data_2N2C
# 
_entry.id   2N2C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104333   RCSB  
2N2C         PDB   
25595        BMRB  
D_1000104333 WWPDB 
# 
_pdbx_database_related.db_id          25595 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N2C 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-06 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lim, L.'  1 
'Song, J.' 2 
# 
_citation.id                        primary 
_citation.title                     
;ALS-causing mutations significantly perturb the self-assembly and interaction with nucleic acid of the intrinsically-disordered prion-like domain of TDP-43
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lim, L.'  1 
primary 'Song, J.' 2 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TAR DNA-binding protein 43' 
_entity.formula_weight             4336.973 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 307-349' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TDP-43 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGP 
_entity_poly.pdbx_seq_one_letter_code_can   MGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGP 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  GLY n 
1 4  GLY n 
1 5  MET n 
1 6  ASN n 
1 7  PHE n 
1 8  GLY n 
1 9  ALA n 
1 10 PHE n 
1 11 SER n 
1 12 ILE n 
1 13 ASN n 
1 14 PRO n 
1 15 ALA n 
1 16 MET n 
1 17 MET n 
1 18 ALA n 
1 19 ALA n 
1 20 ALA n 
1 21 GLN n 
1 22 ALA n 
1 23 ALA n 
1 24 LEU n 
1 25 GLN n 
1 26 SER n 
1 27 SER n 
1 28 TRP n 
1 29 GLY n 
1 30 MET n 
1 31 MET n 
1 32 GLY n 
1 33 MET n 
1 34 LEU n 
1 35 ALA n 
1 36 SER n 
1 37 GLN n 
1 38 GLN n 
1 39 ASN n 
1 40 GLN n 
1 41 SER n 
1 42 GLY n 
1 43 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TARDBP, TDP43' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET28a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TADBP_HUMAN 
_struct_ref.pdbx_db_accession          Q13148 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGP 
_struct_ref.pdbx_align_begin           307 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2N2C 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 43 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13148 
_struct_ref_seq.db_align_beg                  307 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  349 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       307 
_struct_ref_seq.pdbx_auth_seq_align_end       349 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE       ? 'C3 H7 N O2'    89.093  
ASN 'L-peptide linking' y ASPARAGINE    ? 'C4 H8 N2 O3'   132.118 
GLN 'L-peptide linking' y GLUTAMINE     ? 'C5 H10 N2 O3'  146.144 
GLY 'peptide linking'   y GLYCINE       ? 'C2 H5 N O2'    75.067  
ILE 'L-peptide linking' y ISOLEUCINE    ? 'C6 H13 N O2'   131.173 
LEU 'L-peptide linking' y LEUCINE       ? 'C6 H13 N O2'   131.173 
MET 'L-peptide linking' y METHIONINE    ? 'C5 H11 N O2 S' 149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'   165.189 
PRO 'L-peptide linking' y PROLINE       ? 'C5 H9 N O2'    115.130 
SER 'L-peptide linking' y SERINE        ? 'C3 H7 N O3'    105.093 
TRP 'L-peptide linking' y TRYPTOPHAN    ? 'C11 H12 N2 O2' 204.225 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-15N NOESY' 
1 2 1 '3D 1H-15N TOCSY' 
1 3 1 '3D H(CCO)NH'     
1 4 1 '3D HCCH-TOCSY'   
1 5 1 '3D HNCACB'       
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      1 
_pdbx_nmr_exptl_sample_conditions.pH                  4 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '300 uM [U-100% 15N] entity-1, 60 mM DPC-2, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2N2C 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             6 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N2C 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N2C 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Guntert, Mumenthaler and Wuthrich'                                         'structure solution' CYANA 1 2.1 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement           AMBER 2 ?   
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    
'NMR solution Structures of hydrophobic helices in prion-like domain (M307-P349) of TDP-43 (TAR DNA-binding protein-43) using DPC' 
_exptl.entry_id                   2N2C 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N2C 
_struct.title                     'NMR Structure of TDP-43 prion-like hydrophobic helix in DPC' 
_struct.pdbx_descriptor           'TAR DNA-binding protein 43' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N2C 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
'ALS, prion-like domain, hydrophobic helices, membrane interaction, DPC, TAR DNA-binding protein-43, DNA BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        15 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        39 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         321 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         345 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2N2C 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . MET A 1 1  ? 52.890 34.520 15.500 1.00 0.00 ? 307 MET A N    1 
ATOM 2    C CA   . MET A 1 1  ? 54.130 34.670 14.700 1.00 0.00 ? 307 MET A CA   1 
ATOM 3    C C    . MET A 1 1  ? 55.260 33.960 15.440 1.00 0.00 ? 307 MET A C    1 
ATOM 4    O O    . MET A 1 1  ? 54.960 33.020 16.160 1.00 0.00 ? 307 MET A O    1 
ATOM 5    C CB   . MET A 1 1  ? 54.420 36.150 14.390 1.00 0.00 ? 307 MET A CB   1 
ATOM 6    C CG   . MET A 1 1  ? 53.250 36.820 13.660 1.00 0.00 ? 307 MET A CG   1 
ATOM 7    S SD   . MET A 1 1  ? 53.670 38.450 13.010 1.00 0.00 ? 307 MET A SD   1 
ATOM 8    C CE   . MET A 1 1  ? 52.060 38.930 12.300 1.00 0.00 ? 307 MET A CE   1 
ATOM 9    H H1   . MET A 1 1  ? 52.750 33.540 15.710 1.00 0.00 ? 307 MET A H1   1 
ATOM 10   H H2   . MET A 1 1  ? 52.980 35.000 16.380 1.00 0.00 ? 307 MET A H2   1 
ATOM 11   H H3   . MET A 1 1  ? 52.080 34.870 15.010 1.00 0.00 ? 307 MET A H3   1 
ATOM 12   H HA   . MET A 1 1  ? 53.990 34.150 13.750 1.00 0.00 ? 307 MET A HA   1 
ATOM 13   H HB2  . MET A 1 1  ? 54.640 36.690 15.310 1.00 0.00 ? 307 MET A HB2  1 
ATOM 14   H HB3  . MET A 1 1  ? 55.300 36.200 13.740 1.00 0.00 ? 307 MET A HB3  1 
ATOM 15   H HG2  . MET A 1 1  ? 52.940 36.190 12.830 1.00 0.00 ? 307 MET A HG2  1 
ATOM 16   H HG3  . MET A 1 1  ? 52.410 36.940 14.350 1.00 0.00 ? 307 MET A HG3  1 
ATOM 17   H HE1  . MET A 1 1  ? 52.140 39.910 11.850 1.00 0.00 ? 307 MET A HE1  1 
ATOM 18   H HE2  . MET A 1 1  ? 51.770 38.210 11.530 1.00 0.00 ? 307 MET A HE2  1 
ATOM 19   H HE3  . MET A 1 1  ? 51.310 38.950 13.080 1.00 0.00 ? 307 MET A HE3  1 
ATOM 20   N N    . GLY A 1 2  ? 56.540 34.340 15.270 1.00 0.00 ? 308 GLY A N    1 
ATOM 21   C CA   . GLY A 1 2  ? 57.670 33.640 15.910 1.00 0.00 ? 308 GLY A CA   1 
ATOM 22   C C    . GLY A 1 2  ? 57.780 33.890 17.410 1.00 0.00 ? 308 GLY A C    1 
ATOM 23   O O    . GLY A 1 2  ? 58.400 34.860 17.820 1.00 0.00 ? 308 GLY A O    1 
ATOM 24   H H    . GLY A 1 2  ? 56.760 35.140 14.710 1.00 0.00 ? 308 GLY A H    1 
ATOM 25   H HA2  . GLY A 1 2  ? 57.590 32.570 15.730 1.00 0.00 ? 308 GLY A HA2  1 
ATOM 26   H HA3  . GLY A 1 2  ? 58.600 33.990 15.450 1.00 0.00 ? 308 GLY A HA3  1 
ATOM 27   N N    . GLY A 1 3  ? 57.160 33.040 18.230 1.00 0.00 ? 309 GLY A N    1 
ATOM 28   C CA   . GLY A 1 3  ? 57.190 33.100 19.700 1.00 0.00 ? 309 GLY A CA   1 
ATOM 29   C C    . GLY A 1 3  ? 56.060 32.290 20.340 1.00 0.00 ? 309 GLY A C    1 
ATOM 30   O O    . GLY A 1 3  ? 55.290 31.640 19.640 1.00 0.00 ? 309 GLY A O    1 
ATOM 31   H H    . GLY A 1 3  ? 56.590 32.300 17.820 1.00 0.00 ? 309 GLY A H    1 
ATOM 32   H HA2  . GLY A 1 3  ? 58.140 32.690 20.050 1.00 0.00 ? 309 GLY A HA2  1 
ATOM 33   H HA3  . GLY A 1 3  ? 57.120 34.130 20.030 1.00 0.00 ? 309 GLY A HA3  1 
ATOM 34   N N    . GLY A 1 4  ? 55.900 32.380 21.660 1.00 0.00 ? 310 GLY A N    1 
ATOM 35   C CA   . GLY A 1 4  ? 54.900 31.620 22.440 1.00 0.00 ? 310 GLY A CA   1 
ATOM 36   C C    . GLY A 1 4  ? 53.440 32.090 22.330 1.00 0.00 ? 310 GLY A C    1 
ATOM 37   O O    . GLY A 1 4  ? 52.610 31.670 23.130 1.00 0.00 ? 310 GLY A O    1 
ATOM 38   H H    . GLY A 1 4  ? 56.500 33.010 22.180 1.00 0.00 ? 310 GLY A H    1 
ATOM 39   H HA2  . GLY A 1 4  ? 54.930 30.580 22.130 1.00 0.00 ? 310 GLY A HA2  1 
ATOM 40   H HA3  . GLY A 1 4  ? 55.180 31.660 23.500 1.00 0.00 ? 310 GLY A HA3  1 
ATOM 41   N N    . MET A 1 5  ? 53.140 33.000 21.390 1.00 0.00 ? 311 MET A N    1 
ATOM 42   C CA   . MET A 1 5  ? 51.800 33.430 20.920 1.00 0.00 ? 311 MET A CA   1 
ATOM 43   C C    . MET A 1 5  ? 50.710 33.790 21.950 1.00 0.00 ? 311 MET A C    1 
ATOM 44   O O    . MET A 1 5  ? 49.570 34.000 21.550 1.00 0.00 ? 311 MET A O    1 
ATOM 45   C CB   . MET A 1 5  ? 51.310 32.520 19.770 1.00 0.00 ? 311 MET A CB   1 
ATOM 46   C CG   . MET A 1 5  ? 52.200 32.710 18.530 1.00 0.00 ? 311 MET A CG   1 
ATOM 47   S SD   . MET A 1 5  ? 51.540 32.080 16.960 1.00 0.00 ? 311 MET A SD   1 
ATOM 48   C CE   . MET A 1 5  ? 52.520 30.560 16.780 1.00 0.00 ? 311 MET A CE   1 
ATOM 49   H H    . MET A 1 5  ? 53.920 33.250 20.800 1.00 0.00 ? 311 MET A H    1 
ATOM 50   H HA   . MET A 1 5  ? 51.970 34.400 20.450 1.00 0.00 ? 311 MET A HA   1 
ATOM 51   H HB2  . MET A 1 5  ? 51.310 31.470 20.080 1.00 0.00 ? 311 MET A HB2  1 
ATOM 52   H HB3  . MET A 1 5  ? 50.290 32.800 19.490 1.00 0.00 ? 311 MET A HB3  1 
ATOM 53   H HG2  . MET A 1 5  ? 52.370 33.770 18.390 1.00 0.00 ? 311 MET A HG2  1 
ATOM 54   H HG3  . MET A 1 5  ? 53.160 32.240 18.710 1.00 0.00 ? 311 MET A HG3  1 
ATOM 55   H HE1  . MET A 1 5  ? 52.270 30.060 15.850 1.00 0.00 ? 311 MET A HE1  1 
ATOM 56   H HE2  . MET A 1 5  ? 53.590 30.800 16.780 1.00 0.00 ? 311 MET A HE2  1 
ATOM 57   H HE3  . MET A 1 5  ? 52.310 29.880 17.610 1.00 0.00 ? 311 MET A HE3  1 
ATOM 58   N N    . ASN A 1 6  ? 51.030 33.950 23.230 1.00 0.00 ? 312 ASN A N    1 
ATOM 59   C CA   . ASN A 1 6  ? 50.050 34.210 24.300 1.00 0.00 ? 312 ASN A CA   1 
ATOM 60   C C    . ASN A 1 6  ? 49.520 35.660 24.280 1.00 0.00 ? 312 ASN A C    1 
ATOM 61   O O    . ASN A 1 6  ? 48.380 35.890 23.900 1.00 0.00 ? 312 ASN A O    1 
ATOM 62   C CB   . ASN A 1 6  ? 50.670 33.780 25.650 1.00 0.00 ? 312 ASN A CB   1 
ATOM 63   C CG   . ASN A 1 6  ? 49.690 33.020 26.520 1.00 0.00 ? 312 ASN A CG   1 
ATOM 64   O OD1  . ASN A 1 6  ? 49.040 33.570 27.390 1.00 0.00 ? 312 ASN A OD1  1 
ATOM 65   N ND2  . ASN A 1 6  ? 49.560 31.730 26.330 1.00 0.00 ? 312 ASN A ND2  1 
ATOM 66   H H    . ASN A 1 6  ? 51.950 33.620 23.500 1.00 0.00 ? 312 ASN A H    1 
ATOM 67   H HA   . ASN A 1 6  ? 49.180 33.570 24.100 1.00 0.00 ? 312 ASN A HA   1 
ATOM 68   H HB2  . ASN A 1 6  ? 51.530 33.140 25.490 1.00 0.00 ? 312 ASN A HB2  1 
ATOM 69   H HB3  . ASN A 1 6  ? 50.980 34.650 26.210 1.00 0.00 ? 312 ASN A HB3  1 
ATOM 70   H HD21 . ASN A 1 6  ? 50.090 31.260 25.620 1.00 0.00 ? 312 ASN A HD21 1 
ATOM 71   H HD22 . ASN A 1 6  ? 48.910 31.270 26.930 1.00 0.00 ? 312 ASN A HD22 1 
ATOM 72   N N    . PHE A 1 7  ? 50.360 36.640 24.620 1.00 0.00 ? 313 PHE A N    1 
ATOM 73   C CA   . PHE A 1 7  ? 49.950 38.060 24.720 1.00 0.00 ? 313 PHE A CA   1 
ATOM 74   C C    . PHE A 1 7  ? 50.590 38.990 23.690 1.00 0.00 ? 313 PHE A C    1 
ATOM 75   O O    . PHE A 1 7  ? 50.240 40.170 23.630 1.00 0.00 ? 313 PHE A O    1 
ATOM 76   C CB   . PHE A 1 7  ? 50.250 38.590 26.130 1.00 0.00 ? 313 PHE A CB   1 
ATOM 77   C CG   . PHE A 1 7  ? 49.630 37.810 27.260 1.00 0.00 ? 313 PHE A CG   1 
ATOM 78   C CD1  . PHE A 1 7  ? 48.240 37.570 27.280 1.00 0.00 ? 313 PHE A CD1  1 
ATOM 79   C CD2  . PHE A 1 7  ? 50.430 37.330 28.320 1.00 0.00 ? 313 PHE A CD2  1 
ATOM 80   C CE1  . PHE A 1 7  ? 47.660 36.850 28.340 1.00 0.00 ? 313 PHE A CE1  1 
ATOM 81   C CE2  . PHE A 1 7  ? 49.850 36.620 29.380 1.00 0.00 ? 313 PHE A CE2  1 
ATOM 82   C CZ   . PHE A 1 7  ? 48.470 36.380 29.390 1.00 0.00 ? 313 PHE A CZ   1 
ATOM 83   H H    . PHE A 1 7  ? 51.230 36.380 25.050 1.00 0.00 ? 313 PHE A H    1 
ATOM 84   H HA   . PHE A 1 7  ? 48.870 38.140 24.560 1.00 0.00 ? 313 PHE A HA   1 
ATOM 85   H HB2  . PHE A 1 7  ? 51.330 38.620 26.260 1.00 0.00 ? 313 PHE A HB2  1 
ATOM 86   H HB3  . PHE A 1 7  ? 49.890 39.610 26.200 1.00 0.00 ? 313 PHE A HB3  1 
ATOM 87   H HD1  . PHE A 1 7  ? 47.610 37.930 26.480 1.00 0.00 ? 313 PHE A HD1  1 
ATOM 88   H HD2  . PHE A 1 7  ? 51.500 37.520 28.320 1.00 0.00 ? 313 PHE A HD2  1 
ATOM 89   H HE1  . PHE A 1 7  ? 46.600 36.660 28.350 1.00 0.00 ? 313 PHE A HE1  1 
ATOM 90   H HE2  . PHE A 1 7  ? 50.460 36.250 30.190 1.00 0.00 ? 313 PHE A HE2  1 
ATOM 91   H HZ   . PHE A 1 7  ? 48.020 35.820 30.200 1.00 0.00 ? 313 PHE A HZ   1 
ATOM 92   N N    . GLY A 1 8  ? 51.610 38.540 22.950 1.00 0.00 ? 314 GLY A N    1 
ATOM 93   C CA   . GLY A 1 8  ? 52.400 39.380 22.030 1.00 0.00 ? 314 GLY A CA   1 
ATOM 94   C C    . GLY A 1 8  ? 53.300 40.440 22.680 1.00 0.00 ? 314 GLY A C    1 
ATOM 95   O O    . GLY A 1 8  ? 54.360 40.740 22.130 1.00 0.00 ? 314 GLY A O    1 
ATOM 96   H H    . GLY A 1 8  ? 51.800 37.560 22.990 1.00 0.00 ? 314 GLY A H    1 
ATOM 97   H HA2  . GLY A 1 8  ? 53.040 38.730 21.420 1.00 0.00 ? 314 GLY A HA2  1 
ATOM 98   H HA3  . GLY A 1 8  ? 51.720 39.900 21.360 1.00 0.00 ? 314 GLY A HA3  1 
ATOM 99   N N    . ALA A 1 9  ? 52.930 40.970 23.850 1.00 0.00 ? 315 ALA A N    1 
ATOM 100  C CA   . ALA A 1 9  ? 53.630 42.030 24.600 1.00 0.00 ? 315 ALA A CA   1 
ATOM 101  C C    . ALA A 1 9  ? 54.710 41.520 25.570 1.00 0.00 ? 315 ALA A C    1 
ATOM 102  O O    . ALA A 1 9  ? 55.510 42.310 26.070 1.00 0.00 ? 315 ALA A O    1 
ATOM 103  C CB   . ALA A 1 9  ? 52.590 42.850 25.370 1.00 0.00 ? 315 ALA A CB   1 
ATOM 104  H H    . ALA A 1 9  ? 51.980 40.770 24.150 1.00 0.00 ? 315 ALA A H    1 
ATOM 105  H HA   . ALA A 1 9  ? 54.130 42.670 23.870 1.00 0.00 ? 315 ALA A HA   1 
ATOM 106  H HB1  . ALA A 1 9  ? 53.080 43.680 25.880 1.00 0.00 ? 315 ALA A HB1  1 
ATOM 107  H HB2  . ALA A 1 9  ? 51.830 43.250 24.710 1.00 0.00 ? 315 ALA A HB2  1 
ATOM 108  H HB3  . ALA A 1 9  ? 52.100 42.220 26.120 1.00 0.00 ? 315 ALA A HB3  1 
ATOM 109  N N    . PHE A 1 10 ? 54.720 40.220 25.850 1.00 0.00 ? 316 PHE A N    1 
ATOM 110  C CA   . PHE A 1 10 ? 55.730 39.540 26.670 1.00 0.00 ? 316 PHE A CA   1 
ATOM 111  C C    . PHE A 1 10 ? 56.100 38.200 26.020 1.00 0.00 ? 316 PHE A C    1 
ATOM 112  O O    . PHE A 1 10 ? 57.230 37.980 25.630 1.00 0.00 ? 316 PHE A O    1 
ATOM 113  C CB   . PHE A 1 10 ? 55.220 39.350 28.110 1.00 0.00 ? 316 PHE A CB   1 
ATOM 114  C CG   . PHE A 1 10 ? 55.860 40.280 29.120 1.00 0.00 ? 316 PHE A CG   1 
ATOM 115  C CD1  . PHE A 1 10 ? 57.200 40.070 29.500 1.00 0.00 ? 316 PHE A CD1  1 
ATOM 116  C CD2  . PHE A 1 10 ? 55.120 41.320 29.710 1.00 0.00 ? 316 PHE A CD2  1 
ATOM 117  C CE1  . PHE A 1 10 ? 57.800 40.900 30.470 1.00 0.00 ? 316 PHE A CE1  1 
ATOM 118  C CE2  . PHE A 1 10 ? 55.720 42.150 30.680 1.00 0.00 ? 316 PHE A CE2  1 
ATOM 119  C CZ   . PHE A 1 10 ? 57.060 41.940 31.050 1.00 0.00 ? 316 PHE A CZ   1 
ATOM 120  H H    . PHE A 1 10 ? 54.010 39.660 25.410 1.00 0.00 ? 316 PHE A H    1 
ATOM 121  H HA   . PHE A 1 10 ? 56.640 40.140 26.690 1.00 0.00 ? 316 PHE A HA   1 
ATOM 122  H HB2  . PHE A 1 10 ? 54.130 39.470 28.140 1.00 0.00 ? 316 PHE A HB2  1 
ATOM 123  H HB3  . PHE A 1 10 ? 55.420 38.330 28.440 1.00 0.00 ? 316 PHE A HB3  1 
ATOM 124  H HD1  . PHE A 1 10 ? 57.770 39.270 29.060 1.00 0.00 ? 316 PHE A HD1  1 
ATOM 125  H HD2  . PHE A 1 10 ? 54.090 41.490 29.430 1.00 0.00 ? 316 PHE A HD2  1 
ATOM 126  H HE1  . PHE A 1 10 ? 58.820 40.730 30.760 1.00 0.00 ? 316 PHE A HE1  1 
ATOM 127  H HE2  . PHE A 1 10 ? 55.150 42.950 31.130 1.00 0.00 ? 316 PHE A HE2  1 
ATOM 128  H HZ   . PHE A 1 10 ? 57.520 42.570 31.800 1.00 0.00 ? 316 PHE A HZ   1 
ATOM 129  N N    . SER A 1 11 ? 55.100 37.330 25.810 1.00 0.00 ? 317 SER A N    1 
ATOM 130  C CA   . SER A 1 11 ? 55.260 35.950 25.310 1.00 0.00 ? 317 SER A CA   1 
ATOM 131  C C    . SER A 1 11 ? 55.660 35.830 23.830 1.00 0.00 ? 317 SER A C    1 
ATOM 132  O O    . SER A 1 11 ? 55.480 34.770 23.230 1.00 0.00 ? 317 SER A O    1 
ATOM 133  C CB   . SER A 1 11 ? 53.970 35.150 25.570 1.00 0.00 ? 317 SER A CB   1 
ATOM 134  O OG   . SER A 1 11 ? 53.300 35.620 26.730 1.00 0.00 ? 317 SER A OG   1 
ATOM 135  H H    . SER A 1 11 ? 54.210 37.530 26.240 1.00 0.00 ? 317 SER A H    1 
ATOM 136  H HA   . SER A 1 11 ? 56.060 35.490 25.890 1.00 0.00 ? 317 SER A HA   1 
ATOM 137  H HB2  . SER A 1 11 ? 53.300 35.270 24.720 1.00 0.00 ? 317 SER A HB2  1 
ATOM 138  H HB3  . SER A 1 11 ? 54.210 34.090 25.680 1.00 0.00 ? 317 SER A HB3  1 
ATOM 139  H HG   . SER A 1 11 ? 53.480 35.020 27.470 1.00 0.00 ? 317 SER A HG   1 
ATOM 140  N N    . ILE A 1 12 ? 56.170 36.900 23.220 1.00 0.00 ? 318 ILE A N    1 
ATOM 141  C CA   . ILE A 1 12 ? 56.820 36.910 21.900 1.00 0.00 ? 318 ILE A CA   1 
ATOM 142  C C    . ILE A 1 12 ? 58.010 37.880 21.930 1.00 0.00 ? 318 ILE A C    1 
ATOM 143  O O    . ILE A 1 12 ? 59.120 37.510 21.580 1.00 0.00 ? 318 ILE A O    1 
ATOM 144  C CB   . ILE A 1 12 ? 55.840 37.310 20.760 1.00 0.00 ? 318 ILE A CB   1 
ATOM 145  C CG1  . ILE A 1 12 ? 54.630 36.350 20.650 1.00 0.00 ? 318 ILE A CG1  1 
ATOM 146  C CG2  . ILE A 1 12 ? 56.610 37.350 19.420 1.00 0.00 ? 318 ILE A CG2  1 
ATOM 147  C CD1  . ILE A 1 12 ? 53.690 36.660 19.470 1.00 0.00 ? 318 ILE A CD1  1 
ATOM 148  H H    . ILE A 1 12 ? 56.400 37.670 23.840 1.00 0.00 ? 318 ILE A H    1 
ATOM 149  H HA   . ILE A 1 12 ? 57.220 35.920 21.690 1.00 0.00 ? 318 ILE A HA   1 
ATOM 150  H HB   . ILE A 1 12 ? 55.460 38.310 20.950 1.00 0.00 ? 318 ILE A HB   1 
ATOM 151  H HG12 . ILE A 1 12 ? 54.980 35.330 20.560 1.00 0.00 ? 318 ILE A HG12 1 
ATOM 152  H HG13 . ILE A 1 12 ? 54.040 36.430 21.560 1.00 0.00 ? 318 ILE A HG13 1 
ATOM 153  H HG21 . ILE A 1 12 ? 55.970 37.630 18.590 1.00 0.00 ? 318 ILE A HG21 1 
ATOM 154  H HG22 . ILE A 1 12 ? 57.420 38.080 19.450 1.00 0.00 ? 318 ILE A HG22 1 
ATOM 155  H HG23 . ILE A 1 12 ? 57.040 36.370 19.220 1.00 0.00 ? 318 ILE A HG23 1 
ATOM 156  H HD11 . ILE A 1 12 ? 54.130 36.310 18.540 1.00 0.00 ? 318 ILE A HD11 1 
ATOM 157  H HD12 . ILE A 1 12 ? 52.740 36.140 19.610 1.00 0.00 ? 318 ILE A HD12 1 
ATOM 158  H HD13 . ILE A 1 12 ? 53.490 37.720 19.410 1.00 0.00 ? 318 ILE A HD13 1 
ATOM 159  N N    . ASN A 1 13 ? 57.760 39.140 22.310 1.00 0.00 ? 319 ASN A N    1 
ATOM 160  C CA   . ASN A 1 13 ? 58.690 40.260 22.270 1.00 0.00 ? 319 ASN A CA   1 
ATOM 161  C C    . ASN A 1 13 ? 58.290 41.290 23.350 1.00 0.00 ? 319 ASN A C    1 
ATOM 162  O O    . ASN A 1 13 ? 57.130 41.300 23.750 1.00 0.00 ? 319 ASN A O    1 
ATOM 163  C CB   . ASN A 1 13 ? 58.580 40.920 20.870 1.00 0.00 ? 319 ASN A CB   1 
ATOM 164  C CG   . ASN A 1 13 ? 59.710 40.610 19.900 1.00 0.00 ? 319 ASN A CG   1 
ATOM 165  O OD1  . ASN A 1 13 ? 60.090 41.460 19.120 1.00 0.00 ? 319 ASN A OD1  1 
ATOM 166  N ND2  . ASN A 1 13 ? 60.270 39.430 19.880 1.00 0.00 ? 319 ASN A ND2  1 
ATOM 167  H H    . ASN A 1 13 ? 56.830 39.370 22.630 1.00 0.00 ? 319 ASN A H    1 
ATOM 168  H HA   . ASN A 1 13 ? 59.710 39.920 22.460 1.00 0.00 ? 319 ASN A HA   1 
ATOM 169  H HB2  . ASN A 1 13 ? 57.640 40.650 20.390 1.00 0.00 ? 319 ASN A HB2  1 
ATOM 170  H HB3  . ASN A 1 13 ? 58.580 42.000 21.000 1.00 0.00 ? 319 ASN A HB3  1 
ATOM 171  H HD21 . ASN A 1 13 ? 59.970 38.690 20.500 1.00 0.00 ? 319 ASN A HD21 1 
ATOM 172  H HD22 . ASN A 1 13 ? 61.020 39.300 19.220 1.00 0.00 ? 319 ASN A HD22 1 
ATOM 173  N N    . PRO A 1 14 ? 59.210 42.180 23.790 1.00 0.00 ? 320 PRO A N    1 
ATOM 174  C CA   . PRO A 1 14 ? 58.880 43.270 24.710 1.00 0.00 ? 320 PRO A CA   1 
ATOM 175  C C    . PRO A 1 14 ? 57.980 44.300 24.030 1.00 0.00 ? 320 PRO A C    1 
ATOM 176  O O    . PRO A 1 14 ? 58.440 45.060 23.180 1.00 0.00 ? 320 PRO A O    1 
ATOM 177  C CB   . PRO A 1 14 ? 60.240 43.860 25.120 1.00 0.00 ? 320 PRO A CB   1 
ATOM 178  C CG   . PRO A 1 14 ? 61.130 43.600 23.890 1.00 0.00 ? 320 PRO A CG   1 
ATOM 179  C CD   . PRO A 1 14 ? 60.600 42.270 23.360 1.00 0.00 ? 320 PRO A CD   1 
ATOM 180  H HA   . PRO A 1 14 ? 58.380 42.880 25.600 1.00 0.00 ? 320 PRO A HA   1 
ATOM 181  H HB2  . PRO A 1 14 ? 60.180 44.920 25.350 1.00 0.00 ? 320 PRO A HB2  1 
ATOM 182  H HB3  . PRO A 1 14 ? 60.640 43.300 25.970 1.00 0.00 ? 320 PRO A HB3  1 
ATOM 183  H HG2  . PRO A 1 14 ? 60.970 44.380 23.150 1.00 0.00 ? 320 PRO A HG2  1 
ATOM 184  H HG3  . PRO A 1 14 ? 62.180 43.540 24.160 1.00 0.00 ? 320 PRO A HG3  1 
ATOM 185  H HD2  . PRO A 1 14 ? 60.690 42.240 22.280 1.00 0.00 ? 320 PRO A HD2  1 
ATOM 186  H HD3  . PRO A 1 14 ? 61.160 41.450 23.800 1.00 0.00 ? 320 PRO A HD3  1 
ATOM 187  N N    . ALA A 1 15 ? 56.680 44.280 24.350 1.00 0.00 ? 321 ALA A N    1 
ATOM 188  C CA   . ALA A 1 15 ? 55.570 45.020 23.710 1.00 0.00 ? 321 ALA A CA   1 
ATOM 189  C C    . ALA A 1 15 ? 55.340 44.770 22.200 1.00 0.00 ? 321 ALA A C    1 
ATOM 190  O O    . ALA A 1 15 ? 54.190 44.750 21.750 1.00 0.00 ? 321 ALA A O    1 
ATOM 191  C CB   . ALA A 1 15 ? 55.690 46.520 24.040 1.00 0.00 ? 321 ALA A CB   1 
ATOM 192  H H    . ALA A 1 15 ? 56.410 43.610 25.060 1.00 0.00 ? 321 ALA A H    1 
ATOM 193  H HA   . ALA A 1 15 ? 54.660 44.690 24.200 1.00 0.00 ? 321 ALA A HA   1 
ATOM 194  H HB1  . ALA A 1 15 ? 54.810 47.040 23.680 1.00 0.00 ? 321 ALA A HB1  1 
ATOM 195  H HB2  . ALA A 1 15 ? 55.760 46.650 25.120 1.00 0.00 ? 321 ALA A HB2  1 
ATOM 196  H HB3  . ALA A 1 15 ? 56.580 46.940 23.570 1.00 0.00 ? 321 ALA A HB3  1 
ATOM 197  N N    . MET A 1 16 ? 56.400 44.550 21.410 1.00 0.00 ? 322 MET A N    1 
ATOM 198  C CA   . MET A 1 16 ? 56.470 44.770 19.960 1.00 0.00 ? 322 MET A CA   1 
ATOM 199  C C    . MET A 1 16 ? 55.340 44.130 19.150 1.00 0.00 ? 322 MET A C    1 
ATOM 200  O O    . MET A 1 16 ? 54.760 44.780 18.280 1.00 0.00 ? 322 MET A O    1 
ATOM 201  C CB   . MET A 1 16 ? 57.830 44.260 19.450 1.00 0.00 ? 322 MET A CB   1 
ATOM 202  C CG   . MET A 1 16 ? 58.320 45.060 18.240 1.00 0.00 ? 322 MET A CG   1 
ATOM 203  S SD   . MET A 1 16 ? 58.890 46.720 18.680 1.00 0.00 ? 322 MET A SD   1 
ATOM 204  C CE   . MET A 1 16 ? 58.220 47.670 17.300 1.00 0.00 ? 322 MET A CE   1 
ATOM 205  H H    . MET A 1 16 ? 57.300 44.610 21.890 1.00 0.00 ? 322 MET A H    1 
ATOM 206  H HA   . MET A 1 16 ? 56.420 45.850 19.790 1.00 0.00 ? 322 MET A HA   1 
ATOM 207  H HB2  . MET A 1 16 ? 58.590 44.350 20.230 1.00 0.00 ? 322 MET A HB2  1 
ATOM 208  H HB3  . MET A 1 16 ? 57.750 43.210 19.170 1.00 0.00 ? 322 MET A HB3  1 
ATOM 209  H HG2  . MET A 1 16 ? 59.150 44.520 17.780 1.00 0.00 ? 322 MET A HG2  1 
ATOM 210  H HG3  . MET A 1 16 ? 57.510 45.120 17.510 1.00 0.00 ? 322 MET A HG3  1 
ATOM 211  H HE1  . MET A 1 16 ? 58.540 48.710 17.390 1.00 0.00 ? 322 MET A HE1  1 
ATOM 212  H HE2  . MET A 1 16 ? 58.590 47.270 16.360 1.00 0.00 ? 322 MET A HE2  1 
ATOM 213  H HE3  . MET A 1 16 ? 57.130 47.630 17.310 1.00 0.00 ? 322 MET A HE3  1 
ATOM 214  N N    . MET A 1 17 ? 55.010 42.860 19.400 1.00 0.00 ? 323 MET A N    1 
ATOM 215  C CA   . MET A 1 17 ? 54.040 42.130 18.580 1.00 0.00 ? 323 MET A CA   1 
ATOM 216  C C    . MET A 1 17 ? 52.600 42.520 18.940 1.00 0.00 ? 323 MET A C    1 
ATOM 217  O O    . MET A 1 17 ? 51.780 42.720 18.040 1.00 0.00 ? 323 MET A O    1 
ATOM 218  C CB   . MET A 1 17 ? 54.310 40.610 18.690 1.00 0.00 ? 323 MET A CB   1 
ATOM 219  C CG   . MET A 1 17 ? 54.150 39.860 17.360 1.00 0.00 ? 323 MET A CG   1 
ATOM 220  S SD   . MET A 1 17 ? 52.470 39.430 16.850 1.00 0.00 ? 323 MET A SD   1 
ATOM 221  C CE   . MET A 1 17 ? 52.170 40.680 15.560 1.00 0.00 ? 323 MET A CE   1 
ATOM 222  H H    . MET A 1 17 ? 55.460 42.390 20.180 1.00 0.00 ? 323 MET A H    1 
ATOM 223  H HA   . MET A 1 17 ? 54.200 42.420 17.540 1.00 0.00 ? 323 MET A HA   1 
ATOM 224  H HB2  . MET A 1 17 ? 55.340 40.460 19.010 1.00 0.00 ? 323 MET A HB2  1 
ATOM 225  H HB3  . MET A 1 17 ? 53.650 40.170 19.440 1.00 0.00 ? 323 MET A HB3  1 
ATOM 226  H HG2  . MET A 1 17 ? 54.640 40.430 16.560 1.00 0.00 ? 323 MET A HG2  1 
ATOM 227  H HG3  . MET A 1 17 ? 54.690 38.930 17.450 1.00 0.00 ? 323 MET A HG3  1 
ATOM 228  H HE1  . MET A 1 17 ? 51.140 40.580 15.190 1.00 0.00 ? 323 MET A HE1  1 
ATOM 229  H HE2  . MET A 1 17 ? 52.300 41.680 15.960 1.00 0.00 ? 323 MET A HE2  1 
ATOM 230  H HE3  . MET A 1 17 ? 52.860 40.540 14.740 1.00 0.00 ? 323 MET A HE3  1 
ATOM 231  N N    . ALA A 1 18 ? 52.300 42.740 20.220 1.00 0.00 ? 324 ALA A N    1 
ATOM 232  C CA   . ALA A 1 18 ? 51.010 43.290 20.630 1.00 0.00 ? 324 ALA A CA   1 
ATOM 233  C C    . ALA A 1 18 ? 50.830 44.720 20.100 1.00 0.00 ? 324 ALA A C    1 
ATOM 234  O O    . ALA A 1 18 ? 49.770 45.030 19.560 1.00 0.00 ? 324 ALA A O    1 
ATOM 235  C CB   . ALA A 1 18 ? 50.900 43.280 22.150 1.00 0.00 ? 324 ALA A CB   1 
ATOM 236  H H    . ALA A 1 18 ? 53.040 42.680 20.910 1.00 0.00 ? 324 ALA A H    1 
ATOM 237  H HA   . ALA A 1 18 ? 50.210 42.680 20.220 1.00 0.00 ? 324 ALA A HA   1 
ATOM 238  H HB1  . ALA A 1 18 ? 49.930 43.670 22.450 1.00 0.00 ? 324 ALA A HB1  1 
ATOM 239  H HB2  . ALA A 1 18 ? 50.990 42.260 22.510 1.00 0.00 ? 324 ALA A HB2  1 
ATOM 240  H HB3  . ALA A 1 18 ? 51.690 43.910 22.580 1.00 0.00 ? 324 ALA A HB3  1 
ATOM 241  N N    . ALA A 1 19 ? 51.860 45.570 20.200 1.00 0.00 ? 325 ALA A N    1 
ATOM 242  C CA   . ALA A 1 19 ? 51.810 46.930 19.670 1.00 0.00 ? 325 ALA A CA   1 
ATOM 243  C C    . ALA A 1 19 ? 51.580 46.940 18.150 1.00 0.00 ? 325 ALA A C    1 
ATOM 244  O O    . ALA A 1 19 ? 50.670 47.620 17.680 1.00 0.00 ? 325 ALA A O    1 
ATOM 245  C CB   . ALA A 1 19 ? 53.100 47.650 20.070 1.00 0.00 ? 325 ALA A CB   1 
ATOM 246  H H    . ALA A 1 19 ? 52.700 45.260 20.670 1.00 0.00 ? 325 ALA A H    1 
ATOM 247  H HA   . ALA A 1 19 ? 50.970 47.450 20.130 1.00 0.00 ? 325 ALA A HA   1 
ATOM 248  H HB1  . ALA A 1 19 ? 53.070 48.680 19.710 1.00 0.00 ? 325 ALA A HB1  1 
ATOM 249  H HB2  . ALA A 1 19 ? 53.200 47.660 21.160 1.00 0.00 ? 325 ALA A HB2  1 
ATOM 250  H HB3  . ALA A 1 19 ? 53.970 47.150 19.640 1.00 0.00 ? 325 ALA A HB3  1 
ATOM 251  N N    . ALA A 1 20 ? 52.310 46.120 17.380 1.00 0.00 ? 326 ALA A N    1 
ATOM 252  C CA   . ALA A 1 20 ? 52.130 46.020 15.930 1.00 0.00 ? 326 ALA A CA   1 
ATOM 253  C C    . ALA A 1 20 ? 50.740 45.510 15.530 1.00 0.00 ? 326 ALA A C    1 
ATOM 254  O O    . ALA A 1 20 ? 50.160 45.990 14.550 1.00 0.00 ? 326 ALA A O    1 
ATOM 255  C CB   . ALA A 1 20 ? 53.240 45.120 15.370 1.00 0.00 ? 326 ALA A CB   1 
ATOM 256  H H    . ALA A 1 20 ? 53.070 45.590 17.810 1.00 0.00 ? 326 ALA A H    1 
ATOM 257  H HA   . ALA A 1 20 ? 52.250 47.010 15.500 1.00 0.00 ? 326 ALA A HA   1 
ATOM 258  H HB1  . ALA A 1 20 ? 53.150 45.050 14.290 1.00 0.00 ? 326 ALA A HB1  1 
ATOM 259  H HB2  . ALA A 1 20 ? 54.220 45.550 15.620 1.00 0.00 ? 326 ALA A HB2  1 
ATOM 260  H HB3  . ALA A 1 20 ? 53.170 44.120 15.810 1.00 0.00 ? 326 ALA A HB3  1 
ATOM 261  N N    . GLN A 1 21 ? 50.160 44.560 16.280 1.00 0.00 ? 327 GLN A N    1 
ATOM 262  C CA   . GLN A 1 21 ? 48.820 44.030 16.030 1.00 0.00 ? 327 GLN A CA   1 
ATOM 263  C C    . GLN A 1 21 ? 47.710 45.020 16.450 1.00 0.00 ? 327 GLN A C    1 
ATOM 264  O O    . GLN A 1 21 ? 46.740 45.210 15.730 1.00 0.00 ? 327 GLN A O    1 
ATOM 265  C CB   . GLN A 1 21 ? 48.690 42.670 16.730 1.00 0.00 ? 327 GLN A CB   1 
ATOM 266  C CG   . GLN A 1 21 ? 47.390 41.940 16.390 1.00 0.00 ? 327 GLN A CG   1 
ATOM 267  C CD   . GLN A 1 21 ? 47.310 40.530 16.980 1.00 0.00 ? 327 GLN A CD   1 
ATOM 268  O OE1  . GLN A 1 21 ? 48.290 39.920 17.380 1.00 0.00 ? 327 GLN A OE1  1 
ATOM 269  N NE2  . GLN A 1 21 ? 46.140 39.940 17.040 1.00 0.00 ? 327 GLN A NE2  1 
ATOM 270  H H    . GLN A 1 21 ? 50.690 44.170 17.060 1.00 0.00 ? 327 GLN A H    1 
ATOM 271  H HA   . GLN A 1 21 ? 48.710 43.870 14.950 1.00 0.00 ? 327 GLN A HA   1 
ATOM 272  H HB2  . GLN A 1 21 ? 49.530 42.050 16.410 1.00 0.00 ? 327 GLN A HB2  1 
ATOM 273  H HB3  . GLN A 1 21 ? 48.760 42.810 17.810 1.00 0.00 ? 327 GLN A HB3  1 
ATOM 274  H HG2  . GLN A 1 21 ? 46.540 42.520 16.760 1.00 0.00 ? 327 GLN A HG2  1 
ATOM 275  H HG3  . GLN A 1 21 ? 47.290 41.850 15.310 1.00 0.00 ? 327 GLN A HG3  1 
ATOM 276  H HE21 . GLN A 1 21 ? 45.310 40.410 16.720 1.00 0.00 ? 327 GLN A HE21 1 
ATOM 277  H HE22 . GLN A 1 21 ? 46.120 39.030 17.470 1.00 0.00 ? 327 GLN A HE22 1 
ATOM 278  N N    . ALA A 1 22 ? 47.860 45.670 17.610 1.00 0.00 ? 328 ALA A N    1 
ATOM 279  C CA   . ALA A 1 22 ? 46.850 46.550 18.190 1.00 0.00 ? 328 ALA A CA   1 
ATOM 280  C C    . ALA A 1 22 ? 46.880 47.980 17.630 1.00 0.00 ? 328 ALA A C    1 
ATOM 281  O O    . ALA A 1 22 ? 45.850 48.650 17.680 1.00 0.00 ? 328 ALA A O    1 
ATOM 282  C CB   . ALA A 1 22 ? 46.990 46.520 19.720 1.00 0.00 ? 328 ALA A CB   1 
ATOM 283  H H    . ALA A 1 22 ? 48.680 45.460 18.170 1.00 0.00 ? 328 ALA A H    1 
ATOM 284  H HA   . ALA A 1 22 ? 45.870 46.140 17.960 1.00 0.00 ? 328 ALA A HA   1 
ATOM 285  H HB1  . ALA A 1 22 ? 46.170 47.100 20.160 1.00 0.00 ? 328 ALA A HB1  1 
ATOM 286  H HB2  . ALA A 1 22 ? 46.930 45.500 20.080 1.00 0.00 ? 328 ALA A HB2  1 
ATOM 287  H HB3  . ALA A 1 22 ? 47.940 46.960 20.020 1.00 0.00 ? 328 ALA A HB3  1 
ATOM 288  N N    . ALA A 1 23 ? 48.000 48.460 17.080 1.00 0.00 ? 329 ALA A N    1 
ATOM 289  C CA   . ALA A 1 23 ? 48.150 49.830 16.580 1.00 0.00 ? 329 ALA A CA   1 
ATOM 290  C C    . ALA A 1 23 ? 47.040 50.240 15.600 1.00 0.00 ? 329 ALA A C    1 
ATOM 291  O O    . ALA A 1 23 ? 46.440 51.300 15.750 1.00 0.00 ? 329 ALA A O    1 
ATOM 292  C CB   . ALA A 1 23 ? 49.530 49.960 15.900 1.00 0.00 ? 329 ALA A CB   1 
ATOM 293  H H    . ALA A 1 23 ? 48.840 47.890 17.130 1.00 0.00 ? 329 ALA A H    1 
ATOM 294  H HA   . ALA A 1 23 ? 48.110 50.520 17.420 1.00 0.00 ? 329 ALA A HA   1 
ATOM 295  H HB1  . ALA A 1 23 ? 49.600 50.940 15.410 1.00 0.00 ? 329 ALA A HB1  1 
ATOM 296  H HB2  . ALA A 1 23 ? 50.310 49.900 16.650 1.00 0.00 ? 329 ALA A HB2  1 
ATOM 297  H HB3  . ALA A 1 23 ? 49.660 49.180 15.160 1.00 0.00 ? 329 ALA A HB3  1 
ATOM 298  N N    . LEU A 1 24 ? 46.730 49.380 14.620 1.00 0.00 ? 330 LEU A N    1 
ATOM 299  C CA   . LEU A 1 24 ? 45.650 49.630 13.660 1.00 0.00 ? 330 LEU A CA   1 
ATOM 300  C C    . LEU A 1 24 ? 44.320 49.040 14.140 1.00 0.00 ? 330 LEU A C    1 
ATOM 301  O O    . LEU A 1 24 ? 43.260 49.630 13.900 1.00 0.00 ? 330 LEU A O    1 
ATOM 302  C CB   . LEU A 1 24 ? 46.030 49.090 12.260 1.00 0.00 ? 330 LEU A CB   1 
ATOM 303  C CG   . LEU A 1 24 ? 47.430 49.510 11.770 1.00 0.00 ? 330 LEU A CG   1 
ATOM 304  C CD1  . LEU A 1 24 ? 48.440 48.370 11.960 1.00 0.00 ? 330 LEU A CD1  1 
ATOM 305  C CD2  . LEU A 1 24 ? 47.410 49.870 10.280 1.00 0.00 ? 330 LEU A CD2  1 
ATOM 306  H H    . LEU A 1 24 ? 47.280 48.540 14.540 1.00 0.00 ? 330 LEU A H    1 
ATOM 307  H HA   . LEU A 1 24 ? 45.510 50.700 13.560 1.00 0.00 ? 330 LEU A HA   1 
ATOM 308  H HB2  . LEU A 1 24 ? 45.940 48.010 12.250 1.00 0.00 ? 330 LEU A HB2  1 
ATOM 309  H HB3  . LEU A 1 24 ? 45.280 49.480 11.570 1.00 0.00 ? 330 LEU A HB3  1 
ATOM 310  H HG   . LEU A 1 24 ? 47.770 50.390 12.320 1.00 0.00 ? 330 LEU A HG   1 
ATOM 311  H HD11 . LEU A 1 24 ? 49.430 48.710 11.650 1.00 0.00 ? 330 LEU A HD11 1 
ATOM 312  H HD12 . LEU A 1 24 ? 48.490 48.070 13.000 1.00 0.00 ? 330 LEU A HD12 1 
ATOM 313  H HD13 . LEU A 1 24 ? 48.150 47.510 11.360 1.00 0.00 ? 330 LEU A HD13 1 
ATOM 314  H HD21 . LEU A 1 24 ? 46.760 50.730 10.130 1.00 0.00 ? 330 LEU A HD21 1 
ATOM 315  H HD22 . LEU A 1 24 ? 48.420 50.140 9.960  1.00 0.00 ? 330 LEU A HD22 1 
ATOM 316  H HD23 . LEU A 1 24 ? 47.050 49.030 9.690  1.00 0.00 ? 330 LEU A HD23 1 
ATOM 317  N N    . GLN A 1 25 ? 44.360 47.910 14.850 1.00 0.00 ? 331 GLN A N    1 
ATOM 318  C CA   . GLN A 1 25 ? 43.150 47.250 15.350 1.00 0.00 ? 331 GLN A CA   1 
ATOM 319  C C    . GLN A 1 25 ? 42.390 48.100 16.380 1.00 0.00 ? 331 GLN A C    1 
ATOM 320  O O    . GLN A 1 25 ? 41.170 48.060 16.370 1.00 0.00 ? 331 GLN A O    1 
ATOM 321  C CB   . GLN A 1 25 ? 43.520 45.850 15.860 1.00 0.00 ? 331 GLN A CB   1 
ATOM 322  C CG   . GLN A 1 25 ? 42.300 44.960 16.200 1.00 0.00 ? 331 GLN A CG   1 
ATOM 323  C CD   . GLN A 1 25 ? 42.070 44.820 17.710 1.00 0.00 ? 331 GLN A CD   1 
ATOM 324  O OE1  . GLN A 1 25 ? 42.150 45.770 18.470 1.00 0.00 ? 331 GLN A OE1  1 
ATOM 325  N NE2  . GLN A 1 25 ? 41.810 43.630 18.200 1.00 0.00 ? 331 GLN A NE2  1 
ATOM 326  H H    . GLN A 1 25 ? 45.250 47.490 15.050 1.00 0.00 ? 331 GLN A H    1 
ATOM 327  H HA   . GLN A 1 25 ? 42.480 47.120 14.510 1.00 0.00 ? 331 GLN A HA   1 
ATOM 328  H HB2  . GLN A 1 25 ? 44.080 45.340 15.080 1.00 0.00 ? 331 GLN A HB2  1 
ATOM 329  H HB3  . GLN A 1 25 ? 44.160 45.940 16.740 1.00 0.00 ? 331 GLN A HB3  1 
ATOM 330  H HG2  . GLN A 1 25 ? 41.400 45.350 15.740 1.00 0.00 ? 331 GLN A HG2  1 
ATOM 331  H HG3  . GLN A 1 25 ? 42.480 43.970 15.790 1.00 0.00 ? 331 GLN A HG3  1 
ATOM 332  H HE21 . GLN A 1 25 ? 41.730 42.830 17.610 1.00 0.00 ? 331 GLN A HE21 1 
ATOM 333  H HE22 . GLN A 1 25 ? 41.660 43.600 19.200 1.00 0.00 ? 331 GLN A HE22 1 
ATOM 334  N N    . SER A 1 26 ? 43.080 48.960 17.140 1.00 0.00 ? 332 SER A N    1 
ATOM 335  C CA   . SER A 1 26 ? 42.460 49.910 18.080 1.00 0.00 ? 332 SER A CA   1 
ATOM 336  C C    . SER A 1 26 ? 41.430 50.830 17.420 1.00 0.00 ? 332 SER A C    1 
ATOM 337  O O    . SER A 1 26 ? 40.440 51.170 18.050 1.00 0.00 ? 332 SER A O    1 
ATOM 338  C CB   . SER A 1 26 ? 43.540 50.800 18.730 1.00 0.00 ? 332 SER A CB   1 
ATOM 339  O OG   . SER A 1 26 ? 44.440 50.030 19.490 1.00 0.00 ? 332 SER A OG   1 
ATOM 340  H H    . SER A 1 26 ? 44.090 48.910 17.110 1.00 0.00 ? 332 SER A H    1 
ATOM 341  H HA   . SER A 1 26 ? 41.960 49.360 18.870 1.00 0.00 ? 332 SER A HA   1 
ATOM 342  H HB2  . SER A 1 26 ? 44.080 51.340 17.950 1.00 0.00 ? 332 SER A HB2  1 
ATOM 343  H HB3  . SER A 1 26 ? 43.050 51.520 19.380 1.00 0.00 ? 332 SER A HB3  1 
ATOM 344  H HG   . SER A 1 26 ? 45.000 49.520 18.870 1.00 0.00 ? 332 SER A HG   1 
ATOM 345  N N    . SER A 1 27 ? 41.630 51.190 16.140 1.00 0.00 ? 333 SER A N    1 
ATOM 346  C CA   . SER A 1 27 ? 40.670 52.010 15.380 1.00 0.00 ? 333 SER A CA   1 
ATOM 347  C C    . SER A 1 27 ? 39.330 51.290 15.200 1.00 0.00 ? 333 SER A C    1 
ATOM 348  O O    . SER A 1 27 ? 38.270 51.830 15.510 1.00 0.00 ? 333 SER A O    1 
ATOM 349  C CB   . SER A 1 27 ? 41.280 52.360 14.010 1.00 0.00 ? 333 SER A CB   1 
ATOM 350  O OG   . SER A 1 27 ? 40.530 53.370 13.390 1.00 0.00 ? 333 SER A OG   1 
ATOM 351  H H    . SER A 1 27 ? 42.440 50.830 15.660 1.00 0.00 ? 333 SER A H    1 
ATOM 352  H HA   . SER A 1 27 ? 40.490 52.940 15.910 1.00 0.00 ? 333 SER A HA   1 
ATOM 353  H HB2  . SER A 1 27 ? 42.310 52.720 14.160 1.00 0.00 ? 333 SER A HB2  1 
ATOM 354  H HB3  . SER A 1 27 ? 41.310 51.470 13.380 1.00 0.00 ? 333 SER A HB3  1 
ATOM 355  H HG   . SER A 1 27 ? 40.870 53.520 12.500 1.00 0.00 ? 333 SER A HG   1 
ATOM 356  N N    . TRP A 1 28 ? 39.380 50.010 14.830 1.00 0.00 ? 334 TRP A N    1 
ATOM 357  C CA   . TRP A 1 28 ? 38.200 49.130 14.760 1.00 0.00 ? 334 TRP A CA   1 
ATOM 358  C C    . TRP A 1 28 ? 37.680 48.760 16.150 1.00 0.00 ? 334 TRP A C    1 
ATOM 359  O O    . TRP A 1 28 ? 36.470 48.620 16.360 1.00 0.00 ? 334 TRP A O    1 
ATOM 360  C CB   . TRP A 1 28 ? 38.570 47.890 13.930 1.00 0.00 ? 334 TRP A CB   1 
ATOM 361  C CG   . TRP A 1 28 ? 39.270 48.170 12.630 1.00 0.00 ? 334 TRP A CG   1 
ATOM 362  C CD1  . TRP A 1 28 ? 40.500 47.710 12.290 1.00 0.00 ? 334 TRP A CD1  1 
ATOM 363  C CD2  . TRP A 1 28 ? 38.830 48.990 11.510 1.00 0.00 ? 334 TRP A CD2  1 
ATOM 364  N NE1  . TRP A 1 28 ? 40.850 48.200 11.050 1.00 0.00 ? 334 TRP A NE1  1 
ATOM 365  C CE2  . TRP A 1 28 ? 39.860 49.000 10.520 1.00 0.00 ? 334 TRP A CE2  1 
ATOM 366  C CE3  . TRP A 1 28 ? 37.670 49.740 11.220 1.00 0.00 ? 334 TRP A CE3  1 
ATOM 367  C CZ2  . TRP A 1 28 ? 39.750 49.720 9.320  1.00 0.00 ? 334 TRP A CZ2  1 
ATOM 368  C CZ3  . TRP A 1 28 ? 37.540 50.460 10.020 1.00 0.00 ? 334 TRP A CZ3  1 
ATOM 369  C CH2  . TRP A 1 28 ? 38.580 50.450 9.070  1.00 0.00 ? 334 TRP A CH2  1 
ATOM 370  H H    . TRP A 1 28 ? 40.280 49.600 14.630 1.00 0.00 ? 334 TRP A H    1 
ATOM 371  H HA   . TRP A 1 28 ? 37.400 49.660 14.240 1.00 0.00 ? 334 TRP A HA   1 
ATOM 372  H HB2  . TRP A 1 28 ? 39.220 47.250 14.540 1.00 0.00 ? 334 TRP A HB2  1 
ATOM 373  H HB3  . TRP A 1 28 ? 37.660 47.320 13.720 1.00 0.00 ? 334 TRP A HB3  1 
ATOM 374  H HD1  . TRP A 1 28 ? 41.110 47.060 12.900 1.00 0.00 ? 334 TRP A HD1  1 
ATOM 375  H HE1  . TRP A 1 28 ? 41.730 48.010 10.600 1.00 0.00 ? 334 TRP A HE1  1 
ATOM 376  H HE3  . TRP A 1 28 ? 36.860 49.760 11.940 1.00 0.00 ? 334 TRP A HE3  1 
ATOM 377  H HZ2  . TRP A 1 28 ? 40.550 49.700 8.590  1.00 0.00 ? 334 TRP A HZ2  1 
ATOM 378  H HZ3  . TRP A 1 28 ? 36.640 51.020 9.820  1.00 0.00 ? 334 TRP A HZ3  1 
ATOM 379  H HH2  . TRP A 1 28 ? 38.470 51.000 8.140  1.00 0.00 ? 334 TRP A HH2  1 
ATOM 380  N N    . GLY A 1 29 ? 38.570 48.660 17.140 1.00 0.00 ? 335 GLY A N    1 
ATOM 381  C CA   . GLY A 1 29 ? 38.250 48.470 18.550 1.00 0.00 ? 335 GLY A CA   1 
ATOM 382  C C    . GLY A 1 29 ? 37.360 49.570 19.110 1.00 0.00 ? 335 GLY A C    1 
ATOM 383  O O    . GLY A 1 29 ? 36.470 49.260 19.900 1.00 0.00 ? 335 GLY A O    1 
ATOM 384  H H    . GLY A 1 29 ? 39.550 48.730 16.890 1.00 0.00 ? 335 GLY A H    1 
ATOM 385  H HA2  . GLY A 1 29 ? 37.740 47.510 18.670 1.00 0.00 ? 335 GLY A HA2  1 
ATOM 386  H HA3  . GLY A 1 29 ? 39.180 48.450 19.120 1.00 0.00 ? 335 GLY A HA3  1 
ATOM 387  N N    . MET A 1 30 ? 37.500 50.830 18.660 1.00 0.00 ? 336 MET A N    1 
ATOM 388  C CA   . MET A 1 30 ? 36.670 51.940 19.140 1.00 0.00 ? 336 MET A CA   1 
ATOM 389  C C    . MET A 1 30 ? 35.170 51.690 18.930 1.00 0.00 ? 336 MET A C    1 
ATOM 390  O O    . MET A 1 30 ? 34.390 51.850 19.870 1.00 0.00 ? 336 MET A O    1 
ATOM 391  C CB   . MET A 1 30 ? 37.080 53.270 18.480 1.00 0.00 ? 336 MET A CB   1 
ATOM 392  C CG   . MET A 1 30 ? 38.550 53.630 18.710 1.00 0.00 ? 336 MET A CG   1 
ATOM 393  S SD   . MET A 1 30 ? 38.870 55.400 18.930 1.00 0.00 ? 336 MET A SD   1 
ATOM 394  C CE   . MET A 1 30 ? 40.680 55.350 19.110 1.00 0.00 ? 336 MET A CE   1 
ATOM 395  H H    . MET A 1 30 ? 38.280 51.030 18.040 1.00 0.00 ? 336 MET A H    1 
ATOM 396  H HA   . MET A 1 30 ? 36.830 52.040 20.210 1.00 0.00 ? 336 MET A HA   1 
ATOM 397  H HB2  . MET A 1 30 ? 36.890 53.230 17.410 1.00 0.00 ? 336 MET A HB2  1 
ATOM 398  H HB3  . MET A 1 30 ? 36.460 54.060 18.910 1.00 0.00 ? 336 MET A HB3  1 
ATOM 399  H HG2  . MET A 1 30 ? 38.920 53.110 19.590 1.00 0.00 ? 336 MET A HG2  1 
ATOM 400  H HG3  . MET A 1 30 ? 39.130 53.280 17.850 1.00 0.00 ? 336 MET A HG3  1 
ATOM 401  H HE1  . MET A 1 30 ? 41.040 56.340 19.370 1.00 0.00 ? 336 MET A HE1  1 
ATOM 402  H HE2  . MET A 1 30 ? 40.950 54.640 19.890 1.00 0.00 ? 336 MET A HE2  1 
ATOM 403  H HE3  . MET A 1 30 ? 41.130 55.030 18.170 1.00 0.00 ? 336 MET A HE3  1 
ATOM 404  N N    . MET A 1 31 ? 34.750 51.220 17.750 1.00 0.00 ? 337 MET A N    1 
ATOM 405  C CA   . MET A 1 31 ? 33.350 50.860 17.530 1.00 0.00 ? 337 MET A CA   1 
ATOM 406  C C    . MET A 1 31 ? 32.940 49.590 18.290 1.00 0.00 ? 337 MET A C    1 
ATOM 407  O O    . MET A 1 31 ? 31.840 49.520 18.820 1.00 0.00 ? 337 MET A O    1 
ATOM 408  C CB   . MET A 1 31 ? 33.000 50.760 16.030 1.00 0.00 ? 337 MET A CB   1 
ATOM 409  C CG   . MET A 1 31 ? 33.840 49.750 15.240 1.00 0.00 ? 337 MET A CG   1 
ATOM 410  S SD   . MET A 1 31 ? 33.030 49.050 13.780 1.00 0.00 ? 337 MET A SD   1 
ATOM 411  C CE   . MET A 1 31 ? 32.050 47.760 14.590 1.00 0.00 ? 337 MET A CE   1 
ATOM 412  H H    . MET A 1 31 ? 35.430 51.060 17.020 1.00 0.00 ? 337 MET A H    1 
ATOM 413  H HA   . MET A 1 31 ? 32.730 51.660 17.930 1.00 0.00 ? 337 MET A HA   1 
ATOM 414  H HB2  . MET A 1 31 ? 31.950 50.480 15.950 1.00 0.00 ? 337 MET A HB2  1 
ATOM 415  H HB3  . MET A 1 31 ? 33.120 51.740 15.570 1.00 0.00 ? 337 MET A HB3  1 
ATOM 416  H HG2  . MET A 1 31 ? 34.770 50.240 14.930 1.00 0.00 ? 337 MET A HG2  1 
ATOM 417  H HG3  . MET A 1 31 ? 34.100 48.910 15.880 1.00 0.00 ? 337 MET A HG3  1 
ATOM 418  H HE1  . MET A 1 31 ? 31.470 47.210 13.840 1.00 0.00 ? 337 MET A HE1  1 
ATOM 419  H HE2  . MET A 1 31 ? 32.720 47.060 15.100 1.00 0.00 ? 337 MET A HE2  1 
ATOM 420  H HE3  . MET A 1 31 ? 31.370 48.200 15.320 1.00 0.00 ? 337 MET A HE3  1 
ATOM 421  N N    . GLY A 1 32 ? 33.840 48.600 18.400 1.00 0.00 ? 338 GLY A N    1 
ATOM 422  C CA   . GLY A 1 32 ? 33.580 47.340 19.110 1.00 0.00 ? 338 GLY A CA   1 
ATOM 423  C C    . GLY A 1 32 ? 33.380 47.530 20.620 1.00 0.00 ? 338 GLY A C    1 
ATOM 424  O O    . GLY A 1 32 ? 32.490 46.920 21.200 1.00 0.00 ? 338 GLY A O    1 
ATOM 425  H H    . GLY A 1 32 ? 34.750 48.720 17.970 1.00 0.00 ? 338 GLY A H    1 
ATOM 426  H HA2  . GLY A 1 32 ? 32.680 46.880 18.700 1.00 0.00 ? 338 GLY A HA2  1 
ATOM 427  H HA3  . GLY A 1 32 ? 34.420 46.670 18.960 1.00 0.00 ? 338 GLY A HA3  1 
ATOM 428  N N    . MET A 1 33 ? 34.160 48.430 21.240 1.00 0.00 ? 339 MET A N    1 
ATOM 429  C CA   . MET A 1 33 ? 34.060 48.780 22.660 1.00 0.00 ? 339 MET A CA   1 
ATOM 430  C C    . MET A 1 33 ? 32.770 49.540 22.980 1.00 0.00 ? 339 MET A C    1 
ATOM 431  O O    . MET A 1 33 ? 32.160 49.290 24.010 1.00 0.00 ? 339 MET A O    1 
ATOM 432  C CB   . MET A 1 33 ? 35.280 49.630 23.060 1.00 0.00 ? 339 MET A CB   1 
ATOM 433  C CG   . MET A 1 33 ? 36.580 48.810 23.100 1.00 0.00 ? 339 MET A CG   1 
ATOM 434  S SD   . MET A 1 33 ? 38.110 49.780 23.200 1.00 0.00 ? 339 MET A SD   1 
ATOM 435  C CE   . MET A 1 33 ? 37.930 50.540 24.840 1.00 0.00 ? 339 MET A CE   1 
ATOM 436  H H    . MET A 1 33 ? 34.880 48.880 20.690 1.00 0.00 ? 339 MET A H    1 
ATOM 437  H HA   . MET A 1 33 ? 34.060 47.870 23.260 1.00 0.00 ? 339 MET A HA   1 
ATOM 438  H HB2  . MET A 1 33 ? 35.400 50.450 22.340 1.00 0.00 ? 339 MET A HB2  1 
ATOM 439  H HB3  . MET A 1 33 ? 35.110 50.060 24.040 1.00 0.00 ? 339 MET A HB3  1 
ATOM 440  H HG2  . MET A 1 33 ? 36.530 48.130 23.960 1.00 0.00 ? 339 MET A HG2  1 
ATOM 441  H HG3  . MET A 1 33 ? 36.640 48.190 22.210 1.00 0.00 ? 339 MET A HG3  1 
ATOM 442  H HE1  . MET A 1 33 ? 38.830 51.120 25.060 1.00 0.00 ? 339 MET A HE1  1 
ATOM 443  H HE2  . MET A 1 33 ? 37.070 51.200 24.850 1.00 0.00 ? 339 MET A HE2  1 
ATOM 444  H HE3  . MET A 1 33 ? 37.810 49.760 25.590 1.00 0.00 ? 339 MET A HE3  1 
ATOM 445  N N    . LEU A 1 34 ? 32.320 50.440 22.090 1.00 0.00 ? 340 LEU A N    1 
ATOM 446  C CA   . LEU A 1 34 ? 31.060 51.170 22.270 1.00 0.00 ? 340 LEU A CA   1 
ATOM 447  C C    . LEU A 1 34 ? 29.840 50.260 22.060 1.00 0.00 ? 340 LEU A C    1 
ATOM 448  O O    . LEU A 1 34 ? 28.930 50.240 22.880 1.00 0.00 ? 340 LEU A O    1 
ATOM 449  C CB   . LEU A 1 34 ? 31.040 52.400 21.350 1.00 0.00 ? 340 LEU A CB   1 
ATOM 450  C CG   . LEU A 1 34 ? 32.110 53.460 21.700 1.00 0.00 ? 340 LEU A CG   1 
ATOM 451  C CD1  . LEU A 1 34 ? 32.130 54.540 20.620 1.00 0.00 ? 340 LEU A CD1  1 
ATOM 452  C CD2  . LEU A 1 34 ? 31.860 54.130 23.050 1.00 0.00 ? 340 LEU A CD2  1 
ATOM 453  H H    . LEU A 1 34 ? 32.870 50.620 21.260 1.00 0.00 ? 340 LEU A H    1 
ATOM 454  H HA   . LEU A 1 34 ? 31.000 51.500 23.310 1.00 0.00 ? 340 LEU A HA   1 
ATOM 455  H HB2  . LEU A 1 34 ? 31.190 52.070 20.320 1.00 0.00 ? 340 LEU A HB2  1 
ATOM 456  H HB3  . LEU A 1 34 ? 30.060 52.870 21.410 1.00 0.00 ? 340 LEU A HB3  1 
ATOM 457  H HG   . LEU A 1 34 ? 33.100 52.990 21.730 1.00 0.00 ? 340 LEU A HG   1 
ATOM 458  H HD11 . LEU A 1 34 ? 32.920 55.270 20.840 1.00 0.00 ? 340 LEU A HD11 1 
ATOM 459  H HD12 . LEU A 1 34 ? 32.350 54.090 19.650 1.00 0.00 ? 340 LEU A HD12 1 
ATOM 460  H HD13 . LEU A 1 34 ? 31.170 55.050 20.580 1.00 0.00 ? 340 LEU A HD13 1 
ATOM 461  H HD21 . LEU A 1 34 ? 31.950 53.410 23.850 1.00 0.00 ? 340 LEU A HD21 1 
ATOM 462  H HD22 . LEU A 1 34 ? 32.610 54.910 23.210 1.00 0.00 ? 340 LEU A HD22 1 
ATOM 463  H HD23 . LEU A 1 34 ? 30.870 54.580 23.070 1.00 0.00 ? 340 LEU A HD23 1 
ATOM 464  N N    . ALA A 1 35 ? 29.850 49.440 21.000 1.00 0.00 ? 341 ALA A N    1 
ATOM 465  C CA   . ALA A 1 35 ? 28.780 48.470 20.740 1.00 0.00 ? 341 ALA A CA   1 
ATOM 466  C C    . ALA A 1 35 ? 28.670 47.420 21.860 1.00 0.00 ? 341 ALA A C    1 
ATOM 467  O O    . ALA A 1 35 ? 27.580 47.190 22.390 1.00 0.00 ? 341 ALA A O    1 
ATOM 468  C CB   . ALA A 1 35 ? 29.020 47.830 19.370 1.00 0.00 ? 341 ALA A CB   1 
ATOM 469  H H    . ALA A 1 35 ? 30.610 49.490 20.340 1.00 0.00 ? 341 ALA A H    1 
ATOM 470  H HA   . ALA A 1 35 ? 27.830 49.010 20.700 1.00 0.00 ? 341 ALA A HA   1 
ATOM 471  H HB1  . ALA A 1 35 ? 28.210 47.130 19.140 1.00 0.00 ? 341 ALA A HB1  1 
ATOM 472  H HB2  . ALA A 1 35 ? 29.040 48.600 18.600 1.00 0.00 ? 341 ALA A HB2  1 
ATOM 473  H HB3  . ALA A 1 35 ? 29.970 47.300 19.360 1.00 0.00 ? 341 ALA A HB3  1 
ATOM 474  N N    . SER A 1 36 ? 29.780 46.830 22.290 1.00 0.00 ? 342 SER A N    1 
ATOM 475  C CA   . SER A 1 36 ? 29.790 45.770 23.310 1.00 0.00 ? 342 SER A CA   1 
ATOM 476  C C    . SER A 1 36 ? 29.620 46.290 24.750 1.00 0.00 ? 342 SER A C    1 
ATOM 477  O O    . SER A 1 36 ? 29.580 45.490 25.680 1.00 0.00 ? 342 SER A O    1 
ATOM 478  C CB   . SER A 1 36 ? 31.040 44.890 23.210 1.00 0.00 ? 342 SER A CB   1 
ATOM 479  O OG   . SER A 1 36 ? 31.310 44.550 21.860 1.00 0.00 ? 342 SER A OG   1 
ATOM 480  H H    . SER A 1 36 ? 30.660 47.060 21.840 1.00 0.00 ? 342 SER A H    1 
ATOM 481  H HA   . SER A 1 36 ? 28.940 45.120 23.120 1.00 0.00 ? 342 SER A HA   1 
ATOM 482  H HB2  . SER A 1 36 ? 31.900 45.430 23.610 1.00 0.00 ? 342 SER A HB2  1 
ATOM 483  H HB3  . SER A 1 36 ? 30.890 43.980 23.790 1.00 0.00 ? 342 SER A HB3  1 
ATOM 484  H HG   . SER A 1 36 ? 31.770 45.300 21.460 1.00 0.00 ? 342 SER A HG   1 
ATOM 485  N N    . GLN A 1 37 ? 29.490 47.600 24.970 1.00 0.00 ? 343 GLN A N    1 
ATOM 486  C CA   . GLN A 1 37 ? 29.210 48.190 26.290 1.00 0.00 ? 343 GLN A CA   1 
ATOM 487  C C    . GLN A 1 37 ? 27.720 48.230 26.620 1.00 0.00 ? 343 GLN A C    1 
ATOM 488  O O    . GLN A 1 37 ? 27.350 48.000 27.780 1.00 0.00 ? 343 GLN A O    1 
ATOM 489  C CB   . GLN A 1 37 ? 29.830 49.600 26.370 1.00 0.00 ? 343 GLN A CB   1 
ATOM 490  C CG   . GLN A 1 37 ? 31.200 49.590 27.050 1.00 0.00 ? 343 GLN A CG   1 
ATOM 491  C CD   . GLN A 1 37 ? 31.110 49.350 28.550 1.00 0.00 ? 343 GLN A CD   1 
ATOM 492  O OE1  . GLN A 1 37 ? 31.480 48.320 29.070 1.00 0.00 ? 343 GLN A OE1  1 
ATOM 493  N NE2  . GLN A 1 37 ? 30.590 50.290 29.320 1.00 0.00 ? 343 GLN A NE2  1 
ATOM 494  H H    . GLN A 1 37 ? 29.600 48.230 24.180 1.00 0.00 ? 343 GLN A H    1 
ATOM 495  H HA   . GLN A 1 37 ? 29.680 47.560 27.050 1.00 0.00 ? 343 GLN A HA   1 
ATOM 496  H HB2  . GLN A 1 37 ? 29.920 50.020 25.370 1.00 0.00 ? 343 GLN A HB2  1 
ATOM 497  H HB3  . GLN A 1 37 ? 29.160 50.260 26.930 1.00 0.00 ? 343 GLN A HB3  1 
ATOM 498  H HG2  . GLN A 1 37 ? 31.830 48.820 26.600 1.00 0.00 ? 343 GLN A HG2  1 
ATOM 499  H HG3  . GLN A 1 37 ? 31.680 50.560 26.880 1.00 0.00 ? 343 GLN A HG3  1 
ATOM 500  H HE21 . GLN A 1 37 ? 30.270 51.150 28.930 1.00 0.00 ? 343 GLN A HE21 1 
ATOM 501  H HE22 . GLN A 1 37 ? 30.530 50.050 30.290 1.00 0.00 ? 343 GLN A HE22 1 
ATOM 502  N N    . GLN A 1 38 ? 26.850 48.530 25.650 1.00 0.00 ? 344 GLN A N    1 
ATOM 503  C CA   . GLN A 1 38 ? 25.390 48.680 25.870 1.00 0.00 ? 344 GLN A CA   1 
ATOM 504  C C    . GLN A 1 38 ? 24.510 48.070 24.760 1.00 0.00 ? 344 GLN A C    1 
ATOM 505  O O    . GLN A 1 38 ? 23.290 48.030 24.930 1.00 0.00 ? 344 GLN A O    1 
ATOM 506  C CB   . GLN A 1 38 ? 25.040 50.170 26.070 1.00 0.00 ? 344 GLN A CB   1 
ATOM 507  C CG   . GLN A 1 38 ? 25.510 50.780 27.400 1.00 0.00 ? 344 GLN A CG   1 
ATOM 508  C CD   . GLN A 1 38 ? 24.770 50.220 28.610 1.00 0.00 ? 344 GLN A CD   1 
ATOM 509  O OE1  . GLN A 1 38 ? 23.700 50.680 28.980 1.00 0.00 ? 344 GLN A OE1  1 
ATOM 510  N NE2  . GLN A 1 38 ? 25.300 49.230 29.290 1.00 0.00 ? 344 GLN A NE2  1 
ATOM 511  H H    . GLN A 1 38 ? 27.220 48.740 24.740 1.00 0.00 ? 344 GLN A H    1 
ATOM 512  H HA   . GLN A 1 38 ? 25.110 48.140 26.770 1.00 0.00 ? 344 GLN A HA   1 
ATOM 513  H HB2  . GLN A 1 38 ? 25.480 50.740 25.250 1.00 0.00 ? 344 GLN A HB2  1 
ATOM 514  H HB3  . GLN A 1 38 ? 23.960 50.300 26.010 1.00 0.00 ? 344 GLN A HB3  1 
ATOM 515  H HG2  . GLN A 1 38 ? 26.580 50.640 27.530 1.00 0.00 ? 344 GLN A HG2  1 
ATOM 516  H HG3  . GLN A 1 38 ? 25.320 51.850 27.370 1.00 0.00 ? 344 GLN A HG3  1 
ATOM 517  H HE21 . GLN A 1 38 ? 26.160 48.790 28.970 1.00 0.00 ? 344 GLN A HE21 1 
ATOM 518  H HE22 . GLN A 1 38 ? 24.770 48.880 30.070 1.00 0.00 ? 344 GLN A HE22 1 
ATOM 519  N N    . ASN A 1 39 ? 25.080 47.600 23.650 1.00 0.00 ? 345 ASN A N    1 
ATOM 520  C CA   . ASN A 1 39 ? 24.320 47.060 22.510 1.00 0.00 ? 345 ASN A CA   1 
ATOM 521  C C    . ASN A 1 39 ? 24.560 45.550 22.280 1.00 0.00 ? 345 ASN A C    1 
ATOM 522  O O    . ASN A 1 39 ? 23.690 44.890 21.700 1.00 0.00 ? 345 ASN A O    1 
ATOM 523  C CB   . ASN A 1 39 ? 24.640 47.890 21.260 1.00 0.00 ? 345 ASN A CB   1 
ATOM 524  C CG   . ASN A 1 39 ? 23.430 48.110 20.360 1.00 0.00 ? 345 ASN A CG   1 
ATOM 525  O OD1  . ASN A 1 39 ? 23.190 49.200 19.880 1.00 0.00 ? 345 ASN A OD1  1 
ATOM 526  N ND2  . ASN A 1 39 ? 22.620 47.100 20.120 1.00 0.00 ? 345 ASN A ND2  1 
ATOM 527  H H    . ASN A 1 39 ? 26.080 47.650 23.540 1.00 0.00 ? 345 ASN A H    1 
ATOM 528  H HA   . ASN A 1 39 ? 23.250 47.160 22.730 1.00 0.00 ? 345 ASN A HA   1 
ATOM 529  H HB2  . ASN A 1 39 ? 25.000 48.880 21.550 1.00 0.00 ? 345 ASN A HB2  1 
ATOM 530  H HB3  . ASN A 1 39 ? 25.410 47.400 20.670 1.00 0.00 ? 345 ASN A HB3  1 
ATOM 531  H HD21 . ASN A 1 39 ? 22.790 46.190 20.540 1.00 0.00 ? 345 ASN A HD21 1 
ATOM 532  H HD22 . ASN A 1 39 ? 21.810 47.310 19.570 1.00 0.00 ? 345 ASN A HD22 1 
ATOM 533  N N    . GLN A 1 40 ? 25.710 45.020 22.700 1.00 0.00 ? 346 GLN A N    1 
ATOM 534  C CA   . GLN A 1 40 ? 26.080 43.590 22.650 1.00 0.00 ? 346 GLN A CA   1 
ATOM 535  C C    . GLN A 1 40 ? 26.900 43.150 23.890 1.00 0.00 ? 346 GLN A C    1 
ATOM 536  O O    . GLN A 1 40 ? 27.780 42.300 23.790 1.00 0.00 ? 346 GLN A O    1 
ATOM 537  C CB   . GLN A 1 40 ? 26.810 43.260 21.340 1.00 0.00 ? 346 GLN A CB   1 
ATOM 538  C CG   . GLN A 1 40 ? 25.900 43.300 20.100 1.00 0.00 ? 346 GLN A CG   1 
ATOM 539  C CD   . GLN A 1 40 ? 26.460 42.460 18.960 1.00 0.00 ? 346 GLN A CD   1 
ATOM 540  O OE1  . GLN A 1 40 ? 26.950 42.960 17.960 1.00 0.00 ? 346 GLN A OE1  1 
ATOM 541  N NE2  . GLN A 1 40 ? 26.400 41.150 19.050 1.00 0.00 ? 346 GLN A NE2  1 
ATOM 542  H H    . GLN A 1 40 ? 26.400 45.670 23.050 1.00 0.00 ? 346 GLN A H    1 
ATOM 543  H HA   . GLN A 1 40 ? 25.160 43.000 22.690 1.00 0.00 ? 346 GLN A HA   1 
ATOM 544  H HB2  . GLN A 1 40 ? 27.660 43.930 21.200 1.00 0.00 ? 346 GLN A HB2  1 
ATOM 545  H HB3  . GLN A 1 40 ? 27.200 42.240 21.410 1.00 0.00 ? 346 GLN A HB3  1 
ATOM 546  H HG2  . GLN A 1 40 ? 24.920 42.900 20.360 1.00 0.00 ? 346 GLN A HG2  1 
ATOM 547  H HG3  . GLN A 1 40 ? 25.790 44.340 19.770 1.00 0.00 ? 346 GLN A HG3  1 
ATOM 548  H HE21 . GLN A 1 40 ? 26.040 40.720 19.880 1.00 0.00 ? 346 GLN A HE21 1 
ATOM 549  H HE22 . GLN A 1 40 ? 26.800 40.630 18.300 1.00 0.00 ? 346 GLN A HE22 1 
ATOM 550  N N    . SER A 1 41 ? 26.650 43.740 25.060 1.00 0.00 ? 347 SER A N    1 
ATOM 551  C CA   . SER A 1 41 ? 27.320 43.360 26.310 1.00 0.00 ? 347 SER A CA   1 
ATOM 552  C C    . SER A 1 41 ? 26.910 41.960 26.760 1.00 0.00 ? 347 SER A C    1 
ATOM 553  O O    . SER A 1 41 ? 25.740 41.720 27.070 1.00 0.00 ? 347 SER A O    1 
ATOM 554  C CB   . SER A 1 41 ? 27.090 44.410 27.420 1.00 0.00 ? 347 SER A CB   1 
ATOM 555  O OG   . SER A 1 41 ? 26.300 45.510 27.000 1.00 0.00 ? 347 SER A OG   1 
ATOM 556  H H    . SER A 1 41 ? 25.930 44.440 25.140 1.00 0.00 ? 347 SER A H    1 
ATOM 557  H HA   . SER A 1 41 ? 28.400 43.340 26.120 1.00 0.00 ? 347 SER A HA   1 
ATOM 558  H HB2  . SER A 1 41 ? 26.600 43.940 28.280 1.00 0.00 ? 347 SER A HB2  1 
ATOM 559  H HB3  . SER A 1 41 ? 28.060 44.780 27.750 1.00 0.00 ? 347 SER A HB3  1 
ATOM 560  H HG   . SER A 1 41 ? 26.540 46.260 27.560 1.00 0.00 ? 347 SER A HG   1 
ATOM 561  N N    . GLY A 1 42 ? 27.860 41.020 26.770 1.00 0.00 ? 348 GLY A N    1 
ATOM 562  C CA   . GLY A 1 42 ? 27.680 39.630 27.190 1.00 0.00 ? 348 GLY A CA   1 
ATOM 563  C C    . GLY A 1 42 ? 28.210 39.330 28.600 1.00 0.00 ? 348 GLY A C    1 
ATOM 564  O O    . GLY A 1 42 ? 28.690 40.240 29.270 1.00 0.00 ? 348 GLY A O    1 
ATOM 565  H H    . GLY A 1 42 ? 28.790 41.300 26.500 1.00 0.00 ? 348 GLY A H    1 
ATOM 566  H HA2  . GLY A 1 42 ? 26.620 39.370 27.150 1.00 0.00 ? 348 GLY A HA2  1 
ATOM 567  H HA3  . GLY A 1 42 ? 28.210 38.980 26.490 1.00 0.00 ? 348 GLY A HA3  1 
ATOM 568  N N    . PRO A 1 43 ? 28.090 38.060 29.050 1.00 0.00 ? 349 PRO A N    1 
ATOM 569  C CA   . PRO A 1 43 ? 28.710 37.550 30.270 1.00 0.00 ? 349 PRO A CA   1 
ATOM 570  C C    . PRO A 1 43 ? 30.190 37.180 30.090 1.00 0.00 ? 349 PRO A C    1 
ATOM 571  O O    . PRO A 1 43 ? 30.580 36.850 28.940 1.00 0.00 ? 349 PRO A O    1 
ATOM 572  C CB   . PRO A 1 43 ? 27.880 36.310 30.620 1.00 0.00 ? 349 PRO A CB   1 
ATOM 573  C CG   . PRO A 1 43 ? 27.550 35.740 29.240 1.00 0.00 ? 349 PRO A CG   1 
ATOM 574  C CD   . PRO A 1 43 ? 27.380 36.990 28.370 1.00 0.00 ? 349 PRO A CD   1 
ATOM 575  O OXT  . PRO A 1 43 ? 30.900 37.180 31.120 1.00 0.00 ? 349 PRO A OXT  1 
ATOM 576  H HA   . PRO A 1 43 ? 28.640 38.280 31.080 1.00 0.00 ? 349 PRO A HA   1 
ATOM 577  H HB2  . PRO A 1 43 ? 28.430 35.600 31.230 1.00 0.00 ? 349 PRO A HB2  1 
ATOM 578  H HB3  . PRO A 1 43 ? 26.960 36.620 31.120 1.00 0.00 ? 349 PRO A HB3  1 
ATOM 579  H HG2  . PRO A 1 43 ? 28.390 35.150 28.880 1.00 0.00 ? 349 PRO A HG2  1 
ATOM 580  H HG3  . PRO A 1 43 ? 26.640 35.140 29.260 1.00 0.00 ? 349 PRO A HG3  1 
ATOM 581  H HD2  . PRO A 1 43 ? 27.810 36.800 27.380 1.00 0.00 ? 349 PRO A HD2  1 
ATOM 582  H HD3  . PRO A 1 43 ? 26.330 37.240 28.290 1.00 0.00 ? 349 PRO A HD3  1 
ATOM 583  N N    . MET A 1 1  ? 61.462 32.408 20.622 1.00 0.00 ? 307 MET A N    2 
ATOM 584  C CA   . MET A 1 1  ? 61.517 31.625 21.874 1.00 0.00 ? 307 MET A CA   2 
ATOM 585  C C    . MET A 1 1  ? 60.151 31.723 22.523 1.00 0.00 ? 307 MET A C    2 
ATOM 586  O O    . MET A 1 1  ? 59.635 32.834 22.607 1.00 0.00 ? 307 MET A O    2 
ATOM 587  C CB   . MET A 1 1  ? 62.654 32.143 22.783 1.00 0.00 ? 307 MET A CB   2 
ATOM 588  C CG   . MET A 1 1  ? 62.790 31.389 24.104 1.00 0.00 ? 307 MET A CG   2 
ATOM 589  S SD   . MET A 1 1  ? 64.326 31.766 24.989 1.00 0.00 ? 307 MET A SD   2 
ATOM 590  C CE   . MET A 1 1  ? 65.468 30.550 24.270 1.00 0.00 ? 307 MET A CE   2 
ATOM 591  H H1   . MET A 1 1  ? 60.757 32.026 20.003 1.00 0.00 ? 307 MET A H1   2 
ATOM 592  H H2   . MET A 1 1  ? 61.186 33.356 20.843 1.00 0.00 ? 307 MET A H2   2 
ATOM 593  H H3   . MET A 1 1  ? 62.359 32.420 20.157 1.00 0.00 ? 307 MET A H3   2 
ATOM 594  H HA   . MET A 1 1  ? 61.723 30.577 21.643 1.00 0.00 ? 307 MET A HA   2 
ATOM 595  H HB2  . MET A 1 1  ? 63.590 32.055 22.236 1.00 0.00 ? 307 MET A HB2  2 
ATOM 596  H HB3  . MET A 1 1  ? 62.498 33.201 22.994 1.00 0.00 ? 307 MET A HB3  2 
ATOM 597  H HG2  . MET A 1 1  ? 61.954 31.666 24.752 1.00 0.00 ? 307 MET A HG2  2 
ATOM 598  H HG3  . MET A 1 1  ? 62.755 30.311 23.924 1.00 0.00 ? 307 MET A HG3  2 
ATOM 599  H HE1  . MET A 1 1  ? 66.471 30.723 24.656 1.00 0.00 ? 307 MET A HE1  2 
ATOM 600  H HE2  . MET A 1 1  ? 65.157 29.538 24.552 1.00 0.00 ? 307 MET A HE2  2 
ATOM 601  H HE3  . MET A 1 1  ? 65.482 30.630 23.191 1.00 0.00 ? 307 MET A HE3  2 
ATOM 602  N N    . GLY A 1 2  ? 59.520 30.601 22.876 1.00 0.00 ? 308 GLY A N    2 
ATOM 603  C CA   . GLY A 1 2  ? 58.071 30.553 23.114 1.00 0.00 ? 308 GLY A CA   2 
ATOM 604  C C    . GLY A 1 2  ? 57.263 30.388 21.817 1.00 0.00 ? 308 GLY A C    2 
ATOM 605  O O    . GLY A 1 2  ? 57.817 30.448 20.725 1.00 0.00 ? 308 GLY A O    2 
ATOM 606  H H    . GLY A 1 2  ? 59.987 29.711 22.765 1.00 0.00 ? 308 GLY A H    2 
ATOM 607  H HA2  . GLY A 1 2  ? 57.843 29.707 23.777 1.00 0.00 ? 308 GLY A HA2  2 
ATOM 608  H HA3  . GLY A 1 2  ? 57.737 31.469 23.615 1.00 0.00 ? 308 GLY A HA3  2 
ATOM 609  N N    . GLY A 1 3  ? 55.953 30.141 21.953 1.00 0.00 ? 309 GLY A N    2 
ATOM 610  C CA   . GLY A 1 3  ? 55.055 29.614 20.913 1.00 0.00 ? 309 GLY A CA   2 
ATOM 611  C C    . GLY A 1 3  ? 54.641 30.566 19.785 1.00 0.00 ? 309 GLY A C    2 
ATOM 612  O O    . GLY A 1 3  ? 53.666 30.296 19.098 1.00 0.00 ? 309 GLY A O    2 
ATOM 613  H H    . GLY A 1 3  ? 55.549 30.223 22.876 1.00 0.00 ? 309 GLY A H    2 
ATOM 614  H HA2  . GLY A 1 3  ? 55.520 28.747 20.452 1.00 0.00 ? 309 GLY A HA2  2 
ATOM 615  H HA3  . GLY A 1 3  ? 54.127 29.282 21.385 1.00 0.00 ? 309 GLY A HA3  2 
ATOM 616  N N    . GLY A 1 4  ? 55.333 31.696 19.602 1.00 0.00 ? 310 GLY A N    2 
ATOM 617  C CA   . GLY A 1 4  ? 55.129 32.608 18.462 1.00 0.00 ? 310 GLY A CA   2 
ATOM 618  C C    . GLY A 1 4  ? 53.822 33.412 18.447 1.00 0.00 ? 310 GLY A C    2 
ATOM 619  O O    . GLY A 1 4  ? 53.760 34.380 17.687 1.00 0.00 ? 310 GLY A O    2 
ATOM 620  H H    . GLY A 1 4  ? 56.157 31.828 20.168 1.00 0.00 ? 310 GLY A H    2 
ATOM 621  H HA2  . GLY A 1 4  ? 55.951 33.316 18.434 1.00 0.00 ? 310 GLY A HA2  2 
ATOM 622  H HA3  . GLY A 1 4  ? 55.162 32.027 17.536 1.00 0.00 ? 310 GLY A HA3  2 
ATOM 623  N N    . MET A 1 5  ? 52.836 33.077 19.280 1.00 0.00 ? 311 MET A N    2 
ATOM 624  C CA   . MET A 1 5  ? 51.508 33.730 19.354 1.00 0.00 ? 311 MET A CA   2 
ATOM 625  C C    . MET A 1 5  ? 51.068 34.077 20.801 1.00 0.00 ? 311 MET A C    2 
ATOM 626  O O    . MET A 1 5  ? 49.910 34.388 21.051 1.00 0.00 ? 311 MET A O    2 
ATOM 627  C CB   . MET A 1 5  ? 50.471 32.860 18.612 1.00 0.00 ? 311 MET A CB   2 
ATOM 628  C CG   . MET A 1 5  ? 50.652 32.885 17.091 1.00 0.00 ? 311 MET A CG   2 
ATOM 629  S SD   . MET A 1 5  ? 50.362 34.503 16.329 1.00 0.00 ? 311 MET A SD   2 
ATOM 630  C CE   . MET A 1 5  ? 50.670 34.109 14.593 1.00 0.00 ? 311 MET A CE   2 
ATOM 631  H H    . MET A 1 5  ? 52.926 32.182 19.741 1.00 0.00 ? 311 MET A H    2 
ATOM 632  H HA   . MET A 1 5  ? 51.558 34.685 18.833 1.00 0.00 ? 311 MET A HA   2 
ATOM 633  H HB2  . MET A 1 5  ? 50.540 31.827 18.971 1.00 0.00 ? 311 MET A HB2  2 
ATOM 634  H HB3  . MET A 1 5  ? 49.463 33.221 18.822 1.00 0.00 ? 311 MET A HB3  2 
ATOM 635  H HG2  . MET A 1 5  ? 51.659 32.554 16.842 1.00 0.00 ? 311 MET A HG2  2 
ATOM 636  H HG3  . MET A 1 5  ? 49.957 32.171 16.648 1.00 0.00 ? 311 MET A HG3  2 
ATOM 637  H HE1  . MET A 1 5  ? 50.509 34.996 13.982 1.00 0.00 ? 311 MET A HE1  2 
ATOM 638  H HE2  . MET A 1 5  ? 51.699 33.777 14.463 1.00 0.00 ? 311 MET A HE2  2 
ATOM 639  H HE3  . MET A 1 5  ? 49.986 33.325 14.269 1.00 0.00 ? 311 MET A HE3  2 
ATOM 640  N N    . ASN A 1 6  ? 51.993 34.035 21.765 1.00 0.00 ? 312 ASN A N    2 
ATOM 641  C CA   . ASN A 1 6  ? 51.652 34.022 23.207 1.00 0.00 ? 312 ASN A CA   2 
ATOM 642  C C    . ASN A 1 6  ? 51.099 35.338 23.793 1.00 0.00 ? 312 ASN A C    2 
ATOM 643  O O    . ASN A 1 6  ? 50.365 35.281 24.767 1.00 0.00 ? 312 ASN A O    2 
ATOM 644  C CB   . ASN A 1 6  ? 52.915 33.630 23.995 1.00 0.00 ? 312 ASN A CB   2 
ATOM 645  C CG   . ASN A 1 6  ? 53.460 32.231 23.778 1.00 0.00 ? 312 ASN A CG   2 
ATOM 646  O OD1  . ASN A 1 6  ? 53.172 31.531 22.833 1.00 0.00 ? 312 ASN A OD1  2 
ATOM 647  N ND2  . ASN A 1 6  ? 54.324 31.789 24.669 1.00 0.00 ? 312 ASN A ND2  2 
ATOM 648  H H    . ASN A 1 6  ? 52.921 33.745 21.496 1.00 0.00 ? 312 ASN A H    2 
ATOM 649  H HA   . ASN A 1 6  ? 50.891 33.263 23.364 1.00 0.00 ? 312 ASN A HA   2 
ATOM 650  H HB2  . ASN A 1 6  ? 53.716 34.330 23.757 1.00 0.00 ? 312 ASN A HB2  2 
ATOM 651  H HB3  . ASN A 1 6  ? 52.692 33.731 25.058 1.00 0.00 ? 312 ASN A HB3  2 
ATOM 652  H HD21 . ASN A 1 6  ? 54.580 32.371 25.443 1.00 0.00 ? 312 ASN A HD21 2 
ATOM 653  H HD22 . ASN A 1 6  ? 54.481 30.799 24.668 1.00 0.00 ? 312 ASN A HD22 2 
ATOM 654  N N    . PHE A 1 7  ? 51.540 36.511 23.312 1.00 0.00 ? 313 PHE A N    2 
ATOM 655  C CA   . PHE A 1 7  ? 51.067 37.828 23.808 1.00 0.00 ? 313 PHE A CA   2 
ATOM 656  C C    . PHE A 1 7  ? 51.505 38.976 22.876 1.00 0.00 ? 313 PHE A C    2 
ATOM 657  O O    . PHE A 1 7  ? 50.766 39.911 22.610 1.00 0.00 ? 313 PHE A O    2 
ATOM 658  C CB   . PHE A 1 7  ? 51.616 38.122 25.227 1.00 0.00 ? 313 PHE A CB   2 
ATOM 659  C CG   . PHE A 1 7  ? 50.814 39.117 26.062 1.00 0.00 ? 313 PHE A CG   2 
ATOM 660  C CD1  . PHE A 1 7  ? 50.726 40.480 25.716 1.00 0.00 ? 313 PHE A CD1  2 
ATOM 661  C CD2  . PHE A 1 7  ? 50.150 38.667 27.232 1.00 0.00 ? 313 PHE A CD2  2 
ATOM 662  C CE1  . PHE A 1 7  ? 49.993 41.375 26.509 1.00 0.00 ? 313 PHE A CE1  2 
ATOM 663  C CE2  . PHE A 1 7  ? 49.427 39.572 28.035 1.00 0.00 ? 313 PHE A CE2  2 
ATOM 664  C CZ   . PHE A 1 7  ? 49.339 40.926 27.669 1.00 0.00 ? 313 PHE A CZ   2 
ATOM 665  H H    . PHE A 1 7  ? 52.055 36.478 22.458 1.00 0.00 ? 313 PHE A H    2 
ATOM 666  H HA   . PHE A 1 7  ? 49.977 37.821 23.854 1.00 0.00 ? 313 PHE A HA   2 
ATOM 667  H HB2  . PHE A 1 7  ? 51.677 37.197 25.788 1.00 0.00 ? 313 PHE A HB2  2 
ATOM 668  H HB3  . PHE A 1 7  ? 52.647 38.490 25.155 1.00 0.00 ? 313 PHE A HB3  2 
ATOM 669  H HD1  . PHE A 1 7  ? 51.202 40.858 24.837 1.00 0.00 ? 313 PHE A HD1  2 
ATOM 670  H HD2  . PHE A 1 7  ? 50.198 37.624 27.521 1.00 0.00 ? 313 PHE A HD2  2 
ATOM 671  H HE1  . PHE A 1 7  ? 49.915 42.418 26.220 1.00 0.00 ? 313 PHE A HE1  2 
ATOM 672  H HE2  . PHE A 1 7  ? 48.921 39.224 28.924 1.00 0.00 ? 313 PHE A HE2  2 
ATOM 673  H HZ   . PHE A 1 7  ? 48.765 41.611 28.279 1.00 0.00 ? 313 PHE A HZ   2 
ATOM 674  N N    . GLY A 1 8  ? 52.752 38.927 22.398 1.00 0.00 ? 314 GLY A N    2 
ATOM 675  C CA   . GLY A 1 8  ? 53.299 39.924 21.465 1.00 0.00 ? 314 GLY A CA   2 
ATOM 676  C C    . GLY A 1 8  ? 53.886 41.187 22.074 1.00 0.00 ? 314 GLY A C    2 
ATOM 677  O O    . GLY A 1 8  ? 54.674 41.851 21.405 1.00 0.00 ? 314 GLY A O    2 
ATOM 678  H H    . GLY A 1 8  ? 53.331 38.143 22.647 1.00 0.00 ? 314 GLY A H    2 
ATOM 679  H HA2  . GLY A 1 8  ? 54.094 39.468 20.885 1.00 0.00 ? 314 GLY A HA2  2 
ATOM 680  H HA3  . GLY A 1 8  ? 52.506 40.233 20.782 1.00 0.00 ? 314 GLY A HA3  2 
ATOM 681  N N    . ALA A 1 9  ? 53.575 41.495 23.339 1.00 0.00 ? 315 ALA A N    2 
ATOM 682  C CA   . ALA A 1 9  ? 54.163 42.626 24.076 1.00 0.00 ? 315 ALA A CA   2 
ATOM 683  C C    . ALA A 1 9  ? 55.575 42.317 24.595 1.00 0.00 ? 315 ALA A C    2 
ATOM 684  O O    . ALA A 1 9  ? 56.398 43.213 24.739 1.00 0.00 ? 315 ALA A O    2 
ATOM 685  C CB   . ALA A 1 9  ? 53.210 43.008 25.216 1.00 0.00 ? 315 ALA A CB   2 
ATOM 686  H H    . ALA A 1 9  ? 52.826 40.983 23.778 1.00 0.00 ? 315 ALA A H    2 
ATOM 687  H HA   . ALA A 1 9  ? 54.231 43.473 23.404 1.00 0.00 ? 315 ALA A HA   2 
ATOM 688  H HB1  . ALA A 1 9  ? 53.606 43.882 25.732 1.00 0.00 ? 315 ALA A HB1  2 
ATOM 689  H HB2  . ALA A 1 9  ? 52.229 43.245 24.824 1.00 0.00 ? 315 ALA A HB2  2 
ATOM 690  H HB3  . ALA A 1 9  ? 53.132 42.181 25.928 1.00 0.00 ? 315 ALA A HB3  2 
ATOM 691  N N    . PHE A 1 10 ? 55.862 41.034 24.841 1.00 0.00 ? 316 PHE A N    2 
ATOM 692  C CA   . PHE A 1 10 ? 57.183 40.536 25.218 1.00 0.00 ? 316 PHE A CA   2 
ATOM 693  C C    . PHE A 1 10 ? 57.366 39.080 24.752 1.00 0.00 ? 316 PHE A C    2 
ATOM 694  O O    . PHE A 1 10 ? 58.351 38.743 24.103 1.00 0.00 ? 316 PHE A O    2 
ATOM 695  C CB   . PHE A 1 10 ? 57.333 40.660 26.748 1.00 0.00 ? 316 PHE A CB   2 
ATOM 696  C CG   . PHE A 1 10 ? 58.735 40.401 27.247 1.00 0.00 ? 316 PHE A CG   2 
ATOM 697  C CD1  . PHE A 1 10 ? 59.746 41.351 27.001 1.00 0.00 ? 316 PHE A CD1  2 
ATOM 698  C CD2  . PHE A 1 10 ? 59.036 39.233 27.984 1.00 0.00 ? 316 PHE A CD2  2 
ATOM 699  C CE1  . PHE A 1 10 ? 61.049 41.132 27.491 1.00 0.00 ? 316 PHE A CE1  2 
ATOM 700  C CE2  . PHE A 1 10 ? 60.338 39.025 28.464 1.00 0.00 ? 316 PHE A CE2  2 
ATOM 701  C CZ   . PHE A 1 10 ? 61.340 39.974 28.218 1.00 0.00 ? 316 PHE A CZ   2 
ATOM 702  H H    . PHE A 1 10 ? 55.120 40.377 24.699 1.00 0.00 ? 316 PHE A H    2 
ATOM 703  H HA   . PHE A 1 10 ? 57.952 41.138 24.739 1.00 0.00 ? 316 PHE A HA   2 
ATOM 704  H HB2  . PHE A 1 10 ? 57.058 41.669 27.040 1.00 0.00 ? 316 PHE A HB2  2 
ATOM 705  H HB3  . PHE A 1 10 ? 56.634 39.978 27.236 1.00 0.00 ? 316 PHE A HB3  2 
ATOM 706  H HD1  . PHE A 1 10 ? 59.516 42.247 26.451 1.00 0.00 ? 316 PHE A HD1  2 
ATOM 707  H HD2  . PHE A 1 10 ? 58.255 38.503 28.192 1.00 0.00 ? 316 PHE A HD2  2 
ATOM 708  H HE1  . PHE A 1 10 ? 61.820 41.862 27.303 1.00 0.00 ? 316 PHE A HE1  2 
ATOM 709  H HE2  . PHE A 1 10 ? 60.559 38.138 29.044 1.00 0.00 ? 316 PHE A HE2  2 
ATOM 710  H HZ   . PHE A 1 10 ? 62.342 39.807 28.600 1.00 0.00 ? 316 PHE A HZ   2 
ATOM 711  N N    . SER A 1 11 ? 56.345 38.241 24.970 1.00 0.00 ? 317 SER A N    2 
ATOM 712  C CA   . SER A 1 11 ? 56.319 36.793 24.726 1.00 0.00 ? 317 SER A CA   2 
ATOM 713  C C    . SER A 1 11 ? 56.379 36.327 23.251 1.00 0.00 ? 317 SER A C    2 
ATOM 714  O O    . SER A 1 11 ? 56.014 35.201 22.952 1.00 0.00 ? 317 SER A O    2 
ATOM 715  C CB   . SER A 1 11 ? 55.072 36.200 25.408 1.00 0.00 ? 317 SER A CB   2 
ATOM 716  O OG   . SER A 1 11 ? 54.781 36.869 26.616 1.00 0.00 ? 317 SER A OG   2 
ATOM 717  H H    . SER A 1 11 ? 55.630 38.567 25.608 1.00 0.00 ? 317 SER A H    2 
ATOM 718  H HA   . SER A 1 11 ? 57.201 36.366 25.227 1.00 0.00 ? 317 SER A HA   2 
ATOM 719  H HB2  . SER A 1 11 ? 54.218 36.319 24.744 1.00 0.00 ? 317 SER A HB2  2 
ATOM 720  H HB3  . SER A 1 11 ? 55.240 35.138 25.606 1.00 0.00 ? 317 SER A HB3  2 
ATOM 721  H HG   . SER A 1 11 ? 54.072 36.417 27.086 1.00 0.00 ? 317 SER A HG   2 
ATOM 722  N N    . ILE A 1 12 ? 56.776 37.215 22.327 1.00 0.00 ? 318 ILE A N    2 
ATOM 723  C CA   . ILE A 1 12 ? 57.037 36.938 20.903 1.00 0.00 ? 318 ILE A CA   2 
ATOM 724  C C    . ILE A 1 12 ? 58.167 37.860 20.405 1.00 0.00 ? 318 ILE A C    2 
ATOM 725  O O    . ILE A 1 12 ? 59.111 37.403 19.775 1.00 0.00 ? 318 ILE A O    2 
ATOM 726  C CB   . ILE A 1 12 ? 55.792 37.161 20.003 1.00 0.00 ? 318 ILE A CB   2 
ATOM 727  C CG1  . ILE A 1 12 ? 54.503 36.470 20.504 1.00 0.00 ? 318 ILE A CG1  2 
ATOM 728  C CG2  . ILE A 1 12 ? 56.112 36.704 18.566 1.00 0.00 ? 318 ILE A CG2  2 
ATOM 729  C CD1  . ILE A 1 12 ? 53.220 36.871 19.745 1.00 0.00 ? 318 ILE A CD1  2 
ATOM 730  H H    . ILE A 1 12 ? 57.201 38.050 22.713 1.00 0.00 ? 318 ILE A H    2 
ATOM 731  H HA   . ILE A 1 12 ? 57.373 35.909 20.791 1.00 0.00 ? 318 ILE A HA   2 
ATOM 732  H HB   . ILE A 1 12 ? 55.585 38.232 19.964 1.00 0.00 ? 318 ILE A HB   2 
ATOM 733  H HG12 . ILE A 1 12 ? 54.619 35.380 20.452 1.00 0.00 ? 318 ILE A HG12 2 
ATOM 734  H HG13 . ILE A 1 12 ? 54.330 36.730 21.547 1.00 0.00 ? 318 ILE A HG13 2 
ATOM 735  H HG21 . ILE A 1 12 ? 55.258 36.853 17.903 1.00 0.00 ? 318 ILE A HG21 2 
ATOM 736  H HG22 . ILE A 1 12 ? 56.941 37.266 18.157 1.00 0.00 ? 318 ILE A HG22 2 
ATOM 737  H HG23 . ILE A 1 12 ? 56.369 35.643 18.564 1.00 0.00 ? 318 ILE A HG23 2 
ATOM 738  H HD11 . ILE A 1 12 ? 53.222 36.491 18.731 1.00 0.00 ? 318 ILE A HD11 2 
ATOM 739  H HD12 . ILE A 1 12 ? 52.352 36.489 20.267 1.00 0.00 ? 318 ILE A HD12 2 
ATOM 740  H HD13 . ILE A 1 12 ? 53.142 37.952 19.676 1.00 0.00 ? 318 ILE A HD13 2 
ATOM 741  N N    . ASN A 1 13 ? 58.052 39.157 20.709 1.00 0.00 ? 319 ASN A N    2 
ATOM 742  C CA   . ASN A 1 13 ? 58.953 40.248 20.344 1.00 0.00 ? 319 ASN A CA   2 
ATOM 743  C C    . ASN A 1 13 ? 58.893 41.348 21.425 1.00 0.00 ? 319 ASN A C    2 
ATOM 744  O O    . ASN A 1 13 ? 57.898 41.414 22.152 1.00 0.00 ? 319 ASN A O    2 
ATOM 745  C CB   . ASN A 1 13 ? 58.497 40.833 18.982 1.00 0.00 ? 319 ASN A CB   2 
ATOM 746  C CG   . ASN A 1 13 ? 59.238 40.232 17.812 1.00 0.00 ? 319 ASN A CG   2 
ATOM 747  O OD1  . ASN A 1 13 ? 60.448 40.229 17.765 1.00 0.00 ? 319 ASN A OD1  2 
ATOM 748  N ND2  . ASN A 1 13 ? 58.551 39.744 16.801 1.00 0.00 ? 319 ASN A ND2  2 
ATOM 749  H H    . ASN A 1 13 ? 57.277 39.434 21.296 1.00 0.00 ? 319 ASN A H    2 
ATOM 750  H HA   . ASN A 1 13 ? 59.972 39.876 20.264 1.00 0.00 ? 319 ASN A HA   2 
ATOM 751  H HB2  . ASN A 1 13 ? 57.416 40.708 18.858 1.00 0.00 ? 319 ASN A HB2  2 
ATOM 752  H HB3  . ASN A 1 13 ? 58.700 41.903 18.962 1.00 0.00 ? 319 ASN A HB3  2 
ATOM 753  H HD21 . ASN A 1 13 ? 57.550 39.747 16.797 1.00 0.00 ? 319 ASN A HD21 2 
ATOM 754  H HD22 . ASN A 1 13 ? 59.105 39.380 16.044 1.00 0.00 ? 319 ASN A HD22 2 
ATOM 755  N N    . PRO A 1 14 ? 59.896 42.244 21.508 1.00 0.00 ? 320 PRO A N    2 
ATOM 756  C CA   . PRO A 1 14 ? 59.875 43.406 22.400 1.00 0.00 ? 320 PRO A CA   2 
ATOM 757  C C    . PRO A 1 14 ? 58.845 44.434 21.906 1.00 0.00 ? 320 PRO A C    2 
ATOM 758  O O    . PRO A 1 14 ? 59.111 45.172 20.962 1.00 0.00 ? 320 PRO A O    2 
ATOM 759  C CB   . PRO A 1 14 ? 61.306 43.941 22.386 1.00 0.00 ? 320 PRO A CB   2 
ATOM 760  C CG   . PRO A 1 14 ? 61.817 43.584 20.990 1.00 0.00 ? 320 PRO A CG   2 
ATOM 761  C CD   . PRO A 1 14 ? 61.121 42.248 20.701 1.00 0.00 ? 320 PRO A CD   2 
ATOM 762  H HA   . PRO A 1 14 ? 59.610 43.106 23.418 1.00 0.00 ? 320 PRO A HA   2 
ATOM 763  H HB2  . PRO A 1 14 ? 61.351 45.020 22.567 1.00 0.00 ? 320 PRO A HB2  2 
ATOM 764  H HB3  . PRO A 1 14 ? 61.899 43.422 23.138 1.00 0.00 ? 320 PRO A HB3  2 
ATOM 765  H HG2  . PRO A 1 14 ? 61.495 44.332 20.269 1.00 0.00 ? 320 PRO A HG2  2 
ATOM 766  H HG3  . PRO A 1 14 ? 62.907 43.480 20.972 1.00 0.00 ? 320 PRO A HG3  2 
ATOM 767  H HD2  . PRO A 1 14 ? 60.905 42.179 19.641 1.00 0.00 ? 320 PRO A HD2  2 
ATOM 768  H HD3  . PRO A 1 14 ? 61.761 41.423 21.009 1.00 0.00 ? 320 PRO A HD3  2 
ATOM 769  N N    . ALA A 1 15 ? 57.648 44.441 22.493 1.00 0.00 ? 321 ALA A N    2 
ATOM 770  C CA   . ALA A 1 15 ? 56.428 45.189 22.128 1.00 0.00 ? 321 ALA A CA   2 
ATOM 771  C C    . ALA A 1 15 ? 55.869 44.974 20.699 1.00 0.00 ? 321 ALA A C    2 
ATOM 772  O O    . ALA A 1 15 ? 54.658 45.040 20.507 1.00 0.00 ? 321 ALA A O    2 
ATOM 773  C CB   . ALA A 1 15 ? 56.625 46.675 22.461 1.00 0.00 ? 321 ALA A CB   2 
ATOM 774  H H    . ALA A 1 15 ? 57.521 43.804 23.268 1.00 0.00 ? 321 ALA A H    2 
ATOM 775  H HA   . ALA A 1 15 ? 55.651 44.845 22.789 1.00 0.00 ? 321 ALA A HA   2 
ATOM 776  H HB1  . ALA A 1 15 ? 55.685 47.209 22.292 1.00 0.00 ? 321 ALA A HB1  2 
ATOM 777  H HB2  . ALA A 1 15 ? 56.901 46.784 23.511 1.00 0.00 ? 321 ALA A HB2  2 
ATOM 778  H HB3  . ALA A 1 15 ? 57.402 47.109 21.831 1.00 0.00 ? 321 ALA A HB3  2 
ATOM 779  N N    . MET A 1 16 ? 56.723 44.692 19.711 1.00 0.00 ? 322 MET A N    2 
ATOM 780  C CA   . MET A 1 16 ? 56.454 44.826 18.274 1.00 0.00 ? 322 MET A CA   2 
ATOM 781  C C    . MET A 1 16 ? 55.179 44.115 17.794 1.00 0.00 ? 322 MET A C    2 
ATOM 782  O O    . MET A 1 16 ? 54.466 44.645 16.944 1.00 0.00 ? 322 MET A O    2 
ATOM 783  C CB   . MET A 1 16 ? 57.678 44.300 17.491 1.00 0.00 ? 322 MET A CB   2 
ATOM 784  C CG   . MET A 1 16 ? 57.812 44.934 16.107 1.00 0.00 ? 322 MET A CG   2 
ATOM 785  S SD   . MET A 1 16 ? 58.467 46.622 16.109 1.00 0.00 ? 322 MET A SD   2 
ATOM 786  C CE   . MET A 1 16 ? 60.256 46.286 16.085 1.00 0.00 ? 322 MET A CE   2 
ATOM 787  H H    . MET A 1 16 ? 57.704 44.706 19.965 1.00 0.00 ? 322 MET A H    2 
ATOM 788  H HA   . MET A 1 16 ? 56.336 45.889 18.055 1.00 0.00 ? 322 MET A HA   2 
ATOM 789  H HB2  . MET A 1 16 ? 58.592 44.512 18.048 1.00 0.00 ? 322 MET A HB2  2 
ATOM 790  H HB3  . MET A 1 16 ? 57.594 43.222 17.371 1.00 0.00 ? 322 MET A HB3  2 
ATOM 791  H HG2  . MET A 1 16 ? 58.476 44.318 15.497 1.00 0.00 ? 322 MET A HG2  2 
ATOM 792  H HG3  . MET A 1 16 ? 56.839 44.941 15.612 1.00 0.00 ? 322 MET A HG3  2 
ATOM 793  H HE1  . MET A 1 16 ? 60.799 47.234 16.161 1.00 0.00 ? 322 MET A HE1  2 
ATOM 794  H HE2  . MET A 1 16 ? 60.529 45.647 16.917 1.00 0.00 ? 322 MET A HE2  2 
ATOM 795  H HE3  . MET A 1 16 ? 60.518 45.805 15.139 1.00 0.00 ? 322 MET A HE3  2 
ATOM 796  N N    . MET A 1 17 ? 54.869 42.921 18.315 1.00 0.00 ? 323 MET A N    2 
ATOM 797  C CA   . MET A 1 17 ? 53.714 42.139 17.844 1.00 0.00 ? 323 MET A CA   2 
ATOM 798  C C    . MET A 1 17 ? 52.389 42.597 18.466 1.00 0.00 ? 323 MET A C    2 
ATOM 799  O O    . MET A 1 17 ? 51.405 42.747 17.743 1.00 0.00 ? 323 MET A O    2 
ATOM 800  C CB   . MET A 1 17 ? 53.961 40.626 18.057 1.00 0.00 ? 323 MET A CB   2 
ATOM 801  C CG   . MET A 1 17 ? 54.050 39.889 16.720 1.00 0.00 ? 323 MET A CG   2 
ATOM 802  S SD   . MET A 1 17 ? 52.495 39.892 15.799 1.00 0.00 ? 323 MET A SD   2 
ATOM 803  C CE   . MET A 1 17 ? 53.063 39.256 14.199 1.00 0.00 ? 323 MET A CE   2 
ATOM 804  H H    . MET A 1 17 ? 55.403 42.591 19.118 1.00 0.00 ? 323 MET A H    2 
ATOM 805  H HA   . MET A 1 17 ? 53.608 42.310 16.776 1.00 0.00 ? 323 MET A HA   2 
ATOM 806  H HB2  . MET A 1 17 ? 54.873 40.468 18.620 1.00 0.00 ? 323 MET A HB2  2 
ATOM 807  H HB3  . MET A 1 17 ? 53.133 40.193 18.618 1.00 0.00 ? 323 MET A HB3  2 
ATOM 808  H HG2  . MET A 1 17 ? 54.828 40.362 16.120 1.00 0.00 ? 323 MET A HG2  2 
ATOM 809  H HG3  . MET A 1 17 ? 54.338 38.856 16.908 1.00 0.00 ? 323 MET A HG3  2 
ATOM 810  H HE1  . MET A 1 17 ? 52.209 39.155 13.533 1.00 0.00 ? 323 MET A HE1  2 
ATOM 811  H HE2  . MET A 1 17 ? 53.773 39.948 13.762 1.00 0.00 ? 323 MET A HE2  2 
ATOM 812  H HE3  . MET A 1 17 ? 53.521 38.283 14.337 1.00 0.00 ? 323 MET A HE3  2 
ATOM 813  N N    . ALA A 1 18 ? 52.367 42.904 19.769 1.00 0.00 ? 324 ALA A N    2 
ATOM 814  C CA   . ALA A 1 18 ? 51.173 43.471 20.402 1.00 0.00 ? 324 ALA A CA   2 
ATOM 815  C C    . ALA A 1 18 ? 50.894 44.878 19.868 1.00 0.00 ? 324 ALA A C    2 
ATOM 816  O O    . ALA A 1 18 ? 49.753 45.194 19.587 1.00 0.00 ? 324 ALA A O    2 
ATOM 817  C CB   . ALA A 1 18 ? 51.322 43.476 21.921 1.00 0.00 ? 324 ALA A CB   2 
ATOM 818  H H    . ALA A 1 18 ? 53.231 42.876 20.294 1.00 0.00 ? 324 ALA A H    2 
ATOM 819  H HA   . ALA A 1 18 ? 50.310 42.857 20.141 1.00 0.00 ? 324 ALA A HA   2 
ATOM 820  H HB1  . ALA A 1 18 ? 50.466 43.984 22.362 1.00 0.00 ? 324 ALA A HB1  2 
ATOM 821  H HB2  . ALA A 1 18 ? 51.331 42.452 22.291 1.00 0.00 ? 324 ALA A HB2  2 
ATOM 822  H HB3  . ALA A 1 18 ? 52.235 44.000 22.211 1.00 0.00 ? 324 ALA A HB3  2 
ATOM 823  N N    . ALA A 1 19 ? 51.945 45.686 19.659 1.00 0.00 ? 325 ALA A N    2 
ATOM 824  C CA   . ALA A 1 19 ? 51.805 47.003 19.033 1.00 0.00 ? 325 ALA A CA   2 
ATOM 825  C C    . ALA A 1 19 ? 51.256 46.889 17.595 1.00 0.00 ? 325 ALA A C    2 
ATOM 826  O O    . ALA A 1 19 ? 50.276 47.545 17.287 1.00 0.00 ? 325 ALA A O    2 
ATOM 827  C CB   . ALA A 1 19 ? 53.158 47.718 19.102 1.00 0.00 ? 325 ALA A CB   2 
ATOM 828  H H    . ALA A 1 19 ? 52.866 45.381 19.921 1.00 0.00 ? 325 ALA A H    2 
ATOM 829  H HA   . ALA A 1 19 ? 51.080 47.580 19.603 1.00 0.00 ? 325 ALA A HA   2 
ATOM 830  H HB1  . ALA A 1 19 ? 53.048 48.723 18.672 1.00 0.00 ? 325 ALA A HB1  2 
ATOM 831  H HB2  . ALA A 1 19 ? 53.474 47.817 20.141 1.00 0.00 ? 325 ALA A HB2  2 
ATOM 832  H HB3  . ALA A 1 19 ? 53.913 47.172 18.542 1.00 0.00 ? 325 ALA A HB3  2 
ATOM 833  N N    . ALA A 1 20 ? 51.819 46.015 16.753 1.00 0.00 ? 326 ALA A N    2 
ATOM 834  C CA   . ALA A 1 20 ? 51.350 45.840 15.374 1.00 0.00 ? 326 ALA A CA   2 
ATOM 835  C C    . ALA A 1 20 ? 49.898 45.336 15.258 1.00 0.00 ? 326 ALA A C    2 
ATOM 836  O O    . ALA A 1 20 ? 49.183 45.747 14.346 1.00 0.00 ? 326 ALA A O    2 
ATOM 837  C CB   . ALA A 1 20 ? 52.323 44.914 14.639 1.00 0.00 ? 326 ALA A CB   2 
ATOM 838  H H    . ALA A 1 20 ? 52.639 45.500 17.033 1.00 0.00 ? 326 ALA A H    2 
ATOM 839  H HA   . ALA A 1 20 ? 51.380 46.815 14.883 1.00 0.00 ? 326 ALA A HA   2 
ATOM 840  H HB1  . ALA A 1 20 ? 51.996 44.796 13.600 1.00 0.00 ? 326 ALA A HB1  2 
ATOM 841  H HB2  . ALA A 1 20 ? 53.324 45.352 14.637 1.00 0.00 ? 326 ALA A HB2  2 
ATOM 842  H HB3  . ALA A 1 20 ? 52.353 43.940 15.119 1.00 0.00 ? 326 ALA A HB3  2 
ATOM 843  N N    . GLN A 1 21 ? 49.441 44.478 16.182 1.00 0.00 ? 327 GLN A N    2 
ATOM 844  C CA   . GLN A 1 21 ? 48.050 44.032 16.236 1.00 0.00 ? 327 GLN A CA   2 
ATOM 845  C C    . GLN A 1 21 ? 47.116 45.099 16.832 1.00 0.00 ? 327 GLN A C    2 
ATOM 846  O O    . GLN A 1 21 ? 46.084 45.428 16.241 1.00 0.00 ? 327 GLN A O    2 
ATOM 847  C CB   . GLN A 1 21 ? 47.960 42.714 17.024 1.00 0.00 ? 327 GLN A CB   2 
ATOM 848  C CG   . GLN A 1 21 ? 48.492 41.500 16.239 1.00 0.00 ? 327 GLN A CG   2 
ATOM 849  C CD   . GLN A 1 21 ? 47.544 41.074 15.120 1.00 0.00 ? 327 GLN A CD   2 
ATOM 850  O OE1  . GLN A 1 21 ? 46.593 40.345 15.328 1.00 0.00 ? 327 GLN A OE1  2 
ATOM 851  N NE2  . GLN A 1 21 ? 47.728 41.535 13.903 1.00 0.00 ? 327 GLN A NE2  2 
ATOM 852  H H    . GLN A 1 21 ? 50.094 44.129 16.875 1.00 0.00 ? 327 GLN A H    2 
ATOM 853  H HA   . GLN A 1 21 ? 47.693 43.853 15.216 1.00 0.00 ? 327 GLN A HA   2 
ATOM 854  H HB2  . GLN A 1 21 ? 48.526 42.813 17.951 1.00 0.00 ? 327 GLN A HB2  2 
ATOM 855  H HB3  . GLN A 1 21 ? 46.921 42.515 17.288 1.00 0.00 ? 327 GLN A HB3  2 
ATOM 856  H HG2  . GLN A 1 21 ? 49.480 41.721 15.825 1.00 0.00 ? 327 GLN A HG2  2 
ATOM 857  H HG3  . GLN A 1 21 ? 48.604 40.663 16.920 1.00 0.00 ? 327 GLN A HG3  2 
ATOM 858  H HE21 . GLN A 1 21 ? 48.479 42.165 13.695 1.00 0.00 ? 327 GLN A HE21 2 
ATOM 859  H HE22 . GLN A 1 21 ? 47.043 41.244 13.224 1.00 0.00 ? 327 GLN A HE22 2 
ATOM 860  N N    . ALA A 1 22 ? 47.465 45.686 17.976 1.00 0.00 ? 328 ALA A N    2 
ATOM 861  C CA   . ALA A 1 22 ? 46.612 46.632 18.680 1.00 0.00 ? 328 ALA A CA   2 
ATOM 862  C C    . ALA A 1 22 ? 46.552 48.029 18.034 1.00 0.00 ? 328 ALA A C    2 
ATOM 863  O O    . ALA A 1 22 ? 45.586 48.750 18.257 1.00 0.00 ? 328 ALA A O    2 
ATOM 864  C CB   . ALA A 1 22 ? 47.031 46.696 20.159 1.00 0.00 ? 328 ALA A CB   2 
ATOM 865  H H    . ALA A 1 22 ? 48.337 45.409 18.428 1.00 0.00 ? 328 ALA A H    2 
ATOM 866  H HA   . ALA A 1 22 ? 45.591 46.235 18.662 1.00 0.00 ? 328 ALA A HA   2 
ATOM 867  H HB1  . ALA A 1 22 ? 46.316 47.313 20.709 1.00 0.00 ? 328 ALA A HB1  2 
ATOM 868  H HB2  . ALA A 1 22 ? 47.030 45.692 20.579 1.00 0.00 ? 328 ALA A HB2  2 
ATOM 869  H HB3  . ALA A 1 22 ? 48.023 47.133 20.247 1.00 0.00 ? 328 ALA A HB3  2 
ATOM 870  N N    . ALA A 1 23 ? 47.538 48.404 17.202 1.00 0.00 ? 329 ALA A N    2 
ATOM 871  C CA   . ALA A 1 23 ? 47.608 49.700 16.524 1.00 0.00 ? 329 ALA A CA   2 
ATOM 872  C C    . ALA A 1 23 ? 46.315 50.072 15.786 1.00 0.00 ? 329 ALA A C    2 
ATOM 873  O O    . ALA A 1 23 ? 45.779 51.161 15.970 1.00 0.00 ? 329 ALA A O    2 
ATOM 874  C CB   . ALA A 1 23 ? 48.782 49.687 15.537 1.00 0.00 ? 329 ALA A CB   2 
ATOM 875  H H    . ALA A 1 23 ? 48.346 47.792 17.101 1.00 0.00 ? 329 ALA A H    2 
ATOM 876  H HA   . ALA A 1 23 ? 47.785 50.473 17.271 1.00 0.00 ? 329 ALA A HA   2 
ATOM 877  H HB1  . ALA A 1 23 ? 48.761 50.583 14.926 1.00 0.00 ? 329 ALA A HB1  2 
ATOM 878  H HB2  . ALA A 1 23 ? 49.725 49.678 16.081 1.00 0.00 ? 329 ALA A HB2  2 
ATOM 879  H HB3  . ALA A 1 23 ? 48.726 48.813 14.889 1.00 0.00 ? 329 ALA A HB3  2 
ATOM 880  N N    . LEU A 1 24 ? 45.787 49.141 14.970 1.00 0.00 ? 330 LEU A N    2 
ATOM 881  C CA   . LEU A 1 24 ? 44.533 49.362 14.229 1.00 0.00 ? 330 LEU A CA   2 
ATOM 882  C C    . LEU A 1 24 ? 43.326 48.868 15.032 1.00 0.00 ? 330 LEU A C    2 
ATOM 883  O O    . LEU A 1 24 ? 42.278 49.521 15.034 1.00 0.00 ? 330 LEU A O    2 
ATOM 884  C CB   . LEU A 1 24 ? 44.603 48.716 12.832 1.00 0.00 ? 330 LEU A CB   2 
ATOM 885  C CG   . LEU A 1 24 ? 45.899 49.029 12.058 1.00 0.00 ? 330 LEU A CG   2 
ATOM 886  C CD1  . LEU A 1 24 ? 46.846 47.826 12.090 1.00 0.00 ? 330 LEU A CD1  2 
ATOM 887  C CD2  . LEU A 1 24 ? 45.611 49.355 10.592 1.00 0.00 ? 330 LEU A CD2  2 
ATOM 888  H H    . LEU A 1 24 ? 46.274 48.271 14.868 1.00 0.00 ? 330 LEU A H    2 
ATOM 889  H HA   . LEU A 1 24 ? 44.395 50.434 14.091 1.00 0.00 ? 330 LEU A HA   2 
ATOM 890  H HB2  . LEU A 1 24 ? 44.470 47.635 12.923 1.00 0.00 ? 330 LEU A HB2  2 
ATOM 891  H HB3  . LEU A 1 24 ? 43.751 49.104 12.271 1.00 0.00 ? 330 LEU A HB3  2 
ATOM 892  H HG   . LEU A 1 24 ? 46.404 49.884 12.493 1.00 0.00 ? 330 LEU A HG   2 
ATOM 893  H HD11 . LEU A 1 24 ? 47.784 48.068 11.597 1.00 0.00 ? 330 LEU A HD11 2 
ATOM 894  H HD12 . LEU A 1 24 ? 47.071 47.535 13.126 1.00 0.00 ? 330 LEU A HD12 2 
ATOM 895  H HD13 . LEU A 1 24 ? 46.390 46.972 11.584 1.00 0.00 ? 330 LEU A HD13 2 
ATOM 896  H HD21 . LEU A 1 24 ? 45.014 50.257 10.535 1.00 0.00 ? 330 LEU A HD21 2 
ATOM 897  H HD22 . LEU A 1 24 ? 46.549 49.537 10.069 1.00 0.00 ? 330 LEU A HD22 2 
ATOM 898  H HD23 . LEU A 1 24 ? 45.086 48.531 10.117 1.00 0.00 ? 330 LEU A HD23 2 
ATOM 899  N N    . GLN A 1 25 ? 43.488 47.770 15.780 1.00 0.00 ? 331 GLN A N    2 
ATOM 900  C CA   . GLN A 1 25 ? 42.401 47.185 16.581 1.00 0.00 ? 331 GLN A CA   2 
ATOM 901  C C    . GLN A 1 25 ? 41.900 48.136 17.673 1.00 0.00 ? 331 GLN A C    2 
ATOM 902  O O    . GLN A 1 25 ? 40.712 48.117 17.970 1.00 0.00 ? 331 GLN A O    2 
ATOM 903  C CB   . GLN A 1 25 ? 42.860 45.829 17.125 1.00 0.00 ? 331 GLN A CB   2 
ATOM 904  C CG   . GLN A 1 25 ? 41.691 44.967 17.653 1.00 0.00 ? 331 GLN A CG   2 
ATOM 905  C CD   . GLN A 1 25 ? 41.819 44.672 19.140 1.00 0.00 ? 331 GLN A CD   2 
ATOM 906  O OE1  . GLN A 1 25 ? 41.316 45.385 19.980 1.00 0.00 ? 331 GLN A OE1  2 
ATOM 907  N NE2  . GLN A 1 25 ? 42.528 43.636 19.525 1.00 0.00 ? 331 GLN A NE2  2 
ATOM 908  H H    . GLN A 1 25 ? 44.366 47.288 15.750 1.00 0.00 ? 331 GLN A H    2 
ATOM 909  H HA   . GLN A 1 25 ? 41.566 47.014 15.914 1.00 0.00 ? 331 GLN A HA   2 
ATOM 910  H HB2  . GLN A 1 25 ? 43.354 45.275 16.326 1.00 0.00 ? 331 GLN A HB2  2 
ATOM 911  H HB3  . GLN A 1 25 ? 43.585 45.989 17.922 1.00 0.00 ? 331 GLN A HB3  2 
ATOM 912  H HG2  . GLN A 1 25 ? 40.741 45.452 17.464 1.00 0.00 ? 331 GLN A HG2  2 
ATOM 913  H HG3  . GLN A 1 25 ? 41.685 44.022 17.104 1.00 0.00 ? 331 GLN A HG3  2 
ATOM 914  H HE21 . GLN A 1 25 ? 42.952 43.021 18.867 1.00 0.00 ? 331 GLN A HE21 2 
ATOM 915  H HE22 . GLN A 1 25 ? 42.553 43.476 20.524 1.00 0.00 ? 331 GLN A HE22 2 
ATOM 916  N N    . SER A 1 26 ? 42.736 49.039 18.197 1.00 0.00 ? 332 SER A N    2 
ATOM 917  C CA   . SER A 1 26 ? 42.295 50.101 19.130 1.00 0.00 ? 332 SER A CA   2 
ATOM 918  C C    . SER A 1 26 ? 41.224 51.020 18.526 1.00 0.00 ? 332 SER A C    2 
ATOM 919  O O    . SER A 1 26 ? 40.309 51.436 19.225 1.00 0.00 ? 332 SER A O    2 
ATOM 920  C CB   . SER A 1 26 ? 43.490 50.963 19.562 1.00 0.00 ? 332 SER A CB   2 
ATOM 921  O OG   . SER A 1 26 ? 44.472 50.194 20.218 1.00 0.00 ? 332 SER A OG   2 
ATOM 922  H H    . SER A 1 26 ? 43.714 48.998 17.951 1.00 0.00 ? 332 SER A H    2 
ATOM 923  H HA   . SER A 1 26 ? 41.879 49.633 20.018 1.00 0.00 ? 332 SER A HA   2 
ATOM 924  H HB2  . SER A 1 26 ? 43.936 51.450 18.684 1.00 0.00 ? 332 SER A HB2  2 
ATOM 925  H HB3  . SER A 1 26 ? 43.136 51.738 20.241 1.00 0.00 ? 332 SER A HB3  2 
ATOM 926  H HG   . SER A 1 26 ? 44.926 49.659 19.540 1.00 0.00 ? 332 SER A HG   2 
ATOM 927  N N    . SER A 1 27 ? 41.307 51.303 17.218 1.00 0.00 ? 333 SER A N    2 
ATOM 928  C CA   . SER A 1 27 ? 40.305 52.133 16.512 1.00 0.00 ? 333 SER A CA   2 
ATOM 929  C C    . SER A 1 27 ? 38.972 51.388 16.342 1.00 0.00 ? 333 SER A C    2 
ATOM 930  O O    . SER A 1 27 ? 37.905 51.959 16.554 1.00 0.00 ? 333 SER A O    2 
ATOM 931  C CB   . SER A 1 27 ? 40.878 52.544 15.152 1.00 0.00 ? 333 SER A CB   2 
ATOM 932  O OG   . SER A 1 27 ? 40.067 53.533 14.557 1.00 0.00 ? 333 SER A OG   2 
ATOM 933  H H    . SER A 1 27 ? 42.032 50.866 16.669 1.00 0.00 ? 333 SER A H    2 
ATOM 934  H HA   . SER A 1 27 ? 40.121 53.038 17.092 1.00 0.00 ? 333 SER A HA   2 
ATOM 935  H HB2  . SER A 1 27 ? 41.880 52.950 15.290 1.00 0.00 ? 333 SER A HB2  2 
ATOM 936  H HB3  . SER A 1 27 ? 40.942 51.681 14.493 1.00 0.00 ? 333 SER A HB3  2 
ATOM 937  H HG   . SER A 1 27 ? 40.473 53.829 13.737 1.00 0.00 ? 333 SER A HG   2 
ATOM 938  N N    . TRP A 1 28 ? 39.026 50.091 16.059 1.00 0.00 ? 334 TRP A N    2 
ATOM 939  C CA   . TRP A 1 28 ? 37.833 49.235 16.008 1.00 0.00 ? 334 TRP A CA   2 
ATOM 940  C C    . TRP A 1 28 ? 37.241 49.013 17.409 1.00 0.00 ? 334 TRP A C    2 
ATOM 941  O O    . TRP A 1 28 ? 36.022 49.075 17.577 1.00 0.00 ? 334 TRP A O    2 
ATOM 942  C CB   . TRP A 1 28 ? 38.205 47.921 15.293 1.00 0.00 ? 334 TRP A CB   2 
ATOM 943  C CG   . TRP A 1 28 ? 38.858 48.072 13.950 1.00 0.00 ? 334 TRP A CG   2 
ATOM 944  C CD1  . TRP A 1 28 ? 38.595 49.062 13.052 1.00 0.00 ? 334 TRP A CD1  2 
ATOM 945  C CD2  . TRP A 1 28 ? 39.911 47.255 13.326 1.00 0.00 ? 334 TRP A CD2  2 
ATOM 946  N NE1  . TRP A 1 28 ? 39.418 48.920 11.955 1.00 0.00 ? 334 TRP A NE1  2 
ATOM 947  C CE2  . TRP A 1 28 ? 40.256 47.836 12.070 1.00 0.00 ? 334 TRP A CE2  2 
ATOM 948  C CE3  . TRP A 1 28 ? 40.600 46.079 13.690 1.00 0.00 ? 334 TRP A CE3  2 
ATOM 949  C CZ2  . TRP A 1 28 ? 41.249 47.311 11.238 1.00 0.00 ? 334 TRP A CZ2  2 
ATOM 950  C CZ3  . TRP A 1 28 ? 41.604 45.534 12.869 1.00 0.00 ? 334 TRP A CZ3  2 
ATOM 951  C CH2  . TRP A 1 28 ? 41.938 46.145 11.643 1.00 0.00 ? 334 TRP A CH2  2 
ATOM 952  H H    . TRP A 1 28 ? 39.934 49.670 15.890 1.00 0.00 ? 334 TRP A H    2 
ATOM 953  H HA   . TRP A 1 28 ? 37.071 49.733 15.417 1.00 0.00 ? 334 TRP A HA   2 
ATOM 954  H HB2  . TRP A 1 28 ? 38.877 47.352 15.933 1.00 0.00 ? 334 TRP A HB2  2 
ATOM 955  H HB3  . TRP A 1 28 ? 37.303 47.325 15.172 1.00 0.00 ? 334 TRP A HB3  2 
ATOM 956  H HD1  . TRP A 1 28 ? 37.868 49.842 13.204 1.00 0.00 ? 334 TRP A HD1  2 
ATOM 957  H HE1  . TRP A 1 28 ? 39.385 49.548 11.162 1.00 0.00 ? 334 TRP A HE1  2 
ATOM 958  H HE3  . TRP A 1 28 ? 40.334 45.581 14.617 1.00 0.00 ? 334 TRP A HE3  2 
ATOM 959  H HZ2  . TRP A 1 28 ? 41.485 47.780 10.292 1.00 0.00 ? 334 TRP A HZ2  2 
ATOM 960  H HZ3  . TRP A 1 28 ? 42.123 44.630 13.167 1.00 0.00 ? 334 TRP A HZ3  2 
ATOM 961  H HH2  . TRP A 1 28 ? 42.693 45.719 11.014 1.00 0.00 ? 334 TRP A HH2  2 
ATOM 962  N N    . GLY A 1 29 ? 38.087 48.850 18.423 1.00 0.00 ? 335 GLY A N    2 
ATOM 963  C CA   . GLY A 1 29 ? 37.725 48.718 19.834 1.00 0.00 ? 335 GLY A CA   2 
ATOM 964  C C    . GLY A 1 29 ? 37.062 49.964 20.420 1.00 0.00 ? 335 GLY A C    2 
ATOM 965  O O    . GLY A 1 29 ? 36.116 49.819 21.184 1.00 0.00 ? 335 GLY A O    2 
ATOM 966  H H    . GLY A 1 29 ? 39.075 48.780 18.196 1.00 0.00 ? 335 GLY A H    2 
ATOM 967  H HA2  . GLY A 1 29 ? 37.043 47.869 19.950 1.00 0.00 ? 335 GLY A HA2  2 
ATOM 968  H HA3  . GLY A 1 29 ? 38.628 48.509 20.406 1.00 0.00 ? 335 GLY A HA3  2 
ATOM 969  N N    . MET A 1 30 ? 37.463 51.177 20.000 1.00 0.00 ? 336 MET A N    2 
ATOM 970  C CA   . MET A 1 30 ? 36.779 52.425 20.386 1.00 0.00 ? 336 MET A CA   2 
ATOM 971  C C    . MET A 1 30 ? 35.277 52.393 20.065 1.00 0.00 ? 336 MET A C    2 
ATOM 972  O O    . MET A 1 30 ? 34.463 52.797 20.883 1.00 0.00 ? 336 MET A O    2 
ATOM 973  C CB   . MET A 1 30 ? 37.408 53.621 19.654 1.00 0.00 ? 336 MET A CB   2 
ATOM 974  C CG   . MET A 1 30 ? 38.674 54.150 20.322 1.00 0.00 ? 336 MET A CG   2 
ATOM 975  S SD   . MET A 1 30 ? 38.366 55.097 21.833 1.00 0.00 ? 336 MET A SD   2 
ATOM 976  C CE   . MET A 1 30 ? 39.949 55.970 21.972 1.00 0.00 ? 336 MET A CE   2 
ATOM 977  H H    . MET A 1 30 ? 38.290 51.240 19.415 1.00 0.00 ? 336 MET A H    2 
ATOM 978  H HA   . MET A 1 30 ? 36.866 52.565 21.457 1.00 0.00 ? 336 MET A HA   2 
ATOM 979  H HB2  . MET A 1 30 ? 37.631 53.350 18.630 1.00 0.00 ? 336 MET A HB2  2 
ATOM 980  H HB3  . MET A 1 30 ? 36.690 54.443 19.616 1.00 0.00 ? 336 MET A HB3  2 
ATOM 981  H HG2  . MET A 1 30 ? 39.343 53.326 20.550 1.00 0.00 ? 336 MET A HG2  2 
ATOM 982  H HG3  . MET A 1 30 ? 39.171 54.806 19.605 1.00 0.00 ? 336 MET A HG3  2 
ATOM 983  H HE1  . MET A 1 30 ? 39.936 56.602 22.858 1.00 0.00 ? 336 MET A HE1  2 
ATOM 984  H HE2  . MET A 1 30 ? 40.757 55.247 22.050 1.00 0.00 ? 336 MET A HE2  2 
ATOM 985  H HE3  . MET A 1 30 ? 40.096 56.589 21.087 1.00 0.00 ? 336 MET A HE3  2 
ATOM 986  N N    . MET A 1 31 ? 34.888 51.876 18.892 1.00 0.00 ? 337 MET A N    2 
ATOM 987  C CA   . MET A 1 31 ? 33.476 51.743 18.529 1.00 0.00 ? 337 MET A CA   2 
ATOM 988  C C    . MET A 1 31 ? 32.846 50.470 19.120 1.00 0.00 ? 337 MET A C    2 
ATOM 989  O O    . MET A 1 31 ? 31.729 50.508 19.627 1.00 0.00 ? 337 MET A O    2 
ATOM 990  C CB   . MET A 1 31 ? 33.287 51.829 17.011 1.00 0.00 ? 337 MET A CB   2 
ATOM 991  C CG   . MET A 1 31 ? 33.907 53.113 16.440 1.00 0.00 ? 337 MET A CG   2 
ATOM 992  S SD   . MET A 1 31 ? 33.031 53.819 15.012 1.00 0.00 ? 337 MET A SD   2 
ATOM 993  C CE   . MET A 1 31 ? 31.678 54.655 15.888 1.00 0.00 ? 337 MET A CE   2 
ATOM 994  H H    . MET A 1 31 ? 35.594 51.530 18.254 1.00 0.00 ? 337 MET A H    2 
ATOM 995  H HA   . MET A 1 31 ? 32.921 52.581 18.970 1.00 0.00 ? 337 MET A HA   2 
ATOM 996  H HB2  . MET A 1 31 ? 33.741 50.962 16.529 1.00 0.00 ? 337 MET A HB2  2 
ATOM 997  H HB3  . MET A 1 31 ? 32.216 51.814 16.797 1.00 0.00 ? 337 MET A HB3  2 
ATOM 998  H HG2  . MET A 1 31 ? 33.944 53.875 17.217 1.00 0.00 ? 337 MET A HG2  2 
ATOM 999  H HG3  . MET A 1 31 ? 34.935 52.893 16.141 1.00 0.00 ? 337 MET A HG3  2 
ATOM 1000 H HE1  . MET A 1 31 ? 31.036 55.164 15.167 1.00 0.00 ? 337 MET A HE1  2 
ATOM 1001 H HE2  . MET A 1 31 ? 31.080 53.921 16.434 1.00 0.00 ? 337 MET A HE2  2 
ATOM 1002 H HE3  . MET A 1 31 ? 32.085 55.387 16.583 1.00 0.00 ? 337 MET A HE3  2 
ATOM 1003 N N    . GLY A 1 32 ? 33.592 49.357 19.105 1.00 0.00 ? 338 GLY A N    2 
ATOM 1004 C CA   . GLY A 1 32 ? 33.141 48.064 19.615 1.00 0.00 ? 338 GLY A CA   2 
ATOM 1005 C C    . GLY A 1 32 ? 32.820 48.070 21.117 1.00 0.00 ? 338 GLY A C    2 
ATOM 1006 O O    . GLY A 1 32 ? 31.801 47.539 21.518 1.00 0.00 ? 338 GLY A O    2 
ATOM 1007 H H    . GLY A 1 32 ? 34.500 49.389 18.650 1.00 0.00 ? 338 GLY A H    2 
ATOM 1008 H HA2  . GLY A 1 32 ? 32.247 47.742 19.077 1.00 0.00 ? 338 GLY A HA2  2 
ATOM 1009 H HA3  . GLY A 1 32 ? 33.928 47.323 19.453 1.00 0.00 ? 338 GLY A HA3  2 
ATOM 1010 N N    . MET A 1 33 ? 33.627 48.739 21.949 1.00 0.00 ? 339 MET A N    2 
ATOM 1011 C CA   . MET A 1 33 ? 33.366 48.846 23.391 1.00 0.00 ? 339 MET A CA   2 
ATOM 1012 C C    . MET A 1 33 ? 32.141 49.697 23.717 1.00 0.00 ? 339 MET A C    2 
ATOM 1013 O O    . MET A 1 33 ? 31.486 49.449 24.719 1.00 0.00 ? 339 MET A O    2 
ATOM 1014 C CB   . MET A 1 33 ? 34.592 49.385 24.139 1.00 0.00 ? 339 MET A CB   2 
ATOM 1015 C CG   . MET A 1 33 ? 35.730 48.361 24.203 1.00 0.00 ? 339 MET A CG   2 
ATOM 1016 S SD   . MET A 1 33 ? 36.769 48.493 25.698 1.00 0.00 ? 339 MET A SD   2 
ATOM 1017 C CE   . MET A 1 33 ? 35.644 47.755 26.917 1.00 0.00 ? 339 MET A CE   2 
ATOM 1018 H H    . MET A 1 33 ? 34.466 49.180 21.578 1.00 0.00 ? 339 MET A H    2 
ATOM 1019 H HA   . MET A 1 33 ? 33.146 47.843 23.773 1.00 0.00 ? 339 MET A HA   2 
ATOM 1020 H HB2  . MET A 1 33 ? 34.942 50.309 23.676 1.00 0.00 ? 339 MET A HB2  2 
ATOM 1021 H HB3  . MET A 1 33 ? 34.279 49.626 25.154 1.00 0.00 ? 339 MET A HB3  2 
ATOM 1022 H HG2  . MET A 1 33 ? 35.317 47.352 24.175 1.00 0.00 ? 339 MET A HG2  2 
ATOM 1023 H HG3  . MET A 1 33 ? 36.365 48.488 23.330 1.00 0.00 ? 339 MET A HG3  2 
ATOM 1024 H HE1  . MET A 1 33 ? 36.120 47.754 27.895 1.00 0.00 ? 339 MET A HE1  2 
ATOM 1025 H HE2  . MET A 1 33 ? 34.716 48.327 26.968 1.00 0.00 ? 339 MET A HE2  2 
ATOM 1026 H HE3  . MET A 1 33 ? 35.410 46.728 26.629 1.00 0.00 ? 339 MET A HE3  2 
ATOM 1027 N N    . LEU A 1 34 ? 31.809 50.696 22.889 1.00 0.00 ? 340 LEU A N    2 
ATOM 1028 C CA   . LEU A 1 34 ? 30.602 51.508 23.074 1.00 0.00 ? 340 LEU A CA   2 
ATOM 1029 C C    . LEU A 1 34 ? 29.347 50.746 22.614 1.00 0.00 ? 340 LEU A C    2 
ATOM 1030 O O    . LEU A 1 34 ? 28.351 50.702 23.340 1.00 0.00 ? 340 LEU A O    2 
ATOM 1031 C CB   . LEU A 1 34 ? 30.772 52.854 22.356 1.00 0.00 ? 340 LEU A CB   2 
ATOM 1032 C CG   . LEU A 1 34 ? 31.928 53.725 22.898 1.00 0.00 ? 340 LEU A CG   2 
ATOM 1033 C CD1  . LEU A 1 34 ? 32.096 54.963 22.029 1.00 0.00 ? 340 LEU A CD1  2 
ATOM 1034 C CD2  . LEU A 1 34 ? 31.698 54.172 24.344 1.00 0.00 ? 340 LEU A CD2  2 
ATOM 1035 H H    . LEU A 1 34 ? 32.374 50.852 22.067 1.00 0.00 ? 340 LEU A H    2 
ATOM 1036 H HA   . LEU A 1 34 ? 30.459 51.697 24.147 1.00 0.00 ? 340 LEU A HA   2 
ATOM 1037 H HB2  . LEU A 1 34 ? 30.945 52.664 21.293 1.00 0.00 ? 340 LEU A HB2  2 
ATOM 1038 H HB3  . LEU A 1 34 ? 29.844 53.426 22.447 1.00 0.00 ? 340 LEU A HB3  2 
ATOM 1039 H HG   . LEU A 1 34 ? 32.856 53.153 22.867 1.00 0.00 ? 340 LEU A HG   2 
ATOM 1040 H HD11 . LEU A 1 34 ? 32.950 55.547 22.390 1.00 0.00 ? 340 LEU A HD11 2 
ATOM 1041 H HD12 . LEU A 1 34 ? 32.299 54.663 21.005 1.00 0.00 ? 340 LEU A HD12 2 
ATOM 1042 H HD13 . LEU A 1 34 ? 31.188 55.576 22.070 1.00 0.00 ? 340 LEU A HD13 2 
ATOM 1043 H HD21 . LEU A 1 34 ? 31.689 53.315 25.005 1.00 0.00 ? 340 LEU A HD21 2 
ATOM 1044 H HD22 . LEU A 1 34 ? 32.522 54.826 24.655 1.00 0.00 ? 340 LEU A HD22 2 
ATOM 1045 H HD23 . LEU A 1 34 ? 30.760 54.714 24.425 1.00 0.00 ? 340 LEU A HD23 2 
ATOM 1046 N N    . ALA A 1 35 ? 29.408 50.087 21.457 1.00 0.00 ? 341 ALA A N    2 
ATOM 1047 C CA   . ALA A 1 35 ? 28.323 49.255 20.955 1.00 0.00 ? 341 ALA A CA   2 
ATOM 1048 C C    . ALA A 1 35 ? 28.045 48.067 21.895 1.00 0.00 ? 341 ALA A C    2 
ATOM 1049 O O    . ALA A 1 35 ? 26.917 47.866 22.350 1.00 0.00 ? 341 ALA A O    2 
ATOM 1050 C CB   . ALA A 1 35 ? 28.663 48.808 19.529 1.00 0.00 ? 341 ALA A CB   2 
ATOM 1051 H H    . ALA A 1 35 ? 30.255 50.170 20.893 1.00 0.00 ? 341 ALA A H    2 
ATOM 1052 H HA   . ALA A 1 35 ? 27.414 49.858 20.917 1.00 0.00 ? 341 ALA A HA   2 
ATOM 1053 H HB1  . ALA A 1 35 ? 27.849 48.204 19.128 1.00 0.00 ? 341 ALA A HB1  2 
ATOM 1054 H HB2  . ALA A 1 35 ? 28.802 49.674 18.896 1.00 0.00 ? 341 ALA A HB2  2 
ATOM 1055 H HB3  . ALA A 1 35 ? 29.581 48.205 19.527 1.00 0.00 ? 341 ALA A HB3  2 
ATOM 1056 N N    . SER A 1 36 ? 29.075 47.310 22.292 1.00 0.00 ? 342 SER A N    2 
ATOM 1057 C CA   . SER A 1 36 ? 28.917 46.112 23.141 1.00 0.00 ? 342 SER A CA   2 
ATOM 1058 C C    . SER A 1 36 ? 28.747 46.418 24.635 1.00 0.00 ? 342 SER A C    2 
ATOM 1059 O O    . SER A 1 36 ? 28.669 45.480 25.436 1.00 0.00 ? 342 SER A O    2 
ATOM 1060 C CB   . SER A 1 36 ? 30.052 45.121 22.895 1.00 0.00 ? 342 SER A CB   2 
ATOM 1061 O OG   . SER A 1 36 ? 30.113 44.804 21.511 1.00 0.00 ? 342 SER A OG   2 
ATOM 1062 H H    . SER A 1 36 ? 29.983 47.461 21.878 1.00 0.00 ? 342 SER A H    2 
ATOM 1063 H HA   . SER A 1 36 ? 28.003 45.607 22.832 1.00 0.00 ? 342 SER A HA   2 
ATOM 1064 H HB2  . SER A 1 36 ? 30.995 45.545 23.213 1.00 0.00 ? 342 SER A HB2  2 
ATOM 1065 H HB3  . SER A 1 36 ? 29.853 44.206 23.457 1.00 0.00 ? 342 SER A HB3  2 
ATOM 1066 H HG   . SER A 1 36 ? 30.630 44.003 21.400 1.00 0.00 ? 342 SER A HG   2 
ATOM 1067 N N    . GLN A 1 37 ? 28.643 47.684 25.048 1.00 0.00 ? 343 GLN A N    2 
ATOM 1068 C CA   . GLN A 1 37 ? 28.262 48.072 26.414 1.00 0.00 ? 343 GLN A CA   2 
ATOM 1069 C C    . GLN A 1 37 ? 26.733 48.094 26.614 1.00 0.00 ? 343 GLN A C    2 
ATOM 1070 O O    . GLN A 1 37 ? 26.238 47.566 27.612 1.00 0.00 ? 343 GLN A O    2 
ATOM 1071 C CB   . GLN A 1 37 ? 28.878 49.436 26.764 1.00 0.00 ? 343 GLN A CB   2 
ATOM 1072 C CG   . GLN A 1 37 ? 30.202 49.295 27.535 1.00 0.00 ? 343 GLN A CG   2 
ATOM 1073 C CD   . GLN A 1 37 ? 30.030 48.931 29.002 1.00 0.00 ? 343 GLN A CD   2 
ATOM 1074 O OE1  . GLN A 1 37 ? 28.943 48.879 29.558 1.00 0.00 ? 343 GLN A OE1  2 
ATOM 1075 N NE2  . GLN A 1 37 ? 31.104 48.671 29.714 1.00 0.00 ? 343 GLN A NE2  2 
ATOM 1076 H H    . GLN A 1 37 ? 28.791 48.420 24.365 1.00 0.00 ? 343 GLN A H    2 
ATOM 1077 H HA   . GLN A 1 37 ? 28.644 47.334 27.115 1.00 0.00 ? 343 GLN A HA   2 
ATOM 1078 H HB2  . GLN A 1 37 ? 29.064 50.005 25.849 1.00 0.00 ? 343 GLN A HB2  2 
ATOM 1079 H HB3  . GLN A 1 37 ? 28.194 50.033 27.364 1.00 0.00 ? 343 GLN A HB3  2 
ATOM 1080 H HG2  . GLN A 1 37 ? 30.827 48.538 27.054 1.00 0.00 ? 343 GLN A HG2  2 
ATOM 1081 H HG3  . GLN A 1 37 ? 30.745 50.244 27.481 1.00 0.00 ? 343 GLN A HG3  2 
ATOM 1082 H HE21 . GLN A 1 37 ? 32.011 48.692 29.298 1.00 0.00 ? 343 GLN A HE21 2 
ATOM 1083 H HE22 . GLN A 1 37 ? 30.929 48.422 30.672 1.00 0.00 ? 343 GLN A HE22 2 
ATOM 1084 N N    . GLN A 1 38 ? 25.980 48.706 25.694 1.00 0.00 ? 344 GLN A N    2 
ATOM 1085 C CA   . GLN A 1 38 ? 24.521 48.909 25.835 1.00 0.00 ? 344 GLN A CA   2 
ATOM 1086 C C    . GLN A 1 38 ? 23.702 48.584 24.567 1.00 0.00 ? 344 GLN A C    2 
ATOM 1087 O O    . GLN A 1 38 ? 22.483 48.607 24.624 1.00 0.00 ? 344 GLN A O    2 
ATOM 1088 C CB   . GLN A 1 38 ? 24.238 50.345 26.321 1.00 0.00 ? 344 GLN A CB   2 
ATOM 1089 C CG   . GLN A 1 38 ? 24.698 50.639 27.761 1.00 0.00 ? 344 GLN A CG   2 
ATOM 1090 C CD   . GLN A 1 38 ? 23.862 49.911 28.819 1.00 0.00 ? 344 GLN A CD   2 
ATOM 1091 O OE1  . GLN A 1 38 ? 22.876 50.420 29.320 1.00 0.00 ? 344 GLN A OE1  2 
ATOM 1092 N NE2  . GLN A 1 38 ? 24.221 48.707 29.205 1.00 0.00 ? 344 GLN A NE2  2 
ATOM 1093 H H    . GLN A 1 38 ? 26.456 49.152 24.926 1.00 0.00 ? 344 GLN A H    2 
ATOM 1094 H HA   . GLN A 1 38 ? 24.143 48.212 26.580 1.00 0.00 ? 344 GLN A HA   2 
ATOM 1095 H HB2  . GLN A 1 38 ? 24.736 51.040 25.645 1.00 0.00 ? 344 GLN A HB2  2 
ATOM 1096 H HB3  . GLN A 1 38 ? 23.168 50.539 26.269 1.00 0.00 ? 344 GLN A HB3  2 
ATOM 1097 H HG2  . GLN A 1 38 ? 25.748 50.395 27.892 1.00 0.00 ? 344 GLN A HG2  2 
ATOM 1098 H HG3  . GLN A 1 38 ? 24.592 51.708 27.942 1.00 0.00 ? 344 GLN A HG3  2 
ATOM 1099 H HE21 . GLN A 1 38 ? 25.037 48.258 28.806 1.00 0.00 ? 344 GLN A HE21 2 
ATOM 1100 H HE22 . GLN A 1 38 ? 23.653 48.271 29.904 1.00 0.00 ? 344 GLN A HE22 2 
ATOM 1101 N N    . ASN A 1 39 ? 24.345 48.243 23.449 1.00 0.00 ? 345 ASN A N    2 
ATOM 1102 C CA   . ASN A 1 39 ? 23.686 47.857 22.199 1.00 0.00 ? 345 ASN A CA   2 
ATOM 1103 C C    . ASN A 1 39 ? 23.860 46.370 21.844 1.00 0.00 ? 345 ASN A C    2 
ATOM 1104 O O    . ASN A 1 39 ? 22.974 45.798 21.213 1.00 0.00 ? 345 ASN A O    2 
ATOM 1105 C CB   . ASN A 1 39 ? 24.162 48.787 21.056 1.00 0.00 ? 345 ASN A CB   2 
ATOM 1106 C CG   . ASN A 1 39 ? 23.112 49.774 20.601 1.00 0.00 ? 345 ASN A CG   2 
ATOM 1107 O OD1  . ASN A 1 39 ? 23.286 50.973 20.642 1.00 0.00 ? 345 ASN A OD1  2 
ATOM 1108 N ND2  . ASN A 1 39 ? 21.968 49.302 20.154 1.00 0.00 ? 345 ASN A ND2  2 
ATOM 1109 H H    . ASN A 1 39 ? 25.365 48.260 23.443 1.00 0.00 ? 345 ASN A H    2 
ATOM 1110 H HA   . ASN A 1 39 ? 22.607 47.989 22.317 1.00 0.00 ? 345 ASN A HA   2 
ATOM 1111 H HB2  . ASN A 1 39 ? 25.046 49.361 21.366 1.00 0.00 ? 345 ASN A HB2  2 
ATOM 1112 H HB3  . ASN A 1 39 ? 24.445 48.194 20.198 1.00 0.00 ? 345 ASN A HB3  2 
ATOM 1113 H HD21 . ASN A 1 39 ? 21.805 48.313 20.135 1.00 0.00 ? 345 ASN A HD21 2 
ATOM 1114 H HD22 . ASN A 1 39 ? 21.288 49.987 19.894 1.00 0.00 ? 345 ASN A HD22 2 
ATOM 1115 N N    . GLN A 1 40 ? 24.990 45.742 22.241 1.00 0.00 ? 346 GLN A N    2 
ATOM 1116 C CA   . GLN A 1 40 ? 25.315 44.323 22.015 1.00 0.00 ? 346 GLN A CA   2 
ATOM 1117 C C    . GLN A 1 40 ? 26.090 43.700 23.194 1.00 0.00 ? 346 GLN A C    2 
ATOM 1118 O O    . GLN A 1 40 ? 27.097 43.018 23.012 1.00 0.00 ? 346 GLN A O    2 
ATOM 1119 C CB   . GLN A 1 40 ? 26.046 44.124 20.679 1.00 0.00 ? 346 GLN A CB   2 
ATOM 1120 C CG   . GLN A 1 40 ? 25.170 44.449 19.457 1.00 0.00 ? 346 GLN A CG   2 
ATOM 1121 C CD   . GLN A 1 40 ? 25.750 43.890 18.158 1.00 0.00 ? 346 GLN A CD   2 
ATOM 1122 O OE1  . GLN A 1 40 ? 26.819 44.251 17.705 1.00 0.00 ? 346 GLN A OE1  2 
ATOM 1123 N NE2  . GLN A 1 40 ? 25.064 42.988 17.503 1.00 0.00 ? 346 GLN A NE2  2 
ATOM 1124 H H    . GLN A 1 40 ? 25.704 46.326 22.652 1.00 0.00 ? 346 GLN A H    2 
ATOM 1125 H HA   . GLN A 1 40 ? 24.373 43.767 21.965 1.00 0.00 ? 346 GLN A HA   2 
ATOM 1126 H HB2  . GLN A 1 40 ? 26.948 44.732 20.649 1.00 0.00 ? 346 GLN A HB2  2 
ATOM 1127 H HB3  . GLN A 1 40 ? 26.342 43.074 20.596 1.00 0.00 ? 346 GLN A HB3  2 
ATOM 1128 H HG2  . GLN A 1 40 ? 24.179 44.020 19.609 1.00 0.00 ? 346 GLN A HG2  2 
ATOM 1129 H HG3  . GLN A 1 40 ? 25.062 45.530 19.348 1.00 0.00 ? 346 GLN A HG3  2 
ATOM 1130 H HE21 . GLN A 1 40 ? 24.175 42.668 17.845 1.00 0.00 ? 346 GLN A HE21 2 
ATOM 1131 H HE22 . GLN A 1 40 ? 25.497 42.635 16.667 1.00 0.00 ? 346 GLN A HE22 2 
ATOM 1132 N N    . SER A 1 41 ? 25.658 43.959 24.439 1.00 0.00 ? 347 SER A N    2 
ATOM 1133 C CA   . SER A 1 41 ? 26.234 43.365 25.650 1.00 0.00 ? 347 SER A CA   2 
ATOM 1134 C C    . SER A 1 41 ? 25.810 41.895 25.808 1.00 0.00 ? 347 SER A C    2 
ATOM 1135 O O    . SER A 1 41 ? 24.742 41.583 26.342 1.00 0.00 ? 347 SER A O    2 
ATOM 1136 C CB   . SER A 1 41 ? 25.883 44.214 26.881 1.00 0.00 ? 347 SER A CB   2 
ATOM 1137 O OG   . SER A 1 41 ? 24.615 44.849 26.755 1.00 0.00 ? 347 SER A OG   2 
ATOM 1138 H H    . SER A 1 41 ? 24.830 44.520 24.580 1.00 0.00 ? 347 SER A H    2 
ATOM 1139 H HA   . SER A 1 41 ? 27.323 43.373 25.564 1.00 0.00 ? 347 SER A HA   2 
ATOM 1140 H HB2  . SER A 1 41 ? 25.907 43.595 27.775 1.00 0.00 ? 347 SER A HB2  2 
ATOM 1141 H HB3  . SER A 1 41 ? 26.636 44.991 26.984 1.00 0.00 ? 347 SER A HB3  2 
ATOM 1142 H HG   . SER A 1 41 ? 24.451 45.322 27.580 1.00 0.00 ? 347 SER A HG   2 
ATOM 1143 N N    . GLY A 1 42 ? 26.644 40.987 25.294 1.00 0.00 ? 348 GLY A N    2 
ATOM 1144 C CA   . GLY A 1 42 ? 26.471 39.526 25.421 1.00 0.00 ? 348 GLY A CA   2 
ATOM 1145 C C    . GLY A 1 42 ? 27.017 38.942 26.732 1.00 0.00 ? 348 GLY A C    2 
ATOM 1146 O O    . GLY A 1 42 ? 27.714 39.643 27.475 1.00 0.00 ? 348 GLY A O    2 
ATOM 1147 H H    . GLY A 1 42 ? 27.473 41.319 24.843 1.00 0.00 ? 348 GLY A H    2 
ATOM 1148 H HA2  . GLY A 1 42 ? 25.410 39.290 25.355 1.00 0.00 ? 348 GLY A HA2  2 
ATOM 1149 H HA3  . GLY A 1 42 ? 26.984 39.033 24.603 1.00 0.00 ? 348 GLY A HA3  2 
ATOM 1150 N N    . PRO A 1 43 ? 26.705 37.660 27.022 1.00 0.00 ? 349 PRO A N    2 
ATOM 1151 C CA   . PRO A 1 43 ? 27.299 36.867 28.100 1.00 0.00 ? 349 PRO A CA   2 
ATOM 1152 C C    . PRO A 1 43 ? 28.685 36.297 27.746 1.00 0.00 ? 349 PRO A C    2 
ATOM 1153 O O    . PRO A 1 43 ? 28.968 36.128 26.533 1.00 0.00 ? 349 PRO A O    2 
ATOM 1154 C CB   . PRO A 1 43 ? 26.287 35.738 28.345 1.00 0.00 ? 349 PRO A CB   2 
ATOM 1155 C CG   . PRO A 1 43 ? 25.798 35.443 26.935 1.00 0.00 ? 349 PRO A CG   2 
ATOM 1156 C CD   . PRO A 1 43 ? 25.778 36.830 26.269 1.00 0.00 ? 349 PRO A CD   2 
ATOM 1157 O OXT  . PRO A 1 43 ? 29.420 35.965 28.709 1.00 0.00 ? 349 PRO A OXT  2 
ATOM 1158 H HA   . PRO A 1 43 ? 27.406 37.468 29.006 1.00 0.00 ? 349 PRO A HA   2 
ATOM 1159 H HB2  . PRO A 1 43 ? 26.757 34.872 28.804 1.00 0.00 ? 349 PRO A HB2  2 
ATOM 1160 H HB3  . PRO A 1 43 ? 25.472 36.114 28.964 1.00 0.00 ? 349 PRO A HB3  2 
ATOM 1161 H HG2  . PRO A 1 43 ? 26.513 34.806 26.415 1.00 0.00 ? 349 PRO A HG2  2 
ATOM 1162 H HG3  . PRO A 1 43 ? 24.806 34.986 26.937 1.00 0.00 ? 349 PRO A HG3  2 
ATOM 1163 H HD2  . PRO A 1 43 ? 26.071 36.739 25.226 1.00 0.00 ? 349 PRO A HD2  2 
ATOM 1164 H HD3  . PRO A 1 43 ? 24.770 37.252 26.349 1.00 0.00 ? 349 PRO A HD3  2 
ATOM 1165 N N    . MET A 1 1  ? 52.857 36.178 15.649 1.00 0.00 ? 307 MET A N    3 
ATOM 1166 C CA   . MET A 1 1  ? 53.127 35.482 14.378 1.00 0.00 ? 307 MET A CA   3 
ATOM 1167 C C    . MET A 1 1  ? 54.255 34.486 14.630 1.00 0.00 ? 307 MET A C    3 
ATOM 1168 O O    . MET A 1 1  ? 54.011 33.579 15.412 1.00 0.00 ? 307 MET A O    3 
ATOM 1169 C CB   . MET A 1 1  ? 53.375 36.460 13.213 1.00 0.00 ? 307 MET A CB   3 
ATOM 1170 C CG   . MET A 1 1  ? 52.075 37.164 12.808 1.00 0.00 ? 307 MET A CG   3 
ATOM 1171 S SD   . MET A 1 1  ? 52.366 38.573 11.712 1.00 0.00 ? 307 MET A SD   3 
ATOM 1172 C CE   . MET A 1 1  ? 50.742 38.700 10.920 1.00 0.00 ? 307 MET A CE   3 
ATOM 1173 H H1   . MET A 1 1  ? 52.686 35.479 16.366 1.00 0.00 ? 307 MET A H1   3 
ATOM 1174 H H2   . MET A 1 1  ? 53.652 36.737 15.919 1.00 0.00 ? 307 MET A H2   3 
ATOM 1175 H H3   . MET A 1 1  ? 52.054 36.775 15.559 1.00 0.00 ? 307 MET A H3   3 
ATOM 1176 H HA   . MET A 1 1  ? 52.262 34.875 14.119 1.00 0.00 ? 307 MET A HA   3 
ATOM 1177 H HB2  . MET A 1 1  ? 54.121 37.190 13.519 1.00 0.00 ? 307 MET A HB2  3 
ATOM 1178 H HB3  . MET A 1 1  ? 53.744 35.913 12.349 1.00 0.00 ? 307 MET A HB3  3 
ATOM 1179 H HG2  . MET A 1 1  ? 51.430 36.448 12.313 1.00 0.00 ? 307 MET A HG2  3 
ATOM 1180 H HG3  . MET A 1 1  ? 51.564 37.543 13.695 1.00 0.00 ? 307 MET A HG3  3 
ATOM 1181 H HE1  . MET A 1 1  ? 50.725 39.574 10.267 1.00 0.00 ? 307 MET A HE1  3 
ATOM 1182 H HE2  . MET A 1 1  ? 50.556 37.807 10.322 1.00 0.00 ? 307 MET A HE2  3 
ATOM 1183 H HE3  . MET A 1 1  ? 49.959 38.799 11.673 1.00 0.00 ? 307 MET A HE3  3 
ATOM 1184 N N    . GLY A 1 2  ? 55.470 34.659 14.092 1.00 0.00 ? 308 GLY A N    3 
ATOM 1185 C CA   . GLY A 1 2  ? 56.619 33.868 14.559 1.00 0.00 ? 308 GLY A CA   3 
ATOM 1186 C C    . GLY A 1 2  ? 56.893 34.113 16.044 1.00 0.00 ? 308 GLY A C    3 
ATOM 1187 O O    . GLY A 1 2  ? 56.913 35.275 16.475 1.00 0.00 ? 308 GLY A O    3 
ATOM 1188 H H    . GLY A 1 2  ? 55.652 35.421 13.463 1.00 0.00 ? 308 GLY A H    3 
ATOM 1189 H HA2  . GLY A 1 2  ? 56.408 32.806 14.405 1.00 0.00 ? 308 GLY A HA2  3 
ATOM 1190 H HA3  . GLY A 1 2  ? 57.505 34.123 13.987 1.00 0.00 ? 308 GLY A HA3  3 
ATOM 1191 N N    . GLY A 1 3  ? 57.057 33.051 16.833 1.00 0.00 ? 309 GLY A N    3 
ATOM 1192 C CA   . GLY A 1 3  ? 57.349 33.095 18.264 1.00 0.00 ? 309 GLY A CA   3 
ATOM 1193 C C    . GLY A 1 3  ? 56.237 32.490 19.134 1.00 0.00 ? 309 GLY A C    3 
ATOM 1194 O O    . GLY A 1 3  ? 55.323 31.866 18.625 1.00 0.00 ? 309 GLY A O    3 
ATOM 1195 H H    . GLY A 1 3  ? 56.859 32.143 16.436 1.00 0.00 ? 309 GLY A H    3 
ATOM 1196 H HA2  . GLY A 1 3  ? 58.272 32.540 18.464 1.00 0.00 ? 309 GLY A HA2  3 
ATOM 1197 H HA3  . GLY A 1 3  ? 57.519 34.122 18.579 1.00 0.00 ? 309 GLY A HA3  3 
ATOM 1198 N N    . GLY A 1 4  ? 56.322 32.673 20.460 1.00 0.00 ? 310 GLY A N    3 
ATOM 1199 C CA   . GLY A 1 4  ? 55.518 31.938 21.455 1.00 0.00 ? 310 GLY A CA   3 
ATOM 1200 C C    . GLY A 1 4  ? 53.990 32.144 21.442 1.00 0.00 ? 310 GLY A C    3 
ATOM 1201 O O    . GLY A 1 4  ? 53.309 31.533 22.254 1.00 0.00 ? 310 GLY A O    3 
ATOM 1202 H H    . GLY A 1 4  ? 57.096 33.204 20.811 1.00 0.00 ? 310 GLY A H    3 
ATOM 1203 H HA2  . GLY A 1 4  ? 55.697 30.872 21.314 1.00 0.00 ? 310 GLY A HA2  3 
ATOM 1204 H HA3  . GLY A 1 4  ? 55.875 32.210 22.451 1.00 0.00 ? 310 GLY A HA3  3 
ATOM 1205 N N    . MET A 1 5  ? 53.455 33.018 20.586 1.00 0.00 ? 311 MET A N    3 
ATOM 1206 C CA   . MET A 1 5  ? 52.009 33.268 20.351 1.00 0.00 ? 311 MET A CA   3 
ATOM 1207 C C    . MET A 1 5  ? 51.105 33.550 21.569 1.00 0.00 ? 311 MET A C    3 
ATOM 1208 O O    . MET A 1 5  ? 49.907 33.679 21.399 1.00 0.00 ? 311 MET A O    3 
ATOM 1209 C CB   . MET A 1 5  ? 51.432 32.200 19.395 1.00 0.00 ? 311 MET A CB   3 
ATOM 1210 C CG   . MET A 1 5  ? 51.903 32.427 17.952 1.00 0.00 ? 311 MET A CG   3 
ATOM 1211 S SD   . MET A 1 5  ? 51.214 33.914 17.139 1.00 0.00 ? 311 MET A SD   3 
ATOM 1212 C CE   . MET A 1 5  ? 49.580 33.270 16.677 1.00 0.00 ? 311 MET A CE   3 
ATOM 1213 H H    . MET A 1 5  ? 54.093 33.384 19.899 1.00 0.00 ? 311 MET A H    3 
ATOM 1214 H HA   . MET A 1 5  ? 51.962 34.205 19.796 1.00 0.00 ? 311 MET A HA   3 
ATOM 1215 H HB2  . MET A 1 5  ? 51.750 31.214 19.723 1.00 0.00 ? 311 MET A HB2  3 
ATOM 1216 H HB3  . MET A 1 5  ? 50.343 32.232 19.409 1.00 0.00 ? 311 MET A HB3  3 
ATOM 1217 H HG2  . MET A 1 5  ? 52.984 32.505 17.935 1.00 0.00 ? 311 MET A HG2  3 
ATOM 1218 H HG3  . MET A 1 5  ? 51.627 31.554 17.353 1.00 0.00 ? 311 MET A HG3  3 
ATOM 1219 H HE1  . MET A 1 5  ? 49.001 34.044 16.163 1.00 0.00 ? 311 MET A HE1  3 
ATOM 1220 H HE2  . MET A 1 5  ? 49.694 32.421 16.009 1.00 0.00 ? 311 MET A HE2  3 
ATOM 1221 H HE3  . MET A 1 5  ? 49.031 32.959 17.572 1.00 0.00 ? 311 MET A HE3  3 
ATOM 1222 N N    . ASN A 1 6  ? 51.659 33.695 22.779 1.00 0.00 ? 312 ASN A N    3 
ATOM 1223 C CA   . ASN A 1 6  ? 50.925 33.936 24.019 1.00 0.00 ? 312 ASN A CA   3 
ATOM 1224 C C    . ASN A 1 6  ? 50.450 35.404 24.109 1.00 0.00 ? 312 ASN A C    3 
ATOM 1225 O O    . ASN A 1 6  ? 49.387 35.753 23.603 1.00 0.00 ? 312 ASN A O    3 
ATOM 1226 C CB   . ASN A 1 6  ? 51.793 33.507 25.225 1.00 0.00 ? 312 ASN A CB   3 
ATOM 1227 C CG   . ASN A 1 6  ? 51.705 32.037 25.603 1.00 0.00 ? 312 ASN A CG   3 
ATOM 1228 O OD1  . ASN A 1 6  ? 51.465 31.720 26.751 1.00 0.00 ? 312 ASN A OD1  3 
ATOM 1229 N ND2  . ASN A 1 6  ? 51.910 31.101 24.698 1.00 0.00 ? 312 ASN A ND2  3 
ATOM 1230 H H    . ASN A 1 6  ? 52.646 33.476 22.860 1.00 0.00 ? 312 ASN A H    3 
ATOM 1231 H HA   . ASN A 1 6  ? 50.018 33.326 24.020 1.00 0.00 ? 312 ASN A HA   3 
ATOM 1232 H HB2  . ASN A 1 6  ? 52.837 33.751 25.035 1.00 0.00 ? 312 ASN A HB2  3 
ATOM 1233 H HB3  . ASN A 1 6  ? 51.464 34.054 26.120 1.00 0.00 ? 312 ASN A HB3  3 
ATOM 1234 H HD21 . ASN A 1 6  ? 52.208 31.324 23.754 1.00 0.00 ? 312 ASN A HD21 3 
ATOM 1235 H HD22 . ASN A 1 6  ? 51.828 30.160 25.022 1.00 0.00 ? 312 ASN A HD22 3 
ATOM 1236 N N    . PHE A 1 7  ? 51.226 36.282 24.750 1.00 0.00 ? 313 PHE A N    3 
ATOM 1237 C CA   . PHE A 1 7  ? 50.779 37.627 25.113 1.00 0.00 ? 313 PHE A CA   3 
ATOM 1238 C C    . PHE A 1 7  ? 51.186 38.728 24.126 1.00 0.00 ? 313 PHE A C    3 
ATOM 1239 O O    . PHE A 1 7  ? 50.648 39.825 24.175 1.00 0.00 ? 313 PHE A O    3 
ATOM 1240 C CB   . PHE A 1 7  ? 51.284 37.968 26.527 1.00 0.00 ? 313 PHE A CB   3 
ATOM 1241 C CG   . PHE A 1 7  ? 50.179 38.007 27.561 1.00 0.00 ? 313 PHE A CG   3 
ATOM 1242 C CD1  . PHE A 1 7  ? 49.371 39.149 27.667 1.00 0.00 ? 313 PHE A CD1  3 
ATOM 1243 C CD2  . PHE A 1 7  ? 49.942 36.891 28.389 1.00 0.00 ? 313 PHE A CD2  3 
ATOM 1244 C CE1  . PHE A 1 7  ? 48.335 39.196 28.620 1.00 0.00 ? 313 PHE A CE1  3 
ATOM 1245 C CE2  . PHE A 1 7  ? 48.897 36.937 29.342 1.00 0.00 ? 313 PHE A CE2  3 
ATOM 1246 C CZ   . PHE A 1 7  ? 48.099 38.089 29.448 1.00 0.00 ? 313 PHE A CZ   3 
ATOM 1247 H H    . PHE A 1 7  ? 52.070 35.923 25.164 1.00 0.00 ? 313 PHE A H    3 
ATOM 1248 H HA   . PHE A 1 7  ? 49.679 37.650 25.136 1.00 0.00 ? 313 PHE A HA   3 
ATOM 1249 H HB2  . PHE A 1 7  ? 52.045 37.248 26.840 1.00 0.00 ? 313 PHE A HB2  3 
ATOM 1250 H HB3  . PHE A 1 7  ? 51.765 38.943 26.525 1.00 0.00 ? 313 PHE A HB3  3 
ATOM 1251 H HD1  . PHE A 1 7  ? 49.534 40.001 27.025 1.00 0.00 ? 313 PHE A HD1  3 
ATOM 1252 H HD2  . PHE A 1 7  ? 50.543 36.002 28.305 1.00 0.00 ? 313 PHE A HD2  3 
ATOM 1253 H HE1  . PHE A 1 7  ? 47.705 40.075 28.704 1.00 0.00 ? 313 PHE A HE1  3 
ATOM 1254 H HE2  . PHE A 1 7  ? 48.714 36.085 29.973 1.00 0.00 ? 313 PHE A HE2  3 
ATOM 1255 H HZ   . PHE A 1 7  ? 47.295 38.117 30.173 1.00 0.00 ? 313 PHE A HZ   3 
ATOM 1256 N N    . GLY A 1 8  ? 52.209 38.495 23.308 1.00 0.00 ? 314 GLY A N    3 
ATOM 1257 C CA   . GLY A 1 8  ? 52.805 39.485 22.405 1.00 0.00 ? 314 GLY A CA   3 
ATOM 1258 C C    . GLY A 1 8  ? 53.534 40.665 23.058 1.00 0.00 ? 314 GLY A C    3 
ATOM 1259 O O    . GLY A 1 8  ? 54.483 41.179 22.460 1.00 0.00 ? 314 GLY A O    3 
ATOM 1260 H H    . GLY A 1 8  ? 52.569 37.550 23.284 1.00 0.00 ? 314 GLY A H    3 
ATOM 1261 H HA2  . GLY A 1 8  ? 53.533 38.971 21.772 1.00 0.00 ? 314 GLY A HA2  3 
ATOM 1262 H HA3  . GLY A 1 8  ? 52.023 39.888 21.770 1.00 0.00 ? 314 GLY A HA3  3 
ATOM 1263 N N    . ALA A 1 9  ? 53.131 41.081 24.266 1.00 0.00 ? 315 ALA A N    3 
ATOM 1264 C CA   . ALA A 1 9  ? 53.680 42.214 25.010 1.00 0.00 ? 315 ALA A CA   3 
ATOM 1265 C C    . ALA A 1 9  ? 54.951 41.871 25.816 1.00 0.00 ? 315 ALA A C    3 
ATOM 1266 O O    . ALA A 1 9  ? 55.699 42.762 26.187 1.00 0.00 ? 315 ALA A O    3 
ATOM 1267 C CB   . ALA A 1 9  ? 52.580 42.731 25.941 1.00 0.00 ? 315 ALA A CB   3 
ATOM 1268 H H    . ALA A 1 9  ? 52.255 40.698 24.591 1.00 0.00 ? 315 ALA A H    3 
ATOM 1269 H HA   . ALA A 1 9  ? 53.932 42.993 24.301 1.00 0.00 ? 315 ALA A HA   3 
ATOM 1270 H HB1  . ALA A 1 9  ? 52.937 43.620 26.460 1.00 0.00 ? 315 ALA A HB1  3 
ATOM 1271 H HB2  . ALA A 1 9  ? 51.686 42.996 25.369 1.00 0.00 ? 315 ALA A HB2  3 
ATOM 1272 H HB3  . ALA A 1 9  ? 52.317 41.972 26.679 1.00 0.00 ? 315 ALA A HB3  3 
ATOM 1273 N N    . PHE A 1 10 ? 55.166 40.585 26.091 1.00 0.00 ? 316 PHE A N    3 
ATOM 1274 C CA   . PHE A 1 10 ? 56.366 40.089 26.770 1.00 0.00 ? 316 PHE A CA   3 
ATOM 1275 C C    . PHE A 1 10 ? 56.703 38.653 26.329 1.00 0.00 ? 316 PHE A C    3 
ATOM 1276 O O    . PHE A 1 10 ? 57.783 38.388 25.832 1.00 0.00 ? 316 PHE A O    3 
ATOM 1277 C CB   . PHE A 1 10 ? 56.159 40.181 28.297 1.00 0.00 ? 316 PHE A CB   3 
ATOM 1278 C CG   . PHE A 1 10 ? 57.457 40.386 29.059 1.00 0.00 ? 316 PHE A CG   3 
ATOM 1279 C CD1  . PHE A 1 10 ? 57.940 41.697 29.258 1.00 0.00 ? 316 PHE A CD1  3 
ATOM 1280 C CD2  . PHE A 1 10 ? 58.172 39.291 29.562 1.00 0.00 ? 316 PHE A CD2  3 
ATOM 1281 C CE1  . PHE A 1 10 ? 59.128 41.902 29.969 1.00 0.00 ? 316 PHE A CE1  3 
ATOM 1282 C CE2  . PHE A 1 10 ? 59.370 39.496 30.273 1.00 0.00 ? 316 PHE A CE2  3 
ATOM 1283 C CZ   . PHE A 1 10 ? 59.843 40.807 30.482 1.00 0.00 ? 316 PHE A CZ   3 
ATOM 1284 H H    . PHE A 1 10 ? 54.511 39.923 25.724 1.00 0.00 ? 316 PHE A H    3 
ATOM 1285 H HA   . PHE A 1 10 ? 57.215 40.723 26.498 1.00 0.00 ? 316 PHE A HA   3 
ATOM 1286 H HB2  . PHE A 1 10 ? 55.517 41.034 28.522 1.00 0.00 ? 316 PHE A HB2  3 
ATOM 1287 H HB3  . PHE A 1 10 ? 55.647 39.296 28.668 1.00 0.00 ? 316 PHE A HB3  3 
ATOM 1288 H HD1  . PHE A 1 10 ? 57.391 42.543 28.863 1.00 0.00 ? 316 PHE A HD1  3 
ATOM 1289 H HD2  . PHE A 1 10 ? 57.812 38.281 29.416 1.00 0.00 ? 316 PHE A HD2  3 
ATOM 1290 H HE1  . PHE A 1 10 ? 59.498 42.912 30.125 1.00 0.00 ? 316 PHE A HE1  3 
ATOM 1291 H HE2  . PHE A 1 10 ? 59.919 38.660 30.668 1.00 0.00 ? 316 PHE A HE2  3 
ATOM 1292 H HZ   . PHE A 1 10 ? 60.762 40.971 31.033 1.00 0.00 ? 316 PHE A HZ   3 
ATOM 1293 N N    . SER A 1 11 ? 55.713 37.755 26.377 1.00 0.00 ? 317 SER A N    3 
ATOM 1294 C CA   . SER A 1 11 ? 55.830 36.324 26.015 1.00 0.00 ? 317 SER A CA   3 
ATOM 1295 C C    . SER A 1 11 ? 55.915 36.054 24.492 1.00 0.00 ? 317 SER A C    3 
ATOM 1296 O O    . SER A 1 11 ? 55.407 35.056 23.985 1.00 0.00 ? 317 SER A O    3 
ATOM 1297 C CB   . SER A 1 11 ? 54.717 35.524 26.710 1.00 0.00 ? 317 SER A CB   3 
ATOM 1298 O OG   . SER A 1 11 ? 55.061 34.162 26.797 1.00 0.00 ? 317 SER A OG   3 
ATOM 1299 H H    . SER A 1 11 ? 54.864 38.047 26.845 1.00 0.00 ? 317 SER A H    3 
ATOM 1300 H HA   . SER A 1 11 ? 56.773 35.974 26.429 1.00 0.00 ? 317 SER A HA   3 
ATOM 1301 H HB2  . SER A 1 11 ? 54.585 35.912 27.719 1.00 0.00 ? 317 SER A HB2  3 
ATOM 1302 H HB3  . SER A 1 11 ? 53.781 35.650 26.161 1.00 0.00 ? 317 SER A HB3  3 
ATOM 1303 H HG   . SER A 1 11 ? 54.433 33.693 27.366 1.00 0.00 ? 317 SER A HG   3 
ATOM 1304 N N    . ILE A 1 12 ? 56.510 36.998 23.730 1.00 0.00 ? 318 ILE A N    3 
ATOM 1305 C CA   . ILE A 1 12 ? 57.016 36.826 22.347 1.00 0.00 ? 318 ILE A CA   3 
ATOM 1306 C C    . ILE A 1 12 ? 58.179 37.807 22.098 1.00 0.00 ? 318 ILE A C    3 
ATOM 1307 O O    . ILE A 1 12 ? 59.178 37.440 21.492 1.00 0.00 ? 318 ILE A O    3 
ATOM 1308 C CB   . ILE A 1 12 ? 55.945 37.050 21.245 1.00 0.00 ? 318 ILE A CB   3 
ATOM 1309 C CG1  . ILE A 1 12 ? 54.635 36.259 21.448 1.00 0.00 ? 318 ILE A CG1  3 
ATOM 1310 C CG2  . ILE A 1 12 ? 56.589 36.687 19.887 1.00 0.00 ? 318 ILE A CG2  3 
ATOM 1311 C CD1  . ILE A 1 12 ? 53.564 36.473 20.376 1.00 0.00 ? 318 ILE A CD1  3 
ATOM 1312 H H    . ILE A 1 12 ? 56.965 37.727 24.274 1.00 0.00 ? 318 ILE A H    3 
ATOM 1313 H HA   . ILE A 1 12 ? 57.416 35.819 22.255 1.00 0.00 ? 318 ILE A HA   3 
ATOM 1314 H HB   . ILE A 1 12 ? 55.677 38.112 21.226 1.00 0.00 ? 318 ILE A HB   3 
ATOM 1315 H HG12 . ILE A 1 12 ? 54.863 35.197 21.497 1.00 0.00 ? 318 ILE A HG12 3 
ATOM 1316 H HG13 . ILE A 1 12 ? 54.193 36.568 22.388 1.00 0.00 ? 318 ILE A HG13 3 
ATOM 1317 H HG21 . ILE A 1 12 ? 55.863 36.634 19.074 1.00 0.00 ? 318 ILE A HG21 3 
ATOM 1318 H HG22 . ILE A 1 12 ? 57.329 37.432 19.602 1.00 0.00 ? 318 ILE A HG22 3 
ATOM 1319 H HG23 . ILE A 1 12 ? 57.088 35.723 19.965 1.00 0.00 ? 318 ILE A HG23 3 
ATOM 1320 H HD11 . ILE A 1 12 ? 53.792 35.897 19.482 1.00 0.00 ? 318 ILE A HD11 3 
ATOM 1321 H HD12 . ILE A 1 12 ? 52.598 36.154 20.770 1.00 0.00 ? 318 ILE A HD12 3 
ATOM 1322 H HD13 . ILE A 1 12 ? 53.497 37.528 20.129 1.00 0.00 ? 318 ILE A HD13 3 
ATOM 1323 N N    . ASN A 1 13 ? 58.010 39.070 22.514 1.00 0.00 ? 319 ASN A N    3 
ATOM 1324 C CA   . ASN A 1 13 ? 58.953 40.176 22.341 1.00 0.00 ? 319 ASN A CA   3 
ATOM 1325 C C    . ASN A 1 13 ? 58.659 41.257 23.411 1.00 0.00 ? 319 ASN A C    3 
ATOM 1326 O O    . ASN A 1 13 ? 57.536 41.293 23.924 1.00 0.00 ? 319 ASN A O    3 
ATOM 1327 C CB   . ASN A 1 13 ? 58.768 40.792 20.933 1.00 0.00 ? 319 ASN A CB   3 
ATOM 1328 C CG   . ASN A 1 13 ? 59.798 40.304 19.941 1.00 0.00 ? 319 ASN A CG   3 
ATOM 1329 O OD1  . ASN A 1 13 ? 60.988 40.387 20.165 1.00 0.00 ? 319 ASN A OD1  3 
ATOM 1330 N ND2  . ASN A 1 13 ? 59.390 39.819 18.781 1.00 0.00 ? 319 ASN A ND2  3 
ATOM 1331 H H    . ASN A 1 13 ? 57.179 39.293 23.044 1.00 0.00 ? 319 ASN A H    3 
ATOM 1332 H HA   . ASN A 1 13 ? 59.979 39.828 22.475 1.00 0.00 ? 319 ASN A HA   3 
ATOM 1333 H HB2  . ASN A 1 13 ? 57.758 40.593 20.573 1.00 0.00 ? 319 ASN A HB2  3 
ATOM 1334 H HB3  . ASN A 1 13 ? 58.889 41.872 20.996 1.00 0.00 ? 319 ASN A HB3  3 
ATOM 1335 H HD21 . ASN A 1 13 ? 58.430 39.743 18.558 1.00 0.00 ? 319 ASN A HD21 3 
ATOM 1336 H HD22 . ASN A 1 13 ? 60.130 39.505 18.183 1.00 0.00 ? 319 ASN A HD22 3 
ATOM 1337 N N    . PRO A 1 14 ? 59.607 42.175 23.713 1.00 0.00 ? 320 PRO A N    3 
ATOM 1338 C CA   . PRO A 1 14 ? 59.365 43.321 24.582 1.00 0.00 ? 320 PRO A CA   3 
ATOM 1339 C C    . PRO A 1 14 ? 58.409 44.314 23.891 1.00 0.00 ? 320 PRO A C    3 
ATOM 1340 O O    . PRO A 1 14 ? 58.823 45.036 22.984 1.00 0.00 ? 320 PRO A O    3 
ATOM 1341 C CB   . PRO A 1 14 ? 60.750 43.922 24.844 1.00 0.00 ? 320 PRO A CB   3 
ATOM 1342 C CG   . PRO A 1 14 ? 61.543 43.580 23.577 1.00 0.00 ? 320 PRO A CG   3 
ATOM 1343 C CD   . PRO A 1 14 ? 60.961 42.226 23.169 1.00 0.00 ? 320 PRO A CD   3 
ATOM 1344 H HA   . PRO A 1 14 ? 58.926 43.000 25.528 1.00 0.00 ? 320 PRO A HA   3 
ATOM 1345 H HB2  . PRO A 1 14 ? 60.721 44.997 25.016 1.00 0.00 ? 320 PRO A HB2  3 
ATOM 1346 H HB3  . PRO A 1 14 ? 61.209 43.419 25.700 1.00 0.00 ? 320 PRO A HB3  3 
ATOM 1347 H HG2  . PRO A 1 14 ? 61.336 44.313 22.796 1.00 0.00 ? 320 PRO A HG2  3 
ATOM 1348 H HG3  . PRO A 1 14 ? 62.612 43.513 23.764 1.00 0.00 ? 320 PRO A HG3  3 
ATOM 1349 H HD2  . PRO A 1 14 ? 60.966 42.138 22.081 1.00 0.00 ? 320 PRO A HD2  3 
ATOM 1350 H HD3  . PRO A 1 14 ? 61.560 41.420 23.603 1.00 0.00 ? 320 PRO A HD3  3 
ATOM 1351 N N    . ALA A 1 15 ? 57.137 44.308 24.274 1.00 0.00 ? 321 ALA A N    3 
ATOM 1352 C CA   . ALA A 1 15 ? 55.988 45.015 23.679 1.00 0.00 ? 321 ALA A CA   3 
ATOM 1353 C C    . ALA A 1 15 ? 55.673 44.720 22.195 1.00 0.00 ? 321 ALA A C    3 
ATOM 1354 O O    . ALA A 1 15 ? 54.495 44.683 21.819 1.00 0.00 ? 321 ALA A O    3 
ATOM 1355 C CB   . ALA A 1 15 ? 56.113 46.512 23.971 1.00 0.00 ? 321 ALA A CB   3 
ATOM 1356 H H    . ALA A 1 15 ? 56.906 43.670 25.030 1.00 0.00 ? 321 ALA A H    3 
ATOM 1357 H HA   . ALA A 1 15 ? 55.111 44.689 24.233 1.00 0.00 ? 321 ALA A HA   3 
ATOM 1358 H HB1  . ALA A 1 15 ? 55.200 47.024 23.643 1.00 0.00 ? 321 ALA A HB1  3 
ATOM 1359 H HB2  . ALA A 1 15 ? 56.238 46.679 25.048 1.00 0.00 ? 321 ALA A HB2  3 
ATOM 1360 H HB3  . ALA A 1 15 ? 56.961 46.939 23.444 1.00 0.00 ? 321 ALA A HB3  3 
ATOM 1361 N N    . MET A 1 16 ? 56.686 44.487 21.356 1.00 0.00 ? 322 MET A N    3 
ATOM 1362 C CA   . MET A 1 16 ? 56.665 44.589 19.883 1.00 0.00 ? 322 MET A CA   3 
ATOM 1363 C C    . MET A 1 16 ? 55.492 43.884 19.194 1.00 0.00 ? 322 MET A C    3 
ATOM 1364 O O    . MET A 1 16 ? 54.873 44.448 18.296 1.00 0.00 ? 322 MET A O    3 
ATOM 1365 C CB   . MET A 1 16 ? 58.002 44.021 19.354 1.00 0.00 ? 322 MET A CB   3 
ATOM 1366 C CG   . MET A 1 16 ? 58.507 44.672 18.070 1.00 0.00 ? 322 MET A CG   3 
ATOM 1367 S SD   . MET A 1 16 ? 59.769 45.936 18.364 1.00 0.00 ? 322 MET A SD   3 
ATOM 1368 C CE   . MET A 1 16 ? 60.933 45.558 17.020 1.00 0.00 ? 322 MET A CE   3 
ATOM 1369 H H    . MET A 1 16 ? 57.604 44.568 21.779 1.00 0.00 ? 322 MET A H    3 
ATOM 1370 H HA   . MET A 1 16 ? 56.618 45.653 19.625 1.00 0.00 ? 322 MET A HA   3 
ATOM 1371 H HB2  . MET A 1 16 ? 58.779 44.132 20.116 1.00 0.00 ? 322 MET A HB2  3 
ATOM 1372 H HB3  . MET A 1 16 ? 57.882 42.957 19.171 1.00 0.00 ? 322 MET A HB3  3 
ATOM 1373 H HG2  . MET A 1 16 ? 58.942 43.891 17.452 1.00 0.00 ? 322 MET A HG2  3 
ATOM 1374 H HG3  . MET A 1 16 ? 57.675 45.117 17.514 1.00 0.00 ? 322 MET A HG3  3 
ATOM 1375 H HE1  . MET A 1 16 ? 61.819 46.191 17.118 1.00 0.00 ? 322 MET A HE1  3 
ATOM 1376 H HE2  . MET A 1 16 ? 61.231 44.516 17.068 1.00 0.00 ? 322 MET A HE2  3 
ATOM 1377 H HE3  . MET A 1 16 ? 60.450 45.759 16.052 1.00 0.00 ? 322 MET A HE3  3 
ATOM 1378 N N    . MET A 1 17 ? 55.166 42.648 19.595 1.00 0.00 ? 323 MET A N    3 
ATOM 1379 C CA   . MET A 1 17 ? 54.121 41.842 18.940 1.00 0.00 ? 323 MET A CA   3 
ATOM 1380 C C    . MET A 1 17 ? 52.713 42.328 19.339 1.00 0.00 ? 323 MET A C    3 
ATOM 1381 O O    . MET A 1 17 ? 51.839 42.426 18.482 1.00 0.00 ? 323 MET A O    3 
ATOM 1382 C CB   . MET A 1 17 ? 54.312 40.358 19.289 1.00 0.00 ? 323 MET A CB   3 
ATOM 1383 C CG   . MET A 1 17 ? 54.629 39.444 18.104 1.00 0.00 ? 323 MET A CG   3 
ATOM 1384 S SD   . MET A 1 17 ? 53.322 39.067 16.897 1.00 0.00 ? 323 MET A SD   3 
ATOM 1385 C CE   . MET A 1 17 ? 51.842 38.729 17.908 1.00 0.00 ? 323 MET A CE   3 
ATOM 1386 H H    . MET A 1 17 ? 55.627 42.284 20.417 1.00 0.00 ? 323 MET A H    3 
ATOM 1387 H HA   . MET A 1 17 ? 54.198 41.963 17.857 1.00 0.00 ? 323 MET A HA   3 
ATOM 1388 H HB2  . MET A 1 17 ? 55.127 40.248 20.007 1.00 0.00 ? 323 MET A HB2  3 
ATOM 1389 H HB3  . MET A 1 17 ? 53.415 39.981 19.784 1.00 0.00 ? 323 MET A HB3  3 
ATOM 1390 H HG2  . MET A 1 17 ? 55.477 39.861 17.568 1.00 0.00 ? 323 MET A HG2  3 
ATOM 1391 H HG3  . MET A 1 17 ? 54.946 38.490 18.511 1.00 0.00 ? 323 MET A HG3  3 
ATOM 1392 H HE1  . MET A 1 17 ? 50.994 38.552 17.257 1.00 0.00 ? 323 MET A HE1  3 
ATOM 1393 H HE2  . MET A 1 17 ? 51.999 37.854 18.541 1.00 0.00 ? 323 MET A HE2  3 
ATOM 1394 H HE3  . MET A 1 17 ? 51.608 39.598 18.534 1.00 0.00 ? 323 MET A HE3  3 
ATOM 1395 N N    . ALA A 1 18 ? 52.500 42.663 20.610 1.00 0.00 ? 324 ALA A N    3 
ATOM 1396 C CA   . ALA A 1 18 ? 51.223 43.229 21.049 1.00 0.00 ? 324 ALA A CA   3 
ATOM 1397 C C    . ALA A 1 18 ? 51.012 44.627 20.471 1.00 0.00 ? 324 ALA A C    3 
ATOM 1398 O O    . ALA A 1 18 ? 49.928 44.917 19.987 1.00 0.00 ? 324 ALA A O    3 
ATOM 1399 C CB   . ALA A 1 18 ? 51.155 43.240 22.578 1.00 0.00 ? 324 ALA A CB   3 
ATOM 1400 H H    . ALA A 1 18 ? 53.276 42.652 21.255 1.00 0.00 ? 324 ALA A H    3 
ATOM 1401 H HA   . ALA A 1 18 ? 50.409 42.598 20.680 1.00 0.00 ? 324 ALA A HA   3 
ATOM 1402 H HB1  . ALA A 1 18 ? 50.238 43.748 22.890 1.00 0.00 ? 324 ALA A HB1  3 
ATOM 1403 H HB2  . ALA A 1 18 ? 51.101 42.219 22.945 1.00 0.00 ? 324 ALA A HB2  3 
ATOM 1404 H HB3  . ALA A 1 18 ? 52.008 43.761 22.990 1.00 0.00 ? 324 ALA A HB3  3 
ATOM 1405 N N    . ALA A 1 19 ? 52.061 45.465 20.445 1.00 0.00 ? 325 ALA A N    3 
ATOM 1406 C CA   . ALA A 1 19 ? 52.009 46.780 19.830 1.00 0.00 ? 325 ALA A CA   3 
ATOM 1407 C C    . ALA A 1 19 ? 51.677 46.685 18.330 1.00 0.00 ? 325 ALA A C    3 
ATOM 1408 O O    . ALA A 1 19 ? 50.757 47.344 17.868 1.00 0.00 ? 325 ALA A O    3 
ATOM 1409 C CB   . ALA A 1 19 ? 53.326 47.513 20.098 1.00 0.00 ? 325 ALA A CB   3 
ATOM 1410 H H    . ALA A 1 19 ? 52.936 45.167 20.878 1.00 0.00 ? 325 ALA A H    3 
ATOM 1411 H HA   . ALA A 1 19 ? 51.203 47.351 20.291 1.00 0.00 ? 325 ALA A HA   3 
ATOM 1412 H HB1  . ALA A 1 19 ? 53.289 48.513 19.672 1.00 0.00 ? 325 ALA A HB1  3 
ATOM 1413 H HB2  . ALA A 1 19 ? 53.491 47.599 21.178 1.00 0.00 ? 325 ALA A HB2  3 
ATOM 1414 H HB3  . ALA A 1 19 ? 54.162 46.962 19.657 1.00 0.00 ? 325 ALA A HB3  3 
ATOM 1415 N N    . ALA A 1 20 ? 52.362 45.817 17.566 1.00 0.00 ? 326 ALA A N    3 
ATOM 1416 C CA   . ALA A 1 20 ? 52.118 45.643 16.139 1.00 0.00 ? 326 ALA A CA   3 
ATOM 1417 C C    . ALA A 1 20 ? 50.694 45.150 15.814 1.00 0.00 ? 326 ALA A C    3 
ATOM 1418 O O    . ALA A 1 20 ? 50.065 45.664 14.897 1.00 0.00 ? 326 ALA A O    3 
ATOM 1419 C CB   . ALA A 1 20 ? 53.181 44.706 15.569 1.00 0.00 ? 326 ALA A CB   3 
ATOM 1420 H H    . ALA A 1 20 ? 53.134 45.299 17.984 1.00 0.00 ? 326 ALA A H    3 
ATOM 1421 H HA   . ALA A 1 20 ? 52.232 46.620 15.654 1.00 0.00 ? 326 ALA A HA   3 
ATOM 1422 H HB1  . ALA A 1 20 ? 53.036 44.590 14.491 1.00 0.00 ? 326 ALA A HB1  3 
ATOM 1423 H HB2  . ALA A 1 20 ? 54.175 45.130 15.733 1.00 0.00 ? 326 ALA A HB2  3 
ATOM 1424 H HB3  . ALA A 1 20 ? 53.118 43.729 16.044 1.00 0.00 ? 326 ALA A HB3  3 
ATOM 1425 N N    . GLN A 1 21 ? 50.159 44.186 16.576 1.00 0.00 ? 327 GLN A N    3 
ATOM 1426 C CA   . GLN A 1 21 ? 48.775 43.726 16.401 1.00 0.00 ? 327 GLN A CA   3 
ATOM 1427 C C    . GLN A 1 21 ? 47.744 44.770 16.868 1.00 0.00 ? 327 GLN A C    3 
ATOM 1428 O O    . GLN A 1 21 ? 46.740 44.984 16.187 1.00 0.00 ? 327 GLN A O    3 
ATOM 1429 C CB   . GLN A 1 21 ? 48.577 42.365 17.085 1.00 0.00 ? 327 GLN A CB   3 
ATOM 1430 C CG   . GLN A 1 21 ? 48.519 41.180 16.105 1.00 0.00 ? 327 GLN A CG   3 
ATOM 1431 C CD   . GLN A 1 21 ? 49.782 40.995 15.267 1.00 0.00 ? 327 GLN A CD   3 
ATOM 1432 O OE1  . GLN A 1 21 ? 50.877 40.795 15.758 1.00 0.00 ? 327 GLN A OE1  3 
ATOM 1433 N NE2  . GLN A 1 21 ? 49.690 40.982 13.956 1.00 0.00 ? 327 GLN A NE2  3 
ATOM 1434 H H    . GLN A 1 21 ? 50.731 43.748 17.291 1.00 0.00 ? 327 GLN A H    3 
ATOM 1435 H HA   . GLN A 1 21 ? 48.600 43.600 15.333 1.00 0.00 ? 327 GLN A HA   3 
ATOM 1436 H HB2  . GLN A 1 21 ? 49.350 42.186 17.834 1.00 0.00 ? 327 GLN A HB2  3 
ATOM 1437 H HB3  . GLN A 1 21 ? 47.623 42.380 17.630 1.00 0.00 ? 327 GLN A HB3  3 
ATOM 1438 H HG2  . GLN A 1 21 ? 48.356 40.266 16.668 1.00 0.00 ? 327 GLN A HG2  3 
ATOM 1439 H HG3  . GLN A 1 21 ? 47.664 41.323 15.447 1.00 0.00 ? 327 GLN A HG3  3 
ATOM 1440 H HE21 . GLN A 1 21 ? 48.814 41.160 13.506 1.00 0.00 ? 327 GLN A HE21 3 
ATOM 1441 H HE22 . GLN A 1 21 ? 50.562 40.919 13.452 1.00 0.00 ? 327 GLN A HE22 3 
ATOM 1442 N N    . ALA A 1 22 ? 47.965 45.428 18.013 1.00 0.00 ? 328 ALA A N    3 
ATOM 1443 C CA   . ALA A 1 22 ? 46.991 46.354 18.593 1.00 0.00 ? 328 ALA A CA   3 
ATOM 1444 C C    . ALA A 1 22 ? 46.990 47.748 17.957 1.00 0.00 ? 328 ALA A C    3 
ATOM 1445 O O    . ALA A 1 22 ? 45.977 48.432 18.044 1.00 0.00 ? 328 ALA A O    3 
ATOM 1446 C CB   . ALA A 1 22 ? 47.193 46.421 20.113 1.00 0.00 ? 328 ALA A CB   3 
ATOM 1447 H H    . ALA A 1 22 ? 48.799 45.222 18.553 1.00 0.00 ? 328 ALA A H    3 
ATOM 1448 H HA   . ALA A 1 22 ? 45.998 45.930 18.429 1.00 0.00 ? 328 ALA A HA   3 
ATOM 1449 H HB1  . ALA A 1 22 ? 46.397 47.012 20.564 1.00 0.00 ? 328 ALA A HB1  3 
ATOM 1450 H HB2  . ALA A 1 22 ? 47.160 45.412 20.539 1.00 0.00 ? 328 ALA A HB2  3 
ATOM 1451 H HB3  . ALA A 1 22 ? 48.157 46.876 20.347 1.00 0.00 ? 328 ALA A HB3  3 
ATOM 1452 N N    . ALA A 1 23 ? 48.069 48.169 17.282 1.00 0.00 ? 329 ALA A N    3 
ATOM 1453 C CA   . ALA A 1 23 ? 48.207 49.492 16.678 1.00 0.00 ? 329 ALA A CA   3 
ATOM 1454 C C    . ALA A 1 23 ? 47.036 49.861 15.752 1.00 0.00 ? 329 ALA A C    3 
ATOM 1455 O O    . ALA A 1 23 ? 46.477 50.940 15.861 1.00 0.00 ? 329 ALA A O    3 
ATOM 1456 C CB   . ALA A 1 23 ? 49.532 49.547 15.903 1.00 0.00 ? 329 ALA A CB   3 
ATOM 1457 H H    . ALA A 1 23 ? 48.902 47.580 17.312 1.00 0.00 ? 329 ALA A H    3 
ATOM 1458 H HA   . ALA A 1 23 ? 48.240 50.242 17.469 1.00 0.00 ? 329 ALA A HA   3 
ATOM 1459 H HB1  . ALA A 1 23 ? 49.595 50.482 15.349 1.00 0.00 ? 329 ALA A HB1  3 
ATOM 1460 H HB2  . ALA A 1 23 ? 50.367 49.496 16.600 1.00 0.00 ? 329 ALA A HB2  3 
ATOM 1461 H HB3  . ALA A 1 23 ? 49.597 48.708 15.205 1.00 0.00 ? 329 ALA A HB3  3 
ATOM 1462 N N    . LEU A 1 24 ? 46.631 48.932 14.873 1.00 0.00 ? 330 LEU A N    3 
ATOM 1463 C CA   . LEU A 1 24 ? 45.508 49.141 13.951 1.00 0.00 ? 330 LEU A CA   3 
ATOM 1464 C C    . LEU A 1 24 ? 44.189 48.601 14.538 1.00 0.00 ? 330 LEU A C    3 
ATOM 1465 O O    . LEU A 1 24 ? 43.137 49.207 14.337 1.00 0.00 ? 330 LEU A O    3 
ATOM 1466 C CB   . LEU A 1 24 ? 45.800 48.542 12.568 1.00 0.00 ? 330 LEU A CB   3 
ATOM 1467 C CG   . LEU A 1 24 ? 47.197 48.892 12.006 1.00 0.00 ? 330 LEU A CG   3 
ATOM 1468 C CD1  . LEU A 1 24 ? 48.173 47.726 12.202 1.00 0.00 ? 330 LEU A CD1  3 
ATOM 1469 C CD2  . LEU A 1 24 ? 47.139 49.194 10.508 1.00 0.00 ? 330 LEU A CD2  3 
ATOM 1470 H H    . LEU A 1 24 ? 47.152 48.065 14.829 1.00 0.00 ? 330 LEU A H    3 
ATOM 1471 H HA   . LEU A 1 24 ? 45.361 50.209 13.813 1.00 0.00 ? 330 LEU A HA   3 
ATOM 1472 H HB2  . LEU A 1 24 ? 45.678 47.453 12.596 1.00 0.00 ? 330 LEU A HB2  3 
ATOM 1473 H HB3  . LEU A 1 24 ? 45.038 48.923 11.884 1.00 0.00 ? 330 LEU A HB3  3 
ATOM 1474 H HG   . LEU A 1 24 ? 47.594 49.771 12.506 1.00 0.00 ? 330 LEU A HG   3 
ATOM 1475 H HD11 . LEU A 1 24 ? 49.168 48.006 11.850 1.00 0.00 ? 330 LEU A HD11 3 
ATOM 1476 H HD12 . LEU A 1 24 ? 48.244 47.452 13.260 1.00 0.00 ? 330 LEU A HD12 3 
ATOM 1477 H HD13 . LEU A 1 24 ? 47.837 46.855 11.643 1.00 0.00 ? 330 LEU A HD13 3 
ATOM 1478 H HD21 . LEU A 1 24 ? 46.519 50.077 10.341 1.00 0.00 ? 330 LEU A HD21 3 
ATOM 1479 H HD22 . LEU A 1 24 ? 48.143 49.403 10.138 1.00 0.00 ? 330 LEU A HD22 3 
ATOM 1480 H HD23 . LEU A 1 24 ? 46.723 48.344 9.967  1.00 0.00 ? 330 LEU A HD23 3 
ATOM 1481 N N    . GLN A 1 25 ? 44.263 47.510 15.317 1.00 0.00 ? 331 GLN A N    3 
ATOM 1482 C CA   . GLN A 1 25 ? 43.082 46.919 15.956 1.00 0.00 ? 331 GLN A CA   3 
ATOM 1483 C C    . GLN A 1 25 ? 42.417 47.892 16.938 1.00 0.00 ? 331 GLN A C    3 
ATOM 1484 O O    . GLN A 1 25 ? 41.197 47.898 17.021 1.00 0.00 ? 331 GLN A O    3 
ATOM 1485 C CB   . GLN A 1 25 ? 43.484 45.591 16.623 1.00 0.00 ? 331 GLN A CB   3 
ATOM 1486 C CG   . GLN A 1 25 ? 42.332 44.589 16.833 1.00 0.00 ? 331 GLN A CG   3 
ATOM 1487 C CD   . GLN A 1 25 ? 41.290 44.988 17.877 1.00 0.00 ? 331 GLN A CD   3 
ATOM 1488 O OE1  . GLN A 1 25 ? 40.123 45.143 17.597 1.00 0.00 ? 331 GLN A OE1  3 
ATOM 1489 N NE2  . GLN A 1 25 ? 41.665 45.146 19.136 1.00 0.00 ? 331 GLN A NE2  3 
ATOM 1490 H H    . GLN A 1 25 ? 45.157 47.063 15.444 1.00 0.00 ? 331 GLN A H    3 
ATOM 1491 H HA   . GLN A 1 25 ? 42.354 46.707 15.178 1.00 0.00 ? 331 GLN A HA   3 
ATOM 1492 H HB2  . GLN A 1 25 ? 44.192 45.086 15.970 1.00 0.00 ? 331 GLN A HB2  3 
ATOM 1493 H HB3  . GLN A 1 25 ? 43.971 45.790 17.571 1.00 0.00 ? 331 GLN A HB3  3 
ATOM 1494 H HG2  . GLN A 1 25 ? 41.825 44.410 15.885 1.00 0.00 ? 331 GLN A HG2  3 
ATOM 1495 H HG3  . GLN A 1 25 ? 42.770 43.642 17.160 1.00 0.00 ? 331 GLN A HG3  3 
ATOM 1496 H HE21 . GLN A 1 25 ? 42.612 45.013 19.415 1.00 0.00 ? 331 GLN A HE21 3 
ATOM 1497 H HE22 . GLN A 1 25 ? 40.934 45.411 19.765 1.00 0.00 ? 331 GLN A HE22 3 
ATOM 1498 N N    . SER A 1 26 ? 43.163 48.781 17.599 1.00 0.00 ? 332 SER A N    3 
ATOM 1499 C CA   . SER A 1 26 ? 42.589 49.811 18.490 1.00 0.00 ? 332 SER A CA   3 
ATOM 1500 C C    . SER A 1 26 ? 41.553 50.684 17.771 1.00 0.00 ? 332 SER A C    3 
ATOM 1501 O O    . SER A 1 26 ? 40.503 50.961 18.328 1.00 0.00 ? 332 SER A O    3 
ATOM 1502 C CB   . SER A 1 26 ? 43.696 50.704 19.053 1.00 0.00 ? 332 SER A CB   3 
ATOM 1503 O OG   . SER A 1 26 ? 44.613 49.943 19.818 1.00 0.00 ? 332 SER A OG   3 
ATOM 1504 H H    . SER A 1 26 ? 44.173 48.738 17.506 1.00 0.00 ? 332 SER A H    3 
ATOM 1505 H HA   . SER A 1 26 ? 42.089 49.318 19.320 1.00 0.00 ? 332 SER A HA   3 
ATOM 1506 H HB2  . SER A 1 26 ? 44.226 51.207 18.242 1.00 0.00 ? 332 SER A HB2  3 
ATOM 1507 H HB3  . SER A 1 26 ? 43.250 51.456 19.701 1.00 0.00 ? 332 SER A HB3  3 
ATOM 1508 H HG   . SER A 1 26 ? 45.171 49.441 19.204 1.00 0.00 ? 332 SER A HG   3 
ATOM 1509 N N    . SER A 1 27 ? 41.804 51.049 16.502 1.00 0.00 ? 333 SER A N    3 
ATOM 1510 C CA   . SER A 1 27 ? 40.898 51.858 15.676 1.00 0.00 ? 333 SER A CA   3 
ATOM 1511 C C    . SER A 1 27 ? 39.602 51.123 15.318 1.00 0.00 ? 333 SER A C    3 
ATOM 1512 O O    . SER A 1 27 ? 38.559 51.761 15.176 1.00 0.00 ? 333 SER A O    3 
ATOM 1513 C CB   . SER A 1 27 ? 41.620 52.267 14.389 1.00 0.00 ? 333 SER A CB   3 
ATOM 1514 O OG   . SER A 1 27 ? 42.825 52.932 14.708 1.00 0.00 ? 333 SER A OG   3 
ATOM 1515 H H    . SER A 1 27 ? 42.684 50.768 16.084 1.00 0.00 ? 333 SER A H    3 
ATOM 1516 H HA   . SER A 1 27 ? 40.634 52.755 16.222 1.00 0.00 ? 333 SER A HA   3 
ATOM 1517 H HB2  . SER A 1 27 ? 41.834 51.388 13.793 1.00 0.00 ? 333 SER A HB2  3 
ATOM 1518 H HB3  . SER A 1 27 ? 40.970 52.939 13.818 1.00 0.00 ? 333 SER A HB3  3 
ATOM 1519 H HG   . SER A 1 27 ? 43.332 53.075 13.897 1.00 0.00 ? 333 SER A HG   3 
ATOM 1520 N N    . TRP A 1 28 ? 39.638 49.799 15.203 1.00 0.00 ? 334 TRP A N    3 
ATOM 1521 C CA   . TRP A 1 28 ? 38.450 48.955 14.968 1.00 0.00 ? 334 TRP A CA   3 
ATOM 1522 C C    . TRP A 1 28 ? 37.719 48.658 16.292 1.00 0.00 ? 334 TRP A C    3 
ATOM 1523 O O    . TRP A 1 28 ? 36.500 48.764 16.393 1.00 0.00 ? 334 TRP A O    3 
ATOM 1524 C CB   . TRP A 1 28 ? 38.880 47.671 14.243 1.00 0.00 ? 334 TRP A CB   3 
ATOM 1525 C CG   . TRP A 1 28 ? 39.729 47.860 13.013 1.00 0.00 ? 334 TRP A CG   3 
ATOM 1526 C CD1  . TRP A 1 28 ? 39.616 48.879 12.135 1.00 0.00 ? 334 TRP A CD1  3 
ATOM 1527 C CD2  . TRP A 1 28 ? 40.823 47.035 12.520 1.00 0.00 ? 334 TRP A CD2  3 
ATOM 1528 N NE1  . TRP A 1 28 ? 40.590 48.763 11.153 1.00 0.00 ? 334 TRP A NE1  3 
ATOM 1529 C CE2  . TRP A 1 28 ? 41.367 47.649 11.346 1.00 0.00 ? 334 TRP A CE2  3 
ATOM 1530 C CE3  . TRP A 1 28 ? 41.418 45.819 12.935 1.00 0.00 ? 334 TRP A CE3  3 
ATOM 1531 C CZ2  . TRP A 1 28 ? 42.455 47.108 10.646 1.00 0.00 ? 334 TRP A CZ2  3 
ATOM 1532 C CZ3  . TRP A 1 28 ? 42.516 45.268 12.235 1.00 0.00 ? 334 TRP A CZ3  3 
ATOM 1533 C CH2  . TRP A 1 28 ? 43.039 45.913 11.101 1.00 0.00 ? 334 TRP A CH2  3 
ATOM 1534 H H    . TRP A 1 28 ? 40.522 49.322 15.330 1.00 0.00 ? 334 TRP A H    3 
ATOM 1535 H HA   . TRP A 1 28 ? 37.749 49.487 14.330 1.00 0.00 ? 334 TRP A HA   3 
ATOM 1536 H HB2  . TRP A 1 28 ? 39.449 47.053 14.943 1.00 0.00 ? 334 TRP A HB2  3 
ATOM 1537 H HB3  . TRP A 1 28 ? 37.986 47.114 13.973 1.00 0.00 ? 334 TRP A HB3  3 
ATOM 1538 H HD1  . TRP A 1 28 ? 38.894 49.689 12.210 1.00 0.00 ? 334 TRP A HD1  3 
ATOM 1539 H HE1  . TRP A 1 28 ? 40.692 49.422 10.396 1.00 0.00 ? 334 TRP A HE1  3 
ATOM 1540 H HE3  . TRP A 1 28 ? 41.017 45.305 13.786 1.00 0.00 ? 334 TRP A HE3  3 
ATOM 1541 H HZ2  . TRP A 1 28 ? 42.835 47.602 9.765  1.00 0.00 ? 334 TRP A HZ2  3 
ATOM 1542 H HZ3  . TRP A 1 28 ? 42.954 44.342 12.571 1.00 0.00 ? 334 TRP A HZ3  3 
ATOM 1543 H HH2  . TRP A 1 28 ? 43.878 45.480 10.566 1.00 0.00 ? 334 TRP A HH2  3 
ATOM 1544 N N    . GLY A 1 29 ? 38.500 48.396 17.343 1.00 0.00 ? 335 GLY A N    3 
ATOM 1545 C CA   . GLY A 1 29 ? 38.060 48.187 18.717 1.00 0.00 ? 335 GLY A CA   3 
ATOM 1546 C C    . GLY A 1 29 ? 37.269 49.360 19.282 1.00 0.00 ? 335 GLY A C    3 
ATOM 1547 O O    . GLY A 1 29 ? 36.332 49.110 20.024 1.00 0.00 ? 335 GLY A O    3 
ATOM 1548 H H    . GLY A 1 29 ? 39.490 48.291 17.172 1.00 0.00 ? 335 GLY A H    3 
ATOM 1549 H HA2  . GLY A 1 29 ? 37.440 47.284 18.767 1.00 0.00 ? 335 GLY A HA2  3 
ATOM 1550 H HA3  . GLY A 1 29 ? 38.935 48.033 19.346 1.00 0.00 ? 335 GLY A HA3  3 
ATOM 1551 N N    . MET A 1 30 ? 37.526 50.607 18.861 1.00 0.00 ? 336 MET A N    3 
ATOM 1552 C CA   . MET A 1 30 ? 36.686 51.756 19.227 1.00 0.00 ? 336 MET A CA   3 
ATOM 1553 C C    . MET A 1 30 ? 35.205 51.515 18.935 1.00 0.00 ? 336 MET A C    3 
ATOM 1554 O O    . MET A 1 30 ? 34.343 51.826 19.753 1.00 0.00 ? 336 MET A O    3 
ATOM 1555 C CB   . MET A 1 30 ? 37.114 53.043 18.476 1.00 0.00 ? 336 MET A CB   3 
ATOM 1556 C CG   . MET A 1 30 ? 38.568 53.462 18.683 1.00 0.00 ? 336 MET A CG   3 
ATOM 1557 S SD   . MET A 1 30 ? 38.818 55.256 18.518 1.00 0.00 ? 336 MET A SD   3 
ATOM 1558 C CE   . MET A 1 30 ? 40.601 55.299 18.236 1.00 0.00 ? 336 MET A CE   3 
ATOM 1559 H H    . MET A 1 30 ? 38.370 50.764 18.312 1.00 0.00 ? 336 MET A H    3 
ATOM 1560 H HA   . MET A 1 30 ? 36.792 51.933 20.303 1.00 0.00 ? 336 MET A HA   3 
ATOM 1561 H HB2  . MET A 1 30 ? 36.939 52.917 17.408 1.00 0.00 ? 336 MET A HB2  3 
ATOM 1562 H HB3  . MET A 1 30 ? 36.471 53.849 18.831 1.00 0.00 ? 336 MET A HB3  3 
ATOM 1563 H HG2  . MET A 1 30 ? 38.909 53.154 19.673 1.00 0.00 ? 336 MET A HG2  3 
ATOM 1564 H HG3  . MET A 1 30 ? 39.167 52.966 17.929 1.00 0.00 ? 336 MET A HG3  3 
ATOM 1565 H HE1  . MET A 1 30 ? 40.952 56.337 18.291 1.00 0.00 ? 336 MET A HE1  3 
ATOM 1566 H HE2  . MET A 1 30 ? 41.120 54.702 18.995 1.00 0.00 ? 336 MET A HE2  3 
ATOM 1567 H HE3  . MET A 1 30 ? 40.822 54.901 17.247 1.00 0.00 ? 336 MET A HE3  3 
ATOM 1568 N N    . MET A 1 31 ? 34.885 50.928 17.768 1.00 0.00 ? 337 MET A N    3 
ATOM 1569 C CA   . MET A 1 31 ? 33.494 50.644 17.398 1.00 0.00 ? 337 MET A CA   3 
ATOM 1570 C C    . MET A 1 31 ? 32.966 49.398 18.117 1.00 0.00 ? 337 MET A C    3 
ATOM 1571 O O    . MET A 1 31 ? 31.823 49.392 18.572 1.00 0.00 ? 337 MET A O    3 
ATOM 1572 C CB   . MET A 1 31 ? 33.361 50.496 15.870 1.00 0.00 ? 337 MET A CB   3 
ATOM 1573 C CG   . MET A 1 31 ? 33.929 51.711 15.122 1.00 0.00 ? 337 MET A CG   3 
ATOM 1574 S SD   . MET A 1 31 ? 33.202 52.016 13.489 1.00 0.00 ? 337 MET A SD   3 
ATOM 1575 C CE   . MET A 1 31 ? 31.657 52.837 14.000 1.00 0.00 ? 337 MET A CE   3 
ATOM 1576 H H    . MET A 1 31 ? 35.625 50.624 17.160 1.00 0.00 ? 337 MET A H    3 
ATOM 1577 H HA   . MET A 1 31 ? 32.871 51.479 17.703 1.00 0.00 ? 337 MET A HA   3 
ATOM 1578 H HB2  . MET A 1 31 ? 33.873 49.601 15.526 1.00 0.00 ? 337 MET A HB2  3 
ATOM 1579 H HB3  . MET A 1 31 ? 32.301 50.391 15.637 1.00 0.00 ? 337 MET A HB3  3 
ATOM 1580 H HG2  . MET A 1 31 ? 33.785 52.608 15.728 1.00 0.00 ? 337 MET A HG2  3 
ATOM 1581 H HG3  . MET A 1 31 ? 35.008 51.565 15.001 1.00 0.00 ? 337 MET A HG3  3 
ATOM 1582 H HE1  . MET A 1 31 ? 31.085 53.101 13.109 1.00 0.00 ? 337 MET A HE1  3 
ATOM 1583 H HE2  . MET A 1 31 ? 31.066 52.160 14.624 1.00 0.00 ? 337 MET A HE2  3 
ATOM 1584 H HE3  . MET A 1 31 ? 31.894 53.739 14.558 1.00 0.00 ? 337 MET A HE3  3 
ATOM 1585 N N    . GLY A 1 32 ? 33.804 48.372 18.279 1.00 0.00 ? 338 GLY A N    3 
ATOM 1586 C CA   . GLY A 1 32 ? 33.477 47.166 19.049 1.00 0.00 ? 338 GLY A CA   3 
ATOM 1587 C C    . GLY A 1 32 ? 33.151 47.447 20.520 1.00 0.00 ? 338 GLY A C    3 
ATOM 1588 O O    . GLY A 1 32 ? 32.172 46.931 21.038 1.00 0.00 ? 338 GLY A O    3 
ATOM 1589 H H    . GLY A 1 32 ? 34.737 48.452 17.892 1.00 0.00 ? 338 GLY A H    3 
ATOM 1590 H HA2  . GLY A 1 32 ? 32.604 46.673 18.596 1.00 0.00 ? 338 GLY A HA2  3 
ATOM 1591 H HA3  . GLY A 1 32 ? 34.319 46.475 19.011 1.00 0.00 ? 338 GLY A HA3  3 
ATOM 1592 N N    . MET A 1 33 ? 33.917 48.336 21.161 1.00 0.00 ? 339 MET A N    3 
ATOM 1593 C CA   . MET A 1 33 ? 33.694 48.784 22.539 1.00 0.00 ? 339 MET A CA   3 
ATOM 1594 C C    . MET A 1 33 ? 32.331 49.474 22.694 1.00 0.00 ? 339 MET A C    3 
ATOM 1595 O O    . MET A 1 33 ? 31.572 49.145 23.588 1.00 0.00 ? 339 MET A O    3 
ATOM 1596 C CB   . MET A 1 33 ? 34.822 49.733 22.961 1.00 0.00 ? 339 MET A CB   3 
ATOM 1597 C CG   . MET A 1 33 ? 36.153 49.014 23.207 1.00 0.00 ? 339 MET A CG   3 
ATOM 1598 S SD   . MET A 1 33 ? 37.635 50.065 23.097 1.00 0.00 ? 339 MET A SD   3 
ATOM 1599 C CE   . MET A 1 33 ? 37.242 51.362 24.302 1.00 0.00 ? 339 MET A CE   3 
ATOM 1600 H H    . MET A 1 33 ? 34.714 48.715 20.676 1.00 0.00 ? 339 MET A H    3 
ATOM 1601 H HA   . MET A 1 33 ? 33.691 47.921 23.212 1.00 0.00 ? 339 MET A HA   3 
ATOM 1602 H HB2  . MET A 1 33 ? 34.955 50.492 22.181 1.00 0.00 ? 339 MET A HB2  3 
ATOM 1603 H HB3  . MET A 1 33 ? 34.533 50.250 23.876 1.00 0.00 ? 339 MET A HB3  3 
ATOM 1604 H HG2  . MET A 1 33 ? 36.112 48.550 24.189 1.00 0.00 ? 339 MET A HG2  3 
ATOM 1605 H HG3  . MET A 1 33 ? 36.268 48.214 22.478 1.00 0.00 ? 339 MET A HG3  3 
ATOM 1606 H HE1  . MET A 1 33 ? 38.089 52.045 24.389 1.00 0.00 ? 339 MET A HE1  3 
ATOM 1607 H HE2  . MET A 1 33 ? 36.371 51.932 23.952 1.00 0.00 ? 339 MET A HE2  3 
ATOM 1608 H HE3  . MET A 1 33 ? 37.022 50.919 25.273 1.00 0.00 ? 339 MET A HE3  3 
ATOM 1609 N N    . LEU A 1 34 ? 31.996 50.414 21.797 1.00 0.00 ? 340 LEU A N    3 
ATOM 1610 C CA   . LEU A 1 34 ? 30.724 51.140 21.861 1.00 0.00 ? 340 LEU A CA   3 
ATOM 1611 C C    . LEU A 1 34 ? 29.525 50.235 21.548 1.00 0.00 ? 340 LEU A C    3 
ATOM 1612 O O    . LEU A 1 34 ? 28.483 50.364 22.199 1.00 0.00 ? 340 LEU A O    3 
ATOM 1613 C CB   . LEU A 1 34 ? 30.792 52.355 20.910 1.00 0.00 ? 340 LEU A CB   3 
ATOM 1614 C CG   . LEU A 1 34 ? 31.822 53.415 21.318 1.00 0.00 ? 340 LEU A CG   3 
ATOM 1615 C CD1  . LEU A 1 34 ? 31.920 54.476 20.221 1.00 0.00 ? 340 LEU A CD1  3 
ATOM 1616 C CD2  . LEU A 1 34 ? 31.472 54.123 22.628 1.00 0.00 ? 340 LEU A CD2  3 
ATOM 1617 H H    . LEU A 1 34 ? 32.663 50.648 21.064 1.00 0.00 ? 340 LEU A H    3 
ATOM 1618 H HA   . LEU A 1 34 ? 30.582 51.499 22.882 1.00 0.00 ? 340 LEU A HA   3 
ATOM 1619 H HB2  . LEU A 1 34 ? 31.024 51.997 19.910 1.00 0.00 ? 340 LEU A HB2  3 
ATOM 1620 H HB3  . LEU A 1 34 ? 29.808 52.826 20.882 1.00 0.00 ? 340 LEU A HB3  3 
ATOM 1621 H HG   . LEU A 1 34 ? 32.806 52.957 21.435 1.00 0.00 ? 340 LEU A HG   3 
ATOM 1622 H HD11 . LEU A 1 34 ? 32.686 55.214 20.476 1.00 0.00 ? 340 LEU A HD11 3 
ATOM 1623 H HD12 . LEU A 1 34 ? 32.220 53.998 19.284 1.00 0.00 ? 340 LEU A HD12 3 
ATOM 1624 H HD13 . LEU A 1 34 ? 30.966 54.973 20.092 1.00 0.00 ? 340 LEU A HD13 3 
ATOM 1625 H HD21 . LEU A 1 34 ? 31.499 53.404 23.457 1.00 0.00 ? 340 LEU A HD21 3 
ATOM 1626 H HD22 . LEU A 1 34 ? 32.199 54.901 22.832 1.00 0.00 ? 340 LEU A HD22 3 
ATOM 1627 H HD23 . LEU A 1 34 ? 30.477 54.563 22.561 1.00 0.00 ? 340 LEU A HD23 3 
ATOM 1628 N N    . ALA A 1 35 ? 29.671 49.299 20.603 1.00 0.00 ? 341 ALA A N    3 
ATOM 1629 C CA   . ALA A 1 35 ? 28.651 48.302 20.313 1.00 0.00 ? 341 ALA A CA   3 
ATOM 1630 C C    . ALA A 1 35 ? 28.444 47.345 21.497 1.00 0.00 ? 341 ALA A C    3 
ATOM 1631 O O    . ALA A 1 35 ? 27.330 47.210 21.995 1.00 0.00 ? 341 ALA A O    3 
ATOM 1632 C CB   . ALA A 1 35 ? 29.031 47.564 19.024 1.00 0.00 ? 341 ALA A CB   3 
ATOM 1633 H H    . ALA A 1 35 ? 30.543 49.265 20.078 1.00 0.00 ? 341 ALA A H    3 
ATOM 1634 H HA   . ALA A 1 35 ? 27.708 48.818 20.144 1.00 0.00 ? 341 ALA A HA   3 
ATOM 1635 H HB1  . ALA A 1 35 ? 28.264 46.836 18.778 1.00 0.00 ? 341 ALA A HB1  3 
ATOM 1636 H HB2  . ALA A 1 35 ? 29.123 48.282 18.205 1.00 0.00 ? 341 ALA A HB2  3 
ATOM 1637 H HB3  . ALA A 1 35 ? 29.984 47.047 19.153 1.00 0.00 ? 341 ALA A HB3  3 
ATOM 1638 N N    . SER A 1 36 ? 29.504 46.716 22.009 1.00 0.00 ? 342 SER A N    3 
ATOM 1639 C CA   . SER A 1 36 ? 29.407 45.735 23.095 1.00 0.00 ? 342 SER A CA   3 
ATOM 1640 C C    . SER A 1 36 ? 29.206 46.344 24.498 1.00 0.00 ? 342 SER A C    3 
ATOM 1641 O O    . SER A 1 36 ? 28.982 45.610 25.447 1.00 0.00 ? 342 SER A O    3 
ATOM 1642 C CB   . SER A 1 36 ? 30.607 44.781 23.076 1.00 0.00 ? 342 SER A CB   3 
ATOM 1643 O OG   . SER A 1 36 ? 30.708 44.166 21.802 1.00 0.00 ? 342 SER A OG   3 
ATOM 1644 H H    . SER A 1 36 ? 30.408 46.835 21.571 1.00 0.00 ? 342 SER A H    3 
ATOM 1645 H HA   . SER A 1 36 ? 28.532 45.119 22.906 1.00 0.00 ? 342 SER A HA   3 
ATOM 1646 H HB2  . SER A 1 36 ? 31.522 45.336 23.287 1.00 0.00 ? 342 SER A HB2  3 
ATOM 1647 H HB3  . SER A 1 36 ? 30.474 44.011 23.836 1.00 0.00 ? 342 SER A HB3  3 
ATOM 1648 H HG   . SER A 1 36 ? 31.269 43.392 21.895 1.00 0.00 ? 342 SER A HG   3 
ATOM 1649 N N    . GLN A 1 37 ? 29.220 47.668 24.634 1.00 0.00 ? 343 GLN A N    3 
ATOM 1650 C CA   . GLN A 1 37 ? 28.840 48.364 25.874 1.00 0.00 ? 343 GLN A CA   3 
ATOM 1651 C C    . GLN A 1 37 ? 27.309 48.417 26.095 1.00 0.00 ? 343 GLN A C    3 
ATOM 1652 O O    . GLN A 1 37 ? 26.863 48.451 27.232 1.00 0.00 ? 343 GLN A O    3 
ATOM 1653 C CB   . GLN A 1 37 ? 29.466 49.767 25.841 1.00 0.00 ? 343 GLN A CB   3 
ATOM 1654 C CG   . GLN A 1 37 ? 29.059 50.701 26.985 1.00 0.00 ? 343 GLN A CG   3 
ATOM 1655 C CD   . GLN A 1 37 ? 29.765 52.051 26.874 1.00 0.00 ? 343 GLN A CD   3 
ATOM 1656 O OE1  . GLN A 1 37 ? 30.614 52.412 27.660 1.00 0.00 ? 343 GLN A OE1  3 
ATOM 1657 N NE2  . GLN A 1 37 ? 29.459 52.839 25.872 1.00 0.00 ? 343 GLN A NE2  3 
ATOM 1658 H H    . GLN A 1 37 ? 29.560 48.234 23.861 1.00 0.00 ? 343 GLN A H    3 
ATOM 1659 H HA   . GLN A 1 37 ? 29.259 47.821 26.731 1.00 0.00 ? 343 GLN A HA   3 
ATOM 1660 H HB2  . GLN A 1 37 ? 30.544 49.656 25.870 1.00 0.00 ? 343 GLN A HB2  3 
ATOM 1661 H HB3  . GLN A 1 37 ? 29.196 50.246 24.897 1.00 0.00 ? 343 GLN A HB3  3 
ATOM 1662 H HG2  . GLN A 1 37 ? 27.981 50.883 26.955 1.00 0.00 ? 343 GLN A HG2  3 
ATOM 1663 H HG3  . GLN A 1 37 ? 29.309 50.243 27.939 1.00 0.00 ? 343 GLN A HG3  3 
ATOM 1664 H HE21 . GLN A 1 37 ? 28.780 52.559 25.185 1.00 0.00 ? 343 GLN A HE21 3 
ATOM 1665 H HE22 . GLN A 1 37 ? 29.949 53.713 25.842 1.00 0.00 ? 343 GLN A HE22 3 
ATOM 1666 N N    . GLN A 1 38 ? 26.516 48.457 25.009 1.00 0.00 ? 344 GLN A N    3 
ATOM 1667 C CA   . GLN A 1 38 ? 25.058 48.686 25.095 1.00 0.00 ? 344 GLN A CA   3 
ATOM 1668 C C    . GLN A 1 38 ? 24.245 47.918 24.050 1.00 0.00 ? 344 GLN A C    3 
ATOM 1669 O O    . GLN A 1 38 ? 23.129 47.487 24.345 1.00 0.00 ? 344 GLN A O    3 
ATOM 1670 C CB   . GLN A 1 38 ? 24.825 50.207 24.994 1.00 0.00 ? 344 GLN A CB   3 
ATOM 1671 C CG   . GLN A 1 38 ? 23.339 50.612 24.946 1.00 0.00 ? 344 GLN A CG   3 
ATOM 1672 C CD   . GLN A 1 38 ? 23.145 52.118 25.066 1.00 0.00 ? 344 GLN A CD   3 
ATOM 1673 O OE1  . GLN A 1 38 ? 22.605 52.629 26.030 1.00 0.00 ? 344 GLN A OE1  3 
ATOM 1674 N NE2  . GLN A 1 38 ? 23.589 52.898 24.107 1.00 0.00 ? 344 GLN A NE2  3 
ATOM 1675 H H    . GLN A 1 38 ? 26.960 48.409 24.112 1.00 0.00 ? 344 GLN A H    3 
ATOM 1676 H HA   . GLN A 1 38 ? 24.698 48.355 26.072 1.00 0.00 ? 344 GLN A HA   3 
ATOM 1677 H HB2  . GLN A 1 38 ? 25.285 50.684 25.855 1.00 0.00 ? 344 GLN A HB2  3 
ATOM 1678 H HB3  . GLN A 1 38 ? 25.304 50.588 24.087 1.00 0.00 ? 344 GLN A HB3  3 
ATOM 1679 H HG2  . GLN A 1 38 ? 22.891 50.283 24.011 1.00 0.00 ? 344 GLN A HG2  3 
ATOM 1680 H HG3  . GLN A 1 38 ? 22.809 50.119 25.776 1.00 0.00 ? 344 GLN A HG3  3 
ATOM 1681 H HE21 . GLN A 1 38 ? 24.040 52.512 23.300 1.00 0.00 ? 344 GLN A HE21 3 
ATOM 1682 H HE22 . GLN A 1 38 ? 23.429 53.874 24.241 1.00 0.00 ? 344 GLN A HE22 3 
ATOM 1683 N N    . ASN A 1 39 ? 24.760 47.720 22.838 1.00 0.00 ? 345 ASN A N    3 
ATOM 1684 C CA   . ASN A 1 39 ? 24.049 47.050 21.751 1.00 0.00 ? 345 ASN A CA   3 
ATOM 1685 C C    . ASN A 1 39 ? 24.262 45.527 21.752 1.00 0.00 ? 345 ASN A C    3 
ATOM 1686 O O    . ASN A 1 39 ? 23.407 44.803 21.246 1.00 0.00 ? 345 ASN A O    3 
ATOM 1687 C CB   . ASN A 1 39 ? 24.504 47.691 20.416 1.00 0.00 ? 345 ASN A CB   3 
ATOM 1688 C CG   . ASN A 1 39 ? 23.400 47.726 19.369 1.00 0.00 ? 345 ASN A CG   3 
ATOM 1689 O OD1  . ASN A 1 39 ? 23.215 48.721 18.692 1.00 0.00 ? 345 ASN A OD1  3 
ATOM 1690 N ND2  . ASN A 1 39 ? 22.630 46.679 19.202 1.00 0.00 ? 345 ASN A ND2  3 
ATOM 1691 H H    . ASN A 1 39 ? 25.715 48.025 22.655 1.00 0.00 ? 345 ASN A H    3 
ATOM 1692 H HA   . ASN A 1 39 ? 22.980 47.235 21.880 1.00 0.00 ? 345 ASN A HA   3 
ATOM 1693 H HB2  . ASN A 1 39 ? 24.814 48.722 20.581 1.00 0.00 ? 345 ASN A HB2  3 
ATOM 1694 H HB3  . ASN A 1 39 ? 25.350 47.140 20.005 1.00 0.00 ? 345 ASN A HB3  3 
ATOM 1695 H HD21 . ASN A 1 39 ? 22.737 45.853 19.784 1.00 0.00 ? 345 ASN A HD21 3 
ATOM 1696 H HD22 . ASN A 1 39 ? 21.894 46.770 18.525 1.00 0.00 ? 345 ASN A HD22 3 
ATOM 1697 N N    . GLN A 1 40 ? 25.384 45.049 22.300 1.00 0.00 ? 346 GLN A N    3 
ATOM 1698 C CA   . GLN A 1 40 ? 25.717 43.630 22.529 1.00 0.00 ? 346 GLN A CA   3 
ATOM 1699 C C    . GLN A 1 40 ? 26.538 43.465 23.828 1.00 0.00 ? 346 GLN A C    3 
ATOM 1700 O O    . GLN A 1 40 ? 27.632 42.902 23.819 1.00 0.00 ? 346 GLN A O    3 
ATOM 1701 C CB   . GLN A 1 40 ? 26.448 43.020 21.308 1.00 0.00 ? 346 GLN A CB   3 
ATOM 1702 C CG   . GLN A 1 40 ? 25.543 42.829 20.088 1.00 0.00 ? 346 GLN A CG   3 
ATOM 1703 C CD   . GLN A 1 40 ? 26.219 41.973 19.014 1.00 0.00 ? 346 GLN A CD   3 
ATOM 1704 O OE1  . GLN A 1 40 ? 26.176 40.753 19.035 1.00 0.00 ? 346 GLN A OE1  3 
ATOM 1705 N NE2  . GLN A 1 40 ? 26.862 42.561 18.032 1.00 0.00 ? 346 GLN A NE2  3 
ATOM 1706 H H    . GLN A 1 40 ? 26.070 45.729 22.587 1.00 0.00 ? 346 GLN A H    3 
ATOM 1707 H HA   . GLN A 1 40 ? 24.790 43.074 22.678 1.00 0.00 ? 346 GLN A HA   3 
ATOM 1708 H HB2  . GLN A 1 40 ? 27.306 43.644 21.047 1.00 0.00 ? 346 GLN A HB2  3 
ATOM 1709 H HB3  . GLN A 1 40 ? 26.825 42.033 21.586 1.00 0.00 ? 346 GLN A HB3  3 
ATOM 1710 H HG2  . GLN A 1 40 ? 24.625 42.327 20.396 1.00 0.00 ? 346 GLN A HG2  3 
ATOM 1711 H HG3  . GLN A 1 40 ? 25.285 43.791 19.662 1.00 0.00 ? 346 GLN A HG3  3 
ATOM 1712 H HE21 . GLN A 1 40 ? 26.923 43.559 17.986 1.00 0.00 ? 346 GLN A HE21 3 
ATOM 1713 H HE22 . GLN A 1 40 ? 27.299 41.939 17.380 1.00 0.00 ? 346 GLN A HE22 3 
ATOM 1714 N N    . SER A 1 41 ? 26.027 43.989 24.942 1.00 0.00 ? 347 SER A N    3 
ATOM 1715 C CA   . SER A 1 41 ? 26.607 43.737 26.272 1.00 0.00 ? 347 SER A CA   3 
ATOM 1716 C C    . SER A 1 41 ? 26.179 42.365 26.806 1.00 0.00 ? 347 SER A C    3 
ATOM 1717 O O    . SER A 1 41 ? 25.085 41.899 26.492 1.00 0.00 ? 347 SER A O    3 
ATOM 1718 C CB   . SER A 1 41 ? 26.254 44.877 27.231 1.00 0.00 ? 347 SER A CB   3 
ATOM 1719 O OG   . SER A 1 41 ? 26.925 44.711 28.460 1.00 0.00 ? 347 SER A OG   3 
ATOM 1720 H H    . SER A 1 41 ? 25.102 44.399 24.897 1.00 0.00 ? 347 SER A H    3 
ATOM 1721 H HA   . SER A 1 41 ? 27.687 43.723 26.189 1.00 0.00 ? 347 SER A HA   3 
ATOM 1722 H HB2  . SER A 1 41 ? 26.567 45.822 26.788 1.00 0.00 ? 347 SER A HB2  3 
ATOM 1723 H HB3  . SER A 1 41 ? 25.173 44.903 27.405 1.00 0.00 ? 347 SER A HB3  3 
ATOM 1724 H HG   . SER A 1 41 ? 26.881 45.525 28.959 1.00 0.00 ? 347 SER A HG   3 
ATOM 1725 N N    . GLY A 1 42 ? 27.047 41.725 27.578 1.00 0.00 ? 348 GLY A N    3 
ATOM 1726 C CA   . GLY A 1 42 ? 26.870 40.360 28.102 1.00 0.00 ? 348 GLY A CA   3 
ATOM 1727 C C    . GLY A 1 42 ? 27.459 40.180 29.511 1.00 0.00 ? 348 GLY A C    3 
ATOM 1728 O O    . GLY A 1 42 ? 28.097 41.097 30.020 1.00 0.00 ? 348 GLY A O    3 
ATOM 1729 H H    . GLY A 1 42 ? 27.871 42.215 27.889 1.00 0.00 ? 348 GLY A H    3 
ATOM 1730 H HA2  . GLY A 1 42 ? 25.807 40.123 28.133 1.00 0.00 ? 348 GLY A HA2  3 
ATOM 1731 H HA3  . GLY A 1 42 ? 27.366 39.657 27.433 1.00 0.00 ? 348 GLY A HA3  3 
ATOM 1732 N N    . PRO A 1 43 ? 27.203 39.019 30.140 1.00 0.00 ? 349 PRO A N    3 
ATOM 1733 C CA   . PRO A 1 43 ? 27.702 38.658 31.472 1.00 0.00 ? 349 PRO A CA   3 
ATOM 1734 C C    . PRO A 1 43 ? 29.146 38.131 31.454 1.00 0.00 ? 349 PRO A C    3 
ATOM 1735 O O    . PRO A 1 43 ? 29.555 37.530 30.431 1.00 0.00 ? 349 PRO A O    3 
ATOM 1736 C CB   . PRO A 1 43 ? 26.717 37.591 31.965 1.00 0.00 ? 349 PRO A CB   3 
ATOM 1737 C CG   . PRO A 1 43 ? 26.396 36.831 30.682 1.00 0.00 ? 349 PRO A CG   3 
ATOM 1738 C CD   . PRO A 1 43 ? 26.384 37.934 29.613 1.00 0.00 ? 349 PRO A CD   3 
ATOM 1739 O OXT  . PRO A 1 43 ? 29.802 38.271 32.514 1.00 0.00 ? 349 PRO A OXT  3 
ATOM 1740 H HA   . PRO A 1 43 ? 27.677 39.525 32.130 1.00 0.00 ? 349 PRO A HA   3 
ATOM 1741 H HB2  . PRO A 1 43 ? 27.166 36.946 32.724 1.00 0.00 ? 349 PRO A HB2  3 
ATOM 1742 H HB3  . PRO A 1 43 ? 25.820 38.071 32.347 1.00 0.00 ? 349 PRO A HB3  3 
ATOM 1743 H HG2  . PRO A 1 43 ? 27.190 36.116 30.465 1.00 0.00 ? 349 PRO A HG2  3 
ATOM 1744 H HG3  . PRO A 1 43 ? 25.430 36.323 30.750 1.00 0.00 ? 349 PRO A HG3  3 
ATOM 1745 H HD2  . PRO A 1 43 ? 26.795 37.545 28.685 1.00 0.00 ? 349 PRO A HD2  3 
ATOM 1746 H HD3  . PRO A 1 43 ? 25.359 38.282 29.468 1.00 0.00 ? 349 PRO A HD3  3 
ATOM 1747 N N    . MET A 1 1  ? 56.109 30.623 16.765 1.00 0.00 ? 307 MET A N    4 
ATOM 1748 C CA   . MET A 1 1  ? 55.335 31.473 15.816 1.00 0.00 ? 307 MET A CA   4 
ATOM 1749 C C    . MET A 1 1  ? 55.675 32.910 16.171 1.00 0.00 ? 307 MET A C    4 
ATOM 1750 O O    . MET A 1 1  ? 55.132 33.422 17.133 1.00 0.00 ? 307 MET A O    4 
ATOM 1751 C CB   . MET A 1 1  ? 53.827 31.222 15.942 1.00 0.00 ? 307 MET A CB   4 
ATOM 1752 C CG   . MET A 1 1  ? 53.362 29.941 15.230 1.00 0.00 ? 307 MET A CG   4 
ATOM 1753 S SD   . MET A 1 1  ? 52.345 28.838 16.256 1.00 0.00 ? 307 MET A SD   4 
ATOM 1754 C CE   . MET A 1 1  ? 53.560 28.149 17.404 1.00 0.00 ? 307 MET A CE   4 
ATOM 1755 H H1   . MET A 1 1  ? 57.098 30.800 16.668 1.00 0.00 ? 307 MET A H1   4 
ATOM 1756 H H2   . MET A 1 1  ? 55.853 30.852 17.713 1.00 0.00 ? 307 MET A H2   4 
ATOM 1757 H H3   . MET A 1 1  ? 55.922 29.639 16.591 1.00 0.00 ? 307 MET A H3   4 
ATOM 1758 H HA   . MET A 1 1  ? 55.648 31.278 14.792 1.00 0.00 ? 307 MET A HA   4 
ATOM 1759 H HB2  . MET A 1 1  ? 53.562 31.167 16.991 1.00 0.00 ? 307 MET A HB2  4 
ATOM 1760 H HB3  . MET A 1 1  ? 53.295 32.066 15.494 1.00 0.00 ? 307 MET A HB3  4 
ATOM 1761 H HG2  . MET A 1 1  ? 52.757 30.246 14.372 1.00 0.00 ? 307 MET A HG2  4 
ATOM 1762 H HG3  . MET A 1 1  ? 54.211 29.388 14.859 1.00 0.00 ? 307 MET A HG3  4 
ATOM 1763 H HE1  . MET A 1 1  ? 53.072 27.426 18.059 1.00 0.00 ? 307 MET A HE1  4 
ATOM 1764 H HE2  . MET A 1 1  ? 54.352 27.643 16.852 1.00 0.00 ? 307 MET A HE2  4 
ATOM 1765 H HE3  . MET A 1 1  ? 53.986 28.951 18.021 1.00 0.00 ? 307 MET A HE3  4 
ATOM 1766 N N    . GLY A 1 2  ? 56.704 33.469 15.534 1.00 0.00 ? 308 GLY A N    4 
ATOM 1767 C CA   . GLY A 1 2  ? 57.587 34.350 16.306 1.00 0.00 ? 308 GLY A CA   4 
ATOM 1768 C C    . GLY A 1 2  ? 58.094 33.571 17.532 1.00 0.00 ? 308 GLY A C    4 
ATOM 1769 O O    . GLY A 1 2  ? 58.407 32.386 17.401 1.00 0.00 ? 308 GLY A O    4 
ATOM 1770 H H    . GLY A 1 2  ? 57.104 33.047 14.713 1.00 0.00 ? 308 GLY A H    4 
ATOM 1771 H HA2  . GLY A 1 2  ? 58.445 34.662 15.703 1.00 0.00 ? 308 GLY A HA2  4 
ATOM 1772 H HA3  . GLY A 1 2  ? 57.040 35.238 16.629 1.00 0.00 ? 308 GLY A HA3  4 
ATOM 1773 N N    . GLY A 1 3  ? 58.072 34.196 18.713 1.00 0.00 ? 309 GLY A N    4 
ATOM 1774 C CA   . GLY A 1 3  ? 58.343 33.542 19.991 1.00 0.00 ? 309 GLY A CA   4 
ATOM 1775 C C    . GLY A 1 3  ? 57.215 32.623 20.498 1.00 0.00 ? 309 GLY A C    4 
ATOM 1776 O O    . GLY A 1 3  ? 56.513 31.972 19.722 1.00 0.00 ? 309 GLY A O    4 
ATOM 1777 H H    . GLY A 1 3  ? 57.762 35.161 18.729 1.00 0.00 ? 309 GLY A H    4 
ATOM 1778 H HA2  . GLY A 1 3  ? 59.254 32.938 19.903 1.00 0.00 ? 309 GLY A HA2  4 
ATOM 1779 H HA3  . GLY A 1 3  ? 58.543 34.306 20.741 1.00 0.00 ? 309 GLY A HA3  4 
ATOM 1780 N N    . GLY A 1 4  ? 57.043 32.579 21.833 1.00 0.00 ? 310 GLY A N    4 
ATOM 1781 C CA   . GLY A 1 4  ? 56.125 31.683 22.550 1.00 0.00 ? 310 GLY A CA   4 
ATOM 1782 C C    . GLY A 1 4  ? 54.636 32.073 22.529 1.00 0.00 ? 310 GLY A C    4 
ATOM 1783 O O    . GLY A 1 4  ? 53.827 31.412 23.173 1.00 0.00 ? 310 GLY A O    4 
ATOM 1784 H H    . GLY A 1 4  ? 57.644 33.157 22.408 1.00 0.00 ? 310 GLY A H    4 
ATOM 1785 H HA2  . GLY A 1 4  ? 56.206 30.681 22.135 1.00 0.00 ? 310 GLY A HA2  4 
ATOM 1786 H HA3  . GLY A 1 4  ? 56.430 31.644 23.592 1.00 0.00 ? 310 GLY A HA3  4 
ATOM 1787 N N    . MET A 1 5  ? 54.265 33.148 21.817 1.00 0.00 ? 311 MET A N    4 
ATOM 1788 C CA   . MET A 1 5  ? 52.911 33.706 21.638 1.00 0.00 ? 311 MET A CA   4 
ATOM 1789 C C    . MET A 1 5  ? 52.069 34.070 22.884 1.00 0.00 ? 311 MET A C    4 
ATOM 1790 O O    . MET A 1 5  ? 51.129 34.828 22.732 1.00 0.00 ? 311 MET A O    4 
ATOM 1791 C CB   . MET A 1 5  ? 52.098 32.869 20.649 1.00 0.00 ? 311 MET A CB   4 
ATOM 1792 C CG   . MET A 1 5  ? 52.588 33.095 19.207 1.00 0.00 ? 311 MET A CG   4 
ATOM 1793 S SD   . MET A 1 5  ? 51.356 32.742 17.922 1.00 0.00 ? 311 MET A SD   4 
ATOM 1794 C CE   . MET A 1 5  ? 50.210 34.131 18.177 1.00 0.00 ? 311 MET A CE   4 
ATOM 1795 H H    . MET A 1 5  ? 55.008 33.598 21.311 1.00 0.00 ? 311 MET A H    4 
ATOM 1796 H HA   . MET A 1 5  ? 53.050 34.674 21.162 1.00 0.00 ? 311 MET A HA   4 
ATOM 1797 H HB2  . MET A 1 5  ? 52.159 31.803 20.892 1.00 0.00 ? 311 MET A HB2  4 
ATOM 1798 H HB3  . MET A 1 5  ? 51.053 33.161 20.706 1.00 0.00 ? 311 MET A HB3  4 
ATOM 1799 H HG2  . MET A 1 5  ? 52.893 34.127 19.090 1.00 0.00 ? 311 MET A HG2  4 
ATOM 1800 H HG3  . MET A 1 5  ? 53.465 32.466 19.041 1.00 0.00 ? 311 MET A HG3  4 
ATOM 1801 H HE1  . MET A 1 5  ? 49.455 34.121 17.398 1.00 0.00 ? 311 MET A HE1  4 
ATOM 1802 H HE2  . MET A 1 5  ? 49.721 34.033 19.149 1.00 0.00 ? 311 MET A HE2  4 
ATOM 1803 H HE3  . MET A 1 5  ? 50.759 35.077 18.146 1.00 0.00 ? 311 MET A HE3  4 
ATOM 1804 N N    . ASN A 1 6  ? 52.418 33.633 24.103 1.00 0.00 ? 312 ASN A N    4 
ATOM 1805 C CA   . ASN A 1 6  ? 51.571 33.624 25.316 1.00 0.00 ? 312 ASN A CA   4 
ATOM 1806 C C    . ASN A 1 6  ? 51.077 35.008 25.843 1.00 0.00 ? 312 ASN A C    4 
ATOM 1807 O O    . ASN A 1 6  ? 50.515 35.059 26.938 1.00 0.00 ? 312 ASN A O    4 
ATOM 1808 C CB   . ASN A 1 6  ? 52.352 32.843 26.400 1.00 0.00 ? 312 ASN A CB   4 
ATOM 1809 C CG   . ASN A 1 6  ? 51.481 31.949 27.284 1.00 0.00 ? 312 ASN A CG   4 
ATOM 1810 O OD1  . ASN A 1 6  ? 51.735 30.774 27.416 1.00 0.00 ? 312 ASN A OD1  4 
ATOM 1811 N ND2  . ASN A 1 6  ? 50.452 32.461 27.907 1.00 0.00 ? 312 ASN A ND2  4 
ATOM 1812 H H    . ASN A 1 6  ? 53.183 32.967 24.116 1.00 0.00 ? 312 ASN A H    4 
ATOM 1813 H HA   . ASN A 1 6  ? 50.673 33.061 25.065 1.00 0.00 ? 312 ASN A HA   4 
ATOM 1814 H HB2  . ASN A 1 6  ? 53.086 32.184 25.942 1.00 0.00 ? 312 ASN A HB2  4 
ATOM 1815 H HB3  . ASN A 1 6  ? 52.878 33.537 27.050 1.00 0.00 ? 312 ASN A HB3  4 
ATOM 1816 H HD21 . ASN A 1 6  ? 50.227 33.448 27.807 1.00 0.00 ? 312 ASN A HD21 4 
ATOM 1817 H HD22 . ASN A 1 6  ? 49.911 31.833 28.477 1.00 0.00 ? 312 ASN A HD22 4 
ATOM 1818 N N    . PHE A 1 7  ? 51.317 36.109 25.133 1.00 0.00 ? 313 PHE A N    4 
ATOM 1819 C CA   . PHE A 1 7  ? 50.764 37.448 25.444 1.00 0.00 ? 313 PHE A CA   4 
ATOM 1820 C C    . PHE A 1 7  ? 50.872 38.447 24.275 1.00 0.00 ? 313 PHE A C    4 
ATOM 1821 O O    . PHE A 1 7  ? 50.232 39.495 24.281 1.00 0.00 ? 313 PHE A O    4 
ATOM 1822 C CB   . PHE A 1 7  ? 51.494 38.031 26.665 1.00 0.00 ? 313 PHE A CB   4 
ATOM 1823 C CG   . PHE A 1 7  ? 50.942 39.329 27.251 1.00 0.00 ? 313 PHE A CG   4 
ATOM 1824 C CD1  . PHE A 1 7  ? 49.554 39.601 27.274 1.00 0.00 ? 313 PHE A CD1  4 
ATOM 1825 C CD2  . PHE A 1 7  ? 51.836 40.264 27.807 1.00 0.00 ? 313 PHE A CD2  4 
ATOM 1826 C CE1  . PHE A 1 7  ? 49.079 40.805 27.812 1.00 0.00 ? 313 PHE A CE1  4 
ATOM 1827 C CE2  . PHE A 1 7  ? 51.352 41.460 28.367 1.00 0.00 ? 313 PHE A CE2  4 
ATOM 1828 C CZ   . PHE A 1 7  ? 49.973 41.739 28.349 1.00 0.00 ? 313 PHE A CZ   4 
ATOM 1829 H H    . PHE A 1 7  ? 51.604 35.940 24.188 1.00 0.00 ? 313 PHE A H    4 
ATOM 1830 H HA   . PHE A 1 7  ? 49.701 37.321 25.671 1.00 0.00 ? 313 PHE A HA   4 
ATOM 1831 H HB2  . PHE A 1 7  ? 51.472 37.306 27.480 1.00 0.00 ? 313 PHE A HB2  4 
ATOM 1832 H HB3  . PHE A 1 7  ? 52.535 38.185 26.397 1.00 0.00 ? 313 PHE A HB3  4 
ATOM 1833 H HD1  . PHE A 1 7  ? 48.849 38.885 26.874 1.00 0.00 ? 313 PHE A HD1  4 
ATOM 1834 H HD2  . PHE A 1 7  ? 52.897 40.069 27.834 1.00 0.00 ? 313 PHE A HD2  4 
ATOM 1835 H HE1  . PHE A 1 7  ? 48.010 41.013 27.815 1.00 0.00 ? 313 PHE A HE1  4 
ATOM 1836 H HE2  . PHE A 1 7  ? 52.029 42.178 28.798 1.00 0.00 ? 313 PHE A HE2  4 
ATOM 1837 H HZ   . PHE A 1 7  ? 49.600 42.664 28.772 1.00 0.00 ? 313 PHE A HZ   4 
ATOM 1838 N N    . GLY A 1 8  ? 51.747 38.211 23.289 1.00 0.00 ? 314 GLY A N    4 
ATOM 1839 C CA   . GLY A 1 8  ? 52.050 39.176 22.215 1.00 0.00 ? 314 GLY A CA   4 
ATOM 1840 C C    . GLY A 1 8  ? 52.922 40.365 22.664 1.00 0.00 ? 314 GLY A C    4 
ATOM 1841 O O    . GLY A 1 8  ? 53.804 40.787 21.912 1.00 0.00 ? 314 GLY A O    4 
ATOM 1842 H H    . GLY A 1 8  ? 52.228 37.324 23.270 1.00 0.00 ? 314 GLY A H    4 
ATOM 1843 H HA2  . GLY A 1 8  ? 52.549 38.673 21.395 1.00 0.00 ? 314 GLY A HA2  4 
ATOM 1844 H HA3  . GLY A 1 8  ? 51.116 39.576 21.827 1.00 0.00 ? 314 GLY A HA3  4 
ATOM 1845 N N    . ALA A 1 9  ? 52.721 40.893 23.880 1.00 0.00 ? 315 ALA A N    4 
ATOM 1846 C CA   . ALA A 1 9  ? 53.394 42.105 24.357 1.00 0.00 ? 315 ALA A CA   4 
ATOM 1847 C C    . ALA A 1 9  ? 54.698 41.871 25.138 1.00 0.00 ? 315 ALA A C    4 
ATOM 1848 O O    . ALA A 1 9  ? 55.439 42.825 25.378 1.00 0.00 ? 315 ALA A O    4 
ATOM 1849 C CB   . ALA A 1 9  ? 52.408 42.923 25.196 1.00 0.00 ? 315 ALA A CB   4 
ATOM 1850 H H    . ALA A 1 9  ? 51.909 40.574 24.390 1.00 0.00 ? 315 ALA A H    4 
ATOM 1851 H HA   . ALA A 1 9  ? 53.642 42.713 23.480 1.00 0.00 ? 315 ALA A HA   4 
ATOM 1852 H HB1  . ALA A 1 9  ? 52.752 43.958 25.258 1.00 0.00 ? 315 ALA A HB1  4 
ATOM 1853 H HB2  . ALA A 1 9  ? 51.399 42.910 24.771 1.00 0.00 ? 315 ALA A HB2  4 
ATOM 1854 H HB3  . ALA A 1 9  ? 52.359 42.524 26.210 1.00 0.00 ? 315 ALA A HB3  4 
ATOM 1855 N N    . PHE A 1 10 ? 55.004 40.634 25.542 1.00 0.00 ? 316 PHE A N    4 
ATOM 1856 C CA   . PHE A 1 10 ? 56.290 40.310 26.180 1.00 0.00 ? 316 PHE A CA   4 
ATOM 1857 C C    . PHE A 1 10 ? 56.716 38.857 25.952 1.00 0.00 ? 316 PHE A C    4 
ATOM 1858 O O    . PHE A 1 10 ? 57.847 38.600 25.548 1.00 0.00 ? 316 PHE A O    4 
ATOM 1859 C CB   . PHE A 1 10 ? 56.249 40.666 27.672 1.00 0.00 ? 316 PHE A CB   4 
ATOM 1860 C CG   . PHE A 1 10 ? 57.497 41.381 28.127 1.00 0.00 ? 316 PHE A CG   4 
ATOM 1861 C CD1  . PHE A 1 10 ? 58.630 40.652 28.559 1.00 0.00 ? 316 PHE A CD1  4 
ATOM 1862 C CD2  . PHE A 1 10 ? 57.560 42.792 28.086 1.00 0.00 ? 316 PHE A CD2  4 
ATOM 1863 C CE1  . PHE A 1 10 ? 59.796 41.335 28.961 1.00 0.00 ? 316 PHE A CE1  4 
ATOM 1864 C CE2  . PHE A 1 10 ? 58.725 43.463 28.478 1.00 0.00 ? 316 PHE A CE2  4 
ATOM 1865 C CZ   . PHE A 1 10 ? 59.838 42.735 28.921 1.00 0.00 ? 316 PHE A CZ   4 
ATOM 1866 H H    . PHE A 1 10 ? 54.356 39.900 25.312 1.00 0.00 ? 316 PHE A H    4 
ATOM 1867 H HA   . PHE A 1 10 ? 57.056 40.933 25.710 1.00 0.00 ? 316 PHE A HA   4 
ATOM 1868 H HB2  . PHE A 1 10 ? 55.394 41.318 27.875 1.00 0.00 ? 316 PHE A HB2  4 
ATOM 1869 H HB3  . PHE A 1 10 ? 56.106 39.757 28.274 1.00 0.00 ? 316 PHE A HB3  4 
ATOM 1870 H HD1  . PHE A 1 10 ? 58.601 39.572 28.587 1.00 0.00 ? 316 PHE A HD1  4 
ATOM 1871 H HD2  . PHE A 1 10 ? 56.699 43.354 27.733 1.00 0.00 ? 316 PHE A HD2  4 
ATOM 1872 H HE1  . PHE A 1 10 ? 60.656 40.771 29.303 1.00 0.00 ? 316 PHE A HE1  4 
ATOM 1873 H HE2  . PHE A 1 10 ? 58.764 44.544 28.450 1.00 0.00 ? 316 PHE A HE2  4 
ATOM 1874 H HZ   . PHE A 1 10 ? 60.738 43.252 29.235 1.00 0.00 ? 316 PHE A HZ   4 
ATOM 1875 N N    . SER A 1 11 ? 55.792 37.901 26.100 1.00 0.00 ? 317 SER A N    4 
ATOM 1876 C CA   . SER A 1 11 ? 56.003 36.439 26.003 1.00 0.00 ? 317 SER A CA   4 
ATOM 1877 C C    . SER A 1 11 ? 56.336 35.906 24.591 1.00 0.00 ? 317 SER A C    4 
ATOM 1878 O O    . SER A 1 11 ? 56.080 34.742 24.263 1.00 0.00 ? 317 SER A O    4 
ATOM 1879 C CB   . SER A 1 11 ? 54.779 35.695 26.562 1.00 0.00 ? 317 SER A CB   4 
ATOM 1880 O OG   . SER A 1 11 ? 54.225 36.399 27.671 1.00 0.00 ? 317 SER A OG   4 
ATOM 1881 H H    . SER A 1 11 ? 54.924 38.160 26.553 1.00 0.00 ? 317 SER A H    4 
ATOM 1882 H HA   . SER A 1 11 ? 56.860 36.187 26.635 1.00 0.00 ? 317 SER A HA   4 
ATOM 1883 H HB2  . SER A 1 11 ? 54.014 35.626 25.788 1.00 0.00 ? 317 SER A HB2  4 
ATOM 1884 H HB3  . SER A 1 11 ? 55.063 34.693 26.871 1.00 0.00 ? 317 SER A HB3  4 
ATOM 1885 H HG   . SER A 1 11 ? 53.589 35.844 28.130 1.00 0.00 ? 317 SER A HG   4 
ATOM 1886 N N    . ILE A 1 12 ? 56.806 36.782 23.695 1.00 0.00 ? 318 ILE A N    4 
ATOM 1887 C CA   . ILE A 1 12 ? 57.142 36.500 22.295 1.00 0.00 ? 318 ILE A CA   4 
ATOM 1888 C C    . ILE A 1 12 ? 58.131 37.560 21.775 1.00 0.00 ? 318 ILE A C    4 
ATOM 1889 O O    . ILE A 1 12 ? 59.131 37.199 21.164 1.00 0.00 ? 318 ILE A O    4 
ATOM 1890 C CB   . ILE A 1 12 ? 55.879 36.355 21.389 1.00 0.00 ? 318 ILE A CB   4 
ATOM 1891 C CG1  . ILE A 1 12 ? 56.043 36.935 19.966 1.00 0.00 ? 318 ILE A CG1  4 
ATOM 1892 C CG2  . ILE A 1 12 ? 54.581 36.889 22.021 1.00 0.00 ? 318 ILE A CG2  4 
ATOM 1893 C CD1  . ILE A 1 12 ? 55.031 36.407 18.934 1.00 0.00 ? 318 ILE A CD1  4 
ATOM 1894 H H    . ILE A 1 12 ? 57.112 37.669 24.081 1.00 0.00 ? 318 ILE A H    4 
ATOM 1895 H HA   . ILE A 1 12 ? 57.682 35.563 22.277 1.00 0.00 ? 318 ILE A HA   4 
ATOM 1896 H HB   . ILE A 1 12 ? 55.743 35.284 21.269 1.00 0.00 ? 318 ILE A HB   4 
ATOM 1897 H HG12 . ILE A 1 12 ? 55.955 38.021 20.014 1.00 0.00 ? 318 ILE A HG12 4 
ATOM 1898 H HG13 . ILE A 1 12 ? 57.034 36.681 19.588 1.00 0.00 ? 318 ILE A HG13 4 
ATOM 1899 H HG21 . ILE A 1 12 ? 53.749 36.796 21.333 1.00 0.00 ? 318 ILE A HG21 4 
ATOM 1900 H HG22 . ILE A 1 12 ? 54.314 36.312 22.907 1.00 0.00 ? 318 ILE A HG22 4 
ATOM 1901 H HG23 . ILE A 1 12 ? 54.704 37.940 22.293 1.00 0.00 ? 318 ILE A HG23 4 
ATOM 1902 H HD11 . ILE A 1 12 ? 54.024 36.742 19.177 1.00 0.00 ? 318 ILE A HD11 4 
ATOM 1903 H HD12 . ILE A 1 12 ? 55.302 36.797 17.952 1.00 0.00 ? 318 ILE A HD12 4 
ATOM 1904 H HD13 . ILE A 1 12 ? 55.060 35.323 18.919 1.00 0.00 ? 318 ILE A HD13 4 
ATOM 1905 N N    . ASN A 1 13 ? 57.843 38.841 22.009 1.00 0.00 ? 319 ASN A N    4 
ATOM 1906 C CA   . ASN A 1 13 ? 58.657 39.990 21.601 1.00 0.00 ? 319 ASN A CA   4 
ATOM 1907 C C    . ASN A 1 13 ? 58.433 41.155 22.602 1.00 0.00 ? 319 ASN A C    4 
ATOM 1908 O O    . ASN A 1 13 ? 57.349 41.205 23.199 1.00 0.00 ? 319 ASN A O    4 
ATOM 1909 C CB   . ASN A 1 13 ? 58.220 40.455 20.193 1.00 0.00 ? 319 ASN A CB   4 
ATOM 1910 C CG   . ASN A 1 13 ? 58.551 39.500 19.061 1.00 0.00 ? 319 ASN A CG   4 
ATOM 1911 O OD1  . ASN A 1 13 ? 57.684 39.054 18.338 1.00 0.00 ? 319 ASN A OD1  4 
ATOM 1912 N ND2  . ASN A 1 13 ? 59.809 39.186 18.846 1.00 0.00 ? 319 ASN A ND2  4 
ATOM 1913 H H    . ASN A 1 13 ? 57.018 39.064 22.532 1.00 0.00 ? 319 ASN A H    4 
ATOM 1914 H HA   . ASN A 1 13 ? 59.716 39.723 21.612 1.00 0.00 ? 319 ASN A HA   4 
ATOM 1915 H HB2  . ASN A 1 13 ? 57.140 40.623 20.199 1.00 0.00 ? 319 ASN A HB2  4 
ATOM 1916 H HB3  . ASN A 1 13 ? 58.710 41.398 19.974 1.00 0.00 ? 319 ASN A HB3  4 
ATOM 1917 H HD21 . ASN A 1 13 ? 60.540 39.495 19.454 1.00 0.00 ? 319 ASN A HD21 4 
ATOM 1918 H HD22 . ASN A 1 13 ? 59.980 38.559 18.080 1.00 0.00 ? 319 ASN A HD22 4 
ATOM 1919 N N    . PRO A 1 14 ? 59.369 42.110 22.734 1.00 0.00 ? 320 PRO A N    4 
ATOM 1920 C CA   . PRO A 1 14 ? 59.198 43.304 23.571 1.00 0.00 ? 320 PRO A CA   4 
ATOM 1921 C C    . PRO A 1 14 ? 58.158 44.248 22.929 1.00 0.00 ? 320 PRO A C    4 
ATOM 1922 O O    . PRO A 1 14 ? 58.474 44.982 22.000 1.00 0.00 ? 320 PRO A O    4 
ATOM 1923 C CB   . PRO A 1 14 ? 60.589 43.932 23.665 1.00 0.00 ? 320 PRO A CB   4 
ATOM 1924 C CG   . PRO A 1 14 ? 61.258 43.524 22.349 1.00 0.00 ? 320 PRO A CG   4 
ATOM 1925 C CD   . PRO A 1 14 ? 60.682 42.136 22.081 1.00 0.00 ? 320 PRO A CD   4 
ATOM 1926 H HA   . PRO A 1 14 ? 58.858 43.025 24.569 1.00 0.00 ? 320 PRO A HA   4 
ATOM 1927 H HB2  . PRO A 1 14 ? 60.555 45.013 23.781 1.00 0.00 ? 320 PRO A HB2  4 
ATOM 1928 H HB3  . PRO A 1 14 ? 61.132 43.476 24.496 1.00 0.00 ? 320 PRO A HB3  4 
ATOM 1929 H HG2  . PRO A 1 14 ? 60.959 44.211 21.552 1.00 0.00 ? 320 PRO A HG2  4 
ATOM 1930 H HG3  . PRO A 1 14 ? 62.343 43.502 22.433 1.00 0.00 ? 320 PRO A HG3  4 
ATOM 1931 H HD2  . PRO A 1 14 ? 60.603 41.970 21.013 1.00 0.00 ? 320 PRO A HD2  4 
ATOM 1932 H HD3  . PRO A 1 14 ? 61.325 41.381 22.537 1.00 0.00 ? 320 PRO A HD3  4 
ATOM 1933 N N    . ALA A 1 15 ? 56.906 44.169 23.392 1.00 0.00 ? 321 ALA A N    4 
ATOM 1934 C CA   . ALA A 1 15 ? 55.710 44.873 22.894 1.00 0.00 ? 321 ALA A CA   4 
ATOM 1935 C C    . ALA A 1 15 ? 55.322 44.661 21.411 1.00 0.00 ? 321 ALA A C    4 
ATOM 1936 O O    . ALA A 1 15 ? 54.148 44.856 21.079 1.00 0.00 ? 321 ALA A O    4 
ATOM 1937 C CB   . ALA A 1 15 ? 55.773 46.337 23.330 1.00 0.00 ? 321 ALA A CB   4 
ATOM 1938 H H    . ALA A 1 15 ? 56.743 43.521 24.147 1.00 0.00 ? 321 ALA A H    4 
ATOM 1939 H HA   . ALA A 1 15 ? 54.879 44.457 23.452 1.00 0.00 ? 321 ALA A HA   4 
ATOM 1940 H HB1  . ALA A 1 15 ? 54.845 46.845 23.055 1.00 0.00 ? 321 ALA A HB1  4 
ATOM 1941 H HB2  . ALA A 1 15 ? 55.901 46.392 24.404 1.00 0.00 ? 321 ALA A HB2  4 
ATOM 1942 H HB3  . ALA A 1 15 ? 56.618 46.849 22.845 1.00 0.00 ? 321 ALA A HB3  4 
ATOM 1943 N N    . MET A 1 16 ? 56.230 44.221 20.528 1.00 0.00 ? 322 MET A N    4 
ATOM 1944 C CA   . MET A 1 16 ? 56.065 44.249 19.059 1.00 0.00 ? 322 MET A CA   4 
ATOM 1945 C C    . MET A 1 16 ? 54.765 43.621 18.559 1.00 0.00 ? 322 MET A C    4 
ATOM 1946 O O    . MET A 1 16 ? 54.038 44.264 17.804 1.00 0.00 ? 322 MET A O    4 
ATOM 1947 C CB   . MET A 1 16 ? 57.238 43.529 18.344 1.00 0.00 ? 322 MET A CB   4 
ATOM 1948 C CG   . MET A 1 16 ? 58.658 44.003 18.669 1.00 0.00 ? 322 MET A CG   4 
ATOM 1949 S SD   . MET A 1 16 ? 59.309 45.383 17.690 1.00 0.00 ? 322 MET A SD   4 
ATOM 1950 C CE   . MET A 1 16 ? 58.465 46.804 18.420 1.00 0.00 ? 322 MET A CE   4 
ATOM 1951 H H    . MET A 1 16 ? 57.175 44.150 20.882 1.00 0.00 ? 322 MET A H    4 
ATOM 1952 H HA   . MET A 1 16 ? 56.052 45.290 18.745 1.00 0.00 ? 322 MET A HA   4 
ATOM 1953 H HB2  . MET A 1 16 ? 57.178 42.473 18.582 1.00 0.00 ? 322 MET A HB2  4 
ATOM 1954 H HB3  . MET A 1 16 ? 57.091 43.614 17.271 1.00 0.00 ? 322 MET A HB3  4 
ATOM 1955 H HG2  . MET A 1 16 ? 58.757 44.237 19.722 1.00 0.00 ? 322 MET A HG2  4 
ATOM 1956 H HG3  . MET A 1 16 ? 59.322 43.153 18.468 1.00 0.00 ? 322 MET A HG3  4 
ATOM 1957 H HE1  . MET A 1 16 ? 58.918 47.717 18.045 1.00 0.00 ? 322 MET A HE1  4 
ATOM 1958 H HE2  . MET A 1 16 ? 57.411 46.791 18.137 1.00 0.00 ? 322 MET A HE2  4 
ATOM 1959 H HE3  . MET A 1 16 ? 58.562 46.770 19.502 1.00 0.00 ? 322 MET A HE3  4 
ATOM 1960 N N    . MET A 1 17 ? 54.460 42.377 18.941 1.00 0.00 ? 323 MET A N    4 
ATOM 1961 C CA   . MET A 1 17 ? 53.373 41.618 18.311 1.00 0.00 ? 323 MET A CA   4 
ATOM 1962 C C    . MET A 1 17 ? 51.998 42.083 18.801 1.00 0.00 ? 323 MET A C    4 
ATOM 1963 O O    . MET A 1 17 ? 51.094 42.283 17.995 1.00 0.00 ? 323 MET A O    4 
ATOM 1964 C CB   . MET A 1 17 ? 53.597 40.106 18.498 1.00 0.00 ? 323 MET A CB   4 
ATOM 1965 C CG   . MET A 1 17 ? 52.640 39.261 17.657 1.00 0.00 ? 323 MET A CG   4 
ATOM 1966 S SD   . MET A 1 17 ? 51.522 38.215 18.633 1.00 0.00 ? 323 MET A SD   4 
ATOM 1967 C CE   . MET A 1 17 ? 49.950 38.650 17.840 1.00 0.00 ? 323 MET A CE   4 
ATOM 1968 H H    . MET A 1 17 ? 55.046 41.910 19.620 1.00 0.00 ? 323 MET A H    4 
ATOM 1969 H HA   . MET A 1 17 ? 53.398 41.812 17.232 1.00 0.00 ? 323 MET A HA   4 
ATOM 1970 H HB2  . MET A 1 17 ? 54.623 39.868 18.207 1.00 0.00 ? 323 MET A HB2  4 
ATOM 1971 H HB3  . MET A 1 17 ? 53.481 39.850 19.554 1.00 0.00 ? 323 MET A HB3  4 
ATOM 1972 H HG2  . MET A 1 17 ? 52.038 39.921 17.015 1.00 0.00 ? 323 MET A HG2  4 
ATOM 1973 H HG3  . MET A 1 17 ? 53.226 38.618 16.993 1.00 0.00 ? 323 MET A HG3  4 
ATOM 1974 H HE1  . MET A 1 17 ? 49.142 38.055 18.269 1.00 0.00 ? 323 MET A HE1  4 
ATOM 1975 H HE2  . MET A 1 17 ? 49.747 39.705 17.996 1.00 0.00 ? 323 MET A HE2  4 
ATOM 1976 H HE3  . MET A 1 17 ? 50.011 38.454 16.767 1.00 0.00 ? 323 MET A HE3  4 
ATOM 1977 N N    . ALA A 1 18 ? 51.838 42.346 20.104 1.00 0.00 ? 324 ALA A N    4 
ATOM 1978 C CA   . ALA A 1 18 ? 50.605 42.933 20.620 1.00 0.00 ? 324 ALA A CA   4 
ATOM 1979 C C    . ALA A 1 18 ? 50.376 44.351 20.099 1.00 0.00 ? 324 ALA A C    4 
ATOM 1980 O O    . ALA A 1 18 ? 49.243 44.675 19.756 1.00 0.00 ? 324 ALA A O    4 
ATOM 1981 C CB   . ALA A 1 18 ? 50.602 42.910 22.147 1.00 0.00 ? 324 ALA A CB   4 
ATOM 1982 H H    . ALA A 1 18 ? 52.625 42.195 20.732 1.00 0.00 ? 324 ALA A H    4 
ATOM 1983 H HA   . ALA A 1 18 ? 49.763 42.323 20.279 1.00 0.00 ? 324 ALA A HA   4 
ATOM 1984 H HB1  . ALA A 1 18 ? 49.702 43.403 22.514 1.00 0.00 ? 324 ALA A HB1  4 
ATOM 1985 H HB2  . ALA A 1 18 ? 50.588 41.883 22.501 1.00 0.00 ? 324 ALA A HB2  4 
ATOM 1986 H HB3  . ALA A 1 18 ? 51.475 43.442 22.522 1.00 0.00 ? 324 ALA A HB3  4 
ATOM 1987 N N    . ALA A 1 19 ? 51.420 45.187 19.973 1.00 0.00 ? 325 ALA A N    4 
ATOM 1988 C CA   . ALA A 1 19 ? 51.276 46.509 19.375 1.00 0.00 ? 325 ALA A CA   4 
ATOM 1989 C C    . ALA A 1 19 ? 50.890 46.427 17.893 1.00 0.00 ? 325 ALA A C    4 
ATOM 1990 O O    . ALA A 1 19 ? 49.958 47.116 17.485 1.00 0.00 ? 325 ALA A O    4 
ATOM 1991 C CB   . ALA A 1 19 ? 52.565 47.308 19.592 1.00 0.00 ? 325 ALA A CB   4 
ATOM 1992 H H    . ALA A 1 19 ? 52.342 44.892 20.284 1.00 0.00 ? 325 ALA A H    4 
ATOM 1993 H HA   . ALA A 1 19 ? 50.473 47.032 19.886 1.00 0.00 ? 325 ALA A HA   4 
ATOM 1994 H HB1  . ALA A 1 19 ? 52.437 48.313 19.186 1.00 0.00 ? 325 ALA A HB1  4 
ATOM 1995 H HB2  . ALA A 1 19 ? 52.783 47.382 20.661 1.00 0.00 ? 325 ALA A HB2  4 
ATOM 1996 H HB3  . ALA A 1 19 ? 53.409 46.825 19.087 1.00 0.00 ? 325 ALA A HB3  4 
ATOM 1997 N N    . ALA A 1 20 ? 51.517 45.545 17.104 1.00 0.00 ? 326 ALA A N    4 
ATOM 1998 C CA   . ALA A 1 20 ? 51.183 45.367 15.686 1.00 0.00 ? 326 ALA A CA   4 
ATOM 1999 C C    . ALA A 1 20 ? 49.728 44.891 15.484 1.00 0.00 ? 326 ALA A C    4 
ATOM 2000 O O    . ALA A 1 20 ? 49.034 45.427 14.624 1.00 0.00 ? 326 ALA A O    4 
ATOM 2001 C CB   . ALA A 1 20 ? 52.187 44.384 15.068 1.00 0.00 ? 326 ALA A CB   4 
ATOM 2002 H H    . ALA A 1 20 ? 52.299 45.015 17.478 1.00 0.00 ? 326 ALA A H    4 
ATOM 2003 H HA   . ALA A 1 20 ? 51.280 46.323 15.183 1.00 0.00 ? 326 ALA A HA   4 
ATOM 2004 H HB1  . ALA A 1 20 ? 51.969 44.261 14.013 1.00 0.00 ? 326 ALA A HB1  4 
ATOM 2005 H HB2  . ALA A 1 20 ? 53.196 44.776 15.176 1.00 0.00 ? 326 ALA A HB2  4 
ATOM 2006 H HB3  . ALA A 1 20 ? 52.119 43.417 15.561 1.00 0.00 ? 326 ALA A HB3  4 
ATOM 2007 N N    . GLN A 1 21 ? 49.243 43.949 16.295 1.00 0.00 ? 327 GLN A N    4 
ATOM 2008 C CA   . GLN A 1 21 ? 47.847 43.526 16.266 1.00 0.00 ? 327 GLN A CA   4 
ATOM 2009 C C    . GLN A 1 21 ? 46.889 44.621 16.774 1.00 0.00 ? 327 GLN A C    4 
ATOM 2010 O O    . GLN A 1 21 ? 45.872 44.884 16.139 1.00 0.00 ? 327 GLN A O    4 
ATOM 2011 C CB   . GLN A 1 21 ? 47.667 42.198 17.040 1.00 0.00 ? 327 GLN A CB   4 
ATOM 2012 C CG   . GLN A 1 21 ? 47.464 41.000 16.100 1.00 0.00 ? 327 GLN A CG   4 
ATOM 2013 C CD   . GLN A 1 21 ? 48.631 40.705 15.155 1.00 0.00 ? 327 GLN A CD   4 
ATOM 2014 O OE1  . GLN A 1 21 ? 49.797 40.860 15.474 1.00 0.00 ? 327 GLN A OE1  4 
ATOM 2015 N NE2  . GLN A 1 21 ? 48.363 40.222 13.967 1.00 0.00 ? 327 GLN A NE2  4 
ATOM 2016 H H    . GLN A 1 21 ? 49.888 43.479 16.941 1.00 0.00 ? 327 GLN A H    4 
ATOM 2017 H HA   . GLN A 1 21 ? 47.568 43.363 15.217 1.00 0.00 ? 327 GLN A HA   4 
ATOM 2018 H HB2  . GLN A 1 21 ? 48.525 42.018 17.687 1.00 0.00 ? 327 GLN A HB2  4 
ATOM 2019 H HB3  . GLN A 1 21 ? 46.785 42.279 17.676 1.00 0.00 ? 327 GLN A HB3  4 
ATOM 2020 H HG2  . GLN A 1 21 ? 47.292 40.112 16.712 1.00 0.00 ? 327 GLN A HG2  4 
ATOM 2021 H HG3  . GLN A 1 21 ? 46.558 41.165 15.507 1.00 0.00 ? 327 GLN A HG3  4 
ATOM 2022 H HE21 . GLN A 1 21 ? 47.417 40.086 13.658 1.00 0.00 ? 327 GLN A HE21 4 
ATOM 2023 H HE22 . GLN A 1 21 ? 49.166 40.064 13.370 1.00 0.00 ? 327 GLN A HE22 4 
ATOM 2024 N N    . ALA A 1 22 ? 47.185 45.270 17.899 1.00 0.00 ? 328 ALA A N    4 
ATOM 2025 C CA   . ALA A 1 22 ? 46.271 46.223 18.525 1.00 0.00 ? 328 ALA A CA   4 
ATOM 2026 C C    . ALA A 1 22 ? 46.277 47.622 17.895 1.00 0.00 ? 328 ALA A C    4 
ATOM 2027 O O    . ALA A 1 22 ? 45.302 48.363 18.077 1.00 0.00 ? 328 ALA A O    4 
ATOM 2028 C CB   . ALA A 1 22 ? 46.538 46.277 20.035 1.00 0.00 ? 328 ALA A CB   4 
ATOM 2029 H H    . ALA A 1 22 ? 48.036 45.029 18.410 1.00 0.00 ? 328 ALA A H    4 
ATOM 2030 H HA   . ALA A 1 22 ? 45.261 45.840 18.407 1.00 0.00 ? 328 ALA A HA   4 
ATOM 2031 H HB1  . ALA A 1 22 ? 45.785 46.898 20.517 1.00 0.00 ? 328 ALA A HB1  4 
ATOM 2032 H HB2  . ALA A 1 22 ? 46.487 45.275 20.459 1.00 0.00 ? 328 ALA A HB2  4 
ATOM 2033 H HB3  . ALA A 1 22 ? 47.522 46.696 20.232 1.00 0.00 ? 328 ALA A HB3  4 
ATOM 2034 N N    . ALA A 1 23 ? 47.298 48.001 17.120 1.00 0.00 ? 329 ALA A N    4 
ATOM 2035 C CA   . ALA A 1 23 ? 47.433 49.318 16.479 1.00 0.00 ? 329 ALA A CA   4 
ATOM 2036 C C    . ALA A 1 23 ? 46.190 49.701 15.675 1.00 0.00 ? 329 ALA A C    4 
ATOM 2037 O O    . ALA A 1 23 ? 45.619 50.772 15.876 1.00 0.00 ? 329 ALA A O    4 
ATOM 2038 C CB   . ALA A 1 23 ? 48.684 49.306 15.581 1.00 0.00 ? 329 ALA A CB   4 
ATOM 2039 H H    . ALA A 1 23 ? 48.100 47.380 17.058 1.00 0.00 ? 329 ALA A H    4 
ATOM 2040 H HA   . ALA A 1 23 ? 47.565 50.074 17.263 1.00 0.00 ? 329 ALA A HA   4 
ATOM 2041 H HB1  . ALA A 1 23 ? 48.718 50.228 15.003 1.00 0.00 ? 329 ALA A HB1  4 
ATOM 2042 H HB2  . ALA A 1 23 ? 49.582 49.244 16.198 1.00 0.00 ? 329 ALA A HB2  4 
ATOM 2043 H HB3  . ALA A 1 23 ? 48.656 48.456 14.900 1.00 0.00 ? 329 ALA A HB3  4 
ATOM 2044 N N    . LEU A 1 24 ? 45.732 48.810 14.795 1.00 0.00 ? 330 LEU A N    4 
ATOM 2045 C CA   . LEU A 1 24 ? 44.488 48.984 14.026 1.00 0.00 ? 330 LEU A CA   4 
ATOM 2046 C C    . LEU A 1 24 ? 43.254 48.423 14.753 1.00 0.00 ? 330 LEU A C    4 
ATOM 2047 O O    . LEU A 1 24 ? 42.161 48.979 14.582 1.00 0.00 ? 330 LEU A O    4 
ATOM 2048 C CB   . LEU A 1 24 ? 44.660 48.510 12.576 1.00 0.00 ? 330 LEU A CB   4 
ATOM 2049 C CG   . LEU A 1 24 ? 45.486 47.222 12.309 1.00 0.00 ? 330 LEU A CG   4 
ATOM 2050 C CD1  . LEU A 1 24 ? 44.892 45.979 12.955 1.00 0.00 ? 330 LEU A CD1  4 
ATOM 2051 C CD2  . LEU A 1 24 ? 45.568 46.984 10.797 1.00 0.00 ? 330 LEU A CD2  4 
ATOM 2052 H H    . LEU A 1 24 ? 46.259 47.955 14.671 1.00 0.00 ? 330 LEU A H    4 
ATOM 2053 H HA   . LEU A 1 24 ? 44.296 50.054 13.959 1.00 0.00 ? 330 LEU A HA   4 
ATOM 2054 H HB2  . LEU A 1 24 ? 43.678 48.394 12.127 1.00 0.00 ? 330 LEU A HB2  4 
ATOM 2055 H HB3  . LEU A 1 24 ? 45.165 49.320 12.035 1.00 0.00 ? 330 LEU A HB3  4 
ATOM 2056 H HG   . LEU A 1 24 ? 46.495 47.362 12.685 1.00 0.00 ? 330 LEU A HG   4 
ATOM 2057 H HD11 . LEU A 1 24 ? 45.440 45.090 12.632 1.00 0.00 ? 330 LEU A HD11 4 
ATOM 2058 H HD12 . LEU A 1 24 ? 44.990 46.034 14.030 1.00 0.00 ? 330 LEU A HD12 4 
ATOM 2059 H HD13 . LEU A 1 24 ? 43.838 45.867 12.689 1.00 0.00 ? 330 LEU A HD13 4 
ATOM 2060 H HD21 . LEU A 1 24 ? 46.015 47.849 10.314 1.00 0.00 ? 330 LEU A HD21 4 
ATOM 2061 H HD22 . LEU A 1 24 ? 46.201 46.115 10.609 1.00 0.00 ? 330 LEU A HD22 4 
ATOM 2062 H HD23 . LEU A 1 24 ? 44.577 46.812 10.392 1.00 0.00 ? 330 LEU A HD23 4 
ATOM 2063 N N    . GLN A 1 25 ? 43.402 47.409 15.610 1.00 0.00 ? 331 GLN A N    4 
ATOM 2064 C CA   . GLN A 1 25 ? 42.278 46.849 16.362 1.00 0.00 ? 331 GLN A CA   4 
ATOM 2065 C C    . GLN A 1 25 ? 41.692 47.846 17.372 1.00 0.00 ? 331 GLN A C    4 
ATOM 2066 O O    . GLN A 1 25 ? 40.492 47.784 17.651 1.00 0.00 ? 331 GLN A O    4 
ATOM 2067 C CB   . GLN A 1 25 ? 42.687 45.553 17.077 1.00 0.00 ? 331 GLN A CB   4 
ATOM 2068 C CG   . GLN A 1 25 ? 41.541 44.546 17.189 1.00 0.00 ? 331 GLN A CG   4 
ATOM 2069 C CD   . GLN A 1 25 ? 41.346 43.765 15.898 1.00 0.00 ? 331 GLN A CD   4 
ATOM 2070 O OE1  . GLN A 1 25 ? 41.144 44.312 14.825 1.00 0.00 ? 331 GLN A OE1  4 
ATOM 2071 N NE2  . GLN A 1 25 ? 41.444 42.453 15.926 1.00 0.00 ? 331 GLN A NE2  4 
ATOM 2072 H H    . GLN A 1 25 ? 44.313 46.990 15.719 1.00 0.00 ? 331 GLN A H    4 
ATOM 2073 H HA   . GLN A 1 25 ? 41.484 46.623 15.651 1.00 0.00 ? 331 GLN A HA   4 
ATOM 2074 H HB2  . GLN A 1 25 ? 43.489 45.067 16.524 1.00 0.00 ? 331 GLN A HB2  4 
ATOM 2075 H HB3  . GLN A 1 25 ? 43.054 45.792 18.078 1.00 0.00 ? 331 GLN A HB3  4 
ATOM 2076 H HG2  . GLN A 1 25 ? 41.780 43.850 18.000 1.00 0.00 ? 331 GLN A HG2  4 
ATOM 2077 H HG3  . GLN A 1 25 ? 40.607 45.053 17.457 1.00 0.00 ? 331 GLN A HG3  4 
ATOM 2078 H HE21 . GLN A 1 25 ? 41.598 41.971 16.786 1.00 0.00 ? 331 GLN A HE21 4 
ATOM 2079 H HE22 . GLN A 1 25 ? 41.301 41.990 15.042 1.00 0.00 ? 331 GLN A HE22 4 
ATOM 2080 N N    . SER A 1 26 ? 42.483 48.798 17.861 1.00 0.00 ? 332 SER A N    4 
ATOM 2081 C CA   . SER A 1 26 ? 42.033 49.876 18.749 1.00 0.00 ? 332 SER A CA   4 
ATOM 2082 C C    . SER A 1 26 ? 40.931 50.720 18.097 1.00 0.00 ? 332 SER A C    4 
ATOM 2083 O O    . SER A 1 26 ? 39.994 51.116 18.783 1.00 0.00 ? 332 SER A O    4 
ATOM 2084 C CB   . SER A 1 26 ? 43.200 50.798 19.134 1.00 0.00 ? 332 SER A CB   4 
ATOM 2085 O OG   . SER A 1 26 ? 44.185 50.069 19.833 1.00 0.00 ? 332 SER A OG   4 
ATOM 2086 H H    . SER A 1 26 ? 43.474 48.755 17.630 1.00 0.00 ? 332 SER A H    4 
ATOM 2087 H HA   . SER A 1 26 ? 41.618 49.442 19.661 1.00 0.00 ? 332 SER A HA   4 
ATOM 2088 H HB2  . SER A 1 26 ? 43.635 51.232 18.231 1.00 0.00 ? 332 SER A HB2  4 
ATOM 2089 H HB3  . SER A 1 26 ? 42.825 51.597 19.767 1.00 0.00 ? 332 SER A HB3  4 
ATOM 2090 H HG   . SER A 1 26 ? 44.642 49.480 19.212 1.00 0.00 ? 332 SER A HG   4 
ATOM 2091 N N    . SER A 1 27 ? 40.995 50.947 16.773 1.00 0.00 ? 333 SER A N    4 
ATOM 2092 C CA   . SER A 1 27 ? 39.958 51.672 16.016 1.00 0.00 ? 333 SER A CA   4 
ATOM 2093 C C    . SER A 1 27 ? 38.629 50.919 16.018 1.00 0.00 ? 333 SER A C    4 
ATOM 2094 O O    . SER A 1 27 ? 37.591 51.456 16.418 1.00 0.00 ? 333 SER A O    4 
ATOM 2095 C CB   . SER A 1 27 ? 40.458 51.908 14.582 1.00 0.00 ? 333 SER A CB   4 
ATOM 2096 O OG   . SER A 1 27 ? 39.555 52.738 13.892 1.00 0.00 ? 333 SER A OG   4 
ATOM 2097 H H    . SER A 1 27 ? 41.749 50.524 16.258 1.00 0.00 ? 333 SER A H    4 
ATOM 2098 H HA   . SER A 1 27 ? 39.798 52.649 16.486 1.00 0.00 ? 333 SER A HA   4 
ATOM 2099 H HB2  . SER A 1 27 ? 41.435 52.385 14.615 1.00 0.00 ? 333 SER A HB2  4 
ATOM 2100 H HB3  . SER A 1 27 ? 40.546 50.949 14.064 1.00 0.00 ? 333 SER A HB3  4 
ATOM 2101 H HG   . SER A 1 27 ? 39.784 52.730 12.959 1.00 0.00 ? 333 SER A HG   4 
ATOM 2102 N N    . TRP A 1 28 ? 38.651 49.631 15.666 1.00 0.00 ? 334 TRP A N    4 
ATOM 2103 C CA   . TRP A 1 28 ? 37.462 48.768 15.680 1.00 0.00 ? 334 TRP A CA   4 
ATOM 2104 C C    . TRP A 1 28 ? 36.912 48.572 17.103 1.00 0.00 ? 334 TRP A C    4 
ATOM 2105 O O    . TRP A 1 28 ? 35.701 48.615 17.325 1.00 0.00 ? 334 TRP A O    4 
ATOM 2106 C CB   . TRP A 1 28 ? 37.809 47.435 15.006 1.00 0.00 ? 334 TRP A CB   4 
ATOM 2107 C CG   . TRP A 1 28 ? 38.411 47.564 13.635 1.00 0.00 ? 334 TRP A CG   4 
ATOM 2108 C CD1  . TRP A 1 28 ? 39.600 47.047 13.237 1.00 0.00 ? 334 TRP A CD1  4 
ATOM 2109 C CD2  . TRP A 1 28 ? 37.876 48.267 12.466 1.00 0.00 ? 334 TRP A CD2  4 
ATOM 2110 N NE1  . TRP A 1 28 ? 39.846 47.394 11.927 1.00 0.00 ? 334 TRP A NE1  4 
ATOM 2111 C CE2  . TRP A 1 28 ? 38.829 48.155 11.397 1.00 0.00 ? 334 TRP A CE2  4 
ATOM 2112 C CE3  . TRP A 1 28 ? 36.700 48.987 12.187 1.00 0.00 ? 334 TRP A CE3  4 
ATOM 2113 C CZ2  . TRP A 1 28 ? 38.619 48.740 10.141 1.00 0.00 ? 334 TRP A CZ2  4 
ATOM 2114 C CZ3  . TRP A 1 28 ? 36.470 49.572 10.932 1.00 0.00 ? 334 TRP A CZ3  4 
ATOM 2115 C CH2  . TRP A 1 28 ? 37.424 49.453 9.904  1.00 0.00 ? 334 TRP A CH2  4 
ATOM 2116 H H    . TRP A 1 28 ? 39.524 49.232 15.354 1.00 0.00 ? 334 TRP A H    4 
ATOM 2117 H HA   . TRP A 1 28 ? 36.671 49.254 15.109 1.00 0.00 ? 334 TRP A HA   4 
ATOM 2118 H HB2  . TRP A 1 28 ? 38.523 46.904 15.643 1.00 0.00 ? 334 TRP A HB2  4 
ATOM 2119 H HB3  . TRP A 1 28 ? 36.910 46.835 14.938 1.00 0.00 ? 334 TRP A HB3  4 
ATOM 2120 H HD1  . TRP A 1 28 ? 40.252 46.445 13.862 1.00 0.00 ? 334 TRP A HD1  4 
ATOM 2121 H HE1  . TRP A 1 28 ? 40.672 47.112 11.428 1.00 0.00 ? 334 TRP A HE1  4 
ATOM 2122 H HE3  . TRP A 1 28 ? 35.944 49.078 12.967 1.00 0.00 ? 334 TRP A HE3  4 
ATOM 2123 H HZ2  . TRP A 1 28 ? 39.354 48.629 9.354  1.00 0.00 ? 334 TRP A HZ2  4 
ATOM 2124 H HZ3  . TRP A 1 28 ? 35.556 50.116 10.743 1.00 0.00 ? 334 TRP A HZ3  4 
ATOM 2125 H HH2  . TRP A 1 28 ? 37.246 49.897 8.937  1.00 0.00 ? 334 TRP A HH2  4 
ATOM 2126 N N    . GLY A 1 29 ? 37.806 48.465 18.094 1.00 0.00 ? 335 GLY A N    4 
ATOM 2127 C CA   . GLY A 1 29 ? 37.487 48.388 19.519 1.00 0.00 ? 335 GLY A CA   4 
ATOM 2128 C C    . GLY A 1 29 ? 36.773 49.624 20.066 1.00 0.00 ? 335 GLY A C    4 
ATOM 2129 O O    . GLY A 1 29 ? 35.992 49.475 21.004 1.00 0.00 ? 335 GLY A O    4 
ATOM 2130 H H    . GLY A 1 29 ? 38.785 48.420 17.833 1.00 0.00 ? 335 GLY A H    4 
ATOM 2131 H HA2  . GLY A 1 29 ? 36.845 47.512 19.690 1.00 0.00 ? 335 GLY A HA2  4 
ATOM 2132 H HA3  . GLY A 1 29 ? 38.411 48.250 20.069 1.00 0.00 ? 335 GLY A HA3  4 
ATOM 2133 N N    . MET A 1 30 ? 36.939 50.814 19.473 1.00 0.00 ? 336 MET A N    4 
ATOM 2134 C CA   . MET A 1 30 ? 36.177 52.001 19.875 1.00 0.00 ? 336 MET A CA   4 
ATOM 2135 C C    . MET A 1 30 ? 34.674 51.824 19.644 1.00 0.00 ? 336 MET A C    4 
ATOM 2136 O O    . MET A 1 30 ? 33.863 52.307 20.439 1.00 0.00 ? 336 MET A O    4 
ATOM 2137 C CB   . MET A 1 30 ? 36.639 53.280 19.152 1.00 0.00 ? 336 MET A CB   4 
ATOM 2138 C CG   . MET A 1 30 ? 38.130 53.552 19.317 1.00 0.00 ? 336 MET A CG   4 
ATOM 2139 S SD   . MET A 1 30 ? 38.596 55.301 19.284 1.00 0.00 ? 336 MET A SD   4 
ATOM 2140 C CE   . MET A 1 30 ? 40.378 55.106 19.539 1.00 0.00 ? 336 MET A CE   4 
ATOM 2141 H H    . MET A 1 30 ? 37.617 50.896 18.714 1.00 0.00 ? 336 MET A H    4 
ATOM 2142 H HA   . MET A 1 30 ? 36.316 52.146 20.953 1.00 0.00 ? 336 MET A HA   4 
ATOM 2143 H HB2  . MET A 1 30 ? 36.401 53.217 18.094 1.00 0.00 ? 336 MET A HB2  4 
ATOM 2144 H HB3  . MET A 1 30 ? 36.085 54.116 19.580 1.00 0.00 ? 336 MET A HB3  4 
ATOM 2145 H HG2  . MET A 1 30 ? 38.468 53.135 20.265 1.00 0.00 ? 336 MET A HG2  4 
ATOM 2146 H HG3  . MET A 1 30 ? 38.650 53.050 18.507 1.00 0.00 ? 336 MET A HG3  4 
ATOM 2147 H HE1  . MET A 1 30 ? 40.851 56.080 19.610 1.00 0.00 ? 336 MET A HE1  4 
ATOM 2148 H HE2  . MET A 1 30 ? 40.553 54.549 20.463 1.00 0.00 ? 336 MET A HE2  4 
ATOM 2149 H HE3  . MET A 1 30 ? 40.805 54.552 18.696 1.00 0.00 ? 336 MET A HE3  4 
ATOM 2150 N N    . MET A 1 31 ? 34.280 51.100 18.589 1.00 0.00 ? 337 MET A N    4 
ATOM 2151 C CA   . MET A 1 31 ? 32.875 50.753 18.355 1.00 0.00 ? 337 MET A CA   4 
ATOM 2152 C C    . MET A 1 31 ? 32.430 49.563 19.211 1.00 0.00 ? 337 MET A C    4 
ATOM 2153 O O    . MET A 1 31 ? 31.334 49.610 19.769 1.00 0.00 ? 337 MET A O    4 
ATOM 2154 C CB   . MET A 1 31 ? 32.616 50.518 16.858 1.00 0.00 ? 337 MET A CB   4 
ATOM 2155 C CG   . MET A 1 31 ? 32.874 51.803 16.053 1.00 0.00 ? 337 MET A CG   4 
ATOM 2156 S SD   . MET A 1 31 ? 32.337 51.755 14.325 1.00 0.00 ? 337 MET A SD   4 
ATOM 2157 C CE   . MET A 1 31 ? 33.626 50.722 13.597 1.00 0.00 ? 337 MET A CE   4 
ATOM 2158 H H    . MET A 1 31 ? 34.990 50.683 17.994 1.00 0.00 ? 337 MET A H    4 
ATOM 2159 H HA   . MET A 1 31 ? 32.256 51.600 18.654 1.00 0.00 ? 337 MET A HA   4 
ATOM 2160 H HB2  . MET A 1 31 ? 33.262 49.715 16.484 1.00 0.00 ? 337 MET A HB2  4 
ATOM 2161 H HB3  . MET A 1 31 ? 31.576 50.224 16.714 1.00 0.00 ? 337 MET A HB3  4 
ATOM 2162 H HG2  . MET A 1 31 ? 32.343 52.623 16.541 1.00 0.00 ? 337 MET A HG2  4 
ATOM 2163 H HG3  . MET A 1 31 ? 33.938 52.038 16.079 1.00 0.00 ? 337 MET A HG3  4 
ATOM 2164 H HE1  . MET A 1 31 ? 33.447 50.618 12.529 1.00 0.00 ? 337 MET A HE1  4 
ATOM 2165 H HE2  . MET A 1 31 ? 34.598 51.197 13.751 1.00 0.00 ? 337 MET A HE2  4 
ATOM 2166 H HE3  . MET A 1 31 ? 33.616 49.742 14.058 1.00 0.00 ? 337 MET A HE3  4 
ATOM 2167 N N    . GLY A 1 32 ? 33.299 48.557 19.383 1.00 0.00 ? 338 GLY A N    4 
ATOM 2168 C CA   . GLY A 1 32 ? 33.056 47.408 20.268 1.00 0.00 ? 338 GLY A CA   4 
ATOM 2169 C C    . GLY A 1 32 ? 32.743 47.832 21.707 1.00 0.00 ? 338 GLY A C    4 
ATOM 2170 O O    . GLY A 1 32 ? 31.640 47.602 22.174 1.00 0.00 ? 338 GLY A O    4 
ATOM 2171 H H    . GLY A 1 32 ? 34.177 48.595 18.870 1.00 0.00 ? 338 GLY A H    4 
ATOM 2172 H HA2  . GLY A 1 32 ? 32.213 46.836 19.894 1.00 0.00 ? 338 GLY A HA2  4 
ATOM 2173 H HA3  . GLY A 1 32 ? 33.931 46.771 20.284 1.00 0.00 ? 338 GLY A HA3  4 
ATOM 2174 N N    . MET A 1 33 ? 33.650 48.555 22.368 1.00 0.00 ? 339 MET A N    4 
ATOM 2175 C CA   . MET A 1 33 ? 33.476 48.956 23.773 1.00 0.00 ? 339 MET A CA   4 
ATOM 2176 C C    . MET A 1 33 ? 32.184 49.755 24.035 1.00 0.00 ? 339 MET A C    4 
ATOM 2177 O O    . MET A 1 33 ? 31.589 49.614 25.095 1.00 0.00 ? 339 MET A O    4 
ATOM 2178 C CB   . MET A 1 33 ? 34.687 49.754 24.264 1.00 0.00 ? 339 MET A CB   4 
ATOM 2179 C CG   . MET A 1 33 ? 35.955 48.892 24.379 1.00 0.00 ? 339 MET A CG   4 
ATOM 2180 S SD   . MET A 1 33 ? 37.240 49.590 25.446 1.00 0.00 ? 339 MET A SD   4 
ATOM 2181 C CE   . MET A 1 33 ? 36.527 49.229 27.079 1.00 0.00 ? 339 MET A CE   4 
ATOM 2182 H H    . MET A 1 33 ? 34.533 48.777 21.912 1.00 0.00 ? 339 MET A H    4 
ATOM 2183 H HA   . MET A 1 33 ? 33.403 48.046 24.372 1.00 0.00 ? 339 MET A HA   4 
ATOM 2184 H HB2  . MET A 1 33 ? 34.885 50.587 23.585 1.00 0.00 ? 339 MET A HB2  4 
ATOM 2185 H HB3  . MET A 1 33 ? 34.454 50.157 25.250 1.00 0.00 ? 339 MET A HB3  4 
ATOM 2186 H HG2  . MET A 1 33 ? 35.682 47.910 24.781 1.00 0.00 ? 339 MET A HG2  4 
ATOM 2187 H HG3  . MET A 1 33 ? 36.370 48.739 23.388 1.00 0.00 ? 339 MET A HG3  4 
ATOM 2188 H HE1  . MET A 1 33 ? 37.216 49.540 27.859 1.00 0.00 ? 339 MET A HE1  4 
ATOM 2189 H HE2  . MET A 1 33 ? 35.577 49.755 27.195 1.00 0.00 ? 339 MET A HE2  4 
ATOM 2190 H HE3  . MET A 1 33 ? 36.350 48.154 27.162 1.00 0.00 ? 339 MET A HE3  4 
ATOM 2191 N N    . LEU A 1 34 ? 31.719 50.552 23.067 1.00 0.00 ? 340 LEU A N    4 
ATOM 2192 C CA   . LEU A 1 34 ? 30.461 51.301 23.191 1.00 0.00 ? 340 LEU A CA   4 
ATOM 2193 C C    . LEU A 1 34 ? 29.228 50.408 22.917 1.00 0.00 ? 340 LEU A C    4 
ATOM 2194 O O    . LEU A 1 34 ? 28.220 50.515 23.627 1.00 0.00 ? 340 LEU A O    4 
ATOM 2195 C CB   . LEU A 1 34 ? 30.490 52.506 22.232 1.00 0.00 ? 340 LEU A CB   4 
ATOM 2196 C CG   . LEU A 1 34 ? 31.604 53.532 22.521 1.00 0.00 ? 340 LEU A CG   4 
ATOM 2197 C CD1  . LEU A 1 34 ? 31.607 54.608 21.442 1.00 0.00 ? 340 LEU A CD1  4 
ATOM 2198 C CD2  . LEU A 1 34 ? 31.451 54.221 23.884 1.00 0.00 ? 340 LEU A CD2  4 
ATOM 2199 H H    . LEU A 1 34 ? 32.232 50.607 22.197 1.00 0.00 ? 340 LEU A H    4 
ATOM 2200 H HA   . LEU A 1 34 ? 30.349 51.665 24.214 1.00 0.00 ? 340 LEU A HA   4 
ATOM 2201 H HB2  . LEU A 1 34 ? 30.612 52.133 21.219 1.00 0.00 ? 340 LEU A HB2  4 
ATOM 2202 H HB3  . LEU A 1 34 ? 29.527 53.018 22.289 1.00 0.00 ? 340 LEU A HB3  4 
ATOM 2203 H HG   . LEU A 1 34 ? 32.580 53.033 22.512 1.00 0.00 ? 340 LEU A HG   4 
ATOM 2204 H HD11 . LEU A 1 34 ? 32.432 55.296 21.607 1.00 0.00 ? 340 LEU A HD11 4 
ATOM 2205 H HD12 . LEU A 1 34 ? 31.750 54.137 20.465 1.00 0.00 ? 340 LEU A HD12 4 
ATOM 2206 H HD13 . LEU A 1 34 ? 30.662 55.157 21.445 1.00 0.00 ? 340 LEU A HD13 4 
ATOM 2207 H HD21 . LEU A 1 34 ? 31.539 53.485 24.685 1.00 0.00 ? 340 LEU A HD21 4 
ATOM 2208 H HD22 . LEU A 1 34 ? 32.235 54.966 24.007 1.00 0.00 ? 340 LEU A HD22 4 
ATOM 2209 H HD23 . LEU A 1 34 ? 30.477 54.703 23.944 1.00 0.00 ? 340 LEU A HD23 4 
ATOM 2210 N N    . ALA A 1 35 ? 29.316 49.506 21.933 1.00 0.00 ? 341 ALA A N    4 
ATOM 2211 C CA   . ALA A 1 35 ? 28.251 48.567 21.596 1.00 0.00 ? 341 ALA A CA   4 
ATOM 2212 C C    . ALA A 1 35 ? 28.114 47.416 22.606 1.00 0.00 ? 341 ALA A C    4 
ATOM 2213 O O    . ALA A 1 35 ? 27.033 46.852 22.744 1.00 0.00 ? 341 ALA A O    4 
ATOM 2214 C CB   . ALA A 1 35 ? 28.494 48.054 20.176 1.00 0.00 ? 341 ALA A CB   4 
ATOM 2215 H H    . ALA A 1 35 ? 30.183 49.443 21.407 1.00 0.00 ? 341 ALA A H    4 
ATOM 2216 H HA   . ALA A 1 35 ? 27.306 49.105 21.600 1.00 0.00 ? 341 ALA A HA   4 
ATOM 2217 H HB1  . ALA A 1 35 ? 27.653 47.455 19.854 1.00 0.00 ? 341 ALA A HB1  4 
ATOM 2218 H HB2  . ALA A 1 35 ? 28.612 48.897 19.489 1.00 0.00 ? 341 ALA A HB2  4 
ATOM 2219 H HB3  . ALA A 1 35 ? 29.408 47.445 20.158 1.00 0.00 ? 341 ALA A HB3  4 
ATOM 2220 N N    . SER A 1 36 ? 29.155 47.092 23.365 1.00 0.00 ? 342 SER A N    4 
ATOM 2221 C CA   . SER A 1 36 ? 29.140 46.052 24.392 1.00 0.00 ? 342 SER A CA   4 
ATOM 2222 C C    . SER A 1 36 ? 28.665 46.592 25.750 1.00 0.00 ? 342 SER A C    4 
ATOM 2223 O O    . SER A 1 36 ? 27.785 46.000 26.363 1.00 0.00 ? 342 SER A O    4 
ATOM 2224 C CB   . SER A 1 36 ? 30.497 45.354 24.441 1.00 0.00 ? 342 SER A CB   4 
ATOM 2225 O OG   . SER A 1 36 ? 30.765 44.859 23.139 1.00 0.00 ? 342 SER A OG   4 
ATOM 2226 H H    . SER A 1 36 ? 30.068 47.447 23.088 1.00 0.00 ? 342 SER A H    4 
ATOM 2227 H HA   . SER A 1 36 ? 28.419 45.284 24.097 1.00 0.00 ? 342 SER A HA   4 
ATOM 2228 H HB2  . SER A 1 36 ? 31.277 46.061 24.727 1.00 0.00 ? 342 SER A HB2  4 
ATOM 2229 H HB3  . SER A 1 36 ? 30.470 44.522 25.143 1.00 0.00 ? 342 SER A HB3  4 
ATOM 2230 H HG   . SER A 1 36 ? 31.722 44.580 23.106 1.00 0.00 ? 342 SER A HG   4 
ATOM 2231 N N    . GLN A 1 37 ? 29.136 47.791 26.166 1.00 0.00 ? 343 GLN A N    4 
ATOM 2232 C CA   . GLN A 1 37 ? 28.808 48.416 27.462 1.00 0.00 ? 343 GLN A CA   4 
ATOM 2233 C C    . GLN A 1 37 ? 27.313 48.570 27.789 1.00 0.00 ? 343 GLN A C    4 
ATOM 2234 O O    . GLN A 1 37 ? 26.942 48.454 28.947 1.00 0.00 ? 343 GLN A O    4 
ATOM 2235 C CB   . GLN A 1 37 ? 29.455 49.819 27.505 1.00 0.00 ? 343 GLN A CB   4 
ATOM 2236 C CG   . GLN A 1 37 ? 30.891 49.809 28.073 1.00 0.00 ? 343 GLN A CG   4 
ATOM 2237 C CD   . GLN A 1 37 ? 30.909 49.836 29.596 1.00 0.00 ? 343 GLN A CD   4 
ATOM 2238 O OE1  . GLN A 1 37 ? 31.068 48.829 30.261 1.00 0.00 ? 343 GLN A OE1  4 
ATOM 2239 N NE2  . GLN A 1 37 ? 30.737 50.984 30.215 1.00 0.00 ? 343 GLN A NE2  4 
ATOM 2240 H H    . GLN A 1 37 ? 29.835 48.237 25.592 1.00 0.00 ? 343 GLN A H    4 
ATOM 2241 H HA   . GLN A 1 37 ? 29.238 47.808 28.258 1.00 0.00 ? 343 GLN A HA   4 
ATOM 2242 H HB2  . GLN A 1 37 ? 29.455 50.249 26.501 1.00 0.00 ? 343 GLN A HB2  4 
ATOM 2243 H HB3  . GLN A 1 37 ? 28.858 50.478 28.127 1.00 0.00 ? 343 GLN A HB3  4 
ATOM 2244 H HG2  . GLN A 1 37 ? 31.427 48.937 27.709 1.00 0.00 ? 343 GLN A HG2  4 
ATOM 2245 H HG3  . GLN A 1 37 ? 31.404 50.702 27.706 1.00 0.00 ? 343 GLN A HG3  4 
ATOM 2246 H HE21 . GLN A 1 37 ? 30.602 51.830 29.690 1.00 0.00 ? 343 GLN A HE21 4 
ATOM 2247 H HE22 . GLN A 1 37 ? 30.740 50.934 31.212 1.00 0.00 ? 343 GLN A HE22 4 
ATOM 2248 N N    . GLN A 1 38 ? 26.471 48.876 26.791 1.00 0.00 ? 344 GLN A N    4 
ATOM 2249 C CA   . GLN A 1 38 ? 25.011 49.081 26.993 1.00 0.00 ? 344 GLN A CA   4 
ATOM 2250 C C    . GLN A 1 38 ? 24.125 48.477 25.881 1.00 0.00 ? 344 GLN A C    4 
ATOM 2251 O O    . GLN A 1 38 ? 22.908 48.581 25.958 1.00 0.00 ? 344 GLN A O    4 
ATOM 2252 C CB   . GLN A 1 38 ? 24.714 50.580 27.192 1.00 0.00 ? 344 GLN A CB   4 
ATOM 2253 C CG   . GLN A 1 38 ? 25.091 51.128 28.591 1.00 0.00 ? 344 GLN A CG   4 
ATOM 2254 C CD   . GLN A 1 38 ? 24.225 50.583 29.732 1.00 0.00 ? 344 GLN A CD   4 
ATOM 2255 O OE1  . GLN A 1 38 ? 23.180 49.966 29.561 1.00 0.00 ? 344 GLN A OE1  4 
ATOM 2256 N NE2  . GLN A 1 38 ? 24.583 50.829 30.973 1.00 0.00 ? 344 GLN A NE2  4 
ATOM 2257 H H    . GLN A 1 38 ? 26.863 49.039 25.879 1.00 0.00 ? 344 GLN A H    4 
ATOM 2258 H HA   . GLN A 1 38 ? 24.715 48.555 27.896 1.00 0.00 ? 344 GLN A HA   4 
ATOM 2259 H HB2  . GLN A 1 38 ? 25.257 51.155 26.434 1.00 0.00 ? 344 GLN A HB2  4 
ATOM 2260 H HB3  . GLN A 1 38 ? 23.648 50.768 27.045 1.00 0.00 ? 344 GLN A HB3  4 
ATOM 2261 H HG2  . GLN A 1 38 ? 26.129 50.915 28.800 1.00 0.00 ? 344 GLN A HG2  4 
ATOM 2262 H HG3  . GLN A 1 38 ? 24.971 52.211 28.581 1.00 0.00 ? 344 GLN A HG3  4 
ATOM 2263 H HE21 . GLN A 1 38 ? 25.457 51.278 31.173 1.00 0.00 ? 344 GLN A HE21 4 
ATOM 2264 H HE22 . GLN A 1 38 ? 23.999 50.421 31.670 1.00 0.00 ? 344 GLN A HE22 4 
ATOM 2265 N N    . ASN A 1 39 ? 24.714 47.830 24.866 1.00 0.00 ? 345 ASN A N    4 
ATOM 2266 C CA   . ASN A 1 39 ? 23.971 47.071 23.849 1.00 0.00 ? 345 ASN A CA   4 
ATOM 2267 C C    . ASN A 1 39 ? 24.384 45.580 23.785 1.00 0.00 ? 345 ASN A C    4 
ATOM 2268 O O    . ASN A 1 39 ? 23.735 44.822 23.075 1.00 0.00 ? 345 ASN A O    4 
ATOM 2269 C CB   . ASN A 1 39 ? 24.088 47.785 22.479 1.00 0.00 ? 345 ASN A CB   4 
ATOM 2270 C CG   . ASN A 1 39 ? 23.080 48.902 22.295 1.00 0.00 ? 345 ASN A CG   4 
ATOM 2271 O OD1  . ASN A 1 39 ? 21.907 48.674 22.083 1.00 0.00 ? 345 ASN A OD1  4 
ATOM 2272 N ND2  . ASN A 1 39 ? 23.503 50.143 22.299 1.00 0.00 ? 345 ASN A ND2  4 
ATOM 2273 H H    . ASN A 1 39 ? 25.713 47.780 24.835 1.00 0.00 ? 345 ASN A H    4 
ATOM 2274 H HA   . ASN A 1 39 ? 22.901 47.047 24.110 1.00 0.00 ? 345 ASN A HA   4 
ATOM 2275 H HB2  . ASN A 1 39 ? 25.088 48.201 22.355 1.00 0.00 ? 345 ASN A HB2  4 
ATOM 2276 H HB3  . ASN A 1 39 ? 23.926 47.069 21.684 1.00 0.00 ? 345 ASN A HB3  4 
ATOM 2277 H HD21 . ASN A 1 39 ? 24.464 50.360 22.482 1.00 0.00 ? 345 ASN A HD21 4 
ATOM 2278 H HD22 . ASN A 1 39 ? 22.793 50.840 22.172 1.00 0.00 ? 345 ASN A HD22 4 
ATOM 2279 N N    . GLN A 1 40 ? 25.404 45.145 24.543 1.00 0.00 ? 346 GLN A N    4 
ATOM 2280 C CA   . GLN A 1 40 ? 25.923 43.761 24.587 1.00 0.00 ? 346 GLN A CA   4 
ATOM 2281 C C    . GLN A 1 40 ? 26.196 43.131 23.204 1.00 0.00 ? 346 GLN A C    4 
ATOM 2282 O O    . GLN A 1 40 ? 26.066 41.916 23.025 1.00 0.00 ? 346 GLN A O    4 
ATOM 2283 C CB   . GLN A 1 40 ? 25.044 42.900 25.510 1.00 0.00 ? 346 GLN A CB   4 
ATOM 2284 C CG   . GLN A 1 40 ? 25.053 43.404 26.969 1.00 0.00 ? 346 GLN A CG   4 
ATOM 2285 C CD   . GLN A 1 40 ? 24.244 42.502 27.882 1.00 0.00 ? 346 GLN A CD   4 
ATOM 2286 O OE1  . GLN A 1 40 ? 24.748 41.667 28.600 1.00 0.00 ? 346 GLN A OE1  4 
ATOM 2287 N NE2  . GLN A 1 40 ? 22.935 42.633 27.911 1.00 0.00 ? 346 GLN A NE2  4 
ATOM 2288 H H    . GLN A 1 40 ? 25.897 45.815 25.126 1.00 0.00 ? 346 GLN A H    4 
ATOM 2289 H HA   . GLN A 1 40 ? 26.905 43.808 25.061 1.00 0.00 ? 346 GLN A HA   4 
ATOM 2290 H HB2  . GLN A 1 40 ? 24.016 42.881 25.136 1.00 0.00 ? 346 GLN A HB2  4 
ATOM 2291 H HB3  . GLN A 1 40 ? 25.425 41.876 25.515 1.00 0.00 ? 346 GLN A HB3  4 
ATOM 2292 H HG2  . GLN A 1 40 ? 26.090 43.442 27.321 1.00 0.00 ? 346 GLN A HG2  4 
ATOM 2293 H HG3  . GLN A 1 40 ? 24.645 44.412 27.007 1.00 0.00 ? 346 GLN A HG3  4 
ATOM 2294 H HE21 . GLN A 1 40 ? 22.485 43.316 27.321 1.00 0.00 ? 346 GLN A HE21 4 
ATOM 2295 H HE22 . GLN A 1 40 ? 22.446 42.019 28.528 1.00 0.00 ? 346 GLN A HE22 4 
ATOM 2296 N N    . SER A 1 41 ? 26.571 43.950 22.216 1.00 0.00 ? 347 SER A N    4 
ATOM 2297 C CA   . SER A 1 41 ? 26.675 43.549 20.795 1.00 0.00 ? 347 SER A CA   4 
ATOM 2298 C C    . SER A 1 41 ? 28.043 42.960 20.404 1.00 0.00 ? 347 SER A C    4 
ATOM 2299 O O    . SER A 1 41 ? 28.433 43.006 19.239 1.00 0.00 ? 347 SER A O    4 
ATOM 2300 C CB   . SER A 1 41 ? 26.277 44.732 19.907 1.00 0.00 ? 347 SER A CB   4 
ATOM 2301 O OG   . SER A 1 41 ? 25.620 44.292 18.733 1.00 0.00 ? 347 SER A OG   4 
ATOM 2302 H H    . SER A 1 41 ? 26.680 44.927 22.434 1.00 0.00 ? 347 SER A H    4 
ATOM 2303 H HA   . SER A 1 41 ? 25.939 42.760 20.633 1.00 0.00 ? 347 SER A HA   4 
ATOM 2304 H HB2  . SER A 1 41 ? 25.587 45.376 20.454 1.00 0.00 ? 347 SER A HB2  4 
ATOM 2305 H HB3  . SER A 1 41 ? 27.162 45.299 19.647 1.00 0.00 ? 347 SER A HB3  4 
ATOM 2306 H HG   . SER A 1 41 ? 25.708 44.966 18.069 1.00 0.00 ? 347 SER A HG   4 
ATOM 2307 N N    . GLY A 1 42 ? 28.811 42.452 21.369 1.00 0.00 ? 348 GLY A N    4 
ATOM 2308 C CA   . GLY A 1 42 ? 30.179 41.957 21.172 1.00 0.00 ? 348 GLY A CA   4 
ATOM 2309 C C    . GLY A 1 42 ? 30.965 41.783 22.473 1.00 0.00 ? 348 GLY A C    4 
ATOM 2310 O O    . GLY A 1 42 ? 30.373 41.803 23.552 1.00 0.00 ? 348 GLY A O    4 
ATOM 2311 H H    . GLY A 1 42 ? 28.452 42.431 22.319 1.00 0.00 ? 348 GLY A H    4 
ATOM 2312 H HA2  . GLY A 1 42 ? 30.146 40.998 20.649 1.00 0.00 ? 348 GLY A HA2  4 
ATOM 2313 H HA3  . GLY A 1 42 ? 30.709 42.681 20.545 1.00 0.00 ? 348 GLY A HA3  4 
ATOM 2314 N N    . PRO A 1 43 ? 32.291 41.597 22.377 1.00 0.00 ? 349 PRO A N    4 
ATOM 2315 C CA   . PRO A 1 43 ? 33.242 41.739 23.478 1.00 0.00 ? 349 PRO A CA   4 
ATOM 2316 C C    . PRO A 1 43 ? 33.590 43.212 23.791 1.00 0.00 ? 349 PRO A C    4 
ATOM 2317 O O    . PRO A 1 43 ? 34.239 43.432 24.830 1.00 0.00 ? 349 PRO A O    4 
ATOM 2318 C CB   . PRO A 1 43 ? 34.475 40.956 23.017 1.00 0.00 ? 349 PRO A CB   4 
ATOM 2319 C CG   . PRO A 1 43 ? 34.502 41.241 21.520 1.00 0.00 ? 349 PRO A CG   4 
ATOM 2320 C CD   . PRO A 1 43 ? 33.014 41.284 21.142 1.00 0.00 ? 349 PRO A CD   4 
ATOM 2321 O OXT  . PRO A 1 43 ? 33.223 44.100 22.982 1.00 0.00 ? 349 PRO A OXT  4 
ATOM 2322 H HA   . PRO A 1 43 ? 32.847 41.295 24.390 1.00 0.00 ? 349 PRO A HA   4 
ATOM 2323 H HB2  . PRO A 1 43 ? 35.391 41.296 23.514 1.00 0.00 ? 349 PRO A HB2  4 
ATOM 2324 H HB3  . PRO A 1 43 ? 34.322 39.896 23.188 1.00 0.00 ? 349 PRO A HB3  4 
ATOM 2325 H HG2  . PRO A 1 43 ? 34.944 42.218 21.341 1.00 0.00 ? 349 PRO A HG2  4 
ATOM 2326 H HG3  . PRO A 1 43 ? 35.030 40.466 20.969 1.00 0.00 ? 349 PRO A HG3  4 
ATOM 2327 H HD2  . PRO A 1 43 ? 32.848 42.044 20.384 1.00 0.00 ? 349 PRO A HD2  4 
ATOM 2328 H HD3  . PRO A 1 43 ? 32.708 40.299 20.784 1.00 0.00 ? 349 PRO A HD3  4 
ATOM 2329 N N    . MET A 1 1  ? 56.797 33.893 27.597 1.00 0.00 ? 307 MET A N    5 
ATOM 2330 C CA   . MET A 1 1  ? 56.899 32.421 27.593 1.00 0.00 ? 307 MET A CA   5 
ATOM 2331 C C    . MET A 1 1  ? 57.910 31.998 26.547 1.00 0.00 ? 307 MET A C    5 
ATOM 2332 O O    . MET A 1 1  ? 59.073 32.300 26.775 1.00 0.00 ? 307 MET A O    5 
ATOM 2333 C CB   . MET A 1 1  ? 55.512 31.745 27.546 1.00 0.00 ? 307 MET A CB   5 
ATOM 2334 C CG   . MET A 1 1  ? 55.476 30.489 28.424 1.00 0.00 ? 307 MET A CG   5 
ATOM 2335 S SD   . MET A 1 1  ? 53.793 29.998 28.866 1.00 0.00 ? 307 MET A SD   5 
ATOM 2336 C CE   . MET A 1 1  ? 54.107 29.038 30.370 1.00 0.00 ? 307 MET A CE   5 
ATOM 2337 H H1   . MET A 1 1  ? 57.730 34.280 27.613 1.00 0.00 ? 307 MET A H1   5 
ATOM 2338 H H2   . MET A 1 1  ? 56.319 34.221 26.759 1.00 0.00 ? 307 MET A H2   5 
ATOM 2339 H H3   . MET A 1 1  ? 56.285 34.217 28.403 1.00 0.00 ? 307 MET A H3   5 
ATOM 2340 H HA   . MET A 1 1  ? 57.343 32.136 28.552 1.00 0.00 ? 307 MET A HA   5 
ATOM 2341 H HB2  . MET A 1 1  ? 54.773 32.439 27.931 1.00 0.00 ? 307 MET A HB2  5 
ATOM 2342 H HB3  . MET A 1 1  ? 55.234 31.487 26.524 1.00 0.00 ? 307 MET A HB3  5 
ATOM 2343 H HG2  . MET A 1 1  ? 55.979 29.663 27.913 1.00 0.00 ? 307 MET A HG2  5 
ATOM 2344 H HG3  . MET A 1 1  ? 56.020 30.693 29.344 1.00 0.00 ? 307 MET A HG3  5 
ATOM 2345 H HE1  . MET A 1 1  ? 53.154 28.703 30.784 1.00 0.00 ? 307 MET A HE1  5 
ATOM 2346 H HE2  . MET A 1 1  ? 54.713 28.159 30.136 1.00 0.00 ? 307 MET A HE2  5 
ATOM 2347 H HE3  . MET A 1 1  ? 54.615 29.657 31.101 1.00 0.00 ? 307 MET A HE3  5 
ATOM 2348 N N    . GLY A 1 2  ? 57.544 31.427 25.398 1.00 0.00 ? 308 GLY A N    5 
ATOM 2349 C CA   . GLY A 1 2  ? 58.505 31.015 24.363 1.00 0.00 ? 308 GLY A CA   5 
ATOM 2350 C C    . GLY A 1 2  ? 57.848 30.215 23.234 1.00 0.00 ? 308 GLY A C    5 
ATOM 2351 O O    . GLY A 1 2  ? 58.107 29.030 23.105 1.00 0.00 ? 308 GLY A O    5 
ATOM 2352 H H    . GLY A 1 2  ? 56.575 31.157 25.260 1.00 0.00 ? 308 GLY A H    5 
ATOM 2353 H HA2  . GLY A 1 2  ? 58.990 31.901 23.935 1.00 0.00 ? 308 GLY A HA2  5 
ATOM 2354 H HA3  . GLY A 1 2  ? 59.274 30.394 24.815 1.00 0.00 ? 308 GLY A HA3  5 
ATOM 2355 N N    . GLY A 1 3  ? 56.916 30.838 22.499 1.00 0.00 ? 309 GLY A N    5 
ATOM 2356 C CA   . GLY A 1 3  ? 56.011 30.097 21.610 1.00 0.00 ? 309 GLY A CA   5 
ATOM 2357 C C    . GLY A 1 3  ? 55.440 30.896 20.442 1.00 0.00 ? 309 GLY A C    5 
ATOM 2358 O O    . GLY A 1 3  ? 54.272 30.691 20.102 1.00 0.00 ? 309 GLY A O    5 
ATOM 2359 H H    . GLY A 1 3  ? 56.768 31.823 22.639 1.00 0.00 ? 309 GLY A H    5 
ATOM 2360 H HA2  . GLY A 1 3  ? 56.547 29.242 21.178 1.00 0.00 ? 309 GLY A HA2  5 
ATOM 2361 H HA3  . GLY A 1 3  ? 55.185 29.696 22.190 1.00 0.00 ? 309 GLY A HA3  5 
ATOM 2362 N N    . GLY A 1 4  ? 56.190 31.849 19.891 1.00 0.00 ? 310 GLY A N    5 
ATOM 2363 C CA   . GLY A 1 4  ? 55.935 32.544 18.611 1.00 0.00 ? 310 GLY A CA   5 
ATOM 2364 C C    . GLY A 1 4  ? 54.724 33.476 18.521 1.00 0.00 ? 310 GLY A C    5 
ATOM 2365 O O    . GLY A 1 4  ? 54.820 34.519 17.897 1.00 0.00 ? 310 GLY A O    5 
ATOM 2366 H H    . GLY A 1 4  ? 57.120 31.976 20.275 1.00 0.00 ? 310 GLY A H    5 
ATOM 2367 H HA2  . GLY A 1 4  ? 56.817 33.134 18.364 1.00 0.00 ? 310 GLY A HA2  5 
ATOM 2368 H HA3  . GLY A 1 4  ? 55.824 31.792 17.826 1.00 0.00 ? 310 GLY A HA3  5 
ATOM 2369 N N    . MET A 1 5  ? 53.602 33.179 19.182 1.00 0.00 ? 311 MET A N    5 
ATOM 2370 C CA   . MET A 1 5  ? 52.431 34.068 19.322 1.00 0.00 ? 311 MET A CA   5 
ATOM 2371 C C    . MET A 1 5  ? 51.857 34.080 20.750 1.00 0.00 ? 311 MET A C    5 
ATOM 2372 O O    . MET A 1 5  ? 50.790 34.611 21.005 1.00 0.00 ? 311 MET A O    5 
ATOM 2373 C CB   . MET A 1 5  ? 51.379 33.771 18.237 1.00 0.00 ? 311 MET A CB   5 
ATOM 2374 C CG   . MET A 1 5  ? 51.761 34.433 16.909 1.00 0.00 ? 311 MET A CG   5 
ATOM 2375 S SD   . MET A 1 5  ? 50.388 34.716 15.763 1.00 0.00 ? 311 MET A SD   5 
ATOM 2376 C CE   . MET A 1 5  ? 50.263 33.094 14.973 1.00 0.00 ? 311 MET A CE   5 
ATOM 2377 H H    . MET A 1 5  ? 53.533 32.239 19.542 1.00 0.00 ? 311 MET A H    5 
ATOM 2378 H HA   . MET A 1 5  ? 52.759 35.092 19.158 1.00 0.00 ? 311 MET A HA   5 
ATOM 2379 H HB2  . MET A 1 5  ? 51.257 32.697 18.103 1.00 0.00 ? 311 MET A HB2  5 
ATOM 2380 H HB3  . MET A 1 5  ? 50.414 34.183 18.541 1.00 0.00 ? 311 MET A HB3  5 
ATOM 2381 H HG2  . MET A 1 5  ? 52.187 35.418 17.133 1.00 0.00 ? 311 MET A HG2  5 
ATOM 2382 H HG3  . MET A 1 5  ? 52.536 33.856 16.419 1.00 0.00 ? 311 MET A HG3  5 
ATOM 2383 H HE1  . MET A 1 5  ? 49.420 33.097 14.271 1.00 0.00 ? 311 MET A HE1  5 
ATOM 2384 H HE2  . MET A 1 5  ? 51.178 32.885 14.426 1.00 0.00 ? 311 MET A HE2  5 
ATOM 2385 H HE3  . MET A 1 5  ? 50.104 32.315 15.723 1.00 0.00 ? 311 MET A HE3  5 
ATOM 2386 N N    . ASN A 1 6  ? 52.620 33.574 21.730 1.00 0.00 ? 312 ASN A N    5 
ATOM 2387 C CA   . ASN A 1 6  ? 52.213 33.354 23.127 1.00 0.00 ? 312 ASN A CA   5 
ATOM 2388 C C    . ASN A 1 6  ? 51.978 34.649 23.974 1.00 0.00 ? 312 ASN A C    5 
ATOM 2389 O O    . ASN A 1 6  ? 52.104 34.593 25.191 1.00 0.00 ? 312 ASN A O    5 
ATOM 2390 C CB   . ASN A 1 6  ? 53.278 32.428 23.755 1.00 0.00 ? 312 ASN A CB   5 
ATOM 2391 C CG   . ASN A 1 6  ? 52.718 31.261 24.534 1.00 0.00 ? 312 ASN A CG   5 
ATOM 2392 O OD1  . ASN A 1 6  ? 52.853 31.194 25.742 1.00 0.00 ? 312 ASN A OD1  5 
ATOM 2393 N ND2  . ASN A 1 6  ? 52.142 30.284 23.877 1.00 0.00 ? 312 ASN A ND2  5 
ATOM 2394 H H    . ASN A 1 6  ? 53.506 33.192 21.440 1.00 0.00 ? 312 ASN A H    5 
ATOM 2395 H HA   . ASN A 1 6  ? 51.248 32.837 23.106 1.00 0.00 ? 312 ASN A HA   5 
ATOM 2396 H HB2  . ASN A 1 6  ? 53.942 32.024 23.004 1.00 0.00 ? 312 ASN A HB2  5 
ATOM 2397 H HB3  . ASN A 1 6  ? 53.874 32.985 24.463 1.00 0.00 ? 312 ASN A HB3  5 
ATOM 2398 H HD21 . ASN A 1 6  ? 52.046 30.297 22.880 1.00 0.00 ? 312 ASN A HD21 5 
ATOM 2399 H HD22 . ASN A 1 6  ? 51.814 29.511 24.444 1.00 0.00 ? 312 ASN A HD22 5 
ATOM 2400 N N    . PHE A 1 7  ? 51.774 35.823 23.330 1.00 0.00 ? 313 PHE A N    5 
ATOM 2401 C CA   . PHE A 1 7  ? 51.235 37.091 23.880 1.00 0.00 ? 313 PHE A CA   5 
ATOM 2402 C C    . PHE A 1 7  ? 51.283 38.232 22.835 1.00 0.00 ? 313 PHE A C    5 
ATOM 2403 O O    . PHE A 1 7  ? 50.625 39.259 22.997 1.00 0.00 ? 313 PHE A O    5 
ATOM 2404 C CB   . PHE A 1 7  ? 52.006 37.593 25.132 1.00 0.00 ? 313 PHE A CB   5 
ATOM 2405 C CG   . PHE A 1 7  ? 51.406 38.786 25.868 1.00 0.00 ? 313 PHE A CG   5 
ATOM 2406 C CD1  . PHE A 1 7  ? 50.002 38.916 26.030 1.00 0.00 ? 313 PHE A CD1  5 
ATOM 2407 C CD2  . PHE A 1 7  ? 52.249 39.740 26.473 1.00 0.00 ? 313 PHE A CD2  5 
ATOM 2408 C CE1  . PHE A 1 7  ? 49.470 40.008 26.745 1.00 0.00 ? 313 PHE A CE1  5 
ATOM 2409 C CE2  . PHE A 1 7  ? 51.718 40.813 27.199 1.00 0.00 ? 313 PHE A CE2  5 
ATOM 2410 C CZ   . PHE A 1 7  ? 50.323 40.952 27.330 1.00 0.00 ? 313 PHE A CZ   5 
ATOM 2411 H H    . PHE A 1 7  ? 51.598 35.696 22.340 1.00 0.00 ? 313 PHE A H    5 
ATOM 2412 H HA   . PHE A 1 7  ? 50.185 36.922 24.134 1.00 0.00 ? 313 PHE A HA   5 
ATOM 2413 H HB2  . PHE A 1 7  ? 52.057 36.813 25.883 1.00 0.00 ? 313 PHE A HB2  5 
ATOM 2414 H HB3  . PHE A 1 7  ? 53.025 37.841 24.838 1.00 0.00 ? 313 PHE A HB3  5 
ATOM 2415 H HD1  . PHE A 1 7  ? 49.329 38.197 25.610 1.00 0.00 ? 313 PHE A HD1  5 
ATOM 2416 H HD2  . PHE A 1 7  ? 53.326 39.644 26.396 1.00 0.00 ? 313 PHE A HD2  5 
ATOM 2417 H HE1  . PHE A 1 7  ? 48.394 40.105 26.842 1.00 0.00 ? 313 PHE A HE1  5 
ATOM 2418 H HE2  . PHE A 1 7  ? 52.364 41.544 27.670 1.00 0.00 ? 313 PHE A HE2  5 
ATOM 2419 H HZ   . PHE A 1 7  ? 49.902 41.789 27.877 1.00 0.00 ? 313 PHE A HZ   5 
ATOM 2420 N N    . GLY A 1 8  ? 52.157 38.140 21.825 1.00 0.00 ? 314 GLY A N    5 
ATOM 2421 C CA   . GLY A 1 8  ? 52.439 39.233 20.871 1.00 0.00 ? 314 GLY A CA   5 
ATOM 2422 C C    . GLY A 1 8  ? 53.272 40.396 21.451 1.00 0.00 ? 314 GLY A C    5 
ATOM 2423 O O    . GLY A 1 8  ? 54.164 40.894 20.765 1.00 0.00 ? 314 GLY A O    5 
ATOM 2424 H H    . GLY A 1 8  ? 52.658 37.285 21.706 1.00 0.00 ? 314 GLY A H    5 
ATOM 2425 H HA2  . GLY A 1 8  ? 52.967 38.827 20.006 1.00 0.00 ? 314 GLY A HA2  5 
ATOM 2426 H HA3  . GLY A 1 8  ? 51.493 39.647 20.512 1.00 0.00 ? 314 GLY A HA3  5 
ATOM 2427 N N    . ALA A 1 9  ? 53.042 40.792 22.702 1.00 0.00 ? 315 ALA A N    5 
ATOM 2428 C CA   . ALA A 1 9  ? 53.677 41.978 23.321 1.00 0.00 ? 315 ALA A CA   5 
ATOM 2429 C C    . ALA A 1 9  ? 54.983 41.695 24.099 1.00 0.00 ? 315 ALA A C    5 
ATOM 2430 O O    . ALA A 1 9  ? 55.647 42.634 24.513 1.00 0.00 ? 315 ALA A O    5 
ATOM 2431 C CB   . ALA A 1 9  ? 52.661 42.677 24.230 1.00 0.00 ? 315 ALA A CB   5 
ATOM 2432 H H    . ALA A 1 9  ? 52.220 40.418 23.161 1.00 0.00 ? 315 ALA A H    5 
ATOM 2433 H HA   . ALA A 1 9  ? 53.923 42.664 22.509 1.00 0.00 ? 315 ALA A HA   5 
ATOM 2434 H HB1  . ALA A 1 9  ? 52.942 43.720 24.348 1.00 0.00 ? 315 ALA A HB1  5 
ATOM 2435 H HB2  . ALA A 1 9  ? 51.651 42.620 23.817 1.00 0.00 ? 315 ALA A HB2  5 
ATOM 2436 H HB3  . ALA A 1 9  ? 52.654 42.214 25.204 1.00 0.00 ? 315 ALA A HB3  5 
ATOM 2437 N N    . PHE A 1 10 ? 55.328 40.430 24.339 1.00 0.00 ? 316 PHE A N    5 
ATOM 2438 C CA   . PHE A 1 10 ? 56.616 40.072 24.970 1.00 0.00 ? 316 PHE A CA   5 
ATOM 2439 C C    . PHE A 1 10 ? 57.056 38.632 24.669 1.00 0.00 ? 316 PHE A C    5 
ATOM 2440 O O    . PHE A 1 10 ? 58.212 38.379 24.382 1.00 0.00 ? 316 PHE A O    5 
ATOM 2441 C CB   . PHE A 1 10 ? 56.548 40.305 26.489 1.00 0.00 ? 316 PHE A CB   5 
ATOM 2442 C CG   . PHE A 1 10 ? 57.777 41.006 27.033 1.00 0.00 ? 316 PHE A CG   5 
ATOM 2443 C CD1  . PHE A 1 10 ? 59.009 40.333 27.105 1.00 0.00 ? 316 PHE A CD1  5 
ATOM 2444 C CD2  . PHE A 1 10 ? 57.702 42.358 27.430 1.00 0.00 ? 316 PHE A CD2  5 
ATOM 2445 C CE1  . PHE A 1 10 ? 60.155 40.992 27.585 1.00 0.00 ? 316 PHE A CE1  5 
ATOM 2446 C CE2  . PHE A 1 10 ? 58.839 43.017 27.910 1.00 0.00 ? 316 PHE A CE2  5 
ATOM 2447 C CZ   . PHE A 1 10 ? 60.071 42.335 27.992 1.00 0.00 ? 316 PHE A CZ   5 
ATOM 2448 H H    . PHE A 1 10 ? 54.754 39.710 23.925 1.00 0.00 ? 316 PHE A H    5 
ATOM 2449 H HA   . PHE A 1 10 ? 57.382 40.728 24.566 1.00 0.00 ? 316 PHE A HA   5 
ATOM 2450 H HB2  . PHE A 1 10 ? 55.671 40.915 26.733 1.00 0.00 ? 316 PHE A HB2  5 
ATOM 2451 H HB3  . PHE A 1 10 ? 56.417 39.360 27.012 1.00 0.00 ? 316 PHE A HB3  5 
ATOM 2452 H HD1  . PHE A 1 10 ? 59.089 39.303 26.780 1.00 0.00 ? 316 PHE A HD1  5 
ATOM 2453 H HD2  . PHE A 1 10 ? 56.761 42.890 27.359 1.00 0.00 ? 316 PHE A HD2  5 
ATOM 2454 H HE1  . PHE A 1 10 ? 61.106 40.480 27.625 1.00 0.00 ? 316 PHE A HE1  5 
ATOM 2455 H HE2  . PHE A 1 10 ? 58.779 44.057 28.224 1.00 0.00 ? 316 PHE A HE2  5 
ATOM 2456 H HZ   . PHE A 1 10 ? 60.951 42.852 28.357 1.00 0.00 ? 316 PHE A HZ   5 
ATOM 2457 N N    . SER A 1 11 ? 56.119 37.674 24.649 1.00 0.00 ? 317 SER A N    5 
ATOM 2458 C CA   . SER A 1 11 ? 56.399 36.255 24.365 1.00 0.00 ? 317 SER A CA   5 
ATOM 2459 C C    . SER A 1 11 ? 56.811 35.922 22.913 1.00 0.00 ? 317 SER A C    5 
ATOM 2460 O O    . SER A 1 11 ? 56.747 34.751 22.518 1.00 0.00 ? 317 SER A O    5 
ATOM 2461 C CB   . SER A 1 11 ? 55.170 35.409 24.716 1.00 0.00 ? 317 SER A CB   5 
ATOM 2462 O OG   . SER A 1 11 ? 54.863 35.419 26.102 1.00 0.00 ? 317 SER A OG   5 
ATOM 2463 H H    . SER A 1 11 ? 55.194 37.917 24.966 1.00 0.00 ? 317 SER A H    5 
ATOM 2464 H HA   . SER A 1 11 ? 57.228 35.939 24.997 1.00 0.00 ? 317 SER A HA   5 
ATOM 2465 H HB2  . SER A 1 11 ? 54.325 35.796 24.153 1.00 0.00 ? 317 SER A HB2  5 
ATOM 2466 H HB3  . SER A 1 11 ? 55.361 34.379 24.425 1.00 0.00 ? 317 SER A HB3  5 
ATOM 2467 H HG   . SER A 1 11 ? 53.895 35.264 26.171 1.00 0.00 ? 317 SER A HG   5 
ATOM 2468 N N    . ILE A 1 12 ? 57.159 36.929 22.108 1.00 0.00 ? 318 ILE A N    5 
ATOM 2469 C CA   . ILE A 1 12 ? 57.574 36.828 20.700 1.00 0.00 ? 318 ILE A CA   5 
ATOM 2470 C C    . ILE A 1 12 ? 58.545 37.965 20.363 1.00 0.00 ? 318 ILE A C    5 
ATOM 2471 O O    . ILE A 1 12 ? 59.643 37.708 19.888 1.00 0.00 ? 318 ILE A O    5 
ATOM 2472 C CB   . ILE A 1 12 ? 56.366 36.744 19.686 1.00 0.00 ? 318 ILE A CB   5 
ATOM 2473 C CG1  . ILE A 1 12 ? 56.379 37.793 18.555 1.00 0.00 ? 318 ILE A CG1  5 
ATOM 2474 C CG2  . ILE A 1 12 ? 54.986 36.728 20.372 1.00 0.00 ? 318 ILE A CG2  5 
ATOM 2475 C CD1  . ILE A 1 12 ? 55.490 37.512 17.332 1.00 0.00 ? 318 ILE A CD1  5 
ATOM 2476 H H    . ILE A 1 12 ? 57.335 37.811 22.566 1.00 0.00 ? 318 ILE A H    5 
ATOM 2477 H HA   . ILE A 1 12 ? 58.145 35.912 20.588 1.00 0.00 ? 318 ILE A HA   5 
ATOM 2478 H HB   . ILE A 1 12 ? 56.499 35.770 19.206 1.00 0.00 ? 318 ILE A HB   5 
ATOM 2479 H HG12 . ILE A 1 12 ? 56.092 38.766 18.962 1.00 0.00 ? 318 ILE A HG12 5 
ATOM 2480 H HG13 . ILE A 1 12 ? 57.391 37.858 18.146 1.00 0.00 ? 318 ILE A HG13 5 
ATOM 2481 H HG21 . ILE A 1 12 ? 54.190 36.691 19.628 1.00 0.00 ? 318 ILE A HG21 5 
ATOM 2482 H HG22 . ILE A 1 12 ? 54.880 35.846 20.992 1.00 0.00 ? 318 ILE A HG22 5 
ATOM 2483 H HG23 . ILE A 1 12 ? 54.857 37.636 20.963 1.00 0.00 ? 318 ILE A HG23 5 
ATOM 2484 H HD11 . ILE A 1 12 ? 54.442 37.434 17.623 1.00 0.00 ? 318 ILE A HD11 5 
ATOM 2485 H HD12 . ILE A 1 12 ? 55.592 38.332 16.624 1.00 0.00 ? 318 ILE A HD12 5 
ATOM 2486 H HD13 . ILE A 1 12 ? 55.814 36.597 16.852 1.00 0.00 ? 318 ILE A HD13 5 
ATOM 2487 N N    . ASN A 1 13 ? 58.144 39.215 20.637 1.00 0.00 ? 319 ASN A N    5 
ATOM 2488 C CA   . ASN A 1 13 ? 58.888 40.445 20.358 1.00 0.00 ? 319 ASN A CA   5 
ATOM 2489 C C    . ASN A 1 13 ? 58.645 41.448 21.493 1.00 0.00 ? 319 ASN A C    5 
ATOM 2490 O O    . ASN A 1 13 ? 57.583 41.370 22.135 1.00 0.00 ? 319 ASN A O    5 
ATOM 2491 C CB   . ASN A 1 13 ? 58.399 41.060 19.032 1.00 0.00 ? 319 ASN A CB   5 
ATOM 2492 C CG   . ASN A 1 13 ? 58.999 40.413 17.790 1.00 0.00 ? 319 ASN A CG   5 
ATOM 2493 O OD1  . ASN A 1 13 ? 60.195 40.275 17.678 1.00 0.00 ? 319 ASN A OD1  5 
ATOM 2494 N ND2  . ASN A 1 13 ? 58.201 40.048 16.806 1.00 0.00 ? 319 ASN A ND2  5 
ATOM 2495 H H    . ASN A 1 13 ? 57.243 39.340 21.056 1.00 0.00 ? 319 ASN A H    5 
ATOM 2496 H HA   . ASN A 1 13 ? 59.955 40.219 20.285 1.00 0.00 ? 319 ASN A HA   5 
ATOM 2497 H HB2  . ASN A 1 13 ? 57.306 41.013 18.983 1.00 0.00 ? 319 ASN A HB2  5 
ATOM 2498 H HB3  . ASN A 1 13 ? 58.683 42.108 18.989 1.00 0.00 ? 319 ASN A HB3  5 
ATOM 2499 H HD21 . ASN A 1 13 ? 57.213 40.183 16.848 1.00 0.00 ? 319 ASN A HD21 5 
ATOM 2500 H HD22 . ASN A 1 13 ? 58.663 39.654 16.014 1.00 0.00 ? 319 ASN A HD22 5 
ATOM 2501 N N    . PRO A 1 14 ? 59.552 42.421 21.724 1.00 0.00 ? 320 PRO A N    5 
ATOM 2502 C CA   . PRO A 1 14 ? 59.341 43.509 22.675 1.00 0.00 ? 320 PRO A CA   5 
ATOM 2503 C C    . PRO A 1 14 ? 58.231 44.450 22.170 1.00 0.00 ? 320 PRO A C    5 
ATOM 2504 O O    . PRO A 1 14 ? 58.463 45.254 21.265 1.00 0.00 ? 320 PRO A O    5 
ATOM 2505 C CB   . PRO A 1 14 ? 60.711 44.197 22.783 1.00 0.00 ? 320 PRO A CB   5 
ATOM 2506 C CG   . PRO A 1 14 ? 61.347 43.957 21.418 1.00 0.00 ? 320 PRO A CG   5 
ATOM 2507 C CD   . PRO A 1 14 ? 60.822 42.577 21.030 1.00 0.00 ? 320 PRO A CD   5 
ATOM 2508 H HA   . PRO A 1 14 ? 59.053 43.117 23.651 1.00 0.00 ? 320 PRO A HA   5 
ATOM 2509 H HB2  . PRO A 1 14 ? 60.616 45.265 23.008 1.00 0.00 ? 320 PRO A HB2  5 
ATOM 2510 H HB3  . PRO A 1 14 ? 61.304 43.697 23.551 1.00 0.00 ? 320 PRO A HB3  5 
ATOM 2511 H HG2  . PRO A 1 14 ? 60.997 44.708 20.703 1.00 0.00 ? 320 PRO A HG2  5 
ATOM 2512 H HG3  . PRO A 1 14 ? 62.441 43.974 21.477 1.00 0.00 ? 320 PRO A HG3  5 
ATOM 2513 H HD2  . PRO A 1 14 ? 60.711 42.527 19.945 1.00 0.00 ? 320 PRO A HD2  5 
ATOM 2514 H HD3  . PRO A 1 14 ? 61.524 41.814 21.369 1.00 0.00 ? 320 PRO A HD3  5 
ATOM 2515 N N    . ALA A 1 15 ? 57.013 44.309 22.701 1.00 0.00 ? 321 ALA A N    5 
ATOM 2516 C CA   . ALA A 1 15 ? 55.758 44.984 22.330 1.00 0.00 ? 321 ALA A CA   5 
ATOM 2517 C C    . ALA A 1 15 ? 55.279 44.854 20.853 1.00 0.00 ? 321 ALA A C    5 
ATOM 2518 O O    . ALA A 1 15 ? 54.086 44.991 20.584 1.00 0.00 ? 321 ALA A O    5 
ATOM 2519 C CB   . ALA A 1 15 ? 55.799 46.428 22.838 1.00 0.00 ? 321 ALA A CB   5 
ATOM 2520 H H    . ALA A 1 15 ? 56.923 43.599 23.416 1.00 0.00 ? 321 ALA A H    5 
ATOM 2521 H HA   . ALA A 1 15 ? 54.972 44.503 22.910 1.00 0.00 ? 321 ALA A HA   5 
ATOM 2522 H HB1  . ALA A 1 15 ? 54.842 46.917 22.649 1.00 0.00 ? 321 ALA A HB1  5 
ATOM 2523 H HB2  . ALA A 1 15 ? 55.989 46.427 23.911 1.00 0.00 ? 321 ALA A HB2  5 
ATOM 2524 H HB3  . ALA A 1 15 ? 56.590 46.991 22.335 1.00 0.00 ? 321 ALA A HB3  5 
ATOM 2525 N N    . MET A 1 16 ? 56.175 44.544 19.909 1.00 0.00 ? 322 MET A N    5 
ATOM 2526 C CA   . MET A 1 16 ? 56.031 44.835 18.486 1.00 0.00 ? 322 MET A CA   5 
ATOM 2527 C C    . MET A 1 16 ? 54.795 44.211 17.819 1.00 0.00 ? 322 MET A C    5 
ATOM 2528 O O    . MET A 1 16 ? 54.038 44.926 17.173 1.00 0.00 ? 322 MET A O    5 
ATOM 2529 C CB   . MET A 1 16 ? 57.338 44.410 17.786 1.00 0.00 ? 322 MET A CB   5 
ATOM 2530 C CG   . MET A 1 16 ? 57.600 45.122 16.452 1.00 0.00 ? 322 MET A CG   5 
ATOM 2531 S SD   . MET A 1 16 ? 56.690 44.466 15.030 1.00 0.00 ? 322 MET A SD   5 
ATOM 2532 C CE   . MET A 1 16 ? 57.249 45.659 13.779 1.00 0.00 ? 322 MET A CE   5 
ATOM 2533 H H    . MET A 1 16 ? 57.131 44.480 20.247 1.00 0.00 ? 322 MET A H    5 
ATOM 2534 H HA   . MET A 1 16 ? 55.941 45.913 18.380 1.00 0.00 ? 322 MET A HA   5 
ATOM 2535 H HB2  . MET A 1 16 ? 58.179 44.655 18.431 1.00 0.00 ? 322 MET A HB2  5 
ATOM 2536 H HB3  . MET A 1 16 ? 57.344 43.335 17.615 1.00 0.00 ? 322 MET A HB3  5 
ATOM 2537 H HG2  . MET A 1 16 ? 57.370 46.187 16.563 1.00 0.00 ? 322 MET A HG2  5 
ATOM 2538 H HG3  . MET A 1 16 ? 58.660 45.032 16.225 1.00 0.00 ? 322 MET A HG3  5 
ATOM 2539 H HE1  . MET A 1 16 ? 56.872 45.363 12.804 1.00 0.00 ? 322 MET A HE1  5 
ATOM 2540 H HE2  . MET A 1 16 ? 56.875 46.648 14.030 1.00 0.00 ? 322 MET A HE2  5 
ATOM 2541 H HE3  . MET A 1 16 ? 58.339 45.674 13.749 1.00 0.00 ? 322 MET A HE3  5 
ATOM 2542 N N    . MET A 1 17 ? 54.548 42.907 18.017 1.00 0.00 ? 323 MET A N    5 
ATOM 2543 C CA   . MET A 1 17 ? 53.470 42.220 17.295 1.00 0.00 ? 323 MET A CA   5 
ATOM 2544 C C    . MET A 1 17 ? 52.085 42.581 17.830 1.00 0.00 ? 323 MET A C    5 
ATOM 2545 O O    . MET A 1 17 ? 51.159 42.812 17.055 1.00 0.00 ? 323 MET A O    5 
ATOM 2546 C CB   . MET A 1 17 ? 53.714 40.700 17.326 1.00 0.00 ? 323 MET A CB   5 
ATOM 2547 C CG   . MET A 1 17 ? 52.795 39.926 16.368 1.00 0.00 ? 323 MET A CG   5 
ATOM 2548 S SD   . MET A 1 17 ? 51.805 38.642 17.191 1.00 0.00 ? 323 MET A SD   5 
ATOM 2549 C CE   . MET A 1 17 ? 50.163 39.406 17.106 1.00 0.00 ? 323 MET A CE   5 
ATOM 2550 H H    . MET A 1 17 ? 55.135 42.392 18.645 1.00 0.00 ? 323 MET A H    5 
ATOM 2551 H HA   . MET A 1 17 ? 53.493 42.541 16.243 1.00 0.00 ? 323 MET A HA   5 
ATOM 2552 H HB2  . MET A 1 17 ? 54.750 40.507 17.033 1.00 0.00 ? 323 MET A HB2  5 
ATOM 2553 H HB3  . MET A 1 17 ? 53.578 40.338 18.333 1.00 0.00 ? 323 MET A HB3  5 
ATOM 2554 H HG2  . MET A 1 17 ? 52.133 40.604 15.839 1.00 0.00 ? 323 MET A HG2  5 
ATOM 2555 H HG3  . MET A 1 17 ? 53.419 39.433 15.622 1.00 0.00 ? 323 MET A HG3  5 
ATOM 2556 H HE1  . MET A 1 17 ? 49.406 38.699 17.481 1.00 0.00 ? 323 MET A HE1  5 
ATOM 2557 H HE2  . MET A 1 17 ? 50.136 40.314 17.712 1.00 0.00 ? 323 MET A HE2  5 
ATOM 2558 H HE3  . MET A 1 17 ? 49.917 39.658 16.078 1.00 0.00 ? 323 MET A HE3  5 
ATOM 2559 N N    . ALA A 1 18 ? 51.936 42.678 19.156 1.00 0.00 ? 324 ALA A N    5 
ATOM 2560 C CA   . ALA A 1 18 ? 50.685 43.130 19.762 1.00 0.00 ? 324 ALA A CA   5 
ATOM 2561 C C    . ALA A 1 18 ? 50.397 44.603 19.444 1.00 0.00 ? 324 ALA A C    5 
ATOM 2562 O O    . ALA A 1 18 ? 49.255 44.939 19.167 1.00 0.00 ? 324 ALA A O    5 
ATOM 2563 C CB   . ALA A 1 18 ? 50.733 42.902 21.268 1.00 0.00 ? 324 ALA A CB   5 
ATOM 2564 H H    . ALA A 1 18 ? 52.744 42.522 19.754 1.00 0.00 ? 324 ALA A H    5 
ATOM 2565 H HA   . ALA A 1 18 ? 49.863 42.551 19.355 1.00 0.00 ? 324 ALA A HA   5 
ATOM 2566 H HB1  . ALA A 1 18 ? 49.816 43.288 21.731 1.00 0.00 ? 324 ALA A HB1  5 
ATOM 2567 H HB2  . ALA A 1 18 ? 50.798 41.837 21.485 1.00 0.00 ? 324 ALA A HB2  5 
ATOM 2568 H HB3  . ALA A 1 18 ? 51.587 43.441 21.694 1.00 0.00 ? 324 ALA A HB3  5 
ATOM 2569 N N    . ALA A 1 19 ? 51.422 45.469 19.422 1.00 0.00 ? 325 ALA A N    5 
ATOM 2570 C CA   . ALA A 1 19 ? 51.259 46.858 19.001 1.00 0.00 ? 325 ALA A CA   5 
ATOM 2571 C C    . ALA A 1 19 ? 50.861 46.948 17.515 1.00 0.00 ? 325 ALA A C    5 
ATOM 2572 O O    . ALA A 1 19 ? 49.889 47.623 17.200 1.00 0.00 ? 325 ALA A O    5 
ATOM 2573 C CB   . ALA A 1 19 ? 52.529 47.652 19.310 1.00 0.00 ? 325 ALA A CB   5 
ATOM 2574 H H    . ALA A 1 19 ? 52.354 45.163 19.698 1.00 0.00 ? 325 ALA A H    5 
ATOM 2575 H HA   . ALA A 1 19 ? 50.437 47.297 19.577 1.00 0.00 ? 325 ALA A HA   5 
ATOM 2576 H HB1  . ALA A 1 19 ? 52.390 48.695 19.018 1.00 0.00 ? 325 ALA A HB1  5 
ATOM 2577 H HB2  . ALA A 1 19 ? 52.748 47.601 20.373 1.00 0.00 ? 325 ALA A HB2  5 
ATOM 2578 H HB3  . ALA A 1 19 ? 53.372 47.243 18.752 1.00 0.00 ? 325 ALA A HB3  5 
ATOM 2579 N N    . ALA A 1 20 ? 51.527 46.210 16.623 1.00 0.00 ? 326 ALA A N    5 
ATOM 2580 C CA   . ALA A 1 20 ? 51.190 46.201 15.187 1.00 0.00 ? 326 ALA A CA   5 
ATOM 2581 C C    . ALA A 1 20 ? 49.753 45.709 14.916 1.00 0.00 ? 326 ALA A C    5 
ATOM 2582 O O    . ALA A 1 20 ? 49.067 46.278 14.081 1.00 0.00 ? 326 ALA A O    5 
ATOM 2583 C CB   . ALA A 1 20 ? 52.233 45.347 14.461 1.00 0.00 ? 326 ALA A CB   5 
ATOM 2584 H H    . ALA A 1 20 ? 52.339 45.685 16.920 1.00 0.00 ? 326 ALA A H    5 
ATOM 2585 H HA   . ALA A 1 20 ? 51.258 47.221 14.815 1.00 0.00 ? 326 ALA A HA   5 
ATOM 2586 H HB1  . ALA A 1 20 ? 52.014 45.348 13.390 1.00 0.00 ? 326 ALA A HB1  5 
ATOM 2587 H HB2  . ALA A 1 20 ? 53.234 45.758 14.614 1.00 0.00 ? 326 ALA A HB2  5 
ATOM 2588 H HB3  . ALA A 1 20 ? 52.205 44.317 14.831 1.00 0.00 ? 326 ALA A HB3  5 
ATOM 2589 N N    . GLN A 1 21 ? 49.292 44.691 15.657 1.00 0.00 ? 327 GLN A N    5 
ATOM 2590 C CA   . GLN A 1 21 ? 47.905 44.214 15.584 1.00 0.00 ? 327 GLN A CA   5 
ATOM 2591 C C    . GLN A 1 21 ? 46.926 45.244 16.172 1.00 0.00 ? 327 GLN A C    5 
ATOM 2592 O O    . GLN A 1 21 ? 45.977 45.680 15.513 1.00 0.00 ? 327 GLN A O    5 
ATOM 2593 C CB   . GLN A 1 21 ? 47.832 42.864 16.316 1.00 0.00 ? 327 GLN A CB   5 
ATOM 2594 C CG   . GLN A 1 21 ? 46.479 42.154 16.138 1.00 0.00 ? 327 GLN A CG   5 
ATOM 2595 C CD   . GLN A 1 21 ? 46.280 41.043 17.170 1.00 0.00 ? 327 GLN A CD   5 
ATOM 2596 O OE1  . GLN A 1 21 ? 47.185 40.320 17.539 1.00 0.00 ? 327 GLN A OE1  5 
ATOM 2597 N NE2  . GLN A 1 21 ? 45.083 40.892 17.700 1.00 0.00 ? 327 GLN A NE2  5 
ATOM 2598 H H    . GLN A 1 21 ? 49.930 44.226 16.291 1.00 0.00 ? 327 GLN A H    5 
ATOM 2599 H HA   . GLN A 1 21 ? 47.646 44.066 14.539 1.00 0.00 ? 327 GLN A HA   5 
ATOM 2600 H HB2  . GLN A 1 21 ? 48.612 42.201 15.948 1.00 0.00 ? 327 GLN A HB2  5 
ATOM 2601 H HB3  . GLN A 1 21 ? 48.002 43.023 17.385 1.00 0.00 ? 327 GLN A HB3  5 
ATOM 2602 H HG2  . GLN A 1 21 ? 45.666 42.870 16.236 1.00 0.00 ? 327 GLN A HG2  5 
ATOM 2603 H HG3  . GLN A 1 21 ? 46.430 41.716 15.141 1.00 0.00 ? 327 GLN A HG3  5 
ATOM 2604 H HE21 . GLN A 1 21 ? 44.321 41.477 17.409 1.00 0.00 ? 327 GLN A HE21 5 
ATOM 2605 H HE22 . GLN A 1 21 ? 44.990 40.161 18.376 1.00 0.00 ? 327 GLN A HE22 5 
ATOM 2606 N N    . ALA A 1 22 ? 47.136 45.669 17.422 1.00 0.00 ? 328 ALA A N    5 
ATOM 2607 C CA   . ALA A 1 22 ? 46.193 46.503 18.164 1.00 0.00 ? 328 ALA A CA   5 
ATOM 2608 C C    . ALA A 1 22 ? 46.181 47.972 17.733 1.00 0.00 ? 328 ALA A C    5 
ATOM 2609 O O    . ALA A 1 22 ? 45.196 48.663 18.000 1.00 0.00 ? 328 ALA A O    5 
ATOM 2610 C CB   . ALA A 1 22 ? 46.442 46.334 19.669 1.00 0.00 ? 328 ALA A CB   5 
ATOM 2611 H H    . ALA A 1 22 ? 47.948 45.330 17.925 1.00 0.00 ? 328 ALA A H    5 
ATOM 2612 H HA   . ALA A 1 22 ? 45.191 46.111 17.961 1.00 0.00 ? 328 ALA A HA   5 
ATOM 2613 H HB1  . ALA A 1 22 ? 45.660 46.863 20.221 1.00 0.00 ? 328 ALA A HB1  5 
ATOM 2614 H HB2  . ALA A 1 22 ? 46.409 45.282 19.940 1.00 0.00 ? 328 ALA A HB2  5 
ATOM 2615 H HB3  . ALA A 1 22 ? 47.418 46.748 19.933 1.00 0.00 ? 328 ALA A HB3  5 
ATOM 2616 N N    . ALA A 1 23 ? 47.202 48.458 17.021 1.00 0.00 ? 329 ALA A N    5 
ATOM 2617 C CA   . ALA A 1 23 ? 47.304 49.824 16.498 1.00 0.00 ? 329 ALA A CA   5 
ATOM 2618 C C    . ALA A 1 23 ? 46.049 50.237 15.713 1.00 0.00 ? 329 ALA A C    5 
ATOM 2619 O O    . ALA A 1 23 ? 45.476 51.287 15.981 1.00 0.00 ? 329 ALA A O    5 
ATOM 2620 C CB   . ALA A 1 23 ? 48.534 49.924 15.587 1.00 0.00 ? 329 ALA A CB   5 
ATOM 2621 H H    . ALA A 1 23 ? 48.013 47.861 16.880 1.00 0.00 ? 329 ALA A H    5 
ATOM 2622 H HA   . ALA A 1 23 ? 47.417 50.517 17.335 1.00 0.00 ? 329 ALA A HA   5 
ATOM 2623 H HB1  . ALA A 1 23 ? 48.535 50.880 15.069 1.00 0.00 ? 329 ALA A HB1  5 
ATOM 2624 H HB2  . ALA A 1 23 ? 49.443 49.867 16.187 1.00 0.00 ? 329 ALA A HB2  5 
ATOM 2625 H HB3  . ALA A 1 23 ? 48.537 49.113 14.858 1.00 0.00 ? 329 ALA A HB3  5 
ATOM 2626 N N    . LEU A 1 24 ? 45.592 49.373 14.797 1.00 0.00 ? 330 LEU A N    5 
ATOM 2627 C CA   . LEU A 1 24 ? 44.385 49.625 14.005 1.00 0.00 ? 330 LEU A CA   5 
ATOM 2628 C C    . LEU A 1 24 ? 43.151 48.998 14.660 1.00 0.00 ? 330 LEU A C    5 
ATOM 2629 O O    . LEU A 1 24 ? 42.058 49.559 14.565 1.00 0.00 ? 330 LEU A O    5 
ATOM 2630 C CB   . LEU A 1 24 ? 44.566 49.173 12.547 1.00 0.00 ? 330 LEU A CB   5 
ATOM 2631 C CG   . LEU A 1 24 ? 45.910 49.611 11.901 1.00 0.00 ? 330 LEU A CG   5 
ATOM 2632 C CD1  . LEU A 1 24 ? 46.915 48.447 11.907 1.00 0.00 ? 330 LEU A CD1  5 
ATOM 2633 C CD2  . LEU A 1 24 ? 45.715 50.051 10.456 1.00 0.00 ? 330 LEU A CD2  5 
ATOM 2634 H H    . LEU A 1 24 ? 46.121 48.526 14.636 1.00 0.00 ? 330 LEU A H    5 
ATOM 2635 H HA   . LEU A 1 24 ? 44.200 50.706 13.983 1.00 0.00 ? 330 LEU A HA   5 
ATOM 2636 H HB2  . LEU A 1 24 ? 44.467 48.092 12.481 1.00 0.00 ? 330 LEU A HB2  5 
ATOM 2637 H HB3  . LEU A 1 24 ? 43.751 49.611 11.971 1.00 0.00 ? 330 LEU A HB3  5 
ATOM 2638 H HG   . LEU A 1 24 ? 46.340 50.445 12.459 1.00 0.00 ? 330 LEU A HG   5 
ATOM 2639 H HD11 . LEU A 1 24 ? 47.870 48.782 11.513 1.00 0.00 ? 330 LEU A HD11 5 
ATOM 2640 H HD12 . LEU A 1 24 ? 47.070 48.074 12.922 1.00 0.00 ? 330 LEU A HD12 5 
ATOM 2641 H HD13 . LEU A 1 24 ? 46.543 47.631 11.296 1.00 0.00 ? 330 LEU A HD13 5 
ATOM 2642 H HD21 . LEU A 1 24 ? 45.078 50.933 10.431 1.00 0.00 ? 330 LEU A HD21 5 
ATOM 2643 H HD22 . LEU A 1 24 ? 46.688 50.315 10.023 1.00 0.00 ? 330 LEU A HD22 5 
ATOM 2644 H HD23 . LEU A 1 24 ? 45.264 49.256 9.868  1.00 0.00 ? 330 LEU A HD23 5 
ATOM 2645 N N    . GLN A 1 25 ? 43.308 47.866 15.365 1.00 0.00 ? 331 GLN A N    5 
ATOM 2646 C CA   . GLN A 1 25 ? 42.197 47.220 16.086 1.00 0.00 ? 331 GLN A CA   5 
ATOM 2647 C C    . GLN A 1 25 ? 41.580 48.143 17.150 1.00 0.00 ? 331 GLN A C    5 
ATOM 2648 O O    . GLN A 1 25 ? 40.380 48.044 17.399 1.00 0.00 ? 331 GLN A O    5 
ATOM 2649 C CB   . GLN A 1 25 ? 42.671 45.906 16.731 1.00 0.00 ? 331 GLN A CB   5 
ATOM 2650 C CG   . GLN A 1 25 ? 41.548 44.863 16.822 1.00 0.00 ? 331 GLN A CG   5 
ATOM 2651 C CD   . GLN A 1 25 ? 41.273 44.196 15.481 1.00 0.00 ? 331 GLN A CD   5 
ATOM 2652 O OE1  . GLN A 1 25 ? 42.169 43.762 14.771 1.00 0.00 ? 331 GLN A OE1  5 
ATOM 2653 N NE2  . GLN A 1 25 ? 40.032 44.059 15.072 1.00 0.00 ? 331 GLN A NE2  5 
ATOM 2654 H H    . GLN A 1 25 ? 44.218 47.423 15.385 1.00 0.00 ? 331 GLN A H    5 
ATOM 2655 H HA   . GLN A 1 25 ? 41.421 46.993 15.357 1.00 0.00 ? 331 GLN A HA   5 
ATOM 2656 H HB2  . GLN A 1 25 ? 43.504 45.487 16.173 1.00 0.00 ? 331 GLN A HB2  5 
ATOM 2657 H HB3  . GLN A 1 25 ? 43.029 46.123 17.740 1.00 0.00 ? 331 GLN A HB3  5 
ATOM 2658 H HG2  . GLN A 1 25 ? 41.847 44.081 17.521 1.00 0.00 ? 331 GLN A HG2  5 
ATOM 2659 H HG3  . GLN A 1 25 ? 40.637 45.327 17.202 1.00 0.00 ? 331 GLN A HG3  5 
ATOM 2660 H HE21 . GLN A 1 25 ? 39.258 44.368 15.630 1.00 0.00 ? 331 GLN A HE21 5 
ATOM 2661 H HE22 . GLN A 1 25 ? 39.899 43.605 14.189 1.00 0.00 ? 331 GLN A HE22 5 
ATOM 2662 N N    . SER A 1 26 ? 42.353 49.057 17.740 1.00 0.00 ? 332 SER A N    5 
ATOM 2663 C CA   . SER A 1 26 ? 41.862 50.036 18.717 1.00 0.00 ? 332 SER A CA   5 
ATOM 2664 C C    . SER A 1 26 ? 40.749 50.925 18.153 1.00 0.00 ? 332 SER A C    5 
ATOM 2665 O O    . SER A 1 26 ? 39.741 51.148 18.834 1.00 0.00 ? 332 SER A O    5 
ATOM 2666 C CB   . SER A 1 26 ? 43.011 50.926 19.220 1.00 0.00 ? 332 SER A CB   5 
ATOM 2667 O OG   . SER A 1 26 ? 43.969 50.132 19.898 1.00 0.00 ? 332 SER A OG   5 
ATOM 2668 H H    . SER A 1 26 ? 43.344 49.057 17.524 1.00 0.00 ? 332 SER A H    5 
ATOM 2669 H HA   . SER A 1 26 ? 41.449 49.502 19.582 1.00 0.00 ? 332 SER A HA   5 
ATOM 2670 H HB2  . SER A 1 26 ? 43.485 51.442 18.382 1.00 0.00 ? 332 SER A HB2  5 
ATOM 2671 H HB3  . SER A 1 26 ? 42.616 51.668 19.918 1.00 0.00 ? 332 SER A HB3  5 
ATOM 2672 H HG   . SER A 1 26 ? 44.477 49.631 19.238 1.00 0.00 ? 332 SER A HG   5 
ATOM 2673 N N    . SER A 1 27 ? 40.843 51.360 16.895 1.00 0.00 ? 333 SER A N    5 
ATOM 2674 C CA   . SER A 1 27 ? 39.796 52.155 16.230 1.00 0.00 ? 333 SER A CA   5 
ATOM 2675 C C    . SER A 1 27 ? 38.509 51.373 15.991 1.00 0.00 ? 333 SER A C    5 
ATOM 2676 O O    . SER A 1 27 ? 37.439 51.966 15.934 1.00 0.00 ? 333 SER A O    5 
ATOM 2677 C CB   . SER A 1 27 ? 40.308 52.706 14.899 1.00 0.00 ? 333 SER A CB   5 
ATOM 2678 O OG   . SER A 1 27 ? 41.334 53.640 15.136 1.00 0.00 ? 333 SER A OG   5 
ATOM 2679 H H    . SER A 1 27 ? 41.679 51.152 16.361 1.00 0.00 ? 333 SER A H    5 
ATOM 2680 H HA   . SER A 1 27 ? 39.539 53.005 16.869 1.00 0.00 ? 333 SER A HA   5 
ATOM 2681 H HB2  . SER A 1 27 ? 40.675 51.897 14.274 1.00 0.00 ? 333 SER A HB2  5 
ATOM 2682 H HB3  . SER A 1 27 ? 39.485 53.205 14.382 1.00 0.00 ? 333 SER A HB3  5 
ATOM 2683 H HG   . SER A 1 27 ? 41.471 54.167 14.344 1.00 0.00 ? 333 SER A HG   5 
ATOM 2684 N N    . TRP A 1 28 ? 38.578 50.040 15.894 1.00 0.00 ? 334 TRP A N    5 
ATOM 2685 C CA   . TRP A 1 28 ? 37.400 49.172 15.843 1.00 0.00 ? 334 TRP A CA   5 
ATOM 2686 C C    . TRP A 1 28 ? 36.843 48.894 17.248 1.00 0.00 ? 334 TRP A C    5 
ATOM 2687 O O    . TRP A 1 28 ? 35.644 49.025 17.491 1.00 0.00 ? 334 TRP A O    5 
ATOM 2688 C CB   . TRP A 1 28 ? 37.750 47.880 15.092 1.00 0.00 ? 334 TRP A CB   5 
ATOM 2689 C CG   . TRP A 1 28 ? 38.074 48.078 13.639 1.00 0.00 ? 334 TRP A CG   5 
ATOM 2690 C CD1  . TRP A 1 28 ? 39.312 48.209 13.117 1.00 0.00 ? 334 TRP A CD1  5 
ATOM 2691 C CD2  . TRP A 1 28 ? 37.152 48.210 12.516 1.00 0.00 ? 334 TRP A CD2  5 
ATOM 2692 N NE1  . TRP A 1 28 ? 39.220 48.421 11.754 1.00 0.00 ? 334 TRP A NE1  5 
ATOM 2693 C CE2  . TRP A 1 28 ? 37.909 48.434 11.333 1.00 0.00 ? 334 TRP A CE2  5 
ATOM 2694 C CE3  . TRP A 1 28 ? 35.744 48.171 12.382 1.00 0.00 ? 334 TRP A CE3  5 
ATOM 2695 C CZ2  . TRP A 1 28 ? 37.311 48.611 10.074 1.00 0.00 ? 334 TRP A CZ2  5 
ATOM 2696 C CZ3  . TRP A 1 28 ? 35.136 48.349 11.124 1.00 0.00 ? 334 TRP A CZ3  5 
ATOM 2697 C CH2  . TRP A 1 28 ? 35.915 48.573 9.970  1.00 0.00 ? 334 TRP A CH2  5 
ATOM 2698 H H    . TRP A 1 28 ? 39.489 49.608 15.944 1.00 0.00 ? 334 TRP A H    5 
ATOM 2699 H HA   . TRP A 1 28 ? 36.606 49.670 15.285 1.00 0.00 ? 334 TRP A HA   5 
ATOM 2700 H HB2  . TRP A 1 28 ? 38.590 47.380 15.577 1.00 0.00 ? 334 TRP A HB2  5 
ATOM 2701 H HB3  . TRP A 1 28 ? 36.888 47.204 15.150 1.00 0.00 ? 334 TRP A HB3  5 
ATOM 2702 H HD1  . TRP A 1 28 ? 40.229 48.181 13.686 1.00 0.00 ? 334 TRP A HD1  5 
ATOM 2703 H HE1  . TRP A 1 28 ? 40.024 48.551 11.162 1.00 0.00 ? 334 TRP A HE1  5 
ATOM 2704 H HE3  . TRP A 1 28 ? 35.133 48.008 13.256 1.00 0.00 ? 334 TRP A HE3  5 
ATOM 2705 H HZ2  . TRP A 1 28 ? 37.922 48.775 9.200  1.00 0.00 ? 334 TRP A HZ2  5 
ATOM 2706 H HZ3  . TRP A 1 28 ? 34.051 48.320 11.044 1.00 0.00 ? 334 TRP A HZ3  5 
ATOM 2707 H HH2  . TRP A 1 28 ? 35.431 48.699 9.017  1.00 0.00 ? 334 TRP A HH2  5 
ATOM 2708 N N    . GLY A 1 29 ? 37.727 48.607 18.207 1.00 0.00 ? 335 GLY A N    5 
ATOM 2709 C CA   . GLY A 1 29 ? 37.390 48.387 19.611 1.00 0.00 ? 335 GLY A CA   5 
ATOM 2710 C C    . GLY A 1 29 ? 36.737 49.589 20.289 1.00 0.00 ? 335 GLY A C    5 
ATOM 2711 O O    . GLY A 1 29 ? 35.916 49.397 21.183 1.00 0.00 ? 335 GLY A O    5 
ATOM 2712 H H    . GLY A 1 29 ? 38.705 48.526 17.944 1.00 0.00 ? 335 GLY A H    5 
ATOM 2713 H HA2  . GLY A 1 29 ? 36.709 47.532 19.686 1.00 0.00 ? 335 GLY A HA2  5 
ATOM 2714 H HA3  . GLY A 1 29 ? 38.306 48.149 20.166 1.00 0.00 ? 335 GLY A HA3  5 
ATOM 2715 N N    . MET A 1 30 ? 36.992 50.816 19.822 1.00 0.00 ? 336 MET A N    5 
ATOM 2716 C CA   . MET A 1 30 ? 36.276 52.031 20.242 1.00 0.00 ? 336 MET A CA   5 
ATOM 2717 C C    . MET A 1 30 ? 34.747 51.932 20.085 1.00 0.00 ? 336 MET A C    5 
ATOM 2718 O O    . MET A 1 30 ? 34.025 52.547 20.863 1.00 0.00 ? 336 MET A O    5 
ATOM 2719 C CB   . MET A 1 30 ? 36.796 53.227 19.434 1.00 0.00 ? 336 MET A CB   5 
ATOM 2720 C CG   . MET A 1 30 ? 38.106 53.758 20.009 1.00 0.00 ? 336 MET A CG   5 
ATOM 2721 S SD   . MET A 1 30 ? 37.880 54.791 21.493 1.00 0.00 ? 336 MET A SD   5 
ATOM 2722 C CE   . MET A 1 30 ? 39.543 54.704 22.180 1.00 0.00 ? 336 MET A CE   5 
ATOM 2723 H H    . MET A 1 30 ? 37.742 50.914 19.144 1.00 0.00 ? 336 MET A H    5 
ATOM 2724 H HA   . MET A 1 30 ? 36.466 52.210 21.300 1.00 0.00 ? 336 MET A HA   5 
ATOM 2725 H HB2  . MET A 1 30 ? 36.946 52.927 18.393 1.00 0.00 ? 336 MET A HB2  5 
ATOM 2726 H HB3  . MET A 1 30 ? 36.059 54.040 19.445 1.00 0.00 ? 336 MET A HB3  5 
ATOM 2727 H HG2  . MET A 1 30 ? 38.755 52.923 20.273 1.00 0.00 ? 336 MET A HG2  5 
ATOM 2728 H HG3  . MET A 1 30 ? 38.615 54.355 19.248 1.00 0.00 ? 336 MET A HG3  5 
ATOM 2729 H HE1  . MET A 1 30 ? 39.615 55.387 23.028 1.00 0.00 ? 336 MET A HE1  5 
ATOM 2730 H HE2  . MET A 1 30 ? 39.743 53.692 22.519 1.00 0.00 ? 336 MET A HE2  5 
ATOM 2731 H HE3  . MET A 1 30 ? 40.280 54.990 21.426 1.00 0.00 ? 336 MET A HE3  5 
ATOM 2732 N N    . MET A 1 31 ? 34.248 51.166 19.118 1.00 0.00 ? 337 MET A N    5 
ATOM 2733 C CA   . MET A 1 31 ? 32.808 50.888 18.972 1.00 0.00 ? 337 MET A CA   5 
ATOM 2734 C C    . MET A 1 31 ? 32.382 49.693 19.836 1.00 0.00 ? 337 MET A C    5 
ATOM 2735 O O    . MET A 1 31 ? 31.384 49.797 20.551 1.00 0.00 ? 337 MET A O    5 
ATOM 2736 C CB   . MET A 1 31 ? 32.459 50.697 17.492 1.00 0.00 ? 337 MET A CB   5 
ATOM 2737 C CG   . MET A 1 31 ? 32.610 52.016 16.717 1.00 0.00 ? 337 MET A CG   5 
ATOM 2738 S SD   . MET A 1 31 ? 32.605 51.845 14.909 1.00 0.00 ? 337 MET A SD   5 
ATOM 2739 C CE   . MET A 1 31 ? 34.283 51.182 14.680 1.00 0.00 ? 337 MET A CE   5 
ATOM 2740 H H    . MET A 1 31 ? 34.888 50.667 18.512 1.00 0.00 ? 337 MET A H    5 
ATOM 2741 H HA   . MET A 1 31 ? 32.249 51.750 19.335 1.00 0.00 ? 337 MET A HA   5 
ATOM 2742 H HB2  . MET A 1 31 ? 33.106 49.933 17.062 1.00 0.00 ? 337 MET A HB2  5 
ATOM 2743 H HB3  . MET A 1 31 ? 31.422 50.359 17.409 1.00 0.00 ? 337 MET A HB3  5 
ATOM 2744 H HG2  . MET A 1 31 ? 31.785 52.677 16.997 1.00 0.00 ? 337 MET A HG2  5 
ATOM 2745 H HG3  . MET A 1 31 ? 33.536 52.510 17.001 1.00 0.00 ? 337 MET A HG3  5 
ATOM 2746 H HE1  . MET A 1 31 ? 34.484 51.072 13.612 1.00 0.00 ? 337 MET A HE1  5 
ATOM 2747 H HE2  . MET A 1 31 ? 35.008 51.862 15.118 1.00 0.00 ? 337 MET A HE2  5 
ATOM 2748 H HE3  . MET A 1 31 ? 34.361 50.205 15.164 1.00 0.00 ? 337 MET A HE3  5 
ATOM 2749 N N    . GLY A 1 32 ? 33.157 48.599 19.831 1.00 0.00 ? 338 GLY A N    5 
ATOM 2750 C CA   . GLY A 1 32 ? 32.888 47.402 20.638 1.00 0.00 ? 338 GLY A CA   5 
ATOM 2751 C C    . GLY A 1 32 ? 32.788 47.695 22.136 1.00 0.00 ? 338 GLY A C    5 
ATOM 2752 O O    . GLY A 1 32 ? 31.765 47.396 22.763 1.00 0.00 ? 338 GLY A O    5 
ATOM 2753 H H    . GLY A 1 32 ? 33.970 48.590 19.233 1.00 0.00 ? 338 GLY A H    5 
ATOM 2754 H HA2  . GLY A 1 32 ? 31.959 46.937 20.313 1.00 0.00 ? 338 GLY A HA2  5 
ATOM 2755 H HA3  . GLY A 1 32 ? 33.688 46.675 20.491 1.00 0.00 ? 338 GLY A HA3  5 
ATOM 2756 N N    . MET A 1 33 ? 33.740 48.428 22.723 1.00 0.00 ? 339 MET A N    5 
ATOM 2757 C CA   . MET A 1 33 ? 33.708 48.778 24.157 1.00 0.00 ? 339 MET A CA   5 
ATOM 2758 C C    . MET A 1 33 ? 32.469 49.585 24.562 1.00 0.00 ? 339 MET A C    5 
ATOM 2759 O O    . MET A 1 33 ? 32.072 49.539 25.724 1.00 0.00 ? 339 MET A O    5 
ATOM 2760 C CB   . MET A 1 33 ? 34.962 49.575 24.557 1.00 0.00 ? 339 MET A CB   5 
ATOM 2761 C CG   . MET A 1 33 ? 36.274 48.787 24.448 1.00 0.00 ? 339 MET A CG   5 
ATOM 2762 S SD   . MET A 1 33 ? 37.685 49.643 25.200 1.00 0.00 ? 339 MET A SD   5 
ATOM 2763 C CE   . MET A 1 33 ? 39.054 48.795 24.379 1.00 0.00 ? 339 MET A CE   5 
ATOM 2764 H H    . MET A 1 33 ? 34.537 48.720 22.167 1.00 0.00 ? 339 MET A H    5 
ATOM 2765 H HA   . MET A 1 33 ? 33.690 47.864 24.734 1.00 0.00 ? 339 MET A HA   5 
ATOM 2766 H HB2  . MET A 1 33 ? 35.038 50.478 23.938 1.00 0.00 ? 339 MET A HB2  5 
ATOM 2767 H HB3  . MET A 1 33 ? 34.851 49.885 25.595 1.00 0.00 ? 339 MET A HB3  5 
ATOM 2768 H HG2  . MET A 1 33 ? 36.152 47.821 24.941 1.00 0.00 ? 339 MET A HG2  5 
ATOM 2769 H HG3  . MET A 1 33 ? 36.495 48.597 23.402 1.00 0.00 ? 339 MET A HG3  5 
ATOM 2770 H HE1  . MET A 1 33 ? 39.988 49.094 24.849 1.00 0.00 ? 339 MET A HE1  5 
ATOM 2771 H HE2  . MET A 1 33 ? 38.922 47.717 24.465 1.00 0.00 ? 339 MET A HE2  5 
ATOM 2772 H HE3  . MET A 1 33 ? 39.067 49.075 23.329 1.00 0.00 ? 339 MET A HE3  5 
ATOM 2773 N N    . LEU A 1 34 ? 31.830 50.312 23.640 1.00 0.00 ? 340 LEU A N    5 
ATOM 2774 C CA   . LEU A 1 34 ? 30.594 51.064 23.907 1.00 0.00 ? 340 LEU A CA   5 
ATOM 2775 C C    . LEU A 1 34 ? 29.347 50.211 23.648 1.00 0.00 ? 340 LEU A C    5 
ATOM 2776 O O    . LEU A 1 34 ? 28.424 50.197 24.472 1.00 0.00 ? 340 LEU A O    5 
ATOM 2777 C CB   . LEU A 1 34 ? 30.602 52.361 23.069 1.00 0.00 ? 340 LEU A CB   5 
ATOM 2778 C CG   . LEU A 1 34 ? 31.801 53.294 23.338 1.00 0.00 ? 340 LEU A CG   5 
ATOM 2779 C CD1  . LEU A 1 34 ? 31.742 54.478 22.367 1.00 0.00 ? 340 LEU A CD1  5 
ATOM 2780 C CD2  . LEU A 1 34 ? 31.799 53.854 24.765 1.00 0.00 ? 340 LEU A CD2  5 
ATOM 2781 H H    . LEU A 1 34 ? 32.166 50.274 22.684 1.00 0.00 ? 340 LEU A H    5 
ATOM 2782 H HA   . LEU A 1 34 ? 30.564 51.344 24.962 1.00 0.00 ? 340 LEU A HA   5 
ATOM 2783 H HB2  . LEU A 1 34 ? 30.612 52.081 22.005 1.00 0.00 ? 340 LEU A HB2  5 
ATOM 2784 H HB3  . LEU A 1 34 ? 29.673 52.900 23.258 1.00 0.00 ? 340 LEU A HB3  5 
ATOM 2785 H HG   . LEU A 1 34 ? 32.731 52.766 23.170 1.00 0.00 ? 340 LEU A HG   5 
ATOM 2786 H HD11 . LEU A 1 34 ? 32.623 55.109 22.519 1.00 0.00 ? 340 LEU A HD11 5 
ATOM 2787 H HD12 . LEU A 1 34 ? 31.773 54.109 21.344 1.00 0.00 ? 340 LEU A HD12 5 
ATOM 2788 H HD13 . LEU A 1 34 ? 30.841 55.066 22.522 1.00 0.00 ? 340 LEU A HD13 5 
ATOM 2789 H HD21 . LEU A 1 34 ? 31.928 53.033 25.473 1.00 0.00 ? 340 LEU A HD21 5 
ATOM 2790 H HD22 . LEU A 1 34 ? 32.639 54.535 24.877 1.00 0.00 ? 340 LEU A HD22 5 
ATOM 2791 H HD23 . LEU A 1 34 ? 30.870 54.374 24.964 1.00 0.00 ? 340 LEU A HD23 5 
ATOM 2792 N N    . ALA A 1 35 ? 29.332 49.460 22.548 1.00 0.00 ? 341 ALA A N    5 
ATOM 2793 C CA   . ALA A 1 35 ? 28.250 48.543 22.183 1.00 0.00 ? 341 ALA A CA   5 
ATOM 2794 C C    . ALA A 1 35 ? 28.117 47.350 23.133 1.00 0.00 ? 341 ALA A C    5 
ATOM 2795 O O    . ALA A 1 35 ? 27.023 46.829 23.329 1.00 0.00 ? 341 ALA A O    5 
ATOM 2796 C CB   . ALA A 1 35 ? 28.481 48.092 20.733 1.00 0.00 ? 341 ALA A CB   5 
ATOM 2797 H H    . ALA A 1 35 ? 30.135 49.490 21.929 1.00 0.00 ? 341 ALA A H    5 
ATOM 2798 H HA   . ALA A 1 35 ? 27.303 49.098 22.221 1.00 0.00 ? 341 ALA A HA   5 
ATOM 2799 H HB1  . ALA A 1 35 ? 27.662 47.446 20.418 1.00 0.00 ? 341 ALA A HB1  5 
ATOM 2800 H HB2  . ALA A 1 35 ? 28.525 48.954 20.076 1.00 0.00 ? 341 ALA A HB2  5 
ATOM 2801 H HB3  . ALA A 1 35 ? 29.416 47.536 20.665 1.00 0.00 ? 341 ALA A HB3  5 
ATOM 2802 N N    . SER A 1 36 ? 29.206 46.934 23.776 1.00 0.00 ? 342 SER A N    5 
ATOM 2803 C CA   . SER A 1 36 ? 29.250 45.747 24.648 1.00 0.00 ? 342 SER A CA   5 
ATOM 2804 C C    . SER A 1 36 ? 29.131 46.100 26.136 1.00 0.00 ? 342 SER A C    5 
ATOM 2805 O O    . SER A 1 36 ? 28.611 45.282 26.893 1.00 0.00 ? 342 SER A O    5 
ATOM 2806 C CB   . SER A 1 36 ? 30.482 44.913 24.303 1.00 0.00 ? 342 SER A CB   5 
ATOM 2807 O OG   . SER A 1 36 ? 30.377 44.585 22.935 1.00 0.00 ? 342 SER A OG   5 
ATOM 2808 H H    . SER A 1 36 ? 30.104 47.271 23.444 1.00 0.00 ? 342 SER A H    5 
ATOM 2809 H HA   . SER A 1 36 ? 28.395 45.124 24.404 1.00 0.00 ? 342 SER A HA   5 
ATOM 2810 H HB2  . SER A 1 36 ? 31.394 45.475 24.486 1.00 0.00 ? 342 SER A HB2  5 
ATOM 2811 H HB3  . SER A 1 36 ? 30.485 43.999 24.900 1.00 0.00 ? 342 SER A HB3  5 
ATOM 2812 H HG   . SER A 1 36 ? 31.261 44.253 22.613 1.00 0.00 ? 342 SER A HG   5 
ATOM 2813 N N    . GLN A 1 37 ? 29.457 47.331 26.557 1.00 0.00 ? 343 GLN A N    5 
ATOM 2814 C CA   . GLN A 1 37 ? 29.263 47.820 27.934 1.00 0.00 ? 343 GLN A CA   5 
ATOM 2815 C C    . GLN A 1 37 ? 27.780 47.857 28.353 1.00 0.00 ? 343 GLN A C    5 
ATOM 2816 O O    . GLN A 1 37 ? 27.438 47.419 29.442 1.00 0.00 ? 343 GLN A O    5 
ATOM 2817 C CB   . GLN A 1 37 ? 29.857 49.232 28.078 1.00 0.00 ? 343 GLN A CB   5 
ATOM 2818 C CG   . GLN A 1 37 ? 31.293 49.242 28.612 1.00 0.00 ? 343 GLN A CG   5 
ATOM 2819 C CD   . GLN A 1 37 ? 31.352 49.094 30.126 1.00 0.00 ? 343 GLN A CD   5 
ATOM 2820 O OE1  . GLN A 1 37 ? 31.692 48.058 30.669 1.00 0.00 ? 343 GLN A OE1  5 
ATOM 2821 N NE2  . GLN A 1 37 ? 31.032 50.127 30.883 1.00 0.00 ? 343 GLN A NE2  5 
ATOM 2822 H H    . GLN A 1 37 ? 29.889 47.950 25.879 1.00 0.00 ? 343 GLN A H    5 
ATOM 2823 H HA   . GLN A 1 37 ? 29.761 47.147 28.621 1.00 0.00 ? 343 GLN A HA   5 
ATOM 2824 H HB2  . GLN A 1 37 ? 29.834 49.736 27.104 1.00 0.00 ? 343 GLN A HB2  5 
ATOM 2825 H HB3  . GLN A 1 37 ? 29.240 49.834 28.751 1.00 0.00 ? 343 GLN A HB3  5 
ATOM 2826 H HG2  . GLN A 1 37 ? 31.868 48.447 28.147 1.00 0.00 ? 343 GLN A HG2  5 
ATOM 2827 H HG3  . GLN A 1 37 ? 31.756 50.193 28.354 1.00 0.00 ? 343 GLN A HG3  5 
ATOM 2828 H HE21 . GLN A 1 37 ? 30.737 50.987 30.462 1.00 0.00 ? 343 GLN A HE21 5 
ATOM 2829 H HE22 . GLN A 1 37 ? 31.037 49.954 31.869 1.00 0.00 ? 343 GLN A HE22 5 
ATOM 2830 N N    . GLN A 1 38 ? 26.904 48.427 27.516 1.00 0.00 ? 344 GLN A N    5 
ATOM 2831 C CA   . GLN A 1 38 ? 25.489 48.663 27.865 1.00 0.00 ? 344 GLN A CA   5 
ATOM 2832 C C    . GLN A 1 38 ? 24.476 48.266 26.772 1.00 0.00 ? 344 GLN A C    5 
ATOM 2833 O O    . GLN A 1 38 ? 23.284 48.475 26.961 1.00 0.00 ? 344 GLN A O    5 
ATOM 2834 C CB   . GLN A 1 38 ? 25.306 50.146 28.283 1.00 0.00 ? 344 GLN A CB   5 
ATOM 2835 C CG   . GLN A 1 38 ? 25.784 50.474 29.704 1.00 0.00 ? 344 GLN A CG   5 
ATOM 2836 C CD   . GLN A 1 38 ? 24.981 49.798 30.822 1.00 0.00 ? 344 GLN A CD   5 
ATOM 2837 O OE1  . GLN A 1 38 ? 25.515 49.353 31.821 1.00 0.00 ? 344 GLN A OE1  5 
ATOM 2838 N NE2  . GLN A 1 38 ? 23.666 49.751 30.754 1.00 0.00 ? 344 GLN A NE2  5 
ATOM 2839 H H    . GLN A 1 38 ? 27.266 48.812 26.657 1.00 0.00 ? 344 GLN A H    5 
ATOM 2840 H HA   . GLN A 1 38 ? 25.225 48.047 28.716 1.00 0.00 ? 344 GLN A HA   5 
ATOM 2841 H HB2  . GLN A 1 38 ? 25.847 50.774 27.570 1.00 0.00 ? 344 GLN A HB2  5 
ATOM 2842 H HB3  . GLN A 1 38 ? 24.253 50.418 28.214 1.00 0.00 ? 344 GLN A HB3  5 
ATOM 2843 H HG2  . GLN A 1 38 ? 26.829 50.203 29.814 1.00 0.00 ? 344 GLN A HG2  5 
ATOM 2844 H HG3  . GLN A 1 38 ? 25.696 51.548 29.849 1.00 0.00 ? 344 GLN A HG3  5 
ATOM 2845 H HE21 . GLN A 1 38 ? 23.180 50.070 29.936 1.00 0.00 ? 344 GLN A HE21 5 
ATOM 2846 H HE22 . GLN A 1 38 ? 23.219 49.283 31.519 1.00 0.00 ? 344 GLN A HE22 5 
ATOM 2847 N N    . ASN A 1 39 ? 24.932 47.702 25.655 1.00 0.00 ? 345 ASN A N    5 
ATOM 2848 C CA   . ASN A 1 39 ? 24.079 47.146 24.588 1.00 0.00 ? 345 ASN A CA   5 
ATOM 2849 C C    . ASN A 1 39 ? 24.339 45.646 24.317 1.00 0.00 ? 345 ASN A C    5 
ATOM 2850 O O    . ASN A 1 39 ? 23.601 45.028 23.557 1.00 0.00 ? 345 ASN A O    5 
ATOM 2851 C CB   . ASN A 1 39 ? 24.255 48.000 23.314 1.00 0.00 ? 345 ASN A CB   5 
ATOM 2852 C CG   . ASN A 1 39 ? 23.117 48.967 23.060 1.00 0.00 ? 345 ASN A CG   5 
ATOM 2853 O OD1  . ASN A 1 39 ? 22.143 48.672 22.392 1.00 0.00 ? 345 ASN A OD1  5 
ATOM 2854 N ND2  . ASN A 1 39 ? 23.215 50.181 23.532 1.00 0.00 ? 345 ASN A ND2  5 
ATOM 2855 H H    . ASN A 1 39 ? 25.927 47.595 25.531 1.00 0.00 ? 345 ASN A H    5 
ATOM 2856 H HA   . ASN A 1 39 ? 23.022 47.188 24.886 1.00 0.00 ? 345 ASN A HA   5 
ATOM 2857 H HB2  . ASN A 1 39 ? 25.191 48.568 23.355 1.00 0.00 ? 345 ASN A HB2  5 
ATOM 2858 H HB3  . ASN A 1 39 ? 24.311 47.345 22.439 1.00 0.00 ? 345 ASN A HB3  5 
ATOM 2859 H HD21 . ASN A 1 39 ? 24.003 50.443 24.089 1.00 0.00 ? 345 ASN A HD21 5 
ATOM 2860 H HD22 . ASN A 1 39 ? 22.438 50.788 23.331 1.00 0.00 ? 345 ASN A HD22 5 
ATOM 2861 N N    . GLN A 1 40 ? 25.395 45.059 24.916 1.00 0.00 ? 346 GLN A N    5 
ATOM 2862 C CA   . GLN A 1 40 ? 25.861 43.662 24.743 1.00 0.00 ? 346 GLN A CA   5 
ATOM 2863 C C    . GLN A 1 40 ? 25.791 43.112 23.299 1.00 0.00 ? 346 GLN A C    5 
ATOM 2864 O O    . GLN A 1 40 ? 25.535 41.926 23.083 1.00 0.00 ? 346 GLN A O    5 
ATOM 2865 C CB   . GLN A 1 40 ? 25.276 42.734 25.837 1.00 0.00 ? 346 GLN A CB   5 
ATOM 2866 C CG   . GLN A 1 40 ? 23.752 42.715 26.008 1.00 0.00 ? 346 GLN A CG   5 
ATOM 2867 C CD   . GLN A 1 40 ? 23.184 43.900 26.803 1.00 0.00 ? 346 GLN A CD   5 
ATOM 2868 O OE1  . GLN A 1 40 ? 22.239 44.563 26.417 1.00 0.00 ? 346 GLN A OE1  5 
ATOM 2869 N NE2  . GLN A 1 40 ? 23.720 44.230 27.960 1.00 0.00 ? 346 GLN A NE2  5 
ATOM 2870 H H    . GLN A 1 40 ? 25.956 45.634 25.514 1.00 0.00 ? 346 GLN A H    5 
ATOM 2871 H HA   . GLN A 1 40 ? 26.931 43.684 24.943 1.00 0.00 ? 346 GLN A HA   5 
ATOM 2872 H HB2  . GLN A 1 40 ? 25.601 41.717 25.620 1.00 0.00 ? 346 GLN A HB2  5 
ATOM 2873 H HB3  . GLN A 1 40 ? 25.742 42.999 26.789 1.00 0.00 ? 346 GLN A HB3  5 
ATOM 2874 H HG2  . GLN A 1 40 ? 23.276 42.679 25.030 1.00 0.00 ? 346 GLN A HG2  5 
ATOM 2875 H HG3  . GLN A 1 40 ? 23.482 41.810 26.547 1.00 0.00 ? 346 GLN A HG3  5 
ATOM 2876 H HE21 . GLN A 1 40 ? 24.524 43.737 28.307 1.00 0.00 ? 346 GLN A HE21 5 
ATOM 2877 H HE22 . GLN A 1 40 ? 23.304 45.015 28.419 1.00 0.00 ? 346 GLN A HE22 5 
ATOM 2878 N N    . SER A 1 41 ? 26.020 43.973 22.303 1.00 0.00 ? 347 SER A N    5 
ATOM 2879 C CA   . SER A 1 41 ? 25.693 43.705 20.893 1.00 0.00 ? 347 SER A CA   5 
ATOM 2880 C C    . SER A 1 41 ? 26.835 43.029 20.118 1.00 0.00 ? 347 SER A C    5 
ATOM 2881 O O    . SER A 1 41 ? 27.207 43.437 19.028 1.00 0.00 ? 347 SER A O    5 
ATOM 2882 C CB   . SER A 1 41 ? 25.179 44.989 20.231 1.00 0.00 ? 347 SER A CB   5 
ATOM 2883 O OG   . SER A 1 41 ? 24.364 44.680 19.105 1.00 0.00 ? 347 SER A OG   5 
ATOM 2884 H H    . SER A 1 41 ? 26.277 44.920 22.555 1.00 0.00 ? 347 SER A H    5 
ATOM 2885 H HA   . SER A 1 41 ? 24.858 43.007 20.881 1.00 0.00 ? 347 SER A HA   5 
ATOM 2886 H HB2  . SER A 1 41 ? 24.564 45.541 20.945 1.00 0.00 ? 347 SER A HB2  5 
ATOM 2887 H HB3  . SER A 1 41 ? 26.018 45.617 19.924 1.00 0.00 ? 347 SER A HB3  5 
ATOM 2888 H HG   . SER A 1 41 ? 24.157 45.499 18.651 1.00 0.00 ? 347 SER A HG   5 
ATOM 2889 N N    . GLY A 1 42 ? 27.409 41.983 20.722 1.00 0.00 ? 348 GLY A N    5 
ATOM 2890 C CA   . GLY A 1 42 ? 28.571 41.254 20.187 1.00 0.00 ? 348 GLY A CA   5 
ATOM 2891 C C    . GLY A 1 42 ? 29.862 41.482 21.013 1.00 0.00 ? 348 GLY A C    5 
ATOM 2892 O O    . GLY A 1 42 ? 29.769 41.606 22.235 1.00 0.00 ? 348 GLY A O    5 
ATOM 2893 H H    . GLY A 1 42 ? 27.080 41.730 21.645 1.00 0.00 ? 348 GLY A H    5 
ATOM 2894 H HA2  . GLY A 1 42 ? 28.356 40.184 20.197 1.00 0.00 ? 348 GLY A HA2  5 
ATOM 2895 H HA3  . GLY A 1 42 ? 28.746 41.564 19.159 1.00 0.00 ? 348 GLY A HA3  5 
ATOM 2896 N N    . PRO A 1 43 ? 31.043 41.439 20.368 1.00 0.00 ? 349 PRO A N    5 
ATOM 2897 C CA   . PRO A 1 43 ? 32.355 41.682 20.992 1.00 0.00 ? 349 PRO A CA   5 
ATOM 2898 C C    . PRO A 1 43 ? 32.781 43.160 20.961 1.00 0.00 ? 349 PRO A C    5 
ATOM 2899 O O    . PRO A 1 43 ? 33.245 43.639 19.905 1.00 0.00 ? 349 PRO A O    5 
ATOM 2900 C CB   . PRO A 1 43 ? 33.306 40.757 20.222 1.00 0.00 ? 349 PRO A CB   5 
ATOM 2901 C CG   . PRO A 1 43 ? 32.740 40.749 18.807 1.00 0.00 ? 349 PRO A CG   5 
ATOM 2902 C CD   . PRO A 1 43 ? 31.228 40.931 19.012 1.00 0.00 ? 349 PRO A CD   5 
ATOM 2903 O OXT  . PRO A 1 43 ? 32.684 43.801 22.029 1.00 0.00 ? 349 PRO A OXT  5 
ATOM 2904 H HA   . PRO A 1 43 ? 32.321 41.371 22.033 1.00 0.00 ? 349 PRO A HA   5 
ATOM 2905 H HB2  . PRO A 1 43 ? 34.340 41.114 20.245 1.00 0.00 ? 349 PRO A HB2  5 
ATOM 2906 H HB3  . PRO A 1 43 ? 33.250 39.748 20.643 1.00 0.00 ? 349 PRO A HB3  5 
ATOM 2907 H HG2  . PRO A 1 43 ? 33.128 41.592 18.244 1.00 0.00 ? 349 PRO A HG2  5 
ATOM 2908 H HG3  . PRO A 1 43 ? 32.962 39.814 18.292 1.00 0.00 ? 349 PRO A HG3  5 
ATOM 2909 H HD2  . PRO A 1 43 ? 30.827 41.622 18.270 1.00 0.00 ? 349 PRO A HD2  5 
ATOM 2910 H HD3  . PRO A 1 43 ? 30.739 39.960 18.921 1.00 0.00 ? 349 PRO A HD3  5 
ATOM 2911 N N    . MET A 1 1  ? 57.531 28.438 27.180 1.00 0.00 ? 307 MET A N    6 
ATOM 2912 C CA   . MET A 1 1  ? 57.405 29.899 27.076 1.00 0.00 ? 307 MET A CA   6 
ATOM 2913 C C    . MET A 1 1  ? 56.334 30.249 26.038 1.00 0.00 ? 307 MET A C    6 
ATOM 2914 O O    . MET A 1 1  ? 55.243 30.623 26.436 1.00 0.00 ? 307 MET A O    6 
ATOM 2915 C CB   . MET A 1 1  ? 58.747 30.601 26.804 1.00 0.00 ? 307 MET A CB   6 
ATOM 2916 C CG   . MET A 1 1  ? 58.747 32.021 27.392 1.00 0.00 ? 307 MET A CG   6 
ATOM 2917 S SD   . MET A 1 1  ? 60.044 33.111 26.747 1.00 0.00 ? 307 MET A SD   6 
ATOM 2918 C CE   . MET A 1 1  ? 61.555 32.370 27.423 1.00 0.00 ? 307 MET A CE   6 
ATOM 2919 H H1   . MET A 1 1  ? 56.639 28.034 27.403 1.00 0.00 ? 307 MET A H1   6 
ATOM 2920 H H2   . MET A 1 1  ? 57.851 28.045 26.295 1.00 0.00 ? 307 MET A H2   6 
ATOM 2921 H H3   . MET A 1 1  ? 58.198 28.188 27.907 1.00 0.00 ? 307 MET A H3   6 
ATOM 2922 H HA   . MET A 1 1  ? 57.033 30.276 28.030 1.00 0.00 ? 307 MET A HA   6 
ATOM 2923 H HB2  . MET A 1 1  ? 59.561 30.040 27.270 1.00 0.00 ? 307 MET A HB2  6 
ATOM 2924 H HB3  . MET A 1 1  ? 58.948 30.652 25.729 1.00 0.00 ? 307 MET A HB3  6 
ATOM 2925 H HG2  . MET A 1 1  ? 57.788 32.491 27.177 1.00 0.00 ? 307 MET A HG2  6 
ATOM 2926 H HG3  . MET A 1 1  ? 58.855 31.950 28.482 1.00 0.00 ? 307 MET A HG3  6 
ATOM 2927 H HE1  . MET A 1 1  ? 62.408 32.970 27.124 1.00 0.00 ? 307 MET A HE1  6 
ATOM 2928 H HE2  . MET A 1 1  ? 61.503 32.348 28.514 1.00 0.00 ? 307 MET A HE2  6 
ATOM 2929 H HE3  . MET A 1 1  ? 61.678 31.356 27.039 1.00 0.00 ? 307 MET A HE3  6 
ATOM 2930 N N    . GLY A 1 2  ? 56.611 30.007 24.752 1.00 0.00 ? 308 GLY A N    6 
ATOM 2931 C CA   . GLY A 1 2  ? 55.692 30.194 23.634 1.00 0.00 ? 308 GLY A CA   6 
ATOM 2932 C C    . GLY A 1 2  ? 56.440 29.997 22.310 1.00 0.00 ? 308 GLY A C    6 
ATOM 2933 O O    . GLY A 1 2  ? 57.612 29.593 22.333 1.00 0.00 ? 308 GLY A O    6 
ATOM 2934 H H    . GLY A 1 2  ? 57.548 29.753 24.470 1.00 0.00 ? 308 GLY A H    6 
ATOM 2935 H HA2  . GLY A 1 2  ? 54.865 29.472 23.684 1.00 0.00 ? 308 GLY A HA2  6 
ATOM 2936 H HA3  . GLY A 1 2  ? 55.276 31.202 23.651 1.00 0.00 ? 308 GLY A HA3  6 
ATOM 2937 N N    . GLY A 1 3  ? 55.791 30.287 21.186 1.00 0.00 ? 309 GLY A N    6 
ATOM 2938 C CA   . GLY A 1 3  ? 56.407 30.440 19.866 1.00 0.00 ? 309 GLY A CA   6 
ATOM 2939 C C    . GLY A 1 3  ? 56.121 31.818 19.251 1.00 0.00 ? 309 GLY A C    6 
ATOM 2940 O O    . GLY A 1 3  ? 55.425 32.640 19.850 1.00 0.00 ? 309 GLY A O    6 
ATOM 2941 H H    . GLY A 1 3  ? 54.808 30.515 21.264 1.00 0.00 ? 309 GLY A H    6 
ATOM 2942 H HA2  . GLY A 1 3  ? 57.496 30.332 19.939 1.00 0.00 ? 309 GLY A HA2  6 
ATOM 2943 H HA3  . GLY A 1 3  ? 56.035 29.675 19.199 1.00 0.00 ? 309 GLY A HA3  6 
ATOM 2944 N N    . GLY A 1 4  ? 56.605 32.072 18.036 1.00 0.00 ? 310 GLY A N    6 
ATOM 2945 C CA   . GLY A 1 4  ? 56.700 33.404 17.405 1.00 0.00 ? 310 GLY A CA   6 
ATOM 2946 C C    . GLY A 1 4  ? 55.409 34.222 17.200 1.00 0.00 ? 310 GLY A C    6 
ATOM 2947 O O    . GLY A 1 4  ? 55.503 35.325 16.672 1.00 0.00 ? 310 GLY A O    6 
ATOM 2948 H H    . GLY A 1 4  ? 57.138 31.337 17.590 1.00 0.00 ? 310 GLY A H    6 
ATOM 2949 H HA2  . GLY A 1 4  ? 57.364 34.015 18.015 1.00 0.00 ? 310 GLY A HA2  6 
ATOM 2950 H HA3  . GLY A 1 4  ? 57.160 33.289 16.433 1.00 0.00 ? 310 GLY A HA3  6 
ATOM 2951 N N    . MET A 1 5  ? 54.223 33.761 17.613 1.00 0.00 ? 311 MET A N    6 
ATOM 2952 C CA   . MET A 1 5  ? 52.996 34.577 17.710 1.00 0.00 ? 311 MET A CA   6 
ATOM 2953 C C    . MET A 1 5  ? 52.181 34.324 19.009 1.00 0.00 ? 311 MET A C    6 
ATOM 2954 O O    . MET A 1 5  ? 51.037 34.751 19.089 1.00 0.00 ? 311 MET A O    6 
ATOM 2955 C CB   . MET A 1 5  ? 52.152 34.477 16.423 1.00 0.00 ? 311 MET A CB   6 
ATOM 2956 C CG   . MET A 1 5  ? 52.730 35.347 15.295 1.00 0.00 ? 311 MET A CG   6 
ATOM 2957 S SD   . MET A 1 5  ? 51.510 36.017 14.128 1.00 0.00 ? 311 MET A SD   6 
ATOM 2958 C CE   . MET A 1 5  ? 51.037 34.518 13.214 1.00 0.00 ? 311 MET A CE   6 
ATOM 2959 H H    . MET A 1 5  ? 54.229 32.856 18.057 1.00 0.00 ? 311 MET A H    6 
ATOM 2960 H HA   . MET A 1 5  ? 53.299 35.616 17.794 1.00 0.00 ? 311 MET A HA   6 
ATOM 2961 H HB2  . MET A 1 5  ? 52.085 33.438 16.093 1.00 0.00 ? 311 MET A HB2  6 
ATOM 2962 H HB3  . MET A 1 5  ? 51.146 34.836 16.620 1.00 0.00 ? 311 MET A HB3  6 
ATOM 2963 H HG2  . MET A 1 5  ? 53.216 36.219 15.751 1.00 0.00 ? 311 MET A HG2  6 
ATOM 2964 H HG3  . MET A 1 5  ? 53.494 34.791 14.757 1.00 0.00 ? 311 MET A HG3  6 
ATOM 2965 H HE1  . MET A 1 5  ? 50.259 34.776 12.496 1.00 0.00 ? 311 MET A HE1  6 
ATOM 2966 H HE2  . MET A 1 5  ? 51.910 34.133 12.681 1.00 0.00 ? 311 MET A HE2  6 
ATOM 2967 H HE3  . MET A 1 5  ? 50.667 33.771 13.913 1.00 0.00 ? 311 MET A HE3  6 
ATOM 2968 N N    . ASN A 1 6  ? 52.744 33.708 20.058 1.00 0.00 ? 312 ASN A N    6 
ATOM 2969 C CA   . ASN A 1 6  ? 51.993 33.224 21.230 1.00 0.00 ? 312 ASN A CA   6 
ATOM 2970 C C    . ASN A 1 6  ? 51.230 34.291 22.047 1.00 0.00 ? 312 ASN A C    6 
ATOM 2971 O O    . ASN A 1 6  ? 50.415 33.912 22.885 1.00 0.00 ? 312 ASN A O    6 
ATOM 2972 C CB   . ASN A 1 6  ? 52.948 32.498 22.188 1.00 0.00 ? 312 ASN A CB   6 
ATOM 2973 C CG   . ASN A 1 6  ? 52.531 31.072 22.444 1.00 0.00 ? 312 ASN A CG   6 
ATOM 2974 O OD1  . ASN A 1 6  ? 53.038 30.148 21.843 1.00 0.00 ? 312 ASN A OD1  6 
ATOM 2975 N ND2  . ASN A 1 6  ? 51.613 30.837 23.351 1.00 0.00 ? 312 ASN A ND2  6 
ATOM 2976 H H    . ASN A 1 6  ? 53.717 33.431 19.976 1.00 0.00 ? 312 ASN A H    6 
ATOM 2977 H HA   . ASN A 1 6  ? 51.234 32.524 20.872 1.00 0.00 ? 312 ASN A HA   6 
ATOM 2978 H HB2  . ASN A 1 6  ? 53.975 32.493 21.817 1.00 0.00 ? 312 ASN A HB2  6 
ATOM 2979 H HB3  . ASN A 1 6  ? 52.975 32.997 23.158 1.00 0.00 ? 312 ASN A HB3  6 
ATOM 2980 H HD21 . ASN A 1 6  ? 51.130 31.602 23.800 1.00 0.00 ? 312 ASN A HD21 6 
ATOM 2981 H HD22 . ASN A 1 6  ? 51.336 29.873 23.484 1.00 0.00 ? 312 ASN A HD22 6 
ATOM 2982 N N    . PHE A 1 7  ? 51.586 35.568 21.899 1.00 0.00 ? 313 PHE A N    6 
ATOM 2983 C CA   . PHE A 1 7  ? 50.925 36.696 22.582 1.00 0.00 ? 313 PHE A CA   6 
ATOM 2984 C C    . PHE A 1 7  ? 51.220 38.068 21.958 1.00 0.00 ? 313 PHE A C    6 
ATOM 2985 O O    . PHE A 1 7  ? 50.558 39.044 22.259 1.00 0.00 ? 313 PHE A O    6 
ATOM 2986 C CB   . PHE A 1 7  ? 51.355 36.709 24.066 1.00 0.00 ? 313 PHE A CB   6 
ATOM 2987 C CG   . PHE A 1 7  ? 50.433 37.518 24.961 1.00 0.00 ? 313 PHE A CG   6 
ATOM 2988 C CD1  . PHE A 1 7  ? 49.082 37.137 25.096 1.00 0.00 ? 313 PHE A CD1  6 
ATOM 2989 C CD2  . PHE A 1 7  ? 50.912 38.642 25.666 1.00 0.00 ? 313 PHE A CD2  6 
ATOM 2990 C CE1  . PHE A 1 7  ? 48.211 37.893 25.898 1.00 0.00 ? 313 PHE A CE1  6 
ATOM 2991 C CE2  . PHE A 1 7  ? 50.032 39.399 26.458 1.00 0.00 ? 313 PHE A CE2  6 
ATOM 2992 C CZ   . PHE A 1 7  ? 48.681 39.029 26.574 1.00 0.00 ? 313 PHE A CZ   6 
ATOM 2993 H H    . PHE A 1 7  ? 52.200 35.760 21.133 1.00 0.00 ? 313 PHE A H    6 
ATOM 2994 H HA   . PHE A 1 7  ? 49.847 36.532 22.529 1.00 0.00 ? 313 PHE A HA   6 
ATOM 2995 H HB2  . PHE A 1 7  ? 51.363 35.696 24.462 1.00 0.00 ? 313 PHE A HB2  6 
ATOM 2996 H HB3  . PHE A 1 7  ? 52.372 37.102 24.136 1.00 0.00 ? 313 PHE A HB3  6 
ATOM 2997 H HD1  . PHE A 1 7  ? 48.707 36.271 24.573 1.00 0.00 ? 313 PHE A HD1  6 
ATOM 2998 H HD2  . PHE A 1 7  ? 51.942 38.936 25.588 1.00 0.00 ? 313 PHE A HD2  6 
ATOM 2999 H HE1  . PHE A 1 7  ? 47.171 37.608 25.986 1.00 0.00 ? 313 PHE A HE1  6 
ATOM 3000 H HE2  . PHE A 1 7  ? 50.386 40.274 26.991 1.00 0.00 ? 313 PHE A HE2  6 
ATOM 3001 H HZ   . PHE A 1 7  ? 48.005 39.620 27.186 1.00 0.00 ? 313 PHE A HZ   6 
ATOM 3002 N N    . GLY A 1 8  ? 52.276 38.177 21.135 1.00 0.00 ? 314 GLY A N    6 
ATOM 3003 C CA   . GLY A 1 8  ? 52.692 39.432 20.485 1.00 0.00 ? 314 GLY A CA   6 
ATOM 3004 C C    . GLY A 1 8  ? 53.278 40.522 21.390 1.00 0.00 ? 314 GLY A C    6 
ATOM 3005 O O    . GLY A 1 8  ? 54.123 41.284 20.932 1.00 0.00 ? 314 GLY A O    6 
ATOM 3006 H H    . GLY A 1 8  ? 52.776 37.346 20.902 1.00 0.00 ? 314 GLY A H    6 
ATOM 3007 H HA2  . GLY A 1 8  ? 53.439 39.184 19.719 1.00 0.00 ? 314 GLY A HA2  6 
ATOM 3008 H HA3  . GLY A 1 8  ? 51.820 39.855 19.978 1.00 0.00 ? 314 GLY A HA3  6 
ATOM 3009 N N    . ALA A 1 9  ? 52.872 40.584 22.671 1.00 0.00 ? 315 ALA A N    6 
ATOM 3010 C CA   . ALA A 1 9  ? 53.297 41.620 23.619 1.00 0.00 ? 315 ALA A CA   6 
ATOM 3011 C C    . ALA A 1 9  ? 54.542 41.256 24.449 1.00 0.00 ? 315 ALA A C    6 
ATOM 3012 O O    . ALA A 1 9  ? 55.135 42.136 25.078 1.00 0.00 ? 315 ALA A O    6 
ATOM 3013 C CB   . ALA A 1 9  ? 52.126 41.963 24.544 1.00 0.00 ? 315 ALA A CB   6 
ATOM 3014 H H    . ALA A 1 9  ? 52.050 40.039 22.915 1.00 0.00 ? 315 ALA A H    6 
ATOM 3015 H HA   . ALA A 1 9  ? 53.533 42.517 23.039 1.00 0.00 ? 315 ALA A HA   6 
ATOM 3016 H HB1  . ALA A 1 9  ? 52.311 42.932 25.022 1.00 0.00 ? 315 ALA A HB1  6 
ATOM 3017 H HB2  . ALA A 1 9  ? 51.187 42.028 23.989 1.00 0.00 ? 315 ALA A HB2  6 
ATOM 3018 H HB3  . ALA A 1 9  ? 52.025 41.213 25.319 1.00 0.00 ? 315 ALA A HB3  6 
ATOM 3019 N N    . PHE A 1 10 ? 54.919 39.981 24.501 1.00 0.00 ? 316 PHE A N    6 
ATOM 3020 C CA   . PHE A 1 10 ? 56.138 39.537 25.194 1.00 0.00 ? 316 PHE A CA   6 
ATOM 3021 C C    . PHE A 1 10 ? 56.676 38.206 24.664 1.00 0.00 ? 316 PHE A C    6 
ATOM 3022 O O    . PHE A 1 10 ? 57.862 38.075 24.397 1.00 0.00 ? 316 PHE A O    6 
ATOM 3023 C CB   . PHE A 1 10 ? 55.877 39.441 26.717 1.00 0.00 ? 316 PHE A CB   6 
ATOM 3024 C CG   . PHE A 1 10 ? 57.069 39.932 27.519 1.00 0.00 ? 316 PHE A CG   6 
ATOM 3025 C CD1  . PHE A 1 10 ? 58.169 39.079 27.768 1.00 0.00 ? 316 PHE A CD1  6 
ATOM 3026 C CD2  . PHE A 1 10 ? 57.102 41.261 27.990 1.00 0.00 ? 316 PHE A CD2  6 
ATOM 3027 C CE1  . PHE A 1 10 ? 59.272 39.544 28.486 1.00 0.00 ? 316 PHE A CE1  6 
ATOM 3028 C CE2  . PHE A 1 10 ? 58.215 41.726 28.709 1.00 0.00 ? 316 PHE A CE2  6 
ATOM 3029 C CZ   . PHE A 1 10 ? 59.295 40.873 28.957 1.00 0.00 ? 316 PHE A CZ   6 
ATOM 3030 H H    . PHE A 1 10 ? 54.404 39.327 23.941 1.00 0.00 ? 316 PHE A H    6 
ATOM 3031 H HA   . PHE A 1 10 ? 56.917 40.286 25.035 1.00 0.00 ? 316 PHE A HA   6 
ATOM 3032 H HB2  . PHE A 1 10 ? 55.018 40.067 26.987 1.00 0.00 ? 316 PHE A HB2  6 
ATOM 3033 H HB3  . PHE A 1 10 ? 55.637 38.426 26.997 1.00 0.00 ? 316 PHE A HB3  6 
ATOM 3034 H HD1  . PHE A 1 10 ? 58.162 38.064 27.391 1.00 0.00 ? 316 PHE A HD1  6 
ATOM 3035 H HD2  . PHE A 1 10 ? 56.272 41.922 27.782 1.00 0.00 ? 316 PHE A HD2  6 
ATOM 3036 H HE1  . PHE A 1 10 ? 60.122 38.895 28.665 1.00 0.00 ? 316 PHE A HE1  6 
ATOM 3037 H HE2  . PHE A 1 10 ? 58.232 42.742 29.076 1.00 0.00 ? 316 PHE A HE2  6 
ATOM 3038 H HZ   . PHE A 1 10 ? 60.152 41.239 29.513 1.00 0.00 ? 316 PHE A HZ   6 
ATOM 3039 N N    . SER A 1 11 ? 55.787 37.237 24.404 1.00 0.00 ? 317 SER A N    6 
ATOM 3040 C CA   . SER A 1 11 ? 56.133 35.858 23.966 1.00 0.00 ? 317 SER A CA   6 
ATOM 3041 C C    . SER A 1 11 ? 56.713 35.748 22.535 1.00 0.00 ? 317 SER A C    6 
ATOM 3042 O O    . SER A 1 11 ? 56.731 34.658 21.963 1.00 0.00 ? 317 SER A O    6 
ATOM 3043 C CB   . SER A 1 11 ? 54.895 34.964 24.136 1.00 0.00 ? 317 SER A CB   6 
ATOM 3044 O OG   . SER A 1 11 ? 55.240 33.728 24.742 1.00 0.00 ? 317 SER A OG   6 
ATOM 3045 H H    . SER A 1 11 ? 54.840 37.398 24.698 1.00 0.00 ? 317 SER A H    6 
ATOM 3046 H HA   . SER A 1 11 ? 56.902 35.493 24.636 1.00 0.00 ? 317 SER A HA   6 
ATOM 3047 H HB2  . SER A 1 11 ? 54.169 35.462 24.781 1.00 0.00 ? 317 SER A HB2  6 
ATOM 3048 H HB3  . SER A 1 11 ? 54.425 34.792 23.171 1.00 0.00 ? 317 SER A HB3  6 
ATOM 3049 H HG   . SER A 1 11 ? 54.473 33.359 25.181 1.00 0.00 ? 317 SER A HG   6 
ATOM 3050 N N    . ILE A 1 12 ? 57.119 36.869 21.935 1.00 0.00 ? 318 ILE A N    6 
ATOM 3051 C CA   . ILE A 1 12 ? 57.745 36.974 20.591 1.00 0.00 ? 318 ILE A CA   6 
ATOM 3052 C C    . ILE A 1 12 ? 58.729 38.157 20.559 1.00 0.00 ? 318 ILE A C    6 
ATOM 3053 O O    . ILE A 1 12 ? 59.802 38.048 19.970 1.00 0.00 ? 318 ILE A O    6 
ATOM 3054 C CB   . ILE A 1 12 ? 56.708 37.054 19.413 1.00 0.00 ? 318 ILE A CB   6 
ATOM 3055 C CG1  . ILE A 1 12 ? 56.687 38.387 18.620 1.00 0.00 ? 318 ILE A CG1  6 
ATOM 3056 C CG2  . ILE A 1 12 ? 55.262 36.702 19.830 1.00 0.00 ? 318 ILE A CG2  6 
ATOM 3057 C CD1  . ILE A 1 12 ? 56.004 38.364 17.251 1.00 0.00 ? 318 ILE A CD1  6 
ATOM 3058 H H    . ILE A 1 12 ? 57.242 37.657 22.548 1.00 0.00 ? 318 ILE A H    6 
ATOM 3059 H HA   . ILE A 1 12 ? 58.344 36.076 20.446 1.00 0.00 ? 318 ILE A HA   6 
ATOM 3060 H HB   . ILE A 1 12 ? 57.027 36.288 18.700 1.00 0.00 ? 318 ILE A HB   6 
ATOM 3061 H HG12 . ILE A 1 12 ? 56.220 39.160 19.240 1.00 0.00 ? 318 ILE A HG12 6 
ATOM 3062 H HG13 . ILE A 1 12 ? 57.710 38.701 18.403 1.00 0.00 ? 318 ILE A HG13 6 
ATOM 3063 H HG21 . ILE A 1 12 ? 54.598 36.771 18.979 1.00 0.00 ? 318 ILE A HG21 6 
ATOM 3064 H HG22 . ILE A 1 12 ? 55.230 35.672 20.193 1.00 0.00 ? 318 ILE A HG22 6 
ATOM 3065 H HG23 . ILE A 1 12 ? 54.922 37.384 20.606 1.00 0.00 ? 318 ILE A HG23 6 
ATOM 3066 H HD11 . ILE A 1 12 ? 54.944 38.129 17.342 1.00 0.00 ? 318 ILE A HD11 6 
ATOM 3067 H HD12 . ILE A 1 12 ? 56.118 39.332 16.784 1.00 0.00 ? 318 ILE A HD12 6 
ATOM 3068 H HD13 . ILE A 1 12 ? 56.502 37.633 16.614 1.00 0.00 ? 318 ILE A HD13 6 
ATOM 3069 N N    . ASN A 1 13 ? 58.341 39.283 21.147 1.00 0.00 ? 319 ASN A N    6 
ATOM 3070 C CA   . ASN A 1 13 ? 59.044 40.563 21.126 1.00 0.00 ? 319 ASN A CA   6 
ATOM 3071 C C    . ASN A 1 13 ? 58.605 41.402 22.343 1.00 0.00 ? 319 ASN A C    6 
ATOM 3072 O O    . ASN A 1 13 ? 57.476 41.219 22.809 1.00 0.00 ? 319 ASN A O    6 
ATOM 3073 C CB   . ASN A 1 13 ? 58.686 41.339 19.833 1.00 0.00 ? 319 ASN A CB   6 
ATOM 3074 C CG   . ASN A 1 13 ? 59.777 41.305 18.789 1.00 0.00 ? 319 ASN A CG   6 
ATOM 3075 O OD1  . ASN A 1 13 ? 60.941 41.502 19.077 1.00 0.00 ? 319 ASN A OD1  6 
ATOM 3076 N ND2  . ASN A 1 13 ? 59.444 41.146 17.527 1.00 0.00 ? 319 ASN A ND2  6 
ATOM 3077 H H    . ASN A 1 13 ? 57.461 39.291 21.631 1.00 0.00 ? 319 ASN A H    6 
ATOM 3078 H HA   . ASN A 1 13 ? 60.124 40.396 21.185 1.00 0.00 ? 319 ASN A HA   6 
ATOM 3079 H HB2  . ASN A 1 13 ? 57.746 40.963 19.415 1.00 0.00 ? 319 ASN A HB2  6 
ATOM 3080 H HB3  . ASN A 1 13 ? 58.525 42.383 20.078 1.00 0.00 ? 319 ASN A HB3  6 
ATOM 3081 H HD21 . ASN A 1 13 ? 58.500 40.980 17.245 1.00 0.00 ? 319 ASN A HD21 6 
ATOM 3082 H HD22 . ASN A 1 13 ? 60.217 41.150 16.880 1.00 0.00 ? 319 ASN A HD22 6 
ATOM 3083 N N    . PRO A 1 14 ? 59.420 42.376 22.813 1.00 0.00 ? 320 PRO A N    6 
ATOM 3084 C CA   . PRO A 1 14 ? 59.043 43.296 23.888 1.00 0.00 ? 320 PRO A CA   6 
ATOM 3085 C C    . PRO A 1 14 ? 57.987 44.289 23.380 1.00 0.00 ? 320 PRO A C    6 
ATOM 3086 O O    . PRO A 1 14 ? 58.306 45.236 22.674 1.00 0.00 ? 320 PRO A O    6 
ATOM 3087 C CB   . PRO A 1 14 ? 60.361 43.957 24.294 1.00 0.00 ? 320 PRO A CB   6 
ATOM 3088 C CG   . PRO A 1 14 ? 61.177 43.988 23.009 1.00 0.00 ? 320 PRO A CG   6 
ATOM 3089 C CD   . PRO A 1 14 ? 60.739 42.705 22.292 1.00 0.00 ? 320 PRO A CD   6 
ATOM 3090 H HA   . PRO A 1 14 ? 58.639 42.738 24.731 1.00 0.00 ? 320 PRO A HA   6 
ATOM 3091 H HB2  . PRO A 1 14 ? 60.207 44.958 24.707 1.00 0.00 ? 320 PRO A HB2  6 
ATOM 3092 H HB3  . PRO A 1 14 ? 60.870 43.334 25.030 1.00 0.00 ? 320 PRO A HB3  6 
ATOM 3093 H HG2  . PRO A 1 14 ? 60.905 44.854 22.406 1.00 0.00 ? 320 PRO A HG2  6 
ATOM 3094 H HG3  . PRO A 1 14 ? 62.254 43.982 23.200 1.00 0.00 ? 320 PRO A HG3  6 
ATOM 3095 H HD2  . PRO A 1 14 ? 60.710 42.895 21.213 1.00 0.00 ? 320 PRO A HD2  6 
ATOM 3096 H HD3  . PRO A 1 14 ? 61.439 41.902 22.507 1.00 0.00 ? 320 PRO A HD3  6 
ATOM 3097 N N    . ALA A 1 15 ? 56.713 44.017 23.675 1.00 0.00 ? 321 ALA A N    6 
ATOM 3098 C CA   . ALA A 1 15 ? 55.507 44.743 23.234 1.00 0.00 ? 321 ALA A CA   6 
ATOM 3099 C C    . ALA A 1 15 ? 55.287 44.925 21.709 1.00 0.00 ? 321 ALA A C    6 
ATOM 3100 O O    . ALA A 1 15 ? 54.183 45.279 21.302 1.00 0.00 ? 321 ALA A O    6 
ATOM 3101 C CB   . ALA A 1 15 ? 55.373 46.034 24.060 1.00 0.00 ? 321 ALA A CB   6 
ATOM 3102 H H    . ALA A 1 15 ? 56.546 43.192 24.232 1.00 0.00 ? 321 ALA A H    6 
ATOM 3103 H HA   . ALA A 1 15 ? 54.664 44.131 23.553 1.00 0.00 ? 321 ALA A HA   6 
ATOM 3104 H HB1  . ALA A 1 15 ? 54.435 46.537 23.809 1.00 0.00 ? 321 ALA A HB1  6 
ATOM 3105 H HB2  . ALA A 1 15 ? 55.353 45.774 25.124 1.00 0.00 ? 321 ALA A HB2  6 
ATOM 3106 H HB3  . ALA A 1 15 ? 56.214 46.696 23.866 1.00 0.00 ? 321 ALA A HB3  6 
ATOM 3107 N N    . MET A 1 16 ? 56.276 44.614 20.863 1.00 0.00 ? 322 MET A N    6 
ATOM 3108 C CA   . MET A 1 16 ? 56.331 45.099 19.476 1.00 0.00 ? 322 MET A CA   6 
ATOM 3109 C C    . MET A 1 16 ? 55.172 44.636 18.586 1.00 0.00 ? 322 MET A C    6 
ATOM 3110 O O    . MET A 1 16 ? 54.612 45.449 17.853 1.00 0.00 ? 322 MET A O    6 
ATOM 3111 C CB   . MET A 1 16 ? 57.677 44.685 18.840 1.00 0.00 ? 322 MET A CB   6 
ATOM 3112 C CG   . MET A 1 16 ? 58.163 45.661 17.769 1.00 0.00 ? 322 MET A CG   6 
ATOM 3113 S SD   . MET A 1 16 ? 59.516 46.755 18.288 1.00 0.00 ? 322 MET A SD   6 
ATOM 3114 C CE   . MET A 1 16 ? 58.802 47.564 19.749 1.00 0.00 ? 322 MET A CE   6 
ATOM 3115 H H    . MET A 1 16 ? 57.159 44.368 21.293 1.00 0.00 ? 322 MET A H    6 
ATOM 3116 H HA   . MET A 1 16 ? 56.294 46.190 19.507 1.00 0.00 ? 322 MET A HA   6 
ATOM 3117 H HB2  . MET A 1 16 ? 58.452 44.613 19.612 1.00 0.00 ? 322 MET A HB2  6 
ATOM 3118 H HB3  . MET A 1 16 ? 57.571 43.695 18.392 1.00 0.00 ? 322 MET A HB3  6 
ATOM 3119 H HG2  . MET A 1 16 ? 58.533 45.075 16.920 1.00 0.00 ? 322 MET A HG2  6 
ATOM 3120 H HG3  . MET A 1 16 ? 57.326 46.264 17.406 1.00 0.00 ? 322 MET A HG3  6 
ATOM 3121 H HE1  . MET A 1 16 ? 59.520 48.281 20.148 1.00 0.00 ? 322 MET A HE1  6 
ATOM 3122 H HE2  . MET A 1 16 ? 57.885 48.069 19.478 1.00 0.00 ? 322 MET A HE2  6 
ATOM 3123 H HE3  . MET A 1 16 ? 58.601 46.813 20.521 1.00 0.00 ? 322 MET A HE3  6 
ATOM 3124 N N    . MET A 1 17 ? 54.788 43.355 18.643 1.00 0.00 ? 323 MET A N    6 
ATOM 3125 C CA   . MET A 1 17 ? 53.759 42.825 17.730 1.00 0.00 ? 323 MET A CA   6 
ATOM 3126 C C    . MET A 1 17 ? 52.357 43.221 18.194 1.00 0.00 ? 323 MET A C    6 
ATOM 3127 O O    . MET A 1 17 ? 51.570 43.716 17.403 1.00 0.00 ? 323 MET A O    6 
ATOM 3128 C CB   . MET A 1 17 ? 53.881 41.292 17.578 1.00 0.00 ? 323 MET A CB   6 
ATOM 3129 C CG   . MET A 1 17 ? 53.722 40.817 16.135 1.00 0.00 ? 323 MET A CG   6 
ATOM 3130 S SD   . MET A 1 17 ? 52.176 41.269 15.306 1.00 0.00 ? 323 MET A SD   6 
ATOM 3131 C CE   . MET A 1 17 ? 52.827 42.325 13.984 1.00 0.00 ? 323 MET A CE   6 
ATOM 3132 H H    . MET A 1 17 ? 55.197 42.745 19.338 1.00 0.00 ? 323 MET A H    6 
ATOM 3133 H HA   . MET A 1 17 ? 53.906 43.270 16.754 1.00 0.00 ? 323 MET A HA   6 
ATOM 3134 H HB2  . MET A 1 17 ? 54.855 40.971 17.944 1.00 0.00 ? 323 MET A HB2  6 
ATOM 3135 H HB3  . MET A 1 17 ? 53.111 40.811 18.179 1.00 0.00 ? 323 MET A HB3  6 
ATOM 3136 H HG2  . MET A 1 17 ? 54.562 41.188 15.548 1.00 0.00 ? 323 MET A HG2  6 
ATOM 3137 H HG3  . MET A 1 17 ? 53.779 39.725 16.125 1.00 0.00 ? 323 MET A HG3  6 
ATOM 3138 H HE1  . MET A 1 17 ? 52.007 42.705 13.384 1.00 0.00 ? 323 MET A HE1  6 
ATOM 3139 H HE2  . MET A 1 17 ? 53.373 43.169 14.419 1.00 0.00 ? 323 MET A HE2  6 
ATOM 3140 H HE3  . MET A 1 17 ? 53.503 41.756 13.353 1.00 0.00 ? 323 MET A HE3  6 
ATOM 3141 N N    . ALA A 1 18 ? 52.062 43.062 19.490 1.00 0.00 ? 324 ALA A N    6 
ATOM 3142 C CA   . ALA A 1 18 ? 50.758 43.433 20.034 1.00 0.00 ? 324 ALA A CA   6 
ATOM 3143 C C    . ALA A 1 18 ? 50.502 44.945 19.911 1.00 0.00 ? 324 ALA A C    6 
ATOM 3144 O O    . ALA A 1 18 ? 49.407 45.336 19.537 1.00 0.00 ? 324 ALA A O    6 
ATOM 3145 C CB   . ALA A 1 18 ? 50.642 42.963 21.481 1.00 0.00 ? 324 ALA A CB   6 
ATOM 3146 H H    . ALA A 1 18 ? 52.771 42.709 20.120 1.00 0.00 ? 324 ALA A H    6 
ATOM 3147 H HA   . ALA A 1 18 ? 49.983 42.940 19.450 1.00 0.00 ? 324 ALA A HA   6 
ATOM 3148 H HB1  . ALA A 1 18 ? 49.672 43.268 21.875 1.00 0.00 ? 324 ALA A HB1  6 
ATOM 3149 H HB2  . ALA A 1 18 ? 50.697 41.878 21.511 1.00 0.00 ? 324 ALA A HB2  6 
ATOM 3150 H HB3  . ALA A 1 18 ? 51.427 43.416 22.082 1.00 0.00 ? 324 ALA A HB3  6 
ATOM 3151 N N    . ALA A 1 19 ? 51.523 45.787 20.144 1.00 0.00 ? 325 ALA A N    6 
ATOM 3152 C CA   . ALA A 1 19 ? 51.400 47.219 19.888 1.00 0.00 ? 325 ALA A CA   6 
ATOM 3153 C C    . ALA A 1 19 ? 51.178 47.500 18.390 1.00 0.00 ? 325 ALA A C    6 
ATOM 3154 O O    . ALA A 1 19 ? 50.250 48.229 18.065 1.00 0.00 ? 325 ALA A O    6 
ATOM 3155 C CB   . ALA A 1 19 ? 52.625 47.959 20.439 1.00 0.00 ? 325 ALA A CB   6 
ATOM 3156 H H    . ALA A 1 19 ? 52.418 45.438 20.467 1.00 0.00 ? 325 ALA A H    6 
ATOM 3157 H HA   . ALA A 1 19 ? 50.527 47.584 20.420 1.00 0.00 ? 325 ALA A HA   6 
ATOM 3158 H HB1  . ALA A 1 19 ? 52.491 49.030 20.316 1.00 0.00 ? 325 ALA A HB1  6 
ATOM 3159 H HB2  . ALA A 1 19 ? 52.734 47.740 21.508 1.00 0.00 ? 325 ALA A HB2  6 
ATOM 3160 H HB3  . ALA A 1 19 ? 53.527 47.644 19.912 1.00 0.00 ? 325 ALA A HB3  6 
ATOM 3161 N N    . ALA A 1 20 ? 51.950 46.902 17.478 1.00 0.00 ? 326 ALA A N    6 
ATOM 3162 C CA   . ALA A 1 20 ? 51.768 47.128 16.037 1.00 0.00 ? 326 ALA A CA   6 
ATOM 3163 C C    . ALA A 1 20 ? 50.391 46.666 15.514 1.00 0.00 ? 326 ALA A C    6 
ATOM 3164 O O    . ALA A 1 20 ? 49.814 47.337 14.660 1.00 0.00 ? 326 ALA A O    6 
ATOM 3165 C CB   . ALA A 1 20 ? 52.907 46.440 15.286 1.00 0.00 ? 326 ALA A CB   6 
ATOM 3166 H H    . ALA A 1 20 ? 52.718 46.313 17.780 1.00 0.00 ? 326 ALA A H    6 
ATOM 3167 H HA   . ALA A 1 20 ? 51.836 48.196 15.847 1.00 0.00 ? 326 ALA A HA   6 
ATOM 3168 H HB1  . ALA A 1 20 ? 52.808 46.620 14.214 1.00 0.00 ? 326 ALA A HB1  6 
ATOM 3169 H HB2  . ALA A 1 20 ? 53.869 46.844 15.616 1.00 0.00 ? 326 ALA A HB2  6 
ATOM 3170 H HB3  . ALA A 1 20 ? 52.890 45.363 15.476 1.00 0.00 ? 326 ALA A HB3  6 
ATOM 3171 N N    . GLN A 1 21 ? 49.847 45.560 16.032 1.00 0.00 ? 327 GLN A N    6 
ATOM 3172 C CA   . GLN A 1 21 ? 48.517 45.067 15.658 1.00 0.00 ? 327 GLN A CA   6 
ATOM 3173 C C    . GLN A 1 21 ? 47.409 45.957 16.265 1.00 0.00 ? 327 GLN A C    6 
ATOM 3174 O O    . GLN A 1 21 ? 46.540 46.445 15.552 1.00 0.00 ? 327 GLN A O    6 
ATOM 3175 C CB   . GLN A 1 21 ? 48.377 43.582 16.066 1.00 0.00 ? 327 GLN A CB   6 
ATOM 3176 C CG   . GLN A 1 21 ? 47.602 42.740 15.045 1.00 0.00 ? 327 GLN A CG   6 
ATOM 3177 C CD   . GLN A 1 21 ? 46.154 43.167 14.828 1.00 0.00 ? 327 GLN A CD   6 
ATOM 3178 O OE1  . GLN A 1 21 ? 45.384 43.383 15.751 1.00 0.00 ? 327 GLN A OE1  6 
ATOM 3179 N NE2  . GLN A 1 21 ? 45.708 43.276 13.593 1.00 0.00 ? 327 GLN A NE2  6 
ATOM 3180 H H    . GLN A 1 21 ? 50.397 45.014 16.684 1.00 0.00 ? 327 GLN A H    6 
ATOM 3181 H HA   . GLN A 1 21 ? 48.428 45.138 14.569 1.00 0.00 ? 327 GLN A HA   6 
ATOM 3182 H HB2  . GLN A 1 21 ? 49.368 43.142 16.143 1.00 0.00 ? 327 GLN A HB2  6 
ATOM 3183 H HB3  . GLN A 1 21 ? 47.907 43.505 17.044 1.00 0.00 ? 327 GLN A HB3  6 
ATOM 3184 H HG2  . GLN A 1 21 ? 48.141 42.765 14.095 1.00 0.00 ? 327 GLN A HG2  6 
ATOM 3185 H HG3  . GLN A 1 21 ? 47.601 41.702 15.379 1.00 0.00 ? 327 GLN A HG3  6 
ATOM 3186 H HE21 . GLN A 1 21 ? 46.315 43.108 12.810 1.00 0.00 ? 327 GLN A HE21 6 
ATOM 3187 H HE22 . GLN A 1 21 ? 44.758 43.558 13.485 1.00 0.00 ? 327 GLN A HE22 6 
ATOM 3188 N N    . ALA A 1 22 ? 47.481 46.220 17.580 1.00 0.00 ? 328 ALA A N    6 
ATOM 3189 C CA   . ALA A 1 22 ? 46.452 46.972 18.288 1.00 0.00 ? 328 ALA A CA   6 
ATOM 3190 C C    . ALA A 1 22 ? 46.518 48.503 18.072 1.00 0.00 ? 328 ALA A C    6 
ATOM 3191 O O    . ALA A 1 22 ? 45.519 49.168 18.333 1.00 0.00 ? 328 ALA A O    6 
ATOM 3192 C CB   . ALA A 1 22 ? 46.495 46.591 19.774 1.00 0.00 ? 328 ALA A CB   6 
ATOM 3193 H H    . ALA A 1 22 ? 48.242 45.834 18.127 1.00 0.00 ? 328 ALA A H    6 
ATOM 3194 H HA   . ALA A 1 22 ? 45.492 46.642 17.913 1.00 0.00 ? 328 ALA A HA   6 
ATOM 3195 H HB1  . ALA A 1 22 ? 45.641 47.057 20.294 1.00 0.00 ? 328 ALA A HB1  6 
ATOM 3196 H HB2  . ALA A 1 22 ? 46.418 45.509 19.883 1.00 0.00 ? 328 ALA A HB2  6 
ATOM 3197 H HB3  . ALA A 1 22 ? 47.414 46.944 20.230 1.00 0.00 ? 328 ALA A HB3  6 
ATOM 3198 N N    . ALA A 1 23 ? 47.625 49.050 17.563 1.00 0.00 ? 329 ALA A N    6 
ATOM 3199 C CA   . ALA A 1 23 ? 47.822 50.484 17.313 1.00 0.00 ? 329 ALA A CA   6 
ATOM 3200 C C    . ALA A 1 23 ? 46.675 51.097 16.514 1.00 0.00 ? 329 ALA A C    6 
ATOM 3201 O O    . ALA A 1 23 ? 46.111 52.117 16.910 1.00 0.00 ? 329 ALA A O    6 
ATOM 3202 C CB   . ALA A 1 23 ? 49.147 50.682 16.542 1.00 0.00 ? 329 ALA A CB   6 
ATOM 3203 H H    . ALA A 1 23 ? 48.441 48.453 17.455 1.00 0.00 ? 329 ALA A H    6 
ATOM 3204 H HA   . ALA A 1 23 ? 47.890 51.005 18.266 1.00 0.00 ? 329 ALA A HA   6 
ATOM 3205 H HB1  . ALA A 1 23 ? 49.199 51.703 16.168 1.00 0.00 ? 329 ALA A HB1  6 
ATOM 3206 H HB2  . ALA A 1 23 ? 49.995 50.518 17.208 1.00 0.00 ? 329 ALA A HB2  6 
ATOM 3207 H HB3  . ALA A 1 23 ? 49.198 49.983 15.698 1.00 0.00 ? 329 ALA A HB3  6 
ATOM 3208 N N    . LEU A 1 24 ? 46.311 50.456 15.396 1.00 0.00 ? 330 LEU A N    6 
ATOM 3209 C CA   . LEU A 1 24 ? 45.205 50.913 14.546 1.00 0.00 ? 330 LEU A CA   6 
ATOM 3210 C C    . LEU A 1 24 ? 43.891 50.223 14.930 1.00 0.00 ? 330 LEU A C    6 
ATOM 3211 O O    . LEU A 1 24 ? 42.838 50.859 14.896 1.00 0.00 ? 330 LEU A O    6 
ATOM 3212 C CB   . LEU A 1 24 ? 45.546 50.736 13.055 1.00 0.00 ? 330 LEU A CB   6 
ATOM 3213 C CG   . LEU A 1 24 ? 46.982 51.185 12.675 1.00 0.00 ? 330 LEU A CG   6 
ATOM 3214 C CD1  . LEU A 1 24 ? 47.892 49.961 12.502 1.00 0.00 ? 330 LEU A CD1  6 
ATOM 3215 C CD2  . LEU A 1 24 ? 46.984 51.966 11.360 1.00 0.00 ? 330 LEU A CD2  6 
ATOM 3216 H H    . LEU A 1 24 ? 46.821 49.637 15.134 1.00 0.00 ? 330 LEU A H    6 
ATOM 3217 H HA   . LEU A 1 24 ? 45.055 51.982 14.713 1.00 0.00 ? 330 LEU A HA   6 
ATOM 3218 H HB2  . LEU A 1 24 ? 45.398 49.693 12.773 1.00 0.00 ? 330 LEU A HB2  6 
ATOM 3219 H HB3  . LEU A 1 24 ? 44.824 51.324 12.493 1.00 0.00 ? 330 LEU A HB3  6 
ATOM 3220 H HG   . LEU A 1 24 ? 47.392 51.833 13.444 1.00 0.00 ? 330 LEU A HG   6 
ATOM 3221 H HD11 . LEU A 1 24 ? 48.915 50.295 12.296 1.00 0.00 ? 330 LEU A HD11 6 
ATOM 3222 H HD12 . LEU A 1 24 ? 47.907 49.362 13.420 1.00 0.00 ? 330 LEU A HD12 6 
ATOM 3223 H HD13 . LEU A 1 24 ? 47.542 49.338 11.686 1.00 0.00 ? 330 LEU A HD13 6 
ATOM 3224 H HD21 . LEU A 1 24 ? 46.416 52.885 11.487 1.00 0.00 ? 330 LEU A HD21 6 
ATOM 3225 H HD22 . LEU A 1 24 ? 48.018 52.233 11.099 1.00 0.00 ? 330 LEU A HD22 6 
ATOM 3226 H HD23 . LEU A 1 24 ? 46.553 51.370 10.564 1.00 0.00 ? 330 LEU A HD23 6 
ATOM 3227 N N    . GLN A 1 25 ? 43.959 48.957 15.368 1.00 0.00 ? 331 GLN A N    6 
ATOM 3228 C CA   . GLN A 1 25 ? 42.775 48.195 15.789 1.00 0.00 ? 331 GLN A CA   6 
ATOM 3229 C C    . GLN A 1 25 ? 42.028 48.876 16.938 1.00 0.00 ? 331 GLN A C    6 
ATOM 3230 O O    . GLN A 1 25 ? 40.807 48.825 16.971 1.00 0.00 ? 331 GLN A O    6 
ATOM 3231 C CB   . GLN A 1 25 ? 43.175 46.763 16.201 1.00 0.00 ? 331 GLN A CB   6 
ATOM 3232 C CG   . GLN A 1 25 ? 42.013 45.772 16.064 1.00 0.00 ? 331 GLN A CG   6 
ATOM 3233 C CD   . GLN A 1 25 ? 42.027 44.717 17.169 1.00 0.00 ? 331 GLN A CD   6 
ATOM 3234 O OE1  . GLN A 1 25 ? 41.189 44.715 18.055 1.00 0.00 ? 331 GLN A OE1  6 
ATOM 3235 N NE2  . GLN A 1 25 ? 42.962 43.790 17.188 1.00 0.00 ? 331 GLN A NE2  6 
ATOM 3236 H H    . GLN A 1 25 ? 44.852 48.490 15.391 1.00 0.00 ? 331 GLN A H    6 
ATOM 3237 H HA   . GLN A 1 25 ? 42.102 48.143 14.949 1.00 0.00 ? 331 GLN A HA   6 
ATOM 3238 H HB2  . GLN A 1 25 ? 43.990 46.415 15.569 1.00 0.00 ? 331 GLN A HB2  6 
ATOM 3239 H HB3  . GLN A 1 25 ? 43.514 46.789 17.233 1.00 0.00 ? 331 GLN A HB3  6 
ATOM 3240 H HG2  . GLN A 1 25 ? 41.059 46.292 16.124 1.00 0.00 ? 331 GLN A HG2  6 
ATOM 3241 H HG3  . GLN A 1 25 ? 42.075 45.273 15.095 1.00 0.00 ? 331 GLN A HG3  6 
ATOM 3242 H HE21 . GLN A 1 25 ? 43.735 43.774 16.530 1.00 0.00 ? 331 GLN A HE21 6 
ATOM 3243 H HE22 . GLN A 1 25 ? 42.900 43.131 17.950 1.00 0.00 ? 331 GLN A HE22 6 
ATOM 3244 N N    . SER A 1 26 ? 42.726 49.586 17.838 1.00 0.00 ? 332 SER A N    6 
ATOM 3245 C CA   . SER A 1 26 ? 42.109 50.383 18.918 1.00 0.00 ? 332 SER A CA   6 
ATOM 3246 C C    . SER A 1 26 ? 41.074 51.378 18.391 1.00 0.00 ? 332 SER A C    6 
ATOM 3247 O O    . SER A 1 26 ? 40.011 51.526 18.992 1.00 0.00 ? 332 SER A O    6 
ATOM 3248 C CB   . SER A 1 26 ? 43.179 51.166 19.690 1.00 0.00 ? 332 SER A CB   6 
ATOM 3249 O OG   . SER A 1 26 ? 44.082 50.283 20.324 1.00 0.00 ? 332 SER A OG   6 
ATOM 3250 H H    . SER A 1 26 ? 43.737 49.567 17.786 1.00 0.00 ? 332 SER A H    6 
ATOM 3251 H HA   . SER A 1 26 ? 41.609 49.706 19.620 1.00 0.00 ? 332 SER A HA   6 
ATOM 3252 H HB2  . SER A 1 26 ? 43.730 51.813 19.007 1.00 0.00 ? 332 SER A HB2  6 
ATOM 3253 H HB3  . SER A 1 26 ? 42.701 51.778 20.448 1.00 0.00 ? 332 SER A HB3  6 
ATOM 3254 H HG   . SER A 1 26 ? 44.668 49.896 19.645 1.00 0.00 ? 332 SER A HG   6 
ATOM 3255 N N    . SER A 1 27 ? 41.323 52.017 17.250 1.00 0.00 ? 333 SER A N    6 
ATOM 3256 C CA   . SER A 1 27 ? 40.400 52.979 16.631 1.00 0.00 ? 333 SER A CA   6 
ATOM 3257 C C    . SER A 1 27 ? 39.083 52.321 16.175 1.00 0.00 ? 333 SER A C    6 
ATOM 3258 O O    . SER A 1 27 ? 38.007 52.919 16.259 1.00 0.00 ? 333 SER A O    6 
ATOM 3259 C CB   . SER A 1 27 ? 41.110 53.643 15.451 1.00 0.00 ? 333 SER A CB   6 
ATOM 3260 O OG   . SER A 1 27 ? 40.431 54.821 15.065 1.00 0.00 ? 333 SER A OG   6 
ATOM 3261 H H    . SER A 1 27 ? 42.165 51.770 16.736 1.00 0.00 ? 333 SER A H    6 
ATOM 3262 H HA   . SER A 1 27 ? 40.151 53.745 17.356 1.00 0.00 ? 333 SER A HA   6 
ATOM 3263 H HB2  . SER A 1 27 ? 42.123 53.909 15.752 1.00 0.00 ? 333 SER A HB2  6 
ATOM 3264 H HB3  . SER A 1 27 ? 41.161 52.955 14.609 1.00 0.00 ? 333 SER A HB3  6 
ATOM 3265 H HG   . SER A 1 27 ? 40.991 55.322 14.451 1.00 0.00 ? 333 SER A HG   6 
ATOM 3266 N N    . TRP A 1 28 ? 39.138 51.059 15.761 1.00 0.00 ? 334 TRP A N    6 
ATOM 3267 C CA   . TRP A 1 28 ? 37.970 50.245 15.406 1.00 0.00 ? 334 TRP A CA   6 
ATOM 3268 C C    . TRP A 1 28 ? 37.308 49.646 16.652 1.00 0.00 ? 334 TRP A C    6 
ATOM 3269 O O    . TRP A 1 28 ? 36.085 49.646 16.798 1.00 0.00 ? 334 TRP A O    6 
ATOM 3270 C CB   . TRP A 1 28 ? 38.427 49.171 14.392 1.00 0.00 ? 334 TRP A CB   6 
ATOM 3271 C CG   . TRP A 1 28 ? 39.257 49.654 13.231 1.00 0.00 ? 334 TRP A CG   6 
ATOM 3272 C CD1  . TRP A 1 28 ? 39.133 50.852 12.626 1.00 0.00 ? 334 TRP A CD1  6 
ATOM 3273 C CD2  . TRP A 1 28 ? 40.365 48.981 12.550 1.00 0.00 ? 334 TRP A CD2  6 
ATOM 3274 N NE1  . TRP A 1 28 ? 40.092 50.982 11.642 1.00 0.00 ? 334 TRP A NE1  6 
ATOM 3275 C CE2  . TRP A 1 28 ? 40.890 49.861 11.553 1.00 0.00 ? 334 TRP A CE2  6 
ATOM 3276 C CE3  . TRP A 1 28 ? 40.990 47.714 12.659 1.00 0.00 ? 334 TRP A CE3  6 
ATOM 3277 C CZ2  . TRP A 1 28 ? 41.979 49.529 10.738 1.00 0.00 ? 334 TRP A CZ2  6 
ATOM 3278 C CZ3  . TRP A 1 28 ? 42.079 47.361 11.851 1.00 0.00 ? 334 TRP A CZ3  6 
ATOM 3279 C CH2  . TRP A 1 28 ? 42.583 48.269 10.886 1.00 0.00 ? 334 TRP A CH2  6 
ATOM 3280 H H    . TRP A 1 28 ? 40.052 50.607 15.725 1.00 0.00 ? 334 TRP A H    6 
ATOM 3281 H HA   . TRP A 1 28 ? 37.226 50.878 14.917 1.00 0.00 ? 334 TRP A HA   6 
ATOM 3282 H HB2  . TRP A 1 28 ? 39.000 48.413 14.928 1.00 0.00 ? 334 TRP A HB2  6 
ATOM 3283 H HB3  . TRP A 1 28 ? 37.537 48.672 13.996 1.00 0.00 ? 334 TRP A HB3  6 
ATOM 3284 H HD1  . TRP A 1 28 ? 38.413 51.618 12.900 1.00 0.00 ? 334 TRP A HD1  6 
ATOM 3285 H HE1  . TRP A 1 28 ? 40.189 51.808 11.063 1.00 0.00 ? 334 TRP A HE1  6 
ATOM 3286 H HE3  . TRP A 1 28 ? 40.610 47.015 13.381 1.00 0.00 ? 334 TRP A HE3  6 
ATOM 3287 H HZ2  . TRP A 1 28 ? 42.340 50.219 9.994  1.00 0.00 ? 334 TRP A HZ2  6 
ATOM 3288 H HZ3  . TRP A 1 28 ? 42.543 46.394 11.949 1.00 0.00 ? 334 TRP A HZ3  6 
ATOM 3289 H HH2  . TRP A 1 28 ? 43.418 47.981 10.259 1.00 0.00 ? 334 TRP A HH2  6 
ATOM 3290 N N    . GLY A 1 29 ? 38.131 49.208 17.619 1.00 0.00 ? 335 GLY A N    6 
ATOM 3291 C CA   . GLY A 1 29 ? 37.728 48.677 18.915 1.00 0.00 ? 335 GLY A CA   6 
ATOM 3292 C C    . GLY A 1 29 ? 36.975 49.691 19.778 1.00 0.00 ? 335 GLY A C    6 
ATOM 3293 O O    . GLY A 1 29 ? 36.082 49.278 20.512 1.00 0.00 ? 335 GLY A O    6 
ATOM 3294 H H    . GLY A 1 29 ? 39.125 49.220 17.418 1.00 0.00 ? 335 GLY A H    6 
ATOM 3295 H HA2  . GLY A 1 29 ? 37.086 47.811 18.767 1.00 0.00 ? 335 GLY A HA2  6 
ATOM 3296 H HA3  . GLY A 1 29 ? 38.619 48.362 19.461 1.00 0.00 ? 335 GLY A HA3  6 
ATOM 3297 N N    . MET A 1 30 ? 37.220 50.997 19.630 1.00 0.00 ? 336 MET A N    6 
ATOM 3298 C CA   . MET A 1 30 ? 36.411 52.047 20.264 1.00 0.00 ? 336 MET A CA   6 
ATOM 3299 C C    . MET A 1 30 ? 34.918 51.910 19.934 1.00 0.00 ? 336 MET A C    6 
ATOM 3300 O O    . MET A 1 30 ? 34.080 52.049 20.820 1.00 0.00 ? 336 MET A O    6 
ATOM 3301 C CB   . MET A 1 30 ? 36.883 53.439 19.796 1.00 0.00 ? 336 MET A CB   6 
ATOM 3302 C CG   . MET A 1 30 ? 38.229 53.896 20.388 1.00 0.00 ? 336 MET A CG   6 
ATOM 3303 S SD   . MET A 1 30 ? 38.161 54.666 22.029 1.00 0.00 ? 336 MET A SD   6 
ATOM 3304 C CE   . MET A 1 30 ? 38.267 53.221 23.127 1.00 0.00 ? 336 MET A CE   6 
ATOM 3305 H H    . MET A 1 30 ? 38.030 51.264 19.084 1.00 0.00 ? 336 MET A H    6 
ATOM 3306 H HA   . MET A 1 30 ? 36.500 51.977 21.344 1.00 0.00 ? 336 MET A HA   6 
ATOM 3307 H HB2  . MET A 1 30 ? 36.975 53.430 18.714 1.00 0.00 ? 336 MET A HB2  6 
ATOM 3308 H HB3  . MET A 1 30 ? 36.133 54.186 20.058 1.00 0.00 ? 336 MET A HB3  6 
ATOM 3309 H HG2  . MET A 1 30 ? 38.913 53.056 20.429 1.00 0.00 ? 336 MET A HG2  6 
ATOM 3310 H HG3  . MET A 1 30 ? 38.648 54.632 19.709 1.00 0.00 ? 336 MET A HG3  6 
ATOM 3311 H HE1  . MET A 1 30 ? 38.475 53.558 24.139 1.00 0.00 ? 336 MET A HE1  6 
ATOM 3312 H HE2  . MET A 1 30 ? 37.330 52.672 23.127 1.00 0.00 ? 336 MET A HE2  6 
ATOM 3313 H HE3  . MET A 1 30 ? 39.078 52.569 22.793 1.00 0.00 ? 336 MET A HE3  6 
ATOM 3314 N N    . MET A 1 31 ? 34.575 51.570 18.688 1.00 0.00 ? 337 MET A N    6 
ATOM 3315 C CA   . MET A 1 31 ? 33.175 51.339 18.282 1.00 0.00 ? 337 MET A CA   6 
ATOM 3316 C C    . MET A 1 31 ? 32.693 49.966 18.761 1.00 0.00 ? 337 MET A C    6 
ATOM 3317 O O    . MET A 1 31 ? 31.592 49.848 19.303 1.00 0.00 ? 337 MET A O    6 
ATOM 3318 C CB   . MET A 1 31 ? 33.045 51.482 16.755 1.00 0.00 ? 337 MET A CB   6 
ATOM 3319 C CG   . MET A 1 31 ? 33.598 52.809 16.234 1.00 0.00 ? 337 MET A CG   6 
ATOM 3320 S SD   . MET A 1 31 ? 33.452 53.032 14.442 1.00 0.00 ? 337 MET A SD   6 
ATOM 3321 C CE   . MET A 1 31 ? 34.558 54.458 14.250 1.00 0.00 ? 337 MET A CE   6 
ATOM 3322 H H    . MET A 1 31 ? 35.300 51.405 18.008 1.00 0.00 ? 337 MET A H    6 
ATOM 3323 H HA   . MET A 1 31 ? 32.541 52.092 18.747 1.00 0.00 ? 337 MET A HA   6 
ATOM 3324 H HB2  . MET A 1 31 ? 33.569 50.661 16.263 1.00 0.00 ? 337 MET A HB2  6 
ATOM 3325 H HB3  . MET A 1 31 ? 31.990 51.414 16.489 1.00 0.00 ? 337 MET A HB3  6 
ATOM 3326 H HG2  . MET A 1 31 ? 33.083 53.630 16.736 1.00 0.00 ? 337 MET A HG2  6 
ATOM 3327 H HG3  . MET A 1 31 ? 34.662 52.868 16.490 1.00 0.00 ? 337 MET A HG3  6 
ATOM 3328 H HE1  . MET A 1 31 ? 34.588 54.757 13.209 1.00 0.00 ? 337 MET A HE1  6 
ATOM 3329 H HE2  . MET A 1 31 ? 34.191 55.283 14.856 1.00 0.00 ? 337 MET A HE2  6 
ATOM 3330 H HE3  . MET A 1 31 ? 35.563 54.190 14.580 1.00 0.00 ? 337 MET A HE3  6 
ATOM 3331 N N    . GLY A 1 32 ? 33.541 48.950 18.622 1.00 0.00 ? 338 GLY A N    6 
ATOM 3332 C CA   . GLY A 1 32 ? 33.261 47.572 19.055 1.00 0.00 ? 338 GLY A CA   6 
ATOM 3333 C C    . GLY A 1 32 ? 32.971 47.438 20.554 1.00 0.00 ? 338 GLY A C    6 
ATOM 3334 O O    . GLY A 1 32 ? 32.048 46.712 20.913 1.00 0.00 ? 338 GLY A O    6 
ATOM 3335 H H    . GLY A 1 32 ? 34.440 49.130 18.172 1.00 0.00 ? 338 GLY A H    6 
ATOM 3336 H HA2  . GLY A 1 32 ? 32.394 47.206 18.499 1.00 0.00 ? 338 GLY A HA2  6 
ATOM 3337 H HA3  . GLY A 1 32 ? 34.119 46.944 18.814 1.00 0.00 ? 338 GLY A HA3  6 
ATOM 3338 N N    . MET A 1 33 ? 33.690 48.161 21.414 1.00 0.00 ? 339 MET A N    6 
ATOM 3339 C CA   . MET A 1 33 ? 33.500 48.172 22.866 1.00 0.00 ? 339 MET A CA   6 
ATOM 3340 C C    . MET A 1 33 ? 32.168 48.803 23.278 1.00 0.00 ? 339 MET A C    6 
ATOM 3341 O O    . MET A 1 33 ? 31.532 48.308 24.201 1.00 0.00 ? 339 MET A O    6 
ATOM 3342 C CB   . MET A 1 33 ? 34.642 48.962 23.539 1.00 0.00 ? 339 MET A CB   6 
ATOM 3343 C CG   . MET A 1 33 ? 35.946 48.163 23.625 1.00 0.00 ? 339 MET A CG   6 
ATOM 3344 S SD   . MET A 1 33 ? 37.368 49.111 24.226 1.00 0.00 ? 339 MET A SD   6 
ATOM 3345 C CE   . MET A 1 33 ? 36.802 49.595 25.886 1.00 0.00 ? 339 MET A CE   6 
ATOM 3346 H H    . MET A 1 33 ? 34.454 48.716 21.040 1.00 0.00 ? 339 MET A H    6 
ATOM 3347 H HA   . MET A 1 33 ? 33.499 47.151 23.241 1.00 0.00 ? 339 MET A HA   6 
ATOM 3348 H HB2  . MET A 1 33 ? 34.818 49.887 22.990 1.00 0.00 ? 339 MET A HB2  6 
ATOM 3349 H HB3  . MET A 1 33 ? 34.331 49.215 24.555 1.00 0.00 ? 339 MET A HB3  6 
ATOM 3350 H HG2  . MET A 1 33 ? 35.787 47.310 24.291 1.00 0.00 ? 339 MET A HG2  6 
ATOM 3351 H HG3  . MET A 1 33 ? 36.188 47.777 22.639 1.00 0.00 ? 339 MET A HG3  6 
ATOM 3352 H HE1  . MET A 1 33 ? 37.619 50.072 26.419 1.00 0.00 ? 339 MET A HE1  6 
ATOM 3353 H HE2  . MET A 1 33 ? 35.979 50.307 25.802 1.00 0.00 ? 339 MET A HE2  6 
ATOM 3354 H HE3  . MET A 1 33 ? 36.476 48.719 26.436 1.00 0.00 ? 339 MET A HE3  6 
ATOM 3355 N N    . LEU A 1 34 ? 31.735 49.882 22.618 1.00 0.00 ? 340 LEU A N    6 
ATOM 3356 C CA   . LEU A 1 34 ? 30.494 50.570 22.956 1.00 0.00 ? 340 LEU A CA   6 
ATOM 3357 C C    . LEU A 1 34 ? 29.268 49.775 22.471 1.00 0.00 ? 340 LEU A C    6 
ATOM 3358 O O    . LEU A 1 34 ? 28.304 49.592 23.220 1.00 0.00 ? 340 LEU A O    6 
ATOM 3359 C CB   . LEU A 1 34 ? 30.528 51.998 22.371 1.00 0.00 ? 340 LEU A CB   6 
ATOM 3360 C CG   . LEU A 1 34 ? 31.652 52.886 22.941 1.00 0.00 ? 340 LEU A CG   6 
ATOM 3361 C CD1  . LEU A 1 34 ? 31.730 54.198 22.158 1.00 0.00 ? 340 LEU A CD1  6 
ATOM 3362 C CD2  . LEU A 1 34 ? 31.460 53.215 24.426 1.00 0.00 ? 340 LEU A CD2  6 
ATOM 3363 H H    . LEU A 1 34 ? 32.308 50.243 21.864 1.00 0.00 ? 340 LEU A H    6 
ATOM 3364 H HA   . LEU A 1 34 ? 30.402 50.639 24.032 1.00 0.00 ? 340 LEU A HA   6 
ATOM 3365 H HB2  . LEU A 1 34 ? 30.650 51.929 21.285 1.00 0.00 ? 340 LEU A HB2  6 
ATOM 3366 H HB3  . LEU A 1 34 ? 29.571 52.478 22.569 1.00 0.00 ? 340 LEU A HB3  6 
ATOM 3367 H HG   . LEU A 1 34 ? 32.607 52.369 22.841 1.00 0.00 ? 340 LEU A HG   6 
ATOM 3368 H HD11 . LEU A 1 34 ? 32.559 54.798 22.530 1.00 0.00 ? 340 LEU A HD11 6 
ATOM 3369 H HD12 . LEU A 1 34 ? 31.902 53.978 21.102 1.00 0.00 ? 340 LEU A HD12 6 
ATOM 3370 H HD13 . LEU A 1 34 ? 30.794 54.755 22.272 1.00 0.00 ? 340 LEU A HD13 6 
ATOM 3371 H HD21 . LEU A 1 34 ? 31.493 52.308 25.021 1.00 0.00 ? 340 LEU A HD21 6 
ATOM 3372 H HD22 . LEU A 1 34 ? 32.269 53.868 24.762 1.00 0.00 ? 340 LEU A HD22 6 
ATOM 3373 H HD23 . LEU A 1 34 ? 30.504 53.718 24.575 1.00 0.00 ? 340 LEU A HD23 6 
ATOM 3374 N N    . ALA A 1 35 ? 29.336 49.214 21.257 1.00 0.00 ? 341 ALA A N    6 
ATOM 3375 C CA   . ALA A 1 35 ? 28.311 48.313 20.738 1.00 0.00 ? 341 ALA A CA   6 
ATOM 3376 C C    . ALA A 1 35 ? 28.221 47.035 21.593 1.00 0.00 ? 341 ALA A C    6 
ATOM 3377 O O    . ALA A 1 35 ? 27.153 46.689 22.098 1.00 0.00 ? 341 ALA A O    6 
ATOM 3378 C CB   . ALA A 1 35 ? 28.613 48.024 19.268 1.00 0.00 ? 341 ALA A CB   6 
ATOM 3379 H H    . ALA A 1 35 ? 30.147 49.414 20.676 1.00 0.00 ? 341 ALA A H    6 
ATOM 3380 H HA   . ALA A 1 35 ? 27.347 48.823 20.797 1.00 0.00 ? 341 ALA A HA   6 
ATOM 3381 H HB1  . ALA A 1 35 ? 27.834 47.387 18.854 1.00 0.00 ? 341 ALA A HB1  6 
ATOM 3382 H HB2  . ALA A 1 35 ? 28.629 48.958 18.706 1.00 0.00 ? 341 ALA A HB2  6 
ATOM 3383 H HB3  . ALA A 1 35 ? 29.578 47.527 19.160 1.00 0.00 ? 341 ALA A HB3  6 
ATOM 3384 N N    . SER A 1 36 ? 29.360 46.382 21.858 1.00 0.00 ? 342 SER A N    6 
ATOM 3385 C CA   . SER A 1 36 ? 29.451 45.140 22.649 1.00 0.00 ? 342 SER A CA   6 
ATOM 3386 C C    . SER A 1 36 ? 29.489 45.378 24.172 1.00 0.00 ? 342 SER A C    6 
ATOM 3387 O O    . SER A 1 36 ? 30.019 44.564 24.914 1.00 0.00 ? 342 SER A O    6 
ATOM 3388 C CB   . SER A 1 36 ? 30.625 44.249 22.205 1.00 0.00 ? 342 SER A CB   6 
ATOM 3389 O OG   . SER A 1 36 ? 30.814 44.295 20.798 1.00 0.00 ? 342 SER A OG   6 
ATOM 3390 H H    . SER A 1 36 ? 30.216 46.739 21.460 1.00 0.00 ? 342 SER A H    6 
ATOM 3391 H HA   . SER A 1 36 ? 28.548 44.556 22.458 1.00 0.00 ? 342 SER A HA   6 
ATOM 3392 H HB2  . SER A 1 36 ? 31.544 44.601 22.681 1.00 0.00 ? 342 SER A HB2  6 
ATOM 3393 H HB3  . SER A 1 36 ? 30.435 43.222 22.515 1.00 0.00 ? 342 SER A HB3  6 
ATOM 3394 H HG   . SER A 1 36 ? 31.272 45.124 20.628 1.00 0.00 ? 342 SER A HG   6 
ATOM 3395 N N    . GLN A 1 37 ? 28.923 46.493 24.626 1.00 0.00 ? 343 GLN A N    6 
ATOM 3396 C CA   . GLN A 1 37 ? 28.564 46.736 26.031 1.00 0.00 ? 343 GLN A CA   6 
ATOM 3397 C C    . GLN A 1 37 ? 27.041 46.645 26.175 1.00 0.00 ? 343 GLN A C    6 
ATOM 3398 O O    . GLN A 1 37 ? 26.526 45.669 26.703 1.00 0.00 ? 343 GLN A O    6 
ATOM 3399 C CB   . GLN A 1 37 ? 29.137 48.090 26.495 1.00 0.00 ? 343 GLN A CB   6 
ATOM 3400 C CG   . GLN A 1 37 ? 30.493 47.936 27.212 1.00 0.00 ? 343 GLN A CG   6 
ATOM 3401 C CD   . GLN A 1 37 ? 30.327 47.466 28.658 1.00 0.00 ? 343 GLN A CD   6 
ATOM 3402 O OE1  . GLN A 1 37 ? 29.499 47.966 29.401 1.00 0.00 ? 343 GLN A OE1  6 
ATOM 3403 N NE2  . GLN A 1 37 ? 31.113 46.524 29.125 1.00 0.00 ? 343 GLN A NE2  6 
ATOM 3404 H H    . GLN A 1 37 ? 28.613 47.173 23.948 1.00 0.00 ? 343 GLN A H    6 
ATOM 3405 H HA   . GLN A 1 37 ? 28.975 45.950 26.662 1.00 0.00 ? 343 GLN A HA   6 
ATOM 3406 H HB2  . GLN A 1 37 ? 29.270 48.757 25.634 1.00 0.00 ? 343 GLN A HB2  6 
ATOM 3407 H HB3  . GLN A 1 37 ? 28.440 48.586 27.170 1.00 0.00 ? 343 GLN A HB3  6 
ATOM 3408 H HG2  . GLN A 1 37 ? 31.119 47.239 26.661 1.00 0.00 ? 343 GLN A HG2  6 
ATOM 3409 H HG3  . GLN A 1 37 ? 30.998 48.901 27.234 1.00 0.00 ? 343 GLN A HG3  6 
ATOM 3410 H HE21 . GLN A 1 37 ? 31.778 46.062 28.521 1.00 0.00 ? 343 GLN A HE21 6 
ATOM 3411 H HE22 . GLN A 1 37 ? 30.906 46.183 30.048 1.00 0.00 ? 343 GLN A HE22 6 
ATOM 3412 N N    . GLN A 1 38 ? 26.306 47.632 25.642 1.00 0.00 ? 344 GLN A N    6 
ATOM 3413 C CA   . GLN A 1 38 ? 24.860 47.765 25.864 1.00 0.00 ? 344 GLN A CA   6 
ATOM 3414 C C    . GLN A 1 38 ? 24.007 47.613 24.592 1.00 0.00 ? 344 GLN A C    6 
ATOM 3415 O O    . GLN A 1 38 ? 22.784 47.689 24.674 1.00 0.00 ? 344 GLN A O    6 
ATOM 3416 C CB   . GLN A 1 38 ? 24.598 49.094 26.580 1.00 0.00 ? 344 GLN A CB   6 
ATOM 3417 C CG   . GLN A 1 38 ? 24.908 49.024 28.086 1.00 0.00 ? 344 GLN A CG   6 
ATOM 3418 C CD   . GLN A 1 38 ? 23.878 48.197 28.846 1.00 0.00 ? 344 GLN A CD   6 
ATOM 3419 O OE1  . GLN A 1 38 ? 24.115 47.084 29.279 1.00 0.00 ? 344 GLN A OE1  6 
ATOM 3420 N NE2  . GLN A 1 38 ? 22.671 48.686 29.039 1.00 0.00 ? 344 GLN A NE2  6 
ATOM 3421 H H    . GLN A 1 38 ? 26.801 48.381 25.186 1.00 0.00 ? 344 GLN A H    6 
ATOM 3422 H HA   . GLN A 1 38 ? 24.522 46.962 26.510 1.00 0.00 ? 344 GLN A HA   6 
ATOM 3423 H HB2  . GLN A 1 38 ? 25.203 49.884 26.130 1.00 0.00 ? 344 GLN A HB2  6 
ATOM 3424 H HB3  . GLN A 1 38 ? 23.549 49.385 26.471 1.00 0.00 ? 344 GLN A HB3  6 
ATOM 3425 H HG2  . GLN A 1 38 ? 25.898 48.598 28.244 1.00 0.00 ? 344 GLN A HG2  6 
ATOM 3426 H HG3  . GLN A 1 38 ? 24.904 50.036 28.492 1.00 0.00 ? 344 GLN A HG3  6 
ATOM 3427 H HE21 . GLN A 1 38 ? 22.413 49.574 28.669 1.00 0.00 ? 344 GLN A HE21 6 
ATOM 3428 H HE22 . GLN A 1 38 ? 22.034 48.063 29.522 1.00 0.00 ? 344 GLN A HE22 6 
ATOM 3429 N N    . ASN A 1 39 ? 24.622 47.405 23.415 1.00 0.00 ? 345 ASN A N    6 
ATOM 3430 C CA   . ASN A 1 39 ? 23.898 47.264 22.147 1.00 0.00 ? 345 ASN A CA   6 
ATOM 3431 C C    . ASN A 1 39 ? 23.826 45.806 21.645 1.00 0.00 ? 345 ASN A C    6 
ATOM 3432 O O    . ASN A 1 39 ? 22.851 45.447 20.987 1.00 0.00 ? 345 ASN A O    6 
ATOM 3433 C CB   . ASN A 1 39 ? 24.524 48.208 21.107 1.00 0.00 ? 345 ASN A CB   6 
ATOM 3434 C CG   . ASN A 1 39 ? 23.486 48.934 20.278 1.00 0.00 ? 345 ASN A CG   6 
ATOM 3435 O OD1  . ASN A 1 39 ? 23.522 50.139 20.128 1.00 0.00 ? 345 ASN A OD1  6 
ATOM 3436 N ND2  . ASN A 1 39 ? 22.510 48.245 19.746 1.00 0.00 ? 345 ASN A ND2  6 
ATOM 3437 H H    . ASN A 1 39 ? 25.633 47.354 23.392 1.00 0.00 ? 345 ASN A H    6 
ATOM 3438 H HA   . ASN A 1 39 ? 22.863 47.576 22.300 1.00 0.00 ? 345 ASN A HA   6 
ATOM 3439 H HB2  . ASN A 1 39 ? 25.140 48.958 21.596 1.00 0.00 ? 345 ASN A HB2  6 
ATOM 3440 H HB3  . ASN A 1 39 ? 25.161 47.632 20.424 1.00 0.00 ? 345 ASN A HB3  6 
ATOM 3441 H HD21 . ASN A 1 39 ? 22.473 47.242 19.881 1.00 0.00 ? 345 ASN A HD21 6 
ATOM 3442 H HD22 . ASN A 1 39 ? 21.828 48.770 19.230 1.00 0.00 ? 345 ASN A HD22 6 
ATOM 3443 N N    . GLN A 1 40 ? 24.845 44.997 21.966 1.00 0.00 ? 346 GLN A N    6 
ATOM 3444 C CA   . GLN A 1 40 ? 25.010 43.582 21.593 1.00 0.00 ? 346 GLN A CA   6 
ATOM 3445 C C    . GLN A 1 40 ? 25.161 42.631 22.798 1.00 0.00 ? 346 GLN A C    6 
ATOM 3446 O O    . GLN A 1 40 ? 25.322 41.434 22.592 1.00 0.00 ? 346 GLN A O    6 
ATOM 3447 C CB   . GLN A 1 40 ? 26.201 43.463 20.614 1.00 0.00 ? 346 GLN A CB   6 
ATOM 3448 C CG   . GLN A 1 40 ? 25.781 43.248 19.156 1.00 0.00 ? 346 GLN A CG   6 
ATOM 3449 C CD   . GLN A 1 40 ? 24.755 44.270 18.670 1.00 0.00 ? 346 GLN A CD   6 
ATOM 3450 O OE1  . GLN A 1 40 ? 25.032 45.449 18.493 1.00 0.00 ? 346 GLN A OE1  6 
ATOM 3451 N NE2  . GLN A 1 40 ? 23.521 43.865 18.475 1.00 0.00 ? 346 GLN A NE2  6 
ATOM 3452 H H    . GLN A 1 40 ? 25.644 45.453 22.387 1.00 0.00 ? 346 GLN A H    6 
ATOM 3453 H HA   . GLN A 1 40 ? 24.102 43.243 21.088 1.00 0.00 ? 346 GLN A HA   6 
ATOM 3454 H HB2  . GLN A 1 40 ? 26.825 44.367 20.664 1.00 0.00 ? 346 GLN A HB2  6 
ATOM 3455 H HB3  . GLN A 1 40 ? 26.840 42.635 20.896 1.00 0.00 ? 346 GLN A HB3  6 
ATOM 3456 H HG2  . GLN A 1 40 ? 26.664 43.313 18.516 1.00 0.00 ? 346 GLN A HG2  6 
ATOM 3457 H HG3  . GLN A 1 40 ? 25.369 42.250 19.053 1.00 0.00 ? 346 GLN A HG3  6 
ATOM 3458 H HE21 . GLN A 1 40 ? 23.262 42.923 18.701 1.00 0.00 ? 346 GLN A HE21 6 
ATOM 3459 H HE22 . GLN A 1 40 ? 22.850 44.602 18.337 1.00 0.00 ? 346 GLN A HE22 6 
ATOM 3460 N N    . SER A 1 41 ? 25.024 43.160 24.029 1.00 0.00 ? 347 SER A N    6 
ATOM 3461 C CA   . SER A 1 41 ? 25.341 42.514 25.321 1.00 0.00 ? 347 SER A CA   6 
ATOM 3462 C C    . SER A 1 41 ? 26.838 42.296 25.565 1.00 0.00 ? 347 SER A C    6 
ATOM 3463 O O    . SER A 1 41 ? 27.508 41.617 24.795 1.00 0.00 ? 347 SER A O    6 
ATOM 3464 C CB   . SER A 1 41 ? 24.564 41.208 25.549 1.00 0.00 ? 347 SER A CB   6 
ATOM 3465 O OG   . SER A 1 41 ? 23.178 41.378 25.293 1.00 0.00 ? 347 SER A OG   6 
ATOM 3466 H H    . SER A 1 41 ? 24.777 44.127 24.076 1.00 0.00 ? 347 SER A H    6 
ATOM 3467 H HA   . SER A 1 41 ? 24.992 43.196 26.097 1.00 0.00 ? 347 SER A HA   6 
ATOM 3468 H HB2  . SER A 1 41 ? 24.962 40.438 24.887 1.00 0.00 ? 347 SER A HB2  6 
ATOM 3469 H HB3  . SER A 1 41 ? 24.705 40.882 26.570 1.00 0.00 ? 347 SER A HB3  6 
ATOM 3470 H HG   . SER A 1 41 ? 22.914 40.678 24.694 1.00 0.00 ? 347 SER A HG   6 
ATOM 3471 N N    . GLY A 1 42 ? 27.353 42.882 26.642 1.00 0.00 ? 348 GLY A N    6 
ATOM 3472 C CA   . GLY A 1 42 ? 28.735 42.727 27.099 1.00 0.00 ? 348 GLY A CA   6 
ATOM 3473 C C    . GLY A 1 42 ? 28.961 41.581 28.101 1.00 0.00 ? 348 GLY A C    6 
ATOM 3474 O O    . GLY A 1 42 ? 27.997 40.931 28.514 1.00 0.00 ? 348 GLY A O    6 
ATOM 3475 H H    . GLY A 1 42 ? 26.768 43.498 27.188 1.00 0.00 ? 348 GLY A H    6 
ATOM 3476 H HA2  . GLY A 1 42 ? 29.374 42.535 26.234 1.00 0.00 ? 348 GLY A HA2  6 
ATOM 3477 H HA3  . GLY A 1 42 ? 29.060 43.657 27.566 1.00 0.00 ? 348 GLY A HA3  6 
ATOM 3478 N N    . PRO A 1 43 ? 30.235 41.341 28.479 1.00 0.00 ? 349 PRO A N    6 
ATOM 3479 C CA   . PRO A 1 43 ? 30.650 40.394 29.520 1.00 0.00 ? 349 PRO A CA   6 
ATOM 3480 C C    . PRO A 1 43 ? 30.568 40.979 30.946 1.00 0.00 ? 349 PRO A C    6 
ATOM 3481 O O    . PRO A 1 43 ? 30.224 40.187 31.853 1.00 0.00 ? 349 PRO A O    6 
ATOM 3482 C CB   . PRO A 1 43 ? 32.090 40.041 29.150 1.00 0.00 ? 349 PRO A CB   6 
ATOM 3483 C CG   . PRO A 1 43 ? 32.624 41.350 28.597 1.00 0.00 ? 349 PRO A CG   6 
ATOM 3484 C CD   . PRO A 1 43 ? 31.414 41.975 27.898 1.00 0.00 ? 349 PRO A CD   6 
ATOM 3485 O OXT  . PRO A 1 43 ? 30.908 42.172 31.112 1.00 0.00 ? 349 PRO A OXT  6 
ATOM 3486 H HA   . PRO A 1 43 ? 30.025 39.509 29.491 1.00 0.00 ? 349 PRO A HA   6 
ATOM 3487 H HB2  . PRO A 1 43 ? 32.654 39.699 30.019 1.00 0.00 ? 349 PRO A HB2  6 
ATOM 3488 H HB3  . PRO A 1 43 ? 32.090 39.277 28.371 1.00 0.00 ? 349 PRO A HB3  6 
ATOM 3489 H HG2  . PRO A 1 43 ? 32.953 42.003 29.415 1.00 0.00 ? 349 PRO A HG2  6 
ATOM 3490 H HG3  . PRO A 1 43 ? 33.449 41.187 27.899 1.00 0.00 ? 349 PRO A HG3  6 
ATOM 3491 H HD2  . PRO A 1 43 ? 31.394 43.056 28.058 1.00 0.00 ? 349 PRO A HD2  6 
ATOM 3492 H HD3  . PRO A 1 43 ? 31.447 41.744 26.828 1.00 0.00 ? 349 PRO A HD3  6 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  307 307 MET MET A . n 
A 1 2  GLY 2  308 308 GLY GLY A . n 
A 1 3  GLY 3  309 309 GLY GLY A . n 
A 1 4  GLY 4  310 310 GLY GLY A . n 
A 1 5  MET 5  311 311 MET MET A . n 
A 1 6  ASN 6  312 312 ASN ASN A . n 
A 1 7  PHE 7  313 313 PHE PHE A . n 
A 1 8  GLY 8  314 314 GLY GLY A . n 
A 1 9  ALA 9  315 315 ALA ALA A . n 
A 1 10 PHE 10 316 316 PHE PHE A . n 
A 1 11 SER 11 317 317 SER SER A . n 
A 1 12 ILE 12 318 318 ILE ILE A . n 
A 1 13 ASN 13 319 319 ASN ASN A . n 
A 1 14 PRO 14 320 320 PRO PRO A . n 
A 1 15 ALA 15 321 321 ALA ALA A . n 
A 1 16 MET 16 322 322 MET MET A . n 
A 1 17 MET 17 323 323 MET MET A . n 
A 1 18 ALA 18 324 324 ALA ALA A . n 
A 1 19 ALA 19 325 325 ALA ALA A . n 
A 1 20 ALA 20 326 326 ALA ALA A . n 
A 1 21 GLN 21 327 327 GLN GLN A . n 
A 1 22 ALA 22 328 328 ALA ALA A . n 
A 1 23 ALA 23 329 329 ALA ALA A . n 
A 1 24 LEU 24 330 330 LEU LEU A . n 
A 1 25 GLN 25 331 331 GLN GLN A . n 
A 1 26 SER 26 332 332 SER SER A . n 
A 1 27 SER 27 333 333 SER SER A . n 
A 1 28 TRP 28 334 334 TRP TRP A . n 
A 1 29 GLY 29 335 335 GLY GLY A . n 
A 1 30 MET 30 336 336 MET MET A . n 
A 1 31 MET 31 337 337 MET MET A . n 
A 1 32 GLY 32 338 338 GLY GLY A . n 
A 1 33 MET 33 339 339 MET MET A . n 
A 1 34 LEU 34 340 340 LEU LEU A . n 
A 1 35 ALA 35 341 341 ALA ALA A . n 
A 1 36 SER 36 342 342 SER SER A . n 
A 1 37 GLN 37 343 343 GLN GLN A . n 
A 1 38 GLN 38 344 344 GLN GLN A . n 
A 1 39 ASN 39 345 345 ASN ASN A . n 
A 1 40 GLN 40 346 346 GLN GLN A . n 
A 1 41 SER 41 347 347 SER SER A . n 
A 1 42 GLY 42 348 348 GLY GLY A . n 
A 1 43 PRO 43 349 349 PRO PRO A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-12-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
entity-1 300 ? uM '[U-100% 15N]' 1 
DPC-2    60  ? mM ?              1 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    4 
_pdbx_validate_close_contact.auth_atom_id_1   HG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    342 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OXT 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   PRO 
_pdbx_validate_close_contact.auth_seq_id_2    349 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 311 ? ? 47.79   12.14  
2  1 PHE A 316 ? ? -138.14 -57.56 
3  1 ILE A 318 ? ? -141.82 -55.16 
4  1 ALA A 321 ? ? 58.54   -34.94 
5  1 GLN A 346 ? ? -142.97 32.50  
6  2 PHE A 313 ? ? -167.51 -41.94 
7  2 PHE A 316 ? ? -151.53 -44.76 
8  2 SER A 317 ? ? -67.60  16.06  
9  2 ILE A 318 ? ? -147.36 -48.24 
10 2 ALA A 321 ? ? 57.18   -30.69 
11 2 GLN A 346 ? ? -144.27 44.85  
12 3 MET A 311 ? ? 51.44   6.63   
13 3 ASN A 312 ? ? -76.35  -93.70 
14 3 PHE A 316 ? ? -150.56 -50.64 
15 3 SER A 317 ? ? -74.40  31.43  
16 3 ILE A 318 ? ? -152.02 -45.00 
17 3 ALA A 321 ? ? 58.11   -34.87 
18 3 GLN A 344 ? ? -144.98 -34.43 
19 3 GLN A 346 ? ? -145.37 53.41  
20 4 MET A 311 ? ? 54.84   -14.31 
21 4 ASN A 312 ? ? -62.04  6.34   
22 4 PHE A 313 ? ? -164.06 -19.35 
23 4 PHE A 316 ? ? -152.27 -44.54 
24 4 SER A 317 ? ? -68.70  20.12  
25 4 ILE A 318 ? ? -157.89 -48.07 
26 4 ALA A 321 ? ? 57.84   -20.34 
27 5 ASN A 312 ? ? -69.20  18.91  
28 5 PHE A 313 ? ? 174.86  -22.85 
29 5 PHE A 316 ? ? -157.58 -39.14 
30 5 SER A 317 ? ? -69.31  13.94  
31 5 ILE A 318 ? ? -150.27 -53.45 
32 5 ALA A 321 ? ? 56.73   -21.56 
33 5 GLN A 346 ? ? 39.51   34.21  
34 5 SER A 347 ? ? -89.81  47.42  
35 6 PHE A 313 ? ? -162.93 -17.49 
36 6 PHE A 316 ? ? -156.20 -42.29 
37 6 SER A 317 ? ? -69.37  14.02  
38 6 ILE A 318 ? ? -148.72 -42.21 
39 6 ALA A 321 ? ? 55.78   -10.33 
40 6 GLN A 343 ? ? -106.54 -70.94 
41 6 SER A 347 ? ? 69.16   120.58 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    4 
_pdbx_validate_peptide_omega.auth_comp_id_1   MET 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    307 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    308 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -141.17 
#