 2.62  ? 22  ASP B HA   4  
ATOM 8218  H HB2  . ASP B 2 1   ? -8.176  -17.409 -10.780 1.00 2.95  ? 22  ASP B HB2  4  
ATOM 8219  H HB3  . ASP B 2 1   ? -8.463  -18.123 -9.197  1.00 3.06  ? 22  ASP B HB3  4  
ATOM 8220  N N    . THR B 2 2   ? -6.633  -15.407 -9.277  1.00 2.32  ? 23  THR B N    4  
ATOM 8221  C CA   . THR B 2 2   ? -5.337  -15.181 -8.657  1.00 2.14  ? 23  THR B CA   4  
ATOM 8222  C C    . THR B 2 2   ? -5.333  -13.915 -7.810  1.00 1.87  ? 23  THR B C    4  
ATOM 8223  O O    . THR B 2 2   ? -4.983  -13.953 -6.633  1.00 1.65  ? 23  THR B O    4  
ATOM 8224  C CB   . THR B 2 2   ? -4.229  -15.100 -9.714  1.00 2.44  ? 23  THR B CB   4  
ATOM 8225  O OG1  . THR B 2 2   ? -4.651  -14.260 -10.796 1.00 2.75  ? 23  THR B OG1  4  
ATOM 8226  C CG2  . THR B 2 2   ? -3.878  -16.485 -10.237 1.00 2.78  ? 23  THR B CG2  4  
ATOM 8227  H H    . THR B 2 2   ? -6.714  -15.321 -10.253 1.00 2.56  ? 23  THR B H    4  
ATOM 8228  H HA   . THR B 2 2   ? -5.124  -16.023 -8.017  1.00 2.12  ? 23  THR B HA   4  
ATOM 8229  H HB   . THR B 2 2   ? -3.355  -14.670 -9.253  1.00 2.61  ? 23  THR B HB   4  
ATOM 8230  H HG1  . THR B 2 2   ? -4.616  -14.757 -11.620 1.00 3.07  ? 23  THR B HG1  4  
ATOM 8231  H HG21 . THR B 2 2   ? -4.758  -16.943 -10.664 1.00 3.18  ? 23  THR B HG21 4  
ATOM 8232  H HG22 . THR B 2 2   ? -3.512  -17.096 -9.425  1.00 3.12  ? 23  THR B HG22 4  
ATOM 8233  H HG23 . THR B 2 2   ? -3.114  -16.400 -10.994 1.00 2.90  ? 23  THR B HG23 4  
ATOM 8234  N N    . GLN B 2 3   ? -5.738  -12.802 -8.407  1.00 1.97  ? 24  GLN B N    4  
ATOM 8235  C CA   . GLN B 2 3   ? -5.820  -11.536 -7.687  1.00 1.86  ? 24  GLN B CA   4  
ATOM 8236  C C    . GLN B 2 3   ? -6.895  -11.608 -6.611  1.00 1.69  ? 24  GLN B C    4  
ATOM 8237  O O    . GLN B 2 3   ? -6.815  -10.938 -5.582  1.00 1.59  ? 24  GLN B O    4  
ATOM 8238  C CB   . GLN B 2 3   ? -6.121  -10.386 -8.650  1.00 2.14  ? 24  GLN B CB   4  
ATOM 8239  C CG   . GLN B 2 3   ? -5.017  -10.124 -9.660  1.00 2.53  ? 24  GLN B CG   4  
ATOM 8240  C CD   . GLN B 2 3   ? -3.690  -9.810  -8.999  1.00 3.01  ? 24  GLN B CD   4  
ATOM 8241  O OE1  . GLN B 2 3   ? -3.396  -8.656  -8.684  1.00 3.39  ? 24  GLN B OE1  4  
ATOM 8242  N NE2  . GLN B 2 3   ? -2.871  -10.830 -8.799  1.00 3.58  ? 24  GLN B NE2  4  
ATOM 8243  H H    . GLN B 2 3   ? -5.987  -12.832 -9.358  1.00 2.18  ? 24  GLN B H    4  
ATOM 8244  H HA   . GLN B 2 3   ? -4.866  -11.358 -7.216  1.00 1.79  ? 24  GLN B HA   4  
ATOM 8245  H HB2  . GLN B 2 3   ? -7.026  -10.616 -9.190  1.00 2.52  ? 24  GLN B HB2  4  
ATOM 8246  H HB3  . GLN B 2 3   ? -6.276  -9.484  -8.076  1.00 2.37  ? 24  GLN B HB3  4  
ATOM 8247  H HG2  . GLN B 2 3   ? -4.893  -11.001 -10.278 1.00 2.85  ? 24  GLN B HG2  4  
ATOM 8248  H HG3  . GLN B 2 3   ? -5.302  -9.286  -10.279 1.00 2.92  ? 24  GLN B HG3  4  
ATOM 8249  H HE21 . GLN B 2 3   ? -3.160  -11.720 -9.088  1.00 3.72  ? 24  GLN B HE21 4  
ATOM 8250  H HE22 . GLN B 2 3   ? -2.005  -10.653 -8.368  1.00 4.10  ? 24  GLN B HE22 4  
ATOM 8251  N N    . ASP B 2 4   ? -7.890  -12.452 -6.853  1.00 1.74  ? 25  ASP B N    4  
ATOM 8252  C CA   . ASP B 2 4   ? -8.997  -12.618 -5.919  1.00 1.67  ? 25  ASP B CA   4  
ATOM 8253  C C    . ASP B 2 4   ? -8.532  -13.368 -4.681  1.00 1.46  ? 25  ASP B C    4  
ATOM 8254  O O    . ASP B 2 4   ? -9.071  -13.189 -3.592  1.00 1.37  ? 25  ASP B O    4  
ATOM 8255  C CB   . ASP B 2 4   ? -10.159 -13.361 -6.576  1.00 1.88  ? 25  ASP B CB   4  
ATOM 8256  C CG   . ASP B 2 4   ? -10.674 -12.655 -7.812  1.00 2.23  ? 25  ASP B CG   4  
ATOM 8257  O OD1  . ASP B 2 4   ? -11.439 -11.677 -7.676  1.00 2.56  ? 25  ASP B OD1  4  
ATOM 8258  O OD2  . ASP B 2 4   ? -10.327 -13.090 -8.931  1.00 2.67  ? 25  ASP B OD2  4  
ATOM 8259  H H    . ASP B 2 4   ? -7.874  -12.979 -7.679  1.00 1.88  ? 25  ASP B H    4  
ATOM 8260  H HA   . ASP B 2 4   ? -9.330  -11.634 -5.624  1.00 1.70  ? 25  ASP B HA   4  
ATOM 8261  H HB2  . ASP B 2 4   ? -9.830  -14.349 -6.861  1.00 2.16  ? 25  ASP B HB2  4  
ATOM 8262  H HB3  . ASP B 2 4   ? -10.970 -13.447 -5.868  1.00 2.05  ? 25  ASP B HB3  4  
ATOM 8263  N N    . ASP B 2 5   ? -7.520  -14.209 -4.856  1.00 1.48  ? 26  ASP B N    4  
ATOM 8264  C CA   . ASP B 2 5   ? -6.910  -14.907 -3.733  1.00 1.38  ? 26  ASP B CA   4  
ATOM 8265  C C    . ASP B 2 5   ? -6.269  -13.901 -2.791  1.00 1.16  ? 26  ASP B C    4  
ATOM 8266  O O    . ASP B 2 5   ? -6.373  -14.017 -1.574  1.00 1.08  ? 26  ASP B O    4  
ATOM 8267  C CB   . ASP B 2 5   ? -5.859  -15.910 -4.219  1.00 1.61  ? 26  ASP B CB   4  
ATOM 8268  C CG   . ASP B 2 5   ? -5.104  -16.568 -3.077  1.00 1.69  ? 26  ASP B CG   4  
ATOM 8269  O OD1  . ASP B 2 5   ? -5.692  -17.419 -2.377  1.00 1.79  ? 26  ASP B OD1  4  
ATOM 8270  O OD2  . ASP B 2 5   ? -3.909  -16.250 -2.885  1.00 2.16  ? 26  ASP B OD2  4  
ATOM 8271  H H    . ASP B 2 5   ? -7.178  -14.366 -5.762  1.00 1.64  ? 26  ASP B H    4  
ATOM 8272  H HA   . ASP B 2 5   ? -7.687  -15.438 -3.206  1.00 1.41  ? 26  ASP B HA   4  
ATOM 8273  H HB2  . ASP B 2 5   ? -6.347  -16.681 -4.794  1.00 2.03  ? 26  ASP B HB2  4  
ATOM 8274  H HB3  . ASP B 2 5   ? -5.146  -15.396 -4.847  1.00 1.90  ? 26  ASP B HB3  4  
ATOM 8275  N N    . PHE B 2 6   ? -5.649  -12.883 -3.371  1.00 1.18  ? 27  PHE B N    4  
ATOM 8276  C CA   . PHE B 2 6   ? -4.934  -11.878 -2.599  1.00 1.13  ? 27  PHE B CA   4  
ATOM 8277  C C    . PHE B 2 6   ? -5.866  -11.057 -1.718  1.00 1.08  ? 27  PHE B C    4  
ATOM 8278  O O    . PHE B 2 6   ? -5.485  -10.642 -0.626  1.00 1.20  ? 27  PHE B O    4  
ATOM 8279  C CB   . PHE B 2 6   ? -4.141  -10.953 -3.518  1.00 1.30  ? 27  PHE B CB   4  
ATOM 8280  C CG   . PHE B 2 6   ? -2.879  -11.566 -4.060  1.00 1.11  ? 27  PHE B CG   4  
ATOM 8281  C CD1  . PHE B 2 6   ? -1.692  -11.480 -3.357  1.00 1.14  ? 27  PHE B CD1  4  
ATOM 8282  C CD2  . PHE B 2 6   ? -2.887  -12.233 -5.275  1.00 1.45  ? 27  PHE B CD2  4  
ATOM 8283  C CE1  . PHE B 2 6   ? -0.535  -12.048 -3.854  1.00 1.16  ? 27  PHE B CE1  4  
ATOM 8284  C CE2  . PHE B 2 6   ? -1.734  -12.802 -5.777  1.00 1.84  ? 27  PHE B CE2  4  
ATOM 8285  C CZ   . PHE B 2 6   ? -0.542  -12.688 -5.059  1.00 1.59  ? 27  PHE B CZ   4  
ATOM 8286  H H    . PHE B 2 6   ? -5.674  -12.806 -4.348  1.00 1.30  ? 27  PHE B H    4  
ATOM 8287  H HA   . PHE B 2 6   ? -4.240  -12.404 -1.957  1.00 1.14  ? 27  PHE B HA   4  
ATOM 8288  H HB2  . PHE B 2 6   ? -4.760  -10.675 -4.357  1.00 1.57  ? 27  PHE B HB2  4  
ATOM 8289  H HB3  . PHE B 2 6   ? -3.871  -10.064 -2.968  1.00 1.63  ? 27  PHE B HB3  4  
ATOM 8290  H HD1  . PHE B 2 6   ? -1.672  -10.962 -2.411  1.00 1.49  ? 27  PHE B HD1  4  
ATOM 8291  H HD2  . PHE B 2 6   ? -3.809  -12.305 -5.833  1.00 1.68  ? 27  PHE B HD2  4  
ATOM 8292  H HE1  . PHE B 2 6   ? 0.387   -11.974 -3.295  1.00 1.20  ? 27  PHE B HE1  4  
ATOM 8293  H HE2  . PHE B 2 6   ? -1.754  -13.319 -6.725  1.00 2.44  ? 27  PHE B HE2  4  
ATOM 8294  H HZ   . PHE B 2 6   ? 0.366   -13.123 -5.448  1.00 1.95  ? 27  PHE B HZ   4  
ATOM 8295  N N    . LEU B 2 7   ? -7.083  -10.818 -2.182  1.00 1.07  ? 28  LEU B N    4  
ATOM 8296  C CA   . LEU B 2 7   ? -8.020  -10.021 -1.406  1.00 1.16  ? 28  LEU B CA   4  
ATOM 8297  C C    . LEU B 2 7   ? -8.646  -10.853 -0.290  1.00 1.10  ? 28  LEU B C    4  
ATOM 8298  O O    . LEU B 2 7   ? -9.043  -10.315 0.744   1.00 1.17  ? 28  LEU B O    4  
ATOM 8299  C CB   . LEU B 2 7   ? -9.094  -9.382  -2.310  1.00 1.40  ? 28  LEU B CB   4  
ATOM 8300  C CG   . LEU B 2 7   ? -9.970  -10.340 -3.131  1.00 1.80  ? 28  LEU B CG   4  
ATOM 8301  C CD1  . LEU B 2 7   ? -11.127 -10.880 -2.304  1.00 2.39  ? 28  LEU B CD1  4  
ATOM 8302  C CD2  . LEU B 2 7   ? -10.491 -9.641  -4.376  1.00 2.28  ? 28  LEU B CD2  4  
ATOM 8303  H H    . LEU B 2 7   ? -7.352  -11.176 -3.054  1.00 1.12  ? 28  LEU B H    4  
ATOM 8304  H HA   . LEU B 2 7   ? -7.450  -9.228  -0.947  1.00 1.23  ? 28  LEU B HA   4  
ATOM 8305  H HB2  . LEU B 2 7   ? -9.746  -8.792  -1.684  1.00 1.64  ? 28  LEU B HB2  4  
ATOM 8306  H HB3  . LEU B 2 7   ? -8.594  -8.716  -2.998  1.00 2.04  ? 28  LEU B HB3  4  
ATOM 8307  H HG   . LEU B 2 7   ? -9.369  -11.179 -3.449  1.00 2.36  ? 28  LEU B HG   4  
ATOM 8308  H HD11 . LEU B 2 7   ? -11.728 -11.539 -2.912  1.00 2.97  ? 28  LEU B HD11 4  
ATOM 8309  H HD12 . LEU B 2 7   ? -11.735 -10.058 -1.953  1.00 2.48  ? 28  LEU B HD12 4  
ATOM 8310  H HD13 . LEU B 2 7   ? -10.738 -11.427 -1.457  1.00 2.89  ? 28  LEU B HD13 4  
ATOM 8311  H HD21 . LEU B 2 7   ? -11.095 -10.328 -4.949  1.00 2.77  ? 28  LEU B HD21 4  
ATOM 8312  H HD22 . LEU B 2 7   ? -9.658  -9.306  -4.978  1.00 2.61  ? 28  LEU B HD22 4  
ATOM 8313  H HD23 . LEU B 2 7   ? -11.091 -8.790  -4.088  1.00 2.57  ? 28  LEU B HD23 4  
ATOM 8314  N N    . LYS B 2 8   ? -8.719  -12.163 -0.491  1.00 1.07  ? 29  LYS B N    4  
ATOM 8315  C CA   . LYS B 2 8   ? -9.319  -13.038 0.505   1.00 1.14  ? 29  LYS B CA   4  
ATOM 8316  C C    . LYS B 2 8   ? -8.302  -13.484 1.554   1.00 1.04  ? 29  LYS B C    4  
ATOM 8317  O O    . LYS B 2 8   ? -8.597  -13.432 2.748   1.00 1.06  ? 29  LYS B O    4  
ATOM 8318  C CB   . LYS B 2 8   ? -9.997  -14.251 -0.145  1.00 1.33  ? 29  LYS B CB   4  
ATOM 8319  C CG   . LYS B 2 8   ? -9.068  -15.107 -0.984  1.00 1.71  ? 29  LYS B CG   4  
ATOM 8320  C CD   . LYS B 2 8   ? -9.777  -16.315 -1.568  1.00 1.99  ? 29  LYS B CD   4  
ATOM 8321  C CE   . LYS B 2 8   ? -10.249 -17.267 -0.483  1.00 2.39  ? 29  LYS B CE   4  
ATOM 8322  N NZ   . LYS B 2 8   ? -10.835 -18.504 -1.054  1.00 2.91  ? 29  LYS B NZ   4  
ATOM 8323  H H    . LYS B 2 8   ? -8.365  -12.546 -1.322  1.00 1.09  ? 29  LYS B H    4  
ATOM 8324  H HA   . LYS B 2 8   ? -10.079 -12.458 1.010   1.00 1.24  ? 29  LYS B HA   4  
ATOM 8325  H HB2  . LYS B 2 8   ? -10.414 -14.871 0.634   1.00 1.79  ? 29  LYS B HB2  4  
ATOM 8326  H HB3  . LYS B 2 8   ? -10.799 -13.902 -0.778  1.00 1.82  ? 29  LYS B HB3  4  
ATOM 8327  H HG2  . LYS B 2 8   ? -8.680  -14.508 -1.793  1.00 2.29  ? 29  LYS B HG2  4  
ATOM 8328  H HG3  . LYS B 2 8   ? -8.251  -15.446 -0.364  1.00 2.15  ? 29  LYS B HG3  4  
ATOM 8329  H HD2  . LYS B 2 8   ? -10.632 -15.979 -2.134  1.00 2.21  ? 29  LYS B HD2  4  
ATOM 8330  H HD3  . LYS B 2 8   ? -9.094  -16.839 -2.221  1.00 2.44  ? 29  LYS B HD3  4  
ATOM 8331  H HE2  . LYS B 2 8   ? -9.409  -17.531 0.141   1.00 2.72  ? 29  LYS B HE2  4  
ATOM 8332  H HE3  . LYS B 2 8   ? -10.998 -16.768 0.114   1.00 2.71  ? 29  LYS B HE3  4  
ATOM 8333  H HZ1  . LYS B 2 8   ? -11.214 -19.104 -0.293  1.00 3.26  ? 29  LYS B HZ1  4  
ATOM 8334  H HZ2  . LYS B 2 8   ? -10.108 -19.039 -1.569  1.00 3.28  ? 29  LYS B HZ2  4  
ATOM 8335  H HZ3  . LYS B 2 8   ? -11.606 -18.267 -1.710  1.00 3.20  ? 29  LYS B HZ3  4  
ATOM 8336  N N    . TRP B 2 9   ? -7.099  -13.899 1.128   1.00 0.99  ? 30  TRP B N    4  
ATOM 8337  C CA   . TRP B 2 9   ? -6.109  -14.401 2.082   1.00 1.00  ? 30  TRP B CA   4  
ATOM 8338  C C    . TRP B 2 9   ? -5.669  -13.289 3.011   1.00 0.90  ? 30  TRP B C    4  
ATOM 8339  O O    . TRP B 2 9   ? -5.338  -13.531 4.168   1.00 1.00  ? 30  TRP B O    4  
ATOM 8340  C CB   . TRP B 2 9   ? -4.887  -15.060 1.397   1.00 1.03  ? 30  TRP B CB   4  
ATOM 8341  C CG   . TRP B 2 9   ? -3.865  -14.128 0.793   1.00 0.95  ? 30  TRP B CG   4  
ATOM 8342  C CD1  . TRP B 2 9   ? -3.690  -13.884 -0.533  1.00 1.06  ? 30  TRP B CD1  4  
ATOM 8343  C CD2  . TRP B 2 9   ? -2.848  -13.363 1.473   1.00 0.86  ? 30  TRP B CD2  4  
ATOM 8344  N NE1  . TRP B 2 9   ? -2.661  -12.998 -0.727  1.00 1.00  ? 30  TRP B NE1  4  
ATOM 8345  C CE2  . TRP B 2 9   ? -2.129  -12.664 0.483   1.00 0.85  ? 30  TRP B CE2  4  
ATOM 8346  C CE3  . TRP B 2 9   ? -2.482  -13.183 2.816   1.00 0.94  ? 30  TRP B CE3  4  
ATOM 8347  C CZ2  . TRP B 2 9   ? -1.073  -11.812 0.787   1.00 0.83  ? 30  TRP B CZ2  4  
ATOM 8348  C CZ3  . TRP B 2 9   ? -1.431  -12.335 3.112   1.00 1.00  ? 30  TRP B CZ3  4  
ATOM 8349  C CH2  . TRP B 2 9   ? -0.739  -11.659 2.101   1.00 0.90  ? 30  TRP B CH2  4  
ATOM 8350  H H    . TRP B 2 9   ? -6.883  -13.874 0.168   1.00 1.00  ? 30  TRP B H    4  
ATOM 8351  H HA   . TRP B 2 9   ? -6.607  -15.152 2.680   1.00 1.11  ? 30  TRP B HA   4  
ATOM 8352  H HB2  . TRP B 2 9   ? -4.373  -15.669 2.120   1.00 1.09  ? 30  TRP B HB2  4  
ATOM 8353  H HB3  . TRP B 2 9   ? -5.248  -15.698 0.602   1.00 1.11  ? 30  TRP B HB3  4  
ATOM 8354  H HD1  . TRP B 2 9   ? -4.296  -14.321 -1.313  1.00 1.24  ? 30  TRP B HD1  4  
ATOM 8355  H HE1  . TRP B 2 9   ? -2.356  -12.660 -1.597  1.00 1.11  ? 30  TRP B HE1  4  
ATOM 8356  H HE3  . TRP B 2 9   ? -3.004  -13.696 3.611   1.00 1.05  ? 30  TRP B HE3  4  
ATOM 8357  H HZ2  . TRP B 2 9   ? -0.527  -11.283 0.020   1.00 0.86  ? 30  TRP B HZ2  4  
ATOM 8358  H HZ3  . TRP B 2 9   ? -1.130  -12.190 4.139   1.00 1.18  ? 30  TRP B HZ3  4  
ATOM 8359  H HH2  . TRP B 2 9   ? 0.076   -11.006 2.378   1.00 0.99  ? 30  TRP B HH2  4  
ATOM 8360  N N    . TRP B 2 10  ? -5.682  -12.066 2.502   1.00 0.76  ? 31  TRP B N    4  
ATOM 8361  C CA   . TRP B 2 10  ? -5.306  -10.912 3.292   1.00 0.73  ? 31  TRP B CA   4  
ATOM 8362  C C    . TRP B 2 10  ? -6.247  -10.775 4.478   1.00 0.86  ? 31  TRP B C    4  
ATOM 8363  O O    . TRP B 2 10  ? -5.817  -10.596 5.615   1.00 1.02  ? 31  TRP B O    4  
ATOM 8364  C CB   . TRP B 2 10  ? -5.366  -9.648  2.438   1.00 0.61  ? 31  TRP B CB   4  
ATOM 8365  C CG   . TRP B 2 10  ? -4.404  -8.593  2.874   1.00 0.56  ? 31  TRP B CG   4  
ATOM 8366  C CD1  . TRP B 2 10  ? -4.489  -7.802  3.981   1.00 0.66  ? 31  TRP B CD1  4  
ATOM 8367  C CD2  . TRP B 2 10  ? -3.208  -8.212  2.196   1.00 0.46  ? 31  TRP B CD2  4  
ATOM 8368  N NE1  . TRP B 2 10  ? -3.411  -6.953  4.035   1.00 0.65  ? 31  TRP B NE1  4  
ATOM 8369  C CE2  . TRP B 2 10  ? -2.609  -7.187  2.947   1.00 0.50  ? 31  TRP B CE2  4  
ATOM 8370  C CE3  . TRP B 2 10  ? -2.583  -8.645  1.027   1.00 0.42  ? 31  TRP B CE3  4  
ATOM 8371  C CZ2  . TRP B 2 10  ? -1.416  -6.587  2.561   1.00 0.45  ? 31  TRP B CZ2  4  
ATOM 8372  C CZ3  . TRP B 2 10  ? -1.401  -8.048  0.646   1.00 0.38  ? 31  TRP B CZ3  4  
ATOM 8373  C CH2  . TRP B 2 10  ? -0.827  -7.029  1.414   1.00 0.36  ? 31  TRP B CH2  4  
ATOM 8374  H H    . TRP B 2 10  ? -5.945  -11.941 1.566   1.00 0.76  ? 31  TRP B H    4  
ATOM 8375  H HA   . TRP B 2 10  ? -4.297  -11.058 3.651   1.00 0.76  ? 31  TRP B HA   4  
ATOM 8376  H HB2  . TRP B 2 10  ? -5.139  -9.902  1.414   1.00 0.59  ? 31  TRP B HB2  4  
ATOM 8377  H HB3  . TRP B 2 10  ? -6.362  -9.235  2.491   1.00 0.67  ? 31  TRP B HB3  4  
ATOM 8378  H HD1  . TRP B 2 10  ? -5.292  -7.849  4.703   1.00 0.78  ? 31  TRP B HD1  4  
ATOM 8379  H HE1  . TRP B 2 10  ? -3.244  -6.287  4.739   1.00 0.75  ? 31  TRP B HE1  4  
ATOM 8380  H HE3  . TRP B 2 10  ? -3.012  -9.430  0.421   1.00 0.49  ? 31  TRP B HE3  4  
ATOM 8381  H HZ2  . TRP B 2 10  ? -0.960  -5.802  3.134   1.00 0.54  ? 31  TRP B HZ2  4  
ATOM 8382  H HZ3  . TRP B 2 10  ? -0.904  -8.370  -0.257  1.00 0.43  ? 31  TRP B HZ3  4  
ATOM 8383  H HH2  . TRP B 2 10  ? 0.101   -6.589  1.080   1.00 0.36  ? 31  TRP B HH2  4  
ATOM 8384  N N    . ARG B 2 11  ? -7.536  -10.904 4.202   1.00 0.87  ? 32  ARG B N    4  
ATOM 8385  C CA   . ARG B 2 11  ? -8.550  -10.744 5.225   1.00 1.03  ? 32  ARG B CA   4  
ATOM 8386  C C    . ARG B 2 11  ? -8.572  -11.946 6.163   1.00 1.15  ? 32  ARG B C    4  
ATOM 8387  O O    . ARG B 2 11  ? -8.679  -11.785 7.376   1.00 1.33  ? 32  ARG B O    4  
ATOM 8388  C CB   . ARG B 2 11  ? -9.925  -10.535 4.593   1.00 1.08  ? 32  ARG B CB   4  
ATOM 8389  C CG   . ARG B 2 11  ? -10.014 -9.279  3.742   1.00 1.34  ? 32  ARG B CG   4  
ATOM 8390  C CD   . ARG B 2 11  ? -11.449 -8.966  3.349   1.00 1.58  ? 32  ARG B CD   4  
ATOM 8391  N NE   . ARG B 2 11  ? -12.284 -8.691  4.518   1.00 2.01  ? 32  ARG B NE   4  
ATOM 8392  C CZ   . ARG B 2 11  ? -13.301 -7.829  4.532   1.00 2.63  ? 32  ARG B CZ   4  
ATOM 8393  N NH1  . ARG B 2 11  ? -13.634 -7.166  3.429   1.00 3.04  ? 32  ARG B NH1  4  
ATOM 8394  N NH2  . ARG B 2 11  ? -13.991 -7.641  5.650   1.00 3.37  ? 32  ARG B NH2  4  
ATOM 8395  H H    . ARG B 2 11  ? -7.809  -11.123 3.287   1.00 0.82  ? 32  ARG B H    4  
ATOM 8396  H HA   . ARG B 2 11  ? -8.296  -9.867  5.801   1.00 1.12  ? 32  ARG B HA   4  
ATOM 8397  H HB2  . ARG B 2 11  ? -10.152 -11.386 3.966   1.00 1.33  ? 32  ARG B HB2  4  
ATOM 8398  H HB3  . ARG B 2 11  ? -10.663 -10.469 5.376   1.00 1.39  ? 32  ARG B HB3  4  
ATOM 8399  H HG2  . ARG B 2 11  ? -9.617  -8.447  4.305   1.00 1.84  ? 32  ARG B HG2  4  
ATOM 8400  H HG3  . ARG B 2 11  ? -9.428  -9.421  2.847   1.00 1.90  ? 32  ARG B HG3  4  
ATOM 8401  H HD2  . ARG B 2 11  ? -11.453 -8.101  2.704   1.00 2.09  ? 32  ARG B HD2  4  
ATOM 8402  H HD3  . ARG B 2 11  ? -11.857 -9.812  2.818   1.00 2.02  ? 32  ARG B HD3  4  
ATOM 8403  H HE   . ARG B 2 11  ? -12.071 -9.180  5.346   1.00 2.35  ? 32  ARG B HE   4  
ATOM 8404  H HH11 . ARG B 2 11  ? -13.122 -7.310  2.580   1.00 2.99  ? 32  ARG B HH11 4  
ATOM 8405  H HH12 . ARG B 2 11  ? -14.405 -6.523  3.439   1.00 3.72  ? 32  ARG B HH12 4  
ATOM 8406  H HH21 . ARG B 2 11  ? -13.747 -8.145  6.483   1.00 3.63  ? 32  ARG B HH21 4  
ATOM 8407  H HH22 . ARG B 2 11  ? -14.760 -6.997  5.668   1.00 3.92  ? 32  ARG B HH22 4  
ATOM 8408  N N    . SER B 2 12  ? -8.445  -13.144 5.607   1.00 1.13  ? 33  SER B N    4  
ATOM 8409  C CA   . SER B 2 12  ? -8.473  -14.357 6.411   1.00 1.30  ? 33  SER B CA   4  
ATOM 8410  C C    . SER B 2 12  ? -7.239  -14.445 7.310   1.00 1.45  ? 33  SER B C    4  
ATOM 8411  O O    . SER B 2 12  ? -7.313  -14.940 8.436   1.00 1.65  ? 33  SER B O    4  
ATOM 8412  C CB   . SER B 2 12  ? -8.576  -15.587 5.509   1.00 1.33  ? 33  SER B CB   4  
ATOM 8413  O OG   . SER B 2 12  ? -7.577  -15.572 4.507   1.00 1.90  ? 33  SER B OG   4  
ATOM 8414  H H    . SER B 2 12  ? -8.332  -13.218 4.631   1.00 1.04  ? 33  SER B H    4  
ATOM 8415  H HA   . SER B 2 12  ? -9.350  -14.311 7.038   1.00 1.37  ? 33  SER B HA   4  
ATOM 8416  H HB2  . SER B 2 12  ? -8.456  -16.479 6.105   1.00 1.77  ? 33  SER B HB2  4  
ATOM 8417  H HB3  . SER B 2 12  ? -9.546  -15.601 5.033   1.00 1.58  ? 33  SER B HB3  4  
ATOM 8418  H HG   . SER B 2 12  ? -7.031  -16.362 4.587   1.00 2.15  ? 33  SER B HG   4  
ATOM 8419  N N    . GLU B 2 13  ? -6.109  -13.959 6.814   1.00 1.40  ? 34  GLU B N    4  
ATOM 8420  C CA   . GLU B 2 13  ? -4.878  -13.941 7.594   1.00 1.57  ? 34  GLU B CA   4  
ATOM 8421  C C    . GLU B 2 13  ? -4.995  -12.927 8.733   1.00 1.63  ? 34  GLU B C    4  
ATOM 8422  O O    . GLU B 2 13  ? -4.657  -13.221 9.881   1.00 1.85  ? 34  GLU B O    4  
ATOM 8423  C CB   . GLU B 2 13  ? -3.691  -13.585 6.696   1.00 1.57  ? 34  GLU B CB   4  
ATOM 8424  C CG   . GLU B 2 13  ? -2.337  -13.873 7.321   1.00 1.84  ? 34  GLU B CG   4  
ATOM 8425  C CD   . GLU B 2 13  ? -2.036  -15.352 7.408   1.00 1.90  ? 34  GLU B CD   4  
ATOM 8426  O OE1  . GLU B 2 13  ? -2.646  -16.036 8.256   1.00 2.32  ? 34  GLU B OE1  4  
ATOM 8427  O OE2  . GLU B 2 13  ? -1.193  -15.842 6.630   1.00 2.15  ? 34  GLU B OE2  4  
ATOM 8428  H H    . GLU B 2 13  ? -6.097  -13.615 5.890   1.00 1.27  ? 34  GLU B H    4  
ATOM 8429  H HA   . GLU B 2 13  ? -4.729  -14.925 8.011   1.00 1.73  ? 34  GLU B HA   4  
ATOM 8430  H HB2  . GLU B 2 13  ? -3.767  -14.153 5.780   1.00 1.70  ? 34  GLU B HB2  4  
ATOM 8431  H HB3  . GLU B 2 13  ? -3.738  -12.533 6.459   1.00 1.80  ? 34  GLU B HB3  4  
ATOM 8432  H HG2  . GLU B 2 13  ? -1.572  -13.401 6.723   1.00 2.25  ? 34  GLU B HG2  4  
ATOM 8433  H HG3  . GLU B 2 13  ? -2.320  -13.458 8.317   1.00 2.41  ? 34  GLU B HG3  4  
ATOM 8434  N N    . GLU B 2 14  ? -5.504  -11.743 8.404   1.00 1.50  ? 35  GLU B N    4  
ATOM 8435  C CA   . GLU B 2 14  ? -5.683  -10.672 9.382   1.00 1.65  ? 35  GLU B CA   4  
ATOM 8436  C C    . GLU B 2 14  ? -6.748  -11.027 10.414  1.00 1.86  ? 35  GLU B C    4  
ATOM 8437  O O    . GLU B 2 14  ? -6.631  -10.664 11.583  1.00 2.10  ? 35  GLU B O    4  
ATOM 8438  C CB   . GLU B 2 14  ? -6.064  -9.374  8.671   1.00 1.57  ? 35  GLU B CB   4  
ATOM 8439  C CG   . GLU B 2 14  ? -4.900  -8.704  7.961   1.00 2.12  ? 35  GLU B CG   4  
ATOM 8440  C CD   . GLU B 2 14  ? -4.077  -7.839  8.890   1.00 2.43  ? 35  GLU B CD   4  
ATOM 8441  O OE1  . GLU B 2 14  ? -3.334  -8.385  9.735   1.00 2.46  ? 35  GLU B OE1  4  
ATOM 8442  O OE2  . GLU B 2 14  ? -4.177  -6.601  8.780   1.00 3.14  ? 35  GLU B OE2  4  
ATOM 8443  H H    . GLU B 2 14  ? -5.758  -11.578 7.468   1.00 1.35  ? 35  GLU B H    4  
ATOM 8444  H HA   . GLU B 2 14  ? -4.742  -10.529 9.890   1.00 1.76  ? 35  GLU B HA   4  
ATOM 8445  H HB2  . GLU B 2 14  ? -6.828  -9.589  7.939   1.00 1.55  ? 35  GLU B HB2  4  
ATOM 8446  H HB3  . GLU B 2 14  ? -6.459  -8.682  9.399   1.00 1.87  ? 35  GLU B HB3  4  
ATOM 8447  H HG2  . GLU B 2 14  ? -4.260  -9.468  7.544   1.00 2.69  ? 35  GLU B HG2  4  
ATOM 8448  H HG3  . GLU B 2 14  ? -5.287  -8.086  7.165   1.00 2.55  ? 35  GLU B HG3  4  
ATOM 8449  N N    . ALA B 2 15  ? -7.781  -11.740 9.978   1.00 1.84  ? 36  ALA B N    4  
ATOM 8450  C CA   . ALA B 2 15  ? -8.882  -12.125 10.857  1.00 2.10  ? 36  ALA B CA   4  
ATOM 8451  C C    . ALA B 2 15  ? -8.397  -13.000 12.006  1.00 2.31  ? 36  ALA B C    4  
ATOM 8452  O O    . ALA B 2 15  ? -8.946  -12.954 13.107  1.00 2.58  ? 36  ALA B O    4  
ATOM 8453  C CB   . ALA B 2 15  ? -9.960  -12.849 10.067  1.00 2.10  ? 36  ALA B CB   4  
ATOM 8454  H H    . ALA B 2 15  ? -7.813  -12.004 9.031   1.00 1.67  ? 36  ALA B H    4  
ATOM 8455  H HA   . ALA B 2 15  ? -9.313  -11.222 11.263  1.00 2.20  ? 36  ALA B HA   4  
ATOM 8456  H HB1  . ALA B 2 15  ? -10.285 -12.225 9.247   1.00 2.33  ? 36  ALA B HB1  4  
ATOM 8457  H HB2  . ALA B 2 15  ? -10.798 -13.061 10.713  1.00 2.25  ? 36  ALA B HB2  4  
ATOM 8458  H HB3  . ALA B 2 15  ? -9.560  -13.774 9.678   1.00 2.42  ? 36  ALA B HB3  4  
ATOM 8459  N N    . GLN B 2 16  ? -7.363  -13.784 11.743  1.00 2.24  ? 37  GLN B N    4  
ATOM 8460  C CA   . GLN B 2 16  ? -6.795  -14.668 12.752  1.00 2.49  ? 37  GLN B CA   4  
ATOM 8461  C C    . GLN B 2 16  ? -5.988  -13.876 13.771  1.00 2.66  ? 37  GLN B C    4  
ATOM 8462  O O    . GLN B 2 16  ? -5.904  -14.250 14.938  1.00 2.93  ? 37  GLN B O    4  
ATOM 8463  C CB   . GLN B 2 16  ? -5.913  -15.723 12.090  1.00 2.39  ? 37  GLN B CB   4  
ATOM 8464  C CG   . GLN B 2 16  ? -6.681  -16.676 11.191  1.00 2.54  ? 37  GLN B CG   4  
ATOM 8465  C CD   . GLN B 2 16  ? -5.771  -17.556 10.364  1.00 3.04  ? 37  GLN B CD   4  
ATOM 8466  O OE1  . GLN B 2 16  ? -5.378  -18.640 10.790  1.00 3.65  ? 37  GLN B OE1  4  
ATOM 8467  N NE2  . GLN B 2 16  ? -5.439  -17.096 9.170   1.00 3.38  ? 37  GLN B NE2  4  
ATOM 8468  H H    . GLN B 2 16  ? -6.967  -13.767 10.846  1.00 2.05  ? 37  GLN B H    4  
ATOM 8469  H HA   . GLN B 2 16  ? -7.611  -15.160 13.259  1.00 2.69  ? 37  GLN B HA   4  
ATOM 8470  H HB2  . GLN B 2 16  ? -5.163  -15.226 11.492  1.00 2.65  ? 37  GLN B HB2  4  
ATOM 8471  H HB3  . GLN B 2 16  ? -5.423  -16.302 12.857  1.00 2.45  ? 37  GLN B HB3  4  
ATOM 8472  H HG2  . GLN B 2 16  ? -7.304  -17.308 11.805  1.00 2.72  ? 37  GLN B HG2  4  
ATOM 8473  H HG3  . GLN B 2 16  ? -7.304  -16.098 10.524  1.00 2.94  ? 37  GLN B HG3  4  
ATOM 8474  H HE21 . GLN B 2 16  ? -5.798  -16.227 8.893   1.00 3.31  ? 37  GLN B HE21 4  
ATOM 8475  H HE22 . GLN B 2 16  ? -4.844  -17.641 8.613   1.00 4.00  ? 37  GLN B HE22 4  
ATOM 8476  N N    . ASP B 2 17  ? -5.413  -12.770 13.321  1.00 2.57  ? 38  ASP B N    4  
ATOM 8477  C CA   . ASP B 2 17  ? -4.602  -11.919 14.181  1.00 2.80  ? 38  ASP B CA   4  
ATOM 8478  C C    . ASP B 2 17  ? -5.486  -10.970 14.984  1.00 2.96  ? 38  ASP B C    4  
ATOM 8479  O O    . ASP B 2 17  ? -5.377  -10.902 16.211  1.00 3.22  ? 38  ASP B O    4  
ATOM 8480  C CB   . ASP B 2 17  ? -3.608  -11.119 13.337  1.00 2.80  ? 38  ASP B CB   4  
ATOM 8481  C CG   . ASP B 2 17  ? -2.766  -10.175 14.170  1.00 2.83  ? 38  ASP B CG   4  
ATOM 8482  O OD1  . ASP B 2 17  ? -1.796  -10.641 14.806  1.00 3.06  ? 38  ASP B OD1  4  
ATOM 8483  O OD2  . ASP B 2 17  ? -3.079  -8.965  14.203  1.00 3.03  ? 38  ASP B OD2  4  
ATOM 8484  H H    . ASP B 2 17  ? -5.539  -12.518 12.383  1.00 2.38  ? 38  ASP B H    4  
ATOM 8485  H HA   . ASP B 2 17  ? -4.059  -12.553 14.863  1.00 2.97  ? 38  ASP B HA   4  
ATOM 8486  H HB2  . ASP B 2 17  ? -2.948  -11.803 12.826  1.00 3.09  ? 38  ASP B HB2  4  
ATOM 8487  H HB3  . ASP B 2 17  ? -4.152  -10.538 12.607  1.00 2.90  ? 38  ASP B HB3  4  
ATOM 8488  N N    . MET B 2 18  ? -6.364  -10.261 14.280  1.00 2.89  ? 39  MET B N    4  
ATOM 8489  C CA   . MET B 2 18  ? -7.288  -9.305  14.890  1.00 3.13  ? 39  MET B CA   4  
ATOM 8490  C C    . MET B 2 18  ? -6.516  -8.176  15.573  1.00 3.86  ? 39  MET B C    4  
ATOM 8491  O O    . MET B 2 18  ? -6.276  -8.203  16.785  1.00 4.43  ? 39  MET B O    4  
ATOM 8492  C CB   . MET B 2 18  ? -8.219  -10.002 15.890  1.00 3.09  ? 39  MET B CB   4  
ATOM 8493  C CG   . MET B 2 18  ? -9.607  -9.381  15.979  1.00 3.39  ? 39  MET B CG   4  
ATOM 8494  S SD   . MET B 2 18  ? -9.583  -7.634  16.426  1.00 3.72  ? 39  MET B SD   4  
ATOM 8495  C CE   . MET B 2 18  ? -11.331 -7.251  16.369  1.00 4.34  ? 39  MET B CE   4  
ATOM 8496  H H    . MET B 2 18  ? -6.391  -10.383 13.303  1.00 2.73  ? 39  MET B H    4  
ATOM 8497  H HA   . MET B 2 18  ? -7.885  -8.880  14.098  1.00 3.23  ? 39  MET B HA   4  
ATOM 8498  H HB2  . MET B 2 18  ? -8.330  -11.035 15.598  1.00 3.27  ? 39  MET B HB2  4  
ATOM 8499  H HB3  . MET B 2 18  ? -7.767  -9.962  16.871  1.00 3.33  ? 39  MET B HB3  4  
ATOM 8500  H HG2  . MET B 2 18  ? -10.090 -9.481  15.018  1.00 3.53  ? 39  MET B HG2  4  
ATOM 8501  H HG3  . MET B 2 18  ? -10.177 -9.920  16.721  1.00 3.93  ? 39  MET B HG3  4  
ATOM 8502  H HE1  . MET B 2 18  ? -11.700 -7.404  15.366  1.00 4.48  ? 39  MET B HE1  4  
ATOM 8503  H HE2  . MET B 2 18  ? -11.482 -6.221  16.657  1.00 4.79  ? 39  MET B HE2  4  
ATOM 8504  H HE3  . MET B 2 18  ? -11.864 -7.896  17.050  1.00 4.64  ? 39  MET B HE3  4  
ATOM 8505  N N    . GLY B 2 19  ? -6.115  -7.197  14.778  1.00 4.23  ? 40  GLY B N    4  
ATOM 8506  C CA   . GLY B 2 19  ? -5.411  -6.045  15.297  1.00 5.19  ? 40  GLY B CA   4  
ATOM 8507  C C    . GLY B 2 19  ? -5.860  -4.771  14.619  1.00 5.68  ? 40  GLY B C    4  
ATOM 8508  O O    . GLY B 2 19  ? -5.318  -4.443  13.540  1.00 6.18  ? 40  GLY B O    4  
ATOM 8509  O OXT  . GLY B 2 19  ? -6.787  -4.114  15.134  1.00 5.90  ? 40  GLY B OXT  4  
ATOM 8510  H H    . GLY B 2 19  ? -6.296  -7.258  13.817  1.00 4.07  ? 40  GLY B H    4  
ATOM 8511  H HA2  . GLY B 2 19  ? -5.599  -5.968  16.358  1.00 5.50  ? 40  GLY B HA2  4  
ATOM 8512  H HA3  . GLY B 2 19  ? -4.352  -6.176  15.134  1.00 5.60  ? 40  GLY B HA3  4  
ATOM 8513  N N    . PRO A 1 1   ? 18.787  1.878   8.106   1.00 2.80  ? 1   PRO A N    5  
ATOM 8514  C CA   . PRO A 1 1   ? 17.952  1.297   7.034   1.00 2.09  ? 1   PRO A CA   5  
ATOM 8515  C C    . PRO A 1 1   ? 16.506  1.752   7.177   1.00 1.70  ? 1   PRO A C    5  
ATOM 8516  O O    . PRO A 1 1   ? 15.903  1.601   8.241   1.00 2.48  ? 1   PRO A O    5  
ATOM 8517  C CB   . PRO A 1 1   ? 18.033  -0.219  7.106   1.00 2.88  ? 1   PRO A CB   5  
ATOM 8518  C CG   . PRO A 1 1   ? 19.034  -0.474  8.178   1.00 3.60  ? 1   PRO A CG   5  
ATOM 8519  C CD   . PRO A 1 1   ? 19.073  0.772   9.036   1.00 3.50  ? 1   PRO A CD   5  
ATOM 8520  H H2   . PRO A 1 1   ? 19.579  2.344   7.604   1.00 2.93  ? 1   PRO A H2   5  
ATOM 8521  H H3   . PRO A 1 1   ? 18.242  2.674   8.476   1.00 3.05  ? 1   PRO A H3   5  
ATOM 8522  H HA   . PRO A 1 1   ? 18.335  1.631   6.081   1.00 2.07  ? 1   PRO A HA   5  
ATOM 8523  H HB2  . PRO A 1 1   ? 17.063  -0.624  7.360   1.00 3.16  ? 1   PRO A HB2  5  
ATOM 8524  H HB3  . PRO A 1 1   ? 18.360  -0.615  6.155   1.00 3.12  ? 1   PRO A HB3  5  
ATOM 8525  H HG2  . PRO A 1 1   ? 18.729  -1.325  8.768   1.00 4.35  ? 1   PRO A HG2  5  
ATOM 8526  H HG3  . PRO A 1 1   ? 20.003  -0.653  7.737   1.00 3.85  ? 1   PRO A HG3  5  
ATOM 8527  H HD2  . PRO A 1 1   ? 18.317  0.719   9.806   1.00 4.20  ? 1   PRO A HD2  5  
ATOM 8528  H HD3  . PRO A 1 1   ? 20.050  0.891   9.480   1.00 3.65  ? 1   PRO A HD3  5  
ATOM 8529  N N    . SER A 1 2   ? 15.964  2.325   6.112   1.00 1.00  ? 2   SER A N    5  
ATOM 8530  C CA   . SER A 1 2   ? 14.580  2.771   6.087   1.00 0.75  ? 2   SER A CA   5  
ATOM 8531  C C    . SER A 1 2   ? 14.234  3.277   4.697   1.00 0.89  ? 2   SER A C    5  
ATOM 8532  O O    . SER A 1 2   ? 15.113  3.384   3.841   1.00 1.99  ? 2   SER A O    5  
ATOM 8533  C CB   . SER A 1 2   ? 14.349  3.885   7.116   1.00 1.16  ? 2   SER A CB   5  
ATOM 8534  O OG   . SER A 1 2   ? 15.202  4.989   6.871   1.00 1.66  ? 2   SER A OG   5  
ATOM 8535  H H    . SER A 1 2   ? 16.514  2.453   5.309   1.00 1.37  ? 2   SER A H    5  
ATOM 8536  H HA   . SER A 1 2   ? 13.949  1.928   6.325   1.00 0.60  ? 2   SER A HA   5  
ATOM 8537  H HB2  . SER A 1 2   ? 13.324  4.218   7.057   1.00 1.50  ? 2   SER A HB2  5  
ATOM 8538  H HB3  . SER A 1 2   ? 14.548  3.504   8.107   1.00 1.23  ? 2   SER A HB3  5  
ATOM 8539  H HG   . SER A 1 2   ? 16.057  4.831   7.289   1.00 1.95  ? 2   SER A HG   5  
ATOM 8540  N N    . HIS A 1 3   ? 12.951  3.557   4.475   1.00 0.41  ? 3   HIS A N    5  
ATOM 8541  C CA   . HIS A 1 3   ? 12.472  4.191   3.243   1.00 0.27  ? 3   HIS A CA   5  
ATOM 8542  C C    . HIS A 1 3   ? 12.535  3.281   2.023   1.00 0.23  ? 3   HIS A C    5  
ATOM 8543  O O    . HIS A 1 3   ? 11.804  3.490   1.066   1.00 0.33  ? 3   HIS A O    5  
ATOM 8544  C CB   . HIS A 1 3   ? 13.234  5.489   2.948   1.00 0.28  ? 3   HIS A CB   5  
ATOM 8545  C CG   . HIS A 1 3   ? 12.883  6.625   3.857   1.00 0.36  ? 3   HIS A CG   5  
ATOM 8546  N ND1  . HIS A 1 3   ? 13.552  6.889   5.031   1.00 0.56  ? 3   HIS A ND1  5  
ATOM 8547  C CD2  . HIS A 1 3   ? 11.927  7.576   3.749   1.00 0.38  ? 3   HIS A CD2  5  
ATOM 8548  C CE1  . HIS A 1 3   ? 13.022  7.950   5.608   1.00 0.61  ? 3   HIS A CE1  5  
ATOM 8549  N NE2  . HIS A 1 3   ? 12.035  8.388   4.849   1.00 0.49  ? 3   HIS A NE2  5  
ATOM 8550  H H    . HIS A 1 3   ? 12.293  3.330   5.169   1.00 1.21  ? 3   HIS A H    5  
ATOM 8551  H HA   . HIS A 1 3   ? 11.443  4.440   3.406   1.00 0.31  ? 3   HIS A HA   5  
ATOM 8552  H HB2  . HIS A 1 3   ? 14.293  5.305   3.045   1.00 0.33  ? 3   HIS A HB2  5  
ATOM 8553  H HB3  . HIS A 1 3   ? 13.020  5.796   1.933   1.00 0.28  ? 3   HIS A HB3  5  
ATOM 8554  H HD1  . HIS A 1 3   ? 14.316  6.375   5.387   1.00 0.69  ? 3   HIS A HD1  5  
ATOM 8555  H HD2  . HIS A 1 3   ? 11.209  7.676   2.946   1.00 0.44  ? 3   HIS A HD2  5  
ATOM 8556  H HE1  . HIS A 1 3   ? 13.342  8.389   6.542   1.00 0.78  ? 3   HIS A HE1  5  
ATOM 8557  H HE2  . HIS A 1 3   ? 11.591  9.270   4.948   1.00 0.56  ? 3   HIS A HE2  5  
ATOM 8558  N N    . SER A 1 4   ? 13.389  2.283   2.043   1.00 0.21  ? 4   SER A N    5  
ATOM 8559  C CA   . SER A 1 4   ? 13.575  1.455   0.868   1.00 0.17  ? 4   SER A CA   5  
ATOM 8560  C C    . SER A 1 4   ? 13.940  0.023   1.203   1.00 0.18  ? 4   SER A C    5  
ATOM 8561  O O    . SER A 1 4   ? 14.399  -0.287  2.304   1.00 0.24  ? 4   SER A O    5  
ATOM 8562  C CB   . SER A 1 4   ? 14.622  2.078   -0.041  1.00 0.19  ? 4   SER A CB   5  
ATOM 8563  O OG   . SER A 1 4   ? 15.767  2.487   0.692   1.00 0.28  ? 4   SER A OG   5  
ATOM 8564  H H    . SER A 1 4   ? 13.902  2.101   2.855   1.00 0.28  ? 4   SER A H    5  
ATOM 8565  H HA   . SER A 1 4   ? 12.639  1.437   0.327   1.00 0.15  ? 4   SER A HA   5  
ATOM 8566  H HB2  . SER A 1 4   ? 14.914  1.357   -0.785  1.00 0.19  ? 4   SER A HB2  5  
ATOM 8567  H HB3  . SER A 1 4   ? 14.194  2.932   -0.530  1.00 0.19  ? 4   SER A HB3  5  
ATOM 8568  H HG   . SER A 1 4   ? 15.504  3.141   1.355   1.00 0.91  ? 4   SER A HG   5  
ATOM 8569  N N    . GLY A 1 5   ? 13.714  -0.832  0.223   1.00 0.15  ? 5   GLY A N    5  
ATOM 8570  C CA   . GLY A 1 5   ? 13.965  -2.245  0.351   1.00 0.15  ? 5   GLY A CA   5  
ATOM 8571  C C    . GLY A 1 5   ? 13.466  -2.974  -0.863  1.00 0.13  ? 5   GLY A C    5  
ATOM 8572  O O    . GLY A 1 5   ? 12.556  -2.498  -1.542  1.00 0.12  ? 5   GLY A O    5  
ATOM 8573  H H    . GLY A 1 5   ? 13.357  -0.487  -0.625  1.00 0.15  ? 5   GLY A H    5  
ATOM 8574  H HA2  . GLY A 1 5   ? 15.028  -2.409  0.439   1.00 0.17  ? 5   GLY A HA2  5  
ATOM 8575  H HA3  . GLY A 1 5   ? 13.464  -2.625  1.228   1.00 0.17  ? 5   GLY A HA3  5  
ATOM 8576  N N    . ALA A 1 6   ? 14.066  -4.108  -1.152  1.00 0.14  ? 6   ALA A N    5  
ATOM 8577  C CA   . ALA A 1 6   ? 13.774  -4.828  -2.377  1.00 0.15  ? 6   ALA A CA   5  
ATOM 8578  C C    . ALA A 1 6   ? 12.355  -5.383  -2.387  1.00 0.15  ? 6   ALA A C    5  
ATOM 8579  O O    . ALA A 1 6   ? 12.006  -6.262  -1.597  1.00 0.19  ? 6   ALA A O    5  
ATOM 8580  C CB   . ALA A 1 6   ? 14.787  -5.927  -2.607  1.00 0.17  ? 6   ALA A CB   5  
ATOM 8581  H H    . ALA A 1 6   ? 14.724  -4.470  -0.525  1.00 0.16  ? 6   ALA A H    5  
ATOM 8582  H HA   . ALA A 1 6   ? 13.869  -4.126  -3.187  1.00 0.14  ? 6   ALA A HA   5  
ATOM 8583  H HB1  . ALA A 1 6   ? 14.563  -6.427  -3.536  1.00 1.00  ? 6   ALA A HB1  5  
ATOM 8584  H HB2  . ALA A 1 6   ? 14.749  -6.633  -1.792  1.00 1.07  ? 6   ALA A HB2  5  
ATOM 8585  H HB3  . ALA A 1 6   ? 15.773  -5.489  -2.664  1.00 1.03  ? 6   ALA A HB3  5  
ATOM 8586  N N    . ALA A 1 7   ? 11.556  -4.863  -3.308  1.00 0.14  ? 7   ALA A N    5  
ATOM 8587  C CA   . ALA A 1 7   ? 10.157  -5.221  -3.423  1.00 0.14  ? 7   ALA A CA   5  
ATOM 8588  C C    . ALA A 1 7   ? 9.859   -5.729  -4.825  1.00 0.16  ? 7   ALA A C    5  
ATOM 8589  O O    . ALA A 1 7   ? 10.715  -5.703  -5.693  1.00 0.15  ? 7   ALA A O    5  
ATOM 8590  C CB   . ALA A 1 7   ? 9.275   -4.024  -3.097  1.00 0.14  ? 7   ALA A CB   5  
ATOM 8591  H H    . ALA A 1 7   ? 11.938  -4.241  -3.963  1.00 0.14  ? 7   ALA A H    5  
ATOM 8592  H HA   . ALA A 1 7   ? 9.946   -6.004  -2.709  1.00 0.16  ? 7   ALA A HA   5  
ATOM 8593  H HB1  . ALA A 1 7   ? 8.246   -4.268  -3.315  1.00 1.03  ? 7   ALA A HB1  5  
ATOM 8594  H HB2  . ALA A 1 7   ? 9.583   -3.170  -3.686  1.00 1.05  ? 7   ALA A HB2  5  
ATOM 8595  H HB3  . ALA A 1 7   ? 9.370   -3.787  -2.047  1.00 1.00  ? 7   ALA A HB3  5  
ATOM 8596  N N    . ILE A 1 8   ? 8.639   -6.177  -5.042  1.00 0.20  ? 8   ILE A N    5  
ATOM 8597  C CA   . ILE A 1 8   ? 8.223   -6.704  -6.331  1.00 0.23  ? 8   ILE A CA   5  
ATOM 8598  C C    . ILE A 1 8   ? 6.903   -6.072  -6.756  1.00 0.25  ? 8   ILE A C    5  
ATOM 8599  O O    . ILE A 1 8   ? 6.008   -5.888  -5.929  1.00 0.28  ? 8   ILE A O    5  
ATOM 8600  C CB   . ILE A 1 8   ? 8.086   -8.236  -6.269  1.00 0.28  ? 8   ILE A CB   5  
ATOM 8601  C CG1  . ILE A 1 8   ? 9.475   -8.856  -6.219  1.00 0.29  ? 8   ILE A CG1  5  
ATOM 8602  C CG2  . ILE A 1 8   ? 7.284   -8.789  -7.440  1.00 0.31  ? 8   ILE A CG2  5  
ATOM 8603  C CD1  . ILE A 1 8   ? 9.847   -9.409  -4.878  1.00 0.36  ? 8   ILE A CD1  5  
ATOM 8604  H H    . ILE A 1 8   ? 7.995   -6.168  -4.305  1.00 0.23  ? 8   ILE A H    5  
ATOM 8605  H HA   . ILE A 1 8   ? 8.996   -6.469  -7.060  1.00 0.20  ? 8   ILE A HA   5  
ATOM 8606  H HB   . ILE A 1 8   ? 7.564   -8.478  -5.361  1.00 0.33  ? 8   ILE A HB   5  
ATOM 8607  H HG12 . ILE A 1 8   ? 9.545   -9.644  -6.944  1.00 0.31  ? 8   ILE A HG12 5  
ATOM 8608  H HG13 . ILE A 1 8   ? 10.199  -8.097  -6.458  1.00 0.24  ? 8   ILE A HG13 5  
ATOM 8609  H HG21 . ILE A 1 8   ? 7.210   -9.862  -7.349  1.00 0.99  ? 8   ILE A HG21 5  
ATOM 8610  H HG22 . ILE A 1 8   ? 7.781   -8.539  -8.367  1.00 1.08  ? 8   ILE A HG22 5  
ATOM 8611  H HG23 . ILE A 1 8   ? 6.294   -8.357  -7.434  1.00 1.02  ? 8   ILE A HG23 5  
ATOM 8612  H HD11 . ILE A 1 8   ? 10.839  -9.825  -4.932  1.00 1.04  ? 8   ILE A HD11 5  
ATOM 8613  H HD12 . ILE A 1 8   ? 9.142   -10.176 -4.594  1.00 1.06  ? 8   ILE A HD12 5  
ATOM 8614  H HD13 . ILE A 1 8   ? 9.829   -8.612  -4.154  1.00 1.07  ? 8   ILE A HD13 5  
ATOM 8615  N N    . PHE A 1 9   ? 6.796   -5.734  -8.032  1.00 0.24  ? 9   PHE A N    5  
ATOM 8616  C CA   . PHE A 1 9   ? 5.590   -5.122  -8.570  1.00 0.26  ? 9   PHE A CA   5  
ATOM 8617  C C    . PHE A 1 9   ? 5.423   -5.539  -10.023 1.00 0.28  ? 9   PHE A C    5  
ATOM 8618  O O    . PHE A 1 9   ? 6.349   -5.383  -10.814 1.00 0.28  ? 9   PHE A O    5  
ATOM 8619  C CB   . PHE A 1 9   ? 5.673   -3.596  -8.464  1.00 0.25  ? 9   PHE A CB   5  
ATOM 8620  C CG   . PHE A 1 9   ? 4.374   -2.892  -8.735  1.00 0.28  ? 9   PHE A CG   5  
ATOM 8621  C CD1  . PHE A 1 9   ? 3.483   -2.663  -7.707  1.00 0.31  ? 9   PHE A CD1  5  
ATOM 8622  C CD2  . PHE A 1 9   ? 4.042   -2.468  -10.009 1.00 0.32  ? 9   PHE A CD2  5  
ATOM 8623  C CE1  . PHE A 1 9   ? 2.281   -2.020  -7.938  1.00 0.36  ? 9   PHE A CE1  5  
ATOM 8624  C CE2  . PHE A 1 9   ? 2.843   -1.823  -10.250 1.00 0.38  ? 9   PHE A CE2  5  
ATOM 8625  C CZ   . PHE A 1 9   ? 1.960   -1.600  -9.213  1.00 0.39  ? 9   PHE A CZ   5  
ATOM 8626  H H    . PHE A 1 9   ? 7.550   -5.919  -8.640  1.00 0.23  ? 9   PHE A H    5  
ATOM 8627  H HA   . PHE A 1 9   ? 4.748   -5.478  -7.999  1.00 0.28  ? 9   PHE A HA   5  
ATOM 8628  H HB2  . PHE A 1 9   ? 5.991   -3.329  -7.469  1.00 0.27  ? 9   PHE A HB2  5  
ATOM 8629  H HB3  . PHE A 1 9   ? 6.399   -3.235  -9.177  1.00 0.26  ? 9   PHE A HB3  5  
ATOM 8630  H HD1  . PHE A 1 9   ? 3.744   -2.981  -6.710  1.00 0.33  ? 9   PHE A HD1  5  
ATOM 8631  H HD2  . PHE A 1 9   ? 4.732   -2.641  -10.821 1.00 0.34  ? 9   PHE A HD2  5  
ATOM 8632  H HE1  . PHE A 1 9   ? 1.595   -1.850  -7.123  1.00 0.40  ? 9   PHE A HE1  5  
ATOM 8633  H HE2  . PHE A 1 9   ? 2.598   -1.496  -11.249 1.00 0.43  ? 9   PHE A HE2  5  
ATOM 8634  H HZ   . PHE A 1 9   ? 1.022   -1.098  -9.397  1.00 0.45  ? 9   PHE A HZ   5  
ATOM 8635  N N    . GLU A 1 10  ? 4.250   -6.069  -10.363 1.00 0.37  ? 10  GLU A N    5  
ATOM 8636  C CA   . GLU A 1 10  ? 3.972   -6.570  -11.716 1.00 0.43  ? 10  GLU A CA   5  
ATOM 8637  C C    . GLU A 1 10  ? 4.807   -7.804  -12.020 1.00 0.33  ? 10  GLU A C    5  
ATOM 8638  O O    . GLU A 1 10  ? 5.337   -7.961  -13.121 1.00 0.38  ? 10  GLU A O    5  
ATOM 8639  C CB   . GLU A 1 10  ? 4.226   -5.496  -12.767 1.00 0.59  ? 10  GLU A CB   5  
ATOM 8640  C CG   . GLU A 1 10  ? 3.284   -4.323  -12.652 1.00 0.77  ? 10  GLU A CG   5  
ATOM 8641  C CD   . GLU A 1 10  ? 3.586   -3.240  -13.664 1.00 1.00  ? 10  GLU A CD   5  
ATOM 8642  O OE1  . GLU A 1 10  ? 4.446   -2.381  -13.384 1.00 0.95  ? 10  GLU A OE1  5  
ATOM 8643  O OE2  . GLU A 1 10  ? 2.956   -3.235  -14.742 1.00 1.33  ? 10  GLU A OE2  5  
ATOM 8644  H H    . GLU A 1 10  ? 3.545   -6.127  -9.682  1.00 0.43  ? 10  GLU A H    5  
ATOM 8645  H HA   . GLU A 1 10  ? 2.927   -6.848  -11.749 1.00 0.54  ? 10  GLU A HA   5  
ATOM 8646  H HB2  . GLU A 1 10  ? 5.236   -5.134  -12.657 1.00 0.56  ? 10  GLU A HB2  5  
ATOM 8647  H HB3  . GLU A 1 10  ? 4.110   -5.931  -13.749 1.00 0.67  ? 10  GLU A HB3  5  
ATOM 8648  H HG2  . GLU A 1 10  ? 2.278   -4.679  -12.804 1.00 0.88  ? 10  GLU A HG2  5  
ATOM 8649  H HG3  . GLU A 1 10  ? 3.370   -3.906  -11.661 1.00 0.70  ? 10  GLU A HG3  5  
ATOM 8650  N N    . LYS A 1 11  ? 4.917   -8.660  -11.015 1.00 0.35  ? 11  LYS A N    5  
ATOM 8651  C CA   . LYS A 1 11  ? 5.662   -9.923  -11.097 1.00 0.43  ? 11  LYS A CA   5  
ATOM 8652  C C    . LYS A 1 11  ? 7.170   -9.729  -11.283 1.00 0.41  ? 11  LYS A C    5  
ATOM 8653  O O    . LYS A 1 11  ? 7.931   -10.696 -11.224 1.00 0.59  ? 11  LYS A O    5  
ATOM 8654  C CB   . LYS A 1 11  ? 5.115   -10.821 -12.200 1.00 0.54  ? 11  LYS A CB   5  
ATOM 8655  C CG   . LYS A 1 11  ? 3.799   -11.478 -11.834 1.00 0.63  ? 11  LYS A CG   5  
ATOM 8656  C CD   . LYS A 1 11  ? 2.625   -10.572 -12.054 1.00 1.34  ? 11  LYS A CD   5  
ATOM 8657  C CE   . LYS A 1 11  ? 1.320   -11.334 -11.956 1.00 1.31  ? 11  LYS A CE   5  
ATOM 8658  N NZ   . LYS A 1 11  ? 1.170   -12.323 -13.061 1.00 2.23  ? 11  LYS A NZ   5  
ATOM 8659  H H    . LYS A 1 11  ? 4.457   -8.441  -10.177 1.00 0.41  ? 11  LYS A H    5  
ATOM 8660  H HA   . LYS A 1 11  ? 5.506   -10.436 -10.159 1.00 0.53  ? 11  LYS A HA   5  
ATOM 8661  H HB2  . LYS A 1 11  ? 4.964   -10.230 -13.091 1.00 0.51  ? 11  LYS A HB2  5  
ATOM 8662  H HB3  . LYS A 1 11  ? 5.834   -11.598 -12.409 1.00 0.67  ? 11  LYS A HB3  5  
ATOM 8663  H HG2  . LYS A 1 11  ? 3.664   -12.351 -12.419 1.00 1.25  ? 11  LYS A HG2  5  
ATOM 8664  H HG3  . LYS A 1 11  ? 3.827   -11.741 -10.796 1.00 0.98  ? 11  LYS A HG3  5  
ATOM 8665  H HD2  . LYS A 1 11  ? 2.643   -9.811  -11.310 1.00 1.86  ? 11  LYS A HD2  5  
ATOM 8666  H HD3  . LYS A 1 11  ? 2.708   -10.131 -13.019 1.00 2.00  ? 11  LYS A HD3  5  
ATOM 8667  H HE2  . LYS A 1 11  ? 1.304   -11.858 -11.015 1.00 1.09  ? 11  LYS A HE2  5  
ATOM 8668  H HE3  . LYS A 1 11  ? 0.500   -10.633 -11.995 1.00 1.82  ? 11  LYS A HE3  5  
ATOM 8669  H HZ1  . LYS A 1 11  ? 1.287   -11.852 -13.981 1.00 2.72  ? 11  LYS A HZ1  5  
ATOM 8670  H HZ2  . LYS A 1 11  ? 0.225   -12.755 -13.028 1.00 2.51  ? 11  LYS A HZ2  5  
ATOM 8671  H HZ3  . LYS A 1 11  ? 1.883   -13.075 -12.975 1.00 2.85  ? 11  LYS A HZ3  5  
ATOM 8672  N N    . VAL A 1 12  ? 7.604   -8.499  -11.507 1.00 0.26  ? 12  VAL A N    5  
ATOM 8673  C CA   . VAL A 1 12  ? 9.020   -8.207  -11.601 1.00 0.25  ? 12  VAL A CA   5  
ATOM 8674  C C    . VAL A 1 12  ? 9.515   -7.652  -10.276 1.00 0.22  ? 12  VAL A C    5  
ATOM 8675  O O    . VAL A 1 12  ? 8.783   -6.970  -9.561  1.00 0.20  ? 12  VAL A O    5  
ATOM 8676  C CB   . VAL A 1 12  ? 9.364   -7.231  -12.755 1.00 0.25  ? 12  VAL A CB   5  
ATOM 8677  C CG1  . VAL A 1 12  ? 8.459   -6.013  -12.743 1.00 0.24  ? 12  VAL A CG1  5  
ATOM 8678  C CG2  . VAL A 1 12  ? 10.834  -6.825  -12.695 1.00 0.25  ? 12  VAL A CG2  5  
ATOM 8679  H H    . VAL A 1 12  ? 6.959   -7.771  -11.600 1.00 0.27  ? 12  VAL A H    5  
ATOM 8680  H HA   . VAL A 1 12  ? 9.530   -9.143  -11.789 1.00 0.28  ? 12  VAL A HA   5  
ATOM 8681  H HB   . VAL A 1 12  ? 9.203   -7.743  -13.685 1.00 0.29  ? 12  VAL A HB   5  
ATOM 8682  H HG11 . VAL A 1 12  ? 7.479   -6.290  -13.105 1.00 1.04  ? 12  VAL A HG11 5  
ATOM 8683  H HG12 . VAL A 1 12  ? 8.872   -5.243  -13.379 1.00 1.04  ? 12  VAL A HG12 5  
ATOM 8684  H HG13 . VAL A 1 12  ? 8.371   -5.640  -11.735 1.00 1.04  ? 12  VAL A HG13 5  
ATOM 8685  H HG21 . VAL A 1 12  ? 11.054  -6.417  -11.716 1.00 0.98  ? 12  VAL A HG21 5  
ATOM 8686  H HG22 . VAL A 1 12  ? 11.039  -6.085  -13.452 1.00 0.95  ? 12  VAL A HG22 5  
ATOM 8687  H HG23 . VAL A 1 12  ? 11.453  -7.697  -12.862 1.00 0.99  ? 12  VAL A HG23 5  
ATOM 8688  N N    . SER A 1 13  ? 10.746  -7.975  -9.955  1.00 0.23  ? 13  SER A N    5  
ATOM 8689  C CA   . SER A 1 13  ? 11.345  -7.595  -8.697  1.00 0.22  ? 13  SER A CA   5  
ATOM 8690  C C    . SER A 1 13  ? 12.190  -6.343  -8.834  1.00 0.19  ? 13  SER A C    5  
ATOM 8691  O O    . SER A 1 13  ? 12.665  -6.007  -9.921  1.00 0.20  ? 13  SER A O    5  
ATOM 8692  C CB   . SER A 1 13  ? 12.187  -8.749  -8.197  1.00 0.27  ? 13  SER A CB   5  
ATOM 8693  O OG   . SER A 1 13  ? 12.985  -8.395  -7.081  1.00 1.29  ? 13  SER A OG   5  
ATOM 8694  H H    . SER A 1 13  ? 11.276  -8.492  -10.595 1.00 0.26  ? 13  SER A H    5  
ATOM 8695  H HA   . SER A 1 13  ? 10.554  -7.410  -7.991  1.00 0.21  ? 13  SER A HA   5  
ATOM 8696  H HB2  . SER A 1 13  ? 11.525  -9.537  -7.899  1.00 1.03  ? 13  SER A HB2  5  
ATOM 8697  H HB3  . SER A 1 13  ? 12.822  -9.089  -9.000  1.00 0.99  ? 13  SER A HB3  5  
ATOM 8698  H HG   . SER A 1 13  ? 12.813  -9.005  -6.358  1.00 1.80  ? 13  SER A HG   5  
ATOM 8699  N N    . GLY A 1 14  ? 12.368  -5.672  -7.713  1.00 0.17  ? 14  GLY A N    5  
ATOM 8700  C CA   . GLY A 1 14  ? 13.145  -4.458  -7.659  1.00 0.17  ? 14  GLY A CA   5  
ATOM 8701  C C    . GLY A 1 14  ? 13.262  -3.939  -6.246  1.00 0.15  ? 14  GLY A C    5  
ATOM 8702  O O    . GLY A 1 14  ? 13.354  -4.718  -5.309  1.00 0.15  ? 14  GLY A O    5  
ATOM 8703  H H    . GLY A 1 14  ? 11.953  -6.021  -6.884  1.00 0.18  ? 14  GLY A H    5  
ATOM 8704  H HA2  . GLY A 1 14  ? 14.134  -4.653  -8.047  1.00 0.22  ? 14  GLY A HA2  5  
ATOM 8705  H HA3  . GLY A 1 14  ? 12.669  -3.706  -8.267  1.00 0.18  ? 14  GLY A HA3  5  
ATOM 8706  N N    . ILE A 1 15  ? 13.276  -2.626  -6.095  1.00 0.13  ? 15  ILE A N    5  
ATOM 8707  C CA   . ILE A 1 15  ? 13.303  -1.990  -4.788  1.00 0.12  ? 15  ILE A CA   5  
ATOM 8708  C C    . ILE A 1 15  ? 12.142  -1.007  -4.663  1.00 0.12  ? 15  ILE A C    5  
ATOM 8709  O O    . ILE A 1 15  ? 11.761  -0.360  -5.636  1.00 0.13  ? 15  ILE A O    5  
ATOM 8710  C CB   . ILE A 1 15  ? 14.644  -1.236  -4.539  1.00 0.14  ? 15  ILE A CB   5  
ATOM 8711  C CG1  . ILE A 1 15  ? 15.759  -2.195  -4.110  1.00 0.16  ? 15  ILE A CG1  5  
ATOM 8712  C CG2  . ILE A 1 15  ? 14.487  -0.130  -3.497  1.00 0.15  ? 15  ILE A CG2  5  
ATOM 8713  C CD1  . ILE A 1 15  ? 16.210  -3.151  -5.185  1.00 0.18  ? 15  ILE A CD1  5  
ATOM 8714  H H    . ILE A 1 15  ? 13.277  -2.057  -6.895  1.00 0.14  ? 15  ILE A H    5  
ATOM 8715  H HA   . ILE A 1 15  ? 13.198  -2.762  -4.039  1.00 0.12  ? 15  ILE A HA   5  
ATOM 8716  H HB   . ILE A 1 15  ? 14.932  -0.768  -5.468  1.00 0.15  ? 15  ILE A HB   5  
ATOM 8717  H HG12 . ILE A 1 15  ? 16.616  -1.617  -3.813  1.00 0.18  ? 15  ILE A HG12 5  
ATOM 8718  H HG13 . ILE A 1 15  ? 15.419  -2.782  -3.266  1.00 0.16  ? 15  ILE A HG13 5  
ATOM 8719  H HG21 . ILE A 1 15  ? 14.051  -0.539  -2.593  1.00 0.97  ? 15  ILE A HG21 5  
ATOM 8720  H HG22 . ILE A 1 15  ? 13.840  0.642   -3.890  1.00 0.94  ? 15  ILE A HG22 5  
ATOM 8721  H HG23 . ILE A 1 15  ? 15.453  0.293   -3.271  1.00 0.99  ? 15  ILE A HG23 5  
ATOM 8722  H HD11 . ILE A 1 15  ? 16.470  -2.598  -6.076  1.00 1.01  ? 15  ILE A HD11 5  
ATOM 8723  H HD12 . ILE A 1 15  ? 15.410  -3.840  -5.407  1.00 1.05  ? 15  ILE A HD12 5  
ATOM 8724  H HD13 . ILE A 1 15  ? 17.070  -3.699  -4.833  1.00 1.03  ? 15  ILE A HD13 5  
ATOM 8725  N N    . ILE A 1 16  ? 11.594  -0.899  -3.465  1.00 0.11  ? 16  ILE A N    5  
ATOM 8726  C CA   . ILE A 1 16  ? 10.627  0.132   -3.155  1.00 0.11  ? 16  ILE A CA   5  
ATOM 8727  C C    . ILE A 1 16  ? 11.370  1.241   -2.411  1.00 0.11  ? 16  ILE A C    5  
ATOM 8728  O O    . ILE A 1 16  ? 12.172  0.957   -1.526  1.00 0.13  ? 16  ILE A O    5  
ATOM 8729  C CB   . ILE A 1 16  ? 9.464   -0.434  -2.300  1.00 0.12  ? 16  ILE A CB   5  
ATOM 8730  C CG1  . ILE A 1 16  ? 8.119   -0.159  -2.957  1.00 0.13  ? 16  ILE A CG1  5  
ATOM 8731  C CG2  . ILE A 1 16  ? 9.460   0.130   -0.892  1.00 0.14  ? 16  ILE A CG2  5  
ATOM 8732  C CD1  . ILE A 1 16  ? 6.949   -0.622  -2.118  1.00 0.17  ? 16  ILE A CD1  5  
ATOM 8733  H H    . ILE A 1 16  ? 11.856  -1.535  -2.759  1.00 0.12  ? 16  ILE A H    5  
ATOM 8734  H HA   . ILE A 1 16  ? 10.224  0.512   -4.080  1.00 0.11  ? 16  ILE A HA   5  
ATOM 8735  H HB   . ILE A 1 16  ? 9.601   -1.497  -2.232  1.00 0.14  ? 16  ILE A HB   5  
ATOM 8736  H HG12 . ILE A 1 16  ? 8.013   0.898   -3.128  1.00 0.13  ? 16  ILE A HG12 5  
ATOM 8737  H HG13 . ILE A 1 16  ? 8.075   -0.674  -3.899  1.00 0.14  ? 16  ILE A HG13 5  
ATOM 8738  H HG21 . ILE A 1 16  ? 9.430   1.208   -0.941  1.00 1.01  ? 16  ILE A HG21 5  
ATOM 8739  H HG22 . ILE A 1 16  ? 10.354  -0.186  -0.374  1.00 1.04  ? 16  ILE A HG22 5  
ATOM 8740  H HG23 . ILE A 1 16  ? 8.590   -0.230  -0.367  1.00 1.01  ? 16  ILE A HG23 5  
ATOM 8741  H HD11 . ILE A 1 16  ? 6.026   -0.297  -2.576  1.00 1.04  ? 16  ILE A HD11 5  
ATOM 8742  H HD12 . ILE A 1 16  ? 7.029   -0.204  -1.126  1.00 1.06  ? 16  ILE A HD12 5  
ATOM 8743  H HD13 . ILE A 1 16  ? 6.958   -1.700  -2.056  1.00 1.00  ? 16  ILE A HD13 5  
ATOM 8744  N N    . ALA A 1 17  ? 11.162  2.483   -2.806  1.00 0.12  ? 17  ALA A N    5  
ATOM 8745  C CA   . ALA A 1 17  ? 11.955  3.590   -2.284  1.00 0.13  ? 17  ALA A CA   5  
ATOM 8746  C C    . ALA A 1 17  ? 11.103  4.826   -2.039  1.00 0.13  ? 17  ALA A C    5  
ATOM 8747  O O    . ALA A 1 17  ? 10.627  5.457   -2.977  1.00 0.15  ? 17  ALA A O    5  
ATOM 8748  C CB   . ALA A 1 17  ? 13.087  3.912   -3.250  1.00 0.15  ? 17  ALA A CB   5  
ATOM 8749  H H    . ALA A 1 17  ? 10.461  2.663   -3.467  1.00 0.12  ? 17  ALA A H    5  
ATOM 8750  H HA   . ALA A 1 17  ? 12.393  3.272   -1.349  1.00 0.13  ? 17  ALA A HA   5  
ATOM 8751  H HB1  . ALA A 1 17  ? 12.675  4.146   -4.228  1.00 1.00  ? 17  ALA A HB1  5  
ATOM 8752  H HB2  . ALA A 1 17  ? 13.746  3.057   -3.327  1.00 0.99  ? 17  ALA A HB2  5  
ATOM 8753  H HB3  . ALA A 1 17  ? 13.643  4.761   -2.882  1.00 1.00  ? 17  ALA A HB3  5  
ATOM 8754  N N    . ILE A 1 18  ? 10.916  5.176   -0.780  1.00 0.17  ? 18  ILE A N    5  
ATOM 8755  C CA   . ILE A 1 18  ? 10.126  6.345   -0.431  1.00 0.15  ? 18  ILE A CA   5  
ATOM 8756  C C    . ILE A 1 18  ? 11.008  7.583   -0.353  1.00 0.16  ? 18  ILE A C    5  
ATOM 8757  O O    . ILE A 1 18  ? 11.992  7.624   0.388   1.00 0.23  ? 18  ILE A O    5  
ATOM 8758  C CB   . ILE A 1 18  ? 9.342   6.163   0.892   1.00 0.18  ? 18  ILE A CB   5  
ATOM 8759  C CG1  . ILE A 1 18  ? 8.266   5.092   0.744   1.00 0.21  ? 18  ILE A CG1  5  
ATOM 8760  C CG2  . ILE A 1 18  ? 8.681   7.465   1.311   1.00 0.18  ? 18  ILE A CG2  5  
ATOM 8761  C CD1  . ILE A 1 18  ? 8.782   3.669   0.682   1.00 0.21  ? 18  ILE A CD1  5  
ATOM 8762  H H    . ILE A 1 18  ? 11.321  4.633   -0.064  1.00 0.25  ? 18  ILE A H    5  
ATOM 8763  H HA   . ILE A 1 18  ? 9.408   6.494   -1.224  1.00 0.15  ? 18  ILE A HA   5  
ATOM 8764  H HB   . ILE A 1 18  ? 10.033  5.869   1.665   1.00 0.20  ? 18  ILE A HB   5  
ATOM 8765  H HG12 . ILE A 1 18  ? 7.593   5.165   1.585   1.00 0.27  ? 18  ILE A HG12 5  
ATOM 8766  H HG13 . ILE A 1 18  ? 7.711   5.281   -0.163  1.00 0.22  ? 18  ILE A HG13 5  
ATOM 8767  H HG21 . ILE A 1 18  ? 8.118   7.302   2.221   1.00 1.02  ? 18  ILE A HG21 5  
ATOM 8768  H HG22 . ILE A 1 18  ? 8.011   7.791   0.528   1.00 1.03  ? 18  ILE A HG22 5  
ATOM 8769  H HG23 . ILE A 1 18  ? 9.438   8.218   1.478   1.00 1.03  ? 18  ILE A HG23 5  
ATOM 8770  H HD11 . ILE A 1 18  ? 9.536   3.587   -0.090  1.00 1.03  ? 18  ILE A HD11 5  
ATOM 8771  H HD12 . ILE A 1 18  ? 7.960   3.006   0.454   1.00 1.03  ? 18  ILE A HD12 5  
ATOM 8772  H HD13 . ILE A 1 18  ? 9.210   3.393   1.641   1.00 0.99  ? 18  ILE A HD13 5  
ATOM 8773  N N    . ASN A 1 19  ? 10.629  8.583   -1.124  1.00 0.19  ? 19  ASN A N    5  
ATOM 8774  C CA   . ASN A 1 19  ? 11.417  9.791   -1.295  1.00 0.33  ? 19  ASN A CA   5  
ATOM 8775  C C    . ASN A 1 19  ? 10.778  10.954  -0.561  1.00 0.31  ? 19  ASN A C    5  
ATOM 8776  O O    . ASN A 1 19  ? 9.603   11.252  -0.778  1.00 0.55  ? 19  ASN A O    5  
ATOM 8777  C CB   . ASN A 1 19  ? 11.496  10.119  -2.794  1.00 0.54  ? 19  ASN A CB   5  
ATOM 8778  C CG   . ASN A 1 19  ? 12.459  11.242  -3.141  1.00 0.83  ? 19  ASN A CG   5  
ATOM 8779  O OD1  . ASN A 1 19  ? 12.755  12.115  -2.329  1.00 1.36  ? 19  ASN A OD1  5  
ATOM 8780  N ND2  . ASN A 1 19  ? 12.941  11.237  -4.375  1.00 1.00  ? 19  ASN A ND2  5  
ATOM 8781  H H    . ASN A 1 19  ? 9.770   8.512   -1.602  1.00 0.20  ? 19  ASN A H    5  
ATOM 8782  H HA   . ASN A 1 19  ? 12.404  9.621   -0.905  1.00 0.40  ? 19  ASN A HA   5  
ATOM 8783  H HB2  . ASN A 1 19  ? 11.805  9.238   -3.329  1.00 1.02  ? 19  ASN A HB2  5  
ATOM 8784  H HB3  . ASN A 1 19  ? 10.511  10.404  -3.136  1.00 0.61  ? 19  ASN A HB3  5  
ATOM 8785  H HD21 . ASN A 1 19  ? 12.655  10.521  -4.981  1.00 1.07  ? 19  ASN A HD21 5  
ATOM 8786  H HD22 . ASN A 1 19  ? 13.559  11.951  -4.634  1.00 1.32  ? 19  ASN A HD22 5  
ATOM 8787  N N    . GLU A 1 20  ? 11.539  11.618  0.302   1.00 0.36  ? 20  GLU A N    5  
ATOM 8788  C CA   . GLU A 1 20  ? 11.085  12.869  0.838   1.00 0.31  ? 20  GLU A CA   5  
ATOM 8789  C C    . GLU A 1 20  ? 12.133  13.941  0.553   1.00 0.67  ? 20  GLU A C    5  
ATOM 8790  O O    . GLU A 1 20  ? 12.868  14.371  1.443   1.00 1.47  ? 20  GLU A O    5  
ATOM 8791  C CB   . GLU A 1 20  ? 10.931  12.754  2.351   1.00 0.52  ? 20  GLU A CB   5  
ATOM 8792  C CG   . GLU A 1 20  ? 10.070  11.604  2.827   1.00 0.71  ? 20  GLU A CG   5  
ATOM 8793  C CD   . GLU A 1 20  ? 10.034  11.518  4.337   1.00 1.18  ? 20  GLU A CD   5  
ATOM 8794  O OE1  . GLU A 1 20  ? 9.289   12.299  4.966   1.00 1.47  ? 20  GLU A OE1  5  
ATOM 8795  O OE2  . GLU A 1 20  ? 10.731  10.651  4.901   1.00 1.41  ? 20  GLU A OE2  5  
ATOM 8796  H H    . GLU A 1 20  ? 12.418  11.283  0.543   1.00 0.66  ? 20  GLU A H    5  
ATOM 8797  H HA   . GLU A 1 20  ? 10.133  13.118  0.389   1.00 0.58  ? 20  GLU A HA   5  
ATOM 8798  H HB2  . GLU A 1 20  ? 11.908  12.634  2.788   1.00 0.71  ? 20  GLU A HB2  5  
ATOM 8799  H HB3  . GLU A 1 20  ? 10.503  13.667  2.715   1.00 0.70  ? 20  GLU A HB3  5  
ATOM 8800  H HG2  . GLU A 1 20  ? 9.069   11.750  2.463   1.00 0.85  ? 20  GLU A HG2  5  
ATOM 8801  H HG3  . GLU A 1 20  ? 10.469  10.681  2.434   1.00 0.53  ? 20  GLU A HG3  5  
ATOM 8802  N N    . ASP A 1 21  ? 12.204  14.349  -0.696  1.00 0.99  ? 21  ASP A N    5  
ATOM 8803  C CA   . ASP A 1 21  ? 12.864  15.586  -1.099  1.00 1.38  ? 21  ASP A CA   5  
ATOM 8804  C C    . ASP A 1 21  ? 11.815  16.542  -1.609  1.00 0.91  ? 21  ASP A C    5  
ATOM 8805  O O    . ASP A 1 21  ? 11.967  17.762  -1.614  1.00 0.88  ? 21  ASP A O    5  
ATOM 8806  C CB   . ASP A 1 21  ? 13.892  15.315  -2.194  1.00 2.11  ? 21  ASP A CB   5  
ATOM 8807  C CG   . ASP A 1 21  ? 14.676  16.556  -2.573  1.00 2.89  ? 21  ASP A CG   5  
ATOM 8808  O OD1  . ASP A 1 21  ? 15.633  16.904  -1.850  1.00 2.89  ? 21  ASP A OD1  5  
ATOM 8809  O OD2  . ASP A 1 21  ? 14.349  17.183  -3.603  1.00 3.67  ? 21  ASP A OD2  5  
ATOM 8810  H H    . ASP A 1 21  ? 11.818  13.775  -1.391  1.00 1.43  ? 21  ASP A H    5  
ATOM 8811  H HA   . ASP A 1 21  ? 13.352  16.013  -0.236  1.00 1.72  ? 21  ASP A HA   5  
ATOM 8812  H HB2  . ASP A 1 21  ? 14.579  14.564  -1.848  1.00 1.95  ? 21  ASP A HB2  5  
ATOM 8813  H HB3  . ASP A 1 21  ? 13.382  14.950  -3.074  1.00 2.52  ? 21  ASP A HB3  5  
ATOM 8814  N N    . VAL A 1 22  ? 10.732  15.919  -2.009  1.00 0.60  ? 22  VAL A N    5  
ATOM 8815  C CA   . VAL A 1 22  ? 9.755   16.493  -2.899  1.00 0.46  ? 22  VAL A CA   5  
ATOM 8816  C C    . VAL A 1 22  ? 8.483   16.875  -2.170  1.00 0.40  ? 22  VAL A C    5  
ATOM 8817  O O    . VAL A 1 22  ? 8.424   16.879  -0.936  1.00 0.48  ? 22  VAL A O    5  
ATOM 8818  C CB   . VAL A 1 22  ? 9.413   15.503  -4.043  1.00 0.57  ? 22  VAL A CB   5  
ATOM 8819  C CG1  . VAL A 1 22  ? 10.585  15.354  -4.988  1.00 0.90  ? 22  VAL A CG1  5  
ATOM 8820  C CG2  . VAL A 1 22  ? 9.046   14.130  -3.496  1.00 0.41  ? 22  VAL A CG2  5  
ATOM 8821  H H    . VAL A 1 22  ? 10.577  15.011  -1.683  1.00 0.53  ? 22  VAL A H    5  
ATOM 8822  H HA   . VAL A 1 22  ? 10.185  17.376  -3.340  1.00 0.55  ? 22  VAL A HA   5  
ATOM 8823  H HB   . VAL A 1 22  ? 8.572   15.888  -4.596  1.00 0.68  ? 22  VAL A HB   5  
ATOM 8824  H HG11 . VAL A 1 22  ? 10.872  16.323  -5.368  1.00 1.47  ? 22  VAL A HG11 5  
ATOM 8825  H HG12 . VAL A 1 22  ? 10.300  14.713  -5.806  1.00 1.33  ? 22  VAL A HG12 5  
ATOM 8826  H HG13 . VAL A 1 22  ? 11.412  14.910  -4.456  1.00 1.36  ? 22  VAL A HG13 5  
ATOM 8827  H HG21 . VAL A 1 22  ? 8.291   14.233  -2.733  1.00 1.16  ? 22  VAL A HG21 5  
ATOM 8828  H HG22 . VAL A 1 22  ? 9.929   13.669  -3.080  1.00 1.06  ? 22  VAL A HG22 5  
ATOM 8829  H HG23 . VAL A 1 22  ? 8.665   13.509  -4.300  1.00 1.02  ? 22  VAL A HG23 5  
ATOM 8830  N N    . SER A 1 23  ? 7.486   17.211  -2.957  1.00 0.47  ? 23  SER A N    5  
ATOM 8831  C CA   . SER A 1 23  ? 6.150   17.465  -2.461  1.00 0.58  ? 23  SER A CA   5  
ATOM 8832  C C    . SER A 1 23  ? 5.566   16.094  -2.119  1.00 0.46  ? 23  SER A C    5  
ATOM 8833  O O    . SER A 1 23  ? 6.180   15.099  -2.506  1.00 0.39  ? 23  SER A O    5  
ATOM 8834  C CB   . SER A 1 23  ? 5.340   18.209  -3.535  1.00 0.77  ? 23  SER A CB   5  
ATOM 8835  O OG   . SER A 1 23  ? 5.398   17.540  -4.786  1.00 1.23  ? 23  SER A OG   5  
ATOM 8836  H H    . SER A 1 23  ? 7.652   17.270  -3.916  1.00 0.53  ? 23  SER A H    5  
ATOM 8837  H HA   . SER A 1 23  ? 6.222   18.064  -1.564  1.00 0.66  ? 23  SER A HA   5  
ATOM 8838  H HB2  . SER A 1 23  ? 4.311   18.278  -3.225  1.00 1.36  ? 23  SER A HB2  5  
ATOM 8839  H HB3  . SER A 1 23  ? 5.741   19.205  -3.657  1.00 1.21  ? 23  SER A HB3  5  
ATOM 8840  H HG   . SER A 1 23  ? 6.152   17.871  -5.291  1.00 1.72  ? 23  SER A HG   5  
ATOM 8841  N N    . PRO A 1 24  ? 4.390   15.988  -1.450  1.00 0.46  ? 24  PRO A N    5  
ATOM 8842  C CA   . PRO A 1 24  ? 4.121   14.917  -0.484  1.00 0.39  ? 24  PRO A CA   5  
ATOM 8843  C C    . PRO A 1 24  ? 4.780   13.593  -0.835  1.00 0.27  ? 24  PRO A C    5  
ATOM 8844  O O    . PRO A 1 24  ? 4.589   13.057  -1.931  1.00 0.24  ? 24  PRO A O    5  
ATOM 8845  C CB   . PRO A 1 24  ? 2.615   14.752  -0.558  1.00 0.43  ? 24  PRO A CB   5  
ATOM 8846  C CG   . PRO A 1 24  ? 2.076   16.050  -1.052  1.00 0.50  ? 24  PRO A CG   5  
ATOM 8847  C CD   . PRO A 1 24  ? 3.220   16.855  -1.616  1.00 0.56  ? 24  PRO A CD   5  
ATOM 8848  H HA   . PRO A 1 24  ? 4.392   15.208  0.511   1.00 0.45  ? 24  PRO A HA   5  
ATOM 8849  H HB2  . PRO A 1 24  ? 2.379   13.950  -1.240  1.00 0.39  ? 24  PRO A HB2  5  
ATOM 8850  H HB3  . PRO A 1 24  ? 2.230   14.516  0.422   1.00 0.48  ? 24  PRO A HB3  5  
ATOM 8851  H HG2  . PRO A 1 24  ? 1.363   15.849  -1.824  1.00 0.47  ? 24  PRO A HG2  5  
ATOM 8852  H HG3  . PRO A 1 24  ? 1.607   16.584  -0.238  1.00 0.58  ? 24  PRO A HG3  5  
ATOM 8853  H HD2  . PRO A 1 24  ? 3.042   17.059  -2.660  1.00 0.59  ? 24  PRO A HD2  5  
ATOM 8854  H HD3  . PRO A 1 24  ? 3.340   17.776  -1.066  1.00 0.69  ? 24  PRO A HD3  5  
ATOM 8855  N N    . ALA A 1 25  ? 5.528   13.082  0.151   1.00 0.25  ? 25  ALA A N    5  
ATOM 8856  C CA   . ALA A 1 25  ? 6.469   11.981  -0.025  1.00 0.19  ? 25  ALA A CA   5  
ATOM 8857  C C    . ALA A 1 25  ? 5.922   10.907  -0.927  1.00 0.14  ? 25  ALA A C    5  
ATOM 8858  O O    . ALA A 1 25  ? 4.785   10.481  -0.782  1.00 0.17  ? 25  ALA A O    5  
ATOM 8859  C CB   . ALA A 1 25  ? 6.832   11.380  1.318   1.00 0.27  ? 25  ALA A CB   5  
ATOM 8860  H H    . ALA A 1 25  ? 5.423   13.460  1.051   1.00 0.32  ? 25  ALA A H    5  
ATOM 8861  H HA   . ALA A 1 25  ? 7.371   12.381  -0.465  1.00 0.18  ? 25  ALA A HA   5  
ATOM 8862  H HB1  . ALA A 1 25  ? 7.666   10.705  1.196   1.00 1.02  ? 25  ALA A HB1  5  
ATOM 8863  H HB2  . ALA A 1 25  ? 5.978   10.835  1.708   1.00 1.10  ? 25  ALA A HB2  5  
ATOM 8864  H HB3  . ALA A 1 25  ? 7.104   12.169  2.003   1.00 1.05  ? 25  ALA A HB3  5  
ATOM 8865  N N    . GLU A 1 26  ? 6.730   10.473  -1.860  1.00 0.14  ? 26  GLU A N    5  
ATOM 8866  C CA   . GLU A 1 26  ? 6.284   9.498   -2.819  1.00 0.14  ? 26  GLU A CA   5  
ATOM 8867  C C    . GLU A 1 26  ? 7.070   8.209   -2.666  1.00 0.15  ? 26  GLU A C    5  
ATOM 8868  O O    . GLU A 1 26  ? 8.239   8.214   -2.282  1.00 0.19  ? 26  GLU A O    5  
ATOM 8869  C CB   . GLU A 1 26  ? 6.408   10.046  -4.247  1.00 0.21  ? 26  GLU A CB   5  
ATOM 8870  C CG   . GLU A 1 26  ? 6.947   11.459  -4.319  1.00 0.42  ? 26  GLU A CG   5  
ATOM 8871  C CD   . GLU A 1 26  ? 7.313   11.862  -5.729  1.00 0.54  ? 26  GLU A CD   5  
ATOM 8872  O OE1  . GLU A 1 26  ? 8.399   11.467  -6.201  1.00 0.69  ? 26  GLU A OE1  5  
ATOM 8873  O OE2  . GLU A 1 26  ? 6.518   12.579  -6.374  1.00 0.66  ? 26  GLU A OE2  5  
ATOM 8874  H H    . GLU A 1 26  ? 7.653   10.805  -1.898  1.00 0.18  ? 26  GLU A H    5  
ATOM 8875  H HA   . GLU A 1 26  ? 5.245   9.290   -2.609  1.00 0.15  ? 26  GLU A HA   5  
ATOM 8876  H HB2  . GLU A 1 26  ? 7.079   9.413   -4.804  1.00 0.33  ? 26  GLU A HB2  5  
ATOM 8877  H HB3  . GLU A 1 26  ? 5.428   10.033  -4.720  1.00 0.37  ? 26  GLU A HB3  5  
ATOM 8878  H HG2  . GLU A 1 26  ? 6.195   12.140  -3.949  1.00 0.59  ? 26  GLU A HG2  5  
ATOM 8879  H HG3  . GLU A 1 26  ? 7.821   11.524  -3.699  1.00 0.58  ? 26  GLU A HG3  5  
ATOM 8880  N N    . LEU A 1 27  ? 6.412   7.114   -2.976  1.00 0.15  ? 27  LEU A N    5  
ATOM 8881  C CA   . LEU A 1 27  ? 7.002   5.800   -2.906  1.00 0.16  ? 27  LEU A CA   5  
ATOM 8882  C C    . LEU A 1 27  ? 7.347   5.343   -4.306  1.00 0.16  ? 27  LEU A C    5  
ATOM 8883  O O    . LEU A 1 27  ? 6.526   5.400   -5.207  1.00 0.19  ? 27  LEU A O    5  
ATOM 8884  C CB   . LEU A 1 27  ? 6.027   4.829   -2.236  1.00 0.21  ? 27  LEU A CB   5  
ATOM 8885  C CG   . LEU A 1 27  ? 6.306   3.344   -2.475  1.00 0.29  ? 27  LEU A CG   5  
ATOM 8886  C CD1  . LEU A 1 27  ? 5.878   2.539   -1.274  1.00 0.53  ? 27  LEU A CD1  5  
ATOM 8887  C CD2  . LEU A 1 27  ? 5.570   2.852   -3.716  1.00 0.59  ? 27  LEU A CD2  5  
ATOM 8888  H H    . LEU A 1 27  ? 5.472   7.196   -3.263  1.00 0.15  ? 27  LEU A H    5  
ATOM 8889  H HA   . LEU A 1 27  ? 7.903   5.859   -2.318  1.00 0.17  ? 27  LEU A HA   5  
ATOM 8890  H HB2  . LEU A 1 27  ? 6.055   5.011   -1.171  1.00 0.23  ? 27  LEU A HB2  5  
ATOM 8891  H HB3  . LEU A 1 27  ? 5.035   5.046   -2.592  1.00 0.24  ? 27  LEU A HB3  5  
ATOM 8892  H HG   . LEU A 1 27  ? 7.365   3.196   -2.625  1.00 0.70  ? 27  LEU A HG   5  
ATOM 8893  H HD11 . LEU A 1 27  ? 6.287   2.988   -0.384  1.00 1.19  ? 27  LEU A HD11 5  
ATOM 8894  H HD12 . LEU A 1 27  ? 6.248   1.529   -1.373  1.00 1.10  ? 27  LEU A HD12 5  
ATOM 8895  H HD13 . LEU A 1 27  ? 4.801   2.529   -1.213  1.00 1.21  ? 27  LEU A HD13 5  
ATOM 8896  H HD21 . LEU A 1 27  ? 6.012   3.306   -4.595  1.00 1.11  ? 27  LEU A HD21 5  
ATOM 8897  H HD22 . LEU A 1 27  ? 4.525   3.132   -3.651  1.00 1.22  ? 27  LEU A HD22 5  
ATOM 8898  H HD23 . LEU A 1 27  ? 5.656   1.778   -3.784  1.00 1.17  ? 27  LEU A HD23 5  
ATOM 8899  N N    . THR A 1 28  ? 8.560   4.904   -4.485  1.00 0.16  ? 28  THR A N    5  
ATOM 8900  C CA   . THR A 1 28  ? 9.058   4.620   -5.805  1.00 0.17  ? 28  THR A CA   5  
ATOM 8901  C C    . THR A 1 28  ? 9.511   3.175   -5.917  1.00 0.17  ? 28  THR A C    5  
ATOM 8902  O O    . THR A 1 28  ? 10.542  2.805   -5.367  1.00 0.17  ? 28  THR A O    5  
ATOM 8903  C CB   . THR A 1 28  ? 10.251  5.539   -6.094  1.00 0.19  ? 28  THR A CB   5  
ATOM 8904  O OG1  . THR A 1 28  ? 9.983   6.857   -5.590  1.00 0.22  ? 28  THR A OG1  5  
ATOM 8905  C CG2  . THR A 1 28  ? 10.548  5.615   -7.577  1.00 0.22  ? 28  THR A CG2  5  
ATOM 8906  H H    . THR A 1 28  ? 9.147   4.775   -3.708  1.00 0.16  ? 28  THR A H    5  
ATOM 8907  H HA   . THR A 1 28  ? 8.281   4.820   -6.526  1.00 0.18  ? 28  THR A HA   5  
ATOM 8908  H HB   . THR A 1 28  ? 11.113  5.138   -5.586  1.00 0.20  ? 28  THR A HB   5  
ATOM 8909  H HG1  . THR A 1 28  ? 10.027  6.838   -4.625  1.00 0.24  ? 28  THR A HG1  5  
ATOM 8910  H HG21 . THR A 1 28  ? 11.433  6.213   -7.732  1.00 1.06  ? 28  THR A HG21 5  
ATOM 8911  H HG22 . THR A 1 28  ? 9.708   6.069   -8.087  1.00 1.00  ? 28  THR A HG22 5  
ATOM 8912  H HG23 . THR A 1 28  ? 10.716  4.618   -7.962  1.00 1.03  ? 28  THR A HG23 5  
ATOM 8913  N N    . TRP A 1 29  ? 8.754   2.355   -6.620  1.00 0.19  ? 29  TRP A N    5  
ATOM 8914  C CA   . TRP A 1 29  ? 9.212   1.009   -6.894  1.00 0.18  ? 29  TRP A CA   5  
ATOM 8915  C C    . TRP A 1 29  ? 9.951   1.000   -8.213  1.00 0.19  ? 29  TRP A C    5  
ATOM 8916  O O    . TRP A 1 29  ? 9.421   1.429   -9.236  1.00 0.22  ? 29  TRP A O    5  
ATOM 8917  C CB   . TRP A 1 29  ? 8.073   -0.015  -6.927  1.00 0.20  ? 29  TRP A CB   5  
ATOM 8918  C CG   . TRP A 1 29  ? 8.576   -1.411  -7.158  1.00 0.18  ? 29  TRP A CG   5  
ATOM 8919  C CD1  . TRP A 1 29  ? 8.877   -2.331  -6.201  1.00 0.17  ? 29  TRP A CD1  5  
ATOM 8920  C CD2  . TRP A 1 29  ? 8.861   -2.040  -8.419  1.00 0.17  ? 29  TRP A CD2  5  
ATOM 8921  N NE1  . TRP A 1 29  ? 9.327   -3.491  -6.786  1.00 0.16  ? 29  TRP A NE1  5  
ATOM 8922  C CE2  . TRP A 1 29  ? 9.328   -3.335  -8.144  1.00 0.15  ? 29  TRP A CE2  5  
ATOM 8923  C CE3  . TRP A 1 29  ? 8.766   -1.637  -9.753  1.00 0.18  ? 29  TRP A CE3  5  
ATOM 8924  C CZ2  . TRP A 1 29  ? 9.701   -4.222  -9.149  1.00 0.15  ? 29  TRP A CZ2  5  
ATOM 8925  C CZ3  . TRP A 1 29  ? 9.134   -2.521  -10.748 1.00 0.18  ? 29  TRP A CZ3  5  
ATOM 8926  C CH2  . TRP A 1 29  ? 9.597   -3.802  -10.438 1.00 0.17  ? 29  TRP A CH2  5  
ATOM 8927  H H    . TRP A 1 29  ? 7.886   2.661   -6.965  1.00 0.21  ? 29  TRP A H    5  
ATOM 8928  H HA   . TRP A 1 29  ? 9.904   0.734   -6.108  1.00 0.18  ? 29  TRP A HA   5  
ATOM 8929  H HB2  . TRP A 1 29  ? 7.556   0.003   -5.979  1.00 0.22  ? 29  TRP A HB2  5  
ATOM 8930  H HB3  . TRP A 1 29  ? 7.378   0.229   -7.715  1.00 0.22  ? 29  TRP A HB3  5  
ATOM 8931  H HD1  . TRP A 1 29  ? 8.770   -2.156  -5.139  1.00 0.18  ? 29  TRP A HD1  5  
ATOM 8932  H HE1  . TRP A 1 29  ? 9.605   -4.306  -6.306  1.00 0.17  ? 29  TRP A HE1  5  
ATOM 8933  H HE3  . TRP A 1 29  ? 8.411   -0.650  -10.011 1.00 0.20  ? 29  TRP A HE3  5  
ATOM 8934  H HZ2  . TRP A 1 29  ? 10.070  -5.212  -8.935  1.00 0.16  ? 29  TRP A HZ2  5  
ATOM 8935  H HZ3  . TRP A 1 29  ? 9.066   -2.223  -11.783 1.00 0.20  ? 29  TRP A HZ3  5  
ATOM 8936  H HH2  . TRP A 1 29  ? 9.876   -4.469  -11.245 1.00 0.18  ? 29  TRP A HH2  5  
ATOM 8937  N N    . ARG A 1 30  ? 11.176  0.528   -8.174  1.00 0.19  ? 30  ARG A N    5  
ATOM 8938  C CA   . ARG A 1 30  ? 11.987  0.395   -9.364  1.00 0.21  ? 30  ARG A CA   5  
ATOM 8939  C C    . ARG A 1 30  ? 12.543  -1.005  -9.449  1.00 0.18  ? 30  ARG A C    5  
ATOM 8940  O O    . ARG A 1 30  ? 13.040  -1.535  -8.463  1.00 0.21  ? 30  ARG A O    5  
ATOM 8941  C CB   . ARG A 1 30  ? 13.110  1.407   -9.373  1.00 0.27  ? 30  ARG A CB   5  
ATOM 8942  C CG   . ARG A 1 30  ? 13.540  1.794   -7.999  1.00 0.32  ? 30  ARG A CG   5  
ATOM 8943  C CD   . ARG A 1 30  ? 14.849  2.532   -8.053  1.00 0.61  ? 30  ARG A CD   5  
ATOM 8944  N NE   . ARG A 1 30  ? 15.434  2.747   -6.731  1.00 0.50  ? 30  ARG A NE   5  
ATOM 8945  C CZ   . ARG A 1 30  ? 16.143  3.826   -6.402  1.00 1.09  ? 30  ARG A CZ   5  
ATOM 8946  N NH1  . ARG A 1 30  ? 16.350  4.787   -7.296  1.00 1.93  ? 30  ARG A NH1  5  
ATOM 8947  N NH2  . ARG A 1 30  ? 16.647  3.949   -5.181  1.00 1.05  ? 30  ARG A NH2  5  
ATOM 8948  H H    . ARG A 1 30  ? 11.548  0.242   -7.307  1.00 0.20  ? 30  ARG A H    5  
ATOM 8949  H HA   . ARG A 1 30  ? 11.363  0.570   -10.205 1.00 0.24  ? 30  ARG A HA   5  
ATOM 8950  H HB2  . ARG A 1 30  ? 13.959  0.982   -9.887  1.00 0.55  ? 30  ARG A HB2  5  
ATOM 8951  H HB3  . ARG A 1 30  ? 12.794  2.291   -9.890  1.00 0.51  ? 30  ARG A HB3  5  
ATOM 8952  H HG2  . ARG A 1 30  ? 12.787  2.436   -7.565  1.00 0.90  ? 30  ARG A HG2  5  
ATOM 8953  H HG3  . ARG A 1 30  ? 13.635  0.899   -7.423  1.00 0.90  ? 30  ARG A HG3  5  
ATOM 8954  H HD2  . ARG A 1 30  ? 15.529  1.960   -8.656  1.00 1.11  ? 30  ARG A HD2  5  
ATOM 8955  H HD3  . ARG A 1 30  ? 14.681  3.491   -8.520  1.00 1.10  ? 30  ARG A HD3  5  
ATOM 8956  H HE   . ARG A 1 30  ? 15.292  2.046   -6.056  1.00 0.65  ? 30  ARG A HE   5  
ATOM 8957  H HH11 . ARG A 1 30  ? 15.976  4.706   -8.223  1.00 2.07  ? 30  ARG A HH11 5  
ATOM 8958  H HH12 . ARG A 1 30  ? 16.882  5.604   -7.045  1.00 2.49  ? 30  ARG A HH12 5  
ATOM 8959  H HH21 . ARG A 1 30  ? 16.499  3.231   -4.496  1.00 0.78  ? 30  ARG A HH21 5  
ATOM 8960  H HH22 . ARG A 1 30  ? 17.179  4.764   -4.936  1.00 1.55  ? 30  ARG A HH22 5  
ATOM 8961  N N    . SER A 1 31  ? 12.450  -1.596  -10.627 1.00 0.17  ? 31  SER A N    5  
ATOM 8962  C CA   . SER A 1 31  ? 12.860  -2.970  -10.827 1.00 0.18  ? 31  SER A CA   5  
ATOM 8963  C C    . SER A 1 31  ? 14.351  -3.141  -10.549 1.00 0.19  ? 31  SER A C    5  
ATOM 8964  O O    . SER A 1 31  ? 15.084  -2.151  -10.485 1.00 0.27  ? 31  SER A O    5  
ATOM 8965  C CB   . SER A 1 31  ? 12.516  -3.409  -12.246 1.00 0.21  ? 31  SER A CB   5  
ATOM 8966  O OG   . SER A 1 31  ? 13.258  -2.677  -13.211 1.00 0.25  ? 31  SER A OG   5  
ATOM 8967  H H    . SER A 1 31  ? 12.095  -1.089  -11.389 1.00 0.22  ? 31  SER A H    5  
ATOM 8968  H HA   . SER A 1 31  ? 12.307  -3.582  -10.132 1.00 0.17  ? 31  SER A HA   5  
ATOM 8969  H HB2  . SER A 1 31  ? 12.729  -4.456  -12.351 1.00 0.25  ? 31  SER A HB2  5  
ATOM 8970  H HB3  . SER A 1 31  ? 11.464  -3.243  -12.421 1.00 0.22  ? 31  SER A HB3  5  
ATOM 8971  H HG   . SER A 1 31  ? 13.187  -3.118  -14.069 1.00 0.97  ? 31  SER A HG   5  
ATOM 8972  N N    . THR A 1 32  ? 14.802  -4.375  -10.374 1.00 0.21  ? 32  THR A N    5  
ATOM 8973  C CA   . THR A 1 32  ? 16.198  -4.633  -10.047 1.00 0.22  ? 32  THR A CA   5  
ATOM 8974  C C    . THR A 1 32  ? 17.132  -4.043  -11.109 1.00 0.44  ? 32  THR A C    5  
ATOM 8975  O O    . THR A 1 32  ? 18.241  -3.595  -10.802 1.00 0.67  ? 32  THR A O    5  
ATOM 8976  C CB   . THR A 1 32  ? 16.472  -6.141  -9.899  1.00 0.41  ? 32  THR A CB   5  
ATOM 8977  O OG1  . THR A 1 32  ? 16.052  -6.837  -11.081 1.00 0.97  ? 32  THR A OG1  5  
ATOM 8978  C CG2  . THR A 1 32  ? 15.749  -6.717  -8.690  1.00 0.44  ? 32  THR A CG2  5  
ATOM 8979  H H    . THR A 1 32  ? 14.179  -5.133  -10.460 1.00 0.29  ? 32  THR A H    5  
ATOM 8980  H HA   . THR A 1 32  ? 16.408  -4.160  -9.097  1.00 0.31  ? 32  THR A HA   5  
ATOM 8981  H HB   . THR A 1 32  ? 17.533  -6.279  -9.760  1.00 0.79  ? 32  THR A HB   5  
ATOM 8982  H HG1  . THR A 1 32  ? 16.671  -7.556  -11.265 1.00 1.28  ? 32  THR A HG1  5  
ATOM 8983  H HG21 . THR A 1 32  ? 14.682  -6.604  -8.819  1.00 1.02  ? 32  THR A HG21 5  
ATOM 8984  H HG22 . THR A 1 32  ? 16.061  -6.192  -7.799  1.00 1.14  ? 32  THR A HG22 5  
ATOM 8985  H HG23 . THR A 1 32  ? 15.990  -7.766  -8.593  1.00 1.25  ? 32  THR A HG23 5  
ATOM 8986  N N    . ASP A 1 33  ? 16.670  -4.029  -12.358 1.00 0.55  ? 33  ASP A N    5  
ATOM 8987  C CA   . ASP A 1 33  ? 17.432  -3.436  -13.452 1.00 0.89  ? 33  ASP A CA   5  
ATOM 8988  C C    . ASP A 1 33  ? 17.532  -1.924  -13.278 1.00 1.00  ? 33  ASP A C    5  
ATOM 8989  O O    . ASP A 1 33  ? 18.520  -1.303  -13.669 1.00 1.43  ? 33  ASP A O    5  
ATOM 8990  C CB   . ASP A 1 33  ? 16.774  -3.766  -14.796 1.00 1.09  ? 33  ASP A CB   5  
ATOM 8991  C CG   . ASP A 1 33  ? 17.408  -3.023  -15.958 1.00 1.88  ? 33  ASP A CG   5  
ATOM 8992  O OD1  . ASP A 1 33  ? 18.406  -3.524  -16.514 1.00 2.19  ? 33  ASP A OD1  5  
ATOM 8993  O OD2  . ASP A 1 33  ? 16.917  -1.934  -16.316 1.00 2.57  ? 33  ASP A OD2  5  
ATOM 8994  H H    . ASP A 1 33  ? 15.795  -4.434  -12.547 1.00 0.50  ? 33  ASP A H    5  
ATOM 8995  H HA   . ASP A 1 33  ? 18.427  -3.858  -13.432 1.00 1.02  ? 33  ASP A HA   5  
ATOM 8996  H HB2  . ASP A 1 33  ? 16.864  -4.826  -14.982 1.00 1.40  ? 33  ASP A HB2  5  
ATOM 8997  H HB3  . ASP A 1 33  ? 15.728  -3.501  -14.751 1.00 1.33  ? 33  ASP A HB3  5  
ATOM 8998  N N    . GLY A 1 34  ? 16.511  -1.346  -12.663 1.00 0.80  ? 34  GLY A N    5  
ATOM 8999  C CA   . GLY A 1 34  ? 16.523  0.072   -12.369 1.00 1.07  ? 34  GLY A CA   5  
ATOM 9000  C C    . GLY A 1 34  ? 15.768  0.883   -13.397 1.00 0.75  ? 34  GLY A C    5  
ATOM 9001  O O    . GLY A 1 34  ? 15.718  2.107   -13.314 1.00 0.99  ? 34  GLY A O    5  
ATOM 9002  H H    . GLY A 1 34  ? 15.736  -1.891  -12.404 1.00 0.67  ? 34  GLY A H    5  
ATOM 9003  H HA2  . GLY A 1 34  ? 16.070  0.231   -11.401 1.00 1.36  ? 34  GLY A HA2  5  
ATOM 9004  H HA3  . GLY A 1 34  ? 17.546  0.414   -12.336 1.00 1.41  ? 34  GLY A HA3  5  
ATOM 9005  N N    . ASP A 1 35  ? 15.182  0.200   -14.368 1.00 0.62  ? 35  ASP A N    5  
ATOM 9006  C CA   . ASP A 1 35  ? 14.465  0.871   -15.444 1.00 1.00  ? 35  ASP A CA   5  
ATOM 9007  C C    . ASP A 1 35  ? 13.015  1.143   -15.072 1.00 0.69  ? 35  ASP A C    5  
ATOM 9008  O O    . ASP A 1 35  ? 12.557  2.283   -15.122 1.00 0.72  ? 35  ASP A O    5  
ATOM 9009  C CB   . ASP A 1 35  ? 14.514  0.041   -16.714 1.00 1.52  ? 35  ASP A CB   5  
ATOM 9010  C CG   . ASP A 1 35  ? 13.677  0.639   -17.826 1.00 2.13  ? 35  ASP A CG   5  
ATOM 9011  O OD1  . ASP A 1 35  ? 14.149  1.589   -18.486 1.00 2.16  ? 35  ASP A OD1  5  
ATOM 9012  O OD2  . ASP A 1 35  ? 12.546  0.159   -18.057 1.00 2.64  ? 35  ASP A OD2  5  
ATOM 9013  H H    . ASP A 1 35  ? 15.235  -0.778  -14.364 1.00 0.67  ? 35  ASP A H    5  
ATOM 9014  H HA   . ASP A 1 35  ? 14.954  1.805   -15.630 1.00 1.44  ? 35  ASP A HA   5  
ATOM 9015  H HB2  . ASP A 1 35  ? 15.538  -0.028  -17.053 1.00 1.74  ? 35  ASP A HB2  5  
ATOM 9016  H HB3  . ASP A 1 35  ? 14.147  -0.942  -16.495 1.00 1.48  ? 35  ASP A HB3  5  
ATOM 9017  N N    . LYS A 1 36  ? 12.297  0.092   -14.705 1.00 0.48  ? 36  LYS A N    5  
ATOM 9018  C CA   . LYS A 1 36  ? 10.891  0.205   -14.386 1.00 0.32  ? 36  LYS A CA   5  
ATOM 9019  C C    . LYS A 1 36  ? 10.726  0.910   -13.051 1.00 0.23  ? 36  LYS A C    5  
ATOM 9020  O O    . LYS A 1 36  ? 11.181  0.421   -12.029 1.00 0.39  ? 36  LYS A O    5  
ATOM 9021  C CB   . LYS A 1 36  ? 10.291  -1.191  -14.322 1.00 0.36  ? 36  LYS A CB   5  
ATOM 9022  C CG   . LYS A 1 36  ? 8.840   -1.286  -14.651 1.00 0.49  ? 36  LYS A CG   5  
ATOM 9023  C CD   . LYS A 1 36  ? 8.548   -2.706  -15.060 1.00 0.56  ? 36  LYS A CD   5  
ATOM 9024  C CE   . LYS A 1 36  ? 7.136   -3.141  -14.716 1.00 0.44  ? 36  LYS A CE   5  
ATOM 9025  N NZ   . LYS A 1 36  ? 6.792   -4.445  -15.347 1.00 1.20  ? 36  LYS A NZ   5  
ATOM 9026  H H    . LYS A 1 36  ? 12.722  -0.786  -14.644 1.00 0.50  ? 36  LYS A H    5  
ATOM 9027  H HA   . LYS A 1 36  ? 10.404  0.776   -15.162 1.00 0.44  ? 36  LYS A HA   5  
ATOM 9028  H HB2  . LYS A 1 36  ? 10.813  -1.836  -14.997 1.00 0.70  ? 36  LYS A HB2  5  
ATOM 9029  H HB3  . LYS A 1 36  ? 10.412  -1.566  -13.325 1.00 0.69  ? 36  LYS A HB3  5  
ATOM 9030  H HG2  . LYS A 1 36  ? 8.268   -1.033  -13.776 1.00 0.76  ? 36  LYS A HG2  5  
ATOM 9031  H HG3  . LYS A 1 36  ? 8.606   -0.619  -15.463 1.00 0.78  ? 36  LYS A HG3  5  
ATOM 9032  H HD2  . LYS A 1 36  ? 8.689   -2.796  -16.127 1.00 0.72  ? 36  LYS A HD2  5  
ATOM 9033  H HD3  . LYS A 1 36  ? 9.256   -3.341  -14.547 1.00 0.78  ? 36  LYS A HD3  5  
ATOM 9034  H HE2  . LYS A 1 36  ? 7.054   -3.235  -13.641 1.00 0.90  ? 36  LYS A HE2  5  
ATOM 9035  H HE3  . LYS A 1 36  ? 6.447   -2.390  -15.060 1.00 0.84  ? 36  LYS A HE3  5  
ATOM 9036  H HZ1  . LYS A 1 36  ? 6.678   -4.322  -16.374 1.00 1.69  ? 36  LYS A HZ1  5  
ATOM 9037  H HZ2  . LYS A 1 36  ? 5.906   -4.815  -14.955 1.00 1.81  ? 36  LYS A HZ2  5  
ATOM 9038  H HZ3  . LYS A 1 36  ? 7.550   -5.137  -15.180 1.00 1.72  ? 36  LYS A HZ3  5  
ATOM 9039  N N    . VAL A 1 37  ? 10.063  2.045   -13.082 1.00 0.23  ? 37  VAL A N    5  
ATOM 9040  C CA   . VAL A 1 37  ? 9.867   2.883   -11.904 1.00 0.23  ? 37  VAL A CA   5  
ATOM 9041  C C    . VAL A 1 37  ? 8.405   3.285   -11.807 1.00 0.26  ? 37  VAL A C    5  
ATOM 9042  O O    . VAL A 1 37  ? 7.798   3.691   -12.800 1.00 0.37  ? 37  VAL A O    5  
ATOM 9043  C CB   . VAL A 1 37  ? 10.740  4.166   -11.980 1.00 0.27  ? 37  VAL A CB   5  
ATOM 9044  C CG1  . VAL A 1 37  ? 10.184  5.274   -11.096 1.00 0.76  ? 37  VAL A CG1  5  
ATOM 9045  C CG2  . VAL A 1 37  ? 12.170  3.875   -11.582 1.00 0.83  ? 37  VAL A CG2  5  
ATOM 9046  H H    . VAL A 1 37  ? 9.683   2.336   -13.935 1.00 0.32  ? 37  VAL A H    5  
ATOM 9047  H HA   . VAL A 1 37  ? 10.150  2.311   -11.012 1.00 0.22  ? 37  VAL A HA   5  
ATOM 9048  H HB   . VAL A 1 37  ? 10.745  4.518   -13.001 1.00 0.72  ? 37  VAL A HB   5  
ATOM 9049  H HG11 . VAL A 1 37  ? 9.185   5.525   -11.419 1.00 1.48  ? 37  VAL A HG11 5  
ATOM 9050  H HG12 . VAL A 1 37  ? 10.816  6.146   -11.171 1.00 1.31  ? 37  VAL A HG12 5  
ATOM 9051  H HG13 . VAL A 1 37  ? 10.156  4.937   -10.072 1.00 1.29  ? 37  VAL A HG13 5  
ATOM 9052  H HG21 . VAL A 1 37  ? 12.251  3.898   -10.504 1.00 1.35  ? 37  VAL A HG21 5  
ATOM 9053  H HG22 . VAL A 1 37  ? 12.819  4.623   -12.011 1.00 1.53  ? 37  VAL A HG22 5  
ATOM 9054  H HG23 . VAL A 1 37  ? 12.454  2.900   -11.945 1.00 1.35  ? 37  VAL A HG23 5  
ATOM 9055  N N    . HIS A 1 38  ? 7.835   3.143   -10.626 1.00 0.22  ? 38  HIS A N    5  
ATOM 9056  C CA   . HIS A 1 38  ? 6.458   3.548   -10.397 1.00 0.25  ? 38  HIS A CA   5  
ATOM 9057  C C    . HIS A 1 38  ? 6.396   4.364   -9.119  1.00 0.24  ? 38  HIS A C    5  
ATOM 9058  O O    . HIS A 1 38  ? 6.780   3.878   -8.055  1.00 0.26  ? 38  HIS A O    5  
ATOM 9059  C CB   . HIS A 1 38  ? 5.533   2.329   -10.294 1.00 0.27  ? 38  HIS A CB   5  
ATOM 9060  C CG   . HIS A 1 38  ? 5.920   1.198   -11.201 1.00 0.28  ? 38  HIS A CG   5  
ATOM 9061  N ND1  . HIS A 1 38  ? 6.023   1.309   -12.567 1.00 0.30  ? 38  HIS A ND1  5  
ATOM 9062  C CD2  . HIS A 1 38  ? 6.285   -0.063  -10.911 1.00 0.30  ? 38  HIS A CD2  5  
ATOM 9063  C CE1  . HIS A 1 38  ? 6.443   0.160   -13.062 1.00 0.33  ? 38  HIS A CE1  5  
ATOM 9064  N NE2  . HIS A 1 38  ? 6.598   -0.693  -12.079 1.00 0.33  ? 38  HIS A NE2  5  
ATOM 9065  H H    . HIS A 1 38  ? 8.355   2.758   -9.883  1.00 0.22  ? 38  HIS A H    5  
ATOM 9066  H HA   . HIS A 1 38  ? 6.153   4.164   -11.226 1.00 0.27  ? 38  HIS A HA   5  
ATOM 9067  H HB2  . HIS A 1 38  ? 5.546   1.961   -9.277  1.00 0.28  ? 38  HIS A HB2  5  
ATOM 9068  H HB3  . HIS A 1 38  ? 4.527   2.629   -10.548 1.00 0.31  ? 38  HIS A HB3  5  
ATOM 9069  H HD1  . HIS A 1 38  ? 5.817   2.112   -13.099 1.00 0.32  ? 38  HIS A HD1  5  
ATOM 9070  H HD2  . HIS A 1 38  ? 6.371   -0.484  -9.937  1.00 0.32  ? 38  HIS A HD2  5  
ATOM 9071  H HE1  . HIS A 1 38  ? 6.698   -0.035  -14.084 1.00 0.36  ? 38  HIS A HE1  5  
ATOM 9072  H HE2  . HIS A 1 38  ? 6.596   -1.666  -12.195 1.00 0.38  ? 38  HIS A HE2  5  
ATOM 9073  N N    . THR A 1 39  ? 5.929   5.597   -9.220  1.00 0.23  ? 39  THR A N    5  
ATOM 9074  C CA   . THR A 1 39  ? 6.011   6.516   -8.101  1.00 0.22  ? 39  THR A CA   5  
ATOM 9075  C C    . THR A 1 39  ? 4.631   6.841   -7.518  1.00 0.23  ? 39  THR A C    5  
ATOM 9076  O O    . THR A 1 39  ? 3.755   7.378   -8.196  1.00 0.32  ? 39  THR A O    5  
ATOM 9077  C CB   . THR A 1 39  ? 6.731   7.808   -8.515  1.00 0.24  ? 39  THR A CB   5  
ATOM 9078  O OG1  . THR A 1 39  ? 7.770   7.498   -9.455  1.00 0.26  ? 39  THR A OG1  5  
ATOM 9079  C CG2  . THR A 1 39  ? 7.346   8.484   -7.304  1.00 0.24  ? 39  THR A CG2  5  
ATOM 9080  H H    . THR A 1 39  ? 5.512   5.893   -10.059 1.00 0.25  ? 39  THR A H    5  
ATOM 9081  H HA   . THR A 1 39  ? 6.602   6.039   -7.333  1.00 0.19  ? 39  THR A HA   5  
ATOM 9082  H HB   . THR A 1 39  ? 6.022   8.478   -8.970  1.00 0.28  ? 39  THR A HB   5  
ATOM 9083  H HG1  . THR A 1 39  ? 7.443   6.845   -10.086 1.00 0.86  ? 39  THR A HG1  5  
ATOM 9084  H HG21 . THR A 1 39  ? 6.582   8.652   -6.561  1.00 1.03  ? 39  THR A HG21 5  
ATOM 9085  H HG22 . THR A 1 39  ? 7.777   9.427   -7.599  1.00 1.00  ? 39  THR A HG22 5  
ATOM 9086  H HG23 . THR A 1 39  ? 8.117   7.846   -6.894  1.00 0.94  ? 39  THR A HG23 5  
ATOM 9087  N N    . VAL A 1 40  ? 4.473   6.501   -6.250  1.00 0.19  ? 40  VAL A N    5  
ATOM 9088  C CA   . VAL A 1 40  ? 3.232   6.673   -5.511  1.00 0.20  ? 40  VAL A CA   5  
ATOM 9089  C C    . VAL A 1 40  ? 3.350   7.832   -4.516  1.00 0.20  ? 40  VAL A C    5  
ATOM 9090  O O    . VAL A 1 40  ? 3.943   7.682   -3.455  1.00 0.20  ? 40  VAL A O    5  
ATOM 9091  C CB   . VAL A 1 40  ? 2.920   5.362   -4.738  1.00 0.21  ? 40  VAL A CB   5  
ATOM 9092  C CG1  . VAL A 1 40  ? 1.865   5.555   -3.664  1.00 0.23  ? 40  VAL A CG1  5  
ATOM 9093  C CG2  . VAL A 1 40  ? 2.488   4.260   -5.687  1.00 0.22  ? 40  VAL A CG2  5  
ATOM 9094  H H    . VAL A 1 40  ? 5.240   6.102   -5.779  1.00 0.22  ? 40  VAL A H    5  
ATOM 9095  H HA   . VAL A 1 40  ? 2.432   6.867   -6.208  1.00 0.22  ? 40  VAL A HA   5  
ATOM 9096  H HB   . VAL A 1 40  ? 3.829   5.040   -4.252  1.00 0.22  ? 40  VAL A HB   5  
ATOM 9097  H HG11 . VAL A 1 40  ? 2.154   6.365   -3.008  1.00 0.97  ? 40  VAL A HG11 5  
ATOM 9098  H HG12 . VAL A 1 40  ? 1.778   4.640   -3.090  1.00 1.06  ? 40  VAL A HG12 5  
ATOM 9099  H HG13 . VAL A 1 40  ? 0.918   5.784   -4.128  1.00 1.09  ? 40  VAL A HG13 5  
ATOM 9100  H HG21 . VAL A 1 40  ? 1.578   4.554   -6.189  1.00 1.04  ? 40  VAL A HG21 5  
ATOM 9101  H HG22 . VAL A 1 40  ? 2.313   3.353   -5.124  1.00 1.05  ? 40  VAL A HG22 5  
ATOM 9102  H HG23 . VAL A 1 40  ? 3.265   4.087   -6.418  1.00 1.01  ? 40  VAL A HG23 5  
ATOM 9103  N N    . VAL A 1 41  ? 2.786   8.985   -4.849  1.00 0.22  ? 41  VAL A N    5  
ATOM 9104  C CA   . VAL A 1 41  ? 2.769   10.103  -3.911  1.00 0.22  ? 41  VAL A CA   5  
ATOM 9105  C C    . VAL A 1 41  ? 1.785   9.803   -2.781  1.00 0.23  ? 41  VAL A C    5  
ATOM 9106  O O    . VAL A 1 41  ? 0.582   9.623   -3.003  1.00 0.26  ? 41  VAL A O    5  
ATOM 9107  C CB   . VAL A 1 41  ? 2.439   11.447  -4.609  1.00 0.26  ? 41  VAL A CB   5  
ATOM 9108  C CG1  . VAL A 1 41  ? 1.451   11.223  -5.731  1.00 0.63  ? 41  VAL A CG1  5  
ATOM 9109  C CG2  . VAL A 1 41  ? 1.908   12.483  -3.617  1.00 0.59  ? 41  VAL A CG2  5  
ATOM 9110  H H    . VAL A 1 41  ? 2.368   9.082   -5.728  1.00 0.25  ? 41  VAL A H    5  
ATOM 9111  H HA   . VAL A 1 41  ? 3.766   10.186  -3.487  1.00 0.21  ? 41  VAL A HA   5  
ATOM 9112  H HB   . VAL A 1 41  ? 3.350   11.832  -5.040  1.00 0.61  ? 41  VAL A HB   5  
ATOM 9113  H HG11 . VAL A 1 41  ? 1.165   12.172  -6.154  1.00 1.22  ? 41  VAL A HG11 5  
ATOM 9114  H HG12 . VAL A 1 41  ? 0.580   10.715  -5.348  1.00 1.30  ? 41  VAL A HG12 5  
ATOM 9115  H HG13 . VAL A 1 41  ? 1.922   10.616  -6.491  1.00 1.30  ? 41  VAL A HG13 5  
ATOM 9116  H HG21 . VAL A 1 41  ? 1.706   13.411  -4.133  1.00 1.25  ? 41  VAL A HG21 5  
ATOM 9117  H HG22 . VAL A 1 41  ? 2.642   12.656  -2.844  1.00 1.17  ? 41  VAL A HG22 5  
ATOM 9118  H HG23 . VAL A 1 41  ? 0.996   12.115  -3.170  1.00 1.18  ? 41  VAL A HG23 5  
ATOM 9119  N N    . LEU A 1 42  ? 2.326   9.750   -1.577  1.00 0.23  ? 42  LEU A N    5  
ATOM 9120  C CA   . LEU A 1 42  ? 1.621   9.256   -0.398  1.00 0.26  ? 42  LEU A CA   5  
ATOM 9121  C C    . LEU A 1 42  ? 0.424   10.120  -0.009  1.00 0.27  ? 42  LEU A C    5  
ATOM 9122  O O    . LEU A 1 42  ? -0.421  9.699   0.778   1.00 0.37  ? 42  LEU A O    5  
ATOM 9123  C CB   . LEU A 1 42  ? 2.619   9.164   0.756   1.00 0.32  ? 42  LEU A CB   5  
ATOM 9124  C CG   . LEU A 1 42  ? 3.635   8.036   0.622   1.00 0.43  ? 42  LEU A CG   5  
ATOM 9125  C CD1  . LEU A 1 42  ? 4.687   8.158   1.701   1.00 1.24  ? 42  LEU A CD1  5  
ATOM 9126  C CD2  . LEU A 1 42  ? 2.943   6.683   0.691   1.00 1.01  ? 42  LEU A CD2  5  
ATOM 9127  H H    . LEU A 1 42  ? 3.257   10.055  -1.468  1.00 0.25  ? 42  LEU A H    5  
ATOM 9128  H HA   . LEU A 1 42  ? 1.270   8.259   -0.627  1.00 0.31  ? 42  LEU A HA   5  
ATOM 9129  H HB2  . LEU A 1 42  ? 3.160   10.099  0.802   1.00 0.27  ? 42  LEU A HB2  5  
ATOM 9130  H HB3  . LEU A 1 42  ? 2.088   9.036   1.681   1.00 0.45  ? 42  LEU A HB3  5  
ATOM 9131  H HG   . LEU A 1 42  ? 4.128   8.114   -0.336  1.00 1.24  ? 42  LEU A HG   5  
ATOM 9132  H HD11 . LEU A 1 42  ? 4.221   8.055   2.669   1.00 1.86  ? 42  LEU A HD11 5  
ATOM 9133  H HD12 . LEU A 1 42  ? 5.151   9.129   1.627   1.00 1.80  ? 42  LEU A HD12 5  
ATOM 9134  H HD13 . LEU A 1 42  ? 5.431   7.388   1.570   1.00 1.75  ? 42  LEU A HD13 5  
ATOM 9135  H HD21 . LEU A 1 42  ? 2.435   6.587   1.639   1.00 1.58  ? 42  LEU A HD21 5  
ATOM 9136  H HD22 . LEU A 1 42  ? 3.676   5.898   0.592   1.00 1.41  ? 42  LEU A HD22 5  
ATOM 9137  H HD23 . LEU A 1 42  ? 2.224   6.608   -0.111  1.00 1.79  ? 42  LEU A HD23 5  
ATOM 9138  N N    . SER A 1 43  ? 0.350   11.316  -0.568  1.00 0.23  ? 43  SER A N    5  
ATOM 9139  C CA   . SER A 1 43  ? -0.776  12.213  -0.318  1.00 0.28  ? 43  SER A CA   5  
ATOM 9140  C C    . SER A 1 43  ? -2.072  11.638  -0.894  1.00 0.28  ? 43  SER A C    5  
ATOM 9141  O O    . SER A 1 43  ? -3.168  11.966  -0.438  1.00 0.34  ? 43  SER A O    5  
ATOM 9142  C CB   . SER A 1 43  ? -0.501  13.588  -0.930  1.00 0.35  ? 43  SER A CB   5  
ATOM 9143  O OG   . SER A 1 43  ? -1.503  14.526  -0.585  1.00 1.08  ? 43  SER A OG   5  
ATOM 9144  H H    . SER A 1 43  ? 1.075   11.608  -1.157  1.00 0.22  ? 43  SER A H    5  
ATOM 9145  H HA   . SER A 1 43  ? -0.885  12.319  0.751   1.00 0.32  ? 43  SER A HA   5  
ATOM 9146  H HB2  . SER A 1 43  ? 0.449   13.953  -0.573  1.00 0.86  ? 43  SER A HB2  5  
ATOM 9147  H HB3  . SER A 1 43  ? -0.466  13.498  -2.007  1.00 1.04  ? 43  SER A HB3  5  
ATOM 9148  H HG   . SER A 1 43  ? -1.349  14.841  0.317   1.00 1.37  ? 43  SER A HG   5  
ATOM 9149  N N    . THR A 1 44  ? -1.946  10.761  -1.884  1.00 0.26  ? 44  THR A N    5  
ATOM 9150  C CA   . THR A 1 44  ? -3.116  10.201  -2.543  1.00 0.28  ? 44  THR A CA   5  
ATOM 9151  C C    . THR A 1 44  ? -3.511  8.890   -1.879  1.00 0.26  ? 44  THR A C    5  
ATOM 9152  O O    . THR A 1 44  ? -4.517  8.271   -2.224  1.00 0.29  ? 44  THR A O    5  
ATOM 9153  C CB   . THR A 1 44  ? -2.862  9.978   -4.049  1.00 0.32  ? 44  THR A CB   5  
ATOM 9154  O OG1  . THR A 1 44  ? -1.799  9.032   -4.254  1.00 0.30  ? 44  THR A OG1  5  
ATOM 9155  C CG2  . THR A 1 44  ? -2.503  11.292  -4.725  1.00 0.36  ? 44  THR A CG2  5  
ATOM 9156  H H    . THR A 1 44  ? -1.048  10.472  -2.162  1.00 0.26  ? 44  THR A H    5  
ATOM 9157  H HA   . THR A 1 44  ? -3.930  10.904  -2.434  1.00 0.31  ? 44  THR A HA   5  
ATOM 9158  H HB   . THR A 1 44  ? -3.766  9.596   -4.499  1.00 0.36  ? 44  THR A HB   5  
ATOM 9159  H HG1  . THR A 1 44  ? -1.006  9.326   -3.788  1.00 0.26  ? 44  THR A HG1  5  
ATOM 9160  H HG21 . THR A 1 44  ? -3.314  11.994  -4.601  1.00 1.04  ? 44  THR A HG21 5  
ATOM 9161  H HG22 . THR A 1 44  ? -2.334  11.120  -5.778  1.00 1.05  ? 44  THR A HG22 5  
ATOM 9162  H HG23 . THR A 1 44  ? -1.607  11.693  -4.278  1.00 1.04  ? 44  THR A HG23 5  
ATOM 9163  N N    . ILE A 1 45  ? -2.703  8.488   -0.914  1.00 0.24  ? 45  ILE A N    5  
ATOM 9164  C CA   . ILE A 1 45  ? -2.916  7.268   -0.176  1.00 0.22  ? 45  ILE A CA   5  
ATOM 9165  C C    . ILE A 1 45  ? -3.680  7.558   1.110   1.00 0.25  ? 45  ILE A C    5  
ATOM 9166  O O    . ILE A 1 45  ? -3.402  8.537   1.798   1.00 0.36  ? 45  ILE A O    5  
ATOM 9167  C CB   . ILE A 1 45  ? -1.553  6.648   0.166   1.00 0.25  ? 45  ILE A CB   5  
ATOM 9168  C CG1  . ILE A 1 45  ? -0.710  6.530   -1.105  1.00 0.25  ? 45  ILE A CG1  5  
ATOM 9169  C CG2  . ILE A 1 45  ? -1.724  5.293   0.820   1.00 0.28  ? 45  ILE A CG2  5  
ATOM 9170  C CD1  . ILE A 1 45  ? -1.223  5.490   -2.083  1.00 0.27  ? 45  ILE A CD1  5  
ATOM 9171  H H    . ILE A 1 45  ? -1.919  9.031   -0.691  1.00 0.26  ? 45  ILE A H    5  
ATOM 9172  H HA   . ILE A 1 45  ? -3.475  6.578   -0.793  1.00 0.22  ? 45  ILE A HA   5  
ATOM 9173  H HB   . ILE A 1 45  ? -1.050  7.297   0.871   1.00 0.29  ? 45  ILE A HB   5  
ATOM 9174  H HG12 . ILE A 1 45  ? -0.709  7.484   -1.612  1.00 0.23  ? 45  ILE A HG12 5  
ATOM 9175  H HG13 . ILE A 1 45  ? 0.299   6.275   -0.838  1.00 0.27  ? 45  ILE A HG13 5  
ATOM 9176  H HG21 . ILE A 1 45  ? -2.247  4.632   0.145   1.00 1.01  ? 45  ILE A HG21 5  
ATOM 9177  H HG22 . ILE A 1 45  ? -2.293  5.403   1.730   1.00 1.07  ? 45  ILE A HG22 5  
ATOM 9178  H HG23 . ILE A 1 45  ? -0.753  4.879   1.048   1.00 1.04  ? 45  ILE A HG23 5  
ATOM 9179  H HD11 . ILE A 1 45  ? -1.295  4.534   -1.586  1.00 1.05  ? 45  ILE A HD11 5  
ATOM 9180  H HD12 . ILE A 1 45  ? -0.539  5.409   -2.916  1.00 1.05  ? 45  ILE A HD12 5  
ATOM 9181  H HD13 . ILE A 1 45  ? -2.198  5.783   -2.444  1.00 1.01  ? 45  ILE A HD13 5  
ATOM 9182  N N    . ASP A 1 46  ? -4.651  6.718   1.420   1.00 0.22  ? 46  ASP A N    5  
ATOM 9183  C CA   . ASP A 1 46  ? -5.405  6.844   2.654   1.00 0.27  ? 46  ASP A CA   5  
ATOM 9184  C C    . ASP A 1 46  ? -4.768  5.991   3.740   1.00 0.30  ? 46  ASP A C    5  
ATOM 9185  O O    . ASP A 1 46  ? -4.483  6.477   4.833   1.00 0.38  ? 46  ASP A O    5  
ATOM 9186  C CB   . ASP A 1 46  ? -6.862  6.421   2.468   1.00 0.33  ? 46  ASP A CB   5  
ATOM 9187  C CG   . ASP A 1 46  ? -7.655  6.546   3.758   1.00 0.48  ? 46  ASP A CG   5  
ATOM 9188  O OD1  . ASP A 1 46  ? -7.866  7.687   4.225   1.00 0.70  ? 46  ASP A OD1  5  
ATOM 9189  O OD2  . ASP A 1 46  ? -8.063  5.506   4.317   1.00 0.55  ? 46  ASP A OD2  5  
ATOM 9190  H H    . ASP A 1 46  ? -4.858  5.975   0.806   1.00 0.21  ? 46  ASP A H    5  
ATOM 9191  H HA   . ASP A 1 46  ? -5.376  7.878   2.955   1.00 0.31  ? 46  ASP A HA   5  
ATOM 9192  H HB2  . ASP A 1 46  ? -7.321  7.047   1.720   1.00 0.36  ? 46  ASP A HB2  5  
ATOM 9193  H HB3  . ASP A 1 46  ? -6.895  5.392   2.144   1.00 0.33  ? 46  ASP A HB3  5  
ATOM 9194  N N    . LYS A 1 47  ? -4.508  4.731   3.416   1.00 0.28  ? 47  LYS A N    5  
ATOM 9195  C CA   . LYS A 1 47  ? -3.972  3.792   4.385   1.00 0.36  ? 47  LYS A CA   5  
ATOM 9196  C C    . LYS A 1 47  ? -2.828  2.999   3.783   1.00 0.31  ? 47  LYS A C    5  
ATOM 9197  O O    . LYS A 1 47  ? -2.596  3.025   2.580   1.00 0.26  ? 47  LYS A O    5  
ATOM 9198  C CB   . LYS A 1 47  ? -5.069  2.818   4.833   1.00 0.42  ? 47  LYS A CB   5  
ATOM 9199  C CG   . LYS A 1 47  ? -4.715  1.980   6.046   1.00 0.74  ? 47  LYS A CG   5  
ATOM 9200  C CD   . LYS A 1 47  ? -4.675  2.828   7.292   1.00 0.79  ? 47  LYS A CD   5  
ATOM 9201  C CE   . LYS A 1 47  ? -4.183  2.047   8.497   1.00 1.12  ? 47  LYS A CE   5  
ATOM 9202  N NZ   . LYS A 1 47  ? -4.246  2.855   9.742   1.00 1.56  ? 47  LYS A NZ   5  
ATOM 9203  H H    . LYS A 1 47  ? -4.680  4.420   2.497   1.00 0.25  ? 47  LYS A H    5  
ATOM 9204  H HA   . LYS A 1 47  ? -3.616  4.344   5.241   1.00 0.44  ? 47  LYS A HA   5  
ATOM 9205  H HB2  . LYS A 1 47  ? -5.942  3.375   5.068   1.00 0.63  ? 47  LYS A HB2  5  
ATOM 9206  H HB3  . LYS A 1 47  ? -5.295  2.153   4.021   1.00 0.50  ? 47  LYS A HB3  5  
ATOM 9207  H HG2  . LYS A 1 47  ? -5.456  1.218   6.172   1.00 1.36  ? 47  LYS A HG2  5  
ATOM 9208  H HG3  . LYS A 1 47  ? -3.746  1.526   5.894   1.00 1.37  ? 47  LYS A HG3  5  
ATOM 9209  H HD2  . LYS A 1 47  ? -4.025  3.655   7.117   1.00 1.37  ? 47  LYS A HD2  5  
ATOM 9210  H HD3  . LYS A 1 47  ? -5.660  3.192   7.490   1.00 1.28  ? 47  LYS A HD3  5  
ATOM 9211  H HE2  . LYS A 1 47  ? -4.797  1.168   8.617   1.00 1.79  ? 47  LYS A HE2  5  
ATOM 9212  H HE3  . LYS A 1 47  ? -3.162  1.749   8.322   1.00 1.63  ? 47  LYS A HE3  5  
ATOM 9213  H HZ1  . LYS A 1 47  ? -5.236  3.006   10.022  1.00 1.86  ? 47  LYS A HZ1  5  
ATOM 9214  H HZ2  . LYS A 1 47  ? -3.801  3.783   9.592   1.00 2.16  ? 47  LYS A HZ2  5  
ATOM 9215  H HZ3  . LYS A 1 47  ? -3.746  2.367   10.513  1.00 1.99  ? 47  LYS A HZ3  5  
ATOM 9216  N N    . LEU A 1 48  ? -2.114  2.308   4.632   1.00 0.39  ? 48  LEU A N    5  
ATOM 9217  C CA   . LEU A 1 48  ? -1.183  1.290   4.200   1.00 0.36  ? 48  LEU A CA   5  
ATOM 9218  C C    . LEU A 1 48  ? -1.220  0.154   5.197   1.00 0.40  ? 48  LEU A C    5  
ATOM 9219  O O    . LEU A 1 48  ? -1.535  0.353   6.374   1.00 0.50  ? 48  LEU A O    5  
ATOM 9220  C CB   . LEU A 1 48  ? 0.241   1.831   3.978   1.00 0.60  ? 48  LEU A CB   5  
ATOM 9221  C CG   . LEU A 1 48  ? 1.109   2.125   5.198   1.00 0.64  ? 48  LEU A CG   5  
ATOM 9222  C CD1  . LEU A 1 48  ? 0.322   2.829   6.277   1.00 1.37  ? 48  LEU A CD1  5  
ATOM 9223  C CD2  . LEU A 1 48  ? 1.789   0.877   5.732   1.00 1.12  ? 48  LEU A CD2  5  
ATOM 9224  H H    . LEU A 1 48  ? -2.229  2.475   5.586   1.00 0.51  ? 48  LEU A H    5  
ATOM 9225  H HA   . LEU A 1 48  ? -1.551  0.917   3.261   1.00 0.27  ? 48  LEU A HA   5  
ATOM 9226  H HB2  . LEU A 1 48  ? 0.772   1.121   3.363   1.00 1.30  ? 48  LEU A HB2  5  
ATOM 9227  H HB3  . LEU A 1 48  ? 0.148   2.744   3.421   1.00 1.37  ? 48  LEU A HB3  5  
ATOM 9228  H HG   . LEU A 1 48  ? 1.883   2.789   4.882   1.00 1.45  ? 48  LEU A HG   5  
ATOM 9229  H HD11 . LEU A 1 48  ? 0.126   3.846   5.975   1.00 1.81  ? 48  LEU A HD11 5  
ATOM 9230  H HD12 . LEU A 1 48  ? 0.887   2.821   7.197   1.00 1.98  ? 48  LEU A HD12 5  
ATOM 9231  H HD13 . LEU A 1 48  ? -0.618  2.309   6.418   1.00 1.91  ? 48  LEU A HD13 5  
ATOM 9232  H HD21 . LEU A 1 48  ? 2.393   0.437   4.950   1.00 1.75  ? 48  LEU A HD21 5  
ATOM 9233  H HD22 . LEU A 1 48  ? 1.039   0.171   6.052   1.00 1.68  ? 48  LEU A HD22 5  
ATOM 9234  H HD23 . LEU A 1 48  ? 2.421   1.147   6.573   1.00 1.48  ? 48  LEU A HD23 5  
ATOM 9235  N N    . GLN A 1 49  ? -0.909  -1.025  4.726   1.00 0.39  ? 49  GLN A N    5  
ATOM 9236  C CA   . GLN A 1 49  ? -1.096  -2.241  5.516   1.00 0.45  ? 49  GLN A CA   5  
ATOM 9237  C C    . GLN A 1 49  ? -0.161  -3.325  5.037   1.00 0.33  ? 49  GLN A C    5  
ATOM 9238  O O    . GLN A 1 49  ? 0.165   -3.390  3.863   1.00 0.35  ? 49  GLN A O    5  
ATOM 9239  C CB   . GLN A 1 49  ? -2.543  -2.759  5.443   1.00 0.55  ? 49  GLN A CB   5  
ATOM 9240  C CG   . GLN A 1 49  ? -3.584  -1.790  5.984   1.00 0.79  ? 49  GLN A CG   5  
ATOM 9241  C CD   . GLN A 1 49  ? -4.904  -2.455  6.320   1.00 1.36  ? 49  GLN A CD   5  
ATOM 9242  O OE1  . GLN A 1 49  ? -4.945  -3.614  6.728   1.00 2.28  ? 49  GLN A OE1  5  
ATOM 9243  N NE2  . GLN A 1 49  ? -5.996  -1.729  6.141   1.00 1.62  ? 49  GLN A NE2  5  
ATOM 9244  H H    . GLN A 1 49  ? -0.480  -1.074  3.842   1.00 0.39  ? 49  GLN A H    5  
ATOM 9245  H HA   . GLN A 1 49  ? -0.858  -2.007  6.542   1.00 0.56  ? 49  GLN A HA   5  
ATOM 9246  H HB2  . GLN A 1 49  ? -2.783  -2.969  4.411   1.00 0.50  ? 49  GLN A HB2  5  
ATOM 9247  H HB3  . GLN A 1 49  ? -2.611  -3.673  6.005   1.00 0.72  ? 49  GLN A HB3  5  
ATOM 9248  H HG2  . GLN A 1 49  ? -3.196  -1.326  6.879   1.00 1.39  ? 49  GLN A HG2  5  
ATOM 9249  H HG3  . GLN A 1 49  ? -3.761  -1.035  5.241   1.00 1.03  ? 49  GLN A HG3  5  
ATOM 9250  H HE21 . GLN A 1 49  ? -5.897  -0.813  5.807   1.00 1.74  ? 49  GLN A HE21 5  
ATOM 9251  H HE22 . GLN A 1 49  ? -6.862  -2.139  6.346   1.00 2.18  ? 49  GLN A HE22 5  
ATOM 9252  N N    . ALA A 1 50  ? 0.257   -4.178  5.941   1.00 0.34  ? 50  ALA A N    5  
ATOM 9253  C CA   . ALA A 1 50  ? 1.141   -5.268  5.593   1.00 0.28  ? 50  ALA A CA   5  
ATOM 9254  C C    . ALA A 1 50  ? 0.418   -6.598  5.729   1.00 0.32  ? 50  ALA A C    5  
ATOM 9255  O O    . ALA A 1 50  ? -0.685  -6.647  6.280   1.00 0.43  ? 50  ALA A O    5  
ATOM 9256  C CB   . ALA A 1 50  ? 2.380   -5.223  6.457   1.00 0.38  ? 50  ALA A CB   5  
ATOM 9257  H H    . ALA A 1 50  ? -0.046  -4.082  6.870   1.00 0.46  ? 50  ALA A H    5  
ATOM 9258  H HA   . ALA A 1 50  ? 1.447   -5.133  4.566   1.00 0.27  ? 50  ALA A HA   5  
ATOM 9259  H HB1  . ALA A 1 50  ? 2.109   -5.375  7.489   1.00 1.06  ? 50  ALA A HB1  5  
ATOM 9260  H HB2  . ALA A 1 50  ? 2.854   -4.258  6.344   1.00 1.01  ? 50  ALA A HB2  5  
ATOM 9261  H HB3  . ALA A 1 50  ? 3.063   -5.995  6.144   1.00 1.17  ? 50  ALA A HB3  5  
ATOM 9262  N N    . THR A 1 51  ? 1.010   -7.663  5.207   1.00 0.32  ? 51  THR A N    5  
ATOM 9263  C CA   . THR A 1 51  ? 0.410   -8.987  5.299   1.00 0.40  ? 51  THR A CA   5  
ATOM 9264  C C    . THR A 1 51  ? 0.205   -9.410  6.753   1.00 0.53  ? 51  THR A C    5  
ATOM 9265  O O    . THR A 1 51  ? 0.922   -8.961  7.652   1.00 0.55  ? 51  THR A O    5  
ATOM 9266  C CB   . THR A 1 51  ? 1.262   -10.050 4.572   1.00 0.41  ? 51  THR A CB   5  
ATOM 9267  O OG1  . THR A 1 51  ? 2.660   -9.769  4.727   1.00 0.43  ? 51  THR A OG1  5  
ATOM 9268  C CG2  . THR A 1 51  ? 0.904   -10.117 3.097   1.00 0.46  ? 51  THR A CG2  5  
ATOM 9269  H H    . THR A 1 51  ? 1.873   -7.561  4.753   1.00 0.32  ? 51  THR A H    5  
ATOM 9270  H HA   . THR A 1 51  ? -0.555  -8.942  4.814   1.00 0.48  ? 51  THR A HA   5  
ATOM 9271  H HB   . THR A 1 51  ? 1.051   -11.013 5.016   1.00 0.48  ? 51  THR A HB   5  
ATOM 9272  H HG1  . THR A 1 51  ? 3.173   -10.522 4.394   1.00 0.54  ? 51  THR A HG1  5  
ATOM 9273  H HG21 . THR A 1 51  ? -0.100  -10.500 2.986   1.00 1.07  ? 51  THR A HG21 5  
ATOM 9274  H HG22 . THR A 1 51  ? 1.597   -10.769 2.585   1.00 1.05  ? 51  THR A HG22 5  
ATOM 9275  H HG23 . THR A 1 51  ? 0.958   -9.129  2.671   1.00 1.15  ? 51  THR A HG23 5  
ATOM 9276  N N    . PRO A 1 52  ? -0.812  -10.249 6.999   1.00 0.71  ? 52  PRO A N    5  
ATOM 9277  C CA   . PRO A 1 52  ? -1.066  -10.834 8.316   1.00 0.91  ? 52  PRO A CA   5  
ATOM 9278  C C    . PRO A 1 52  ? 0.166   -11.544 8.871   1.00 0.96  ? 52  PRO A C    5  
ATOM 9279  O O    . PRO A 1 52  ? 0.973   -12.098 8.119   1.00 0.88  ? 52  PRO A O    5  
ATOM 9280  C CB   . PRO A 1 52  ? -2.192  -11.846 8.063   1.00 1.10  ? 52  PRO A CB   5  
ATOM 9281  C CG   . PRO A 1 52  ? -2.334  -11.950 6.583   1.00 1.03  ? 52  PRO A CG   5  
ATOM 9282  C CD   . PRO A 1 52  ? -1.816  -10.667 6.014   1.00 0.80  ? 52  PRO A CD   5  
ATOM 9283  H HA   . PRO A 1 52  ? -1.399  -10.089 9.020   1.00 0.95  ? 52  PRO A HA   5  
ATOM 9284  H HB2  . PRO A 1 52  ? -1.923  -12.798 8.499   1.00 1.22  ? 52  PRO A HB2  5  
ATOM 9285  H HB3  . PRO A 1 52  ? -3.102  -11.486 8.518   1.00 1.17  ? 52  PRO A HB3  5  
ATOM 9286  H HG2  . PRO A 1 52  ? -1.754  -12.784 6.216   1.00 1.06  ? 52  PRO A HG2  5  
ATOM 9287  H HG3  . PRO A 1 52  ? -3.374  -12.076 6.327   1.00 1.16  ? 52  PRO A HG3  5  
ATOM 9288  H HD2  . PRO A 1 52  ? -1.364  -10.838 5.048   1.00 0.73  ? 52  PRO A HD2  5  
ATOM 9289  H HD3  . PRO A 1 52  ? -2.609  -9.939  5.938   1.00 0.85  ? 52  PRO A HD3  5  
ATOM 9290  N N    . ALA A 1 53  ? 0.298   -11.526 10.193  1.00 1.16  ? 53  ALA A N    5  
ATOM 9291  C CA   . ALA A 1 53  ? 1.464   -12.084 10.870  1.00 1.29  ? 53  ALA A CA   5  
ATOM 9292  C C    . ALA A 1 53  ? 1.516   -13.600 10.743  1.00 1.31  ? 53  ALA A C    5  
ATOM 9293  O O    . ALA A 1 53  ? 2.569   -14.213 10.931  1.00 1.36  ? 53  ALA A O    5  
ATOM 9294  C CB   . ALA A 1 53  ? 1.460   -11.688 12.337  1.00 1.58  ? 53  ALA A CB   5  
ATOM 9295  H H    . ALA A 1 53  ? -0.418  -11.122 10.735  1.00 1.25  ? 53  ALA A H    5  
ATOM 9296  H HA   . ALA A 1 53  ? 2.348   -11.664 10.414  1.00 1.21  ? 53  ALA A HA   5  
ATOM 9297  H HB1  . ALA A 1 53  ? 0.605   -12.132 12.826  1.00 1.87  ? 53  ALA A HB1  5  
ATOM 9298  H HB2  . ALA A 1 53  ? 1.407   -10.614 12.420  1.00 1.82  ? 53  ALA A HB2  5  
ATOM 9299  H HB3  . ALA A 1 53  ? 2.366   -12.043 12.807  1.00 1.98  ? 53  ALA A HB3  5  
ATOM 9300  N N    . SER A 1 54  ? 0.380   -14.200 10.429  1.00 1.32  ? 54  SER A N    5  
ATOM 9301  C CA   . SER A 1 54  ? 0.300   -15.641 10.271  1.00 1.41  ? 54  SER A CA   5  
ATOM 9302  C C    . SER A 1 54  ? 0.860   -16.076 8.920   1.00 1.26  ? 54  SER A C    5  
ATOM 9303  O O    . SER A 1 54  ? 1.246   -17.231 8.738   1.00 1.35  ? 54  SER A O    5  
ATOM 9304  C CB   . SER A 1 54  ? -1.152  -16.102 10.423  1.00 1.55  ? 54  SER A CB   5  
ATOM 9305  O OG   . SER A 1 54  ? -2.033  -15.277 9.675   1.00 1.49  ? 54  SER A OG   5  
ATOM 9306  H H    . SER A 1 54  ? -0.430  -13.660 10.306  1.00 1.32  ? 54  SER A H    5  
ATOM 9307  H HA   . SER A 1 54  ? 0.893   -16.087 11.055  1.00 1.52  ? 54  SER A HA   5  
ATOM 9308  H HB2  . SER A 1 54  ? -1.243  -17.118 10.069  1.00 1.60  ? 54  SER A HB2  5  
ATOM 9309  H HB3  . SER A 1 54  ? -1.434  -16.058 11.464  1.00 1.70  ? 54  SER A HB3  5  
ATOM 9310  H HG   . SER A 1 54  ? -2.256  -15.720 8.844   1.00 1.65  ? 54  SER A HG   5  
ATOM 9311  N N    . SER A 1 55  ? 0.909   -15.140 7.983   1.00 1.09  ? 55  SER A N    5  
ATOM 9312  C CA   . SER A 1 55  ? 1.378   -15.405 6.646   1.00 1.02  ? 55  SER A CA   5  
ATOM 9313  C C    . SER A 1 55  ? 2.896   -15.337 6.565   1.00 0.94  ? 55  SER A C    5  
ATOM 9314  O O    . SER A 1 55  ? 3.544   -14.612 7.324   1.00 0.99  ? 55  SER A O    5  
ATOM 9315  C CB   . SER A 1 55  ? 0.769   -14.367 5.722   1.00 0.96  ? 55  SER A CB   5  
ATOM 9316  O OG   . SER A 1 55  ? -0.648  -14.432 5.756   1.00 1.32  ? 55  SER A OG   5  
ATOM 9317  H H    . SER A 1 55  ? 0.616   -14.234 8.191   1.00 1.06  ? 55  SER A H    5  
ATOM 9318  H HA   . SER A 1 55  ? 1.042   -16.386 6.352   1.00 1.13  ? 55  SER A HA   5  
ATOM 9319  H HB2  . SER A 1 55  ? 1.086   -13.383 6.038   1.00 1.12  ? 55  SER A HB2  5  
ATOM 9320  H HB3  . SER A 1 55  ? 1.106   -14.545 4.728   1.00 1.06  ? 55  SER A HB3  5  
ATOM 9321  H HG   . SER A 1 55  ? -0.976  -14.831 4.932   1.00 1.49  ? 55  SER A HG   5  
ATOM 9322  N N    . GLU A 1 56  ? 3.453   -16.110 5.645   1.00 0.88  ? 56  GLU A N    5  
ATOM 9323  C CA   . GLU A 1 56  ? 4.880   -16.091 5.389   1.00 0.85  ? 56  GLU A CA   5  
ATOM 9324  C C    . GLU A 1 56  ? 5.230   -15.046 4.340   1.00 0.70  ? 56  GLU A C    5  
ATOM 9325  O O    . GLU A 1 56  ? 6.261   -14.380 4.440   1.00 0.74  ? 56  GLU A O    5  
ATOM 9326  C CB   . GLU A 1 56  ? 5.359   -17.459 4.926   1.00 0.93  ? 56  GLU A CB   5  
ATOM 9327  C CG   . GLU A 1 56  ? 6.803   -17.460 4.481   1.00 1.08  ? 56  GLU A CG   5  
ATOM 9328  C CD   . GLU A 1 56  ? 7.305   -18.833 4.099   1.00 1.75  ? 56  GLU A CD   5  
ATOM 9329  O OE1  . GLU A 1 56  ? 7.055   -19.271 2.958   1.00 2.37  ? 56  GLU A OE1  5  
ATOM 9330  O OE2  . GLU A 1 56  ? 7.971   -19.474 4.937   1.00 2.08  ? 56  GLU A OE2  5  
ATOM 9331  H H    . GLU A 1 56  ? 2.883   -16.721 5.128   1.00 0.92  ? 56  GLU A H    5  
ATOM 9332  H HA   . GLU A 1 56  ? 5.379   -15.846 6.304   1.00 0.96  ? 56  GLU A HA   5  
ATOM 9333  H HB2  . GLU A 1 56  ? 5.248   -18.168 5.734   1.00 1.09  ? 56  GLU A HB2  5  
ATOM 9334  H HB3  . GLU A 1 56  ? 4.755   -17.769 4.100   1.00 0.96  ? 56  GLU A HB3  5  
ATOM 9335  H HG2  . GLU A 1 56  ? 6.893   -16.806 3.627   1.00 1.32  ? 56  GLU A HG2  5  
ATOM 9336  H HG3  . GLU A 1 56  ? 7.409   -17.080 5.285   1.00 1.15  ? 56  GLU A HG3  5  
ATOM 9337  N N    . LYS A 1 57  ? 4.366   -14.901 3.344   1.00 0.62  ? 57  LYS A N    5  
ATOM 9338  C CA   . LYS A 1 57  ? 4.643   -14.017 2.222   1.00 0.54  ? 57  LYS A CA   5  
ATOM 9339  C C    . LYS A 1 57  ? 4.659   -12.560 2.665   1.00 0.48  ? 57  LYS A C    5  
ATOM 9340  O O    . LYS A 1 57  ? 3.825   -12.123 3.464   1.00 0.68  ? 57  LYS A O    5  
ATOM 9341  C CB   . LYS A 1 57  ? 3.613   -14.223 1.107   1.00 0.63  ? 57  LYS A CB   5  
ATOM 9342  C CG   . LYS A 1 57  ? 3.551   -15.650 0.600   1.00 1.10  ? 57  LYS A CG   5  
ATOM 9343  C CD   . LYS A 1 57  ? 2.501   -15.817 -0.474  1.00 1.47  ? 57  LYS A CD   5  
ATOM 9344  C CE   . LYS A 1 57  ? 2.743   -14.876 -1.637  1.00 1.47  ? 57  LYS A CE   5  
ATOM 9345  N NZ   . LYS A 1 57  ? 1.999   -15.292 -2.854  1.00 2.29  ? 57  LYS A NZ   5  
ATOM 9346  H H    . LYS A 1 57  ? 3.518   -15.392 3.368   1.00 0.68  ? 57  LYS A H    5  
ATOM 9347  H HA   . LYS A 1 57  ? 5.628   -14.273 1.849   1.00 0.55  ? 57  LYS A HA   5  
ATOM 9348  H HB2  . LYS A 1 57  ? 2.637   -13.950 1.474   1.00 1.00  ? 57  LYS A HB2  5  
ATOM 9349  H HB3  . LYS A 1 57  ? 3.867   -13.584 0.271   1.00 1.00  ? 57  LYS A HB3  5  
ATOM 9350  H HG2  . LYS A 1 57  ? 4.509   -15.917 0.190   1.00 1.61  ? 57  LYS A HG2  5  
ATOM 9351  H HG3  . LYS A 1 57  ? 3.314   -16.310 1.417   1.00 1.61  ? 57  LYS A HG3  5  
ATOM 9352  H HD2  . LYS A 1 57  ? 2.538   -16.831 -0.824  1.00 2.16  ? 57  LYS A HD2  5  
ATOM 9353  H HD3  . LYS A 1 57  ? 1.528   -15.614 -0.050  1.00 1.97  ? 57  LYS A HD3  5  
ATOM 9354  H HE2  . LYS A 1 57  ? 2.422   -13.885 -1.352  1.00 1.55  ? 57  LYS A HE2  5  
ATOM 9355  H HE3  . LYS A 1 57  ? 3.798   -14.862 -1.850  1.00 1.84  ? 57  LYS A HE3  5  
ATOM 9356  H HZ1  . LYS A 1 57  ? 2.326   -16.224 -3.175  1.00 2.69  ? 57  LYS A HZ1  5  
ATOM 9357  H HZ2  . LYS A 1 57  ? 2.147   -14.603 -3.618  1.00 2.69  ? 57  LYS A HZ2  5  
ATOM 9358  H HZ3  . LYS A 1 57  ? 0.981   -15.346 -2.648  1.00 2.71  ? 57  LYS A HZ3  5  
ATOM 9359  N N    . MET A 1 58  ? 5.610   -11.813 2.136   1.00 0.38  ? 58  MET A N    5  
ATOM 9360  C CA   . MET A 1 58  ? 5.835   -10.447 2.568   1.00 0.39  ? 58  MET A CA   5  
ATOM 9361  C C    . MET A 1 58  ? 5.273   -9.468  1.561   1.00 0.33  ? 58  MET A C    5  
ATOM 9362  O O    . MET A 1 58  ? 5.618   -9.505  0.380   1.00 0.40  ? 58  MET A O    5  
ATOM 9363  C CB   . MET A 1 58  ? 7.324   -10.190 2.756   1.00 0.53  ? 58  MET A CB   5  
ATOM 9364  C CG   . MET A 1 58  ? 8.058   -11.351 3.375   1.00 0.81  ? 58  MET A CG   5  
ATOM 9365  S SD   . MET A 1 58  ? 8.558   -12.559 2.135   1.00 1.13  ? 58  MET A SD   5  
ATOM 9366  C CE   . MET A 1 58  ? 9.340   -13.775 3.168   1.00 0.71  ? 58  MET A CE   5  
ATOM 9367  H H    . MET A 1 58  ? 6.180   -12.191 1.432   1.00 0.49  ? 58  MET A H    5  
ATOM 9368  H HA   . MET A 1 58  ? 5.331   -10.309 3.513   1.00 0.43  ? 58  MET A HA   5  
ATOM 9369  H HB2  . MET A 1 58  ? 7.769   -9.993  1.794   1.00 1.04  ? 58  MET A HB2  5  
ATOM 9370  H HB3  . MET A 1 58  ? 7.454   -9.326  3.392   1.00 1.02  ? 58  MET A HB3  5  
ATOM 9371  H HG2  . MET A 1 58  ? 8.931   -10.977 3.878   1.00 1.60  ? 58  MET A HG2  5  
ATOM 9372  H HG3  . MET A 1 58  ? 7.410   -11.835 4.089   1.00 1.52  ? 58  MET A HG3  5  
ATOM 9373  H HE1  . MET A 1 58  ? 9.941   -14.430 2.557   1.00 1.18  ? 58  MET A HE1  5  
ATOM 9374  H HE2  . MET A 1 58  ? 8.578   -14.349 3.675   1.00 1.35  ? 58  MET A HE2  5  
ATOM 9375  H HE3  . MET A 1 58  ? 9.966   -13.272 3.893   1.00 1.18  ? 58  MET A HE3  5  
ATOM 9376  N N    . MET A 1 59  ? 4.412   -8.591  2.035   1.00 0.29  ? 59  MET A N    5  
ATOM 9377  C CA   . MET A 1 59  ? 3.741   -7.637  1.164   1.00 0.26  ? 59  MET A CA   5  
ATOM 9378  C C    . MET A 1 59  ? 3.345   -6.380  1.923   1.00 0.24  ? 59  MET A C    5  
ATOM 9379  O O    . MET A 1 59  ? 2.890   -6.454  3.064   1.00 0.29  ? 59  MET A O    5  
ATOM 9380  C CB   . MET A 1 59  ? 2.480   -8.257  0.581   1.00 0.32  ? 59  MET A CB   5  
ATOM 9381  C CG   . MET A 1 59  ? 2.075   -7.680  -0.761  1.00 0.38  ? 59  MET A CG   5  
ATOM 9382  S SD   . MET A 1 59  ? 2.857   -8.518  -2.152  1.00 0.49  ? 59  MET A SD   5  
ATOM 9383  C CE   . MET A 1 59  ? 2.173   -10.168 -1.980  1.00 0.63  ? 59  MET A CE   5  
ATOM 9384  H H    . MET A 1 59  ? 4.236   -8.573  3.000   1.00 0.34  ? 59  MET A H    5  
ATOM 9385  H HA   . MET A 1 59  ? 4.407   -7.374  0.360   1.00 0.25  ? 59  MET A HA   5  
ATOM 9386  H HB2  . MET A 1 59  ? 2.630   -9.316  0.470   1.00 0.42  ? 59  MET A HB2  5  
ATOM 9387  H HB3  . MET A 1 59  ? 1.671   -8.091  1.272   1.00 0.34  ? 59  MET A HB3  5  
ATOM 9388  H HG2  . MET A 1 59  ? 1.011   -7.769  -0.862  1.00 0.45  ? 59  MET A HG2  5  
ATOM 9389  H HG3  . MET A 1 59  ? 2.351   -6.636  -0.787  1.00 0.40  ? 59  MET A HG3  5  
ATOM 9390  H HE1  . MET A 1 59  ? 1.096   -10.118 -2.044  1.00 1.24  ? 59  MET A HE1  5  
ATOM 9391  H HE2  . MET A 1 59  ? 2.459   -10.580 -1.024  1.00 1.09  ? 59  MET A HE2  5  
ATOM 9392  H HE3  . MET A 1 59  ? 2.551   -10.797 -2.772  1.00 1.26  ? 59  MET A HE3  5  
ATOM 9393  N N    . LEU A 1 60  ? 3.512   -5.237  1.286   1.00 0.20  ? 60  LEU A N    5  
ATOM 9394  C CA   . LEU A 1 60  ? 2.949   -3.996  1.793   1.00 0.19  ? 60  LEU A CA   5  
ATOM 9395  C C    . LEU A 1 60  ? 1.863   -3.513  0.853   1.00 0.21  ? 60  LEU A C    5  
ATOM 9396  O O    . LEU A 1 60  ? 1.968   -3.663  -0.367  1.00 0.25  ? 60  LEU A O    5  
ATOM 9397  C CB   . LEU A 1 60  ? 4.002   -2.891  1.950   1.00 0.21  ? 60  LEU A CB   5  
ATOM 9398  C CG   . LEU A 1 60  ? 4.491   -2.623  3.379   1.00 0.26  ? 60  LEU A CG   5  
ATOM 9399  C CD1  . LEU A 1 60  ? 3.320   -2.534  4.331   1.00 0.48  ? 60  LEU A CD1  5  
ATOM 9400  C CD2  . LEU A 1 60  ? 5.460   -3.682  3.862   1.00 0.40  ? 60  LEU A CD2  5  
ATOM 9401  H H    . LEU A 1 60  ? 4.013   -5.227  0.440   1.00 0.21  ? 60  LEU A H    5  
ATOM 9402  H HA   . LEU A 1 60  ? 2.507   -4.204  2.755   1.00 0.18  ? 60  LEU A HA   5  
ATOM 9403  H HB2  . LEU A 1 60  ? 4.848   -3.149  1.342   1.00 0.28  ? 60  LEU A HB2  5  
ATOM 9404  H HB3  . LEU A 1 60  ? 3.577   -1.972  1.571   1.00 0.21  ? 60  LEU A HB3  5  
ATOM 9405  H HG   . LEU A 1 60  ? 5.005   -1.673  3.396   1.00 0.52  ? 60  LEU A HG   5  
ATOM 9406  H HD11 . LEU A 1 60  ? 2.965   -3.534  4.547   1.00 1.23  ? 60  LEU A HD11 5  
ATOM 9407  H HD12 . LEU A 1 60  ? 2.526   -1.959  3.876   1.00 0.99  ? 60  LEU A HD12 5  
ATOM 9408  H HD13 . LEU A 1 60  ? 3.634   -2.059  5.245   1.00 1.17  ? 60  LEU A HD13 5  
ATOM 9409  H HD21 . LEU A 1 60  ? 5.046   -4.662  3.675   1.00 1.03  ? 60  LEU A HD21 5  
ATOM 9410  H HD22 . LEU A 1 60  ? 5.618   -3.555  4.924   1.00 1.14  ? 60  LEU A HD22 5  
ATOM 9411  H HD23 . LEU A 1 60  ? 6.400   -3.578  3.347   1.00 1.12  ? 60  LEU A HD23 5  
ATOM 9412  N N    . ARG A 1 61  ? 0.815   -2.962  1.426   1.00 0.22  ? 61  ARG A N    5  
ATOM 9413  C CA   . ARG A 1 61  ? -0.262  -2.376  0.636   1.00 0.25  ? 61  ARG A CA   5  
ATOM 9414  C C    . ARG A 1 61  ? -0.212  -0.862  0.666   1.00 0.26  ? 61  ARG A C    5  
ATOM 9415  O O    . ARG A 1 61  ? 0.120   -0.254  1.680   1.00 0.31  ? 61  ARG A O    5  
ATOM 9416  C CB   . ARG A 1 61  ? -1.653  -2.785  1.117   1.00 0.31  ? 61  ARG A CB   5  
ATOM 9417  C CG   . ARG A 1 61  ? -2.109  -4.143  0.623   1.00 0.40  ? 61  ARG A CG   5  
ATOM 9418  C CD   . ARG A 1 61  ? -3.569  -4.407  0.963   1.00 0.56  ? 61  ARG A CD   5  
ATOM 9419  N NE   . ARG A 1 61  ? -3.790  -4.624  2.392   1.00 1.20  ? 61  ARG A NE   5  
ATOM 9420  C CZ   . ARG A 1 61  ? -4.988  -4.559  2.977   1.00 1.42  ? 61  ARG A CZ   5  
ATOM 9421  N NH1  . ARG A 1 61  ? -6.061  -4.219  2.272   1.00 1.03  ? 61  ARG A NH1  5  
ATOM 9422  N NH2  . ARG A 1 61  ? -5.118  -4.835  4.265   1.00 2.37  ? 61  ARG A NH2  5  
ATOM 9423  H H    . ARG A 1 61  ? 0.770   -2.946  2.418   1.00 0.24  ? 61  ARG A H    5  
ATOM 9424  H HA   . ARG A 1 61  ? -0.135  -2.717  -0.388  1.00 0.26  ? 61  ARG A HA   5  
ATOM 9425  H HB2  . ARG A 1 61  ? -1.663  -2.794  2.198   1.00 0.33  ? 61  ARG A HB2  5  
ATOM 9426  H HB3  . ARG A 1 61  ? -2.359  -2.040  0.759   1.00 0.35  ? 61  ARG A HB3  5  
ATOM 9427  H HG2  . ARG A 1 61  ? -1.990  -4.177  -0.447  1.00 0.46  ? 61  ARG A HG2  5  
ATOM 9428  H HG3  . ARG A 1 61  ? -1.496  -4.907  1.081   1.00 0.41  ? 61  ARG A HG3  5  
ATOM 9429  H HD2  . ARG A 1 61  ? -4.157  -3.558  0.647   1.00 0.96  ? 61  ARG A HD2  5  
ATOM 9430  H HD3  . ARG A 1 61  ? -3.895  -5.285  0.424   1.00 1.24  ? 61  ARG A HD3  5  
ATOM 9431  H HE   . ARG A 1 61  ? -3.007  -4.857  2.939   1.00 1.81  ? 61  ARG A HE   5  
ATOM 9432  H HH11 . ARG A 1 61  ? -5.982  -4.013  1.300   1.00 1.07  ? 61  ARG A HH11 5  
ATOM 9433  H HH12 . ARG A 1 61  ? -6.962  -4.162  2.719   1.00 1.28  ? 61  ARG A HH12 5  
ATOM 9434  H HH21 . ARG A 1 61  ? -4.318  -5.102  4.814   1.00 2.99  ? 61  ARG A HH21 5  
ATOM 9435  H HH22 . ARG A 1 61  ? -6.016  -4.759  4.708   1.00 2.55  ? 61  ARG A HH22 5  
ATOM 9436  N N    . LEU A 1 62  ? -0.569  -0.279  -0.454  1.00 0.28  ? 62  LEU A N    5  
ATOM 9437  C CA   . LEU A 1 62  ? -0.781  1.149   -0.569  1.00 0.28  ? 62  LEU A CA   5  
ATOM 9438  C C    . LEU A 1 62  ? -2.252  1.414   -0.833  1.00 0.28  ? 62  LEU A C    5  
ATOM 9439  O O    . LEU A 1 62  ? -2.719  1.219   -1.951  1.00 0.33  ? 62  LEU A O    5  
ATOM 9440  C CB   . LEU A 1 62  ? 0.027   1.698   -1.729  1.00 0.31  ? 62  LEU A CB   5  
ATOM 9441  C CG   . LEU A 1 62  ? 1.462   2.106   -1.433  1.00 0.37  ? 62  LEU A CG   5  
ATOM 9442  C CD1  . LEU A 1 62  ? 1.537   3.042   -0.238  1.00 0.70  ? 62  LEU A CD1  5  
ATOM 9443  C CD2  . LEU A 1 62  ? 2.334   0.883   -1.235  1.00 0.68  ? 62  LEU A CD2  5  
ATOM 9444  H H    . LEU A 1 62  ? -0.678  -0.837  -1.255  1.00 0.34  ? 62  LEU A H    5  
ATOM 9445  H HA   . LEU A 1 62  ? -0.478  1.623   0.353   1.00 0.27  ? 62  LEU A HA   5  
ATOM 9446  H HB2  . LEU A 1 62  ? 0.059   0.926   -2.473  1.00 0.39  ? 62  LEU A HB2  5  
ATOM 9447  H HB3  . LEU A 1 62  ? -0.494  2.549   -2.142  1.00 0.33  ? 62  LEU A HB3  5  
ATOM 9448  H HG   . LEU A 1 62  ? 1.835   2.638   -2.284  1.00 0.72  ? 62  LEU A HG   5  
ATOM 9449  H HD11 . LEU A 1 62  ? 2.550   3.396   -0.122  1.00 1.29  ? 62  LEU A HD11 5  
ATOM 9450  H HD12 . LEU A 1 62  ? 1.238   2.513   0.655   1.00 1.45  ? 62  LEU A HD12 5  
ATOM 9451  H HD13 . LEU A 1 62  ? 0.878   3.881   -0.398  1.00 1.20  ? 62  LEU A HD13 5  
ATOM 9452  H HD21 . LEU A 1 62  ? 1.977   0.319   -0.387  1.00 1.18  ? 62  LEU A HD21 5  
ATOM 9453  H HD22 . LEU A 1 62  ? 3.352   1.192   -1.063  1.00 1.33  ? 62  LEU A HD22 5  
ATOM 9454  H HD23 . LEU A 1 62  ? 2.287   0.268   -2.123  1.00 1.28  ? 62  LEU A HD23 5  
ATOM 9455  N N    . ILE A 1 63  ? -2.972  1.852   0.175   1.00 0.26  ? 63  ILE A N    5  
ATOM 9456  C CA   . ILE A 1 63  ? -4.408  2.046   0.054   1.00 0.26  ? 63  ILE A CA   5  
ATOM 9457  C C    . ILE A 1 63  ? -4.706  3.451   -0.442  1.00 0.25  ? 63  ILE A C    5  
ATOM 9458  O O    . ILE A 1 63  ? -4.680  4.394   0.336   1.00 0.24  ? 63  ILE A O    5  
ATOM 9459  C CB   . ILE A 1 63  ? -5.106  1.865   1.410   1.00 0.27  ? 63  ILE A CB   5  
ATOM 9460  C CG1  . ILE A 1 63  ? -4.654  0.566   2.084   1.00 0.32  ? 63  ILE A CG1  5  
ATOM 9461  C CG2  . ILE A 1 63  ? -6.618  1.894   1.230   1.00 0.33  ? 63  ILE A CG2  5  
ATOM 9462  C CD1  . ILE A 1 63  ? -5.445  -0.643  1.669   1.00 0.41  ? 63  ILE A CD1  5  
ATOM 9463  H H    . ILE A 1 63  ? -2.530  2.073   1.025   1.00 0.25  ? 63  ILE A H    5  
ATOM 9464  H HA   . ILE A 1 63  ? -4.798  1.318   -0.643  1.00 0.29  ? 63  ILE A HA   5  
ATOM 9465  H HB   . ILE A 1 63  ? -4.832  2.700   2.032   1.00 0.28  ? 63  ILE A HB   5  
ATOM 9466  H HG12 . ILE A 1 63  ? -3.622  0.386   1.834   1.00 0.36  ? 63  ILE A HG12 5  
ATOM 9467  H HG13 . ILE A 1 63  ? -4.743  0.668   3.154   1.00 0.39  ? 63  ILE A HG13 5  
ATOM 9468  H HG21 . ILE A 1 63  ? -6.917  2.861   0.852   1.00 1.10  ? 63  ILE A HG21 5  
ATOM 9469  H HG22 . ILE A 1 63  ? -7.099  1.713   2.179   1.00 1.02  ? 63  ILE A HG22 5  
ATOM 9470  H HG23 . ILE A 1 63  ? -6.909  1.128   0.525   1.00 1.11  ? 63  ILE A HG23 5  
ATOM 9471  H HD11 . ILE A 1 63  ? -6.480  -0.484  1.930   1.00 1.24  ? 63  ILE A HD11 5  
ATOM 9472  H HD12 . ILE A 1 63  ? -5.070  -1.512  2.187   1.00 0.97  ? 63  ILE A HD12 5  
ATOM 9473  H HD13 . ILE A 1 63  ? -5.357  -0.787  0.604   1.00 1.08  ? 63  ILE A HD13 5  
ATOM 9474  N N    . GLY A 1 64  ? -4.987  3.592   -1.723  1.00 0.28  ? 64  GLY A N    5  
ATOM 9475  C CA   . GLY A 1 64  ? -5.274  4.906   -2.267  1.00 0.27  ? 64  GLY A CA   5  
ATOM 9476  C C    . GLY A 1 64  ? -6.633  5.414   -1.833  1.00 0.29  ? 64  GLY A C    5  
ATOM 9477  O O    . GLY A 1 64  ? -7.543  4.619   -1.584  1.00 0.37  ? 64  GLY A O    5  
ATOM 9478  H H    . GLY A 1 64  ? -5.018  2.802   -2.300  1.00 0.32  ? 64  GLY A H    5  
ATOM 9479  H HA2  . GLY A 1 64  ? -4.518  5.594   -1.928  1.00 0.26  ? 64  GLY A HA2  5  
ATOM 9480  H HA3  . GLY A 1 64  ? -5.243  4.858   -3.340  1.00 0.33  ? 64  GLY A HA3  5  
ATOM 9481  N N    . LYS A 1 65  ? -6.773  6.732   -1.732  1.00 0.34  ? 65  LYS A N    5  
ATOM 9482  C CA   . LYS A 1 65  ? -8.010  7.334   -1.283  1.00 0.41  ? 65  LYS A CA   5  
ATOM 9483  C C    . LYS A 1 65  ? -9.141  7.086   -2.253  1.00 0.60  ? 65  LYS A C    5  
ATOM 9484  O O    . LYS A 1 65  ? -8.937  6.816   -3.439  1.00 0.80  ? 65  LYS A O    5  
ATOM 9485  C CB   . LYS A 1 65  ? -7.859  8.823   -1.126  1.00 0.53  ? 65  LYS A CB   5  
ATOM 9486  C CG   . LYS A 1 65  ? -6.881  9.207   -0.065  1.00 0.50  ? 65  LYS A CG   5  
ATOM 9487  C CD   . LYS A 1 65  ? -6.605  10.686  -0.107  1.00 0.68  ? 65  LYS A CD   5  
ATOM 9488  C CE   . LYS A 1 65  ? -6.291  11.185  1.273   1.00 0.91  ? 65  LYS A CE   5  
ATOM 9489  N NZ   . LYS A 1 65  ? -6.317  12.669  1.352   1.00 1.16  ? 65  LYS A NZ   5  
ATOM 9490  H H    . LYS A 1 65  ? -6.024  7.318   -1.970  1.00 0.41  ? 65  LYS A H    5  
ATOM 9491  H HA   . LYS A 1 65  ? -8.255  6.917   -0.316  1.00 0.37  ? 65  LYS A HA   5  
ATOM 9492  H HB2  . LYS A 1 65  ? -7.545  9.242   -2.053  1.00 0.66  ? 65  LYS A HB2  5  
ATOM 9493  H HB3  . LYS A 1 65  ? -8.812  9.238   -0.866  1.00 0.67  ? 65  LYS A HB3  5  
ATOM 9494  H HG2  . LYS A 1 65  ? -7.292  8.951   0.901   1.00 0.58  ? 65  LYS A HG2  5  
ATOM 9495  H HG3  . LYS A 1 65  ? -5.971  8.665   -0.225  1.00 0.52  ? 65  LYS A HG3  5  
ATOM 9496  H HD2  . LYS A 1 65  ? -5.762  10.873  -0.756  1.00 0.90  ? 65  LYS A HD2  5  
ATOM 9497  H HD3  . LYS A 1 65  ? -7.479  11.197  -0.482  1.00 0.68  ? 65  LYS A HD3  5  
ATOM 9498  H HE2  . LYS A 1 65  ? -7.029  10.773  1.942   1.00 0.98  ? 65  LYS A HE2  5  
ATOM 9499  H HE3  . LYS A 1 65  ? -5.313  10.828  1.556   1.00 1.08  ? 65  LYS A HE3  5  
ATOM 9500  H HZ1  . LYS A 1 65  ? -6.025  12.985  2.298   1.00 1.67  ? 65  LYS A HZ1  5  
ATOM 9501  H HZ2  . LYS A 1 65  ? -7.278  13.021  1.164   1.00 1.54  ? 65  LYS A HZ2  5  
ATOM 9502  H HZ3  . LYS A 1 65  ? -5.669  13.079  0.648   1.00 1.48  ? 65  LYS A HZ3  5  
ATOM 9503  N N    . VAL A 1 66  ? -10.327 7.189   -1.729  1.00 0.67  ? 66  VAL A N    5  
ATOM 9504  C CA   . VAL A 1 66  ? -11.534 7.076   -2.527  1.00 1.01  ? 66  VAL A CA   5  
ATOM 9505  C C    . VAL A 1 66  ? -12.341 8.358   -2.459  1.00 1.29  ? 66  VAL A C    5  
ATOM 9506  O O    . VAL A 1 66  ? -12.495 8.947   -1.387  1.00 1.39  ? 66  VAL A O    5  
ATOM 9507  C CB   . VAL A 1 66  ? -12.425 5.882   -2.120  1.00 1.12  ? 66  VAL A CB   5  
ATOM 9508  C CG1  . VAL A 1 66  ? -11.703 4.576   -2.369  1.00 1.26  ? 66  VAL A CG1  5  
ATOM 9509  C CG2  . VAL A 1 66  ? -12.866 5.981   -0.669  1.00 1.48  ? 66  VAL A CG2  5  
ATOM 9510  H H    . VAL A 1 66  ? -10.388 7.417   -0.781  1.00 0.65  ? 66  VAL A H    5  
ATOM 9511  H HA   . VAL A 1 66  ? -11.226 6.925   -3.550  1.00 1.28  ? 66  VAL A HA   5  
ATOM 9512  H HB   . VAL A 1 66  ? -13.309 5.898   -2.738  1.00 1.58  ? 66  VAL A HB   5  
ATOM 9513  H HG11 . VAL A 1 66  ? -10.785 4.558   -1.798  1.00 1.62  ? 66  VAL A HG11 5  
ATOM 9514  H HG12 . VAL A 1 66  ? -11.475 4.485   -3.421  1.00 1.87  ? 66  VAL A HG12 5  
ATOM 9515  H HG13 . VAL A 1 66  ? -12.332 3.752   -2.063  1.00 1.61  ? 66  VAL A HG13 5  
ATOM 9516  H HG21 . VAL A 1 66  ? -13.479 6.862   -0.541  1.00 1.91  ? 66  VAL A HG21 5  
ATOM 9517  H HG22 . VAL A 1 66  ? -11.997 6.047   -0.033  1.00 2.10  ? 66  VAL A HG22 5  
ATOM 9518  H HG23 . VAL A 1 66  ? -13.438 5.103   -0.410  1.00 1.76  ? 66  VAL A HG23 5  
ATOM 9519  N N    . ASP A 1 67  ? -12.830 8.804   -3.596  1.00 1.84  ? 67  ASP A N    5  
ATOM 9520  C CA   . ASP A 1 67  ? -13.789 9.893   -3.614  1.00 2.24  ? 67  ASP A CA   5  
ATOM 9521  C C    . ASP A 1 67  ? -15.172 9.319   -3.858  1.00 2.23  ? 67  ASP A C    5  
ATOM 9522  O O    . ASP A 1 67  ? -15.462 8.821   -4.943  1.00 2.60  ? 67  ASP A O    5  
ATOM 9523  C CB   . ASP A 1 67  ? -13.454 10.929  -4.684  1.00 3.07  ? 67  ASP A CB   5  
ATOM 9524  C CG   . ASP A 1 67  ? -14.302 12.175  -4.533  1.00 3.61  ? 67  ASP A CG   5  
ATOM 9525  O OD1  . ASP A 1 67  ? -15.518 12.108  -4.807  1.00 3.94  ? 67  ASP A OD1  5  
ATOM 9526  O OD2  . ASP A 1 67  ? -13.758 13.231  -4.156  1.00 4.14  ? 67  ASP A OD2  5  
ATOM 9527  H H    . ASP A 1 67  ? -12.540 8.399   -4.438  1.00 2.14  ? 67  ASP A H    5  
ATOM 9528  H HA   . ASP A 1 67  ? -13.773 10.365  -2.641  1.00 2.38  ? 67  ASP A HA   5  
ATOM 9529  H HB2  . ASP A 1 67  ? -12.414 11.207  -4.601  1.00 3.41  ? 67  ASP A HB2  5  
ATOM 9530  H HB3  . ASP A 1 67  ? -13.637 10.506  -5.660  1.00 3.48  ? 67  ASP A HB3  5  
ATOM 9531  N N    . GLU A 1 68  ? -16.017 9.380   -2.850  1.00 2.48  ? 68  GLU A N    5  
ATOM 9532  C CA   . GLU A 1 68  ? -17.319 8.735   -2.904  1.00 2.96  ? 68  GLU A CA   5  
ATOM 9533  C C    . GLU A 1 68  ? -18.259 9.430   -3.892  1.00 3.03  ? 68  GLU A C    5  
ATOM 9534  O O    . GLU A 1 68  ? -19.179 8.808   -4.423  1.00 3.47  ? 68  GLU A O    5  
ATOM 9535  C CB   . GLU A 1 68  ? -17.956 8.683   -1.515  1.00 3.79  ? 68  GLU A CB   5  
ATOM 9536  C CG   . GLU A 1 68  ? -18.362 10.027  -0.989  1.00 4.24  ? 68  GLU A CG   5  
ATOM 9537  C CD   . GLU A 1 68  ? -17.184 10.907  -0.621  1.00 4.33  ? 68  GLU A CD   5  
ATOM 9538  O OE1  . GLU A 1 68  ? -16.652 10.761  0.499   1.00 4.54  ? 68  GLU A OE1  5  
ATOM 9539  O OE2  . GLU A 1 68  ? -16.796 11.761  -1.442  1.00 4.61  ? 68  GLU A OE2  5  
ATOM 9540  H H    . GLU A 1 68  ? -15.768 9.886   -2.046  1.00 2.75  ? 68  GLU A H    5  
ATOM 9541  H HA   . GLU A 1 68  ? -17.165 7.732   -3.237  1.00 3.16  ? 68  GLU A HA   5  
ATOM 9542  H HB2  . GLU A 1 68  ? -18.833 8.058   -1.555  1.00 4.05  ? 68  GLU A HB2  5  
ATOM 9543  H HB3  . GLU A 1 68  ? -17.258 8.260   -0.822  1.00 4.24  ? 68  GLU A HB3  5  
ATOM 9544  H HG2  . GLU A 1 68  ? -18.921 10.511  -1.761  1.00 4.79  ? 68  GLU A HG2  5  
ATOM 9545  H HG3  . GLU A 1 68  ? -18.977 9.882   -0.119  1.00 4.43  ? 68  GLU A HG3  5  
ATOM 9546  N N    . SER A 1 69  ? -18.030 10.712  -4.140  1.00 3.10  ? 69  SER A N    5  
ATOM 9547  C CA   . SER A 1 69  ? -18.929 11.489  -4.984  1.00 3.63  ? 69  SER A CA   5  
ATOM 9548  C C    . SER A 1 69  ? -18.506 11.487  -6.457  1.00 3.71  ? 69  SER A C    5  
ATOM 9549  O O    . SER A 1 69  ? -19.347 11.388  -7.352  1.00 4.40  ? 69  SER A O    5  
ATOM 9550  C CB   . SER A 1 69  ? -19.017 12.924  -4.458  1.00 4.49  ? 69  SER A CB   5  
ATOM 9551  O OG   . SER A 1 69  ? -17.729 13.477  -4.216  1.00 4.68  ? 69  SER A OG   5  
ATOM 9552  H H    . SER A 1 69  ? -17.243 11.147  -3.743  1.00 3.14  ? 69  SER A H    5  
ATOM 9553  H HA   . SER A 1 69  ? -19.907 11.038  -4.911  1.00 3.90  ? 69  SER A HA   5  
ATOM 9554  H HB2  . SER A 1 69  ? -19.525 13.536  -5.180  1.00 4.89  ? 69  SER A HB2  5  
ATOM 9555  H HB3  . SER A 1 69  ? -19.576 12.932  -3.539  1.00 4.96  ? 69  SER A HB3  5  
ATOM 9556  H HG   . SER A 1 69  ? -17.041 12.845  -4.487  1.00 4.92  ? 69  SER A HG   5  
ATOM 9557  N N    . LYS A 1 70  ? -17.208 11.583  -6.704  1.00 3.46  ? 70  LYS A N    5  
ATOM 9558  C CA   . LYS A 1 70  ? -16.686 11.731  -8.045  1.00 4.25  ? 70  LYS A CA   5  
ATOM 9559  C C    . LYS A 1 70  ? -16.439 10.385  -8.715  1.00 4.39  ? 70  LYS A C    5  
ATOM 9560  O O    . LYS A 1 70  ? -16.555 10.260  -9.935  1.00 5.30  ? 70  LYS A O    5  
ATOM 9561  C CB   . LYS A 1 70  ? -15.387 12.528  -7.975  1.00 4.65  ? 70  LYS A CB   5  
ATOM 9562  C CG   . LYS A 1 70  ? -14.792 12.828  -9.315  1.00 5.30  ? 70  LYS A CG   5  
ATOM 9563  C CD   . LYS A 1 70  ? -13.566 13.701  -9.173  1.00 5.73  ? 70  LYS A CD   5  
ATOM 9564  C CE   . LYS A 1 70  ? -12.682 13.567  -10.383 1.00 6.36  ? 70  LYS A CE   5  
ATOM 9565  N NZ   . LYS A 1 70  ? -11.444 14.378  -10.265 1.00 6.99  ? 70  LYS A NZ   5  
ATOM 9566  H H    . LYS A 1 70  ? -16.570 11.586  -5.957  1.00 3.05  ? 70  LYS A H    5  
ATOM 9567  H HA   . LYS A 1 70  ? -17.405 12.286  -8.625  1.00 4.88  ? 70  LYS A HA   5  
ATOM 9568  H HB2  . LYS A 1 70  ? -15.574 13.462  -7.471  1.00 4.40  ? 70  LYS A HB2  5  
ATOM 9569  H HB3  . LYS A 1 70  ? -14.657 11.964  -7.414  1.00 5.12  ? 70  LYS A HB3  5  
ATOM 9570  H HG2  . LYS A 1 70  ? -14.516 11.901  -9.790  1.00 5.74  ? 70  LYS A HG2  5  
ATOM 9571  H HG3  . LYS A 1 70  ? -15.525 13.338  -9.907  1.00 5.41  ? 70  LYS A HG3  5  
ATOM 9572  H HD2  . LYS A 1 70  ? -13.874 14.730  -9.071  1.00 5.78  ? 70  LYS A HD2  5  
ATOM 9573  H HD3  . LYS A 1 70  ? -13.013 13.397  -8.296  1.00 5.93  ? 70  LYS A HD3  5  
ATOM 9574  H HE2  . LYS A 1 70  ? -12.422 12.528  -10.481 1.00 6.60  ? 70  LYS A HE2  5  
ATOM 9575  H HE3  . LYS A 1 70  ? -13.234 13.885  -11.255 1.00 6.43  ? 70  LYS A HE3  5  
ATOM 9576  H HZ1  . LYS A 1 70  ? -11.682 15.385  -10.159 1.00 6.98  ? 70  LYS A HZ1  5  
ATOM 9577  H HZ2  . LYS A 1 70  ? -10.856 14.262  -11.113 1.00 7.36  ? 70  LYS A HZ2  5  
ATOM 9578  H HZ3  . LYS A 1 70  ? -10.895 14.076  -9.435  1.00 7.35  ? 70  LYS A HZ3  5  
ATOM 9579  N N    . LYS A 1 71  ? -16.113 9.377   -7.921  1.00 3.86  ? 71  LYS A N    5  
ATOM 9580  C CA   . LYS A 1 71  ? -15.686 8.099   -8.470  1.00 4.42  ? 71  LYS A CA   5  
ATOM 9581  C C    . LYS A 1 71  ? -16.844 7.323   -9.079  1.00 4.63  ? 71  LYS A C    5  
ATOM 9582  O O    . LYS A 1 71  ? -18.017 7.597   -8.808  1.00 4.42  ? 71  LYS A O    5  
ATOM 9583  C CB   . LYS A 1 71  ? -14.962 7.264   -7.427  1.00 4.55  ? 71  LYS A CB   5  
ATOM 9584  C CG   . LYS A 1 71  ? -14.081 6.204   -8.027  1.00 5.51  ? 71  LYS A CG   5  
ATOM 9585  C CD   . LYS A 1 71  ? -12.845 6.014   -7.198  1.00 6.15  ? 71  LYS A CD   5  
ATOM 9586  C CE   . LYS A 1 71  ? -12.025 4.844   -7.685  1.00 7.31  ? 71  LYS A CE   5  
ATOM 9587  N NZ   . LYS A 1 71  ? -10.671 4.825   -7.074  1.00 8.20  ? 71  LYS A NZ   5  
ATOM 9588  H H    . LYS A 1 71  ? -16.167 9.492   -6.947  1.00 3.38  ? 71  LYS A H    5  
ATOM 9589  H HA   . LYS A 1 71  ? -14.987 8.315   -9.259  1.00 5.06  ? 71  LYS A HA   5  
ATOM 9590  H HB2  . LYS A 1 71  ? -14.341 7.908   -6.847  1.00 4.44  ? 71  LYS A HB2  5  
ATOM 9591  H HB3  . LYS A 1 71  ? -15.682 6.784   -6.785  1.00 4.51  ? 71  LYS A HB3  5  
ATOM 9592  H HG2  . LYS A 1 71  ? -14.621 5.277   -8.092  1.00 5.66  ? 71  LYS A HG2  5  
ATOM 9593  H HG3  . LYS A 1 71  ? -13.782 6.529   -9.003  1.00 5.91  ? 71  LYS A HG3  5  
ATOM 9594  H HD2  . LYS A 1 71  ? -12.258 6.909   -7.282  1.00 6.23  ? 71  LYS A HD2  5  
ATOM 9595  H HD3  . LYS A 1 71  ? -13.126 5.848   -6.170  1.00 5.97  ? 71  LYS A HD3  5  
ATOM 9596  H HE2  . LYS A 1 71  ? -12.546 3.939   -7.418  1.00 7.38  ? 71  LYS A HE2  5  
ATOM 9597  H HE3  . LYS A 1 71  ? -11.931 4.905   -8.758  1.00 7.65  ? 71  LYS A HE3  5  
ATOM 9598  H HZ1  . LYS A 1 71  ? -10.079 4.103   -7.540  1.00 8.38  ? 71  LYS A HZ1  5  
ATOM 9599  H HZ2  . LYS A 1 71  ? -10.733 4.603   -6.062  1.00 8.58  ? 71  LYS A HZ2  5  
ATOM 9600  H HZ3  . LYS A 1 71  ? -10.214 5.752   -7.185  1.00 8.49  ? 71  LYS A HZ3  5  
ATOM 9601  N N    . ARG A 1 72  ? -16.478 6.377   -9.925  1.00 5.41  ? 72  ARG A N    5  
ATOM 9602  C CA   . ARG A 1 72  ? -17.406 5.610   -10.727 1.00 5.92  ? 72  ARG A CA   5  
ATOM 9603  C C    . ARG A 1 72  ? -18.461 4.887   -9.888  1.00 5.77  ? 72  ARG A C    5  
ATOM 9604  O O    . ARG A 1 72  ? -18.216 4.473   -8.753  1.00 5.54  ? 72  ARG A O    5  
ATOM 9605  C CB   . ARG A 1 72  ? -16.608 4.601   -11.540 1.00 6.97  ? 72  ARG A CB   5  
ATOM 9606  C CG   . ARG A 1 72  ? -17.349 4.094   -12.745 1.00 7.56  ? 72  ARG A CG   5  
ATOM 9607  C CD   . ARG A 1 72  ? -16.498 3.145   -13.567 1.00 8.44  ? 72  ARG A CD   5  
ATOM 9608  N NE   . ARG A 1 72  ? -17.266 2.522   -14.641 1.00 9.04  ? 72  ARG A NE   5  
ATOM 9609  C CZ   . ARG A 1 72  ? -16.734 2.052   -15.765 1.00 10.00 ? 72  ARG A CZ   5  
ATOM 9610  N NH1  . ARG A 1 72  ? -15.426 2.150   -15.986 1.00 10.44 ? 72  ARG A NH1  5  
ATOM 9611  N NH2  . ARG A 1 72  ? -17.516 1.487   -16.673 1.00 10.67 ? 72  ARG A NH2  5  
ATOM 9612  H H    . ARG A 1 72  ? -15.526 6.190   -10.023 1.00 5.81  ? 72  ARG A H    5  
ATOM 9613  H HA   . ARG A 1 72  ? -17.899 6.286   -11.404 1.00 5.94  ? 72  ARG A HA   5  
ATOM 9614  H HB2  . ARG A 1 72  ? -15.696 5.069   -11.879 1.00 7.23  ? 72  ARG A HB2  5  
ATOM 9615  H HB3  . ARG A 1 72  ? -16.362 3.760   -10.910 1.00 7.35  ? 72  ARG A HB3  5  
ATOM 9616  H HG2  . ARG A 1 72  ? -18.245 3.584   -12.423 1.00 7.62  ? 72  ARG A HG2  5  
ATOM 9617  H HG3  . ARG A 1 72  ? -17.607 4.946   -13.345 1.00 7.57  ? 72  ARG A HG3  5  
ATOM 9618  H HD2  . ARG A 1 72  ? -15.681 3.700   -14.001 1.00 8.79  ? 72  ARG A HD2  5  
ATOM 9619  H HD3  . ARG A 1 72  ? -16.109 2.374   -12.920 1.00 8.51  ? 72  ARG A HD3  5  
ATOM 9620  H HE   . ARG A 1 72  ? -18.241 2.443   -14.509 1.00 8.87  ? 72  ARG A HE   5  
ATOM 9621  H HH11 . ARG A 1 72  ? -14.828 2.581   -15.303 1.00 10.10 ? 72  ARG A HH11 5  
ATOM 9622  H HH12 . ARG A 1 72  ? -15.030 1.796   -16.838 1.00 11.22 ? 72  ARG A HH12 5  
ATOM 9623  H HH21 . ARG A 1 72  ? -18.506 1.416   -16.513 1.00 10.52 ? 72  ARG A HH21 5  
ATOM 9624  H HH22 . ARG A 1 72  ? -17.126 1.128   -17.523 1.00 11.45 ? 72  ARG A HH22 5  
ATOM 9625  N N    . LYS A 1 73  ? -19.641 4.760   -10.478 1.00 6.20  ? 73  LYS A N    5  
ATOM 9626  C CA   . LYS A 1 73  ? -20.764 4.056   -9.876  1.00 6.28  ? 73  LYS A CA   5  
ATOM 9627  C C    . LYS A 1 73  ? -20.667 2.561   -10.135 1.00 6.69  ? 73  LYS A C    5  
ATOM 9628  O O    . LYS A 1 73  ? -19.823 2.102   -10.907 1.00 7.13  ? 73  LYS A O    5  
ATOM 9629  C CB   . LYS A 1 73  ? -22.074 4.612   -10.437 1.00 6.89  ? 73  LYS A CB   5  
ATOM 9630  C CG   . LYS A 1 73  ? -22.360 6.026   -9.964  1.00 6.88  ? 73  LYS A CG   5  
ATOM 9631  C CD   . LYS A 1 73  ? -23.702 6.524   -10.458 1.00 7.64  ? 73  LYS A CD   5  
ATOM 9632  C CE   . LYS A 1 73  ? -23.704 6.729   -11.964 1.00 8.45  ? 73  LYS A CE   5  
ATOM 9633  N NZ   . LYS A 1 73  ? -24.966 7.350   -12.443 1.00 8.97  ? 73  LYS A NZ   5  
ATOM 9634  H H    . LYS A 1 73  ? -19.764 5.159   -11.368 1.00 6.62  ? 73  LYS A H    5  
ATOM 9635  H HA   . LYS A 1 73  ? -20.751 4.223   -8.807  1.00 5.84  ? 73  LYS A HA   5  
ATOM 9636  H HB2  . LYS A 1 73  ? -22.014 4.619   -11.516 1.00 7.51  ? 73  LYS A HB2  5  
ATOM 9637  H HB3  . LYS A 1 73  ? -22.895 3.976   -10.135 1.00 7.00  ? 73  LYS A HB3  5  
ATOM 9638  H HG2  . LYS A 1 73  ? -22.357 6.040   -8.885  1.00 6.63  ? 73  LYS A HG2  5  
ATOM 9639  H HG3  . LYS A 1 73  ? -21.584 6.679   -10.335 1.00 6.84  ? 73  LYS A HG3  5  
ATOM 9640  H HD2  . LYS A 1 73  ? -24.449 5.789   -10.203 1.00 7.77  ? 73  LYS A HD2  5  
ATOM 9641  H HD3  . LYS A 1 73  ? -23.932 7.461   -9.971  1.00 7.70  ? 73  LYS A HD3  5  
ATOM 9642  H HE2  . LYS A 1 73  ? -22.877 7.369   -12.227 1.00 8.78  ? 73  LYS A HE2  5  
ATOM 9643  H HE3  . LYS A 1 73  ? -23.581 5.770   -12.443 1.00 8.56  ? 73  LYS A HE3  5  
ATOM 9644  H HZ1  . LYS A 1 73  ? -24.934 7.475   -13.474 1.00 9.28  ? 73  LYS A HZ1  5  
ATOM 9645  H HZ2  . LYS A 1 73  ? -25.099 8.280   -12.001 1.00 9.21  ? 73  LYS A HZ2  5  
ATOM 9646  H HZ3  . LYS A 1 73  ? -25.779 6.747   -12.205 1.00 9.02  ? 73  LYS A HZ3  5  
ATOM 9647  N N    . ASP A 1 74  ? -21.526 1.815   -9.463  1.00 6.78  ? 74  ASP A N    5  
ATOM 9648  C CA   . ASP A 1 74  ? -21.630 0.369   -9.642  1.00 7.38  ? 74  ASP A CA   5  
ATOM 9649  C C    . ASP A 1 74  ? -22.027 0.036   -11.087 1.00 8.21  ? 74  ASP A C    5  
ATOM 9650  O O    . ASP A 1 74  ? -22.379 0.942   -11.843 1.00 8.34  ? 74  ASP A O    5  
ATOM 9651  C CB   . ASP A 1 74  ? -22.665 -0.152  -8.646  1.00 7.38  ? 74  ASP A CB   5  
ATOM 9652  C CG   . ASP A 1 74  ? -23.009 -1.612  -8.806  1.00 8.19  ? 74  ASP A CG   5  
ATOM 9653  O OD1  . ASP A 1 74  ? -22.209 -2.470  -8.380  1.00 8.40  ? 74  ASP A OD1  5  
ATOM 9654  O OD2  . ASP A 1 74  ? -24.099 -1.900  -9.336  1.00 8.74  ? 74  ASP A OD2  5  
ATOM 9655  H H    . ASP A 1 74  ? -22.115 2.254   -8.811  1.00 6.59  ? 74  ASP A H    5  
ATOM 9656  H HA   . ASP A 1 74  ? -20.675 -0.071  -9.422  1.00 7.42  ? 74  ASP A HA   5  
ATOM 9657  H HB2  . ASP A 1 74  ? -22.293 -0.003  -7.645  1.00 6.84  ? 74  ASP A HB2  5  
ATOM 9658  H HB3  . ASP A 1 74  ? -23.564 0.420   -8.774  1.00 7.53  ? 74  ASP A HB3  5  
ATOM 9659  N N    . ASN A 1 75  ? -21.973 -1.231  -11.487 1.00 8.89  ? 75  ASN A N    5  
ATOM 9660  C CA   . ASN A 1 75  ? -22.298 -1.596  -12.870 1.00 9.75  ? 75  ASN A CA   5  
ATOM 9661  C C    . ASN A 1 75  ? -23.736 -1.215  -13.225 1.00 9.91  ? 75  ASN A C    5  
ATOM 9662  O O    . ASN A 1 75  ? -24.049 -0.972  -14.390 1.00 10.47 ? 75  ASN A O    5  
ATOM 9663  C CB   . ASN A 1 75  ? -22.063 -3.092  -13.144 1.00 10.48 ? 75  ASN A CB   5  
ATOM 9664  C CG   . ASN A 1 75  ? -23.035 -4.010  -12.423 1.00 10.99 ? 75  ASN A CG   5  
ATOM 9665  O OD1  . ASN A 1 75  ? -23.482 -3.726  -11.318 1.00 11.25 ? 75  ASN A OD1  5  
ATOM 9666  N ND2  . ASN A 1 75  ? -23.371 -5.124  -13.050 1.00 11.37 ? 75  ASN A ND2  5  
ATOM 9667  H H    . ASN A 1 75  ? -21.711 -1.931  -10.850 1.00 8.89  ? 75  ASN A H    5  
ATOM 9668  H HA   . ASN A 1 75  ? -21.637 -1.027  -13.509 1.00 9.91  ? 75  ASN A HA   5  
ATOM 9669  H HB2  . ASN A 1 75  ? -22.157 -3.272  -14.203 1.00 10.54 ? 75  ASN A HB2  5  
ATOM 9670  H HB3  . ASN A 1 75  ? -21.061 -3.349  -12.833 1.00 10.77 ? 75  ASN A HB3  5  
ATOM 9671  H HD21 . ASN A 1 75  ? -22.981 -5.293  -13.935 1.00 11.28 ? 75  ASN A HD21 5  
ATOM 9672  H HD22 . ASN A 1 75  ? -23.993 -5.737  -12.605 1.00 11.84 ? 75  ASN A HD22 5  
ATOM 9673  N N    . GLU A 1 76  ? -24.605 -1.148  -12.221 1.00 9.56  ? 76  GLU A N    5  
ATOM 9674  C CA   . GLU A 1 76  ? -25.982 -0.719  -12.437 1.00 9.89  ? 76  GLU A CA   5  
ATOM 9675  C C    . GLU A 1 76  ? -26.135 0.776   -12.161 1.00 9.42  ? 76  GLU A C    5  
ATOM 9676  O O    . GLU A 1 76  ? -27.249 1.287   -12.040 1.00 9.74  ? 76  GLU A O    5  
ATOM 9677  C CB   . GLU A 1 76  ? -26.941 -1.511  -11.549 1.00 10.10 ? 76  GLU A CB   5  
ATOM 9678  C CG   . GLU A 1 76  ? -26.894 -3.009  -11.786 1.00 10.22 ? 76  GLU A CG   5  
ATOM 9679  C CD   . GLU A 1 76  ? -27.954 -3.746  -10.999 1.00 10.82 ? 76  GLU A CD   5  
ATOM 9680  O OE1  . GLU A 1 76  ? -27.703 -4.079  -9.824  1.00 11.06 ? 76  GLU A OE1  5  
ATOM 9681  O OE2  . GLU A 1 76  ? -29.045 -3.992  -11.552 1.00 11.20 ? 76  GLU A OE2  5  
ATOM 9682  H H    . GLU A 1 76  ? -24.317 -1.411  -11.316 1.00 9.17  ? 76  GLU A H    5  
ATOM 9683  H HA   . GLU A 1 76  ? -26.226 -0.907  -13.472 1.00 10.50 ? 76  GLU A HA   5  
ATOM 9684  H HB2  . GLU A 1 76  ? -26.692 -1.324  -10.515 1.00 9.97  ? 76  GLU A HB2  5  
ATOM 9685  H HB3  . GLU A 1 76  ? -27.950 -1.170  -11.735 1.00 10.53 ? 76  GLU A HB3  5  
ATOM 9686  H HG2  . GLU A 1 76  ? -27.049 -3.200  -12.837 1.00 10.34 ? 76  GLU A HG2  5  
ATOM 9687  H HG3  . GLU A 1 76  ? -25.923 -3.379  -11.492 1.00 9.99  ? 76  GLU A HG3  5  
ATOM 9688  N N    . GLY A 1 77  ? -25.008 1.465   -12.059 1.00 8.81  ? 77  GLY A N    5  
ATOM 9689  C CA   . GLY A 1 77  ? -25.017 2.893   -11.814 1.00 8.45  ? 77  GLY A CA   5  
ATOM 9690  C C    . GLY A 1 77  ? -25.504 3.249   -10.428 1.00 7.87  ? 77  GLY A C    5  
ATOM 9691  O O    . GLY A 1 77  ? -26.259 4.202   -10.255 1.00 7.68  ? 77  GLY A O    5  
ATOM 9692  H H    . GLY A 1 77  ? -24.149 0.996   -12.163 1.00 8.72  ? 77  GLY A H    5  
ATOM 9693  H HA2  . GLY A 1 77  ? -24.011 3.267   -11.930 1.00 8.21  ? 77  GLY A HA2  5  
ATOM 9694  H HA3  . GLY A 1 77  ? -25.649 3.371   -12.539 1.00 8.99  ? 77  GLY A HA3  5  
ATOM 9695  N N    . ASN A 1 78  ? -25.073 2.484   -9.441  1.00 7.80  ? 78  ASN A N    5  
ATOM 9696  C CA   . ASN A 1 78  ? -25.383 2.784   -8.060  1.00 7.46  ? 78  ASN A CA   5  
ATOM 9697  C C    . ASN A 1 78  ? -24.310 3.696   -7.505  1.00 6.97  ? 78  ASN A C    5  
ATOM 9698  O O    . ASN A 1 78  ? -23.118 3.443   -7.698  1.00 7.29  ? 78  ASN A O    5  
ATOM 9699  C CB   . ASN A 1 78  ? -25.470 1.512   -7.208  1.00 7.23  ? 78  ASN A CB   5  
ATOM 9700  C CG   . ASN A 1 78  ? -26.648 0.625   -7.565  1.00 8.06  ? 78  ASN A CG   5  
ATOM 9701  O OD1  . ASN A 1 78  ? -27.766 0.842   -7.096  1.00 8.60  ? 78  ASN A OD1  5  
ATOM 9702  N ND2  . ASN A 1 78  ? -26.406 -0.409  -8.358  1.00 8.39  ? 78  ASN A ND2  5  
ATOM 9703  H H    . ASN A 1 78  ? -24.520 1.714   -9.644  1.00 8.12  ? 78  ASN A H    5  
ATOM 9704  H HA   . ASN A 1 78  ? -26.332 3.297   -8.032  1.00 7.96  ? 78  ASN A HA   5  
ATOM 9705  H HB2  . ASN A 1 78  ? -24.567 0.942   -7.341  1.00 7.05  ? 78  ASN A HB2  5  
ATOM 9706  H HB3  . ASN A 1 78  ? -25.553 1.792   -6.169  1.00 6.85  ? 78  ASN A HB3  5  
ATOM 9707  H HD21 . ASN A 1 78  ? -25.485 -0.553  -8.674  1.00 8.13  ? 78  ASN A HD21 5  
ATOM 9708  H HD22 . ASN A 1 78  ? -27.156 -0.996  -8.594  1.00 9.00  ? 78  ASN A HD22 5  
ATOM 9709  N N    . GLU A 1 79  ? -24.736 4.765   -6.855  1.00 6.44  ? 79  GLU A N    5  
ATOM 9710  C CA   . GLU A 1 79  ? -23.817 5.718   -6.236  1.00 6.06  ? 79  GLU A CA   5  
ATOM 9711  C C    . GLU A 1 79  ? -23.162 5.109   -4.998  1.00 5.51  ? 79  GLU A C    5  
ATOM 9712  O O    . GLU A 1 79  ? -23.433 5.493   -3.858  1.00 5.77  ? 79  GLU A O    5  
ATOM 9713  C CB   . GLU A 1 79  ? -24.534 7.029   -5.893  1.00 6.75  ? 79  GLU A CB   5  
ATOM 9714  C CG   . GLU A 1 79  ? -25.801 6.855   -5.082  1.00 7.16  ? 79  GLU A CG   5  
ATOM 9715  C CD   . GLU A 1 79  ? -26.405 8.181   -4.670  1.00 7.94  ? 79  GLU A CD   5  
ATOM 9716  O OE1  . GLU A 1 79  ? -27.083 8.813   -5.504  1.00 8.38  ? 79  GLU A OE1  5  
ATOM 9717  O OE2  . GLU A 1 79  ? -26.194 8.606   -3.513  1.00 8.32  ? 79  GLU A OE2  5  
ATOM 9718  H H    . GLU A 1 79  ? -25.696 4.919   -6.799  1.00 6.47  ? 79  GLU A H    5  
ATOM 9719  H HA   . GLU A 1 79  ? -23.046 5.929   -6.955  1.00 5.88  ? 79  GLU A HA   5  
ATOM 9720  H HB2  . GLU A 1 79  ? -23.860 7.658   -5.333  1.00 7.10  ? 79  GLU A HB2  5  
ATOM 9721  H HB3  . GLU A 1 79  ? -24.794 7.528   -6.813  1.00 6.91  ? 79  GLU A HB3  5  
ATOM 9722  H HG2  . GLU A 1 79  ? -26.516 6.320   -5.684  1.00 6.94  ? 79  GLU A HG2  5  
ATOM 9723  H HG3  . GLU A 1 79  ? -25.575 6.284   -4.194  1.00 7.42  ? 79  GLU A HG3  5  
ATOM 9724  N N    . VAL A 1 80  ? -22.292 4.155   -5.250  1.00 4.98  ? 80  VAL A N    5  
ATOM 9725  C CA   . VAL A 1 80  ? -21.634 3.395   -4.205  1.00 4.58  ? 80  VAL A CA   5  
ATOM 9726  C C    . VAL A 1 80  ? -20.331 4.057   -3.786  1.00 3.98  ? 80  VAL A C    5  
ATOM 9727  O O    . VAL A 1 80  ? -19.694 4.755   -4.580  1.00 3.86  ? 80  VAL A O    5  
ATOM 9728  C CB   . VAL A 1 80  ? -21.339 1.953   -4.684  1.00 4.62  ? 80  VAL A CB   5  
ATOM 9729  C CG1  . VAL A 1 80  ? -22.594 1.320   -5.245  1.00 5.39  ? 80  VAL A CG1  5  
ATOM 9730  C CG2  . VAL A 1 80  ? -20.242 1.935   -5.738  1.00 4.28  ? 80  VAL A CG2  5  
ATOM 9731  H H    . VAL A 1 80  ? -22.088 3.946   -6.187  1.00 5.01  ? 80  VAL A H    5  
ATOM 9732  H HA   . VAL A 1 80  ? -22.298 3.343   -3.356  1.00 5.01  ? 80  VAL A HA   5  
ATOM 9733  H HB   . VAL A 1 80  ? -21.009 1.370   -3.837  1.00 4.65  ? 80  VAL A HB   5  
ATOM 9734  H HG11 . VAL A 1 80  ? -23.393 1.400   -4.525  1.00 5.49  ? 80  VAL A HG11 5  
ATOM 9735  H HG12 . VAL A 1 80  ? -22.405 0.280   -5.464  1.00 5.78  ? 80  VAL A HG12 5  
ATOM 9736  H HG13 . VAL A 1 80  ? -22.872 1.838   -6.157  1.00 5.71  ? 80  VAL A HG13 5  
ATOM 9737  H HG21 . VAL A 1 80  ? -20.036 0.915   -6.026  1.00 4.44  ? 80  VAL A HG21 5  
ATOM 9738  H HG22 . VAL A 1 80  ? -19.345 2.385   -5.335  1.00 4.33  ? 80  VAL A HG22 5  
ATOM 9739  H HG23 . VAL A 1 80  ? -20.569 2.495   -6.602  1.00 4.29  ? 80  VAL A HG23 5  
ATOM 9740  N N    . VAL A 1 81  ? -19.961 3.883   -2.530  1.00 3.91  ? 81  VAL A N    5  
ATOM 9741  C CA   . VAL A 1 81  ? -18.636 4.251   -2.097  1.00 3.49  ? 81  VAL A CA   5  
ATOM 9742  C C    . VAL A 1 81  ? -17.680 3.115   -2.458  1.00 2.81  ? 81  VAL A C    5  
ATOM 9743  O O    . VAL A 1 81  ? -17.810 1.989   -1.971  1.00 2.88  ? 81  VAL A O    5  
ATOM 9744  C CB   . VAL A 1 81  ? -18.574 4.586   -0.588  1.00 4.02  ? 81  VAL A CB   5  
ATOM 9745  C CG1  . VAL A 1 81  ? -19.075 3.433   0.271   1.00 4.27  ? 81  VAL A CG1  5  
ATOM 9746  C CG2  . VAL A 1 81  ? -17.160 4.977   -0.201  1.00 4.20  ? 81  VAL A CG2  5  
ATOM 9747  H H    . VAL A 1 81  ? -20.586 3.488   -1.887  1.00 4.34  ? 81  VAL A H    5  
ATOM 9748  H HA   . VAL A 1 81  ? -18.346 5.131   -2.653  1.00 3.57  ? 81  VAL A HA   5  
ATOM 9749  H HB   . VAL A 1 81  ? -19.215 5.437   -0.407  1.00 4.55  ? 81  VAL A HB   5  
ATOM 9750  H HG11 . VAL A 1 81  ? -20.116 3.251   0.057   1.00 4.42  ? 81  VAL A HG11 5  
ATOM 9751  H HG12 . VAL A 1 81  ? -18.959 3.683   1.315   1.00 4.47  ? 81  VAL A HG12 5  
ATOM 9752  H HG13 . VAL A 1 81  ? -18.502 2.545   0.049   1.00 4.58  ? 81  VAL A HG13 5  
ATOM 9753  H HG21 . VAL A 1 81  ? -17.138 5.281   0.833   1.00 4.50  ? 81  VAL A HG21 5  
ATOM 9754  H HG22 . VAL A 1 81  ? -16.834 5.795   -0.828  1.00 4.41  ? 81  VAL A HG22 5  
ATOM 9755  H HG23 . VAL A 1 81  ? -16.506 4.132   -0.345  1.00 4.31  ? 81  VAL A HG23 5  
ATOM 9756  N N    . PRO A 1 82  ? -16.724 3.393   -3.346  1.00 2.49  ? 82  PRO A N    5  
ATOM 9757  C CA   . PRO A 1 82  ? -15.903 2.362   -3.967  1.00 2.15  ? 82  PRO A CA   5  
ATOM 9758  C C    . PRO A 1 82  ? -14.819 1.831   -3.045  1.00 1.66  ? 82  PRO A C    5  
ATOM 9759  O O    . PRO A 1 82  ? -14.262 2.571   -2.233  1.00 1.69  ? 82  PRO A O    5  
ATOM 9760  C CB   . PRO A 1 82  ? -15.293 3.083   -5.159  1.00 2.57  ? 82  PRO A CB   5  
ATOM 9761  C CG   . PRO A 1 82  ? -15.199 4.486   -4.740  1.00 2.91  ? 82  PRO A CG   5  
ATOM 9762  C CD   . PRO A 1 82  ? -16.344 4.741   -3.798  1.00 2.92  ? 82  PRO A CD   5  
ATOM 9763  H HA   . PRO A 1 82  ? -16.500 1.548   -4.321  1.00 2.39  ? 82  PRO A HA   5  
ATOM 9764  H HB2  . PRO A 1 82  ? -14.324 2.676   -5.377  1.00 2.53  ? 82  PRO A HB2  5  
ATOM 9765  H HB3  . PRO A 1 82  ? -15.931 2.984   -6.015  1.00 2.99  ? 82  PRO A HB3  5  
ATOM 9766  H HG2  . PRO A 1 82  ? -14.263 4.644   -4.245  1.00 2.90  ? 82  PRO A HG2  5  
ATOM 9767  H HG3  . PRO A 1 82  ? -15.278 5.107   -5.607  1.00 3.42  ? 82  PRO A HG3  5  
ATOM 9768  H HD2  . PRO A 1 82  ? -16.016 5.347   -2.965  1.00 3.15  ? 82  PRO A HD2  5  
ATOM 9769  H HD3  . PRO A 1 82  ? -17.161 5.222   -4.312  1.00 3.30  ? 82  PRO A HD3  5  
ATOM 9770  N N    . LYS A 1 83  ? -14.542 0.538   -3.166  1.00 1.57  ? 83  LYS A N    5  
ATOM 9771  C CA   . LYS A 1 83  ? -13.453 -0.083  -2.435  1.00 1.32  ? 83  LYS A CA   5  
ATOM 9772  C C    . LYS A 1 83  ? -12.141 0.552   -2.848  1.00 1.05  ? 83  LYS A C    5  
ATOM 9773  O O    . LYS A 1 83  ? -11.841 0.669   -4.039  1.00 1.19  ? 83  LYS A O    5  
ATOM 9774  C CB   . LYS A 1 83  ? -13.418 -1.588  -2.705  1.00 1.66  ? 83  LYS A CB   5  
ATOM 9775  C CG   . LYS A 1 83  ? -14.664 -2.324  -2.262  1.00 2.23  ? 83  LYS A CG   5  
ATOM 9776  C CD   . LYS A 1 83  ? -14.569 -3.810  -2.570  1.00 2.76  ? 83  LYS A CD   5  
ATOM 9777  C CE   . LYS A 1 83  ? -15.827 -4.559  -2.153  1.00 3.60  ? 83  LYS A CE   5  
ATOM 9778  N NZ   . LYS A 1 83  ? -16.051 -4.509  -0.685  1.00 4.42  ? 83  LYS A NZ   5  
ATOM 9779  H H    . LYS A 1 83  ? -15.085 -0.013  -3.768  1.00 1.91  ? 83  LYS A H    5  
ATOM 9780  H HA   . LYS A 1 83  ? -13.601 0.091   -1.376  1.00 1.32  ? 83  LYS A HA   5  
ATOM 9781  H HB2  . LYS A 1 83  ? -13.293 -1.749  -3.763  1.00 1.85  ? 83  LYS A HB2  5  
ATOM 9782  H HB3  . LYS A 1 83  ? -12.581 -2.012  -2.188  1.00 1.86  ? 83  LYS A HB3  5  
ATOM 9783  H HG2  . LYS A 1 83  ? -14.790 -2.190  -1.200  1.00 2.38  ? 83  LYS A HG2  5  
ATOM 9784  H HG3  . LYS A 1 83  ? -15.510 -1.911  -2.781  1.00 2.76  ? 83  LYS A HG3  5  
ATOM 9785  H HD2  . LYS A 1 83  ? -14.423 -3.938  -3.632  1.00 2.93  ? 83  LYS A HD2  5  
ATOM 9786  H HD3  . LYS A 1 83  ? -13.724 -4.223  -2.038  1.00 3.05  ? 83  LYS A HD3  5  
ATOM 9787  H HE2  . LYS A 1 83  ? -16.675 -4.116  -2.650  1.00 3.67  ? 83  LYS A HE2  5  
ATOM 9788  H HE3  . LYS A 1 83  ? -15.733 -5.592  -2.459  1.00 4.07  ? 83  LYS A HE3  5  
ATOM 9789  H HZ1  . LYS A 1 83  ? -16.848 -5.126  -0.423  1.00 4.83  ? 83  LYS A HZ1  5  
ATOM 9790  H HZ2  . LYS A 1 83  ? -16.271 -3.537  -0.385  1.00 4.81  ? 83  LYS A HZ2  5  
ATOM 9791  H HZ3  . LYS A 1 83  ? -15.201 -4.830  -0.180  1.00 4.64  ? 83  LYS A HZ3  5  
ATOM 9792  N N    . PRO A 1 84  ? -11.361 0.989   -1.860  1.00 0.80  ? 84  PRO A N    5  
ATOM 9793  C CA   . PRO A 1 84  ? -10.115 1.712   -2.085  1.00 0.60  ? 84  PRO A CA   5  
ATOM 9794  C C    . PRO A 1 84  ? -9.124  0.914   -2.912  1.00 0.62  ? 84  PRO A C    5  
ATOM 9795  O O    . PRO A 1 84  ? -8.790  -0.226  -2.578  1.00 0.78  ? 84  PRO A O    5  
ATOM 9796  C CB   . PRO A 1 84  ? -9.577  1.934   -0.680  1.00 0.60  ? 84  PRO A CB   5  
ATOM 9797  C CG   . PRO A 1 84  ? -10.768 1.837   0.193   1.00 0.84  ? 84  PRO A CG   5  
ATOM 9798  C CD   . PRO A 1 84  ? -11.630 0.806   -0.431  1.00 0.94  ? 84  PRO A CD   5  
ATOM 9799  H HA   . PRO A 1 84  ? -10.296 2.665   -2.551  1.00 0.63  ? 84  PRO A HA   5  
ATOM 9800  H HB2  . PRO A 1 84  ? -8.861  1.169   -0.454  1.00 0.66  ? 84  PRO A HB2  5  
ATOM 9801  H HB3  . PRO A 1 84  ? -9.112  2.907   -0.615  1.00 0.60  ? 84  PRO A HB3  5  
ATOM 9802  H HG2  . PRO A 1 84  ? -10.482 1.525   1.169   1.00 1.06  ? 84  PRO A HG2  5  
ATOM 9803  H HG3  . PRO A 1 84  ? -11.287 2.779   0.228   1.00 0.88  ? 84  PRO A HG3  5  
ATOM 9804  H HD2  . PRO A 1 84  ? -11.343 -0.179  -0.100  1.00 1.13  ? 84  PRO A HD2  5  
ATOM 9805  H HD3  . PRO A 1 84  ? -12.656 1.002   -0.200  1.00 1.08  ? 84  PRO A HD3  5  
ATOM 9806  N N    . GLN A 1 85  ? -8.652  1.522   -3.980  1.00 0.61  ? 85  GLN A N    5  
ATOM 9807  C CA   . GLN A 1 85  ? -7.718  0.867   -4.868  1.00 0.63  ? 85  GLN A CA   5  
ATOM 9808  C C    . GLN A 1 85  ? -6.344  0.866   -4.242  1.00 0.51  ? 85  GLN A C    5  
ATOM 9809  O O    . GLN A 1 85  ? -5.762  1.917   -3.967  1.00 0.51  ? 85  GLN A O    5  
ATOM 9810  C CB   . GLN A 1 85  ? -7.694  1.533   -6.239  1.00 0.77  ? 85  GLN A CB   5  
ATOM 9811  C CG   . GLN A 1 85  ? -8.975  1.332   -7.021  1.00 1.26  ? 85  GLN A CG   5  
ATOM 9812  C CD   . GLN A 1 85  ? -8.920  1.947   -8.398  1.00 1.44  ? 85  GLN A CD   5  
ATOM 9813  O OE1  . GLN A 1 85  ? -9.274  3.111   -8.583  1.00 1.73  ? 85  GLN A OE1  5  
ATOM 9814  N NE2  . GLN A 1 85  ? -8.478  1.174   -9.376  1.00 2.01  ? 85  GLN A NE2  5  
ATOM 9815  H H    . GLN A 1 85  ? -8.917  2.444   -4.156  1.00 0.66  ? 85  GLN A H    5  
ATOM 9816  H HA   . GLN A 1 85  ? -8.042  -0.156  -4.984  1.00 0.70  ? 85  GLN A HA   5  
ATOM 9817  H HB2  . GLN A 1 85  ? -7.543  2.587   -6.109  1.00 0.90  ? 85  GLN A HB2  5  
ATOM 9818  H HB3  . GLN A 1 85  ? -6.877  1.125   -6.815  1.00 1.01  ? 85  GLN A HB3  5  
ATOM 9819  H HG2  . GLN A 1 85  ? -9.149  0.276   -7.123  1.00 1.59  ? 85  GLN A HG2  5  
ATOM 9820  H HG3  . GLN A 1 85  ? -9.791  1.780   -6.472  1.00 1.51  ? 85  GLN A HG3  5  
ATOM 9821  H HE21 . GLN A 1 85  ? -8.213  0.253   -9.158  1.00 2.53  ? 85  GLN A HE21 5  
ATOM 9822  H HE22 . GLN A 1 85  ? -8.434  1.552   -10.278 1.00 2.15  ? 85  GLN A HE22 5  
ATOM 9823  N N    . ARG A 1 86  ? -5.840  -0.318  -4.005  1.00 0.50  ? 86  ARG A N    5  
ATOM 9824  C CA   . ARG A 1 86  ? -4.617  -0.481  -3.266  1.00 0.48  ? 86  ARG A CA   5  
ATOM 9825  C C    . ARG A 1 86  ? -3.544  -1.120  -4.123  1.00 0.43  ? 86  ARG A C    5  
ATOM 9826  O O    . ARG A 1 86  ? -3.834  -1.808  -5.098  1.00 0.51  ? 86  ARG A O    5  
ATOM 9827  C CB   . ARG A 1 86  ? -4.874  -1.296  -2.021  1.00 0.62  ? 86  ARG A CB   5  
ATOM 9828  C CG   . ARG A 1 86  ? -5.556  -2.580  -2.295  1.00 0.85  ? 86  ARG A CG   5  
ATOM 9829  C CD   . ARG A 1 86  ? -6.721  -2.742  -1.371  1.00 0.65  ? 86  ARG A CD   5  
ATOM 9830  N NE   . ARG A 1 86  ? -7.470  -3.974  -1.626  1.00 1.27  ? 86  ARG A NE   5  
ATOM 9831  C CZ   . ARG A 1 86  ? -8.541  -4.035  -2.426  1.00 1.38  ? 86  ARG A CZ   5  
ATOM 9832  N NH1  . ARG A 1 86  ? -9.019  -2.933  -2.994  1.00 1.19  ? 86  ARG A NH1  5  
ATOM 9833  N NH2  . ARG A 1 86  ? -9.152  -5.191  -2.636  1.00 2.24  ? 86  ARG A NH2  5  
ATOM 9834  H H    . ARG A 1 86  ? -6.294  -1.109  -4.362  1.00 0.55  ? 86  ARG A H    5  
ATOM 9835  H HA   . ARG A 1 86  ? -4.293  0.491   -2.959  1.00 0.50  ? 86  ARG A HA   5  
ATOM 9836  H HB2  . ARG A 1 86  ? -3.945  -1.505  -1.532  1.00 1.45  ? 86  ARG A HB2  5  
ATOM 9837  H HB3  . ARG A 1 86  ? -5.503  -0.730  -1.370  1.00 1.30  ? 86  ARG A HB3  5  
ATOM 9838  H HG2  . ARG A 1 86  ? -5.906  -2.554  -3.287  1.00 1.55  ? 86  ARG A HG2  5  
ATOM 9839  H HG3  . ARG A 1 86  ? -4.858  -3.390  -2.155  1.00 1.67  ? 86  ARG A HG3  5  
ATOM 9840  H HD2  . ARG A 1 86  ? -6.334  -2.742  -0.379  1.00 1.04  ? 86  ARG A HD2  5  
ATOM 9841  H HD3  . ARG A 1 86  ? -7.382  -1.897  -1.496  1.00 1.07  ? 86  ARG A HD3  5  
ATOM 9842  H HE   . ARG A 1 86  ? -7.160  -4.793  -1.188  1.00 1.95  ? 86  ARG A HE   5  
ATOM 9843  H HH11 . ARG A 1 86  ? -8.589  -2.040  -2.822  1.00 1.35  ? 86  ARG A HH11 5  
ATOM 9844  H HH12 . ARG A 1 86  ? -9.807  -2.989  -3.615  1.00 1.49  ? 86  ARG A HH12 5  
ATOM 9845  H HH21 . ARG A 1 86  ? -8.824  -6.029  -2.195  1.00 2.89  ? 86  ARG A HH21 5  
ATOM 9846  H HH22 . ARG A 1 86  ? -9.952  -5.234  -3.242  1.00 2.35  ? 86  ARG A HH22 5  
ATOM 9847  N N    . HIS A 1 87  ? -2.308  -0.893  -3.740  1.00 0.37  ? 87  HIS A N    5  
ATOM 9848  C CA   . HIS A 1 87  ? -1.161  -1.379  -4.489  1.00 0.35  ? 87  HIS A CA   5  
ATOM 9849  C C    . HIS A 1 87  ? -0.380  -2.330  -3.605  1.00 0.34  ? 87  HIS A C    5  
ATOM 9850  O O    . HIS A 1 87  ? -0.161  -2.033  -2.435  1.00 0.47  ? 87  HIS A O    5  
ATOM 9851  C CB   . HIS A 1 87  ? -0.263  -0.216  -4.925  1.00 0.36  ? 87  HIS A CB   5  
ATOM 9852  C CG   . HIS A 1 87  ? -0.995  0.910   -5.583  1.00 0.41  ? 87  HIS A CG   5  
ATOM 9853  N ND1  . HIS A 1 87  ? -1.440  0.887   -6.889  1.00 0.52  ? 87  HIS A ND1  5  
ATOM 9854  C CD2  . HIS A 1 87  ? -1.363  2.108   -5.086  1.00 0.45  ? 87  HIS A CD2  5  
ATOM 9855  C CE1  . HIS A 1 87  ? -2.048  2.028   -7.162  1.00 0.60  ? 87  HIS A CE1  5  
ATOM 9856  N NE2  . HIS A 1 87  ? -2.014  2.784   -6.083  1.00 0.55  ? 87  HIS A NE2  5  
ATOM 9857  H H    . HIS A 1 87  ? -2.162  -0.402  -2.905  1.00 0.40  ? 87  HIS A H    5  
ATOM 9858  H HA   . HIS A 1 87  ? -1.520  -1.902  -5.357  1.00 0.39  ? 87  HIS A HA   5  
ATOM 9859  H HB2  . HIS A 1 87  ? 0.233   0.181   -4.060  1.00 0.32  ? 87  HIS A HB2  5  
ATOM 9860  H HB3  . HIS A 1 87  ? 0.481   -0.578  -5.611  1.00 0.41  ? 87  HIS A HB3  5  
ATOM 9861  H HD1  . HIS A 1 87  ? -1.344  0.138   -7.523  1.00 0.57  ? 87  HIS A HD1  5  
ATOM 9862  H HD2  . HIS A 1 87  ? -1.182  2.457   -4.081  1.00 0.46  ? 87  HIS A HD2  5  
ATOM 9863  H HE1  . HIS A 1 87  ? -2.495  2.296   -8.108  1.00 0.71  ? 87  HIS A HE1  5  
ATOM 9864  H HE2  . HIS A 1 87  ? -2.516  3.627   -5.968  1.00 0.63  ? 87  HIS A HE2  5  
ATOM 9865  N N    . MET A 1 88  ? 0.016   -3.474  -4.131  1.00 0.29  ? 88  MET A N    5  
ATOM 9866  C CA   . MET A 1 88  ? 0.707   -4.459  -3.322  1.00 0.25  ? 88  MET A CA   5  
ATOM 9867  C C    . MET A 1 88  ? 2.114   -4.709  -3.834  1.00 0.25  ? 88  MET A C    5  
ATOM 9868  O O    . MET A 1 88  ? 2.313   -5.052  -5.002  1.00 0.29  ? 88  MET A O    5  
ATOM 9869  C CB   . MET A 1 88  ? -0.072  -5.757  -3.297  1.00 0.27  ? 88  MET A CB   5  
ATOM 9870  C CG   . MET A 1 88  ? -1.465  -5.601  -2.735  1.00 0.44  ? 88  MET A CG   5  
ATOM 9871  S SD   . MET A 1 88  ? -2.502  -7.039  -3.016  1.00 0.62  ? 88  MET A SD   5  
ATOM 9872  C CE   . MET A 1 88  ? -4.056  -6.421  -2.396  1.00 0.73  ? 88  MET A CE   5  
ATOM 9873  H H    . MET A 1 88  ? -0.156  -3.666  -5.075  1.00 0.35  ? 88  MET A H    5  
ATOM 9874  H HA   . MET A 1 88  ? 0.759   -4.074  -2.314  1.00 0.24  ? 88  MET A HA   5  
ATOM 9875  H HB2  . MET A 1 88  ? -0.145  -6.151  -4.301  1.00 0.47  ? 88  MET A HB2  5  
ATOM 9876  H HB3  . MET A 1 88  ? 0.460   -6.453  -2.680  1.00 0.51  ? 88  MET A HB3  5  
ATOM 9877  H HG2  . MET A 1 88  ? -1.386  -5.440  -1.672  1.00 0.63  ? 88  MET A HG2  5  
ATOM 9878  H HG3  . MET A 1 88  ? -1.928  -4.743  -3.190  1.00 0.61  ? 88  MET A HG3  5  
ATOM 9879  H HE1  . MET A 1 88  ? -4.365  -5.572  -2.988  1.00 1.16  ? 88  MET A HE1  5  
ATOM 9880  H HE2  . MET A 1 88  ? -3.932  -6.115  -1.369  1.00 1.33  ? 88  MET A HE2  5  
ATOM 9881  H HE3  . MET A 1 88  ? -4.804  -7.196  -2.456  1.00 1.26  ? 88  MET A HE3  5  
ATOM 9882  N N    . PHE A 1 89  ? 3.085   -4.532  -2.954  1.00 0.25  ? 89  PHE A N    5  
ATOM 9883  C CA   . PHE A 1 89  ? 4.482   -4.753  -3.291  1.00 0.26  ? 89  PHE A CA   5  
ATOM 9884  C C    . PHE A 1 89  ? 5.060   -5.832  -2.388  1.00 0.26  ? 89  PHE A C    5  
ATOM 9885  O O    . PHE A 1 89  ? 4.877   -5.792  -1.169  1.00 0.30  ? 89  PHE A O    5  
ATOM 9886  C CB   . PHE A 1 89  ? 5.291   -3.468  -3.130  1.00 0.31  ? 89  PHE A CB   5  
ATOM 9887  C CG   . PHE A 1 89  ? 4.790   -2.304  -3.945  1.00 0.48  ? 89  PHE A CG   5  
ATOM 9888  C CD1  . PHE A 1 89  ? 3.598   -1.679  -3.624  1.00 0.76  ? 89  PHE A CD1  5  
ATOM 9889  C CD2  . PHE A 1 89  ? 5.528   -1.814  -5.009  1.00 0.55  ? 89  PHE A CD2  5  
ATOM 9890  C CE1  . PHE A 1 89  ? 3.147   -0.595  -4.349  1.00 0.94  ? 89  PHE A CE1  5  
ATOM 9891  C CE2  . PHE A 1 89  ? 5.078   -0.730  -5.741  1.00 0.77  ? 89  PHE A CE2  5  
ATOM 9892  C CZ   . PHE A 1 89  ? 3.887   -0.119  -5.408  1.00 0.91  ? 89  PHE A CZ   5  
ATOM 9893  H H    . PHE A 1 89  ? 2.855   -4.246  -2.042  1.00 0.26  ? 89  PHE A H    5  
ATOM 9894  H HA   . PHE A 1 89  ? 4.531   -5.080  -4.318  1.00 0.27  ? 89  PHE A HA   5  
ATOM 9895  H HB2  . PHE A 1 89  ? 5.270   -3.177  -2.094  1.00 0.44  ? 89  PHE A HB2  5  
ATOM 9896  H HB3  . PHE A 1 89  ? 6.312   -3.660  -3.419  1.00 0.22  ? 89  PHE A HB3  5  
ATOM 9897  H HD1  . PHE A 1 89  ? 3.015   -2.056  -2.800  1.00 0.91  ? 89  PHE A HD1  5  
ATOM 9898  H HD2  . PHE A 1 89  ? 6.462   -2.290  -5.271  1.00 0.60  ? 89  PHE A HD2  5  
ATOM 9899  H HE1  . PHE A 1 89  ? 2.215   -0.121  -4.087  1.00 1.18  ? 89  PHE A HE1  5  
ATOM 9900  H HE2  . PHE A 1 89  ? 5.659   -0.361  -6.571  1.00 0.92  ? 89  PHE A HE2  5  
ATOM 9901  H HZ   . PHE A 1 89  ? 3.536   0.728   -5.978  1.00 1.10  ? 89  PHE A HZ   5  
ATOM 9902  N N    . SER A 1 90  ? 5.758   -6.789  -2.975  1.00 0.26  ? 90  SER A N    5  
ATOM 9903  C CA   . SER A 1 90  ? 6.251   -7.934  -2.221  1.00 0.27  ? 90  SER A CA   5  
ATOM 9904  C C    . SER A 1 90  ? 7.721   -7.772  -1.853  1.00 0.27  ? 90  SER A C    5  
ATOM 9905  O O    . SER A 1 90  ? 8.540   -7.427  -2.685  1.00 0.37  ? 90  SER A O    5  
ATOM 9906  C CB   . SER A 1 90  ? 6.066   -9.223  -3.028  1.00 0.32  ? 90  SER A CB   5  
ATOM 9907  O OG   . SER A 1 90  ? 6.188   -10.369 -2.198  1.00 1.30  ? 90  SER A OG   5  
ATOM 9908  H H    . SER A 1 90  ? 5.941   -6.727  -3.936  1.00 0.28  ? 90  SER A H    5  
ATOM 9909  H HA   . SER A 1 90  ? 5.673   -8.005  -1.313  1.00 0.30  ? 90  SER A HA   5  
ATOM 9910  H HB2  . SER A 1 90  ? 5.091   -9.225  -3.485  1.00 0.87  ? 90  SER A HB2  5  
ATOM 9911  H HB3  . SER A 1 90  ? 6.822   -9.273  -3.796  1.00 0.66  ? 90  SER A HB3  5  
ATOM 9912  H HG   . SER A 1 90  ? 5.926   -10.137 -1.293  1.00 1.50  ? 90  SER A HG   5  
ATOM 9913  N N    . PHE A 1 91  ? 8.039   -8.034  -0.601  1.00 0.22  ? 91  PHE A N    5  
ATOM 9914  C CA   . PHE A 1 91  ? 9.424   -8.077  -0.144  1.00 0.24  ? 91  PHE A CA   5  
ATOM 9915  C C    . PHE A 1 91  ? 9.768   -9.502  0.238   1.00 0.29  ? 91  PHE A C    5  
ATOM 9916  O O    . PHE A 1 91  ? 8.936   -10.397 0.116   1.00 0.32  ? 91  PHE A O    5  
ATOM 9917  C CB   . PHE A 1 91  ? 9.660   -7.175  1.070   1.00 0.22  ? 91  PHE A CB   5  
ATOM 9918  C CG   . PHE A 1 91  ? 9.253   -5.750  0.872   1.00 0.20  ? 91  PHE A CG   5  
ATOM 9919  C CD1  . PHE A 1 91  ? 10.074  -4.851  0.217   1.00 0.25  ? 91  PHE A CD1  5  
ATOM 9920  C CD2  . PHE A 1 91  ? 8.044   -5.315  1.349   1.00 0.22  ? 91  PHE A CD2  5  
ATOM 9921  C CE1  . PHE A 1 91  ? 9.683   -3.539  0.045   1.00 0.31  ? 91  PHE A CE1  5  
ATOM 9922  C CE2  . PHE A 1 91  ? 7.645   -4.011  1.179   1.00 0.28  ? 91  PHE A CE2  5  
ATOM 9923  C CZ   . PHE A 1 91  ? 8.463   -3.119  0.529   1.00 0.32  ? 91  PHE A CZ   5  
ATOM 9924  H H    . PHE A 1 91  ? 7.323   -8.204  0.040   1.00 0.22  ? 91  PHE A H    5  
ATOM 9925  H HA   . PHE A 1 91  ? 10.060  -7.762  -0.958  1.00 0.26  ? 91  PHE A HA   5  
ATOM 9926  H HB2  . PHE A 1 91  ? 9.099   -7.563  1.908   1.00 0.25  ? 91  PHE A HB2  5  
ATOM 9927  H HB3  . PHE A 1 91  ? 10.712  -7.189  1.317   1.00 0.28  ? 91  PHE A HB3  5  
ATOM 9928  H HD1  . PHE A 1 91  ? 11.030  -5.183  -0.161  1.00 0.31  ? 91  PHE A HD1  5  
ATOM 9929  H HD2  . PHE A 1 91  ? 7.411   -6.011  1.866   1.00 0.25  ? 91  PHE A HD2  5  
ATOM 9930  H HE1  . PHE A 1 91  ? 10.331  -2.842  -0.467  1.00 0.38  ? 91  PHE A HE1  5  
ATOM 9931  H HE2  . PHE A 1 91  ? 6.695   -3.688  1.556   1.00 0.35  ? 91  PHE A HE2  5  
ATOM 9932  H HZ   . PHE A 1 91  ? 8.149   -2.096  0.396   1.00 0.40  ? 91  PHE A HZ   5  
ATOM 9933  N N    . ASN A 1 92  ? 10.996  -9.713  0.665   1.00 0.35  ? 92  ASN A N    5  
ATOM 9934  C CA   . ASN A 1 92  ? 11.431  -11.031 1.117   1.00 0.43  ? 92  ASN A CA   5  
ATOM 9935  C C    . ASN A 1 92  ? 12.146  -10.925 2.456   1.00 0.38  ? 92  ASN A C    5  
ATOM 9936  O O    . ASN A 1 92  ? 13.048  -11.705 2.762   1.00 0.46  ? 92  ASN A O    5  
ATOM 9937  C CB   . ASN A 1 92  ? 12.339  -11.699 0.079   1.00 0.62  ? 92  ASN A CB   5  
ATOM 9938  C CG   . ASN A 1 92  ? 13.502  -10.820 -0.345  1.00 0.70  ? 92  ASN A CG   5  
ATOM 9939  O OD1  . ASN A 1 92  ? 14.561  -10.826 0.281   1.00 1.17  ? 92  ASN A OD1  5  
ATOM 9940  N ND2  . ASN A 1 92  ? 13.316  -10.063 -1.418  1.00 1.11  ? 92  ASN A ND2  5  
ATOM 9941  H H    . ASN A 1 92  ? 11.629  -8.963  0.684   1.00 0.36  ? 92  ASN A H    5  
ATOM 9942  H HA   . ASN A 1 92  ? 10.546  -11.638 1.249   1.00 0.47  ? 92  ASN A HA   5  
ATOM 9943  H HB2  . ASN A 1 92  ? 12.739  -12.609 0.500   1.00 0.67  ? 92  ASN A HB2  5  
ATOM 9944  H HB3  . ASN A 1 92  ? 11.752  -11.942 -0.793  1.00 0.71  ? 92  ASN A HB3  5  
ATOM 9945  H HD21 . ASN A 1 92  ? 12.449  -10.109 -1.873  1.00 1.58  ? 92  ASN A HD21 5  
ATOM 9946  H HD22 . ASN A 1 92  ? 14.058  -9.493  -1.716  1.00 1.21  ? 92  ASN A HD22 5  
ATOM 9947  N N    . ASN A 1 93  ? 11.732  -9.952  3.257   1.00 0.32  ? 93  ASN A N    5  
ATOM 9948  C CA   . ASN A 1 93  ? 12.340  -9.723  4.557   1.00 0.34  ? 93  ASN A CA   5  
ATOM 9949  C C    . ASN A 1 93  ? 11.351  -8.980  5.451   1.00 0.32  ? 93  ASN A C    5  
ATOM 9950  O O    . ASN A 1 93  ? 10.840  -7.921  5.074   1.00 0.29  ? 93  ASN A O    5  
ATOM 9951  C CB   . ASN A 1 93  ? 13.637  -8.917  4.379   1.00 0.38  ? 93  ASN A CB   5  
ATOM 9952  C CG   . ASN A 1 93  ? 14.466  -8.789  5.646   1.00 0.87  ? 93  ASN A CG   5  
ATOM 9953  O OD1  . ASN A 1 93  ? 13.939  -8.733  6.752   1.00 1.62  ? 93  ASN A OD1  5  
ATOM 9954  N ND2  . ASN A 1 93  ? 15.779  -8.733  5.488   1.00 0.98  ? 93  ASN A ND2  5  
ATOM 9955  H H    . ASN A 1 93  ? 10.996  -9.371  2.968   1.00 0.33  ? 93  ASN A H    5  
ATOM 9956  H HA   . ASN A 1 93  ? 12.564  -10.683 4.996   1.00 0.40  ? 93  ASN A HA   5  
ATOM 9957  H HB2  . ASN A 1 93  ? 14.246  -9.399  3.629   1.00 0.79  ? 93  ASN A HB2  5  
ATOM 9958  H HB3  . ASN A 1 93  ? 13.384  -7.924  4.038   1.00 0.72  ? 93  ASN A HB3  5  
ATOM 9959  H HD21 . ASN A 1 93  ? 16.138  -8.776  4.576   1.00 1.05  ? 93  ASN A HD21 5  
ATOM 9960  H HD22 . ASN A 1 93  ? 16.341  -8.660  6.288   1.00 1.41  ? 93  ASN A HD22 5  
ATOM 9961  N N    . ARG A 1 94  ? 11.071  -9.550  6.623   1.00 0.42  ? 94  ARG A N    5  
ATOM 9962  C CA   . ARG A 1 94  ? 10.088  -8.974  7.543   1.00 0.45  ? 94  ARG A CA   5  
ATOM 9963  C C    . ARG A 1 94  ? 10.596  -7.660  8.117   1.00 0.35  ? 94  ARG A C    5  
ATOM 9964  O O    . ARG A 1 94  ? 9.813   -6.756  8.414   1.00 0.36  ? 94  ARG A O    5  
ATOM 9965  C CB   . ARG A 1 94  ? 9.744   -9.937  8.686   1.00 0.64  ? 94  ARG A CB   5  
ATOM 9966  C CG   . ARG A 1 94  ? 8.832   -11.088 8.294   1.00 1.15  ? 94  ARG A CG   5  
ATOM 9967  C CD   . ARG A 1 94  ? 9.535   -12.106 7.411   1.00 1.32  ? 94  ARG A CD   5  
ATOM 9968  N NE   . ARG A 1 94  ? 8.662   -13.231 7.087   1.00 2.12  ? 94  ARG A NE   5  
ATOM 9969  C CZ   . ARG A 1 94  ? 9.084   -14.485 6.925   1.00 2.84  ? 94  ARG A CZ   5  
ATOM 9970  N NH1  . ARG A 1 94  ? 10.372  -14.780 7.041   1.00 3.14  ? 94  ARG A NH1  5  
ATOM 9971  N NH2  . ARG A 1 94  ? 8.212   -15.443 6.650   1.00 3.68  ? 94  ARG A NH2  5  
ATOM 9972  H H    . ARG A 1 94  ? 11.553  -10.367 6.885   1.00 0.50  ? 94  ARG A H    5  
ATOM 9973  H HA   . ARG A 1 94  ? 9.190   -8.774  6.975   1.00 0.49  ? 94  ARG A HA   5  
ATOM 9974  H HB2  . ARG A 1 94  ? 10.656  -10.356 9.075   1.00 0.98  ? 94  ARG A HB2  5  
ATOM 9975  H HB3  . ARG A 1 94  ? 9.258   -9.377  9.472   1.00 0.78  ? 94  ARG A HB3  5  
ATOM 9976  H HG2  . ARG A 1 94  ? 8.500   -11.584 9.192   1.00 1.71  ? 94  ARG A HG2  5  
ATOM 9977  H HG3  . ARG A 1 94  ? 7.978   -10.693 7.763   1.00 1.82  ? 94  ARG A HG3  5  
ATOM 9978  H HD2  . ARG A 1 94  ? 9.840   -11.622 6.495   1.00 1.72  ? 94  ARG A HD2  5  
ATOM 9979  H HD3  . ARG A 1 94  ? 10.406  -12.475 7.931   1.00 1.56  ? 94  ARG A HD3  5  
ATOM 9980  H HE   . ARG A 1 94  ? 7.700   -13.040 6.993   1.00 2.50  ? 94  ARG A HE   5  
ATOM 9981  H HH11 . ARG A 1 94  ? 11.039  -14.062 7.253   1.00 2.91  ? 94  ARG A HH11 5  
ATOM 9982  H HH12 . ARG A 1 94  ? 10.689  -15.724 6.910   1.00 3.89  ? 94  ARG A HH12 5  
ATOM 9983  H HH21 . ARG A 1 94  ? 7.238   -15.225 6.560   1.00 3.93  ? 94  ARG A HH21 5  
ATOM 9984  H HH22 . ARG A 1 94  ? 8.521   -16.394 6.543   1.00 4.27  ? 94  ARG A HH22 5  
ATOM 9985  N N    . THR A 1 95  ? 11.908  -7.561  8.272   1.00 0.34  ? 95  THR A N    5  
ATOM 9986  C CA   . THR A 1 95  ? 12.538  -6.325  8.696   1.00 0.31  ? 95  THR A CA   5  
ATOM 9987  C C    . THR A 1 95  ? 12.226  -5.210  7.702   1.00 0.26  ? 95  THR A C    5  
ATOM 9988  O O    . THR A 1 95  ? 11.728  -4.147  8.079   1.00 0.27  ? 95  THR A O    5  
ATOM 9989  C CB   . THR A 1 95  ? 14.059  -6.501  8.825   1.00 0.40  ? 95  THR A CB   5  
ATOM 9990  O OG1  . THR A 1 95  ? 14.357  -7.486  9.826   1.00 0.50  ? 95  THR A OG1  5  
ATOM 9991  C CG2  . THR A 1 95  ? 14.735  -5.184  9.166   1.00 0.44  ? 95  THR A CG2  5  
ATOM 9992  H H    . THR A 1 95  ? 12.471  -8.349  8.093   1.00 0.40  ? 95  THR A H    5  
ATOM 9993  H HA   . THR A 1 95  ? 12.145  -6.060  9.661   1.00 0.33  ? 95  THR A HA   5  
ATOM 9994  H HB   . THR A 1 95  ? 14.433  -6.844  7.879   1.00 0.42  ? 95  THR A HB   5  
ATOM 9995  H HG1  . THR A 1 95  ? 14.447  -8.355  9.404   1.00 0.94  ? 95  THR A HG1  5  
ATOM 9996  H HG21 . THR A 1 95  ? 14.536  -4.469  8.382   1.00 1.02  ? 95  THR A HG21 5  
ATOM 9997  H HG22 . THR A 1 95  ? 15.800  -5.337  9.253   1.00 1.07  ? 95  THR A HG22 5  
ATOM 9998  H HG23 . THR A 1 95  ? 14.347  -4.811  10.102  1.00 1.10  ? 95  THR A HG23 5  
ATOM 9999  N N    . VAL A 1 96  ? 12.506  -5.476  6.427   1.00 0.24  ? 96  VAL A N    5  
ATOM 10000 C CA   . VAL A 1 96  ? 12.154  -4.556  5.346   1.00 0.22  ? 96  VAL A CA   5  
ATOM 10001 C C    . VAL A 1 96  ? 10.682  -4.177  5.419   1.00 0.21  ? 96  VAL A C    5  
ATOM 10002 O O    . VAL A 1 96  ? 10.338  -2.997  5.360   1.00 0.22  ? 96  VAL A O    5  
ATOM 10003 C CB   . VAL A 1 96  ? 12.449  -5.167  3.959   1.00 0.22  ? 96  VAL A CB   5  
ATOM 10004 C CG1  . VAL A 1 96  ? 11.870  -4.311  2.845   1.00 0.22  ? 96  VAL A CG1  5  
ATOM 10005 C CG2  . VAL A 1 96  ? 13.941  -5.334  3.752   1.00 0.27  ? 96  VAL A CG2  5  
ATOM 10006 H H    . VAL A 1 96  ? 12.975  -6.306  6.212   1.00 0.26  ? 96  VAL A H    5  
ATOM 10007 H HA   . VAL A 1 96  ? 12.752  -3.664  5.460   1.00 0.25  ? 96  VAL A HA   5  
ATOM 10008 H HB   . VAL A 1 96  ? 11.990  -6.143  3.910   1.00 0.23  ? 96  VAL A HB   5  
ATOM 10009 H HG11 . VAL A 1 96  ? 12.110  -3.274  3.027   1.00 1.01  ? 96  VAL A HG11 5  
ATOM 10010 H HG12 . VAL A 1 96  ? 10.790  -4.439  2.804   1.00 1.03  ? 96  VAL A HG12 5  
ATOM 10011 H HG13 . VAL A 1 96  ? 12.306  -4.618  1.905   1.00 1.03  ? 96  VAL A HG13 5  
ATOM 10012 H HG21 . VAL A 1 96  ? 14.120  -5.702  2.752   1.00 1.03  ? 96  VAL A HG21 5  
ATOM 10013 H HG22 . VAL A 1 96  ? 14.331  -6.036  4.473   1.00 1.07  ? 96  VAL A HG22 5  
ATOM 10014 H HG23 . VAL A 1 96  ? 14.428  -4.379  3.874   1.00 1.05  ? 96  VAL A HG23 5  
ATOM 10015 N N    . MET A 1 97  ? 9.823   -5.184  5.553   1.00 0.26  ? 97  MET A N    5  
ATOM 10016 C CA   . MET A 1 97  ? 8.392   -4.953  5.700   1.00 0.39  ? 97  MET A CA   5  
ATOM 10017 C C    . MET A 1 97  ? 8.090   -3.932  6.783   1.00 0.34  ? 97  MET A C    5  
ATOM 10018 O O    . MET A 1 97  ? 7.315   -3.012  6.564   1.00 0.34  ? 97  MET A O    5  
ATOM 10019 C CB   . MET A 1 97  ? 7.658   -6.242  6.033   1.00 0.62  ? 97  MET A CB   5  
ATOM 10020 C CG   . MET A 1 97  ? 7.510   -7.179  4.860   1.00 0.62  ? 97  MET A CG   5  
ATOM 10021 S SD   . MET A 1 97  ? 6.172   -8.358  5.109   1.00 0.84  ? 97  MET A SD   5  
ATOM 10022 C CE   . MET A 1 97  ? 4.801   -7.251  5.429   1.00 0.37  ? 97  MET A CE   5  
ATOM 10023 H H    . MET A 1 97  ? 10.158  -6.111  5.529   1.00 0.24  ? 97  MET A H    5  
ATOM 10024 H HA   . MET A 1 97  ? 8.022   -4.577  4.758   1.00 0.47  ? 97  MET A HA   5  
ATOM 10025 H HB2  . MET A 1 97  ? 8.197   -6.757  6.814   1.00 1.36  ? 97  MET A HB2  5  
ATOM 10026 H HB3  . MET A 1 97  ? 6.672   -5.993  6.396   1.00 1.35  ? 97  MET A HB3  5  
ATOM 10027 H HG2  . MET A 1 97  ? 7.310   -6.599  3.974   1.00 1.26  ? 97  MET A HG2  5  
ATOM 10028 H HG3  . MET A 1 97  ? 8.434   -7.726  4.733   1.00 1.33  ? 97  MET A HG3  5  
ATOM 10029 H HE1  . MET A 1 97  ? 4.764   -6.479  4.669   1.00 1.03  ? 97  MET A HE1  5  
ATOM 10030 H HE2  . MET A 1 97  ? 4.924   -6.793  6.399   1.00 0.97  ? 97  MET A HE2  5  
ATOM 10031 H HE3  . MET A 1 97  ? 3.878   -7.810  5.414   1.00 1.05  ? 97  MET A HE3  5  
ATOM 10032 N N    . ASP A 1 98  ? 8.695   -4.099  7.949   1.00 0.36  ? 98  ASP A N    5  
ATOM 10033 C CA   . ASP A 1 98  ? 8.421   -3.212  9.071   1.00 0.36  ? 98  ASP A CA   5  
ATOM 10034 C C    . ASP A 1 98  ? 8.973   -1.816  8.808   1.00 0.28  ? 98  ASP A C    5  
ATOM 10035 O O    . ASP A 1 98  ? 8.352   -0.817  9.168   1.00 0.29  ? 98  ASP A O    5  
ATOM 10036 C CB   . ASP A 1 98  ? 9.012   -3.772  10.365  1.00 0.45  ? 98  ASP A CB   5  
ATOM 10037 C CG   . ASP A 1 98  ? 8.661   -2.924  11.574  1.00 0.55  ? 98  ASP A CG   5  
ATOM 10038 O OD1  . ASP A 1 98  ? 7.556   -3.103  12.132  1.00 0.67  ? 98  ASP A OD1  5  
ATOM 10039 O OD2  . ASP A 1 98  ? 9.489   -2.070  11.969  1.00 0.61  ? 98  ASP A OD2  5  
ATOM 10040 H H    . ASP A 1 98  ? 9.339   -4.836  8.059   1.00 0.41  ? 98  ASP A H    5  
ATOM 10041 H HA   . ASP A 1 98  ? 7.346   -3.146  9.174   1.00 0.39  ? 98  ASP A HA   5  
ATOM 10042 H HB2  . ASP A 1 98  ? 8.634   -4.770  10.524  1.00 0.51  ? 98  ASP A HB2  5  
ATOM 10043 H HB3  . ASP A 1 98  ? 10.087  -3.808  10.275  1.00 0.44  ? 98  ASP A HB3  5  
ATOM 10044 N N    . ASN A 1 99  ? 10.133  -1.758  8.167   1.00 0.22  ? 99  ASN A N    5  
ATOM 10045 C CA   . ASN A 1 99  ? 10.755  -0.493  7.806   1.00 0.21  ? 99  ASN A CA   5  
ATOM 10046 C C    . ASN A 1 99  ? 9.864   0.280   6.844   1.00 0.15  ? 99  ASN A C    5  
ATOM 10047 O O    . ASN A 1 99  ? 9.525   1.439   7.089   1.00 0.18  ? 99  ASN A O    5  
ATOM 10048 C CB   . ASN A 1 99  ? 12.116  -0.751  7.160   1.00 0.26  ? 99  ASN A CB   5  
ATOM 10049 C CG   . ASN A 1 99  ? 13.215  -1.072  8.158   1.00 0.77  ? 99  ASN A CG   5  
ATOM 10050 O OD1  . ASN A 1 99  ? 14.389  -0.812  7.900   1.00 1.55  ? 99  ASN A OD1  5  
ATOM 10051 N ND2  . ASN A 1 99  ? 12.851  -1.636  9.301   1.00 1.17  ? 99  ASN A ND2  5  
ATOM 10052 H H    . ASN A 1 99  ? 10.587  -2.592  7.918   1.00 0.21  ? 99  ASN A H    5  
ATOM 10053 H HA   . ASN A 1 99  ? 10.890  0.088   8.708   1.00 0.28  ? 99  ASN A HA   5  
ATOM 10054 H HB2  . ASN A 1 99  ? 12.027  -1.584  6.479   1.00 0.64  ? 99  ASN A HB2  5  
ATOM 10055 H HB3  . ASN A 1 99  ? 12.405  0.121   6.606   1.00 0.50  ? 99  ASN A HB3  5  
ATOM 10056 H HD21 . ASN A 1 99  ? 11.898  -1.816  9.448   1.00 1.55  ? 99  ASN A HD21 5  
ATOM 10057 H HD22 . ASN A 1 99  ? 13.549  -1.850  9.954   1.00 1.51  ? 99  ASN A HD22 5  
ATOM 10058 N N    . ILE A 1 100 ? 9.487   -0.377  5.755   1.00 0.12  ? 100 ILE A N    5  
ATOM 10059 C CA   . ILE A 1 100 ? 8.573   0.193   4.774   1.00 0.14  ? 100 ILE A CA   5  
ATOM 10060 C C    . ILE A 1 100 ? 7.216   0.473   5.424   1.00 0.16  ? 100 ILE A C    5  
ATOM 10061 O O    . ILE A 1 100 ? 6.622   1.514   5.179   1.00 0.20  ? 100 ILE A O    5  
ATOM 10062 C CB   . ILE A 1 100 ? 8.419   -0.749  3.561   1.00 0.18  ? 100 ILE A CB   5  
ATOM 10063 C CG1  . ILE A 1 100 ? 9.794   -1.050  2.932   1.00 0.18  ? 100 ILE A CG1  5  
ATOM 10064 C CG2  . ILE A 1 100 ? 7.482   -0.144  2.530   1.00 0.22  ? 100 ILE A CG2  5  
ATOM 10065 C CD1  . ILE A 1 100 ? 10.557  0.177   2.457   1.00 0.18  ? 100 ILE A CD1  5  
ATOM 10066 H H    . ILE A 1 100 ? 9.835   -1.288  5.606   1.00 0.14  ? 100 ILE A H    5  
ATOM 10067 H HA   . ILE A 1 100 ? 8.980   1.135   4.416   1.00 0.16  ? 100 ILE A HA   5  
ATOM 10068 H HB   . ILE A 1 100 ? 7.982   -1.674  3.906   1.00 0.20  ? 100 ILE A HB   5  
ATOM 10069 H HG12 . ILE A 1 100 ? 10.409  -1.554  3.661   1.00 0.19  ? 100 ILE A HG12 5  
ATOM 10070 H HG13 . ILE A 1 100 ? 9.653   -1.700  2.080   1.00 0.21  ? 100 ILE A HG13 5  
ATOM 10071 H HG21 . ILE A 1 100 ? 7.403   -0.806  1.683   1.00 1.03  ? 100 ILE A HG21 5  
ATOM 10072 H HG22 . ILE A 1 100 ? 7.873   0.811   2.207   1.00 1.05  ? 100 ILE A HG22 5  
ATOM 10073 H HG23 . ILE A 1 100 ? 6.508   -0.004  2.971   1.00 1.01  ? 100 ILE A HG23 5  
ATOM 10074 H HD11 . ILE A 1 100 ? 10.786  0.809   3.301   1.00 1.02  ? 100 ILE A HD11 5  
ATOM 10075 H HD12 . ILE A 1 100 ? 9.954   0.726   1.750   1.00 1.07  ? 100 ILE A HD12 5  
ATOM 10076 H HD13 . ILE A 1 100 ? 11.482  -0.129  1.976   1.00 1.01  ? 100 ILE A HD13 5  
ATOM 10077 N N    . LYS A 1 101 ? 6.745   -0.431  6.282   1.00 0.17  ? 101 LYS A N    5  
ATOM 10078 C CA   . LYS A 1 101 ? 5.509   -0.191  7.026   1.00 0.22  ? 101 LYS A CA   5  
ATOM 10079 C C    . LYS A 1 101 ? 5.565   1.155   7.725   1.00 0.21  ? 101 LYS A C    5  
ATOM 10080 O O    . LYS A 1 101 ? 4.797   2.061   7.416   1.00 0.25  ? 101 LYS A O    5  
ATOM 10081 C CB   . LYS A 1 101 ? 5.251   -1.268  8.082   1.00 0.28  ? 101 LYS A CB   5  
ATOM 10082 C CG   . LYS A 1 101 ? 4.343   -2.369  7.613   1.00 0.49  ? 101 LYS A CG   5  
ATOM 10083 C CD   . LYS A 1 101 ? 3.955   -3.295  8.734   1.00 0.65  ? 101 LYS A CD   5  
ATOM 10084 C CE   . LYS A 1 101 ? 5.132   -4.036  9.317   1.00 0.63  ? 101 LYS A CE   5  
ATOM 10085 N NZ   . LYS A 1 101 ? 4.699   -5.107  10.252  1.00 0.92  ? 101 LYS A NZ   5  
ATOM 10086 H H    . LYS A 1 101 ? 7.232   -1.276  6.414   1.00 0.19  ? 101 LYS A H    5  
ATOM 10087 H HA   . LYS A 1 101 ? 4.694   -0.192  6.316   1.00 0.26  ? 101 LYS A HA   5  
ATOM 10088 H HB2  . LYS A 1 101 ? 6.185   -1.716  8.367   1.00 0.54  ? 101 LYS A HB2  5  
ATOM 10089 H HB3  . LYS A 1 101 ? 4.803   -0.809  8.949   1.00 0.49  ? 101 LYS A HB3  5  
ATOM 10090 H HG2  . LYS A 1 101 ? 3.447   -1.932  7.205   1.00 0.71  ? 101 LYS A HG2  5  
ATOM 10091 H HG3  . LYS A 1 101 ? 4.850   -2.933  6.858   1.00 0.73  ? 101 LYS A HG3  5  
ATOM 10092 H HD2  . LYS A 1 101 ? 3.492   -2.719  9.501   1.00 1.34  ? 101 LYS A HD2  5  
ATOM 10093 H HD3  . LYS A 1 101 ? 3.265   -4.006  8.353   1.00 1.33  ? 101 LYS A HD3  5  
ATOM 10094 H HE2  . LYS A 1 101 ? 5.688   -4.477  8.507   1.00 1.36  ? 101 LYS A HE2  5  
ATOM 10095 H HE3  . LYS A 1 101 ? 5.749   -3.334  9.852   1.00 1.37  ? 101 LYS A HE3  5  
ATOM 10096 H HZ1  . LYS A 1 101 ? 4.181   -4.694  11.053  1.00 1.30  ? 101 LYS A HZ1  5  
ATOM 10097 H HZ2  . LYS A 1 101 ? 5.522   -5.625  10.616  1.00 1.45  ? 101 LYS A HZ2  5  
ATOM 10098 H HZ3  . LYS A 1 101 ? 4.073   -5.778  9.763   1.00 1.55  ? 101 LYS A HZ3  5  
ATOM 10099 N N    . MET A 1 102 ? 6.505   1.264   8.653   1.00 0.20  ? 102 MET A N    5  
ATOM 10100 C CA   . MET A 1 102 ? 6.687   2.439   9.461   1.00 0.23  ? 102 MET A CA   5  
ATOM 10101 C C    . MET A 1 102 ? 6.877   3.694   8.618   1.00 0.20  ? 102 MET A C    5  
ATOM 10102 O O    . MET A 1 102 ? 6.239   4.719   8.868   1.00 0.26  ? 102 MET A O    5  
ATOM 10103 C CB   . MET A 1 102 ? 7.906   2.220   10.333  1.00 0.25  ? 102 MET A CB   5  
ATOM 10104 C CG   . MET A 1 102 ? 8.067   3.272   11.390  1.00 0.79  ? 102 MET A CG   5  
ATOM 10105 S SD   . MET A 1 102 ? 9.594   3.101   12.338  1.00 0.83  ? 102 MET A SD   5  
ATOM 10106 C CE   . MET A 1 102 ? 10.823  3.330   11.053  1.00 1.41  ? 102 MET A CE   5  
ATOM 10107 H H    . MET A 1 102 ? 7.105   0.510   8.813   1.00 0.19  ? 102 MET A H    5  
ATOM 10108 H HA   . MET A 1 102 ? 5.825   2.558   10.085  1.00 0.28  ? 102 MET A HA   5  
ATOM 10109 H HB2  . MET A 1 102 ? 7.826   1.259   10.814  1.00 0.59  ? 102 MET A HB2  5  
ATOM 10110 H HB3  . MET A 1 102 ? 8.777   2.228   9.708   1.00 0.57  ? 102 MET A HB3  5  
ATOM 10111 H HG2  . MET A 1 102 ? 8.059   4.232   10.907  1.00 1.14  ? 102 MET A HG2  5  
ATOM 10112 H HG3  . MET A 1 102 ? 7.229   3.197   12.058  1.00 1.13  ? 102 MET A HG3  5  
ATOM 10113 H HE1  . MET A 1 102 ? 11.811  3.293   11.489  1.00 1.87  ? 102 MET A HE1  5  
ATOM 10114 H HE2  . MET A 1 102 ? 10.676  4.289   10.579  1.00 1.92  ? 102 MET A HE2  5  
ATOM 10115 H HE3  . MET A 1 102 ? 10.725  2.546   10.317  1.00 1.78  ? 102 MET A HE3  5  
ATOM 10116 N N    . THR A 1 103 ? 7.758   3.599   7.628   1.00 0.15  ? 103 THR A N    5  
ATOM 10117 C CA   . THR A 1 103 ? 8.055   4.717   6.747   1.00 0.16  ? 103 THR A CA   5  
ATOM 10118 C C    . THR A 1 103 ? 6.780   5.293   6.142   1.00 0.18  ? 103 THR A C    5  
ATOM 10119 O O    . THR A 1 103 ? 6.486   6.478   6.293   1.00 0.24  ? 103 THR A O    5  
ATOM 10120 C CB   . THR A 1 103 ? 8.998   4.289   5.605   1.00 0.18  ? 103 THR A CB   5  
ATOM 10121 O OG1  . THR A 1 103 ? 10.231  3.782   6.136   1.00 0.23  ? 103 THR A OG1  5  
ATOM 10122 C CG2  . THR A 1 103 ? 9.283   5.460   4.683   1.00 0.27  ? 103 THR A CG2  5  
ATOM 10123 H H    . THR A 1 103 ? 8.222   2.747   7.486   1.00 0.14  ? 103 THR A H    5  
ATOM 10124 H HA   . THR A 1 103 ? 8.547   5.479   7.326   1.00 0.19  ? 103 THR A HA   5  
ATOM 10125 H HB   . THR A 1 103 ? 8.514   3.509   5.032   1.00 0.19  ? 103 THR A HB   5  
ATOM 10126 H HG1  . THR A 1 103 ? 10.042  3.038   6.724   1.00 0.47  ? 103 THR A HG1  5  
ATOM 10127 H HG21 . THR A 1 103 ? 8.354   5.938   4.417   1.00 1.04  ? 103 THR A HG21 5  
ATOM 10128 H HG22 . THR A 1 103 ? 9.769   5.102   3.790   1.00 1.00  ? 103 THR A HG22 5  
ATOM 10129 H HG23 . THR A 1 103 ? 9.923   6.167   5.186   1.00 1.07  ? 103 THR A HG23 5  
ATOM 10130 N N    . LEU A 1 104 ? 6.019   4.435   5.483   1.00 0.16  ? 104 LEU A N    5  
ATOM 10131 C CA   . LEU A 1 104 ? 4.835   4.860   4.757   1.00 0.20  ? 104 LEU A CA   5  
ATOM 10132 C C    . LEU A 1 104 ? 3.773   5.302   5.748   1.00 0.22  ? 104 LEU A C    5  
ATOM 10133 O O    . LEU A 1 104 ? 3.196   6.379   5.621   1.00 0.26  ? 104 LEU A O    5  
ATOM 10134 C CB   . LEU A 1 104 ? 4.289   3.709   3.894   1.00 0.23  ? 104 LEU A CB   5  
ATOM 10135 C CG   . LEU A 1 104 ? 5.119   3.300   2.660   1.00 0.25  ? 104 LEU A CG   5  
ATOM 10136 C CD1  . LEU A 1 104 ? 6.597   3.278   2.965   1.00 0.99  ? 104 LEU A CD1  5  
ATOM 10137 C CD2  . LEU A 1 104 ? 4.690   1.923   2.195   1.00 1.03  ? 104 LEU A CD2  5  
ATOM 10138 H H    . LEU A 1 104 ? 6.251   3.479   5.496   1.00 0.16  ? 104 LEU A H    5  
ATOM 10139 H HA   . LEU A 1 104 ? 5.108   5.692   4.119   1.00 0.23  ? 104 LEU A HA   5  
ATOM 10140 H HB2  . LEU A 1 104 ? 4.189   2.840   4.527   1.00 0.22  ? 104 LEU A HB2  5  
ATOM 10141 H HB3  . LEU A 1 104 ? 3.303   3.991   3.553   1.00 0.26  ? 104 LEU A HB3  5  
ATOM 10142 H HG   . LEU A 1 104 ? 4.958   3.995   1.851   1.00 0.76  ? 104 LEU A HG   5  
ATOM 10143 H HD11 . LEU A 1 104 ? 7.138   2.960   2.091   1.00 1.58  ? 104 LEU A HD11 5  
ATOM 10144 H HD12 . LEU A 1 104 ? 6.787   2.591   3.775   1.00 1.46  ? 104 LEU A HD12 5  
ATOM 10145 H HD13 . LEU A 1 104 ? 6.920   4.268   3.250   1.00 1.67  ? 104 LEU A HD13 5  
ATOM 10146 H HD21 . LEU A 1 104 ? 3.626   1.917   2.013   1.00 1.69  ? 104 LEU A HD21 5  
ATOM 10147 H HD22 . LEU A 1 104 ? 4.933   1.201   2.964   1.00 1.54  ? 104 LEU A HD22 5  
ATOM 10148 H HD23 . LEU A 1 104 ? 5.217   1.671   1.288   1.00 1.59  ? 104 LEU A HD23 5  
ATOM 10149 N N    . GLN A 1 105 ? 3.553   4.453   6.748   1.00 0.22  ? 105 GLN A N    5  
ATOM 10150 C CA   . GLN A 1 105 ? 2.567   4.676   7.786   1.00 0.27  ? 105 GLN A CA   5  
ATOM 10151 C C    . GLN A 1 105 ? 2.675   6.074   8.382   1.00 0.25  ? 105 GLN A C    5  
ATOM 10152 O O    . GLN A 1 105 ? 1.698   6.818   8.392   1.00 0.27  ? 105 GLN A O    5  
ATOM 10153 C CB   . GLN A 1 105 ? 2.755   3.613   8.864   1.00 0.33  ? 105 GLN A CB   5  
ATOM 10154 C CG   . GLN A 1 105 ? 1.492   3.281   9.622   1.00 0.55  ? 105 GLN A CG   5  
ATOM 10155 C CD   . GLN A 1 105 ? 1.210   4.236   10.761  1.00 1.00  ? 105 GLN A CD   5  
ATOM 10156 O OE1  . GLN A 1 105 ? 2.127   4.791   11.363  1.00 1.72  ? 105 GLN A OE1  5  
ATOM 10157 N NE2  . GLN A 1 105 ? -0.060  4.427   11.069  1.00 1.60  ? 105 GLN A NE2  5  
ATOM 10158 H H    . GLN A 1 105 ? 4.073   3.620   6.786   1.00 0.21  ? 105 GLN A H    5  
ATOM 10159 H HA   . GLN A 1 105 ? 1.588   4.557   7.352   1.00 0.34  ? 105 GLN A HA   5  
ATOM 10160 H HB2  . GLN A 1 105 ? 3.128   2.707   8.409   1.00 0.29  ? 105 GLN A HB2  5  
ATOM 10161 H HB3  . GLN A 1 105 ? 3.482   3.963   9.565   1.00 0.36  ? 105 GLN A HB3  5  
ATOM 10162 H HG2  . GLN A 1 105 ? 0.666   3.320   8.935   1.00 0.67  ? 105 GLN A HG2  5  
ATOM 10163 H HG3  . GLN A 1 105 ? 1.584   2.287   10.011  1.00 0.76  ? 105 GLN A HG3  5  
ATOM 10164 H HE21 . GLN A 1 105 ? -0.740  3.942   10.552  1.00 2.10  ? 105 GLN A HE21 5  
ATOM 10165 H HE22 . GLN A 1 105 ? -0.272  5.047   11.797  1.00 1.93  ? 105 GLN A HE22 5  
ATOM 10166 N N    . GLN A 1 106 ? 3.860   6.440   8.853   1.00 0.23  ? 106 GLN A N    5  
ATOM 10167 C CA   . GLN A 1 106 ? 4.048   7.717   9.515   1.00 0.25  ? 106 GLN A CA   5  
ATOM 10168 C C    . GLN A 1 106 ? 3.843   8.891   8.567   1.00 0.22  ? 106 GLN A C    5  
ATOM 10169 O O    . GLN A 1 106 ? 3.126   9.830   8.900   1.00 0.25  ? 106 GLN A O    5  
ATOM 10170 C CB   . GLN A 1 106 ? 5.428   7.778   10.157  1.00 0.31  ? 106 GLN A CB   5  
ATOM 10171 C CG   . GLN A 1 106 ? 5.521   6.990   11.452  1.00 0.37  ? 106 GLN A CG   5  
ATOM 10172 C CD   . GLN A 1 106 ? 4.553   7.497   12.506  1.00 1.40  ? 106 GLN A CD   5  
ATOM 10173 O OE1  . GLN A 1 106 ? 3.411   7.046   12.585  1.00 2.15  ? 106 GLN A OE1  5  
ATOM 10174 N NE2  . GLN A 1 106 ? 4.999   8.441   13.320  1.00 2.21  ? 106 GLN A NE2  5  
ATOM 10175 H H    . GLN A 1 106 ? 4.629   5.836   8.754   1.00 0.23  ? 106 GLN A H    5  
ATOM 10176 H HA   . GLN A 1 106 ? 3.305   7.787   10.296  1.00 0.28  ? 106 GLN A HA   5  
ATOM 10177 H HB2  . GLN A 1 106 ? 6.149   7.377   9.462   1.00 0.34  ? 106 GLN A HB2  5  
ATOM 10178 H HB3  . GLN A 1 106 ? 5.670   8.803   10.362  1.00 0.36  ? 106 GLN A HB3  5  
ATOM 10179 H HG2  . GLN A 1 106 ? 5.296   5.954   11.247  1.00 0.87  ? 106 GLN A HG2  5  
ATOM 10180 H HG3  . GLN A 1 106 ? 6.524   7.070   11.837  1.00 0.89  ? 106 GLN A HG3  5  
ATOM 10181 H HE21 . GLN A 1 106 ? 5.919   8.759   13.203  1.00 2.44  ? 106 GLN A HE21 5  
ATOM 10182 H HE22 . GLN A 1 106 ? 4.389   8.783   14.011  1.00 2.91  ? 106 GLN A HE22 5  
ATOM 10183 N N    . ILE A 1 107 ? 4.448   8.839   7.383   1.00 0.21  ? 107 ILE A N    5  
ATOM 10184 C CA   . ILE A 1 107 ? 4.304   9.930   6.420   1.00 0.23  ? 107 ILE A CA   5  
ATOM 10185 C C    . ILE A 1 107 ? 2.846   10.073  5.998   1.00 0.26  ? 107 ILE A C    5  
ATOM 10186 O O    . ILE A 1 107 ? 2.314   11.179  5.923   1.00 0.31  ? 107 ILE A O    5  
ATOM 10187 C CB   . ILE A 1 107 ? 5.175   9.726   5.162   1.00 0.25  ? 107 ILE A CB   5  
ATOM 10188 C CG1  . ILE A 1 107 ? 6.630   9.437   5.532   1.00 0.22  ? 107 ILE A CG1  5  
ATOM 10189 C CG2  . ILE A 1 107 ? 5.102   10.962  4.287   1.00 0.39  ? 107 ILE A CG2  5  
ATOM 10190 C CD1  . ILE A 1 107 ? 7.496   9.058   4.347   1.00 0.25  ? 107 ILE A CD1  5  
ATOM 10191 H H    . ILE A 1 107 ? 4.995   8.056   7.152   1.00 0.21  ? 107 ILE A H    5  
ATOM 10192 H HA   . ILE A 1 107 ? 4.611   10.846  6.907   1.00 0.25  ? 107 ILE A HA   5  
ATOM 10193 H HB   . ILE A 1 107 ? 4.776   8.892   4.604   1.00 0.27  ? 107 ILE A HB   5  
ATOM 10194 H HG12 . ILE A 1 107 ? 7.061   10.315  5.990   1.00 0.27  ? 107 ILE A HG12 5  
ATOM 10195 H HG13 . ILE A 1 107 ? 6.658   8.623   6.230   1.00 0.20  ? 107 ILE A HG13 5  
ATOM 10196 H HG21 . ILE A 1 107 ? 5.285   11.840  4.889   1.00 1.16  ? 107 ILE A HG21 5  
ATOM 10197 H HG22 . ILE A 1 107 ? 4.123   11.032  3.835   1.00 0.94  ? 107 ILE A HG22 5  
ATOM 10198 H HG23 . ILE A 1 107 ? 5.851   10.897  3.516   1.00 1.11  ? 107 ILE A HG23 5  
ATOM 10199 H HD11 . ILE A 1 107 ? 7.115   8.153   3.894   1.00 1.05  ? 107 ILE A HD11 5  
ATOM 10200 H HD12 . ILE A 1 107 ? 8.511   8.895   4.679   1.00 1.08  ? 107 ILE A HD12 5  
ATOM 10201 H HD13 . ILE A 1 107 ? 7.480   9.856   3.619   1.00 0.99  ? 107 ILE A HD13 5  
ATOM 10202 N N    . ILE A 1 108 ? 2.207   8.944   5.740   1.00 0.26  ? 108 ILE A N    5  
ATOM 10203 C CA   . ILE A 1 108 ? 0.787   8.914   5.428   1.00 0.30  ? 108 ILE A CA   5  
ATOM 10204 C C    . ILE A 1 108 ? -0.023  9.538   6.557   1.00 0.33  ? 108 ILE A C    5  
ATOM 10205 O O    . ILE A 1 108 ? -0.892  10.380  6.323   1.00 0.40  ? 108 ILE A O    5  
ATOM 10206 C CB   . ILE A 1 108 ? 0.314   7.464   5.197   1.00 0.32  ? 108 ILE A CB   5  
ATOM 10207 C CG1  . ILE A 1 108 ? 0.742   6.984   3.811   1.00 0.35  ? 108 ILE A CG1  5  
ATOM 10208 C CG2  . ILE A 1 108 ? -1.191  7.340   5.380   1.00 0.32  ? 108 ILE A CG2  5  
ATOM 10209 C CD1  . ILE A 1 108 ? 0.485   5.513   3.577   1.00 0.39  ? 108 ILE A CD1  5  
ATOM 10210 H H    . ILE A 1 108 ? 2.710   8.096   5.757   1.00 0.24  ? 108 ILE A H    5  
ATOM 10211 H HA   . ILE A 1 108 ? 0.625   9.479   4.522   1.00 0.33  ? 108 ILE A HA   5  
ATOM 10212 H HB   . ILE A 1 108 ? 0.786   6.840   5.942   1.00 0.35  ? 108 ILE A HB   5  
ATOM 10213 H HG12 . ILE A 1 108 ? 0.200   7.539   3.059   1.00 0.35  ? 108 ILE A HG12 5  
ATOM 10214 H HG13 . ILE A 1 108 ? 1.801   7.160   3.689   1.00 0.41  ? 108 ILE A HG13 5  
ATOM 10215 H HG21 . ILE A 1 108 ? -1.482  6.307   5.270   1.00 1.09  ? 108 ILE A HG21 5  
ATOM 10216 H HG22 . ILE A 1 108 ? -1.696  7.940   4.633   1.00 0.95  ? 108 ILE A HG22 5  
ATOM 10217 H HG23 . ILE A 1 108 ? -1.462  7.692   6.371   1.00 1.05  ? 108 ILE A HG23 5  
ATOM 10218 H HD11 . ILE A 1 108 ? -0.570  5.309   3.685   1.00 1.14  ? 108 ILE A HD11 5  
ATOM 10219 H HD12 . ILE A 1 108 ? 1.039   4.933   4.302   1.00 1.06  ? 108 ILE A HD12 5  
ATOM 10220 H HD13 . ILE A 1 108 ? 0.805   5.244   2.582   1.00 1.08  ? 108 ILE A HD13 5  
ATOM 10221 N N    . SER A 1 109 ? 0.275   9.127   7.778   1.00 0.31  ? 109 SER A N    5  
ATOM 10222 C CA   . SER A 1 109 ? -0.408  9.622   8.945   1.00 0.35  ? 109 SER A CA   5  
ATOM 10223 C C    . SER A 1 109 ? -0.120  11.108  9.178   1.00 0.39  ? 109 SER A C    5  
ATOM 10224 O O    . SER A 1 109 ? -0.932  11.818  9.776   1.00 0.46  ? 109 SER A O    5  
ATOM 10225 C CB   . SER A 1 109 ? 0.011   8.782   10.139  1.00 0.36  ? 109 SER A CB   5  
ATOM 10226 O OG   . SER A 1 109 ? -0.324  7.420   9.934   1.00 1.32  ? 109 SER A OG   5  
ATOM 10227 H H    . SER A 1 109 ? 0.972   8.448   7.902   1.00 0.28  ? 109 SER A H    5  
ATOM 10228 H HA   . SER A 1 109 ? -1.470  9.495   8.785   1.00 0.41  ? 109 SER A HA   5  
ATOM 10229 H HB2  . SER A 1 109 ? 1.082   8.860   10.286  1.00 0.81  ? 109 SER A HB2  5  
ATOM 10230 H HB3  . SER A 1 109 ? -0.500  9.133   11.000  1.00 1.05  ? 109 SER A HB3  5  
ATOM 10231 H HG   . SER A 1 109 ? 0.429   6.969   9.523   1.00 1.90  ? 109 SER A HG   5  
ATOM 10232 N N    . ARG A 1 110 ? 1.026   11.580  8.690   1.00 0.38  ? 110 ARG A N    5  
ATOM 10233 C CA   . ARG A 1 110 ? 1.328   13.007  8.708   1.00 0.43  ? 110 ARG A CA   5  
ATOM 10234 C C    . ARG A 1 110 ? 0.292   13.769  7.897   1.00 0.48  ? 110 ARG A C    5  
ATOM 10235 O O    . ARG A 1 110 ? -0.068  14.896  8.226   1.00 0.62  ? 110 ARG A O    5  
ATOM 10236 C CB   . ARG A 1 110 ? 2.709   13.298  8.137   1.00 0.45  ? 110 ARG A CB   5  
ATOM 10237 C CG   . ARG A 1 110 ? 3.860   12.787  8.954   1.00 0.97  ? 110 ARG A CG   5  
ATOM 10238 C CD   . ARG A 1 110 ? 5.142   13.051  8.208   1.00 0.88  ? 110 ARG A CD   5  
ATOM 10239 N NE   . ARG A 1 110 ? 6.318   12.494  8.864   1.00 1.78  ? 110 ARG A NE   5  
ATOM 10240 C CZ   . ARG A 1 110 ? 7.453   12.234  8.224   1.00 1.98  ? 110 ARG A CZ   5  
ATOM 10241 N NH1  . ARG A 1 110 ? 7.553   12.503  6.927   1.00 1.39  ? 110 ARG A NH1  5  
ATOM 10242 N NH2  . ARG A 1 110 ? 8.487   11.724  8.881   1.00 2.87  ? 110 ARG A NH2  5  
ATOM 10243 H H    . ARG A 1 110 ? 1.689   10.951  8.322   1.00 0.36  ? 110 ARG A H    5  
ATOM 10244 H HA   . ARG A 1 110 ? 1.298   13.342  9.726   1.00 0.48  ? 110 ARG A HA   5  
ATOM 10245 H HB2  . ARG A 1 110 ? 2.782   12.863  7.161   1.00 0.98  ? 110 ARG A HB2  5  
ATOM 10246 H HB3  . ARG A 1 110 ? 2.826   14.361  8.046   1.00 1.02  ? 110 ARG A HB3  5  
ATOM 10247 H HG2  . ARG A 1 110 ? 3.878   13.313  9.895   1.00 1.52  ? 110 ARG A HG2  5  
ATOM 10248 H HG3  . ARG A 1 110 ? 3.748   11.727  9.118   1.00 1.51  ? 110 ARG A HG3  5  
ATOM 10249 H HD2  . ARG A 1 110 ? 5.053   12.619  7.227   1.00 0.91  ? 110 ARG A HD2  5  
ATOM 10250 H HD3  . ARG A 1 110 ? 5.261   14.117  8.111   1.00 0.92  ? 110 ARG A HD3  5  
ATOM 10251 H HE   . ARG A 1 110 ? 6.255   12.309  9.831   1.00 2.33  ? 110 ARG A HE   5  
ATOM 10252 H HH11 . ARG A 1 110 ? 6.775   12.904  6.435   1.00 0.94  ? 110 ARG A HH11 5  
ATOM 10253 H HH12 . ARG A 1 110 ? 8.407   12.304  6.422   1.00 1.59  ? 110 ARG A HH12 5  
ATOM 10254 H HH21 . ARG A 1 110 ? 8.419   11.537  9.864   1.00 3.42  ? 110 ARG A HH21 5  
ATOM 10255 H HH22 . ARG A 1 110 ? 9.342   11.518  8.395   1.00 3.03  ? 110 ARG A HH22 5  
ATOM 10256 N N    . TYR A 1 111 ? -0.187  13.130  6.836   1.00 0.44  ? 111 TYR A N    5  
ATOM 10257 C CA   . TYR A 1 111 ? -1.174  13.736  5.953   1.00 0.51  ? 111 TYR A CA   5  
ATOM 10258 C C    . TYR A 1 111 ? -2.589  13.447  6.452   1.00 0.61  ? 111 TYR A C    5  
ATOM 10259 O O    . TYR A 1 111 ? -3.542  14.112  6.056   1.00 0.75  ? 111 TYR A O    5  
ATOM 10260 C CB   . TYR A 1 111 ? -0.992  13.213  4.524   1.00 0.51  ? 111 TYR A CB   5  
ATOM 10261 C CG   . TYR A 1 111 ? 0.417   13.369  3.992   1.00 0.76  ? 111 TYR A CG   5  
ATOM 10262 C CD1  . TYR A 1 111 ? 1.143   14.533  4.215   1.00 1.67  ? 111 TYR A CD1  5  
ATOM 10263 C CD2  . TYR A 1 111 ? 1.024   12.344  3.278   1.00 0.79  ? 111 TYR A CD2  5  
ATOM 10264 C CE1  . TYR A 1 111 ? 2.430   14.671  3.739   1.00 2.33  ? 111 TYR A CE1  5  
ATOM 10265 C CE2  . TYR A 1 111 ? 2.312   12.473  2.801   1.00 1.30  ? 111 TYR A CE2  5  
ATOM 10266 C CZ   . TYR A 1 111 ? 3.012   13.639  3.035   1.00 2.05  ? 111 TYR A CZ   5  
ATOM 10267 O OH   . TYR A 1 111 ? 4.299   13.775  2.567   1.00 2.75  ? 111 TYR A OH   5  
ATOM 10268 H H    . TYR A 1 111 ? 0.139   12.226  6.635   1.00 0.38  ? 111 TYR A H    5  
ATOM 10269 H HA   . TYR A 1 111 ? -1.017  14.805  5.962   1.00 0.58  ? 111 TYR A HA   5  
ATOM 10270 H HB2  . TYR A 1 111 ? -1.237  12.162  4.499   1.00 0.92  ? 111 TYR A HB2  5  
ATOM 10271 H HB3  . TYR A 1 111 ? -1.654  13.745  3.862   1.00 0.90  ? 111 TYR A HB3  5  
ATOM 10272 H HD1  . TYR A 1 111 ? 0.685   15.339  4.768   1.00 1.98  ? 111 TYR A HD1  5  
ATOM 10273 H HD2  . TYR A 1 111 ? 0.475   11.433  3.096   1.00 1.04  ? 111 TYR A HD2  5  
ATOM 10274 H HE1  . TYR A 1 111 ? 2.978   15.583  3.922   1.00 3.10  ? 111 TYR A HE1  5  
ATOM 10275 H HE2  . TYR A 1 111 ? 2.764   11.662  2.249   1.00 1.39  ? 111 TYR A HE2  5  
ATOM 10276 H HH   . TYR A 1 111 ? 4.875   14.034  3.297   1.00 2.95  ? 111 TYR A HH   5  
ATOM 10277 N N    . LYS A 1 112 ? -2.715  12.459  7.334   1.00 0.60  ? 112 LYS A N    5  
ATOM 10278 C CA   . LYS A 1 112 ? -3.988  12.189  8.001   1.00 0.72  ? 112 LYS A CA   5  
ATOM 10279 C C    . LYS A 1 112 ? -4.258  13.265  9.034   1.00 0.82  ? 112 LYS A C    5  
ATOM 10280 O O    . LYS A 1 112 ? -5.335  13.866  9.069   1.00 1.00  ? 112 LYS A O    5  
ATOM 10281 C CB   . LYS A 1 112 ? -3.985  10.816  8.681   1.00 0.65  ? 112 LYS A CB   5  
ATOM 10282 C CG   . LYS A 1 112 ? -4.664  9.733   7.907   1.00 0.66  ? 112 LYS A CG   5  
ATOM 10283 C CD   . LYS A 1 112 ? -3.756  9.258   6.823   1.00 0.79  ? 112 LYS A CD   5  
ATOM 10284 C CE   . LYS A 1 112 ? -4.284  9.649   5.475   1.00 1.06  ? 112 LYS A CE   5  
ATOM 10285 N NZ   . LYS A 1 112 ? -3.405  9.208   4.369   1.00 1.63  ? 112 LYS A NZ   5  
ATOM 10286 H H    . LYS A 1 112 ? -1.937  11.899  7.540   1.00 0.53  ? 112 LYS A H    5  
ATOM 10287 H HA   . LYS A 1 112 ? -4.769  12.214  7.258   1.00 0.83  ? 112 LYS A HA   5  
ATOM 10288 H HB2  . LYS A 1 112 ? -2.968  10.494  8.809   1.00 1.01  ? 112 LYS A HB2  5  
ATOM 10289 H HB3  . LYS A 1 112 ? -4.456  10.897  9.636   1.00 0.83  ? 112 LYS A HB3  5  
ATOM 10290 H HG2  . LYS A 1 112 ? -4.889  8.909   8.564   1.00 0.90  ? 112 LYS A HG2  5  
ATOM 10291 H HG3  . LYS A 1 112 ? -5.573  10.118  7.469   1.00 1.12  ? 112 LYS A HG3  5  
ATOM 10292 H HD2  . LYS A 1 112 ? -2.784  9.709   6.959   1.00 0.91  ? 112 LYS A HD2  5  
ATOM 10293 H HD3  . LYS A 1 112 ? -3.670  8.207   6.893   1.00 0.95  ? 112 LYS A HD3  5  
ATOM 10294 H HE2  . LYS A 1 112 ? -5.264  9.222   5.343   1.00 1.20  ? 112 LYS A HE2  5  
ATOM 10295 H HE3  . LYS A 1 112 ? -4.350  10.713  5.464   1.00 1.67  ? 112 LYS A HE3  5  
ATOM 10296 H HZ1  . LYS A 1 112 ? -3.762  9.571   3.459   1.00 2.18  ? 112 LYS A HZ1  5  
ATOM 10297 H HZ2  . LYS A 1 112 ? -3.380  8.170   4.325   1.00 2.02  ? 112 LYS A HZ2  5  
ATOM 10298 H HZ3  . LYS A 1 112 ? -2.442  9.565   4.514   1.00 2.08  ? 112 LYS A HZ3  5  
ATOM 10299 N N    . ASP A 1 113 ? -3.262  13.503  9.872   1.00 0.77  ? 113 ASP A N    5  
ATOM 10300 C CA   . ASP A 1 113 ? -3.334  14.551  10.878  1.00 0.91  ? 113 ASP A CA   5  
ATOM 10301 C C    . ASP A 1 113 ? -3.284  15.908  10.199  1.00 0.99  ? 113 ASP A C    5  
ATOM 10302 O O    . ASP A 1 113 ? -3.902  16.873  10.645  1.00 1.15  ? 113 ASP A O    5  
ATOM 10303 C CB   . ASP A 1 113 ? -2.171  14.410  11.854  1.00 0.91  ? 113 ASP A CB   5  
ATOM 10304 C CG   . ASP A 1 113 ? -2.346  15.233  13.114  1.00 1.31  ? 113 ASP A CG   5  
ATOM 10305 O OD1  . ASP A 1 113 ? -3.379  15.066  13.795  1.00 1.55  ? 113 ASP A OD1  5  
ATOM 10306 O OD2  . ASP A 1 113 ? -1.434  16.016  13.450  1.00 1.60  ? 113 ASP A OD2  5  
ATOM 10307 H H    . ASP A 1 113 ? -2.453  12.947  9.820   1.00 0.66  ? 113 ASP A H    5  
ATOM 10308 H HA   . ASP A 1 113 ? -4.267  14.450  11.410  1.00 1.01  ? 113 ASP A HA   5  
ATOM 10309 H HB2  . ASP A 1 113 ? -2.066  13.380  12.128  1.00 0.88  ? 113 ASP A HB2  5  
ATOM 10310 H HB3  . ASP A 1 113 ? -1.267  14.728  11.366  1.00 0.93  ? 113 ASP A HB3  5  
ATOM 10311 N N    . ALA A 1 114 ? -2.521  15.943  9.104   1.00 0.91  ? 114 ALA A N    5  
ATOM 10312 C CA   . ALA A 1 114 ? -2.430  17.102  8.214   1.00 0.99  ? 114 ALA A CA   5  
ATOM 10313 C C    . ALA A 1 114 ? -1.775  18.286  8.907   1.00 1.16  ? 114 ALA A C    5  
ATOM 10314 O O    . ALA A 1 114 ? -1.911  19.432  8.477   1.00 1.33  ? 114 ALA A O    5  
ATOM 10315 C CB   . ALA A 1 114 ? -3.801  17.477  7.667   1.00 1.07  ? 114 ALA A CB   5  
ATOM 10316 H H    . ALA A 1 114 ? -1.980  15.153  8.897   1.00 0.81  ? 114 ALA A H    5  
ATOM 10317 H HA   . ALA A 1 114 ? -1.810  16.815  7.376   1.00 0.95  ? 114 ALA A HA   5  
ATOM 10318 H HB1  . ALA A 1 114 ? -4.448  17.762  8.483   1.00 1.53  ? 114 ALA A HB1  5  
ATOM 10319 H HB2  . ALA A 1 114 ? -4.223  16.629  7.150   1.00 1.53  ? 114 ALA A HB2  5  
ATOM 10320 H HB3  . ALA A 1 114 ? -3.700  18.303  6.979   1.00 1.42  ? 114 ALA A HB3  5  
ATOM 10321 N N    . ASP A 1 115 ? -1.050  17.993  9.970   1.00 1.20  ? 115 ASP A N    5  
ATOM 10322 C CA   . ASP A 1 115 ? -0.358  19.013  10.736  1.00 1.43  ? 115 ASP A CA   5  
ATOM 10323 C C    . ASP A 1 115 ? 1.141   18.881  10.534  1.00 1.61  ? 115 ASP A C    5  
ATOM 10324 O O    . ASP A 1 115 ? 1.693   17.824  10.900  1.00 2.01  ? 115 ASP A O    5  
ATOM 10325 C CB   . ASP A 1 115 ? -0.701  18.890  12.218  1.00 1.66  ? 115 ASP A CB   5  
ATOM 10326 C CG   . ASP A 1 115 ? -0.048  19.970  13.051  1.00 1.90  ? 115 ASP A CG   5  
ATOM 10327 O OD1  . ASP A 1 115 ? 1.092   19.757  13.513  1.00 1.96  ? 115 ASP A OD1  5  
ATOM 10328 O OD2  . ASP A 1 115 ? -0.665  21.039  13.241  1.00 2.23  ? 115 ASP A OD2  5  
ATOM 10329 O OXT  . ASP A 1 115 ? 1.761   19.816  9.999   1.00 2.09  ? 115 ASP A OXT  5  
ATOM 10330 H H    . ASP A 1 115 ? -0.976  17.059  10.249  1.00 1.12  ? 115 ASP A H    5  
ATOM 10331 H HA   . ASP A 1 115 ? -0.678  19.978  10.374  1.00 1.58  ? 115 ASP A HA   5  
ATOM 10332 H HB2  . ASP A 1 115 ? -1.770  18.964  12.342  1.00 1.77  ? 115 ASP A HB2  5  
ATOM 10333 H HB3  . ASP A 1 115 ? -0.365  17.930  12.579  1.00 1.74  ? 115 ASP A HB3  5  
ATOM 10334 N N    . ASP B 2 1   ? -11.012 -12.992 -11.981 1.00 2.92  ? 22  ASP B N    5  
ATOM 10335 C CA   . ASP B 2 1   ? -10.973 -13.971 -10.875 1.00 2.59  ? 22  ASP B CA   5  
ATOM 10336 C C    . ASP B 2 1   ? -9.573  -14.089 -10.277 1.00 2.27  ? 22  ASP B C    5  
ATOM 10337 O O    . ASP B 2 1   ? -9.417  -14.081 -9.060  1.00 2.08  ? 22  ASP B O    5  
ATOM 10338 C CB   . ASP B 2 1   ? -11.435 -15.344 -11.354 1.00 2.80  ? 22  ASP B CB   5  
ATOM 10339 C CG   . ASP B 2 1   ? -11.286 -16.396 -10.276 1.00 3.30  ? 22  ASP B CG   5  
ATOM 10340 O OD1  . ASP B 2 1   ? -12.172 -16.483 -9.401  1.00 3.65  ? 22  ASP B OD1  5  
ATOM 10341 O OD2  . ASP B 2 1   ? -10.288 -17.145 -10.304 1.00 3.79  ? 22  ASP B OD2  5  
ATOM 10342 H H1   . ASP B 2 1   ? -10.321 -13.243 -12.715 1.00 3.10  ? 22  ASP B H1   5  
ATOM 10343 H H2   . ASP B 2 1   ? -10.790 -12.037 -11.622 1.00 3.28  ? 22  ASP B H2   5  
ATOM 10344 H H3   . ASP B 2 1   ? -11.960 -12.971 -12.406 1.00 3.12  ? 22  ASP B H3   5  
ATOM 10345 H HA   . ASP B 2 1   ? -11.647 -13.628 -10.104 1.00 2.62  ? 22  ASP B HA   5  
ATOM 10346 H HB2  . ASP B 2 1   ? -12.475 -15.291 -11.641 1.00 2.95  ? 22  ASP B HB2  5  
ATOM 10347 H HB3  . ASP B 2 1   ? -10.844 -15.641 -12.208 1.00 3.06  ? 22  ASP B HB3  5  
ATOM 10348 N N    . THR B 2 2   ? -8.559  -14.187 -11.128 1.00 2.32  ? 23  THR B N    5  
ATOM 10349 C CA   . THR B 2 2   ? -7.190  -14.383 -10.665 1.00 2.14  ? 23  THR B CA   5  
ATOM 10350 C C    . THR B 2 2   ? -6.649  -13.145 -9.951  1.00 1.87  ? 23  THR B C    5  
ATOM 10351 O O    . THR B 2 2   ? -6.218  -13.218 -8.801  1.00 1.65  ? 23  THR B O    5  
ATOM 10352 C CB   . THR B 2 2   ? -6.272  -14.744 -11.837 1.00 2.44  ? 23  THR B CB   5  
ATOM 10353 O OG1  . THR B 2 2   ? -6.578  -13.912 -12.963 1.00 2.75  ? 23  THR B OG1  5  
ATOM 10354 C CG2  . THR B 2 2   ? -6.423  -16.209 -12.219 1.00 2.78  ? 23  THR B CG2  5  
ATOM 10355 H H    . THR B 2 2   ? -8.729  -14.130 -12.093 1.00 2.56  ? 23  THR B H    5  
ATOM 10356 H HA   . THR B 2 2   ? -7.188  -15.210 -9.972  1.00 2.12  ? 23  THR B HA   5  
ATOM 10357 H HB   . THR B 2 2   ? -5.253  -14.567 -11.534 1.00 2.61  ? 23  THR B HB   5  
ATOM 10358 H HG1  . THR B 2 2   ? -6.377  -14.388 -13.778 1.00 3.07  ? 23  THR B HG1  5  
ATOM 10359 H HG21 . THR B 2 2   ? -5.772  -16.434 -13.052 1.00 3.18  ? 23  THR B HG21 5  
ATOM 10360 H HG22 . THR B 2 2   ? -7.447  -16.404 -12.500 1.00 3.12  ? 23  THR B HG22 5  
ATOM 10361 H HG23 . THR B 2 2   ? -6.156  -16.830 -11.376 1.00 2.90  ? 23  THR B HG23 5  
ATOM 10362 N N    . GLN B 2 3   ? -6.699  -12.005 -10.626 1.00 1.97  ? 24  GLN B N    5  
ATOM 10363 C CA   . GLN B 2 3   ? -6.248  -10.749 -10.033 1.00 1.86  ? 24  GLN B CA   5  
ATOM 10364 C C    . GLN B 2 3   ? -7.199  -10.331 -8.923  1.00 1.69  ? 24  GLN B C    5  
ATOM 10365 O O    . GLN B 2 3   ? -6.816  -9.634  -7.987  1.00 1.59  ? 24  GLN B O    5  
ATOM 10366 C CB   . GLN B 2 3   ? -6.133  -9.642  -11.087 1.00 2.14  ? 24  GLN B CB   5  
ATOM 10367 C CG   . GLN B 2 3   ? -4.884  -9.739  -11.959 1.00 2.53  ? 24  GLN B CG   5  
ATOM 10368 C CD   . GLN B 2 3   ? -4.852  -10.984 -12.827 1.00 3.01  ? 24  GLN B CD   5  
ATOM 10369 O OE1  . GLN B 2 3   ? -5.335  -10.978 -13.958 1.00 3.39  ? 24  GLN B OE1  5  
ATOM 10370 N NE2  . GLN B 2 3   ? -4.269  -12.055 -12.311 1.00 3.58  ? 24  GLN B NE2  5  
ATOM 10371 H H    . GLN B 2 3   ? -7.043  -12.008 -11.546 1.00 2.18  ? 24  GLN B H    5  
ATOM 10372 H HA   . GLN B 2 3   ? -5.274  -10.924 -9.601  1.00 1.79  ? 24  GLN B HA   5  
ATOM 10373 H HB2  . GLN B 2 3   ? -6.997  -9.686  -11.731 1.00 2.52  ? 24  GLN B HB2  5  
ATOM 10374 H HB3  . GLN B 2 3   ? -6.120  -8.686  -10.585 1.00 2.37  ? 24  GLN B HB3  5  
ATOM 10375 H HG2  . GLN B 2 3   ? -4.844  -8.875  -12.603 1.00 2.85  ? 24  GLN B HG2  5  
ATOM 10376 H HG3  . GLN B 2 3   ? -4.015  -9.745  -11.316 1.00 2.92  ? 24  GLN B HG3  5  
ATOM 10377 H HE21 . GLN B 2 3   ? -3.890  -11.990 -11.403 1.00 3.72  ? 24  GLN B HE21 5  
ATOM 10378 H HE22 . GLN B 2 3   ? -4.256  -12.880 -12.847 1.00 4.10  ? 24  GLN B HE22 5  
ATOM 10379 N N    . ASP B 2 4   ? -8.443  -10.770 -9.037  1.00 1.74  ? 25  ASP B N    5  
ATOM 10380 C CA   . ASP B 2 4   ? -9.440  -10.521 -8.005  1.00 1.67  ? 25  ASP B CA   5  
ATOM 10381 C C    . ASP B 2 4   ? -9.097  -11.326 -6.761  1.00 1.46  ? 25  ASP B C    5  
ATOM 10382 O O    . ASP B 2 4   ? -9.291  -10.865 -5.635  1.00 1.37  ? 25  ASP B O    5  
ATOM 10383 C CB   . ASP B 2 4   ? -10.839 -10.890 -8.495  1.00 1.88  ? 25  ASP B CB   5  
ATOM 10384 C CG   . ASP B 2 4   ? -11.250 -10.108 -9.724  1.00 2.23  ? 25  ASP B CG   5  
ATOM 10385 O OD1  . ASP B 2 4   ? -10.942 -10.563 -10.848 1.00 2.67  ? 25  ASP B OD1  5  
ATOM 10386 O OD2  . ASP B 2 4   ? -11.873 -9.034  -9.574  1.00 2.56  ? 25  ASP B OD2  5  
ATOM 10387 H H    . ASP B 2 4   ? -8.696  -11.279 -9.839  1.00 1.88  ? 25  ASP B H    5  
ATOM 10388 H HA   . ASP B 2 4   ? -9.412  -9.468  -7.763  1.00 1.70  ? 25  ASP B HA   5  
ATOM 10389 H HB2  . ASP B 2 4   ? -10.862 -11.942 -8.738  1.00 2.16  ? 25  ASP B HB2  5  
ATOM 10390 H HB3  . ASP B 2 4   ? -11.553 -10.692 -7.709  1.00 2.05  ? 25  ASP B HB3  5  
ATOM 10391 N N    . ASP B 2 5   ? -8.580  -12.533 -6.979  1.00 1.48  ? 26  ASP B N    5  
ATOM 10392 C CA   . ASP B 2 5   ? -8.111  -13.393 -5.896  1.00 1.38  ? 26  ASP B CA   5  
ATOM 10393 C C    . ASP B 2 5   ? -6.929  -12.744 -5.195  1.00 1.16  ? 26  ASP B C    5  
ATOM 10394 O O    . ASP B 2 5   ? -6.794  -12.828 -3.977  1.00 1.08  ? 26  ASP B O    5  
ATOM 10395 C CB   . ASP B 2 5   ? -7.712  -14.769 -6.435  1.00 1.61  ? 26  ASP B CB   5  
ATOM 10396 C CG   . ASP B 2 5   ? -7.191  -15.696 -5.354  1.00 1.69  ? 26  ASP B CG   5  
ATOM 10397 O OD1  . ASP B 2 5   ? -8.002  -16.167 -4.525  1.00 1.79  ? 26  ASP B OD1  5  
ATOM 10398 O OD2  . ASP B 2 5   ? -5.963  -15.934 -5.312  1.00 2.16  ? 26  ASP B OD2  5  
ATOM 10399 H H    . ASP B 2 5   ? -8.516  -12.860 -7.904  1.00 1.64  ? 26  ASP B H    5  
ATOM 10400 H HA   . ASP B 2 5   ? -8.917  -13.512 -5.191  1.00 1.41  ? 26  ASP B HA   5  
ATOM 10401 H HB2  . ASP B 2 5   ? -8.573  -15.230 -6.892  1.00 2.03  ? 26  ASP B HB2  5  
ATOM 10402 H HB3  . ASP B 2 5   ? -6.939  -14.643 -7.179  1.00 1.90  ? 26  ASP B HB3  5  
ATOM 10403 N N    . PHE B 2 6   ? -6.104  -12.063 -5.981  1.00 1.18  ? 27  PHE B N    5  
ATOM 10404 C CA   . PHE B 2 6   ? -4.954  -11.321 -5.470  1.00 1.13  ? 27  PHE B CA   5  
ATOM 10405 C C    . PHE B 2 6   ? -5.406  -10.181 -4.549  1.00 1.08  ? 27  PHE B C    5  
ATOM 10406 O O    . PHE B 2 6   ? -4.605  -9.589  -3.827  1.00 1.20  ? 27  PHE B O    5  
ATOM 10407 C CB   . PHE B 2 6   ? -4.128  -10.781 -6.646  1.00 1.30  ? 27  PHE B CB   5  
ATOM 10408 C CG   . PHE B 2 6   ? -2.866  -10.063 -6.247  1.00 1.11  ? 27  PHE B CG   5  
ATOM 10409 C CD1  . PHE B 2 6   ? -1.886  -10.717 -5.517  1.00 1.14  ? 27  PHE B CD1  5  
ATOM 10410 C CD2  . PHE B 2 6   ? -2.663  -8.737  -6.598  1.00 1.45  ? 27  PHE B CD2  5  
ATOM 10411 C CE1  . PHE B 2 6   ? -0.727  -10.063 -5.145  1.00 1.16  ? 27  PHE B CE1  5  
ATOM 10412 C CE2  . PHE B 2 6   ? -1.504  -8.079  -6.230  1.00 1.84  ? 27  PHE B CE2  5  
ATOM 10413 C CZ   . PHE B 2 6   ? -0.535  -8.733  -5.522  1.00 1.59  ? 27  PHE B CZ   5  
ATOM 10414 H H    . PHE B 2 6   ? -6.268  -12.069 -6.950  1.00 1.30  ? 27  PHE B H    5  
ATOM 10415 H HA   . PHE B 2 6   ? -4.345  -12.007 -4.900  1.00 1.14  ? 27  PHE B HA   5  
ATOM 10416 H HB2  . PHE B 2 6   ? -3.849  -11.604 -7.284  1.00 1.57  ? 27  PHE B HB2  5  
ATOM 10417 H HB3  . PHE B 2 6   ? -4.738  -10.090 -7.210  1.00 1.63  ? 27  PHE B HB3  5  
ATOM 10418 H HD1  . PHE B 2 6   ? -2.034  -11.749 -5.239  1.00 1.49  ? 27  PHE B HD1  5  
ATOM 10419 H HD2  . PHE B 2 6   ? -3.419  -8.217  -7.167  1.00 1.68  ? 27  PHE B HD2  5  
ATOM 10420 H HE1  . PHE B 2 6   ? 0.029   -10.584 -4.576  1.00 1.20  ? 27  PHE B HE1  5  
ATOM 10421 H HE2  . PHE B 2 6   ? -1.357  -7.047  -6.509  1.00 2.44  ? 27  PHE B HE2  5  
ATOM 10422 H HZ   . PHE B 2 6   ? 0.370   -8.217  -5.240  1.00 1.95  ? 27  PHE B HZ   5  
ATOM 10423 N N    . LEU B 2 7   ? -6.693  -9.874  -4.581  1.00 1.07  ? 28  LEU B N    5  
ATOM 10424 C CA   . LEU B 2 7   ? -7.254  -8.865  -3.700  1.00 1.16  ? 28  LEU B CA   5  
ATOM 10425 C C    . LEU B 2 7   ? -7.966  -9.508  -2.507  1.00 1.10  ? 28  LEU B C    5  
ATOM 10426 O O    . LEU B 2 7   ? -7.834  -9.044  -1.374  1.00 1.17  ? 28  LEU B O    5  
ATOM 10427 C CB   . LEU B 2 7   ? -8.231  -7.974  -4.471  1.00 1.40  ? 28  LEU B CB   5  
ATOM 10428 C CG   . LEU B 2 7   ? -7.638  -7.243  -5.681  1.00 1.80  ? 28  LEU B CG   5  
ATOM 10429 C CD1  . LEU B 2 7   ? -8.723  -6.477  -6.422  1.00 2.39  ? 28  LEU B CD1  5  
ATOM 10430 C CD2  . LEU B 2 7   ? -6.521  -6.301  -5.247  1.00 2.28  ? 28  LEU B CD2  5  
ATOM 10431 H H    . LEU B 2 7   ? -7.277  -10.332 -5.220  1.00 1.12  ? 28  LEU B H    5  
ATOM 10432 H HA   . LEU B 2 7   ? -6.441  -8.257  -3.332  1.00 1.23  ? 28  LEU B HA   5  
ATOM 10433 H HB2  . LEU B 2 7   ? -9.049  -8.590  -4.816  1.00 1.64  ? 28  LEU B HB2  5  
ATOM 10434 H HB3  . LEU B 2 7   ? -8.624  -7.233  -3.790  1.00 2.04  ? 28  LEU B HB3  5  
ATOM 10435 H HG   . LEU B 2 7   ? -7.219  -7.970  -6.361  1.00 2.36  ? 28  LEU B HG   5  
ATOM 10436 H HD11 . LEU B 2 7   ? -8.289  -5.970  -7.271  1.00 2.97  ? 28  LEU B HD11 5  
ATOM 10437 H HD12 . LEU B 2 7   ? -9.169  -5.752  -5.759  1.00 2.48  ? 28  LEU B HD12 5  
ATOM 10438 H HD13 . LEU B 2 7   ? -9.480  -7.167  -6.763  1.00 2.89  ? 28  LEU B HD13 5  
ATOM 10439 H HD21 . LEU B 2 7   ? -6.128  -5.787  -6.113  1.00 2.77  ? 28  LEU B HD21 5  
ATOM 10440 H HD22 . LEU B 2 7   ? -5.732  -6.870  -4.779  1.00 2.61  ? 28  LEU B HD22 5  
ATOM 10441 H HD23 . LEU B 2 7   ? -6.911  -5.579  -4.546  1.00 2.57  ? 28  LEU B HD23 5  
ATOM 10442 N N    . LYS B 2 8   ? -8.701  -10.590 -2.760  1.00 1.07  ? 29  LYS B N    5  
ATOM 10443 C CA   . LYS B 2 8   ? -9.549  -11.194 -1.730  1.00 1.14  ? 29  LYS B CA   5  
ATOM 10444 C C    . LYS B 2 8   ? -8.789  -12.154 -0.815  1.00 1.04  ? 29  LYS B C    5  
ATOM 10445 O O    . LYS B 2 8   ? -9.232  -12.409 0.306   1.00 1.06  ? 29  LYS B O    5  
ATOM 10446 C CB   . LYS B 2 8   ? -10.752 -11.907 -2.361  1.00 1.33  ? 29  LYS B CB   5  
ATOM 10447 C CG   . LYS B 2 8   ? -10.393 -12.823 -3.518  1.00 1.71  ? 29  LYS B CG   5  
ATOM 10448 C CD   . LYS B 2 8   ? -11.621 -13.480 -4.131  1.00 1.99  ? 29  LYS B CD   5  
ATOM 10449 C CE   . LYS B 2 8   ? -12.109 -14.666 -3.311  1.00 2.39  ? 29  LYS B CE   5  
ATOM 10450 N NZ   . LYS B 2 8   ? -11.162 -15.814 -3.366  1.00 2.91  ? 29  LYS B NZ   5  
ATOM 10451 H H    . LYS B 2 8   ? -8.676  -10.986 -3.657  1.00 1.09  ? 29  LYS B H    5  
ATOM 10452 H HA   . LYS B 2 8   ? -9.922  -10.385 -1.120  1.00 1.24  ? 29  LYS B HA   5  
ATOM 10453 H HB2  . LYS B 2 8   ? -11.239 -12.500 -1.601  1.00 1.79  ? 29  LYS B HB2  5  
ATOM 10454 H HB3  . LYS B 2 8   ? -11.447 -11.163 -2.721  1.00 1.82  ? 29  LYS B HB3  5  
ATOM 10455 H HG2  . LYS B 2 8   ? -9.899  -12.236 -4.279  1.00 2.29  ? 29  LYS B HG2  5  
ATOM 10456 H HG3  . LYS B 2 8   ? -9.723  -13.591 -3.161  1.00 2.15  ? 29  LYS B HG3  5  
ATOM 10457 H HD2  . LYS B 2 8   ? -12.415 -12.750 -4.189  1.00 2.21  ? 29  LYS B HD2  5  
ATOM 10458 H HD3  . LYS B 2 8   ? -11.375 -13.821 -5.125  1.00 2.44  ? 29  LYS B HD3  5  
ATOM 10459 H HE2  . LYS B 2 8   ? -12.220 -14.355 -2.282  1.00 2.72  ? 29  LYS B HE2  5  
ATOM 10460 H HE3  . LYS B 2 8   ? -13.067 -14.983 -3.694  1.00 2.71  ? 29  LYS B HE3  5  
ATOM 10461 H HZ1  . LYS B 2 8   ? -11.019 -16.119 -4.350  1.00 3.26  ? 29  LYS B HZ1  5  
ATOM 10462 H HZ2  . LYS B 2 8   ? -11.539 -16.614 -2.821  1.00 3.28  ? 29  LYS B HZ2  5  
ATOM 10463 H HZ3  . LYS B 2 8   ? -10.242 -15.542 -2.963  1.00 3.20  ? 29  LYS B HZ3  5  
ATOM 10464 N N    . TRP B 2 9   ? -7.651  -12.684 -1.268  1.00 0.99  ? 30  TRP B N    5  
ATOM 10465 C CA   . TRP B 2 9   ? -6.867  -13.597 -0.428  1.00 1.00  ? 30  TRP B CA   5  
ATOM 10466 C C    . TRP B 2 9   ? -6.470  -12.894 0.861   1.00 0.90  ? 30  TRP B C    5  
ATOM 10467 O O    . TRP B 2 9   ? -6.460  -13.496 1.932   1.00 1.00  ? 30  TRP B O    5  
ATOM 10468 C CB   . TRP B 2 9   ? -5.613  -14.120 -1.154  1.00 1.03  ? 30  TRP B CB   5  
ATOM 10469 C CG   . TRP B 2 9   ? -4.502  -13.115 -1.289  1.00 0.95  ? 30  TRP B CG   5  
ATOM 10470 C CD1  . TRP B 2 9   ? -4.451  -12.077 -2.162  1.00 1.06  ? 30  TRP B CD1  5  
ATOM 10471 C CD2  . TRP B 2 9   ? -3.275  -13.062 -0.537  1.00 0.86  ? 30  TRP B CD2  5  
ATOM 10472 N NE1  . TRP B 2 9   ? -3.287  -11.373 -2.001  1.00 1.00  ? 30  TRP B NE1  5  
ATOM 10473 C CE2  . TRP B 2 9   ? -2.545  -11.956 -1.014  1.00 0.85  ? 30  TRP B CE2  5  
ATOM 10474 C CE3  . TRP B 2 9   ? -2.725  -13.832 0.494   1.00 0.94  ? 30  TRP B CE3  5  
ATOM 10475 C CZ2  . TRP B 2 9   ? -1.300  -11.607 -0.503  1.00 0.83  ? 30  TRP B CZ2  5  
ATOM 10476 C CZ3  . TRP B 2 9   ? -1.483  -13.483 0.999   1.00 1.00  ? 30  TRP B CZ3  5  
ATOM 10477 C CH2  . TRP B 2 9   ? -0.784  -12.379 0.499   1.00 0.90  ? 30  TRP B CH2  5  
ATOM 10478 H H    . TRP B 2 9   ? -7.341  -12.473 -2.178  1.00 1.00  ? 30  TRP B H    5  
ATOM 10479 H HA   . TRP B 2 9   ? -7.502  -14.434 -0.179  1.00 1.11  ? 30  TRP B HA   5  
ATOM 10480 H HB2  . TRP B 2 9   ? -5.224  -14.966 -0.611  1.00 1.09  ? 30  TRP B HB2  5  
ATOM 10481 H HB3  . TRP B 2 9   ? -5.894  -14.440 -2.147  1.00 1.11  ? 30  TRP B HB3  5  
ATOM 10482 H HD1  . TRP B 2 9   ? -5.231  -11.846 -2.873  1.00 1.24  ? 30  TRP B HD1  5  
ATOM 10483 H HE1  . TRP B 2 9   ? -3.028  -10.576 -2.518  1.00 1.11  ? 30  TRP B HE1  5  
ATOM 10484 H HE3  . TRP B 2 9   ? -3.250  -14.687 0.896   1.00 1.05  ? 30  TRP B HE3  5  
ATOM 10485 H HZ2  . TRP B 2 9   ? -0.747  -10.757 -0.877  1.00 0.86  ? 30  TRP B HZ2  5  
ATOM 10486 H HZ3  . TRP B 2 9   ? -1.038  -14.069 1.790   1.00 1.18  ? 30  TRP B HZ3  5  
ATOM 10487 H HH2  . TRP B 2 9   ? 0.181   -12.144 0.923   1.00 0.99  ? 30  TRP B HH2  5  
ATOM 10488 N N    . TRP B 2 10  ? -6.180  -11.604 0.740   1.00 0.76  ? 31  TRP B N    5  
ATOM 10489 C CA   . TRP B 2 10  ? -5.789  -10.780 1.869   1.00 0.73  ? 31  TRP B CA   5  
ATOM 10490 C C    . TRP B 2 10  ? -6.893  -10.765 2.914   1.00 0.86  ? 31  TRP B C    5  
ATOM 10491 O O    . TRP B 2 10  ? -6.645  -10.900 4.110   1.00 1.02  ? 31  TRP B O    5  
ATOM 10492 C CB   . TRP B 2 10  ? -5.535  -9.358  1.392   1.00 0.61  ? 31  TRP B CB   5  
ATOM 10493 C CG   . TRP B 2 10  ? -4.452  -8.659  2.144   1.00 0.56  ? 31  TRP B CG   5  
ATOM 10494 C CD1  . TRP B 2 10  ? -4.446  -8.295  3.458   1.00 0.66  ? 31  TRP B CD1  5  
ATOM 10495 C CD2  . TRP B 2 10  ? -3.212  -8.228  1.599   1.00 0.46  ? 31  TRP B CD2  5  
ATOM 10496 N NE1  . TRP B 2 10  ? -3.264  -7.662  3.761   1.00 0.65  ? 31  TRP B NE1  5  
ATOM 10497 C CE2  . TRP B 2 10  ? -2.491  -7.607  2.632   1.00 0.50  ? 31  TRP B CE2  5  
ATOM 10498 C CE3  . TRP B 2 10  ? -2.643  -8.310  0.331   1.00 0.42  ? 31  TRP B CE3  5  
ATOM 10499 C CZ2  . TRP B 2 10  ? -1.226  -7.067  2.427   1.00 0.45  ? 31  TRP B CZ2  5  
ATOM 10500 C CZ3  . TRP B 2 10  ? -1.394  -7.777  0.131   1.00 0.38  ? 31  TRP B CZ3  5  
ATOM 10501 C CH2  . TRP B 2 10  ? -0.695  -7.160  1.171   1.00 0.36  ? 31  TRP B CH2  5  
ATOM 10502 H H    . TRP B 2 10  ? -6.222  -11.196 -0.152  1.00 0.76  ? 31  TRP B H    5  
ATOM 10503 H HA   . TRP B 2 10  ? -4.883  -11.184 2.296   1.00 0.76  ? 31  TRP B HA   5  
ATOM 10504 H HB2  . TRP B 2 10  ? -5.255  -9.381  0.350   1.00 0.59  ? 31  TRP B HB2  5  
ATOM 10505 H HB3  . TRP B 2 10  ? -6.443  -8.783  1.502   1.00 0.67  ? 31  TRP B HB3  5  
ATOM 10506 H HD1  . TRP B 2 10  ? -5.255  -8.485  4.148   1.00 0.78  ? 31  TRP B HD1  5  
ATOM 10507 H HE1  . TRP B 2 10  ? -3.016  -7.307  4.645   1.00 0.75  ? 31  TRP B HE1  5  
ATOM 10508 H HE3  . TRP B 2 10  ? -3.167  -8.784  -0.487  1.00 0.49  ? 31  TRP B HE3  5  
ATOM 10509 H HZ2  . TRP B 2 10  ? -0.676  -6.587  3.220   1.00 0.54  ? 31  TRP B HZ2  5  
ATOM 10510 H HZ3  . TRP B 2 10  ? -0.942  -7.832  -0.846  1.00 0.43  ? 31  TRP B HZ3  5  
ATOM 10511 H HH2  . TRP B 2 10  ? 0.279   -6.744  0.961   1.00 0.36  ? 31  TRP B HH2  5  
ATOM 10512 N N    . ARG B 2 11  ? -8.118  -10.606 2.436   1.00 0.87  ? 32  ARG B N    5  
ATOM 10513 C CA   . ARG B 2 11  ? -9.279  -10.526 3.305   1.00 1.03  ? 32  ARG B CA   5  
ATOM 10514 C C    . ARG B 2 11  ? -9.511  -11.851 4.018   1.00 1.15  ? 32  ARG B C    5  
ATOM 10515 O O    . ARG B 2 11  ? -9.819  -11.870 5.205   1.00 1.33  ? 32  ARG B O    5  
ATOM 10516 C CB   . ARG B 2 11  ? -10.513 -10.125 2.496   1.00 1.08  ? 32  ARG B CB   5  
ATOM 10517 C CG   . ARG B 2 11  ? -10.409 -8.753  1.833   1.00 1.34  ? 32  ARG B CG   5  
ATOM 10518 C CD   . ARG B 2 11  ? -10.481 -7.610  2.842   1.00 1.58  ? 32  ARG B CD   5  
ATOM 10519 N NE   . ARG B 2 11  ? -9.339  -7.589  3.760   1.00 2.01  ? 32  ARG B NE   5  
ATOM 10520 C CZ   . ARG B 2 11  ? -9.278  -6.828  4.856   1.00 2.63  ? 32  ARG B CZ   5  
ATOM 10521 N NH1  . ARG B 2 11  ? -10.263 -5.987  5.142   1.00 3.04  ? 32  ARG B NH1  5  
ATOM 10522 N NH2  . ARG B 2 11  ? -8.224  -6.901  5.661   1.00 3.37  ? 32  ARG B NH2  5  
ATOM 10523 H H    . ARG B 2 11  ? -8.246  -10.554 1.465   1.00 0.82  ? 32  ARG B H    5  
ATOM 10524 H HA   . ARG B 2 11  ? -9.085  -9.766  4.046   1.00 1.12  ? 32  ARG B HA   5  
ATOM 10525 H HB2  . ARG B 2 11  ? -10.674 -10.859 1.722   1.00 1.33  ? 32  ARG B HB2  5  
ATOM 10526 H HB3  . ARG B 2 11  ? -11.369 -10.118 3.153   1.00 1.39  ? 32  ARG B HB3  5  
ATOM 10527 H HG2  . ARG B 2 11  ? -9.467  -8.693  1.310   1.00 1.84  ? 32  ARG B HG2  5  
ATOM 10528 H HG3  . ARG B 2 11  ? -11.218 -8.647  1.127   1.00 1.90  ? 32  ARG B HG3  5  
ATOM 10529 H HD2  . ARG B 2 11  ? -10.509 -6.675  2.302   1.00 2.09  ? 32  ARG B HD2  5  
ATOM 10530 H HD3  . ARG B 2 11  ? -11.389 -7.716  3.417   1.00 2.02  ? 32  ARG B HD3  5  
ATOM 10531 H HE   . ARG B 2 11  ? -8.589  -8.184  3.555   1.00 2.35  ? 32  ARG B HE   5  
ATOM 10532 H HH11 . ARG B 2 11  ? -11.060 -5.918  4.536   1.00 2.99  ? 32  ARG B HH11 5  
ATOM 10533 H HH12 . ARG B 2 11  ? -10.216 -5.416  5.966   1.00 3.72  ? 32  ARG B HH12 5  
ATOM 10534 H HH21 . ARG B 2 11  ? -7.471  -7.525  5.451   1.00 3.63  ? 32  ARG B HH21 5  
ATOM 10535 H HH22 . ARG B 2 11  ? -8.183  -6.338  6.494   1.00 3.92  ? 32  ARG B HH22 5  
ATOM 10536 N N    . SER B 2 12  ? -9.340  -12.952 3.297   1.00 1.13  ? 33  SER B N    5  
ATOM 10537 C CA   . SER B 2 12  ? -9.493  -14.279 3.879   1.00 1.30  ? 33  SER B CA   5  
ATOM 10538 C C    . SER B 2 12  ? -8.394  -14.543 4.911   1.00 1.45  ? 33  SER B C    5  
ATOM 10539 O O    . SER B 2 12  ? -8.650  -15.093 5.985   1.00 1.65  ? 33  SER B O    5  
ATOM 10540 C CB   . SER B 2 12  ? -9.455  -15.336 2.776   1.00 1.33  ? 33  SER B CB   5  
ATOM 10541 O OG   . SER B 2 12  ? -10.423 -15.056 1.777   1.00 1.90  ? 33  SER B OG   5  
ATOM 10542 H H    . SER B 2 12  ? -9.112  -12.871 2.344   1.00 1.04  ? 33  SER B H    5  
ATOM 10543 H HA   . SER B 2 12  ? -10.453 -14.317 4.373   1.00 1.37  ? 33  SER B HA   5  
ATOM 10544 H HB2  . SER B 2 12  ? -8.476  -15.344 2.320   1.00 1.77  ? 33  SER B HB2  5  
ATOM 10545 H HB3  . SER B 2 12  ? -9.663  -16.306 3.201   1.00 1.58  ? 33  SER B HB3  5  
ATOM 10546 H HG   . SER B 2 12  ? -11.240 -15.532 1.981   1.00 2.15  ? 33  SER B HG   5  
ATOM 10547 N N    . GLU B 2 13  ? -7.175  -14.134 4.579   1.00 1.40  ? 34  GLU B N    5  
ATOM 10548 C CA   . GLU B 2 13  ? -6.041  -14.265 5.487   1.00 1.57  ? 34  GLU B CA   5  
ATOM 10549 C C    . GLU B 2 13  ? -6.265  -13.448 6.757   1.00 1.63  ? 34  GLU B C    5  
ATOM 10550 O O    . GLU B 2 13  ? -6.006  -13.917 7.865   1.00 1.85  ? 34  GLU B O    5  
ATOM 10551 C CB   . GLU B 2 13  ? -4.764  -13.794 4.794   1.00 1.57  ? 34  GLU B CB   5  
ATOM 10552 C CG   . GLU B 2 13  ? -4.288  -14.704 3.672   1.00 1.84  ? 34  GLU B CG   5  
ATOM 10553 C CD   . GLU B 2 13  ? -3.424  -15.847 4.163   1.00 1.90  ? 34  GLU B CD   5  
ATOM 10554 O OE1  . GLU B 2 13  ? -3.977  -16.813 4.731   1.00 2.32  ? 34  GLU B OE1  5  
ATOM 10555 O OE2  . GLU B 2 13  ? -2.189  -15.785 4.002   1.00 2.15  ? 34  GLU B OE2  5  
ATOM 10556 H H    . GLU B 2 13  ? -7.031  -13.736 3.691   1.00 1.27  ? 34  GLU B H    5  
ATOM 10557 H HA   . GLU B 2 13  ? -5.939  -15.307 5.749   1.00 1.73  ? 34  GLU B HA   5  
ATOM 10558 H HB2  . GLU B 2 13  ? -4.937  -12.812 4.380   1.00 1.70  ? 34  GLU B HB2  5  
ATOM 10559 H HB3  . GLU B 2 13  ? -3.984  -13.730 5.531   1.00 1.80  ? 34  GLU B HB3  5  
ATOM 10560 H HG2  . GLU B 2 13  ? -5.151  -15.117 3.173   1.00 2.25  ? 34  GLU B HG2  5  
ATOM 10561 H HG3  . GLU B 2 13  ? -3.717  -14.116 2.970   1.00 2.41  ? 34  GLU B HG3  5  
ATOM 10562 N N    . GLU B 2 14  ? -6.749  -12.222 6.591   1.00 1.50  ? 35  GLU B N    5  
ATOM 10563 C CA   . GLU B 2 14  ? -7.016  -11.346 7.724   1.00 1.65  ? 35  GLU B CA   5  
ATOM 10564 C C    . GLU B 2 14  ? -8.243  -11.801 8.503   1.00 1.86  ? 35  GLU B C    5  
ATOM 10565 O O    . GLU B 2 14  ? -8.322  -11.597 9.711   1.00 2.10  ? 35  GLU B O    5  
ATOM 10566 C CB   . GLU B 2 14  ? -7.186  -9.900  7.256   1.00 1.57  ? 35  GLU B CB   5  
ATOM 10567 C CG   . GLU B 2 14  ? -5.877  -9.246  6.834   1.00 2.12  ? 35  GLU B CG   5  
ATOM 10568 C CD   . GLU B 2 14  ? -4.948  -8.976  8.006   1.00 2.43  ? 35  GLU B CD   5  
ATOM 10569 O OE1  . GLU B 2 14  ? -4.612  -9.940  8.729   1.00 3.14  ? 35  GLU B OE1  5  
ATOM 10570 O OE2  . GLU B 2 14  ? -4.564  -7.806  8.218   1.00 2.46  ? 35  GLU B OE2  5  
ATOM 10571 H H    . GLU B 2 14  ? -6.918  -11.895 5.680   1.00 1.35  ? 35  GLU B H    5  
ATOM 10572 H HA   . GLU B 2 14  ? -6.161  -11.395 8.379   1.00 1.76  ? 35  GLU B HA   5  
ATOM 10573 H HB2  . GLU B 2 14  ? -7.862  -9.882  6.414   1.00 1.55  ? 35  GLU B HB2  5  
ATOM 10574 H HB3  . GLU B 2 14  ? -7.610  -9.320  8.062   1.00 1.87  ? 35  GLU B HB3  5  
ATOM 10575 H HG2  . GLU B 2 14  ? -5.371  -9.899  6.139   1.00 2.69  ? 35  GLU B HG2  5  
ATOM 10576 H HG3  . GLU B 2 14  ? -6.100  -8.308  6.347   1.00 2.55  ? 35  GLU B HG3  5  
ATOM 10577 N N    . ALA B 2 15  ? -9.185  -12.441 7.815   1.00 1.84  ? 36  ALA B N    5  
ATOM 10578 C CA   . ALA B 2 15  ? -10.399 -12.947 8.453   1.00 2.10  ? 36  ALA B CA   5  
ATOM 10579 C C    . ALA B 2 15  ? -10.079 -14.083 9.419   1.00 2.31  ? 36  ALA B C    5  
ATOM 10580 O O    . ALA B 2 15  ? -10.904 -14.456 10.252  1.00 2.58  ? 36  ALA B O    5  
ATOM 10581 C CB   . ALA B 2 15  ? -11.399 -13.410 7.405   1.00 2.10  ? 36  ALA B CB   5  
ATOM 10582 H H    . ALA B 2 15  ? -9.068  -12.566 6.848   1.00 1.67  ? 36  ALA B H    5  
ATOM 10583 H HA   . ALA B 2 15  ? -10.847 -12.134 9.007   1.00 2.20  ? 36  ALA B HA   5  
ATOM 10584 H HB1  . ALA B 2 15  ? -11.610 -12.599 6.725   1.00 2.33  ? 36  ALA B HB1  5  
ATOM 10585 H HB2  . ALA B 2 15  ? -12.311 -13.721 7.891   1.00 2.25  ? 36  ALA B HB2  5  
ATOM 10586 H HB3  . ALA B 2 15  ? -10.983 -14.241 6.854   1.00 2.42  ? 36  ALA B HB3  5  
ATOM 10587 N N    . GLN B 2 16  ? -8.877  -14.632 9.290   1.00 2.24  ? 37  GLN B N    5  
ATOM 10588 C CA   . GLN B 2 16  ? -8.402  -15.667 10.196  1.00 2.49  ? 37  GLN B CA   5  
ATOM 10589 C C    . GLN B 2 16  ? -8.172  -15.077 11.586  1.00 2.66  ? 37  GLN B C    5  
ATOM 10590 O O    . GLN B 2 16  ? -8.427  -15.723 12.605  1.00 2.93  ? 37  GLN B O    5  
ATOM 10591 C CB   . GLN B 2 16  ? -7.109  -16.279 9.653   1.00 2.39  ? 37  GLN B CB   5  
ATOM 10592 C CG   . GLN B 2 16  ? -6.550  -17.411 10.499  1.00 2.54  ? 37  GLN B CG   5  
ATOM 10593 C CD   . GLN B 2 16  ? -5.298  -18.018 9.897   1.00 3.04  ? 37  GLN B CD   5  
ATOM 10594 O OE1  . GLN B 2 16  ? -5.121  -18.026 8.680   1.00 3.65  ? 37  GLN B OE1  5  
ATOM 10595 N NE2  . GLN B 2 16  ? -4.425  -18.535 10.745  1.00 3.38  ? 37  GLN B NE2  5  
ATOM 10596 H H    . GLN B 2 16  ? -8.293  -14.332 8.561   1.00 2.05  ? 37  GLN B H    5  
ATOM 10597 H HA   . GLN B 2 16  ? -9.161  -16.432 10.258  1.00 2.69  ? 37  GLN B HA   5  
ATOM 10598 H HB2  . GLN B 2 16  ? -7.296  -16.662 8.661   1.00 2.65  ? 37  GLN B HB2  5  
ATOM 10599 H HB3  . GLN B 2 16  ? -6.360  -15.504 9.591   1.00 2.45  ? 37  GLN B HB3  5  
ATOM 10600 H HG2  . GLN B 2 16  ? -6.311  -17.029 11.479  1.00 2.72  ? 37  GLN B HG2  5  
ATOM 10601 H HG3  . GLN B 2 16  ? -7.300  -18.182 10.586  1.00 2.94  ? 37  GLN B HG3  5  
ATOM 10602 H HE21 . GLN B 2 16  ? -4.631  -18.496 11.704  1.00 3.31  ? 37  GLN B HE21 5  
ATOM 10603 H HE22 . GLN B 2 16  ? -3.608  -18.939 10.379  1.00 4.00  ? 37  GLN B HE22 5  
ATOM 10604 N N    . ASP B 2 17  ? -7.694  -13.839 11.619  1.00 2.57  ? 38  ASP B N    5  
ATOM 10605 C CA   . ASP B 2 17  ? -7.477  -13.142 12.879  1.00 2.80  ? 38  ASP B CA   5  
ATOM 10606 C C    . ASP B 2 17  ? -8.698  -12.306 13.223  1.00 2.96  ? 38  ASP B C    5  
ATOM 10607 O O    . ASP B 2 17  ? -9.171  -12.304 14.359  1.00 3.22  ? 38  ASP B O    5  
ATOM 10608 C CB   . ASP B 2 17  ? -6.242  -12.245 12.800  1.00 2.80  ? 38  ASP B CB   5  
ATOM 10609 C CG   . ASP B 2 17  ? -5.876  -11.639 14.140  1.00 2.83  ? 38  ASP B CG   5  
ATOM 10610 O OD1  . ASP B 2 17  ? -5.187  -12.318 14.932  1.00 3.06  ? 38  ASP B OD1  5  
ATOM 10611 O OD2  . ASP B 2 17  ? -6.266  -10.481 14.408  1.00 3.03  ? 38  ASP B OD2  5  
ATOM 10612 H H    . ASP B 2 17  ? -7.489  -13.381 10.776  1.00 2.38  ? 38  ASP B H    5  
ATOM 10613 H HA   . ASP B 2 17  ? -7.329  -13.883 13.649  1.00 2.97  ? 38  ASP B HA   5  
ATOM 10614 H HB2  . ASP B 2 17  ? -5.405  -12.828 12.450  1.00 3.09  ? 38  ASP B HB2  5  
ATOM 10615 H HB3  . ASP B 2 17  ? -6.433  -11.443 12.103  1.00 2.90  ? 38  ASP B HB3  5  
ATOM 10616 N N    . MET B 2 18  ? -9.203  -11.597 12.228  1.00 2.89  ? 39  MET B N    5  
ATOM 10617 C CA   . MET B 2 18  ? -10.394 -10.782 12.381  1.00 3.13  ? 39  MET B CA   5  
ATOM 10618 C C    . MET B 2 18  ? -11.620 -11.576 11.953  1.00 3.86  ? 39  MET B C    5  
ATOM 10619 O O    . MET B 2 18  ? -12.011 -11.556 10.785  1.00 4.43  ? 39  MET B O    5  
ATOM 10620 C CB   . MET B 2 18  ? -10.272 -9.501  11.548  1.00 3.09  ? 39  MET B CB   5  
ATOM 10621 C CG   . MET B 2 18  ? -11.486 -8.588  11.640  1.00 3.39  ? 39  MET B CG   5  
ATOM 10622 S SD   . MET B 2 18  ? -11.802 -8.014  13.320  1.00 3.72  ? 39  MET B SD   5  
ATOM 10623 C CE   . MET B 2 18  ? -13.270 -7.018  13.067  1.00 4.34  ? 39  MET B CE   5  
ATOM 10624 H H    . MET B 2 18  ? -8.761  -11.629 11.348  1.00 2.73  ? 39  MET B H    5  
ATOM 10625 H HA   . MET B 2 18  ? -10.491 -10.521 13.424  1.00 3.23  ? 39  MET B HA   5  
ATOM 10626 H HB2  . MET B 2 18  ? -9.408  -8.948  11.887  1.00 3.27  ? 39  MET B HB2  5  
ATOM 10627 H HB3  . MET B 2 18  ? -10.130 -9.772  10.512  1.00 3.33  ? 39  MET B HB3  5  
ATOM 10628 H HG2  . MET B 2 18  ? -11.323 -7.728  11.008  1.00 3.53  ? 39  MET B HG2  5  
ATOM 10629 H HG3  . MET B 2 18  ? -12.353 -9.130  11.291  1.00 3.93  ? 39  MET B HG3  5  
ATOM 10630 H HE1  . MET B 2 18  ? -13.573 -6.581  14.007  1.00 4.48  ? 39  MET B HE1  5  
ATOM 10631 H HE2  . MET B 2 18  ? -14.066 -7.640  12.686  1.00 4.79  ? 39  MET B HE2  5  
ATOM 10632 H HE3  . MET B 2 18  ? -13.055 -6.233  12.358  1.00 4.64  ? 39  MET B HE3  5  
ATOM 10633 N N    . GLY B 2 19  ? -12.209 -12.287 12.894  1.00 4.23  ? 40  GLY B N    5  
ATOM 10634 C CA   . GLY B 2 19  ? -13.365 -13.099 12.596  1.00 5.19  ? 40  GLY B CA   5  
ATOM 10635 C C    . GLY B 2 19  ? -14.404 -13.002 13.684  1.00 5.68  ? 40  GLY B C    5  
ATOM 10636 O O    . GLY B 2 19  ? -15.606 -13.138 13.382  1.00 6.18  ? 40  GLY B O    5  
ATOM 10637 O OXT  . GLY B 2 19  ? -14.019 -12.775 14.854  1.00 5.90  ? 40  GLY B OXT  5  
ATOM 10638 H H    . GLY B 2 19  ? -11.860 -12.252 13.811  1.00 4.07  ? 40  GLY B H    5  
ATOM 10639 H HA2  . GLY B 2 19  ? -13.798 -12.766 11.665  1.00 5.50  ? 40  GLY B HA2  5  
ATOM 10640 H HA3  . GLY B 2 19  ? -13.056 -14.129 12.494  1.00 5.60  ? 40  GLY B HA3  5  
ATOM 10641 N N    . PRO A 1 1   ? 17.852  0.154   5.936   1.00 2.80  ? 1   PRO A N    6  
ATOM 10642 C CA   . PRO A 1 1   ? 16.766  0.122   4.934   1.00 2.09  ? 1   PRO A CA   6  
ATOM 10643 C C    . PRO A 1 1   ? 15.460  0.614   5.546   1.00 1.70  ? 1   PRO A C    6  
ATOM 10644 O O    . PRO A 1 1   ? 14.574  -0.179  5.866   1.00 2.48  ? 1   PRO A O    6  
ATOM 10645 C CB   . PRO A 1 1   ? 16.611  -1.303  4.420   1.00 2.88  ? 1   PRO A CB   6  
ATOM 10646 C CG   . PRO A 1 1   ? 17.754  -2.027  5.041   1.00 3.60  ? 1   PRO A CG   6  
ATOM 10647 C CD   . PRO A 1 1   ? 18.116  -1.251  6.288   1.00 3.50  ? 1   PRO A CD   6  
ATOM 10648 H H2   . PRO A 1 1   ? 18.611  0.718   5.487   1.00 2.93  ? 1   PRO A H2   6  
ATOM 10649 H H3   . PRO A 1 1   ? 17.513  0.772   6.691   1.00 3.05  ? 1   PRO A H3   6  
ATOM 10650 H HA   . PRO A 1 1   ? 17.035  0.771   4.114   1.00 2.07  ? 1   PRO A HA   6  
ATOM 10651 H HB2  . PRO A 1 1   ? 15.660  -1.704  4.740   1.00 3.16  ? 1   PRO A HB2  6  
ATOM 10652 H HB3  . PRO A 1 1   ? 16.674  -1.313  3.343   1.00 3.12  ? 1   PRO A HB3  6  
ATOM 10653 H HG2  . PRO A 1 1   ? 17.454  -3.032  5.300   1.00 4.35  ? 1   PRO A HG2  6  
ATOM 10654 H HG3  . PRO A 1 1   ? 18.589  -2.049  4.358   1.00 3.85  ? 1   PRO A HG3  6  
ATOM 10655 H HD2  . PRO A 1 1   ? 17.493  -1.560  7.114   1.00 4.20  ? 1   PRO A HD2  6  
ATOM 10656 H HD3  . PRO A 1 1   ? 19.158  -1.394  6.529   1.00 3.65  ? 1   PRO A HD3  6  
ATOM 10657 N N    . SER A 1 2   ? 15.356  1.923   5.725   1.00 1.00  ? 2   SER A N    6  
ATOM 10658 C CA   . SER A 1 2   ? 14.163  2.524   6.290   1.00 0.75  ? 2   SER A CA   6  
ATOM 10659 C C    . SER A 1 2   ? 13.240  3.024   5.185   1.00 0.89  ? 2   SER A C    6  
ATOM 10660 O O    . SER A 1 2   ? 12.058  2.688   5.148   1.00 1.99  ? 2   SER A O    6  
ATOM 10661 C CB   . SER A 1 2   ? 14.554  3.673   7.221   1.00 1.16  ? 2   SER A CB   6  
ATOM 10662 O OG   . SER A 1 2   ? 15.472  4.549   6.588   1.00 1.66  ? 2   SER A OG   6  
ATOM 10663 H H    . SER A 1 2   ? 16.106  2.505   5.469   1.00 1.37  ? 2   SER A H    6  
ATOM 10664 H HA   . SER A 1 2   ? 13.648  1.768   6.862   1.00 0.60  ? 2   SER A HA   6  
ATOM 10665 H HB2  . SER A 1 2   ? 13.670  4.231   7.491   1.00 1.50  ? 2   SER A HB2  6  
ATOM 10666 H HB3  . SER A 1 2   ? 15.013  3.272   8.112   1.00 1.23  ? 2   SER A HB3  6  
ATOM 10667 H HG   . SER A 1 2   ? 15.921  5.077   7.261   1.00 1.95  ? 2   SER A HG   6  
ATOM 10668 N N    . HIS A 1 3   ? 13.793  3.813   4.276   1.00 0.41  ? 3   HIS A N    6  
ATOM 10669 C CA   . HIS A 1 3   ? 13.012  4.387   3.188   1.00 0.27  ? 3   HIS A CA   6  
ATOM 10670 C C    . HIS A 1 3   ? 12.906  3.435   2.014   1.00 0.23  ? 3   HIS A C    6  
ATOM 10671 O O    . HIS A 1 3   ? 12.056  3.606   1.153   1.00 0.33  ? 3   HIS A O    6  
ATOM 10672 C CB   . HIS A 1 3   ? 13.625  5.699   2.700   1.00 0.28  ? 3   HIS A CB   6  
ATOM 10673 C CG   . HIS A 1 3   ? 13.342  6.878   3.574   1.00 0.36  ? 3   HIS A CG   6  
ATOM 10674 N ND1  . HIS A 1 3   ? 14.195  7.303   4.566   1.00 0.56  ? 3   HIS A ND1  6  
ATOM 10675 C CD2  . HIS A 1 3   ? 12.302  7.742   3.579   1.00 0.38  ? 3   HIS A CD2  6  
ATOM 10676 C CE1  . HIS A 1 3   ? 13.692  8.378   5.142   1.00 0.61  ? 3   HIS A CE1  6  
ATOM 10677 N NE2  . HIS A 1 3   ? 12.544  8.665   4.559   1.00 0.49  ? 3   HIS A NE2  6  
ATOM 10678 H H    . HIS A 1 3   ? 14.754  4.013   4.337   1.00 1.21  ? 3   HIS A H    6  
ATOM 10679 H HA   . HIS A 1 3   ? 12.024  4.583   3.562   1.00 0.31  ? 3   HIS A HA   6  
ATOM 10680 H HB2  . HIS A 1 3   ? 14.696  5.585   2.641   1.00 0.33  ? 3   HIS A HB2  6  
ATOM 10681 H HB3  . HIS A 1 3   ? 13.238  5.916   1.715   1.00 0.28  ? 3   HIS A HB3  6  
ATOM 10682 H HD1  . HIS A 1 3   ? 15.051  6.884   4.808   1.00 0.69  ? 3   HIS A HD1  6  
ATOM 10683 H HD2  . HIS A 1 3   ? 11.440  7.709   2.928   1.00 0.44  ? 3   HIS A HD2  6  
ATOM 10684 H HE1  . HIS A 1 3   ? 14.143  8.927   5.952   1.00 0.78  ? 3   HIS A HE1  6  
ATOM 10685 H HE2  . HIS A 1 3   ? 12.030  9.505   4.694   1.00 0.56  ? 3   HIS A HE2  6  
ATOM 10686 N N    . SER A 1 4   ? 13.759  2.436   1.975   1.00 0.21  ? 4   SER A N    6  
ATOM 10687 C CA   . SER A 1 4   ? 13.799  1.551   0.825   1.00 0.17  ? 4   SER A CA   6  
ATOM 10688 C C    . SER A 1 4   ? 14.088  0.112   1.201   1.00 0.18  ? 4   SER A C    6  
ATOM 10689 O O    . SER A 1 4   ? 14.560  -0.187  2.299   1.00 0.24  ? 4   SER A O    6  
ATOM 10690 C CB   . SER A 1 4   ? 14.818  2.051   -0.188  1.00 0.19  ? 4   SER A CB   6  
ATOM 10691 O OG   . SER A 1 4   ? 16.087  2.273   0.412   1.00 0.28  ? 4   SER A OG   6  
ATOM 10692 H H    . SER A 1 4   ? 14.355  2.281   2.734   1.00 0.28  ? 4   SER A H    6  
ATOM 10693 H HA   . SER A 1 4   ? 12.828  1.578   0.353   1.00 0.15  ? 4   SER A HA   6  
ATOM 10694 H HB2  . SER A 1 4   ? 14.920  1.319   -0.972  1.00 0.19  ? 4   SER A HB2  6  
ATOM 10695 H HB3  . SER A 1 4   ? 14.462  2.970   -0.608  1.00 0.19  ? 4   SER A HB3  6  
ATOM 10696 H HG   . SER A 1 4   ? 15.980  2.857   1.174   1.00 0.91  ? 4   SER A HG   6  
ATOM 10697 N N    . GLY A 1 5   ? 13.792  -0.760  0.260   1.00 0.15  ? 5   GLY A N    6  
ATOM 10698 C CA   . GLY A 1 5   ? 13.974  -2.177  0.429   1.00 0.15  ? 5   GLY A CA   6  
ATOM 10699 C C    . GLY A 1 5   ? 13.453  -2.914  -0.771  1.00 0.13  ? 5   GLY A C    6  
ATOM 10700 O O    . GLY A 1 5   ? 12.536  -2.437  -1.437  1.00 0.12  ? 5   GLY A O    6  
ATOM 10701 H H    . GLY A 1 5   ? 13.433  -0.423  -0.591  1.00 0.15  ? 5   GLY A H    6  
ATOM 10702 H HA2  . GLY A 1 5   ? 15.024  -2.392  0.532   1.00 0.17  ? 5   GLY A HA2  6  
ATOM 10703 H HA3  . GLY A 1 5   ? 13.447  -2.510  1.309   1.00 0.17  ? 5   GLY A HA3  6  
ATOM 10704 N N    . ALA A 1 6   ? 14.038  -4.056  -1.060  1.00 0.14  ? 6   ALA A N    6  
ATOM 10705 C CA   . ALA A 1 6   ? 13.717  -4.778  -2.276  1.00 0.15  ? 6   ALA A CA   6  
ATOM 10706 C C    . ALA A 1 6   ? 12.288  -5.299  -2.257  1.00 0.15  ? 6   ALA A C    6  
ATOM 10707 O O    . ALA A 1 6   ? 11.884  -6.031  -1.351  1.00 0.19  ? 6   ALA A O    6  
ATOM 10708 C CB   . ALA A 1 6   ? 14.709  -5.898  -2.510  1.00 0.17  ? 6   ALA A CB   6  
ATOM 10709 H H    . ALA A 1 6   ? 14.701  -4.424  -0.444  1.00 0.16  ? 6   ALA A H    6  
ATOM 10710 H HA   . ALA A 1 6   ? 13.815  -4.084  -3.092  1.00 0.14  ? 6   ALA A HA   6  
ATOM 10711 H HB1  . ALA A 1 6   ? 15.702  -5.480  -2.574  1.00 1.00  ? 6   ALA A HB1  6  
ATOM 10712 H HB2  . ALA A 1 6   ? 14.468  -6.398  -3.436  1.00 1.07  ? 6   ALA A HB2  6  
ATOM 10713 H HB3  . ALA A 1 6   ? 14.662  -6.602  -1.694  1.00 1.03  ? 6   ALA A HB3  6  
ATOM 10714 N N    . ALA A 1 7   ? 11.535  -4.900  -3.271  1.00 0.14  ? 7   ALA A N    6  
ATOM 10715 C CA   . ALA A 1 7   ? 10.134  -5.247  -3.388  1.00 0.14  ? 7   ALA A CA   6  
ATOM 10716 C C    . ALA A 1 7   ? 9.827   -5.721  -4.802  1.00 0.16  ? 7   ALA A C    6  
ATOM 10717 O O    . ALA A 1 7   ? 10.673  -5.663  -5.679  1.00 0.15  ? 7   ALA A O    6  
ATOM 10718 C CB   . ALA A 1 7   ? 9.259   -4.056  -3.020  1.00 0.14  ? 7   ALA A CB   6  
ATOM 10719 H H    . ALA A 1 7   ? 11.952  -4.375  -3.989  1.00 0.14  ? 7   ALA A H    6  
ATOM 10720 H HA   . ALA A 1 7   ? 9.926   -6.048  -2.695  1.00 0.16  ? 7   ALA A HA   6  
ATOM 10721 H HB1  . ALA A 1 7   ? 8.228   -4.282  -3.250  1.00 1.03  ? 7   ALA A HB1  6  
ATOM 10722 H HB2  . ALA A 1 7   ? 9.575   -3.181  -3.574  1.00 1.05  ? 7   ALA A HB2  6  
ATOM 10723 H HB3  . ALA A 1 7   ? 9.350   -3.860  -1.959  1.00 1.00  ? 7   ALA A HB3  6  
ATOM 10724 N N    . ILE A 1 8   ? 8.612   -6.185  -5.019  1.00 0.20  ? 8   ILE A N    6  
ATOM 10725 C CA   . ILE A 1 8   ? 8.196   -6.711  -6.310  1.00 0.23  ? 8   ILE A CA   6  
ATOM 10726 C C    . ILE A 1 8   ? 6.862   -6.101  -6.725  1.00 0.25  ? 8   ILE A C    6  
ATOM 10727 O O    . ILE A 1 8   ? 5.966   -5.939  -5.894  1.00 0.28  ? 8   ILE A O    6  
ATOM 10728 C CB   . ILE A 1 8   ? 8.083   -8.246  -6.253  1.00 0.28  ? 8   ILE A CB   6  
ATOM 10729 C CG1  . ILE A 1 8   ? 9.482   -8.845  -6.205  1.00 0.29  ? 8   ILE A CG1  6  
ATOM 10730 C CG2  . ILE A 1 8   ? 7.290   -8.807  -7.428  1.00 0.31  ? 8   ILE A CG2  6  
ATOM 10731 C CD1  . ILE A 1 8   ? 9.872   -9.380  -4.858  1.00 0.36  ? 8   ILE A CD1  6  
ATOM 10732 H H    . ILE A 1 8   ? 7.971   -6.188  -4.278  1.00 0.23  ? 8   ILE A H    6  
ATOM 10733 H HA   . ILE A 1 8   ? 8.961   -6.462  -7.043  1.00 0.20  ? 8   ILE A HA   6  
ATOM 10734 H HB   . ILE A 1 8   ? 7.564   -8.503  -5.349  1.00 0.33  ? 8   ILE A HB   6  
ATOM 10735 H HG12 . ILE A 1 8   ? 9.561   -9.639  -6.923  1.00 0.31  ? 8   ILE A HG12 6  
ATOM 10736 H HG13 . ILE A 1 8   ? 10.191  -8.078  -6.453  1.00 0.24  ? 8   ILE A HG13 6  
ATOM 10737 H HG21 . ILE A 1 8   ? 7.255   -9.884  -7.358  1.00 0.99  ? 8   ILE A HG21 6  
ATOM 10738 H HG22 . ILE A 1 8   ? 7.767   -8.522  -8.354  1.00 1.08  ? 8   ILE A HG22 6  
ATOM 10739 H HG23 . ILE A 1 8   ? 6.285   -8.413  -7.404  1.00 1.02  ? 8   ILE A HG23 6  
ATOM 10740 H HD11 . ILE A 1 8   ? 10.870  -9.782  -4.915  1.00 1.04  ? 8   ILE A HD11 6  
ATOM 10741 H HD12 . ILE A 1 8   ? 9.182   -10.153 -4.562  1.00 1.06  ? 8   ILE A HD12 6  
ATOM 10742 H HD13 . ILE A 1 8   ? 9.849   -8.574  -4.142  1.00 1.07  ? 8   ILE A HD13 6  
ATOM 10743 N N    . PHE A 1 9   ? 6.743   -5.761  -8.000  1.00 0.24  ? 9   PHE A N    6  
ATOM 10744 C CA   . PHE A 1 9   ? 5.526   -5.165  -8.534  1.00 0.26  ? 9   PHE A CA   6  
ATOM 10745 C C    . PHE A 1 9   ? 5.348   -5.612  -9.979  1.00 0.28  ? 9   PHE A C    6  
ATOM 10746 O O    . PHE A 1 9   ? 6.302   -5.582  -10.745 1.00 0.28  ? 9   PHE A O    6  
ATOM 10747 C CB   . PHE A 1 9   ? 5.607   -3.635  -8.458  1.00 0.25  ? 9   PHE A CB   6  
ATOM 10748 C CG   . PHE A 1 9   ? 4.295   -2.936  -8.691  1.00 0.28  ? 9   PHE A CG   6  
ATOM 10749 C CD1  . PHE A 1 9   ? 3.895   -2.568  -9.963  1.00 0.32  ? 9   PHE A CD1  6  
ATOM 10750 C CD2  . PHE A 1 9   ? 3.462   -2.652  -7.629  1.00 0.31  ? 9   PHE A CD2  6  
ATOM 10751 C CE1  . PHE A 1 9   ? 2.687   -1.928  -10.169 1.00 0.38  ? 9   PHE A CE1  6  
ATOM 10752 C CE2  . PHE A 1 9   ? 2.253   -2.014  -7.823  1.00 0.36  ? 9   PHE A CE2  6  
ATOM 10753 C CZ   . PHE A 1 9   ? 1.865   -1.650  -9.096  1.00 0.39  ? 9   PHE A CZ   6  
ATOM 10754 H H    . PHE A 1 9   ? 7.497   -5.936  -8.611  1.00 0.23  ? 9   PHE A H    6  
ATOM 10755 H HA   . PHE A 1 9   ? 4.691   -5.514  -7.947  1.00 0.28  ? 9   PHE A HA   6  
ATOM 10756 H HB2  . PHE A 1 9   ? 5.960   -3.351  -7.479  1.00 0.27  ? 9   PHE A HB2  6  
ATOM 10757 H HB3  . PHE A 1 9   ? 6.306   -3.283  -9.201  1.00 0.26  ? 9   PHE A HB3  6  
ATOM 10758 H HD1  . PHE A 1 9   ? 4.540   -2.783  -10.803 1.00 0.34  ? 9   PHE A HD1  6  
ATOM 10759 H HD2  . PHE A 1 9   ? 3.772   -2.928  -6.632  1.00 0.33  ? 9   PHE A HD2  6  
ATOM 10760 H HE1  . PHE A 1 9   ? 2.388   -1.644  -11.167 1.00 0.43  ? 9   PHE A HE1  6  
ATOM 10761 H HE2  . PHE A 1 9   ? 1.612   -1.801  -6.980  1.00 0.40  ? 9   PHE A HE2  6  
ATOM 10762 H HZ   . PHE A 1 9   ? 0.919   -1.151  -9.252  1.00 0.45  ? 9   PHE A HZ   6  
ATOM 10763 N N    . GLU A 1 10  ? 4.137   -6.034  -10.339 1.00 0.37  ? 10  GLU A N    6  
ATOM 10764 C CA   . GLU A 1 10  ? 3.851   -6.534  -11.691 1.00 0.43  ? 10  GLU A CA   6  
ATOM 10765 C C    . GLU A 1 10  ? 4.676   -7.772  -12.005 1.00 0.33  ? 10  GLU A C    6  
ATOM 10766 O O    . GLU A 1 10  ? 5.158   -7.953  -13.125 1.00 0.38  ? 10  GLU A O    6  
ATOM 10767 C CB   . GLU A 1 10  ? 4.111   -5.460  -12.739 1.00 0.59  ? 10  GLU A CB   6  
ATOM 10768 C CG   . GLU A 1 10  ? 3.109   -4.336  -12.693 1.00 0.77  ? 10  GLU A CG   6  
ATOM 10769 C CD   . GLU A 1 10  ? 3.430   -3.246  -13.689 1.00 1.00  ? 10  GLU A CD   6  
ATOM 10770 O OE1  . GLU A 1 10  ? 2.967   -3.341  -14.845 1.00 1.33  ? 10  GLU A OE1  6  
ATOM 10771 O OE2  . GLU A 1 10  ? 4.130   -2.281  -13.322 1.00 0.95  ? 10  GLU A OE2  6  
ATOM 10772 H H    . GLU A 1 10  ? 3.411   -6.005  -9.679  1.00 0.43  ? 10  GLU A H    6  
ATOM 10773 H HA   . GLU A 1 10  ? 2.806   -6.805  -11.722 1.00 0.54  ? 10  GLU A HA   6  
ATOM 10774 H HB2  . GLU A 1 10  ? 5.096   -5.046  -12.578 1.00 0.56  ? 10  GLU A HB2  6  
ATOM 10775 H HB3  . GLU A 1 10  ? 4.073   -5.911  -13.719 1.00 0.67  ? 10  GLU A HB3  6  
ATOM 10776 H HG2  . GLU A 1 10  ? 2.135   -4.742  -12.910 1.00 0.88  ? 10  GLU A HG2  6  
ATOM 10777 H HG3  . GLU A 1 10  ? 3.108   -3.912  -11.701 1.00 0.70  ? 10  GLU A HG3  6  
ATOM 10778 N N    . LYS A 1 11  ? 4.835   -8.602  -10.989 1.00 0.35  ? 11  LYS A N    6  
ATOM 10779 C CA   . LYS A 1 11  ? 5.563   -9.872  -11.087 1.00 0.43  ? 11  LYS A CA   6  
ATOM 10780 C C    . LYS A 1 11  ? 7.060   -9.687  -11.352 1.00 0.41  ? 11  LYS A C    6  
ATOM 10781 O O    . LYS A 1 11  ? 7.796   -10.667 -11.461 1.00 0.59  ? 11  LYS A O    6  
ATOM 10782 C CB   . LYS A 1 11  ? 4.952   -10.792 -12.145 1.00 0.54  ? 11  LYS A CB   6  
ATOM 10783 C CG   . LYS A 1 11  ? 3.595   -11.345 -11.747 1.00 0.63  ? 11  LYS A CG   6  
ATOM 10784 C CD   . LYS A 1 11  ? 2.474   -10.424 -12.119 1.00 1.34  ? 11  LYS A CD   6  
ATOM 10785 C CE   . LYS A 1 11  ? 1.129   -11.059 -11.835 1.00 1.31  ? 11  LYS A CE   6  
ATOM 10786 N NZ   . LYS A 1 11  ? 0.870   -12.238 -12.703 1.00 2.23  ? 11  LYS A NZ   6  
ATOM 10787 H H    . LYS A 1 11  ? 4.431   -8.352  -10.130 1.00 0.41  ? 11  LYS A H    6  
ATOM 10788 H HA   . LYS A 1 11  ? 5.455   -10.363 -10.131 1.00 0.53  ? 11  LYS A HA   6  
ATOM 10789 H HB2  . LYS A 1 11  ? 4.836   -10.236 -13.065 1.00 0.51  ? 11  LYS A HB2  6  
ATOM 10790 H HB3  . LYS A 1 11  ? 5.620   -11.621 -12.316 1.00 0.67  ? 11  LYS A HB3  6  
ATOM 10791 H HG2  . LYS A 1 11  ? 3.435   -12.275 -12.230 1.00 1.25  ? 11  LYS A HG2  6  
ATOM 10792 H HG3  . LYS A 1 11  ? 3.578   -11.486 -10.686 1.00 0.98  ? 11  LYS A HG3  6  
ATOM 10793 H HD2  . LYS A 1 11  ? 2.567   -9.530  -11.548 1.00 1.86  ? 11  LYS A HD2  6  
ATOM 10794 H HD3  . LYS A 1 11  ? 2.544   -10.196 -13.157 1.00 2.00  ? 11  LYS A HD3  6  
ATOM 10795 H HE2  . LYS A 1 11  ? 1.122   -11.380 -10.807 1.00 1.09  ? 11  LYS A HE2  6  
ATOM 10796 H HE3  . LYS A 1 11  ? 0.354   -10.325 -11.992 1.00 1.82  ? 11  LYS A HE3  6  
ATOM 10797 H HZ1  . LYS A 1 11  ? 0.996   -11.982 -13.702 1.00 2.72  ? 11  LYS A HZ1  6  
ATOM 10798 H HZ2  . LYS A 1 11  ? -0.106  -12.573 -12.565 1.00 2.51  ? 11  LYS A HZ2  6  
ATOM 10799 H HZ3  . LYS A 1 11  ? 1.525   -13.010 -12.468 1.00 2.85  ? 11  LYS A HZ3  6  
ATOM 10800 N N    . VAL A 1 12  ? 7.518   -8.449  -11.457 1.00 0.26  ? 12  VAL A N    6  
ATOM 10801 C CA   . VAL A 1 12  ? 8.940   -8.185  -11.574 1.00 0.25  ? 12  VAL A CA   6  
ATOM 10802 C C    . VAL A 1 12  ? 9.464   -7.641  -10.257 1.00 0.22  ? 12  VAL A C    6  
ATOM 10803 O O    . VAL A 1 12  ? 8.744   -6.975  -9.516  1.00 0.20  ? 12  VAL A O    6  
ATOM 10804 C CB   . VAL A 1 12  ? 9.283   -7.217  -12.737 1.00 0.25  ? 12  VAL A CB   6  
ATOM 10805 C CG1  . VAL A 1 12  ? 8.365   -6.012  -12.747 1.00 0.24  ? 12  VAL A CG1  6  
ATOM 10806 C CG2  . VAL A 1 12  ? 10.744  -6.784  -12.669 1.00 0.25  ? 12  VAL A CG2  6  
ATOM 10807 H H    . VAL A 1 12  ? 6.891   -7.697  -11.443 1.00 0.27  ? 12  VAL A H    6  
ATOM 10808 H HA   . VAL A 1 12  ? 9.428   -9.131  -11.769 1.00 0.28  ? 12  VAL A HA   6  
ATOM 10809 H HB   . VAL A 1 12  ? 9.137   -7.740  -13.662 1.00 0.29  ? 12  VAL A HB   6  
ATOM 10810 H HG11 . VAL A 1 12  ? 7.392   -6.302  -13.113 1.00 1.04  ? 12  VAL A HG11 6  
ATOM 10811 H HG12 . VAL A 1 12  ? 8.778   -5.245  -13.387 1.00 1.04  ? 12  VAL A HG12 6  
ATOM 10812 H HG13 . VAL A 1 12  ? 8.266   -5.629  -11.743 1.00 1.04  ? 12  VAL A HG13 6  
ATOM 10813 H HG21 . VAL A 1 12  ? 11.001  -6.227  -13.557 1.00 0.98  ? 12  VAL A HG21 6  
ATOM 10814 H HG22 . VAL A 1 12  ? 11.377  -7.659  -12.590 1.00 0.95  ? 12  VAL A HG22 6  
ATOM 10815 H HG23 . VAL A 1 12  ? 10.892  -6.162  -11.798 1.00 0.99  ? 12  VAL A HG23 6  
ATOM 10816 N N    . SER A 1 13  ? 10.705  -7.960  -9.964  1.00 0.23  ? 13  SER A N    6  
ATOM 10817 C CA   . SER A 1 13  ? 11.322  -7.588  -8.712  1.00 0.22  ? 13  SER A CA   6  
ATOM 10818 C C    . SER A 1 13  ? 12.141  -6.317  -8.844  1.00 0.19  ? 13  SER A C    6  
ATOM 10819 O O    . SER A 1 13  ? 12.607  -5.970  -9.930  1.00 0.20  ? 13  SER A O    6  
ATOM 10820 C CB   . SER A 1 13  ? 12.186  -8.736  -8.230  1.00 0.27  ? 13  SER A CB   6  
ATOM 10821 O OG   . SER A 1 13  ? 13.031  -8.359  -7.158  1.00 1.29  ? 13  SER A OG   6  
ATOM 10822 H H    . SER A 1 13  ? 11.231  -8.457  -10.621 1.00 0.26  ? 13  SER A H    6  
ATOM 10823 H HA   . SER A 1 13  ? 10.537  -7.423  -7.992  1.00 0.21  ? 13  SER A HA   6  
ATOM 10824 H HB2  . SER A 1 13  ? 11.538  -9.520  -7.890  1.00 1.03  ? 13  SER A HB2  6  
ATOM 10825 H HB3  . SER A 1 13  ? 12.786  -9.089  -9.055  1.00 0.99  ? 13  SER A HB3  6  
ATOM 10826 H HG   . SER A 1 13  ? 13.592  -9.105  -6.912  1.00 1.80  ? 13  SER A HG   6  
ATOM 10827 N N    . GLY A 1 14  ? 12.304  -5.640  -7.724  1.00 0.17  ? 14  GLY A N    6  
ATOM 10828 C CA   . GLY A 1 14  ? 13.045  -4.402  -7.675  1.00 0.17  ? 14  GLY A CA   6  
ATOM 10829 C C    . GLY A 1 14  ? 13.195  -3.900  -6.259  1.00 0.15  ? 14  GLY A C    6  
ATOM 10830 O O    . GLY A 1 14  ? 13.251  -4.690  -5.324  1.00 0.15  ? 14  GLY A O    6  
ATOM 10831 H H    . GLY A 1 14  ? 11.908  -6.002  -6.893  1.00 0.18  ? 14  GLY A H    6  
ATOM 10832 H HA2  . GLY A 1 14  ? 14.024  -4.557  -8.100  1.00 0.22  ? 14  GLY A HA2  6  
ATOM 10833 H HA3  . GLY A 1 14  ? 12.522  -3.657  -8.255  1.00 0.18  ? 14  GLY A HA3  6  
ATOM 10834 N N    . ILE A 1 15  ? 13.281  -2.593  -6.097  1.00 0.13  ? 15  ILE A N    6  
ATOM 10835 C CA   . ILE A 1 15  ? 13.330  -1.979  -4.782  1.00 0.12  ? 15  ILE A CA   6  
ATOM 10836 C C    . ILE A 1 15  ? 12.177  -0.995  -4.628  1.00 0.12  ? 15  ILE A C    6  
ATOM 10837 O O    . ILE A 1 15  ? 11.774  -0.347  -5.589  1.00 0.13  ? 15  ILE A O    6  
ATOM 10838 C CB   . ILE A 1 15  ? 14.683  -1.244  -4.529  1.00 0.14  ? 15  ILE A CB   6  
ATOM 10839 C CG1  . ILE A 1 15  ? 15.778  -2.219  -4.084  1.00 0.16  ? 15  ILE A CG1  6  
ATOM 10840 C CG2  . ILE A 1 15  ? 14.540  -0.128  -3.495  1.00 0.15  ? 15  ILE A CG2  6  
ATOM 10841 C CD1  . ILE A 1 15  ? 16.164  -3.240  -5.122  1.00 0.18  ? 15  ILE A CD1  6  
ATOM 10842 H H    . ILE A 1 15  ? 13.320  -2.017  -6.892  1.00 0.14  ? 15  ILE A H    6  
ATOM 10843 H HA   . ILE A 1 15  ? 13.224  -2.761  -4.047  1.00 0.12  ? 15  ILE A HA   6  
ATOM 10844 H HB   . ILE A 1 15  ? 14.986  -0.789  -5.460  1.00 0.15  ? 15  ILE A HB   6  
ATOM 10845 H HG12 . ILE A 1 15  ? 16.662  -1.656  -3.838  1.00 0.18  ? 15  ILE A HG12 6  
ATOM 10846 H HG13 . ILE A 1 15  ? 15.441  -2.753  -3.204  1.00 0.16  ? 15  ILE A HG13 6  
ATOM 10847 H HG21 . ILE A 1 15  ? 13.884  0.639   -3.885  1.00 0.97  ? 15  ILE A HG21 6  
ATOM 10848 H HG22 . ILE A 1 15  ? 15.508  0.299   -3.288  1.00 0.94  ? 15  ILE A HG22 6  
ATOM 10849 H HG23 . ILE A 1 15  ? 14.118  -0.529  -2.580  1.00 0.99  ? 15  ILE A HG23 6  
ATOM 10850 H HD11 . ILE A 1 15  ? 15.358  -3.947  -5.236  1.00 1.01  ? 15  ILE A HD11 6  
ATOM 10851 H HD12 . ILE A 1 15  ? 17.055  -3.754  -4.801  1.00 1.05  ? 15  ILE A HD12 6  
ATOM 10852 H HD13 . ILE A 1 15  ? 16.344  -2.745  -6.068  1.00 1.03  ? 15  ILE A HD13 6  
ATOM 10853 N N    . ILE A 1 16  ? 11.658  -0.896  -3.419  1.00 0.11  ? 16  ILE A N    6  
ATOM 10854 C CA   . ILE A 1 16  ? 10.672  0.106   -3.082  1.00 0.11  ? 16  ILE A CA   6  
ATOM 10855 C C    . ILE A 1 16  ? 11.400  1.232   -2.349  1.00 0.11  ? 16  ILE A C    6  
ATOM 10856 O O    . ILE A 1 16  ? 12.242  0.967   -1.495  1.00 0.13  ? 16  ILE A O    6  
ATOM 10857 C CB   . ILE A 1 16  ? 9.553   -0.507  -2.208  1.00 0.12  ? 16  ILE A CB   6  
ATOM 10858 C CG1  . ILE A 1 16  ? 8.185   -0.306  -2.848  1.00 0.13  ? 16  ILE A CG1  6  
ATOM 10859 C CG2  . ILE A 1 16  ? 9.553   0.058   -0.801  1.00 0.14  ? 16  ILE A CG2  6  
ATOM 10860 C CD1  . ILE A 1 16  ? 7.051   -0.846  -2.000  1.00 0.17  ? 16  ILE A CD1  6  
ATOM 10861 H H    . ILE A 1 16  ? 11.957  -1.523  -2.719  1.00 0.12  ? 16  ILE A H    6  
ATOM 10862 H HA   . ILE A 1 16  ? 10.238  0.481   -3.992  1.00 0.11  ? 16  ILE A HA   6  
ATOM 10863 H HB   . ILE A 1 16  ? 9.745   -1.562  -2.141  1.00 0.14  ? 16  ILE A HB   6  
ATOM 10864 H HG12 . ILE A 1 16  ? 8.015   0.746   -3.006  1.00 0.13  ? 16  ILE A HG12 6  
ATOM 10865 H HG13 . ILE A 1 16  ? 8.162   -0.815  -3.795  1.00 0.14  ? 16  ILE A HG13 6  
ATOM 10866 H HG21 . ILE A 1 16  ? 8.743   -0.380  -0.241  1.00 1.01  ? 16  ILE A HG21 6  
ATOM 10867 H HG22 . ILE A 1 16  ? 9.423   1.128   -0.849  1.00 1.04  ? 16  ILE A HG22 6  
ATOM 10868 H HG23 . ILE A 1 16  ? 10.492  -0.173  -0.321  1.00 1.01  ? 16  ILE A HG23 6  
ATOM 10869 H HD11 . ILE A 1 16  ? 7.175   -1.911  -1.869  1.00 1.04  ? 16  ILE A HD11 6  
ATOM 10870 H HD12 . ILE A 1 16  ? 6.109   -0.650  -2.492  1.00 1.06  ? 16  ILE A HD12 6  
ATOM 10871 H HD13 . ILE A 1 16  ? 7.062   -0.363  -1.034  1.00 1.00  ? 16  ILE A HD13 6  
ATOM 10872 N N    . ALA A 1 17  ? 11.131  2.471   -2.719  1.00 0.12  ? 17  ALA A N    6  
ATOM 10873 C CA   . ALA A 1 17  ? 11.927  3.589   -2.231  1.00 0.13  ? 17  ALA A CA   6  
ATOM 10874 C C    . ALA A 1 17  ? 11.073  4.810   -1.924  1.00 0.13  ? 17  ALA A C    6  
ATOM 10875 O O    . ALA A 1 17  ? 10.592  5.482   -2.828  1.00 0.15  ? 17  ALA A O    6  
ATOM 10876 C CB   . ALA A 1 17  ? 12.997  3.940   -3.257  1.00 0.15  ? 17  ALA A CB   6  
ATOM 10877 H H    . ALA A 1 17  ? 10.383  2.640   -3.326  1.00 0.12  ? 17  ALA A H    6  
ATOM 10878 H HA   . ALA A 1 17  ? 12.425  3.274   -1.327  1.00 0.13  ? 17  ALA A HA   6  
ATOM 10879 H HB1  . ALA A 1 17  ? 13.550  4.803   -2.918  1.00 1.00  ? 17  ALA A HB1  6  
ATOM 10880 H HB2  . ALA A 1 17  ? 12.527  4.162   -4.210  1.00 0.99  ? 17  ALA A HB2  6  
ATOM 10881 H HB3  . ALA A 1 17  ? 13.671  3.102   -3.371  1.00 1.00  ? 17  ALA A HB3  6  
ATOM 10882 N N    . ILE A 1 18  ? 10.898  5.101   -0.648  1.00 0.17  ? 18  ILE A N    6  
ATOM 10883 C CA   . ILE A 1 18  ? 10.158  6.283   -0.237  1.00 0.15  ? 18  ILE A CA   6  
ATOM 10884 C C    . ILE A 1 18  ? 11.096  7.479   -0.210  1.00 0.16  ? 18  ILE A C    6  
ATOM 10885 O O    . ILE A 1 18  ? 12.138  7.456   0.445   1.00 0.23  ? 18  ILE A O    6  
ATOM 10886 C CB   . ILE A 1 18  ? 9.473   6.126   1.146   1.00 0.18  ? 18  ILE A CB   6  
ATOM 10887 C CG1  . ILE A 1 18  ? 8.406   5.029   1.138   1.00 0.21  ? 18  ILE A CG1  6  
ATOM 10888 C CG2  . ILE A 1 18  ? 8.819   7.431   1.553   1.00 0.18  ? 18  ILE A CG2  6  
ATOM 10889 C CD1  . ILE A 1 18  ? 8.935   3.618   1.003   1.00 0.21  ? 18  ILE A CD1  6  
ATOM 10890 H H    . ILE A 1 18  ? 11.290  4.511   0.037   1.00 0.25  ? 18  ILE A H    6  
ATOM 10891 H HA   . ILE A 1 18  ? 9.392   6.464   -0.976  1.00 0.15  ? 18  ILE A HA   6  
ATOM 10892 H HB   . ILE A 1 18  ? 10.227  5.887   1.880   1.00 0.20  ? 18  ILE A HB   6  
ATOM 10893 H HG12 . ILE A 1 18  ? 7.851   5.086   2.062   1.00 0.27  ? 18  ILE A HG12 6  
ATOM 10894 H HG13 . ILE A 1 18  ? 7.732   5.210   0.315   1.00 0.22  ? 18  ILE A HG13 6  
ATOM 10895 H HG21 . ILE A 1 18  ? 8.339   7.302   2.511   1.00 1.02  ? 18  ILE A HG21 6  
ATOM 10896 H HG22 . ILE A 1 18  ? 8.078   7.703   0.812   1.00 1.03  ? 18  ILE A HG22 6  
ATOM 10897 H HG23 . ILE A 1 18  ? 9.567   8.206   1.622   1.00 1.03  ? 18  ILE A HG23 6  
ATOM 10898 H HD11 . ILE A 1 18  ? 9.640   3.417   1.797   1.00 1.03  ? 18  ILE A HD11 6  
ATOM 10899 H HD12 . ILE A 1 18  ? 9.426   3.506   0.044   1.00 1.03  ? 18  ILE A HD12 6  
ATOM 10900 H HD13 . ILE A 1 18  ? 8.113   2.920   1.067   1.00 0.99  ? 18  ILE A HD13 6  
ATOM 10901 N N    . ASN A 1 19  ? 10.717  8.515   -0.928  1.00 0.19  ? 19  ASN A N    6  
ATOM 10902 C CA   . ASN A 1 19  ? 11.577  9.663   -1.140  1.00 0.33  ? 19  ASN A CA   6  
ATOM 10903 C C    . ASN A 1 19  ? 10.969  10.918  -0.555  1.00 0.31  ? 19  ASN A C    6  
ATOM 10904 O O    . ASN A 1 19  ? 9.858   11.303  -0.928  1.00 0.55  ? 19  ASN A O    6  
ATOM 10905 C CB   . ASN A 1 19  ? 11.787  9.860   -2.644  1.00 0.54  ? 19  ASN A CB   6  
ATOM 10906 C CG   . ASN A 1 19  ? 12.738  10.995  -2.980  1.00 0.83  ? 19  ASN A CG   6  
ATOM 10907 O OD1  . ASN A 1 19  ? 13.621  11.342  -2.196  1.00 1.36  ? 19  ASN A OD1  6  
ATOM 10908 N ND2  . ASN A 1 19  ? 12.567  11.574  -4.159  1.00 1.00  ? 19  ASN A ND2  6  
ATOM 10909 H H    . ASN A 1 19  ? 9.821   8.508   -1.336  1.00 0.20  ? 19  ASN A H    6  
ATOM 10910 H HA   . ASN A 1 19  ? 12.524  9.478   -0.668  1.00 0.40  ? 19  ASN A HA   6  
ATOM 10911 H HB2  . ASN A 1 19  ? 12.177  8.955   -3.065  1.00 1.02  ? 19  ASN A HB2  6  
ATOM 10912 H HB3  . ASN A 1 19  ? 10.832  10.075  -3.102  1.00 0.61  ? 19  ASN A HB3  6  
ATOM 10913 H HD21 . ASN A 1 19  ? 11.844  11.240  -4.738  1.00 1.07  ? 19  ASN A HD21 6  
ATOM 10914 H HD22 . ASN A 1 19  ? 13.176  12.297  -4.414  1.00 1.32  ? 19  ASN A HD22 6  
ATOM 10915 N N    . GLU A 1 20  ? 11.683  11.567  0.356   1.00 0.36  ? 20  GLU A N    6  
ATOM 10916 C CA   . GLU A 1 20  ? 11.274  12.874  0.778   1.00 0.31  ? 20  GLU A CA   6  
ATOM 10917 C C    . GLU A 1 20  ? 12.391  13.852  0.434   1.00 0.67  ? 20  GLU A C    6  
ATOM 10918 O O    . GLU A 1 20  ? 13.098  14.358  1.303   1.00 1.47  ? 20  GLU A O    6  
ATOM 10919 C CB   . GLU A 1 20  ? 11.067  12.876  2.292   1.00 0.52  ? 20  GLU A CB   6  
ATOM 10920 C CG   . GLU A 1 20  ? 10.188  11.752  2.806   1.00 0.71  ? 20  GLU A CG   6  
ATOM 10921 C CD   . GLU A 1 20  ? 10.243  11.612  4.313   1.00 1.18  ? 20  GLU A CD   6  
ATOM 10922 O OE1  . GLU A 1 20  ? 9.482   12.318  5.009   1.00 1.47  ? 20  GLU A OE1  6  
ATOM 10923 O OE2  . GLU A 1 20  ? 11.038  10.792  4.815   1.00 1.41  ? 20  GLU A OE2  6  
ATOM 10924 H H    . GLU A 1 20  ? 12.503  11.183  0.711   1.00 0.66  ? 20  GLU A H    6  
ATOM 10925 H HA   . GLU A 1 20  ? 10.355  13.135  0.274   1.00 0.58  ? 20  GLU A HA   6  
ATOM 10926 H HB2  . GLU A 1 20  ? 12.026  12.792  2.772   1.00 0.71  ? 20  GLU A HB2  6  
ATOM 10927 H HB3  . GLU A 1 20  ? 10.619  13.811  2.572   1.00 0.70  ? 20  GLU A HB3  6  
ATOM 10928 H HG2  . GLU A 1 20  ? 9.173   11.955  2.517   1.00 0.85  ? 20  GLU A HG2  6  
ATOM 10929 H HG3  . GLU A 1 20  ? 10.511  10.823  2.358   1.00 0.53  ? 20  GLU A HG3  6  
ATOM 10930 N N    . ASP A 1 21  ? 12.528  14.104  -0.850  1.00 0.99  ? 21  ASP A N    6  
ATOM 10931 C CA   . ASP A 1 21  ? 13.312  15.217  -1.378  1.00 1.38  ? 21  ASP A CA   6  
ATOM 10932 C C    . ASP A 1 21  ? 12.371  16.199  -2.026  1.00 0.91  ? 21  ASP A C    6  
ATOM 10933 O O    . ASP A 1 21  ? 12.635  17.393  -2.168  1.00 0.88  ? 21  ASP A O    6  
ATOM 10934 C CB   . ASP A 1 21  ? 14.319  14.707  -2.406  1.00 2.11  ? 21  ASP A CB   6  
ATOM 10935 C CG   . ASP A 1 21  ? 15.140  15.818  -3.024  1.00 2.89  ? 21  ASP A CG   6  
ATOM 10936 O OD1  . ASP A 1 21  ? 16.142  16.229  -2.410  1.00 2.89  ? 21  ASP A OD1  6  
ATOM 10937 O OD2  . ASP A 1 21  ? 14.786  16.292  -4.121  1.00 3.67  ? 21  ASP A OD2  6  
ATOM 10938 H H    . ASP A 1 21  ? 12.102  13.491  -1.483  1.00 1.43  ? 21  ASP A H    6  
ATOM 10939 H HA   . ASP A 1 21  ? 13.830  15.694  -0.560  1.00 1.72  ? 21  ASP A HA   6  
ATOM 10940 H HB2  . ASP A 1 21  ? 14.985  14.013  -1.924  1.00 1.95  ? 21  ASP A HB2  6  
ATOM 10941 H HB3  . ASP A 1 21  ? 13.787  14.196  -3.194  1.00 2.52  ? 21  ASP A HB3  6  
ATOM 10942 N N    . VAL A 1 22  ? 11.248  15.630  -2.386  1.00 0.60  ? 22  VAL A N    6  
ATOM 10943 C CA   . VAL A 1 22  ? 10.323  16.183  -3.343  1.00 0.46  ? 22  VAL A CA   6  
ATOM 10944 C C    . VAL A 1 22  ? 9.069   16.703  -2.671  1.00 0.40  ? 22  VAL A C    6  
ATOM 10945 O O    . VAL A 1 22  ? 9.002   16.830  -1.446  1.00 0.48  ? 22  VAL A O    6  
ATOM 10946 C CB   . VAL A 1 22  ? 9.933   15.121  -4.399  1.00 0.57  ? 22  VAL A CB   6  
ATOM 10947 C CG1  . VAL A 1 22  ? 11.093  14.839  -5.328  1.00 0.90  ? 22  VAL A CG1  6  
ATOM 10948 C CG2  . VAL A 1 22  ? 9.504   13.823  -3.735  1.00 0.41  ? 22  VAL A CG2  6  
ATOM 10949 H H    . VAL A 1 22  ? 11.023  14.770  -1.979  1.00 0.53  ? 22  VAL A H    6  
ATOM 10950 H HA   . VAL A 1 22  ? 10.814  16.996  -3.851  1.00 0.55  ? 22  VAL A HA   6  
ATOM 10951 H HB   . VAL A 1 22  ? 9.108   15.497  -4.982  1.00 0.68  ? 22  VAL A HB   6  
ATOM 10952 H HG11 . VAL A 1 22  ? 10.780  14.131  -6.080  1.00 1.47  ? 22  VAL A HG11 6  
ATOM 10953 H HG12 . VAL A 1 22  ? 11.908  14.418  -4.758  1.00 1.33  ? 22  VAL A HG12 6  
ATOM 10954 H HG13 . VAL A 1 22  ? 11.413  15.755  -5.801  1.00 1.36  ? 22  VAL A HG13 6  
ATOM 10955 H HG21 . VAL A 1 22  ? 10.364  13.362  -3.271  1.00 1.16  ? 22  VAL A HG21 6  
ATOM 10956 H HG22 . VAL A 1 22  ? 9.094   13.150  -4.480  1.00 1.06  ? 22  VAL A HG22 6  
ATOM 10957 H HG23 . VAL A 1 22  ? 8.755   14.028  -2.985  1.00 1.02  ? 22  VAL A HG23 6  
ATOM 10958 N N    . SER A 1 23  ? 8.092   17.007  -3.494  1.00 0.47  ? 23  SER A N    6  
ATOM 10959 C CA   . SER A 1 23  ? 6.773   17.383  -3.028  1.00 0.58  ? 23  SER A CA   6  
ATOM 10960 C C    . SER A 1 23  ? 6.139   16.095  -2.507  1.00 0.46  ? 23  SER A C    6  
ATOM 10961 O O    . SER A 1 23  ? 6.708   15.035  -2.761  1.00 0.39  ? 23  SER A O    6  
ATOM 10962 C CB   . SER A 1 23  ? 5.976   17.979  -4.185  1.00 0.77  ? 23  SER A CB   6  
ATOM 10963 O OG   . SER A 1 23  ? 6.731   18.966  -4.867  1.00 1.23  ? 23  SER A OG   6  
ATOM 10964 H H    . SER A 1 23  ? 8.262   16.963  -4.457  1.00 0.53  ? 23  SER A H    6  
ATOM 10965 H HA   . SER A 1 23  ? 6.871   18.097  -2.230  1.00 0.66  ? 23  SER A HA   6  
ATOM 10966 H HB2  . SER A 1 23  ? 5.719   17.198  -4.874  1.00 1.36  ? 23  SER A HB2  6  
ATOM 10967 H HB3  . SER A 1 23  ? 5.075   18.435  -3.803  1.00 1.21  ? 23  SER A HB3  6  
ATOM 10968 H HG   . SER A 1 23  ? 7.574   19.093  -4.415  1.00 1.72  ? 23  SER A HG   6  
ATOM 10969 N N    . PRO A 1 24  ? 4.970   16.133  -1.822  1.00 0.46  ? 24  PRO A N    6  
ATOM 10970 C CA   . PRO A 1 24  ? 4.638   15.173  -0.766  1.00 0.39  ? 24  PRO A CA   6  
ATOM 10971 C C    . PRO A 1 24  ? 5.185   13.776  -1.019  1.00 0.27  ? 24  PRO A C    6  
ATOM 10972 O O    . PRO A 1 24  ? 4.940   13.176  -2.070  1.00 0.24  ? 24  PRO A O    6  
ATOM 10973 C CB   . PRO A 1 24  ? 3.123   15.128  -0.800  1.00 0.43  ? 24  PRO A CB   6  
ATOM 10974 C CG   . PRO A 1 24  ? 2.678   16.415  -1.398  1.00 0.50  ? 24  PRO A CG   6  
ATOM 10975 C CD   . PRO A 1 24  ? 3.869   17.077  -2.043  1.00 0.56  ? 24  PRO A CD   6  
ATOM 10976 H HA   . PRO A 1 24  ? 4.957   15.522  0.195   1.00 0.45  ? 24  PRO A HA   6  
ATOM 10977 H HB2  . PRO A 1 24  ? 2.803   14.289  -1.399  1.00 0.39  ? 24  PRO A HB2  6  
ATOM 10978 H HB3  . PRO A 1 24  ? 2.746   15.015  0.205   1.00 0.48  ? 24  PRO A HB3  6  
ATOM 10979 H HG2  . PRO A 1 24  ? 1.935   16.208  -2.141  1.00 0.47  ? 24  PRO A HG2  6  
ATOM 10980 H HG3  . PRO A 1 24  ? 2.268   17.052  -0.628  1.00 0.58  ? 24  PRO A HG3  6  
ATOM 10981 H HD2  . PRO A 1 24  ? 3.689   17.206  -3.098  1.00 0.59  ? 24  PRO A HD2  6  
ATOM 10982 H HD3  . PRO A 1 24  ? 4.073   18.027  -1.573  1.00 0.69  ? 24  PRO A HD3  6  
ATOM 10983 N N    . ALA A 1 25  ? 5.909   13.286  -0.003  1.00 0.25  ? 25  ALA A N    6  
ATOM 10984 C CA   . ALA A 1 25  ? 6.772   12.110  -0.099  1.00 0.19  ? 25  ALA A CA   6  
ATOM 10985 C C    . ALA A 1 25  ? 6.168   11.020  -0.944  1.00 0.14  ? 25  ALA A C    6  
ATOM 10986 O O    . ALA A 1 25  ? 4.997   10.694  -0.803  1.00 0.17  ? 25  ALA A O    6  
ATOM 10987 C CB   . ALA A 1 25  ? 7.071   11.564  1.282   1.00 0.27  ? 25  ALA A CB   6  
ATOM 10988 H H    . ALA A 1 25  ? 5.841   13.738  0.868   1.00 0.32  ? 25  ALA A H    6  
ATOM 10989 H HA   . ALA A 1 25  ? 7.707   12.420  -0.544  1.00 0.18  ? 25  ALA A HA   6  
ATOM 10990 H HB1  . ALA A 1 25  ? 7.278   12.381  1.956   1.00 1.02  ? 25  ALA A HB1  6  
ATOM 10991 H HB2  . ALA A 1 25  ? 7.934   10.915  1.231   1.00 1.10  ? 25  ALA A HB2  6  
ATOM 10992 H HB3  . ALA A 1 25  ? 6.213   11.002  1.639   1.00 1.05  ? 25  ALA A HB3  6  
ATOM 10993 N N    . GLU A 1 26  ? 6.968   10.449  -1.812  1.00 0.14  ? 26  GLU A N    6  
ATOM 10994 C CA   . GLU A 1 26  ? 6.468   9.456   -2.725  1.00 0.14  ? 26  GLU A CA   6  
ATOM 10995 C C    . GLU A 1 26  ? 7.239   8.159   -2.568  1.00 0.15  ? 26  GLU A C    6  
ATOM 10996 O O    . GLU A 1 26  ? 8.408   8.158   -2.194  1.00 0.19  ? 26  GLU A O    6  
ATOM 10997 C CB   . GLU A 1 26  ? 6.550   9.966   -4.171  1.00 0.21  ? 26  GLU A CB   6  
ATOM 10998 C CG   . GLU A 1 26  ? 7.162   11.348  -4.300  1.00 0.42  ? 26  GLU A CG   6  
ATOM 10999 C CD   . GLU A 1 26  ? 7.467   11.718  -5.734  1.00 0.54  ? 26  GLU A CD   6  
ATOM 11000 O OE1  . GLU A 1 26  ? 8.574   11.392  -6.216  1.00 0.69  ? 26  GLU A OE1  6  
ATOM 11001 O OE2  . GLU A 1 26  ? 6.601   12.331  -6.392  1.00 0.66  ? 26  GLU A OE2  6  
ATOM 11002 H H    . GLU A 1 26  ? 7.924   10.688  -1.832  1.00 0.18  ? 26  GLU A H    6  
ATOM 11003 H HA   . GLU A 1 26  ? 5.434   9.274   -2.472  1.00 0.15  ? 26  GLU A HA   6  
ATOM 11004 H HB2  . GLU A 1 26  ? 7.155   9.284   -4.746  1.00 0.33  ? 26  GLU A HB2  6  
ATOM 11005 H HB3  . GLU A 1 26  ? 5.549   10.000  -4.595  1.00 0.37  ? 26  GLU A HB3  6  
ATOM 11006 H HG2  . GLU A 1 26  ? 6.474   12.075  -3.895  1.00 0.59  ? 26  GLU A HG2  6  
ATOM 11007 H HG3  . GLU A 1 26  ? 8.074   11.369  -3.732  1.00 0.58  ? 26  GLU A HG3  6  
ATOM 11008 N N    . LEU A 1 27  ? 6.571   7.065   -2.859  1.00 0.15  ? 27  LEU A N    6  
ATOM 11009 C CA   . LEU A 1 27  ? 7.176   5.756   -2.817  1.00 0.16  ? 27  LEU A CA   6  
ATOM 11010 C C    . LEU A 1 27  ? 7.468   5.316   -4.233  1.00 0.16  ? 27  LEU A C    6  
ATOM 11011 O O    . LEU A 1 27  ? 6.613   5.374   -5.100  1.00 0.19  ? 27  LEU A O    6  
ATOM 11012 C CB   . LEU A 1 27  ? 6.250   4.763   -2.113  1.00 0.21  ? 27  LEU A CB   6  
ATOM 11013 C CG   . LEU A 1 27  ? 6.474   3.287   -2.457  1.00 0.29  ? 27  LEU A CG   6  
ATOM 11014 C CD1  . LEU A 1 27  ? 6.135   2.422   -1.270  1.00 0.53  ? 27  LEU A CD1  6  
ATOM 11015 C CD2  . LEU A 1 27  ? 5.629   2.876   -3.657  1.00 0.59  ? 27  LEU A CD2  6  
ATOM 11016 H H    . LEU A 1 27  ? 5.622   7.144   -3.108  1.00 0.15  ? 27  LEU A H    6  
ATOM 11017 H HA   . LEU A 1 27  ? 8.102   5.826   -2.269  1.00 0.17  ? 27  LEU A HA   6  
ATOM 11018 H HB2  . LEU A 1 27  ? 6.382   4.885   -1.046  1.00 0.23  ? 27  LEU A HB2  6  
ATOM 11019 H HB3  . LEU A 1 27  ? 5.234   5.014   -2.357  1.00 0.24  ? 27  LEU A HB3  6  
ATOM 11020 H HG   . LEU A 1 27  ? 7.513   3.129   -2.705  1.00 0.70  ? 27  LEU A HG   6  
ATOM 11021 H HD11 . LEU A 1 27  ? 6.217   1.383   -1.546  1.00 1.19  ? 27  LEU A HD11 6  
ATOM 11022 H HD12 . LEU A 1 27  ? 5.128   2.635   -0.946  1.00 1.10  ? 27  LEU A HD12 6  
ATOM 11023 H HD13 . LEU A 1 27  ? 6.827   2.638   -0.472  1.00 1.21  ? 27  LEU A HD13 6  
ATOM 11024 H HD21 . LEU A 1 27  ? 5.997   3.386   -4.541  1.00 1.11  ? 27  LEU A HD21 6  
ATOM 11025 H HD22 . LEU A 1 27  ? 4.595   3.153   -3.482  1.00 1.22  ? 27  LEU A HD22 6  
ATOM 11026 H HD23 . LEU A 1 27  ? 5.699   1.809   -3.802  1.00 1.17  ? 27  LEU A HD23 6  
ATOM 11027 N N    . THR A 1 28  ? 8.679   4.905   -4.466  1.00 0.16  ? 28  THR A N    6  
ATOM 11028 C CA   . THR A 1 28  ? 9.120   4.608   -5.799  1.00 0.17  ? 28  THR A CA   6  
ATOM 11029 C C    . THR A 1 28  ? 9.604   3.173   -5.902  1.00 0.17  ? 28  THR A C    6  
ATOM 11030 O O    . THR A 1 28  ? 10.662  2.831   -5.381  1.00 0.17  ? 28  THR A O    6  
ATOM 11031 C CB   . THR A 1 28  ? 10.264  5.555   -6.168  1.00 0.19  ? 28  THR A CB   6  
ATOM 11032 O OG1  . THR A 1 28  ? 9.935   6.893   -5.768  1.00 0.22  ? 28  THR A OG1  6  
ATOM 11033 C CG2  . THR A 1 28  ? 10.546  5.527   -7.656  1.00 0.22  ? 28  THR A CG2  6  
ATOM 11034 H H    . THR A 1 28  ? 9.308   4.810   -3.718  1.00 0.16  ? 28  THR A H    6  
ATOM 11035 H HA   . THR A 1 28  ? 8.301   4.767   -6.484  1.00 0.18  ? 28  THR A HA   6  
ATOM 11036 H HB   . THR A 1 28  ? 11.144  5.234   -5.640  1.00 0.20  ? 28  THR A HB   6  
ATOM 11037 H HG1  . THR A 1 28  ? 9.895   6.932   -4.805  1.00 0.24  ? 28  THR A HG1  6  
ATOM 11038 H HG21 . THR A 1 28  ? 11.405  6.146   -7.867  1.00 1.06  ? 28  THR A HG21 6  
ATOM 11039 H HG22 . THR A 1 28  ? 9.685   5.908   -8.191  1.00 1.00  ? 28  THR A HG22 6  
ATOM 11040 H HG23 . THR A 1 28  ? 10.749  4.511   -7.965  1.00 1.03  ? 28  THR A HG23 6  
ATOM 11041 N N    . TRP A 1 29  ? 8.834   2.331   -6.559  1.00 0.19  ? 29  TRP A N    6  
ATOM 11042 C CA   . TRP A 1 29  ? 9.285   0.983   -6.821  1.00 0.18  ? 29  TRP A CA   6  
ATOM 11043 C C    . TRP A 1 29  ? 10.016  0.957   -8.151  1.00 0.19  ? 29  TRP A C    6  
ATOM 11044 O O    . TRP A 1 29  ? 9.502   1.441   -9.157  1.00 0.22  ? 29  TRP A O    6  
ATOM 11045 C CB   . TRP A 1 29  ? 8.128   -0.022  -6.831  1.00 0.20  ? 29  TRP A CB   6  
ATOM 11046 C CG   . TRP A 1 29  ? 8.593   -1.422  -7.090  1.00 0.18  ? 29  TRP A CG   6  
ATOM 11047 C CD1  . TRP A 1 29  ? 8.891   -2.364  -6.155  1.00 0.17  ? 29  TRP A CD1  6  
ATOM 11048 C CD2  . TRP A 1 29  ? 8.836   -2.033  -8.364  1.00 0.17  ? 29  TRP A CD2  6  
ATOM 11049 N NE1  . TRP A 1 29  ? 9.304   -3.521  -6.768  1.00 0.16  ? 29  TRP A NE1  6  
ATOM 11050 C CE2  . TRP A 1 29  ? 9.278   -3.341  -8.120  1.00 0.15  ? 29  TRP A CE2  6  
ATOM 11051 C CE3  . TRP A 1 29  ? 8.722   -1.602  -9.685  1.00 0.18  ? 29  TRP A CE3  6  
ATOM 11052 C CZ2  . TRP A 1 29  ? 9.607   -4.218  -9.147  1.00 0.15  ? 29  TRP A CZ2  6  
ATOM 11053 C CZ3  . TRP A 1 29  ? 9.049   -2.474  -10.701 1.00 0.18  ? 29  TRP A CZ3  6  
ATOM 11054 C CH2  . TRP A 1 29  ? 9.488   -3.772  -10.424 1.00 0.17  ? 29  TRP A CH2  6  
ATOM 11055 H H    . TRP A 1 29  ? 7.954   2.626   -6.882  1.00 0.21  ? 29  TRP A H    6  
ATOM 11056 H HA   . TRP A 1 29  ? 9.979   0.709   -6.034  1.00 0.18  ? 29  TRP A HA   6  
ATOM 11057 H HB2  . TRP A 1 29  ? 7.641   -0.006  -5.867  1.00 0.22  ? 29  TRP A HB2  6  
ATOM 11058 H HB3  . TRP A 1 29  ? 7.413   0.245   -7.595  1.00 0.22  ? 29  TRP A HB3  6  
ATOM 11059 H HD1  . TRP A 1 29  ? 8.810   -2.207  -5.088  1.00 0.18  ? 29  TRP A HD1  6  
ATOM 11060 H HE1  . TRP A 1 29  ? 9.575   -4.348  -6.308  1.00 0.17  ? 29  TRP A HE1  6  
ATOM 11061 H HE3  . TRP A 1 29  ? 8.386   -0.603  -9.919  1.00 0.20  ? 29  TRP A HE3  6  
ATOM 11062 H HZ2  . TRP A 1 29  ? 9.956   -5.222  -8.956  1.00 0.16  ? 29  TRP A HZ2  6  
ATOM 11063 H HZ3  . TRP A 1 29  ? 8.972   -2.153  -11.727 1.00 0.20  ? 29  TRP A HZ3  6  
ATOM 11064 H HH2  . TRP A 1 29  ? 9.735   -4.429  -11.248 1.00 0.18  ? 29  TRP A HH2  6  
ATOM 11065 N N    . ARG A 1 30  ? 11.215  0.412   -8.143  1.00 0.19  ? 30  ARG A N    6  
ATOM 11066 C CA   . ARG A 1 30  ? 12.016  0.303   -9.347  1.00 0.21  ? 30  ARG A CA   6  
ATOM 11067 C C    . ARG A 1 30  ? 12.586  -1.092  -9.487  1.00 0.18  ? 30  ARG A C    6  
ATOM 11068 O O    . ARG A 1 30  ? 13.234  -1.598  -8.575  1.00 0.21  ? 30  ARG A O    6  
ATOM 11069 C CB   . ARG A 1 30  ? 13.139  1.319   -9.344  1.00 0.27  ? 30  ARG A CB   6  
ATOM 11070 C CG   . ARG A 1 30  ? 13.553  1.703   -7.967  1.00 0.32  ? 30  ARG A CG   6  
ATOM 11071 C CD   . ARG A 1 30  ? 14.908  2.356   -7.993  1.00 0.61  ? 30  ARG A CD   6  
ATOM 11072 N NE   . ARG A 1 30  ? 15.459  2.565   -6.655  1.00 0.50  ? 30  ARG A NE   6  
ATOM 11073 C CZ   . ARG A 1 30  ? 16.444  1.839   -6.127  1.00 1.09  ? 30  ARG A CZ   6  
ATOM 11074 N NH1  . ARG A 1 30  ? 16.968  0.821   -6.802  1.00 1.93  ? 30  ARG A NH1  6  
ATOM 11075 N NH2  . ARG A 1 30  ? 16.905  2.133   -4.919  1.00 1.05  ? 30  ARG A NH2  6  
ATOM 11076 H H    . ARG A 1 30  ? 11.574  0.062   -7.294  1.00 0.20  ? 30  ARG A H    6  
ATOM 11077 H HA   . ARG A 1 30  ? 11.383  0.502   -10.179 1.00 0.24  ? 30  ARG A HA   6  
ATOM 11078 H HB2  . ARG A 1 30  ? 13.992  0.897   -9.851  1.00 0.55  ? 30  ARG A HB2  6  
ATOM 11079 H HB3  . ARG A 1 30  ? 12.831  2.203   -9.861  1.00 0.51  ? 30  ARG A HB3  6  
ATOM 11080 H HG2  . ARG A 1 30  ? 12.830  2.397   -7.564  1.00 0.90  ? 30  ARG A HG2  6  
ATOM 11081 H HG3  . ARG A 1 30  ? 13.577  0.812   -7.375  1.00 0.90  ? 30  ARG A HG3  6  
ATOM 11082 H HD2  . ARG A 1 30  ? 15.565  1.728   -8.563  1.00 1.11  ? 30  ARG A HD2  6  
ATOM 11083 H HD3  . ARG A 1 30  ? 14.814  3.311   -8.488  1.00 1.10  ? 30  ARG A HD3  6  
ATOM 11084 H HE   . ARG A 1 30  ? 15.083  3.305   -6.126  1.00 0.65  ? 30  ARG A HE   6  
ATOM 11085 H HH11 . ARG A 1 30  ? 16.623  0.590   -7.716  1.00 2.07  ? 30  ARG A HH11 6  
ATOM 11086 H HH12 . ARG A 1 30  ? 17.710  0.277   -6.400  1.00 2.49  ? 30  ARG A HH12 6  
ATOM 11087 H HH21 . ARG A 1 30  ? 16.515  2.902   -4.402  1.00 0.78  ? 30  ARG A HH21 6  
ATOM 11088 H HH22 . ARG A 1 30  ? 17.647  1.592   -4.515  1.00 1.55  ? 30  ARG A HH22 6  
ATOM 11089 N N    . SER A 1 31  ? 12.341  -1.691  -10.641 1.00 0.17  ? 31  SER A N    6  
ATOM 11090 C CA   . SER A 1 31  ? 12.764  -3.047  -10.930 1.00 0.18  ? 31  SER A CA   6  
ATOM 11091 C C    . SER A 1 31  ? 14.281  -3.166  -10.812 1.00 0.19  ? 31  SER A C    6  
ATOM 11092 O O    . SER A 1 31  ? 15.008  -2.191  -11.009 1.00 0.27  ? 31  SER A O    6  
ATOM 11093 C CB   . SER A 1 31  ? 12.271  -3.430  -12.329 1.00 0.21  ? 31  SER A CB   6  
ATOM 11094 O OG   . SER A 1 31  ? 12.935  -2.698  -13.351 1.00 0.25  ? 31  SER A OG   6  
ATOM 11095 H H    . SER A 1 31  ? 11.856  -1.192  -11.336 1.00 0.22  ? 31  SER A H    6  
ATOM 11096 H HA   . SER A 1 31  ? 12.303  -3.701  -10.205 1.00 0.17  ? 31  SER A HA   6  
ATOM 11097 H HB2  . SER A 1 31  ? 12.425  -4.477  -12.492 1.00 0.25  ? 31  SER A HB2  6  
ATOM 11098 H HB3  . SER A 1 31  ? 11.215  -3.220  -12.393 1.00 0.22  ? 31  SER A HB3  6  
ATOM 11099 H HG   . SER A 1 31  ? 12.804  -3.155  -14.193 1.00 0.97  ? 31  SER A HG   6  
ATOM 11100 N N    . THR A 1 32  ? 14.737  -4.372  -10.464 1.00 0.21  ? 32  THR A N    6  
ATOM 11101 C CA   . THR A 1 32  ? 16.134  -4.626  -10.110 1.00 0.22  ? 32  THR A CA   6  
ATOM 11102 C C    . THR A 1 32  ? 17.099  -4.218  -11.220 1.00 0.44  ? 32  THR A C    6  
ATOM 11103 O O    . THR A 1 32  ? 18.276  -3.969  -10.962 1.00 0.67  ? 32  THR A O    6  
ATOM 11104 C CB   . THR A 1 32  ? 16.365  -6.114  -9.778  1.00 0.41  ? 32  THR A CB   6  
ATOM 11105 O OG1  . THR A 1 32  ? 15.887  -6.939  -10.847 1.00 0.97  ? 32  THR A OG1  6  
ATOM 11106 C CG2  . THR A 1 32  ? 15.670  -6.508  -8.482  1.00 0.44  ? 32  THR A CG2  6  
ATOM 11107 H H    . THR A 1 32  ? 14.104  -5.126  -10.444 1.00 0.29  ? 32  THR A H    6  
ATOM 11108 H HA   . THR A 1 32  ? 16.361  -4.050  -9.219  1.00 0.31  ? 32  THR A HA   6  
ATOM 11109 H HB   . THR A 1 32  ? 17.425  -6.271  -9.657  1.00 0.79  ? 32  THR A HB   6  
ATOM 11110 H HG1  . THR A 1 32  ? 15.305  -7.622  -10.488 1.00 1.28  ? 32  THR A HG1  6  
ATOM 11111 H HG21 . THR A 1 32  ? 15.991  -5.853  -7.686  1.00 1.02  ? 32  THR A HG21 6  
ATOM 11112 H HG22 . THR A 1 32  ? 15.925  -7.527  -8.233  1.00 1.14  ? 32  THR A HG22 6  
ATOM 11113 H HG23 . THR A 1 32  ? 14.600  -6.428  -8.608  1.00 1.25  ? 32  THR A HG23 6  
ATOM 11114 N N    . ASP A 1 33  ? 16.602  -4.173  -12.453 1.00 0.55  ? 33  ASP A N    6  
ATOM 11115 C CA   . ASP A 1 33  ? 17.412  -3.754  -13.593 1.00 0.89  ? 33  ASP A CA   6  
ATOM 11116 C C    . ASP A 1 33  ? 17.603  -2.239  -13.596 1.00 1.00  ? 33  ASP A C    6  
ATOM 11117 O O    . ASP A 1 33  ? 18.618  -1.727  -14.070 1.00 1.43  ? 33  ASP A O    6  
ATOM 11118 C CB   . ASP A 1 33  ? 16.760  -4.201  -14.904 1.00 1.09  ? 33  ASP A CB   6  
ATOM 11119 C CG   . ASP A 1 33  ? 17.614  -3.890  -16.117 1.00 1.88  ? 33  ASP A CG   6  
ATOM 11120 O OD1  . ASP A 1 33  ? 18.444  -4.740  -16.498 1.00 2.19  ? 33  ASP A OD1  6  
ATOM 11121 O OD2  . ASP A 1 33  ? 17.459  -2.800  -16.701 1.00 2.57  ? 33  ASP A OD2  6  
ATOM 11122 H H    . ASP A 1 33  ? 15.668  -4.442  -12.602 1.00 0.50  ? 33  ASP A H    6  
ATOM 11123 H HA   . ASP A 1 33  ? 18.379  -4.225  -13.503 1.00 1.02  ? 33  ASP A HA   6  
ATOM 11124 H HB2  . ASP A 1 33  ? 16.594  -5.267  -14.870 1.00 1.40  ? 33  ASP A HB2  6  
ATOM 11125 H HB3  . ASP A 1 33  ? 15.811  -3.697  -15.016 1.00 1.33  ? 33  ASP A HB3  6  
ATOM 11126 N N    . GLY A 1 34  ? 16.631  -1.529  -13.037 1.00 0.80  ? 34  GLY A N    6  
ATOM 11127 C CA   . GLY A 1 34  ? 16.685  -0.078  -12.998 1.00 1.07  ? 34  GLY A CA   6  
ATOM 11128 C C    . GLY A 1 34  ? 15.870  0.554   -14.105 1.00 0.75  ? 34  GLY A C    6  
ATOM 11129 O O    . GLY A 1 34  ? 16.023  1.739   -14.410 1.00 0.99  ? 34  GLY A O    6  
ATOM 11130 H H    . GLY A 1 34  ? 15.871  -1.998  -12.625 1.00 0.67  ? 34  GLY A H    6  
ATOM 11131 H HA2  . GLY A 1 34  ? 16.305  0.263   -12.046 1.00 1.36  ? 34  GLY A HA2  6  
ATOM 11132 H HA3  . GLY A 1 34  ? 17.713  0.237   -13.098 1.00 1.41  ? 34  GLY A HA3  6  
ATOM 11133 N N    . ASP A 1 35  ? 14.995  -0.239  -14.704 1.00 0.62  ? 35  ASP A N    6  
ATOM 11134 C CA   . ASP A 1 35  ? 14.191  0.218   -15.829 1.00 1.00  ? 35  ASP A CA   6  
ATOM 11135 C C    . ASP A 1 35  ? 12.802  0.654   -15.387 1.00 0.69  ? 35  ASP A C    6  
ATOM 11136 O O    . ASP A 1 35  ? 12.379  1.781   -15.646 1.00 0.72  ? 35  ASP A O    6  
ATOM 11137 C CB   . ASP A 1 35  ? 14.074  -0.885  -16.872 1.00 1.52  ? 35  ASP A CB   6  
ATOM 11138 C CG   . ASP A 1 35  ? 13.070  -0.555  -17.961 1.00 2.13  ? 35  ASP A CG   6  
ATOM 11139 O OD1  . ASP A 1 35  ? 13.362  0.318   -18.808 1.00 2.16  ? 35  ASP A OD1  6  
ATOM 11140 O OD2  . ASP A 1 35  ? 11.986  -1.171  -17.981 1.00 2.64  ? 35  ASP A OD2  6  
ATOM 11141 H H    . ASP A 1 35  ? 14.889  -1.158  -14.383 1.00 0.67  ? 35  ASP A H    6  
ATOM 11142 H HA   . ASP A 1 35  ? 14.693  1.055   -16.273 1.00 1.44  ? 35  ASP A HA   6  
ATOM 11143 H HB2  . ASP A 1 35  ? 15.037  -1.043  -17.332 1.00 1.74  ? 35  ASP A HB2  6  
ATOM 11144 H HB3  . ASP A 1 35  ? 13.763  -1.786  -16.383 1.00 1.48  ? 35  ASP A HB3  6  
ATOM 11145 N N    . LYS A 1 36  ? 12.101  -0.241  -14.715 1.00 0.48  ? 36  LYS A N    6  
ATOM 11146 C CA   . LYS A 1 36  ? 10.716  -0.036  -14.385 1.00 0.32  ? 36  LYS A CA   6  
ATOM 11147 C C    . LYS A 1 36  ? 10.575  0.653   -13.042 1.00 0.23  ? 36  LYS A C    6  
ATOM 11148 O O    . LYS A 1 36  ? 11.010  0.149   -12.019 1.00 0.39  ? 36  LYS A O    6  
ATOM 11149 C CB   . LYS A 1 36  ? 10.033  -1.387  -14.397 1.00 0.36  ? 36  LYS A CB   6  
ATOM 11150 C CG   . LYS A 1 36  ? 8.571   -1.386  -14.175 1.00 0.49  ? 36  LYS A CG   6  
ATOM 11151 C CD   . LYS A 1 36  ? 8.103   -2.805  -14.041 1.00 0.56  ? 36  LYS A CD   6  
ATOM 11152 C CE   . LYS A 1 36  ? 6.806   -3.036  -14.755 1.00 0.44  ? 36  LYS A CE   6  
ATOM 11153 N NZ   . LYS A 1 36  ? 6.927   -2.855  -16.228 1.00 1.20  ? 36  LYS A NZ   6  
ATOM 11154 H H    . LYS A 1 36  ? 12.526  -1.072  -14.428 1.00 0.50  ? 36  LYS A H    6  
ATOM 11155 H HA   . LYS A 1 36  ? 10.278  0.587   -15.148 1.00 0.44  ? 36  LYS A HA   6  
ATOM 11156 H HB2  . LYS A 1 36  ? 10.185  -1.811  -15.349 1.00 0.70  ? 36  LYS A HB2  6  
ATOM 11157 H HB3  . LYS A 1 36  ? 10.476  -2.026  -13.658 1.00 0.69  ? 36  LYS A HB3  6  
ATOM 11158 H HG2  . LYS A 1 36  ? 8.350   -0.847  -13.273 1.00 0.76  ? 36  LYS A HG2  6  
ATOM 11159 H HG3  . LYS A 1 36  ? 8.082   -0.930  -15.016 1.00 0.78  ? 36  LYS A HG3  6  
ATOM 11160 H HD2  . LYS A 1 36  ? 8.846   -3.439  -14.461 1.00 0.72  ? 36  LYS A HD2  6  
ATOM 11161 H HD3  . LYS A 1 36  ? 7.973   -3.041  -12.995 1.00 0.78  ? 36  LYS A HD3  6  
ATOM 11162 H HE2  . LYS A 1 36  ? 6.476   -4.034  -14.546 1.00 0.90  ? 36  LYS A HE2  6  
ATOM 11163 H HE3  . LYS A 1 36  ? 6.098   -2.339  -14.366 1.00 0.84  ? 36  LYS A HE3  6  
ATOM 11164 H HZ1  . LYS A 1 36  ? 6.038   -3.122  -16.697 1.00 1.69  ? 36  LYS A HZ1  6  
ATOM 11165 H HZ2  . LYS A 1 36  ? 7.693   -3.452  -16.600 1.00 1.81  ? 36  LYS A HZ2  6  
ATOM 11166 H HZ3  . LYS A 1 36  ? 7.139   -1.862  -16.454 1.00 1.72  ? 36  LYS A HZ3  6  
ATOM 11167 N N    . VAL A 1 37  ? 9.950   1.803   -13.080 1.00 0.23  ? 37  VAL A N    6  
ATOM 11168 C CA   . VAL A 1 37  ? 9.788   2.664   -11.907 1.00 0.23  ? 37  VAL A CA   6  
ATOM 11169 C C    . VAL A 1 37  ? 8.335   3.096   -11.783 1.00 0.26  ? 37  VAL A C    6  
ATOM 11170 O O    . VAL A 1 37  ? 7.718   3.506   -12.765 1.00 0.37  ? 37  VAL A O    6  
ATOM 11171 C CB   . VAL A 1 37  ? 10.676  3.933   -12.017 1.00 0.27  ? 37  VAL A CB   6  
ATOM 11172 C CG1  . VAL A 1 37  ? 10.147  5.062   -11.143 1.00 0.76  ? 37  VAL A CG1  6  
ATOM 11173 C CG2  . VAL A 1 37  ? 12.106  3.634   -11.632 1.00 0.83  ? 37  VAL A CG2  6  
ATOM 11174 H H    . VAL A 1 37  ? 9.565   2.086   -13.939 1.00 0.32  ? 37  VAL A H    6  
ATOM 11175 H HA   . VAL A 1 37  ? 10.080  2.101   -11.012 1.00 0.22  ? 37  VAL A HA   6  
ATOM 11176 H HB   . VAL A 1 37  ? 10.670  4.267   -13.042 1.00 0.72  ? 37  VAL A HB   6  
ATOM 11177 H HG11 . VAL A 1 37  ? 10.793  5.922   -11.235 1.00 1.48  ? 37  VAL A HG11 6  
ATOM 11178 H HG12 . VAL A 1 37  ? 10.123  4.738   -10.113 1.00 1.31  ? 37  VAL A HG12 6  
ATOM 11179 H HG13 . VAL A 1 37  ? 9.148   5.326   -11.460 1.00 1.29  ? 37  VAL A HG13 6  
ATOM 11180 H HG21 . VAL A 1 37  ? 12.364  2.633   -11.946 1.00 1.35  ? 37  VAL A HG21 6  
ATOM 11181 H HG22 . VAL A 1 37  ? 12.212  3.725   -10.560 1.00 1.53  ? 37  VAL A HG22 6  
ATOM 11182 H HG23 . VAL A 1 37  ? 12.758  4.341   -12.119 1.00 1.35  ? 37  VAL A HG23 6  
ATOM 11183 N N    . HIS A 1 38  ? 7.784   2.984   -10.589 1.00 0.22  ? 38  HIS A N    6  
ATOM 11184 C CA   . HIS A 1 38  ? 6.426   3.437   -10.336 1.00 0.25  ? 38  HIS A CA   6  
ATOM 11185 C C    . HIS A 1 38  ? 6.416   4.263   -9.062  1.00 0.24  ? 38  HIS A C    6  
ATOM 11186 O O    . HIS A 1 38  ? 6.852   3.789   -8.013  1.00 0.26  ? 38  HIS A O    6  
ATOM 11187 C CB   . HIS A 1 38  ? 5.460   2.253   -10.210 1.00 0.27  ? 38  HIS A CB   6  
ATOM 11188 C CG   . HIS A 1 38  ? 5.765   1.129   -11.156 1.00 0.28  ? 38  HIS A CG   6  
ATOM 11189 N ND1  . HIS A 1 38  ? 5.831   1.273   -12.521 1.00 0.30  ? 38  HIS A ND1  6  
ATOM 11190 C CD2  . HIS A 1 38  ? 6.086   -0.153  -10.911 1.00 0.30  ? 38  HIS A CD2  6  
ATOM 11191 C CE1  . HIS A 1 38  ? 6.190   0.122   -13.056 1.00 0.33  ? 38  HIS A CE1  6  
ATOM 11192 N NE2  . HIS A 1 38  ? 6.337   -0.761  -12.099 1.00 0.33  ? 38  HIS A NE2  6  
ATOM 11193 H H    . HIS A 1 38  ? 8.307   2.587   -9.853  1.00 0.22  ? 38  HIS A H    6  
ATOM 11194 H HA   . HIS A 1 38  ? 6.127   4.060   -11.163 1.00 0.27  ? 38  HIS A HA   6  
ATOM 11195 H HB2  . HIS A 1 38  ? 5.509   1.864   -9.202  1.00 0.28  ? 38  HIS A HB2  6  
ATOM 11196 H HB3  . HIS A 1 38  ? 4.455   2.595   -10.409 1.00 0.31  ? 38  HIS A HB3  6  
ATOM 11197 H HD1  . HIS A 1 38  ? 5.630   2.094   -13.027 1.00 0.32  ? 38  HIS A HD1  6  
ATOM 11198 H HD2  . HIS A 1 38  ? 6.195   -0.602  -9.955  1.00 0.32  ? 38  HIS A HD2  6  
ATOM 11199 H HE1  . HIS A 1 38  ? 6.449   -0.051  -14.088 1.00 0.36  ? 38  HIS A HE1  6  
ATOM 11200 H HE2  . HIS A 1 38  ? 6.278   -1.730  -12.242 1.00 0.38  ? 38  HIS A HE2  6  
ATOM 11201 N N    . THR A 1 39  ? 5.946   5.496   -9.154  1.00 0.23  ? 39  THR A N    6  
ATOM 11202 C CA   . THR A 1 39  ? 6.048   6.420   -8.041  1.00 0.22  ? 39  THR A CA   6  
ATOM 11203 C C    . THR A 1 39  ? 4.675   6.719   -7.427  1.00 0.23  ? 39  THR A C    6  
ATOM 11204 O O    . THR A 1 39  ? 3.723   7.066   -8.125  1.00 0.32  ? 39  THR A O    6  
ATOM 11205 C CB   . THR A 1 39  ? 6.729   7.723   -8.487  1.00 0.24  ? 39  THR A CB   6  
ATOM 11206 O OG1  . THR A 1 39  ? 7.704   7.431   -9.498  1.00 0.26  ? 39  THR A OG1  6  
ATOM 11207 C CG2  . THR A 1 39  ? 7.416   8.398   -7.316  1.00 0.24  ? 39  THR A CG2  6  
ATOM 11208 H H    . THR A 1 39  ? 5.508   5.790   -9.984  1.00 0.25  ? 39  THR A H    6  
ATOM 11209 H HA   . THR A 1 39  ? 6.668   5.959   -7.286  1.00 0.19  ? 39  THR A HA   6  
ATOM 11210 H HB   . THR A 1 39  ? 5.986   8.390   -8.890  1.00 0.28  ? 39  THR A HB   6  
ATOM 11211 H HG1  . THR A 1 39  ? 7.668   6.493   -9.708  1.00 0.86  ? 39  THR A HG1  6  
ATOM 11212 H HG21 . THR A 1 39  ? 8.213   7.760   -6.954  1.00 1.03  ? 39  THR A HG21 6  
ATOM 11213 H HG22 . THR A 1 39  ? 6.699   8.564   -6.527  1.00 1.00  ? 39  THR A HG22 6  
ATOM 11214 H HG23 . THR A 1 39  ? 7.829   9.343   -7.636  1.00 0.94  ? 39  THR A HG23 6  
ATOM 11215 N N    . VAL A 1 40  ? 4.598   6.560   -6.114  1.00 0.19  ? 40  VAL A N    6  
ATOM 11216 C CA   . VAL A 1 40  ? 3.371   6.737   -5.352  1.00 0.20  ? 40  VAL A CA   6  
ATOM 11217 C C    . VAL A 1 40  ? 3.512   7.901   -4.367  1.00 0.20  ? 40  VAL A C    6  
ATOM 11218 O O    . VAL A 1 40  ? 4.109   7.747   -3.308  1.00 0.20  ? 40  VAL A O    6  
ATOM 11219 C CB   . VAL A 1 40  ? 3.071   5.431   -4.562  1.00 0.21  ? 40  VAL A CB   6  
ATOM 11220 C CG1  . VAL A 1 40  ? 2.012   5.621   -3.490  1.00 0.23  ? 40  VAL A CG1  6  
ATOM 11221 C CG2  . VAL A 1 40  ? 2.650   4.314   -5.500  1.00 0.22  ? 40  VAL A CG2  6  
ATOM 11222 H H    . VAL A 1 40  ? 5.414   6.297   -5.629  1.00 0.22  ? 40  VAL A H    6  
ATOM 11223 H HA   . VAL A 1 40  ? 2.557   6.930   -6.034  1.00 0.22  ? 40  VAL A HA   6  
ATOM 11224 H HB   . VAL A 1 40  ? 3.982   5.122   -4.074  1.00 0.22  ? 40  VAL A HB   6  
ATOM 11225 H HG11 . VAL A 1 40  ? 1.918   4.701   -2.922  1.00 0.97  ? 40  VAL A HG11 6  
ATOM 11226 H HG12 . VAL A 1 40  ? 1.067   5.857   -3.955  1.00 1.06  ? 40  VAL A HG12 6  
ATOM 11227 H HG13 . VAL A 1 40  ? 2.303   6.425   -2.828  1.00 1.09  ? 40  VAL A HG13 6  
ATOM 11228 H HG21 . VAL A 1 40  ? 3.427   4.141   -6.229  1.00 1.04  ? 40  VAL A HG21 6  
ATOM 11229 H HG22 . VAL A 1 40  ? 1.736   4.593   -6.000  1.00 1.05  ? 40  VAL A HG22 6  
ATOM 11230 H HG23 . VAL A 1 40  ? 2.486   3.411   -4.926  1.00 1.01  ? 40  VAL A HG23 6  
ATOM 11231 N N    . VAL A 1 41  ? 2.959   9.059   -4.705  1.00 0.22  ? 41  VAL A N    6  
ATOM 11232 C CA   . VAL A 1 41  ? 2.970   10.191  -3.782  1.00 0.22  ? 41  VAL A CA   6  
ATOM 11233 C C    . VAL A 1 41  ? 2.007   9.909   -2.631  1.00 0.23  ? 41  VAL A C    6  
ATOM 11234 O O    . VAL A 1 41  ? 0.810   9.691   -2.831  1.00 0.26  ? 41  VAL A O    6  
ATOM 11235 C CB   . VAL A 1 41  ? 2.641   11.528  -4.494  1.00 0.26  ? 41  VAL A CB   6  
ATOM 11236 C CG1  . VAL A 1 41  ? 1.609   11.309  -5.579  1.00 0.63  ? 41  VAL A CG1  6  
ATOM 11237 C CG2  . VAL A 1 41  ? 2.174   12.592  -3.502  1.00 0.59  ? 41  VAL A CG2  6  
ATOM 11238 H H    . VAL A 1 41  ? 2.533   9.154   -5.580  1.00 0.25  ? 41  VAL A H    6  
ATOM 11239 H HA   . VAL A 1 41  ? 3.975   10.266  -3.376  1.00 0.21  ? 41  VAL A HA   6  
ATOM 11240 H HB   . VAL A 1 41  ? 3.545   11.886  -4.966  1.00 0.61  ? 41  VAL A HB   6  
ATOM 11241 H HG11 . VAL A 1 41  ? 2.021   10.636  -6.318  1.00 1.22  ? 41  VAL A HG11 6  
ATOM 11242 H HG12 . VAL A 1 41  ? 1.366   12.252  -6.043  1.00 1.30  ? 41  VAL A HG12 6  
ATOM 11243 H HG13 . VAL A 1 41  ? 0.721   10.874  -5.149  1.00 1.30  ? 41  VAL A HG13 6  
ATOM 11244 H HG21 . VAL A 1 41  ? 2.927   12.728  -2.740  1.00 1.25  ? 41  VAL A HG21 6  
ATOM 11245 H HG22 . VAL A 1 41  ? 1.251   12.274  -3.042  1.00 1.17  ? 41  VAL A HG22 6  
ATOM 11246 H HG23 . VAL A 1 41  ? 2.016   13.530  -4.018  1.00 1.18  ? 41  VAL A HG23 6  
ATOM 11247 N N    . LEU A 1 42  ? 2.555   9.910   -1.431  1.00 0.23  ? 42  LEU A N    6  
ATOM 11248 C CA   . LEU A 1 42  ? 1.893   9.374   -0.248  1.00 0.26  ? 42  LEU A CA   6  
ATOM 11249 C C    . LEU A 1 42  ? 0.664   10.169  0.172   1.00 0.27  ? 42  LEU A C    6  
ATOM 11250 O O    . LEU A 1 42  ? -0.174  9.667   0.919   1.00 0.37  ? 42  LEU A O    6  
ATOM 11251 C CB   . LEU A 1 42  ? 2.911   9.306   0.885   1.00 0.32  ? 42  LEU A CB   6  
ATOM 11252 C CG   . LEU A 1 42  ? 3.987   8.245   0.687   1.00 0.43  ? 42  LEU A CG   6  
ATOM 11253 C CD1  . LEU A 1 42  ? 4.998   8.316   1.807   1.00 1.24  ? 42  LEU A CD1  6  
ATOM 11254 C CD2  . LEU A 1 42  ? 3.362   6.861   0.609   1.00 1.01  ? 42  LEU A CD2  6  
ATOM 11255 H H    . LEU A 1 42  ? 3.462   10.285  -1.330  1.00 0.25  ? 42  LEU A H    6  
ATOM 11256 H HA   . LEU A 1 42  ? 1.581   8.369   -0.485  1.00 0.31  ? 42  LEU A HA   6  
ATOM 11257 H HB2  . LEU A 1 42  ? 3.396   10.269  0.958   1.00 0.27  ? 42  LEU A HB2  6  
ATOM 11258 H HB3  . LEU A 1 42  ? 2.405   9.110   1.811   1.00 0.45  ? 42  LEU A HB3  6  
ATOM 11259 H HG   . LEU A 1 42  ? 4.503   8.435   -0.242  1.00 1.24  ? 42  LEU A HG   6  
ATOM 11260 H HD11 . LEU A 1 42  ? 5.863   7.727   1.547   1.00 1.86  ? 42  LEU A HD11 6  
ATOM 11261 H HD12 . LEU A 1 42  ? 4.556   7.933   2.714   1.00 1.80  ? 42  LEU A HD12 6  
ATOM 11262 H HD13 . LEU A 1 42  ? 5.290   9.346   1.953   1.00 1.75  ? 42  LEU A HD13 6  
ATOM 11263 H HD21 . LEU A 1 42  ? 2.706   6.809   -0.247  1.00 1.58  ? 42  LEU A HD21 6  
ATOM 11264 H HD22 . LEU A 1 42  ? 2.795   6.671   1.507   1.00 1.41  ? 42  LEU A HD22 6  
ATOM 11265 H HD23 . LEU A 1 42  ? 4.141   6.121   0.511   1.00 1.79  ? 42  LEU A HD23 6  
ATOM 11266 N N    . SER A 1 43  ? 0.541   11.395  -0.313  1.00 0.23  ? 43  SER A N    6  
ATOM 11267 C CA   . SER A 1 43  ? -0.635  12.207  -0.020  1.00 0.28  ? 43  SER A CA   6  
ATOM 11268 C C    . SER A 1 43  ? -1.895  11.631  -0.670  1.00 0.28  ? 43  SER A C    6  
ATOM 11269 O O    . SER A 1 43  ? -3.009  12.066  -0.376  1.00 0.34  ? 43  SER A O    6  
ATOM 11270 C CB   . SER A 1 43  ? -0.428  13.648  -0.480  1.00 0.35  ? 43  SER A CB   6  
ATOM 11271 O OG   . SER A 1 43  ? 0.553   14.292  0.308   1.00 1.08  ? 43  SER A OG   6  
ATOM 11272 H H    . SER A 1 43  ? 1.260   11.765  -0.865  1.00 0.22  ? 43  SER A H    6  
ATOM 11273 H HA   . SER A 1 43  ? -0.766  12.202  1.052   1.00 0.32  ? 43  SER A HA   6  
ATOM 11274 H HB2  . SER A 1 43  ? -0.104  13.653  -1.509  1.00 0.86  ? 43  SER A HB2  6  
ATOM 11275 H HB3  . SER A 1 43  ? -1.357  14.190  -0.391  1.00 1.04  ? 43  SER A HB3  6  
ATOM 11276 H HG   . SER A 1 43  ? 0.126   14.925  0.897   1.00 1.37  ? 43  SER A HG   6  
ATOM 11277 N N    . THR A 1 44  ? -1.722  10.651  -1.551  1.00 0.26  ? 44  THR A N    6  
ATOM 11278 C CA   . THR A 1 44  ? -2.857  10.030  -2.218  1.00 0.28  ? 44  THR A CA   6  
ATOM 11279 C C    . THR A 1 44  ? -3.273  8.757   -1.495  1.00 0.26  ? 44  THR A C    6  
ATOM 11280 O O    . THR A 1 44  ? -4.289  8.150   -1.827  1.00 0.29  ? 44  THR A O    6  
ATOM 11281 C CB   . THR A 1 44  ? -2.539  9.688   -3.688  1.00 0.32  ? 44  THR A CB   6  
ATOM 11282 O OG1  . THR A 1 44  ? -1.452  8.753   -3.760  1.00 0.30  ? 44  THR A OG1  6  
ATOM 11283 C CG2  . THR A 1 44  ? -2.185  10.941  -4.473  1.00 0.36  ? 44  THR A CG2  6  
ATOM 11284 H H    . THR A 1 44  ? -0.815  10.333  -1.751  1.00 0.26  ? 44  THR A H    6  
ATOM 11285 H HA   . THR A 1 44  ? -3.680  10.730  -2.201  1.00 0.31  ? 44  THR A HA   6  
ATOM 11286 H HB   . THR A 1 44  ? -3.415  9.240   -4.135  1.00 0.36  ? 44  THR A HB   6  
ATOM 11287 H HG1  . THR A 1 44  ? -0.619  9.212   -3.573  1.00 0.26  ? 44  THR A HG1  6  
ATOM 11288 H HG21 . THR A 1 44  ? -3.024  11.621  -4.460  1.00 1.04  ? 44  THR A HG21 6  
ATOM 11289 H HG22 . THR A 1 44  ? -1.954  10.673  -5.493  1.00 1.05  ? 44  THR A HG22 6  
ATOM 11290 H HG23 . THR A 1 44  ? -1.328  11.418  -4.022  1.00 1.04  ? 44  THR A HG23 6  
ATOM 11291 N N    . ILE A 1 45  ? -2.482  8.354   -0.510  1.00 0.24  ? 45  ILE A N    6  
ATOM 11292 C CA   . ILE A 1 45  ? -2.710  7.113   0.196   1.00 0.22  ? 45  ILE A CA   6  
ATOM 11293 C C    . ILE A 1 45  ? -3.404  7.352   1.541   1.00 0.25  ? 45  ILE A C    6  
ATOM 11294 O O    . ILE A 1 45  ? -3.133  8.335   2.234   1.00 0.36  ? 45  ILE A O    6  
ATOM 11295 C CB   . ILE A 1 45  ? -1.367  6.400   0.418   1.00 0.25  ? 45  ILE A CB   6  
ATOM 11296 C CG1  . ILE A 1 45  ? -0.580  6.357   -0.895  1.00 0.25  ? 45  ILE A CG1  6  
ATOM 11297 C CG2  . ILE A 1 45  ? -1.589  4.998   0.953   1.00 0.28  ? 45  ILE A CG2  6  
ATOM 11298 C CD1  . ILE A 1 45  ? -1.146  5.397   -1.923  1.00 0.27  ? 45  ILE A CD1  6  
ATOM 11299 H H    . ILE A 1 45  ? -1.708  8.898   -0.256  1.00 0.26  ? 45  ILE A H    6  
ATOM 11300 H HA   . ILE A 1 45  ? -3.335  6.481   -0.421  1.00 0.22  ? 45  ILE A HA   6  
ATOM 11301 H HB   . ILE A 1 45  ? -0.802  6.957   1.151   1.00 0.29  ? 45  ILE A HB   6  
ATOM 11302 H HG12 . ILE A 1 45  ? -0.583  7.344   -1.334  1.00 0.23  ? 45  ILE A HG12 6  
ATOM 11303 H HG13 . ILE A 1 45  ? 0.436   6.071   -0.688  1.00 0.27  ? 45  ILE A HG13 6  
ATOM 11304 H HG21 . ILE A 1 45  ? -2.193  4.442   0.254   1.00 1.01  ? 45  ILE A HG21 6  
ATOM 11305 H HG22 . ILE A 1 45  ? -2.096  5.055   1.903   1.00 1.07  ? 45  ILE A HG22 6  
ATOM 11306 H HG23 . ILE A 1 45  ? -0.637  4.506   1.080   1.00 1.04  ? 45  ILE A HG23 6  
ATOM 11307 H HD11 . ILE A 1 45  ? -2.120  5.740   -2.237  1.00 1.05  ? 45  ILE A HD11 6  
ATOM 11308 H HD12 . ILE A 1 45  ? -1.235  4.414   -1.487  1.00 1.05  ? 45  ILE A HD12 6  
ATOM 11309 H HD13 . ILE A 1 45  ? -0.486  5.353   -2.779  1.00 1.01  ? 45  ILE A HD13 6  
ATOM 11310 N N    . ASP A 1 46  ? -4.307  6.442   1.882   1.00 0.22  ? 46  ASP A N    6  
ATOM 11311 C CA   . ASP A 1 46  ? -5.088  6.509   3.112   1.00 0.27  ? 46  ASP A CA   6  
ATOM 11312 C C    . ASP A 1 46  ? -4.597  5.485   4.130   1.00 0.30  ? 46  ASP A C    6  
ATOM 11313 O O    . ASP A 1 46  ? -4.374  5.807   5.301   1.00 0.38  ? 46  ASP A O    6  
ATOM 11314 C CB   . ASP A 1 46  ? -6.560  6.230   2.804   1.00 0.33  ? 46  ASP A CB   6  
ATOM 11315 C CG   . ASP A 1 46  ? -7.404  6.062   4.052   1.00 0.48  ? 46  ASP A CG   6  
ATOM 11316 O OD1  . ASP A 1 46  ? -7.395  6.962   4.918   1.00 0.70  ? 46  ASP A OD1  6  
ATOM 11317 O OD2  . ASP A 1 46  ? -8.089  5.027   4.174   1.00 0.55  ? 46  ASP A OD2  6  
ATOM 11318 H H    . ASP A 1 46  ? -4.452  5.680   1.277   1.00 0.21  ? 46  ASP A H    6  
ATOM 11319 H HA   . ASP A 1 46  ? -4.994  7.502   3.522   1.00 0.31  ? 46  ASP A HA   6  
ATOM 11320 H HB2  . ASP A 1 46  ? -6.961  7.042   2.230   1.00 0.36  ? 46  ASP A HB2  6  
ATOM 11321 H HB3  . ASP A 1 46  ? -6.628  5.324   2.222   1.00 0.33  ? 46  ASP A HB3  6  
ATOM 11322 N N    . LYS A 1 47  ? -4.434  4.247   3.681   1.00 0.28  ? 47  LYS A N    6  
ATOM 11323 C CA   . LYS A 1 47  ? -4.098  3.154   4.581   1.00 0.36  ? 47  LYS A CA   6  
ATOM 11324 C C    . LYS A 1 47  ? -2.982  2.304   4.000   1.00 0.31  ? 47  LYS A C    6  
ATOM 11325 O O    . LYS A 1 47  ? -2.549  2.499   2.865   1.00 0.26  ? 47  LYS A O    6  
ATOM 11326 C CB   . LYS A 1 47  ? -5.335  2.271   4.804   1.00 0.42  ? 47  LYS A CB   6  
ATOM 11327 C CG   . LYS A 1 47  ? -5.280  1.389   6.035   1.00 0.74  ? 47  LYS A CG   6  
ATOM 11328 C CD   . LYS A 1 47  ? -5.358  2.217   7.289   1.00 0.79  ? 47  LYS A CD   6  
ATOM 11329 C CE   . LYS A 1 47  ? -5.262  1.362   8.539   1.00 1.12  ? 47  LYS A CE   6  
ATOM 11330 N NZ   . LYS A 1 47  ? -5.268  2.181   9.781   1.00 1.56  ? 47  LYS A NZ   6  
ATOM 11331 H H    . LYS A 1 47  ? -4.546  4.060   2.719   1.00 0.25  ? 47  LYS A H    6  
ATOM 11332 H HA   . LYS A 1 47  ? -3.777  3.569   5.523   1.00 0.44  ? 47  LYS A HA   6  
ATOM 11333 H HB2  . LYS A 1 47  ? -6.188  2.898   4.894   1.00 0.63  ? 47  LYS A HB2  6  
ATOM 11334 H HB3  . LYS A 1 47  ? -5.466  1.638   3.946   1.00 0.50  ? 47  LYS A HB3  6  
ATOM 11335 H HG2  . LYS A 1 47  ? -6.112  0.712   6.017   1.00 1.36  ? 47  LYS A HG2  6  
ATOM 11336 H HG3  . LYS A 1 47  ? -4.356  0.831   6.032   1.00 1.37  ? 47  LYS A HG3  6  
ATOM 11337 H HD2  . LYS A 1 47  ? -4.561  2.920   7.278   1.00 1.37  ? 47  LYS A HD2  6  
ATOM 11338 H HD3  . LYS A 1 47  ? -6.287  2.744   7.296   1.00 1.28  ? 47  LYS A HD3  6  
ATOM 11339 H HE2  . LYS A 1 47  ? -6.103  0.684   8.562   1.00 1.79  ? 47  LYS A HE2  6  
ATOM 11340 H HE3  . LYS A 1 47  ? -4.347  0.797   8.495   1.00 1.63  ? 47  LYS A HE3  6  
ATOM 11341 H HZ1  . LYS A 1 47  ? -6.087  2.821   9.788   1.00 1.86  ? 47  LYS A HZ1  6  
ATOM 11342 H HZ2  . LYS A 1 47  ? -4.398  2.746   9.843   1.00 2.16  ? 47  LYS A HZ2  6  
ATOM 11343 H HZ3  . LYS A 1 47  ? -5.321  1.562   10.615  1.00 1.99  ? 47  LYS A HZ3  6  
ATOM 11344 N N    . LEU A 1 48  ? -2.522  1.368   4.798   1.00 0.39  ? 48  LEU A N    6  
ATOM 11345 C CA   . LEU A 1 48  ? -1.597  0.350   4.342   1.00 0.36  ? 48  LEU A CA   6  
ATOM 11346 C C    . LEU A 1 48  ? -2.105  -1.010  4.733   1.00 0.40  ? 48  LEU A C    6  
ATOM 11347 O O    . LEU A 1 48  ? -2.894  -1.157  5.667   1.00 0.50  ? 48  LEU A O    6  
ATOM 11348 C CB   . LEU A 1 48  ? -0.200  0.469   4.915   1.00 0.60  ? 48  LEU A CB   6  
ATOM 11349 C CG   . LEU A 1 48  ? 0.530   1.763   4.676   1.00 0.64  ? 48  LEU A CG   6  
ATOM 11350 C CD1  . LEU A 1 48  ? 0.047   2.811   5.643   1.00 1.37  ? 48  LEU A CD1  6  
ATOM 11351 C CD2  . LEU A 1 48  ? 2.006   1.515   4.836   1.00 1.12  ? 48  LEU A CD2  6  
ATOM 11352 H H    . LEU A 1 48  ? -2.823  1.360   5.733   1.00 0.51  ? 48  LEU A H    6  
ATOM 11353 H HA   . LEU A 1 48  ? -1.538  0.415   3.264   1.00 0.27  ? 48  LEU A HA   6  
ATOM 11354 H HB2  . LEU A 1 48  ? -0.255  0.306   5.979   1.00 1.30  ? 48  LEU A HB2  6  
ATOM 11355 H HB3  . LEU A 1 48  ? 0.391   -0.324  4.478   1.00 1.37  ? 48  LEU A HB3  6  
ATOM 11356 H HG   . LEU A 1 48  ? 0.345   2.107   3.670   1.00 1.45  ? 48  LEU A HG   6  
ATOM 11357 H HD11 . LEU A 1 48  ? 0.583   3.730   5.484   1.00 1.81  ? 48  LEU A HD11 6  
ATOM 11358 H HD12 . LEU A 1 48  ? 0.219   2.463   6.650   1.00 1.98  ? 48  LEU A HD12 6  
ATOM 11359 H HD13 . LEU A 1 48  ? -1.010  2.972   5.491   1.00 1.91  ? 48  LEU A HD13 6  
ATOM 11360 H HD21 . LEU A 1 48  ? 2.552   2.332   4.404   1.00 1.75  ? 48  LEU A HD21 6  
ATOM 11361 H HD22 . LEU A 1 48  ? 2.265   0.588   4.331   1.00 1.68  ? 48  LEU A HD22 6  
ATOM 11362 H HD23 . LEU A 1 48  ? 2.239   1.438   5.893   1.00 1.48  ? 48  LEU A HD23 6  
ATOM 11363 N N    . GLN A 1 49  ? -1.642  -1.998  4.023   1.00 0.39  ? 49  GLN A N    6  
ATOM 11364 C CA   . GLN A 1 49  ? -1.933  -3.366  4.355   1.00 0.45  ? 49  GLN A CA   6  
ATOM 11365 C C    . GLN A 1 49  ? -0.638  -4.149  4.364   1.00 0.33  ? 49  GLN A C    6  
ATOM 11366 O O    . GLN A 1 49  ? 0.222   -3.945  3.514   1.00 0.35  ? 49  GLN A O    6  
ATOM 11367 C CB   . GLN A 1 49  ? -2.932  -3.948  3.370   1.00 0.55  ? 49  GLN A CB   6  
ATOM 11368 C CG   . GLN A 1 49  ? -4.149  -4.525  4.034   1.00 0.79  ? 49  GLN A CG   6  
ATOM 11369 C CD   . GLN A 1 49  ? -5.273  -4.799  3.057   1.00 1.36  ? 49  GLN A CD   6  
ATOM 11370 O OE1  . GLN A 1 49  ? -5.335  -5.857  2.437   1.00 2.28  ? 49  GLN A OE1  6  
ATOM 11371 N NE2  . GLN A 1 49  ? -6.179  -3.846  2.919   1.00 1.62  ? 49  GLN A NE2  6  
ATOM 11372 H H    . GLN A 1 49  ? -1.051  -1.800  3.272   1.00 0.39  ? 49  GLN A H    6  
ATOM 11373 H HA   . GLN A 1 49  ? -2.358  -3.384  5.347   1.00 0.56  ? 49  GLN A HA   6  
ATOM 11374 H HB2  . GLN A 1 49  ? -3.252  -3.170  2.705   1.00 0.50  ? 49  GLN A HB2  6  
ATOM 11375 H HB3  . GLN A 1 49  ? -2.455  -4.728  2.805   1.00 0.72  ? 49  GLN A HB3  6  
ATOM 11376 H HG2  . GLN A 1 49  ? -3.875  -5.444  4.524   1.00 1.39  ? 49  GLN A HG2  6  
ATOM 11377 H HG3  . GLN A 1 49  ? -4.488  -3.814  4.762   1.00 1.03  ? 49  GLN A HG3  6  
ATOM 11378 H HE21 . GLN A 1 49  ? -6.074  -3.025  3.450   1.00 1.74  ? 49  GLN A HE21 6  
ATOM 11379 H HE22 . GLN A 1 49  ? -6.926  -4.001  2.306   1.00 2.18  ? 49  GLN A HE22 6  
ATOM 11380 N N    . ALA A 1 50  ? -0.489  -5.010  5.335   1.00 0.34  ? 50  ALA A N    6  
ATOM 11381 C CA   . ALA A 1 50  ? 0.755   -5.735  5.519   1.00 0.28  ? 50  ALA A CA   6  
ATOM 11382 C C    . ALA A 1 50  ? 0.468   -7.151  5.969   1.00 0.32  ? 50  ALA A C    6  
ATOM 11383 O O    . ALA A 1 50  ? -0.371  -7.379  6.842   1.00 0.43  ? 50  ALA A O    6  
ATOM 11384 C CB   . ALA A 1 50  ? 1.634   -5.007  6.515   1.00 0.38  ? 50  ALA A CB   6  
ATOM 11385 H H    . ALA A 1 50  ? -1.240  -5.177  5.945   1.00 0.46  ? 50  ALA A H    6  
ATOM 11386 H HA   . ALA A 1 50  ? 1.279   -5.763  4.574   1.00 0.27  ? 50  ALA A HA   6  
ATOM 11387 H HB1  . ALA A 1 50  ? 1.134   -4.955  7.469   1.00 1.06  ? 50  ALA A HB1  6  
ATOM 11388 H HB2  . ALA A 1 50  ? 1.820   -4.006  6.150   1.00 1.01  ? 50  ALA A HB2  6  
ATOM 11389 H HB3  . ALA A 1 50  ? 2.577   -5.529  6.628   1.00 1.17  ? 50  ALA A HB3  6  
ATOM 11390 N N    . THR A 1 51  ? 1.152   -8.093  5.353   1.00 0.32  ? 51  THR A N    6  
ATOM 11391 C CA   . THR A 1 51  ? 0.931   -9.497  5.629   1.00 0.40  ? 51  THR A CA   6  
ATOM 11392 C C    . THR A 1 51  ? 1.392   -9.878  7.030   1.00 0.53  ? 51  THR A C    6  
ATOM 11393 O O    . THR A 1 51  ? 2.349   -9.306  7.562   1.00 0.55  ? 51  THR A O    6  
ATOM 11394 C CB   . THR A 1 51  ? 1.646   -10.371 4.591   1.00 0.41  ? 51  THR A CB   6  
ATOM 11395 O OG1  . THR A 1 51  ? 2.937   -9.827  4.294   1.00 0.43  ? 51  THR A OG1  6  
ATOM 11396 C CG2  . THR A 1 51  ? 0.820   -10.470 3.323   1.00 0.46  ? 51  THR A CG2  6  
ATOM 11397 H H    . THR A 1 51  ? 1.837   -7.836  4.695   1.00 0.32  ? 51  THR A H    6  
ATOM 11398 H HA   . THR A 1 51  ? -0.131  -9.684  5.550   1.00 0.48  ? 51  THR A HA   6  
ATOM 11399 H HB   . THR A 1 51  ? 1.768   -11.364 5.001   1.00 0.48  ? 51  THR A HB   6  
ATOM 11400 H HG1  . THR A 1 51  ? 3.560   -10.555 4.154   1.00 0.54  ? 51  THR A HG1  6  
ATOM 11401 H HG21 . THR A 1 51  ? -0.107  -10.983 3.535   1.00 1.07  ? 51  THR A HG21 6  
ATOM 11402 H HG22 . THR A 1 51  ? 1.373   -11.018 2.575   1.00 1.05  ? 51  THR A HG22 6  
ATOM 11403 H HG23 . THR A 1 51  ? 0.605   -9.477  2.957   1.00 1.15  ? 51  THR A HG23 6  
ATOM 11404 N N    . PRO A 1 52  ? 0.690   -10.839 7.649   1.00 0.71  ? 52  PRO A N    6  
ATOM 11405 C CA   . PRO A 1 52  ? 1.013   -11.331 8.988   1.00 0.91  ? 52  PRO A CA   6  
ATOM 11406 C C    . PRO A 1 52  ? 2.404   -11.947 9.049   1.00 0.96  ? 52  PRO A C    6  
ATOM 11407 O O    . PRO A 1 52  ? 2.794   -12.713 8.168   1.00 0.88  ? 52  PRO A O    6  
ATOM 11408 C CB   . PRO A 1 52  ? -0.053  -12.401 9.253   1.00 1.10  ? 52  PRO A CB   6  
ATOM 11409 C CG   . PRO A 1 52  ? -0.579  -12.767 7.911   1.00 1.03  ? 52  PRO A CG   6  
ATOM 11410 C CD   . PR