data_2N57
# 
_entry.id   2N57 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104436   RCSB  
2N57         PDB   
25695        BMRB  
D_1000104436 WWPDB 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2015-07-22 
_pdbx_database_PDB_obs_spr.pdb_id           2N57 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2L3V 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 25695                BMRB        . 
unspecified SSGCID-BRABA.00026.A TargetTrack . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N57 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-08 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barnwal, R.'                                                        1 
'Varani, G.'                                                         2 
'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 3 
# 
_citation.id                        primary 
_citation.title                     'NMR structure of Acyl carrier protein from Brucella melitensis.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barnwal, R.' 1 
primary 'Varani, G.'  2 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Acyl carrier protein' 
_entity.formula_weight             8308.197 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA 
_entity_poly.pdbx_seq_one_letter_code_can   MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         SSGCID-BRABA.00026.A 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  ASP n 
1 4  THR n 
1 5  ALA n 
1 6  GLU n 
1 7  ARG n 
1 8  VAL n 
1 9  LYS n 
1 10 LYS n 
1 11 ILE n 
1 12 VAL n 
1 13 VAL n 
1 14 GLU n 
1 15 HIS n 
1 16 LEU n 
1 17 GLY n 
1 18 VAL n 
1 19 ASP n 
1 20 ALA n 
1 21 ASP n 
1 22 LYS n 
1 23 VAL n 
1 24 THR n 
1 25 GLU n 
1 26 GLY n 
1 27 ALA n 
1 28 SER n 
1 29 PHE n 
1 30 ILE n 
1 31 ASP n 
1 32 ASP n 
1 33 LEU n 
1 34 GLY n 
1 35 ALA n 
1 36 ASP n 
1 37 SER n 
1 38 LEU n 
1 39 ASP n 
1 40 THR n 
1 41 VAL n 
1 42 GLU n 
1 43 LEU n 
1 44 VAL n 
1 45 MET n 
1 46 ALA n 
1 47 PHE n 
1 48 GLU n 
1 49 GLU n 
1 50 GLU n 
1 51 PHE n 
1 52 GLY n 
1 53 VAL n 
1 54 GLU n 
1 55 ILE n 
1 56 PRO n 
1 57 ASP n 
1 58 ASP n 
1 59 ALA n 
1 60 ALA n 
1 61 GLU n 
1 62 THR n 
1 63 ILE n 
1 64 LEU n 
1 65 THR n 
1 66 VAL n 
1 67 GLY n 
1 68 ASP n 
1 69 ALA n 
1 70 VAL n 
1 71 LYS n 
1 72 PHE n 
1 73 ILE n 
1 74 ASP n 
1 75 LYS n 
1 76 ALA n 
1 77 SER n 
1 78 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'acpP, BAOG_00187' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Brucella melitensis bv. 3 str. Ether' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     520466 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET28-AVA 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D1F788_BRUML 
_struct_ref.pdbx_db_accession          D1F788 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2N57 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 78 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             D1F788 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  78 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       78 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '2D 1H-13C HSQC'            
1 3  1 '3D CBCA(CO)NH'             
1 4  1 '3D HNCO'                   
1 5  1 '3D HNCACB'                 
1 6  1 '3D HBHA(CO)NH'             
1 7  1 '3D C(CO)NH'                
1 8  1 '3D H(CCO)NH'               
1 9  1 '3D 1H-15N NOESY'           
1 10 1 '3D 1H-13C NOESY aliphatic' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '1.2-1.4 mM [U-95% 13C; U-95% 15N] Acyl carrier protein, 93% H2O/7% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '93% H2O/7% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2N57 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N57 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N57 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ? 1 
CCPN                                                'chemical shift assignment' CCPNMR  ? 2 
CCPN                                                'data analysis'             CCPNMR  ? 3 
CCPN                                                'peak picking'              CCPNMR  ? 4 
'Bruker Biospin'                                    collection                  TOPSPIN ? 5 
'Bruker Biospin'                                    processing                  TOPSPIN ? 6 
'Guntert, Mumenthaler and Wuthrich'                 'geometry optimization'     CYANA   ? 7 
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA   ? 8 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA   ? 9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N57 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N57 
_struct.title                     'NMR structure of Acyl carrier protein from Brucella melitensis' 
_struct.pdbx_descriptor           'Acyl carrier protein' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N57 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
_struct_keywords.text            
;acyl carrier protein, Brucella melitensis, structural genomics, LIPID BINDING PROTEIN, Seattle Structural Genomics Center for Infectious Disease, SSGCID
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 3  ? GLY A 17 ? ASP A 3  GLY A 17 1 ? 15 
HELX_P HELX_P2 2 ASP A 36 ? GLY A 52 ? ASP A 36 GLY A 52 1 ? 17 
HELX_P HELX_P3 3 ASP A 58 ? ILE A 63 ? ASP A 58 ILE A 63 1 ? 6  
HELX_P HELX_P4 4 THR A 65 ? ALA A 78 ? THR A 65 ALA A 78 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2N57 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -1.349 -1.132  -2.822 1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? -0.566 -1.768  -3.876 1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? 0.485  -2.702  -3.283 1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? 0.908  -3.663  -3.926 1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? 0.109  -0.710  -4.749 1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? 0.958  0.276   -3.963 1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? 0.051  1.767   -3.511 1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? 0.677  2.925   -4.726 1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? -0.918 -0.471  -2.241 1.00 0.00 ? 1  MET A H1   1  
ATOM 10    H HA   . MET A 1 1  ? -1.242 -2.348  -4.486 1.00 0.00 ? 1  MET A HA   1  
ATOM 11    H HB2  . MET A 1 1  ? 0.745  -1.205  -5.468 1.00 0.00 ? 1  MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1  ? -0.652 -0.155  -5.276 1.00 0.00 ? 1  MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1  ? 1.302  -0.205  -3.060 1.00 0.00 ? 1  MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1  ? 1.809  0.557   -4.565 1.00 0.00 ? 1  MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1  ? 1.110  2.382   -5.552 1.00 0.00 ? 1  MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1  ? -0.133 3.542   -5.085 1.00 0.00 ? 1  MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1  ? 1.432  3.550   -4.271 1.00 0.00 ? 1  MET A HE3  1  
ATOM 18    N N    . SER A 1 2  ? 0.902  -2.413  -2.055 1.00 0.00 ? 2  SER A N    1  
ATOM 19    C CA   . SER A 1 2  ? 1.907  -3.224  -1.378 1.00 0.00 ? 2  SER A CA   1  
ATOM 20    C C    . SER A 1 2  ? 1.270  -4.451  -0.733 1.00 0.00 ? 2  SER A C    1  
ATOM 21    O O    . SER A 1 2  ? 0.133  -4.399  -0.262 1.00 0.00 ? 2  SER A O    1  
ATOM 22    C CB   . SER A 1 2  ? 2.632  -2.395  -0.316 1.00 0.00 ? 2  SER A CB   1  
ATOM 23    O OG   . SER A 1 2  ? 3.329  -1.310  -0.905 1.00 0.00 ? 2  SER A OG   1  
ATOM 24    H H    . SER A 1 2  ? 0.526  -1.633  -1.594 1.00 0.00 ? 2  SER A H    1  
ATOM 25    H HA   . SER A 1 2  ? 2.622  -3.551  -2.118 1.00 0.00 ? 2  SER A HA   1  
ATOM 26    H HB2  . SER A 1 2  ? 1.912  -2.005  0.386  1.00 0.00 ? 2  SER A HB2  1  
ATOM 27    H HB3  . SER A 1 2  ? 3.340  -3.022  0.205  1.00 0.00 ? 2  SER A HB3  1  
ATOM 28    H HG   . SER A 1 2  ? 4.271  -1.410  -0.745 1.00 0.00 ? 2  SER A HG   1  
ATOM 29    N N    . ASP A 1 3  ? 2.010  -5.554  -0.716 1.00 0.00 ? 3  ASP A N    1  
ATOM 30    C CA   . ASP A 1 3  ? 1.519  -6.795  -0.128 1.00 0.00 ? 3  ASP A CA   1  
ATOM 31    C C    . ASP A 1 3  ? 1.947  -6.912  1.331  1.00 0.00 ? 3  ASP A C    1  
ATOM 32    O O    . ASP A 1 3  ? 1.141  -7.239  2.202  1.00 0.00 ? 3  ASP A O    1  
ATOM 33    C CB   . ASP A 1 3  ? 2.033  -7.998  -0.921 1.00 0.00 ? 3  ASP A CB   1  
ATOM 34    C CG   . ASP A 1 3  ? 1.674  -7.918  -2.392 1.00 0.00 ? 3  ASP A CG   1  
ATOM 35    O OD1  . ASP A 1 3  ? 0.653  -7.277  -2.720 1.00 0.00 ? 3  ASP A OD1  1  
ATOM 36    O OD2  . ASP A 1 3  ? 2.414  -8.495  -3.215 1.00 0.00 ? 3  ASP A OD2  1  
ATOM 37    H H    . ASP A 1 3  ? 2.909  -5.533  -1.107 1.00 0.00 ? 3  ASP A H    1  
ATOM 38    H HA   . ASP A 1 3  ? 0.441  -6.780  -0.174 1.00 0.00 ? 3  ASP A HA   1  
ATOM 39    H HB2  . ASP A 1 3  ? 3.109  -8.045  -0.835 1.00 0.00 ? 3  ASP A HB2  1  
ATOM 40    H HB3  . ASP A 1 3  ? 1.604  -8.901  -0.512 1.00 0.00 ? 3  ASP A HB3  1  
ATOM 41    N N    . THR A 1 4  ? 3.223  -6.644  1.592  1.00 0.00 ? 4  THR A N    1  
ATOM 42    C CA   . THR A 1 4  ? 3.760  -6.721  2.945  1.00 0.00 ? 4  THR A CA   1  
ATOM 43    C C    . THR A 1 4  ? 3.386  -5.485  3.755  1.00 0.00 ? 4  THR A C    1  
ATOM 44    O O    . THR A 1 4  ? 2.970  -5.590  4.908  1.00 0.00 ? 4  THR A O    1  
ATOM 45    C CB   . THR A 1 4  ? 5.293  -6.870  2.934  1.00 0.00 ? 4  THR A CB   1  
ATOM 46    O OG1  . THR A 1 4  ? 5.684  -7.828  1.944  1.00 0.00 ? 4  THR A OG1  1  
ATOM 47    C CG2  . THR A 1 4  ? 5.804  -7.306  4.299  1.00 0.00 ? 4  THR A CG2  1  
ATOM 48    H H    . THR A 1 4  ? 3.817  -6.389  0.855  1.00 0.00 ? 4  THR A H    1  
ATOM 49    H HA   . THR A 1 4  ? 3.337  -7.594  3.422  1.00 0.00 ? 4  THR A HA   1  
ATOM 50    H HB   . THR A 1 4  ? 5.731  -5.913  2.691  1.00 0.00 ? 4  THR A HB   1  
ATOM 51    H HG1  . THR A 1 4  ? 5.532  -7.464  1.069  1.00 0.00 ? 4  THR A HG1  1  
ATOM 52    H HG21 . THR A 1 4  ? 5.030  -7.157  5.037  1.00 0.00 ? 4  THR A HG21 1  
ATOM 53    H HG22 . THR A 1 4  ? 6.671  -6.720  4.562  1.00 0.00 ? 4  THR A HG22 1  
ATOM 54    H HG23 . THR A 1 4  ? 6.072  -8.351  4.266  1.00 0.00 ? 4  THR A HG23 1  
ATOM 55    N N    . ALA A 1 5  ? 3.538  -4.315  3.144  1.00 0.00 ? 5  ALA A N    1  
ATOM 56    C CA   . ALA A 1 5  ? 3.214  -3.058  3.809  1.00 0.00 ? 5  ALA A CA   1  
ATOM 57    C C    . ALA A 1 5  ? 1.808  -3.095  4.397  1.00 0.00 ? 5  ALA A C    1  
ATOM 58    O O    . ALA A 1 5  ? 1.622  -2.899  5.597  1.00 0.00 ? 5  ALA A O    1  
ATOM 59    C CB   . ALA A 1 5  ? 3.352  -1.896  2.837  1.00 0.00 ? 5  ALA A CB   1  
ATOM 60    H H    . ALA A 1 5  ? 3.874  -4.296  2.224  1.00 0.00 ? 5  ALA A H    1  
ATOM 61    H HA   . ALA A 1 5  ? 3.924  -2.912  4.610  1.00 0.00 ? 5  ALA A HA   1  
ATOM 62    H HB1  . ALA A 1 5  ? 3.708  -1.025  3.367  1.00 0.00 ? 5  ALA A HB1  1  
ATOM 63    H HB2  . ALA A 1 5  ? 4.055  -2.158  2.060  1.00 0.00 ? 5  ALA A HB2  1  
ATOM 64    H HB3  . ALA A 1 5  ? 2.390  -1.681  2.395  1.00 0.00 ? 5  ALA A HB3  1  
ATOM 65    N N    . GLU A 1 6  ? 0.820  -3.347  3.543  1.00 0.00 ? 6  GLU A N    1  
ATOM 66    C CA   . GLU A 1 6  ? -0.570 -3.408  3.979  1.00 0.00 ? 6  GLU A CA   1  
ATOM 67    C C    . GLU A 1 6  ? -0.732 -4.376  5.147  1.00 0.00 ? 6  GLU A C    1  
ATOM 68    O O    . GLU A 1 6  ? -1.461 -4.099  6.100  1.00 0.00 ? 6  GLU A O    1  
ATOM 69    C CB   . GLU A 1 6  ? -1.473 -3.834  2.820  1.00 0.00 ? 6  GLU A CB   1  
ATOM 70    C CG   . GLU A 1 6  ? -1.704 -2.738  1.794  1.00 0.00 ? 6  GLU A CG   1  
ATOM 71    C CD   . GLU A 1 6  ? -2.744 -1.729  2.241  1.00 0.00 ? 6  GLU A CD   1  
ATOM 72    O OE1  . GLU A 1 6  ? -3.880 -2.147  2.552  1.00 0.00 ? 6  GLU A OE1  1  
ATOM 73    O OE2  . GLU A 1 6  ? -2.423 -0.523  2.281  1.00 0.00 ? 6  GLU A OE2  1  
ATOM 74    H H    . GLU A 1 6  ? 1.032  -3.495  2.597  1.00 0.00 ? 6  GLU A H    1  
ATOM 75    H HA   . GLU A 1 6  ? -0.859 -2.420  4.303  1.00 0.00 ? 6  GLU A HA   1  
ATOM 76    H HB2  . GLU A 1 6  ? -1.022 -4.679  2.320  1.00 0.00 ? 6  GLU A HB2  1  
ATOM 77    H HB3  . GLU A 1 6  ? -2.431 -4.133  3.219  1.00 0.00 ? 6  GLU A HB3  1  
ATOM 78    H HG2  . GLU A 1 6  ? -0.773 -2.220  1.623  1.00 0.00 ? 6  GLU A HG2  1  
ATOM 79    H HG3  . GLU A 1 6  ? -2.037 -3.191  0.871  1.00 0.00 ? 6  GLU A HG3  1  
ATOM 80    N N    . ARG A 1 7  ? -0.046 -5.511  5.066  1.00 0.00 ? 7  ARG A N    1  
ATOM 81    C CA   . ARG A 1 7  ? -0.115 -6.522  6.115  1.00 0.00 ? 7  ARG A CA   1  
ATOM 82    C C    . ARG A 1 7  ? 0.442  -5.980  7.429  1.00 0.00 ? 7  ARG A C    1  
ATOM 83    O O    . ARG A 1 7  ? -0.264 -5.918  8.436  1.00 0.00 ? 7  ARG A O    1  
ATOM 84    C CB   . ARG A 1 7  ? 0.660  -7.774  5.699  1.00 0.00 ? 7  ARG A CB   1  
ATOM 85    C CG   . ARG A 1 7  ? 0.097  -9.060  6.281  1.00 0.00 ? 7  ARG A CG   1  
ATOM 86    C CD   . ARG A 1 7  ? 0.299  -10.234 5.337  1.00 0.00 ? 7  ARG A CD   1  
ATOM 87    N NE   . ARG A 1 7  ? -0.817 -10.387 4.407  1.00 0.00 ? 7  ARG A NE   1  
ATOM 88    C CZ   . ARG A 1 7  ? -1.974 -10.952 4.733  1.00 0.00 ? 7  ARG A CZ   1  
ATOM 89    N NH1  . ARG A 1 7  ? -2.166 -11.416 5.960  1.00 0.00 ? 7  ARG A NH1  1  
ATOM 90    N NH2  . ARG A 1 7  ? -2.942 -11.054 3.831  1.00 0.00 ? 7  ARG A NH2  1  
ATOM 91    H H    . ARG A 1 7  ? 0.519  -5.675  4.282  1.00 0.00 ? 7  ARG A H    1  
ATOM 92    H HA   . ARG A 1 7  ? -1.153 -6.782  6.258  1.00 0.00 ? 7  ARG A HA   1  
ATOM 93    H HB2  . ARG A 1 7  ? 0.640  -7.853  4.622  1.00 0.00 ? 7  ARG A HB2  1  
ATOM 94    H HB3  . ARG A 1 7  ? 1.684  -7.674  6.026  1.00 0.00 ? 7  ARG A HB3  1  
ATOM 95    H HG2  . ARG A 1 7  ? 0.599  -9.272  7.214  1.00 0.00 ? 7  ARG A HG2  1  
ATOM 96    H HG3  . ARG A 1 7  ? -0.960 -8.930  6.461  1.00 0.00 ? 7  ARG A HG3  1  
ATOM 97    H HD2  . ARG A 1 7  ? 1.205  -10.074 4.772  1.00 0.00 ? 7  ARG A HD2  1  
ATOM 98    H HD3  . ARG A 1 7  ? 0.394  -11.137 5.921  1.00 0.00 ? 7  ARG A HD3  1  
ATOM 99    H HE   . ARG A 1 7  ? -0.697 -10.051 3.494  1.00 0.00 ? 7  ARG A HE   1  
ATOM 100   H HH11 . ARG A 1 7  ? -1.439 -11.339 6.642  1.00 0.00 ? 7  ARG A HH11 1  
ATOM 101   H HH12 . ARG A 1 7  ? -3.038 -11.840 6.204  1.00 0.00 ? 7  ARG A HH12 1  
ATOM 102   H HH21 . ARG A 1 7  ? -2.801 -10.706 2.905  1.00 0.00 ? 7  ARG A HH21 1  
ATOM 103   H HH22 . ARG A 1 7  ? -3.812 -11.480 4.078  1.00 0.00 ? 7  ARG A HH22 1  
ATOM 104   N N    . VAL A 1 8  ? 1.712  -5.590  7.412  1.00 0.00 ? 8  VAL A N    1  
ATOM 105   C CA   . VAL A 1 8  ? 2.364  -5.053  8.600  1.00 0.00 ? 8  VAL A CA   1  
ATOM 106   C C    . VAL A 1 8  ? 1.542  -3.925  9.215  1.00 0.00 ? 8  VAL A C    1  
ATOM 107   O O    . VAL A 1 8  ? 1.186  -3.972  10.393 1.00 0.00 ? 8  VAL A O    1  
ATOM 108   C CB   . VAL A 1 8  ? 3.775  -4.528  8.278  1.00 0.00 ? 8  VAL A CB   1  
ATOM 109   C CG1  . VAL A 1 8  ? 4.429  -3.954  9.526  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 110   C CG2  . VAL A 1 8  ? 4.631  -5.634  7.679  1.00 0.00 ? 8  VAL A CG2  1  
ATOM 111   H H    . VAL A 1 8  ? 2.223  -5.663  6.579  1.00 0.00 ? 8  VAL A H    1  
ATOM 112   H HA   . VAL A 1 8  ? 2.455  -5.853  9.321  1.00 0.00 ? 8  VAL A HA   1  
ATOM 113   H HB   . VAL A 1 8  ? 3.686  -3.736  7.549  1.00 0.00 ? 8  VAL A HB   1  
ATOM 114   H HG11 . VAL A 1 8  ? 4.058  -4.472  10.398 1.00 0.00 ? 8  VAL A HG11 1  
ATOM 115   H HG12 . VAL A 1 8  ? 5.500  -4.077  9.461  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 116   H HG13 . VAL A 1 8  ? 4.192  -2.903  9.605  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 117   H HG21 . VAL A 1 8  ? 4.734  -5.473  6.617  1.00 0.00 ? 8  VAL A HG21 1  
ATOM 118   H HG22 . VAL A 1 8  ? 5.607  -5.625  8.141  1.00 0.00 ? 8  VAL A HG22 1  
ATOM 119   H HG23 . VAL A 1 8  ? 4.159  -6.590  7.855  1.00 0.00 ? 8  VAL A HG23 1  
ATOM 120   N N    . LYS A 1 9  ? 1.243  -2.911  8.410  1.00 0.00 ? 9  LYS A N    1  
ATOM 121   C CA   . LYS A 1 9  ? 0.462  -1.771  8.873  1.00 0.00 ? 9  LYS A CA   1  
ATOM 122   C C    . LYS A 1 9  ? -0.845 -2.230  9.512  1.00 0.00 ? 9  LYS A C    1  
ATOM 123   O O    . LYS A 1 9  ? -1.199 -1.793  10.607 1.00 0.00 ? 9  LYS A O    1  
ATOM 124   C CB   . LYS A 1 9  ? 0.166  -0.823  7.708  1.00 0.00 ? 9  LYS A CB   1  
ATOM 125   C CG   . LYS A 1 9  ? 1.411  -0.338  6.987  1.00 0.00 ? 9  LYS A CG   1  
ATOM 126   C CD   . LYS A 1 9  ? 1.105  0.067   5.554  1.00 0.00 ? 9  LYS A CD   1  
ATOM 127   C CE   . LYS A 1 9  ? 2.306  0.722   4.891  1.00 0.00 ? 9  LYS A CE   1  
ATOM 128   N NZ   . LYS A 1 9  ? 2.419  2.163   5.246  1.00 0.00 ? 9  LYS A NZ   1  
ATOM 129   H H    . LYS A 1 9  ? 1.555  -2.932  7.480  1.00 0.00 ? 9  LYS A H    1  
ATOM 130   H HA   . LYS A 1 9  ? 1.046  -1.246  9.613  1.00 0.00 ? 9  LYS A HA   1  
ATOM 131   H HB2  . LYS A 1 9  ? -0.463 -1.335  6.994  1.00 0.00 ? 9  LYS A HB2  1  
ATOM 132   H HB3  . LYS A 1 9  ? -0.363 0.040   8.087  1.00 0.00 ? 9  LYS A HB3  1  
ATOM 133   H HG2  . LYS A 1 9  ? 1.812  0.515   7.513  1.00 0.00 ? 9  LYS A HG2  1  
ATOM 134   H HG3  . LYS A 1 9  ? 2.143  -1.134  6.977  1.00 0.00 ? 9  LYS A HG3  1  
ATOM 135   H HD2  . LYS A 1 9  ? 0.832  -0.814  4.991  1.00 0.00 ? 9  LYS A HD2  1  
ATOM 136   H HD3  . LYS A 1 9  ? 0.280  0.765   5.556  1.00 0.00 ? 9  LYS A HD3  1  
ATOM 137   H HE2  . LYS A 1 9  ? 3.201  0.210   5.211  1.00 0.00 ? 9  LYS A HE2  1  
ATOM 138   H HE3  . LYS A 1 9  ? 2.203  0.630   3.820  1.00 0.00 ? 9  LYS A HE3  1  
ATOM 139   H HZ1  . LYS A 1 9  ? 3.401  2.484   5.129  1.00 0.00 ? 9  LYS A HZ1  1  
ATOM 140   H HZ2  . LYS A 1 9  ? 2.134  2.311   6.235  1.00 0.00 ? 9  LYS A HZ2  1  
ATOM 141   H HZ3  . LYS A 1 9  ? 1.803  2.732   4.631  1.00 0.00 ? 9  LYS A HZ3  1  
ATOM 142   N N    . LYS A 1 10 ? -1.557 -3.115  8.823  1.00 0.00 ? 10 LYS A N    1  
ATOM 143   C CA   . LYS A 1 10 ? -2.823 -3.636  9.325  1.00 0.00 ? 10 LYS A CA   1  
ATOM 144   C C    . LYS A 1 10 ? -2.651 -4.233  10.718 1.00 0.00 ? 10 LYS A C    1  
ATOM 145   O O    . LYS A 1 10 ? -3.369 -3.871  11.651 1.00 0.00 ? 10 LYS A O    1  
ATOM 146   C CB   . LYS A 1 10 ? -3.376 -4.696  8.369  1.00 0.00 ? 10 LYS A CB   1  
ATOM 147   C CG   . LYS A 1 10 ? -4.229 -4.120  7.251  1.00 0.00 ? 10 LYS A CG   1  
ATOM 148   C CD   . LYS A 1 10 ? -5.672 -3.937  7.689  1.00 0.00 ? 10 LYS A CD   1  
ATOM 149   C CE   . LYS A 1 10 ? -6.406 -5.268  7.761  1.00 0.00 ? 10 LYS A CE   1  
ATOM 150   N NZ   . LYS A 1 10 ? -6.807 -5.754  6.411  1.00 0.00 ? 10 LYS A NZ   1  
ATOM 151   H H    . LYS A 1 10 ? -1.222 -3.426  7.956  1.00 0.00 ? 10 LYS A H    1  
ATOM 152   H HA   . LYS A 1 10 ? -3.521 -2.815  9.382  1.00 0.00 ? 10 LYS A HA   1  
ATOM 153   H HB2  . LYS A 1 10 ? -2.549 -5.229  7.925  1.00 0.00 ? 10 LYS A HB2  1  
ATOM 154   H HB3  . LYS A 1 10 ? -3.981 -5.391  8.933  1.00 0.00 ? 10 LYS A HB3  1  
ATOM 155   H HG2  . LYS A 1 10 ? -3.827 -3.160  6.962  1.00 0.00 ? 10 LYS A HG2  1  
ATOM 156   H HG3  . LYS A 1 10 ? -4.201 -4.794  6.407  1.00 0.00 ? 10 LYS A HG3  1  
ATOM 157   H HD2  . LYS A 1 10 ? -5.688 -3.478  8.666  1.00 0.00 ? 10 LYS A HD2  1  
ATOM 158   H HD3  . LYS A 1 10 ? -6.176 -3.296  6.979  1.00 0.00 ? 10 LYS A HD3  1  
ATOM 159   H HE2  . LYS A 1 10 ? -5.756 -5.998  8.219  1.00 0.00 ? 10 LYS A HE2  1  
ATOM 160   H HE3  . LYS A 1 10 ? -7.291 -5.143  8.367  1.00 0.00 ? 10 LYS A HE3  1  
ATOM 161   H HZ1  . LYS A 1 10 ? -6.557 -5.048  5.689  1.00 0.00 ? 10 LYS A HZ1  1  
ATOM 162   H HZ2  . LYS A 1 10 ? -7.833 -5.916  6.380  1.00 0.00 ? 10 LYS A HZ2  1  
ATOM 163   H HZ3  . LYS A 1 10 ? -6.318 -6.645  6.193  1.00 0.00 ? 10 LYS A HZ3  1  
ATOM 164   N N    . ILE A 1 11 ? -1.697 -5.148  10.852 1.00 0.00 ? 11 ILE A N    1  
ATOM 165   C CA   . ILE A 1 11 ? -1.431 -5.792  12.132 1.00 0.00 ? 11 ILE A CA   1  
ATOM 166   C C    . ILE A 1 11 ? -1.084 -4.764  13.203 1.00 0.00 ? 11 ILE A C    1  
ATOM 167   O O    . ILE A 1 11 ? -1.475 -4.903  14.362 1.00 0.00 ? 11 ILE A O    1  
ATOM 168   C CB   . ILE A 1 11 ? -0.280 -6.810  12.021 1.00 0.00 ? 11 ILE A CB   1  
ATOM 169   C CG1  . ILE A 1 11 ? -0.611 -7.875  10.974 1.00 0.00 ? 11 ILE A CG1  1  
ATOM 170   C CG2  . ILE A 1 11 ? -0.011 -7.454  13.373 1.00 0.00 ? 11 ILE A CG2  1  
ATOM 171   C CD1  . ILE A 1 11 ? 0.576  -8.729  10.585 1.00 0.00 ? 11 ILE A CD1  1  
ATOM 172   H H    . ILE A 1 11 ? -1.159 -5.395  10.071 1.00 0.00 ? 11 ILE A H    1  
ATOM 173   H HA   . ILE A 1 11 ? -2.325 -6.321  12.431 1.00 0.00 ? 11 ILE A HA   1  
ATOM 174   H HB   . ILE A 1 11 ? 0.611  -6.281  11.718 1.00 0.00 ? 11 ILE A HB   1  
ATOM 175   H HG12 . ILE A 1 11 ? -1.375 -8.528  11.363 1.00 0.00 ? 11 ILE A HG12 1  
ATOM 176   H HG13 . ILE A 1 11 ? -0.978 -7.389  10.081 1.00 0.00 ? 11 ILE A HG13 1  
ATOM 177   H HG21 . ILE A 1 11 ? -0.906 -7.947  13.722 1.00 0.00 ? 11 ILE A HG21 1  
ATOM 178   H HG22 . ILE A 1 11 ? 0.783  -8.179  13.274 1.00 0.00 ? 11 ILE A HG22 1  
ATOM 179   H HG23 . ILE A 1 11 ? 0.281  -6.694  14.083 1.00 0.00 ? 11 ILE A HG23 1  
ATOM 180   H HD11 . ILE A 1 11 ? 0.353  -9.261  9.672  1.00 0.00 ? 11 ILE A HD11 1  
ATOM 181   H HD12 . ILE A 1 11 ? 1.440  -8.099  10.436 1.00 0.00 ? 11 ILE A HD12 1  
ATOM 182   H HD13 . ILE A 1 11 ? 0.781  -9.440  11.373 1.00 0.00 ? 11 ILE A HD13 1  
ATOM 183   N N    . VAL A 1 12 ? -0.349 -3.730  12.807 1.00 0.00 ? 12 VAL A N    1  
ATOM 184   C CA   . VAL A 1 12 ? 0.048  -2.675  13.733 1.00 0.00 ? 12 VAL A CA   1  
ATOM 185   C C    . VAL A 1 12 ? -1.160 -1.872  14.202 1.00 0.00 ? 12 VAL A C    1  
ATOM 186   O O    . VAL A 1 12 ? -1.242 -1.476  15.365 1.00 0.00 ? 12 VAL A O    1  
ATOM 187   C CB   . VAL A 1 12 ? 1.068  -1.718  13.088 1.00 0.00 ? 12 VAL A CB   1  
ATOM 188   C CG1  . VAL A 1 12 ? 1.448  -0.610  14.059 1.00 0.00 ? 12 VAL A CG1  1  
ATOM 189   C CG2  . VAL A 1 12 ? 2.301  -2.483  12.631 1.00 0.00 ? 12 VAL A CG2  1  
ATOM 190   H H    . VAL A 1 12 ? -0.068 -3.674  11.870 1.00 0.00 ? 12 VAL A H    1  
ATOM 191   H HA   . VAL A 1 12 ? 0.514  -3.141  14.589 1.00 0.00 ? 12 VAL A HA   1  
ATOM 192   H HB   . VAL A 1 12 ? 0.609  -1.265  12.222 1.00 0.00 ? 12 VAL A HB   1  
ATOM 193   H HG11 . VAL A 1 12 ? 2.516  -0.450  14.022 1.00 0.00 ? 12 VAL A HG11 1  
ATOM 194   H HG12 . VAL A 1 12 ? 0.936  0.300   13.785 1.00 0.00 ? 12 VAL A HG12 1  
ATOM 195   H HG13 . VAL A 1 12 ? 1.163  -0.897  15.061 1.00 0.00 ? 12 VAL A HG13 1  
ATOM 196   H HG21 . VAL A 1 12 ? 3.156  -2.163  13.206 1.00 0.00 ? 12 VAL A HG21 1  
ATOM 197   H HG22 . VAL A 1 12 ? 2.143  -3.542  12.778 1.00 0.00 ? 12 VAL A HG22 1  
ATOM 198   H HG23 . VAL A 1 12 ? 2.477  -2.289  11.583 1.00 0.00 ? 12 VAL A HG23 1  
ATOM 199   N N    . VAL A 1 13 ? -2.097 -1.635  13.290 1.00 0.00 ? 13 VAL A N    1  
ATOM 200   C CA   . VAL A 1 13 ? -3.303 -0.881  13.610 1.00 0.00 ? 13 VAL A CA   1  
ATOM 201   C C    . VAL A 1 13 ? -4.251 -1.702  14.476 1.00 0.00 ? 13 VAL A C    1  
ATOM 202   O O    . VAL A 1 13 ? -4.944 -1.161  15.338 1.00 0.00 ? 13 VAL A O    1  
ATOM 203   C CB   . VAL A 1 13 ? -4.044 -0.439  12.334 1.00 0.00 ? 13 VAL A CB   1  
ATOM 204   C CG1  . VAL A 1 13 ? -5.311 0.324   12.689 1.00 0.00 ? 13 VAL A CG1  1  
ATOM 205   C CG2  . VAL A 1 13 ? -3.133 0.404   11.454 1.00 0.00 ? 13 VAL A CG2  1  
ATOM 206   H H    . VAL A 1 13 ? -1.975 -1.977  12.379 1.00 0.00 ? 13 VAL A H    1  
ATOM 207   H HA   . VAL A 1 13 ? -3.008 0.004   14.154 1.00 0.00 ? 13 VAL A HA   1  
ATOM 208   H HB   . VAL A 1 13 ? -4.325 -1.323  11.781 1.00 0.00 ? 13 VAL A HB   1  
ATOM 209   H HG11 . VAL A 1 13 ? -6.174 -0.261  12.407 1.00 0.00 ? 13 VAL A HG11 1  
ATOM 210   H HG12 . VAL A 1 13 ? -5.333 0.510   13.753 1.00 0.00 ? 13 VAL A HG12 1  
ATOM 211   H HG13 . VAL A 1 13 ? -5.325 1.264   12.158 1.00 0.00 ? 13 VAL A HG13 1  
ATOM 212   H HG21 . VAL A 1 13 ? -3.209 0.068   10.431 1.00 0.00 ? 13 VAL A HG21 1  
ATOM 213   H HG22 . VAL A 1 13 ? -3.432 1.441   11.515 1.00 0.00 ? 13 VAL A HG22 1  
ATOM 214   H HG23 . VAL A 1 13 ? -2.112 0.304   11.792 1.00 0.00 ? 13 VAL A HG23 1  
ATOM 215   N N    . GLU A 1 14 ? -4.275 -3.010  14.243 1.00 0.00 ? 14 GLU A N    1  
ATOM 216   C CA   . GLU A 1 14 ? -5.139 -3.906  15.003 1.00 0.00 ? 14 GLU A CA   1  
ATOM 217   C C    . GLU A 1 14 ? -4.509 -4.258  16.347 1.00 0.00 ? 14 GLU A C    1  
ATOM 218   O O    . GLU A 1 14 ? -5.209 -4.577  17.309 1.00 0.00 ? 14 GLU A O    1  
ATOM 219   C CB   . GLU A 1 14 ? -5.414 -5.183  14.206 1.00 0.00 ? 14 GLU A CB   1  
ATOM 220   C CG   . GLU A 1 14 ? -6.715 -5.869  14.586 1.00 0.00 ? 14 GLU A CG   1  
ATOM 221   C CD   . GLU A 1 14 ? -6.785 -7.301  14.093 1.00 0.00 ? 14 GLU A CD   1  
ATOM 222   O OE1  . GLU A 1 14 ? -6.809 -7.503  12.861 1.00 0.00 ? 14 GLU A OE1  1  
ATOM 223   O OE2  . GLU A 1 14 ? -6.817 -8.219  14.939 1.00 0.00 ? 14 GLU A OE2  1  
ATOM 224   H H    . GLU A 1 14 ? -3.698 -3.381  13.543 1.00 0.00 ? 14 GLU A H    1  
ATOM 225   H HA   . GLU A 1 14 ? -6.073 -3.394  15.179 1.00 0.00 ? 14 GLU A HA   1  
ATOM 226   H HB2  . GLU A 1 14 ? -5.454 -4.936  13.155 1.00 0.00 ? 14 GLU A HB2  1  
ATOM 227   H HB3  . GLU A 1 14 ? -4.604 -5.877  14.372 1.00 0.00 ? 14 GLU A HB3  1  
ATOM 228   H HG2  . GLU A 1 14 ? -6.806 -5.870  15.662 1.00 0.00 ? 14 GLU A HG2  1  
ATOM 229   H HG3  . GLU A 1 14 ? -7.538 -5.315  14.157 1.00 0.00 ? 14 GLU A HG3  1  
ATOM 230   N N    . HIS A 1 15 ? -3.183 -4.198  16.407 1.00 0.00 ? 15 HIS A N    1  
ATOM 231   C CA   . HIS A 1 15 ? -2.457 -4.510  17.633 1.00 0.00 ? 15 HIS A CA   1  
ATOM 232   C C    . HIS A 1 15 ? -2.335 -3.275  18.521 1.00 0.00 ? 15 HIS A C    1  
ATOM 233   O O    . HIS A 1 15 ? -2.728 -3.296  19.689 1.00 0.00 ? 15 HIS A O    1  
ATOM 234   C CB   . HIS A 1 15 ? -1.067 -5.056  17.304 1.00 0.00 ? 15 HIS A CB   1  
ATOM 235   C CG   . HIS A 1 15 ? -1.068 -6.503  16.919 1.00 0.00 ? 15 HIS A CG   1  
ATOM 236   N ND1  . HIS A 1 15 ? -0.123 -7.402  17.366 1.00 0.00 ? 15 HIS A ND1  1  
ATOM 237   C CD2  . HIS A 1 15 ? -1.908 -7.207  16.124 1.00 0.00 ? 15 HIS A CD2  1  
ATOM 238   C CE1  . HIS A 1 15 ? -0.380 -8.595  16.862 1.00 0.00 ? 15 HIS A CE1  1  
ATOM 239   N NE2  . HIS A 1 15 ? -1.458 -8.505  16.105 1.00 0.00 ? 15 HIS A NE2  1  
ATOM 240   H H    . HIS A 1 15 ? -2.680 -3.937  15.607 1.00 0.00 ? 15 HIS A H    1  
ATOM 241   H HA   . HIS A 1 15 ? -3.015 -5.266  18.165 1.00 0.00 ? 15 HIS A HA   1  
ATOM 242   H HB2  . HIS A 1 15 ? -0.653 -4.494  16.480 1.00 0.00 ? 15 HIS A HB2  1  
ATOM 243   H HB3  . HIS A 1 15 ? -0.429 -4.942  18.169 1.00 0.00 ? 15 HIS A HB3  1  
ATOM 244   H HD1  . HIS A 1 15 ? 0.626  -7.195  17.963 1.00 0.00 ? 15 HIS A HD1  1  
ATOM 245   H HD2  . HIS A 1 15 ? -2.772 -6.821  15.601 1.00 0.00 ? 15 HIS A HD2  1  
ATOM 246   H HE1  . HIS A 1 15 ? 0.193  -9.493  17.038 1.00 0.00 ? 15 HIS A HE1  1  
ATOM 247   N N    . LEU A 1 16 ? -1.786 -2.203  17.962 1.00 0.00 ? 16 LEU A N    1  
ATOM 248   C CA   . LEU A 1 16 ? -1.611 -0.958  18.703 1.00 0.00 ? 16 LEU A CA   1  
ATOM 249   C C    . LEU A 1 16 ? -2.943 -0.236  18.878 1.00 0.00 ? 16 LEU A C    1  
ATOM 250   O O    . LEU A 1 16 ? -3.180 0.413   19.895 1.00 0.00 ? 16 LEU A O    1  
ATOM 251   C CB   . LEU A 1 16 ? -0.615 -0.048  17.982 1.00 0.00 ? 16 LEU A CB   1  
ATOM 252   C CG   . LEU A 1 16 ? 0.808  -0.589  17.841 1.00 0.00 ? 16 LEU A CG   1  
ATOM 253   C CD1  . LEU A 1 16 ? 1.717  0.458   17.217 1.00 0.00 ? 16 LEU A CD1  1  
ATOM 254   C CD2  . LEU A 1 16 ? 1.348  -1.030  19.193 1.00 0.00 ? 16 LEU A CD2  1  
ATOM 255   H H    . LEU A 1 16 ? -1.492 -2.247  17.029 1.00 0.00 ? 16 LEU A H    1  
ATOM 256   H HA   . LEU A 1 16 ? -1.219 -1.206  19.678 1.00 0.00 ? 16 LEU A HA   1  
ATOM 257   H HB2  . LEU A 1 16 ? -0.997 0.140   16.991 1.00 0.00 ? 16 LEU A HB2  1  
ATOM 258   H HB3  . LEU A 1 16 ? -0.564 0.883   18.529 1.00 0.00 ? 16 LEU A HB3  1  
ATOM 259   H HG   . LEU A 1 16 ? 0.795  -1.451  17.188 1.00 0.00 ? 16 LEU A HG   1  
ATOM 260   H HD11 . LEU A 1 16 ? 2.358  0.877   17.978 1.00 0.00 ? 16 LEU A HD11 1  
ATOM 261   H HD12 . LEU A 1 16 ? 1.117  1.242   16.780 1.00 0.00 ? 16 LEU A HD12 1  
ATOM 262   H HD13 . LEU A 1 16 ? 2.322  -0.002  16.450 1.00 0.00 ? 16 LEU A HD13 1  
ATOM 263   H HD21 . LEU A 1 16 ? 1.341  -0.191  19.874 1.00 0.00 ? 16 LEU A HD21 1  
ATOM 264   H HD22 . LEU A 1 16 ? 2.360  -1.391  19.077 1.00 0.00 ? 16 LEU A HD22 1  
ATOM 265   H HD23 . LEU A 1 16 ? 0.727  -1.820  19.589 1.00 0.00 ? 16 LEU A HD23 1  
ATOM 266   N N    . GLY A 1 17 ? -3.812 -0.356  17.878 1.00 0.00 ? 17 GLY A N    1  
ATOM 267   C CA   . GLY A 1 17 ? -5.110 0.288   17.941 1.00 0.00 ? 17 GLY A CA   1  
ATOM 268   C C    . GLY A 1 17 ? -5.046 1.758   17.575 1.00 0.00 ? 17 GLY A C    1  
ATOM 269   O O    . GLY A 1 17 ? -5.835 2.563   18.071 1.00 0.00 ? 17 GLY A O    1  
ATOM 270   H H    . GLY A 1 17 ? -3.568 -0.887  17.091 1.00 0.00 ? 17 GLY A H    1  
ATOM 271   H HA2  . GLY A 1 17 ? -5.782 -0.213  17.261 1.00 0.00 ? 17 GLY A HA2  1  
ATOM 272   H HA3  . GLY A 1 17 ? -5.496 0.196   18.946 1.00 0.00 ? 17 GLY A HA3  1  
ATOM 273   N N    . VAL A 1 18 ? -4.104 2.109   16.706 1.00 0.00 ? 18 VAL A N    1  
ATOM 274   C CA   . VAL A 1 18 ? -3.940 3.492   16.274 1.00 0.00 ? 18 VAL A CA   1  
ATOM 275   C C    . VAL A 1 18 ? -4.428 3.683   14.843 1.00 0.00 ? 18 VAL A C    1  
ATOM 276   O O    . VAL A 1 18 ? -4.990 2.768   14.241 1.00 0.00 ? 18 VAL A O    1  
ATOM 277   C CB   . VAL A 1 18 ? -2.468 3.938   16.367 1.00 0.00 ? 18 VAL A CB   1  
ATOM 278   C CG1  . VAL A 1 18 ? -1.938 3.739   17.779 1.00 0.00 ? 18 VAL A CG1  1  
ATOM 279   C CG2  . VAL A 1 18 ? -1.618 3.181   15.358 1.00 0.00 ? 18 VAL A CG2  1  
ATOM 280   H H    . VAL A 1 18 ? -3.506 1.422   16.346 1.00 0.00 ? 18 VAL A H    1  
ATOM 281   H HA   . VAL A 1 18 ? -4.526 4.119   16.931 1.00 0.00 ? 18 VAL A HA   1  
ATOM 282   H HB   . VAL A 1 18 ? -2.417 4.991   16.133 1.00 0.00 ? 18 VAL A HB   1  
ATOM 283   H HG11 . VAL A 1 18 ? -2.141 2.728   18.100 1.00 0.00 ? 18 VAL A HG11 1  
ATOM 284   H HG12 . VAL A 1 18 ? -0.872 3.914   17.792 1.00 0.00 ? 18 VAL A HG12 1  
ATOM 285   H HG13 . VAL A 1 18 ? -2.425 4.433   18.448 1.00 0.00 ? 18 VAL A HG13 1  
ATOM 286   H HG21 . VAL A 1 18 ? -0.574 3.387   15.542 1.00 0.00 ? 18 VAL A HG21 1  
ATOM 287   H HG22 . VAL A 1 18 ? -1.799 2.121   15.457 1.00 0.00 ? 18 VAL A HG22 1  
ATOM 288   H HG23 . VAL A 1 18 ? -1.878 3.498   14.359 1.00 0.00 ? 18 VAL A HG23 1  
ATOM 289   N N    . ASP A 1 19 ? -4.207 4.876   14.303 1.00 0.00 ? 19 ASP A N    1  
ATOM 290   C CA   . ASP A 1 19 ? -4.623 5.187   12.940 1.00 0.00 ? 19 ASP A CA   1  
ATOM 291   C C    . ASP A 1 19 ? -3.653 4.590   11.926 1.00 0.00 ? 19 ASP A C    1  
ATOM 292   O O    . ASP A 1 19 ? -2.458 4.469   12.193 1.00 0.00 ? 19 ASP A O    1  
ATOM 293   C CB   . ASP A 1 19 ? -4.716 6.701   12.745 1.00 0.00 ? 19 ASP A CB   1  
ATOM 294   C CG   . ASP A 1 19 ? -5.745 7.089   11.701 1.00 0.00 ? 19 ASP A CG   1  
ATOM 295   O OD1  . ASP A 1 19 ? -6.157 6.207   10.920 1.00 0.00 ? 19 ASP A OD1  1  
ATOM 296   O OD2  . ASP A 1 19 ? -6.136 8.275   11.666 1.00 0.00 ? 19 ASP A OD2  1  
ATOM 297   H H    . ASP A 1 19 ? -3.754 5.565   14.833 1.00 0.00 ? 19 ASP A H    1  
ATOM 298   H HA   . ASP A 1 19 ? -5.599 4.753   12.784 1.00 0.00 ? 19 ASP A HA   1  
ATOM 299   H HB2  . ASP A 1 19 ? -4.990 7.162   13.683 1.00 0.00 ? 19 ASP A HB2  1  
ATOM 300   H HB3  . ASP A 1 19 ? -3.752 7.077   12.433 1.00 0.00 ? 19 ASP A HB3  1  
ATOM 301   N N    . ALA A 1 20 ? -4.176 4.216   10.763 1.00 0.00 ? 20 ALA A N    1  
ATOM 302   C CA   . ALA A 1 20 ? -3.356 3.632   9.709  1.00 0.00 ? 20 ALA A CA   1  
ATOM 303   C C    . ALA A 1 20 ? -2.551 4.704   8.982  1.00 0.00 ? 20 ALA A C    1  
ATOM 304   O O    . ALA A 1 20 ? -1.396 4.486   8.616  1.00 0.00 ? 20 ALA A O    1  
ATOM 305   C CB   . ALA A 1 20 ? -4.228 2.866   8.725  1.00 0.00 ? 20 ALA A CB   1  
ATOM 306   H H    . ALA A 1 20 ? -5.136 4.338   10.610 1.00 0.00 ? 20 ALA A H    1  
ATOM 307   H HA   . ALA A 1 20 ? -2.672 2.932   10.167 1.00 0.00 ? 20 ALA A HA   1  
ATOM 308   H HB1  . ALA A 1 20 ? -4.284 3.412   7.794  1.00 0.00 ? 20 ALA A HB1  1  
ATOM 309   H HB2  . ALA A 1 20 ? -3.798 1.892   8.546  1.00 0.00 ? 20 ALA A HB2  1  
ATOM 310   H HB3  . ALA A 1 20 ? -5.220 2.753   9.136  1.00 0.00 ? 20 ALA A HB3  1  
ATOM 311   N N    . ASP A 1 21 ? -3.169 5.862   8.774  1.00 0.00 ? 21 ASP A N    1  
ATOM 312   C CA   . ASP A 1 21 ? -2.509 6.968   8.091  1.00 0.00 ? 21 ASP A CA   1  
ATOM 313   C C    . ASP A 1 21 ? -1.177 7.301   8.755  1.00 0.00 ? 21 ASP A C    1  
ATOM 314   O O    . ASP A 1 21 ? -0.189 7.591   8.080  1.00 0.00 ? 21 ASP A O    1  
ATOM 315   C CB   . ASP A 1 21 ? -3.413 8.203   8.084  1.00 0.00 ? 21 ASP A CB   1  
ATOM 316   C CG   . ASP A 1 21 ? -4.434 8.166   6.964  1.00 0.00 ? 21 ASP A CG   1  
ATOM 317   O OD1  . ASP A 1 21 ? -4.110 7.632   5.882  1.00 0.00 ? 21 ASP A OD1  1  
ATOM 318   O OD2  . ASP A 1 21 ? -5.557 8.671   7.170  1.00 0.00 ? 21 ASP A OD2  1  
ATOM 319   H H    . ASP A 1 21 ? -4.090 5.975   9.089  1.00 0.00 ? 21 ASP A H    1  
ATOM 320   H HA   . ASP A 1 21 ? -2.323 6.665   7.072  1.00 0.00 ? 21 ASP A HA   1  
ATOM 321   H HB2  . ASP A 1 21 ? -3.940 8.260   9.025  1.00 0.00 ? 21 ASP A HB2  1  
ATOM 322   H HB3  . ASP A 1 21 ? -2.803 9.086   7.963  1.00 0.00 ? 21 ASP A HB3  1  
ATOM 323   N N    . LYS A 1 22 ? -1.158 7.259   10.083 1.00 0.00 ? 22 LYS A N    1  
ATOM 324   C CA   . LYS A 1 22 ? 0.052  7.556   10.841 1.00 0.00 ? 22 LYS A CA   1  
ATOM 325   C C    . LYS A 1 22 ? 1.133  6.515   10.569 1.00 0.00 ? 22 LYS A C    1  
ATOM 326   O O    . LYS A 1 22 ? 2.325  6.795   10.697 1.00 0.00 ? 22 LYS A O    1  
ATOM 327   C CB   . LYS A 1 22 ? -0.258 7.606   12.339 1.00 0.00 ? 22 LYS A CB   1  
ATOM 328   C CG   . LYS A 1 22 ? -1.294 8.653   12.711 1.00 0.00 ? 22 LYS A CG   1  
ATOM 329   C CD   . LYS A 1 22 ? -1.472 8.750   14.217 1.00 0.00 ? 22 LYS A CD   1  
ATOM 330   C CE   . LYS A 1 22 ? -2.007 10.114  14.627 1.00 0.00 ? 22 LYS A CE   1  
ATOM 331   N NZ   . LYS A 1 22 ? -2.799 10.042  15.886 1.00 0.00 ? 22 LYS A NZ   1  
ATOM 332   H H    . LYS A 1 22 ? -1.978 7.022   10.566 1.00 0.00 ? 22 LYS A H    1  
ATOM 333   H HA   . LYS A 1 22 ? 0.413  8.523   10.525 1.00 0.00 ? 22 LYS A HA   1  
ATOM 334   H HB2  . LYS A 1 22 ? -0.626 6.639   12.650 1.00 0.00 ? 22 LYS A HB2  1  
ATOM 335   H HB3  . LYS A 1 22 ? 0.653  7.824   12.876 1.00 0.00 ? 22 LYS A HB3  1  
ATOM 336   H HG2  . LYS A 1 22 ? -0.973 9.613   12.334 1.00 0.00 ? 22 LYS A HG2  1  
ATOM 337   H HG3  . LYS A 1 22 ? -2.240 8.386   12.262 1.00 0.00 ? 22 LYS A HG3  1  
ATOM 338   H HD2  . LYS A 1 22 ? -2.169 7.991   14.538 1.00 0.00 ? 22 LYS A HD2  1  
ATOM 339   H HD3  . LYS A 1 22 ? -0.516 8.589   14.695 1.00 0.00 ? 22 LYS A HD3  1  
ATOM 340   H HE2  . LYS A 1 22 ? -1.173 10.783  14.775 1.00 0.00 ? 22 LYS A HE2  1  
ATOM 341   H HE3  . LYS A 1 22 ? -2.637 10.492  13.836 1.00 0.00 ? 22 LYS A HE3  1  
ATOM 342   H HZ1  . LYS A 1 22 ? -3.752 10.430  15.730 1.00 0.00 ? 22 LYS A HZ1  1  
ATOM 343   H HZ2  . LYS A 1 22 ? -2.332 10.593  16.634 1.00 0.00 ? 22 LYS A HZ2  1  
ATOM 344   H HZ3  . LYS A 1 22 ? -2.885 9.054   16.199 1.00 0.00 ? 22 LYS A HZ3  1  
ATOM 345   N N    . VAL A 1 23 ? 0.710  5.312   10.193 1.00 0.00 ? 23 VAL A N    1  
ATOM 346   C CA   . VAL A 1 23 ? 1.642  4.230   9.901  1.00 0.00 ? 23 VAL A CA   1  
ATOM 347   C C    . VAL A 1 23 ? 2.302  4.426   8.541  1.00 0.00 ? 23 VAL A C    1  
ATOM 348   O O    . VAL A 1 23 ? 1.910  3.805   7.552  1.00 0.00 ? 23 VAL A O    1  
ATOM 349   C CB   . VAL A 1 23 ? 0.937  2.861   9.925  1.00 0.00 ? 23 VAL A CB   1  
ATOM 350   C CG1  . VAL A 1 23 ? 1.953  1.735   9.804  1.00 0.00 ? 23 VAL A CG1  1  
ATOM 351   C CG2  . VAL A 1 23 ? 0.110  2.710   11.193 1.00 0.00 ? 23 VAL A CG2  1  
ATOM 352   H H    . VAL A 1 23 ? -0.253 5.150   10.109 1.00 0.00 ? 23 VAL A H    1  
ATOM 353   H HA   . VAL A 1 23 ? 2.405  4.232   10.665 1.00 0.00 ? 23 VAL A HA   1  
ATOM 354   H HB   . VAL A 1 23 ? 0.270  2.806   9.077  1.00 0.00 ? 23 VAL A HB   1  
ATOM 355   H HG11 . VAL A 1 23 ? 1.440  0.785   9.817  1.00 0.00 ? 23 VAL A HG11 1  
ATOM 356   H HG12 . VAL A 1 23 ? 2.498  1.839   8.877  1.00 0.00 ? 23 VAL A HG12 1  
ATOM 357   H HG13 . VAL A 1 23 ? 2.642  1.782   10.634 1.00 0.00 ? 23 VAL A HG13 1  
ATOM 358   H HG21 . VAL A 1 23 ? 0.022  1.663   11.441 1.00 0.00 ? 23 VAL A HG21 1  
ATOM 359   H HG22 . VAL A 1 23 ? 0.595  3.233   12.004 1.00 0.00 ? 23 VAL A HG22 1  
ATOM 360   H HG23 . VAL A 1 23 ? -0.873 3.127   11.033 1.00 0.00 ? 23 VAL A HG23 1  
ATOM 361   N N    . THR A 1 24 ? 3.309  5.293   8.497  1.00 0.00 ? 24 THR A N    1  
ATOM 362   C CA   . THR A 1 24 ? 4.024  5.572   7.258  1.00 0.00 ? 24 THR A CA   1  
ATOM 363   C C    . THR A 1 24 ? 5.446  5.024   7.309  1.00 0.00 ? 24 THR A C    1  
ATOM 364   O O    . THR A 1 24 ? 5.951  4.683   8.378  1.00 0.00 ? 24 THR A O    1  
ATOM 365   C CB   . THR A 1 24 ? 4.079  7.084   6.969  1.00 0.00 ? 24 THR A CB   1  
ATOM 366   O OG1  . THR A 1 24 ? 5.000  7.720   7.861  1.00 0.00 ? 24 THR A OG1  1  
ATOM 367   C CG2  . THR A 1 24 ? 2.702  7.713   7.119  1.00 0.00 ? 24 THR A CG2  1  
ATOM 368   H H    . THR A 1 24 ? 3.575  5.756   9.318  1.00 0.00 ? 24 THR A H    1  
ATOM 369   H HA   . THR A 1 24 ? 3.492  5.091   6.450  1.00 0.00 ? 24 THR A HA   1  
ATOM 370   H HB   . THR A 1 24 ? 4.416  7.228   5.952  1.00 0.00 ? 24 THR A HB   1  
ATOM 371   H HG1  . THR A 1 24 ? 5.058  8.655   7.649  1.00 0.00 ? 24 THR A HG1  1  
ATOM 372   H HG21 . THR A 1 24 ? 2.518  7.933   8.160  1.00 0.00 ? 24 THR A HG21 1  
ATOM 373   H HG22 . THR A 1 24 ? 1.951  7.027   6.757  1.00 0.00 ? 24 THR A HG22 1  
ATOM 374   H HG23 . THR A 1 24 ? 2.660  8.627   6.546  1.00 0.00 ? 24 THR A HG23 1  
ATOM 375   N N    . GLU A 1 25 ? 6.086  4.943   6.147  1.00 0.00 ? 25 GLU A N    1  
ATOM 376   C CA   . GLU A 1 25 ? 7.450  4.436   6.061  1.00 0.00 ? 25 GLU A CA   1  
ATOM 377   C C    . GLU A 1 25 ? 8.366  5.169   7.036  1.00 0.00 ? 25 GLU A C    1  
ATOM 378   O O    . GLU A 1 25 ? 9.257  4.571   7.638  1.00 0.00 ? 25 GLU A O    1  
ATOM 379   C CB   . GLU A 1 25 ? 7.984  4.583   4.634  1.00 0.00 ? 25 GLU A CB   1  
ATOM 380   C CG   . GLU A 1 25 ? 9.375  4.003   4.441  1.00 0.00 ? 25 GLU A CG   1  
ATOM 381   C CD   . GLU A 1 25 ? 9.966  4.344   3.087  1.00 0.00 ? 25 GLU A CD   1  
ATOM 382   O OE1  . GLU A 1 25 ? 9.187  4.560   2.136  1.00 0.00 ? 25 GLU A OE1  1  
ATOM 383   O OE2  . GLU A 1 25 ? 11.210 4.395   2.980  1.00 0.00 ? 25 GLU A OE2  1  
ATOM 384   H H    . GLU A 1 25 ? 5.630  5.230   5.328  1.00 0.00 ? 25 GLU A H    1  
ATOM 385   H HA   . GLU A 1 25 ? 7.432  3.388   6.321  1.00 0.00 ? 25 GLU A HA   1  
ATOM 386   H HB2  . GLU A 1 25 ? 7.309  4.081   3.956  1.00 0.00 ? 25 GLU A HB2  1  
ATOM 387   H HB3  . GLU A 1 25 ? 8.017  5.633   4.382  1.00 0.00 ? 25 GLU A HB3  1  
ATOM 388   H HG2  . GLU A 1 25 ? 10.024 4.395   5.210  1.00 0.00 ? 25 GLU A HG2  1  
ATOM 389   H HG3  . GLU A 1 25 ? 9.318  2.929   4.533  1.00 0.00 ? 25 GLU A HG3  1  
ATOM 390   N N    . GLY A 1 26 ? 8.139  6.471   7.187  1.00 0.00 ? 26 GLY A N    1  
ATOM 391   C CA   . GLY A 1 26 ? 8.951  7.266   8.089  1.00 0.00 ? 26 GLY A CA   1  
ATOM 392   C C    . GLY A 1 26 ? 8.338  7.383   9.470  1.00 0.00 ? 26 GLY A C    1  
ATOM 393   O O    . GLY A 1 26 ? 8.515  8.392   10.152 1.00 0.00 ? 26 GLY A O    1  
ATOM 394   H H    . GLY A 1 26 ? 7.415  6.895   6.681  1.00 0.00 ? 26 GLY A H    1  
ATOM 395   H HA2  . GLY A 1 26 ? 9.925  6.808   8.178  1.00 0.00 ? 26 GLY A HA2  1  
ATOM 396   H HA3  . GLY A 1 26 ? 9.067  8.256   7.674  1.00 0.00 ? 26 GLY A HA3  1  
ATOM 397   N N    . ALA A 1 27 ? 7.612  6.350   9.884  1.00 0.00 ? 27 ALA A N    1  
ATOM 398   C CA   . ALA A 1 27 ? 6.970  6.341   11.192 1.00 0.00 ? 27 ALA A CA   1  
ATOM 399   C C    . ALA A 1 27 ? 7.743  5.472   12.178 1.00 0.00 ? 27 ALA A C    1  
ATOM 400   O O    . ALA A 1 27 ? 7.763  4.247   12.057 1.00 0.00 ? 27 ALA A O    1  
ATOM 401   C CB   . ALA A 1 27 ? 5.533  5.856   11.072 1.00 0.00 ? 27 ALA A CB   1  
ATOM 402   H H    . ALA A 1 27 ? 7.506  5.574   9.295  1.00 0.00 ? 27 ALA A H    1  
ATOM 403   H HA   . ALA A 1 27 ? 6.951  7.357   11.561 1.00 0.00 ? 27 ALA A HA   1  
ATOM 404   H HB1  . ALA A 1 27 ? 5.083  5.819   12.054 1.00 0.00 ? 27 ALA A HB1  1  
ATOM 405   H HB2  . ALA A 1 27 ? 4.975  6.535   10.445 1.00 0.00 ? 27 ALA A HB2  1  
ATOM 406   H HB3  . ALA A 1 27 ? 5.522  4.869   10.634 1.00 0.00 ? 27 ALA A HB3  1  
ATOM 407   N N    . SER A 1 28 ? 8.380  6.114   13.152 1.00 0.00 ? 28 SER A N    1  
ATOM 408   C CA   . SER A 1 28 ? 9.159  5.399   14.156 1.00 0.00 ? 28 SER A CA   1  
ATOM 409   C C    . SER A 1 28 ? 8.297  5.048   15.365 1.00 0.00 ? 28 SER A C    1  
ATOM 410   O O    . SER A 1 28 ? 7.790  5.931   16.058 1.00 0.00 ? 28 SER A O    1  
ATOM 411   C CB   . SER A 1 28 ? 10.357 6.242   14.598 1.00 0.00 ? 28 SER A CB   1  
ATOM 412   O OG   . SER A 1 28 ? 11.232 6.494   13.512 1.00 0.00 ? 28 SER A OG   1  
ATOM 413   H H    . SER A 1 28 ? 8.326  7.092   13.195 1.00 0.00 ? 28 SER A H    1  
ATOM 414   H HA   . SER A 1 28 ? 9.519  4.485   13.708 1.00 0.00 ? 28 SER A HA   1  
ATOM 415   H HB2  . SER A 1 28 ? 10.006 7.186   14.988 1.00 0.00 ? 28 SER A HB2  1  
ATOM 416   H HB3  . SER A 1 28 ? 10.901 5.715   15.368 1.00 0.00 ? 28 SER A HB3  1  
ATOM 417   H HG   . SER A 1 28 ? 12.083 6.083   13.684 1.00 0.00 ? 28 SER A HG   1  
ATOM 418   N N    . PHE A 1 29 ? 8.134  3.753   15.611 1.00 0.00 ? 29 PHE A N    1  
ATOM 419   C CA   . PHE A 1 29 ? 7.332  3.283   16.735 1.00 0.00 ? 29 PHE A CA   1  
ATOM 420   C C    . PHE A 1 29 ? 7.935  3.738   18.061 1.00 0.00 ? 29 PHE A C    1  
ATOM 421   O O    . PHE A 1 29 ? 7.291  3.657   19.108 1.00 0.00 ? 29 PHE A O    1  
ATOM 422   C CB   . PHE A 1 29 ? 7.223  1.757   16.708 1.00 0.00 ? 29 PHE A CB   1  
ATOM 423   C CG   . PHE A 1 29 ? 6.895  1.203   15.351 1.00 0.00 ? 29 PHE A CG   1  
ATOM 424   C CD1  . PHE A 1 29 ? 5.588  1.194   14.890 1.00 0.00 ? 29 PHE A CD1  1  
ATOM 425   C CD2  . PHE A 1 29 ? 7.893  0.692   14.538 1.00 0.00 ? 29 PHE A CD2  1  
ATOM 426   C CE1  . PHE A 1 29 ? 5.283  0.685   13.641 1.00 0.00 ? 29 PHE A CE1  1  
ATOM 427   C CE2  . PHE A 1 29 ? 7.593  0.182   13.288 1.00 0.00 ? 29 PHE A CE2  1  
ATOM 428   C CZ   . PHE A 1 29 ? 6.287  0.178   12.840 1.00 0.00 ? 29 PHE A CZ   1  
ATOM 429   H H    . PHE A 1 29 ? 8.563  3.096   15.023 1.00 0.00 ? 29 PHE A H    1  
ATOM 430   H HA   . PHE A 1 29 ? 6.345  3.708   16.637 1.00 0.00 ? 29 PHE A HA   1  
ATOM 431   H HB2  . PHE A 1 29 ? 8.163  1.330   17.022 1.00 0.00 ? 29 PHE A HB2  1  
ATOM 432   H HB3  . PHE A 1 29 ? 6.446  1.447   17.391 1.00 0.00 ? 29 PHE A HB3  1  
ATOM 433   H HD1  . PHE A 1 29 ? 4.802  1.590   15.516 1.00 0.00 ? 29 PHE A HD1  1  
ATOM 434   H HD2  . PHE A 1 29 ? 8.915  0.693   14.887 1.00 0.00 ? 29 PHE A HD2  1  
ATOM 435   H HE1  . PHE A 1 29 ? 4.260  0.683   13.294 1.00 0.00 ? 29 PHE A HE1  1  
ATOM 436   H HE2  . PHE A 1 29 ? 8.380  -0.214  12.664 1.00 0.00 ? 29 PHE A HE2  1  
ATOM 437   H HZ   . PHE A 1 29 ? 6.051  -0.219  11.864 1.00 0.00 ? 29 PHE A HZ   1  
ATOM 438   N N    . ILE A 1 30 ? 9.174  4.215   18.008 1.00 0.00 ? 30 ILE A N    1  
ATOM 439   C CA   . ILE A 1 30 ? 9.864  4.683   19.204 1.00 0.00 ? 30 ILE A CA   1  
ATOM 440   C C    . ILE A 1 30 ? 9.500  6.131   19.517 1.00 0.00 ? 30 ILE A C    1  
ATOM 441   O O    . ILE A 1 30 ? 9.078  6.449   20.628 1.00 0.00 ? 30 ILE A O    1  
ATOM 442   C CB   . ILE A 1 30 ? 11.392 4.570   19.052 1.00 0.00 ? 30 ILE A CB   1  
ATOM 443   C CG1  . ILE A 1 30 ? 11.799 3.111   18.834 1.00 0.00 ? 30 ILE A CG1  1  
ATOM 444   C CG2  . ILE A 1 30 ? 12.089 5.142   20.278 1.00 0.00 ? 30 ILE A CG2  1  
ATOM 445   C CD1  . ILE A 1 30 ? 11.360 2.188   19.949 1.00 0.00 ? 30 ILE A CD1  1  
ATOM 446   H H    . ILE A 1 30 ? 9.635  4.254   17.144 1.00 0.00 ? 30 ILE A H    1  
ATOM 447   H HA   . ILE A 1 30 ? 9.557  4.059   20.031 1.00 0.00 ? 30 ILE A HA   1  
ATOM 448   H HB   . ILE A 1 30 ? 11.691 5.152   18.194 1.00 0.00 ? 30 ILE A HB   1  
ATOM 449   H HG12 . ILE A 1 30 ? 11.358 2.755   17.916 1.00 0.00 ? 30 ILE A HG12 1  
ATOM 450   H HG13 . ILE A 1 30 ? 12.875 3.053   18.758 1.00 0.00 ? 30 ILE A HG13 1  
ATOM 451   H HG21 . ILE A 1 30 ? 11.352 5.401   21.023 1.00 0.00 ? 30 ILE A HG21 1  
ATOM 452   H HG22 . ILE A 1 30 ? 12.766 4.405   20.683 1.00 0.00 ? 30 ILE A HG22 1  
ATOM 453   H HG23 . ILE A 1 30 ? 12.643 6.025   19.998 1.00 0.00 ? 30 ILE A HG23 1  
ATOM 454   H HD11 . ILE A 1 30 ? 10.290 2.047   19.900 1.00 0.00 ? 30 ILE A HD11 1  
ATOM 455   H HD12 . ILE A 1 30 ? 11.855 1.235   19.844 1.00 0.00 ? 30 ILE A HD12 1  
ATOM 456   H HD13 . ILE A 1 30 ? 11.620 2.626   20.902 1.00 0.00 ? 30 ILE A HD13 1  
ATOM 457   N N    . ASP A 1 31 ? 9.666  7.003   18.529 1.00 0.00 ? 31 ASP A N    1  
ATOM 458   C CA   . ASP A 1 31 ? 9.353  8.417   18.697 1.00 0.00 ? 31 ASP A CA   1  
ATOM 459   C C    . ASP A 1 31 ? 7.940  8.723   18.210 1.00 0.00 ? 31 ASP A C    1  
ATOM 460   O O    . ASP A 1 31 ? 7.091  9.172   18.980 1.00 0.00 ? 31 ASP A O    1  
ATOM 461   C CB   . ASP A 1 31 ? 10.365 9.279   17.940 1.00 0.00 ? 31 ASP A CB   1  
ATOM 462   C CG   . ASP A 1 31 ? 11.155 10.188  18.861 1.00 0.00 ? 31 ASP A CG   1  
ATOM 463   O OD1  . ASP A 1 31 ? 10.536 11.055  19.512 1.00 0.00 ? 31 ASP A OD1  1  
ATOM 464   O OD2  . ASP A 1 31 ? 12.392 10.033  18.929 1.00 0.00 ? 31 ASP A OD2  1  
ATOM 465   H H    . ASP A 1 31 ? 10.007 6.688   17.665 1.00 0.00 ? 31 ASP A H    1  
ATOM 466   H HA   . ASP A 1 31 ? 9.415  8.648   19.750 1.00 0.00 ? 31 ASP A HA   1  
ATOM 467   H HB2  . ASP A 1 31 ? 11.058 8.635   17.419 1.00 0.00 ? 31 ASP A HB2  1  
ATOM 468   H HB3  . ASP A 1 31 ? 9.839  9.892   17.222 1.00 0.00 ? 31 ASP A HB3  1  
ATOM 469   N N    . ASP A 1 32 ? 7.696  8.478   16.927 1.00 0.00 ? 32 ASP A N    1  
ATOM 470   C CA   . ASP A 1 32 ? 6.386  8.727   16.337 1.00 0.00 ? 32 ASP A CA   1  
ATOM 471   C C    . ASP A 1 32 ? 5.273  8.252   17.265 1.00 0.00 ? 32 ASP A C    1  
ATOM 472   O O    . ASP A 1 32 ? 4.265  8.937   17.445 1.00 0.00 ? 32 ASP A O    1  
ATOM 473   C CB   . ASP A 1 32 ? 6.272  8.025   14.983 1.00 0.00 ? 32 ASP A CB   1  
ATOM 474   C CG   . ASP A 1 32 ? 5.256  8.686   14.072 1.00 0.00 ? 32 ASP A CG   1  
ATOM 475   O OD1  . ASP A 1 32 ? 4.049  8.619   14.384 1.00 0.00 ? 32 ASP A OD1  1  
ATOM 476   O OD2  . ASP A 1 32 ? 5.668  9.269   13.047 1.00 0.00 ? 32 ASP A OD2  1  
ATOM 477   H H    . ASP A 1 32 ? 8.415  8.120   16.364 1.00 0.00 ? 32 ASP A H    1  
ATOM 478   H HA   . ASP A 1 32 ? 6.286  9.791   16.190 1.00 0.00 ? 32 ASP A HA   1  
ATOM 479   H HB2  . ASP A 1 32 ? 7.234  8.045   14.492 1.00 0.00 ? 32 ASP A HB2  1  
ATOM 480   H HB3  . ASP A 1 32 ? 5.974  6.999   15.140 1.00 0.00 ? 32 ASP A HB3  1  
ATOM 481   N N    . LEU A 1 33 ? 5.461  7.075   17.852 1.00 0.00 ? 33 LEU A N    1  
ATOM 482   C CA   . LEU A 1 33 ? 4.471  6.507   18.762 1.00 0.00 ? 33 LEU A CA   1  
ATOM 483   C C    . LEU A 1 33 ? 4.874  6.736   20.216 1.00 0.00 ? 33 LEU A C    1  
ATOM 484   O O    . LEU A 1 33 ? 4.055  6.606   21.125 1.00 0.00 ? 33 LEU A O    1  
ATOM 485   C CB   . LEU A 1 33 ? 4.306  5.010   18.497 1.00 0.00 ? 33 LEU A CB   1  
ATOM 486   C CG   . LEU A 1 33 ? 3.862  4.624   17.085 1.00 0.00 ? 33 LEU A CG   1  
ATOM 487   C CD1  . LEU A 1 33 ? 3.427  3.167   17.042 1.00 0.00 ? 33 LEU A CD1  1  
ATOM 488   C CD2  . LEU A 1 33 ? 2.738  5.533   16.612 1.00 0.00 ? 33 LEU A CD2  1  
ATOM 489   H H    . LEU A 1 33 ? 6.283  6.575   17.671 1.00 0.00 ? 33 LEU A H    1  
ATOM 490   H HA   . LEU A 1 33 ? 3.530  7.004   18.580 1.00 0.00 ? 33 LEU A HA   1  
ATOM 491   H HB2  . LEU A 1 33 ? 5.255  4.534   18.687 1.00 0.00 ? 33 LEU A HB2  1  
ATOM 492   H HB3  . LEU A 1 33 ? 3.569  4.632   19.191 1.00 0.00 ? 33 LEU A HB3  1  
ATOM 493   H HG   . LEU A 1 33 ? 4.697  4.742   16.408 1.00 0.00 ? 33 LEU A HG   1  
ATOM 494   H HD11 . LEU A 1 33 ? 3.044  2.935   16.060 1.00 0.00 ? 33 LEU A HD11 1  
ATOM 495   H HD12 . LEU A 1 33 ? 2.655  3.001   17.779 1.00 0.00 ? 33 LEU A HD12 1  
ATOM 496   H HD13 . LEU A 1 33 ? 4.273  2.532   17.259 1.00 0.00 ? 33 LEU A HD13 1  
ATOM 497   H HD21 . LEU A 1 33 ? 2.032  4.958   16.030 1.00 0.00 ? 33 LEU A HD21 1  
ATOM 498   H HD22 . LEU A 1 33 ? 3.148  6.324   16.001 1.00 0.00 ? 33 LEU A HD22 1  
ATOM 499   H HD23 . LEU A 1 33 ? 2.236  5.961   17.467 1.00 0.00 ? 33 LEU A HD23 1  
ATOM 500   N N    . GLY A 1 34 ? 6.141  7.080   20.427 1.00 0.00 ? 34 GLY A N    1  
ATOM 501   C CA   . GLY A 1 34 ? 6.629  7.324   21.771 1.00 0.00 ? 34 GLY A CA   1  
ATOM 502   C C    . GLY A 1 34 ? 6.778  6.047   22.575 1.00 0.00 ? 34 GLY A C    1  
ATOM 503   O O    . GLY A 1 34 ? 6.564  6.039   23.787 1.00 0.00 ? 34 GLY A O    1  
ATOM 504   H H    . GLY A 1 34 ? 6.749  7.168   19.663 1.00 0.00 ? 34 GLY A H    1  
ATOM 505   H HA2  . GLY A 1 34 ? 7.590  7.812   21.711 1.00 0.00 ? 34 GLY A HA2  1  
ATOM 506   H HA3  . GLY A 1 34 ? 5.936  7.977   22.281 1.00 0.00 ? 34 GLY A HA3  1  
ATOM 507   N N    . ALA A 1 35 ? 7.144  4.963   21.898 1.00 0.00 ? 35 ALA A N    1  
ATOM 508   C CA   . ALA A 1 35 ? 7.320  3.675   22.556 1.00 0.00 ? 35 ALA A CA   1  
ATOM 509   C C    . ALA A 1 35 ? 8.796  3.385   22.809 1.00 0.00 ? 35 ALA A C    1  
ATOM 510   O O    . ALA A 1 35 ? 9.671  4.112   22.338 1.00 0.00 ? 35 ALA A O    1  
ATOM 511   C CB   . ALA A 1 35 ? 6.699  2.565   21.721 1.00 0.00 ? 35 ALA A CB   1  
ATOM 512   H H    . ALA A 1 35 ? 7.299  5.032   20.933 1.00 0.00 ? 35 ALA A H    1  
ATOM 513   H HA   . ALA A 1 35 ? 6.803  3.711   23.505 1.00 0.00 ? 35 ALA A HA   1  
ATOM 514   H HB1  . ALA A 1 35 ? 6.363  1.771   22.372 1.00 0.00 ? 35 ALA A HB1  1  
ATOM 515   H HB2  . ALA A 1 35 ? 5.858  2.958   21.169 1.00 0.00 ? 35 ALA A HB2  1  
ATOM 516   H HB3  . ALA A 1 35 ? 7.434  2.179   21.032 1.00 0.00 ? 35 ALA A HB3  1  
ATOM 517   N N    . ASP A 1 36 ? 9.066  2.321   23.557 1.00 0.00 ? 36 ASP A N    1  
ATOM 518   C CA   . ASP A 1 36 ? 10.436 1.935   23.872 1.00 0.00 ? 36 ASP A CA   1  
ATOM 519   C C    . ASP A 1 36 ? 10.834 0.672   23.115 1.00 0.00 ? 36 ASP A C    1  
ATOM 520   O O    . ASP A 1 36 ? 10.034 0.105   22.370 1.00 0.00 ? 36 ASP A O    1  
ATOM 521   C CB   . ASP A 1 36 ? 10.592 1.712   25.377 1.00 0.00 ? 36 ASP A CB   1  
ATOM 522   C CG   . ASP A 1 36 ? 9.763  2.683   26.195 1.00 0.00 ? 36 ASP A CG   1  
ATOM 523   O OD1  . ASP A 1 36 ? 8.562  2.412   26.397 1.00 0.00 ? 36 ASP A OD1  1  
ATOM 524   O OD2  . ASP A 1 36 ? 10.316 3.714   26.632 1.00 0.00 ? 36 ASP A OD2  1  
ATOM 525   H H    . ASP A 1 36 ? 8.325  1.780   23.904 1.00 0.00 ? 36 ASP A H    1  
ATOM 526   H HA   . ASP A 1 36 ? 11.086 2.741   23.567 1.00 0.00 ? 36 ASP A HA   1  
ATOM 527   H HB2  . ASP A 1 36 ? 10.280 0.707   25.620 1.00 0.00 ? 36 ASP A HB2  1  
ATOM 528   H HB3  . ASP A 1 36 ? 11.631 1.837   25.647 1.00 0.00 ? 36 ASP A HB3  1  
ATOM 529   N N    . SER A 1 37 ? 12.075 0.237   23.309 1.00 0.00 ? 37 SER A N    1  
ATOM 530   C CA   . SER A 1 37 ? 12.580 -0.956  22.640 1.00 0.00 ? 37 SER A CA   1  
ATOM 531   C C    . SER A 1 37 ? 11.645 -2.141  22.864 1.00 0.00 ? 37 SER A C    1  
ATOM 532   O O    . SER A 1 37 ? 11.507 -3.010  22.002 1.00 0.00 ? 37 SER A O    1  
ATOM 533   C CB   . SER A 1 37 ? 13.982 -1.296  23.148 1.00 0.00 ? 37 SER A CB   1  
ATOM 534   O OG   . SER A 1 37 ? 14.567 -2.332  22.378 1.00 0.00 ? 37 SER A OG   1  
ATOM 535   H H    . SER A 1 37 ? 12.665 0.732   23.915 1.00 0.00 ? 37 SER A H    1  
ATOM 536   H HA   . SER A 1 37 ? 12.630 -0.747  21.582 1.00 0.00 ? 37 SER A HA   1  
ATOM 537   H HB2  . SER A 1 37 ? 14.608 -0.419  23.084 1.00 0.00 ? 37 SER A HB2  1  
ATOM 538   H HB3  . SER A 1 37 ? 13.921 -1.619  24.177 1.00 0.00 ? 37 SER A HB3  1  
ATOM 539   H HG   . SER A 1 37 ? 15.454 -2.074  22.114 1.00 0.00 ? 37 SER A HG   1  
ATOM 540   N N    . LEU A 1 38 ? 11.005 -2.170  24.027 1.00 0.00 ? 38 LEU A N    1  
ATOM 541   C CA   . LEU A 1 38 ? 10.082 -3.248  24.366 1.00 0.00 ? 38 LEU A CA   1  
ATOM 542   C C    . LEU A 1 38 ? 9.013  -3.408  23.290 1.00 0.00 ? 38 LEU A C    1  
ATOM 543   O O    . LEU A 1 38 ? 8.844  -4.489  22.725 1.00 0.00 ? 38 LEU A O    1  
ATOM 544   C CB   . LEU A 1 38 ? 9.423  -2.974  25.720 1.00 0.00 ? 38 LEU A CB   1  
ATOM 545   C CG   . LEU A 1 38 ? 10.168 -3.499  26.947 1.00 0.00 ? 38 LEU A CG   1  
ATOM 546   C CD1  . LEU A 1 38 ? 10.265 -5.016  26.905 1.00 0.00 ? 38 LEU A CD1  1  
ATOM 547   C CD2  . LEU A 1 38 ? 11.553 -2.877  27.037 1.00 0.00 ? 38 LEU A CD2  1  
ATOM 548   H H    . LEU A 1 38 ? 11.155 -1.450  24.674 1.00 0.00 ? 38 LEU A H    1  
ATOM 549   H HA   . LEU A 1 38 ? 10.651 -4.163  24.431 1.00 0.00 ? 38 LEU A HA   1  
ATOM 550   H HB2  . LEU A 1 38 ? 9.320  -1.906  25.827 1.00 0.00 ? 38 LEU A HB2  1  
ATOM 551   H HB3  . LEU A 1 38 ? 8.442  -3.429  25.707 1.00 0.00 ? 38 LEU A HB3  1  
ATOM 552   H HG   . LEU A 1 38 ? 9.619  -3.225  27.838 1.00 0.00 ? 38 LEU A HG   1  
ATOM 553   H HD11 . LEU A 1 38 ? 9.651  -5.394  26.101 1.00 0.00 ? 38 LEU A HD11 1  
ATOM 554   H HD12 . LEU A 1 38 ? 9.920  -5.426  27.843 1.00 0.00 ? 38 LEU A HD12 1  
ATOM 555   H HD13 . LEU A 1 38 ? 11.292 -5.307  26.741 1.00 0.00 ? 38 LEU A HD13 1  
ATOM 556   H HD21 . LEU A 1 38 ? 12.094 -3.319  27.860 1.00 0.00 ? 38 LEU A HD21 1  
ATOM 557   H HD22 . LEU A 1 38 ? 11.460 -1.812  27.198 1.00 0.00 ? 38 LEU A HD22 1  
ATOM 558   H HD23 . LEU A 1 38 ? 12.089 -3.057  26.116 1.00 0.00 ? 38 LEU A HD23 1  
ATOM 559   N N    . ASP A 1 39 ? 8.296  -2.325  23.010 1.00 0.00 ? 39 ASP A N    1  
ATOM 560   C CA   . ASP A 1 39 ? 7.245  -2.345  21.999 1.00 0.00 ? 39 ASP A CA   1  
ATOM 561   C C    . ASP A 1 39 ? 7.776  -2.884  20.674 1.00 0.00 ? 39 ASP A C    1  
ATOM 562   O O    . ASP A 1 39 ? 7.154  -3.742  20.047 1.00 0.00 ? 39 ASP A O    1  
ATOM 563   C CB   . ASP A 1 39 ? 6.674  -0.940  21.800 1.00 0.00 ? 39 ASP A CB   1  
ATOM 564   C CG   . ASP A 1 39 ? 5.486  -0.926  20.858 1.00 0.00 ? 39 ASP A CG   1  
ATOM 565   O OD1  . ASP A 1 39 ? 5.699  -0.768  19.638 1.00 0.00 ? 39 ASP A OD1  1  
ATOM 566   O OD2  . ASP A 1 39 ? 4.343  -1.073  21.340 1.00 0.00 ? 39 ASP A OD2  1  
ATOM 567   H H    . ASP A 1 39 ? 8.478  -1.493  23.495 1.00 0.00 ? 39 ASP A H    1  
ATOM 568   H HA   . ASP A 1 39 ? 6.459  -2.996  22.350 1.00 0.00 ? 39 ASP A HA   1  
ATOM 569   H HB2  . ASP A 1 39 ? 6.356  -0.549  22.756 1.00 0.00 ? 39 ASP A HB2  1  
ATOM 570   H HB3  . ASP A 1 39 ? 7.442  -0.300  21.392 1.00 0.00 ? 39 ASP A HB3  1  
ATOM 571   N N    . THR A 1 40 ? 8.929  -2.374  20.253 1.00 0.00 ? 40 THR A N    1  
ATOM 572   C CA   . THR A 1 40 ? 9.542  -2.803  19.002 1.00 0.00 ? 40 THR A CA   1  
ATOM 573   C C    . THR A 1 40 ? 9.752  -4.312  18.982 1.00 0.00 ? 40 THR A C    1  
ATOM 574   O O    . THR A 1 40 ? 9.389  -4.987  18.018 1.00 0.00 ? 40 THR A O    1  
ATOM 575   C CB   . THR A 1 40 ? 10.896 -2.104  18.772 1.00 0.00 ? 40 THR A CB   1  
ATOM 576   O OG1  . THR A 1 40 ? 10.745 -0.687  18.910 1.00 0.00 ? 40 THR A OG1  1  
ATOM 577   C CG2  . THR A 1 40 ? 11.444 -2.429  17.391 1.00 0.00 ? 40 THR A CG2  1  
ATOM 578   H H    . THR A 1 40 ? 9.377  -1.693  20.797 1.00 0.00 ? 40 THR A H    1  
ATOM 579   H HA   . THR A 1 40 ? 8.878  -2.530  18.195 1.00 0.00 ? 40 THR A HA   1  
ATOM 580   H HB   . THR A 1 40 ? 11.597 -2.458  19.514 1.00 0.00 ? 40 THR A HB   1  
ATOM 581   H HG1  . THR A 1 40 ? 10.267 -0.341  18.153 1.00 0.00 ? 40 THR A HG1  1  
ATOM 582   H HG21 . THR A 1 40 ? 12.514 -2.284  17.385 1.00 0.00 ? 40 THR A HG21 1  
ATOM 583   H HG22 . THR A 1 40 ? 10.988 -1.778  16.660 1.00 0.00 ? 40 THR A HG22 1  
ATOM 584   H HG23 . THR A 1 40 ? 11.220 -3.457  17.148 1.00 0.00 ? 40 THR A HG23 1  
ATOM 585   N N    . VAL A 1 41 ? 10.340 -4.838  20.051 1.00 0.00 ? 41 VAL A N    1  
ATOM 586   C CA   . VAL A 1 41 ? 10.597 -6.270  20.157 1.00 0.00 ? 41 VAL A CA   1  
ATOM 587   C C    . VAL A 1 41 ? 9.307  -7.071  20.019 1.00 0.00 ? 41 VAL A C    1  
ATOM 588   O O    . VAL A 1 41 ? 9.222  -7.993  19.209 1.00 0.00 ? 41 VAL A O    1  
ATOM 589   C CB   . VAL A 1 41 ? 11.267 -6.622  21.498 1.00 0.00 ? 41 VAL A CB   1  
ATOM 590   C CG1  . VAL A 1 41 ? 11.560 -8.113  21.573 1.00 0.00 ? 41 VAL A CG1  1  
ATOM 591   C CG2  . VAL A 1 41 ? 12.539 -5.810  21.688 1.00 0.00 ? 41 VAL A CG2  1  
ATOM 592   H H    . VAL A 1 41 ? 10.607 -4.249  20.788 1.00 0.00 ? 41 VAL A H    1  
ATOM 593   H HA   . VAL A 1 41 ? 11.269 -6.548  19.358 1.00 0.00 ? 41 VAL A HA   1  
ATOM 594   H HB   . VAL A 1 41 ? 10.583 -6.373  22.296 1.00 0.00 ? 41 VAL A HB   1  
ATOM 595   H HG11 . VAL A 1 41 ? 12.137 -8.410  20.709 1.00 0.00 ? 41 VAL A HG11 1  
ATOM 596   H HG12 . VAL A 1 41 ? 12.120 -8.326  22.472 1.00 0.00 ? 41 VAL A HG12 1  
ATOM 597   H HG13 . VAL A 1 41 ? 10.630 -8.662  21.589 1.00 0.00 ? 41 VAL A HG13 1  
ATOM 598   H HG21 . VAL A 1 41 ? 12.659 -5.131  20.857 1.00 0.00 ? 41 VAL A HG21 1  
ATOM 599   H HG22 . VAL A 1 41 ? 12.473 -5.246  22.607 1.00 0.00 ? 41 VAL A HG22 1  
ATOM 600   H HG23 . VAL A 1 41 ? 13.388 -6.476  21.735 1.00 0.00 ? 41 VAL A HG23 1  
ATOM 601   N N    . GLU A 1 42 ? 8.305  -6.711  20.815 1.00 0.00 ? 42 GLU A N    1  
ATOM 602   C CA   . GLU A 1 42 ? 7.019  -7.397  20.782 1.00 0.00 ? 42 GLU A CA   1  
ATOM 603   C C    . GLU A 1 42 ? 6.469  -7.452  19.359 1.00 0.00 ? 42 GLU A C    1  
ATOM 604   O O    . GLU A 1 42 ? 6.098  -8.518  18.866 1.00 0.00 ? 42 GLU A O    1  
ATOM 605   C CB   . GLU A 1 42 ? 6.018  -6.696  21.701 1.00 0.00 ? 42 GLU A CB   1  
ATOM 606   C CG   . GLU A 1 42 ? 6.335  -6.853  23.179 1.00 0.00 ? 42 GLU A CG   1  
ATOM 607   C CD   . GLU A 1 42 ? 6.116  -8.269  23.675 1.00 0.00 ? 42 GLU A CD   1  
ATOM 608   O OE1  . GLU A 1 42 ? 5.741  -9.133  22.855 1.00 0.00 ? 42 GLU A OE1  1  
ATOM 609   O OE2  . GLU A 1 42 ? 6.320  -8.513  24.883 1.00 0.00 ? 42 GLU A OE2  1  
ATOM 610   H H    . GLU A 1 42 ? 8.434  -5.967  21.440 1.00 0.00 ? 42 GLU A H    1  
ATOM 611   H HA   . GLU A 1 42 ? 7.173  -8.406  21.134 1.00 0.00 ? 42 GLU A HA   1  
ATOM 612   H HB2  . GLU A 1 42 ? 6.008  -5.642  21.466 1.00 0.00 ? 42 GLU A HB2  1  
ATOM 613   H HB3  . GLU A 1 42 ? 5.035  -7.105  21.520 1.00 0.00 ? 42 GLU A HB3  1  
ATOM 614   H HG2  . GLU A 1 42 ? 7.368  -6.586  23.343 1.00 0.00 ? 42 GLU A HG2  1  
ATOM 615   H HG3  . GLU A 1 42 ? 5.698  -6.187  23.743 1.00 0.00 ? 42 GLU A HG3  1  
ATOM 616   N N    . LEU A 1 43 ? 6.418  -6.297  18.706 1.00 0.00 ? 43 LEU A N    1  
ATOM 617   C CA   . LEU A 1 43 ? 5.912  -6.211  17.341 1.00 0.00 ? 43 LEU A CA   1  
ATOM 618   C C    . LEU A 1 43 ? 6.674  -7.158  16.418 1.00 0.00 ? 43 LEU A C    1  
ATOM 619   O O    . LEU A 1 43 ? 6.073  -7.932  15.673 1.00 0.00 ? 43 LEU A O    1  
ATOM 620   C CB   . LEU A 1 43 ? 6.025  -4.776  16.823 1.00 0.00 ? 43 LEU A CB   1  
ATOM 621   C CG   . LEU A 1 43 ? 4.796  -3.890  17.031 1.00 0.00 ? 43 LEU A CG   1  
ATOM 622   C CD1  . LEU A 1 43 ? 3.584  -4.485  16.332 1.00 0.00 ? 43 LEU A CD1  1  
ATOM 623   C CD2  . LEU A 1 43 ? 4.520  -3.702  18.515 1.00 0.00 ? 43 LEU A CD2  1  
ATOM 624   H H    . LEU A 1 43 ? 6.727  -5.481  19.152 1.00 0.00 ? 43 LEU A H    1  
ATOM 625   H HA   . LEU A 1 43 ? 4.872  -6.500  17.354 1.00 0.00 ? 43 LEU A HA   1  
ATOM 626   H HB2  . LEU A 1 43 ? 6.858  -4.309  17.324 1.00 0.00 ? 43 LEU A HB2  1  
ATOM 627   H HB3  . LEU A 1 43 ? 6.225  -4.823  15.762 1.00 0.00 ? 43 LEU A HB3  1  
ATOM 628   H HG   . LEU A 1 43 ? 4.986  -2.916  16.599 1.00 0.00 ? 43 LEU A HG   1  
ATOM 629   H HD11 . LEU A 1 43 ? 3.274  -3.831  15.531 1.00 0.00 ? 43 LEU A HD11 1  
ATOM 630   H HD12 . LEU A 1 43 ? 2.777  -4.593  17.041 1.00 0.00 ? 43 LEU A HD12 1  
ATOM 631   H HD13 . LEU A 1 43 ? 3.841  -5.453  15.928 1.00 0.00 ? 43 LEU A HD13 1  
ATOM 632   H HD21 . LEU A 1 43 ? 3.538  -3.271  18.646 1.00 0.00 ? 43 LEU A HD21 1  
ATOM 633   H HD22 . LEU A 1 43 ? 5.262  -3.041  18.939 1.00 0.00 ? 43 LEU A HD22 1  
ATOM 634   H HD23 . LEU A 1 43 ? 4.562  -4.659  19.014 1.00 0.00 ? 43 LEU A HD23 1  
ATOM 635   N N    . VAL A 1 44 ? 8.000  -7.092  16.475 1.00 0.00 ? 44 VAL A N    1  
ATOM 636   C CA   . VAL A 1 44 ? 8.844  -7.945  15.647 1.00 0.00 ? 44 VAL A CA   1  
ATOM 637   C C    . VAL A 1 44 ? 8.472  -9.414  15.814 1.00 0.00 ? 44 VAL A C    1  
ATOM 638   O O    . VAL A 1 44 ? 8.297  -10.136 14.833 1.00 0.00 ? 44 VAL A O    1  
ATOM 639   C CB   . VAL A 1 44 ? 10.335 -7.762  15.989 1.00 0.00 ? 44 VAL A CB   1  
ATOM 640   C CG1  . VAL A 1 44 ? 11.196 -8.671  15.126 1.00 0.00 ? 44 VAL A CG1  1  
ATOM 641   C CG2  . VAL A 1 44 ? 10.745 -6.307  15.820 1.00 0.00 ? 44 VAL A CG2  1  
ATOM 642   H H    . VAL A 1 44 ? 8.421  -6.455  17.088 1.00 0.00 ? 44 VAL A H    1  
ATOM 643   H HA   . VAL A 1 44 ? 8.696  -7.661  14.615 1.00 0.00 ? 44 VAL A HA   1  
ATOM 644   H HB   . VAL A 1 44 ? 10.482 -8.038  17.023 1.00 0.00 ? 44 VAL A HB   1  
ATOM 645   H HG11 . VAL A 1 44 ? 10.971 -9.702  15.354 1.00 0.00 ? 44 VAL A HG11 1  
ATOM 646   H HG12 . VAL A 1 44 ? 10.991 -8.478  14.083 1.00 0.00 ? 44 VAL A HG12 1  
ATOM 647   H HG13 . VAL A 1 44 ? 12.239 -8.477  15.330 1.00 0.00 ? 44 VAL A HG13 1  
ATOM 648   H HG21 . VAL A 1 44 ? 9.895  -5.731  15.484 1.00 0.00 ? 44 VAL A HG21 1  
ATOM 649   H HG22 . VAL A 1 44 ? 11.091 -5.918  16.767 1.00 0.00 ? 44 VAL A HG22 1  
ATOM 650   H HG23 . VAL A 1 44 ? 11.538 -6.238  15.092 1.00 0.00 ? 44 VAL A HG23 1  
ATOM 651   N N    . MET A 1 45 ? 8.353  -9.850  17.064 1.00 0.00 ? 45 MET A N    1  
ATOM 652   C CA   . MET A 1 45 ? 8.000  -11.234 17.360 1.00 0.00 ? 45 MET A CA   1  
ATOM 653   C C    . MET A 1 45 ? 6.647  -11.591 16.754 1.00 0.00 ? 45 MET A C    1  
ATOM 654   O O    . MET A 1 45 ? 6.488  -12.650 16.148 1.00 0.00 ? 45 MET A O    1  
ATOM 655   C CB   . MET A 1 45 ? 7.971  -11.463 18.872 1.00 0.00 ? 45 MET A CB   1  
ATOM 656   C CG   . MET A 1 45 ? 9.342  -11.730 19.473 1.00 0.00 ? 45 MET A CG   1  
ATOM 657   S SD   . MET A 1 45 ? 10.005 -13.339 19.002 1.00 0.00 ? 45 MET A SD   1  
ATOM 658   C CE   . MET A 1 45 ? 10.269 -14.081 20.611 1.00 0.00 ? 45 MET A CE   1  
ATOM 659   H H    . MET A 1 45 ? 8.505  -9.227  17.805 1.00 0.00 ? 45 MET A H    1  
ATOM 660   H HA   . MET A 1 45 ? 8.756  -11.869 16.923 1.00 0.00 ? 45 MET A HA   1  
ATOM 661   H HB2  . MET A 1 45 ? 7.558  -10.587 19.349 1.00 0.00 ? 45 MET A HB2  1  
ATOM 662   H HB3  . MET A 1 45 ? 7.338  -12.311 19.084 1.00 0.00 ? 45 MET A HB3  1  
ATOM 663   H HG2  . MET A 1 45 ? 10.024 -10.963 19.136 1.00 0.00 ? 45 MET A HG2  1  
ATOM 664   H HG3  . MET A 1 45 ? 9.262  -11.689 20.549 1.00 0.00 ? 45 MET A HG3  1  
ATOM 665   H HE1  . MET A 1 45 ? 9.797  -15.052 20.642 1.00 0.00 ? 45 MET A HE1  1  
ATOM 666   H HE2  . MET A 1 45 ? 11.329 -14.189 20.787 1.00 0.00 ? 45 MET A HE2  1  
ATOM 667   H HE3  . MET A 1 45 ? 9.839  -13.447 21.373 1.00 0.00 ? 45 MET A HE3  1  
ATOM 668   N N    . ALA A 1 46 ? 5.675  -10.700 16.922 1.00 0.00 ? 46 ALA A N    1  
ATOM 669   C CA   . ALA A 1 46 ? 4.336  -10.922 16.389 1.00 0.00 ? 46 ALA A CA   1  
ATOM 670   C C    . ALA A 1 46 ? 4.376  -11.163 14.884 1.00 0.00 ? 46 ALA A C    1  
ATOM 671   O O    . ALA A 1 46 ? 3.822  -12.144 14.387 1.00 0.00 ? 46 ALA A O    1  
ATOM 672   C CB   . ALA A 1 46 ? 3.437  -9.737  16.712 1.00 0.00 ? 46 ALA A CB   1  
ATOM 673   H H    . ALA A 1 46 ? 5.863  -9.874  17.414 1.00 0.00 ? 46 ALA A H    1  
ATOM 674   H HA   . ALA A 1 46 ? 3.925  -11.796 16.873 1.00 0.00 ? 46 ALA A HA   1  
ATOM 675   H HB1  . ALA A 1 46 ? 4.035  -8.931  17.110 1.00 0.00 ? 46 ALA A HB1  1  
ATOM 676   H HB2  . ALA A 1 46 ? 2.940  -9.407  15.812 1.00 0.00 ? 46 ALA A HB2  1  
ATOM 677   H HB3  . ALA A 1 46 ? 2.700  -10.034 17.443 1.00 0.00 ? 46 ALA A HB3  1  
ATOM 678   N N    . PHE A 1 47 ? 5.035  -10.262 14.163 1.00 0.00 ? 47 PHE A N    1  
ATOM 679   C CA   . PHE A 1 47 ? 5.146  -10.376 12.713 1.00 0.00 ? 47 PHE A CA   1  
ATOM 680   C C    . PHE A 1 47 ? 5.884  -11.654 12.323 1.00 0.00 ? 47 PHE A C    1  
ATOM 681   O O    . PHE A 1 47 ? 5.514  -12.327 11.362 1.00 0.00 ? 47 PHE A O    1  
ATOM 682   C CB   . PHE A 1 47 ? 5.873  -9.159  12.139 1.00 0.00 ? 47 PHE A CB   1  
ATOM 683   C CG   . PHE A 1 47 ? 5.268  -7.848  12.553 1.00 0.00 ? 47 PHE A CG   1  
ATOM 684   C CD1  . PHE A 1 47 ? 3.896  -7.657  12.505 1.00 0.00 ? 47 PHE A CD1  1  
ATOM 685   C CD2  . PHE A 1 47 ? 6.070  -6.807  12.992 1.00 0.00 ? 47 PHE A CD2  1  
ATOM 686   C CE1  . PHE A 1 47 ? 3.337  -6.452  12.885 1.00 0.00 ? 47 PHE A CE1  1  
ATOM 687   C CE2  . PHE A 1 47 ? 5.516  -5.600  13.374 1.00 0.00 ? 47 PHE A CE2  1  
ATOM 688   C CZ   . PHE A 1 47 ? 4.147  -5.423  13.321 1.00 0.00 ? 47 PHE A CZ   1  
ATOM 689   H H    . PHE A 1 47 ? 5.456  -9.502  14.616 1.00 0.00 ? 47 PHE A H    1  
ATOM 690   H HA   . PHE A 1 47 ? 4.147  -10.413 12.307 1.00 0.00 ? 47 PHE A HA   1  
ATOM 691   H HB2  . PHE A 1 47 ? 6.899  -9.170  12.474 1.00 0.00 ? 47 PHE A HB2  1  
ATOM 692   H HB3  . PHE A 1 47 ? 5.850  -9.210  11.061 1.00 0.00 ? 47 PHE A HB3  1  
ATOM 693   H HD1  . PHE A 1 47 ? 3.261  -8.462  12.165 1.00 0.00 ? 47 PHE A HD1  1  
ATOM 694   H HD2  . PHE A 1 47 ? 7.141  -6.945  13.034 1.00 0.00 ? 47 PHE A HD2  1  
ATOM 695   H HE1  . PHE A 1 47 ? 2.266  -6.316  12.843 1.00 0.00 ? 47 PHE A HE1  1  
ATOM 696   H HE2  . PHE A 1 47 ? 6.153  -4.797  13.715 1.00 0.00 ? 47 PHE A HE2  1  
ATOM 697   H HZ   . PHE A 1 47 ? 3.712  -4.480  13.618 1.00 0.00 ? 47 PHE A HZ   1  
ATOM 698   N N    . GLU A 1 48 ? 6.929  -11.980 13.077 1.00 0.00 ? 48 GLU A N    1  
ATOM 699   C CA   . GLU A 1 48 ? 7.720  -13.176 12.809 1.00 0.00 ? 48 GLU A CA   1  
ATOM 700   C C    . GLU A 1 48 ? 6.859  -14.432 12.912 1.00 0.00 ? 48 GLU A C    1  
ATOM 701   O O    . GLU A 1 48 ? 6.975  -15.345 12.096 1.00 0.00 ? 48 GLU A O    1  
ATOM 702   C CB   . GLU A 1 48 ? 8.894  -13.268 13.786 1.00 0.00 ? 48 GLU A CB   1  
ATOM 703   C CG   . GLU A 1 48 ? 10.193 -13.714 13.136 1.00 0.00 ? 48 GLU A CG   1  
ATOM 704   C CD   . GLU A 1 48 ? 11.191 -14.257 14.140 1.00 0.00 ? 48 GLU A CD   1  
ATOM 705   O OE1  . GLU A 1 48 ? 11.762 -13.449 14.903 1.00 0.00 ? 48 GLU A OE1  1  
ATOM 706   O OE2  . GLU A 1 48 ? 11.401 -15.487 14.163 1.00 0.00 ? 48 GLU A OE2  1  
ATOM 707   H H    . GLU A 1 48 ? 7.175  -11.403 13.830 1.00 0.00 ? 48 GLU A H    1  
ATOM 708   H HA   . GLU A 1 48 ? 8.105  -13.100 11.803 1.00 0.00 ? 48 GLU A HA   1  
ATOM 709   H HB2  . GLU A 1 48 ? 9.053  -12.296 14.231 1.00 0.00 ? 48 GLU A HB2  1  
ATOM 710   H HB3  . GLU A 1 48 ? 8.644  -13.973 14.564 1.00 0.00 ? 48 GLU A HB3  1  
ATOM 711   H HG2  . GLU A 1 48 ? 9.973  -14.488 12.416 1.00 0.00 ? 48 GLU A HG2  1  
ATOM 712   H HG3  . GLU A 1 48 ? 10.636 -12.869 12.630 1.00 0.00 ? 48 GLU A HG3  1  
ATOM 713   N N    . GLU A 1 49 ? 5.995  -14.469 13.923 1.00 0.00 ? 49 GLU A N    1  
ATOM 714   C CA   . GLU A 1 49 ? 5.116  -15.612 14.134 1.00 0.00 ? 49 GLU A CA   1  
ATOM 715   C C    . GLU A 1 49 ? 3.968  -15.609 13.128 1.00 0.00 ? 49 GLU A C    1  
ATOM 716   O O    . GLU A 1 49 ? 3.493  -16.665 12.710 1.00 0.00 ? 49 GLU A O    1  
ATOM 717   C CB   . GLU A 1 49 ? 4.559  -15.600 15.559 1.00 0.00 ? 49 GLU A CB   1  
ATOM 718   C CG   . GLU A 1 49 ? 4.425  -16.984 16.172 1.00 0.00 ? 49 GLU A CG   1  
ATOM 719   C CD   . GLU A 1 49 ? 5.106  -17.092 17.523 1.00 0.00 ? 49 GLU A CD   1  
ATOM 720   O OE1  . GLU A 1 49 ? 4.639  -16.437 18.477 1.00 0.00 ? 49 GLU A OE1  1  
ATOM 721   O OE2  . GLU A 1 49 ? 6.107  -17.832 17.624 1.00 0.00 ? 49 GLU A OE2  1  
ATOM 722   H H    . GLU A 1 49 ? 5.949  -13.709 14.540 1.00 0.00 ? 49 GLU A H    1  
ATOM 723   H HA   . GLU A 1 49 ? 5.699  -16.510 13.993 1.00 0.00 ? 49 GLU A HA   1  
ATOM 724   H HB2  . GLU A 1 49 ? 5.216  -15.013 16.184 1.00 0.00 ? 49 GLU A HB2  1  
ATOM 725   H HB3  . GLU A 1 49 ? 3.583  -15.139 15.546 1.00 0.00 ? 49 GLU A HB3  1  
ATOM 726   H HG2  . GLU A 1 49 ? 3.376  -17.209 16.296 1.00 0.00 ? 49 GLU A HG2  1  
ATOM 727   H HG3  . GLU A 1 49 ? 4.870  -17.705 15.502 1.00 0.00 ? 49 GLU A HG3  1  
ATOM 728   N N    . GLU A 1 50 ? 3.528  -14.415 12.744 1.00 0.00 ? 50 GLU A N    1  
ATOM 729   C CA   . GLU A 1 50 ? 2.436  -14.275 11.789 1.00 0.00 ? 50 GLU A CA   1  
ATOM 730   C C    . GLU A 1 50 ? 2.836  -14.820 10.421 1.00 0.00 ? 50 GLU A C    1  
ATOM 731   O O    . GLU A 1 50 ? 2.147  -15.668 9.852  1.00 0.00 ? 50 GLU A O    1  
ATOM 732   C CB   . GLU A 1 50 ? 2.023  -12.807 11.664 1.00 0.00 ? 50 GLU A CB   1  
ATOM 733   C CG   . GLU A 1 50 ? 1.065  -12.349 12.750 1.00 0.00 ? 50 GLU A CG   1  
ATOM 734   C CD   . GLU A 1 50 ? -0.389 -12.559 12.371 1.00 0.00 ? 50 GLU A CD   1  
ATOM 735   O OE1  . GLU A 1 50 ? -0.752 -13.700 12.017 1.00 0.00 ? 50 GLU A OE1  1  
ATOM 736   O OE2  . GLU A 1 50 ? -1.163 -11.581 12.430 1.00 0.00 ? 50 GLU A OE2  1  
ATOM 737   H H    . GLU A 1 50 ? 3.948  -13.610 13.113 1.00 0.00 ? 50 GLU A H    1  
ATOM 738   H HA   . GLU A 1 50 ? 1.597  -14.844 12.158 1.00 0.00 ? 50 GLU A HA   1  
ATOM 739   H HB2  . GLU A 1 50 ? 2.909  -12.191 11.711 1.00 0.00 ? 50 GLU A HB2  1  
ATOM 740   H HB3  . GLU A 1 50 ? 1.546  -12.660 10.706 1.00 0.00 ? 50 GLU A HB3  1  
ATOM 741   H HG2  . GLU A 1 50 ? 1.269  -12.907 13.651 1.00 0.00 ? 50 GLU A HG2  1  
ATOM 742   H HG3  . GLU A 1 50 ? 1.225  -11.297 12.935 1.00 0.00 ? 50 GLU A HG3  1  
ATOM 743   N N    . PHE A 1 51 ? 3.954  -14.328 9.898  1.00 0.00 ? 51 PHE A N    1  
ATOM 744   C CA   . PHE A 1 51 ? 4.446  -14.764 8.596  1.00 0.00 ? 51 PHE A CA   1  
ATOM 745   C C    . PHE A 1 51 ? 5.169  -16.103 8.709  1.00 0.00 ? 51 PHE A C    1  
ATOM 746   O O    . PHE A 1 51 ? 5.265  -16.852 7.738  1.00 0.00 ? 51 PHE A O    1  
ATOM 747   C CB   . PHE A 1 51 ? 5.387  -13.712 8.005  1.00 0.00 ? 51 PHE A CB   1  
ATOM 748   C CG   . PHE A 1 51 ? 4.682  -12.467 7.548  1.00 0.00 ? 51 PHE A CG   1  
ATOM 749   C CD1  . PHE A 1 51 ? 4.138  -11.585 8.468  1.00 0.00 ? 51 PHE A CD1  1  
ATOM 750   C CD2  . PHE A 1 51 ? 4.563  -12.178 6.198  1.00 0.00 ? 51 PHE A CD2  1  
ATOM 751   C CE1  . PHE A 1 51 ? 3.489  -10.438 8.051  1.00 0.00 ? 51 PHE A CE1  1  
ATOM 752   C CE2  . PHE A 1 51 ? 3.916  -11.032 5.775  1.00 0.00 ? 51 PHE A CE2  1  
ATOM 753   C CZ   . PHE A 1 51 ? 3.377  -10.162 6.702  1.00 0.00 ? 51 PHE A CZ   1  
ATOM 754   H H    . PHE A 1 51 ? 4.460  -13.654 10.399 1.00 0.00 ? 51 PHE A H    1  
ATOM 755   H HA   . PHE A 1 51 ? 3.595  -14.881 7.944  1.00 0.00 ? 51 PHE A HA   1  
ATOM 756   H HB2  . PHE A 1 51 ? 6.112  -13.427 8.752  1.00 0.00 ? 51 PHE A HB2  1  
ATOM 757   H HB3  . PHE A 1 51 ? 5.899  -14.136 7.154  1.00 0.00 ? 51 PHE A HB3  1  
ATOM 758   H HD1  . PHE A 1 51 ? 4.225  -11.801 9.524  1.00 0.00 ? 51 PHE A HD1  1  
ATOM 759   H HD2  . PHE A 1 51 ? 4.983  -12.858 5.471  1.00 0.00 ? 51 PHE A HD2  1  
ATOM 760   H HE1  . PHE A 1 51 ? 3.069  -9.760  8.779  1.00 0.00 ? 51 PHE A HE1  1  
ATOM 761   H HE2  . PHE A 1 51 ? 3.829  -10.819 4.720  1.00 0.00 ? 51 PHE A HE2  1  
ATOM 762   H HZ   . PHE A 1 51 ? 2.871  -9.267  6.374  1.00 0.00 ? 51 PHE A HZ   1  
ATOM 763   N N    . GLY A 1 52 ? 5.677  -16.396 9.902  1.00 0.00 ? 52 GLY A N    1  
ATOM 764   C CA   . GLY A 1 52 ? 6.385  -17.644 10.120 1.00 0.00 ? 52 GLY A CA   1  
ATOM 765   C C    . GLY A 1 52 ? 7.804  -17.606 9.588  1.00 0.00 ? 52 GLY A C    1  
ATOM 766   O O    . GLY A 1 52 ? 8.188  -18.438 8.766  1.00 0.00 ? 52 GLY A O    1  
ATOM 767   H H    . GLY A 1 52 ? 5.570  -15.760 10.640 1.00 0.00 ? 52 GLY A H    1  
ATOM 768   H HA2  . GLY A 1 52 ? 6.415  -17.848 11.180 1.00 0.00 ? 52 GLY A HA2  1  
ATOM 769   H HA3  . GLY A 1 52 ? 5.849  -18.440 9.626  1.00 0.00 ? 52 GLY A HA3  1  
ATOM 770   N N    . VAL A 1 53 ? 8.584  -16.637 10.055 1.00 0.00 ? 53 VAL A N    1  
ATOM 771   C CA   . VAL A 1 53 ? 9.969  -16.494 9.620  1.00 0.00 ? 53 VAL A CA   1  
ATOM 772   C C    . VAL A 1 53 ? 10.929 -16.598 10.800 1.00 0.00 ? 53 VAL A C    1  
ATOM 773   O O    . VAL A 1 53 ? 10.505 -16.729 11.947 1.00 0.00 ? 53 VAL A O    1  
ATOM 774   C CB   . VAL A 1 53 ? 10.195 -15.148 8.905  1.00 0.00 ? 53 VAL A CB   1  
ATOM 775   C CG1  . VAL A 1 53 ? 9.338  -15.058 7.652  1.00 0.00 ? 53 VAL A CG1  1  
ATOM 776   C CG2  . VAL A 1 53 ? 9.903  -13.989 9.846  1.00 0.00 ? 53 VAL A CG2  1  
ATOM 777   H H    . VAL A 1 53 ? 8.221  -16.004 10.709 1.00 0.00 ? 53 VAL A H    1  
ATOM 778   H HA   . VAL A 1 53 ? 10.183 -17.289 8.922  1.00 0.00 ? 53 VAL A HA   1  
ATOM 779   H HB   . VAL A 1 53 ? 11.233 -15.091 8.610  1.00 0.00 ? 53 VAL A HB   1  
ATOM 780   H HG11 . VAL A 1 53 ? 9.211  -14.021 7.378  1.00 0.00 ? 53 VAL A HG11 1  
ATOM 781   H HG12 . VAL A 1 53 ? 9.821  -15.589 6.846  1.00 0.00 ? 53 VAL A HG12 1  
ATOM 782   H HG13 . VAL A 1 53 ? 8.371  -15.499 7.846  1.00 0.00 ? 53 VAL A HG13 1  
ATOM 783   H HG21 . VAL A 1 53 ? 9.095  -14.260 10.510 1.00 0.00 ? 53 VAL A HG21 1  
ATOM 784   H HG22 . VAL A 1 53 ? 10.786 -13.765 10.428 1.00 0.00 ? 53 VAL A HG22 1  
ATOM 785   H HG23 . VAL A 1 53 ? 9.622  -13.120 9.271  1.00 0.00 ? 53 VAL A HG23 1  
ATOM 786   N N    . GLU A 1 54 ? 12.225 -16.540 10.508 1.00 0.00 ? 54 GLU A N    1  
ATOM 787   C CA   . GLU A 1 54 ? 13.245 -16.628 11.545 1.00 0.00 ? 54 GLU A CA   1  
ATOM 788   C C    . GLU A 1 54 ? 14.313 -15.556 11.351 1.00 0.00 ? 54 GLU A C    1  
ATOM 789   O O    . GLU A 1 54 ? 15.100 -15.612 10.405 1.00 0.00 ? 54 GLU A O    1  
ATOM 790   C CB   . GLU A 1 54 ? 13.893 -18.015 11.538 1.00 0.00 ? 54 GLU A CB   1  
ATOM 791   C CG   . GLU A 1 54 ? 12.961 -19.124 11.996 1.00 0.00 ? 54 GLU A CG   1  
ATOM 792   C CD   . GLU A 1 54 ? 13.633 -20.483 12.008 1.00 0.00 ? 54 GLU A CD   1  
ATOM 793   O OE1  . GLU A 1 54 ? 14.452 -20.730 12.918 1.00 0.00 ? 54 GLU A OE1  1  
ATOM 794   O OE2  . GLU A 1 54 ? 13.341 -21.298 11.109 1.00 0.00 ? 54 GLU A OE2  1  
ATOM 795   H H    . GLU A 1 54 ? 12.500 -16.435 9.573  1.00 0.00 ? 54 GLU A H    1  
ATOM 796   H HA   . GLU A 1 54 ? 12.764 -16.471 12.498 1.00 0.00 ? 54 GLU A HA   1  
ATOM 797   H HB2  . GLU A 1 54 ? 14.221 -18.240 10.534 1.00 0.00 ? 54 GLU A HB2  1  
ATOM 798   H HB3  . GLU A 1 54 ? 14.751 -18.001 12.193 1.00 0.00 ? 54 GLU A HB3  1  
ATOM 799   H HG2  . GLU A 1 54 ? 12.619 -18.900 12.995 1.00 0.00 ? 54 GLU A HG2  1  
ATOM 800   H HG3  . GLU A 1 54 ? 12.113 -19.164 11.327 1.00 0.00 ? 54 GLU A HG3  1  
ATOM 801   N N    . ILE A 1 55 ? 14.334 -14.579 12.252 1.00 0.00 ? 55 ILE A N    1  
ATOM 802   C CA   . ILE A 1 55 ? 15.304 -13.495 12.181 1.00 0.00 ? 55 ILE A CA   1  
ATOM 803   C C    . ILE A 1 55 ? 16.118 -13.399 13.467 1.00 0.00 ? 55 ILE A C    1  
ATOM 804   O O    . ILE A 1 55 ? 15.687 -13.829 14.537 1.00 0.00 ? 55 ILE A O    1  
ATOM 805   C CB   . ILE A 1 55 ? 14.617 -12.141 11.920 1.00 0.00 ? 55 ILE A CB   1  
ATOM 806   C CG1  . ILE A 1 55 ? 13.390 -11.985 12.820 1.00 0.00 ? 55 ILE A CG1  1  
ATOM 807   C CG2  . ILE A 1 55 ? 14.225 -12.020 10.455 1.00 0.00 ? 55 ILE A CG2  1  
ATOM 808   C CD1  . ILE A 1 55 ? 12.700 -10.647 12.674 1.00 0.00 ? 55 ILE A CD1  1  
ATOM 809   H H    . ILE A 1 55 ? 13.681 -14.590 12.983 1.00 0.00 ? 55 ILE A H    1  
ATOM 810   H HA   . ILE A 1 55 ? 15.974 -13.700 11.358 1.00 0.00 ? 55 ILE A HA   1  
ATOM 811   H HB   . ILE A 1 55 ? 15.322 -11.355 12.145 1.00 0.00 ? 55 ILE A HB   1  
ATOM 812   H HG12 . ILE A 1 55 ? 12.674 -12.755 12.578 1.00 0.00 ? 55 ILE A HG12 1  
ATOM 813   H HG13 . ILE A 1 55 ? 13.693 -12.093 13.851 1.00 0.00 ? 55 ILE A HG13 1  
ATOM 814   H HG21 . ILE A 1 55 ? 15.112 -12.068 9.840  1.00 0.00 ? 55 ILE A HG21 1  
ATOM 815   H HG22 . ILE A 1 55 ? 13.562 -12.830 10.192 1.00 0.00 ? 55 ILE A HG22 1  
ATOM 816   H HG23 . ILE A 1 55 ? 13.726 -11.077 10.292 1.00 0.00 ? 55 ILE A HG23 1  
ATOM 817   H HD11 . ILE A 1 55 ? 11.955 -10.539 13.450 1.00 0.00 ? 55 ILE A HD11 1  
ATOM 818   H HD12 . ILE A 1 55 ? 13.428 -9.855  12.760 1.00 0.00 ? 55 ILE A HD12 1  
ATOM 819   H HD13 . ILE A 1 55 ? 12.221 -10.593 11.707 1.00 0.00 ? 55 ILE A HD13 1  
ATOM 820   N N    . PRO A 1 56 ? 17.323 -12.820 13.363 1.00 0.00 ? 56 PRO A N    1  
ATOM 821   C CA   . PRO A 1 56 ? 18.223 -12.652 14.508 1.00 0.00 ? 56 PRO A CA   1  
ATOM 822   C C    . PRO A 1 56 ? 17.705 -11.621 15.505 1.00 0.00 ? 56 PRO A C    1  
ATOM 823   O O    . PRO A 1 56 ? 16.737 -10.911 15.232 1.00 0.00 ? 56 PRO A O    1  
ATOM 824   C CB   . PRO A 1 56 ? 19.526 -12.170 13.868 1.00 0.00 ? 56 PRO A CB   1  
ATOM 825   C CG   . PRO A 1 56 ? 19.106 -11.521 12.595 1.00 0.00 ? 56 PRO A CG   1  
ATOM 826   C CD   . PRO A 1 56 ? 17.901 -12.285 12.119 1.00 0.00 ? 56 PRO A CD   1  
ATOM 827   H HA   . PRO A 1 56 ? 18.395 -13.589 15.018 1.00 0.00 ? 56 PRO A HA   1  
ATOM 828   H HB2  . PRO A 1 56 ? 20.016 -11.467 14.528 1.00 0.00 ? 56 PRO A HB2  1  
ATOM 829   H HB3  . PRO A 1 56 ? 20.176 -13.012 13.686 1.00 0.00 ? 56 PRO A HB3  1  
ATOM 830   H HG2  . PRO A 1 56 ? 18.847 -10.489 12.777 1.00 0.00 ? 56 PRO A HG2  1  
ATOM 831   H HG3  . PRO A 1 56 ? 19.902 -11.587 11.869 1.00 0.00 ? 56 PRO A HG3  1  
ATOM 832   H HD2  . PRO A 1 56 ? 17.206 -11.623 11.624 1.00 0.00 ? 56 PRO A HD2  1  
ATOM 833   H HD3  . PRO A 1 56 ? 18.200 -13.085 11.457 1.00 0.00 ? 56 PRO A HD3  1  
ATOM 834   N N    . ASP A 1 57 ? 18.355 -11.544 16.661 1.00 0.00 ? 57 ASP A N    1  
ATOM 835   C CA   . ASP A 1 57 ? 17.961 -10.598 17.698 1.00 0.00 ? 57 ASP A CA   1  
ATOM 836   C C    . ASP A 1 57 ? 18.347 -9.174  17.310 1.00 0.00 ? 57 ASP A C    1  
ATOM 837   O O    . ASP A 1 57 ? 17.600 -8.227  17.562 1.00 0.00 ? 57 ASP A O    1  
ATOM 838   C CB   . ASP A 1 57 ? 18.612 -10.970 19.032 1.00 0.00 ? 57 ASP A CB   1  
ATOM 839   C CG   . ASP A 1 57 ? 17.919 -10.323 20.215 1.00 0.00 ? 57 ASP A CG   1  
ATOM 840   O OD1  . ASP A 1 57 ? 16.716 -10.593 20.417 1.00 0.00 ? 57 ASP A OD1  1  
ATOM 841   O OD2  . ASP A 1 57 ? 18.578 -9.547  20.938 1.00 0.00 ? 57 ASP A OD2  1  
ATOM 842   H H    . ASP A 1 57 ? 19.119 -12.137 16.820 1.00 0.00 ? 57 ASP A H    1  
ATOM 843   H HA   . ASP A 1 57 ? 16.888 -10.650 17.805 1.00 0.00 ? 57 ASP A HA   1  
ATOM 844   H HB2  . ASP A 1 57 ? 18.572 -12.042 19.157 1.00 0.00 ? 57 ASP A HB2  1  
ATOM 845   H HB3  . ASP A 1 57 ? 19.643 -10.650 19.023 1.00 0.00 ? 57 ASP A HB3  1  
ATOM 846   N N    . ASP A 1 58 ? 19.516 -9.029  16.697 1.00 0.00 ? 58 ASP A N    1  
ATOM 847   C CA   . ASP A 1 58 ? 20.001 -7.721  16.273 1.00 0.00 ? 58 ASP A CA   1  
ATOM 848   C C    . ASP A 1 58 ? 19.005 -7.051  15.332 1.00 0.00 ? 58 ASP A C    1  
ATOM 849   O O    . ASP A 1 58 ? 18.956 -5.825  15.235 1.00 0.00 ? 58 ASP A O    1  
ATOM 850   C CB   . ASP A 1 58 ? 21.360 -7.855  15.585 1.00 0.00 ? 58 ASP A CB   1  
ATOM 851   C CG   . ASP A 1 58 ? 22.508 -7.897  16.575 1.00 0.00 ? 58 ASP A CG   1  
ATOM 852   O OD1  . ASP A 1 58 ? 22.317 -8.441  17.683 1.00 0.00 ? 58 ASP A OD1  1  
ATOM 853   O OD2  . ASP A 1 58 ? 23.598 -7.385  16.242 1.00 0.00 ? 58 ASP A OD2  1  
ATOM 854   H H    . ASP A 1 58 ? 20.066 -9.822  16.524 1.00 0.00 ? 58 ASP A H    1  
ATOM 855   H HA   . ASP A 1 58 ? 20.113 -7.108  17.154 1.00 0.00 ? 58 ASP A HA   1  
ATOM 856   H HB2  . ASP A 1 58 ? 21.375 -8.767  15.007 1.00 0.00 ? 58 ASP A HB2  1  
ATOM 857   H HB3  . ASP A 1 58 ? 21.508 -7.013  14.926 1.00 0.00 ? 58 ASP A HB3  1  
ATOM 858   N N    . ALA A 1 59 ? 18.214 -7.864  14.640 1.00 0.00 ? 59 ALA A N    1  
ATOM 859   C CA   . ALA A 1 59 ? 17.218 -7.349  13.707 1.00 0.00 ? 59 ALA A CA   1  
ATOM 860   C C    . ALA A 1 59 ? 16.335 -6.299  14.371 1.00 0.00 ? 59 ALA A C    1  
ATOM 861   O O    . ALA A 1 59 ? 16.099 -5.229  13.811 1.00 0.00 ? 59 ALA A O    1  
ATOM 862   C CB   . ALA A 1 59 ? 16.369 -8.487  13.161 1.00 0.00 ? 59 ALA A CB   1  
ATOM 863   H H    . ALA A 1 59 ? 18.300 -8.832  14.760 1.00 0.00 ? 59 ALA A H    1  
ATOM 864   H HA   . ALA A 1 59 ? 17.741 -6.894  12.879 1.00 0.00 ? 59 ALA A HA   1  
ATOM 865   H HB1  . ALA A 1 59 ? 16.960 -9.081  12.479 1.00 0.00 ? 59 ALA A HB1  1  
ATOM 866   H HB2  . ALA A 1 59 ? 16.030 -9.107  13.978 1.00 0.00 ? 59 ALA A HB2  1  
ATOM 867   H HB3  . ALA A 1 59 ? 15.516 -8.081  12.639 1.00 0.00 ? 59 ALA A HB3  1  
ATOM 868   N N    . ALA A 1 60 ? 15.849 -6.612  15.568 1.00 0.00 ? 60 ALA A N    1  
ATOM 869   C CA   . ALA A 1 60 ? 14.992 -5.694  16.308 1.00 0.00 ? 60 ALA A CA   1  
ATOM 870   C C    . ALA A 1 60 ? 15.671 -4.342  16.499 1.00 0.00 ? 60 ALA A C    1  
ATOM 871   O O    . ALA A 1 60 ? 15.005 -3.320  16.655 1.00 0.00 ? 60 ALA A O    1  
ATOM 872   C CB   . ALA A 1 60 ? 14.617 -6.293  17.656 1.00 0.00 ? 60 ALA A CB   1  
ATOM 873   H H    . ALA A 1 60 ? 16.073 -7.480  15.962 1.00 0.00 ? 60 ALA A H    1  
ATOM 874   H HA   . ALA A 1 60 ? 14.084 -5.553  15.740 1.00 0.00 ? 60 ALA A HA   1  
ATOM 875   H HB1  . ALA A 1 60 ? 15.412 -6.942  17.994 1.00 0.00 ? 60 ALA A HB1  1  
ATOM 876   H HB2  . ALA A 1 60 ? 14.470 -5.500  18.374 1.00 0.00 ? 60 ALA A HB2  1  
ATOM 877   H HB3  . ALA A 1 60 ? 13.705 -6.862  17.556 1.00 0.00 ? 60 ALA A HB3  1  
ATOM 878   N N    . GLU A 1 61 ? 17.000 -4.345  16.485 1.00 0.00 ? 61 GLU A N    1  
ATOM 879   C CA   . GLU A 1 61 ? 17.769 -3.118  16.657 1.00 0.00 ? 61 GLU A CA   1  
ATOM 880   C C    . GLU A 1 61 ? 17.807 -2.313  15.361 1.00 0.00 ? 61 GLU A C    1  
ATOM 881   O O    . GLU A 1 61 ? 17.909 -1.086  15.381 1.00 0.00 ? 61 GLU A O    1  
ATOM 882   C CB   . GLU A 1 61 ? 19.194 -3.441  17.112 1.00 0.00 ? 61 GLU A CB   1  
ATOM 883   C CG   . GLU A 1 61 ? 19.253 -4.385  18.302 1.00 0.00 ? 61 GLU A CG   1  
ATOM 884   C CD   . GLU A 1 61 ? 20.558 -4.276  19.067 1.00 0.00 ? 61 GLU A CD   1  
ATOM 885   O OE1  . GLU A 1 61 ? 21.189 -3.199  19.013 1.00 0.00 ? 61 GLU A OE1  1  
ATOM 886   O OE2  . GLU A 1 61 ? 20.948 -5.266  19.720 1.00 0.00 ? 61 GLU A OE2  1  
ATOM 887   H H    . GLU A 1 61 ? 17.476 -5.193  16.356 1.00 0.00 ? 61 GLU A H    1  
ATOM 888   H HA   . GLU A 1 61 ? 17.283 -2.527  17.419 1.00 0.00 ? 61 GLU A HA   1  
ATOM 889   H HB2  . GLU A 1 61 ? 19.726 -3.897  16.290 1.00 0.00 ? 61 GLU A HB2  1  
ATOM 890   H HB3  . GLU A 1 61 ? 19.689 -2.521  17.384 1.00 0.00 ? 61 GLU A HB3  1  
ATOM 891   H HG2  . GLU A 1 61 ? 18.440 -4.150  18.972 1.00 0.00 ? 61 GLU A HG2  1  
ATOM 892   H HG3  . GLU A 1 61 ? 19.145 -5.399  17.947 1.00 0.00 ? 61 GLU A HG3  1  
ATOM 893   N N    . THR A 1 62 ? 17.725 -3.013  14.234 1.00 0.00 ? 62 THR A N    1  
ATOM 894   C CA   . THR A 1 62 ? 17.752 -2.366  12.929 1.00 0.00 ? 62 THR A CA   1  
ATOM 895   C C    . THR A 1 62 ? 16.368 -1.862  12.536 1.00 0.00 ? 62 THR A C    1  
ATOM 896   O O    . THR A 1 62 ? 16.234 -1.005  11.662 1.00 0.00 ? 62 THR A O    1  
ATOM 897   C CB   . THR A 1 62 ? 18.266 -3.323  11.837 1.00 0.00 ? 62 THR A CB   1  
ATOM 898   O OG1  . THR A 1 62 ? 17.270 -4.309  11.541 1.00 0.00 ? 62 THR A OG1  1  
ATOM 899   C CG2  . THR A 1 62 ? 19.550 -4.009  12.280 1.00 0.00 ? 62 THR A CG2  1  
ATOM 900   H H    . THR A 1 62 ? 17.646 -3.989  14.283 1.00 0.00 ? 62 THR A H    1  
ATOM 901   H HA   . THR A 1 62 ? 18.428 -1.524  12.988 1.00 0.00 ? 62 THR A HA   1  
ATOM 902   H HB   . THR A 1 62 ? 18.471 -2.750  10.944 1.00 0.00 ? 62 THR A HB   1  
ATOM 903   H HG1  . THR A 1 62 ? 17.195 -4.919  12.279 1.00 0.00 ? 62 THR A HG1  1  
ATOM 904   H HG21 . THR A 1 62 ? 20.288 -3.933  11.495 1.00 0.00 ? 62 THR A HG21 1  
ATOM 905   H HG22 . THR A 1 62 ? 19.349 -5.050  12.485 1.00 0.00 ? 62 THR A HG22 1  
ATOM 906   H HG23 . THR A 1 62 ? 19.923 -3.531  13.173 1.00 0.00 ? 62 THR A HG23 1  
ATOM 907   N N    . ILE A 1 63 ? 15.342 -2.398  13.188 1.00 0.00 ? 63 ILE A N    1  
ATOM 908   C CA   . ILE A 1 63 ? 13.968 -2.001  12.907 1.00 0.00 ? 63 ILE A CA   1  
ATOM 909   C C    . ILE A 1 63 ? 13.569 -0.780  13.730 1.00 0.00 ? 63 ILE A C    1  
ATOM 910   O O    . ILE A 1 63 ? 13.278 -0.890  14.922 1.00 0.00 ? 63 ILE A O    1  
ATOM 911   C CB   . ILE A 1 63 ? 12.980 -3.146  13.197 1.00 0.00 ? 63 ILE A CB   1  
ATOM 912   C CG1  . ILE A 1 63 ? 13.331 -4.377  12.358 1.00 0.00 ? 63 ILE A CG1  1  
ATOM 913   C CG2  . ILE A 1 63 ? 11.553 -2.698  12.919 1.00 0.00 ? 63 ILE A CG2  1  
ATOM 914   C CD1  . ILE A 1 63 ? 12.626 -5.637  12.809 1.00 0.00 ? 63 ILE A CD1  1  
ATOM 915   H H    . ILE A 1 63 ? 15.512 -3.077  13.873 1.00 0.00 ? 63 ILE A H    1  
ATOM 916   H HA   . ILE A 1 63 ? 13.901 -1.752  11.858 1.00 0.00 ? 63 ILE A HA   1  
ATOM 917   H HB   . ILE A 1 63 ? 13.055 -3.400  14.244 1.00 0.00 ? 63 ILE A HB   1  
ATOM 918   H HG12 . ILE A 1 63 ? 13.057 -4.194  11.331 1.00 0.00 ? 63 ILE A HG12 1  
ATOM 919   H HG13 . ILE A 1 63 ? 14.395 -4.551  12.417 1.00 0.00 ? 63 ILE A HG13 1  
ATOM 920   H HG21 . ILE A 1 63 ? 11.266 -1.944  13.637 1.00 0.00 ? 63 ILE A HG21 1  
ATOM 921   H HG22 . ILE A 1 63 ? 11.493 -2.287  11.923 1.00 0.00 ? 63 ILE A HG22 1  
ATOM 922   H HG23 . ILE A 1 63 ? 10.887 -3.544  13.001 1.00 0.00 ? 63 ILE A HG23 1  
ATOM 923   H HD11 . ILE A 1 63 ? 12.727 -6.398  12.049 1.00 0.00 ? 63 ILE A HD11 1  
ATOM 924   H HD12 . ILE A 1 63 ? 13.066 -5.986  13.730 1.00 0.00 ? 63 ILE A HD12 1  
ATOM 925   H HD13 . ILE A 1 63 ? 11.578 -5.426  12.969 1.00 0.00 ? 63 ILE A HD13 1  
ATOM 926   N N    . LEU A 1 64 ? 13.557 0.382   13.086 1.00 0.00 ? 64 LEU A N    1  
ATOM 927   C CA   . LEU A 1 64 ? 13.192 1.624   13.758 1.00 0.00 ? 64 LEU A CA   1  
ATOM 928   C C    . LEU A 1 64 ? 11.848 2.141   13.254 1.00 0.00 ? 64 LEU A C    1  
ATOM 929   O O    . LEU A 1 64 ? 10.905 2.308   14.028 1.00 0.00 ? 64 LEU A O    1  
ATOM 930   C CB   . LEU A 1 64 ? 14.274 2.683   13.537 1.00 0.00 ? 64 LEU A CB   1  
ATOM 931   C CG   . LEU A 1 64 ? 15.712 2.238   13.805 1.00 0.00 ? 64 LEU A CG   1  
ATOM 932   C CD1  . LEU A 1 64 ? 16.693 3.323   13.385 1.00 0.00 ? 64 LEU A CD1  1  
ATOM 933   C CD2  . LEU A 1 64 ? 15.898 1.888   15.274 1.00 0.00 ? 64 LEU A CD2  1  
ATOM 934   H H    . LEU A 1 64 ? 13.798 0.406   12.137 1.00 0.00 ? 64 LEU A H    1  
ATOM 935   H HA   . LEU A 1 64 ? 13.111 1.418   14.815 1.00 0.00 ? 64 LEU A HA   1  
ATOM 936   H HB2  . LEU A 1 64 ? 14.214 3.008   12.510 1.00 0.00 ? 64 LEU A HB2  1  
ATOM 937   H HB3  . LEU A 1 64 ? 14.057 3.517   14.190 1.00 0.00 ? 64 LEU A HB3  1  
ATOM 938   H HG   . LEU A 1 64 ? 15.924 1.354   13.220 1.00 0.00 ? 64 LEU A HG   1  
ATOM 939   H HD11 . LEU A 1 64 ? 16.323 3.820   12.501 1.00 0.00 ? 64 LEU A HD11 1  
ATOM 940   H HD12 . LEU A 1 64 ? 17.653 2.877   13.173 1.00 0.00 ? 64 LEU A HD12 1  
ATOM 941   H HD13 . LEU A 1 64 ? 16.798 4.041   14.185 1.00 0.00 ? 64 LEU A HD13 1  
ATOM 942   H HD21 . LEU A 1 64 ? 16.447 0.962   15.356 1.00 0.00 ? 64 LEU A HD21 1  
ATOM 943   H HD22 . LEU A 1 64 ? 14.931 1.775   15.742 1.00 0.00 ? 64 LEU A HD22 1  
ATOM 944   H HD23 . LEU A 1 64 ? 16.447 2.677   15.765 1.00 0.00 ? 64 LEU A HD23 1  
ATOM 945   N N    . THR A 1 65 ? 11.767 2.392   11.951 1.00 0.00 ? 65 THR A N    1  
ATOM 946   C CA   . THR A 1 65 ? 10.539 2.889   11.343 1.00 0.00 ? 65 THR A CA   1  
ATOM 947   C C    . THR A 1 65 ? 9.741  1.754   10.711 1.00 0.00 ? 65 THR A C    1  
ATOM 948   O O    . THR A 1 65 ? 10.247 0.646   10.540 1.00 0.00 ? 65 THR A O    1  
ATOM 949   C CB   . THR A 1 65 ? 10.835 3.954   10.270 1.00 0.00 ? 65 THR A CB   1  
ATOM 950   O OG1  . THR A 1 65 ? 11.618 3.382   9.216  1.00 0.00 ? 65 THR A OG1  1  
ATOM 951   C CG2  . THR A 1 65 ? 11.573 5.139   10.873 1.00 0.00 ? 65 THR A CG2  1  
ATOM 952   H H    . THR A 1 65 ? 12.553 2.240   11.386 1.00 0.00 ? 65 THR A H    1  
ATOM 953   H HA   . THR A 1 65 ? 9.944  3.346   12.120 1.00 0.00 ? 65 THR A HA   1  
ATOM 954   H HB   . THR A 1 65 ? 9.896  4.302   9.863  1.00 0.00 ? 65 THR A HB   1  
ATOM 955   H HG1  . THR A 1 65 ? 11.917 4.079   8.626  1.00 0.00 ? 65 THR A HG1  1  
ATOM 956   H HG21 . THR A 1 65 ? 10.858 5.856   11.248 1.00 0.00 ? 65 THR A HG21 1  
ATOM 957   H HG22 . THR A 1 65 ? 12.186 5.604   10.115 1.00 0.00 ? 65 THR A HG22 1  
ATOM 958   H HG23 . THR A 1 65 ? 12.200 4.798   11.683 1.00 0.00 ? 65 THR A HG23 1  
ATOM 959   N N    . VAL A 1 66 ? 8.489  2.039   10.366 1.00 0.00 ? 66 VAL A N    1  
ATOM 960   C CA   . VAL A 1 66 ? 7.620  1.043   9.751  1.00 0.00 ? 66 VAL A CA   1  
ATOM 961   C C    . VAL A 1 66 ? 8.293  0.397   8.545  1.00 0.00 ? 66 VAL A C    1  
ATOM 962   O O    . VAL A 1 66 ? 8.301  -0.826  8.407  1.00 0.00 ? 66 VAL A O    1  
ATOM 963   C CB   . VAL A 1 66 ? 6.282  1.662   9.308  1.00 0.00 ? 66 VAL A CB   1  
ATOM 964   C CG1  . VAL A 1 66 ? 5.412  0.620   8.621  1.00 0.00 ? 66 VAL A CG1  1  
ATOM 965   C CG2  . VAL A 1 66 ? 5.557  2.273   10.498 1.00 0.00 ? 66 VAL A CG2  1  
ATOM 966   H H    . VAL A 1 66 ? 8.142  2.941   10.528 1.00 0.00 ? 66 VAL A H    1  
ATOM 967   H HA   . VAL A 1 66 ? 7.413  0.280   10.488 1.00 0.00 ? 66 VAL A HA   1  
ATOM 968   H HB   . VAL A 1 66 ? 6.490  2.449   8.597  1.00 0.00 ? 66 VAL A HB   1  
ATOM 969   H HG11 . VAL A 1 66 ? 5.777  -0.368  8.862  1.00 0.00 ? 66 VAL A HG11 1  
ATOM 970   H HG12 . VAL A 1 66 ? 4.392  0.721   8.962  1.00 0.00 ? 66 VAL A HG12 1  
ATOM 971   H HG13 . VAL A 1 66 ? 5.451  0.766   7.552  1.00 0.00 ? 66 VAL A HG13 1  
ATOM 972   H HG21 . VAL A 1 66 ? 5.001  1.504   11.013 1.00 0.00 ? 66 VAL A HG21 1  
ATOM 973   H HG22 . VAL A 1 66 ? 6.279  2.709   11.174 1.00 0.00 ? 66 VAL A HG22 1  
ATOM 974   H HG23 . VAL A 1 66 ? 4.879  3.039   10.153 1.00 0.00 ? 66 VAL A HG23 1  
ATOM 975   N N    . GLY A 1 67 ? 8.858  1.227   7.674  1.00 0.00 ? 67 GLY A N    1  
ATOM 976   C CA   . GLY A 1 67 ? 9.526  0.718   6.490  1.00 0.00 ? 67 GLY A CA   1  
ATOM 977   C C    . GLY A 1 67 ? 10.554 -0.347  6.817  1.00 0.00 ? 67 GLY A C    1  
ATOM 978   O O    . GLY A 1 67 ? 10.738 -1.296  6.056  1.00 0.00 ? 67 GLY A O    1  
ATOM 979   H H    . GLY A 1 67 ? 8.820  2.193   7.836  1.00 0.00 ? 67 GLY A H    1  
ATOM 980   H HA2  . GLY A 1 67 ? 8.786  0.298   5.825  1.00 0.00 ? 67 GLY A HA2  1  
ATOM 981   H HA3  . GLY A 1 67 ? 10.021 1.538   5.990  1.00 0.00 ? 67 GLY A HA3  1  
ATOM 982   N N    . ASP A 1 68 ? 11.226 -0.189  7.952  1.00 0.00 ? 68 ASP A N    1  
ATOM 983   C CA   . ASP A 1 68 ? 12.242 -1.144  8.379  1.00 0.00 ? 68 ASP A CA   1  
ATOM 984   C C    . ASP A 1 68 ? 11.612 -2.492  8.718  1.00 0.00 ? 68 ASP A C    1  
ATOM 985   O O    . ASP A 1 68 ? 11.993 -3.523  8.164  1.00 0.00 ? 68 ASP A O    1  
ATOM 986   C CB   . ASP A 1 68 ? 13.004 -0.604  9.590  1.00 0.00 ? 68 ASP A CB   1  
ATOM 987   C CG   . ASP A 1 68 ? 13.736 0.688   9.284  1.00 0.00 ? 68 ASP A CG   1  
ATOM 988   O OD1  . ASP A 1 68 ? 14.376 0.769   8.215  1.00 0.00 ? 68 ASP A OD1  1  
ATOM 989   O OD2  . ASP A 1 68 ? 13.669 1.619   10.115 1.00 0.00 ? 68 ASP A OD2  1  
ATOM 990   H H    . ASP A 1 68 ? 11.034 0.589   8.518  1.00 0.00 ? 68 ASP A H    1  
ATOM 991   H HA   . ASP A 1 68 ? 12.934 -1.280  7.561  1.00 0.00 ? 68 ASP A HA   1  
ATOM 992   H HB2  . ASP A 1 68 ? 12.306 -0.420  10.393 1.00 0.00 ? 68 ASP A HB2  1  
ATOM 993   H HB3  . ASP A 1 68 ? 13.728 -1.340  9.909  1.00 0.00 ? 68 ASP A HB3  1  
ATOM 994   N N    . ALA A 1 69 ? 10.648 -2.475  9.632  1.00 0.00 ? 69 ALA A N    1  
ATOM 995   C CA   . ALA A 1 69 ? 9.965  -3.695  10.044 1.00 0.00 ? 69 ALA A CA   1  
ATOM 996   C C    . ALA A 1 69 ? 9.307  -4.385  8.854  1.00 0.00 ? 69 ALA A C    1  
ATOM 997   O O    . ALA A 1 69 ? 9.439  -5.595  8.674  1.00 0.00 ? 69 ALA A O    1  
ATOM 998   C CB   . ALA A 1 69 ? 8.930  -3.385  11.115 1.00 0.00 ? 69 ALA A CB   1  
ATOM 999   H H    . ALA A 1 69 ? 10.389 -1.622  10.038 1.00 0.00 ? 69 ALA A H    1  
ATOM 1000  H HA   . ALA A 1 69 ? 10.701 -4.361  10.471 1.00 0.00 ? 69 ALA A HA   1  
ATOM 1001  H HB1  . ALA A 1 69 ? 8.930  -2.323  11.318 1.00 0.00 ? 69 ALA A HB1  1  
ATOM 1002  H HB2  . ALA A 1 69 ? 7.953  -3.685  10.769 1.00 0.00 ? 69 ALA A HB2  1  
ATOM 1003  H HB3  . ALA A 1 69 ? 9.175  -3.924  12.018 1.00 0.00 ? 69 ALA A HB3  1  
ATOM 1004  N N    . VAL A 1 70 ? 8.596  -3.607  8.044  1.00 0.00 ? 70 VAL A N    1  
ATOM 1005  C CA   . VAL A 1 70 ? 7.917  -4.143  6.870  1.00 0.00 ? 70 VAL A CA   1  
ATOM 1006  C C    . VAL A 1 70 ? 8.910  -4.772  5.900  1.00 0.00 ? 70 VAL A C    1  
ATOM 1007  O O    . VAL A 1 70 ? 8.768  -5.933  5.514  1.00 0.00 ? 70 VAL A O    1  
ATOM 1008  C CB   . VAL A 1 70 ? 7.121  -3.049  6.134  1.00 0.00 ? 70 VAL A CB   1  
ATOM 1009  C CG1  . VAL A 1 70 ? 6.416  -3.628  4.917  1.00 0.00 ? 70 VAL A CG1  1  
ATOM 1010  C CG2  . VAL A 1 70 ? 6.123  -2.392  7.076  1.00 0.00 ? 70 VAL A CG2  1  
ATOM 1011  H H    . VAL A 1 70 ? 8.527  -2.649  8.240  1.00 0.00 ? 70 VAL A H    1  
ATOM 1012  H HA   . VAL A 1 70 ? 7.223  -4.901  7.203  1.00 0.00 ? 70 VAL A HA   1  
ATOM 1013  H HB   . VAL A 1 70 ? 7.814  -2.293  5.795  1.00 0.00 ? 70 VAL A HB   1  
ATOM 1014  H HG11 . VAL A 1 70 ? 7.143  -4.093  4.267  1.00 0.00 ? 70 VAL A HG11 1  
ATOM 1015  H HG12 . VAL A 1 70 ? 5.694  -4.366  5.236  1.00 0.00 ? 70 VAL A HG12 1  
ATOM 1016  H HG13 . VAL A 1 70 ? 5.911  -2.837  4.383  1.00 0.00 ? 70 VAL A HG13 1  
ATOM 1017  H HG21 . VAL A 1 70 ? 5.119  -2.596  6.735  1.00 0.00 ? 70 VAL A HG21 1  
ATOM 1018  H HG22 . VAL A 1 70 ? 6.253  -2.788  8.072  1.00 0.00 ? 70 VAL A HG22 1  
ATOM 1019  H HG23 . VAL A 1 70 ? 6.289  -1.325  7.089  1.00 0.00 ? 70 VAL A HG23 1  
ATOM 1020  N N    . LYS A 1 71 ? 9.918  -4.000  5.510  1.00 0.00 ? 71 LYS A N    1  
ATOM 1021  C CA   . LYS A 1 71 ? 10.938 -4.481  4.586  1.00 0.00 ? 71 LYS A CA   1  
ATOM 1022  C C    . LYS A 1 71 ? 11.588 -5.758  5.110  1.00 0.00 ? 71 LYS A C    1  
ATOM 1023  O O    . LYS A 1 71 ? 11.905 -6.666  4.341  1.00 0.00 ? 71 LYS A O    1  
ATOM 1024  C CB   . LYS A 1 71 ? 12.005 -3.406  4.366  1.00 0.00 ? 71 LYS A CB   1  
ATOM 1025  C CG   . LYS A 1 71 ? 11.600 -2.343  3.360  1.00 0.00 ? 71 LYS A CG   1  
ATOM 1026  C CD   . LYS A 1 71 ? 12.522 -1.137  3.421  1.00 0.00 ? 71 LYS A CD   1  
ATOM 1027  C CE   . LYS A 1 71 ? 12.386 -0.268  2.180  1.00 0.00 ? 71 LYS A CE   1  
ATOM 1028  N NZ   . LYS A 1 71 ? 13.580 0.598   1.976  1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1029  H H    . LYS A 1 71 ? 9.978  -3.083  5.852  1.00 0.00 ? 71 LYS A H    1  
ATOM 1030  H HA   . LYS A 1 71 ? 10.458 -4.697  3.644  1.00 0.00 ? 71 LYS A HA   1  
ATOM 1031  H HB2  . LYS A 1 71 ? 12.209 -2.921  5.309  1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1032  H HB3  . LYS A 1 71 ? 12.909 -3.880  4.013  1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1033  H HG2  . LYS A 1 71 ? 11.642 -2.765  2.367  1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1034  H HG3  . LYS A 1 71 ? 10.590 -2.024  3.575  1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1035  H HD2  . LYS A 1 71 ? 12.271 -0.545  4.289  1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1036  H HD3  . LYS A 1 71 ? 13.544 -1.480  3.501  1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1037  H HE2  . LYS A 1 71 ? 12.267 -0.909  1.320  1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1038  H HE3  . LYS A 1 71 ? 11.512 0.357   2.288  1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1039  H HZ1  . LYS A 1 71 ? 13.314 1.455   1.451  1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1040  H HZ2  . LYS A 1 71 ? 14.306 0.086   1.435  1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1041  H HZ3  . LYS A 1 71 ? 13.980 0.877   2.894  1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1042  N N    . PHE A 1 72 ? 11.783 -5.821  6.423  1.00 0.00 ? 72 PHE A N    1  
ATOM 1043  C CA   . PHE A 1 72 ? 12.395 -6.987  7.049  1.00 0.00 ? 72 PHE A CA   1  
ATOM 1044  C C    . PHE A 1 72 ? 11.514 -8.221  6.879  1.00 0.00 ? 72 PHE A C    1  
ATOM 1045  O O    . PHE A 1 72 ? 11.957 -9.247  6.362  1.00 0.00 ? 72 PHE A O    1  
ATOM 1046  C CB   . PHE A 1 72 ? 12.641 -6.723  8.536  1.00 0.00 ? 72 PHE A CB   1  
ATOM 1047  C CG   . PHE A 1 72 ? 13.941 -7.284  9.038  1.00 0.00 ? 72 PHE A CG   1  
ATOM 1048  C CD1  . PHE A 1 72 ? 14.325 -8.575  8.711  1.00 0.00 ? 72 PHE A CD1  1  
ATOM 1049  C CD2  . PHE A 1 72 ? 14.778 -6.521  9.835  1.00 0.00 ? 72 PHE A CD2  1  
ATOM 1050  C CE1  . PHE A 1 72 ? 15.521 -9.093  9.172  1.00 0.00 ? 72 PHE A CE1  1  
ATOM 1051  C CE2  . PHE A 1 72 ? 15.975 -7.034  10.298 1.00 0.00 ? 72 PHE A CE2  1  
ATOM 1052  C CZ   . PHE A 1 72 ? 16.347 -8.322  9.966  1.00 0.00 ? 72 PHE A CZ   1  
ATOM 1053  H H    . PHE A 1 72 ? 11.510 -5.065  6.984  1.00 0.00 ? 72 PHE A H    1  
ATOM 1054  H HA   . PHE A 1 72 ? 13.341 -7.165  6.563  1.00 0.00 ? 72 PHE A HA   1  
ATOM 1055  H HB2  . PHE A 1 72 ? 12.651 -5.658  8.709  1.00 0.00 ? 72 PHE A HB2  1  
ATOM 1056  H HB3  . PHE A 1 72 ? 11.842 -7.169  9.110  1.00 0.00 ? 72 PHE A HB3  1  
ATOM 1057  H HD1  . PHE A 1 72 ? 13.681 -9.179  8.090  1.00 0.00 ? 72 PHE A HD1  1  
ATOM 1058  H HD2  . PHE A 1 72 ? 14.488 -5.513  10.095 1.00 0.00 ? 72 PHE A HD2  1  
ATOM 1059  H HE1  . PHE A 1 72 ? 15.810 -10.100 8.911  1.00 0.00 ? 72 PHE A HE1  1  
ATOM 1060  H HE2  . PHE A 1 72 ? 16.619 -6.428  10.918 1.00 0.00 ? 72 PHE A HE2  1  
ATOM 1061  H HZ   . PHE A 1 72 ? 17.282 -8.725  10.327 1.00 0.00 ? 72 PHE A HZ   1  
ATOM 1062  N N    . ILE A 1 73 ? 10.264 -8.114  7.318  1.00 0.00 ? 73 ILE A N    1  
ATOM 1063  C CA   . ILE A 1 73 ? 9.321  -9.220  7.214  1.00 0.00 ? 73 ILE A CA   1  
ATOM 1064  C C    . ILE A 1 73 ? 9.200  -9.706  5.774  1.00 0.00 ? 73 ILE A C    1  
ATOM 1065  O O    . ILE A 1 73 ? 9.114  -10.907 5.518  1.00 0.00 ? 73 ILE A O    1  
ATOM 1066  C CB   . ILE A 1 73 ? 7.925  -8.819  7.727  1.00 0.00 ? 73 ILE A CB   1  
ATOM 1067  C CG1  . ILE A 1 73 ? 8.001  -8.388  9.193  1.00 0.00 ? 73 ILE A CG1  1  
ATOM 1068  C CG2  . ILE A 1 73 ? 6.947  -9.972  7.558  1.00 0.00 ? 73 ILE A CG2  1  
ATOM 1069  C CD1  . ILE A 1 73 ? 7.026  -7.288  9.550  1.00 0.00 ? 73 ILE A CD1  1  
ATOM 1070  H H    . ILE A 1 73 ? 9.970  -7.270  7.721  1.00 0.00 ? 73 ILE A H    1  
ATOM 1071  H HA   . ILE A 1 73 ? 9.688  -10.030 7.827  1.00 0.00 ? 73 ILE A HA   1  
ATOM 1072  H HB   . ILE A 1 73 ? 7.572  -7.990  7.133  1.00 0.00 ? 73 ILE A HB   1  
ATOM 1073  H HG12 . ILE A 1 73 ? 7.787  -9.237  9.823  1.00 0.00 ? 73 ILE A HG12 1  
ATOM 1074  H HG13 . ILE A 1 73 ? 8.998  -8.030  9.404  1.00 0.00 ? 73 ILE A HG13 1  
ATOM 1075  H HG21 . ILE A 1 73 ? 6.106  -9.831  8.221  1.00 0.00 ? 73 ILE A HG21 1  
ATOM 1076  H HG22 . ILE A 1 73 ? 6.598  -10.001 6.537  1.00 0.00 ? 73 ILE A HG22 1  
ATOM 1077  H HG23 . ILE A 1 73 ? 7.442  -10.902 7.796  1.00 0.00 ? 73 ILE A HG23 1  
ATOM 1078  H HD11 . ILE A 1 73 ? 6.025  -7.592  9.283  1.00 0.00 ? 73 ILE A HD11 1  
ATOM 1079  H HD12 . ILE A 1 73 ? 7.074  -7.094  10.611 1.00 0.00 ? 73 ILE A HD12 1  
ATOM 1080  H HD13 . ILE A 1 73 ? 7.284  -6.388  9.009  1.00 0.00 ? 73 ILE A HD13 1  
ATOM 1081  N N    . ASP A 1 74 ? 9.198  -8.765  4.836  1.00 0.00 ? 74 ASP A N    1  
ATOM 1082  C CA   . ASP A 1 74 ? 9.091  -9.098  3.420  1.00 0.00 ? 74 ASP A CA   1  
ATOM 1083  C C    . ASP A 1 74 ? 10.347 -9.815  2.934  1.00 0.00 ? 74 ASP A C    1  
ATOM 1084  O O    . ASP A 1 74 ? 10.270 -10.763 2.152  1.00 0.00 ? 74 ASP A O    1  
ATOM 1085  C CB   . ASP A 1 74 ? 8.861  -7.832  2.593  1.00 0.00 ? 74 ASP A CB   1  
ATOM 1086  C CG   . ASP A 1 74 ? 8.383  -8.138  1.187  1.00 0.00 ? 74 ASP A CG   1  
ATOM 1087  O OD1  . ASP A 1 74 ? 8.086  -9.317  0.905  1.00 0.00 ? 74 ASP A OD1  1  
ATOM 1088  O OD2  . ASP A 1 74 ? 8.309  -7.198  0.367  1.00 0.00 ? 74 ASP A OD2  1  
ATOM 1089  H H    . ASP A 1 74 ? 9.270  -7.824  5.102  1.00 0.00 ? 74 ASP A H    1  
ATOM 1090  H HA   . ASP A 1 74 ? 8.245  -9.756  3.296  1.00 0.00 ? 74 ASP A HA   1  
ATOM 1091  H HB2  . ASP A 1 74 ? 8.115  -7.221  3.081  1.00 0.00 ? 74 ASP A HB2  1  
ATOM 1092  H HB3  . ASP A 1 74 ? 9.786  -7.279  2.528  1.00 0.00 ? 74 ASP A HB3  1  
ATOM 1093  N N    . LYS A 1 75 ? 11.503 -9.357  3.402  1.00 0.00 ? 75 LYS A N    1  
ATOM 1094  C CA   . LYS A 1 75 ? 12.776 -9.954  3.017  1.00 0.00 ? 75 LYS A CA   1  
ATOM 1095  C C    . LYS A 1 75 ? 12.884 -11.385 3.534  1.00 0.00 ? 75 LYS A C    1  
ATOM 1096  O O    . LYS A 1 75 ? 13.258 -12.295 2.795  1.00 0.00 ? 75 LYS A O    1  
ATOM 1097  C CB   . LYS A 1 75 ? 13.939 -9.117  3.554  1.00 0.00 ? 75 LYS A CB   1  
ATOM 1098  C CG   . LYS A 1 75 ? 14.357 -7.990  2.625  1.00 0.00 ? 75 LYS A CG   1  
ATOM 1099  C CD   . LYS A 1 75 ? 15.432 -7.120  3.253  1.00 0.00 ? 75 LYS A CD   1  
ATOM 1100  C CE   . LYS A 1 75 ? 15.516 -5.761  2.574  1.00 0.00 ? 75 LYS A CE   1  
ATOM 1101  N NZ   . LYS A 1 75 ? 16.121 -5.855  1.217  1.00 0.00 ? 75 LYS A NZ   1  
ATOM 1102  H H    . LYS A 1 75 ? 11.499 -8.598  4.023  1.00 0.00 ? 75 LYS A H    1  
ATOM 1103  H HA   . LYS A 1 75 ? 12.822 -9.969  1.938  1.00 0.00 ? 75 LYS A HA   1  
ATOM 1104  H HB2  . LYS A 1 75 ? 13.649 -8.686  4.501  1.00 0.00 ? 75 LYS A HB2  1  
ATOM 1105  H HB3  . LYS A 1 75 ? 14.791 -9.763  3.707  1.00 0.00 ? 75 LYS A HB3  1  
ATOM 1106  H HG2  . LYS A 1 75 ? 14.741 -8.414  1.709  1.00 0.00 ? 75 LYS A HG2  1  
ATOM 1107  H HG3  . LYS A 1 75 ? 13.493 -7.377  2.406  1.00 0.00 ? 75 LYS A HG3  1  
ATOM 1108  H HD2  . LYS A 1 75 ? 15.201 -6.974  4.297  1.00 0.00 ? 75 LYS A HD2  1  
ATOM 1109  H HD3  . LYS A 1 75 ? 16.387 -7.618  3.159  1.00 0.00 ? 75 LYS A HD3  1  
ATOM 1110  H HE2  . LYS A 1 75 ? 14.521 -5.354  2.488  1.00 0.00 ? 75 LYS A HE2  1  
ATOM 1111  H HE3  . LYS A 1 75 ? 16.121 -5.106  3.184  1.00 0.00 ? 75 LYS A HE3  1  
ATOM 1112  H HZ1  . LYS A 1 75 ? 16.799 -6.643  1.182  1.00 0.00 ? 75 LYS A HZ1  1  
ATOM 1113  H HZ2  . LYS A 1 75 ? 16.621 -4.973  0.986  1.00 0.00 ? 75 LYS A HZ2  1  
ATOM 1114  H HZ3  . LYS A 1 75 ? 15.380 -6.017  0.505  1.00 0.00 ? 75 LYS A HZ3  1  
ATOM 1115  N N    . ALA A 1 76 ? 12.554 -11.575 4.807  1.00 0.00 ? 76 ALA A N    1  
ATOM 1116  C CA   . ALA A 1 76 ? 12.611 -12.896 5.422  1.00 0.00 ? 76 ALA A CA   1  
ATOM 1117  C C    . ALA A 1 76 ? 11.470 -13.780 4.930  1.00 0.00 ? 76 ALA A C    1  
ATOM 1118  O O    . ALA A 1 76 ? 11.574 -15.007 4.939  1.00 0.00 ? 76 ALA A O    1  
ATOM 1119  C CB   . ALA A 1 76 ? 12.571 -12.774 6.938  1.00 0.00 ? 76 ALA A CB   1  
ATOM 1120  H H    . ALA A 1 76 ? 12.263 -10.810 5.345  1.00 0.00 ? 76 ALA A H    1  
ATOM 1121  H HA   . ALA A 1 76 ? 13.551 -13.352 5.146  1.00 0.00 ? 76 ALA A HA   1  
ATOM 1122  H HB1  . ALA A 1 76 ? 13.576 -12.837 7.330  1.00 0.00 ? 76 ALA A HB1  1  
ATOM 1123  H HB2  . ALA A 1 76 ? 12.136 -11.825 7.212  1.00 0.00 ? 76 ALA A HB2  1  
ATOM 1124  H HB3  . ALA A 1 76 ? 11.974 -13.576 7.347  1.00 0.00 ? 76 ALA A HB3  1  
ATOM 1125  N N    . SER A 1 77 ? 10.381 -13.149 4.501  1.00 0.00 ? 77 SER A N    1  
ATOM 1126  C CA   . SER A 1 77 ? 9.219  -13.880 4.010  1.00 0.00 ? 77 SER A CA   1  
ATOM 1127  C C    . SER A 1 77 ? 9.594  -14.762 2.823  1.00 0.00 ? 77 SER A C    1  
ATOM 1128  O O    . SER A 1 77 ? 8.997  -15.816 2.606  1.00 0.00 ? 77 SER A O    1  
ATOM 1129  C CB   . SER A 1 77 ? 8.111  -12.905 3.605  1.00 0.00 ? 77 SER A CB   1  
ATOM 1130  O OG   . SER A 1 77 ? 7.135  -13.547 2.804  1.00 0.00 ? 77 SER A OG   1  
ATOM 1131  H H    . SER A 1 77 ? 10.359 -12.170 4.519  1.00 0.00 ? 77 SER A H    1  
ATOM 1132  H HA   . SER A 1 77 ? 8.859  -14.508 4.811  1.00 0.00 ? 77 SER A HA   1  
ATOM 1133  H HB2  . SER A 1 77 ? 7.634  -12.518 4.493  1.00 0.00 ? 77 SER A HB2  1  
ATOM 1134  H HB3  . SER A 1 77 ? 8.542  -12.089 3.043  1.00 0.00 ? 77 SER A HB3  1  
ATOM 1135  H HG   . SER A 1 77 ? 6.354  -13.728 3.333  1.00 0.00 ? 77 SER A HG   1  
ATOM 1136  N N    . ALA A 1 78 ? 10.586 -14.322 2.056  1.00 0.00 ? 78 ALA A N    1  
ATOM 1137  C CA   . ALA A 1 78 ? 11.043 -15.071 0.893  1.00 0.00 ? 78 ALA A CA   1  
ATOM 1138  C C    . ALA A 1 78 ? 12.062 -16.134 1.289  1.00 0.00 ? 78 ALA A C    1  
ATOM 1139  O O    . ALA A 1 78 ? 12.054 -17.245 0.757  1.00 0.00 ? 78 ALA A O    1  
ATOM 1140  C CB   . ALA A 1 78 ? 11.637 -14.128 -0.143 1.00 0.00 ? 78 ALA A CB   1  
ATOM 1141  H H    . ALA A 1 78 ? 11.023 -13.474 2.280  1.00 0.00 ? 78 ALA A H    1  
ATOM 1142  H HA   . ALA A 1 78 ? 10.185 -15.557 0.451  1.00 0.00 ? 78 ALA A HA   1  
ATOM 1143  H HB1  . ALA A 1 78 ? 11.427 -14.504 -1.134 1.00 0.00 ? 78 ALA A HB1  1  
ATOM 1144  H HB2  . ALA A 1 78 ? 11.199 -13.148 -0.029 1.00 0.00 ? 78 ALA A HB2  1  
ATOM 1145  H HB3  . ALA A 1 78 ? 12.705 -14.064 0.000  1.00 0.00 ? 78 ALA A HB3  1  
ATOM 1146  N N    . MET A 1 1  ? 1.329  0.000   0.000  1.00 0.00 ? 1  MET A N    2  
ATOM 1147  C CA   . MET A 1 1  ? 2.093  -0.001  -1.242 1.00 0.00 ? 1  MET A CA   2  
ATOM 1148  C C    . MET A 1 1  ? 2.351  -1.426  -1.721 1.00 0.00 ? 1  MET A C    2  
ATOM 1149  O O    . MET A 1 1  ? 2.123  -1.750  -2.887 1.00 0.00 ? 1  MET A O    2  
ATOM 1150  C CB   . MET A 1 1  ? 3.421  0.733   -1.050 1.00 0.00 ? 1  MET A CB   2  
ATOM 1151  C CG   . MET A 1 1  ? 4.019  1.258   -2.345 1.00 0.00 ? 1  MET A CG   2  
ATOM 1152  S SD   . MET A 1 1  ? 3.059  2.608   -3.056 1.00 0.00 ? 1  MET A SD   2  
ATOM 1153  C CE   . MET A 1 1  ? 2.546  1.878   -4.609 1.00 0.00 ? 1  MET A CE   2  
ATOM 1154  H H1   . MET A 1 1  ? 1.808  0.000   0.855  1.00 0.00 ? 1  MET A H1   2  
ATOM 1155  H HA   . MET A 1 1  ? 1.511  0.518   -1.989 1.00 0.00 ? 1  MET A HA   2  
ATOM 1156  H HB2  . MET A 1 1  ? 3.264  1.570   -0.386 1.00 0.00 ? 1  MET A HB2  2  
ATOM 1157  H HB3  . MET A 1 1  ? 4.132  0.056   -0.600 1.00 0.00 ? 1  MET A HB3  2  
ATOM 1158  H HG2  . MET A 1 1  ? 5.019  1.613   -2.147 1.00 0.00 ? 1  MET A HG2  2  
ATOM 1159  H HG3  . MET A 1 1  ? 4.061  0.449   -3.059 1.00 0.00 ? 1  MET A HG3  2  
ATOM 1160  H HE1  . MET A 1 1  ? 1.729  1.194   -4.433 1.00 0.00 ? 1  MET A HE1  2  
ATOM 1161  H HE2  . MET A 1 1  ? 2.224  2.657   -5.284 1.00 0.00 ? 1  MET A HE2  2  
ATOM 1162  H HE3  . MET A 1 1  ? 3.376  1.342   -5.046 1.00 0.00 ? 1  MET A HE3  2  
ATOM 1163  N N    . SER A 1 2  ? 2.828  -2.273  -0.815 1.00 0.00 ? 2  SER A N    2  
ATOM 1164  C CA   . SER A 1 2  ? 3.121  -3.662  -1.146 1.00 0.00 ? 2  SER A CA   2  
ATOM 1165  C C    . SER A 1 2  ? 2.281  -4.612  -0.296 1.00 0.00 ? 2  SER A C    2  
ATOM 1166  O O    . SER A 1 2  ? 1.786  -4.238  0.767  1.00 0.00 ? 2  SER A O    2  
ATOM 1167  C CB   . SER A 1 2  ? 4.608  -3.955  -0.940 1.00 0.00 ? 2  SER A CB   2  
ATOM 1168  O OG   . SER A 1 2  ? 5.411  -2.927  -1.494 1.00 0.00 ? 2  SER A OG   2  
ATOM 1169  H H    . SER A 1 2  ? 2.989  -1.955  0.098  1.00 0.00 ? 2  SER A H    2  
ATOM 1170  H HA   . SER A 1 2  ? 2.873  -3.814  -2.186 1.00 0.00 ? 2  SER A HA   2  
ATOM 1171  H HB2  . SER A 1 2  ? 4.815  -4.028  0.116  1.00 0.00 ? 2  SER A HB2  2  
ATOM 1172  H HB3  . SER A 1 2  ? 4.858  -4.890  -1.422 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1173  H HG   . SER A 1 2  ? 6.337  -3.121  -1.329 1.00 0.00 ? 2  SER A HG   2  
ATOM 1174  N N    . ASP A 1 3  ? 2.127  -5.842  -0.773 1.00 0.00 ? 3  ASP A N    2  
ATOM 1175  C CA   . ASP A 1 3  ? 1.349  -6.847  -0.058 1.00 0.00 ? 3  ASP A CA   2  
ATOM 1176  C C    . ASP A 1 3  ? 1.842  -6.995  1.378  1.00 0.00 ? 3  ASP A C    2  
ATOM 1177  O O    . ASP A 1 3  ? 1.047  -7.146  2.306  1.00 0.00 ? 3  ASP A O    2  
ATOM 1178  C CB   . ASP A 1 3  ? 1.429  -8.193  -0.780 1.00 0.00 ? 3  ASP A CB   2  
ATOM 1179  C CG   . ASP A 1 3  ? 0.525  -8.254  -1.995 1.00 0.00 ? 3  ASP A CG   2  
ATOM 1180  O OD1  . ASP A 1 3  ? -0.680 -8.538  -1.825 1.00 0.00 ? 3  ASP A OD1  2  
ATOM 1181  O OD2  . ASP A 1 3  ? 1.021  -8.016  -3.116 1.00 0.00 ? 3  ASP A OD2  2  
ATOM 1182  H H    . ASP A 1 3  ? 2.547  -6.080  -1.627 1.00 0.00 ? 3  ASP A H    2  
ATOM 1183  H HA   . ASP A 1 3  ? 0.320  -6.520  -0.041 1.00 0.00 ? 3  ASP A HA   2  
ATOM 1184  H HB2  . ASP A 1 3  ? 2.446  -8.361  -1.103 1.00 0.00 ? 3  ASP A HB2  2  
ATOM 1185  H HB3  . ASP A 1 3  ? 1.138  -8.978  -0.097 1.00 0.00 ? 3  ASP A HB3  2  
ATOM 1186  N N    . THR A 1 4  ? 3.159  -6.953  1.554  1.00 0.00 ? 4  THR A N    2  
ATOM 1187  C CA   . THR A 1 4  ? 3.758  -7.085  2.876  1.00 0.00 ? 4  THR A CA   2  
ATOM 1188  C C    . THR A 1 4  ? 3.399  -5.899  3.763  1.00 0.00 ? 4  THR A C    2  
ATOM 1189  O O    . THR A 1 4  ? 2.977  -6.072  4.906  1.00 0.00 ? 4  THR A O    2  
ATOM 1190  C CB   . THR A 1 4  ? 5.291  -7.201  2.788  1.00 0.00 ? 4  THR A CB   2  
ATOM 1191  O OG1  . THR A 1 4  ? 5.653  -8.286  1.926  1.00 0.00 ? 4  THR A OG1  2  
ATOM 1192  C CG2  . THR A 1 4  ? 5.897  -7.419  4.167  1.00 0.00 ? 4  THR A CG2  2  
ATOM 1193  H H    . THR A 1 4  ? 3.740  -6.831  0.774  1.00 0.00 ? 4  THR A H    2  
ATOM 1194  H HA   . THR A 1 4  ? 3.375  -7.989  3.327  1.00 0.00 ? 4  THR A HA   2  
ATOM 1195  H HB   . THR A 1 4  ? 5.684  -6.280  2.380  1.00 0.00 ? 4  THR A HB   2  
ATOM 1196  H HG1  . THR A 1 4  ? 5.131  -9.060  2.150  1.00 0.00 ? 4  THR A HG1  2  
ATOM 1197  H HG21 . THR A 1 4  ? 5.116  -7.386  4.912  1.00 0.00 ? 4  THR A HG21 2  
ATOM 1198  H HG22 . THR A 1 4  ? 6.621  -6.643  4.368  1.00 0.00 ? 4  THR A HG22 2  
ATOM 1199  H HG23 . THR A 1 4  ? 6.383  -8.382  4.198  1.00 0.00 ? 4  THR A HG23 2  
ATOM 1200  N N    . ALA A 1 5  ? 3.568  -4.694  3.229  1.00 0.00 ? 5  ALA A N    2  
ATOM 1201  C CA   . ALA A 1 5  ? 3.259  -3.478  3.972  1.00 0.00 ? 5  ALA A CA   2  
ATOM 1202  C C    . ALA A 1 5  ? 1.851  -3.534  4.553  1.00 0.00 ? 5  ALA A C    2  
ATOM 1203  O O    . ALA A 1 5  ? 1.644  -3.243  5.731  1.00 0.00 ? 5  ALA A O    2  
ATOM 1204  C CB   . ALA A 1 5  ? 3.414  -2.258  3.076  1.00 0.00 ? 5  ALA A CB   2  
ATOM 1205  H H    . ALA A 1 5  ? 3.908  -4.620  2.312  1.00 0.00 ? 5  ALA A H    2  
ATOM 1206  H HA   . ALA A 1 5  ? 3.969  -3.393  4.782  1.00 0.00 ? 5  ALA A HA   2  
ATOM 1207  H HB1  . ALA A 1 5  ? 3.334  -2.560  2.041  1.00 0.00 ? 5  ALA A HB1  2  
ATOM 1208  H HB2  . ALA A 1 5  ? 2.638  -1.543  3.304  1.00 0.00 ? 5  ALA A HB2  2  
ATOM 1209  H HB3  . ALA A 1 5  ? 4.381  -1.808  3.246  1.00 0.00 ? 5  ALA A HB3  2  
ATOM 1210  N N    . GLU A 1 6  ? 0.885  -3.908  3.720  1.00 0.00 ? 6  GLU A N    2  
ATOM 1211  C CA   . GLU A 1 6  ? -0.504 -4.000  4.153  1.00 0.00 ? 6  GLU A CA   2  
ATOM 1212  C C    . GLU A 1 6  ? -0.625 -4.845  5.417  1.00 0.00 ? 6  GLU A C    2  
ATOM 1213  O O    . GLU A 1 6  ? -1.175 -4.399  6.425  1.00 0.00 ? 6  GLU A O    2  
ATOM 1214  C CB   . GLU A 1 6  ? -1.370 -4.598  3.042  1.00 0.00 ? 6  GLU A CB   2  
ATOM 1215  C CG   . GLU A 1 6  ? -1.650 -3.632  1.902  1.00 0.00 ? 6  GLU A CG   2  
ATOM 1216  C CD   . GLU A 1 6  ? -2.888 -2.791  2.142  1.00 0.00 ? 6  GLU A CD   2  
ATOM 1217  O OE1  . GLU A 1 6  ? -3.886 -3.338  2.656  1.00 0.00 ? 6  GLU A OE1  2  
ATOM 1218  O OE2  . GLU A 1 6  ? -2.860 -1.586  1.815  1.00 0.00 ? 6  GLU A OE2  2  
ATOM 1219  H H    . GLU A 1 6  ? 1.112  -4.127  2.792  1.00 0.00 ? 6  GLU A H    2  
ATOM 1220  H HA   . GLU A 1 6  ? -0.851 -3.000  4.368  1.00 0.00 ? 6  GLU A HA   2  
ATOM 1221  H HB2  . GLU A 1 6  ? -0.867 -5.464  2.637  1.00 0.00 ? 6  GLU A HB2  2  
ATOM 1222  H HB3  . GLU A 1 6  ? -2.314 -4.906  3.465  1.00 0.00 ? 6  GLU A HB3  2  
ATOM 1223  H HG2  . GLU A 1 6  ? -0.802 -2.974  1.789  1.00 0.00 ? 6  GLU A HG2  2  
ATOM 1224  H HG3  . GLU A 1 6  ? -1.788 -4.199  0.993  1.00 0.00 ? 6  GLU A HG3  2  
ATOM 1225  N N    . ARG A 1 7  ? -0.109 -6.068  5.356  1.00 0.00 ? 7  ARG A N    2  
ATOM 1226  C CA   . ARG A 1 7  ? -0.160 -6.977  6.495  1.00 0.00 ? 7  ARG A CA   2  
ATOM 1227  C C    . ARG A 1 7  ? 0.495  -6.349  7.722  1.00 0.00 ? 7  ARG A C    2  
ATOM 1228  O O    . ARG A 1 7  ? -0.019 -6.454  8.835  1.00 0.00 ? 7  ARG A O    2  
ATOM 1229  C CB   . ARG A 1 7  ? 0.532  -8.297  6.153  1.00 0.00 ? 7  ARG A CB   2  
ATOM 1230  C CG   . ARG A 1 7  ? -0.386 -9.314  5.494  1.00 0.00 ? 7  ARG A CG   2  
ATOM 1231  C CD   . ARG A 1 7  ? -0.646 -8.967  4.036  1.00 0.00 ? 7  ARG A CD   2  
ATOM 1232  N NE   . ARG A 1 7  ? -1.720 -9.775  3.465  1.00 0.00 ? 7  ARG A NE   2  
ATOM 1233  C CZ   . ARG A 1 7  ? -2.225 -9.575  2.253  1.00 0.00 ? 7  ARG A CZ   2  
ATOM 1234  N NH1  . ARG A 1 7  ? -1.756 -8.599  1.488  1.00 0.00 ? 7  ARG A NH1  2  
ATOM 1235  N NH2  . ARG A 1 7  ? -3.201 -10.353 1.802  1.00 0.00 ? 7  ARG A NH2  2  
ATOM 1236  H H    . ARG A 1 7  ? 0.316  -6.367  4.525  1.00 0.00 ? 7  ARG A H    2  
ATOM 1237  H HA   . ARG A 1 7  ? -1.199 -7.173  6.717  1.00 0.00 ? 7  ARG A HA   2  
ATOM 1238  H HB2  . ARG A 1 7  ? 1.352  -8.096  5.479  1.00 0.00 ? 7  ARG A HB2  2  
ATOM 1239  H HB3  . ARG A 1 7  ? 0.921  -8.732  7.061  1.00 0.00 ? 7  ARG A HB3  2  
ATOM 1240  H HG2  . ARG A 1 7  ? 0.077  -10.288 5.543  1.00 0.00 ? 7  ARG A HG2  2  
ATOM 1241  H HG3  . ARG A 1 7  ? -1.326 -9.333  6.024  1.00 0.00 ? 7  ARG A HG3  2  
ATOM 1242  H HD2  . ARG A 1 7  ? -0.920 -7.924  3.972  1.00 0.00 ? 7  ARG A HD2  2  
ATOM 1243  H HD3  . ARG A 1 7  ? 0.259  -9.136  3.473  1.00 0.00 ? 7  ARG A HD3  2  
ATOM 1244  H HE   . ARG A 1 7  ? -2.082 -10.502 4.013  1.00 0.00 ? 7  ARG A HE   2  
ATOM 1245  H HH11 . ARG A 1 7  ? -1.019 -8.012  1.824  1.00 0.00 ? 7  ARG A HH11 2  
ATOM 1246  H HH12 . ARG A 1 7  ? -2.137 -8.451  0.575  1.00 0.00 ? 7  ARG A HH12 2  
ATOM 1247  H HH21 . ARG A 1 7  ? -3.558 -11.090 2.376  1.00 0.00 ? 7  ARG A HH21 2  
ATOM 1248  H HH22 . ARG A 1 7  ? -3.581 -10.201 0.890  1.00 0.00 ? 7  ARG A HH22 2  
ATOM 1249  N N    . VAL A 1 8  ? 1.634  -5.698  7.509  1.00 0.00 ? 8  VAL A N    2  
ATOM 1250  C CA   . VAL A 1 8  ? 2.360  -5.053  8.597  1.00 0.00 ? 8  VAL A CA   2  
ATOM 1251  C C    . VAL A 1 8  ? 1.535  -3.933  9.220  1.00 0.00 ? 8  VAL A C    2  
ATOM 1252  O O    . VAL A 1 8  ? 1.155  -4.003  10.389 1.00 0.00 ? 8  VAL A O    2  
ATOM 1253  C CB   . VAL A 1 8  ? 3.704  -4.477  8.111  1.00 0.00 ? 8  VAL A CB   2  
ATOM 1254  C CG1  . VAL A 1 8  ? 4.429  -3.779  9.251  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1255  C CG2  . VAL A 1 8  ? 4.568  -5.576  7.511  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1256  H H    . VAL A 1 8  ? 1.994  -5.649  6.599  1.00 0.00 ? 8  VAL A H    2  
ATOM 1257  H HA   . VAL A 1 8  ? 2.564  -5.799  9.351  1.00 0.00 ? 8  VAL A HA   2  
ATOM 1258  H HB   . VAL A 1 8  ? 3.502  -3.746  7.342  1.00 0.00 ? 8  VAL A HB   2  
ATOM 1259  H HG11 . VAL A 1 8  ? 4.167  -2.731  9.256  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1260  H HG12 . VAL A 1 8  ? 4.140  -4.228  10.190 1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1261  H HG13 . VAL A 1 8  ? 5.496  -3.882  9.115  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1262  H HG21 . VAL A 1 8  ? 4.586  -5.472  6.436  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1263  H HG22 . VAL A 1 8  ? 5.574  -5.495  7.898  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1264  H HG23 . VAL A 1 8  ? 4.159  -6.540  7.773  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1265  N N    . LYS A 1 9  ? 1.261  -2.899  8.432  1.00 0.00 ? 9  LYS A N    2  
ATOM 1266  C CA   . LYS A 1 9  ? 0.479  -1.763  8.904  1.00 0.00 ? 9  LYS A CA   2  
ATOM 1267  C C    . LYS A 1 9  ? -0.852 -2.224  9.489  1.00 0.00 ? 9  LYS A C    2  
ATOM 1268  O O    . LYS A 1 9  ? -1.378 -1.613  10.421 1.00 0.00 ? 9  LYS A O    2  
ATOM 1269  C CB   . LYS A 1 9  ? 0.231  -0.777  7.760  1.00 0.00 ? 9  LYS A CB   2  
ATOM 1270  C CG   . LYS A 1 9  ? -0.748 -1.289  6.717  1.00 0.00 ? 9  LYS A CG   2  
ATOM 1271  C CD   . LYS A 1 9  ? -1.075 -0.221  5.687  1.00 0.00 ? 9  LYS A CD   2  
ATOM 1272  C CE   . LYS A 1 9  ? -2.418 -0.481  5.022  1.00 0.00 ? 9  LYS A CE   2  
ATOM 1273  N NZ   . LYS A 1 9  ? -3.013 0.766   4.468  1.00 0.00 ? 9  LYS A NZ   2  
ATOM 1274  H H    . LYS A 1 9  ? 1.592  -2.901  7.509  1.00 0.00 ? 9  LYS A H    2  
ATOM 1275  H HA   . LYS A 1 9  ? 1.046  -1.268  9.678  1.00 0.00 ? 9  LYS A HA   2  
ATOM 1276  H HB2  . LYS A 1 9  ? -0.162 0.142   8.171  1.00 0.00 ? 9  LYS A HB2  2  
ATOM 1277  H HB3  . LYS A 1 9  ? 1.171  -0.569  7.270  1.00 0.00 ? 9  LYS A HB3  2  
ATOM 1278  H HG2  . LYS A 1 9  ? -0.311 -2.138  6.213  1.00 0.00 ? 9  LYS A HG2  2  
ATOM 1279  H HG3  . LYS A 1 9  ? -1.660 -1.592  7.211  1.00 0.00 ? 9  LYS A HG3  2  
ATOM 1280  H HD2  . LYS A 1 9  ? -1.108 0.741   6.176  1.00 0.00 ? 9  LYS A HD2  2  
ATOM 1281  H HD3  . LYS A 1 9  ? -0.303 -0.215  4.930  1.00 0.00 ? 9  LYS A HD3  2  
ATOM 1282  H HE2  . LYS A 1 9  ? -2.276 -1.189  4.220  1.00 0.00 ? 9  LYS A HE2  2  
ATOM 1283  H HE3  . LYS A 1 9  ? -3.093 -0.898  5.755  1.00 0.00 ? 9  LYS A HE3  2  
ATOM 1284  H HZ1  . LYS A 1 9  ? -2.885 0.795   3.436  1.00 0.00 ? 9  LYS A HZ1  2  
ATOM 1285  H HZ2  . LYS A 1 9  ? -2.551 1.599   4.886  1.00 0.00 ? 9  LYS A HZ2  2  
ATOM 1286  H HZ3  . LYS A 1 9  ? -4.030 0.803   4.682  1.00 0.00 ? 9  LYS A HZ3  2  
ATOM 1287  N N    . LYS A 1 10 ? -1.393 -3.305  8.939  1.00 0.00 ? 10 LYS A N    2  
ATOM 1288  C CA   . LYS A 1 10 ? -2.661 -3.851  9.407  1.00 0.00 ? 10 LYS A CA   2  
ATOM 1289  C C    . LYS A 1 10 ? -2.540 -4.356  10.841 1.00 0.00 ? 10 LYS A C    2  
ATOM 1290  O O    . LYS A 1 10 ? -3.268 -3.912  11.729 1.00 0.00 ? 10 LYS A O    2  
ATOM 1291  C CB   . LYS A 1 10 ? -3.120 -4.988  8.492  1.00 0.00 ? 10 LYS A CB   2  
ATOM 1292  C CG   . LYS A 1 10 ? -4.395 -5.668  8.959  1.00 0.00 ? 10 LYS A CG   2  
ATOM 1293  C CD   . LYS A 1 10 ? -5.110 -6.362  7.811  1.00 0.00 ? 10 LYS A CD   2  
ATOM 1294  C CE   . LYS A 1 10 ? -5.921 -5.376  6.984  1.00 0.00 ? 10 LYS A CE   2  
ATOM 1295  N NZ   . LYS A 1 10 ? -7.192 -4.997  7.661  1.00 0.00 ? 10 LYS A NZ   2  
ATOM 1296  H H    . LYS A 1 10 ? -0.926 -3.749  8.199  1.00 0.00 ? 10 LYS A H    2  
ATOM 1297  H HA   . LYS A 1 10 ? -3.394 -3.059  9.378  1.00 0.00 ? 10 LYS A HA   2  
ATOM 1298  H HB2  . LYS A 1 10 ? -3.290 -4.592  7.502  1.00 0.00 ? 10 LYS A HB2  2  
ATOM 1299  H HB3  . LYS A 1 10 ? -2.338 -5.732  8.443  1.00 0.00 ? 10 LYS A HB3  2  
ATOM 1300  H HG2  . LYS A 1 10 ? -4.147 -6.403  9.710  1.00 0.00 ? 10 LYS A HG2  2  
ATOM 1301  H HG3  . LYS A 1 10 ? -5.054 -4.924  9.385  1.00 0.00 ? 10 LYS A HG3  2  
ATOM 1302  H HD2  . LYS A 1 10 ? -4.377 -6.832  7.173  1.00 0.00 ? 10 LYS A HD2  2  
ATOM 1303  H HD3  . LYS A 1 10 ? -5.775 -7.113  8.214  1.00 0.00 ? 10 LYS A HD3  2  
ATOM 1304  H HE2  . LYS A 1 10 ? -5.329 -4.488  6.823  1.00 0.00 ? 10 LYS A HE2  2  
ATOM 1305  H HE3  . LYS A 1 10 ? -6.153 -5.831  6.032  1.00 0.00 ? 10 LYS A HE3  2  
ATOM 1306  H HZ1  . LYS A 1 10 ? -7.403 -5.669  8.426  1.00 0.00 ? 10 LYS A HZ1  2  
ATOM 1307  H HZ2  . LYS A 1 10 ? -7.977 -5.007  6.980  1.00 0.00 ? 10 LYS A HZ2  2  
ATOM 1308  H HZ3  . LYS A 1 10 ? -7.110 -4.042  8.065  1.00 0.00 ? 10 LYS A HZ3  2  
ATOM 1309  N N    . ILE A 1 11 ? -1.614 -5.284  11.061 1.00 0.00 ? 11 ILE A N    2  
ATOM 1310  C CA   . ILE A 1 11 ? -1.397 -5.847  12.388 1.00 0.00 ? 11 ILE A CA   2  
ATOM 1311  C C    . ILE A 1 11 ? -1.011 -4.762  13.388 1.00 0.00 ? 11 ILE A C    2  
ATOM 1312  O O    . ILE A 1 11 ? -1.349 -4.842  14.569 1.00 0.00 ? 11 ILE A O    2  
ATOM 1313  C CB   . ILE A 1 11 ? -0.298 -6.926  12.368 1.00 0.00 ? 11 ILE A CB   2  
ATOM 1314  C CG1  . ILE A 1 11 ? -0.672 -8.048  11.398 1.00 0.00 ? 11 ILE A CG1  2  
ATOM 1315  C CG2  . ILE A 1 11 ? -0.075 -7.480  13.767 1.00 0.00 ? 11 ILE A CG2  2  
ATOM 1316  C CD1  . ILE A 1 11 ? 0.504  -8.902  10.979 1.00 0.00 ? 11 ILE A CD1  2  
ATOM 1317  H H    . ILE A 1 11 ? -1.065 -5.598  10.312 1.00 0.00 ? 11 ILE A H    2  
ATOM 1318  H HA   . ILE A 1 11 ? -2.320 -6.307  12.710 1.00 0.00 ? 11 ILE A HA   2  
ATOM 1319  H HB   . ILE A 1 11 ? 0.621  -6.466  12.039 1.00 0.00 ? 11 ILE A HB   2  
ATOM 1320  H HG12 . ILE A 1 11 ? -1.399 -8.693  11.866 1.00 0.00 ? 11 ILE A HG12 2  
ATOM 1321  H HG13 . ILE A 1 11 ? -1.103 -7.615  10.507 1.00 0.00 ? 11 ILE A HG13 2  
ATOM 1322  H HG21 . ILE A 1 11 ? 0.708  -8.223  13.740 1.00 0.00 ? 11 ILE A HG21 2  
ATOM 1323  H HG22 . ILE A 1 11 ? 0.214  -6.678  14.430 1.00 0.00 ? 11 ILE A HG22 2  
ATOM 1324  H HG23 . ILE A 1 11 ? -0.988 -7.932  14.125 1.00 0.00 ? 11 ILE A HG23 2  
ATOM 1325  H HD11 . ILE A 1 11 ? 0.615  -9.726  11.669 1.00 0.00 ? 11 ILE A HD11 2  
ATOM 1326  H HD12 . ILE A 1 11 ? 0.336  -9.285  9.984  1.00 0.00 ? 11 ILE A HD12 2  
ATOM 1327  H HD13 . ILE A 1 11 ? 1.404  -8.304  10.987 1.00 0.00 ? 11 ILE A HD13 2  
ATOM 1328  N N    . VAL A 1 12 ? -0.301 -3.746  12.906 1.00 0.00 ? 12 VAL A N    2  
ATOM 1329  C CA   . VAL A 1 12 ? 0.129  -2.643  13.757 1.00 0.00 ? 12 VAL A CA   2  
ATOM 1330  C C    . VAL A 1 12 ? -1.062 -1.810  14.221 1.00 0.00 ? 12 VAL A C    2  
ATOM 1331  O O    . VAL A 1 12 ? -1.171 -1.465  15.397 1.00 0.00 ? 12 VAL A O    2  
ATOM 1332  C CB   . VAL A 1 12 ? 1.128  -1.727  13.026 1.00 0.00 ? 12 VAL A CB   2  
ATOM 1333  C CG1  . VAL A 1 12 ? 1.538  -0.564  13.917 1.00 0.00 ? 12 VAL A CG1  2  
ATOM 1334  C CG2  . VAL A 1 12 ? 2.346  -2.520  12.576 1.00 0.00 ? 12 VAL A CG2  2  
ATOM 1335  H H    . VAL A 1 12 ? -0.062 -3.738  11.956 1.00 0.00 ? 12 VAL A H    2  
ATOM 1336  H HA   . VAL A 1 12 ? 0.622  -3.061  14.622 1.00 0.00 ? 12 VAL A HA   2  
ATOM 1337  H HB   . VAL A 1 12 ? 0.642  -1.325  12.149 1.00 0.00 ? 12 VAL A HB   2  
ATOM 1338  H HG11 . VAL A 1 12 ? 0.829  0.243   13.804 1.00 0.00 ? 12 VAL A HG11 2  
ATOM 1339  H HG12 . VAL A 1 12 ? 1.554  -0.888  14.947 1.00 0.00 ? 12 VAL A HG12 2  
ATOM 1340  H HG13 . VAL A 1 12 ? 2.521  -0.221  13.631 1.00 0.00 ? 12 VAL A HG13 2  
ATOM 1341  H HG21 . VAL A 1 12 ? 2.219  -3.557  12.847 1.00 0.00 ? 12 VAL A HG21 2  
ATOM 1342  H HG22 . VAL A 1 12 ? 2.454  -2.438  11.504 1.00 0.00 ? 12 VAL A HG22 2  
ATOM 1343  H HG23 . VAL A 1 12 ? 3.229  -2.127  13.057 1.00 0.00 ? 12 VAL A HG23 2  
ATOM 1344  N N    . VAL A 1 13 ? -1.953 -1.491  13.288 1.00 0.00 ? 13 VAL A N    2  
ATOM 1345  C CA   . VAL A 1 13 ? -3.137 -0.700  13.601 1.00 0.00 ? 13 VAL A CA   2  
ATOM 1346  C C    . VAL A 1 13 ? -4.121 -1.497  14.450 1.00 0.00 ? 13 VAL A C    2  
ATOM 1347  O O    . VAL A 1 13 ? -4.845 -0.933  15.270 1.00 0.00 ? 13 VAL A O    2  
ATOM 1348  C CB   . VAL A 1 13 ? -3.849 -0.225  12.320 1.00 0.00 ? 13 VAL A CB   2  
ATOM 1349  C CG1  . VAL A 1 13 ? -5.108 0.555   12.667 1.00 0.00 ? 13 VAL A CG1  2  
ATOM 1350  C CG2  . VAL A 1 13 ? -2.909 0.614   11.468 1.00 0.00 ? 13 VAL A CG2  2  
ATOM 1351  H H    . VAL A 1 13 ? -1.811 -1.796  12.367 1.00 0.00 ? 13 VAL A H    2  
ATOM 1352  H HA   . VAL A 1 13 ? -2.820 0.171   14.155 1.00 0.00 ? 13 VAL A HA   2  
ATOM 1353  H HB   . VAL A 1 13 ? -4.138 -1.096  11.749 1.00 0.00 ? 13 VAL A HB   2  
ATOM 1354  H HG11 . VAL A 1 13 ? -5.120 1.482   12.113 1.00 0.00 ? 13 VAL A HG11 2  
ATOM 1355  H HG12 . VAL A 1 13 ? -5.978 -0.031  12.410 1.00 0.00 ? 13 VAL A HG12 2  
ATOM 1356  H HG13 . VAL A 1 13 ? -5.118 0.769   13.726 1.00 0.00 ? 13 VAL A HG13 2  
ATOM 1357  H HG21 . VAL A 1 13 ? -1.902 0.519   11.845 1.00 0.00 ? 13 VAL A HG21 2  
ATOM 1358  H HG22 . VAL A 1 13 ? -2.944 0.269   10.445 1.00 0.00 ? 13 VAL A HG22 2  
ATOM 1359  H HG23 . VAL A 1 13 ? -3.213 1.649   11.509 1.00 0.00 ? 13 VAL A HG23 2  
ATOM 1360  N N    . GLU A 1 14 ? -4.141 -2.810  14.249 1.00 0.00 ? 14 GLU A N    2  
ATOM 1361  C CA   . GLU A 1 14 ? -5.037 -3.684  14.997 1.00 0.00 ? 14 GLU A CA   2  
ATOM 1362  C C    . GLU A 1 14 ? -4.460 -4.005  16.373 1.00 0.00 ? 14 GLU A C    2  
ATOM 1363  O O    . GLU A 1 14 ? -5.196 -4.316  17.310 1.00 0.00 ? 14 GLU A O    2  
ATOM 1364  C CB   . GLU A 1 14 ? -5.287 -4.980  14.222 1.00 0.00 ? 14 GLU A CB   2  
ATOM 1365  C CG   . GLU A 1 14 ? -6.583 -5.676  14.603 1.00 0.00 ? 14 GLU A CG   2  
ATOM 1366  C CD   . GLU A 1 14 ? -6.638 -7.112  14.118 1.00 0.00 ? 14 GLU A CD   2  
ATOM 1367  O OE1  . GLU A 1 14 ? -6.139 -7.381  13.005 1.00 0.00 ? 14 GLU A OE1  2  
ATOM 1368  O OE2  . GLU A 1 14 ? -7.179 -7.966  14.850 1.00 0.00 ? 14 GLU A OE2  2  
ATOM 1369  H H    . GLU A 1 14 ? -3.540 -3.201  13.581 1.00 0.00 ? 14 GLU A H    2  
ATOM 1370  H HA   . GLU A 1 14 ? -5.975 -3.166  15.125 1.00 0.00 ? 14 GLU A HA   2  
ATOM 1371  H HB2  . GLU A 1 14 ? -5.321 -4.753  13.166 1.00 0.00 ? 14 GLU A HB2  2  
ATOM 1372  H HB3  . GLU A 1 14 ? -4.469 -5.660  14.408 1.00 0.00 ? 14 GLU A HB3  2  
ATOM 1373  H HG2  . GLU A 1 14 ? -6.676 -5.672  15.678 1.00 0.00 ? 14 GLU A HG2  2  
ATOM 1374  H HG3  . GLU A 1 14 ? -7.410 -5.133  14.169 1.00 0.00 ? 14 GLU A HG3  2  
ATOM 1375  N N    . HIS A 1 15 ? -3.138 -3.928  16.486 1.00 0.00 ? 15 HIS A N    2  
ATOM 1376  C CA   . HIS A 1 15 ? -2.461 -4.211  17.747 1.00 0.00 ? 15 HIS A CA   2  
ATOM 1377  C C    . HIS A 1 15 ? -2.368 -2.954  18.607 1.00 0.00 ? 15 HIS A C    2  
ATOM 1378  O O    . HIS A 1 15 ? -2.797 -2.945  19.761 1.00 0.00 ? 15 HIS A O    2  
ATOM 1379  C CB   . HIS A 1 15 ? -1.062 -4.769  17.485 1.00 0.00 ? 15 HIS A CB   2  
ATOM 1380  C CG   . HIS A 1 15 ? -1.053 -6.227  17.143 1.00 0.00 ? 15 HIS A CG   2  
ATOM 1381  N ND1  . HIS A 1 15 ? 0.074  -7.015  17.237 1.00 0.00 ? 15 HIS A ND1  2  
ATOM 1382  C CD2  . HIS A 1 15 ? -2.044 -7.040  16.707 1.00 0.00 ? 15 HIS A CD2  2  
ATOM 1383  C CE1  . HIS A 1 15 ? -0.223 -8.250  16.872 1.00 0.00 ? 15 HIS A CE1  2  
ATOM 1384  N NE2  . HIS A 1 15 ? -1.502 -8.291  16.546 1.00 0.00 ? 15 HIS A NE2  2  
ATOM 1385  H H    . HIS A 1 15 ? -2.605 -3.675  15.704 1.00 0.00 ? 15 HIS A H    2  
ATOM 1386  H HA   . HIS A 1 15 ? -3.041 -4.951  18.276 1.00 0.00 ? 15 HIS A HA   2  
ATOM 1387  H HB2  . HIS A 1 15 ? -0.616 -4.232  16.661 1.00 0.00 ? 15 HIS A HB2  2  
ATOM 1388  H HB3  . HIS A 1 15 ? -0.455 -4.631  18.369 1.00 0.00 ? 15 HIS A HB3  2  
ATOM 1389  H HD1  . HIS A 1 15 ? 0.960  -6.714  17.527 1.00 0.00 ? 15 HIS A HD1  2  
ATOM 1390  H HD2  . HIS A 1 15 ? -3.070 -6.757  16.520 1.00 0.00 ? 15 HIS A HD2  2  
ATOM 1391  H HE1  . HIS A 1 15 ? 0.463  -9.083  16.844 1.00 0.00 ? 15 HIS A HE1  2  
ATOM 1392  N N    . LEU A 1 16 ? -1.803 -1.894  18.037 1.00 0.00 ? 16 LEU A N    2  
ATOM 1393  C CA   . LEU A 1 16 ? -1.652 -0.631  18.752 1.00 0.00 ? 16 LEU A CA   2  
ATOM 1394  C C    . LEU A 1 16 ? -2.987 0.101   18.851 1.00 0.00 ? 16 LEU A C    2  
ATOM 1395  O O    . LEU A 1 16 ? -3.236 0.831   19.810 1.00 0.00 ? 16 LEU A O    2  
ATOM 1396  C CB   . LEU A 1 16 ? -0.623 0.255   18.049 1.00 0.00 ? 16 LEU A CB   2  
ATOM 1397  C CG   . LEU A 1 16 ? 0.303  1.061   18.961 1.00 0.00 ? 16 LEU A CG   2  
ATOM 1398  C CD1  . LEU A 1 16 ? -0.496 2.057   19.786 1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1399  C CD2  . LEU A 1 16 ? 1.100  0.133   19.866 1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1400  H H    . LEU A 1 16 ? -1.480 -1.962  17.115 1.00 0.00 ? 16 LEU A H    2  
ATOM 1401  H HA   . LEU A 1 16 ? -1.303 -0.854  19.749 1.00 0.00 ? 16 LEU A HA   2  
ATOM 1402  H HB2  . LEU A 1 16 ? -0.007 -0.380  17.431 1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1403  H HB3  . LEU A 1 16 ? -1.161 0.952   17.422 1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1404  H HG   . LEU A 1 16 ? 1.002  1.618   18.352 1.00 0.00 ? 16 LEU A HG   2  
ATOM 1405  H HD11 . LEU A 1 16 ? 0.036  2.995   19.833 1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1406  H HD12 . LEU A 1 16 ? -0.631 1.670   20.786 1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1407  H HD13 . LEU A 1 16 ? -1.461 2.213   19.327 1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1408  H HD21 . LEU A 1 16 ? 2.032  0.607   20.135 1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1409  H HD22 . LEU A 1 16 ? 1.304  -0.791  19.345 1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1410  H HD23 . LEU A 1 16 ? 0.530  -0.075  20.760 1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1411  N N    . GLY A 1 17 ? -3.843 -0.102  17.854 1.00 0.00 ? 17 GLY A N    2  
ATOM 1412  C CA   . GLY A 1 17 ? -5.143 0.544   17.850 1.00 0.00 ? 17 GLY A CA   2  
ATOM 1413  C C    . GLY A 1 17 ? -5.057 2.016   17.498 1.00 0.00 ? 17 GLY A C    2  
ATOM 1414  O O    . GLY A 1 17 ? -5.842 2.827   17.992 1.00 0.00 ? 17 GLY A O    2  
ATOM 1415  H H    . GLY A 1 17 ? -3.590 -0.694  17.116 1.00 0.00 ? 17 GLY A H    2  
ATOM 1416  H HA2  . GLY A 1 17 ? -5.776 0.049   17.129 1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1417  H HA3  . GLY A 1 17 ? -5.584 0.446   18.831 1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1418  N N    . VAL A 1 18 ? -4.101 2.365   16.643 1.00 0.00 ? 18 VAL A N    2  
ATOM 1419  C CA   . VAL A 1 18 ? -3.915 3.749   16.227 1.00 0.00 ? 18 VAL A CA   2  
ATOM 1420  C C    . VAL A 1 18 ? -4.385 3.959   14.792 1.00 0.00 ? 18 VAL A C    2  
ATOM 1421  O O    . VAL A 1 18 ? -4.887 3.036   14.151 1.00 0.00 ? 18 VAL A O    2  
ATOM 1422  C CB   . VAL A 1 18 ? -2.439 4.176   16.339 1.00 0.00 ? 18 VAL A CB   2  
ATOM 1423  C CG1  . VAL A 1 18 ? -2.012 4.243   17.797 1.00 0.00 ? 18 VAL A CG1  2  
ATOM 1424  C CG2  . VAL A 1 18 ? -1.548 3.222   15.557 1.00 0.00 ? 18 VAL A CG2  2  
ATOM 1425  H H    . VAL A 1 18 ? -3.506 1.673   16.284 1.00 0.00 ? 18 VAL A H    2  
ATOM 1426  H HA   . VAL A 1 18 ? -4.500 4.377   16.883 1.00 0.00 ? 18 VAL A HA   2  
ATOM 1427  H HB   . VAL A 1 18 ? -2.337 5.163   15.911 1.00 0.00 ? 18 VAL A HB   2  
ATOM 1428  H HG11 . VAL A 1 18 ? -0.992 3.899   17.889 1.00 0.00 ? 18 VAL A HG11 2  
ATOM 1429  H HG12 . VAL A 1 18 ? -2.083 5.263   18.147 1.00 0.00 ? 18 VAL A HG12 2  
ATOM 1430  H HG13 . VAL A 1 18 ? -2.658 3.613   18.391 1.00 0.00 ? 18 VAL A HG13 2  
ATOM 1431  H HG21 . VAL A 1 18 ? -1.844 3.224   14.519 1.00 0.00 ? 18 VAL A HG21 2  
ATOM 1432  H HG22 . VAL A 1 18 ? -0.519 3.542   15.639 1.00 0.00 ? 18 VAL A HG22 2  
ATOM 1433  H HG23 . VAL A 1 18 ? -1.648 2.225   15.959 1.00 0.00 ? 18 VAL A HG23 2  
ATOM 1434  N N    . ASP A 1 19 ? -4.219 5.179   14.293 1.00 0.00 ? 19 ASP A N    2  
ATOM 1435  C CA   . ASP A 1 19 ? -4.626 5.511   12.933 1.00 0.00 ? 19 ASP A CA   2  
ATOM 1436  C C    . ASP A 1 19 ? -3.599 5.010   11.921 1.00 0.00 ? 19 ASP A C    2  
ATOM 1437  O O    . ASP A 1 19 ? -2.394 5.091   12.154 1.00 0.00 ? 19 ASP A O    2  
ATOM 1438  C CB   . ASP A 1 19 ? -4.808 7.022   12.786 1.00 0.00 ? 19 ASP A CB   2  
ATOM 1439  C CG   . ASP A 1 19 ? -5.904 7.381   11.802 1.00 0.00 ? 19 ASP A CG   2  
ATOM 1440  O OD1  . ASP A 1 19 ? -7.005 6.798   11.902 1.00 0.00 ? 19 ASP A OD1  2  
ATOM 1441  O OD2  . ASP A 1 19 ? -5.663 8.244   10.934 1.00 0.00 ? 19 ASP A OD2  2  
ATOM 1442  H H    . ASP A 1 19 ? -3.813 5.873   14.854 1.00 0.00 ? 19 ASP A H    2  
ATOM 1443  H HA   . ASP A 1 19 ? -5.569 5.024   12.740 1.00 0.00 ? 19 ASP A HA   2  
ATOM 1444  H HB2  . ASP A 1 19 ? -5.062 7.443   13.748 1.00 0.00 ? 19 ASP A HB2  2  
ATOM 1445  H HB3  . ASP A 1 19 ? -3.882 7.458   12.441 1.00 0.00 ? 19 ASP A HB3  2  
ATOM 1446  N N    . ALA A 1 20 ? -4.086 4.490   10.800 1.00 0.00 ? 20 ALA A N    2  
ATOM 1447  C CA   . ALA A 1 20 ? -3.212 3.976   9.753  1.00 0.00 ? 20 ALA A CA   2  
ATOM 1448  C C    . ALA A 1 20 ? -2.495 5.111   9.030  1.00 0.00 ? 20 ALA A C    2  
ATOM 1449  O O    . ALA A 1 20 ? -1.380 4.940   8.538  1.00 0.00 ? 20 ALA A O    2  
ATOM 1450  C CB   . ALA A 1 20 ? -4.008 3.137   8.764  1.00 0.00 ? 20 ALA A CB   2  
ATOM 1451  H H    . ALA A 1 20 ? -5.057 4.452   10.672 1.00 0.00 ? 20 ALA A H    2  
ATOM 1452  H HA   . ALA A 1 20 ? -2.475 3.337   10.218 1.00 0.00 ? 20 ALA A HA   2  
ATOM 1453  H HB1  . ALA A 1 20 ? -3.499 2.199   8.597  1.00 0.00 ? 20 ALA A HB1  2  
ATOM 1454  H HB2  . ALA A 1 20 ? -4.993 2.947   9.165  1.00 0.00 ? 20 ALA A HB2  2  
ATOM 1455  H HB3  . ALA A 1 20 ? -4.096 3.671   7.829  1.00 0.00 ? 20 ALA A HB3  2  
ATOM 1456  N N    . ASP A 1 21 ? -3.143 6.269   8.969  1.00 0.00 ? 21 ASP A N    2  
ATOM 1457  C CA   . ASP A 1 21 ? -2.567 7.433   8.306  1.00 0.00 ? 21 ASP A CA   2  
ATOM 1458  C C    . ASP A 1 21 ? -1.194 7.764   8.883  1.00 0.00 ? 21 ASP A C    2  
ATOM 1459  O O    . ASP A 1 21 ? -0.348 8.348   8.206  1.00 0.00 ? 21 ASP A O    2  
ATOM 1460  C CB   . ASP A 1 21 ? -3.497 8.639   8.447  1.00 0.00 ? 21 ASP A CB   2  
ATOM 1461  C CG   . ASP A 1 21 ? -3.058 9.812   7.592  1.00 0.00 ? 21 ASP A CG   2  
ATOM 1462  O OD1  . ASP A 1 21 ? -2.695 9.588   6.418  1.00 0.00 ? 21 ASP A OD1  2  
ATOM 1463  O OD2  . ASP A 1 21 ? -3.079 10.954  8.096  1.00 0.00 ? 21 ASP A OD2  2  
ATOM 1464  H H    . ASP A 1 21 ? -4.030 6.343   9.380  1.00 0.00 ? 21 ASP A H    2  
ATOM 1465  H HA   . ASP A 1 21 ? -2.455 7.197   7.258  1.00 0.00 ? 21 ASP A HA   2  
ATOM 1466  H HB2  . ASP A 1 21 ? -4.495 8.353   8.147  1.00 0.00 ? 21 ASP A HB2  2  
ATOM 1467  H HB3  . ASP A 1 21 ? -3.513 8.955   9.479  1.00 0.00 ? 21 ASP A HB3  2  
ATOM 1468  N N    . LYS A 1 22 ? -0.981 7.387   10.140 1.00 0.00 ? 22 LYS A N    2  
ATOM 1469  C CA   . LYS A 1 22 ? 0.289  7.643   10.810 1.00 0.00 ? 22 LYS A CA   2  
ATOM 1470  C C    . LYS A 1 22 ? 1.309  6.559   10.475 1.00 0.00 ? 22 LYS A C    2  
ATOM 1471  O O    . LYS A 1 22 ? 2.516  6.795   10.516 1.00 0.00 ? 22 LYS A O    2  
ATOM 1472  C CB   . LYS A 1 22 ? 0.084  7.715   12.325 1.00 0.00 ? 22 LYS A CB   2  
ATOM 1473  C CG   . LYS A 1 22 ? -0.879 8.807   12.757 1.00 0.00 ? 22 LYS A CG   2  
ATOM 1474  C CD   . LYS A 1 22 ? -0.899 8.968   14.268 1.00 0.00 ? 22 LYS A CD   2  
ATOM 1475  C CE   . LYS A 1 22 ? -1.910 8.035   14.915 1.00 0.00 ? 22 LYS A CE   2  
ATOM 1476  N NZ   . LYS A 1 22 ? -3.255 8.664   15.023 1.00 0.00 ? 22 LYS A NZ   2  
ATOM 1477  H H    . LYS A 1 22 ? -1.694 6.925   10.628 1.00 0.00 ? 22 LYS A H    2  
ATOM 1478  H HA   . LYS A 1 22 ? 0.663  8.593   10.460 1.00 0.00 ? 22 LYS A HA   2  
ATOM 1479  H HB2  . LYS A 1 22 ? -0.302 6.767   12.669 1.00 0.00 ? 22 LYS A HB2  2  
ATOM 1480  H HB3  . LYS A 1 22 ? 1.038  7.899   12.797 1.00 0.00 ? 22 LYS A HB3  2  
ATOM 1481  H HG2  . LYS A 1 22 ? -0.574 9.742   12.310 1.00 0.00 ? 22 LYS A HG2  2  
ATOM 1482  H HG3  . LYS A 1 22 ? -1.873 8.552   12.418 1.00 0.00 ? 22 LYS A HG3  2  
ATOM 1483  H HD2  . LYS A 1 22 ? 0.083  8.743   14.658 1.00 0.00 ? 22 LYS A HD2  2  
ATOM 1484  H HD3  . LYS A 1 22 ? -1.158 9.989   14.509 1.00 0.00 ? 22 LYS A HD3  2  
ATOM 1485  H HE2  . LYS A 1 22 ? -1.988 7.140   14.317 1.00 0.00 ? 22 LYS A HE2  2  
ATOM 1486  H HE3  . LYS A 1 22 ? -1.562 7.777   15.904 1.00 0.00 ? 22 LYS A HE3  2  
ATOM 1487  H HZ1  . LYS A 1 22 ? -3.240 9.417   15.740 1.00 0.00 ? 22 LYS A HZ1  2  
ATOM 1488  H HZ2  . LYS A 1 22 ? -3.962 7.953   15.299 1.00 0.00 ? 22 LYS A HZ2  2  
ATOM 1489  H HZ3  . LYS A 1 22 ? -3.532 9.076   14.109 1.00 0.00 ? 22 LYS A HZ3  2  
ATOM 1490  N N    . VAL A 1 23 ? 0.815  5.370   10.143 1.00 0.00 ? 23 VAL A N    2  
ATOM 1491  C CA   . VAL A 1 23 ? 1.683  4.251   9.799  1.00 0.00 ? 23 VAL A CA   2  
ATOM 1492  C C    . VAL A 1 23 ? 2.315  4.447   8.425  1.00 0.00 ? 23 VAL A C    2  
ATOM 1493  O O    . VAL A 1 23 ? 1.856  3.882   7.432  1.00 0.00 ? 23 VAL A O    2  
ATOM 1494  C CB   . VAL A 1 23 ? 0.912  2.918   9.811  1.00 0.00 ? 23 VAL A CB   2  
ATOM 1495  C CG1  . VAL A 1 23 ? 1.838  1.762   9.466  1.00 0.00 ? 23 VAL A CG1  2  
ATOM 1496  C CG2  . VAL A 1 23 ? 0.251  2.697   11.164 1.00 0.00 ? 23 VAL A CG2  2  
ATOM 1497  H H    . VAL A 1 23 ? -0.157 5.244   10.129 1.00 0.00 ? 23 VAL A H    2  
ATOM 1498  H HA   . VAL A 1 23 ? 2.467  4.196   10.540 1.00 0.00 ? 23 VAL A HA   2  
ATOM 1499  H HB   . VAL A 1 23 ? 0.137  2.966   9.060  1.00 0.00 ? 23 VAL A HB   2  
ATOM 1500  H HG11 . VAL A 1 23 ? 1.770  1.550   8.409  1.00 0.00 ? 23 VAL A HG11 2  
ATOM 1501  H HG12 . VAL A 1 23 ? 2.854  2.027   9.717  1.00 0.00 ? 23 VAL A HG12 2  
ATOM 1502  H HG13 . VAL A 1 23 ? 1.545  0.886   10.027 1.00 0.00 ? 23 VAL A HG13 2  
ATOM 1503  H HG21 . VAL A 1 23 ? 0.699  1.841   11.647 1.00 0.00 ? 23 VAL A HG21 2  
ATOM 1504  H HG22 . VAL A 1 23 ? 0.392  3.573   11.781 1.00 0.00 ? 23 VAL A HG22 2  
ATOM 1505  H HG23 . VAL A 1 23 ? -0.805 2.522   11.025 1.00 0.00 ? 23 VAL A HG23 2  
ATOM 1506  N N    . THR A 1 24 ? 3.371  5.253   8.375  1.00 0.00 ? 24 THR A N    2  
ATOM 1507  C CA   . THR A 1 24 ? 4.066  5.525   7.124  1.00 0.00 ? 24 THR A CA   2  
ATOM 1508  C C    . THR A 1 24 ? 5.516  5.060   7.187  1.00 0.00 ? 24 THR A C    2  
ATOM 1509  O O    . THR A 1 24 ? 6.028  4.740   8.260  1.00 0.00 ? 24 THR A O    2  
ATOM 1510  C CB   . THR A 1 24 ? 4.035  7.026   6.779  1.00 0.00 ? 24 THR A CB   2  
ATOM 1511  O OG1  . THR A 1 24 ? 4.603  7.787   7.851  1.00 0.00 ? 24 THR A OG1  2  
ATOM 1512  C CG2  . THR A 1 24 ? 2.611  7.493   6.519  1.00 0.00 ? 24 THR A CG2  2  
ATOM 1513  H H    . THR A 1 24 ? 3.689  5.674   9.201  1.00 0.00 ? 24 THR A H    2  
ATOM 1514  H HA   . THR A 1 24 ? 3.559  4.986   6.337  1.00 0.00 ? 24 THR A HA   2  
ATOM 1515  H HB   . THR A 1 24 ? 4.620  7.187   5.885  1.00 0.00 ? 24 THR A HB   2  
ATOM 1516  H HG1  . THR A 1 24 ? 5.550  7.873   7.716  1.00 0.00 ? 24 THR A HG1  2  
ATOM 1517  H HG21 . THR A 1 24 ? 2.193  6.932   5.696  1.00 0.00 ? 24 THR A HG21 2  
ATOM 1518  H HG22 . THR A 1 24 ? 2.616  8.544   6.273  1.00 0.00 ? 24 THR A HG22 2  
ATOM 1519  H HG23 . THR A 1 24 ? 2.013  7.333   7.403  1.00 0.00 ? 24 THR A HG23 2  
ATOM 1520  N N    . GLU A 1 25 ? 6.173  5.025   6.032  1.00 0.00 ? 25 GLU A N    2  
ATOM 1521  C CA   . GLU A 1 25 ? 7.565  4.598   5.958  1.00 0.00 ? 25 GLU A CA   2  
ATOM 1522  C C    . GLU A 1 25 ? 8.429  5.387   6.938  1.00 0.00 ? 25 GLU A C    2  
ATOM 1523  O O    . GLU A 1 25 ? 9.409  4.871   7.474  1.00 0.00 ? 25 GLU A O    2  
ATOM 1524  C CB   . GLU A 1 25 ? 8.101  4.771   4.536  1.00 0.00 ? 25 GLU A CB   2  
ATOM 1525  C CG   . GLU A 1 25 ? 7.565  3.742   3.554  1.00 0.00 ? 25 GLU A CG   2  
ATOM 1526  C CD   . GLU A 1 25 ? 6.213  4.126   2.986  1.00 0.00 ? 25 GLU A CD   2  
ATOM 1527  O OE1  . GLU A 1 25 ? 5.827  5.306   3.120  1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1528  O OE2  . GLU A 1 25 ? 5.541  3.247   2.407  1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1529  H H    . GLU A 1 25 ? 5.711  5.292   5.211  1.00 0.00 ? 25 GLU A H    2  
ATOM 1530  H HA   . GLU A 1 25 ? 7.606  3.552   6.223  1.00 0.00 ? 25 GLU A HA   2  
ATOM 1531  H HB2  . GLU A 1 25 ? 7.829  5.754   4.179  1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1532  H HB3  . GLU A 1 25 ? 9.177  4.691   4.557  1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1533  H HG2  . GLU A 1 25 ? 8.266  3.642   2.739  1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1534  H HG3  . GLU A 1 25 ? 7.470  2.794   4.063  1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1535  N N    . GLY A 1 26 ? 8.057  6.643   7.167  1.00 0.00 ? 26 GLY A N    2  
ATOM 1536  C CA   . GLY A 1 26 ? 8.808  7.484   8.081  1.00 0.00 ? 26 GLY A CA   2  
ATOM 1537  C C    . GLY A 1 26 ? 8.179  7.550   9.458  1.00 0.00 ? 26 GLY A C    2  
ATOM 1538  O O    . GLY A 1 26 ? 8.280  8.565   10.147 1.00 0.00 ? 26 GLY A O    2  
ATOM 1539  H H    . GLY A 1 26 ? 7.267  7.001   6.712  1.00 0.00 ? 26 GLY A H    2  
ATOM 1540  H HA2  . GLY A 1 26 ? 9.810  7.092   8.173  1.00 0.00 ? 26 GLY A HA2  2  
ATOM 1541  H HA3  . GLY A 1 26 ? 8.859  8.483   7.673  1.00 0.00 ? 26 GLY A HA3  2  
ATOM 1542  N N    . ALA A 1 27 ? 7.524  6.465   9.861  1.00 0.00 ? 27 ALA A N    2  
ATOM 1543  C CA   . ALA A 1 27 ? 6.876  6.404   11.165 1.00 0.00 ? 27 ALA A CA   2  
ATOM 1544  C C    . ALA A 1 27 ? 7.681  5.551   12.139 1.00 0.00 ? 27 ALA A C    2  
ATOM 1545  O O    . ALA A 1 27 ? 7.751  4.330   11.998 1.00 0.00 ? 27 ALA A O    2  
ATOM 1546  C CB   . ALA A 1 27 ? 5.462  5.859   11.026 1.00 0.00 ? 27 ALA A CB   2  
ATOM 1547  H H    . ALA A 1 27 ? 7.478  5.687   9.267  1.00 0.00 ? 27 ALA A H    2  
ATOM 1548  H HA   . ALA A 1 27 ? 6.811  7.411   11.553 1.00 0.00 ? 27 ALA A HA   2  
ATOM 1549  H HB1  . ALA A 1 27 ? 4.855  6.568   10.483 1.00 0.00 ? 27 ALA A HB1  2  
ATOM 1550  H HB2  . ALA A 1 27 ? 5.489  4.922   10.490 1.00 0.00 ? 27 ALA A HB2  2  
ATOM 1551  H HB3  . ALA A 1 27 ? 5.040  5.701   12.007 1.00 0.00 ? 27 ALA A HB3  2  
ATOM 1552  N N    . SER A 1 28 ? 8.288  6.202   13.126 1.00 0.00 ? 28 SER A N    2  
ATOM 1553  C CA   . SER A 1 28 ? 9.093  5.502   14.121 1.00 0.00 ? 28 SER A CA   2  
ATOM 1554  C C    . SER A 1 28 ? 8.243  5.101   15.323 1.00 0.00 ? 28 SER A C    2  
ATOM 1555  O O    . SER A 1 28 ? 7.714  5.954   16.036 1.00 0.00 ? 28 SER A O    2  
ATOM 1556  C CB   . SER A 1 28 ? 10.257 6.384   14.578 1.00 0.00 ? 28 SER A CB   2  
ATOM 1557  O OG   . SER A 1 28 ? 11.410 6.158   13.785 1.00 0.00 ? 28 SER A OG   2  
ATOM 1558  H H    . SER A 1 28 ? 8.195  7.176   13.185 1.00 0.00 ? 28 SER A H    2  
ATOM 1559  H HA   . SER A 1 28 ? 9.488  4.610   13.660 1.00 0.00 ? 28 SER A HA   2  
ATOM 1560  H HB2  . SER A 1 28 ? 9.974  7.422   14.492 1.00 0.00 ? 28 SER A HB2  2  
ATOM 1561  H HB3  . SER A 1 28 ? 10.493 6.159   15.608 1.00 0.00 ? 28 SER A HB3  2  
ATOM 1562  H HG   . SER A 1 28 ? 12.129 5.857   14.344 1.00 0.00 ? 28 SER A HG   2  
ATOM 1563  N N    . PHE A 1 29 ? 8.116  3.796   15.540 1.00 0.00 ? 29 PHE A N    2  
ATOM 1564  C CA   . PHE A 1 29 ? 7.329  3.280   16.654 1.00 0.00 ? 29 PHE A CA   2  
ATOM 1565  C C    . PHE A 1 29 ? 7.922  3.721   17.989 1.00 0.00 ? 29 PHE A C    2  
ATOM 1566  O O    . PHE A 1 29 ? 7.284  3.597   19.035 1.00 0.00 ? 29 PHE A O    2  
ATOM 1567  C CB   . PHE A 1 29 ? 7.261  1.752   16.593 1.00 0.00 ? 29 PHE A CB   2  
ATOM 1568  C CG   . PHE A 1 29 ? 6.944  1.221   15.225 1.00 0.00 ? 29 PHE A CG   2  
ATOM 1569  C CD1  . PHE A 1 29 ? 5.638  1.187   14.765 1.00 0.00 ? 29 PHE A CD1  2  
ATOM 1570  C CD2  . PHE A 1 29 ? 7.954  0.755   14.397 1.00 0.00 ? 29 PHE A CD2  2  
ATOM 1571  C CE1  . PHE A 1 29 ? 5.344  0.697   13.507 1.00 0.00 ? 29 PHE A CE1  2  
ATOM 1572  C CE2  . PHE A 1 29 ? 7.666  0.265   13.137 1.00 0.00 ? 29 PHE A CE2  2  
ATOM 1573  C CZ   . PHE A 1 29 ? 6.359  0.237   12.691 1.00 0.00 ? 29 PHE A CZ   2  
ATOM 1574  H H    . PHE A 1 29 ? 8.561  3.165   14.936 1.00 0.00 ? 29 PHE A H    2  
ATOM 1575  H HA   . PHE A 1 29 ? 6.331  3.680   16.568 1.00 0.00 ? 29 PHE A HA   2  
ATOM 1576  H HB2  . PHE A 1 29 ? 8.214  1.344   16.895 1.00 0.00 ? 29 PHE A HB2  2  
ATOM 1577  H HB3  . PHE A 1 29 ? 6.495  1.406   17.270 1.00 0.00 ? 29 PHE A HB3  2  
ATOM 1578  H HD1  . PHE A 1 29 ? 4.842  1.547   15.401 1.00 0.00 ? 29 PHE A HD1  2  
ATOM 1579  H HD2  . PHE A 1 29 ? 8.977  0.777   14.745 1.00 0.00 ? 29 PHE A HD2  2  
ATOM 1580  H HE1  . PHE A 1 29 ? 4.321  0.677   13.160 1.00 0.00 ? 29 PHE A HE1  2  
ATOM 1581  H HE2  . PHE A 1 29 ? 8.462  -0.094  12.502 1.00 0.00 ? 29 PHE A HE2  2  
ATOM 1582  H HZ   . PHE A 1 29 ? 6.132  -0.146  11.708 1.00 0.00 ? 29 PHE A HZ   2  
ATOM 1583  N N    . ILE A 1 30 ? 9.147  4.234   17.945 1.00 0.00 ? 30 ILE A N    2  
ATOM 1584  C CA   . ILE A 1 30 ? 9.826  4.694   19.150 1.00 0.00 ? 30 ILE A CA   2  
ATOM 1585  C C    . ILE A 1 30 ? 9.421  6.122   19.499 1.00 0.00 ? 30 ILE A C    2  
ATOM 1586  O O    . ILE A 1 30 ? 8.989  6.400   20.618 1.00 0.00 ? 30 ILE A O    2  
ATOM 1587  C CB   . ILE A 1 30 ? 11.357 4.630   18.992 1.00 0.00 ? 30 ILE A CB   2  
ATOM 1588  C CG1  . ILE A 1 30 ? 11.805 3.191   18.730 1.00 0.00 ? 30 ILE A CG1  2  
ATOM 1589  C CG2  . ILE A 1 30 ? 12.040 5.186   20.233 1.00 0.00 ? 30 ILE A CG2  2  
ATOM 1590  C CD1  . ILE A 1 30 ? 11.393 2.222   19.816 1.00 0.00 ? 30 ILE A CD1  2  
ATOM 1591  H H    . ILE A 1 30 ? 9.604  4.306   17.081 1.00 0.00 ? 30 ILE A H    2  
ATOM 1592  H HA   . ILE A 1 30 ? 9.541  4.041   19.962 1.00 0.00 ? 30 ILE A HA   2  
ATOM 1593  H HB   . ILE A 1 30 ? 11.635 5.246   18.151 1.00 0.00 ? 30 ILE A HB   2  
ATOM 1594  H HG12 . ILE A 1 30 ? 11.376 2.850   17.801 1.00 0.00 ? 30 ILE A HG12 2  
ATOM 1595  H HG13 . ILE A 1 30 ? 12.883 3.166   18.654 1.00 0.00 ? 30 ILE A HG13 2  
ATOM 1596  H HG21 . ILE A 1 30 ? 11.297 5.409   20.984 1.00 0.00 ? 30 ILE A HG21 2  
ATOM 1597  H HG22 . ILE A 1 30 ? 12.734 4.455   20.619 1.00 0.00 ? 30 ILE A HG22 2  
ATOM 1598  H HG23 . ILE A 1 30 ? 12.574 6.089   19.976 1.00 0.00 ? 30 ILE A HG23 2  
ATOM 1599  H HD11 . ILE A 1 30 ? 12.254 1.658   20.142 1.00 0.00 ? 30 ILE A HD11 2  
ATOM 1600  H HD12 . ILE A 1 30 ? 10.982 2.770   20.651 1.00 0.00 ? 30 ILE A HD12 2  
ATOM 1601  H HD13 . ILE A 1 30 ? 10.646 1.544   19.428 1.00 0.00 ? 30 ILE A HD13 2  
ATOM 1602  N N    . ASP A 1 31 ? 9.561  7.023   18.533 1.00 0.00 ? 31 ASP A N    2  
ATOM 1603  C CA   . ASP A 1 31 ? 9.207  8.423   18.737 1.00 0.00 ? 31 ASP A CA   2  
ATOM 1604  C C    . ASP A 1 31 ? 7.786  8.700   18.254 1.00 0.00 ? 31 ASP A C    2  
ATOM 1605  O O    . ASP A 1 31 ? 6.924  9.106   19.032 1.00 0.00 ? 31 ASP A O    2  
ATOM 1606  C CB   . ASP A 1 31 ? 10.194 9.333   18.004 1.00 0.00 ? 31 ASP A CB   2  
ATOM 1607  C CG   . ASP A 1 31 ? 9.843  10.801  18.145 1.00 0.00 ? 31 ASP A CG   2  
ATOM 1608  O OD1  . ASP A 1 31 ? 9.585  11.243  19.284 1.00 0.00 ? 31 ASP A OD1  2  
ATOM 1609  O OD2  . ASP A 1 31 ? 9.826  11.508  17.116 1.00 0.00 ? 31 ASP A OD2  2  
ATOM 1610  H H    . ASP A 1 31 ? 9.911  6.740   17.662 1.00 0.00 ? 31 ASP A H    2  
ATOM 1611  H HA   . ASP A 1 31 ? 9.260  8.628   19.795 1.00 0.00 ? 31 ASP A HA   2  
ATOM 1612  H HB2  . ASP A 1 31 ? 11.184 9.179   18.409 1.00 0.00 ? 31 ASP A HB2  2  
ATOM 1613  H HB3  . ASP A 1 31 ? 10.196 9.080   16.954 1.00 0.00 ? 31 ASP A HB3  2  
ATOM 1614  N N    . ASP A 1 32 ? 7.552  8.478   16.965 1.00 0.00 ? 32 ASP A N    2  
ATOM 1615  C CA   . ASP A 1 32 ? 6.236  8.704   16.378 1.00 0.00 ? 32 ASP A CA   2  
ATOM 1616  C C    . ASP A 1 32 ? 5.135  8.177   17.293 1.00 0.00 ? 32 ASP A C    2  
ATOM 1617  O O    . ASP A 1 32 ? 4.103  8.824   17.477 1.00 0.00 ? 32 ASP A O    2  
ATOM 1618  C CB   . ASP A 1 32 ? 6.143  8.031   15.008 1.00 0.00 ? 32 ASP A CB   2  
ATOM 1619  C CG   . ASP A 1 32 ? 5.117  8.689   14.107 1.00 0.00 ? 32 ASP A CG   2  
ATOM 1620  O OD1  . ASP A 1 32 ? 5.196  9.921   13.918 1.00 0.00 ? 32 ASP A OD1  2  
ATOM 1621  O OD2  . ASP A 1 32 ? 4.234  7.972   13.591 1.00 0.00 ? 32 ASP A OD2  2  
ATOM 1622  H H    . ASP A 1 32 ? 8.281  8.155   16.395 1.00 0.00 ? 32 ASP A H    2  
ATOM 1623  H HA   . ASP A 1 32 ? 6.106  9.768   16.255 1.00 0.00 ? 32 ASP A HA   2  
ATOM 1624  H HB2  . ASP A 1 32 ? 7.107  8.083   14.522 1.00 0.00 ? 32 ASP A HB2  2  
ATOM 1625  H HB3  . ASP A 1 32 ? 5.868  6.995   15.141 1.00 0.00 ? 32 ASP A HB3  2  
ATOM 1626  N N    . LEU A 1 33 ? 5.360  6.998   17.863 1.00 0.00 ? 33 LEU A N    2  
ATOM 1627  C CA   . LEU A 1 33 ? 4.387  6.383   18.758 1.00 0.00 ? 33 LEU A CA   2  
ATOM 1628  C C    . LEU A 1 33 ? 4.782  6.590   20.217 1.00 0.00 ? 33 LEU A C    2  
ATOM 1629  O O    . LEU A 1 33 ? 3.965  6.423   21.122 1.00 0.00 ? 33 LEU A O    2  
ATOM 1630  C CB   . LEU A 1 33 ? 4.263  4.888   18.459 1.00 0.00 ? 33 LEU A CB   2  
ATOM 1631  C CG   . LEU A 1 33 ? 3.826  4.521   17.040 1.00 0.00 ? 33 LEU A CG   2  
ATOM 1632  C CD1  . LEU A 1 33 ? 3.433  3.054   16.965 1.00 0.00 ? 33 LEU A CD1  2  
ATOM 1633  C CD2  . LEU A 1 33 ? 2.674  5.408   16.591 1.00 0.00 ? 33 LEU A CD2  2  
ATOM 1634  H H    . LEU A 1 33 ? 6.201  6.530   17.678 1.00 0.00 ? 33 LEU A H    2  
ATOM 1635  H HA   . LEU A 1 33 ? 3.432  6.857   18.586 1.00 0.00 ? 33 LEU A HA   2  
ATOM 1636  H HB2  . LEU A 1 33 ? 5.226  4.434   18.636 1.00 0.00 ? 33 LEU A HB2  2  
ATOM 1637  H HB3  . LEU A 1 33 ? 3.540  4.473   19.147 1.00 0.00 ? 33 LEU A HB3  2  
ATOM 1638  H HG   . LEU A 1 33 ? 4.655  4.679   16.363 1.00 0.00 ? 33 LEU A HG   2  
ATOM 1639  H HD11 . LEU A 1 33 ? 3.267  2.779   15.935 1.00 0.00 ? 33 LEU A HD11 2  
ATOM 1640  H HD12 . LEU A 1 33 ? 2.527  2.895   17.531 1.00 0.00 ? 33 LEU A HD12 2  
ATOM 1641  H HD13 . LEU A 1 33 ? 4.226  2.448   17.377 1.00 0.00 ? 33 LEU A HD13 2  
ATOM 1642  H HD21 . LEU A 1 33 ? 2.161  5.797   17.458 1.00 0.00 ? 33 LEU A HD21 2  
ATOM 1643  H HD22 . LEU A 1 33 ? 1.985  4.828   15.995 1.00 0.00 ? 33 LEU A HD22 2  
ATOM 1644  H HD23 . LEU A 1 33 ? 3.059  6.228   16.002 1.00 0.00 ? 33 LEU A HD23 2  
ATOM 1645  N N    . GLY A 1 34 ? 6.041  6.958   20.438 1.00 0.00 ? 34 GLY A N    2  
ATOM 1646  C CA   . GLY A 1 34 ? 6.522  7.184   21.788 1.00 0.00 ? 34 GLY A CA   2  
ATOM 1647  C C    . GLY A 1 34 ? 6.699  5.894   22.564 1.00 0.00 ? 34 GLY A C    2  
ATOM 1648  O O    . GLY A 1 34 ? 6.473  5.853   23.773 1.00 0.00 ? 34 GLY A O    2  
ATOM 1649  H H    . GLY A 1 34 ? 6.648  7.076   19.677 1.00 0.00 ? 34 GLY A H    2  
ATOM 1650  H HA2  . GLY A 1 34 ? 7.471  7.696   21.739 1.00 0.00 ? 34 GLY A HA2  2  
ATOM 1651  H HA3  . GLY A 1 34 ? 5.812  7.809   22.310 1.00 0.00 ? 34 GLY A HA3  2  
ATOM 1652  N N    . ALA A 1 35 ? 7.104  4.837   21.867 1.00 0.00 ? 35 ALA A N    2  
ATOM 1653  C CA   . ALA A 1 35 ? 7.311  3.540   22.499 1.00 0.00 ? 35 ALA A CA   2  
ATOM 1654  C C    . ALA A 1 35 ? 8.791  3.292   22.770 1.00 0.00 ? 35 ALA A C    2  
ATOM 1655  O O    . ALA A 1 35 ? 9.650  4.055   22.327 1.00 0.00 ? 35 ALA A O    2  
ATOM 1656  C CB   . ALA A 1 35 ? 6.739  2.431   21.628 1.00 0.00 ? 35 ALA A CB   2  
ATOM 1657  H H    . ALA A 1 35 ? 7.267  4.932   20.906 1.00 0.00 ? 35 ALA A H    2  
ATOM 1658  H HA   . ALA A 1 35 ? 6.778  3.537   23.439 1.00 0.00 ? 35 ALA A HA   2  
ATOM 1659  H HB1  . ALA A 1 35 ? 7.501  2.079   20.948 1.00 0.00 ? 35 ALA A HB1  2  
ATOM 1660  H HB2  . ALA A 1 35 ? 6.410  1.615   22.254 1.00 0.00 ? 35 ALA A HB2  2  
ATOM 1661  H HB3  . ALA A 1 35 ? 5.901  2.813   21.064 1.00 0.00 ? 35 ALA A HB3  2  
ATOM 1662  N N    . ASP A 1 36 ? 9.083  2.221   23.499 1.00 0.00 ? 36 ASP A N    2  
ATOM 1663  C CA   . ASP A 1 36 ? 10.460 1.872   23.829 1.00 0.00 ? 36 ASP A CA   2  
ATOM 1664  C C    . ASP A 1 36 ? 10.911 0.641   23.048 1.00 0.00 ? 36 ASP A C    2  
ATOM 1665  O O    . ASP A 1 36 ? 10.127 0.036   22.317 1.00 0.00 ? 36 ASP A O    2  
ATOM 1666  C CB   . ASP A 1 36 ? 10.599 1.618   25.331 1.00 0.00 ? 36 ASP A CB   2  
ATOM 1667  C CG   . ASP A 1 36 ? 10.047 2.757   26.164 1.00 0.00 ? 36 ASP A CG   2  
ATOM 1668  O OD1  . ASP A 1 36 ? 10.232 3.926   25.767 1.00 0.00 ? 36 ASP A OD1  2  
ATOM 1669  O OD2  . ASP A 1 36 ? 9.429  2.480   27.214 1.00 0.00 ? 36 ASP A OD2  2  
ATOM 1670  H H    . ASP A 1 36 ? 8.355  1.650   23.823 1.00 0.00 ? 36 ASP A H    2  
ATOM 1671  H HA   . ASP A 1 36 ? 11.088 2.706   23.555 1.00 0.00 ? 36 ASP A HA   2  
ATOM 1672  H HB2  . ASP A 1 36 ? 10.063 0.716   25.588 1.00 0.00 ? 36 ASP A HB2  2  
ATOM 1673  H HB3  . ASP A 1 36 ? 11.644 1.491   25.573 1.00 0.00 ? 36 ASP A HB3  2  
ATOM 1674  N N    . SER A 1 37 ? 12.179 0.277   23.208 1.00 0.00 ? 37 SER A N    2  
ATOM 1675  C CA   . SER A 1 37 ? 12.736 -0.879  22.515 1.00 0.00 ? 37 SER A CA   2  
ATOM 1676  C C    . SER A 1 37 ? 11.869 -2.115  22.737 1.00 0.00 ? 37 SER A C    2  
ATOM 1677  O O    . SER A 1 37 ? 11.654 -2.910  21.821 1.00 0.00 ? 37 SER A O    2  
ATOM 1678  C CB   . SER A 1 37 ? 14.163 -1.149  22.994 1.00 0.00 ? 37 SER A CB   2  
ATOM 1679  O OG   . SER A 1 37 ? 14.284 -0.923  24.388 1.00 0.00 ? 37 SER A OG   2  
ATOM 1680  H H    . SER A 1 37 ? 12.755 0.799   23.805 1.00 0.00 ? 37 SER A H    2  
ATOM 1681  H HA   . SER A 1 37 ? 12.756 -0.653  21.459 1.00 0.00 ? 37 SER A HA   2  
ATOM 1682  H HB2  . SER A 1 37 ? 14.422 -2.176  22.785 1.00 0.00 ? 37 SER A HB2  2  
ATOM 1683  H HB3  . SER A 1 37 ? 14.845 -0.493  22.474 1.00 0.00 ? 37 SER A HB3  2  
ATOM 1684  H HG   . SER A 1 37 ? 15.160 -1.186  24.680 1.00 0.00 ? 37 SER A HG   2  
ATOM 1685  N N    . LEU A 1 38 ? 11.375 -2.271  23.960 1.00 0.00 ? 38 LEU A N    2  
ATOM 1686  C CA   . LEU A 1 38 ? 10.532 -3.410  24.305 1.00 0.00 ? 38 LEU A CA   2  
ATOM 1687  C C    . LEU A 1 38 ? 9.376  -3.550  23.319 1.00 0.00 ? 38 LEU A C    2  
ATOM 1688  O O    . LEU A 1 38 ? 9.154  -4.623  22.757 1.00 0.00 ? 38 LEU A O    2  
ATOM 1689  C CB   . LEU A 1 38 ? 9.988  -3.255  25.726 1.00 0.00 ? 38 LEU A CB   2  
ATOM 1690  C CG   . LEU A 1 38 ? 10.909 -3.726  26.852 1.00 0.00 ? 38 LEU A CG   2  
ATOM 1691  C CD1  . LEU A 1 38 ? 11.172 -5.220  26.737 1.00 0.00 ? 38 LEU A CD1  2  
ATOM 1692  C CD2  . LEU A 1 38 ? 12.218 -2.950  26.831 1.00 0.00 ? 38 LEU A CD2  2  
ATOM 1693  H H    . LEU A 1 38 ? 11.581 -1.605  24.648 1.00 0.00 ? 38 LEU A H    2  
ATOM 1694  H HA   . LEU A 1 38 ? 11.141 -4.300  24.256 1.00 0.00 ? 38 LEU A HA   2  
ATOM 1695  H HB2  . LEU A 1 38 ? 9.777  -2.209  25.888 1.00 0.00 ? 38 LEU A HB2  2  
ATOM 1696  H HB3  . LEU A 1 38 ? 9.069  -3.820  25.791 1.00 0.00 ? 38 LEU A HB3  2  
ATOM 1697  H HG   . LEU A 1 38 ? 10.427 -3.545  27.803 1.00 0.00 ? 38 LEU A HG   2  
ATOM 1698  H HD11 . LEU A 1 38 ? 10.284 -5.714  26.374 1.00 0.00 ? 38 LEU A HD11 2  
ATOM 1699  H HD12 . LEU A 1 38 ? 11.432 -5.615  27.708 1.00 0.00 ? 38 LEU A HD12 2  
ATOM 1700  H HD13 . LEU A 1 38 ? 11.987 -5.390  26.049 1.00 0.00 ? 38 LEU A HD13 2  
ATOM 1701  H HD21 . LEU A 1 38 ? 12.013 -1.905  26.648 1.00 0.00 ? 38 LEU A HD21 2  
ATOM 1702  H HD22 . LEU A 1 38 ? 12.852 -3.335  26.046 1.00 0.00 ? 38 LEU A HD22 2  
ATOM 1703  H HD23 . LEU A 1 38 ? 12.716 -3.058  27.783 1.00 0.00 ? 38 LEU A HD23 2  
ATOM 1704  N N    . ASP A 1 39 ? 8.646  -2.460  23.113 1.00 0.00 ? 39 ASP A N    2  
ATOM 1705  C CA   . ASP A 1 39 ? 7.515  -2.461  22.192 1.00 0.00 ? 39 ASP A CA   2  
ATOM 1706  C C    . ASP A 1 39 ? 7.927  -2.999  20.825 1.00 0.00 ? 39 ASP A C    2  
ATOM 1707  O O    . ASP A 1 39 ? 7.283  -3.895  20.279 1.00 0.00 ? 39 ASP A O    2  
ATOM 1708  C CB   . ASP A 1 39 ? 6.947  -1.048  22.047 1.00 0.00 ? 39 ASP A CB   2  
ATOM 1709  C CG   . ASP A 1 39 ? 5.696  -0.839  22.877 1.00 0.00 ? 39 ASP A CG   2  
ATOM 1710  O OD1  . ASP A 1 39 ? 5.709  -1.201  24.072 1.00 0.00 ? 39 ASP A OD1  2  
ATOM 1711  O OD2  . ASP A 1 39 ? 4.704  -0.311  22.332 1.00 0.00 ? 39 ASP A OD2  2  
ATOM 1712  H H    . ASP A 1 39 ? 8.873  -1.635  23.591 1.00 0.00 ? 39 ASP A H    2  
ATOM 1713  H HA   . ASP A 1 39 ? 6.752  -3.104  22.603 1.00 0.00 ? 39 ASP A HA   2  
ATOM 1714  H HB2  . ASP A 1 39 ? 7.692  -0.333  22.366 1.00 0.00 ? 39 ASP A HB2  2  
ATOM 1715  H HB3  . ASP A 1 39 ? 6.704  -0.869  21.010 1.00 0.00 ? 39 ASP A HB3  2  
ATOM 1716  N N    . THR A 1 40 ? 9.004  -2.446  20.277 1.00 0.00 ? 40 THR A N    2  
ATOM 1717  C CA   . THR A 1 40 ? 9.501  -2.868  18.974 1.00 0.00 ? 40 THR A CA   2  
ATOM 1718  C C    . THR A 1 40 ? 9.791  -4.365  18.955 1.00 0.00 ? 40 THR A C    2  
ATOM 1719  O O    . THR A 1 40 ? 9.385  -5.074  18.034 1.00 0.00 ? 40 THR A O    2  
ATOM 1720  C CB   . THR A 1 40 ? 10.782 -2.104  18.586 1.00 0.00 ? 40 THR A CB   2  
ATOM 1721  O OG1  . THR A 1 40 ? 10.744 -0.779  19.127 1.00 0.00 ? 40 THR A OG1  2  
ATOM 1722  C CG2  . THR A 1 40 ? 10.934 -2.036  17.074 1.00 0.00 ? 40 THR A CG2  2  
ATOM 1723  H H    . THR A 1 40 ? 9.475  -1.736  20.762 1.00 0.00 ? 40 THR A H    2  
ATOM 1724  H HA   . THR A 1 40 ? 8.740  -2.649  18.239 1.00 0.00 ? 40 THR A HA   2  
ATOM 1725  H HB   . THR A 1 40 ? 11.633 -2.628  18.996 1.00 0.00 ? 40 THR A HB   2  
ATOM 1726  H HG1  . THR A 1 40 ? 11.085 -0.790  20.025 1.00 0.00 ? 40 THR A HG1  2  
ATOM 1727  H HG21 . THR A 1 40 ? 9.964  -2.134  16.610 1.00 0.00 ? 40 THR A HG21 2  
ATOM 1728  H HG22 . THR A 1 40 ? 11.576 -2.839  16.741 1.00 0.00 ? 40 THR A HG22 2  
ATOM 1729  H HG23 . THR A 1 40 ? 11.371 -1.088  16.799 1.00 0.00 ? 40 THR A HG23 2  
ATOM 1730  N N    . VAL A 1 41 ? 10.495 -4.840  19.977 1.00 0.00 ? 41 VAL A N    2  
ATOM 1731  C CA   . VAL A 1 41 ? 10.837 -6.254  20.078 1.00 0.00 ? 41 VAL A CA   2  
ATOM 1732  C C    . VAL A 1 41 ? 9.590  -7.128  19.996 1.00 0.00 ? 41 VAL A C    2  
ATOM 1733  O O    . VAL A 1 41 ? 9.530  -8.065  19.201 1.00 0.00 ? 41 VAL A O    2  
ATOM 1734  C CB   . VAL A 1 41 ? 11.578 -6.559  21.394 1.00 0.00 ? 41 VAL A CB   2  
ATOM 1735  C CG1  . VAL A 1 41 ? 12.030 -8.011  21.427 1.00 0.00 ? 41 VAL A CG1  2  
ATOM 1736  C CG2  . VAL A 1 41 ? 12.762 -5.619  21.568 1.00 0.00 ? 41 VAL A CG2  2  
ATOM 1737  H H    . VAL A 1 41 ? 10.790 -4.225  20.681 1.00 0.00 ? 41 VAL A H    2  
ATOM 1738  H HA   . VAL A 1 41 ? 11.492 -6.499  19.255 1.00 0.00 ? 41 VAL A HA   2  
ATOM 1739  H HB   . VAL A 1 41 ? 10.894 -6.399  22.214 1.00 0.00 ? 41 VAL A HB   2  
ATOM 1740  H HG11 . VAL A 1 41 ? 11.239 -8.624  21.835 1.00 0.00 ? 41 VAL A HG11 2  
ATOM 1741  H HG12 . VAL A 1 41 ? 12.262 -8.340  20.425 1.00 0.00 ? 41 VAL A HG12 2  
ATOM 1742  H HG13 . VAL A 1 41 ? 12.909 -8.100  22.048 1.00 0.00 ? 41 VAL A HG13 2  
ATOM 1743  H HG21 . VAL A 1 41 ? 12.872 -5.012  20.682 1.00 0.00 ? 41 VAL A HG21 2  
ATOM 1744  H HG22 . VAL A 1 41 ? 12.592 -4.981  22.423 1.00 0.00 ? 41 VAL A HG22 2  
ATOM 1745  H HG23 . VAL A 1 41 ? 13.660 -6.197  21.723 1.00 0.00 ? 41 VAL A HG23 2  
ATOM 1746  N N    . GLU A 1 42 ? 8.597  -6.813  20.822 1.00 0.00 ? 42 GLU A N    2  
ATOM 1747  C CA   . GLU A 1 42 ? 7.352  -7.571  20.841 1.00 0.00 ? 42 GLU A CA   2  
ATOM 1748  C C    . GLU A 1 42 ? 6.707  -7.594  19.459 1.00 0.00 ? 42 GLU A C    2  
ATOM 1749  O O    . GLU A 1 42 ? 6.381  -8.658  18.930 1.00 0.00 ? 42 GLU A O    2  
ATOM 1750  C CB   . GLU A 1 42 ? 6.380  -6.972  21.860 1.00 0.00 ? 42 GLU A CB   2  
ATOM 1751  C CG   . GLU A 1 42 ? 6.878  -7.046  23.293 1.00 0.00 ? 42 GLU A CG   2  
ATOM 1752  C CD   . GLU A 1 42 ? 7.053  -8.473  23.777 1.00 0.00 ? 42 GLU A CD   2  
ATOM 1753  O OE1  . GLU A 1 42 ? 6.071  -9.053  24.283 1.00 0.00 ? 42 GLU A OE1  2  
ATOM 1754  O OE2  . GLU A 1 42 ? 8.174  -9.009  23.647 1.00 0.00 ? 42 GLU A OE2  2  
ATOM 1755  H H    . GLU A 1 42 ? 8.705  -6.055  21.432 1.00 0.00 ? 42 GLU A H    2  
ATOM 1756  H HA   . GLU A 1 42 ? 7.585  -8.584  21.133 1.00 0.00 ? 42 GLU A HA   2  
ATOM 1757  H HB2  . GLU A 1 42 ? 6.213  -5.934  21.612 1.00 0.00 ? 42 GLU A HB2  2  
ATOM 1758  H HB3  . GLU A 1 42 ? 5.442  -7.503  21.799 1.00 0.00 ? 42 GLU A HB3  2  
ATOM 1759  H HG2  . GLU A 1 42 ? 7.830  -6.542  23.357 1.00 0.00 ? 42 GLU A HG2  2  
ATOM 1760  H HG3  . GLU A 1 42 ? 6.165  -6.550  23.935 1.00 0.00 ? 42 GLU A HG3  2  
ATOM 1761  N N    . LEU A 1 43 ? 6.525  -6.413  18.878 1.00 0.00 ? 43 LEU A N    2  
ATOM 1762  C CA   . LEU A 1 43 ? 5.918  -6.296  17.556 1.00 0.00 ? 43 LEU A CA   2  
ATOM 1763  C C    . LEU A 1 43 ? 6.642  -7.179  16.545 1.00 0.00 ? 43 LEU A C    2  
ATOM 1764  O O    . LEU A 1 43 ? 6.017  -7.958  15.825 1.00 0.00 ? 43 LEU A O    2  
ATOM 1765  C CB   . LEU A 1 43 ? 5.943  -4.840  17.090 1.00 0.00 ? 43 LEU A CB   2  
ATOM 1766  C CG   . LEU A 1 43 ? 4.702  -4.009  17.417 1.00 0.00 ? 43 LEU A CG   2  
ATOM 1767  C CD1  . LEU A 1 43 ? 4.894  -2.566  16.975 1.00 0.00 ? 43 LEU A CD1  2  
ATOM 1768  C CD2  . LEU A 1 43 ? 3.468  -4.611  16.761 1.00 0.00 ? 43 LEU A CD2  2  
ATOM 1769  H H    . LEU A 1 43 ? 6.805  -5.601  19.348 1.00 0.00 ? 43 LEU A H    2  
ATOM 1770  H HA   . LEU A 1 43 ? 4.892  -6.624  17.633 1.00 0.00 ? 43 LEU A HA   2  
ATOM 1771  H HB2  . LEU A 1 43 ? 6.793  -4.360  17.549 1.00 0.00 ? 43 LEU A HB2  2  
ATOM 1772  H HB3  . LEU A 1 43 ? 6.069  -4.839  16.016 1.00 0.00 ? 43 LEU A HB3  2  
ATOM 1773  H HG   . LEU A 1 43 ? 4.547  -4.011  18.488 1.00 0.00 ? 43 LEU A HG   2  
ATOM 1774  H HD11 . LEU A 1 43 ? 5.661  -2.104  17.577 1.00 0.00 ? 43 LEU A HD11 2  
ATOM 1775  H HD12 . LEU A 1 43 ? 3.966  -2.026  17.097 1.00 0.00 ? 43 LEU A HD12 2  
ATOM 1776  H HD13 . LEU A 1 43 ? 5.188  -2.545  15.936 1.00 0.00 ? 43 LEU A HD13 2  
ATOM 1777  H HD21 . LEU A 1 43 ? 3.732  -5.547  16.291 1.00 0.00 ? 43 LEU A HD21 2  
ATOM 1778  H HD22 . LEU A 1 43 ? 3.089  -3.928  16.014 1.00 0.00 ? 43 LEU A HD22 2  
ATOM 1779  H HD23 . LEU A 1 43 ? 2.710  -4.784  17.510 1.00 0.00 ? 43 LEU A HD23 2  
ATOM 1780  N N    . VAL A 1 44 ? 7.965  -7.052  16.496 1.00 0.00 ? 44 VAL A N    2  
ATOM 1781  C CA   . VAL A 1 44 ? 8.775  -7.841  15.575 1.00 0.00 ? 44 VAL A CA   2  
ATOM 1782  C C    . VAL A 1 44 ? 8.502  -9.331  15.742 1.00 0.00 ? 44 VAL A C    2  
ATOM 1783  O O    . VAL A 1 44 ? 8.213  -10.032 14.772 1.00 0.00 ? 44 VAL A O    2  
ATOM 1784  C CB   . VAL A 1 44 ? 10.278 -7.578  15.784 1.00 0.00 ? 44 VAL A CB   2  
ATOM 1785  C CG1  . VAL A 1 44 ? 11.106 -8.430  14.834 1.00 0.00 ? 44 VAL A CG1  2  
ATOM 1786  C CG2  . VAL A 1 44 ? 10.591 -6.101  15.599 1.00 0.00 ? 44 VAL A CG2  2  
ATOM 1787  H H    . VAL A 1 44 ? 8.406  -6.414  17.095 1.00 0.00 ? 44 VAL A H    2  
ATOM 1788  H HA   . VAL A 1 44 ? 8.516  -7.547  14.568 1.00 0.00 ? 44 VAL A HA   2  
ATOM 1789  H HB   . VAL A 1 44 ? 10.534 -7.855  16.796 1.00 0.00 ? 44 VAL A HB   2  
ATOM 1790  H HG11 . VAL A 1 44 ? 12.155 -8.222  14.986 1.00 0.00 ? 44 VAL A HG11 2  
ATOM 1791  H HG12 . VAL A 1 44 ? 10.913 -9.475  15.026 1.00 0.00 ? 44 VAL A HG12 2  
ATOM 1792  H HG13 . VAL A 1 44 ? 10.838 -8.195  13.814 1.00 0.00 ? 44 VAL A HG13 2  
ATOM 1793  H HG21 . VAL A 1 44 ? 11.008 -5.705  16.513 1.00 0.00 ? 44 VAL A HG21 2  
ATOM 1794  H HG22 . VAL A 1 44 ? 11.305 -5.981  14.797 1.00 0.00 ? 44 VAL A HG22 2  
ATOM 1795  H HG23 . VAL A 1 44 ? 9.684  -5.568  15.356 1.00 0.00 ? 44 VAL A HG23 2  
ATOM 1796  N N    . MET A 1 45 ? 8.596  -9.810  16.978 1.00 0.00 ? 45 MET A N    2  
ATOM 1797  C CA   . MET A 1 45 ? 8.358  -11.218 17.272 1.00 0.00 ? 45 MET A CA   2  
ATOM 1798  C C    . MET A 1 45 ? 6.991  -11.657 16.758 1.00 0.00 ? 45 MET A C    2  
ATOM 1799  O O    . MET A 1 45 ? 6.851  -12.736 16.181 1.00 0.00 ? 45 MET A O    2  
ATOM 1800  C CB   . MET A 1 45 ? 8.455  -11.470 18.778 1.00 0.00 ? 45 MET A CB   2  
ATOM 1801  C CG   . MET A 1 45 ? 9.884  -11.544 19.291 1.00 0.00 ? 45 MET A CG   2  
ATOM 1802  S SD   . MET A 1 45 ? 9.985  -12.183 20.974 1.00 0.00 ? 45 MET A SD   2  
ATOM 1803  C CE   . MET A 1 45 ? 11.628 -12.898 20.966 1.00 0.00 ? 45 MET A CE   2  
ATOM 1804  H H    . MET A 1 45 ? 8.830  -9.202  17.710 1.00 0.00 ? 45 MET A H    2  
ATOM 1805  H HA   . MET A 1 45 ? 9.121  -11.795 16.770 1.00 0.00 ? 45 MET A HA   2  
ATOM 1806  H HB2  . MET A 1 45 ? 7.949  -10.671 19.298 1.00 0.00 ? 45 MET A HB2  2  
ATOM 1807  H HB3  . MET A 1 45 ? 7.965  -12.405 19.007 1.00 0.00 ? 45 MET A HB3  2  
ATOM 1808  H HG2  . MET A 1 45 ? 10.453 -12.191 18.641 1.00 0.00 ? 45 MET A HG2  2  
ATOM 1809  H HG3  . MET A 1 45 ? 10.310 -10.552 19.271 1.00 0.00 ? 45 MET A HG3  2  
ATOM 1810  H HE1  . MET A 1 45 ? 12.208 -12.457 20.170 1.00 0.00 ? 45 MET A HE1  2  
ATOM 1811  H HE2  . MET A 1 45 ? 12.109 -12.703 21.913 1.00 0.00 ? 45 MET A HE2  2  
ATOM 1812  H HE3  . MET A 1 45 ? 11.555 -13.965 20.811 1.00 0.00 ? 45 MET A HE3  2  
ATOM 1813  N N    . ALA A 1 46 ? 5.985  -10.815 16.971 1.00 0.00 ? 46 ALA A N    2  
ATOM 1814  C CA   . ALA A 1 46 ? 4.630  -11.116 16.527 1.00 0.00 ? 46 ALA A CA   2  
ATOM 1815  C C    . ALA A 1 46 ? 4.577  -11.309 15.016 1.00 0.00 ? 46 ALA A C    2  
ATOM 1816  O O    . ALA A 1 46 ? 4.094  -12.331 14.527 1.00 0.00 ? 46 ALA A O    2  
ATOM 1817  C CB   . ALA A 1 46 ? 3.677  -10.009 16.954 1.00 0.00 ? 46 ALA A CB   2  
ATOM 1818  H H    . ALA A 1 46 ? 6.159  -9.971  17.436 1.00 0.00 ? 46 ALA A H    2  
ATOM 1819  H HA   . ALA A 1 46 ? 4.317  -12.032 17.008 1.00 0.00 ? 46 ALA A HA   2  
ATOM 1820  H HB1  . ALA A 1 46 ? 4.079  -9.502  17.819 1.00 0.00 ? 46 ALA A HB1  2  
ATOM 1821  H HB2  . ALA A 1 46 ? 3.560  -9.304  16.144 1.00 0.00 ? 46 ALA A HB2  2  
ATOM 1822  H HB3  . ALA A 1 46 ? 2.717  -10.436 17.201 1.00 0.00 ? 46 ALA A HB3  2  
ATOM 1823  N N    . PHE A 1 47 ? 5.076  -10.322 14.280 1.00 0.00 ? 47 PHE A N    2  
ATOM 1824  C CA   . PHE A 1 47 ? 5.084  -10.383 12.823 1.00 0.00 ? 47 PHE A CA   2  
ATOM 1825  C C    . PHE A 1 47 ? 5.790  -11.645 12.335 1.00 0.00 ? 47 PHE A C    2  
ATOM 1826  O O    . PHE A 1 47 ? 5.330  -12.304 11.403 1.00 0.00 ? 47 PHE A O    2  
ATOM 1827  C CB   . PHE A 1 47 ? 5.771  -9.144  12.243 1.00 0.00 ? 47 PHE A CB   2  
ATOM 1828  C CG   . PHE A 1 47 ? 5.189  -7.850  12.735 1.00 0.00 ? 47 PHE A CG   2  
ATOM 1829  C CD1  . PHE A 1 47 ? 3.816  -7.664  12.775 1.00 0.00 ? 47 PHE A CD1  2  
ATOM 1830  C CD2  . PHE A 1 47 ? 6.013  -6.819  13.156 1.00 0.00 ? 47 PHE A CD2  2  
ATOM 1831  C CE1  . PHE A 1 47 ? 3.277  -6.474  13.228 1.00 0.00 ? 47 PHE A CE1  2  
ATOM 1832  C CE2  . PHE A 1 47 ? 5.480  -5.628  13.610 1.00 0.00 ? 47 PHE A CE2  2  
ATOM 1833  C CZ   . PHE A 1 47 ? 4.110  -5.455  13.644 1.00 0.00 ? 47 PHE A CZ   2  
ATOM 1834  H H    . PHE A 1 47 ? 5.448  -9.533  14.728 1.00 0.00 ? 47 PHE A H    2  
ATOM 1835  H HA   . PHE A 1 47 ? 4.059  -10.405 12.487 1.00 0.00 ? 47 PHE A HA   2  
ATOM 1836  H HB2  . PHE A 1 47 ? 6.816  -9.161  12.514 1.00 0.00 ? 47 PHE A HB2  2  
ATOM 1837  H HB3  . PHE A 1 47 ? 5.682  -9.162  11.168 1.00 0.00 ? 47 PHE A HB3  2  
ATOM 1838  H HD1  . PHE A 1 47 ? 3.163  -8.461  12.449 1.00 0.00 ? 47 PHE A HD1  2  
ATOM 1839  H HD2  . PHE A 1 47 ? 7.085  -6.953  13.129 1.00 0.00 ? 47 PHE A HD2  2  
ATOM 1840  H HE1  . PHE A 1 47 ? 2.205  -6.343  13.253 1.00 0.00 ? 47 PHE A HE1  2  
ATOM 1841  H HE2  . PHE A 1 47 ? 6.133  -4.832  13.935 1.00 0.00 ? 47 PHE A HE2  2  
ATOM 1842  H HZ   . PHE A 1 47 ? 3.690  -4.525  13.999 1.00 0.00 ? 47 PHE A HZ   2  
ATOM 1843  N N    . GLU A 1 48 ? 6.909  -11.973 12.972 1.00 0.00 ? 48 GLU A N    2  
ATOM 1844  C CA   . GLU A 1 48 ? 7.679  -13.155 12.602 1.00 0.00 ? 48 GLU A CA   2  
ATOM 1845  C C    . GLU A 1 48 ? 6.895  -14.430 12.897 1.00 0.00 ? 48 GLU A C    2  
ATOM 1846  O O    . GLU A 1 48 ? 6.979  -15.408 12.156 1.00 0.00 ? 48 GLU A O    2  
ATOM 1847  C CB   . GLU A 1 48 ? 9.012  -13.178 13.352 1.00 0.00 ? 48 GLU A CB   2  
ATOM 1848  C CG   . GLU A 1 48 ? 10.115 -12.395 12.659 1.00 0.00 ? 48 GLU A CG   2  
ATOM 1849  C CD   . GLU A 1 48 ? 9.630  -11.069 12.106 1.00 0.00 ? 48 GLU A CD   2  
ATOM 1850  O OE1  . GLU A 1 48 ? 9.018  -11.069 11.018 1.00 0.00 ? 48 GLU A OE1  2  
ATOM 1851  O OE2  . GLU A 1 48 ? 9.862  -10.032 12.762 1.00 0.00 ? 48 GLU A OE2  2  
ATOM 1852  H H    . GLU A 1 48 ? 7.225  -11.407 13.707 1.00 0.00 ? 48 GLU A H    2  
ATOM 1853  H HA   . GLU A 1 48 ? 7.875  -13.105 11.541 1.00 0.00 ? 48 GLU A HA   2  
ATOM 1854  H HB2  . GLU A 1 48 ? 8.865  -12.758 14.337 1.00 0.00 ? 48 GLU A HB2  2  
ATOM 1855  H HB3  . GLU A 1 48 ? 9.337  -14.203 13.453 1.00 0.00 ? 48 GLU A HB3  2  
ATOM 1856  H HG2  . GLU A 1 48 ? 10.905 -12.204 13.370 1.00 0.00 ? 48 GLU A HG2  2  
ATOM 1857  H HG3  . GLU A 1 48 ? 10.502 -12.989 11.844 1.00 0.00 ? 48 GLU A HG3  2  
ATOM 1858  N N    . GLU A 1 49 ? 6.132  -14.410 13.986 1.00 0.00 ? 49 GLU A N    2  
ATOM 1859  C CA   . GLU A 1 49 ? 5.334  -15.564 14.380 1.00 0.00 ? 49 GLU A CA   2  
ATOM 1860  C C    . GLU A 1 49 ? 4.113  -15.716 13.477 1.00 0.00 ? 49 GLU A C    2  
ATOM 1861  O O    . GLU A 1 49 ? 3.604  -16.819 13.285 1.00 0.00 ? 49 GLU A O    2  
ATOM 1862  C CB   . GLU A 1 49 ? 4.889  -15.431 15.839 1.00 0.00 ? 49 GLU A CB   2  
ATOM 1863  C CG   . GLU A 1 49 ? 4.505  -16.754 16.481 1.00 0.00 ? 49 GLU A CG   2  
ATOM 1864  C CD   . GLU A 1 49 ? 5.685  -17.693 16.632 1.00 0.00 ? 49 GLU A CD   2  
ATOM 1865  O OE1  . GLU A 1 49 ? 5.950  -18.469 15.690 1.00 0.00 ? 49 GLU A OE1  2  
ATOM 1866  O OE2  . GLU A 1 49 ? 6.344  -17.654 17.692 1.00 0.00 ? 49 GLU A OE2  2  
ATOM 1867  H H    . GLU A 1 49 ? 6.107  -13.600 14.537 1.00 0.00 ? 49 GLU A H    2  
ATOM 1868  H HA   . GLU A 1 49 ? 5.951  -16.444 14.281 1.00 0.00 ? 49 GLU A HA   2  
ATOM 1869  H HB2  . GLU A 1 49 ? 5.697  -14.998 16.410 1.00 0.00 ? 49 GLU A HB2  2  
ATOM 1870  H HB3  . GLU A 1 49 ? 4.035  -14.772 15.883 1.00 0.00 ? 49 GLU A HB3  2  
ATOM 1871  H HG2  . GLU A 1 49 ? 4.093  -16.558 17.459 1.00 0.00 ? 49 GLU A HG2  2  
ATOM 1872  H HG3  . GLU A 1 49 ? 3.758  -17.234 15.866 1.00 0.00 ? 49 GLU A HG3  2  
ATOM 1873  N N    . GLU A 1 50 ? 3.650  -14.598 12.926 1.00 0.00 ? 50 GLU A N    2  
ATOM 1874  C CA   . GLU A 1 50 ? 2.488  -14.607 12.045 1.00 0.00 ? 50 GLU A CA   2  
ATOM 1875  C C    . GLU A 1 50 ? 2.894  -14.948 10.614 1.00 0.00 ? 50 GLU A C    2  
ATOM 1876  O O    . GLU A 1 50 ? 2.216  -15.717 9.931  1.00 0.00 ? 50 GLU A O    2  
ATOM 1877  C CB   . GLU A 1 50 ? 1.786  -13.248 12.077 1.00 0.00 ? 50 GLU A CB   2  
ATOM 1878  C CG   . GLU A 1 50 ? 0.812  -13.093 13.233 1.00 0.00 ? 50 GLU A CG   2  
ATOM 1879  C CD   . GLU A 1 50 ? -0.512 -13.786 12.977 1.00 0.00 ? 50 GLU A CD   2  
ATOM 1880  O OE1  . GLU A 1 50 ? -1.079 -13.595 11.881 1.00 0.00 ? 50 GLU A OE1  2  
ATOM 1881  O OE2  . GLU A 1 50 ? -0.982 -14.519 13.872 1.00 0.00 ? 50 GLU A OE2  2  
ATOM 1882  H H    . GLU A 1 50 ? 4.099  -13.749 13.118 1.00 0.00 ? 50 GLU A H    2  
ATOM 1883  H HA   . GLU A 1 50 ? 1.806  -15.363 12.403 1.00 0.00 ? 50 GLU A HA   2  
ATOM 1884  H HB2  . GLU A 1 50 ? 2.532  -12.472 12.156 1.00 0.00 ? 50 GLU A HB2  2  
ATOM 1885  H HB3  . GLU A 1 50 ? 1.240  -13.117 11.154 1.00 0.00 ? 50 GLU A HB3  2  
ATOM 1886  H HG2  . GLU A 1 50 ? 1.257  -13.517 14.121 1.00 0.00 ? 50 GLU A HG2  2  
ATOM 1887  H HG3  . GLU A 1 50 ? 0.626  -12.041 13.393 1.00 0.00 ? 50 GLU A HG3  2  
ATOM 1888  N N    . PHE A 1 51 ? 4.004  -14.371 10.166 1.00 0.00 ? 51 PHE A N    2  
ATOM 1889  C CA   . PHE A 1 51 ? 4.500  -14.611 8.816  1.00 0.00 ? 51 PHE A CA   2  
ATOM 1890  C C    . PHE A 1 51 ? 5.254  -15.936 8.742  1.00 0.00 ? 51 PHE A C    2  
ATOM 1891  O O    . PHE A 1 51 ? 5.363  -16.542 7.677  1.00 0.00 ? 51 PHE A O    2  
ATOM 1892  C CB   . PHE A 1 51 ? 5.413  -13.466 8.373  1.00 0.00 ? 51 PHE A CB   2  
ATOM 1893  C CG   . PHE A 1 51 ? 4.687  -12.364 7.657  1.00 0.00 ? 51 PHE A CG   2  
ATOM 1894  C CD1  . PHE A 1 51 ? 3.964  -11.418 8.365  1.00 0.00 ? 51 PHE A CD1  2  
ATOM 1895  C CD2  . PHE A 1 51 ? 4.728  -12.273 6.275  1.00 0.00 ? 51 PHE A CD2  2  
ATOM 1896  C CE1  . PHE A 1 51 ? 3.294  -10.403 7.708  1.00 0.00 ? 51 PHE A CE1  2  
ATOM 1897  C CE2  . PHE A 1 51 ? 4.061  -11.260 5.612  1.00 0.00 ? 51 PHE A CE2  2  
ATOM 1898  C CZ   . PHE A 1 51 ? 3.344  -10.323 6.330  1.00 0.00 ? 51 PHE A CZ   2  
ATOM 1899  H H    . PHE A 1 51 ? 4.501  -13.767 10.758 1.00 0.00 ? 51 PHE A H    2  
ATOM 1900  H HA   . PHE A 1 51 ? 3.648  -14.658 8.154  1.00 0.00 ? 51 PHE A HA   2  
ATOM 1901  H HB2  . PHE A 1 51 ? 5.889  -13.039 9.243  1.00 0.00 ? 51 PHE A HB2  2  
ATOM 1902  H HB3  . PHE A 1 51 ? 6.169  -13.855 7.708  1.00 0.00 ? 51 PHE A HB3  2  
ATOM 1903  H HD1  . PHE A 1 51 ? 3.925  -11.478 9.443  1.00 0.00 ? 51 PHE A HD1  2  
ATOM 1904  H HD2  . PHE A 1 51 ? 5.290  -13.006 5.712  1.00 0.00 ? 51 PHE A HD2  2  
ATOM 1905  H HE1  . PHE A 1 51 ? 2.735  -9.671  8.272  1.00 0.00 ? 51 PHE A HE1  2  
ATOM 1906  H HE2  . PHE A 1 51 ? 4.102  -11.200 4.535  1.00 0.00 ? 51 PHE A HE2  2  
ATOM 1907  H HZ   . PHE A 1 51 ? 2.822  -9.531  5.814  1.00 0.00 ? 51 PHE A HZ   2  
ATOM 1908  N N    . GLY A 1 52 ? 5.773  -16.379 9.883  1.00 0.00 ? 52 GLY A N    2  
ATOM 1909  C CA   . GLY A 1 52 ? 6.511  -17.628 9.926  1.00 0.00 ? 52 GLY A CA   2  
ATOM 1910  C C    . GLY A 1 52 ? 7.925  -17.485 9.397  1.00 0.00 ? 52 GLY A C    2  
ATOM 1911  O O    . GLY A 1 52 ? 8.371  -18.284 8.574  1.00 0.00 ? 52 GLY A O    2  
ATOM 1912  H H    . GLY A 1 52 ? 5.655  -15.853 10.702 1.00 0.00 ? 52 GLY A H    2  
ATOM 1913  H HA2  . GLY A 1 52 ? 6.554  -17.973 10.949 1.00 0.00 ? 52 GLY A HA2  2  
ATOM 1914  H HA3  . GLY A 1 52 ? 5.989  -18.362 9.331  1.00 0.00 ? 52 GLY A HA3  2  
ATOM 1915  N N    . VAL A 1 53 ? 8.631  -16.462 9.869  1.00 0.00 ? 53 VAL A N    2  
ATOM 1916  C CA   . VAL A 1 53 ? 10.002 -16.216 9.437  1.00 0.00 ? 53 VAL A CA   2  
ATOM 1917  C C    . VAL A 1 53 ? 10.967 -16.268 10.617 1.00 0.00 ? 53 VAL A C    2  
ATOM 1918  O O    . VAL A 1 53 ? 10.553 -16.189 11.773 1.00 0.00 ? 53 VAL A O    2  
ATOM 1919  C CB   . VAL A 1 53 ? 10.134 -14.849 8.740  1.00 0.00 ? 53 VAL A CB   2  
ATOM 1920  C CG1  . VAL A 1 53 ? 9.523  -14.898 7.348  1.00 0.00 ? 53 VAL A CG1  2  
ATOM 1921  C CG2  . VAL A 1 53 ? 9.484  -13.759 9.579  1.00 0.00 ? 53 VAL A CG2  2  
ATOM 1922  H H    . VAL A 1 53 ? 8.220  -15.859 10.523 1.00 0.00 ? 53 VAL A H    2  
ATOM 1923  H HA   . VAL A 1 53 ? 10.272 -16.986 8.729  1.00 0.00 ? 53 VAL A HA   2  
ATOM 1924  H HB   . VAL A 1 53 ? 11.185 -14.619 8.640  1.00 0.00 ? 53 VAL A HB   2  
ATOM 1925  H HG11 . VAL A 1 53 ? 9.996  -15.682 6.775  1.00 0.00 ? 53 VAL A HG11 2  
ATOM 1926  H HG12 . VAL A 1 53 ? 8.464  -15.096 7.426  1.00 0.00 ? 53 VAL A HG12 2  
ATOM 1927  H HG13 . VAL A 1 53 ? 9.677  -13.950 6.854  1.00 0.00 ? 53 VAL A HG13 2  
ATOM 1928  H HG21 . VAL A 1 53 ? 8.508  -13.531 9.178  1.00 0.00 ? 53 VAL A HG21 2  
ATOM 1929  H HG22 . VAL A 1 53 ? 9.383  -14.100 10.599 1.00 0.00 ? 53 VAL A HG22 2  
ATOM 1930  H HG23 . VAL A 1 53 ? 10.099 -12.871 9.556  1.00 0.00 ? 53 VAL A HG23 2  
ATOM 1931  N N    . GLU A 1 54 ? 12.254 -16.402 10.315 1.00 0.00 ? 54 GLU A N    2  
ATOM 1932  C CA   . GLU A 1 54 ? 13.278 -16.466 11.351 1.00 0.00 ? 54 GLU A CA   2  
ATOM 1933  C C    . GLU A 1 54 ? 14.335 -15.386 11.138 1.00 0.00 ? 54 GLU A C    2  
ATOM 1934  O O    . GLU A 1 54 ? 15.107 -15.438 10.180 1.00 0.00 ? 54 GLU A O    2  
ATOM 1935  C CB   . GLU A 1 54 ? 13.939 -17.846 11.363 1.00 0.00 ? 54 GLU A CB   2  
ATOM 1936  C CG   . GLU A 1 54 ? 14.473 -18.277 10.008 1.00 0.00 ? 54 GLU A CG   2  
ATOM 1937  C CD   . GLU A 1 54 ? 14.820 -19.752 9.960  1.00 0.00 ? 54 GLU A CD   2  
ATOM 1938  O OE1  . GLU A 1 54 ? 13.899 -20.584 10.097 1.00 0.00 ? 54 GLU A OE1  2  
ATOM 1939  O OE2  . GLU A 1 54 ? 16.014 -20.075 9.785  1.00 0.00 ? 54 GLU A OE2  2  
ATOM 1940  H H    . GLU A 1 54 ? 12.522 -16.461 9.374  1.00 0.00 ? 54 GLU A H    2  
ATOM 1941  H HA   . GLU A 1 54 ? 12.797 -16.299 12.303 1.00 0.00 ? 54 GLU A HA   2  
ATOM 1942  H HB2  . GLU A 1 54 ? 14.760 -17.833 12.064 1.00 0.00 ? 54 GLU A HB2  2  
ATOM 1943  H HB3  . GLU A 1 54 ? 13.212 -18.576 11.689 1.00 0.00 ? 54 GLU A HB3  2  
ATOM 1944  H HG2  . GLU A 1 54 ? 13.723 -18.075 9.258  1.00 0.00 ? 54 GLU A HG2  2  
ATOM 1945  H HG3  . GLU A 1 54 ? 15.363 -17.705 9.788  1.00 0.00 ? 54 GLU A HG3  2  
ATOM 1946  N N    . ILE A 1 55 ? 14.364 -14.409 12.038 1.00 0.00 ? 55 ILE A N    2  
ATOM 1947  C CA   . ILE A 1 55 ? 15.326 -13.317 11.949 1.00 0.00 ? 55 ILE A CA   2  
ATOM 1948  C C    . ILE A 1 55 ? 16.113 -13.171 13.247 1.00 0.00 ? 55 ILE A C    2  
ATOM 1949  O O    . ILE A 1 55 ? 15.665 -13.570 14.322 1.00 0.00 ? 55 ILE A O    2  
ATOM 1950  C CB   . ILE A 1 55 ? 14.632 -11.980 11.629 1.00 0.00 ? 55 ILE A CB   2  
ATOM 1951  C CG1  . ILE A 1 55 ? 13.384 -11.807 12.498 1.00 0.00 ? 55 ILE A CG1  2  
ATOM 1952  C CG2  . ILE A 1 55 ? 14.271 -11.911 10.153 1.00 0.00 ? 55 ILE A CG2  2  
ATOM 1953  C CD1  . ILE A 1 55 ? 12.693 -10.476 12.304 1.00 0.00 ? 55 ILE A CD1  2  
ATOM 1954  H H    . ILE A 1 55 ? 13.724 -14.422 12.780 1.00 0.00 ? 55 ILE A H    2  
ATOM 1955  H HA   . ILE A 1 55 ? 16.014 -13.544 11.147 1.00 0.00 ? 55 ILE A HA   2  
ATOM 1956  H HB   . ILE A 1 55 ? 15.325 -11.180 11.844 1.00 0.00 ? 55 ILE A HB   2  
ATOM 1957  H HG12 . ILE A 1 55 ? 12.677 -12.585 12.259 1.00 0.00 ? 55 ILE A HG12 2  
ATOM 1958  H HG13 . ILE A 1 55 ? 13.665 -11.889 13.538 1.00 0.00 ? 55 ILE A HG13 2  
ATOM 1959  H HG21 . ILE A 1 55 ? 13.740 -10.991 9.956  1.00 0.00 ? 55 ILE A HG21 2  
ATOM 1960  H HG22 . ILE A 1 55 ? 15.173 -11.938 9.561  1.00 0.00 ? 55 ILE A HG22 2  
ATOM 1961  H HG23 . ILE A 1 55 ? 13.644 -12.751 9.896  1.00 0.00 ? 55 ILE A HG23 2  
ATOM 1962  H HD11 . ILE A 1 55 ? 12.009 -10.542 11.471 1.00 0.00 ? 55 ILE A HD11 2  
ATOM 1963  H HD12 . ILE A 1 55 ? 12.148 -10.219 13.200 1.00 0.00 ? 55 ILE A HD12 2  
ATOM 1964  H HD13 . ILE A 1 55 ? 13.432 -9.713  12.102 1.00 0.00 ? 55 ILE A HD13 2  
ATOM 1965  N N    . PRO A 1 56 ? 17.315 -12.584 13.148 1.00 0.00 ? 56 PRO A N    2  
ATOM 1966  C CA   . PRO A 1 56 ? 18.189 -12.368 14.305 1.00 0.00 ? 56 PRO A CA   2  
ATOM 1967  C C    . PRO A 1 56 ? 17.641 -11.310 15.256 1.00 0.00 ? 56 PRO A C    2  
ATOM 1968  O O    . PRO A 1 56 ? 16.979 -10.363 14.832 1.00 0.00 ? 56 PRO A O    2  
ATOM 1969  C CB   . PRO A 1 56 ? 19.501 -11.894 13.674 1.00 0.00 ? 56 PRO A CB   2  
ATOM 1970  C CG   . PRO A 1 56 ? 19.099 -11.292 12.372 1.00 0.00 ? 56 PRO A CG   2  
ATOM 1971  C CD   . PRO A 1 56 ? 17.912 -12.084 11.898 1.00 0.00 ? 56 PRO A CD   2  
ATOM 1972  H HA   . PRO A 1 56 ? 18.360 -13.286 14.849 1.00 0.00 ? 56 PRO A HA   2  
ATOM 1973  H HB2  . PRO A 1 56 ? 19.970 -11.165 14.320 1.00 0.00 ? 56 PRO A HB2  2  
ATOM 1974  H HB3  . PRO A 1 56 ? 20.162 -12.736 13.533 1.00 0.00 ? 56 PRO A HB3  2  
ATOM 1975  H HG2  . PRO A 1 56 ? 18.827 -10.257 12.515 1.00 0.00 ? 56 PRO A HG2  2  
ATOM 1976  H HG3  . PRO A 1 56 ? 19.911 -11.374 11.665 1.00 0.00 ? 56 PRO A HG3  2  
ATOM 1977  H HD2  . PRO A 1 56 ? 17.220 -11.446 11.368 1.00 0.00 ? 56 PRO A HD2  2  
ATOM 1978  H HD3  . PRO A 1 56 ? 18.231 -12.902 11.270 1.00 0.00 ? 56 PRO A HD3  2  
ATOM 1979  N N    . ASP A 1 57 ? 17.922 -11.477 16.544 1.00 0.00 ? 57 ASP A N    2  
ATOM 1980  C CA   . ASP A 1 57 ? 17.459 -10.534 17.556 1.00 0.00 ? 57 ASP A CA   2  
ATOM 1981  C C    . ASP A 1 57 ? 17.844 -9.106  17.184 1.00 0.00 ? 57 ASP A C    2  
ATOM 1982  O O    . ASP A 1 57 ? 17.068 -8.171  17.384 1.00 0.00 ? 57 ASP A O    2  
ATOM 1983  C CB   . ASP A 1 57 ? 18.042 -10.894 18.923 1.00 0.00 ? 57 ASP A CB   2  
ATOM 1984  C CG   . ASP A 1 57 ? 17.743 -12.326 19.322 1.00 0.00 ? 57 ASP A CG   2  
ATOM 1985  O OD1  . ASP A 1 57 ? 16.581 -12.755 19.164 1.00 0.00 ? 57 ASP A OD1  2  
ATOM 1986  O OD2  . ASP A 1 57 ? 18.671 -13.017 19.792 1.00 0.00 ? 57 ASP A OD2  2  
ATOM 1987  H H    . ASP A 1 57 ? 18.455 -12.252 16.820 1.00 0.00 ? 57 ASP A H    2  
ATOM 1988  H HA   . ASP A 1 57 ? 16.383 -10.602 17.604 1.00 0.00 ? 57 ASP A HA   2  
ATOM 1989  H HB2  . ASP A 1 57 ? 19.115 -10.765 18.896 1.00 0.00 ? 57 ASP A HB2  2  
ATOM 1990  H HB3  . ASP A 1 57 ? 17.623 -10.236 19.670 1.00 0.00 ? 57 ASP A HB3  2  
ATOM 1991  N N    . ASP A 1 58 ? 19.047 -8.944  16.645 1.00 0.00 ? 58 ASP A N    2  
ATOM 1992  C CA   . ASP A 1 58 ? 19.536 -7.629  16.245 1.00 0.00 ? 58 ASP A CA   2  
ATOM 1993  C C    . ASP A 1 58 ? 18.539 -6.937  15.321 1.00 0.00 ? 58 ASP A C    2  
ATOM 1994  O O    . ASP A 1 58 ? 18.459 -5.709  15.286 1.00 0.00 ? 58 ASP A O    2  
ATOM 1995  C CB   . ASP A 1 58 ? 20.893 -7.755  15.551 1.00 0.00 ? 58 ASP A CB   2  
ATOM 1996  C CG   . ASP A 1 58 ? 22.038 -7.883  16.536 1.00 0.00 ? 58 ASP A CG   2  
ATOM 1997  O OD1  . ASP A 1 58 ? 21.765 -8.020  17.747 1.00 0.00 ? 58 ASP A OD1  2  
ATOM 1998  O OD2  . ASP A 1 58 ? 23.206 -7.846  16.096 1.00 0.00 ? 58 ASP A OD2  2  
ATOM 1999  H H    . ASP A 1 58 ? 19.620 -9.728  16.511 1.00 0.00 ? 58 ASP A H    2  
ATOM 2000  H HA   . ASP A 1 58 ? 19.653 -7.034  17.138 1.00 0.00 ? 58 ASP A HA   2  
ATOM 2001  H HB2  . ASP A 1 58 ? 20.886 -8.631  14.919 1.00 0.00 ? 58 ASP A HB2  2  
ATOM 2002  H HB3  . ASP A 1 58 ? 21.061 -6.879  14.943 1.00 0.00 ? 58 ASP A HB3  2  
ATOM 2003  N N    . ALA A 1 59 ? 17.782 -7.733  14.573 1.00 0.00 ? 59 ALA A N    2  
ATOM 2004  C CA   . ALA A 1 59 ? 16.791 -7.197  13.649 1.00 0.00 ? 59 ALA A CA   2  
ATOM 2005  C C    . ALA A 1 59 ? 15.817 -6.269  14.366 1.00 0.00 ? 59 ALA A C    2  
ATOM 2006  O O    . ALA A 1 59 ? 15.621 -5.124  13.959 1.00 0.00 ? 59 ALA A O    2  
ATOM 2007  C CB   . ALA A 1 59 ? 16.038 -8.330  12.967 1.00 0.00 ? 59 ALA A CB   2  
ATOM 2008  H H    . ALA A 1 59 ? 17.893 -8.704  14.645 1.00 0.00 ? 59 ALA A H    2  
ATOM 2009  H HA   . ALA A 1 59 ? 17.313 -6.635  12.888 1.00 0.00 ? 59 ALA A HA   2  
ATOM 2010  H HB1  . ALA A 1 59 ? 15.505 -8.905  13.709 1.00 0.00 ? 59 ALA A HB1  2  
ATOM 2011  H HB2  . ALA A 1 59 ? 15.336 -7.919  12.256 1.00 0.00 ? 59 ALA A HB2  2  
ATOM 2012  H HB3  . ALA A 1 59 ? 16.740 -8.969  12.452 1.00 0.00 ? 59 ALA A HB3  2  
ATOM 2013  N N    . ALA A 1 60 ? 15.208 -6.771  15.436 1.00 0.00 ? 60 ALA A N    2  
ATOM 2014  C CA   . ALA A 1 60 ? 14.255 -5.986  16.211 1.00 0.00 ? 60 ALA A CA   2  
ATOM 2015  C C    . ALA A 1 60 ? 14.871 -4.667  16.665 1.00 0.00 ? 60 ALA A C    2  
ATOM 2016  O O    . ALA A 1 60 ? 14.163 -3.684  16.883 1.00 0.00 ? 60 ALA A O    2  
ATOM 2017  C CB   . ALA A 1 60 ? 13.767 -6.783  17.411 1.00 0.00 ? 60 ALA A CB   2  
ATOM 2018  H H    . ALA A 1 60 ? 15.405 -7.690  15.711 1.00 0.00 ? 60 ALA A H    2  
ATOM 2019  H HA   . ALA A 1 60 ? 13.404 -5.776  15.579 1.00 0.00 ? 60 ALA A HA   2  
ATOM 2020  H HB1  . ALA A 1 60 ? 12.730 -6.547  17.602 1.00 0.00 ? 60 ALA A HB1  2  
ATOM 2021  H HB2  . ALA A 1 60 ? 13.863 -7.839  17.205 1.00 0.00 ? 60 ALA A HB2  2  
ATOM 2022  H HB3  . ALA A 1 60 ? 14.359 -6.529  18.277 1.00 0.00 ? 60 ALA A HB3  2  
ATOM 2023  N N    . GLU A 1 61 ? 16.192 -4.654  16.806 1.00 0.00 ? 61 GLU A N    2  
ATOM 2024  C CA   . GLU A 1 61 ? 16.902 -3.454  17.236 1.00 0.00 ? 61 GLU A CA   2  
ATOM 2025  C C    . GLU A 1 61 ? 17.221 -2.555  16.045 1.00 0.00 ? 61 GLU A C    2  
ATOM 2026  O O    . GLU A 1 61 ? 17.368 -1.341  16.191 1.00 0.00 ? 61 GLU A O    2  
ATOM 2027  C CB   . GLU A 1 61 ? 18.194 -3.833  17.964 1.00 0.00 ? 61 GLU A CB   2  
ATOM 2028  C CG   . GLU A 1 61 ? 17.983 -4.806  19.112 1.00 0.00 ? 61 GLU A CG   2  
ATOM 2029  C CD   . GLU A 1 61 ? 19.179 -4.880  20.040 1.00 0.00 ? 61 GLU A CD   2  
ATOM 2030  O OE1  . GLU A 1 61 ? 20.322 -4.791  19.545 1.00 0.00 ? 61 GLU A OE1  2  
ATOM 2031  O OE2  . GLU A 1 61 ? 18.972 -5.027  21.263 1.00 0.00 ? 61 GLU A OE2  2  
ATOM 2032  H H    . GLU A 1 61 ? 16.702 -5.469  16.617 1.00 0.00 ? 61 GLU A H    2  
ATOM 2033  H HA   . GLU A 1 61 ? 16.261 -2.916  17.917 1.00 0.00 ? 61 GLU A HA   2  
ATOM 2034  H HB2  . GLU A 1 61 ? 18.873 -4.285  17.256 1.00 0.00 ? 61 GLU A HB2  2  
ATOM 2035  H HB3  . GLU A 1 61 ? 18.646 -2.935  18.359 1.00 0.00 ? 61 GLU A HB3  2  
ATOM 2036  H HG2  . GLU A 1 61 ? 17.123 -4.489  19.682 1.00 0.00 ? 61 GLU A HG2  2  
ATOM 2037  H HG3  . GLU A 1 61 ? 17.801 -5.789  18.704 1.00 0.00 ? 61 GLU A HG3  2  
ATOM 2038  N N    . THR A 1 62 ? 17.328 -3.159  14.866 1.00 0.00 ? 62 THR A N    2  
ATOM 2039  C CA   . THR A 1 62 ? 17.631 -2.415  13.650 1.00 0.00 ? 62 THR A CA   2  
ATOM 2040  C C    . THR A 1 62 ? 16.380 -1.753  13.085 1.00 0.00 ? 62 THR A C    2  
ATOM 2041  O O    . THR A 1 62 ? 16.467 -0.820  12.285 1.00 0.00 ? 62 THR A O    2  
ATOM 2042  C CB   . THR A 1 62 ? 18.248 -3.326  12.573 1.00 0.00 ? 62 THR A CB   2  
ATOM 2043  O OG1  . THR A 1 62 ? 17.283 -4.290  12.136 1.00 0.00 ? 62 THR A OG1  2  
ATOM 2044  C CG2  . THR A 1 62 ? 19.480 -4.040  13.108 1.00 0.00 ? 62 THR A CG2  2  
ATOM 2045  H H    . THR A 1 62 ? 17.200 -4.129  14.814 1.00 0.00 ? 62 THR A H    2  
ATOM 2046  H HA   . THR A 1 62 ? 18.351 -1.649  13.899 1.00 0.00 ? 62 THR A HA   2  
ATOM 2047  H HB   . THR A 1 62 ? 18.541 -2.715  11.731 1.00 0.00 ? 62 THR A HB   2  
ATOM 2048  H HG1  . THR A 1 62 ? 16.574 -3.844  11.667 1.00 0.00 ? 62 THR A HG1  2  
ATOM 2049  H HG21 . THR A 1 62 ? 19.574 -3.851  14.167 1.00 0.00 ? 62 THR A HG21 2  
ATOM 2050  H HG22 . THR A 1 62 ? 20.358 -3.674  12.597 1.00 0.00 ? 62 THR A HG22 2  
ATOM 2051  H HG23 . THR A 1 62 ? 19.382 -5.102  12.939 1.00 0.00 ? 62 THR A HG23 2  
ATOM 2052  N N    . ILE A 1 63 ? 15.217 -2.240  13.504 1.00 0.00 ? 63 ILE A N    2  
ATOM 2053  C CA   . ILE A 1 63 ? 13.948 -1.693  13.040 1.00 0.00 ? 63 ILE A CA   2  
ATOM 2054  C C    . ILE A 1 63 ? 13.533 -0.485  13.872 1.00 0.00 ? 63 ILE A C    2  
ATOM 2055  O O    . ILE A 1 63 ? 13.171 -0.618  15.042 1.00 0.00 ? 63 ILE A O    2  
ATOM 2056  C CB   . ILE A 1 63 ? 12.828 -2.749  13.093 1.00 0.00 ? 63 ILE A CB   2  
ATOM 2057  C CG1  . ILE A 1 63 ? 13.198 -3.960  12.235 1.00 0.00 ? 63 ILE A CG1  2  
ATOM 2058  C CG2  . ILE A 1 63 ? 11.511 -2.146  12.627 1.00 0.00 ? 63 ILE A CG2  2  
ATOM 2059  C CD1  . ILE A 1 63 ? 12.408 -5.205  12.574 1.00 0.00 ? 63 ILE A CD1  2  
ATOM 2060  H H    . ILE A 1 63 ? 15.213 -2.984  14.142 1.00 0.00 ? 63 ILE A H    2  
ATOM 2061  H HA   . ILE A 1 63 ? 14.075 -1.383  12.013 1.00 0.00 ? 63 ILE A HA   2  
ATOM 2062  H HB   . ILE A 1 63 ? 12.709 -3.065  14.118 1.00 0.00 ? 63 ILE A HB   2  
ATOM 2063  H HG12 . ILE A 1 63 ? 13.019 -3.727  11.197 1.00 0.00 ? 63 ILE A HG12 2  
ATOM 2064  H HG13 . ILE A 1 63 ? 14.246 -4.184  12.374 1.00 0.00 ? 63 ILE A HG13 2  
ATOM 2065  H HG21 . ILE A 1 63 ? 10.769 -2.927  12.539 1.00 0.00 ? 63 ILE A HG21 2  
ATOM 2066  H HG22 . ILE A 1 63 ? 11.176 -1.414  13.347 1.00 0.00 ? 63 ILE A HG22 2  
ATOM 2067  H HG23 . ILE A 1 63 ? 11.650 -1.671  11.668 1.00 0.00 ? 63 ILE A HG23 2  
ATOM 2068  H HD11 . ILE A 1 63 ? 12.918 -5.756  13.350 1.00 0.00 ? 63 ILE A HD11 2  
ATOM 2069  H HD12 . ILE A 1 63 ? 11.424 -4.924  12.918 1.00 0.00 ? 63 ILE A HD12 2  
ATOM 2070  H HD13 . ILE A 1 63 ? 12.317 -5.825  11.693 1.00 0.00 ? 63 ILE A HD13 2  
ATOM 2071  N N    . LEU A 1 64 ? 13.585 0.693   13.261 1.00 0.00 ? 64 LEU A N    2  
ATOM 2072  C CA   . LEU A 1 64 ? 13.212 1.927   13.945 1.00 0.00 ? 64 LEU A CA   2  
ATOM 2073  C C    . LEU A 1 64 ? 11.913 2.492   13.379 1.00 0.00 ? 64 LEU A C    2  
ATOM 2074  O O    . LEU A 1 64 ? 11.053 2.966   14.122 1.00 0.00 ? 64 LEU A O    2  
ATOM 2075  C CB   . LEU A 1 64 ? 14.330 2.962   13.817 1.00 0.00 ? 64 LEU A CB   2  
ATOM 2076  C CG   . LEU A 1 64 ? 15.730 2.491   14.214 1.00 0.00 ? 64 LEU A CG   2  
ATOM 2077  C CD1  . LEU A 1 64 ? 16.789 3.413   13.630 1.00 0.00 ? 64 LEU A CD1  2  
ATOM 2078  C CD2  . LEU A 1 64 ? 15.859 2.421   15.729 1.00 0.00 ? 64 LEU A CD2  2  
ATOM 2079  H H    . LEU A 1 64 ? 13.881 0.736   12.328 1.00 0.00 ? 64 LEU A H    2  
ATOM 2080  H HA   . LEU A 1 64 ? 13.065 1.695   14.989 1.00 0.00 ? 64 LEU A HA   2  
ATOM 2081  H HB2  . LEU A 1 64 ? 14.369 3.281   12.787 1.00 0.00 ? 64 LEU A HB2  2  
ATOM 2082  H HB3  . LEU A 1 64 ? 14.073 3.805   14.443 1.00 0.00 ? 64 LEU A HB3  2  
ATOM 2083  H HG   . LEU A 1 64 ? 15.895 1.499   13.817 1.00 0.00 ? 64 LEU A HG   2  
ATOM 2084  H HD11 . LEU A 1 64 ? 16.336 4.061   12.895 1.00 0.00 ? 64 LEU A HD11 2  
ATOM 2085  H HD12 . LEU A 1 64 ? 17.561 2.821   13.161 1.00 0.00 ? 64 LEU A HD12 2  
ATOM 2086  H HD13 . LEU A 1 64 ? 17.223 4.009   14.419 1.00 0.00 ? 64 LEU A HD13 2  
ATOM 2087  H HD21 . LEU A 1 64 ? 16.776 1.913   15.988 1.00 0.00 ? 64 LEU A HD21 2  
ATOM 2088  H HD22 . LEU A 1 64 ? 15.018 1.878   16.137 1.00 0.00 ? 64 LEU A HD22 2  
ATOM 2089  H HD23 . LEU A 1 64 ? 15.873 3.421   16.136 1.00 0.00 ? 64 LEU A HD23 2  
ATOM 2090  N N    . THR A 1 65 ? 11.775 2.436   12.058 1.00 0.00 ? 65 THR A N    2  
ATOM 2091  C CA   . THR A 1 65 ? 10.581 2.941   11.392 1.00 0.00 ? 65 THR A CA   2  
ATOM 2092  C C    . THR A 1 65 ? 9.814  1.814   10.711 1.00 0.00 ? 65 THR A C    2  
ATOM 2093  O O    . THR A 1 65 ? 10.324 0.704   10.560 1.00 0.00 ? 65 THR A O    2  
ATOM 2094  C CB   . THR A 1 65 ? 10.934 4.013   10.344 1.00 0.00 ? 65 THR A CB   2  
ATOM 2095  O OG1  . THR A 1 65 ? 11.787 3.454   9.339  1.00 0.00 ? 65 THR A OG1  2  
ATOM 2096  C CG2  . THR A 1 65 ? 11.623 5.202   10.996 1.00 0.00 ? 65 THR A CG2  2  
ATOM 2097  H H    . THR A 1 65 ? 12.496 2.047   11.520 1.00 0.00 ? 65 THR A H    2  
ATOM 2098  H HA   . THR A 1 65 ? 9.948  3.394   12.141 1.00 0.00 ? 65 THR A HA   2  
ATOM 2099  H HB   . THR A 1 65 ? 10.020 4.356   9.880  1.00 0.00 ? 65 THR A HB   2  
ATOM 2100  H HG1  . THR A 1 65 ? 11.257 3.180   8.586  1.00 0.00 ? 65 THR A HG1  2  
ATOM 2101  H HG21 . THR A 1 65 ? 10.878 5.879   11.388 1.00 0.00 ? 65 THR A HG21 2  
ATOM 2102  H HG22 . THR A 1 65 ? 12.226 5.716   10.263 1.00 0.00 ? 65 THR A HG22 2  
ATOM 2103  H HG23 . THR A 1 65 ? 12.252 4.855   11.802 1.00 0.00 ? 65 THR A HG23 2  
ATOM 2104  N N    . VAL A 1 66 ? 8.584  2.106   10.300 1.00 0.00 ? 66 VAL A N    2  
ATOM 2105  C CA   . VAL A 1 66 ? 7.746  1.117   9.632  1.00 0.00 ? 66 VAL A CA   2  
ATOM 2106  C C    . VAL A 1 66 ? 8.469  0.496   8.443  1.00 0.00 ? 66 VAL A C    2  
ATOM 2107  O O    . VAL A 1 66 ? 8.349  -0.700  8.185  1.00 0.00 ? 66 VAL A O    2  
ATOM 2108  C CB   . VAL A 1 66 ? 6.422  1.738   9.147  1.00 0.00 ? 66 VAL A CB   2  
ATOM 2109  C CG1  . VAL A 1 66 ? 5.582  0.702   8.417  1.00 0.00 ? 66 VAL A CG1  2  
ATOM 2110  C CG2  . VAL A 1 66 ? 5.653  2.332   10.317 1.00 0.00 ? 66 VAL A CG2  2  
ATOM 2111  H H    . VAL A 1 66 ? 8.232  3.009   10.448 1.00 0.00 ? 66 VAL A H    2  
ATOM 2112  H HA   . VAL A 1 66 ? 7.514  0.340   10.346 1.00 0.00 ? 66 VAL A HA   2  
ATOM 2113  H HB   . VAL A 1 66 ? 6.654  2.534   8.455  1.00 0.00 ? 66 VAL A HB   2  
ATOM 2114  H HG11 . VAL A 1 66 ? 4.551  0.793   8.725  1.00 0.00 ? 66 VAL A HG11 2  
ATOM 2115  H HG12 . VAL A 1 66 ? 5.656  0.863   7.352  1.00 0.00 ? 66 VAL A HG12 2  
ATOM 2116  H HG13 . VAL A 1 66 ? 5.942  -0.288  8.658  1.00 0.00 ? 66 VAL A HG13 2  
ATOM 2117  H HG21 . VAL A 1 66 ? 4.957  3.072   9.951  1.00 0.00 ? 66 VAL A HG21 2  
ATOM 2118  H HG22 . VAL A 1 66 ? 5.110  1.549   10.827 1.00 0.00 ? 66 VAL A HG22 2  
ATOM 2119  H HG23 . VAL A 1 66 ? 6.344  2.797   11.005 1.00 0.00 ? 66 VAL A HG23 2  
ATOM 2120  N N    . GLY A 1 67 ? 9.223  1.320   7.720  1.00 0.00 ? 67 GLY A N    2  
ATOM 2121  C CA   . GLY A 1 67 ? 9.956  0.834   6.565  1.00 0.00 ? 67 GLY A CA   2  
ATOM 2122  C C    . GLY A 1 67 ? 10.808 -0.378  6.888  1.00 0.00 ? 67 GLY A C    2  
ATOM 2123  O O    . GLY A 1 67 ? 10.728 -1.400  6.207  1.00 0.00 ? 67 GLY A O    2  
ATOM 2124  H H    . GLY A 1 67 ? 9.281  2.265   7.973  1.00 0.00 ? 67 GLY A H    2  
ATOM 2125  H HA2  . GLY A 1 67 ? 9.252  0.570   5.791  1.00 0.00 ? 67 GLY A HA2  2  
ATOM 2126  H HA3  . GLY A 1 67 ? 10.597 1.624   6.202  1.00 0.00 ? 67 GLY A HA3  2  
ATOM 2127  N N    . ASP A 1 68 ? 11.627 -0.263  7.927  1.00 0.00 ? 68 ASP A N    2  
ATOM 2128  C CA   . ASP A 1 68 ? 12.498 -1.358  8.338  1.00 0.00 ? 68 ASP A CA   2  
ATOM 2129  C C    . ASP A 1 68 ? 11.687 -2.612  8.647  1.00 0.00 ? 68 ASP A C    2  
ATOM 2130  O O    . ASP A 1 68 ? 11.932 -3.677  8.082  1.00 0.00 ? 68 ASP A O    2  
ATOM 2131  C CB   . ASP A 1 68 ? 13.319 -0.952  9.563  1.00 0.00 ? 68 ASP A CB   2  
ATOM 2132  C CG   . ASP A 1 68 ? 14.597 -0.225  9.189  1.00 0.00 ? 68 ASP A CG   2  
ATOM 2133  O OD1  . ASP A 1 68 ? 15.575 -0.902  8.810  1.00 0.00 ? 68 ASP A OD1  2  
ATOM 2134  O OD2  . ASP A 1 68 ? 14.617 1.020   9.275  1.00 0.00 ? 68 ASP A OD2  2  
ATOM 2135  H H    . ASP A 1 68 ? 11.645 0.578   8.431  1.00 0.00 ? 68 ASP A H    2  
ATOM 2136  H HA   . ASP A 1 68 ? 13.170 -1.572  7.521  1.00 0.00 ? 68 ASP A HA   2  
ATOM 2137  H HB2  . ASP A 1 68 ? 12.726 -0.299  10.187 1.00 0.00 ? 68 ASP A HB2  2  
ATOM 2138  H HB3  . ASP A 1 68 ? 13.581 -1.838  10.123 1.00 0.00 ? 68 ASP A HB3  2  
ATOM 2139  N N    . ALA A 1 69 ? 10.720 -2.478  9.550  1.00 0.00 ? 69 ALA A N    2  
ATOM 2140  C CA   . ALA A 1 69 ? 9.872  -3.599  9.933  1.00 0.00 ? 69 ALA A CA   2  
ATOM 2141  C C    . ALA A 1 69 ? 9.270  -4.277  8.707  1.00 0.00 ? 69 ALA A C    2  
ATOM 2142  O O    . ALA A 1 69 ? 9.303  -5.501  8.583  1.00 0.00 ? 69 ALA A O    2  
ATOM 2143  C CB   . ALA A 1 69 ? 8.771  -3.131  10.874 1.00 0.00 ? 69 ALA A CB   2  
ATOM 2144  H H    . ALA A 1 69 ? 10.573 -1.603  9.966  1.00 0.00 ? 69 ALA A H    2  
ATOM 2145  H HA   . ALA A 1 69 ? 10.484 -4.315  10.463 1.00 0.00 ? 69 ALA A HA   2  
ATOM 2146  H HB1  . ALA A 1 69 ? 7.810  -3.420  10.473 1.00 0.00 ? 69 ALA A HB1  2  
ATOM 2147  H HB2  . ALA A 1 69 ? 8.909  -3.586  11.843 1.00 0.00 ? 69 ALA A HB2  2  
ATOM 2148  H HB3  . ALA A 1 69 ? 8.814  -2.057  10.970 1.00 0.00 ? 69 ALA A HB3  2  
ATOM 2149  N N    . VAL A 1 70 ? 8.720  -3.473  7.803  1.00 0.00 ? 70 VAL A N    2  
ATOM 2150  C CA   . VAL A 1 70 ? 8.111  -3.995  6.585  1.00 0.00 ? 70 VAL A CA   2  
ATOM 2151  C C    . VAL A 1 70 ? 9.142  -4.705  5.716  1.00 0.00 ? 70 VAL A C    2  
ATOM 2152  O O    . VAL A 1 70 ? 8.986  -5.880  5.382  1.00 0.00 ? 70 VAL A O    2  
ATOM 2153  C CB   . VAL A 1 70 ? 7.447  -2.874  5.764  1.00 0.00 ? 70 VAL A CB   2  
ATOM 2154  C CG1  . VAL A 1 70 ? 6.839  -3.435  4.488  1.00 0.00 ? 70 VAL A CG1  2  
ATOM 2155  C CG2  . VAL A 1 70 ? 6.394  -2.157  6.595  1.00 0.00 ? 70 VAL A CG2  2  
ATOM 2156  H H    . VAL A 1 70 ? 8.725  -2.505  7.957  1.00 0.00 ? 70 VAL A H    2  
ATOM 2157  H HA   . VAL A 1 70 ? 7.347  -4.703  6.872  1.00 0.00 ? 70 VAL A HA   2  
ATOM 2158  H HB   . VAL A 1 70 ? 8.208  -2.158  5.490  1.00 0.00 ? 70 VAL A HB   2  
ATOM 2159  H HG11 . VAL A 1 70 ? 7.619  -3.869  3.878  1.00 0.00 ? 70 VAL A HG11 2  
ATOM 2160  H HG12 . VAL A 1 70 ? 6.112  -4.193  4.738  1.00 0.00 ? 70 VAL A HG12 2  
ATOM 2161  H HG13 . VAL A 1 70 ? 6.356  -2.639  3.939  1.00 0.00 ? 70 VAL A HG13 2  
ATOM 2162  H HG21 . VAL A 1 70 ? 6.606  -1.098  6.607  1.00 0.00 ? 70 VAL A HG21 2  
ATOM 2163  H HG22 . VAL A 1 70 ? 5.418  -2.324  6.163  1.00 0.00 ? 70 VAL A HG22 2  
ATOM 2164  H HG23 . VAL A 1 70 ? 6.410  -2.539  7.605  1.00 0.00 ? 70 VAL A HG23 2  
ATOM 2165  N N    . LYS A 1 71 ? 10.197 -3.985  5.351  1.00 0.00 ? 71 LYS A N    2  
ATOM 2166  C CA   . LYS A 1 71 ? 11.257 -4.545  4.521  1.00 0.00 ? 71 LYS A CA   2  
ATOM 2167  C C    . LYS A 1 71 ? 11.773 -5.855  5.108  1.00 0.00 ? 71 LYS A C    2  
ATOM 2168  O O    . LYS A 1 71 ? 12.139 -6.773  4.375  1.00 0.00 ? 71 LYS A O    2  
ATOM 2169  C CB   . LYS A 1 71 ? 12.409 -3.546  4.386  1.00 0.00 ? 71 LYS A CB   2  
ATOM 2170  C CG   . LYS A 1 71 ? 12.603 -3.029  2.971  1.00 0.00 ? 71 LYS A CG   2  
ATOM 2171  C CD   . LYS A 1 71 ? 12.578 -1.511  2.924  1.00 0.00 ? 71 LYS A CD   2  
ATOM 2172  C CE   . LYS A 1 71 ? 12.573 -0.998  1.492  1.00 0.00 ? 71 LYS A CE   2  
ATOM 2173  N NZ   . LYS A 1 71 ? 11.192 -0.728  1.005  1.00 0.00 ? 71 LYS A NZ   2  
ATOM 2174  H H    . LYS A 1 71 ? 10.265 -3.053  5.649  1.00 0.00 ? 71 LYS A H    2  
ATOM 2175  H HA   . LYS A 1 71 ? 10.844 -4.740  3.543  1.00 0.00 ? 71 LYS A HA   2  
ATOM 2176  H HB2  . LYS A 1 71 ? 12.215 -2.702  5.032  1.00 0.00 ? 71 LYS A HB2  2  
ATOM 2177  H HB3  . LYS A 1 71 ? 13.324 -4.026  4.700  1.00 0.00 ? 71 LYS A HB3  2  
ATOM 2178  H HG2  . LYS A 1 71 ? 13.556 -3.375  2.599  1.00 0.00 ? 71 LYS A HG2  2  
ATOM 2179  H HG3  . LYS A 1 71 ? 11.809 -3.413  2.346  1.00 0.00 ? 71 LYS A HG3  2  
ATOM 2180  H HD2  . LYS A 1 71 ? 11.688 -1.158  3.424  1.00 0.00 ? 71 LYS A HD2  2  
ATOM 2181  H HD3  . LYS A 1 71 ? 13.453 -1.129  3.431  1.00 0.00 ? 71 LYS A HD3  2  
ATOM 2182  H HE2  . LYS A 1 71 ? 13.145 -0.084  1.449  1.00 0.00 ? 71 LYS A HE2  2  
ATOM 2183  H HE3  . LYS A 1 71 ? 13.032 -1.740  0.856  1.00 0.00 ? 71 LYS A HE3  2  
ATOM 2184  H HZ1  . LYS A 1 71 ? 11.066 0.290   0.834  1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 2185  H HZ2  . LYS A 1 71 ? 10.496 -1.038  1.712  1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 2186  H HZ3  . LYS A 1 71 ? 11.020 -1.242  0.117  1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 2187  N N    . PHE A 1 72 ? 11.797 -5.935  6.434  1.00 0.00 ? 72 PHE A N    2  
ATOM 2188  C CA   . PHE A 1 72 ? 12.267 -7.134  7.119  1.00 0.00 ? 72 PHE A CA   2  
ATOM 2189  C C    . PHE A 1 72 ? 11.298 -8.294  6.912  1.00 0.00 ? 72 PHE A C    2  
ATOM 2190  O O    . PHE A 1 72 ? 11.665 -9.332  6.361  1.00 0.00 ? 72 PHE A O    2  
ATOM 2191  C CB   . PHE A 1 72 ? 12.438 -6.859  8.615  1.00 0.00 ? 72 PHE A CB   2  
ATOM 2192  C CG   . PHE A 1 72 ? 13.855 -7.001  9.092  1.00 0.00 ? 72 PHE A CG   2  
ATOM 2193  C CD1  . PHE A 1 72 ? 14.426 -8.255  9.242  1.00 0.00 ? 72 PHE A CD1  2  
ATOM 2194  C CD2  . PHE A 1 72 ? 14.615 -5.882  9.391  1.00 0.00 ? 72 PHE A CD2  2  
ATOM 2195  C CE1  . PHE A 1 72 ? 15.730 -8.390  9.681  1.00 0.00 ? 72 PHE A CE1  2  
ATOM 2196  C CE2  . PHE A 1 72 ? 15.920 -6.011  9.830  1.00 0.00 ? 72 PHE A CE2  2  
ATOM 2197  C CZ   . PHE A 1 72 ? 16.477 -7.266  9.976  1.00 0.00 ? 72 PHE A CZ   2  
ATOM 2198  H H    . PHE A 1 72 ? 11.491 -5.170  6.965  1.00 0.00 ? 72 PHE A H    2  
ATOM 2199  H HA   . PHE A 1 72 ? 13.224 -7.401  6.699  1.00 0.00 ? 72 PHE A HA   2  
ATOM 2200  H HB2  . PHE A 1 72 ? 12.117 -5.850  8.827  1.00 0.00 ? 72 PHE A HB2  2  
ATOM 2201  H HB3  . PHE A 1 72 ? 11.827 -7.551  9.173  1.00 0.00 ? 72 PHE A HB3  2  
ATOM 2202  H HD1  . PHE A 1 72 ? 13.842 -9.135  9.012  1.00 0.00 ? 72 PHE A HD1  2  
ATOM 2203  H HD2  . PHE A 1 72 ? 14.180 -4.900  9.278  1.00 0.00 ? 72 PHE A HD2  2  
ATOM 2204  H HE1  . PHE A 1 72 ? 16.163 -9.373  9.794  1.00 0.00 ? 72 PHE A HE1  2  
ATOM 2205  H HE2  . PHE A 1 72 ? 16.502 -5.131  10.060 1.00 0.00 ? 72 PHE A HE2  2  
ATOM 2206  H HZ   . PHE A 1 72 ? 17.496 -7.369  10.318 1.00 0.00 ? 72 PHE A HZ   2  
ATOM 2207  N N    . ILE A 1 73 ? 10.060 -8.110  7.358  1.00 0.00 ? 73 ILE A N    2  
ATOM 2208  C CA   . ILE A 1 73 ? 9.038  -9.140  7.221  1.00 0.00 ? 73 ILE A CA   2  
ATOM 2209  C C    . ILE A 1 73 ? 8.855  -9.544  5.762  1.00 0.00 ? 73 ILE A C    2  
ATOM 2210  O O    . ILE A 1 73 ? 8.452  -10.668 5.464  1.00 0.00 ? 73 ILE A O    2  
ATOM 2211  C CB   . ILE A 1 73 ? 7.684  -8.669  7.785  1.00 0.00 ? 73 ILE A CB   2  
ATOM 2212  C CG1  . ILE A 1 73 ? 7.820  -8.314  9.267  1.00 0.00 ? 73 ILE A CG1  2  
ATOM 2213  C CG2  . ILE A 1 73 ? 6.625  -9.743  7.587  1.00 0.00 ? 73 ILE A CG2  2  
ATOM 2214  C CD1  . ILE A 1 73 ? 6.803  -7.300  9.741  1.00 0.00 ? 73 ILE A CD1  2  
ATOM 2215  H H    . ILE A 1 73 ? 9.828  -7.261  7.788  1.00 0.00 ? 73 ILE A H    2  
ATOM 2216  H HA   . ILE A 1 73 ? 9.359  -10.004 7.785  1.00 0.00 ? 73 ILE A HA   2  
ATOM 2217  H HB   . ILE A 1 73 ? 7.378  -7.790  7.238  1.00 0.00 ? 73 ILE A HB   2  
ATOM 2218  H HG12 . ILE A 1 73 ? 7.696  -9.208  9.858  1.00 0.00 ? 73 ILE A HG12 2  
ATOM 2219  H HG13 . ILE A 1 73 ? 8.805  -7.905  9.443  1.00 0.00 ? 73 ILE A HG13 2  
ATOM 2220  H HG21 . ILE A 1 73 ? 5.703  -9.430  8.055  1.00 0.00 ? 73 ILE A HG21 2  
ATOM 2221  H HG22 . ILE A 1 73 ? 6.459  -9.893  6.531  1.00 0.00 ? 73 ILE A HG22 2  
ATOM 2222  H HG23 . ILE A 1 73 ? 6.960  -10.667 8.034  1.00 0.00 ? 73 ILE A HG23 2  
ATOM 2223  H HD11 . ILE A 1 73 ? 6.858  -6.417  9.121  1.00 0.00 ? 73 ILE A HD11 2  
ATOM 2224  H HD12 . ILE A 1 73 ? 5.813  -7.725  9.678  1.00 0.00 ? 73 ILE A HD12 2  
ATOM 2225  H HD13 . ILE A 1 73 ? 7.014  -7.031  10.767 1.00 0.00 ? 73 ILE A HD13 2  
ATOM 2226  N N    . ASP A 1 74 ? 9.157  -8.619  4.857  1.00 0.00 ? 74 ASP A N    2  
ATOM 2227  C CA   . ASP A 1 74 ? 9.029  -8.879  3.427  1.00 0.00 ? 74 ASP A CA   2  
ATOM 2228  C C    . ASP A 1 74 ? 10.184 -9.741  2.926  1.00 0.00 ? 74 ASP A C    2  
ATOM 2229  O O    . ASP A 1 74 ? 9.975  -10.840 2.414  1.00 0.00 ? 74 ASP A O    2  
ATOM 2230  C CB   . ASP A 1 74 ? 8.984  -7.562  2.650  1.00 0.00 ? 74 ASP A CB   2  
ATOM 2231  C CG   . ASP A 1 74 ? 8.623  -7.763  1.192  1.00 0.00 ? 74 ASP A CG   2  
ATOM 2232  O OD1  . ASP A 1 74 ? 8.531  -8.931  0.759  1.00 0.00 ? 74 ASP A OD1  2  
ATOM 2233  O OD2  . ASP A 1 74 ? 8.432  -6.752  0.483  1.00 0.00 ? 74 ASP A OD2  2  
ATOM 2234  H H    . ASP A 1 74 ? 9.473  -7.741  5.157  1.00 0.00 ? 74 ASP A H    2  
ATOM 2235  H HA   . ASP A 1 74 ? 8.104  -9.412  3.268  1.00 0.00 ? 74 ASP A HA   2  
ATOM 2236  H HB2  . ASP A 1 74 ? 8.246  -6.912  3.098  1.00 0.00 ? 74 ASP A HB2  2  
ATOM 2237  H HB3  . ASP A 1 74 ? 9.953  -7.089  2.701  1.00 0.00 ? 74 ASP A HB3  2  
ATOM 2238  N N    . LYS A 1 75 ? 11.402 -9.233  3.077  1.00 0.00 ? 75 LYS A N    2  
ATOM 2239  C CA   . LYS A 1 75 ? 12.592 -9.955  2.640  1.00 0.00 ? 75 LYS A CA   2  
ATOM 2240  C C    . LYS A 1 75 ? 12.676 -11.322 3.313  1.00 0.00 ? 75 LYS A C    2  
ATOM 2241  O O    . LYS A 1 75 ? 13.215 -12.271 2.745  1.00 0.00 ? 75 LYS A O    2  
ATOM 2242  C CB   . LYS A 1 75 ? 13.850 -9.143  2.953  1.00 0.00 ? 75 LYS A CB   2  
ATOM 2243  C CG   . LYS A 1 75 ? 15.142 -9.902  2.705  1.00 0.00 ? 75 LYS A CG   2  
ATOM 2244  C CD   . LYS A 1 75 ? 16.327 -8.960  2.577  1.00 0.00 ? 75 LYS A CD   2  
ATOM 2245  C CE   . LYS A 1 75 ? 17.638 -9.725  2.477  1.00 0.00 ? 75 LYS A CE   2  
ATOM 2246  N NZ   . LYS A 1 75 ? 17.888 -10.559 3.685  1.00 0.00 ? 75 LYS A NZ   2  
ATOM 2247  H H    . LYS A 1 75 ? 11.505 -8.351  3.493  1.00 0.00 ? 75 LYS A H    2  
ATOM 2248  H HA   . LYS A 1 75 ? 12.521 -10.096 1.573  1.00 0.00 ? 75 LYS A HA   2  
ATOM 2249  H HB2  . LYS A 1 75 ? 13.854 -8.256  2.337  1.00 0.00 ? 75 LYS A HB2  2  
ATOM 2250  H HB3  . LYS A 1 75 ? 13.825 -8.848  3.993  1.00 0.00 ? 75 LYS A HB3  2  
ATOM 2251  H HG2  . LYS A 1 75 ? 15.318 -10.575 3.532  1.00 0.00 ? 75 LYS A HG2  2  
ATOM 2252  H HG3  . LYS A 1 75 ? 15.045 -10.470 1.791  1.00 0.00 ? 75 LYS A HG3  2  
ATOM 2253  H HD2  . LYS A 1 75 ? 16.205 -8.360  1.688  1.00 0.00 ? 75 LYS A HD2  2  
ATOM 2254  H HD3  . LYS A 1 75 ? 16.361 -8.318  3.446  1.00 0.00 ? 75 LYS A HD3  2  
ATOM 2255  H HE2  . LYS A 1 75 ? 17.601 -10.365 1.609  1.00 0.00 ? 75 LYS A HE2  2  
ATOM 2256  H HE3  . LYS A 1 75 ? 18.445 -9.015  2.366  1.00 0.00 ? 75 LYS A HE3  2  
ATOM 2257  H HZ1  . LYS A 1 75 ? 18.821 -10.335 4.086  1.00 0.00 ? 75 LYS A HZ1  2  
ATOM 2258  H HZ2  . LYS A 1 75 ? 17.865 -11.567 3.434  1.00 0.00 ? 75 LYS A HZ2  2  
ATOM 2259  H HZ3  . LYS A 1 75 ? 17.160 -10.374 4.404  1.00 0.00 ? 75 LYS A HZ3  2  
ATOM 2260  N N    . ALA A 1 76 ? 12.138 -11.414 4.524  1.00 0.00 ? 76 ALA A N    2  
ATOM 2261  C CA   . ALA A 1 76 ? 12.150 -12.666 5.272  1.00 0.00 ? 76 ALA A CA   2  
ATOM 2262  C C    . ALA A 1 76 ? 11.049 -13.604 4.789  1.00 0.00 ? 76 ALA A C    2  
ATOM 2263  O O    . ALA A 1 76 ? 11.152 -14.822 4.929  1.00 0.00 ? 76 ALA A O    2  
ATOM 2264  C CB   . ALA A 1 76 ? 11.997 -12.393 6.761  1.00 0.00 ? 76 ALA A CB   2  
ATOM 2265  H H    . ALA A 1 76 ? 11.723 -10.622 4.925  1.00 0.00 ? 76 ALA A H    2  
ATOM 2266  H HA   . ALA A 1 76 ? 13.108 -13.140 5.114  1.00 0.00 ? 76 ALA A HA   2  
ATOM 2267  H HB1  . ALA A 1 76 ? 10.972 -12.126 6.974  1.00 0.00 ? 76 ALA A HB1  2  
ATOM 2268  H HB2  . ALA A 1 76 ? 12.263 -13.278 7.318  1.00 0.00 ? 76 ALA A HB2  2  
ATOM 2269  H HB3  . ALA A 1 76 ? 12.647 -11.579 7.046  1.00 0.00 ? 76 ALA A HB3  2  
ATOM 2270  N N    . SER A 1 77 ? 9.994  -13.028 4.220  1.00 0.00 ? 77 SER A N    2  
ATOM 2271  C CA   . SER A 1 77 ? 8.872  -13.813 3.720  1.00 0.00 ? 77 SER A CA   2  
ATOM 2272  C C    . SER A 1 77 ? 9.334  -14.811 2.663  1.00 0.00 ? 77 SER A C    2  
ATOM 2273  O O    . SER A 1 77 ? 8.781  -15.903 2.541  1.00 0.00 ? 77 SER A O    2  
ATOM 2274  C CB   . SER A 1 77 ? 7.799  -12.892 3.134  1.00 0.00 ? 77 SER A CB   2  
ATOM 2275  O OG   . SER A 1 77 ? 8.034  -12.648 1.758  1.00 0.00 ? 77 SER A OG   2  
ATOM 2276  H H    . SER A 1 77 ? 9.970  -12.051 4.137  1.00 0.00 ? 77 SER A H    2  
ATOM 2277  H HA   . SER A 1 77 ? 8.451  -14.357 4.553  1.00 0.00 ? 77 SER A HA   2  
ATOM 2278  H HB2  . SER A 1 77 ? 6.831  -13.356 3.245  1.00 0.00 ? 77 SER A HB2  2  
ATOM 2279  H HB3  . SER A 1 77 ? 7.810  -11.950 3.662  1.00 0.00 ? 77 SER A HB3  2  
ATOM 2280  H HG   . SER A 1 77 ? 7.247  -12.869 1.255  1.00 0.00 ? 77 SER A HG   2  
ATOM 2281  N N    . ALA A 1 78 ? 10.353 -14.427 1.902  1.00 0.00 ? 78 ALA A N    2  
ATOM 2282  C CA   . ALA A 1 78 ? 10.893 -15.288 0.856  1.00 0.00 ? 78 ALA A CA   2  
ATOM 2283  C C    . ALA A 1 78 ? 12.305 -15.750 1.200  1.00 0.00 ? 78 ALA A C    2  
ATOM 2284  O O    . ALA A 1 78 ? 13.272 -15.010 1.016  1.00 0.00 ? 78 ALA A O    2  
ATOM 2285  C CB   . ALA A 1 78 ? 10.883 -14.563 -0.481 1.00 0.00 ? 78 ALA A CB   2  
ATOM 2286  H H    . ALA A 1 78 ? 10.753 -13.544 2.047  1.00 0.00 ? 78 ALA A H    2  
ATOM 2287  H HA   . ALA A 1 78 ? 10.252 -16.154 0.773  1.00 0.00 ? 78 ALA A HA   2  
ATOM 2288  H HB1  . ALA A 1 78 ? 10.261 -13.683 -0.409 1.00 0.00 ? 78 ALA A HB1  2  
ATOM 2289  H HB2  . ALA A 1 78 ? 11.890 -14.271 -0.740 1.00 0.00 ? 78 ALA A HB2  2  
ATOM 2290  H HB3  . ALA A 1 78 ? 10.491 -15.219 -1.244 1.00 0.00 ? 78 ALA A HB3  2  
ATOM 2291  N N    . MET A 1 1  ? -0.255 -0.540  -3.901 1.00 0.00 ? 1  MET A N    3  
ATOM 2292  C CA   . MET A 1 1  ? 0.243  -1.781  -4.483 1.00 0.00 ? 1  MET A CA   3  
ATOM 2293  C C    . MET A 1 1  ? 1.316  -2.405  -3.596 1.00 0.00 ? 1  MET A C    3  
ATOM 2294  O O    . MET A 1 1  ? 2.508  -2.314  -3.890 1.00 0.00 ? 1  MET A O    3  
ATOM 2295  C CB   . MET A 1 1  ? 0.808  -1.524  -5.881 1.00 0.00 ? 1  MET A CB   3  
ATOM 2296  C CG   . MET A 1 1  ? -0.222 -0.990  -6.863 1.00 0.00 ? 1  MET A CG   3  
ATOM 2297  S SD   . MET A 1 1  ? -1.105 -2.305  -7.727 1.00 0.00 ? 1  MET A SD   3  
ATOM 2298  C CE   . MET A 1 1  ? -2.784 -1.685  -7.660 1.00 0.00 ? 1  MET A CE   3  
ATOM 2299  H H1   . MET A 1 1  ? 0.313  0.259   -3.923 1.00 0.00 ? 1  MET A H1   3  
ATOM 2300  H HA   . MET A 1 1  ? -0.587 -2.467  -4.560 1.00 0.00 ? 1  MET A HA   3  
ATOM 2301  H HB2  . MET A 1 1  ? 1.609  -0.804  -5.806 1.00 0.00 ? 1  MET A HB2  3  
ATOM 2302  H HB3  . MET A 1 1  ? 1.201  -2.450  -6.274 1.00 0.00 ? 1  MET A HB3  3  
ATOM 2303  H HG2  . MET A 1 1  ? -0.940 -0.391  -6.323 1.00 0.00 ? 1  MET A HG2  3  
ATOM 2304  H HG3  . MET A 1 1  ? 0.282  -0.374  -7.593 1.00 0.00 ? 1  MET A HG3  3  
ATOM 2305  H HE1  . MET A 1 1  ? -3.446 -2.475  -7.336 1.00 0.00 ? 1  MET A HE1  3  
ATOM 2306  H HE2  . MET A 1 1  ? -2.837 -0.862  -6.963 1.00 0.00 ? 1  MET A HE2  3  
ATOM 2307  H HE3  . MET A 1 1  ? -3.081 -1.346  -8.642 1.00 0.00 ? 1  MET A HE3  3  
ATOM 2308  N N    . SER A 1 2  ? 0.885  -3.037  -2.509 1.00 0.00 ? 2  SER A N    3  
ATOM 2309  C CA   . SER A 1 2  ? 1.810  -3.672  -1.577 1.00 0.00 ? 2  SER A CA   3  
ATOM 2310  C C    . SER A 1 2  ? 1.093  -4.718  -0.728 1.00 0.00 ? 2  SER A C    3  
ATOM 2311  O O    . SER A 1 2  ? 0.017  -4.462  -0.186 1.00 0.00 ? 2  SER A O    3  
ATOM 2312  C CB   . SER A 1 2  ? 2.457  -2.622  -0.673 1.00 0.00 ? 2  SER A CB   3  
ATOM 2313  O OG   . SER A 1 2  ? 3.189  -1.676  -1.433 1.00 0.00 ? 2  SER A OG   3  
ATOM 2314  H H    . SER A 1 2  ? -0.077 -3.075  -2.329 1.00 0.00 ? 2  SER A H    3  
ATOM 2315  H HA   . SER A 1 2  ? 2.580  -4.161  -2.155 1.00 0.00 ? 2  SER A HA   3  
ATOM 2316  H HB2  . SER A 1 2  ? 1.689  -2.104  -0.119 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2317  H HB3  . SER A 1 2  ? 3.131  -3.110  0.017  1.00 0.00 ? 2  SER A HB3  3  
ATOM 2318  H HG   . SER A 1 2  ? 4.068  -2.018  -1.611 1.00 0.00 ? 2  SER A HG   3  
ATOM 2319  N N    . ASP A 1 3  ? 1.696  -5.896  -0.618 1.00 0.00 ? 3  ASP A N    3  
ATOM 2320  C CA   . ASP A 1 3  ? 1.117  -6.981  0.166  1.00 0.00 ? 3  ASP A CA   3  
ATOM 2321  C C    . ASP A 1 3  ? 1.747  -7.046  1.554  1.00 0.00 ? 3  ASP A C    3  
ATOM 2322  O O    . ASP A 1 3  ? 1.050  -7.195  2.558  1.00 0.00 ? 3  ASP A O    3  
ATOM 2323  C CB   . ASP A 1 3  ? 1.306  -8.317  -0.556 1.00 0.00 ? 3  ASP A CB   3  
ATOM 2324  C CG   . ASP A 1 3  ? 0.464  -8.420  -1.812 1.00 0.00 ? 3  ASP A CG   3  
ATOM 2325  O OD1  . ASP A 1 3  ? -0.048 -7.377  -2.271 1.00 0.00 ? 3  ASP A OD1  3  
ATOM 2326  O OD2  . ASP A 1 3  ? 0.316  -9.544  -2.337 1.00 0.00 ? 3  ASP A OD2  3  
ATOM 2327  H H    . ASP A 1 3  ? 2.552  -6.039  -1.073 1.00 0.00 ? 3  ASP A H    3  
ATOM 2328  H HA   . ASP A 1 3  ? 0.061  -6.787  0.272  1.00 0.00 ? 3  ASP A HA   3  
ATOM 2329  H HB2  . ASP A 1 3  ? 2.345  -8.426  -0.832 1.00 0.00 ? 3  ASP A HB2  3  
ATOM 2330  H HB3  . ASP A 1 3  ? 1.028  -9.120  0.110  1.00 0.00 ? 3  ASP A HB3  3  
ATOM 2331  N N    . THR A 1 4  ? 3.071  -6.932  1.604  1.00 0.00 ? 4  THR A N    3  
ATOM 2332  C CA   . THR A 1 4  ? 3.795  -6.980  2.867  1.00 0.00 ? 4  THR A CA   3  
ATOM 2333  C C    . THR A 1 4  ? 3.486  -5.757  3.724  1.00 0.00 ? 4  THR A C    3  
ATOM 2334  O O    . THR A 1 4  ? 3.093  -5.883  4.883  1.00 0.00 ? 4  THR A O    3  
ATOM 2335  C CB   . THR A 1 4  ? 5.316  -7.063  2.641  1.00 0.00 ? 4  THR A CB   3  
ATOM 2336  O OG1  . THR A 1 4  ? 5.602  -7.957  1.559  1.00 0.00 ? 4  THR A OG1  3  
ATOM 2337  C CG2  . THR A 1 4  ? 6.026  -7.538  3.899  1.00 0.00 ? 4  THR A CG2  3  
ATOM 2338  H H    . THR A 1 4  ? 3.571  -6.815  0.769  1.00 0.00 ? 4  THR A H    3  
ATOM 2339  H HA   . THR A 1 4  ? 3.482  -7.867  3.398  1.00 0.00 ? 4  THR A HA   3  
ATOM 2340  H HB   . THR A 1 4  ? 5.682  -6.077  2.389  1.00 0.00 ? 4  THR A HB   3  
ATOM 2341  H HG1  . THR A 1 4  ? 5.525  -8.864  1.865  1.00 0.00 ? 4  THR A HG1  3  
ATOM 2342  H HG21 . THR A 1 4  ? 6.651  -6.745  4.282  1.00 0.00 ? 4  THR A HG21 3  
ATOM 2343  H HG22 . THR A 1 4  ? 6.636  -8.398  3.665  1.00 0.00 ? 4  THR A HG22 3  
ATOM 2344  H HG23 . THR A 1 4  ? 5.293  -7.809  4.644  1.00 0.00 ? 4  THR A HG23 3  
ATOM 2345  N N    . ALA A 1 5  ? 3.666  -4.574  3.145  1.00 0.00 ? 5  ALA A N    3  
ATOM 2346  C CA   . ALA A 1 5  ? 3.404  -3.329  3.855  1.00 0.00 ? 5  ALA A CA   3  
ATOM 2347  C C    . ALA A 1 5  ? 2.011  -3.333  4.476  1.00 0.00 ? 5  ALA A C    3  
ATOM 2348  O O    . ALA A 1 5  ? 1.854  -3.089  5.672  1.00 0.00 ? 5  ALA A O    3  
ATOM 2349  C CB   . ALA A 1 5  ? 3.562  -2.142  2.916  1.00 0.00 ? 5  ALA A CB   3  
ATOM 2350  H H    . ALA A 1 5  ? 3.981  -4.539  2.218  1.00 0.00 ? 5  ALA A H    3  
ATOM 2351  H HA   . ALA A 1 5  ? 4.138  -3.233  4.643  1.00 0.00 ? 5  ALA A HA   3  
ATOM 2352  H HB1  . ALA A 1 5  ? 4.539  -1.702  3.054  1.00 0.00 ? 5  ALA A HB1  3  
ATOM 2353  H HB2  . ALA A 1 5  ? 3.458  -2.476  1.894  1.00 0.00 ? 5  ALA A HB2  3  
ATOM 2354  H HB3  . ALA A 1 5  ? 2.802  -1.407  3.134  1.00 0.00 ? 5  ALA A HB3  3  
ATOM 2355  N N    . GLU A 1 6  ? 1.003  -3.611  3.655  1.00 0.00 ? 6  GLU A N    3  
ATOM 2356  C CA   . GLU A 1 6  ? -0.377 -3.645  4.124  1.00 0.00 ? 6  GLU A CA   3  
ATOM 2357  C C    . GLU A 1 6  ? -0.513 -4.545  5.350  1.00 0.00 ? 6  GLU A C    3  
ATOM 2358  O O    . GLU A 1 6  ? -1.090 -4.149  6.362  1.00 0.00 ? 6  GLU A O    3  
ATOM 2359  C CB   . GLU A 1 6  ? -1.305 -4.137  3.012  1.00 0.00 ? 6  GLU A CB   3  
ATOM 2360  C CG   . GLU A 1 6  ? -1.568 -3.097  1.935  1.00 0.00 ? 6  GLU A CG   3  
ATOM 2361  C CD   . GLU A 1 6  ? -2.705 -2.160  2.294  1.00 0.00 ? 6  GLU A CD   3  
ATOM 2362  O OE1  . GLU A 1 6  ? -3.780 -2.655  2.690  1.00 0.00 ? 6  GLU A OE1  3  
ATOM 2363  O OE2  . GLU A 1 6  ? -2.518 -0.931  2.179  1.00 0.00 ? 6  GLU A OE2  3  
ATOM 2364  H H    . GLU A 1 6  ? 1.192  -3.797  2.711  1.00 0.00 ? 6  GLU A H    3  
ATOM 2365  H HA   . GLU A 1 6  ? -0.659 -2.640  4.398  1.00 0.00 ? 6  GLU A HA   3  
ATOM 2366  H HB2  . GLU A 1 6  ? -0.862 -5.004  2.546  1.00 0.00 ? 6  GLU A HB2  3  
ATOM 2367  H HB3  . GLU A 1 6  ? -2.252 -4.419  3.449  1.00 0.00 ? 6  GLU A HB3  3  
ATOM 2368  H HG2  . GLU A 1 6  ? -0.672 -2.513  1.791  1.00 0.00 ? 6  GLU A HG2  3  
ATOM 2369  H HG3  . GLU A 1 6  ? -1.817 -3.606  1.015  1.00 0.00 ? 6  GLU A HG3  3  
ATOM 2370  N N    . ARG A 1 7  ? 0.024  -5.757  5.249  1.00 0.00 ? 7  ARG A N    3  
ATOM 2371  C CA   . ARG A 1 7  ? -0.039 -6.713  6.347  1.00 0.00 ? 7  ARG A CA   3  
ATOM 2372  C C    . ARG A 1 7  ? 0.562  -6.121  7.619  1.00 0.00 ? 7  ARG A C    3  
ATOM 2373  O O    . ARG A 1 7  ? -0.024 -6.217  8.698  1.00 0.00 ? 7  ARG A O    3  
ATOM 2374  C CB   . ARG A 1 7  ? 0.699  -8.000  5.973  1.00 0.00 ? 7  ARG A CB   3  
ATOM 2375  C CG   . ARG A 1 7  ? -0.057 -8.870  4.983  1.00 0.00 ? 7  ARG A CG   3  
ATOM 2376  C CD   . ARG A 1 7  ? -1.066 -9.766  5.686  1.00 0.00 ? 7  ARG A CD   3  
ATOM 2377  N NE   . ARG A 1 7  ? -1.814 -10.592 4.743  1.00 0.00 ? 7  ARG A NE   3  
ATOM 2378  C CZ   . ARG A 1 7  ? -1.286 -11.618 4.084  1.00 0.00 ? 7  ARG A CZ   3  
ATOM 2379  N NH1  . ARG A 1 7  ? -0.013 -11.941 4.265  1.00 0.00 ? 7  ARG A NH1  3  
ATOM 2380  N NH2  . ARG A 1 7  ? -2.032 -12.322 3.242  1.00 0.00 ? 7  ARG A NH2  3  
ATOM 2381  H H    . ARG A 1 7  ? 0.471  -6.014  4.416  1.00 0.00 ? 7  ARG A H    3  
ATOM 2382  H HA   . ARG A 1 7  ? -1.078 -6.944  6.528  1.00 0.00 ? 7  ARG A HA   3  
ATOM 2383  H HB2  . ARG A 1 7  ? 1.652  -7.741  5.536  1.00 0.00 ? 7  ARG A HB2  3  
ATOM 2384  H HB3  . ARG A 1 7  ? 0.869  -8.577  6.870  1.00 0.00 ? 7  ARG A HB3  3  
ATOM 2385  H HG2  . ARG A 1 7  ? -0.582 -8.234  4.286  1.00 0.00 ? 7  ARG A HG2  3  
ATOM 2386  H HG3  . ARG A 1 7  ? 0.649  -9.488  4.449  1.00 0.00 ? 7  ARG A HG3  3  
ATOM 2387  H HD2  . ARG A 1 7  ? -0.538 -10.410 6.374  1.00 0.00 ? 7  ARG A HD2  3  
ATOM 2388  H HD3  . ARG A 1 7  ? -1.758 -9.145  6.234  1.00 0.00 ? 7  ARG A HD3  3  
ATOM 2389  H HE   . ARG A 1 7  ? -2.757 -10.371 4.594  1.00 0.00 ? 7  ARG A HE   3  
ATOM 2390  H HH11 . ARG A 1 7  ? 0.551  -11.413 4.899  1.00 0.00 ? 7  ARG A HH11 3  
ATOM 2391  H HH12 . ARG A 1 7  ? 0.382  -12.714 3.768  1.00 0.00 ? 7  ARG A HH12 3  
ATOM 2392  H HH21 . ARG A 1 7  ? -2.992 -12.081 3.104  1.00 0.00 ? 7  ARG A HH21 3  
ATOM 2393  H HH22 . ARG A 1 7  ? -1.633 -13.093 2.747  1.00 0.00 ? 7  ARG A HH22 3  
ATOM 2394  N N    . VAL A 1 8  ? 1.734  -5.508  7.484  1.00 0.00 ? 8  VAL A N    3  
ATOM 2395  C CA   . VAL A 1 8  ? 2.413  -4.900  8.622  1.00 0.00 ? 8  VAL A CA   3  
ATOM 2396  C C    . VAL A 1 8  ? 1.566  -3.794  9.240  1.00 0.00 ? 8  VAL A C    3  
ATOM 2397  O O    . VAL A 1 8  ? 1.134  -3.896  10.389 1.00 0.00 ? 8  VAL A O    3  
ATOM 2398  C CB   . VAL A 1 8  ? 3.780  -4.318  8.213  1.00 0.00 ? 8  VAL A CB   3  
ATOM 2399  C CG1  . VAL A 1 8  ? 4.457  -3.658  9.405  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2400  C CG2  . VAL A 1 8  ? 4.665  -5.403  7.620  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2401  H H    . VAL A 1 8  ? 2.151  -5.464  6.599  1.00 0.00 ? 8  VAL A H    3  
ATOM 2402  H HA   . VAL A 1 8  ? 2.580  -5.669  9.362  1.00 0.00 ? 8  VAL A HA   3  
ATOM 2403  H HB   . VAL A 1 8  ? 3.615  -3.563  7.458  1.00 0.00 ? 8  VAL A HB   3  
ATOM 2404  H HG11 . VAL A 1 8  ? 4.196  -2.611  9.433  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2405  H HG12 . VAL A 1 8  ? 4.129  -4.137  10.316 1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2406  H HG13 . VAL A 1 8  ? 5.528  -3.759  9.311  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2407  H HG21 . VAL A 1 8  ? 4.606  -5.365  6.542  1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2408  H HG22 . VAL A 1 8  ? 5.687  -5.244  7.930  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2409  H HG23 . VAL A 1 8  ? 4.330  -6.370  7.965  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2410  N N    . LYS A 1 9  ? 1.332  -2.735  8.472  1.00 0.00 ? 9  LYS A N    3  
ATOM 2411  C CA   . LYS A 1 9  ? 0.535  -1.609  8.942  1.00 0.00 ? 9  LYS A CA   3  
ATOM 2412  C C    . LYS A 1 9  ? -0.813 -2.082  9.478  1.00 0.00 ? 9  LYS A C    3  
ATOM 2413  O O    . LYS A 1 9  ? -1.391 -1.461  10.370 1.00 0.00 ? 9  LYS A O    3  
ATOM 2414  C CB   . LYS A 1 9  ? 0.321  -0.601  7.811  1.00 0.00 ? 9  LYS A CB   3  
ATOM 2415  C CG   . LYS A 1 9  ? -0.572 -1.118  6.697  1.00 0.00 ? 9  LYS A CG   3  
ATOM 2416  C CD   . LYS A 1 9  ? -0.954 -0.011  5.729  1.00 0.00 ? 9  LYS A CD   3  
ATOM 2417  C CE   . LYS A 1 9  ? -2.304 -0.279  5.080  1.00 0.00 ? 9  LYS A CE   3  
ATOM 2418  N NZ   . LYS A 1 9  ? -3.429 -0.070  6.034  1.00 0.00 ? 9  LYS A NZ   3  
ATOM 2419  H H    . LYS A 1 9  ? 1.704  -2.712  7.565  1.00 0.00 ? 9  LYS A H    3  
ATOM 2420  H HA   . LYS A 1 9  ? 1.078  -1.129  9.742  1.00 0.00 ? 9  LYS A HA   3  
ATOM 2421  H HB2  . LYS A 1 9  ? -0.130 0.291   8.220  1.00 0.00 ? 9  LYS A HB2  3  
ATOM 2422  H HB3  . LYS A 1 9  ? 1.281  -0.347  7.385  1.00 0.00 ? 9  LYS A HB3  3  
ATOM 2423  H HG2  . LYS A 1 9  ? -0.046 -1.890  6.154  1.00 0.00 ? 9  LYS A HG2  3  
ATOM 2424  H HG3  . LYS A 1 9  ? -1.472 -1.531  7.131  1.00 0.00 ? 9  LYS A HG3  3  
ATOM 2425  H HD2  . LYS A 1 9  ? -1.005 0.924   6.266  1.00 0.00 ? 9  LYS A HD2  3  
ATOM 2426  H HD3  . LYS A 1 9  ? -0.201 0.056   4.957  1.00 0.00 ? 9  LYS A HD3  3  
ATOM 2427  H HE2  . LYS A 1 9  ? -2.425 0.390   4.242  1.00 0.00 ? 9  LYS A HE2  3  
ATOM 2428  H HE3  . LYS A 1 9  ? -2.324 -1.301  4.731  1.00 0.00 ? 9  LYS A HE3  3  
ATOM 2429  H HZ1  . LYS A 1 9  ? -3.098 -0.205  7.011  1.00 0.00 ? 9  LYS A HZ1  3  
ATOM 2430  H HZ2  . LYS A 1 9  ? -4.191 -0.750  5.841  1.00 0.00 ? 9  LYS A HZ2  3  
ATOM 2431  H HZ3  . LYS A 1 9  ? -3.805 0.894   5.937  1.00 0.00 ? 9  LYS A HZ3  3  
ATOM 2432  N N    . LYS A 1 10 ? -1.308 -3.186  8.928  1.00 0.00 ? 10 LYS A N    3  
ATOM 2433  C CA   . LYS A 1 10 ? -2.586 -3.744  9.352  1.00 0.00 ? 10 LYS A CA   3  
ATOM 2434  C C    . LYS A 1 10 ? -2.505 -4.266  10.783 1.00 0.00 ? 10 LYS A C    3  
ATOM 2435  O O    . LYS A 1 10 ? -3.260 -3.834  11.655 1.00 0.00 ? 10 LYS A O    3  
ATOM 2436  C CB   . LYS A 1 10 ? -3.010 -4.874  8.410  1.00 0.00 ? 10 LYS A CB   3  
ATOM 2437  C CG   . LYS A 1 10 ? -4.307 -5.551  8.817  1.00 0.00 ? 10 LYS A CG   3  
ATOM 2438  C CD   . LYS A 1 10 ? -4.806 -6.495  7.736  1.00 0.00 ? 10 LYS A CD   3  
ATOM 2439  C CE   . LYS A 1 10 ? -5.596 -5.753  6.669  1.00 0.00 ? 10 LYS A CE   3  
ATOM 2440  N NZ   . LYS A 1 10 ? -5.894 -6.621  5.496  1.00 0.00 ? 10 LYS A NZ   3  
ATOM 2441  H H    . LYS A 1 10 ? -0.800 -3.636  8.221  1.00 0.00 ? 10 LYS A H    3  
ATOM 2442  H HA   . LYS A 1 10 ? -3.323 -2.957  9.310  1.00 0.00 ? 10 LYS A HA   3  
ATOM 2443  H HB2  . LYS A 1 10 ? -3.135 -4.470  7.416  1.00 0.00 ? 10 LYS A HB2  3  
ATOM 2444  H HB3  . LYS A 1 10 ? -2.230 -5.621  8.390  1.00 0.00 ? 10 LYS A HB3  3  
ATOM 2445  H HG2  . LYS A 1 10 ? -4.140 -6.114  9.723  1.00 0.00 ? 10 LYS A HG2  3  
ATOM 2446  H HG3  . LYS A 1 10 ? -5.057 -4.793  8.995  1.00 0.00 ? 10 LYS A HG3  3  
ATOM 2447  H HD2  . LYS A 1 10 ? -3.959 -6.977  7.271  1.00 0.00 ? 10 LYS A HD2  3  
ATOM 2448  H HD3  . LYS A 1 10 ? -5.444 -7.242  8.189  1.00 0.00 ? 10 LYS A HD3  3  
ATOM 2449  H HE2  . LYS A 1 10 ? -6.525 -5.411  7.099  1.00 0.00 ? 10 LYS A HE2  3  
ATOM 2450  H HE3  . LYS A 1 10 ? -5.017 -4.902  6.339  1.00 0.00 ? 10 LYS A HE3  3  
ATOM 2451  H HZ1  . LYS A 1 10 ? -5.377 -7.520  5.576  1.00 0.00 ? 10 LYS A HZ1  3  
ATOM 2452  H HZ2  . LYS A 1 10 ? -5.605 -6.146  4.617  1.00 0.00 ? 10 LYS A HZ2  3  
ATOM 2453  H HZ3  . LYS A 1 10 ? -6.913 -6.822  5.450  1.00 0.00 ? 10 LYS A HZ3  3  
ATOM 2454  N N    . ILE A 1 11 ? -1.584 -5.194  11.019 1.00 0.00 ? 11 ILE A N    3  
ATOM 2455  C CA   . ILE A 1 11 ? -1.403 -5.771  12.345 1.00 0.00 ? 11 ILE A CA   3  
ATOM 2456  C C    . ILE A 1 11 ? -1.010 -4.703  13.360 1.00 0.00 ? 11 ILE A C    3  
ATOM 2457  O O    . ILE A 1 11 ? -1.316 -4.817  14.547 1.00 0.00 ? 11 ILE A O    3  
ATOM 2458  C CB   . ILE A 1 11 ? -0.329 -6.875  12.336 1.00 0.00 ? 11 ILE A CB   3  
ATOM 2459  C CG1  . ILE A 1 11 ? -0.682 -7.952  11.309 1.00 0.00 ? 11 ILE A CG1  3  
ATOM 2460  C CG2  . ILE A 1 11 ? -0.186 -7.485  13.723 1.00 0.00 ? 11 ILE A CG2  3  
ATOM 2461  C CD1  . ILE A 1 11 ? 0.455  -8.907  11.019 1.00 0.00 ? 11 ILE A CD1  3  
ATOM 2462  H H    . ILE A 1 11 ? -1.012 -5.497  10.283 1.00 0.00 ? 11 ILE A H    3  
ATOM 2463  H HA   . ILE A 1 11 ? -2.342 -6.212  12.647 1.00 0.00 ? 11 ILE A HA   3  
ATOM 2464  H HB   . ILE A 1 11 ? 0.615  -6.426  12.068 1.00 0.00 ? 11 ILE A HB   3  
ATOM 2465  H HG12 . ILE A 1 11 ? -1.515 -8.531  11.675 1.00 0.00 ? 11 ILE A HG12 3  
ATOM 2466  H HG13 . ILE A 1 11 ? -0.961 -7.475  10.380 1.00 0.00 ? 11 ILE A HG13 3  
ATOM 2467  H HG21 . ILE A 1 11 ? 0.032  -6.705  14.438 1.00 0.00 ? 11 ILE A HG21 3  
ATOM 2468  H HG22 . ILE A 1 11 ? -1.108 -7.976  13.997 1.00 0.00 ? 11 ILE A HG22 3  
ATOM 2469  H HG23 . ILE A 1 11 ? 0.619  -8.205  13.719 1.00 0.00 ? 11 ILE A HG23 3  
ATOM 2470  H HD11 . ILE A 1 11 ? 0.056  -9.847  10.667 1.00 0.00 ? 11 ILE A HD11 3  
ATOM 2471  H HD12 . ILE A 1 11 ? 1.099  -8.482  10.263 1.00 0.00 ? 11 ILE A HD12 3  
ATOM 2472  H HD13 . ILE A 1 11 ? 1.024  -9.074  11.923 1.00 0.00 ? 11 ILE A HD13 3  
ATOM 2473  N N    . VAL A 1 12 ? -0.331 -3.664  12.885 1.00 0.00 ? 12 VAL A N    3  
ATOM 2474  C CA   . VAL A 1 12 ? 0.102  -2.573  13.750 1.00 0.00 ? 12 VAL A CA   3  
ATOM 2475  C C    . VAL A 1 12 ? -1.083 -1.727  14.202 1.00 0.00 ? 12 VAL A C    3  
ATOM 2476  O O    . VAL A 1 12 ? -1.222 -1.416  15.385 1.00 0.00 ? 12 VAL A O    3  
ATOM 2477  C CB   . VAL A 1 12 ? 1.125  -1.666  13.041 1.00 0.00 ? 12 VAL A CB   3  
ATOM 2478  C CG1  . VAL A 1 12 ? 1.534  -0.513  13.945 1.00 0.00 ? 12 VAL A CG1  3  
ATOM 2479  C CG2  . VAL A 1 12 ? 2.340  -2.471  12.607 1.00 0.00 ? 12 VAL A CG2  3  
ATOM 2480  H H    . VAL A 1 12 ? -0.117 -3.629  11.929 1.00 0.00 ? 12 VAL A H    3  
ATOM 2481  H HA   . VAL A 1 12 ? 0.576  -3.004  14.619 1.00 0.00 ? 12 VAL A HA   3  
ATOM 2482  H HB   . VAL A 1 12 ? 0.659  -1.253  12.158 1.00 0.00 ? 12 VAL A HB   3  
ATOM 2483  H HG11 . VAL A 1 12 ? 1.910  -0.905  14.879 1.00 0.00 ? 12 VAL A HG11 3  
ATOM 2484  H HG12 . VAL A 1 12 ? 2.305  0.069   13.461 1.00 0.00 ? 12 VAL A HG12 3  
ATOM 2485  H HG13 . VAL A 1 12 ? 0.676  0.115   14.138 1.00 0.00 ? 12 VAL A HG13 3  
ATOM 2486  H HG21 . VAL A 1 12 ? 2.504  -2.333  11.549 1.00 0.00 ? 12 VAL A HG21 3  
ATOM 2487  H HG22 . VAL A 1 12 ? 3.210  -2.134  13.153 1.00 0.00 ? 12 VAL A HG22 3  
ATOM 2488  H HG23 . VAL A 1 12 ? 2.171  -3.518  12.812 1.00 0.00 ? 12 VAL A HG23 3  
ATOM 2489  N N    . VAL A 1 13 ? -1.937 -1.358  13.252 1.00 0.00 ? 13 VAL A N    3  
ATOM 2490  C CA   . VAL A 1 13 ? -3.112 -0.549  13.553 1.00 0.00 ? 13 VAL A CA   3  
ATOM 2491  C C    . VAL A 1 13 ? -4.145 -1.351  14.336 1.00 0.00 ? 13 VAL A C    3  
ATOM 2492  O O    . VAL A 1 13 ? -4.909 -0.794  15.124 1.00 0.00 ? 13 VAL A O    3  
ATOM 2493  C CB   . VAL A 1 13 ? -3.765 -0.009  12.267 1.00 0.00 ? 13 VAL A CB   3  
ATOM 2494  C CG1  . VAL A 1 13 ? -5.013 0.795   12.598 1.00 0.00 ? 13 VAL A CG1  3  
ATOM 2495  C CG2  . VAL A 1 13 ? -2.773 0.833   11.479 1.00 0.00 ? 13 VAL A CG2  3  
ATOM 2496  H H    . VAL A 1 13 ? -1.772 -1.637  12.327 1.00 0.00 ? 13 VAL A H    3  
ATOM 2497  H HA   . VAL A 1 13 ? -2.794 0.293   14.151 1.00 0.00 ? 13 VAL A HA   3  
ATOM 2498  H HB   . VAL A 1 13 ? -4.057 -0.849  11.655 1.00 0.00 ? 13 VAL A HB   3  
ATOM 2499  H HG11 . VAL A 1 13 ? -5.043 0.991   13.660 1.00 0.00 ? 13 VAL A HG11 3  
ATOM 2500  H HG12 . VAL A 1 13 ? -4.994 1.730   12.058 1.00 0.00 ? 13 VAL A HG12 3  
ATOM 2501  H HG13 . VAL A 1 13 ? -5.890 0.231   12.313 1.00 0.00 ? 13 VAL A HG13 3  
ATOM 2502  H HG21 . VAL A 1 13 ? -1.783 0.702   11.891 1.00 0.00 ? 13 VAL A HG21 3  
ATOM 2503  H HG22 . VAL A 1 13 ? -2.777 0.521   10.444 1.00 0.00 ? 13 VAL A HG22 3  
ATOM 2504  H HG23 . VAL A 1 13 ? -3.054 1.874   11.541 1.00 0.00 ? 13 VAL A HG23 3  
ATOM 2505  N N    . GLU A 1 14 ? -4.162 -2.661  14.114 1.00 0.00 ? 14 GLU A N    3  
ATOM 2506  C CA   . GLU A 1 14 ? -5.102 -3.540  14.800 1.00 0.00 ? 14 GLU A CA   3  
ATOM 2507  C C    . GLU A 1 14 ? -4.603 -3.884  16.201 1.00 0.00 ? 14 GLU A C    3  
ATOM 2508  O O    . GLU A 1 14 ? -5.391 -4.200  17.093 1.00 0.00 ? 14 GLU A O    3  
ATOM 2509  C CB   . GLU A 1 14 ? -5.317 -4.822  13.994 1.00 0.00 ? 14 GLU A CB   3  
ATOM 2510  C CG   . GLU A 1 14 ? -6.657 -5.490  14.258 1.00 0.00 ? 14 GLU A CG   3  
ATOM 2511  C CD   . GLU A 1 14 ? -6.826 -6.783  13.485 1.00 0.00 ? 14 GLU A CD   3  
ATOM 2512  O OE1  . GLU A 1 14 ? -6.309 -6.868  12.352 1.00 0.00 ? 14 GLU A OE1  3  
ATOM 2513  O OE2  . GLU A 1 14 ? -7.476 -7.710  14.014 1.00 0.00 ? 14 GLU A OE2  3  
ATOM 2514  H H    . GLU A 1 14 ? -3.527 -3.046  13.475 1.00 0.00 ? 14 GLU A H    3  
ATOM 2515  H HA   . GLU A 1 14 ? -6.043 -3.017  14.885 1.00 0.00 ? 14 GLU A HA   3  
ATOM 2516  H HB2  . GLU A 1 14 ? -5.257 -4.586  12.942 1.00 0.00 ? 14 GLU A HB2  3  
ATOM 2517  H HB3  . GLU A 1 14 ? -4.535 -5.524  14.242 1.00 0.00 ? 14 GLU A HB3  3  
ATOM 2518  H HG2  . GLU A 1 14 ? -6.735 -5.706  15.313 1.00 0.00 ? 14 GLU A HG2  3  
ATOM 2519  H HG3  . GLU A 1 14 ? -7.446 -4.810  13.972 1.00 0.00 ? 14 GLU A HG3  3  
ATOM 2520  N N    . HIS A 1 15 ? -3.288 -3.821  16.386 1.00 0.00 ? 15 HIS A N    3  
ATOM 2521  C CA   . HIS A 1 15 ? -2.682 -4.126  17.677 1.00 0.00 ? 15 HIS A CA   3  
ATOM 2522  C C    . HIS A 1 15 ? -2.585 -2.873  18.541 1.00 0.00 ? 15 HIS A C    3  
ATOM 2523  O O    . HIS A 1 15 ? -3.070 -2.848  19.674 1.00 0.00 ? 15 HIS A O    3  
ATOM 2524  C CB   . HIS A 1 15 ? -1.293 -4.734  17.482 1.00 0.00 ? 15 HIS A CB   3  
ATOM 2525  C CG   . HIS A 1 15 ? -1.321 -6.184  17.107 1.00 0.00 ? 15 HIS A CG   3  
ATOM 2526  N ND1  . HIS A 1 15 ? -2.442 -6.810  16.606 1.00 0.00 ? 15 HIS A ND1  3  
ATOM 2527  C CD2  . HIS A 1 15 ? -0.355 -7.130  17.160 1.00 0.00 ? 15 HIS A CD2  3  
ATOM 2528  C CE1  . HIS A 1 15 ? -2.166 -8.080  16.369 1.00 0.00 ? 15 HIS A CE1  3  
ATOM 2529  N NE2  . HIS A 1 15 ? -0.905 -8.300  16.696 1.00 0.00 ? 15 HIS A NE2  3  
ATOM 2530  H H    . HIS A 1 15 ? -2.712 -3.564  15.636 1.00 0.00 ? 15 HIS A H    3  
ATOM 2531  H HA   . HIS A 1 15 ? -3.313 -4.845  18.178 1.00 0.00 ? 15 HIS A HA   3  
ATOM 2532  H HB2  . HIS A 1 15 ? -0.780 -4.198  16.696 1.00 0.00 ? 15 HIS A HB2  3  
ATOM 2533  H HB3  . HIS A 1 15 ? -0.733 -4.639  18.401 1.00 0.00 ? 15 HIS A HB3  3  
ATOM 2534  H HD1  . HIS A 1 15 ? -3.312 -6.388  16.450 1.00 0.00 ? 15 HIS A HD1  3  
ATOM 2535  H HD2  . HIS A 1 15 ? 0.661  -6.992  17.503 1.00 0.00 ? 15 HIS A HD2  3  
ATOM 2536  H HE1  . HIS A 1 15 ? -2.853 -8.814  15.975 1.00 0.00 ? 15 HIS A HE1  3  
ATOM 2537  N N    . LEU A 1 16 ? -1.956 -1.835  18.001 1.00 0.00 ? 16 LEU A N    3  
ATOM 2538  C CA   . LEU A 1 16 ? -1.795 -0.578  18.723 1.00 0.00 ? 16 LEU A CA   3  
ATOM 2539  C C    . LEU A 1 16 ? -3.110 0.194   18.773 1.00 0.00 ? 16 LEU A C    3  
ATOM 2540  O O    . LEU A 1 16 ? -3.336 0.998   19.676 1.00 0.00 ? 16 LEU A O    3  
ATOM 2541  C CB   . LEU A 1 16 ? -0.713 0.278   18.062 1.00 0.00 ? 16 LEU A CB   3  
ATOM 2542  C CG   . LEU A 1 16 ? 0.732  -0.073  18.420 1.00 0.00 ? 16 LEU A CG   3  
ATOM 2543  C CD1  . LEU A 1 16 ? 0.957  0.059   19.918 1.00 0.00 ? 16 LEU A CD1  3  
ATOM 2544  C CD2  . LEU A 1 16 ? 1.072  -1.479  17.949 1.00 0.00 ? 16 LEU A CD2  3  
ATOM 2545  H H    . LEU A 1 16 ? -1.591 -1.915  17.095 1.00 0.00 ? 16 LEU A H    3  
ATOM 2546  H HA   . LEU A 1 16 ? -1.491 -0.812  19.732 1.00 0.00 ? 16 LEU A HA   3  
ATOM 2547  H HB2  . LEU A 1 16 ? -0.821 0.179   16.992 1.00 0.00 ? 16 LEU A HB2  3  
ATOM 2548  H HB3  . LEU A 1 16 ? -0.885 1.306   18.346 1.00 0.00 ? 16 LEU A HB3  3  
ATOM 2549  H HG   . LEU A 1 16 ? 1.398  0.618   17.921 1.00 0.00 ? 16 LEU A HG   3  
ATOM 2550  H HD11 . LEU A 1 16 ? 0.887  -0.915  20.379 1.00 0.00 ? 16 LEU A HD11 3  
ATOM 2551  H HD12 . LEU A 1 16 ? 0.207  0.711   20.339 1.00 0.00 ? 16 LEU A HD12 3  
ATOM 2552  H HD13 . LEU A 1 16 ? 1.937  0.474   20.100 1.00 0.00 ? 16 LEU A HD13 3  
ATOM 2553  H HD21 . LEU A 1 16 ? 2.123  -1.531  17.703 1.00 0.00 ? 16 LEU A HD21 3  
ATOM 2554  H HD22 . LEU A 1 16 ? 0.485  -1.717  17.073 1.00 0.00 ? 16 LEU A HD22 3  
ATOM 2555  H HD23 . LEU A 1 16 ? 0.851  -2.185  18.735 1.00 0.00 ? 16 LEU A HD23 3  
ATOM 2556  N N    . GLY A 1 17 ? -3.975 -0.057  17.795 1.00 0.00 ? 17 GLY A N    3  
ATOM 2557  C CA   . GLY A 1 17 ? -5.257 0.620   17.747 1.00 0.00 ? 17 GLY A CA   3  
ATOM 2558  C C    . GLY A 1 17 ? -5.121 2.099   17.443 1.00 0.00 ? 17 GLY A C    3  
ATOM 2559  O O    . GLY A 1 17 ? -5.887 2.918   17.950 1.00 0.00 ? 17 GLY A O    3  
ATOM 2560  H H    . GLY A 1 17 ? -3.741 -0.708  17.101 1.00 0.00 ? 17 GLY A H    3  
ATOM 2561  H HA2  . GLY A 1 17 ? -5.867 0.161   16.983 1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2562  H HA3  . GLY A 1 17 ? -5.748 0.506   18.703 1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2563  N N    . VAL A 1 18 ? -4.141 2.443   16.612 1.00 0.00 ? 18 VAL A N    3  
ATOM 2564  C CA   . VAL A 1 18 ? -3.906 3.833   16.241 1.00 0.00 ? 18 VAL A CA   3  
ATOM 2565  C C    . VAL A 1 18 ? -4.348 4.101   14.807 1.00 0.00 ? 18 VAL A C    3  
ATOM 2566  O O    . VAL A 1 18 ? -4.937 3.238   14.156 1.00 0.00 ? 18 VAL A O    3  
ATOM 2567  C CB   . VAL A 1 18 ? -2.420 4.209   16.388 1.00 0.00 ? 18 VAL A CB   3  
ATOM 2568  C CG1  . VAL A 1 18 ? -1.935 3.930   17.802 1.00 0.00 ? 18 VAL A CG1  3  
ATOM 2569  C CG2  . VAL A 1 18 ? -1.577 3.457   15.368 1.00 0.00 ? 18 VAL A CG2  3  
ATOM 2570  H H    . VAL A 1 18 ? -3.564 1.745   16.240 1.00 0.00 ? 18 VAL A H    3  
ATOM 2571  H HA   . VAL A 1 18 ? -4.481 4.459   16.908 1.00 0.00 ? 18 VAL A HA   3  
ATOM 2572  H HB   . VAL A 1 18 ? -2.317 5.267   16.198 1.00 0.00 ? 18 VAL A HB   3  
ATOM 2573  H HG11 . VAL A 1 18 ? -2.406 4.620   18.487 1.00 0.00 ? 18 VAL A HG11 3  
ATOM 2574  H HG12 . VAL A 1 18 ? -2.190 2.917   18.077 1.00 0.00 ? 18 VAL A HG12 3  
ATOM 2575  H HG13 . VAL A 1 18 ? -0.863 4.057   17.846 1.00 0.00 ? 18 VAL A HG13 3  
ATOM 2576  H HG21 . VAL A 1 18 ? -2.068 2.530   15.111 1.00 0.00 ? 18 VAL A HG21 3  
ATOM 2577  H HG22 . VAL A 1 18 ? -1.461 4.061   14.480 1.00 0.00 ? 18 VAL A HG22 3  
ATOM 2578  H HG23 . VAL A 1 18 ? -0.606 3.246   15.789 1.00 0.00 ? 18 VAL A HG23 3  
ATOM 2579  N N    . ASP A 1 19 ? -4.061 5.304   14.321 1.00 0.00 ? 19 ASP A N    3  
ATOM 2580  C CA   . ASP A 1 19 ? -4.427 5.686   12.962 1.00 0.00 ? 19 ASP A CA   3  
ATOM 2581  C C    . ASP A 1 19 ? -3.422 5.138   11.953 1.00 0.00 ? 19 ASP A C    3  
ATOM 2582  O O    . ASP A 1 19 ? -2.220 5.104   12.216 1.00 0.00 ? 19 ASP A O    3  
ATOM 2583  C CB   . ASP A 1 19 ? -4.509 7.209   12.843 1.00 0.00 ? 19 ASP A CB   3  
ATOM 2584  C CG   . ASP A 1 19 ? -5.538 7.655   11.823 1.00 0.00 ? 19 ASP A CG   3  
ATOM 2585  O OD1  . ASP A 1 19 ? -6.694 7.189   11.903 1.00 0.00 ? 19 ASP A OD1  3  
ATOM 2586  O OD2  . ASP A 1 19 ? -5.188 8.471   10.945 1.00 0.00 ? 19 ASP A OD2  3  
ATOM 2587  H H    . ASP A 1 19 ? -3.590 5.949   14.889 1.00 0.00 ? 19 ASP A H    3  
ATOM 2588  H HA   . ASP A 1 19 ? -5.398 5.265   12.749 1.00 0.00 ? 19 ASP A HA   3  
ATOM 2589  H HB2  . ASP A 1 19 ? -4.777 7.625   13.803 1.00 0.00 ? 19 ASP A HB2  3  
ATOM 2590  H HB3  . ASP A 1 19 ? -3.544 7.592   12.546 1.00 0.00 ? 19 ASP A HB3  3  
ATOM 2591  N N    . ALA A 1 20 ? -3.924 4.709   10.800 1.00 0.00 ? 20 ALA A N    3  
ATOM 2592  C CA   . ALA A 1 20 ? -3.071 4.163   9.752  1.00 0.00 ? 20 ALA A CA   3  
ATOM 2593  C C    . ALA A 1 20 ? -2.325 5.272   9.017  1.00 0.00 ? 20 ALA A C    3  
ATOM 2594  O O    . ALA A 1 20 ? -1.204 5.075   8.549  1.00 0.00 ? 20 ALA A O    3  
ATOM 2595  C CB   . ALA A 1 20 ? -3.897 3.341   8.773  1.00 0.00 ? 20 ALA A CB   3  
ATOM 2596  H H    . ALA A 1 20 ? -4.891 4.762   10.650 1.00 0.00 ? 20 ALA A H    3  
ATOM 2597  H HA   . ALA A 1 20 ? -2.350 3.506   10.217 1.00 0.00 ? 20 ALA A HA   3  
ATOM 2598  H HB1  . ALA A 1 20 ? -4.863 3.807   8.640  1.00 0.00 ? 20 ALA A HB1  3  
ATOM 2599  H HB2  . ALA A 1 20 ? -3.386 3.293   7.823  1.00 0.00 ? 20 ALA A HB2  3  
ATOM 2600  H HB3  . ALA A 1 20 ? -4.028 2.343   9.163  1.00 0.00 ? 20 ALA A HB3  3  
ATOM 2601  N N    . ASP A 1 21 ? -2.956 6.437   8.919  1.00 0.00 ? 21 ASP A N    3  
ATOM 2602  C CA   . ASP A 1 21 ? -2.352 7.579   8.242  1.00 0.00 ? 21 ASP A CA   3  
ATOM 2603  C C    . ASP A 1 21 ? -0.986 7.904   8.838  1.00 0.00 ? 21 ASP A C    3  
ATOM 2604  O O    . ASP A 1 21 ? -0.119 8.460   8.163  1.00 0.00 ? 21 ASP A O    3  
ATOM 2605  C CB   . ASP A 1 21 ? -3.268 8.799   8.338  1.00 0.00 ? 21 ASP A CB   3  
ATOM 2606  C CG   . ASP A 1 21 ? -4.561 8.615   7.568  1.00 0.00 ? 21 ASP A CG   3  
ATOM 2607  O OD1  . ASP A 1 21 ? -4.525 7.984   6.492  1.00 0.00 ? 21 ASP A OD1  3  
ATOM 2608  O OD2  . ASP A 1 21 ? -5.609 9.103   8.042  1.00 0.00 ? 21 ASP A OD2  3  
ATOM 2609  H H    . ASP A 1 21 ? -3.849 6.532   9.313  1.00 0.00 ? 21 ASP A H    3  
ATOM 2610  H HA   . ASP A 1 21 ? -2.224 7.317   7.202  1.00 0.00 ? 21 ASP A HA   3  
ATOM 2611  H HB2  . ASP A 1 21 ? -3.511 8.978   9.375  1.00 0.00 ? 21 ASP A HB2  3  
ATOM 2612  H HB3  . ASP A 1 21 ? -2.752 9.661   7.940  1.00 0.00 ? 21 ASP A HB3  3  
ATOM 2613  N N    . LYS A 1 22 ? -0.801 7.555   10.106 1.00 0.00 ? 22 LYS A N    3  
ATOM 2614  C CA   . LYS A 1 22 ? 0.459  7.809   10.795 1.00 0.00 ? 22 LYS A CA   3  
ATOM 2615  C C    . LYS A 1 22 ? 1.476  6.714   10.489 1.00 0.00 ? 22 LYS A C    3  
ATOM 2616  O O    . LYS A 1 22 ? 2.684  6.942   10.550 1.00 0.00 ? 22 LYS A O    3  
ATOM 2617  C CB   . LYS A 1 22 ? 0.229  7.901   12.305 1.00 0.00 ? 22 LYS A CB   3  
ATOM 2618  C CG   . LYS A 1 22 ? -0.768 8.974   12.705 1.00 0.00 ? 22 LYS A CG   3  
ATOM 2619  C CD   . LYS A 1 22 ? -0.756 9.216   14.205 1.00 0.00 ? 22 LYS A CD   3  
ATOM 2620  C CE   . LYS A 1 22 ? -1.580 8.173   14.944 1.00 0.00 ? 22 LYS A CE   3  
ATOM 2621  N NZ   . LYS A 1 22 ? -1.849 8.575   16.353 1.00 0.00 ? 22 LYS A NZ   3  
ATOM 2622  H H    . LYS A 1 22 ? -1.531 7.115   10.592 1.00 0.00 ? 22 LYS A H    3  
ATOM 2623  H HA   . LYS A 1 22 ? 0.846  8.753   10.440 1.00 0.00 ? 22 LYS A HA   3  
ATOM 2624  H HB2  . LYS A 1 22 ? -0.137 6.948   12.659 1.00 0.00 ? 22 LYS A HB2  3  
ATOM 2625  H HB3  . LYS A 1 22 ? 1.172  8.117   12.788 1.00 0.00 ? 22 LYS A HB3  3  
ATOM 2626  H HG2  . LYS A 1 22 ? -0.514 9.895   12.201 1.00 0.00 ? 22 LYS A HG2  3  
ATOM 2627  H HG3  . LYS A 1 22 ? -1.759 8.661   12.408 1.00 0.00 ? 22 LYS A HG3  3  
ATOM 2628  H HD2  . LYS A 1 22 ? 0.263  9.170   14.560 1.00 0.00 ? 22 LYS A HD2  3  
ATOM 2629  H HD3  . LYS A 1 22 ? -1.166 10.195  14.406 1.00 0.00 ? 22 LYS A HD3  3  
ATOM 2630  H HE2  . LYS A 1 22 ? -2.520 8.045   14.429 1.00 0.00 ? 22 LYS A HE2  3  
ATOM 2631  H HE3  . LYS A 1 22 ? -1.039 7.238   14.942 1.00 0.00 ? 22 LYS A HE3  3  
ATOM 2632  H HZ1  . LYS A 1 22 ? -2.565 7.947   16.772 1.00 0.00 ? 22 LYS A HZ1  3  
ATOM 2633  H HZ2  . LYS A 1 22 ? -2.201 9.553   16.384 1.00 0.00 ? 22 LYS A HZ2  3  
ATOM 2634  H HZ3  . LYS A 1 22 ? -0.977 8.513   16.915 1.00 0.00 ? 22 LYS A HZ3  3  
ATOM 2635  N N    . VAL A 1 23 ? 0.979  5.526   10.160 1.00 0.00 ? 23 VAL A N    3  
ATOM 2636  C CA   . VAL A 1 23 ? 1.845  4.397   9.843  1.00 0.00 ? 23 VAL A CA   3  
ATOM 2637  C C    . VAL A 1 23 ? 2.524  4.588   8.492  1.00 0.00 ? 23 VAL A C    3  
ATOM 2638  O O    . VAL A 1 23 ? 2.088  4.036   7.481  1.00 0.00 ? 23 VAL A O    3  
ATOM 2639  C CB   . VAL A 1 23 ? 1.057  3.073   9.827  1.00 0.00 ? 23 VAL A CB   3  
ATOM 2640  C CG1  . VAL A 1 23 ? 1.994  1.897   9.599  1.00 0.00 ? 23 VAL A CG1  3  
ATOM 2641  C CG2  . VAL A 1 23 ? 0.277  2.902   11.122 1.00 0.00 ? 23 VAL A CG2  3  
ATOM 2642  H H    . VAL A 1 23 ? 0.007  5.407   10.129 1.00 0.00 ? 23 VAL A H    3  
ATOM 2643  H HA   . VAL A 1 23 ? 2.602  4.331   10.610 1.00 0.00 ? 23 VAL A HA   3  
ATOM 2644  H HB   . VAL A 1 23 ? 0.352  3.107   9.009  1.00 0.00 ? 23 VAL A HB   3  
ATOM 2645  H HG11 . VAL A 1 23 ? 2.876  2.016   10.211 1.00 0.00 ? 23 VAL A HG11 3  
ATOM 2646  H HG12 . VAL A 1 23 ? 1.491  0.979   9.865  1.00 0.00 ? 23 VAL A HG12 3  
ATOM 2647  H HG13 . VAL A 1 23 ? 2.281  1.862   8.558  1.00 0.00 ? 23 VAL A HG13 3  
ATOM 2648  H HG21 . VAL A 1 23 ? -0.352 2.028   11.049 1.00 0.00 ? 23 VAL A HG21 3  
ATOM 2649  H HG22 . VAL A 1 23 ? 0.967  2.780   11.945 1.00 0.00 ? 23 VAL A HG22 3  
ATOM 2650  H HG23 . VAL A 1 23 ? -0.335 3.774   11.292 1.00 0.00 ? 23 VAL A HG23 3  
ATOM 2651  N N    . THR A 1 24 ? 3.597  5.373   8.481  1.00 0.00 ? 24 THR A N    3  
ATOM 2652  C CA   . THR A 1 24 ? 4.337  5.638   7.254  1.00 0.00 ? 24 THR A CA   3  
ATOM 2653  C C    . THR A 1 24 ? 5.777  5.149   7.364  1.00 0.00 ? 24 THR A C    3  
ATOM 2654  O O    . THR A 1 24 ? 6.254  4.837   8.455  1.00 0.00 ? 24 THR A O    3  
ATOM 2655  C CB   . THR A 1 24 ? 4.342  7.140   6.913  1.00 0.00 ? 24 THR A CB   3  
ATOM 2656  O OG1  . THR A 1 24 ? 5.016  7.874   7.942  1.00 0.00 ? 24 THR A OG1  3  
ATOM 2657  C CG2  . THR A 1 24 ? 2.922  7.664   6.757  1.00 0.00 ? 24 THR A CG2  3  
ATOM 2658  H H    . THR A 1 24 ? 3.896  5.784   9.319  1.00 0.00 ? 24 THR A H    3  
ATOM 2659  H HA   . THR A 1 24 ? 3.849  5.109   6.448  1.00 0.00 ? 24 THR A HA   3  
ATOM 2660  H HB   . THR A 1 24 ? 4.866  7.280   5.979  1.00 0.00 ? 24 THR A HB   3  
ATOM 2661  H HG1  . THR A 1 24 ? 5.912  8.071   7.659  1.00 0.00 ? 24 THR A HG1  3  
ATOM 2662  H HG21 . THR A 1 24 ? 2.286  7.208   7.502  1.00 0.00 ? 24 THR A HG21 3  
ATOM 2663  H HG22 . THR A 1 24 ? 2.554  7.419   5.772  1.00 0.00 ? 24 THR A HG22 3  
ATOM 2664  H HG23 . THR A 1 24 ? 2.917  8.735   6.887  1.00 0.00 ? 24 THR A HG23 3  
ATOM 2665  N N    . GLU A 1 25 ? 6.465  5.087   6.228  1.00 0.00 ? 25 GLU A N    3  
ATOM 2666  C CA   . GLU A 1 25 ? 7.851  4.636   6.199  1.00 0.00 ? 25 GLU A CA   3  
ATOM 2667  C C    . GLU A 1 25 ? 8.701  5.425   7.192  1.00 0.00 ? 25 GLU A C    3  
ATOM 2668  O O    . GLU A 1 25 ? 9.690  4.918   7.719  1.00 0.00 ? 25 GLU A O    3  
ATOM 2669  C CB   . GLU A 1 25 ? 8.429  4.781   4.790  1.00 0.00 ? 25 GLU A CB   3  
ATOM 2670  C CG   . GLU A 1 25 ? 8.136  3.593   3.888  1.00 0.00 ? 25 GLU A CG   3  
ATOM 2671  C CD   . GLU A 1 25 ? 6.701  3.572   3.398  1.00 0.00 ? 25 GLU A CD   3  
ATOM 2672  O OE1  . GLU A 1 25 ? 6.382  4.340   2.466  1.00 0.00 ? 25 GLU A OE1  3  
ATOM 2673  O OE2  . GLU A 1 25 ? 5.898  2.789   3.946  1.00 0.00 ? 25 GLU A OE2  3  
ATOM 2674  H H    . GLU A 1 25 ? 6.030  5.350   5.390  1.00 0.00 ? 25 GLU A H    3  
ATOM 2675  H HA   . GLU A 1 25 ? 7.867  3.594   6.479  1.00 0.00 ? 25 GLU A HA   3  
ATOM 2676  H HB2  . GLU A 1 25 ? 8.012  5.666   4.332  1.00 0.00 ? 25 GLU A HB2  3  
ATOM 2677  H HB3  . GLU A 1 25 ? 9.500  4.895   4.863  1.00 0.00 ? 25 GLU A HB3  3  
ATOM 2678  H HG2  . GLU A 1 25 ? 8.792  3.638   3.031  1.00 0.00 ? 25 GLU A HG2  3  
ATOM 2679  H HG3  . GLU A 1 25 ? 8.327  2.684   4.438  1.00 0.00 ? 25 GLU A HG3  3  
ATOM 2680  N N    . GLY A 1 26 ? 8.307  6.670   7.441  1.00 0.00 ? 26 GLY A N    3  
ATOM 2681  C CA   . GLY A 1 26 ? 9.042  7.510   8.368  1.00 0.00 ? 26 GLY A CA   3  
ATOM 2682  C C    . GLY A 1 26 ? 8.398  7.562   9.739  1.00 0.00 ? 26 GLY A C    3  
ATOM 2683  O O    . GLY A 1 26 ? 8.515  8.560   10.449 1.00 0.00 ? 26 GLY A O    3  
ATOM 2684  H H    . GLY A 1 26 ? 7.510  7.021   6.991  1.00 0.00 ? 26 GLY A H    3  
ATOM 2685  H HA2  . GLY A 1 26 ? 10.046 7.124   8.468  1.00 0.00 ? 26 GLY A HA2  3  
ATOM 2686  H HA3  . GLY A 1 26 ? 9.091  8.512   7.968  1.00 0.00 ? 26 GLY A HA3  3  
ATOM 2687  N N    . ALA A 1 27 ? 7.714  6.485   10.112 1.00 0.00 ? 27 ALA A N    3  
ATOM 2688  C CA   . ALA A 1 27 ? 7.049  6.412   11.407 1.00 0.00 ? 27 ALA A CA   3  
ATOM 2689  C C    . ALA A 1 27 ? 7.832  5.535   12.377 1.00 0.00 ? 27 ALA A C    3  
ATOM 2690  O O    . ALA A 1 27 ? 7.887  4.315   12.221 1.00 0.00 ? 27 ALA A O    3  
ATOM 2691  C CB   . ALA A 1 27 ? 5.631  5.886   11.243 1.00 0.00 ? 27 ALA A CB   3  
ATOM 2692  H H    . ALA A 1 27 ? 7.657  5.720   9.501  1.00 0.00 ? 27 ALA A H    3  
ATOM 2693  H HA   . ALA A 1 27 ? 6.991  7.413   11.809 1.00 0.00 ? 27 ALA A HA   3  
ATOM 2694  H HB1  . ALA A 1 27 ? 5.652  4.970   10.670 1.00 0.00 ? 27 ALA A HB1  3  
ATOM 2695  H HB2  . ALA A 1 27 ? 5.204  5.693   12.215 1.00 0.00 ? 27 ALA A HB2  3  
ATOM 2696  H HB3  . ALA A 1 27 ? 5.033  6.621   10.725 1.00 0.00 ? 27 ALA A HB3  3  
ATOM 2697  N N    . SER A 1 28 ? 8.437  6.164   13.380 1.00 0.00 ? 28 SER A N    3  
ATOM 2698  C CA   . SER A 1 28 ? 9.221  5.440   14.374 1.00 0.00 ? 28 SER A CA   3  
ATOM 2699  C C    . SER A 1 28 ? 8.352  5.033   15.560 1.00 0.00 ? 28 SER A C    3  
ATOM 2700  O O    . SER A 1 28 ? 7.823  5.882   16.278 1.00 0.00 ? 28 SER A O    3  
ATOM 2701  C CB   . SER A 1 28 ? 10.391 6.300   14.856 1.00 0.00 ? 28 SER A CB   3  
ATOM 2702  O OG   . SER A 1 28 ? 10.958 5.771   16.042 1.00 0.00 ? 28 SER A OG   3  
ATOM 2703  H H    . SER A 1 28 ? 8.356  7.138   13.451 1.00 0.00 ? 28 SER A H    3  
ATOM 2704  H HA   . SER A 1 28 ? 9.610  4.549   13.905 1.00 0.00 ? 28 SER A HA   3  
ATOM 2705  H HB2  . SER A 1 28 ? 11.152 6.330   14.091 1.00 0.00 ? 28 SER A HB2  3  
ATOM 2706  H HB3  . SER A 1 28 ? 10.040 7.302   15.055 1.00 0.00 ? 28 SER A HB3  3  
ATOM 2707  H HG   . SER A 1 28 ? 11.915 5.816   15.988 1.00 0.00 ? 28 SER A HG   3  
ATOM 2708  N N    . PHE A 1 29 ? 8.209  3.727   15.760 1.00 0.00 ? 29 PHE A N    3  
ATOM 2709  C CA   . PHE A 1 29 ? 7.403  3.205   16.857 1.00 0.00 ? 29 PHE A CA   3  
ATOM 2710  C C    . PHE A 1 29 ? 7.985  3.622   18.205 1.00 0.00 ? 29 PHE A C    3  
ATOM 2711  O O    . PHE A 1 29 ? 7.332  3.493   19.241 1.00 0.00 ? 29 PHE A O    3  
ATOM 2712  C CB   . PHE A 1 29 ? 7.319  1.679   16.776 1.00 0.00 ? 29 PHE A CB   3  
ATOM 2713  C CG   . PHE A 1 29 ? 7.014  1.168   15.397 1.00 0.00 ? 29 PHE A CG   3  
ATOM 2714  C CD1  . PHE A 1 29 ? 5.713  1.152   14.922 1.00 0.00 ? 29 PHE A CD1  3  
ATOM 2715  C CD2  . PHE A 1 29 ? 8.029  0.703   14.576 1.00 0.00 ? 29 PHE A CD2  3  
ATOM 2716  C CE1  . PHE A 1 29 ? 5.428  0.683   13.654 1.00 0.00 ? 29 PHE A CE1  3  
ATOM 2717  C CE2  . PHE A 1 29 ? 7.751  0.233   13.307 1.00 0.00 ? 29 PHE A CE2  3  
ATOM 2718  C CZ   . PHE A 1 29 ? 6.449  0.222   12.845 1.00 0.00 ? 29 PHE A CZ   3  
ATOM 2719  H H    . PHE A 1 29 ? 8.655  3.099   15.153 1.00 0.00 ? 29 PHE A H    3  
ATOM 2720  H HA   . PHE A 1 29 ? 6.410  3.617   16.764 1.00 0.00 ? 29 PHE A HA   3  
ATOM 2721  H HB2  . PHE A 1 29 ? 8.264  1.257   17.084 1.00 0.00 ? 29 PHE A HB2  3  
ATOM 2722  H HB3  . PHE A 1 29 ? 6.541  1.333   17.440 1.00 0.00 ? 29 PHE A HB3  3  
ATOM 2723  H HD1  . PHE A 1 29 ? 4.913  1.513   15.555 1.00 0.00 ? 29 PHE A HD1  3  
ATOM 2724  H HD2  . PHE A 1 29 ? 9.047  0.710   14.936 1.00 0.00 ? 29 PHE A HD2  3  
ATOM 2725  H HE1  . PHE A 1 29 ? 4.409  0.676   13.296 1.00 0.00 ? 29 PHE A HE1  3  
ATOM 2726  H HE2  . PHE A 1 29 ? 8.550  -0.127  12.676 1.00 0.00 ? 29 PHE A HE2  3  
ATOM 2727  H HZ   . PHE A 1 29 ? 6.229  -0.144  11.854 1.00 0.00 ? 29 PHE A HZ   3  
ATOM 2728  N N    . ILE A 1 30 ? 9.215  4.123   18.182 1.00 0.00 ? 30 ILE A N    3  
ATOM 2729  C CA   . ILE A 1 30 ? 9.885  4.560   19.401 1.00 0.00 ? 30 ILE A CA   3  
ATOM 2730  C C    . ILE A 1 30 ? 9.492  5.989   19.762 1.00 0.00 ? 30 ILE A C    3  
ATOM 2731  O O    . ILE A 1 30 ? 9.050  6.258   20.878 1.00 0.00 ? 30 ILE A O    3  
ATOM 2732  C CB   . ILE A 1 30 ? 11.416 4.480   19.262 1.00 0.00 ? 30 ILE A CB   3  
ATOM 2733  C CG1  . ILE A 1 30 ? 11.852 3.037   18.997 1.00 0.00 ? 30 ILE A CG1  3  
ATOM 2734  C CG2  . ILE A 1 30 ? 12.091 5.021   20.513 1.00 0.00 ? 30 ILE A CG2  3  
ATOM 2735  C CD1  . ILE A 1 30 ? 11.419 2.068   20.074 1.00 0.00 ? 30 ILE A CD1  3  
ATOM 2736  H H    . ILE A 1 30 ? 9.684  4.201   17.325 1.00 0.00 ? 30 ILE A H    3  
ATOM 2737  H HA   . ILE A 1 30 ? 9.581  3.901   20.202 1.00 0.00 ? 30 ILE A HA   3  
ATOM 2738  H HB   . ILE A 1 30 ? 11.713 5.097   18.427 1.00 0.00 ? 30 ILE A HB   3  
ATOM 2739  H HG12 . ILE A 1 30 ? 11.427 2.705   18.063 1.00 0.00 ? 30 ILE A HG12 3  
ATOM 2740  H HG13 . ILE A 1 30 ? 12.929 3.001   18.930 1.00 0.00 ? 30 ILE A HG13 3  
ATOM 2741  H HG21 . ILE A 1 30 ? 12.780 4.284   20.898 1.00 0.00 ? 30 ILE A HG21 3  
ATOM 2742  H HG22 . ILE A 1 30 ? 12.630 5.924   20.269 1.00 0.00 ? 30 ILE A HG22 3  
ATOM 2743  H HG23 . ILE A 1 30 ? 11.343 5.238   21.261 1.00 0.00 ? 30 ILE A HG23 3  
ATOM 2744  H HD11 . ILE A 1 30 ? 10.342 1.980   20.069 1.00 0.00 ? 30 ILE A HD11 3  
ATOM 2745  H HD12 . ILE A 1 30 ? 11.861 1.101   19.888 1.00 0.00 ? 30 ILE A HD12 3  
ATOM 2746  H HD13 . ILE A 1 30 ? 11.744 2.432   21.038 1.00 0.00 ? 30 ILE A HD13 3  
ATOM 2747  N N    . ASP A 1 31 ? 9.655  6.899   18.809 1.00 0.00 ? 31 ASP A N    3  
ATOM 2748  C CA   . ASP A 1 31 ? 9.315  8.301   19.024 1.00 0.00 ? 31 ASP A CA   3  
ATOM 2749  C C    . ASP A 1 31 ? 7.904  8.600   18.530 1.00 0.00 ? 31 ASP A C    3  
ATOM 2750  O O    . ASP A 1 31 ? 7.037  9.007   19.304 1.00 0.00 ? 31 ASP A O    3  
ATOM 2751  C CB   . ASP A 1 31 ? 10.321 9.207   18.312 1.00 0.00 ? 31 ASP A CB   3  
ATOM 2752  C CG   . ASP A 1 31 ? 10.238 10.646  18.783 1.00 0.00 ? 31 ASP A CG   3  
ATOM 2753  O OD1  . ASP A 1 31 ? 10.493 10.895  19.980 1.00 0.00 ? 31 ASP A OD1  3  
ATOM 2754  O OD2  . ASP A 1 31 ? 9.919  11.523  17.954 1.00 0.00 ? 31 ASP A OD2  3  
ATOM 2755  H H    . ASP A 1 31 ? 10.012 6.622   17.939 1.00 0.00 ? 31 ASP A H    3  
ATOM 2756  H HA   . ASP A 1 31 ? 9.360  8.494   20.085 1.00 0.00 ? 31 ASP A HA   3  
ATOM 2757  H HB2  . ASP A 1 31 ? 11.321 8.843   18.501 1.00 0.00 ? 31 ASP A HB2  3  
ATOM 2758  H HB3  . ASP A 1 31 ? 10.128 9.183   17.250 1.00 0.00 ? 31 ASP A HB3  3  
ATOM 2759  N N    . ASP A 1 32 ? 7.680  8.396   17.236 1.00 0.00 ? 32 ASP A N    3  
ATOM 2760  C CA   . ASP A 1 32 ? 6.373  8.644   16.638 1.00 0.00 ? 32 ASP A CA   3  
ATOM 2761  C C    . ASP A 1 32 ? 5.256  8.118   17.535 1.00 0.00 ? 32 ASP A C    3  
ATOM 2762  O O    . ASP A 1 32 ? 4.233  8.778   17.722 1.00 0.00 ? 32 ASP A O    3  
ATOM 2763  C CB   . ASP A 1 32 ? 6.287  7.988   15.259 1.00 0.00 ? 32 ASP A CB   3  
ATOM 2764  C CG   . ASP A 1 32 ? 5.276  8.668   14.357 1.00 0.00 ? 32 ASP A CG   3  
ATOM 2765  O OD1  . ASP A 1 32 ? 5.376  9.900   14.175 1.00 0.00 ? 32 ASP A OD1  3  
ATOM 2766  O OD2  . ASP A 1 32 ? 4.385  7.969   13.832 1.00 0.00 ? 32 ASP A OD2  3  
ATOM 2767  H H    . ASP A 1 32 ? 8.411  8.070   16.670 1.00 0.00 ? 32 ASP A H    3  
ATOM 2768  H HA   . ASP A 1 32 ? 6.256  9.711   16.527 1.00 0.00 ? 32 ASP A HA   3  
ATOM 2769  H HB2  . ASP A 1 32 ? 7.256  8.037   14.783 1.00 0.00 ? 32 ASP A HB2  3  
ATOM 2770  H HB3  . ASP A 1 32 ? 6.000  6.954   15.376 1.00 0.00 ? 32 ASP A HB3  3  
ATOM 2771  N N    . LEU A 1 33 ? 5.459  6.927   18.087 1.00 0.00 ? 33 LEU A N    3  
ATOM 2772  C CA   . LEU A 1 33 ? 4.469  6.311   18.964 1.00 0.00 ? 33 LEU A CA   3  
ATOM 2773  C C    . LEU A 1 33 ? 4.850  6.496   20.429 1.00 0.00 ? 33 LEU A C    3  
ATOM 2774  O O    . LEU A 1 33 ? 4.022  6.322   21.323 1.00 0.00 ? 33 LEU A O    3  
ATOM 2775  C CB   . LEU A 1 33 ? 4.332  4.821   18.644 1.00 0.00 ? 33 LEU A CB   3  
ATOM 2776  C CG   . LEU A 1 33 ? 3.908  4.478   17.216 1.00 0.00 ? 33 LEU A CG   3  
ATOM 2777  C CD1  . LEU A 1 33 ? 3.499  3.016   17.118 1.00 0.00 ? 33 LEU A CD1  3  
ATOM 2778  C CD2  . LEU A 1 33 ? 2.772  5.383   16.764 1.00 0.00 ? 33 LEU A CD2  3  
ATOM 2779  H H    . LEU A 1 33 ? 6.294  6.449   17.901 1.00 0.00 ? 33 LEU A H    3  
ATOM 2780  H HA   . LEU A 1 33 ? 3.522  6.798   18.786 1.00 0.00 ? 33 LEU A HA   3  
ATOM 2781  H HB2  . LEU A 1 33 ? 5.288  4.355   18.826 1.00 0.00 ? 33 LEU A HB2  3  
ATOM 2782  H HB3  . LEU A 1 33 ? 3.596  4.406   19.318 1.00 0.00 ? 33 LEU A HB3  3  
ATOM 2783  H HG   . LEU A 1 33 ? 4.746  4.634   16.551 1.00 0.00 ? 33 LEU A HG   3  
ATOM 2784  H HD11 . LEU A 1 33 ? 3.315  2.762   16.085 1.00 0.00 ? 33 LEU A HD11 3  
ATOM 2785  H HD12 . LEU A 1 33 ? 2.599  2.855   17.693 1.00 0.00 ? 33 LEU A HD12 3  
ATOM 2786  H HD13 . LEU A 1 33 ? 4.291  2.394   17.507 1.00 0.00 ? 33 LEU A HD13 3  
ATOM 2787  H HD21 . LEU A 1 33 ? 2.088  4.820   16.146 1.00 0.00 ? 33 LEU A HD21 3  
ATOM 2788  H HD22 . LEU A 1 33 ? 3.174  6.209   16.195 1.00 0.00 ? 33 LEU A HD22 3  
ATOM 2789  H HD23 . LEU A 1 33 ? 2.248  5.762   17.629 1.00 0.00 ? 33 LEU A HD23 3  
ATOM 2790  N N    . GLY A 1 34 ? 6.109  6.850   20.668 1.00 0.00 ? 34 GLY A N    3  
ATOM 2791  C CA   . GLY A 1 34 ? 6.577  7.055   22.026 1.00 0.00 ? 34 GLY A CA   3  
ATOM 2792  C C    . GLY A 1 34 ? 6.736  5.753   22.787 1.00 0.00 ? 34 GLY A C    3  
ATOM 2793  O O    . GLY A 1 34 ? 6.506  5.700   23.995 1.00 0.00 ? 34 GLY A O    3  
ATOM 2794  H H    . GLY A 1 34 ? 6.725  6.974   19.916 1.00 0.00 ? 34 GLY A H    3  
ATOM 2795  H HA2  . GLY A 1 34 ? 7.531  7.560   21.995 1.00 0.00 ? 34 GLY A HA2  3  
ATOM 2796  H HA3  . GLY A 1 34 ? 5.867  7.679   22.549 1.00 0.00 ? 34 GLY A HA3  3  
ATOM 2797  N N    . ALA A 1 35 ? 7.129  4.700   22.078 1.00 0.00 ? 35 ALA A N    3  
ATOM 2798  C CA   . ALA A 1 35 ? 7.318  3.392   22.694 1.00 0.00 ? 35 ALA A CA   3  
ATOM 2799  C C    . ALA A 1 35 ? 8.795  3.120   22.960 1.00 0.00 ? 35 ALA A C    3  
ATOM 2800  O O    . ALA A 1 35 ? 9.665  3.859   22.499 1.00 0.00 ? 35 ALA A O    3  
ATOM 2801  C CB   . ALA A 1 35 ? 6.729  2.303   21.811 1.00 0.00 ? 35 ALA A CB   3  
ATOM 2802  H H    . ALA A 1 35 ? 7.296  4.805   21.119 1.00 0.00 ? 35 ALA A H    3  
ATOM 2803  H HA   . ALA A 1 35 ? 6.786  3.386   23.635 1.00 0.00 ? 35 ALA A HA   3  
ATOM 2804  H HB1  . ALA A 1 35 ? 6.084  2.751   21.069 1.00 0.00 ? 35 ALA A HB1  3  
ATOM 2805  H HB2  . ALA A 1 35 ? 7.527  1.768   21.319 1.00 0.00 ? 35 ALA A HB2  3  
ATOM 2806  H HB3  . ALA A 1 35 ? 6.157  1.618   22.419 1.00 0.00 ? 35 ALA A HB3  3  
ATOM 2807  N N    . ASP A 1 36 ? 9.070  2.056   23.706 1.00 0.00 ? 36 ASP A N    3  
ATOM 2808  C CA   . ASP A 1 36 ? 10.442 1.685   24.033 1.00 0.00 ? 36 ASP A CA   3  
ATOM 2809  C C    . ASP A 1 36 ? 10.885 0.471   23.223 1.00 0.00 ? 36 ASP A C    3  
ATOM 2810  O O    . ASP A 1 36 ? 10.121 -0.063  22.419 1.00 0.00 ? 36 ASP A O    3  
ATOM 2811  C CB   . ASP A 1 36 ? 10.571 1.390   25.528 1.00 0.00 ? 36 ASP A CB   3  
ATOM 2812  C CG   . ASP A 1 36 ? 11.940 1.747   26.073 1.00 0.00 ? 36 ASP A CG   3  
ATOM 2813  O OD1  . ASP A 1 36 ? 12.296 2.944   26.045 1.00 0.00 ? 36 ASP A OD1  3  
ATOM 2814  O OD2  . ASP A 1 36 ? 12.654 0.830   26.528 1.00 0.00 ? 36 ASP A OD2  3  
ATOM 2815  H H    . ASP A 1 36 ? 8.333  1.505   24.044 1.00 0.00 ? 36 ASP A H    3  
ATOM 2816  H HA   . ASP A 1 36 ? 11.079 2.520   23.784 1.00 0.00 ? 36 ASP A HA   3  
ATOM 2817  H HB2  . ASP A 1 36 ? 9.829  1.963   26.067 1.00 0.00 ? 36 ASP A HB2  3  
ATOM 2818  H HB3  . ASP A 1 36 ? 10.399 0.338   25.697 1.00 0.00 ? 36 ASP A HB3  3  
ATOM 2819  N N    . SER A 1 37 ? 12.124 0.041   23.439 1.00 0.00 ? 37 SER A N    3  
ATOM 2820  C CA   . SER A 1 37 ? 12.671 -1.107  22.725 1.00 0.00 ? 37 SER A CA   3  
ATOM 2821  C C    . SER A 1 37 ? 11.788 -2.336  22.916 1.00 0.00 ? 37 SER A C    3  
ATOM 2822  O O    . SER A 1 37 ? 11.664 -3.172  22.020 1.00 0.00 ? 37 SER A O    3  
ATOM 2823  C CB   . SER A 1 37 ? 14.091 -1.405  23.208 1.00 0.00 ? 37 SER A CB   3  
ATOM 2824  O OG   . SER A 1 37 ? 15.029 -0.531  22.604 1.00 0.00 ? 37 SER A OG   3  
ATOM 2825  H H    . SER A 1 37 ? 12.685 0.510   24.093 1.00 0.00 ? 37 SER A H    3  
ATOM 2826  H HA   . SER A 1 37 ? 12.701 -0.860  21.674 1.00 0.00 ? 37 SER A HA   3  
ATOM 2827  H HB2  . SER A 1 37 ? 14.139 -1.279  24.279 1.00 0.00 ? 37 SER A HB2  3  
ATOM 2828  H HB3  . SER A 1 37 ? 14.349 -2.423  22.953 1.00 0.00 ? 37 SER A HB3  3  
ATOM 2829  H HG   . SER A 1 37 ? 15.716 -1.046  22.173 1.00 0.00 ? 37 SER A HG   3  
ATOM 2830  N N    . LEU A 1 38 ? 11.176 -2.440  24.091 1.00 0.00 ? 38 LEU A N    3  
ATOM 2831  C CA   . LEU A 1 38 ? 10.303 -3.567  24.402 1.00 0.00 ? 38 LEU A CA   3  
ATOM 2832  C C    . LEU A 1 38 ? 9.159  -3.663  23.397 1.00 0.00 ? 38 LEU A C    3  
ATOM 2833  O O    . LEU A 1 38 ? 8.949  -4.707  22.780 1.00 0.00 ? 38 LEU A O    3  
ATOM 2834  C CB   . LEU A 1 38 ? 9.743  -3.428  25.819 1.00 0.00 ? 38 LEU A CB   3  
ATOM 2835  C CG   . LEU A 1 38 ? 10.749 -3.595  26.958 1.00 0.00 ? 38 LEU A CG   3  
ATOM 2836  C CD1  . LEU A 1 38 ? 10.222 -2.956  28.233 1.00 0.00 ? 38 LEU A CD1  3  
ATOM 2837  C CD2  . LEU A 1 38 ? 11.057 -5.068  27.185 1.00 0.00 ? 38 LEU A CD2  3  
ATOM 2838  H H    . LEU A 1 38 ? 11.313 -1.743  24.766 1.00 0.00 ? 38 LEU A H    3  
ATOM 2839  H HA   . LEU A 1 38 ? 10.894 -4.469  24.344 1.00 0.00 ? 38 LEU A HA   3  
ATOM 2840  H HB2  . LEU A 1 38 ? 9.305  -2.445  25.906 1.00 0.00 ? 38 LEU A HB2  3  
ATOM 2841  H HB3  . LEU A 1 38 ? 8.972  -4.175  25.943 1.00 0.00 ? 38 LEU A HB3  3  
ATOM 2842  H HG   . LEU A 1 38 ? 11.671 -3.097  26.691 1.00 0.00 ? 38 LEU A HG   3  
ATOM 2843  H HD11 . LEU A 1 38 ? 10.387 -1.890  28.196 1.00 0.00 ? 38 LEU A HD11 3  
ATOM 2844  H HD12 . LEU A 1 38 ? 10.741 -3.371  29.084 1.00 0.00 ? 38 LEU A HD12 3  
ATOM 2845  H HD13 . LEU A 1 38 ? 9.164  -3.155  28.325 1.00 0.00 ? 38 LEU A HD13 3  
ATOM 2846  H HD21 . LEU A 1 38 ? 11.281 -5.538  26.239 1.00 0.00 ? 38 LEU A HD21 3  
ATOM 2847  H HD22 . LEU A 1 38 ? 10.200 -5.550  27.632 1.00 0.00 ? 38 LEU A HD22 3  
ATOM 2848  H HD23 . LEU A 1 38 ? 11.908 -5.160  27.844 1.00 0.00 ? 38 LEU A HD23 3  
ATOM 2849  N N    . ASP A 1 39 ? 8.425  -2.568  23.238 1.00 0.00 ? 39 ASP A N    3  
ATOM 2850  C CA   . ASP A 1 39 ? 7.304  -2.527  22.306 1.00 0.00 ? 39 ASP A CA   3  
ATOM 2851  C C    . ASP A 1 39 ? 7.732  -3.003  20.921 1.00 0.00 ? 39 ASP A C    3  
ATOM 2852  O O    . ASP A 1 39 ? 7.118  -3.901  20.344 1.00 0.00 ? 39 ASP A O    3  
ATOM 2853  C CB   . ASP A 1 39 ? 6.736  -1.110  22.219 1.00 0.00 ? 39 ASP A CB   3  
ATOM 2854  C CG   . ASP A 1 39 ? 5.844  -0.917  21.009 1.00 0.00 ? 39 ASP A CG   3  
ATOM 2855  O OD1  . ASP A 1 39 ? 4.704  -1.427  21.024 1.00 0.00 ? 39 ASP A OD1  3  
ATOM 2856  O OD2  . ASP A 1 39 ? 6.286  -0.255  20.046 1.00 0.00 ? 39 ASP A OD2  3  
ATOM 2857  H H    . ASP A 1 39 ? 8.642  -1.767  23.759 1.00 0.00 ? 39 ASP A H    3  
ATOM 2858  H HA   . ASP A 1 39 ? 6.538  -3.190  22.679 1.00 0.00 ? 39 ASP A HA   3  
ATOM 2859  H HB2  . ASP A 1 39 ? 6.155  -0.907  23.107 1.00 0.00 ? 39 ASP A HB2  3  
ATOM 2860  H HB3  . ASP A 1 39 ? 7.552  -0.405  22.159 1.00 0.00 ? 39 ASP A HB3  3  
ATOM 2861  N N    . THR A 1 40 ? 8.788  -2.394  20.392 1.00 0.00 ? 40 THR A N    3  
ATOM 2862  C CA   . THR A 1 40 ? 9.297  -2.753  19.074 1.00 0.00 ? 40 THR A CA   3  
ATOM 2863  C C    . THR A 1 40 ? 9.555  -4.252  18.974 1.00 0.00 ? 40 THR A C    3  
ATOM 2864  O O    . THR A 1 40 ? 9.063  -4.917  18.062 1.00 0.00 ? 40 THR A O    3  
ATOM 2865  C CB   . THR A 1 40 ? 10.599 -1.996  18.749 1.00 0.00 ? 40 THR A CB   3  
ATOM 2866  O OG1  . THR A 1 40 ? 11.268 -1.629  19.960 1.00 0.00 ? 40 THR A OG1  3  
ATOM 2867  C CG2  . THR A 1 40 ? 10.309 -0.750  17.926 1.00 0.00 ? 40 THR A CG2  3  
ATOM 2868  H H    . THR A 1 40 ? 9.235  -1.685  20.900 1.00 0.00 ? 40 THR A H    3  
ATOM 2869  H HA   . THR A 1 40 ? 8.552  -2.476  18.342 1.00 0.00 ? 40 THR A HA   3  
ATOM 2870  H HB   . THR A 1 40 ? 11.242 -2.648  18.174 1.00 0.00 ? 40 THR A HB   3  
ATOM 2871  H HG1  . THR A 1 40 ? 12.196 -1.868  19.899 1.00 0.00 ? 40 THR A HG1  3  
ATOM 2872  H HG21 . THR A 1 40 ? 11.172 -0.100  17.941 1.00 0.00 ? 40 THR A HG21 3  
ATOM 2873  H HG22 . THR A 1 40 ? 9.460  -0.232  18.345 1.00 0.00 ? 40 THR A HG22 3  
ATOM 2874  H HG23 . THR A 1 40 ? 10.092 -1.034  16.907 1.00 0.00 ? 40 THR A HG23 3  
ATOM 2875  N N    . VAL A 1 41 ? 10.329 -4.778  19.917 1.00 0.00 ? 41 VAL A N    3  
ATOM 2876  C CA   . VAL A 1 41 ? 10.652 -6.200  19.936 1.00 0.00 ? 41 VAL A CA   3  
ATOM 2877  C C    . VAL A 1 41 ? 9.388  -7.051  19.868 1.00 0.00 ? 41 VAL A C    3  
ATOM 2878  O O    . VAL A 1 41 ? 9.325  -8.025  19.120 1.00 0.00 ? 41 VAL A O    3  
ATOM 2879  C CB   . VAL A 1 41 ? 11.445 -6.579  21.201 1.00 0.00 ? 41 VAL A CB   3  
ATOM 2880  C CG1  . VAL A 1 41 ? 11.745 -8.070  21.217 1.00 0.00 ? 41 VAL A CG1  3  
ATOM 2881  C CG2  . VAL A 1 41 ? 12.729 -5.768  21.287 1.00 0.00 ? 41 VAL A CG2  3  
ATOM 2882  H H    . VAL A 1 41 ? 10.692 -4.197  20.618 1.00 0.00 ? 41 VAL A H    3  
ATOM 2883  H HA   . VAL A 1 41 ? 11.266 -6.415  19.074 1.00 0.00 ? 41 VAL A HA   3  
ATOM 2884  H HB   . VAL A 1 41 ? 10.839 -6.347  22.065 1.00 0.00 ? 41 VAL A HB   3  
ATOM 2885  H HG11 . VAL A 1 41 ? 10.866 -8.610  21.538 1.00 0.00 ? 41 VAL A HG11 3  
ATOM 2886  H HG12 . VAL A 1 41 ? 12.024 -8.392  20.224 1.00 0.00 ? 41 VAL A HG12 3  
ATOM 2887  H HG13 . VAL A 1 41 ? 12.557 -8.266  21.901 1.00 0.00 ? 41 VAL A HG13 3  
ATOM 2888  H HG21 . VAL A 1 41 ? 12.755 -5.050  20.481 1.00 0.00 ? 41 VAL A HG21 3  
ATOM 2889  H HG22 . VAL A 1 41 ? 12.764 -5.248  22.234 1.00 0.00 ? 41 VAL A HG22 3  
ATOM 2890  H HG23 . VAL A 1 41 ? 13.579 -6.429  21.209 1.00 0.00 ? 41 VAL A HG23 3  
ATOM 2891  N N    . GLU A 1 42 ? 8.385  -6.675  20.655 1.00 0.00 ? 42 GLU A N    3  
ATOM 2892  C CA   . GLU A 1 42 ? 7.123  -7.404  20.684 1.00 0.00 ? 42 GLU A CA   3  
ATOM 2893  C C    . GLU A 1 42 ? 6.479  -7.432  19.301 1.00 0.00 ? 42 GLU A C    3  
ATOM 2894  O O    . GLU A 1 42 ? 6.171  -8.500  18.768 1.00 0.00 ? 42 GLU A O    3  
ATOM 2895  C CB   . GLU A 1 42 ? 6.163  -6.768  21.692 1.00 0.00 ? 42 GLU A CB   3  
ATOM 2896  C CG   . GLU A 1 42 ? 6.550  -7.016  23.140 1.00 0.00 ? 42 GLU A CG   3  
ATOM 2897  C CD   . GLU A 1 42 ? 6.116  -8.382  23.635 1.00 0.00 ? 42 GLU A CD   3  
ATOM 2898  O OE1  . GLU A 1 42 ? 5.967  -9.296  22.796 1.00 0.00 ? 42 GLU A OE1  3  
ATOM 2899  O OE2  . GLU A 1 42 ? 5.924  -8.538  24.859 1.00 0.00 ? 42 GLU A OE2  3  
ATOM 2900  H H    . GLU A 1 42 ? 8.496  -5.889  21.230 1.00 0.00 ? 42 GLU A H    3  
ATOM 2901  H HA   . GLU A 1 42 ? 7.332  -8.418  20.991 1.00 0.00 ? 42 GLU A HA   3  
ATOM 2902  H HB2  . GLU A 1 42 ? 6.139  -5.702  21.524 1.00 0.00 ? 42 GLU A HB2  3  
ATOM 2903  H HB3  . GLU A 1 42 ? 5.174  -7.171  21.532 1.00 0.00 ? 42 GLU A HB3  3  
ATOM 2904  H HG2  . GLU A 1 42 ? 7.624  -6.942  23.231 1.00 0.00 ? 42 GLU A HG2  3  
ATOM 2905  H HG3  . GLU A 1 42 ? 6.085  -6.262  23.758 1.00 0.00 ? 42 GLU A HG3  3  
ATOM 2906  N N    . LEU A 1 43 ? 6.279  -6.253  18.724 1.00 0.00 ? 43 LEU A N    3  
ATOM 2907  C CA   . LEU A 1 43 ? 5.671  -6.141  17.402 1.00 0.00 ? 43 LEU A CA   3  
ATOM 2908  C C    . LEU A 1 43 ? 6.424  -6.989  16.383 1.00 0.00 ? 43 LEU A C    3  
ATOM 2909  O O    . LEU A 1 43 ? 5.833  -7.822  15.695 1.00 0.00 ? 43 LEU A O    3  
ATOM 2910  C CB   . LEU A 1 43 ? 5.651  -4.679  16.951 1.00 0.00 ? 43 LEU A CB   3  
ATOM 2911  C CG   . LEU A 1 43 ? 5.018  -3.684  17.924 1.00 0.00 ? 43 LEU A CG   3  
ATOM 2912  C CD1  . LEU A 1 43 ? 5.520  -2.275  17.650 1.00 0.00 ? 43 LEU A CD1  3  
ATOM 2913  C CD2  . LEU A 1 43 ? 3.500  -3.739  17.831 1.00 0.00 ? 43 LEU A CD2  3  
ATOM 2914  H H    . LEU A 1 43 ? 6.545  -5.437  19.197 1.00 0.00 ? 43 LEU A H    3  
ATOM 2915  H HA   . LEU A 1 43 ? 4.656  -6.501  17.473 1.00 0.00 ? 43 LEU A HA   3  
ATOM 2916  H HB2  . LEU A 1 43 ? 6.672  -4.372  16.781 1.00 0.00 ? 43 LEU A HB2  3  
ATOM 2917  H HB3  . LEU A 1 43 ? 5.103  -4.629  16.021 1.00 0.00 ? 43 LEU A HB3  3  
ATOM 2918  H HG   . LEU A 1 43 ? 5.302  -3.948  18.934 1.00 0.00 ? 43 LEU A HG   3  
ATOM 2919  H HD11 . LEU A 1 43 ? 5.846  -2.203  16.623 1.00 0.00 ? 43 LEU A HD11 3  
ATOM 2920  H HD12 . LEU A 1 43 ? 6.349  -2.054  18.306 1.00 0.00 ? 43 LEU A HD12 3  
ATOM 2921  H HD13 . LEU A 1 43 ? 4.723  -1.568  17.826 1.00 0.00 ? 43 LEU A HD13 3  
ATOM 2922  H HD21 . LEU A 1 43 ? 3.180  -4.770  17.784 1.00 0.00 ? 43 LEU A HD21 3  
ATOM 2923  H HD22 . LEU A 1 43 ? 3.176  -3.221  16.940 1.00 0.00 ? 43 LEU A HD22 3  
ATOM 2924  H HD23 . LEU A 1 43 ? 3.069  -3.267  18.701 1.00 0.00 ? 43 LEU A HD23 3  
ATOM 2925  N N    . VAL A 1 44 ? 7.733  -6.775  16.293 1.00 0.00 ? 44 VAL A N    3  
ATOM 2926  C CA   . VAL A 1 44 ? 8.568  -7.522  15.360 1.00 0.00 ? 44 VAL A CA   3  
ATOM 2927  C C    . VAL A 1 44 ? 8.355  -9.024  15.514 1.00 0.00 ? 44 VAL A C    3  
ATOM 2928  O O    . VAL A 1 44 ? 8.167  -9.738  14.530 1.00 0.00 ? 44 VAL A O    3  
ATOM 2929  C CB   . VAL A 1 44 ? 10.061 -7.203  15.563 1.00 0.00 ? 44 VAL A CB   3  
ATOM 2930  C CG1  . VAL A 1 44 ? 10.917 -8.021  14.609 1.00 0.00 ? 44 VAL A CG1  3  
ATOM 2931  C CG2  . VAL A 1 44 ? 10.317 -5.715  15.379 1.00 0.00 ? 44 VAL A CG2  3  
ATOM 2932  H H    . VAL A 1 44 ? 8.147  -6.098  16.868 1.00 0.00 ? 44 VAL A H    3  
ATOM 2933  H HA   . VAL A 1 44 ? 8.292  -7.230  14.357 1.00 0.00 ? 44 VAL A HA   3  
ATOM 2934  H HB   . VAL A 1 44 ? 10.331 -7.471  16.574 1.00 0.00 ? 44 VAL A HB   3  
ATOM 2935  H HG11 . VAL A 1 44 ? 11.958 -7.778  14.762 1.00 0.00 ? 44 VAL A HG11 3  
ATOM 2936  H HG12 . VAL A 1 44 ? 10.760 -9.074  14.797 1.00 0.00 ? 44 VAL A HG12 3  
ATOM 2937  H HG13 . VAL A 1 44 ? 10.641 -7.792  13.591 1.00 0.00 ? 44 VAL A HG13 3  
ATOM 2938  H HG21 . VAL A 1 44 ? 9.505  -5.154  15.818 1.00 0.00 ? 44 VAL A HG21 3  
ATOM 2939  H HG22 . VAL A 1 44 ? 11.244 -5.445  15.865 1.00 0.00 ? 44 VAL A HG22 3  
ATOM 2940  H HG23 . VAL A 1 44 ? 10.384 -5.488  14.326 1.00 0.00 ? 44 VAL A HG23 3  
ATOM 2941  N N    . MET A 1 45 ? 8.386  -9.496  16.756 1.00 0.00 ? 45 MET A N    3  
ATOM 2942  C CA   . MET A 1 45 ? 8.194  -10.914 17.039 1.00 0.00 ? 45 MET A CA   3  
ATOM 2943  C C    . MET A 1 45 ? 6.843  -11.394 16.519 1.00 0.00 ? 45 MET A C    3  
ATOM 2944  O O    . MET A 1 45 ? 6.742  -12.469 15.929 1.00 0.00 ? 45 MET A O    3  
ATOM 2945  C CB   . MET A 1 45 ? 8.297  -11.174 18.543 1.00 0.00 ? 45 MET A CB   3  
ATOM 2946  C CG   . MET A 1 45 ? 9.727  -11.270 19.047 1.00 0.00 ? 45 MET A CG   3  
ATOM 2947  S SD   . MET A 1 45 ? 9.826  -11.354 20.846 1.00 0.00 ? 45 MET A SD   3  
ATOM 2948  C CE   . MET A 1 45 ? 10.246 -13.079 21.082 1.00 0.00 ? 45 MET A CE   3  
ATOM 2949  H H    . MET A 1 45 ? 8.540  -8.877  17.500 1.00 0.00 ? 45 MET A H    3  
ATOM 2950  H HA   . MET A 1 45 ? 8.976  -11.461 16.535 1.00 0.00 ? 45 MET A HA   3  
ATOM 2951  H HB2  . MET A 1 45 ? 7.806  -10.369 19.070 1.00 0.00 ? 45 MET A HB2  3  
ATOM 2952  H HB3  . MET A 1 45 ? 7.794  -12.102 18.772 1.00 0.00 ? 45 MET A HB3  3  
ATOM 2953  H HG2  . MET A 1 45 ? 10.181 -12.159 18.635 1.00 0.00 ? 45 MET A HG2  3  
ATOM 2954  H HG3  . MET A 1 45 ? 10.272 -10.401 18.710 1.00 0.00 ? 45 MET A HG3  3  
ATOM 2955  H HE1  . MET A 1 45 ? 11.270 -13.158 21.415 1.00 0.00 ? 45 MET A HE1  3  
ATOM 2956  H HE2  . MET A 1 45 ? 9.591  -13.510 21.825 1.00 0.00 ? 45 MET A HE2  3  
ATOM 2957  H HE3  . MET A 1 45 ? 10.129 -13.608 20.148 1.00 0.00 ? 45 MET A HE3  3  
ATOM 2958  N N    . ALA A 1 46 ? 5.808  -10.591 16.743 1.00 0.00 ? 46 ALA A N    3  
ATOM 2959  C CA   . ALA A 1 46 ? 4.464  -10.935 16.296 1.00 0.00 ? 46 ALA A CA   3  
ATOM 2960  C C    . ALA A 1 46 ? 4.420  -11.121 14.783 1.00 0.00 ? 46 ALA A C    3  
ATOM 2961  O O    . ALA A 1 46 ? 3.950  -12.145 14.287 1.00 0.00 ? 46 ALA A O    3  
ATOM 2962  C CB   . ALA A 1 46 ? 3.474  -9.862  16.726 1.00 0.00 ? 46 ALA A CB   3  
ATOM 2963  H H    . ALA A 1 46 ? 5.952  -9.747  17.220 1.00 0.00 ? 46 ALA A H    3  
ATOM 2964  H HA   . ALA A 1 46 ? 4.181  -11.863 16.771 1.00 0.00 ? 46 ALA A HA   3  
ATOM 2965  H HB1  . ALA A 1 46 ? 3.194  -9.267  15.869 1.00 0.00 ? 46 ALA A HB1  3  
ATOM 2966  H HB2  . ALA A 1 46 ? 2.595  -10.330 17.143 1.00 0.00 ? 46 ALA A HB2  3  
ATOM 2967  H HB3  . ALA A 1 46 ? 3.932  -9.228  17.471 1.00 0.00 ? 46 ALA A HB3  3  
ATOM 2968  N N    . PHE A 1 47 ? 4.913  -10.125 14.054 1.00 0.00 ? 47 PHE A N    3  
ATOM 2969  C CA   . PHE A 1 47 ? 4.928  -10.178 12.597 1.00 0.00 ? 47 PHE A CA   3  
ATOM 2970  C C    . PHE A 1 47 ? 5.693  -11.404 12.106 1.00 0.00 ? 47 PHE A C    3  
ATOM 2971  O O    . PHE A 1 47 ? 5.250  -12.100 11.193 1.00 0.00 ? 47 PHE A O    3  
ATOM 2972  C CB   . PHE A 1 47 ? 5.558  -8.907  12.025 1.00 0.00 ? 47 PHE A CB   3  
ATOM 2973  C CG   . PHE A 1 47 ? 5.004  -7.644  12.619 1.00 0.00 ? 47 PHE A CG   3  
ATOM 2974  C CD1  . PHE A 1 47 ? 3.637  -7.477  12.774 1.00 0.00 ? 47 PHE A CD1  3  
ATOM 2975  C CD2  . PHE A 1 47 ? 5.849  -6.622  13.022 1.00 0.00 ? 47 PHE A CD2  3  
ATOM 2976  C CE1  . PHE A 1 47 ? 3.123  -6.316  13.321 1.00 0.00 ? 47 PHE A CE1  3  
ATOM 2977  C CE2  . PHE A 1 47 ? 5.341  -5.459  13.569 1.00 0.00 ? 47 PHE A CE2  3  
ATOM 2978  C CZ   . PHE A 1 47 ? 3.977  -5.305  13.718 1.00 0.00 ? 47 PHE A CZ   3  
ATOM 2979  H H    . PHE A 1 47 ? 5.274  -9.334  14.507 1.00 0.00 ? 47 PHE A H    3  
ATOM 2980  H HA   . PHE A 1 47 ? 3.906  -10.247 12.258 1.00 0.00 ? 47 PHE A HA   3  
ATOM 2981  H HB2  . PHE A 1 47 ? 6.621  -8.923  12.215 1.00 0.00 ? 47 PHE A HB2  3  
ATOM 2982  H HB3  . PHE A 1 47 ? 5.387  -8.877  10.960 1.00 0.00 ? 47 PHE A HB3  3  
ATOM 2983  H HD1  . PHE A 1 47 ? 2.968  -8.268  12.464 1.00 0.00 ? 47 PHE A HD1  3  
ATOM 2984  H HD2  . PHE A 1 47 ? 6.916  -6.740  12.905 1.00 0.00 ? 47 PHE A HD2  3  
ATOM 2985  H HE1  . PHE A 1 47 ? 2.056  -6.199  13.436 1.00 0.00 ? 47 PHE A HE1  3  
ATOM 2986  H HE2  . PHE A 1 47 ? 6.011  -4.670  13.879 1.00 0.00 ? 47 PHE A HE2  3  
ATOM 2987  H HZ   . PHE A 1 47 ? 3.578  -4.398  14.146 1.00 0.00 ? 47 PHE A HZ   3  
ATOM 2988  N N    . GLU A 1 48 ? 6.845  -11.660 12.718 1.00 0.00 ? 48 GLU A N    3  
ATOM 2989  C CA   . GLU A 1 48 ? 7.672  -12.800 12.342 1.00 0.00 ? 48 GLU A CA   3  
ATOM 2990  C C    . GLU A 1 48 ? 6.922  -14.111 12.559 1.00 0.00 ? 48 GLU A C    3  
ATOM 2991  O O    . GLU A 1 48 ? 7.011  -15.030 11.745 1.00 0.00 ? 48 GLU A O    3  
ATOM 2992  C CB   . GLU A 1 48 ? 8.972  -12.804 13.150 1.00 0.00 ? 48 GLU A CB   3  
ATOM 2993  C CG   . GLU A 1 48 ? 10.107 -12.049 12.480 1.00 0.00 ? 48 GLU A CG   3  
ATOM 2994  C CD   . GLU A 1 48 ? 9.653  -10.742 11.860 1.00 0.00 ? 48 GLU A CD   3  
ATOM 2995  O OE1  . GLU A 1 48 ? 9.142  -10.772 10.720 1.00 0.00 ? 48 GLU A OE1  3  
ATOM 2996  O OE2  . GLU A 1 48 ? 9.807  -9.689  12.513 1.00 0.00 ? 48 GLU A OE2  3  
ATOM 2997  H H    . GLU A 1 48 ? 7.145  -11.068 13.439 1.00 0.00 ? 48 GLU A H    3  
ATOM 2998  H HA   . GLU A 1 48 ? 7.911  -12.705 11.294 1.00 0.00 ? 48 GLU A HA   3  
ATOM 2999  H HB2  . GLU A 1 48 ? 8.785  -12.351 14.113 1.00 0.00 ? 48 GLU A HB2  3  
ATOM 3000  H HB3  . GLU A 1 48 ? 9.286  -13.826 13.298 1.00 0.00 ? 48 GLU A HB3  3  
ATOM 3001  H HG2  . GLU A 1 48 ? 10.865 -11.834 13.218 1.00 0.00 ? 48 GLU A HG2  3  
ATOM 3002  H HG3  . GLU A 1 48 ? 10.528 -12.671 11.704 1.00 0.00 ? 48 GLU A HG3  3  
ATOM 3003  N N    . GLU A 1 49 ? 6.185  -14.189 13.662 1.00 0.00 ? 49 GLU A N    3  
ATOM 3004  C CA   . GLU A 1 49 ? 5.421  -15.388 13.986 1.00 0.00 ? 49 GLU A CA   3  
ATOM 3005  C C    . GLU A 1 49 ? 4.219  -15.535 13.057 1.00 0.00 ? 49 GLU A C    3  
ATOM 3006  O O    . GLU A 1 49 ? 3.780  -16.647 12.765 1.00 0.00 ? 49 GLU A O    3  
ATOM 3007  C CB   . GLU A 1 49 ? 4.951  -15.343 15.442 1.00 0.00 ? 49 GLU A CB   3  
ATOM 3008  C CG   . GLU A 1 49 ? 4.080  -16.523 15.838 1.00 0.00 ? 49 GLU A CG   3  
ATOM 3009  C CD   . GLU A 1 49 ? 4.097  -16.786 17.331 1.00 0.00 ? 49 GLU A CD   3  
ATOM 3010  O OE1  . GLU A 1 49 ? 5.046  -17.441 17.808 1.00 0.00 ? 49 GLU A OE1  3  
ATOM 3011  O OE2  . GLU A 1 49 ? 3.159  -16.335 18.022 1.00 0.00 ? 49 GLU A OE2  3  
ATOM 3012  H H    . GLU A 1 49 ? 6.154  -13.423 14.272 1.00 0.00 ? 49 GLU A H    3  
ATOM 3013  H HA   . GLU A 1 49 ? 6.069  -16.241 13.853 1.00 0.00 ? 49 GLU A HA   3  
ATOM 3014  H HB2  . GLU A 1 49 ? 5.817  -15.328 16.087 1.00 0.00 ? 49 GLU A HB2  3  
ATOM 3015  H HB3  . GLU A 1 49 ? 4.384  -14.437 15.596 1.00 0.00 ? 49 GLU A HB3  3  
ATOM 3016  H HG2  . GLU A 1 49 ? 3.064  -16.322 15.534 1.00 0.00 ? 49 GLU A HG2  3  
ATOM 3017  H HG3  . GLU A 1 49 ? 4.438  -17.405 15.328 1.00 0.00 ? 49 GLU A HG3  3  
ATOM 3018  N N    . GLU A 1 50 ? 3.692  -14.405 12.597 1.00 0.00 ? 50 GLU A N    3  
ATOM 3019  C CA   . GLU A 1 50 ? 2.540  -14.408 11.703 1.00 0.00 ? 50 GLU A CA   3  
ATOM 3020  C C    . GLU A 1 50 ? 2.960  -14.753 10.277 1.00 0.00 ? 50 GLU A C    3  
ATOM 3021  O O    . GLU A 1 50 ? 2.237  -15.440 9.554  1.00 0.00 ? 50 GLU A O    3  
ATOM 3022  C CB   . GLU A 1 50 ? 1.844  -13.045 11.726 1.00 0.00 ? 50 GLU A CB   3  
ATOM 3023  C CG   . GLU A 1 50 ? 1.110  -12.759 13.025 1.00 0.00 ? 50 GLU A CG   3  
ATOM 3024  C CD   . GLU A 1 50 ? -0.263 -13.399 13.073 1.00 0.00 ? 50 GLU A CD   3  
ATOM 3025  O OE1  . GLU A 1 50 ? -0.356 -14.623 12.841 1.00 0.00 ? 50 GLU A OE1  3  
ATOM 3026  O OE2  . GLU A 1 50 ? -1.245 -12.676 13.341 1.00 0.00 ? 50 GLU A OE2  3  
ATOM 3027  H H    . GLU A 1 50 ? 4.086  -13.549 12.866 1.00 0.00 ? 50 GLU A H    3  
ATOM 3028  H HA   . GLU A 1 50 ? 1.850  -15.160 12.054 1.00 0.00 ? 50 GLU A HA   3  
ATOM 3029  H HB2  . GLU A 1 50 ? 2.585  -12.274 11.577 1.00 0.00 ? 50 GLU A HB2  3  
ATOM 3030  H HB3  . GLU A 1 50 ? 1.130  -13.006 10.917 1.00 0.00 ? 50 GLU A HB3  3  
ATOM 3031  H HG2  . GLU A 1 50 ? 1.697  -13.141 13.847 1.00 0.00 ? 50 GLU A HG2  3  
ATOM 3032  H HG3  . GLU A 1 50 ? 0.997  -11.690 13.131 1.00 0.00 ? 50 GLU A HG3  3  
ATOM 3033  N N    . PHE A 1 51 ? 4.132  -14.271 9.879  1.00 0.00 ? 51 PHE A N    3  
ATOM 3034  C CA   . PHE A 1 51 ? 4.648  -14.526 8.539  1.00 0.00 ? 51 PHE A CA   3  
ATOM 3035  C C    . PHE A 1 51 ? 5.360  -15.875 8.478  1.00 0.00 ? 51 PHE A C    3  
ATOM 3036  O O    . PHE A 1 51 ? 5.472  -16.482 7.414  1.00 0.00 ? 51 PHE A O    3  
ATOM 3037  C CB   . PHE A 1 51 ? 5.608  -13.411 8.118  1.00 0.00 ? 51 PHE A CB   3  
ATOM 3038  C CG   . PHE A 1 51 ? 4.935  -12.286 7.385  1.00 0.00 ? 51 PHE A CG   3  
ATOM 3039  C CD1  . PHE A 1 51 ? 4.155  -11.366 8.066  1.00 0.00 ? 51 PHE A CD1  3  
ATOM 3040  C CD2  . PHE A 1 51 ? 5.084  -12.148 6.014  1.00 0.00 ? 51 PHE A CD2  3  
ATOM 3041  C CE1  . PHE A 1 51 ? 3.534  -10.331 7.394  1.00 0.00 ? 51 PHE A CE1  3  
ATOM 3042  C CE2  . PHE A 1 51 ? 4.466  -11.114 5.336  1.00 0.00 ? 51 PHE A CE2  3  
ATOM 3043  C CZ   . PHE A 1 51 ? 3.691  -10.204 6.027  1.00 0.00 ? 51 PHE A CZ   3  
ATOM 3044  H H    . PHE A 1 51 ? 4.663  -13.730 10.501 1.00 0.00 ? 51 PHE A H    3  
ATOM 3045  H HA   . PHE A 1 51 ? 3.810  -14.543 7.859  1.00 0.00 ? 51 PHE A HA   3  
ATOM 3046  H HB2  . PHE A 1 51 ? 6.078  -12.999 8.998  1.00 0.00 ? 51 PHE A HB2  3  
ATOM 3047  H HB3  . PHE A 1 51 ? 6.367  -13.824 7.471  1.00 0.00 ? 51 PHE A HB3  3  
ATOM 3048  H HD1  . PHE A 1 51 ? 4.032  -11.464 9.135  1.00 0.00 ? 51 PHE A HD1  3  
ATOM 3049  H HD2  . PHE A 1 51 ? 5.691  -12.860 5.472  1.00 0.00 ? 51 PHE A HD2  3  
ATOM 3050  H HE1  . PHE A 1 51 ? 2.928  -9.620  7.936  1.00 0.00 ? 51 PHE A HE1  3  
ATOM 3051  H HE2  . PHE A 1 51 ? 4.591  -11.018 4.268  1.00 0.00 ? 51 PHE A HE2  3  
ATOM 3052  H HZ   . PHE A 1 51 ? 3.206  -9.396  5.500  1.00 0.00 ? 51 PHE A HZ   3  
ATOM 3053  N N    . GLY A 1 52 ? 5.840  -16.336 9.629  1.00 0.00 ? 52 GLY A N    3  
ATOM 3054  C CA   . GLY A 1 52 ? 6.535  -17.609 9.685  1.00 0.00 ? 52 GLY A CA   3  
ATOM 3055  C C    . GLY A 1 52 ? 8.021  -17.470 9.419  1.00 0.00 ? 52 GLY A C    3  
ATOM 3056  O O    . GLY A 1 52 ? 8.673  -18.420 8.983  1.00 0.00 ? 52 GLY A O    3  
ATOM 3057  H H    . GLY A 1 52 ? 5.721  -15.808 10.446 1.00 0.00 ? 52 GLY A H    3  
ATOM 3058  H HA2  . GLY A 1 52 ? 6.394  -18.041 10.664 1.00 0.00 ? 52 GLY A HA2  3  
ATOM 3059  H HA3  . GLY A 1 52 ? 6.110  -18.272 8.946  1.00 0.00 ? 52 GLY A HA3  3  
ATOM 3060  N N    . VAL A 1 53 ? 8.559  -16.283 9.680  1.00 0.00 ? 53 VAL A N    3  
ATOM 3061  C CA   . VAL A 1 53 ? 9.978  -16.023 9.465  1.00 0.00 ? 53 VAL A CA   3  
ATOM 3062  C C    . VAL A 1 53 ? 10.727 -15.936 10.790 1.00 0.00 ? 53 VAL A C    3  
ATOM 3063  O O    . VAL A 1 53 ? 10.186 -15.466 11.790 1.00 0.00 ? 53 VAL A O    3  
ATOM 3064  C CB   . VAL A 1 53 ? 10.196 -14.717 8.678  1.00 0.00 ? 53 VAL A CB   3  
ATOM 3065  C CG1  . VAL A 1 53 ? 9.594  -14.826 7.285  1.00 0.00 ? 53 VAL A CG1  3  
ATOM 3066  C CG2  . VAL A 1 53 ? 9.606  -13.536 9.432  1.00 0.00 ? 53 VAL A CG2  3  
ATOM 3067  H H    . VAL A 1 53 ? 7.989  -15.565 10.026 1.00 0.00 ? 53 VAL A H    3  
ATOM 3068  H HA   . VAL A 1 53 ? 10.383 -16.840 8.886  1.00 0.00 ? 53 VAL A HA   3  
ATOM 3069  H HB   . VAL A 1 53 ? 11.259 -14.556 8.574  1.00 0.00 ? 53 VAL A HB   3  
ATOM 3070  H HG11 . VAL A 1 53 ? 10.153 -15.547 6.707  1.00 0.00 ? 53 VAL A HG11 3  
ATOM 3071  H HG12 . VAL A 1 53 ? 8.564  -15.145 7.362  1.00 0.00 ? 53 VAL A HG12 3  
ATOM 3072  H HG13 . VAL A 1 53 ? 9.638  -13.863 6.798  1.00 0.00 ? 53 VAL A HG13 3  
ATOM 3073  H HG21 . VAL A 1 53 ? 10.353 -12.762 9.530  1.00 0.00 ? 53 VAL A HG21 3  
ATOM 3074  H HG22 . VAL A 1 53 ? 8.756  -13.149 8.888  1.00 0.00 ? 53 VAL A HG22 3  
ATOM 3075  H HG23 . VAL A 1 53 ? 9.288  -13.856 10.413 1.00 0.00 ? 53 VAL A HG23 3  
ATOM 3076  N N    . GLU A 1 54 ? 11.976 -16.392 10.789 1.00 0.00 ? 54 GLU A N    3  
ATOM 3077  C CA   . GLU A 1 54 ? 12.799 -16.365 11.992 1.00 0.00 ? 54 GLU A CA   3  
ATOM 3078  C C    . GLU A 1 54 ? 14.014 -15.462 11.800 1.00 0.00 ? 54 GLU A C    3  
ATOM 3079  O O    . GLU A 1 54 ? 14.826 -15.679 10.899 1.00 0.00 ? 54 GLU A O    3  
ATOM 3080  C CB   . GLU A 1 54 ? 13.254 -17.780 12.356 1.00 0.00 ? 54 GLU A CB   3  
ATOM 3081  C CG   . GLU A 1 54 ? 12.108 -18.761 12.535 1.00 0.00 ? 54 GLU A CG   3  
ATOM 3082  C CD   . GLU A 1 54 ? 12.553 -20.072 13.154 1.00 0.00 ? 54 GLU A CD   3  
ATOM 3083  O OE1  . GLU A 1 54 ? 13.451 -20.044 14.021 1.00 0.00 ? 54 GLU A OE1  3  
ATOM 3084  O OE2  . GLU A 1 54 ? 12.002 -21.125 12.771 1.00 0.00 ? 54 GLU A OE2  3  
ATOM 3085  H H    . GLU A 1 54 ? 12.352 -16.755 9.960  1.00 0.00 ? 54 GLU A H    3  
ATOM 3086  H HA   . GLU A 1 54 ? 12.197 -15.972 12.797 1.00 0.00 ? 54 GLU A HA   3  
ATOM 3087  H HB2  . GLU A 1 54 ? 13.900 -18.150 11.574 1.00 0.00 ? 54 GLU A HB2  3  
ATOM 3088  H HB3  . GLU A 1 54 ? 13.812 -17.738 13.280 1.00 0.00 ? 54 GLU A HB3  3  
ATOM 3089  H HG2  . GLU A 1 54 ? 11.364 -18.313 13.176 1.00 0.00 ? 54 GLU A HG2  3  
ATOM 3090  H HG3  . GLU A 1 54 ? 11.672 -18.966 11.568 1.00 0.00 ? 54 GLU A HG3  3  
ATOM 3091  N N    . ILE A 1 55 ? 14.131 -14.449 12.652 1.00 0.00 ? 55 ILE A N    3  
ATOM 3092  C CA   . ILE A 1 55 ? 15.246 -13.513 12.576 1.00 0.00 ? 55 ILE A CA   3  
ATOM 3093  C C    . ILE A 1 55 ? 15.966 -13.407 13.916 1.00 0.00 ? 55 ILE A C    3  
ATOM 3094  O O    . ILE A 1 55 ? 15.400 -13.675 14.976 1.00 0.00 ? 55 ILE A O    3  
ATOM 3095  C CB   . ILE A 1 55 ? 14.777 -12.111 12.146 1.00 0.00 ? 55 ILE A CB   3  
ATOM 3096  C CG1  . ILE A 1 55 ? 13.518 -11.711 12.919 1.00 0.00 ? 55 ILE A CG1  3  
ATOM 3097  C CG2  . ILE A 1 55 ? 14.518 -12.076 10.647 1.00 0.00 ? 55 ILE A CG2  3  
ATOM 3098  C CD1  . ILE A 1 55 ? 13.095 -10.278 12.684 1.00 0.00 ? 55 ILE A CD1  3  
ATOM 3099  H H    . ILE A 1 55 ? 13.452 -14.329 13.348 1.00 0.00 ? 55 ILE A H    3  
ATOM 3100  H HA   . ILE A 1 55 ? 15.941 -13.882 11.835 1.00 0.00 ? 55 ILE A HA   3  
ATOM 3101  H HB   . ILE A 1 55 ? 15.565 -11.408 12.367 1.00 0.00 ? 55 ILE A HB   3  
ATOM 3102  H HG12 . ILE A 1 55 ? 12.702 -12.351 12.620 1.00 0.00 ? 55 ILE A HG12 3  
ATOM 3103  H HG13 . ILE A 1 55 ? 13.700 -11.836 13.976 1.00 0.00 ? 55 ILE A HG13 3  
ATOM 3104  H HG21 . ILE A 1 55 ? 15.460 -12.033 10.120 1.00 0.00 ? 55 ILE A HG21 3  
ATOM 3105  H HG22 . ILE A 1 55 ? 13.983 -12.967 10.354 1.00 0.00 ? 55 ILE A HG22 3  
ATOM 3106  H HG23 . ILE A 1 55 ? 13.929 -11.205 10.403 1.00 0.00 ? 55 ILE A HG23 3  
ATOM 3107  H HD11 . ILE A 1 55 ? 12.242 -10.258 12.023 1.00 0.00 ? 55 ILE A HD11 3  
ATOM 3108  H HD12 . ILE A 1 55 ? 12.833 -9.821  13.626 1.00 0.00 ? 55 ILE A HD12 3  
ATOM 3109  H HD13 . ILE A 1 55 ? 13.911 -9.731  12.234 1.00 0.00 ? 55 ILE A HD13 3  
ATOM 3110  N N    . PRO A 1 56 ? 17.245 -13.005 13.871 1.00 0.00 ? 56 PRO A N    3  
ATOM 3111  C CA   . PRO A 1 56 ? 18.070 -12.851 15.073 1.00 0.00 ? 56 PRO A CA   3  
ATOM 3112  C C    . PRO A 1 56 ? 17.627 -11.672 15.933 1.00 0.00 ? 56 PRO A C    3  
ATOM 3113  O O    . PRO A 1 56 ? 16.964 -10.753 15.450 1.00 0.00 ? 56 PRO A O    3  
ATOM 3114  C CB   . PRO A 1 56 ? 19.472 -12.606 14.512 1.00 0.00 ? 56 PRO A CB   3  
ATOM 3115  C CG   . PRO A 1 56 ? 19.244 -12.029 13.158 1.00 0.00 ? 56 PRO A CG   3  
ATOM 3116  C CD   . PRO A 1 56 ? 17.984 -12.668 12.643 1.00 0.00 ? 56 PRO A CD   3  
ATOM 3117  H HA   . PRO A 1 56 ? 18.071 -13.750 15.671 1.00 0.00 ? 56 PRO A HA   3  
ATOM 3118  H HB2  . PRO A 1 56 ? 20.004 -11.916 15.152 1.00 0.00 ? 56 PRO A HB2  3  
ATOM 3119  H HB3  . PRO A 1 56 ? 20.010 -13.541 14.457 1.00 0.00 ? 56 PRO A HB3  3  
ATOM 3120  H HG2  . PRO A 1 56 ? 19.118 -10.959 13.231 1.00 0.00 ? 56 PRO A HG2  3  
ATOM 3121  H HG3  . PRO A 1 56 ? 20.076 -12.267 12.512 1.00 0.00 ? 56 PRO A HG3  3  
ATOM 3122  H HD2  . PRO A 1 56 ? 17.427 -11.970 12.036 1.00 0.00 ? 56 PRO A HD2  3  
ATOM 3123  H HD3  . PRO A 1 56 ? 18.217 -13.559 12.078 1.00 0.00 ? 56 PRO A HD3  3  
ATOM 3124  N N    . ASP A 1 57 ? 17.997 -11.704 17.208 1.00 0.00 ? 57 ASP A N    3  
ATOM 3125  C CA   . ASP A 1 57 ? 17.639 -10.636 18.135 1.00 0.00 ? 57 ASP A CA   3  
ATOM 3126  C C    . ASP A 1 57 ? 18.439 -9.371  17.842 1.00 0.00 ? 57 ASP A C    3  
ATOM 3127  O O    . ASP A 1 57 ? 18.005 -8.263  18.159 1.00 0.00 ? 57 ASP A O    3  
ATOM 3128  C CB   . ASP A 1 57 ? 17.879 -11.083 19.578 1.00 0.00 ? 57 ASP A CB   3  
ATOM 3129  C CG   . ASP A 1 57 ? 17.545 -9.998  20.583 1.00 0.00 ? 57 ASP A CG   3  
ATOM 3130  O OD1  . ASP A 1 57 ? 16.368 -9.584  20.639 1.00 0.00 ? 57 ASP A OD1  3  
ATOM 3131  O OD2  . ASP A 1 57 ? 18.460 -9.563  21.313 1.00 0.00 ? 57 ASP A OD2  3  
ATOM 3132  H H    . ASP A 1 57 ? 18.524 -12.463 17.534 1.00 0.00 ? 57 ASP A H    3  
ATOM 3133  H HA   . ASP A 1 57 ? 16.589 -10.422 18.005 1.00 0.00 ? 57 ASP A HA   3  
ATOM 3134  H HB2  . ASP A 1 57 ? 17.263 -11.945 19.789 1.00 0.00 ? 57 ASP A HB2  3  
ATOM 3135  H HB3  . ASP A 1 57 ? 18.919 -11.351 19.697 1.00 0.00 ? 57 ASP A HB3  3  
ATOM 3136  N N    . ASP A 1 58 ? 19.608 -9.543  17.235 1.00 0.00 ? 58 ASP A N    3  
ATOM 3137  C CA   . ASP A 1 58 ? 20.469 -8.415  16.899 1.00 0.00 ? 58 ASP A CA   3  
ATOM 3138  C C    . ASP A 1 58 ? 19.848 -7.569  15.791 1.00 0.00 ? 58 ASP A C    3  
ATOM 3139  O O    . ASP A 1 58 ? 19.807 -6.343  15.882 1.00 0.00 ? 58 ASP A O    3  
ATOM 3140  C CB   . ASP A 1 58 ? 21.849 -8.911  16.466 1.00 0.00 ? 58 ASP A CB   3  
ATOM 3141  C CG   . ASP A 1 58 ? 22.520 -9.759  17.529 1.00 0.00 ? 58 ASP A CG   3  
ATOM 3142  O OD1  . ASP A 1 58 ? 22.218 -9.559  18.724 1.00 0.00 ? 58 ASP A OD1  3  
ATOM 3143  O OD2  . ASP A 1 58 ? 23.347 -10.621 17.166 1.00 0.00 ? 58 ASP A OD2  3  
ATOM 3144  H H    . ASP A 1 58 ? 19.899 -10.451 17.008 1.00 0.00 ? 58 ASP A H    3  
ATOM 3145  H HA   . ASP A 1 58 ? 20.576 -7.805  17.783 1.00 0.00 ? 58 ASP A HA   3  
ATOM 3146  H HB2  . ASP A 1 58 ? 21.746 -9.506  15.570 1.00 0.00 ? 58 ASP A HB2  3  
ATOM 3147  H HB3  . ASP A 1 58 ? 22.481 -8.060  16.258 1.00 0.00 ? 58 ASP A HB3  3  
ATOM 3148  N N    . ALA A 1 59 ? 19.366 -8.234  14.746 1.00 0.00 ? 59 ALA A N    3  
ATOM 3149  C CA   . ALA A 1 59 ? 18.747 -7.543  13.621 1.00 0.00 ? 59 ALA A CA   3  
ATOM 3150  C C    . ALA A 1 59 ? 17.553 -6.713  14.078 1.00 0.00 ? 59 ALA A C    3  
ATOM 3151  O O    . ALA A 1 59 ? 17.290 -5.638  13.538 1.00 0.00 ? 59 ALA A O    3  
ATOM 3152  C CB   . ALA A 1 59 ? 18.321 -8.544  12.557 1.00 0.00 ? 59 ALA A CB   3  
ATOM 3153  H H    . ALA A 1 59 ? 19.428 -9.211  14.731 1.00 0.00 ? 59 ALA A H    3  
ATOM 3154  H HA   . ALA A 1 59 ? 19.486 -6.885  13.186 1.00 0.00 ? 59 ALA A HA   3  
ATOM 3155  H HB1  . ALA A 1 59 ? 18.000 -8.013  11.673 1.00 0.00 ? 59 ALA A HB1  3  
ATOM 3156  H HB2  . ALA A 1 59 ? 19.155 -9.184  12.311 1.00 0.00 ? 59 ALA A HB2  3  
ATOM 3157  H HB3  . ALA A 1 59 ? 17.505 -9.143  12.933 1.00 0.00 ? 59 ALA A HB3  3  
ATOM 3158  N N    . ALA A 1 60 ? 16.832 -7.218  15.073 1.00 0.00 ? 60 ALA A N    3  
ATOM 3159  C CA   . ALA A 1 60 ? 15.666 -6.521  15.603 1.00 0.00 ? 60 ALA A CA   3  
ATOM 3160  C C    . ALA A 1 60 ? 16.032 -5.117  16.073 1.00 0.00 ? 60 ALA A C    3  
ATOM 3161  O O    . ALA A 1 60 ? 15.182 -4.229  16.120 1.00 0.00 ? 60 ALA A O    3  
ATOM 3162  C CB   . ALA A 1 60 ? 15.049 -7.317  16.743 1.00 0.00 ? 60 ALA A CB   3  
ATOM 3163  H H    . ALA A 1 60 ? 17.092 -8.079  15.462 1.00 0.00 ? 60 ALA A H    3  
ATOM 3164  H HA   . ALA A 1 60 ? 14.935 -6.446  14.811 1.00 0.00 ? 60 ALA A HA   3  
ATOM 3165  H HB1  . ALA A 1 60 ? 13.989 -7.434  16.566 1.00 0.00 ? 60 ALA A HB1  3  
ATOM 3166  H HB2  . ALA A 1 60 ? 15.514 -8.290  16.796 1.00 0.00 ? 60 ALA A HB2  3  
ATOM 3167  H HB3  . ALA A 1 60 ? 15.203 -6.792  17.673 1.00 0.00 ? 60 ALA A HB3  3  
ATOM 3168  N N    . GLU A 1 61 ? 17.301 -4.926  16.419 1.00 0.00 ? 61 GLU A N    3  
ATOM 3169  C CA   . GLU A 1 61 ? 17.777 -3.630  16.887 1.00 0.00 ? 61 GLU A CA   3  
ATOM 3170  C C    . GLU A 1 61 ? 17.657 -2.577  15.789 1.00 0.00 ? 61 GLU A C    3  
ATOM 3171  O O    . GLU A 1 61 ? 17.568 -1.380  16.066 1.00 0.00 ? 61 GLU A O    3  
ATOM 3172  C CB   . GLU A 1 61 ? 19.231 -3.733  17.352 1.00 0.00 ? 61 GLU A CB   3  
ATOM 3173  C CG   . GLU A 1 61 ? 19.418 -4.612  18.578 1.00 0.00 ? 61 GLU A CG   3  
ATOM 3174  C CD   . GLU A 1 61 ? 19.139 -3.873  19.872 1.00 0.00 ? 61 GLU A CD   3  
ATOM 3175  O OE1  . GLU A 1 61 ? 19.966 -3.019  20.257 1.00 0.00 ? 61 GLU A OE1  3  
ATOM 3176  O OE2  . GLU A 1 61 ? 18.096 -4.148  20.501 1.00 0.00 ? 61 GLU A OE2  3  
ATOM 3177  H H    . GLU A 1 61 ? 17.931 -5.674  16.360 1.00 0.00 ? 61 GLU A H    3  
ATOM 3178  H HA   . GLU A 1 61 ? 17.162 -3.332  17.723 1.00 0.00 ? 61 GLU A HA   3  
ATOM 3179  H HB2  . GLU A 1 61 ? 19.826 -4.141  16.548 1.00 0.00 ? 61 GLU A HB2  3  
ATOM 3180  H HB3  . GLU A 1 61 ? 19.592 -2.743  17.587 1.00 0.00 ? 61 GLU A HB3  3  
ATOM 3181  H HG2  . GLU A 1 61 ? 18.743 -5.452  18.508 1.00 0.00 ? 61 GLU A HG2  3  
ATOM 3182  H HG3  . GLU A 1 61 ? 20.436 -4.970  18.596 1.00 0.00 ? 61 GLU A HG3  3  
ATOM 3183  N N    . THR A 1 62 ? 17.654 -3.031  14.539 1.00 0.00 ? 62 THR A N    3  
ATOM 3184  C CA   . THR A 1 62 ? 17.547 -2.131  13.399 1.00 0.00 ? 62 THR A CA   3  
ATOM 3185  C C    . THR A 1 62 ? 16.109 -1.663  13.201 1.00 0.00 ? 62 THR A C    3  
ATOM 3186  O O    . THR A 1 62 ? 15.860 -0.658  12.534 1.00 0.00 ? 62 THR A O    3  
ATOM 3187  C CB   . THR A 1 62 ? 18.038 -2.804  12.103 1.00 0.00 ? 62 THR A CB   3  
ATOM 3188  O OG1  . THR A 1 62 ? 17.087 -3.783  11.669 1.00 0.00 ? 62 THR A OG1  3  
ATOM 3189  C CG2  . THR A 1 62 ? 19.392 -3.463  12.316 1.00 0.00 ? 62 THR A CG2  3  
ATOM 3190  H H    . THR A 1 62 ? 17.728 -3.996  14.383 1.00 0.00 ? 62 THR A H    3  
ATOM 3191  H HA   . THR A 1 62 ? 18.172 -1.271  13.592 1.00 0.00 ? 62 THR A HA   3  
ATOM 3192  H HB   . THR A 1 62 ? 18.138 -2.047  11.338 1.00 0.00 ? 62 THR A HB   3  
ATOM 3193  H HG1  . THR A 1 62 ? 16.842 -3.609  10.757 1.00 0.00 ? 62 THR A HG1  3  
ATOM 3194  H HG21 . THR A 1 62 ? 20.035 -2.795  12.870 1.00 0.00 ? 62 THR A HG21 3  
ATOM 3195  H HG22 . THR A 1 62 ? 19.840 -3.682  11.358 1.00 0.00 ? 62 THR A HG22 3  
ATOM 3196  H HG23 . THR A 1 62 ? 19.262 -4.380  12.871 1.00 0.00 ? 62 THR A HG23 3  
ATOM 3197  N N    . ILE A 1 63 ? 15.168 -2.396  13.786 1.00 0.00 ? 63 ILE A N    3  
ATOM 3198  C CA   . ILE A 1 63 ? 13.755 -2.054  13.675 1.00 0.00 ? 63 ILE A CA   3  
ATOM 3199  C C    . ILE A 1 63 ? 13.453 -0.733  14.374 1.00 0.00 ? 63 ILE A C    3  
ATOM 3200  O O    . ILE A 1 63 ? 13.157 -0.703  15.569 1.00 0.00 ? 63 ILE A O    3  
ATOM 3201  C CB   . ILE A 1 63 ? 12.861 -3.155  14.275 1.00 0.00 ? 63 ILE A CB   3  
ATOM 3202  C CG1  . ILE A 1 63 ? 13.264 -4.525  13.726 1.00 0.00 ? 63 ILE A CG1  3  
ATOM 3203  C CG2  . ILE A 1 63 ? 11.397 -2.869  13.977 1.00 0.00 ? 63 ILE A CG2  3  
ATOM 3204  C CD1  . ILE A 1 63 ? 13.170 -4.624  12.220 1.00 0.00 ? 63 ILE A CD1  3  
ATOM 3205  H H    . ILE A 1 63 ? 15.430 -3.185  14.304 1.00 0.00 ? 63 ILE A H    3  
ATOM 3206  H HA   . ILE A 1 63 ? 13.518 -1.957  12.626 1.00 0.00 ? 63 ILE A HA   3  
ATOM 3207  H HB   . ILE A 1 63 ? 12.993 -3.151  15.346 1.00 0.00 ? 63 ILE A HB   3  
ATOM 3208  H HG12 . ILE A 1 63 ? 14.284 -4.734  14.009 1.00 0.00 ? 63 ILE A HG12 3  
ATOM 3209  H HG13 . ILE A 1 63 ? 12.616 -5.279  14.150 1.00 0.00 ? 63 ILE A HG13 3  
ATOM 3210  H HG21 . ILE A 1 63 ? 10.883 -2.627  14.896 1.00 0.00 ? 63 ILE A HG21 3  
ATOM 3211  H HG22 . ILE A 1 63 ? 11.325 -2.035  13.295 1.00 0.00 ? 63 ILE A HG22 3  
ATOM 3212  H HG23 . ILE A 1 63 ? 10.943 -3.740  13.530 1.00 0.00 ? 63 ILE A HG23 3  
ATOM 3213  H HD11 . ILE A 1 63 ? 13.980 -4.068  11.771 1.00 0.00 ? 63 ILE A HD11 3  
ATOM 3214  H HD12 . ILE A 1 63 ? 13.235 -5.660  11.922 1.00 0.00 ? 63 ILE A HD12 3  
ATOM 3215  H HD13 . ILE A 1 63 ? 12.227 -4.214  11.890 1.00 0.00 ? 63 ILE A HD13 3  
ATOM 3216  N N    . LEU A 1 64 ? 13.528 0.359   13.620 1.00 0.00 ? 64 LEU A N    3  
ATOM 3217  C CA   . LEU A 1 64 ? 13.261 1.685   14.166 1.00 0.00 ? 64 LEU A CA   3  
ATOM 3218  C C    . LEU A 1 64 ? 11.960 2.252   13.606 1.00 0.00 ? 64 LEU A C    3  
ATOM 3219  O O    . LEU A 1 64 ? 11.033 2.565   14.353 1.00 0.00 ? 64 LEU A O    3  
ATOM 3220  C CB   . LEU A 1 64 ? 14.421 2.631   13.851 1.00 0.00 ? 64 LEU A CB   3  
ATOM 3221  C CG   . LEU A 1 64 ? 15.780 2.244   14.435 1.00 0.00 ? 64 LEU A CG   3  
ATOM 3222  C CD1  . LEU A 1 64 ? 16.900 2.975   13.710 1.00 0.00 ? 64 LEU A CD1  3  
ATOM 3223  C CD2  . LEU A 1 64 ? 15.824 2.542   15.926 1.00 0.00 ? 64 LEU A CD2  3  
ATOM 3224  H H    . LEU A 1 64 ? 13.769 0.272   12.674 1.00 0.00 ? 64 LEU A H    3  
ATOM 3225  H HA   . LEU A 1 64 ? 13.166 1.589   15.237 1.00 0.00 ? 64 LEU A HA   3  
ATOM 3226  H HB2  . LEU A 1 64 ? 14.524 2.681   12.778 1.00 0.00 ? 64 LEU A HB2  3  
ATOM 3227  H HB3  . LEU A 1 64 ? 14.162 3.609   14.232 1.00 0.00 ? 64 LEU A HB3  3  
ATOM 3228  H HG   . LEU A 1 64 ? 15.933 1.182   14.300 1.00 0.00 ? 64 LEU A HG   3  
ATOM 3229  H HD11 . LEU A 1 64 ? 17.193 2.411   12.838 1.00 0.00 ? 64 LEU A HD11 3  
ATOM 3230  H HD12 . LEU A 1 64 ? 17.747 3.082   14.372 1.00 0.00 ? 64 LEU A HD12 3  
ATOM 3231  H HD13 . LEU A 1 64 ? 16.554 3.953   13.408 1.00 0.00 ? 64 LEU A HD13 3  
ATOM 3232  H HD21 . LEU A 1 64 ? 16.277 3.509   16.087 1.00 0.00 ? 64 LEU A HD21 3  
ATOM 3233  H HD22 . LEU A 1 64 ? 16.407 1.783   16.428 1.00 0.00 ? 64 LEU A HD22 3  
ATOM 3234  H HD23 . LEU A 1 64 ? 14.819 2.545   16.322 1.00 0.00 ? 64 LEU A HD23 3  
ATOM 3235  N N    . THR A 1 65 ? 11.897 2.381   12.284 1.00 0.00 ? 65 THR A N    3  
ATOM 3236  C CA   . THR A 1 65 ? 10.711 2.909   11.623 1.00 0.00 ? 65 THR A CA   3  
ATOM 3237  C C    . THR A 1 65 ? 9.944  1.805   10.904 1.00 0.00 ? 65 THR A C    3  
ATOM 3238  O O    . THR A 1 65 ? 10.463 0.707   10.700 1.00 0.00 ? 65 THR A O    3  
ATOM 3239  C CB   . THR A 1 65 ? 11.075 4.010   10.609 1.00 0.00 ? 65 THR A CB   3  
ATOM 3240  O OG1  . THR A 1 65 ? 12.070 3.527   9.699  1.00 0.00 ? 65 THR A OG1  3  
ATOM 3241  C CG2  . THR A 1 65 ? 11.591 5.251   11.320 1.00 0.00 ? 65 THR A CG2  3  
ATOM 3242  H H    . THR A 1 65 ? 12.669 2.114   11.742 1.00 0.00 ? 65 THR A H    3  
ATOM 3243  H HA   . THR A 1 65 ? 10.073 3.343   12.379 1.00 0.00 ? 65 THR A HA   3  
ATOM 3244  H HB   . THR A 1 65 ? 10.187 4.274   10.053 1.00 0.00 ? 65 THR A HB   3  
ATOM 3245  H HG1  . THR A 1 65 ? 12.944 3.732   10.041 1.00 0.00 ? 65 THR A HG1  3  
ATOM 3246  H HG21 . THR A 1 65 ? 11.919 4.987   12.314 1.00 0.00 ? 65 THR A HG21 3  
ATOM 3247  H HG22 . THR A 1 65 ? 10.801 5.984   11.384 1.00 0.00 ? 65 THR A HG22 3  
ATOM 3248  H HG23 . THR A 1 65 ? 12.421 5.665   10.766 1.00 0.00 ? 65 THR A HG23 3  
ATOM 3249  N N    . VAL A 1 66 ? 8.707  2.103   10.520 1.00 0.00 ? 66 VAL A N    3  
ATOM 3250  C CA   . VAL A 1 66 ? 7.869  1.135   9.822  1.00 0.00 ? 66 VAL A CA   3  
ATOM 3251  C C    . VAL A 1 66 ? 8.598  0.544   8.620  1.00 0.00 ? 66 VAL A C    3  
ATOM 3252  O O    . VAL A 1 66 ? 8.546  -0.661  8.380  1.00 0.00 ? 66 VAL A O    3  
ATOM 3253  C CB   . VAL A 1 66 ? 6.551  1.774   9.346  1.00 0.00 ? 66 VAL A CB   3  
ATOM 3254  C CG1  . VAL A 1 66 ? 5.715  0.763   8.577  1.00 0.00 ? 66 VAL A CG1  3  
ATOM 3255  C CG2  . VAL A 1 66 ? 5.773  2.332   10.528 1.00 0.00 ? 66 VAL A CG2  3  
ATOM 3256  H H    . VAL A 1 66 ? 8.349  2.995   10.711 1.00 0.00 ? 66 VAL A H    3  
ATOM 3257  H HA   . VAL A 1 66 ? 7.631  0.339   10.513 1.00 0.00 ? 66 VAL A HA   3  
ATOM 3258  H HB   . VAL A 1 66 ? 6.790  2.591   8.681  1.00 0.00 ? 66 VAL A HB   3  
ATOM 3259  H HG11 . VAL A 1 66 ? 5.816  0.945   7.517  1.00 0.00 ? 66 VAL A HG11 3  
ATOM 3260  H HG12 . VAL A 1 66 ? 6.055  -0.236  8.806  1.00 0.00 ? 66 VAL A HG12 3  
ATOM 3261  H HG13 . VAL A 1 66 ? 4.677  0.864   8.860  1.00 0.00 ? 66 VAL A HG13 3  
ATOM 3262  H HG21 . VAL A 1 66 ? 6.463  2.743   11.250 1.00 0.00 ? 66 VAL A HG21 3  
ATOM 3263  H HG22 . VAL A 1 66 ? 5.105  3.109   10.186 1.00 0.00 ? 66 VAL A HG22 3  
ATOM 3264  H HG23 . VAL A 1 66 ? 5.199  1.542   10.988 1.00 0.00 ? 66 VAL A HG23 3  
ATOM 3265  N N    . GLY A 1 67 ? 9.278  1.403   7.866  1.00 0.00 ? 67 GLY A N    3  
ATOM 3266  C CA   . GLY A 1 67 ? 10.009 0.948   6.698  1.00 0.00 ? 67 GLY A CA   3  
ATOM 3267  C C    . GLY A 1 67 ? 10.944 -0.203  7.011  1.00 0.00 ? 67 GLY A C    3  
ATOM 3268  O O    . GLY A 1 67 ? 11.018 -1.174  6.258  1.00 0.00 ? 67 GLY A O    3  
ATOM 3269  H H    . GLY A 1 67 ? 9.285  2.354   8.106  1.00 0.00 ? 67 GLY A H    3  
ATOM 3270  H HA2  . GLY A 1 67 ? 9.302  0.629   5.946  1.00 0.00 ? 67 GLY A HA2  3  
ATOM 3271  H HA3  . GLY A 1 67 ? 10.588 1.771   6.306  1.00 0.00 ? 67 GLY A HA3  3  
ATOM 3272  N N    . ASP A 1 68 ? 11.661 -0.095  8.124  1.00 0.00 ? 68 ASP A N    3  
ATOM 3273  C CA   . ASP A 1 68 ? 12.597 -1.134  8.534  1.00 0.00 ? 68 ASP A CA   3  
ATOM 3274  C C    . ASP A 1 68 ? 11.870 -2.451  8.788  1.00 0.00 ? 68 ASP A C    3  
ATOM 3275  O O    . ASP A 1 68 ? 12.201 -3.478  8.196  1.00 0.00 ? 68 ASP A O    3  
ATOM 3276  C CB   . ASP A 1 68 ? 13.351 -0.703  9.793  1.00 0.00 ? 68 ASP A CB   3  
ATOM 3277  C CG   . ASP A 1 68 ? 14.323 0.429   9.527  1.00 0.00 ? 68 ASP A CG   3  
ATOM 3278  O OD1  . ASP A 1 68 ? 14.759 0.577   8.366  1.00 0.00 ? 68 ASP A OD1  3  
ATOM 3279  O OD2  . ASP A 1 68 ? 14.647 1.169   10.480 1.00 0.00 ? 68 ASP A OD2  3  
ATOM 3280  H H    . ASP A 1 68 ? 11.558 0.704   8.683  1.00 0.00 ? 68 ASP A H    3  
ATOM 3281  H HA   . ASP A 1 68 ? 13.306 -1.278  7.733  1.00 0.00 ? 68 ASP A HA   3  
ATOM 3282  H HB2  . ASP A 1 68 ? 12.639 -0.374  10.537 1.00 0.00 ? 68 ASP A HB2  3  
ATOM 3283  H HB3  . ASP A 1 68 ? 13.905 -1.546  10.180 1.00 0.00 ? 68 ASP A HB3  3  
ATOM 3284  N N    . ALA A 1 69 ? 10.879 -2.413  9.672  1.00 0.00 ? 69 ALA A N    3  
ATOM 3285  C CA   . ALA A 1 69 ? 10.104 -3.603  10.003 1.00 0.00 ? 69 ALA A CA   3  
ATOM 3286  C C    . ALA A 1 69 ? 9.507  -4.235  8.751  1.00 0.00 ? 69 ALA A C    3  
ATOM 3287  O O    . ALA A 1 69 ? 9.733  -5.411  8.468  1.00 0.00 ? 69 ALA A O    3  
ATOM 3288  C CB   . ALA A 1 69 ? 9.006  -3.258  10.998 1.00 0.00 ? 69 ALA A CB   3  
ATOM 3289  H H    . ALA A 1 69 ? 10.662 -1.564  10.111 1.00 0.00 ? 69 ALA A H    3  
ATOM 3290  H HA   . ALA A 1 69 ? 10.769 -4.314  10.471 1.00 0.00 ? 69 ALA A HA   3  
ATOM 3291  H HB1  . ALA A 1 69 ? 8.960  -2.186  11.124 1.00 0.00 ? 69 ALA A HB1  3  
ATOM 3292  H HB2  . ALA A 1 69 ? 8.058  -3.618  10.627 1.00 0.00 ? 69 ALA A HB2  3  
ATOM 3293  H HB3  . ALA A 1 69 ? 9.222  -3.723  11.948 1.00 0.00 ? 69 ALA A HB3  3  
ATOM 3294  N N    . VAL A 1 70 ? 8.741  -3.446  8.003  1.00 0.00 ? 70 VAL A N    3  
ATOM 3295  C CA   . VAL A 1 70 ? 8.111  -3.929  6.780  1.00 0.00 ? 70 VAL A CA   3  
ATOM 3296  C C    . VAL A 1 70 ? 9.142  -4.526  5.829  1.00 0.00 ? 70 VAL A C    3  
ATOM 3297  O O    . VAL A 1 70 ? 9.022  -5.678  5.410  1.00 0.00 ? 70 VAL A O    3  
ATOM 3298  C CB   . VAL A 1 70 ? 7.354  -2.800  6.055  1.00 0.00 ? 70 VAL A CB   3  
ATOM 3299  C CG1  . VAL A 1 70 ? 6.733  -3.315  4.766  1.00 0.00 ? 70 VAL A CG1  3  
ATOM 3300  C CG2  . VAL A 1 70 ? 6.292  -2.200  6.965  1.00 0.00 ? 70 VAL A CG2  3  
ATOM 3301  H H    . VAL A 1 70 ? 8.597  -2.517  8.280  1.00 0.00 ? 70 VAL A H    3  
ATOM 3302  H HA   . VAL A 1 70 ? 7.398  -4.694  7.051  1.00 0.00 ? 70 VAL A HA   3  
ATOM 3303  H HB   . VAL A 1 70 ? 8.062  -2.023  5.803  1.00 0.00 ? 70 VAL A HB   3  
ATOM 3304  H HG11 . VAL A 1 70 ? 6.119  -4.177  4.981  1.00 0.00 ? 70 VAL A HG11 3  
ATOM 3305  H HG12 . VAL A 1 70 ? 6.125  -2.539  4.324  1.00 0.00 ? 70 VAL A HG12 3  
ATOM 3306  H HG13 . VAL A 1 70 ? 7.516  -3.595  4.077  1.00 0.00 ? 70 VAL A HG13 3  
ATOM 3307  H HG21 . VAL A 1 70 ? 6.325  -1.123  6.895  1.00 0.00 ? 70 VAL A HG21 3  
ATOM 3308  H HG22 . VAL A 1 70 ? 5.317  -2.552  6.661  1.00 0.00 ? 70 VAL A HG22 3  
ATOM 3309  H HG23 . VAL A 1 70 ? 6.481  -2.501  7.985  1.00 0.00 ? 70 VAL A HG23 3  
ATOM 3310  N N    . LYS A 1 71 ? 10.156 -3.737  5.493  1.00 0.00 ? 71 LYS A N    3  
ATOM 3311  C CA   . LYS A 1 71 ? 11.211 -4.187  4.593  1.00 0.00 ? 71 LYS A CA   3  
ATOM 3312  C C    . LYS A 1 71 ? 11.809 -5.506  5.072  1.00 0.00 ? 71 LYS A C    3  
ATOM 3313  O O    . LYS A 1 71 ? 12.179 -6.360  4.267  1.00 0.00 ? 71 LYS A O    3  
ATOM 3314  C CB   . LYS A 1 71 ? 12.308 -3.125  4.488  1.00 0.00 ? 71 LYS A CB   3  
ATOM 3315  C CG   . LYS A 1 71 ? 11.942 -1.961  3.584  1.00 0.00 ? 71 LYS A CG   3  
ATOM 3316  C CD   . LYS A 1 71 ? 12.988 -0.860  3.642  1.00 0.00 ? 71 LYS A CD   3  
ATOM 3317  C CE   . LYS A 1 71 ? 13.069 -0.098  2.328  1.00 0.00 ? 71 LYS A CE   3  
ATOM 3318  N NZ   . LYS A 1 71 ? 11.732 0.378   1.879  1.00 0.00 ? 71 LYS A NZ   3  
ATOM 3319  H H    . LYS A 1 71 ? 10.196 -2.828  5.860  1.00 0.00 ? 71 LYS A H    3  
ATOM 3320  H HA   . LYS A 1 71 ? 10.773 -4.338  3.618  1.00 0.00 ? 71 LYS A HA   3  
ATOM 3321  H HB2  . LYS A 1 71 ? 12.512 -2.737  5.475  1.00 0.00 ? 71 LYS A HB2  3  
ATOM 3322  H HB3  . LYS A 1 71 ? 13.204 -3.588  4.099  1.00 0.00 ? 71 LYS A HB3  3  
ATOM 3323  H HG2  . LYS A 1 71 ? 11.866 -2.316  2.567  1.00 0.00 ? 71 LYS A HG2  3  
ATOM 3324  H HG3  . LYS A 1 71 ? 10.990 -1.557  3.899  1.00 0.00 ? 71 LYS A HG3  3  
ATOM 3325  H HD2  . LYS A 1 71 ? 12.727 -0.169  4.430  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 3326  H HD3  . LYS A 1 71 ? 13.952 -1.302  3.852  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 3327  H HE2  . LYS A 1 71 ? 13.719 0.753   2.460  1.00 0.00 ? 71 LYS A HE2  3  
ATOM 3328  H HE3  . LYS A 1 71 ? 13.482 -0.752  1.573  1.00 0.00 ? 71 LYS A HE3  3  
ATOM 3329  H HZ1  . LYS A 1 71 ? 11.160 -0.426  1.546  1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 3330  H HZ2  . LYS A 1 71 ? 11.837 1.058   1.100  1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 3331  H HZ3  . LYS A 1 71 ? 11.234 0.841   2.665  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 3332  N N    . PHE A 1 72 ? 11.901 -5.664  6.389  1.00 0.00 ? 72 PHE A N    3  
ATOM 3333  C CA   . PHE A 1 72 ? 12.454 -6.880  6.975  1.00 0.00 ? 72 PHE A CA   3  
ATOM 3334  C C    . PHE A 1 72 ? 11.558 -8.080  6.686  1.00 0.00 ? 72 PHE A C    3  
ATOM 3335  O O    . PHE A 1 72 ? 11.988 -9.054  6.067  1.00 0.00 ? 72 PHE A O    3  
ATOM 3336  C CB   . PHE A 1 72 ? 12.625 -6.709  8.486  1.00 0.00 ? 72 PHE A CB   3  
ATOM 3337  C CG   . PHE A 1 72 ? 13.839 -7.405  9.034  1.00 0.00 ? 72 PHE A CG   3  
ATOM 3338  C CD1  . PHE A 1 72 ? 14.141 -8.702  8.653  1.00 0.00 ? 72 PHE A CD1  3  
ATOM 3339  C CD2  . PHE A 1 72 ? 14.677 -6.761  9.930  1.00 0.00 ? 72 PHE A CD2  3  
ATOM 3340  C CE1  . PHE A 1 72 ? 15.257 -9.345  9.155  1.00 0.00 ? 72 PHE A CE1  3  
ATOM 3341  C CE2  . PHE A 1 72 ? 15.794 -7.398  10.435 1.00 0.00 ? 72 PHE A CE2  3  
ATOM 3342  C CZ   . PHE A 1 72 ? 16.084 -8.692  10.048 1.00 0.00 ? 72 PHE A CZ   3  
ATOM 3343  H H    . PHE A 1 72 ? 11.589 -4.947  6.980  1.00 0.00 ? 72 PHE A H    3  
ATOM 3344  H HA   . PHE A 1 72 ? 13.421 -7.051  6.529  1.00 0.00 ? 72 PHE A HA   3  
ATOM 3345  H HB2  . PHE A 1 72 ? 12.714 -5.658  8.715  1.00 0.00 ? 72 PHE A HB2  3  
ATOM 3346  H HB3  . PHE A 1 72 ? 11.757 -7.110  8.987  1.00 0.00 ? 72 PHE A HB3  3  
ATOM 3347  H HD1  . PHE A 1 72 ? 13.494 -9.214  7.955  1.00 0.00 ? 72 PHE A HD1  3  
ATOM 3348  H HD2  . PHE A 1 72 ? 14.451 -5.750  10.235 1.00 0.00 ? 72 PHE A HD2  3  
ATOM 3349  H HE1  . PHE A 1 72 ? 15.480 -10.356 8.850  1.00 0.00 ? 72 PHE A HE1  3  
ATOM 3350  H HE2  . PHE A 1 72 ? 16.439 -6.886  11.134 1.00 0.00 ? 72 PHE A HE2  3  
ATOM 3351  H HZ   . PHE A 1 72 ? 16.957 -9.192  10.441 1.00 0.00 ? 72 PHE A HZ   3  
ATOM 3352  N N    . ILE A 1 73 ? 10.311 -8.003  7.138  1.00 0.00 ? 73 ILE A N    3  
ATOM 3353  C CA   . ILE A 1 73 ? 9.354  -9.082  6.927  1.00 0.00 ? 73 ILE A CA   3  
ATOM 3354  C C    . ILE A 1 73 ? 9.278  -9.470  5.454  1.00 0.00 ? 73 ILE A C    3  
ATOM 3355  O O    . ILE A 1 73 ? 9.138  -10.646 5.118  1.00 0.00 ? 73 ILE A O    3  
ATOM 3356  C CB   . ILE A 1 73 ? 7.947  -8.690  7.416  1.00 0.00 ? 73 ILE A CB   3  
ATOM 3357  C CG1  . ILE A 1 73 ? 7.979  -8.345  8.906  1.00 0.00 ? 73 ILE A CG1  3  
ATOM 3358  C CG2  . ILE A 1 73 ? 6.961  -9.818  7.149  1.00 0.00 ? 73 ILE A CG2  3  
ATOM 3359  C CD1  . ILE A 1 73 ? 6.840  -7.450  9.343  1.00 0.00 ? 73 ILE A CD1  3  
ATOM 3360  H H    . ILE A 1 73 ? 10.027 -7.201  7.624  1.00 0.00 ? 73 ILE A H    3  
ATOM 3361  H HA   . ILE A 1 73 ? 9.686  -9.938  7.497  1.00 0.00 ? 73 ILE A HA   3  
ATOM 3362  H HB   . ILE A 1 73 ? 7.625  -7.824  6.859  1.00 0.00 ? 73 ILE A HB   3  
ATOM 3363  H HG12 . ILE A 1 73 ? 7.925  -9.255  9.482  1.00 0.00 ? 73 ILE A HG12 3  
ATOM 3364  H HG13 . ILE A 1 73 ? 8.906  -7.836  9.130  1.00 0.00 ? 73 ILE A HG13 3  
ATOM 3365  H HG21 . ILE A 1 73 ? 7.346  -10.738 7.562  1.00 0.00 ? 73 ILE A HG21 3  
ATOM 3366  H HG22 . ILE A 1 73 ? 6.014  -9.585  7.614  1.00 0.00 ? 73 ILE A HG22 3  
ATOM 3367  H HG23 . ILE A 1 73 ? 6.822  -9.931  6.085  1.00 0.00 ? 73 ILE A HG23 3  
ATOM 3368  H HD11 . ILE A 1 73 ? 6.864  -7.336  10.417 1.00 0.00 ? 73 ILE A HD11 3  
ATOM 3369  H HD12 . ILE A 1 73 ? 6.941  -6.483  8.875  1.00 0.00 ? 73 ILE A HD12 3  
ATOM 3370  H HD13 . ILE A 1 73 ? 5.900  -7.895  9.050  1.00 0.00 ? 73 ILE A HD13 3  
ATOM 3371  N N    . ASP A 1 74 ? 9.375  -8.474  4.580  1.00 0.00 ? 74 ASP A N    3  
ATOM 3372  C CA   . ASP A 1 74 ? 9.320  -8.711  3.142  1.00 0.00 ? 74 ASP A CA   3  
ATOM 3373  C C    . ASP A 1 74 ? 10.592 -9.399  2.657  1.00 0.00 ? 74 ASP A C    3  
ATOM 3374  O O    . ASP A 1 74 ? 10.543 -10.292 1.810  1.00 0.00 ? 74 ASP A O    3  
ATOM 3375  C CB   . ASP A 1 74 ? 9.122  -7.392  2.394  1.00 0.00 ? 74 ASP A CB   3  
ATOM 3376  C CG   . ASP A 1 74 ? 8.516  -7.592  1.019  1.00 0.00 ? 74 ASP A CG   3  
ATOM 3377  O OD1  . ASP A 1 74 ? 8.511  -8.743  0.535  1.00 0.00 ? 74 ASP A OD1  3  
ATOM 3378  O OD2  . ASP A 1 74 ? 8.047  -6.597  0.426  1.00 0.00 ? 74 ASP A OD2  3  
ATOM 3379  H H    . ASP A 1 74 ? 9.486  -7.558  4.910  1.00 0.00 ? 74 ASP A H    3  
ATOM 3380  H HA   . ASP A 1 74 ? 8.478  -9.356  2.944  1.00 0.00 ? 74 ASP A HA   3  
ATOM 3381  H HB2  . ASP A 1 74 ? 8.464  -6.755  2.968  1.00 0.00 ? 74 ASP A HB2  3  
ATOM 3382  H HB3  . ASP A 1 74 ? 10.078 -6.904  2.279  1.00 0.00 ? 74 ASP A HB3  3  
ATOM 3383  N N    . LYS A 1 75 ? 11.730 -8.978  3.197  1.00 0.00 ? 75 LYS A N    3  
ATOM 3384  C CA   . LYS A 1 75 ? 13.016 -9.554  2.820  1.00 0.00 ? 75 LYS A CA   3  
ATOM 3385  C C    . LYS A 1 75 ? 13.164 -10.966 3.378  1.00 0.00 ? 75 LYS A C    3  
ATOM 3386  O O    . LYS A 1 75 ? 13.899 -11.786 2.828  1.00 0.00 ? 75 LYS A O    3  
ATOM 3387  C CB   . LYS A 1 75 ? 14.160 -8.672  3.325  1.00 0.00 ? 75 LYS A CB   3  
ATOM 3388  C CG   . LYS A 1 75 ? 14.534 -7.553  2.367  1.00 0.00 ? 75 LYS A CG   3  
ATOM 3389  C CD   . LYS A 1 75 ? 15.540 -8.021  1.329  1.00 0.00 ? 75 LYS A CD   3  
ATOM 3390  C CE   . LYS A 1 75 ? 14.850 -8.638  0.122  1.00 0.00 ? 75 LYS A CE   3  
ATOM 3391  N NZ   . LYS A 1 75 ? 15.644 -8.455  -1.124 1.00 0.00 ? 75 LYS A NZ   3  
ATOM 3392  H H    . LYS A 1 75 ? 11.705 -8.263  3.868  1.00 0.00 ? 75 LYS A H    3  
ATOM 3393  H HA   . LYS A 1 75 ? 13.056 -9.599  1.742  1.00 0.00 ? 75 LYS A HA   3  
ATOM 3394  H HB2  . LYS A 1 75 ? 13.870 -8.229  4.266  1.00 0.00 ? 75 LYS A HB2  3  
ATOM 3395  H HB3  . LYS A 1 75 ? 15.033 -9.290  3.481  1.00 0.00 ? 75 LYS A HB3  3  
ATOM 3396  H HG2  . LYS A 1 75 ? 13.643 -7.212  1.861  1.00 0.00 ? 75 LYS A HG2  3  
ATOM 3397  H HG3  . LYS A 1 75 ? 14.964 -6.738  2.931  1.00 0.00 ? 75 LYS A HG3  3  
ATOM 3398  H HD2  . LYS A 1 75 ? 16.125 -7.175  1.001  1.00 0.00 ? 75 LYS A HD2  3  
ATOM 3399  H HD3  . LYS A 1 75 ? 16.190 -8.759  1.778  1.00 0.00 ? 75 LYS A HD3  3  
ATOM 3400  H HE2  . LYS A 1 75 ? 14.716 -9.694  0.302  1.00 0.00 ? 75 LYS A HE2  3  
ATOM 3401  H HE3  . LYS A 1 75 ? 13.885 -8.169  -0.003 1.00 0.00 ? 75 LYS A HE3  3  
ATOM 3402  H HZ1  . LYS A 1 75 ? 15.988 -7.475  -1.187 1.00 0.00 ? 75 LYS A HZ1  3  
ATOM 3403  H HZ2  . LYS A 1 75 ? 15.054 -8.657  -1.956 1.00 0.00 ? 75 LYS A HZ2  3  
ATOM 3404  H HZ3  . LYS A 1 75 ? 16.460 -9.099  -1.126 1.00 0.00 ? 75 LYS A HZ3  3  
ATOM 3405  N N    . ALA A 1 76 ? 12.461 -11.243 4.471  1.00 0.00 ? 76 ALA A N    3  
ATOM 3406  C CA   . ALA A 1 76 ? 12.513 -12.556 5.100  1.00 0.00 ? 76 ALA A CA   3  
ATOM 3407  C C    . ALA A 1 76 ? 11.439 -13.479 4.533  1.00 0.00 ? 76 ALA A C    3  
ATOM 3408  O O    . ALA A 1 76 ? 11.578 -14.702 4.565  1.00 0.00 ? 76 ALA A O    3  
ATOM 3409  C CB   . ALA A 1 76 ? 12.357 -12.426 6.608  1.00 0.00 ? 76 ALA A CB   3  
ATOM 3410  H H    . ALA A 1 76 ? 11.894 -10.547 4.863  1.00 0.00 ? 76 ALA A H    3  
ATOM 3411  H HA   . ALA A 1 76 ? 13.485 -12.985 4.899  1.00 0.00 ? 76 ALA A HA   3  
ATOM 3412  H HB1  . ALA A 1 76 ? 11.823 -11.515 6.836  1.00 0.00 ? 76 ALA A HB1  3  
ATOM 3413  H HB2  . ALA A 1 76 ? 11.804 -13.272 6.987  1.00 0.00 ? 76 ALA A HB2  3  
ATOM 3414  H HB3  . ALA A 1 76 ? 13.332 -12.397 7.069  1.00 0.00 ? 76 ALA A HB3  3  
ATOM 3415  N N    . SER A 1 77 ? 10.369 -12.886 4.015  1.00 0.00 ? 77 SER A N    3  
ATOM 3416  C CA   . SER A 1 77 ? 9.269  -13.655 3.445  1.00 0.00 ? 77 SER A CA   3  
ATOM 3417  C C    . SER A 1 77 ? 9.761  -14.543 2.305  1.00 0.00 ? 77 SER A C    3  
ATOM 3418  O O    . SER A 1 77 ? 9.179  -15.590 2.024  1.00 0.00 ? 77 SER A O    3  
ATOM 3419  C CB   . SER A 1 77 ? 8.171  -12.717 2.939  1.00 0.00 ? 77 SER A CB   3  
ATOM 3420  O OG   . SER A 1 77 ? 8.595  -12.013 1.784  1.00 0.00 ? 77 SER A OG   3  
ATOM 3421  H H    . SER A 1 77 ? 10.317 -11.907 4.019  1.00 0.00 ? 77 SER A H    3  
ATOM 3422  H HA   . SER A 1 77 ? 8.864  -14.282 4.225  1.00 0.00 ? 77 SER A HA   3  
ATOM 3423  H HB2  . SER A 1 77 ? 7.294  -13.295 2.691  1.00 0.00 ? 77 SER A HB2  3  
ATOM 3424  H HB3  . SER A 1 77 ? 7.927  -12.004 3.712  1.00 0.00 ? 77 SER A HB3  3  
ATOM 3425  H HG   . SER A 1 77 ? 7.981  -12.179 1.065  1.00 0.00 ? 77 SER A HG   3  
ATOM 3426  N N    . ALA A 1 78 ? 10.837 -14.115 1.652  1.00 0.00 ? 78 ALA A N    3  
ATOM 3427  C CA   . ALA A 1 78 ? 11.409 -14.870 0.545  1.00 0.00 ? 78 ALA A CA   3  
ATOM 3428  C C    . ALA A 1 78 ? 12.312 -15.989 1.052  1.00 0.00 ? 78 ALA A C    3  
ATOM 3429  O O    . ALA A 1 78 ? 13.500 -15.777 1.299  1.00 0.00 ? 78 ALA A O    3  
ATOM 3430  C CB   . ALA A 1 78 ? 12.182 -13.944 -0.382 1.00 0.00 ? 78 ALA A CB   3  
ATOM 3431  H H    . ALA A 1 78 ? 11.256 -13.272 1.923  1.00 0.00 ? 78 ALA A H    3  
ATOM 3432  H HA   . ALA A 1 78 ? 10.595 -15.306 -0.018 1.00 0.00 ? 78 ALA A HA   3  
ATOM 3433  H HB1  . ALA A 1 78 ? 12.314 -14.424 -1.341 1.00 0.00 ? 78 ALA A HB1  3  
ATOM 3434  H HB2  . ALA A 1 78 ? 11.632 -13.024 -0.512 1.00 0.00 ? 78 ALA A HB2  3  
ATOM 3435  H HB3  . ALA A 1 78 ? 13.148 -13.729 0.049  1.00 0.00 ? 78 ALA A HB3  3  
ATOM 3436  N N    . MET A 1 1  ? -1.672 -2.221  -3.693 1.00 0.00 ? 1  MET A N    4  
ATOM 3437  C CA   . MET A 1 1  ? -0.726 -2.880  -4.586 1.00 0.00 ? 1  MET A CA   4  
ATOM 3438  C C    . MET A 1 1  ? 0.274  -3.719  -3.795 1.00 0.00 ? 1  MET A C    4  
ATOM 3439  O O    . MET A 1 1  ? 0.821  -4.696  -4.307 1.00 0.00 ? 1  MET A O    4  
ATOM 3440  C CB   . MET A 1 1  ? 0.016  -1.844  -5.432 1.00 0.00 ? 1  MET A CB   4  
ATOM 3441  C CG   . MET A 1 1  ? 0.824  -0.853  -4.610 1.00 0.00 ? 1  MET A CG   4  
ATOM 3442  S SD   . MET A 1 1  ? 1.583  0.432   -5.621 1.00 0.00 ? 1  MET A SD   4  
ATOM 3443  C CE   . MET A 1 1  ? 2.918  -0.483  -6.387 1.00 0.00 ? 1  MET A CE   4  
ATOM 3444  H H1   . MET A 1 1  ? -1.898 -1.280  -3.847 1.00 0.00 ? 1  MET A H1   4  
ATOM 3445  H HA   . MET A 1 1  ? -1.286 -3.532  -5.240 1.00 0.00 ? 1  MET A HA   4  
ATOM 3446  H HB2  . MET A 1 1  ? 0.691  -2.359  -6.100 1.00 0.00 ? 1  MET A HB2  4  
ATOM 3447  H HB3  . MET A 1 1  ? -0.704 -1.291  -6.016 1.00 0.00 ? 1  MET A HB3  4  
ATOM 3448  H HG2  . MET A 1 1  ? 0.169  -0.385  -3.890 1.00 0.00 ? 1  MET A HG2  4  
ATOM 3449  H HG3  . MET A 1 1  ? 1.603  -1.390  -4.089 1.00 0.00 ? 1  MET A HG3  4  
ATOM 3450  H HE1  . MET A 1 1  ? 2.649  -1.528  -6.449 1.00 0.00 ? 1  MET A HE1  4  
ATOM 3451  H HE2  . MET A 1 1  ? 3.096  -0.097  -7.379 1.00 0.00 ? 1  MET A HE2  4  
ATOM 3452  H HE3  . MET A 1 1  ? 3.814  -0.378  -5.792 1.00 0.00 ? 1  MET A HE3  4  
ATOM 3453  N N    . SER A 1 2  ? 0.510  -3.329  -2.547 1.00 0.00 ? 2  SER A N    4  
ATOM 3454  C CA   . SER A 1 2  ? 1.447  -4.042  -1.687 1.00 0.00 ? 2  SER A CA   4  
ATOM 3455  C C    . SER A 1 2  ? 0.708  -4.979  -0.736 1.00 0.00 ? 2  SER A C    4  
ATOM 3456  O O    . SER A 1 2  ? -0.366 -4.649  -0.233 1.00 0.00 ? 2  SER A O    4  
ATOM 3457  C CB   . SER A 1 2  ? 2.296  -3.051  -0.889 1.00 0.00 ? 2  SER A CB   4  
ATOM 3458  O OG   . SER A 1 2  ? 2.724  -1.974  -1.704 1.00 0.00 ? 2  SER A OG   4  
ATOM 3459  H H    . SER A 1 2  ? 0.043  -2.542  -2.196 1.00 0.00 ? 2  SER A H    4  
ATOM 3460  H HA   . SER A 1 2  ? 2.096  -4.630  -2.320 1.00 0.00 ? 2  SER A HA   4  
ATOM 3461  H HB2  . SER A 1 2  ? 1.711  -2.658  -0.071 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3462  H HB3  . SER A 1 2  ? 3.165  -3.559  -0.498 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3463  H HG   . SER A 1 2  ? 3.656  -2.078  -1.908 1.00 0.00 ? 2  SER A HG   4  
ATOM 3464  N N    . ASP A 1 3  ? 1.292  -6.147  -0.494 1.00 0.00 ? 3  ASP A N    4  
ATOM 3465  C CA   . ASP A 1 3  ? 0.690  -7.132  0.398  1.00 0.00 ? 3  ASP A CA   4  
ATOM 3466  C C    . ASP A 1 3  ? 1.413  -7.162  1.741  1.00 0.00 ? 3  ASP A C    4  
ATOM 3467  O O    . ASP A 1 3  ? 0.795  -7.364  2.787  1.00 0.00 ? 3  ASP A O    4  
ATOM 3468  C CB   . ASP A 1 3  ? 0.723  -8.520  -0.244 1.00 0.00 ? 3  ASP A CB   4  
ATOM 3469  C CG   . ASP A 1 3  ? -0.232 -8.639  -1.415 1.00 0.00 ? 3  ASP A CG   4  
ATOM 3470  O OD1  . ASP A 1 3  ? -1.456 -8.707  -1.177 1.00 0.00 ? 3  ASP A OD1  4  
ATOM 3471  O OD2  . ASP A 1 3  ? 0.244  -8.666  -2.569 1.00 0.00 ? 3  ASP A OD2  4  
ATOM 3472  H H    . ASP A 1 3  ? 2.148  -6.352  -0.925 1.00 0.00 ? 3  ASP A H    4  
ATOM 3473  H HA   . ASP A 1 3  ? -0.338 -6.846  0.563  1.00 0.00 ? 3  ASP A HA   4  
ATOM 3474  H HB2  . ASP A 1 3  ? 1.724  -8.722  -0.598 1.00 0.00 ? 3  ASP A HB2  4  
ATOM 3475  H HB3  . ASP A 1 3  ? 0.452  -9.258  0.496  1.00 0.00 ? 3  ASP A HB3  4  
ATOM 3476  N N    . THR A 1 4  ? 2.726  -6.959  1.706  1.00 0.00 ? 4  THR A N    4  
ATOM 3477  C CA   . THR A 1 4  ? 3.533  -6.965  2.919  1.00 0.00 ? 4  THR A CA   4  
ATOM 3478  C C    . THR A 1 4  ? 3.263  -5.726  3.765  1.00 0.00 ? 4  THR A C    4  
ATOM 3479  O O    . THR A 1 4  ? 2.918  -5.829  4.941  1.00 0.00 ? 4  THR A O    4  
ATOM 3480  C CB   . THR A 1 4  ? 5.037  -7.032  2.593  1.00 0.00 ? 4  THR A CB   4  
ATOM 3481  O OG1  . THR A 1 4  ? 5.291  -8.098  1.671  1.00 0.00 ? 4  THR A OG1  4  
ATOM 3482  C CG2  . THR A 1 4  ? 5.856  -7.243  3.857  1.00 0.00 ? 4  THR A CG2  4  
ATOM 3483  H H    . THR A 1 4  ? 3.161  -6.803  0.842  1.00 0.00 ? 4  THR A H    4  
ATOM 3484  H HA   . THR A 1 4  ? 3.271  -7.843  3.490  1.00 0.00 ? 4  THR A HA   4  
ATOM 3485  H HB   . THR A 1 4  ? 5.335  -6.097  2.141  1.00 0.00 ? 4  THR A HB   4  
ATOM 3486  H HG1  . THR A 1 4  ? 6.221  -8.335  1.704  1.00 0.00 ? 4  THR A HG1  4  
ATOM 3487  H HG21 . THR A 1 4  ? 6.632  -6.494  3.913  1.00 0.00 ? 4  THR A HG21 4  
ATOM 3488  H HG22 . THR A 1 4  ? 6.306  -8.225  3.835  1.00 0.00 ? 4  THR A HG22 4  
ATOM 3489  H HG23 . THR A 1 4  ? 5.213  -7.161  4.720  1.00 0.00 ? 4  THR A HG23 4  
ATOM 3490  N N    . ALA A 1 5  ? 3.423  -4.554  3.158  1.00 0.00 ? 5  ALA A N    4  
ATOM 3491  C CA   . ALA A 1 5  ? 3.194  -3.295  3.855  1.00 0.00 ? 5  ALA A CA   4  
ATOM 3492  C C    . ALA A 1 5  ? 1.828  -3.284  4.532  1.00 0.00 ? 5  ALA A C    4  
ATOM 3493  O O    . ALA A 1 5  ? 1.724  -3.051  5.736  1.00 0.00 ? 5  ALA A O    4  
ATOM 3494  C CB   . ALA A 1 5  ? 3.316  -2.127  2.888  1.00 0.00 ? 5  ALA A CB   4  
ATOM 3495  H H    . ALA A 1 5  ? 3.700  -4.537  2.218  1.00 0.00 ? 5  ALA A H    4  
ATOM 3496  H HA   . ALA A 1 5  ? 3.959  -3.187  4.610  1.00 0.00 ? 5  ALA A HA   4  
ATOM 3497  H HB1  . ALA A 1 5  ? 2.574  -1.380  3.132  1.00 0.00 ? 5  ALA A HB1  4  
ATOM 3498  H HB2  . ALA A 1 5  ? 4.302  -1.694  2.969  1.00 0.00 ? 5  ALA A HB2  4  
ATOM 3499  H HB3  . ALA A 1 5  ? 3.157  -2.477  1.879  1.00 0.00 ? 5  ALA A HB3  4  
ATOM 3500  N N    . GLU A 1 6  ? 0.782  -3.535  3.750  1.00 0.00 ? 6  GLU A N    4  
ATOM 3501  C CA   . GLU A 1 6  ? -0.578 -3.552  4.276  1.00 0.00 ? 6  GLU A CA   4  
ATOM 3502  C C    . GLU A 1 6  ? -0.679 -4.464  5.495  1.00 0.00 ? 6  GLU A C    4  
ATOM 3503  O O    . GLU A 1 6  ? -1.234 -4.082  6.525  1.00 0.00 ? 6  GLU A O    4  
ATOM 3504  C CB   . GLU A 1 6  ? -1.560 -4.013  3.197  1.00 0.00 ? 6  GLU A CB   4  
ATOM 3505  C CG   . GLU A 1 6  ? -1.948 -2.917  2.219  1.00 0.00 ? 6  GLU A CG   4  
ATOM 3506  C CD   . GLU A 1 6  ? -3.189 -3.262  1.419  1.00 0.00 ? 6  GLU A CD   4  
ATOM 3507  O OE1  . GLU A 1 6  ? -3.729 -4.371  1.612  1.00 0.00 ? 6  GLU A OE1  4  
ATOM 3508  O OE2  . GLU A 1 6  ? -3.620 -2.423  0.600  1.00 0.00 ? 6  GLU A OE2  4  
ATOM 3509  H H    . GLU A 1 6  ? 0.929  -3.713  2.798  1.00 0.00 ? 6  GLU A H    4  
ATOM 3510  H HA   . GLU A 1 6  ? -0.831 -2.545  4.573  1.00 0.00 ? 6  GLU A HA   4  
ATOM 3511  H HB2  . GLU A 1 6  ? -1.110 -4.822  2.640  1.00 0.00 ? 6  GLU A HB2  4  
ATOM 3512  H HB3  . GLU A 1 6  ? -2.458 -4.374  3.676  1.00 0.00 ? 6  GLU A HB3  4  
ATOM 3513  H HG2  . GLU A 1 6  ? -2.136 -2.008  2.771  1.00 0.00 ? 6  GLU A HG2  4  
ATOM 3514  H HG3  . GLU A 1 6  ? -1.129 -2.756  1.533  1.00 0.00 ? 6  GLU A HG3  4  
ATOM 3515  N N    . ARG A 1 7  ? -0.139 -5.672  5.369  1.00 0.00 ? 7  ARG A N    4  
ATOM 3516  C CA   . ARG A 1 7  ? -0.169 -6.640  6.458  1.00 0.00 ? 7  ARG A CA   4  
ATOM 3517  C C    . ARG A 1 7  ? 0.464  -6.059  7.719  1.00 0.00 ? 7  ARG A C    4  
ATOM 3518  O O    . ARG A 1 7  ? -0.082 -6.185  8.816  1.00 0.00 ? 7  ARG A O    4  
ATOM 3519  C CB   . ARG A 1 7  ? 0.561  -7.921  6.051  1.00 0.00 ? 7  ARG A CB   4  
ATOM 3520  C CG   . ARG A 1 7  ? -0.293 -8.875  5.232  1.00 0.00 ? 7  ARG A CG   4  
ATOM 3521  C CD   . ARG A 1 7  ? -1.233 -9.680  6.116  1.00 0.00 ? 7  ARG A CD   4  
ATOM 3522  N NE   . ARG A 1 7  ? -2.298 -10.317 5.345  1.00 0.00 ? 7  ARG A NE   4  
ATOM 3523  C CZ   . ARG A 1 7  ? -3.383 -9.677  4.924  1.00 0.00 ? 7  ARG A CZ   4  
ATOM 3524  N NH1  . ARG A 1 7  ? -3.546 -8.390  5.197  1.00 0.00 ? 7  ARG A NH1  4  
ATOM 3525  N NH2  . ARG A 1 7  ? -4.308 -10.326 4.227  1.00 0.00 ? 7  ARG A NH2  4  
ATOM 3526  H H    . ARG A 1 7  ? 0.290  -5.918  4.523  1.00 0.00 ? 7  ARG A H    4  
ATOM 3527  H HA   . ARG A 1 7  ? -1.203 -6.875  6.664  1.00 0.00 ? 7  ARG A HA   4  
ATOM 3528  H HB2  . ARG A 1 7  ? 1.429  -7.656  5.465  1.00 0.00 ? 7  ARG A HB2  4  
ATOM 3529  H HB3  . ARG A 1 7  ? 0.882  -8.436  6.944  1.00 0.00 ? 7  ARG A HB3  4  
ATOM 3530  H HG2  . ARG A 1 7  ? -0.880 -8.304  4.528  1.00 0.00 ? 7  ARG A HG2  4  
ATOM 3531  H HG3  . ARG A 1 7  ? 0.354  -9.553  4.697  1.00 0.00 ? 7  ARG A HG3  4  
ATOM 3532  H HD2  . ARG A 1 7  ? -0.663 -10.444 6.623  1.00 0.00 ? 7  ARG A HD2  4  
ATOM 3533  H HD3  . ARG A 1 7  ? -1.676 -9.018  6.845  1.00 0.00 ? 7  ARG A HD3  4  
ATOM 3534  H HE   . ARG A 1 7  ? -2.197 -11.268 5.132  1.00 0.00 ? 7  ARG A HE   4  
ATOM 3535  H HH11 . ARG A 1 7  ? -2.851 -7.899  5.720  1.00 0.00 ? 7  ARG A HH11 4  
ATOM 3536  H HH12 . ARG A 1 7  ? -4.364 -7.911  4.877  1.00 0.00 ? 7  ARG A HH12 4  
ATOM 3537  H HH21 . ARG A 1 7  ? -4.188 -11.296 4.019  1.00 0.00 ? 7  ARG A HH21 4  
ATOM 3538  H HH22 . ARG A 1 7  ? -5.125 -9.844  3.911  1.00 0.00 ? 7  ARG A HH22 4  
ATOM 3539  N N    . VAL A 1 8  ? 1.620  -5.424  7.556  1.00 0.00 ? 8  VAL A N    4  
ATOM 3540  C CA   . VAL A 1 8  ? 2.328  -4.823  8.680  1.00 0.00 ? 8  VAL A CA   4  
ATOM 3541  C C    . VAL A 1 8  ? 1.487  -3.738  9.343  1.00 0.00 ? 8  VAL A C    4  
ATOM 3542  O O    . VAL A 1 8  ? 1.093  -3.863  10.503 1.00 0.00 ? 8  VAL A O    4  
ATOM 3543  C CB   . VAL A 1 8  ? 3.672  -4.216  8.237  1.00 0.00 ? 8  VAL A CB   4  
ATOM 3544  C CG1  . VAL A 1 8  ? 4.380  -3.567  9.417  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 3545  C CG2  . VAL A 1 8  ? 4.552  -5.280  7.597  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 3546  H H    . VAL A 1 8  ? 2.006  -5.356  6.658  1.00 0.00 ? 8  VAL A H    4  
ATOM 3547  H HA   . VAL A 1 8  ? 2.529  -5.601  9.403  1.00 0.00 ? 8  VAL A HA   4  
ATOM 3548  H HB   . VAL A 1 8  ? 3.474  -3.452  7.500  1.00 0.00 ? 8  VAL A HB   4  
ATOM 3549  H HG11 . VAL A 1 8  ? 5.445  -3.720  9.326  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 3550  H HG12 . VAL A 1 8  ? 4.167  -2.508  9.427  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 3551  H HG13 . VAL A 1 8  ? 4.030  -4.014  10.336 1.00 0.00 ? 8  VAL A HG13 4  
ATOM 3552  H HG21 . VAL A 1 8  ? 4.216  -6.258  7.909  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 3553  H HG22 . VAL A 1 8  ? 4.486  -5.203  6.522  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 3554  H HG23 . VAL A 1 8  ? 5.576  -5.135  7.906  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 3555  N N    . LYS A 1 9  ? 1.213  -2.672  8.599  1.00 0.00 ? 9  LYS A N    4  
ATOM 3556  C CA   . LYS A 1 9  ? 0.417  -1.564  9.112  1.00 0.00 ? 9  LYS A CA   4  
ATOM 3557  C C    . LYS A 1 9  ? -0.912 -2.062  9.671  1.00 0.00 ? 9  LYS A C    4  
ATOM 3558  O O    . LYS A 1 9  ? -1.473 -1.466  10.591 1.00 0.00 ? 9  LYS A O    4  
ATOM 3559  C CB   . LYS A 1 9  ? 0.164  -0.536  8.007  1.00 0.00 ? 9  LYS A CB   4  
ATOM 3560  C CG   . LYS A 1 9  ? -0.686 -1.066  6.865  1.00 0.00 ? 9  LYS A CG   4  
ATOM 3561  C CD   . LYS A 1 9  ? -1.123 0.049   5.930  1.00 0.00 ? 9  LYS A CD   4  
ATOM 3562  C CE   . LYS A 1 9  ? 0.063  0.661   5.201  1.00 0.00 ? 9  LYS A CE   4  
ATOM 3563  N NZ   . LYS A 1 9  ? 0.590  -0.243  4.141  1.00 0.00 ? 9  LYS A NZ   4  
ATOM 3564  H H    . LYS A 1 9  ? 1.555  -2.630  7.681  1.00 0.00 ? 9  LYS A H    4  
ATOM 3565  H HA   . LYS A 1 9  ? 0.975  -1.094  9.908  1.00 0.00 ? 9  LYS A HA   4  
ATOM 3566  H HB2  . LYS A 1 9  ? -0.338 0.319   8.435  1.00 0.00 ? 9  LYS A HB2  4  
ATOM 3567  H HB3  . LYS A 1 9  ? 1.114  -0.219  7.602  1.00 0.00 ? 9  LYS A HB3  4  
ATOM 3568  H HG2  . LYS A 1 9  ? -0.110 -1.787  6.304  1.00 0.00 ? 9  LYS A HG2  4  
ATOM 3569  H HG3  . LYS A 1 9  ? -1.564 -1.545  7.275  1.00 0.00 ? 9  LYS A HG3  4  
ATOM 3570  H HD2  . LYS A 1 9  ? -1.811 -0.353  5.201  1.00 0.00 ? 9  LYS A HD2  4  
ATOM 3571  H HD3  . LYS A 1 9  ? -1.616 0.818   6.507  1.00 0.00 ? 9  LYS A HD3  4  
ATOM 3572  H HE2  . LYS A 1 9  ? -0.250 1.589   4.748  1.00 0.00 ? 9  LYS A HE2  4  
ATOM 3573  H HE3  . LYS A 1 9  ? 0.847  0.857   5.918  1.00 0.00 ? 9  LYS A HE3  4  
ATOM 3574  H HZ1  . LYS A 1 9  ? -0.181 -0.824  3.753  1.00 0.00 ? 9  LYS A HZ1  4  
ATOM 3575  H HZ2  . LYS A 1 9  ? 1.317  -0.871  4.537  1.00 0.00 ? 9  LYS A HZ2  4  
ATOM 3576  H HZ3  . LYS A 1 9  ? 1.010  0.316   3.372  1.00 0.00 ? 9  LYS A HZ3  4  
ATOM 3577  N N    . LYS A 1 10 ? -1.410 -3.159  9.111  1.00 0.00 ? 10 LYS A N    4  
ATOM 3578  C CA   . LYS A 1 10 ? -2.672 -3.740  9.555  1.00 0.00 ? 10 LYS A CA   4  
ATOM 3579  C C    . LYS A 1 10 ? -2.548 -4.293  10.971 1.00 0.00 ? 10 LYS A C    4  
ATOM 3580  O O    . LYS A 1 10 ? -3.289 -3.895  11.870 1.00 0.00 ? 10 LYS A O    4  
ATOM 3581  C CB   . LYS A 1 10 ? -3.110 -4.851  8.598  1.00 0.00 ? 10 LYS A CB   4  
ATOM 3582  C CG   . LYS A 1 10 ? -4.352 -5.595  9.058  1.00 0.00 ? 10 LYS A CG   4  
ATOM 3583  C CD   . LYS A 1 10 ? -4.815 -6.602  8.019  1.00 0.00 ? 10 LYS A CD   4  
ATOM 3584  C CE   . LYS A 1 10 ? -6.083 -7.317  8.462  1.00 0.00 ? 10 LYS A CE   4  
ATOM 3585  N NZ   . LYS A 1 10 ? -5.799 -8.380  9.465  1.00 0.00 ? 10 LYS A NZ   4  
ATOM 3586  H H    . LYS A 1 10 ? -0.916 -3.589  8.381  1.00 0.00 ? 10 LYS A H    4  
ATOM 3587  H HA   . LYS A 1 10 ? -3.417 -2.958  9.551  1.00 0.00 ? 10 LYS A HA   4  
ATOM 3588  H HB2  . LYS A 1 10 ? -3.314 -4.417  7.631  1.00 0.00 ? 10 LYS A HB2  4  
ATOM 3589  H HB3  . LYS A 1 10 ? -2.304 -5.564  8.501  1.00 0.00 ? 10 LYS A HB3  4  
ATOM 3590  H HG2  . LYS A 1 10 ? -4.128 -6.118  9.976  1.00 0.00 ? 10 LYS A HG2  4  
ATOM 3591  H HG3  . LYS A 1 10 ? -5.144 -4.881  9.233  1.00 0.00 ? 10 LYS A HG3  4  
ATOM 3592  H HD2  . LYS A 1 10 ? -5.012 -6.085  7.092  1.00 0.00 ? 10 LYS A HD2  4  
ATOM 3593  H HD3  . LYS A 1 10 ? -4.034 -7.334  7.866  1.00 0.00 ? 10 LYS A HD3  4  
ATOM 3594  H HE2  . LYS A 1 10 ? -6.755 -6.593  8.898  1.00 0.00 ? 10 LYS A HE2  4  
ATOM 3595  H HE3  . LYS A 1 10 ? -6.549 -7.764  7.597  1.00 0.00 ? 10 LYS A HE3  4  
ATOM 3596  H HZ1  . LYS A 1 10 ? -4.772 -8.481  9.597  1.00 0.00 ? 10 LYS A HZ1  4  
ATOM 3597  H HZ2  . LYS A 1 10 ? -6.185 -9.289  9.140  1.00 0.00 ? 10 LYS A HZ2  4  
ATOM 3598  H HZ3  . LYS A 1 10 ? -6.233 -8.136  10.378 1.00 0.00 ? 10 LYS A HZ3  4  
ATOM 3599  N N    . ILE A 1 11 ? -1.606 -5.211  11.162 1.00 0.00 ? 11 ILE A N    4  
ATOM 3600  C CA   . ILE A 1 11 ? -1.384 -5.816  12.469 1.00 0.00 ? 11 ILE A CA   4  
ATOM 3601  C C    . ILE A 1 11 ? -0.989 -4.766  13.502 1.00 0.00 ? 11 ILE A C    4  
ATOM 3602  O O    . ILE A 1 11 ? -1.282 -4.905  14.689 1.00 0.00 ? 11 ILE A O    4  
ATOM 3603  C CB   . ILE A 1 11 ? -0.290 -6.898  12.410 1.00 0.00 ? 11 ILE A CB   4  
ATOM 3604  C CG1  . ILE A 1 11 ? -0.672 -7.987  11.406 1.00 0.00 ? 11 ILE A CG1  4  
ATOM 3605  C CG2  . ILE A 1 11 ? -0.063 -7.498  13.790 1.00 0.00 ? 11 ILE A CG2  4  
ATOM 3606  C CD1  . ILE A 1 11 ? 0.497  -8.840  10.965 1.00 0.00 ? 11 ILE A CD1  4  
ATOM 3607  H H    . ILE A 1 11 ? -1.047 -5.487  10.406 1.00 0.00 ? 11 ILE A H    4  
ATOM 3608  H HA   . ILE A 1 11 ? -2.307 -6.283  12.781 1.00 0.00 ? 11 ILE A HA   4  
ATOM 3609  H HB   . ILE A 1 11 ? 0.630  -6.432  12.092 1.00 0.00 ? 11 ILE A HB   4  
ATOM 3610  H HG12 . ILE A 1 11 ? -1.407 -8.639  11.853 1.00 0.00 ? 11 ILE A HG12 4  
ATOM 3611  H HG13 . ILE A 1 11 ? -1.096 -7.523  10.527 1.00 0.00 ? 11 ILE A HG13 4  
ATOM 3612  H HG21 . ILE A 1 11 ? 0.407  -6.765  14.428 1.00 0.00 ? 11 ILE A HG21 4  
ATOM 3613  H HG22 . ILE A 1 11 ? -1.012 -7.789  14.216 1.00 0.00 ? 11 ILE A HG22 4  
ATOM 3614  H HG23 . ILE A 1 11 ? 0.575  -8.365  13.706 1.00 0.00 ? 11 ILE A HG23 4  
ATOM 3615  H HD11 . ILE A 1 11 ? 0.160  -9.565  10.239 1.00 0.00 ? 11 ILE A HD11 4  
ATOM 3616  H HD12 . ILE A 1 11 ? 1.255  -8.211  10.522 1.00 0.00 ? 11 ILE A HD12 4  
ATOM 3617  H HD13 . ILE A 1 11 ? 0.910  -9.354  11.820 1.00 0.00 ? 11 ILE A HD13 4  
ATOM 3618  N N    . VAL A 1 12 ? -0.323 -3.712  13.040 1.00 0.00 ? 12 VAL A N    4  
ATOM 3619  C CA   . VAL A 1 12 ? 0.110  -2.635  13.923 1.00 0.00 ? 12 VAL A CA   4  
ATOM 3620  C C    . VAL A 1 12 ? -1.079 -1.816  14.415 1.00 0.00 ? 12 VAL A C    4  
ATOM 3621  O O    . VAL A 1 12 ? -1.204 -1.540  15.608 1.00 0.00 ? 12 VAL A O    4  
ATOM 3622  C CB   . VAL A 1 12 ? 1.107  -1.697  13.217 1.00 0.00 ? 12 VAL A CB   4  
ATOM 3623  C CG1  . VAL A 1 12 ? 1.518  -0.561  14.141 1.00 0.00 ? 12 VAL A CG1  4  
ATOM 3624  C CG2  . VAL A 1 12 ? 2.324  -2.476  12.741 1.00 0.00 ? 12 VAL A CG2  4  
ATOM 3625  H H    . VAL A 1 12 ? -0.119 -3.657  12.084 1.00 0.00 ? 12 VAL A H    4  
ATOM 3626  H HA   . VAL A 1 12 ? 0.606  -3.079  14.773 1.00 0.00 ? 12 VAL A HA   4  
ATOM 3627  H HB   . VAL A 1 12 ? 0.619  -1.270  12.353 1.00 0.00 ? 12 VAL A HB   4  
ATOM 3628  H HG11 . VAL A 1 12 ? 1.084  0.363   13.789 1.00 0.00 ? 12 VAL A HG11 4  
ATOM 3629  H HG12 . VAL A 1 12 ? 1.169  -0.767  15.142 1.00 0.00 ? 12 VAL A HG12 4  
ATOM 3630  H HG13 . VAL A 1 12 ? 2.595  -0.473  14.145 1.00 0.00 ? 12 VAL A HG13 4  
ATOM 3631  H HG21 . VAL A 1 12 ? 2.521  -2.238  11.706 1.00 0.00 ? 12 VAL A HG21 4  
ATOM 3632  H HG22 . VAL A 1 12 ? 3.181  -2.207  13.341 1.00 0.00 ? 12 VAL A HG22 4  
ATOM 3633  H HG23 . VAL A 1 12 ? 2.135  -3.535  12.838 1.00 0.00 ? 12 VAL A HG23 4  
ATOM 3634  N N    . VAL A 1 13 ? -1.950 -1.432  13.488 1.00 0.00 ? 13 VAL A N    4  
ATOM 3635  C CA   . VAL A 1 13 ? -3.131 -0.646  13.827 1.00 0.00 ? 13 VAL A CA   4  
ATOM 3636  C C    . VAL A 1 13 ? -4.136 -1.477  14.617 1.00 0.00 ? 13 VAL A C    4  
ATOM 3637  O O    . VAL A 1 13 ? -4.892 -0.946  15.430 1.00 0.00 ? 13 VAL A O    4  
ATOM 3638  C CB   . VAL A 1 13 ? -3.818 -0.092  12.565 1.00 0.00 ? 13 VAL A CB   4  
ATOM 3639  C CG1  . VAL A 1 13 ? -5.077 0.677   12.936 1.00 0.00 ? 13 VAL A CG1  4  
ATOM 3640  C CG2  . VAL A 1 13 ? -2.858 0.787   11.778 1.00 0.00 ? 13 VAL A CG2  4  
ATOM 3641  H H    . VAL A 1 13 ? -1.796 -1.683  12.553 1.00 0.00 ? 13 VAL A H    4  
ATOM 3642  H HA   . VAL A 1 13 ? -2.813 0.189   14.434 1.00 0.00 ? 13 VAL A HA   4  
ATOM 3643  H HB   . VAL A 1 13 ? -4.104 -0.926  11.940 1.00 0.00 ? 13 VAL A HB   4  
ATOM 3644  H HG11 . VAL A 1 13 ? -5.091 1.619   12.408 1.00 0.00 ? 13 VAL A HG11 4  
ATOM 3645  H HG12 . VAL A 1 13 ? -5.947 0.097   12.665 1.00 0.00 ? 13 VAL A HG12 4  
ATOM 3646  H HG13 . VAL A 1 13 ? -5.084 0.862   14.001 1.00 0.00 ? 13 VAL A HG13 4  
ATOM 3647  H HG21 . VAL A 1 13 ? -2.880 0.501   10.737 1.00 0.00 ? 13 VAL A HG21 4  
ATOM 3648  H HG22 . VAL A 1 13 ? -3.156 1.821   11.874 1.00 0.00 ? 13 VAL A HG22 4  
ATOM 3649  H HG23 . VAL A 1 13 ? -1.858 0.664   12.165 1.00 0.00 ? 13 VAL A HG23 4  
ATOM 3650  N N    . GLU A 1 14 ? -4.137 -2.784  14.372 1.00 0.00 ? 14 GLU A N    4  
ATOM 3651  C CA   . GLU A 1 14 ? -5.050 -3.688  15.061 1.00 0.00 ? 14 GLU A CA   4  
ATOM 3652  C C    . GLU A 1 14 ? -4.517 -4.051  16.444 1.00 0.00 ? 14 GLU A C    4  
ATOM 3653  O O    . GLU A 1 14 ? -5.281 -4.401  17.344 1.00 0.00 ? 14 GLU A O    4  
ATOM 3654  C CB   . GLU A 1 14 ? -5.264 -4.959  14.235 1.00 0.00 ? 14 GLU A CB   4  
ATOM 3655  C CG   . GLU A 1 14 ? -6.598 -5.638  14.498 1.00 0.00 ? 14 GLU A CG   4  
ATOM 3656  C CD   . GLU A 1 14 ? -6.563 -7.125  14.202 1.00 0.00 ? 14 GLU A CD   4  
ATOM 3657  O OE1  . GLU A 1 14 ? -6.550 -7.493  13.009 1.00 0.00 ? 14 GLU A OE1  4  
ATOM 3658  O OE2  . GLU A 1 14 ? -6.549 -7.920  15.165 1.00 0.00 ? 14 GLU A OE2  4  
ATOM 3659  H H    . GLU A 1 14 ? -3.510 -3.148  13.712 1.00 0.00 ? 14 GLU A H    4  
ATOM 3660  H HA   . GLU A 1 14 ? -5.996 -3.181  15.175 1.00 0.00 ? 14 GLU A HA   4  
ATOM 3661  H HB2  . GLU A 1 14 ? -5.212 -4.706  13.187 1.00 0.00 ? 14 GLU A HB2  4  
ATOM 3662  H HB3  . GLU A 1 14 ? -4.475 -5.660  14.466 1.00 0.00 ? 14 GLU A HB3  4  
ATOM 3663  H HG2  . GLU A 1 14 ? -6.860 -5.499  15.536 1.00 0.00 ? 14 GLU A HG2  4  
ATOM 3664  H HG3  . GLU A 1 14 ? -7.350 -5.179  13.873 1.00 0.00 ? 14 GLU A HG3  4  
ATOM 3665  N N    . HIS A 1 15 ? -3.200 -3.965  16.605 1.00 0.00 ? 15 HIS A N    4  
ATOM 3666  C CA   . HIS A 1 15 ? -2.563 -4.284  17.878 1.00 0.00 ? 15 HIS A CA   4  
ATOM 3667  C C    . HIS A 1 15 ? -2.473 -3.046  18.765 1.00 0.00 ? 15 HIS A C    4  
ATOM 3668  O O    . HIS A 1 15 ? -2.938 -3.053  19.906 1.00 0.00 ? 15 HIS A O    4  
ATOM 3669  C CB   . HIS A 1 15 ? -1.166 -4.860  17.643 1.00 0.00 ? 15 HIS A CB   4  
ATOM 3670  C CG   . HIS A 1 15 ? -1.171 -6.313  17.282 1.00 0.00 ? 15 HIS A CG   4  
ATOM 3671  N ND1  . HIS A 1 15 ? -2.291 -6.970  16.817 1.00 0.00 ? 15 HIS A ND1  4  
ATOM 3672  C CD2  . HIS A 1 15 ? -0.182 -7.238  17.318 1.00 0.00 ? 15 HIS A CD2  4  
ATOM 3673  C CE1  . HIS A 1 15 ? -1.991 -8.236  16.584 1.00 0.00 ? 15 HIS A CE1  4  
ATOM 3674  N NE2  . HIS A 1 15 ? -0.718 -8.424  16.880 1.00 0.00 ? 15 HIS A NE2  4  
ATOM 3675  H H    . HIS A 1 15 ? -2.644 -3.680  15.850 1.00 0.00 ? 15 HIS A H    4  
ATOM 3676  H HA   . HIS A 1 15 ? -3.170 -5.025  18.375 1.00 0.00 ? 15 HIS A HA   4  
ATOM 3677  H HB2  . HIS A 1 15 ? -0.692 -4.320  16.837 1.00 0.00 ? 15 HIS A HB2  4  
ATOM 3678  H HB3  . HIS A 1 15 ? -0.580 -4.742  18.543 1.00 0.00 ? 15 HIS A HB3  4  
ATOM 3679  H HD1  . HIS A 1 15 ? -3.174 -6.569  16.680 1.00 0.00 ? 15 HIS A HD1  4  
ATOM 3680  H HD2  . HIS A 1 15 ? 0.839  -7.073  17.633 1.00 0.00 ? 15 HIS A HD2  4  
ATOM 3681  H HE1  . HIS A 1 15 ? -2.671 -8.988  16.215 1.00 0.00 ? 15 HIS A HE1  4  
ATOM 3682  N N    . LEU A 1 16 ? -1.873 -1.986  18.235 1.00 0.00 ? 16 LEU A N    4  
ATOM 3683  C CA   . LEU A 1 16 ? -1.722 -0.741  18.979 1.00 0.00 ? 16 LEU A CA   4  
ATOM 3684  C C    . LEU A 1 16 ? -3.050 0.004   19.070 1.00 0.00 ? 16 LEU A C    4  
ATOM 3685  O O    . LEU A 1 16 ? -3.290 0.753   20.016 1.00 0.00 ? 16 LEU A O    4  
ATOM 3686  C CB   . LEU A 1 16 ? -0.669 0.148   18.315 1.00 0.00 ? 16 LEU A CB   4  
ATOM 3687  C CG   . LEU A 1 16 ? 0.781  -0.105  18.729 1.00 0.00 ? 16 LEU A CG   4  
ATOM 3688  C CD1  . LEU A 1 16 ? 1.130  -1.578  18.577 1.00 0.00 ? 16 LEU A CD1  4  
ATOM 3689  C CD2  . LEU A 1 16 ? 1.728  0.756   17.906 1.00 0.00 ? 16 LEU A CD2  4  
ATOM 3690  H H    . LEU A 1 16 ? -1.523 -2.041  17.322 1.00 0.00 ? 16 LEU A H    4  
ATOM 3691  H HA   . LEU A 1 16 ? -1.393 -0.989  19.978 1.00 0.00 ? 16 LEU A HA   4  
ATOM 3692  H HB2  . LEU A 1 16 ? -0.739 0.003   17.248 1.00 0.00 ? 16 LEU A HB2  4  
ATOM 3693  H HB3  . LEU A 1 16 ? -0.907 1.175   18.553 1.00 0.00 ? 16 LEU A HB3  4  
ATOM 3694  H HG   . LEU A 1 16 ? 0.904  0.161   19.770 1.00 0.00 ? 16 LEU A HG   4  
ATOM 3695  H HD11 . LEU A 1 16 ? 0.645  -2.144  19.358 1.00 0.00 ? 16 LEU A HD11 4  
ATOM 3696  H HD12 . LEU A 1 16 ? 2.200  -1.704  18.652 1.00 0.00 ? 16 LEU A HD12 4  
ATOM 3697  H HD13 . LEU A 1 16 ? 0.793  -1.930  17.613 1.00 0.00 ? 16 LEU A HD13 4  
ATOM 3698  H HD21 . LEU A 1 16 ? 2.579  1.033   18.512 1.00 0.00 ? 16 LEU A HD21 4  
ATOM 3699  H HD22 . LEU A 1 16 ? 1.213  1.648   17.581 1.00 0.00 ? 16 LEU A HD22 4  
ATOM 3700  H HD23 . LEU A 1 16 ? 2.065  0.200   17.045 1.00 0.00 ? 16 LEU A HD23 4  
ATOM 3701  N N    . GLY A 1 17 ? -3.911 -0.209  18.079 1.00 0.00 ? 17 GLY A N    4  
ATOM 3702  C CA   . GLY A 1 17 ? -5.205 0.448   18.067 1.00 0.00 ? 17 GLY A CA   4  
ATOM 3703  C C    . GLY A 1 17 ? -5.098 1.933   17.781 1.00 0.00 ? 17 GLY A C    4  
ATOM 3704  O O    . GLY A 1 17 ? -5.889 2.729   18.289 1.00 0.00 ? 17 GLY A O    4  
ATOM 3705  H H    . GLY A 1 17 ? -3.665 -0.817  17.351 1.00 0.00 ? 17 GLY A H    4  
ATOM 3706  H HA2  . GLY A 1 17 ? -5.822 -0.010  17.309 1.00 0.00 ? 17 GLY A HA2  4  
ATOM 3707  H HA3  . GLY A 1 17 ? -5.674 0.312   19.031 1.00 0.00 ? 17 GLY A HA3  4  
ATOM 3708  N N    . VAL A 1 18 ? -4.117 2.309   16.967 1.00 0.00 ? 18 VAL A N    4  
ATOM 3709  C CA   . VAL A 1 18 ? -3.910 3.708   16.614 1.00 0.00 ? 18 VAL A CA   4  
ATOM 3710  C C    . VAL A 1 18 ? -4.342 3.983   15.178 1.00 0.00 ? 18 VAL A C    4  
ATOM 3711  O O    . VAL A 1 18 ? -4.881 3.107   14.503 1.00 0.00 ? 18 VAL A O    4  
ATOM 3712  C CB   . VAL A 1 18 ? -2.434 4.116   16.782 1.00 0.00 ? 18 VAL A CB   4  
ATOM 3713  C CG1  . VAL A 1 18 ? -1.979 3.896   18.217 1.00 0.00 ? 18 VAL A CG1  4  
ATOM 3714  C CG2  . VAL A 1 18 ? -1.554 3.344   15.811 1.00 0.00 ? 18 VAL A CG2  4  
ATOM 3715  H H    . VAL A 1 18 ? -3.519 1.628   16.593 1.00 0.00 ? 18 VAL A H    4  
ATOM 3716  H HA   . VAL A 1 18 ? -4.507 4.313   17.282 1.00 0.00 ? 18 VAL A HA   4  
ATOM 3717  H HB   . VAL A 1 18 ? -2.345 5.169   16.557 1.00 0.00 ? 18 VAL A HB   4  
ATOM 3718  H HG11 . VAL A 1 18 ? -0.921 4.098   18.294 1.00 0.00 ? 18 VAL A HG11 4  
ATOM 3719  H HG12 . VAL A 1 18 ? -2.522 4.560   18.873 1.00 0.00 ? 18 VAL A HG12 4  
ATOM 3720  H HG13 . VAL A 1 18 ? -2.170 2.872   18.502 1.00 0.00 ? 18 VAL A HG13 4  
ATOM 3721  H HG21 . VAL A 1 18 ? -1.069 4.036   15.139 1.00 0.00 ? 18 VAL A HG21 4  
ATOM 3722  H HG22 . VAL A 1 18 ? -0.806 2.793   16.362 1.00 0.00 ? 18 VAL A HG22 4  
ATOM 3723  H HG23 . VAL A 1 18 ? -2.162 2.656   15.243 1.00 0.00 ? 18 VAL A HG23 4  
ATOM 3724  N N    . ASP A 1 19 ? -4.100 5.206   14.718 1.00 0.00 ? 19 ASP A N    4  
ATOM 3725  C CA   . ASP A 1 19 ? -4.462 5.597   13.360 1.00 0.00 ? 19 ASP A CA   4  
ATOM 3726  C C    . ASP A 1 19 ? -3.493 4.998   12.346 1.00 0.00 ? 19 ASP A C    4  
ATOM 3727  O O    . ASP A 1 19 ? -2.295 4.890   12.606 1.00 0.00 ? 19 ASP A O    4  
ATOM 3728  C CB   . ASP A 1 19 ? -4.477 7.121   13.233 1.00 0.00 ? 19 ASP A CB   4  
ATOM 3729  C CG   . ASP A 1 19 ? -5.435 7.603   12.161 1.00 0.00 ? 19 ASP A CG   4  
ATOM 3730  O OD1  . ASP A 1 19 ? -6.662 7.503   12.374 1.00 0.00 ? 19 ASP A OD1  4  
ATOM 3731  O OD2  . ASP A 1 19 ? -4.959 8.081   11.111 1.00 0.00 ? 19 ASP A OD2  4  
ATOM 3732  H H    . ASP A 1 19 ? -3.667 5.861   15.305 1.00 0.00 ? 19 ASP A H    4  
ATOM 3733  H HA   . ASP A 1 19 ? -5.453 5.218   13.159 1.00 0.00 ? 19 ASP A HA   4  
ATOM 3734  H HB2  . ASP A 1 19 ? -4.776 7.552   14.177 1.00 0.00 ? 19 ASP A HB2  4  
ATOM 3735  H HB3  . ASP A 1 19 ? -3.484 7.464   12.983 1.00 0.00 ? 19 ASP A HB3  4  
ATOM 3736  N N    . ALA A 1 20 ? -4.020 4.610   11.189 1.00 0.00 ? 20 ALA A N    4  
ATOM 3737  C CA   . ALA A 1 20 ? -3.202 4.024   10.135 1.00 0.00 ? 20 ALA A CA   4  
ATOM 3738  C C    . ALA A 1 20 ? -2.418 5.097   9.387  1.00 0.00 ? 20 ALA A C    4  
ATOM 3739  O O    . ALA A 1 20 ? -1.305 4.854   8.921  1.00 0.00 ? 20 ALA A O    4  
ATOM 3740  C CB   . ALA A 1 20 ? -4.073 3.234   9.169  1.00 0.00 ? 20 ALA A CB   4  
ATOM 3741  H H    . ALA A 1 20 ? -4.982 4.723   11.041 1.00 0.00 ? 20 ALA A H    4  
ATOM 3742  H HA   . ALA A 1 20 ? -2.505 3.339   10.596 1.00 0.00 ? 20 ALA A HA   4  
ATOM 3743  H HB1  . ALA A 1 20 ? -4.086 2.195   9.465  1.00 0.00 ? 20 ALA A HB1  4  
ATOM 3744  H HB2  . ALA A 1 20 ? -5.078 3.627   9.187  1.00 0.00 ? 20 ALA A HB2  4  
ATOM 3745  H HB3  . ALA A 1 20 ? -3.670 3.319   8.170  1.00 0.00 ? 20 ALA A HB3  4  
ATOM 3746  N N    . ASP A 1 21 ? -3.006 6.283   9.276  1.00 0.00 ? 21 ASP A N    4  
ATOM 3747  C CA   . ASP A 1 21 ? -2.362 7.394   8.585  1.00 0.00 ? 21 ASP A CA   4  
ATOM 3748  C C    . ASP A 1 21 ? -0.982 7.672   9.172  1.00 0.00 ? 21 ASP A C    4  
ATOM 3749  O O    . ASP A 1 21 ? -0.060 8.069   8.458  1.00 0.00 ? 21 ASP A O    4  
ATOM 3750  C CB   . ASP A 1 21 ? -3.230 8.650   8.673  1.00 0.00 ? 21 ASP A CB   4  
ATOM 3751  C CG   . ASP A 1 21 ? -2.747 9.754   7.753  1.00 0.00 ? 21 ASP A CG   4  
ATOM 3752  O OD1  . ASP A 1 21 ? -1.913 10.571  8.194  1.00 0.00 ? 21 ASP A OD1  4  
ATOM 3753  O OD2  . ASP A 1 21 ? -3.205 9.801   6.592  1.00 0.00 ? 21 ASP A OD2  4  
ATOM 3754  H H    . ASP A 1 21 ? -3.894 6.415   9.669  1.00 0.00 ? 21 ASP A H    4  
ATOM 3755  H HA   . ASP A 1 21 ? -2.249 7.118   7.547  1.00 0.00 ? 21 ASP A HA   4  
ATOM 3756  H HB2  . ASP A 1 21 ? -4.245 8.398   8.401  1.00 0.00 ? 21 ASP A HB2  4  
ATOM 3757  H HB3  . ASP A 1 21 ? -3.216 9.019   9.688  1.00 0.00 ? 21 ASP A HB3  4  
ATOM 3758  N N    . LYS A 1 22 ? -0.846 7.463   10.477 1.00 0.00 ? 22 LYS A N    4  
ATOM 3759  C CA   . LYS A 1 22 ? 0.421  7.691   11.161 1.00 0.00 ? 22 LYS A CA   4  
ATOM 3760  C C    . LYS A 1 22 ? 1.450  6.638   10.765 1.00 0.00 ? 22 LYS A C    4  
ATOM 3761  O O    . LYS A 1 22 ? 2.656  6.875   10.840 1.00 0.00 ? 22 LYS A O    4  
ATOM 3762  C CB   . LYS A 1 22 ? 0.215  7.674   12.678 1.00 0.00 ? 22 LYS A CB   4  
ATOM 3763  C CG   . LYS A 1 22 ? -0.639 8.821   13.189 1.00 0.00 ? 22 LYS A CG   4  
ATOM 3764  C CD   . LYS A 1 22 ? -0.468 9.021   14.685 1.00 0.00 ? 22 LYS A CD   4  
ATOM 3765  C CE   . LYS A 1 22 ? -1.125 10.309  15.155 1.00 0.00 ? 22 LYS A CE   4  
ATOM 3766  N NZ   . LYS A 1 22 ? -0.186 11.463  15.099 1.00 0.00 ? 22 LYS A NZ   4  
ATOM 3767  H H    . LYS A 1 22 ? -1.618 7.147   10.993 1.00 0.00 ? 22 LYS A H    4  
ATOM 3768  H HA   . LYS A 1 22 ? 0.786  8.663   10.867 1.00 0.00 ? 22 LYS A HA   4  
ATOM 3769  H HB2  . LYS A 1 22 ? -0.263 6.746   12.954 1.00 0.00 ? 22 LYS A HB2  4  
ATOM 3770  H HB3  . LYS A 1 22 ? 1.180  7.729   13.160 1.00 0.00 ? 22 LYS A HB3  4  
ATOM 3771  H HG2  . LYS A 1 22 ? -0.349 9.729   12.680 1.00 0.00 ? 22 LYS A HG2  4  
ATOM 3772  H HG3  . LYS A 1 22 ? -1.678 8.606   12.980 1.00 0.00 ? 22 LYS A HG3  4  
ATOM 3773  H HD2  . LYS A 1 22 ? -0.921 8.189   15.205 1.00 0.00 ? 22 LYS A HD2  4  
ATOM 3774  H HD3  . LYS A 1 22 ? 0.587  9.060   14.916 1.00 0.00 ? 22 LYS A HD3  4  
ATOM 3775  H HE2  . LYS A 1 22 ? -1.974 10.517  14.522 1.00 0.00 ? 22 LYS A HE2  4  
ATOM 3776  H HE3  . LYS A 1 22 ? -1.460 10.177  16.173 1.00 0.00 ? 22 LYS A HE3  4  
ATOM 3777  H HZ1  . LYS A 1 22 ? -0.680 12.309  14.750 1.00 0.00 ? 22 LYS A HZ1  4  
ATOM 3778  H HZ2  . LYS A 1 22 ? 0.606  11.249  14.460 1.00 0.00 ? 22 LYS A HZ2  4  
ATOM 3779  H HZ3  . LYS A 1 22 ? 0.192  11.663  16.047 1.00 0.00 ? 22 LYS A HZ3  4  
ATOM 3780  N N    . VAL A 1 23 ? 0.967  5.474   10.343 1.00 0.00 ? 23 VAL A N    4  
ATOM 3781  C CA   . VAL A 1 23 ? 1.845  4.385   9.932  1.00 0.00 ? 23 VAL A CA   4  
ATOM 3782  C C    . VAL A 1 23 ? 2.474  4.669   8.573  1.00 0.00 ? 23 VAL A C    4  
ATOM 3783  O O    . VAL A 1 23 ? 2.082  4.088   7.561  1.00 0.00 ? 23 VAL A O    4  
ATOM 3784  C CB   . VAL A 1 23 ? 1.086  3.046   9.864  1.00 0.00 ? 23 VAL A CB   4  
ATOM 3785  C CG1  . VAL A 1 23 ? 2.046  1.901   9.581  1.00 0.00 ? 23 VAL A CG1  4  
ATOM 3786  C CG2  . VAL A 1 23 ? 0.320  2.803   11.156 1.00 0.00 ? 23 VAL A CG2  4  
ATOM 3787  H H    . VAL A 1 23 ? -0.004 5.345   10.305 1.00 0.00 ? 23 VAL A H    4  
ATOM 3788  H HA   . VAL A 1 23 ? 2.630  4.293   10.669 1.00 0.00 ? 23 VAL A HA   4  
ATOM 3789  H HB   . VAL A 1 23 ? 0.375  3.100   9.053  1.00 0.00 ? 23 VAL A HB   4  
ATOM 3790  H HG11 . VAL A 1 23 ? 3.054  2.284   9.520  1.00 0.00 ? 23 VAL A HG11 4  
ATOM 3791  H HG12 . VAL A 1 23 ? 1.983  1.173   10.376 1.00 0.00 ? 23 VAL A HG12 4  
ATOM 3792  H HG13 . VAL A 1 23 ? 1.782  1.435   8.643  1.00 0.00 ? 23 VAL A HG13 4  
ATOM 3793  H HG21 . VAL A 1 23 ? 0.992  2.898   11.996 1.00 0.00 ? 23 VAL A HG21 4  
ATOM 3794  H HG22 . VAL A 1 23 ? -0.474 3.531   11.247 1.00 0.00 ? 23 VAL A HG22 4  
ATOM 3795  H HG23 . VAL A 1 23 ? -0.103 1.810   11.143 1.00 0.00 ? 23 VAL A HG23 4  
ATOM 3796  N N    . THR A 1 24 ? 3.454  5.567   8.557  1.00 0.00 ? 24 THR A N    4  
ATOM 3797  C CA   . THR A 1 24 ? 4.138  5.930   7.322  1.00 0.00 ? 24 THR A CA   4  
ATOM 3798  C C    . THR A 1 24 ? 5.532  5.314   7.264  1.00 0.00 ? 24 THR A C    4  
ATOM 3799  O O    . THR A 1 24 ? 6.067  4.873   8.280  1.00 0.00 ? 24 THR A O    4  
ATOM 3800  C CB   . THR A 1 24 ? 4.258  7.458   7.174  1.00 0.00 ? 24 THR A CB   4  
ATOM 3801  O OG1  . THR A 1 24 ? 5.055  7.992   8.237  1.00 0.00 ? 24 THR A OG1  4  
ATOM 3802  C CG2  . THR A 1 24 ? 2.885  8.112   7.184  1.00 0.00 ? 24 THR A CG2  4  
ATOM 3803  H H    . THR A 1 24 ? 3.722  5.996   9.396  1.00 0.00 ? 24 THR A H    4  
ATOM 3804  H HA   . THR A 1 24 ? 3.554  5.554   6.494  1.00 0.00 ? 24 THR A HA   4  
ATOM 3805  H HB   . THR A 1 24 ? 4.738  7.677   6.230  1.00 0.00 ? 24 THR A HB   4  
ATOM 3806  H HG1  . THR A 1 24 ? 4.969  8.949   8.252  1.00 0.00 ? 24 THR A HG1  4  
ATOM 3807  H HG21 . THR A 1 24 ? 2.644  8.429   8.189  1.00 0.00 ? 24 THR A HG21 4  
ATOM 3808  H HG22 . THR A 1 24 ? 2.146  7.403   6.844  1.00 0.00 ? 24 THR A HG22 4  
ATOM 3809  H HG23 . THR A 1 24 ? 2.890  8.970   6.529  1.00 0.00 ? 24 THR A HG23 4  
ATOM 3810  N N    . GLU A 1 25 ? 6.114  5.289   6.069  1.00 0.00 ? 25 GLU A N    4  
ATOM 3811  C CA   . GLU A 1 25 ? 7.446  4.727   5.881  1.00 0.00 ? 25 GLU A CA   4  
ATOM 3812  C C    . GLU A 1 25 ? 8.439  5.341   6.862  1.00 0.00 ? 25 GLU A C    4  
ATOM 3813  O O    . GLU A 1 25 ? 9.354  4.670   7.338  1.00 0.00 ? 25 GLU A O    4  
ATOM 3814  C CB   . GLU A 1 25 ? 7.922  4.957   4.445  1.00 0.00 ? 25 GLU A CB   4  
ATOM 3815  C CG   . GLU A 1 25 ? 7.083  4.237   3.402  1.00 0.00 ? 25 GLU A CG   4  
ATOM 3816  C CD   . GLU A 1 25 ? 5.901  5.063   2.933  1.00 0.00 ? 25 GLU A CD   4  
ATOM 3817  O OE1  . GLU A 1 25 ? 6.106  5.978   2.108  1.00 0.00 ? 25 GLU A OE1  4  
ATOM 3818  O OE2  . GLU A 1 25 ? 4.771  4.793   3.390  1.00 0.00 ? 25 GLU A OE2  4  
ATOM 3819  H H    . GLU A 1 25 ? 5.636  5.657   5.296  1.00 0.00 ? 25 GLU A H    4  
ATOM 3820  H HA   . GLU A 1 25 ? 7.386  3.665   6.064  1.00 0.00 ? 25 GLU A HA   4  
ATOM 3821  H HB2  . GLU A 1 25 ? 7.892  6.016   4.234  1.00 0.00 ? 25 GLU A HB2  4  
ATOM 3822  H HB3  . GLU A 1 25 ? 8.941  4.611   4.357  1.00 0.00 ? 25 GLU A HB3  4  
ATOM 3823  H HG2  . GLU A 1 25 ? 7.707  4.012   2.550  1.00 0.00 ? 25 GLU A HG2  4  
ATOM 3824  H HG3  . GLU A 1 25 ? 6.714  3.316   3.830  1.00 0.00 ? 25 GLU A HG3  4  
ATOM 3825  N N    . GLY A 1 26 ? 8.252  6.623   7.161  1.00 0.00 ? 26 GLY A N    4  
ATOM 3826  C CA   . GLY A 1 26 ? 9.139  7.307   8.084  1.00 0.00 ? 26 GLY A CA   4  
ATOM 3827  C C    . GLY A 1 26 ? 8.542  7.441   9.471  1.00 0.00 ? 26 GLY A C    4  
ATOM 3828  O O    . GLY A 1 26 ? 8.801  8.417   10.174 1.00 0.00 ? 26 GLY A O    4  
ATOM 3829  H H    . GLY A 1 26 ? 7.505  7.108   6.752  1.00 0.00 ? 26 GLY A H    4  
ATOM 3830  H HA2  . GLY A 1 26 ? 10.064 6.754   8.153  1.00 0.00 ? 26 GLY A HA2  4  
ATOM 3831  H HA3  . GLY A 1 26 ? 9.349  8.294   7.698  1.00 0.00 ? 26 GLY A HA3  4  
ATOM 3832  N N    . ALA A 1 27 ? 7.738  6.458   9.865  1.00 0.00 ? 27 ALA A N    4  
ATOM 3833  C CA   . ALA A 1 27 ? 7.103  6.471   11.176 1.00 0.00 ? 27 ALA A CA   4  
ATOM 3834  C C    . ALA A 1 27 ? 7.851  5.575   12.157 1.00 0.00 ? 27 ALA A C    4  
ATOM 3835  O O    . ALA A 1 27 ? 7.834  4.350   12.032 1.00 0.00 ? 27 ALA A O    4  
ATOM 3836  C CB   . ALA A 1 27 ? 5.649  6.034   11.063 1.00 0.00 ? 27 ALA A CB   4  
ATOM 3837  H H    . ALA A 1 27 ? 7.570  5.707   9.259  1.00 0.00 ? 27 ALA A H    4  
ATOM 3838  H HA   . ALA A 1 27 ? 7.120  7.486   11.546 1.00 0.00 ? 27 ALA A HA   4  
ATOM 3839  H HB1  . ALA A 1 27 ? 5.596  5.103   10.519 1.00 0.00 ? 27 ALA A HB1  4  
ATOM 3840  H HB2  . ALA A 1 27 ? 5.236  5.899   12.051 1.00 0.00 ? 27 ALA A HB2  4  
ATOM 3841  H HB3  . ALA A 1 27 ? 5.087  6.791   10.538 1.00 0.00 ? 27 ALA A HB3  4  
ATOM 3842  N N    . SER A 1 28 ? 8.508  6.193   13.134 1.00 0.00 ? 28 SER A N    4  
ATOM 3843  C CA   . SER A 1 28 ? 9.267  5.451   14.134 1.00 0.00 ? 28 SER A CA   4  
ATOM 3844  C C    . SER A 1 28 ? 8.389  5.101   15.332 1.00 0.00 ? 28 SER A C    4  
ATOM 3845  O O    . SER A 1 28 ? 7.899  5.985   16.035 1.00 0.00 ? 28 SER A O    4  
ATOM 3846  C CB   . SER A 1 28 ? 10.477 6.265   14.594 1.00 0.00 ? 28 SER A CB   4  
ATOM 3847  O OG   . SER A 1 28 ? 10.076 7.389   15.359 1.00 0.00 ? 28 SER A OG   4  
ATOM 3848  H H    . SER A 1 28 ? 8.484  7.172   13.181 1.00 0.00 ? 28 SER A H    4  
ATOM 3849  H HA   . SER A 1 28 ? 9.612  4.536   13.676 1.00 0.00 ? 28 SER A HA   4  
ATOM 3850  H HB2  . SER A 1 28 ? 11.118 5.643   15.200 1.00 0.00 ? 28 SER A HB2  4  
ATOM 3851  H HB3  . SER A 1 28 ? 11.025 6.611   13.729 1.00 0.00 ? 28 SER A HB3  4  
ATOM 3852  H HG   . SER A 1 28 ? 10.586 8.157   15.092 1.00 0.00 ? 28 SER A HG   4  
ATOM 3853  N N    . PHE A 1 29 ? 8.196  3.806   15.558 1.00 0.00 ? 29 PHE A N    4  
ATOM 3854  C CA   . PHE A 1 29 ? 7.378  3.338   16.670 1.00 0.00 ? 29 PHE A CA   4  
ATOM 3855  C C    . PHE A 1 29 ? 7.982  3.760   18.006 1.00 0.00 ? 29 PHE A C    4  
ATOM 3856  O O    . PHE A 1 29 ? 7.330  3.680   19.048 1.00 0.00 ? 29 PHE A O    4  
ATOM 3857  C CB   . PHE A 1 29 ? 7.235  1.816   16.621 1.00 0.00 ? 29 PHE A CB   4  
ATOM 3858  C CG   . PHE A 1 29 ? 6.905  1.289   15.254 1.00 0.00 ? 29 PHE A CG   4  
ATOM 3859  C CD1  . PHE A 1 29 ? 5.602  1.316   14.782 1.00 0.00 ? 29 PHE A CD1  4  
ATOM 3860  C CD2  . PHE A 1 29 ? 7.897  0.766   14.440 1.00 0.00 ? 29 PHE A CD2  4  
ATOM 3861  C CE1  . PHE A 1 29 ? 5.295  0.832   13.524 1.00 0.00 ? 29 PHE A CE1  4  
ATOM 3862  C CE2  . PHE A 1 29 ? 7.596  0.281   13.181 1.00 0.00 ? 29 PHE A CE2  4  
ATOM 3863  C CZ   . PHE A 1 29 ? 6.294  0.313   12.723 1.00 0.00 ? 29 PHE A CZ   4  
ATOM 3864  H H    . PHE A 1 29 ? 8.614  3.149   14.962 1.00 0.00 ? 29 PHE A H    4  
ATOM 3865  H HA   . PHE A 1 29 ? 6.401  3.786   16.573 1.00 0.00 ? 29 PHE A HA   4  
ATOM 3866  H HB2  . PHE A 1 29 ? 8.164  1.363   16.935 1.00 0.00 ? 29 PHE A HB2  4  
ATOM 3867  H HB3  . PHE A 1 29 ? 6.447  1.513   17.294 1.00 0.00 ? 29 PHE A HB3  4  
ATOM 3868  H HD1  . PHE A 1 29 ? 4.820  1.722   15.408 1.00 0.00 ? 29 PHE A HD1  4  
ATOM 3869  H HD2  . PHE A 1 29 ? 8.916  0.739   14.797 1.00 0.00 ? 29 PHE A HD2  4  
ATOM 3870  H HE1  . PHE A 1 29 ? 4.276  0.859   13.169 1.00 0.00 ? 29 PHE A HE1  4  
ATOM 3871  H HE2  . PHE A 1 29 ? 8.378  -0.125  12.557 1.00 0.00 ? 29 PHE A HE2  4  
ATOM 3872  H HZ   . PHE A 1 29 ? 6.056  -0.065  11.740 1.00 0.00 ? 29 PHE A HZ   4  
ATOM 3873  N N    . ILE A 1 30 ? 9.232  4.209   17.968 1.00 0.00 ? 30 ILE A N    4  
ATOM 3874  C CA   . ILE A 1 30 ? 9.925  4.644   19.174 1.00 0.00 ? 30 ILE A CA   4  
ATOM 3875  C C    . ILE A 1 30 ? 9.597  6.097   19.503 1.00 0.00 ? 30 ILE A C    4  
ATOM 3876  O O    . ILE A 1 30 ? 9.175  6.412   20.616 1.00 0.00 ? 30 ILE A O    4  
ATOM 3877  C CB   . ILE A 1 30 ? 11.451 4.494   19.032 1.00 0.00 ? 30 ILE A CB   4  
ATOM 3878  C CG1  . ILE A 1 30 ? 11.821 3.029   18.795 1.00 0.00 ? 30 ILE A CG1  4  
ATOM 3879  C CG2  . ILE A 1 30 ? 12.153 5.030   20.271 1.00 0.00 ? 30 ILE A CG2  4  
ATOM 3880  C CD1  . ILE A 1 30 ? 11.346 2.101   19.891 1.00 0.00 ? 30 ILE A CD1  4  
ATOM 3881  H H    . ILE A 1 30 ? 9.699  4.250   17.107 1.00 0.00 ? 30 ILE A H    4  
ATOM 3882  H HA   . ILE A 1 30 ? 9.596  4.018   19.991 1.00 0.00 ? 30 ILE A HA   4  
ATOM 3883  H HB   . ILE A 1 30 ? 11.771 5.081   18.184 1.00 0.00 ? 30 ILE A HB   4  
ATOM 3884  H HG12 . ILE A 1 30 ? 11.382 2.698   17.868 1.00 0.00 ? 30 ILE A HG12 4  
ATOM 3885  H HG13 . ILE A 1 30 ? 12.897 2.943   18.730 1.00 0.00 ? 30 ILE A HG13 4  
ATOM 3886  H HG21 . ILE A 1 30 ? 12.806 4.269   20.672 1.00 0.00 ? 30 ILE A HG21 4  
ATOM 3887  H HG22 . ILE A 1 30 ? 12.736 5.900   20.005 1.00 0.00 ? 30 ILE A HG22 4  
ATOM 3888  H HG23 . ILE A 1 30 ? 11.418 5.302   21.013 1.00 0.00 ? 30 ILE A HG23 4  
ATOM 3889  H HD11 . ILE A 1 30 ? 10.414 1.643   19.597 1.00 0.00 ? 30 ILE A HD11 4  
ATOM 3890  H HD12 . ILE A 1 30 ? 12.087 1.334   20.061 1.00 0.00 ? 30 ILE A HD12 4  
ATOM 3891  H HD13 . ILE A 1 30 ? 11.197 2.665   20.801 1.00 0.00 ? 30 ILE A HD13 4  
ATOM 3892  N N    . ASP A 1 31 ? 9.791  6.977   18.527 1.00 0.00 ? 31 ASP A N    4  
ATOM 3893  C CA   . ASP A 1 31 ? 9.512  8.397   18.711 1.00 0.00 ? 31 ASP A CA   4  
ATOM 3894  C C    . ASP A 1 31 ? 8.111  8.744   18.219 1.00 0.00 ? 31 ASP A C    4  
ATOM 3895  O O    . ASP A 1 31 ? 7.268  9.204   18.990 1.00 0.00 ? 31 ASP A O    4  
ATOM 3896  C CB   . ASP A 1 31 ? 10.550 9.242   17.971 1.00 0.00 ? 31 ASP A CB   4  
ATOM 3897  C CG   . ASP A 1 31 ? 11.279 10.201  18.892 1.00 0.00 ? 31 ASP A CG   4  
ATOM 3898  O OD1  . ASP A 1 31 ? 10.658 10.677  19.865 1.00 0.00 ? 31 ASP A OD1  4  
ATOM 3899  O OD2  . ASP A 1 31 ? 12.471 10.474  18.640 1.00 0.00 ? 31 ASP A OD2  4  
ATOM 3900  H H    . ASP A 1 31 ? 10.128 6.664   17.661 1.00 0.00 ? 31 ASP A H    4  
ATOM 3901  H HA   . ASP A 1 31 ? 9.573  8.612   19.767 1.00 0.00 ? 31 ASP A HA   4  
ATOM 3902  H HB2  . ASP A 1 31 ? 11.278 8.587   17.514 1.00 0.00 ? 31 ASP A HB2  4  
ATOM 3903  H HB3  . ASP A 1 31 ? 10.055 9.816   17.201 1.00 0.00 ? 31 ASP A HB3  4  
ATOM 3904  N N    . ASP A 1 32 ? 7.869  8.522   16.932 1.00 0.00 ? 32 ASP A N    4  
ATOM 3905  C CA   . ASP A 1 32 ? 6.570  8.811   16.336 1.00 0.00 ? 32 ASP A CA   4  
ATOM 3906  C C    . ASP A 1 32 ? 5.439  8.351   17.251 1.00 0.00 ? 32 ASP A C    4  
ATOM 3907  O O    . ASP A 1 32 ? 4.446  9.057   17.431 1.00 0.00 ? 32 ASP A O    4  
ATOM 3908  C CB   . ASP A 1 32 ? 6.448  8.132   14.971 1.00 0.00 ? 32 ASP A CB   4  
ATOM 3909  C CG   . ASP A 1 32 ? 5.457  8.833   14.063 1.00 0.00 ? 32 ASP A CG   4  
ATOM 3910  O OD1  . ASP A 1 32 ? 5.799  9.908   13.529 1.00 0.00 ? 32 ASP A OD1  4  
ATOM 3911  O OD2  . ASP A 1 32 ? 4.338  8.306   13.887 1.00 0.00 ? 32 ASP A OD2  4  
ATOM 3912  H H    . ASP A 1 32 ? 8.582  8.154   16.368 1.00 0.00 ? 32 ASP A H    4  
ATOM 3913  H HA   . ASP A 1 32 ? 6.496  9.880   16.204 1.00 0.00 ? 32 ASP A HA   4  
ATOM 3914  H HB2  . ASP A 1 32 ? 7.414  8.134   14.488 1.00 0.00 ? 32 ASP A HB2  4  
ATOM 3915  H HB3  . ASP A 1 32 ? 6.122  7.112   15.112 1.00 0.00 ? 32 ASP A HB3  4  
ATOM 3916  N N    . LEU A 1 33 ? 5.595  7.163   17.824 1.00 0.00 ? 33 LEU A N    4  
ATOM 3917  C CA   . LEU A 1 33 ? 4.586  6.607   18.719 1.00 0.00 ? 33 LEU A CA   4  
ATOM 3918  C C    . LEU A 1 33 ? 4.983  6.807   20.178 1.00 0.00 ? 33 LEU A C    4  
ATOM 3919  O O    . LEU A 1 33 ? 4.155  6.685   21.080 1.00 0.00 ? 33 LEU A O    4  
ATOM 3920  C CB   . LEU A 1 33 ? 4.387  5.117   18.433 1.00 0.00 ? 33 LEU A CB   4  
ATOM 3921  C CG   . LEU A 1 33 ? 3.944  4.760   17.014 1.00 0.00 ? 33 LEU A CG   4  
ATOM 3922  C CD1  . LEU A 1 33 ? 3.477  3.314   16.949 1.00 0.00 ? 33 LEU A CD1  4  
ATOM 3923  C CD2  . LEU A 1 33 ? 2.842  5.699   16.547 1.00 0.00 ? 33 LEU A CD2  4  
ATOM 3924  H H    . LEU A 1 33 ? 6.407  6.647   17.642 1.00 0.00 ? 33 LEU A H    4  
ATOM 3925  H HA   . LEU A 1 33 ? 3.658  7.127   18.536 1.00 0.00 ? 33 LEU A HA   4  
ATOM 3926  H HB2  . LEU A 1 33 ? 5.324  4.616   18.622 1.00 0.00 ? 33 LEU A HB2  4  
ATOM 3927  H HB3  . LEU A 1 33 ? 3.638  4.747   19.118 1.00 0.00 ? 33 LEU A HB3  4  
ATOM 3928  H HG   . LEU A 1 33 ? 4.785  4.869   16.343 1.00 0.00 ? 33 LEU A HG   4  
ATOM 3929  H HD11 . LEU A 1 33 ? 4.291  2.660   17.223 1.00 0.00 ? 33 LEU A HD11 4  
ATOM 3930  H HD12 . LEU A 1 33 ? 3.154  3.085   15.944 1.00 0.00 ? 33 LEU A HD12 4  
ATOM 3931  H HD13 . LEU A 1 33 ? 2.653  3.171   17.633 1.00 0.00 ? 33 LEU A HD13 4  
ATOM 3932  H HD21 . LEU A 1 33 ? 2.337  6.116   17.406 1.00 0.00 ? 33 LEU A HD21 4  
ATOM 3933  H HD22 . LEU A 1 33 ? 2.133  5.151   15.944 1.00 0.00 ? 33 LEU A HD22 4  
ATOM 3934  H HD23 . LEU A 1 33 ? 3.273  6.497   15.960 1.00 0.00 ? 33 LEU A HD23 4  
ATOM 3935  N N    . GLY A 1 34 ? 6.256  7.119   20.403 1.00 0.00 ? 34 GLY A N    4  
ATOM 3936  C CA   . GLY A 1 34 ? 6.740  7.334   21.754 1.00 0.00 ? 34 GLY A CA   4  
ATOM 3937  C C    . GLY A 1 34 ? 6.847  6.045   22.544 1.00 0.00 ? 34 GLY A C    4  
ATOM 3938  O O    . GLY A 1 34 ? 6.612  6.027   23.752 1.00 0.00 ? 34 GLY A O    4  
ATOM 3939  H H    . GLY A 1 34 ? 6.871  7.203   19.645 1.00 0.00 ? 34 GLY A H    4  
ATOM 3940  H HA2  . GLY A 1 34 ? 7.714  7.797   21.706 1.00 0.00 ? 34 GLY A HA2  4  
ATOM 3941  H HA3  . GLY A 1 34 ? 6.060  8.000   22.266 1.00 0.00 ? 34 GLY A HA3  4  
ATOM 3942  N N    . ALA A 1 35 ? 7.200  4.961   21.860 1.00 0.00 ? 35 ALA A N    4  
ATOM 3943  C CA   . ALA A 1 35 ? 7.338  3.662   22.505 1.00 0.00 ? 35 ALA A CA   4  
ATOM 3944  C C    . ALA A 1 35 ? 8.803  3.335   22.774 1.00 0.00 ? 35 ALA A C    4  
ATOM 3945  O O    . ALA A 1 35 ? 9.701  4.035   22.307 1.00 0.00 ? 35 ALA A O    4  
ATOM 3946  C CB   . ALA A 1 35 ? 6.702  2.577   21.648 1.00 0.00 ? 35 ALA A CB   4  
ATOM 3947  H H    . ALA A 1 35 ? 7.374  5.038   20.899 1.00 0.00 ? 35 ALA A H    4  
ATOM 3948  H HA   . ALA A 1 35 ? 6.809  3.699   23.446 1.00 0.00 ? 35 ALA A HA   4  
ATOM 3949  H HB1  . ALA A 1 35 ? 5.862  2.991   21.109 1.00 0.00 ? 35 ALA A HB1  4  
ATOM 3950  H HB2  . ALA A 1 35 ? 7.430  2.200   20.946 1.00 0.00 ? 35 ALA A HB2  4  
ATOM 3951  H HB3  . ALA A 1 35 ? 6.361  1.772   22.282 1.00 0.00 ? 35 ALA A HB3  4  
ATOM 3952  N N    . ASP A 1 36 ? 9.036  2.267   23.530 1.00 0.00 ? 36 ASP A N    4  
ATOM 3953  C CA   . ASP A 1 36 ? 10.393 1.848   23.861 1.00 0.00 ? 36 ASP A CA   4  
ATOM 3954  C C    . ASP A 1 36 ? 10.771 0.581   23.100 1.00 0.00 ? 36 ASP A C    4  
ATOM 3955  O O    . ASP A 1 36 ? 9.958  0.021   22.364 1.00 0.00 ? 36 ASP A O    4  
ATOM 3956  C CB   . ASP A 1 36 ? 10.524 1.611   25.366 1.00 0.00 ? 36 ASP A CB   4  
ATOM 3957  C CG   . ASP A 1 36 ? 10.818 2.887   26.130 1.00 0.00 ? 36 ASP A CG   4  
ATOM 3958  O OD1  . ASP A 1 36 ? 10.408 3.968   25.658 1.00 0.00 ? 36 ASP A OD1  4  
ATOM 3959  O OD2  . ASP A 1 36 ? 11.458 2.805   27.199 1.00 0.00 ? 36 ASP A OD2  4  
ATOM 3960  H H    . ASP A 1 36 ? 8.278  1.749   23.873 1.00 0.00 ? 36 ASP A H    4  
ATOM 3961  H HA   . ASP A 1 36 ? 11.066 2.640   23.571 1.00 0.00 ? 36 ASP A HA   4  
ATOM 3962  H HB2  . ASP A 1 36 ? 9.599  1.195   25.740 1.00 0.00 ? 36 ASP A HB2  4  
ATOM 3963  H HB3  . ASP A 1 36 ? 11.327 0.912   25.546 1.00 0.00 ? 36 ASP A HB3  4  
ATOM 3964  N N    . SER A 1 37 ? 12.010 0.135   23.281 1.00 0.00 ? 37 SER A N    4  
ATOM 3965  C CA   . SER A 1 37 ? 12.497 -1.063  22.607 1.00 0.00 ? 37 SER A CA   4  
ATOM 3966  C C    . SER A 1 37 ? 11.553 -2.239  22.840 1.00 0.00 ? 37 SER A C    4  
ATOM 3967  O O    . SER A 1 37 ? 11.438 -3.134  22.001 1.00 0.00 ? 37 SER A O    4  
ATOM 3968  C CB   . SER A 1 37 ? 13.901 -1.416  23.101 1.00 0.00 ? 37 SER A CB   4  
ATOM 3969  O OG   . SER A 1 37 ? 14.270 -2.724  22.698 1.00 0.00 ? 37 SER A OG   4  
ATOM 3970  H H    . SER A 1 37 ? 12.611 0.625   23.880 1.00 0.00 ? 37 SER A H    4  
ATOM 3971  H HA   . SER A 1 37 ? 12.539 -0.855  21.549 1.00 0.00 ? 37 SER A HA   4  
ATOM 3972  H HB2  . SER A 1 37 ? 14.611 -0.713  22.693 1.00 0.00 ? 37 SER A HB2  4  
ATOM 3973  H HB3  . SER A 1 37 ? 13.924 -1.365  24.180 1.00 0.00 ? 37 SER A HB3  4  
ATOM 3974  H HG   . SER A 1 37 ? 14.025 -2.857  21.780 1.00 0.00 ? 37 SER A HG   4  
ATOM 3975  N N    . LEU A 1 38 ? 10.880 -2.231  23.985 1.00 0.00 ? 38 LEU A N    4  
ATOM 3976  C CA   . LEU A 1 38 ? 9.945  -3.297  24.330 1.00 0.00 ? 38 LEU A CA   4  
ATOM 3977  C C    . LEU A 1 38 ? 8.891  -3.470  23.241 1.00 0.00 ? 38 LEU A C    4  
ATOM 3978  O O    . LEU A 1 38 ? 8.756  -4.547  22.660 1.00 0.00 ? 38 LEU A O    4  
ATOM 3979  C CB   . LEU A 1 38 ? 9.268  -2.995  25.668 1.00 0.00 ? 38 LEU A CB   4  
ATOM 3980  C CG   . LEU A 1 38 ? 8.220  -4.006  26.134 1.00 0.00 ? 38 LEU A CG   4  
ATOM 3981  C CD1  . LEU A 1 38 ? 8.890  -5.274  26.641 1.00 0.00 ? 38 LEU A CD1  4  
ATOM 3982  C CD2  . LEU A 1 38 ? 7.336  -3.399  27.213 1.00 0.00 ? 38 LEU A CD2  4  
ATOM 3983  H H    . LEU A 1 38 ? 11.014 -1.492  24.614 1.00 0.00 ? 38 LEU A H    4  
ATOM 3984  H HA   . LEU A 1 38 ? 10.507 -4.215  24.419 1.00 0.00 ? 38 LEU A HA   4  
ATOM 3985  H HB2  . LEU A 1 38 ? 10.037 -2.944  26.424 1.00 0.00 ? 38 LEU A HB2  4  
ATOM 3986  H HB3  . LEU A 1 38 ? 8.785  -2.031  25.583 1.00 0.00 ? 38 LEU A HB3  4  
ATOM 3987  H HG   . LEU A 1 38 ? 7.591  -4.274  25.296 1.00 0.00 ? 38 LEU A HG   4  
ATOM 3988  H HD11 . LEU A 1 38 ? 8.574  -6.113  26.041 1.00 0.00 ? 38 LEU A HD11 4  
ATOM 3989  H HD12 . LEU A 1 38 ? 8.610  -5.441  27.671 1.00 0.00 ? 38 LEU A HD12 4  
ATOM 3990  H HD13 . LEU A 1 38 ? 9.963  -5.166  26.573 1.00 0.00 ? 38 LEU A HD13 4  
ATOM 3991  H HD21 . LEU A 1 38 ? 6.435  -3.010  26.763 1.00 0.00 ? 38 LEU A HD21 4  
ATOM 3992  H HD22 . LEU A 1 38 ? 7.868  -2.598  27.706 1.00 0.00 ? 38 LEU A HD22 4  
ATOM 3993  H HD23 . LEU A 1 38 ? 7.078  -4.159  27.936 1.00 0.00 ? 38 LEU A HD23 4  
ATOM 3994  N N    . ASP A 1 39 ? 8.148  -2.403  22.970 1.00 0.00 ? 39 ASP A N    4  
ATOM 3995  C CA   . ASP A 1 39 ? 7.108  -2.436  21.948 1.00 0.00 ? 39 ASP A CA   4  
ATOM 3996  C C    . ASP A 1 39 ? 7.664  -2.944  20.622 1.00 0.00 ? 39 ASP A C    4  
ATOM 3997  O O    . ASP A 1 39 ? 7.052  -3.782  19.959 1.00 0.00 ? 39 ASP A O    4  
ATOM 3998  C CB   . ASP A 1 39 ? 6.502  -1.043  21.762 1.00 0.00 ? 39 ASP A CB   4  
ATOM 3999  C CG   . ASP A 1 39 ? 5.193  -1.079  20.997 1.00 0.00 ? 39 ASP A CG   4  
ATOM 4000  O OD1  . ASP A 1 39 ? 4.344  -1.938  21.315 1.00 0.00 ? 39 ASP A OD1  4  
ATOM 4001  O OD2  . ASP A 1 39 ? 5.018  -0.247  20.083 1.00 0.00 ? 39 ASP A OD2  4  
ATOM 4002  H H    . ASP A 1 39 ? 8.303  -1.573  23.468 1.00 0.00 ? 39 ASP A H    4  
ATOM 4003  H HA   . ASP A 1 39 ? 6.335  -3.112  22.283 1.00 0.00 ? 39 ASP A HA   4  
ATOM 4004  H HB2  . ASP A 1 39 ? 6.319  -0.605  22.732 1.00 0.00 ? 39 ASP A HB2  4  
ATOM 4005  H HB3  . ASP A 1 39 ? 7.200  -0.425  21.217 1.00 0.00 ? 39 ASP A HB3  4  
ATOM 4006  N N    . THR A 1 40 ? 8.829  -2.429  20.238 1.00 0.00 ? 40 THR A N    4  
ATOM 4007  C CA   . THR A 1 40 ? 9.467  -2.828  18.991 1.00 0.00 ? 40 THR A CA   4  
ATOM 4008  C C    . THR A 1 40 ? 9.709  -4.333  18.954 1.00 0.00 ? 40 THR A C    4  
ATOM 4009  O O    . THR A 1 40 ? 9.334  -5.009  17.996 1.00 0.00 ? 40 THR A O    4  
ATOM 4010  C CB   . THR A 1 40 ? 10.808 -2.099  18.787 1.00 0.00 ? 40 THR A CB   4  
ATOM 4011  O OG1  . THR A 1 40 ? 10.624 -0.686  18.931 1.00 0.00 ? 40 THR A OG1  4  
ATOM 4012  C CG2  . THR A 1 40 ? 11.386 -2.402  17.413 1.00 0.00 ? 40 THR A CG2  4  
ATOM 4013  H H    . THR A 1 40 ? 9.267  -1.765  20.810 1.00 0.00 ? 40 THR A H    4  
ATOM 4014  H HA   . THR A 1 40 ? 8.808  -2.560  18.178 1.00 0.00 ? 40 THR A HA   4  
ATOM 4015  H HB   . THR A 1 40 ? 11.505 -2.442  19.538 1.00 0.00 ? 40 THR A HB   4  
ATOM 4016  H HG1  . THR A 1 40 ? 9.963  -0.384  18.303 1.00 0.00 ? 40 THR A HG1  4  
ATOM 4017  H HG21 . THR A 1 40 ? 10.656 -2.164  16.654 1.00 0.00 ? 40 THR A HG21 4  
ATOM 4018  H HG22 . THR A 1 40 ? 11.639 -3.450  17.353 1.00 0.00 ? 40 THR A HG22 4  
ATOM 4019  H HG23 . THR A 1 40 ? 12.274 -1.808  17.257 1.00 0.00 ? 40 THR A HG23 4  
ATOM 4020  N N    . VAL A 1 41 ? 10.338 -4.852  20.004 1.00 0.00 ? 41 VAL A N    4  
ATOM 4021  C CA   . VAL A 1 41 ? 10.629 -6.278  20.092 1.00 0.00 ? 41 VAL A CA   4  
ATOM 4022  C C    . VAL A 1 41 ? 9.360  -7.109  19.937 1.00 0.00 ? 41 VAL A C    4  
ATOM 4023  O O    . VAL A 1 41 ? 9.295  -8.009  19.101 1.00 0.00 ? 41 VAL A O    4  
ATOM 4024  C CB   . VAL A 1 41 ? 11.300 -6.632  21.433 1.00 0.00 ? 41 VAL A CB   4  
ATOM 4025  C CG1  . VAL A 1 41 ? 11.574 -8.126  21.515 1.00 0.00 ? 41 VAL A CG1  4  
ATOM 4026  C CG2  . VAL A 1 41 ? 12.583 -5.835  21.612 1.00 0.00 ? 41 VAL A CG2  4  
ATOM 4027  H H    . VAL A 1 41 ? 10.612 -4.262  20.736 1.00 0.00 ? 41 VAL A H    4  
ATOM 4028  H HA   . VAL A 1 41 ? 11.312 -6.530  19.294 1.00 0.00 ? 41 VAL A HA   4  
ATOM 4029  H HB   . VAL A 1 41 ? 10.623 -6.368  22.232 1.00 0.00 ? 41 VAL A HB   4  
ATOM 4030  H HG11 . VAL A 1 41 ? 10.751 -8.616  22.013 1.00 0.00 ? 41 VAL A HG11 4  
ATOM 4031  H HG12 . VAL A 1 41 ? 11.684 -8.527  20.518 1.00 0.00 ? 41 VAL A HG12 4  
ATOM 4032  H HG13 . VAL A 1 41 ? 12.483 -8.294  22.073 1.00 0.00 ? 41 VAL A HG13 4  
ATOM 4033  H HG21 . VAL A 1 41 ? 13.405 -6.513  21.793 1.00 0.00 ? 41 VAL A HG21 4  
ATOM 4034  H HG22 . VAL A 1 41 ? 12.780 -5.262  20.717 1.00 0.00 ? 41 VAL A HG22 4  
ATOM 4035  H HG23 . VAL A 1 41 ? 12.477 -5.165  22.452 1.00 0.00 ? 41 VAL A HG23 4  
ATOM 4036  N N    . GLU A 1 42 ? 8.353  -6.799  20.748 1.00 0.00 ? 42 GLU A N    4  
ATOM 4037  C CA   . GLU A 1 42 ? 7.086  -7.517  20.700 1.00 0.00 ? 42 GLU A CA   4  
ATOM 4038  C C    . GLU A 1 42 ? 6.532  -7.550  19.279 1.00 0.00 ? 42 GLU A C    4  
ATOM 4039  O O    . GLU A 1 42 ? 6.178  -8.611  18.762 1.00 0.00 ? 42 GLU A O    4  
ATOM 4040  C CB   . GLU A 1 42 ? 6.069  -6.866  21.640 1.00 0.00 ? 42 GLU A CB   4  
ATOM 4041  C CG   . GLU A 1 42 ? 6.433  -6.991  23.111 1.00 0.00 ? 42 GLU A CG   4  
ATOM 4042  C CD   . GLU A 1 42 ? 5.907  -8.268  23.736 1.00 0.00 ? 42 GLU A CD   4  
ATOM 4043  O OE1  . GLU A 1 42 ? 6.427  -9.352  23.398 1.00 0.00 ? 42 GLU A OE1  4  
ATOM 4044  O OE2  . GLU A 1 42 ? 4.975  -8.184  24.563 1.00 0.00 ? 42 GLU A OE2  4  
ATOM 4045  H H    . GLU A 1 42 ? 8.466  -6.070  21.394 1.00 0.00 ? 42 GLU A H    4  
ATOM 4046  H HA   . GLU A 1 42 ? 7.266  -8.530  21.026 1.00 0.00 ? 42 GLU A HA   4  
ATOM 4047  H HB2  . GLU A 1 42 ? 5.992  -5.817  21.397 1.00 0.00 ? 42 GLU A HB2  4  
ATOM 4048  H HB3  . GLU A 1 42 ? 5.107  -7.333  21.489 1.00 0.00 ? 42 GLU A HB3  4  
ATOM 4049  H HG2  . GLU A 1 42 ? 7.508  -6.979  23.204 1.00 0.00 ? 42 GLU A HG2  4  
ATOM 4050  H HG3  . GLU A 1 42 ? 6.017  -6.148  23.644 1.00 0.00 ? 42 GLU A HG3  4  
ATOM 4051  N N    . LEU A 1 43 ? 6.459  -6.381  18.652 1.00 0.00 ? 43 LEU A N    4  
ATOM 4052  C CA   . LEU A 1 43 ? 5.948  -6.274  17.290 1.00 0.00 ? 43 LEU A CA   4  
ATOM 4053  C C    . LEU A 1 43 ? 6.740  -7.166  16.339 1.00 0.00 ? 43 LEU A C    4  
ATOM 4054  O O    . LEU A 1 43 ? 6.166  -7.948  15.582 1.00 0.00 ? 43 LEU A O    4  
ATOM 4055  C CB   . LEU A 1 43 ? 6.009  -4.821  16.814 1.00 0.00 ? 43 LEU A CB   4  
ATOM 4056  C CG   . LEU A 1 43 ? 4.678  -4.069  16.782 1.00 0.00 ? 43 LEU A CG   4  
ATOM 4057  C CD1  . LEU A 1 43 ? 4.027  -4.078  18.156 1.00 0.00 ? 43 LEU A CD1  4  
ATOM 4058  C CD2  . LEU A 1 43 ? 4.883  -2.642  16.297 1.00 0.00 ? 43 LEU A CD2  4  
ATOM 4059  H H    . LEU A 1 43 ? 6.756  -5.570  19.115 1.00 0.00 ? 43 LEU A H    4  
ATOM 4060  H HA   . LEU A 1 43 ? 4.918  -6.599  17.296 1.00 0.00 ? 43 LEU A HA   4  
ATOM 4061  H HB2  . LEU A 1 43 ? 6.675  -4.286  17.472 1.00 0.00 ? 43 LEU A HB2  4  
ATOM 4062  H HB3  . LEU A 1 43 ? 6.415  -4.819  15.812 1.00 0.00 ? 43 LEU A HB3  4  
ATOM 4063  H HG   . LEU A 1 43 ? 4.008  -4.565  16.093 1.00 0.00 ? 43 LEU A HG   4  
ATOM 4064  H HD11 . LEU A 1 43 ? 4.772  -4.298  18.906 1.00 0.00 ? 43 LEU A HD11 4  
ATOM 4065  H HD12 . LEU A 1 43 ? 3.254  -4.833  18.184 1.00 0.00 ? 43 LEU A HD12 4  
ATOM 4066  H HD13 . LEU A 1 43 ? 3.591  -3.110  18.354 1.00 0.00 ? 43 LEU A HD13 4  
ATOM 4067  H HD21 . LEU A 1 43 ? 4.065  -2.361  15.650 1.00 0.00 ? 43 LEU A HD21 4  
ATOM 4068  H HD22 . LEU A 1 43 ? 5.813  -2.578  15.750 1.00 0.00 ? 43 LEU A HD22 4  
ATOM 4069  H HD23 . LEU A 1 43 ? 4.917  -1.974  17.145 1.00 0.00 ? 43 LEU A HD23 4  
ATOM 4070  N N    . VAL A 1 44 ? 8.063  -7.044  16.385 1.00 0.00 ? 44 VAL A N    4  
ATOM 4071  C CA   . VAL A 1 44 ? 8.935  -7.841  15.531 1.00 0.00 ? 44 VAL A CA   4  
ATOM 4072  C C    . VAL A 1 44 ? 8.602  -9.325  15.638 1.00 0.00 ? 44 VAL A C    4  
ATOM 4073  O O    . VAL A 1 44 ? 8.410  -10.003 14.629 1.00 0.00 ? 44 VAL A O    4  
ATOM 4074  C CB   . VAL A 1 44 ? 10.418 -7.632  15.891 1.00 0.00 ? 44 VAL A CB   4  
ATOM 4075  C CG1  . VAL A 1 44 ? 11.308 -8.492  15.008 1.00 0.00 ? 44 VAL A CG1  4  
ATOM 4076  C CG2  . VAL A 1 44 ? 10.792 -6.163  15.769 1.00 0.00 ? 44 VAL A CG2  4  
ATOM 4077  H H    . VAL A 1 44 ? 8.462  -6.403  17.010 1.00 0.00 ? 44 VAL A H    4  
ATOM 4078  H HA   . VAL A 1 44 ? 8.785  -7.521  14.510 1.00 0.00 ? 44 VAL A HA   4  
ATOM 4079  H HB   . VAL A 1 44 ? 10.565 -7.935  16.917 1.00 0.00 ? 44 VAL A HB   4  
ATOM 4080  H HG11 . VAL A 1 44 ? 11.335 -9.500  15.397 1.00 0.00 ? 44 VAL A HG11 4  
ATOM 4081  H HG12 . VAL A 1 44 ? 10.915 -8.504  14.002 1.00 0.00 ? 44 VAL A HG12 4  
ATOM 4082  H HG13 . VAL A 1 44 ? 12.308 -8.085  14.999 1.00 0.00 ? 44 VAL A HG13 4  
ATOM 4083  H HG21 . VAL A 1 44 ? 11.094 -5.788  16.736 1.00 0.00 ? 44 VAL A HG21 4  
ATOM 4084  H HG22 . VAL A 1 44 ? 11.610 -6.056  15.071 1.00 0.00 ? 44 VAL A HG22 4  
ATOM 4085  H HG23 . VAL A 1 44 ? 9.941  -5.601  15.414 1.00 0.00 ? 44 VAL A HG23 4  
ATOM 4086  N N    . MET A 1 45 ? 8.534  -9.823  16.869 1.00 0.00 ? 45 MET A N    4  
ATOM 4087  C CA   . MET A 1 45 ? 8.222  -11.228 17.108 1.00 0.00 ? 45 MET A CA   4  
ATOM 4088  C C    . MET A 1 45 ? 6.872  -11.595 16.502 1.00 0.00 ? 45 MET A C    4  
ATOM 4089  O O    . MET A 1 45 ? 6.740  -12.619 15.832 1.00 0.00 ? 45 MET A O    4  
ATOM 4090  C CB   . MET A 1 45 ? 8.219  -11.523 18.609 1.00 0.00 ? 45 MET A CB   4  
ATOM 4091  C CG   . MET A 1 45 ? 9.588  -11.399 19.256 1.00 0.00 ? 45 MET A CG   4  
ATOM 4092  S SD   . MET A 1 45 ? 10.566 -12.907 19.106 1.00 0.00 ? 45 MET A SD   4  
ATOM 4093  C CE   . MET A 1 45 ? 9.609  -14.033 20.118 1.00 0.00 ? 45 MET A CE   4  
ATOM 4094  H H    . MET A 1 45 ? 8.697  -9.233  17.634 1.00 0.00 ? 45 MET A H    4  
ATOM 4095  H HA   . MET A 1 45 ? 8.990  -11.822 16.635 1.00 0.00 ? 45 MET A HA   4  
ATOM 4096  H HB2  . MET A 1 45 ? 7.550  -10.831 19.098 1.00 0.00 ? 45 MET A HB2  4  
ATOM 4097  H HB3  . MET A 1 45 ? 7.860  -12.529 18.766 1.00 0.00 ? 45 MET A HB3  4  
ATOM 4098  H HG2  . MET A 1 45 ? 10.125 -10.591 18.782 1.00 0.00 ? 45 MET A HG2  4  
ATOM 4099  H HG3  . MET A 1 45 ? 9.457  -11.174 20.304 1.00 0.00 ? 45 MET A HG3  4  
ATOM 4100  H HE1  . MET A 1 45 ? 10.275 -14.617 20.735 1.00 0.00 ? 45 MET A HE1  4  
ATOM 4101  H HE2  . MET A 1 45 ? 8.936  -13.469 20.746 1.00 0.00 ? 45 MET A HE2  4  
ATOM 4102  H HE3  . MET A 1 45 ? 9.038  -14.693 19.480 1.00 0.00 ? 45 MET A HE3  4  
ATOM 4103  N N    . ALA A 1 46 ? 5.871  -10.754 16.743 1.00 0.00 ? 46 ALA A N    4  
ATOM 4104  C CA   . ALA A 1 46 ? 4.532  -10.991 16.219 1.00 0.00 ? 46 ALA A CA   4  
ATOM 4105  C C    . ALA A 1 46 ? 4.562  -11.205 14.710 1.00 0.00 ? 46 ALA A C    4  
ATOM 4106  O O    . ALA A 1 46 ? 4.085  -12.222 14.207 1.00 0.00 ? 46 ALA A O    4  
ATOM 4107  C CB   . ALA A 1 46 ? 3.615  -9.828  16.571 1.00 0.00 ? 46 ALA A CB   4  
ATOM 4108  H H    . ALA A 1 46 ? 6.039  -9.955  17.284 1.00 0.00 ? 46 ALA A H    4  
ATOM 4109  H HA   . ALA A 1 46 ? 4.141  -11.881 16.691 1.00 0.00 ? 46 ALA A HA   4  
ATOM 4110  H HB1  . ALA A 1 46 ? 2.887  -9.694  15.784 1.00 0.00 ? 46 ALA A HB1  4  
ATOM 4111  H HB2  . ALA A 1 46 ? 3.106  -10.040 17.500 1.00 0.00 ? 46 ALA A HB2  4  
ATOM 4112  H HB3  . ALA A 1 46 ? 4.201  -8.928  16.677 1.00 0.00 ? 46 ALA A HB3  4  
ATOM 4113  N N    . PHE A 1 47 ? 5.126  -10.240 13.991 1.00 0.00 ? 47 PHE A N    4  
ATOM 4114  C CA   . PHE A 1 47 ? 5.217  -10.322 12.538 1.00 0.00 ? 47 PHE A CA   4  
ATOM 4115  C C    . PHE A 1 47 ? 6.045  -11.531 12.113 1.00 0.00 ? 47 PHE A C    4  
ATOM 4116  O O    . PHE A 1 47 ? 5.763  -12.162 11.095 1.00 0.00 ? 47 PHE A O    4  
ATOM 4117  C CB   . PHE A 1 47 ? 5.833  -9.042  11.971 1.00 0.00 ? 47 PHE A CB   4  
ATOM 4118  C CG   . PHE A 1 47 ? 5.236  -7.786  12.539 1.00 0.00 ? 47 PHE A CG   4  
ATOM 4119  C CD1  . PHE A 1 47 ? 3.863  -7.651  12.664 1.00 0.00 ? 47 PHE A CD1  4  
ATOM 4120  C CD2  . PHE A 1 47 ? 6.048  -6.741  12.948 1.00 0.00 ? 47 PHE A CD2  4  
ATOM 4121  C CE1  . PHE A 1 47 ? 3.311  -6.497  13.185 1.00 0.00 ? 47 PHE A CE1  4  
ATOM 4122  C CE2  . PHE A 1 47 ? 5.502  -5.584  13.471 1.00 0.00 ? 47 PHE A CE2  4  
ATOM 4123  C CZ   . PHE A 1 47 ? 4.131  -5.462  13.591 1.00 0.00 ? 47 PHE A CZ   4  
ATOM 4124  H H    . PHE A 1 47 ? 5.489  -9.452  14.449 1.00 0.00 ? 47 PHE A H    4  
ATOM 4125  H HA   . PHE A 1 47 ? 4.216  -10.432 12.150 1.00 0.00 ? 47 PHE A HA   4  
ATOM 4126  H HB2  . PHE A 1 47 ? 6.891  -9.033  12.188 1.00 0.00 ? 47 PHE A HB2  4  
ATOM 4127  H HB3  . PHE A 1 47 ? 5.689  -9.025  10.901 1.00 0.00 ? 47 PHE A HB3  4  
ATOM 4128  H HD1  . PHE A 1 47 ? 3.220  -8.460  12.348 1.00 0.00 ? 47 PHE A HD1  4  
ATOM 4129  H HD2  . PHE A 1 47 ? 7.121  -6.835  12.856 1.00 0.00 ? 47 PHE A HD2  4  
ATOM 4130  H HE1  . PHE A 1 47 ? 2.239  -6.404  13.278 1.00 0.00 ? 47 PHE A HE1  4  
ATOM 4131  H HE2  . PHE A 1 47 ? 6.146  -4.777  13.787 1.00 0.00 ? 47 PHE A HE2  4  
ATOM 4132  H HZ   . PHE A 1 47 ? 3.702  -4.559  13.998 1.00 0.00 ? 47 PHE A HZ   4  
ATOM 4133  N N    . GLU A 1 48 ? 7.069  -11.845 12.900 1.00 0.00 ? 48 GLU A N    4  
ATOM 4134  C CA   . GLU A 1 48 ? 7.940  -12.977 12.604 1.00 0.00 ? 48 GLU A CA   4  
ATOM 4135  C C    . GLU A 1 48 ? 7.144  -14.278 12.558 1.00 0.00 ? 48 GLU A C    4  
ATOM 4136  O O    . GLU A 1 48 ? 7.254  -15.052 11.608 1.00 0.00 ? 48 GLU A O    4  
ATOM 4137  C CB   . GLU A 1 48 ? 9.050  -13.082 13.651 1.00 0.00 ? 48 GLU A CB   4  
ATOM 4138  C CG   . GLU A 1 48 ? 10.413 -13.409 13.062 1.00 0.00 ? 48 GLU A CG   4  
ATOM 4139  C CD   . GLU A 1 48 ? 11.461 -13.668 14.127 1.00 0.00 ? 48 GLU A CD   4  
ATOM 4140  O OE1  . GLU A 1 48 ? 11.388 -13.032 15.199 1.00 0.00 ? 48 GLU A OE1  4  
ATOM 4141  O OE2  . GLU A 1 48 ? 12.355 -14.506 13.887 1.00 0.00 ? 48 GLU A OE2  4  
ATOM 4142  H H    . GLU A 1 48 ? 7.243  -11.304 13.697 1.00 0.00 ? 48 GLU A H    4  
ATOM 4143  H HA   . GLU A 1 48 ? 8.386  -12.808 11.635 1.00 0.00 ? 48 GLU A HA   4  
ATOM 4144  H HB2  . GLU A 1 48 ? 9.124  -12.141 14.176 1.00 0.00 ? 48 GLU A HB2  4  
ATOM 4145  H HB3  . GLU A 1 48 ? 8.791  -13.858 14.356 1.00 0.00 ? 48 GLU A HB3  4  
ATOM 4146  H HG2  . GLU A 1 48 ? 10.322 -14.291 12.446 1.00 0.00 ? 48 GLU A HG2  4  
ATOM 4147  H HG3  . GLU A 1 48 ? 10.736 -12.577 12.454 1.00 0.00 ? 48 GLU A HG3  4  
ATOM 4148  N N    . GLU A 1 49 ? 6.342  -14.512 13.593 1.00 0.00 ? 49 GLU A N    4  
ATOM 4149  C CA   . GLU A 1 49 ? 5.529  -15.720 13.672 1.00 0.00 ? 49 GLU A CA   4  
ATOM 4150  C C    . GLU A 1 49 ? 4.340  -15.638 12.720 1.00 0.00 ? 49 GLU A C    4  
ATOM 4151  O O    . GLU A 1 49 ? 3.826  -16.658 12.264 1.00 0.00 ? 49 GLU A O    4  
ATOM 4152  C CB   . GLU A 1 49 ? 5.036  -15.937 15.104 1.00 0.00 ? 49 GLU A CB   4  
ATOM 4153  C CG   . GLU A 1 49 ? 4.379  -17.289 15.323 1.00 0.00 ? 49 GLU A CG   4  
ATOM 4154  C CD   . GLU A 1 49 ? 3.910  -17.485 16.751 1.00 0.00 ? 49 GLU A CD   4  
ATOM 4155  O OE1  . GLU A 1 49 ? 3.320  -16.540 17.317 1.00 0.00 ? 49 GLU A OE1  4  
ATOM 4156  O OE2  . GLU A 1 49 ? 4.132  -18.583 17.304 1.00 0.00 ? 49 GLU A OE2  4  
ATOM 4157  H H    . GLU A 1 49 ? 6.297  -13.857 14.321 1.00 0.00 ? 49 GLU A H    4  
ATOM 4158  H HA   . GLU A 1 49 ? 6.149  -16.555 13.384 1.00 0.00 ? 49 GLU A HA   4  
ATOM 4159  H HB2  . GLU A 1 49 ? 5.877  -15.854 15.778 1.00 0.00 ? 49 GLU A HB2  4  
ATOM 4160  H HB3  . GLU A 1 49 ? 4.317  -15.168 15.345 1.00 0.00 ? 49 GLU A HB3  4  
ATOM 4161  H HG2  . GLU A 1 49 ? 3.526  -17.371 14.666 1.00 0.00 ? 49 GLU A HG2  4  
ATOM 4162  H HG3  . GLU A 1 49 ? 5.092  -18.065 15.084 1.00 0.00 ? 49 GLU A HG3  4  
ATOM 4163  N N    . GLU A 1 50 ? 3.907  -14.415 12.426 1.00 0.00 ? 50 GLU A N    4  
ATOM 4164  C CA   . GLU A 1 50 ? 2.778  -14.200 11.530 1.00 0.00 ? 50 GLU A CA   4  
ATOM 4165  C C    . GLU A 1 50 ? 3.115  -14.650 10.111 1.00 0.00 ? 50 GLU A C    4  
ATOM 4166  O O    . GLU A 1 50 ? 2.342  -15.366 9.475  1.00 0.00 ? 50 GLU A O    4  
ATOM 4167  C CB   . GLU A 1 50 ? 2.375  -12.724 11.526 1.00 0.00 ? 50 GLU A CB   4  
ATOM 4168  C CG   . GLU A 1 50 ? 0.927  -12.489 11.128 1.00 0.00 ? 50 GLU A CG   4  
ATOM 4169  C CD   . GLU A 1 50 ? -0.053 -13.139 12.085 1.00 0.00 ? 50 GLU A CD   4  
ATOM 4170  O OE1  . GLU A 1 50 ? 0.330  -13.395 13.245 1.00 0.00 ? 50 GLU A OE1  4  
ATOM 4171  O OE2  . GLU A 1 50 ? -1.205 -13.390 11.673 1.00 0.00 ? 50 GLU A OE2  4  
ATOM 4172  H H    . GLU A 1 50 ? 4.359  -13.640 12.821 1.00 0.00 ? 50 GLU A H    4  
ATOM 4173  H HA   . GLU A 1 50 ? 1.949  -14.789 11.894 1.00 0.00 ? 50 GLU A HA   4  
ATOM 4174  H HB2  . GLU A 1 50 ? 2.525  -12.320 12.516 1.00 0.00 ? 50 GLU A HB2  4  
ATOM 4175  H HB3  . GLU A 1 50 ? 3.008  -12.193 10.830 1.00 0.00 ? 50 GLU A HB3  4  
ATOM 4176  H HG2  . GLU A 1 50 ? 0.740  -11.426 11.112 1.00 0.00 ? 50 GLU A HG2  4  
ATOM 4177  H HG3  . GLU A 1 50 ? 0.768  -12.896 10.141 1.00 0.00 ? 50 GLU A HG3  4  
ATOM 4178  N N    . PHE A 1 51 ? 4.275  -14.224 9.622  1.00 0.00 ? 51 PHE A N    4  
ATOM 4179  C CA   . PHE A 1 51 ? 4.715  -14.581 8.278  1.00 0.00 ? 51 PHE A CA   4  
ATOM 4180  C C    . PHE A 1 51 ? 5.478  -15.903 8.289  1.00 0.00 ? 51 PHE A C    4  
ATOM 4181  O O    . PHE A 1 51 ? 5.547  -16.601 7.278  1.00 0.00 ? 51 PHE A O    4  
ATOM 4182  C CB   . PHE A 1 51 ? 5.597  -13.475 7.697  1.00 0.00 ? 51 PHE A CB   4  
ATOM 4183  C CG   . PHE A 1 51 ? 4.826  -12.267 7.246  1.00 0.00 ? 51 PHE A CG   4  
ATOM 4184  C CD1  . PHE A 1 51 ? 4.201  -11.445 8.169  1.00 0.00 ? 51 PHE A CD1  4  
ATOM 4185  C CD2  . PHE A 1 51 ? 4.726  -11.955 5.900  1.00 0.00 ? 51 PHE A CD2  4  
ATOM 4186  C CE1  . PHE A 1 51 ? 3.490  -10.333 7.758  1.00 0.00 ? 51 PHE A CE1  4  
ATOM 4187  C CE2  . PHE A 1 51 ? 4.018  -10.844 5.483  1.00 0.00 ? 51 PHE A CE2  4  
ATOM 4188  C CZ   . PHE A 1 51 ? 3.398  -10.033 6.413  1.00 0.00 ? 51 PHE A CZ   4  
ATOM 4189  H H    . PHE A 1 51 ? 4.848  -13.656 10.178 1.00 0.00 ? 51 PHE A H    4  
ATOM 4190  H HA   . PHE A 1 51 ? 3.837  -14.691 7.661  1.00 0.00 ? 51 PHE A HA   4  
ATOM 4191  H HB2  . PHE A 1 51 ? 6.304  -13.156 8.448  1.00 0.00 ? 51 PHE A HB2  4  
ATOM 4192  H HB3  . PHE A 1 51 ? 6.135  -13.864 6.845  1.00 0.00 ? 51 PHE A HB3  4  
ATOM 4193  H HD1  . PHE A 1 51 ? 4.272  -11.679 9.222  1.00 0.00 ? 51 PHE A HD1  4  
ATOM 4194  H HD2  . PHE A 1 51 ? 5.210  -12.590 5.172  1.00 0.00 ? 51 PHE A HD2  4  
ATOM 4195  H HE1  . PHE A 1 51 ? 3.007  -9.700  8.488  1.00 0.00 ? 51 PHE A HE1  4  
ATOM 4196  H HE2  . PHE A 1 51 ? 3.947  -10.612 4.431  1.00 0.00 ? 51 PHE A HE2  4  
ATOM 4197  H HZ   . PHE A 1 51 ? 2.844  -9.164  6.090  1.00 0.00 ? 51 PHE A HZ   4  
ATOM 4198  N N    . GLY A 1 52 ? 6.050  -16.240 9.441  1.00 0.00 ? 52 GLY A N    4  
ATOM 4199  C CA   . GLY A 1 52 ? 6.801  -17.476 9.563  1.00 0.00 ? 52 GLY A CA   4  
ATOM 4200  C C    . GLY A 1 52 ? 8.246  -17.321 9.132  1.00 0.00 ? 52 GLY A C    4  
ATOM 4201  O O    . GLY A 1 52 ? 8.725  -18.054 8.267  1.00 0.00 ? 52 GLY A O    4  
ATOM 4202  H H    . GLY A 1 52 ? 5.961  -15.644 10.215 1.00 0.00 ? 52 GLY A H    4  
ATOM 4203  H HA2  . GLY A 1 52 ? 6.776  -17.799 10.593 1.00 0.00 ? 52 GLY A HA2  4  
ATOM 4204  H HA3  . GLY A 1 52 ? 6.332  -18.230 8.948  1.00 0.00 ? 52 GLY A HA3  4  
ATOM 4205  N N    . VAL A 1 53 ? 8.942  -16.363 9.735  1.00 0.00 ? 53 VAL A N    4  
ATOM 4206  C CA   . VAL A 1 53 ? 10.341 -16.114 9.408  1.00 0.00 ? 53 VAL A CA   4  
ATOM 4207  C C    . VAL A 1 53 ? 11.233 -16.299 10.631 1.00 0.00 ? 53 VAL A C    4  
ATOM 4208  O O    . VAL A 1 53 ? 10.744 -16.449 11.750 1.00 0.00 ? 53 VAL A O    4  
ATOM 4209  C CB   . VAL A 1 53 ? 10.542 -14.693 8.850  1.00 0.00 ? 53 VAL A CB   4  
ATOM 4210  C CG1  . VAL A 1 53 ? 9.793  -14.523 7.536  1.00 0.00 ? 53 VAL A CG1  4  
ATOM 4211  C CG2  . VAL A 1 53 ? 10.095 -13.653 9.866  1.00 0.00 ? 53 VAL A CG2  4  
ATOM 4212  H H    . VAL A 1 53 ? 8.505  -15.811 10.417 1.00 0.00 ? 53 VAL A H    4  
ATOM 4213  H HA   . VAL A 1 53 ? 10.638 -16.822 8.648  1.00 0.00 ? 53 VAL A HA   4  
ATOM 4214  H HB   . VAL A 1 53 ? 11.596 -14.548 8.659  1.00 0.00 ? 53 VAL A HB   4  
ATOM 4215  H HG11 . VAL A 1 53 ? 8.929  -13.896 7.694  1.00 0.00 ? 53 VAL A HG11 4  
ATOM 4216  H HG12 . VAL A 1 53 ? 10.445 -14.065 6.807  1.00 0.00 ? 53 VAL A HG12 4  
ATOM 4217  H HG13 . VAL A 1 53 ? 9.474  -15.491 7.177  1.00 0.00 ? 53 VAL A HG13 4  
ATOM 4218  H HG21 . VAL A 1 53 ? 9.504  -12.897 9.370  1.00 0.00 ? 53 VAL A HG21 4  
ATOM 4219  H HG22 . VAL A 1 53 ? 9.499  -14.130 10.631 1.00 0.00 ? 53 VAL A HG22 4  
ATOM 4220  H HG23 . VAL A 1 53 ? 10.961 -13.195 10.318 1.00 0.00 ? 53 VAL A HG23 4  
ATOM 4221  N N    . GLU A 1 54 ? 12.543 -16.287 10.408 1.00 0.00 ? 54 GLU A N    4  
ATOM 4222  C CA   . GLU A 1 54 ? 13.503 -16.453 11.493 1.00 0.00 ? 54 GLU A CA   4  
ATOM 4223  C C    . GLU A 1 54 ? 14.627 -15.426 11.387 1.00 0.00 ? 54 GLU A C    4  
ATOM 4224  O O    . GLU A 1 54 ? 15.495 -15.527 10.520 1.00 0.00 ? 54 GLU A O    4  
ATOM 4225  C CB   . GLU A 1 54 ? 14.087 -17.868 11.474 1.00 0.00 ? 54 GLU A CB   4  
ATOM 4226  C CG   . GLU A 1 54 ? 13.056 -18.955 11.726 1.00 0.00 ? 54 GLU A CG   4  
ATOM 4227  C CD   . GLU A 1 54 ? 13.687 -20.280 12.109 1.00 0.00 ? 54 GLU A CD   4  
ATOM 4228  O OE1  . GLU A 1 54 ? 14.901 -20.449 11.870 1.00 0.00 ? 54 GLU A OE1  4  
ATOM 4229  O OE2  . GLU A 1 54 ? 12.967 -21.147 12.646 1.00 0.00 ? 54 GLU A OE2  4  
ATOM 4230  H H    . GLU A 1 54 ? 12.872 -16.163 9.493  1.00 0.00 ? 54 GLU A H    4  
ATOM 4231  H HA   . GLU A 1 54 ? 12.980 -16.302 12.425 1.00 0.00 ? 54 GLU A HA   4  
ATOM 4232  H HB2  . GLU A 1 54 ? 14.539 -18.045 10.509 1.00 0.00 ? 54 GLU A HB2  4  
ATOM 4233  H HB3  . GLU A 1 54 ? 14.848 -17.940 12.237 1.00 0.00 ? 54 GLU A HB3  4  
ATOM 4234  H HG2  . GLU A 1 54 ? 12.406 -18.638 12.529 1.00 0.00 ? 54 GLU A HG2  4  
ATOM 4235  H HG3  . GLU A 1 54 ? 12.473 -19.096 10.828 1.00 0.00 ? 54 GLU A HG3  4  
ATOM 4236  N N    . ILE A 1 55 ? 14.603 -14.439 12.276 1.00 0.00 ? 55 ILE A N    4  
ATOM 4237  C CA   . ILE A 1 55 ? 15.619 -13.394 12.284 1.00 0.00 ? 55 ILE A CA   4  
ATOM 4238  C C    . ILE A 1 55 ? 16.265 -13.266 13.659 1.00 0.00 ? 55 ILE A C    4  
ATOM 4239  O O    . ILE A 1 55 ? 15.683 -13.626 14.683 1.00 0.00 ? 55 ILE A O    4  
ATOM 4240  C CB   . ILE A 1 55 ? 15.028 -12.031 11.878 1.00 0.00 ? 55 ILE A CB   4  
ATOM 4241  C CG1  . ILE A 1 55 ? 13.708 -11.785 12.610 1.00 0.00 ? 55 ILE A CG1  4  
ATOM 4242  C CG2  . ILE A 1 55 ? 14.825 -11.970 10.371 1.00 0.00 ? 55 ILE A CG2  4  
ATOM 4243  C CD1  . ILE A 1 55 ? 13.424 -10.322 12.869 1.00 0.00 ? 55 ILE A CD1  4  
ATOM 4244  H H    . ILE A 1 55 ? 13.886 -14.413 12.943 1.00 0.00 ? 55 ILE A H    4  
ATOM 4245  H HA   . ILE A 1 55 ? 16.379 -13.663 11.565 1.00 0.00 ? 55 ILE A HA   4  
ATOM 4246  H HB   . ILE A 1 55 ? 15.733 -11.262 12.153 1.00 0.00 ? 55 ILE A HB   4  
ATOM 4247  H HG12 . ILE A 1 55 ? 12.897 -12.180 12.019 1.00 0.00 ? 55 ILE A HG12 4  
ATOM 4248  H HG13 . ILE A 1 55 ? 13.733 -12.292 13.563 1.00 0.00 ? 55 ILE A HG13 4  
ATOM 4249  H HG21 . ILE A 1 55 ? 14.168 -11.147 10.130 1.00 0.00 ? 55 ILE A HG21 4  
ATOM 4250  H HG22 . ILE A 1 55 ? 15.778 -11.824 9.885  1.00 0.00 ? 55 ILE A HG22 4  
ATOM 4251  H HG23 . ILE A 1 55 ? 14.384 -12.894 10.030 1.00 0.00 ? 55 ILE A HG23 4  
ATOM 4252  H HD11 . ILE A 1 55 ? 12.965 -9.883  11.995 1.00 0.00 ? 55 ILE A HD11 4  
ATOM 4253  H HD12 . ILE A 1 55 ? 12.758 -10.227 13.713 1.00 0.00 ? 55 ILE A HD12 4  
ATOM 4254  H HD13 . ILE A 1 55 ? 14.351 -9.808  13.082 1.00 0.00 ? 55 ILE A HD13 4  
ATOM 4255  N N    . PRO A 1 56 ? 17.499 -12.739 13.687 1.00 0.00 ? 56 PRO A N    4  
ATOM 4256  C CA   . PRO A 1 56 ? 18.250 -12.548 14.931 1.00 0.00 ? 56 PRO A CA   4  
ATOM 4257  C C    . PRO A 1 56 ? 17.655 -11.450 15.805 1.00 0.00 ? 56 PRO A C    4  
ATOM 4258  O O    . PRO A 1 56 ? 16.899 -10.604 15.327 1.00 0.00 ? 56 PRO A O    4  
ATOM 4259  C CB   . PRO A 1 56 ? 19.645 -12.147 14.444 1.00 0.00 ? 56 PRO A CB   4  
ATOM 4260  C CG   . PRO A 1 56 ? 19.420 -11.547 13.100 1.00 0.00 ? 56 PRO A CG   4  
ATOM 4261  C CD   . PRO A 1 56 ? 18.254 -12.288 12.506 1.00 0.00 ? 56 PRO A CD   4  
ATOM 4262  H HA   . PRO A 1 56 ? 18.315 -13.464 15.500 1.00 0.00 ? 56 PRO A HA   4  
ATOM 4263  H HB2  . PRO A 1 56 ? 20.076 -11.432 15.130 1.00 0.00 ? 56 PRO A HB2  4  
ATOM 4264  H HB3  . PRO A 1 56 ? 20.275 -13.022 14.385 1.00 0.00 ? 56 PRO A HB3  4  
ATOM 4265  H HG2  . PRO A 1 56 ? 19.185 -10.498 13.201 1.00 0.00 ? 56 PRO A HG2  4  
ATOM 4266  H HG3  . PRO A 1 56 ? 20.299 -11.679 12.487 1.00 0.00 ? 56 PRO A HG3  4  
ATOM 4267  H HD2  . PRO A 1 56 ? 17.657 -11.626 11.896 1.00 0.00 ? 56 PRO A HD2  4  
ATOM 4268  H HD3  . PRO A 1 56 ? 18.599 -13.131 11.925 1.00 0.00 ? 56 PRO A HD3  4  
ATOM 4269  N N    . ASP A 1 57 ? 18.001 -11.468 17.088 1.00 0.00 ? 57 ASP A N    4  
ATOM 4270  C CA   . ASP A 1 57 ? 17.502 -10.472 18.029 1.00 0.00 ? 57 ASP A CA   4  
ATOM 4271  C C    . ASP A 1 57 ? 18.178 -9.124  17.802 1.00 0.00 ? 57 ASP A C    4  
ATOM 4272  O O    . ASP A 1 57 ? 17.626 -8.077  18.142 1.00 0.00 ? 57 ASP A O    4  
ATOM 4273  C CB   . ASP A 1 57 ? 17.734 -10.937 19.467 1.00 0.00 ? 57 ASP A CB   4  
ATOM 4274  C CG   . ASP A 1 57 ? 16.747 -12.004 19.897 1.00 0.00 ? 57 ASP A CG   4  
ATOM 4275  O OD1  . ASP A 1 57 ? 16.126 -12.630 19.012 1.00 0.00 ? 57 ASP A OD1  4  
ATOM 4276  O OD2  . ASP A 1 57 ? 16.595 -12.214 21.119 1.00 0.00 ? 57 ASP A OD2  4  
ATOM 4277  H H    . ASP A 1 57 ? 18.608 -12.168 17.409 1.00 0.00 ? 57 ASP A H    4  
ATOM 4278  H HA   . ASP A 1 57 ? 16.441 -10.361 17.863 1.00 0.00 ? 57 ASP A HA   4  
ATOM 4279  H HB2  . ASP A 1 57 ? 18.732 -11.343 19.551 1.00 0.00 ? 57 ASP A HB2  4  
ATOM 4280  H HB3  . ASP A 1 57 ? 17.636 -10.092 20.132 1.00 0.00 ? 57 ASP A HB3  4  
ATOM 4281  N N    . ASP A 1 58 ? 19.375 -9.157  17.227 1.00 0.00 ? 58 ASP A N    4  
ATOM 4282  C CA   . ASP A 1 58 ? 20.126 -7.937  16.954 1.00 0.00 ? 58 ASP A CA   4  
ATOM 4283  C C    . ASP A 1 58 ? 19.472 -7.134  15.834 1.00 0.00 ? 58 ASP A C    4  
ATOM 4284  O O    . ASP A 1 58 ? 19.248 -5.931  15.968 1.00 0.00 ? 58 ASP A O    4  
ATOM 4285  C CB   . ASP A 1 58 ? 21.570 -8.275  16.580 1.00 0.00 ? 58 ASP A CB   4  
ATOM 4286  C CG   . ASP A 1 58 ? 22.519 -7.119  16.831 1.00 0.00 ? 58 ASP A CG   4  
ATOM 4287  O OD1  . ASP A 1 58 ? 22.100 -5.957  16.649 1.00 0.00 ? 58 ASP A OD1  4  
ATOM 4288  O OD2  . ASP A 1 58 ? 23.681 -7.377  17.210 1.00 0.00 ? 58 ASP A OD2  4  
ATOM 4289  H H    . ASP A 1 58 ? 19.762 -10.022 16.979 1.00 0.00 ? 58 ASP A H    4  
ATOM 4290  H HA   . ASP A 1 58 ? 20.128 -7.340  17.854 1.00 0.00 ? 58 ASP A HA   4  
ATOM 4291  H HB2  . ASP A 1 58 ? 21.899 -9.120  17.167 1.00 0.00 ? 58 ASP A HB2  4  
ATOM 4292  H HB3  . ASP A 1 58 ? 21.613 -8.531  15.532 1.00 0.00 ? 58 ASP A HB3  4  
ATOM 4293  N N    . ALA A 1 59 ? 19.169 -7.808  14.730 1.00 0.00 ? 59 ALA A N    4  
ATOM 4294  C CA   . ALA A 1 59 ? 18.539 -7.158  13.587 1.00 0.00 ? 59 ALA A CA   4  
ATOM 4295  C C    . ALA A 1 59 ? 17.236 -6.477  13.992 1.00 0.00 ? 59 ALA A C    4  
ATOM 4296  O O    . ALA A 1 59 ? 16.794 -5.527  13.345 1.00 0.00 ? 59 ALA A O    4  
ATOM 4297  C CB   . ALA A 1 59 ? 18.287 -8.168  12.478 1.00 0.00 ? 59 ALA A CB   4  
ATOM 4298  H H    . ALA A 1 59 ? 19.372 -8.765  14.683 1.00 0.00 ? 59 ALA A H    4  
ATOM 4299  H HA   . ALA A 1 59 ? 19.223 -6.410  13.210 1.00 0.00 ? 59 ALA A HA   4  
ATOM 4300  H HB1  . ALA A 1 59 ? 19.194 -8.722  12.283 1.00 0.00 ? 59 ALA A HB1  4  
ATOM 4301  H HB2  . ALA A 1 59 ? 17.507 -8.850  12.784 1.00 0.00 ? 59 ALA A HB2  4  
ATOM 4302  H HB3  . ALA A 1 59 ? 17.981 -7.650  11.582 1.00 0.00 ? 59 ALA A HB3  4  
ATOM 4303  N N    . ALA A 1 60 ? 16.626 -6.968  15.065 1.00 0.00 ? 60 ALA A N    4  
ATOM 4304  C CA   . ALA A 1 60 ? 15.374 -6.406  15.556 1.00 0.00 ? 60 ALA A CA   4  
ATOM 4305  C C    . ALA A 1 60 ? 15.581 -4.995  16.098 1.00 0.00 ? 60 ALA A C    4  
ATOM 4306  O O    . ALA A 1 60 ? 14.649 -4.193  16.136 1.00 0.00 ? 60 ALA A O    4  
ATOM 4307  C CB   . ALA A 1 60 ? 14.778 -7.303  16.630 1.00 0.00 ? 60 ALA A CB   4  
ATOM 4308  H H    . ALA A 1 60 ? 17.028 -7.726  15.538 1.00 0.00 ? 60 ALA A H    4  
ATOM 4309  H HA   . ALA A 1 60 ? 14.679 -6.365  14.730 1.00 0.00 ? 60 ALA A HA   4  
ATOM 4310  H HB1  . ALA A 1 60 ? 13.851 -6.874  16.983 1.00 0.00 ? 60 ALA A HB1  4  
ATOM 4311  H HB2  . ALA A 1 60 ? 14.587 -8.282  16.216 1.00 0.00 ? 60 ALA A HB2  4  
ATOM 4312  H HB3  . ALA A 1 60 ? 15.472 -7.389  17.453 1.00 0.00 ? 60 ALA A HB3  4  
ATOM 4313  N N    . GLU A 1 61 ? 16.808 -4.701  16.516 1.00 0.00 ? 61 GLU A N    4  
ATOM 4314  C CA   . GLU A 1 61 ? 17.136 -3.387  17.057 1.00 0.00 ? 61 GLU A CA   4  
ATOM 4315  C C    . GLU A 1 61 ? 17.191 -2.340  15.948 1.00 0.00 ? 61 GLU A C    4  
ATOM 4316  O O    . GLU A 1 61 ? 16.997 -1.149  16.192 1.00 0.00 ? 61 GLU A O    4  
ATOM 4317  C CB   . GLU A 1 61 ? 18.475 -3.434  17.796 1.00 0.00 ? 61 GLU A CB   4  
ATOM 4318  C CG   . GLU A 1 61 ? 18.425 -4.218  19.097 1.00 0.00 ? 61 GLU A CG   4  
ATOM 4319  C CD   . GLU A 1 61 ? 17.270 -3.800  19.986 1.00 0.00 ? 61 GLU A CD   4  
ATOM 4320  O OE1  . GLU A 1 61 ? 17.242 -2.627  20.410 1.00 0.00 ? 61 GLU A OE1  4  
ATOM 4321  O OE2  . GLU A 1 61 ? 16.393 -4.648  20.256 1.00 0.00 ? 61 GLU A OE2  4  
ATOM 4322  H H    . GLU A 1 61 ? 17.509 -5.383  16.460 1.00 0.00 ? 61 GLU A H    4  
ATOM 4323  H HA   . GLU A 1 61 ? 16.359 -3.113  17.755 1.00 0.00 ? 61 GLU A HA   4  
ATOM 4324  H HB2  . GLU A 1 61 ? 19.212 -3.891  17.152 1.00 0.00 ? 61 GLU A HB2  4  
ATOM 4325  H HB3  . GLU A 1 61 ? 18.783 -2.424  18.021 1.00 0.00 ? 61 GLU A HB3  4  
ATOM 4326  H HG2  . GLU A 1 61 ? 18.320 -5.268  18.866 1.00 0.00 ? 61 GLU A HG2  4  
ATOM 4327  H HG3  . GLU A 1 61 ? 19.348 -4.060  19.633 1.00 0.00 ? 61 GLU A HG3  4  
ATOM 4328  N N    . THR A 1 62 ? 17.457 -2.794  14.727 1.00 0.00 ? 62 THR A N    4  
ATOM 4329  C CA   . THR A 1 62 ? 17.540 -1.898  13.580 1.00 0.00 ? 62 THR A CA   4  
ATOM 4330  C C    . THR A 1 62 ? 16.152 -1.494  13.097 1.00 0.00 ? 62 THR A C    4  
ATOM 4331  O O    . THR A 1 62 ? 15.997 -0.500  12.386 1.00 0.00 ? 62 THR A O    4  
ATOM 4332  C CB   . THR A 1 62 ? 18.308 -2.549  12.414 1.00 0.00 ? 62 THR A CB   4  
ATOM 4333  O OG1  . THR A 1 62 ? 17.500 -3.559  11.799 1.00 0.00 ? 62 THR A OG1  4  
ATOM 4334  C CG2  . THR A 1 62 ? 19.613 -3.161  12.899 1.00 0.00 ? 62 THR A CG2  4  
ATOM 4335  H H    . THR A 1 62 ? 17.602 -3.754  14.596 1.00 0.00 ? 62 THR A H    4  
ATOM 4336  H HA   . THR A 1 62 ? 18.077 -1.012  13.887 1.00 0.00 ? 62 THR A HA   4  
ATOM 4337  H HB   . THR A 1 62 ? 18.535 -1.786  11.683 1.00 0.00 ? 62 THR A HB   4  
ATOM 4338  H HG1  . THR A 1 62 ? 17.670 -3.573  10.854 1.00 0.00 ? 62 THR A HG1  4  
ATOM 4339  H HG21 . THR A 1 62 ? 20.180 -2.418  13.440 1.00 0.00 ? 62 THR A HG21 4  
ATOM 4340  H HG22 . THR A 1 62 ? 20.186 -3.506  12.052 1.00 0.00 ? 62 THR A HG22 4  
ATOM 4341  H HG23 . THR A 1 62 ? 19.398 -3.994  13.552 1.00 0.00 ? 62 THR A HG23 4  
ATOM 4342  N N    . ILE A 1 63 ? 15.146 -2.269  13.487 1.00 0.00 ? 63 ILE A N    4  
ATOM 4343  C CA   . ILE A 1 63 ? 13.770 -1.989  13.095 1.00 0.00 ? 63 ILE A CA   4  
ATOM 4344  C C    . ILE A 1 63 ? 13.173 -0.870  13.942 1.00 0.00 ? 63 ILE A C    4  
ATOM 4345  O O    . ILE A 1 63 ? 12.632 -1.115  15.022 1.00 0.00 ? 63 ILE A O    4  
ATOM 4346  C CB   . ILE A 1 63 ? 12.883 -3.241  13.220 1.00 0.00 ? 63 ILE A CB   4  
ATOM 4347  C CG1  . ILE A 1 63 ? 13.435 -4.373  12.351 1.00 0.00 ? 63 ILE A CG1  4  
ATOM 4348  C CG2  . ILE A 1 63 ? 11.449 -2.916  12.828 1.00 0.00 ? 63 ILE A CG2  4  
ATOM 4349  C CD1  . ILE A 1 63 ? 12.624 -5.647  12.431 1.00 0.00 ? 63 ILE A CD1  4  
ATOM 4350  H H    . ILE A 1 63 ? 15.333 -3.046  14.053 1.00 0.00 ? 63 ILE A H    4  
ATOM 4351  H HA   . ILE A 1 63 ? 13.776 -1.678  12.060 1.00 0.00 ? 63 ILE A HA   4  
ATOM 4352  H HB   . ILE A 1 63 ? 12.886 -3.555  14.253 1.00 0.00 ? 63 ILE A HB   4  
ATOM 4353  H HG12 . ILE A 1 63 ? 13.449 -4.054  11.321 1.00 0.00 ? 63 ILE A HG12 4  
ATOM 4354  H HG13 . ILE A 1 63 ? 14.443 -4.600  12.667 1.00 0.00 ? 63 ILE A HG13 4  
ATOM 4355  H HG21 . ILE A 1 63 ? 11.425 -2.569  11.806 1.00 0.00 ? 63 ILE A HG21 4  
ATOM 4356  H HG22 . ILE A 1 63 ? 10.841 -3.804  12.920 1.00 0.00 ? 63 ILE A HG22 4  
ATOM 4357  H HG23 . ILE A 1 63 ? 11.063 -2.146  13.479 1.00 0.00 ? 63 ILE A HG23 4  
ATOM 4358  H HD11 . ILE A 1 63 ? 11.832 -5.525  13.155 1.00 0.00 ? 63 ILE A HD11 4  
ATOM 4359  H HD12 . ILE A 1 63 ? 12.198 -5.865  11.464 1.00 0.00 ? 63 ILE A HD12 4  
ATOM 4360  H HD13 . ILE A 1 63 ? 13.264 -6.463  12.735 1.00 0.00 ? 63 ILE A HD13 4  
ATOM 4361  N N    . LEU A 1 64 ? 13.274 0.358   13.446 1.00 0.00 ? 64 LEU A N    4  
ATOM 4362  C CA   . LEU A 1 64 ? 12.742 1.516   14.157 1.00 0.00 ? 64 LEU A CA   4  
ATOM 4363  C C    . LEU A 1 64 ? 11.531 2.091   13.431 1.00 0.00 ? 64 LEU A C    4  
ATOM 4364  O O    . LEU A 1 64 ? 10.460 2.254   14.018 1.00 0.00 ? 64 LEU A O    4  
ATOM 4365  C CB   . LEU A 1 64 ? 13.822 2.590   14.301 1.00 0.00 ? 64 LEU A CB   4  
ATOM 4366  C CG   . LEU A 1 64 ? 15.230 2.088   14.622 1.00 0.00 ? 64 LEU A CG   4  
ATOM 4367  C CD1  . LEU A 1 64 ? 16.235 3.226   14.537 1.00 0.00 ? 64 LEU A CD1  4  
ATOM 4368  C CD2  . LEU A 1 64 ? 15.265 1.445   16.001 1.00 0.00 ? 64 LEU A CD2  4  
ATOM 4369  H H    . LEU A 1 64 ? 13.716 0.491   12.582 1.00 0.00 ? 64 LEU A H    4  
ATOM 4370  H HA   . LEU A 1 64 ? 12.437 1.190   15.140 1.00 0.00 ? 64 LEU A HA   4  
ATOM 4371  H HB2  . LEU A 1 64 ? 13.870 3.137   13.372 1.00 0.00 ? 64 LEU A HB2  4  
ATOM 4372  H HB3  . LEU A 1 64 ? 13.519 3.258   15.095 1.00 0.00 ? 64 LEU A HB3  4  
ATOM 4373  H HG   . LEU A 1 64 ? 15.513 1.339   13.896 1.00 0.00 ? 64 LEU A HG   4  
ATOM 4374  H HD11 . LEU A 1 64 ? 16.558 3.345   13.514 1.00 0.00 ? 64 LEU A HD11 4  
ATOM 4375  H HD12 . LEU A 1 64 ? 17.088 3.000   15.160 1.00 0.00 ? 64 LEU A HD12 4  
ATOM 4376  H HD13 . LEU A 1 64 ? 15.773 4.141   14.879 1.00 0.00 ? 64 LEU A HD13 4  
ATOM 4377  H HD21 . LEU A 1 64 ? 16.286 1.202   16.258 1.00 0.00 ? 64 LEU A HD21 4  
ATOM 4378  H HD22 . LEU A 1 64 ? 14.671 0.543   15.993 1.00 0.00 ? 64 LEU A HD22 4  
ATOM 4379  H HD23 . LEU A 1 64 ? 14.865 2.134   16.730 1.00 0.00 ? 64 LEU A HD23 4  
ATOM 4380  N N    . THR A 1 65 ? 11.705 2.397   12.149 1.00 0.00 ? 65 THR A N    4  
ATOM 4381  C CA   . THR A 1 65 ? 10.626 2.952   11.342 1.00 0.00 ? 65 THR A CA   4  
ATOM 4382  C C    . THR A 1 65 ? 9.817  1.849   10.670 1.00 0.00 ? 65 THR A C    4  
ATOM 4383  O O    . THR A 1 65 ? 10.309 0.737   10.472 1.00 0.00 ? 65 THR A O    4  
ATOM 4384  C CB   . THR A 1 65 ? 11.168 3.907   10.261 1.00 0.00 ? 65 THR A CB   4  
ATOM 4385  O OG1  . THR A 1 65 ? 12.348 3.355   9.667  1.00 0.00 ? 65 THR A OG1  4  
ATOM 4386  C CG2  . THR A 1 65 ? 11.482 5.272   10.853 1.00 0.00 ? 65 THR A CG2  4  
ATOM 4387  H H    . THR A 1 65 ? 12.581 2.244   11.737 1.00 0.00 ? 65 THR A H    4  
ATOM 4388  H HA   . THR A 1 65 ? 9.976  3.515   11.996 1.00 0.00 ? 65 THR A HA   4  
ATOM 4389  H HB   . THR A 1 65 ? 10.412 4.027   9.497  1.00 0.00 ? 65 THR A HB   4  
ATOM 4390  H HG1  . THR A 1 65 ? 12.109 2.855   8.883  1.00 0.00 ? 65 THR A HG1  4  
ATOM 4391  H HG21 . THR A 1 65 ? 12.006 5.870   10.121 1.00 0.00 ? 65 THR A HG21 4  
ATOM 4392  H HG22 . THR A 1 65 ? 12.101 5.151   11.729 1.00 0.00 ? 65 THR A HG22 4  
ATOM 4393  H HG23 . THR A 1 65 ? 10.562 5.766   11.127 1.00 0.00 ? 65 THR A HG23 4  
ATOM 4394  N N    . VAL A 1 66 ? 8.574  2.162   10.320 1.00 0.00 ? 66 VAL A N    4  
ATOM 4395  C CA   . VAL A 1 66 ? 7.697  1.197   9.668  1.00 0.00 ? 66 VAL A CA   4  
ATOM 4396  C C    . VAL A 1 66 ? 8.375  0.570   8.455  1.00 0.00 ? 66 VAL A C    4  
ATOM 4397  O O    . VAL A 1 66 ? 8.361  -0.648  8.283  1.00 0.00 ? 66 VAL A O    4  
ATOM 4398  C CB   . VAL A 1 66 ? 6.375  1.850   9.223  1.00 0.00 ? 66 VAL A CB   4  
ATOM 4399  C CG1  . VAL A 1 66 ? 5.498  0.841   8.498  1.00 0.00 ? 66 VAL A CG1  4  
ATOM 4400  C CG2  . VAL A 1 66 ? 5.644  2.441   10.419 1.00 0.00 ? 66 VAL A CG2  4  
ATOM 4401  H H    . VAL A 1 66 ? 8.238  3.064   10.504 1.00 0.00 ? 66 VAL A H    4  
ATOM 4402  H HA   . VAL A 1 66 ? 7.467  0.419   10.382 1.00 0.00 ? 66 VAL A HA   4  
ATOM 4403  H HB   . VAL A 1 66 ? 6.606  2.652   8.537  1.00 0.00 ? 66 VAL A HB   4  
ATOM 4404  H HG11 . VAL A 1 66 ? 5.889  -0.153  8.654  1.00 0.00 ? 66 VAL A HG11 4  
ATOM 4405  H HG12 . VAL A 1 66 ? 4.490  0.898   8.882  1.00 0.00 ? 66 VAL A HG12 4  
ATOM 4406  H HG13 . VAL A 1 66 ? 5.494  1.063   7.440  1.00 0.00 ? 66 VAL A HG13 4  
ATOM 4407  H HG21 . VAL A 1 66 ? 5.050  1.674   10.892 1.00 0.00 ? 66 VAL A HG21 4  
ATOM 4408  H HG22 . VAL A 1 66 ? 6.364  2.826   11.127 1.00 0.00 ? 66 VAL A HG22 4  
ATOM 4409  H HG23 . VAL A 1 66 ? 5.001  3.243   10.089 1.00 0.00 ? 66 VAL A HG23 4  
ATOM 4410  N N    . GLY A 1 67 ? 8.969  1.412   7.615  1.00 0.00 ? 67 GLY A N    4  
ATOM 4411  C CA   . GLY A 1 67 ? 9.645  0.922   6.428  1.00 0.00 ? 67 GLY A CA   4  
ATOM 4412  C C    . GLY A 1 67 ? 10.649 -0.169  6.741  1.00 0.00 ? 67 GLY A C    4  
ATOM 4413  O O    . GLY A 1 67 ? 10.860 -1.078  5.938  1.00 0.00 ? 67 GLY A O    4  
ATOM 4414  H H    . GLY A 1 67 ? 8.948  2.374   7.803  1.00 0.00 ? 67 GLY A H    4  
ATOM 4415  H HA2  . GLY A 1 67 ? 8.908  0.532   5.742  1.00 0.00 ? 67 GLY A HA2  4  
ATOM 4416  H HA3  . GLY A 1 67 ? 10.161 1.745   5.956  1.00 0.00 ? 67 GLY A HA3  4  
ATOM 4417  N N    . ASP A 1 68 ? 11.272 -0.079  7.911  1.00 0.00 ? 68 ASP A N    4  
ATOM 4418  C CA   . ASP A 1 68 ? 12.261 -1.066  8.329  1.00 0.00 ? 68 ASP A CA   4  
ATOM 4419  C C    . ASP A 1 68 ? 11.600 -2.413  8.608  1.00 0.00 ? 68 ASP A C    4  
ATOM 4420  O O    . ASP A 1 68 ? 11.976 -3.431  8.028  1.00 0.00 ? 68 ASP A O    4  
ATOM 4421  C CB   . ASP A 1 68 ? 13.003 -0.581  9.575  1.00 0.00 ? 68 ASP A CB   4  
ATOM 4422  C CG   . ASP A 1 68 ? 14.393 -1.176  9.690  1.00 0.00 ? 68 ASP A CG   4  
ATOM 4423  O OD1  . ASP A 1 68 ? 14.497 -2.406  9.881  1.00 0.00 ? 68 ASP A OD1  4  
ATOM 4424  O OD2  . ASP A 1 68 ? 15.376 -0.412  9.590  1.00 0.00 ? 68 ASP A OD2  4  
ATOM 4425  H H    . ASP A 1 68 ? 11.062 0.669   8.509  1.00 0.00 ? 68 ASP A H    4  
ATOM 4426  H HA   . ASP A 1 68 ? 12.970 -1.187  7.523  1.00 0.00 ? 68 ASP A HA   4  
ATOM 4427  H HB2  . ASP A 1 68 ? 13.095 0.495   9.535  1.00 0.00 ? 68 ASP A HB2  4  
ATOM 4428  H HB3  . ASP A 1 68 ? 12.438 -0.857  10.453 1.00 0.00 ? 68 ASP A HB3  4  
ATOM 4429  N N    . ALA A 1 69 ? 10.615 -2.409  9.500  1.00 0.00 ? 69 ALA A N    4  
ATOM 4430  C CA   . ALA A 1 69 ? 9.902  -3.630  9.855  1.00 0.00 ? 69 ALA A CA   4  
ATOM 4431  C C    . ALA A 1 69 ? 9.290  -4.287  8.622  1.00 0.00 ? 69 ALA A C    4  
ATOM 4432  O O    . ALA A 1 69 ? 9.446  -5.488  8.404  1.00 0.00 ? 69 ALA A O    4  
ATOM 4433  C CB   . ALA A 1 69 ? 8.823  -3.330  10.885 1.00 0.00 ? 69 ALA A CB   4  
ATOM 4434  H H    . ALA A 1 69 ? 10.361 -1.566  9.928  1.00 0.00 ? 69 ALA A H    4  
ATOM 4435  H HA   . ALA A 1 69 ? 10.611 -4.313  10.300 1.00 0.00 ? 69 ALA A HA   4  
ATOM 4436  H HB1  . ALA A 1 69 ? 9.006  -3.914  11.776 1.00 0.00 ? 69 ALA A HB1  4  
ATOM 4437  H HB2  . ALA A 1 69 ? 8.844  -2.279  11.132 1.00 0.00 ? 69 ALA A HB2  4  
ATOM 4438  H HB3  . ALA A 1 69 ? 7.856  -3.586  10.479 1.00 0.00 ? 69 ALA A HB3  4  
ATOM 4439  N N    . VAL A 1 70 ? 8.593  -3.491  7.818  1.00 0.00 ? 70 VAL A N    4  
ATOM 4440  C CA   . VAL A 1 70 ? 7.957  -3.995  6.606  1.00 0.00 ? 70 VAL A CA   4  
ATOM 4441  C C    . VAL A 1 70 ? 8.988  -4.585  5.650  1.00 0.00 ? 70 VAL A C    4  
ATOM 4442  O O    . VAL A 1 70 ? 8.868  -5.733  5.221  1.00 0.00 ? 70 VAL A O    4  
ATOM 4443  C CB   . VAL A 1 70 ? 7.176  -2.885  5.879  1.00 0.00 ? 70 VAL A CB   4  
ATOM 4444  C CG1  . VAL A 1 70 ? 6.549  -3.422  4.601  1.00 0.00 ? 70 VAL A CG1  4  
ATOM 4445  C CG2  . VAL A 1 70 ? 6.115  -2.293  6.795  1.00 0.00 ? 70 VAL A CG2  4  
ATOM 4446  H H    . VAL A 1 70 ? 8.504  -2.541  8.044  1.00 0.00 ? 70 VAL A H    4  
ATOM 4447  H HA   . VAL A 1 70 ? 7.260  -4.769  6.892  1.00 0.00 ? 70 VAL A HA   4  
ATOM 4448  H HB   . VAL A 1 70 ? 7.868  -2.100  5.611  1.00 0.00 ? 70 VAL A HB   4  
ATOM 4449  H HG11 . VAL A 1 70 ? 5.883  -4.237  4.843  1.00 0.00 ? 70 VAL A HG11 4  
ATOM 4450  H HG12 . VAL A 1 70 ? 5.994  -2.634  4.113  1.00 0.00 ? 70 VAL A HG12 4  
ATOM 4451  H HG13 . VAL A 1 70 ? 7.326  -3.777  3.941  1.00 0.00 ? 70 VAL A HG13 4  
ATOM 4452  H HG21 . VAL A 1 70 ? 5.135  -2.564  6.431  1.00 0.00 ? 70 VAL A HG21 4  
ATOM 4453  H HG22 . VAL A 1 70 ? 6.247  -2.679  7.795  1.00 0.00 ? 70 VAL A HG22 4  
ATOM 4454  H HG23 . VAL A 1 70 ? 6.210  -1.218  6.809  1.00 0.00 ? 70 VAL A HG23 4  
ATOM 4455  N N    . LYS A 1 71 ? 10.002 -3.793  5.320  1.00 0.00 ? 71 LYS A N    4  
ATOM 4456  C CA   . LYS A 1 71 ? 11.057 -4.236  4.415  1.00 0.00 ? 71 LYS A CA   4  
ATOM 4457  C C    . LYS A 1 71 ? 11.697 -5.527  4.917  1.00 0.00 ? 71 LYS A C    4  
ATOM 4458  O O    . LYS A 1 71 ? 12.090 -6.385  4.126  1.00 0.00 ? 71 LYS A O    4  
ATOM 4459  C CB   . LYS A 1 71 ? 12.124 -3.149  4.271  1.00 0.00 ? 71 LYS A CB   4  
ATOM 4460  C CG   . LYS A 1 71 ? 11.727 -2.030  3.323  1.00 0.00 ? 71 LYS A CG   4  
ATOM 4461  C CD   . LYS A 1 71 ? 12.754 -0.910  3.322  1.00 0.00 ? 71 LYS A CD   4  
ATOM 4462  C CE   . LYS A 1 71 ? 14.075 -1.366  2.722  1.00 0.00 ? 71 LYS A CE   4  
ATOM 4463  N NZ   . LYS A 1 71 ? 14.872 -0.221  2.201  1.00 0.00 ? 71 LYS A NZ   4  
ATOM 4464  H H    . LYS A 1 71 ? 10.043 -2.888  5.694  1.00 0.00 ? 71 LYS A H    4  
ATOM 4465  H HA   . LYS A 1 71 ? 10.610 -4.421  3.450  1.00 0.00 ? 71 LYS A HA   4  
ATOM 4466  H HB2  . LYS A 1 71 ? 12.316 -2.718  5.242  1.00 0.00 ? 71 LYS A HB2  4  
ATOM 4467  H HB3  . LYS A 1 71 ? 13.033 -3.600  3.901  1.00 0.00 ? 71 LYS A HB3  4  
ATOM 4468  H HG2  . LYS A 1 71 ? 11.645 -2.430  2.323  1.00 0.00 ? 71 LYS A HG2  4  
ATOM 4469  H HG3  . LYS A 1 71 ? 10.772 -1.630  3.632  1.00 0.00 ? 71 LYS A HG3  4  
ATOM 4470  H HD2  . LYS A 1 71 ? 12.373 -0.085  2.738  1.00 0.00 ? 71 LYS A HD2  4  
ATOM 4471  H HD3  . LYS A 1 71 ? 12.922 -0.587  4.339  1.00 0.00 ? 71 LYS A HD3  4  
ATOM 4472  H HE2  . LYS A 1 71 ? 14.646 -1.872  3.486  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 4473  H HE3  . LYS A 1 71 ? 13.871 -2.050  1.912  1.00 0.00 ? 71 LYS A HE3  4  
ATOM 4474  H HZ1  . LYS A 1 71 ? 15.001 -0.314  1.173  1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 4475  H HZ2  . LYS A 1 71 ? 15.808 -0.200  2.655  1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 4476  H HZ3  . LYS A 1 71 ? 14.383 0.675   2.399  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 4477  N N    . PHE A 1 72 ? 11.796 -5.659  6.236  1.00 0.00 ? 72 PHE A N    4  
ATOM 4478  C CA   . PHE A 1 72 ? 12.388 -6.846  6.842  1.00 0.00 ? 72 PHE A CA   4  
ATOM 4479  C C    . PHE A 1 72 ? 11.518 -8.075  6.595  1.00 0.00 ? 72 PHE A C    4  
ATOM 4480  O O    . PHE A 1 72 ? 11.976 -9.070  6.033  1.00 0.00 ? 72 PHE A O    4  
ATOM 4481  C CB   . PHE A 1 72 ? 12.577 -6.635  8.346  1.00 0.00 ? 72 PHE A CB   4  
ATOM 4482  C CG   . PHE A 1 72 ? 13.834 -7.255  8.885  1.00 0.00 ? 72 PHE A CG   4  
ATOM 4483  C CD1  . PHE A 1 72 ? 14.198 -8.543  8.524  1.00 0.00 ? 72 PHE A CD1  4  
ATOM 4484  C CD2  . PHE A 1 72 ? 14.653 -6.550  9.752  1.00 0.00 ? 72 PHE A CD2  4  
ATOM 4485  C CE1  . PHE A 1 72 ? 15.355 -9.116  9.018  1.00 0.00 ? 72 PHE A CE1  4  
ATOM 4486  C CE2  . PHE A 1 72 ? 15.811 -7.118  10.249 1.00 0.00 ? 72 PHE A CE2  4  
ATOM 4487  C CZ   . PHE A 1 72 ? 16.162 -8.402  9.882  1.00 0.00 ? 72 PHE A CZ   4  
ATOM 4488  H H    . PHE A 1 72 ? 11.464 -4.941  6.814  1.00 0.00 ? 72 PHE A H    4  
ATOM 4489  H HA   . PHE A 1 72 ? 13.352 -7.005  6.386  1.00 0.00 ? 72 PHE A HA   4  
ATOM 4490  H HB2  . PHE A 1 72 ? 12.615 -5.576  8.552  1.00 0.00 ? 72 PHE A HB2  4  
ATOM 4491  H HB3  . PHE A 1 72 ? 11.740 -7.071  8.871  1.00 0.00 ? 72 PHE A HB3  4  
ATOM 4492  H HD1  . PHE A 1 72 ? 13.566 -9.102  7.848  1.00 0.00 ? 72 PHE A HD1  4  
ATOM 4493  H HD2  . PHE A 1 72 ? 14.380 -5.546  10.041 1.00 0.00 ? 72 PHE A HD2  4  
ATOM 4494  H HE1  . PHE A 1 72 ? 15.625 -10.120 8.729  1.00 0.00 ? 72 PHE A HE1  4  
ATOM 4495  H HE2  . PHE A 1 72 ? 16.441 -6.558  10.924 1.00 0.00 ? 72 PHE A HE2  4  
ATOM 4496  H HZ   . PHE A 1 72 ? 17.067 -8.848  10.268 1.00 0.00 ? 72 PHE A HZ   4  
ATOM 4497  N N    . ILE A 1 73 ? 10.261 -7.997  7.019  1.00 0.00 ? 73 ILE A N    4  
ATOM 4498  C CA   . ILE A 1 73 ? 9.326  -9.102  6.843  1.00 0.00 ? 73 ILE A CA   4  
ATOM 4499  C C    . ILE A 1 73 ? 9.255  -9.535  5.383  1.00 0.00 ? 73 ILE A C    4  
ATOM 4500  O O    . ILE A 1 73 ? 9.183  -10.726 5.080  1.00 0.00 ? 73 ILE A O    4  
ATOM 4501  C CB   . ILE A 1 73 ? 7.913  -8.726  7.325  1.00 0.00 ? 73 ILE A CB   4  
ATOM 4502  C CG1  . ILE A 1 73 ? 7.940  -8.343  8.806  1.00 0.00 ? 73 ILE A CG1  4  
ATOM 4503  C CG2  . ILE A 1 73 ? 6.948  -9.878  7.087  1.00 0.00 ? 73 ILE A CG2  4  
ATOM 4504  C CD1  . ILE A 1 73 ? 6.822  -7.408  9.210  1.00 0.00 ? 73 ILE A CD1  4  
ATOM 4505  H H    . ILE A 1 73 ? 9.955  -7.178  7.460  1.00 0.00 ? 73 ILE A H    4  
ATOM 4506  H HA   . ILE A 1 73 ? 9.678  -9.933  7.437  1.00 0.00 ? 73 ILE A HA   4  
ATOM 4507  H HB   . ILE A 1 73 ? 7.573  -7.879  6.748  1.00 0.00 ? 73 ILE A HB   4  
ATOM 4508  H HG12 . ILE A 1 73 ? 7.856  -9.237  9.404  1.00 0.00 ? 73 ILE A HG12 4  
ATOM 4509  H HG13 . ILE A 1 73 ? 8.878  -7.855  9.027  1.00 0.00 ? 73 ILE A HG13 4  
ATOM 4510  H HG21 . ILE A 1 73 ? 6.880  -10.078 6.028  1.00 0.00 ? 73 ILE A HG21 4  
ATOM 4511  H HG22 . ILE A 1 73 ? 7.308  -10.759 7.597  1.00 0.00 ? 73 ILE A HG22 4  
ATOM 4512  H HG23 . ILE A 1 73 ? 5.972  -9.615  7.467  1.00 0.00 ? 73 ILE A HG23 4  
ATOM 4513  H HD11 . ILE A 1 73 ? 6.953  -7.112  10.240 1.00 0.00 ? 73 ILE A HD11 4  
ATOM 4514  H HD12 . ILE A 1 73 ? 6.838  -6.533  8.578  1.00 0.00 ? 73 ILE A HD12 4  
ATOM 4515  H HD13 . ILE A 1 73 ? 5.873  -7.913  9.099  1.00 0.00 ? 73 ILE A HD13 4  
ATOM 4516  N N    . ASP A 1 74 ? 9.278  -8.560  4.481  1.00 0.00 ? 74 ASP A N    4  
ATOM 4517  C CA   . ASP A 1 74 ? 9.219  -8.839  3.051  1.00 0.00 ? 74 ASP A CA   4  
ATOM 4518  C C    . ASP A 1 74 ? 10.506 -9.503  2.574  1.00 0.00 ? 74 ASP A C    4  
ATOM 4519  O O    . ASP A 1 74 ? 10.476 -10.433 1.768  1.00 0.00 ? 74 ASP A O    4  
ATOM 4520  C CB   . ASP A 1 74 ? 8.975  -7.549  2.267  1.00 0.00 ? 74 ASP A CB   4  
ATOM 4521  C CG   . ASP A 1 74 ? 8.532  -7.812  0.841  1.00 0.00 ? 74 ASP A CG   4  
ATOM 4522  O OD1  . ASP A 1 74 ? 7.921  -8.874  0.596  1.00 0.00 ? 74 ASP A OD1  4  
ATOM 4523  O OD2  . ASP A 1 74 ? 8.795  -6.957  -0.029 1.00 0.00 ? 74 ASP A OD2  4  
ATOM 4524  H H    . ASP A 1 74 ? 9.336  -7.629  4.784  1.00 0.00 ? 74 ASP A H    4  
ATOM 4525  H HA   . ASP A 1 74 ? 8.395  -9.515  2.879  1.00 0.00 ? 74 ASP A HA   4  
ATOM 4526  H HB2  . ASP A 1 74 ? 8.206  -6.974  2.763  1.00 0.00 ? 74 ASP A HB2  4  
ATOM 4527  H HB3  . ASP A 1 74 ? 9.889  -6.973  2.241  1.00 0.00 ? 74 ASP A HB3  4  
ATOM 4528  N N    . LYS A 1 75 ? 11.637 -9.019  3.075  1.00 0.00 ? 75 LYS A N    4  
ATOM 4529  C CA   . LYS A 1 75 ? 12.937 -9.564  2.701  1.00 0.00 ? 75 LYS A CA   4  
ATOM 4530  C C    . LYS A 1 75 ? 13.067 -11.016 3.151  1.00 0.00 ? 75 LYS A C    4  
ATOM 4531  O O    . LYS A 1 75 ? 13.469 -11.882 2.375  1.00 0.00 ? 75 LYS A O    4  
ATOM 4532  C CB   . LYS A 1 75 ? 14.061 -8.727  3.315  1.00 0.00 ? 75 LYS A CB   4  
ATOM 4533  C CG   . LYS A 1 75 ? 15.451 -9.189  2.916  1.00 0.00 ? 75 LYS A CG   4  
ATOM 4534  C CD   . LYS A 1 75 ? 16.476 -8.078  3.077  1.00 0.00 ? 75 LYS A CD   4  
ATOM 4535  C CE   . LYS A 1 75 ? 16.504 -7.165  1.861  1.00 0.00 ? 75 LYS A CE   4  
ATOM 4536  N NZ   . LYS A 1 75 ? 16.935 -7.889  0.634  1.00 0.00 ? 75 LYS A NZ   4  
ATOM 4537  H H    . LYS A 1 75 ? 11.597 -8.276  3.714  1.00 0.00 ? 75 LYS A H    4  
ATOM 4538  H HA   . LYS A 1 75 ? 13.016 -9.525  1.626  1.00 0.00 ? 75 LYS A HA   4  
ATOM 4539  H HB2  . LYS A 1 75 ? 13.941 -7.700  3.001  1.00 0.00 ? 75 LYS A HB2  4  
ATOM 4540  H HB3  . LYS A 1 75 ? 13.983 -8.776  4.392  1.00 0.00 ? 75 LYS A HB3  4  
ATOM 4541  H HG2  . LYS A 1 75 ? 15.738 -10.021 3.542  1.00 0.00 ? 75 LYS A HG2  4  
ATOM 4542  H HG3  . LYS A 1 75 ? 15.433 -9.502  1.882  1.00 0.00 ? 75 LYS A HG3  4  
ATOM 4543  H HD2  . LYS A 1 75 ? 16.224 -7.491  3.948  1.00 0.00 ? 75 LYS A HD2  4  
ATOM 4544  H HD3  . LYS A 1 75 ? 17.454 -8.518  3.209  1.00 0.00 ? 75 LYS A HD3  4  
ATOM 4545  H HE2  . LYS A 1 75 ? 15.513 -6.766  1.703  1.00 0.00 ? 75 LYS A HE2  4  
ATOM 4546  H HE3  . LYS A 1 75 ? 17.192 -6.355  2.051  1.00 0.00 ? 75 LYS A HE3  4  
ATOM 4547  H HZ1  . LYS A 1 75 ? 17.843 -7.511  0.296  1.00 0.00 ? 75 LYS A HZ1  4  
ATOM 4548  H HZ2  . LYS A 1 75 ? 16.225 -7.775  -0.117 1.00 0.00 ? 75 LYS A HZ2  4  
ATOM 4549  H HZ3  . LYS A 1 75 ? 17.049 -8.903  0.838  1.00 0.00 ? 75 LYS A HZ3  4  
ATOM 4550  N N    . ALA A 1 76 ? 12.723 -11.275 4.408  1.00 0.00 ? 76 ALA A N    4  
ATOM 4551  C CA   . ALA A 1 76 ? 12.798 -12.622 4.959  1.00 0.00 ? 76 ALA A CA   4  
ATOM 4552  C C    . ALA A 1 76 ? 11.688 -13.506 4.402  1.00 0.00 ? 76 ALA A C    4  
ATOM 4553  O O    . ALA A 1 76 ? 11.823 -14.728 4.346  1.00 0.00 ? 76 ALA A O    4  
ATOM 4554  C CB   . ALA A 1 76 ? 12.727 -12.576 6.478  1.00 0.00 ? 76 ALA A CB   4  
ATOM 4555  H H    . ALA A 1 76 ? 12.410 -10.542 4.978  1.00 0.00 ? 76 ALA A H    4  
ATOM 4556  H HA   . ALA A 1 76 ? 13.754 -13.044 4.681  1.00 0.00 ? 76 ALA A HA   4  
ATOM 4557  H HB1  . ALA A 1 76 ? 11.697 -12.465 6.786  1.00 0.00 ? 76 ALA A HB1  4  
ATOM 4558  H HB2  . ALA A 1 76 ? 13.128 -13.492 6.885  1.00 0.00 ? 76 ALA A HB2  4  
ATOM 4559  H HB3  . ALA A 1 76 ? 13.303 -11.738 6.840  1.00 0.00 ? 76 ALA A HB3  4  
ATOM 4560  N N    . SER A 1 77 ? 10.589 -12.880 3.992  1.00 0.00 ? 77 SER A N    4  
ATOM 4561  C CA   . SER A 1 77 ? 9.453  -13.610 3.443  1.00 0.00 ? 77 SER A CA   4  
ATOM 4562  C C    . SER A 1 77 ? 9.867  -14.419 2.217  1.00 0.00 ? 77 SER A C    4  
ATOM 4563  O O    . SER A 1 77 ? 9.369  -15.520 1.989  1.00 0.00 ? 77 SER A O    4  
ATOM 4564  C CB   . SER A 1 77 ? 8.328  -12.642 3.073  1.00 0.00 ? 77 SER A CB   4  
ATOM 4565  O OG   . SER A 1 77 ? 7.436  -12.458 4.158  1.00 0.00 ? 77 SER A OG   4  
ATOM 4566  H H    . SER A 1 77 ? 10.541 -11.903 4.062  1.00 0.00 ? 77 SER A H    4  
ATOM 4567  H HA   . SER A 1 77 ? 9.097  -14.289 4.203  1.00 0.00 ? 77 SER A HA   4  
ATOM 4568  H HB2  . SER A 1 77 ? 8.752  -11.687 2.805  1.00 0.00 ? 77 SER A HB2  4  
ATOM 4569  H HB3  . SER A 1 77 ? 7.777  -13.040 2.232  1.00 0.00 ? 77 SER A HB3  4  
ATOM 4570  H HG   . SER A 1 77 ? 7.344  -13.283 4.641  1.00 0.00 ? 77 SER A HG   4  
ATOM 4571  N N    . ALA A 1 78 ? 10.783 -13.862 1.431  1.00 0.00 ? 78 ALA A N    4  
ATOM 4572  C CA   . ALA A 1 78 ? 11.267 -14.531 0.230  1.00 0.00 ? 78 ALA A CA   4  
ATOM 4573  C C    . ALA A 1 78 ? 12.187 -15.695 0.582  1.00 0.00 ? 78 ALA A C    4  
ATOM 4574  O O    . ALA A 1 78 ? 11.815 -16.860 0.435  1.00 0.00 ? 78 ALA A O    4  
ATOM 4575  C CB   . ALA A 1 78 ? 11.988 -13.540 -0.672 1.00 0.00 ? 78 ALA A CB   4  
ATOM 4576  H H    . ALA A 1 78 ? 11.143 -12.982 1.666  1.00 0.00 ? 78 ALA A H    4  
ATOM 4577  H HA   . ALA A 1 78 ? 10.411 -14.912 -0.308 1.00 0.00 ? 78 ALA A HA   4  
ATOM 4578  H HB1  . ALA A 1 78 ? 11.650 -13.668 -1.690 1.00 0.00 ? 78 ALA A HB1  4  
ATOM 4579  H HB2  . ALA A 1 78 ? 11.773 -12.533 -0.345 1.00 0.00 ? 78 ALA A HB2  4  
ATOM 4580  H HB3  . ALA A 1 78 ? 13.052 -13.716 -0.621 1.00 0.00 ? 78 ALA A HB3  4  
ATOM 4581  N N    . MET A 1 1  ? 0.327  0.088   -3.533 1.00 0.00 ? 1  MET A N    5  
ATOM 4582  C CA   . MET A 1 1  ? 0.503  -1.138  -4.303 1.00 0.00 ? 1  MET A CA   5  
ATOM 4583  C C    . MET A 1 1  ? 1.505  -2.067  -3.624 1.00 0.00 ? 1  MET A C    5  
ATOM 4584  O O    . MET A 1 1  ? 2.594  -2.308  -4.144 1.00 0.00 ? 1  MET A O    5  
ATOM 4585  C CB   . MET A 1 1  ? 0.974  -0.812  -5.722 1.00 0.00 ? 1  MET A CB   5  
ATOM 4586  C CG   . MET A 1 1  ? -0.136 -0.307  -6.629 1.00 0.00 ? 1  MET A CG   5  
ATOM 4587  S SD   . MET A 1 1  ? -0.505 1.439   -6.372 1.00 0.00 ? 1  MET A SD   5  
ATOM 4588  C CE   . MET A 1 1  ? 0.979  2.198   -7.028 1.00 0.00 ? 1  MET A CE   5  
ATOM 4589  H H1   . MET A 1 1  ? 1.118  0.573   -3.219 1.00 0.00 ? 1  MET A H1   5  
ATOM 4590  H HA   . MET A 1 1  ? -0.453 -1.636  -4.356 1.00 0.00 ? 1  MET A HA   5  
ATOM 4591  H HB2  . MET A 1 1  ? 1.739  -0.052  -5.668 1.00 0.00 ? 1  MET A HB2  5  
ATOM 4592  H HB3  . MET A 1 1  ? 1.393  -1.703  -6.164 1.00 0.00 ? 1  MET A HB3  5  
ATOM 4593  H HG2  . MET A 1 1  ? 0.164  -0.449  -7.657 1.00 0.00 ? 1  MET A HG2  5  
ATOM 4594  H HG3  . MET A 1 1  ? -1.029 -0.883  -6.435 1.00 0.00 ? 1  MET A HG3  5  
ATOM 4595  H HE1  . MET A 1 1  ? 0.802  3.251   -7.193 1.00 0.00 ? 1  MET A HE1  5  
ATOM 4596  H HE2  . MET A 1 1  ? 1.788  2.075   -6.323 1.00 0.00 ? 1  MET A HE2  5  
ATOM 4597  H HE3  . MET A 1 1  ? 1.241  1.726   -7.964 1.00 0.00 ? 1  MET A HE3  5  
ATOM 4598  N N    . SER A 1 2  ? 1.129  -2.585  -2.459 1.00 0.00 ? 2  SER A N    5  
ATOM 4599  C CA   . SER A 1 2  ? 1.996  -3.484  -1.706 1.00 0.00 ? 2  SER A CA   5  
ATOM 4600  C C    . SER A 1 2  ? 1.173  -4.474  -0.889 1.00 0.00 ? 2  SER A C    5  
ATOM 4601  O O    . SER A 1 2  ? 0.100  -4.141  -0.385 1.00 0.00 ? 2  SER A O    5  
ATOM 4602  C CB   . SER A 1 2  ? 2.917  -2.684  -0.783 1.00 0.00 ? 2  SER A CB   5  
ATOM 4603  O OG   . SER A 1 2  ? 4.024  -2.160  -1.495 1.00 0.00 ? 2  SER A OG   5  
ATOM 4604  H H    . SER A 1 2  ? 0.248  -2.354  -2.095 1.00 0.00 ? 2  SER A H    5  
ATOM 4605  H HA   . SER A 1 2  ? 2.599  -4.032  -2.414 1.00 0.00 ? 2  SER A HA   5  
ATOM 4606  H HB2  . SER A 1 2  ? 2.364  -1.865  -0.349 1.00 0.00 ? 2  SER A HB2  5  
ATOM 4607  H HB3  . SER A 1 2  ? 3.282  -3.329  0.004  1.00 0.00 ? 2  SER A HB3  5  
ATOM 4608  H HG   . SER A 1 2  ? 3.908  -1.216  -1.619 1.00 0.00 ? 2  SER A HG   5  
ATOM 4609  N N    . ASP A 1 3  ? 1.683  -5.694  -0.761 1.00 0.00 ? 3  ASP A N    5  
ATOM 4610  C CA   . ASP A 1 3  ? 0.997  -6.735  -0.005 1.00 0.00 ? 3  ASP A CA   5  
ATOM 4611  C C    . ASP A 1 3  ? 1.549  -6.828  1.414  1.00 0.00 ? 3  ASP A C    5  
ATOM 4612  O O    . ASP A 1 3  ? 0.796  -6.980  2.377  1.00 0.00 ? 3  ASP A O    5  
ATOM 4613  C CB   . ASP A 1 3  ? 1.138  -8.085  -0.710 1.00 0.00 ? 3  ASP A CB   5  
ATOM 4614  C CG   . ASP A 1 3  ? 0.109  -8.275  -1.807 1.00 0.00 ? 3  ASP A CG   5  
ATOM 4615  O OD1  . ASP A 1 3  ? -0.993 -7.700  -1.692 1.00 0.00 ? 3  ASP A OD1  5  
ATOM 4616  O OD2  . ASP A 1 3  ? 0.405  -9.001  -2.779 1.00 0.00 ? 3  ASP A OD2  5  
ATOM 4617  H H    . ASP A 1 3  ? 2.543  -5.900  -1.186 1.00 0.00 ? 3  ASP A H    5  
ATOM 4618  H HA   . ASP A 1 3  ? -0.049 -6.473  0.046  1.00 0.00 ? 3  ASP A HA   5  
ATOM 4619  H HB2  . ASP A 1 3  ? 2.122  -8.153  -1.150 1.00 0.00 ? 3  ASP A HB2  5  
ATOM 4620  H HB3  . ASP A 1 3  ? 1.016  -8.877  0.015  1.00 0.00 ? 3  ASP A HB3  5  
ATOM 4621  N N    . THR A 1 4  ? 2.870  -6.738  1.537  1.00 0.00 ? 4  THR A N    5  
ATOM 4622  C CA   . THR A 1 4  ? 3.523  -6.814  2.838  1.00 0.00 ? 4  THR A CA   5  
ATOM 4623  C C    . THR A 1 4  ? 3.197  -5.593  3.690  1.00 0.00 ? 4  THR A C    5  
ATOM 4624  O O    . THR A 1 4  ? 2.842  -5.719  4.862  1.00 0.00 ? 4  THR A O    5  
ATOM 4625  C CB   . THR A 1 4  ? 5.053  -6.930  2.692  1.00 0.00 ? 4  THR A CB   5  
ATOM 4626  O OG1  . THR A 1 4  ? 5.381  -8.021  1.825  1.00 0.00 ? 4  THR A OG1  5  
ATOM 4627  C CG2  . THR A 1 4  ? 5.711  -7.137  4.048  1.00 0.00 ? 4  THR A CG2  5  
ATOM 4628  H H    . THR A 1 4  ? 3.417  -6.618  0.733  1.00 0.00 ? 4  THR A H    5  
ATOM 4629  H HA   . THR A 1 4  ? 3.163  -7.700  3.341  1.00 0.00 ? 4  THR A HA   5  
ATOM 4630  H HB   . THR A 1 4  ? 5.429  -6.013  2.262  1.00 0.00 ? 4  THR A HB   5  
ATOM 4631  H HG1  . THR A 1 4  ? 4.724  -8.084  1.127  1.00 0.00 ? 4  THR A HG1  5  
ATOM 4632  H HG21 . THR A 1 4  ? 4.957  -7.122  4.821  1.00 0.00 ? 4  THR A HG21 5  
ATOM 4633  H HG22 . THR A 1 4  ? 6.425  -6.348  4.226  1.00 0.00 ? 4  THR A HG22 5  
ATOM 4634  H HG23 . THR A 1 4  ? 6.218  -8.091  4.059  1.00 0.00 ? 4  THR A HG23 5  
ATOM 4635  N N    . ALA A 1 5  ? 3.318  -4.412  3.094  1.00 0.00 ? 5  ALA A N    5  
ATOM 4636  C CA   . ALA A 1 5  ? 3.032  -3.168  3.798  1.00 0.00 ? 5  ALA A CA   5  
ATOM 4637  C C    . ALA A 1 5  ? 1.661  -3.216  4.464  1.00 0.00 ? 5  ALA A C    5  
ATOM 4638  O O    . ALA A 1 5  ? 1.535  -2.973  5.663  1.00 0.00 ? 5  ALA A O    5  
ATOM 4639  C CB   . ALA A 1 5  ? 3.115  -1.988  2.840  1.00 0.00 ? 5  ALA A CB   5  
ATOM 4640  H H    . ALA A 1 5  ? 3.604  -4.376  2.158  1.00 0.00 ? 5  ALA A H    5  
ATOM 4641  H HA   . ALA A 1 5  ? 3.787  -3.035  4.560  1.00 0.00 ? 5  ALA A HA   5  
ATOM 4642  H HB1  . ALA A 1 5  ? 4.082  -1.517  2.935  1.00 0.00 ? 5  ALA A HB1  5  
ATOM 4643  H HB2  . ALA A 1 5  ? 2.981  -2.337  1.827  1.00 0.00 ? 5  ALA A HB2  5  
ATOM 4644  H HB3  . ALA A 1 5  ? 2.341  -1.275  3.081  1.00 0.00 ? 5  ALA A HB3  5  
ATOM 4645  N N    . GLU A 1 6  ? 0.637  -3.531  3.676  1.00 0.00 ? 6  GLU A N    5  
ATOM 4646  C CA   . GLU A 1 6  ? -0.725 -3.609  4.191  1.00 0.00 ? 6  GLU A CA   5  
ATOM 4647  C C    . GLU A 1 6  ? -0.791 -4.506  5.424  1.00 0.00 ? 6  GLU A C    5  
ATOM 4648  O O    . GLU A 1 6  ? -1.347 -4.124  6.454  1.00 0.00 ? 6  GLU A O    5  
ATOM 4649  C CB   . GLU A 1 6  ? -1.672 -4.138  3.112  1.00 0.00 ? 6  GLU A CB   5  
ATOM 4650  C CG   . GLU A 1 6  ? -1.991 -3.119  2.030  1.00 0.00 ? 6  GLU A CG   5  
ATOM 4651  C CD   . GLU A 1 6  ? -3.193 -3.514  1.193  1.00 0.00 ? 6  GLU A CD   5  
ATOM 4652  O OE1  . GLU A 1 6  ? -3.088 -4.497  0.430  1.00 0.00 ? 6  GLU A OE1  5  
ATOM 4653  O OE2  . GLU A 1 6  ? -4.238 -2.840  1.302  1.00 0.00 ? 6  GLU A OE2  5  
ATOM 4654  H H    . GLU A 1 6  ? 0.801  -3.714  2.728  1.00 0.00 ? 6  GLU A H    5  
ATOM 4655  H HA   . GLU A 1 6  ? -1.032 -2.612  4.469  1.00 0.00 ? 6  GLU A HA   5  
ATOM 4656  H HB2  . GLU A 1 6  ? -1.221 -5.000  2.644  1.00 0.00 ? 6  GLU A HB2  5  
ATOM 4657  H HB3  . GLU A 1 6  ? -2.599 -4.437  3.579  1.00 0.00 ? 6  GLU A HB3  5  
ATOM 4658  H HG2  . GLU A 1 6  ? -2.195 -2.168  2.498  1.00 0.00 ? 6  GLU A HG2  5  
ATOM 4659  H HG3  . GLU A 1 6  ? -1.134 -3.023  1.380  1.00 0.00 ? 6  GLU A HG3  5  
ATOM 4660  N N    . ARG A 1 7  ? -0.218 -5.700  5.311  1.00 0.00 ? 7  ARG A N    5  
ATOM 4661  C CA   . ARG A 1 7  ? -0.213 -6.652  6.415  1.00 0.00 ? 7  ARG A CA   5  
ATOM 4662  C C    . ARG A 1 7  ? 0.408  -6.032  7.664  1.00 0.00 ? 7  ARG A C    5  
ATOM 4663  O O    . ARG A 1 7  ? -0.122 -6.169  8.767  1.00 0.00 ? 7  ARG A O    5  
ATOM 4664  C CB   . ARG A 1 7  ? 0.556  -7.915  6.023  1.00 0.00 ? 7  ARG A CB   5  
ATOM 4665  C CG   . ARG A 1 7  ? -0.043 -9.192  6.589  1.00 0.00 ? 7  ARG A CG   5  
ATOM 4666  C CD   . ARG A 1 7  ? -1.337 -9.562  5.881  1.00 0.00 ? 7  ARG A CD   5  
ATOM 4667  N NE   . ARG A 1 7  ? -1.482 -11.007 5.727  1.00 0.00 ? 7  ARG A NE   5  
ATOM 4668  C CZ   . ARG A 1 7  ? -0.723 -11.741 4.921  1.00 0.00 ? 7  ARG A CZ   5  
ATOM 4669  N NH1  . ARG A 1 7  ? 0.232  -11.168 4.201  1.00 0.00 ? 7  ARG A NH1  5  
ATOM 4670  N NH2  . ARG A 1 7  ? -0.916 -13.051 4.836  1.00 0.00 ? 7  ARG A NH2  5  
ATOM 4671  H H    . ARG A 1 7  ? 0.210  -5.947  4.465  1.00 0.00 ? 7  ARG A H    5  
ATOM 4672  H HA   . ARG A 1 7  ? -1.237 -6.916  6.630  1.00 0.00 ? 7  ARG A HA   5  
ATOM 4673  H HB2  . ARG A 1 7  ? 0.568  -7.996  4.946  1.00 0.00 ? 7  ARG A HB2  5  
ATOM 4674  H HB3  . ARG A 1 7  ? 1.571  -7.830  6.381  1.00 0.00 ? 7  ARG A HB3  5  
ATOM 4675  H HG2  . ARG A 1 7  ? 0.666  -9.998  6.464  1.00 0.00 ? 7  ARG A HG2  5  
ATOM 4676  H HG3  . ARG A 1 7  ? -0.246 -9.049  7.640  1.00 0.00 ? 7  ARG A HG3  5  
ATOM 4677  H HD2  . ARG A 1 7  ? -2.168 -9.186  6.458  1.00 0.00 ? 7  ARG A HD2  5  
ATOM 4678  H HD3  . ARG A 1 7  ? -1.340 -9.103  4.903  1.00 0.00 ? 7  ARG A HD3  5  
ATOM 4679  H HE   . ARG A 1 7  ? -2.182 -11.451 6.250  1.00 0.00 ? 7  ARG A HE   5  
ATOM 4680  H HH11 . ARG A 1 7  ? 0.380  -10.182 4.264  1.00 0.00 ? 7  ARG A HH11 5  
ATOM 4681  H HH12 . ARG A 1 7  ? 0.803  -11.723 3.596  1.00 0.00 ? 7  ARG A HH12 5  
ATOM 4682  H HH21 . ARG A 1 7  ? -1.634 -13.487 5.378  1.00 0.00 ? 7  ARG A HH21 5  
ATOM 4683  H HH22 . ARG A 1 7  ? -0.344 -13.602 4.229  1.00 0.00 ? 7  ARG A HH22 5  
ATOM 4684  N N    . VAL A 1 8  ? 1.536  -5.352  7.483  1.00 0.00 ? 8  VAL A N    5  
ATOM 4685  C CA   . VAL A 1 8  ? 2.229  -4.711  8.594  1.00 0.00 ? 8  VAL A CA   5  
ATOM 4686  C C    . VAL A 1 8  ? 1.350  -3.656  9.255  1.00 0.00 ? 8  VAL A C    5  
ATOM 4687  O O    . VAL A 1 8  ? 0.989  -3.777  10.426 1.00 0.00 ? 8  VAL A O    5  
ATOM 4688  C CB   . VAL A 1 8  ? 3.542  -4.053  8.131  1.00 0.00 ? 8  VAL A CB   5  
ATOM 4689  C CG1  . VAL A 1 8  ? 4.233  -3.361  9.297  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 4690  C CG2  . VAL A 1 8  ? 4.460  -5.086  7.495  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 4691  H H    . VAL A 1 8  ? 1.910  -5.278  6.580  1.00 0.00 ? 8  VAL A H    5  
ATOM 4692  H HA   . VAL A 1 8  ? 2.469  -5.473  9.321  1.00 0.00 ? 8  VAL A HA   5  
ATOM 4693  H HB   . VAL A 1 8  ? 3.305  -3.306  7.388  1.00 0.00 ? 8  VAL A HB   5  
ATOM 4694  H HG11 . VAL A 1 8  ? 3.659  -3.517  10.199 1.00 0.00 ? 8  VAL A HG11 5  
ATOM 4695  H HG12 . VAL A 1 8  ? 5.224  -3.771  9.424  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 4696  H HG13 . VAL A 1 8  ? 4.303  -2.302  9.096  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 4697  H HG21 . VAL A 1 8  ? 4.168  -6.074  7.818  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 4698  H HG22 . VAL A 1 8  ? 4.383  -5.022  6.419  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 4699  H HG23 . VAL A 1 8  ? 5.480  -4.895  7.794  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 4700  N N    . LYS A 1 9  ? 1.007  -2.620  8.497  1.00 0.00 ? 9  LYS A N    5  
ATOM 4701  C CA   . LYS A 1 9  ? 0.168  -1.542  9.007  1.00 0.00 ? 9  LYS A CA   5  
ATOM 4702  C C    . LYS A 1 9  ? -1.117 -2.095  9.615  1.00 0.00 ? 9  LYS A C    5  
ATOM 4703  O O    . LYS A 1 9  ? -1.692 -1.499  10.526 1.00 0.00 ? 9  LYS A O    5  
ATOM 4704  C CB   . LYS A 1 9  ? -0.168 -0.556  7.887  1.00 0.00 ? 9  LYS A CB   5  
ATOM 4705  C CG   . LYS A 1 9  ? -1.005 -1.162  6.773  1.00 0.00 ? 9  LYS A CG   5  
ATOM 4706  C CD   . LYS A 1 9  ? -1.565 -0.093  5.850  1.00 0.00 ? 9  LYS A CD   5  
ATOM 4707  C CE   . LYS A 1 9  ? -0.494 0.456   4.919  1.00 0.00 ? 9  LYS A CE   5  
ATOM 4708  N NZ   . LYS A 1 9  ? -0.888 1.766   4.332  1.00 0.00 ? 9  LYS A NZ   5  
ATOM 4709  H H    . LYS A 1 9  ? 1.326  -2.580  7.571  1.00 0.00 ? 9  LYS A H    5  
ATOM 4710  H HA   . LYS A 1 9  ? 0.722  -1.026  9.776  1.00 0.00 ? 9  LYS A HA   5  
ATOM 4711  H HB2  . LYS A 1 9  ? -0.715 0.276   8.307  1.00 0.00 ? 9  LYS A HB2  5  
ATOM 4712  H HB3  . LYS A 1 9  ? 0.753  -0.190  7.457  1.00 0.00 ? 9  LYS A HB3  5  
ATOM 4713  H HG2  . LYS A 1 9  ? -0.387 -1.833  6.196  1.00 0.00 ? 9  LYS A HG2  5  
ATOM 4714  H HG3  . LYS A 1 9  ? -1.826 -1.713  7.211  1.00 0.00 ? 9  LYS A HG3  5  
ATOM 4715  H HD2  . LYS A 1 9  ? -2.358 -0.521  5.256  1.00 0.00 ? 9  LYS A HD2  5  
ATOM 4716  H HD3  . LYS A 1 9  ? -1.958 0.717   6.449  1.00 0.00 ? 9  LYS A HD3  5  
ATOM 4717  H HE2  . LYS A 1 9  ? 0.420  0.581   5.478  1.00 0.00 ? 9  LYS A HE2  5  
ATOM 4718  H HE3  . LYS A 1 9  ? -0.333 -0.253  4.120  1.00 0.00 ? 9  LYS A HE3  5  
ATOM 4719  H HZ1  . LYS A 1 9  ? -1.470 1.617   3.483  1.00 0.00 ? 9  LYS A HZ1  5  
ATOM 4720  H HZ2  . LYS A 1 9  ? -0.041 2.308   4.067  1.00 0.00 ? 9  LYS A HZ2  5  
ATOM 4721  H HZ3  . LYS A 1 9  ? -1.437 2.317   5.023  1.00 0.00 ? 9  LYS A HZ3  5  
ATOM 4722  N N    . LYS A 1 10 ? -1.563 -3.238  9.106  1.00 0.00 ? 10 LYS A N    5  
ATOM 4723  C CA   . LYS A 1 10 ? -2.779 -3.874  9.601  1.00 0.00 ? 10 LYS A CA   5  
ATOM 4724  C C    . LYS A 1 10 ? -2.579 -4.404  11.017 1.00 0.00 ? 10 LYS A C    5  
ATOM 4725  O O    . LYS A 1 10 ? -3.331 -4.061  11.930 1.00 0.00 ? 10 LYS A O    5  
ATOM 4726  C CB   . LYS A 1 10 ? -3.196 -5.016  8.671  1.00 0.00 ? 10 LYS A CB   5  
ATOM 4727  C CG   . LYS A 1 10 ? -4.056 -4.566  7.503  1.00 0.00 ? 10 LYS A CG   5  
ATOM 4728  C CD   . LYS A 1 10 ? -4.137 -5.635  6.426  1.00 0.00 ? 10 LYS A CD   5  
ATOM 4729  C CE   . LYS A 1 10 ? -4.999 -6.807  6.867  1.00 0.00 ? 10 LYS A CE   5  
ATOM 4730  N NZ   . LYS A 1 10 ? -6.449 -6.539  6.656  1.00 0.00 ? 10 LYS A NZ   5  
ATOM 4731  H H    . LYS A 1 10 ? -1.061 -3.666  8.381  1.00 0.00 ? 10 LYS A H    5  
ATOM 4732  H HA   . LYS A 1 10 ? -3.560 -3.129  9.615  1.00 0.00 ? 10 LYS A HA   5  
ATOM 4733  H HB2  . LYS A 1 10 ? -2.307 -5.486  8.277  1.00 0.00 ? 10 LYS A HB2  5  
ATOM 4734  H HB3  . LYS A 1 10 ? -3.754 -5.744  9.243  1.00 0.00 ? 10 LYS A HB3  5  
ATOM 4735  H HG2  . LYS A 1 10 ? -5.053 -4.356  7.862  1.00 0.00 ? 10 LYS A HG2  5  
ATOM 4736  H HG3  . LYS A 1 10 ? -3.629 -3.670  7.077  1.00 0.00 ? 10 LYS A HG3  5  
ATOM 4737  H HD2  . LYS A 1 10 ? -4.565 -5.203  5.533  1.00 0.00 ? 10 LYS A HD2  5  
ATOM 4738  H HD3  . LYS A 1 10 ? -3.140 -5.993  6.211  1.00 0.00 ? 10 LYS A HD3  5  
ATOM 4739  H HE2  . LYS A 1 10 ? -4.717 -7.679  6.297  1.00 0.00 ? 10 LYS A HE2  5  
ATOM 4740  H HE3  . LYS A 1 10 ? -4.825 -6.991  7.917  1.00 0.00 ? 10 LYS A HE3  5  
ATOM 4741  H HZ1  . LYS A 1 10 ? -6.708 -6.733  5.667  1.00 0.00 ? 10 LYS A HZ1  5  
ATOM 4742  H HZ2  . LYS A 1 10 ? -6.663 -5.544  6.869  1.00 0.00 ? 10 LYS A HZ2  5  
ATOM 4743  H HZ3  . LYS A 1 10 ? -7.019 -7.147  7.278  1.00 0.00 ? 10 LYS A HZ3  5  
ATOM 4744  N N    . ILE A 1 11 ? -1.561 -5.240  11.192 1.00 0.00 ? 11 ILE A N    5  
ATOM 4745  C CA   . ILE A 1 11 ? -1.261 -5.814  12.498 1.00 0.00 ? 11 ILE A CA   5  
ATOM 4746  C C    . ILE A 1 11 ? -0.859 -4.733  13.495 1.00 0.00 ? 11 ILE A C    5  
ATOM 4747  O O    . ILE A 1 11 ? -1.026 -4.895  14.704 1.00 0.00 ? 11 ILE A O    5  
ATOM 4748  C CB   . ILE A 1 11 ? -0.133 -6.859  12.408 1.00 0.00 ? 11 ILE A CB   5  
ATOM 4749  C CG1  . ILE A 1 11 ? -0.522 -7.980  11.442 1.00 0.00 ? 11 ILE A CG1  5  
ATOM 4750  C CG2  . ILE A 1 11 ? 0.177  -7.423  13.786 1.00 0.00 ? 11 ILE A CG2  5  
ATOM 4751  C CD1  . ILE A 1 11 ? 0.598  -8.959  11.170 1.00 0.00 ? 11 ILE A CD1  5  
ATOM 4752  H H    . ILE A 1 11 ? -0.997 -5.475  10.426 1.00 0.00 ? 11 ILE A H    5  
ATOM 4753  H HA   . ILE A 1 11 ? -2.153 -6.307  12.857 1.00 0.00 ? 11 ILE A HA   5  
ATOM 4754  H HB   . ILE A 1 11 ? 0.754  -6.367  12.039 1.00 0.00 ? 11 ILE A HB   5  
ATOM 4755  H HG12 . ILE A 1 11 ? -1.351 -8.532  11.857 1.00 0.00 ? 11 ILE A HG12 5  
ATOM 4756  H HG13 . ILE A 1 11 ? -0.821 -7.545  10.499 1.00 0.00 ? 11 ILE A HG13 5  
ATOM 4757  H HG21 . ILE A 1 11 ? -0.702 -7.911  14.182 1.00 0.00 ? 11 ILE A HG21 5  
ATOM 4758  H HG22 . ILE A 1 11 ? 0.981  -8.140  13.709 1.00 0.00 ? 11 ILE A HG22 5  
ATOM 4759  H HG23 . ILE A 1 11 ? 0.472  -6.621  14.446 1.00 0.00 ? 11 ILE A HG23 5  
ATOM 4760  H HD11 . ILE A 1 11 ? 0.233  -9.968  11.293 1.00 0.00 ? 11 ILE A HD11 5  
ATOM 4761  H HD12 . ILE A 1 11 ? 0.956  -8.825  10.161 1.00 0.00 ? 11 ILE A HD12 5  
ATOM 4762  H HD13 . ILE A 1 11 ? 1.407  -8.783  11.865 1.00 0.00 ? 11 ILE A HD13 5  
ATOM 4763  N N    . VAL A 1 12 ? -0.330 -3.628  12.980 1.00 0.00 ? 12 VAL A N    5  
ATOM 4764  C CA   . VAL A 1 12 ? 0.093  -2.517  13.825 1.00 0.00 ? 12 VAL A CA   5  
ATOM 4765  C C    . VAL A 1 12 ? -1.106 -1.726  14.335 1.00 0.00 ? 12 VAL A C    5  
ATOM 4766  O O    . VAL A 1 12 ? -1.207 -1.429  15.525 1.00 0.00 ? 12 VAL A O    5  
ATOM 4767  C CB   . VAL A 1 12 ? 1.038  -1.565  13.068 1.00 0.00 ? 12 VAL A CB   5  
ATOM 4768  C CG1  . VAL A 1 12 ? 1.436  -0.393  13.952 1.00 0.00 ? 12 VAL A CG1  5  
ATOM 4769  C CG2  . VAL A 1 12 ? 2.268  -2.314  12.577 1.00 0.00 ? 12 VAL A CG2  5  
ATOM 4770  H H    . VAL A 1 12 ? -0.222 -3.557  12.009 1.00 0.00 ? 12 VAL A H    5  
ATOM 4771  H HA   . VAL A 1 12 ? 0.629  -2.926  14.670 1.00 0.00 ? 12 VAL A HA   5  
ATOM 4772  H HB   . VAL A 1 12 ? 0.512  -1.177  12.208 1.00 0.00 ? 12 VAL A HB   5  
ATOM 4773  H HG11 . VAL A 1 12 ? 2.159  0.220   13.434 1.00 0.00 ? 12 VAL A HG11 5  
ATOM 4774  H HG12 . VAL A 1 12 ? 0.561  0.198   14.182 1.00 0.00 ? 12 VAL A HG12 5  
ATOM 4775  H HG13 . VAL A 1 12 ? 1.871  -0.764  14.868 1.00 0.00 ? 12 VAL A HG13 5  
ATOM 4776  H HG21 . VAL A 1 12 ? 3.153  -1.877  13.014 1.00 0.00 ? 12 VAL A HG21 5  
ATOM 4777  H HG22 . VAL A 1 12 ? 2.198  -3.352  12.869 1.00 0.00 ? 12 VAL A HG22 5  
ATOM 4778  H HG23 . VAL A 1 12 ? 2.326  -2.246  11.501 1.00 0.00 ? 12 VAL A HG23 5  
ATOM 4779  N N    . VAL A 1 13 ? -2.015 -1.388  13.425 1.00 0.00 ? 13 VAL A N    5  
ATOM 4780  C CA   . VAL A 1 13 ? -3.210 -0.633  13.783 1.00 0.00 ? 13 VAL A CA   5  
ATOM 4781  C C    . VAL A 1 13 ? -4.175 -1.485  14.599 1.00 0.00 ? 13 VAL A C    5  
ATOM 4782  O O    . VAL A 1 13 ? -4.931 -0.968  15.421 1.00 0.00 ? 13 VAL A O    5  
ATOM 4783  C CB   . VAL A 1 13 ? -3.938 -0.108  12.531 1.00 0.00 ? 13 VAL A CB   5  
ATOM 4784  C CG1  . VAL A 1 13 ? -5.207 0.632   12.922 1.00 0.00 ? 13 VAL A CG1  5  
ATOM 4785  C CG2  . VAL A 1 13 ? -3.017 0.788   11.716 1.00 0.00 ? 13 VAL A CG2  5  
ATOM 4786  H H    . VAL A 1 13 ? -1.879 -1.654  12.492 1.00 0.00 ? 13 VAL A H    5  
ATOM 4787  H HA   . VAL A 1 13 ? -2.903 0.216   14.377 1.00 0.00 ? 13 VAL A HA   5  
ATOM 4788  H HB   . VAL A 1 13 ? -4.215 -0.955  11.920 1.00 0.00 ? 13 VAL A HB   5  
ATOM 4789  H HG11 . VAL A 1 13 ? -6.067 0.027   12.674 1.00 0.00 ? 13 VAL A HG11 5  
ATOM 4790  H HG12 . VAL A 1 13 ? -5.197 0.828   13.984 1.00 0.00 ? 13 VAL A HG12 5  
ATOM 4791  H HG13 . VAL A 1 13 ? -5.259 1.567   12.384 1.00 0.00 ? 13 VAL A HG13 5  
ATOM 4792  H HG21 . VAL A 1 13 ? -3.067 0.503   10.676 1.00 0.00 ? 13 VAL A HG21 5  
ATOM 4793  H HG22 . VAL A 1 13 ? -3.330 1.817   11.822 1.00 0.00 ? 13 VAL A HG22 5  
ATOM 4794  H HG23 . VAL A 1 13 ? -2.003 0.682   12.072 1.00 0.00 ? 13 VAL A HG23 5  
ATOM 4795  N N    . GLU A 1 14 ? -4.143 -2.793  14.366 1.00 0.00 ? 14 GLU A N    5  
ATOM 4796  C CA   . GLU A 1 14 ? -5.016 -3.717  15.081 1.00 0.00 ? 14 GLU A CA   5  
ATOM 4797  C C    . GLU A 1 14 ? -4.447 -4.050  16.457 1.00 0.00 ? 14 GLU A C    5  
ATOM 4798  O O    . GLU A 1 14 ? -5.183 -4.413  17.375 1.00 0.00 ? 14 GLU A O    5  
ATOM 4799  C CB   . GLU A 1 14 ? -5.208 -5.002  14.272 1.00 0.00 ? 14 GLU A CB   5  
ATOM 4800  C CG   . GLU A 1 14 ? -6.546 -5.680  14.513 1.00 0.00 ? 14 GLU A CG   5  
ATOM 4801  C CD   . GLU A 1 14 ? -6.761 -6.882  13.615 1.00 0.00 ? 14 GLU A CD   5  
ATOM 4802  O OE1  . GLU A 1 14 ? -7.259 -6.695  12.484 1.00 0.00 ? 14 GLU A OE1  5  
ATOM 4803  O OE2  . GLU A 1 14 ? -6.434 -8.009  14.042 1.00 0.00 ? 14 GLU A OE2  5  
ATOM 4804  H H    . GLU A 1 14 ? -3.518 -3.145  13.698 1.00 0.00 ? 14 GLU A H    5  
ATOM 4805  H HA   . GLU A 1 14 ? -5.974 -3.237  15.208 1.00 0.00 ? 14 GLU A HA   5  
ATOM 4806  H HB2  . GLU A 1 14 ? -5.131 -4.766  13.220 1.00 0.00 ? 14 GLU A HB2  5  
ATOM 4807  H HB3  . GLU A 1 14 ? -4.423 -5.697  14.533 1.00 0.00 ? 14 GLU A HB3  5  
ATOM 4808  H HG2  . GLU A 1 14 ? -6.589 -6.006  15.542 1.00 0.00 ? 14 GLU A HG2  5  
ATOM 4809  H HG3  . GLU A 1 14 ? -7.335 -4.965  14.330 1.00 0.00 ? 14 GLU A HG3  5  
ATOM 4810  N N    . HIS A 1 15 ? -3.131 -3.924  16.592 1.00 0.00 ? 15 HIS A N    5  
ATOM 4811  C CA   . HIS A 1 15 ? -2.461 -4.211  17.856 1.00 0.00 ? 15 HIS A CA   5  
ATOM 4812  C C    . HIS A 1 15 ? -2.380 -2.959  18.724 1.00 0.00 ? 15 HIS A C    5  
ATOM 4813  O O    . HIS A 1 15 ? -2.817 -2.960  19.876 1.00 0.00 ? 15 HIS A O    5  
ATOM 4814  C CB   . HIS A 1 15 ? -1.058 -4.761  17.601 1.00 0.00 ? 15 HIS A CB   5  
ATOM 4815  C CG   . HIS A 1 15 ? -0.350 -5.199  18.846 1.00 0.00 ? 15 HIS A CG   5  
ATOM 4816  N ND1  . HIS A 1 15 ? -0.014 -6.512  19.098 1.00 0.00 ? 15 HIS A ND1  5  
ATOM 4817  C CD2  . HIS A 1 15 ? 0.087  -4.489  19.912 1.00 0.00 ? 15 HIS A CD2  5  
ATOM 4818  C CE1  . HIS A 1 15 ? 0.597  -6.591  20.267 1.00 0.00 ? 15 HIS A CE1  5  
ATOM 4819  N NE2  . HIS A 1 15 ? 0.672  -5.377  20.781 1.00 0.00 ? 15 HIS A NE2  5  
ATOM 4820  H H    . HIS A 1 15 ? -2.597 -3.631  15.825 1.00 0.00 ? 15 HIS A H    5  
ATOM 4821  H HA   . HIS A 1 15 ? -3.042 -4.958  18.377 1.00 0.00 ? 15 HIS A HA   5  
ATOM 4822  H HB2  . HIS A 1 15 ? -1.127 -5.614  16.942 1.00 0.00 ? 15 HIS A HB2  5  
ATOM 4823  H HB3  . HIS A 1 15 ? -0.458 -3.995  17.129 1.00 0.00 ? 15 HIS A HB3  5  
ATOM 4824  H HD1  . HIS A 1 15 ? -0.198 -7.273  18.509 1.00 0.00 ? 15 HIS A HD1  5  
ATOM 4825  H HD2  . HIS A 1 15 ? -0.007 -3.421  20.055 1.00 0.00 ? 15 HIS A HD2  5  
ATOM 4826  H HE1  . HIS A 1 15 ? 0.973  -7.494  20.724 1.00 0.00 ? 15 HIS A HE1  5  
ATOM 4827  N N    . LEU A 1 16 ? -1.818 -1.893  18.166 1.00 0.00 ? 16 LEU A N    5  
ATOM 4828  C CA   . LEU A 1 16 ? -1.678 -0.634  18.889 1.00 0.00 ? 16 LEU A CA   5  
ATOM 4829  C C    . LEU A 1 16 ? -3.021 0.081   19.002 1.00 0.00 ? 16 LEU A C    5  
ATOM 4830  O O    . LEU A 1 16 ? -3.252 0.846   19.937 1.00 0.00 ? 16 LEU A O    5  
ATOM 4831  C CB   . LEU A 1 16 ? -0.663 0.270   18.188 1.00 0.00 ? 16 LEU A CB   5  
ATOM 4832  C CG   . LEU A 1 16 ? 0.809  -0.023  18.476 1.00 0.00 ? 16 LEU A CG   5  
ATOM 4833  C CD1  . LEU A 1 16 ? 1.095  0.096   19.965 1.00 0.00 ? 16 LEU A CD1  5  
ATOM 4834  C CD2  . LEU A 1 16 ? 1.187  -1.407  17.969 1.00 0.00 ? 16 LEU A CD2  5  
ATOM 4835  H H    . LEU A 1 16 ? -1.489 -1.953  17.245 1.00 0.00 ? 16 LEU A H    5  
ATOM 4836  H HA   . LEU A 1 16 ? -1.321 -0.861  19.882 1.00 0.00 ? 16 LEU A HA   5  
ATOM 4837  H HB2  . LEU A 1 16 ? -0.817 0.176   17.124 1.00 0.00 ? 16 LEU A HB2  5  
ATOM 4838  H HB3  . LEU A 1 16 ? -0.864 1.288   18.490 1.00 0.00 ? 16 LEU A HB3  5  
ATOM 4839  H HG   . LEU A 1 16 ? 1.422  0.702   17.960 1.00 0.00 ? 16 LEU A HG   5  
ATOM 4840  H HD11 . LEU A 1 16 ? 0.695  -0.764  20.479 1.00 0.00 ? 16 LEU A HD11 5  
ATOM 4841  H HD12 . LEU A 1 16 ? 0.633  0.993   20.350 1.00 0.00 ? 16 LEU A HD12 5  
ATOM 4842  H HD13 . LEU A 1 16 ? 2.163  0.146   20.123 1.00 0.00 ? 16 LEU A HD13 5  
ATOM 4843  H HD21 . LEU A 1 16 ? 0.670  -2.157  18.550 1.00 0.00 ? 16 LEU A HD21 5  
ATOM 4844  H HD22 . LEU A 1 16 ? 2.253  -1.548  18.066 1.00 0.00 ? 16 LEU A HD22 5  
ATOM 4845  H HD23 . LEU A 1 16 ? 0.904  -1.499  16.930 1.00 0.00 ? 16 LEU A HD23 5  
ATOM 4846  N N    . GLY A 1 17 ? -3.905 -0.175  18.042 1.00 0.00 ? 17 GLY A N    5  
ATOM 4847  C CA   . GLY A 1 17 ? -5.214 0.450   18.053 1.00 0.00 ? 17 GLY A CA   5  
ATOM 4848  C C    . GLY A 1 17 ? -5.151 1.933   17.749 1.00 0.00 ? 17 GLY A C    5  
ATOM 4849  O O    . GLY A 1 17 ? -5.945 2.716   18.271 1.00 0.00 ? 17 GLY A O    5  
ATOM 4850  H H    . GLY A 1 17 ? -3.665 -0.794  17.320 1.00 0.00 ? 17 GLY A H    5  
ATOM 4851  H HA2  . GLY A 1 17 ? -5.838 -0.032  17.315 1.00 0.00 ? 17 GLY A HA2  5  
ATOM 4852  H HA3  . GLY A 1 17 ? -5.658 0.313   19.028 1.00 0.00 ? 17 GLY A HA3  5  
ATOM 4853  N N    . VAL A 1 18 ? -4.203 2.323   16.903 1.00 0.00 ? 18 VAL A N    5  
ATOM 4854  C CA   . VAL A 1 18 ? -4.038 3.723   16.531 1.00 0.00 ? 18 VAL A CA   5  
ATOM 4855  C C    . VAL A 1 18 ? -4.516 3.972   15.105 1.00 0.00 ? 18 VAL A C    5  
ATOM 4856  O O    . VAL A 1 18 ? -5.077 3.084   14.463 1.00 0.00 ? 18 VAL A O    5  
ATOM 4857  C CB   . VAL A 1 18 ? -2.568 4.167   16.653 1.00 0.00 ? 18 VAL A CB   5  
ATOM 4858  C CG1  . VAL A 1 18 ? -2.046 3.905   18.058 1.00 0.00 ? 18 VAL A CG1  5  
ATOM 4859  C CG2  . VAL A 1 18 ? -1.710 3.459   15.616 1.00 0.00 ? 18 VAL A CG2  5  
ATOM 4860  H H    . VAL A 1 18 ? -3.600 1.652   16.520 1.00 0.00 ? 18 VAL A H    5  
ATOM 4861  H HA   . VAL A 1 18 ? -4.630 4.321   17.209 1.00 0.00 ? 18 VAL A HA   5  
ATOM 4862  H HB   . VAL A 1 18 ? -2.518 5.230   16.467 1.00 0.00 ? 18 VAL A HB   5  
ATOM 4863  H HG11 . VAL A 1 18 ? -2.276 2.889   18.343 1.00 0.00 ? 18 VAL A HG11 5  
ATOM 4864  H HG12 . VAL A 1 18 ? -0.976 4.053   18.078 1.00 0.00 ? 18 VAL A HG12 5  
ATOM 4865  H HG13 . VAL A 1 18 ? -2.517 4.588   18.750 1.00 0.00 ? 18 VAL A HG13 5  
ATOM 4866  H HG21 . VAL A 1 18 ? -1.995 3.788   14.628 1.00 0.00 ? 18 VAL A HG21 5  
ATOM 4867  H HG22 . VAL A 1 18 ? -0.669 3.695   15.787 1.00 0.00 ? 18 VAL A HG22 5  
ATOM 4868  H HG23 . VAL A 1 18 ? -1.854 2.392   15.696 1.00 0.00 ? 18 VAL A HG23 5  
ATOM 4869  N N    . ASP A 1 19 ? -4.289 5.186   14.615 1.00 0.00 ? 19 ASP A N    5  
ATOM 4870  C CA   . ASP A 1 19 ? -4.695 5.553   13.263 1.00 0.00 ? 19 ASP A CA   5  
ATOM 4871  C C    . ASP A 1 19 ? -3.759 4.936   12.228 1.00 0.00 ? 19 ASP A C    5  
ATOM 4872  O O    . ASP A 1 19 ? -2.548 4.863   12.437 1.00 0.00 ? 19 ASP A O    5  
ATOM 4873  C CB   . ASP A 1 19 ? -4.714 7.074   13.108 1.00 0.00 ? 19 ASP A CB   5  
ATOM 4874  C CG   . ASP A 1 19 ? -5.769 7.543   12.126 1.00 0.00 ? 19 ASP A CG   5  
ATOM 4875  O OD1  . ASP A 1 19 ? -5.954 6.872   11.090 1.00 0.00 ? 19 ASP A OD1  5  
ATOM 4876  O OD2  . ASP A 1 19 ? -6.410 8.582   12.394 1.00 0.00 ? 19 ASP A OD2  5  
ATOM 4877  H H    . ASP A 1 19 ? -3.837 5.851   15.175 1.00 0.00 ? 19 ASP A H    5  
ATOM 4878  H HA   . ASP A 1 19 ? -5.692 5.171   13.101 1.00 0.00 ? 19 ASP A HA   5  
ATOM 4879  H HB2  . ASP A 1 19 ? -4.918 7.525   14.069 1.00 0.00 ? 19 ASP A HB2  5  
ATOM 4880  H HB3  . ASP A 1 19 ? -3.748 7.406   12.757 1.00 0.00 ? 19 ASP A HB3  5  
ATOM 4881  N N    . ALA A 1 20 ? -4.328 4.492   11.113 1.00 0.00 ? 20 ALA A N    5  
ATOM 4882  C CA   . ALA A 1 20 ? -3.545 3.882   10.045 1.00 0.00 ? 20 ALA A CA   5  
ATOM 4883  C C    . ALA A 1 20 ? -2.819 4.941   9.224  1.00 0.00 ? 20 ALA A C    5  
ATOM 4884  O O    . ALA A 1 20 ? -1.725 4.702   8.713  1.00 0.00 ? 20 ALA A O    5  
ATOM 4885  C CB   . ALA A 1 20 ? -4.440 3.038   9.150  1.00 0.00 ? 20 ALA A CB   5  
ATOM 4886  H H    . ALA A 1 20 ? -5.298 4.578   11.005 1.00 0.00 ? 20 ALA A H    5  
ATOM 4887  H HA   . ALA A 1 20 ? -2.814 3.229   10.500 1.00 0.00 ? 20 ALA A HA   5  
ATOM 4888  H HB1  . ALA A 1 20 ? -3.926 2.830   8.223  1.00 0.00 ? 20 ALA A HB1  5  
ATOM 4889  H HB2  . ALA A 1 20 ? -4.675 2.110   9.649  1.00 0.00 ? 20 ALA A HB2  5  
ATOM 4890  H HB3  . ALA A 1 20 ? -5.352 3.577   8.943  1.00 0.00 ? 20 ALA A HB3  5  
ATOM 4891  N N    . ASP A 1 21 ? -3.434 6.112   9.100  1.00 0.00 ? 21 ASP A N    5  
ATOM 4892  C CA   . ASP A 1 21 ? -2.846 7.209   8.340  1.00 0.00 ? 21 ASP A CA   5  
ATOM 4893  C C    . ASP A 1 21 ? -1.446 7.535   8.851  1.00 0.00 ? 21 ASP A C    5  
ATOM 4894  O O    . ASP A 1 21 ? -0.570 7.935   8.084  1.00 0.00 ? 21 ASP A O    5  
ATOM 4895  C CB   . ASP A 1 21 ? -3.735 8.450   8.423  1.00 0.00 ? 21 ASP A CB   5  
ATOM 4896  C CG   . ASP A 1 21 ? -3.226 9.586   7.557  1.00 0.00 ? 21 ASP A CG   5  
ATOM 4897  O OD1  . ASP A 1 21 ? -2.557 9.303   6.542  1.00 0.00 ? 21 ASP A OD1  5  
ATOM 4898  O OD2  . ASP A 1 21 ? -3.497 10.757  7.895  1.00 0.00 ? 21 ASP A OD2  5  
ATOM 4899  H H    . ASP A 1 21 ? -4.305 6.242   9.530  1.00 0.00 ? 21 ASP A H    5  
ATOM 4900  H HA   . ASP A 1 21 ? -2.775 6.897   7.309  1.00 0.00 ? 21 ASP A HA   5  
ATOM 4901  H HB2  . ASP A 1 21 ? -4.733 8.193   8.097  1.00 0.00 ? 21 ASP A HB2  5  
ATOM 4902  H HB3  . ASP A 1 21 ? -3.772 8.790   9.447  1.00 0.00 ? 21 ASP A HB3  5  
ATOM 4903  N N    . LYS A 1 22 ? -1.243 7.362   10.153 1.00 0.00 ? 22 LYS A N    5  
ATOM 4904  C CA   . LYS A 1 22 ? 0.050  7.637   10.769 1.00 0.00 ? 22 LYS A CA   5  
ATOM 4905  C C    . LYS A 1 22 ? 1.097  6.627   10.311 1.00 0.00 ? 22 LYS A C    5  
ATOM 4906  O O    . LYS A 1 22 ? 2.295  6.911   10.323 1.00 0.00 ? 22 LYS A O    5  
ATOM 4907  C CB   . LYS A 1 22 ? -0.072 7.606   12.294 1.00 0.00 ? 22 LYS A CB   5  
ATOM 4908  C CG   . LYS A 1 22 ? -0.795 8.810   12.872 1.00 0.00 ? 22 LYS A CG   5  
ATOM 4909  C CD   . LYS A 1 22 ? -0.341 9.106   14.291 1.00 0.00 ? 22 LYS A CD   5  
ATOM 4910  C CE   . LYS A 1 22 ? -0.766 10.497  14.734 1.00 0.00 ? 22 LYS A CE   5  
ATOM 4911  N NZ   . LYS A 1 22 ? 0.027  10.974  15.901 1.00 0.00 ? 22 LYS A NZ   5  
ATOM 4912  H H    . LYS A 1 22 ? -1.980 7.040   10.713 1.00 0.00 ? 22 LYS A H    5  
ATOM 4913  H HA   . LYS A 1 22 ? 0.361  8.624   10.461 1.00 0.00 ? 22 LYS A HA   5  
ATOM 4914  H HB2  . LYS A 1 22 ? -0.611 6.716   12.582 1.00 0.00 ? 22 LYS A HB2  5  
ATOM 4915  H HB3  . LYS A 1 22 ? 0.920  7.569   12.722 1.00 0.00 ? 22 LYS A HB3  5  
ATOM 4916  H HG2  . LYS A 1 22 ? -0.592 9.672   12.253 1.00 0.00 ? 22 LYS A HG2  5  
ATOM 4917  H HG3  . LYS A 1 22 ? -1.858 8.611   12.877 1.00 0.00 ? 22 LYS A HG3  5  
ATOM 4918  H HD2  . LYS A 1 22 ? -0.778 8.379   14.959 1.00 0.00 ? 22 LYS A HD2  5  
ATOM 4919  H HD3  . LYS A 1 22 ? 0.737  9.036   14.337 1.00 0.00 ? 22 LYS A HD3  5  
ATOM 4920  H HE2  . LYS A 1 22 ? -0.625 11.181  13.911 1.00 0.00 ? 22 LYS A HE2  5  
ATOM 4921  H HE3  . LYS A 1 22 ? -1.811 10.471  15.005 1.00 0.00 ? 22 LYS A HE3  5  
ATOM 4922  H HZ1  . LYS A 1 22 ? 0.980  10.559  15.879 1.00 0.00 ? 22 LYS A HZ1  5  
ATOM 4923  H HZ2  . LYS A 1 22 ? -0.440 10.695  16.788 1.00 0.00 ? 22 LYS A HZ2  5  
ATOM 4924  H HZ3  . LYS A 1 22 ? 0.110  12.010  15.877 1.00 0.00 ? 22 LYS A HZ3  5  
ATOM 4925  N N    . VAL A 1 23 ? 0.638  5.447   9.906  1.00 0.00 ? 23 VAL A N    5  
ATOM 4926  C CA   . VAL A 1 23 ? 1.535  4.396   9.441  1.00 0.00 ? 23 VAL A CA   5  
ATOM 4927  C C    . VAL A 1 23 ? 2.308  4.840   8.205  1.00 0.00 ? 23 VAL A C    5  
ATOM 4928  O O    . VAL A 1 23 ? 1.822  4.726   7.079  1.00 0.00 ? 23 VAL A O    5  
ATOM 4929  C CB   . VAL A 1 23 ? 0.763  3.104   9.114  1.00 0.00 ? 23 VAL A CB   5  
ATOM 4930  C CG1  . VAL A 1 23 ? 1.719  2.012   8.659  1.00 0.00 ? 23 VAL A CG1  5  
ATOM 4931  C CG2  . VAL A 1 23 ? -0.047 2.648   10.318 1.00 0.00 ? 23 VAL A CG2  5  
ATOM 4932  H H    . VAL A 1 23 ? -0.328 5.281   9.919  1.00 0.00 ? 23 VAL A H    5  
ATOM 4933  H HA   . VAL A 1 23 ? 2.236  4.181   10.234 1.00 0.00 ? 23 VAL A HA   5  
ATOM 4934  H HB   . VAL A 1 23 ? 0.079  3.313   8.304  1.00 0.00 ? 23 VAL A HB   5  
ATOM 4935  H HG11 . VAL A 1 23 ? 1.659  1.906   7.586  1.00 0.00 ? 23 VAL A HG11 5  
ATOM 4936  H HG12 . VAL A 1 23 ? 2.728  2.275   8.941  1.00 0.00 ? 23 VAL A HG12 5  
ATOM 4937  H HG13 . VAL A 1 23 ? 1.446  1.077   9.128  1.00 0.00 ? 23 VAL A HG13 5  
ATOM 4938  H HG21 . VAL A 1 23 ? 0.622  2.419   11.134 1.00 0.00 ? 23 VAL A HG21 5  
ATOM 4939  H HG22 . VAL A 1 23 ? -0.723 3.436   10.617 1.00 0.00 ? 23 VAL A HG22 5  
ATOM 4940  H HG23 . VAL A 1 23 ? -0.614 1.767   10.058 1.00 0.00 ? 23 VAL A HG23 5  
ATOM 4941  N N    . THR A 1 24 ? 3.517  5.349   8.421  1.00 0.00 ? 24 THR A N    5  
ATOM 4942  C CA   . THR A 1 24 ? 4.359  5.811   7.324  1.00 0.00 ? 24 THR A CA   5  
ATOM 4943  C C    . THR A 1 24 ? 5.718  5.122   7.346  1.00 0.00 ? 24 THR A C    5  
ATOM 4944  O O    . THR A 1 24 ? 6.203  4.720   8.403  1.00 0.00 ? 24 THR A O    5  
ATOM 4945  C CB   . THR A 1 24 ? 4.568  7.336   7.382  1.00 0.00 ? 24 THR A CB   5  
ATOM 4946  O OG1  . THR A 1 24 ? 5.437  7.671   8.470  1.00 0.00 ? 24 THR A OG1  5  
ATOM 4947  C CG2  . THR A 1 24 ? 3.240  8.059   7.546  1.00 0.00 ? 24 THR A CG2  5  
ATOM 4948  H H    . THR A 1 24 ? 3.850  5.414   9.340  1.00 0.00 ? 24 THR A H    5  
ATOM 4949  H HA   . THR A 1 24 ? 3.860  5.572   6.397  1.00 0.00 ? 24 THR A HA   5  
ATOM 4950  H HB   . THR A 1 24 ? 5.024  7.657   6.456  1.00 0.00 ? 24 THR A HB   5  
ATOM 4951  H HG1  . THR A 1 24 ? 4.918  7.793   9.268  1.00 0.00 ? 24 THR A HG1  5  
ATOM 4952  H HG21 . THR A 1 24 ? 3.208  8.909   6.881  1.00 0.00 ? 24 THR A HG21 5  
ATOM 4953  H HG22 . THR A 1 24 ? 3.138  8.396   8.567  1.00 0.00 ? 24 THR A HG22 5  
ATOM 4954  H HG23 . THR A 1 24 ? 2.432  7.385   7.307  1.00 0.00 ? 24 THR A HG23 5  
ATOM 4955  N N    . GLU A 1 25 ? 6.328  4.989   6.172  1.00 0.00 ? 25 GLU A N    5  
ATOM 4956  C CA   . GLU A 1 25 ? 7.633  4.347   6.059  1.00 0.00 ? 25 GLU A CA   5  
ATOM 4957  C C    . GLU A 1 25 ? 8.632  4.969   7.030  1.00 0.00 ? 25 GLU A C    5  
ATOM 4958  O O    . GLU A 1 25 ? 9.509  4.287   7.558  1.00 0.00 ? 25 GLU A O    5  
ATOM 4959  C CB   . GLU A 1 25 ? 8.159  4.461   4.626  1.00 0.00 ? 25 GLU A CB   5  
ATOM 4960  C CG   . GLU A 1 25 ? 7.587  3.417   3.683  1.00 0.00 ? 25 GLU A CG   5  
ATOM 4961  C CD   . GLU A 1 25 ? 7.804  3.767   2.224  1.00 0.00 ? 25 GLU A CD   5  
ATOM 4962  O OE1  . GLU A 1 25 ? 7.508  4.918   1.839  1.00 0.00 ? 25 GLU A OE1  5  
ATOM 4963  O OE2  . GLU A 1 25 ? 8.271  2.891   1.466  1.00 0.00 ? 25 GLU A OE2  5  
ATOM 4964  H H    . GLU A 1 25 ? 5.891  5.330   5.365  1.00 0.00 ? 25 GLU A H    5  
ATOM 4965  H HA   . GLU A 1 25 ? 7.512  3.303   6.305  1.00 0.00 ? 25 GLU A HA   5  
ATOM 4966  H HB2  . GLU A 1 25 ? 7.911  5.440   4.241  1.00 0.00 ? 25 GLU A HB2  5  
ATOM 4967  H HB3  . GLU A 1 25 ? 9.233  4.353   4.641  1.00 0.00 ? 25 GLU A HB3  5  
ATOM 4968  H HG2  . GLU A 1 25 ? 8.064  2.469   3.884  1.00 0.00 ? 25 GLU A HG2  5  
ATOM 4969  H HG3  . GLU A 1 25 ? 6.526  3.330   3.863  1.00 0.00 ? 25 GLU A HG3  5  
ATOM 4970  N N    . GLY A 1 26 ? 8.492  6.272   7.261  1.00 0.00 ? 26 GLY A N    5  
ATOM 4971  C CA   . GLY A 1 26 ? 9.389  6.965   8.167  1.00 0.00 ? 26 GLY A CA   5  
ATOM 4972  C C    . GLY A 1 26 ? 8.783  7.163   9.543  1.00 0.00 ? 26 GLY A C    5  
ATOM 4973  O O    . GLY A 1 26 ? 9.062  8.156   10.213 1.00 0.00 ? 26 GLY A O    5  
ATOM 4974  H H    . GLY A 1 26 ? 7.774  6.765   6.811  1.00 0.00 ? 26 GLY A H    5  
ATOM 4975  H HA2  . GLY A 1 26 ? 10.298 6.392   8.265  1.00 0.00 ? 26 GLY A HA2  5  
ATOM 4976  H HA3  . GLY A 1 26 ? 9.627  7.932   7.749  1.00 0.00 ? 26 GLY A HA3  5  
ATOM 4977  N N    . ALA A 1 27 ? 7.951  6.216   9.963  1.00 0.00 ? 27 ALA A N    5  
ATOM 4978  C CA   . ALA A 1 27 ? 7.305  6.291   11.267 1.00 0.00 ? 27 ALA A CA   5  
ATOM 4979  C C    . ALA A 1 27 ? 8.000  5.385   12.278 1.00 0.00 ? 27 ALA A C    5  
ATOM 4980  O O    . ALA A 1 27 ? 7.943  4.160   12.169 1.00 0.00 ? 27 ALA A O    5  
ATOM 4981  C CB   . ALA A 1 27 ? 5.833  5.922   11.149 1.00 0.00 ? 27 ALA A CB   5  
ATOM 4982  H H    . ALA A 1 27 ? 7.768  5.448   9.383  1.00 0.00 ? 27 ALA A H    5  
ATOM 4983  H HA   . ALA A 1 27 ? 7.368  7.313   11.613 1.00 0.00 ? 27 ALA A HA   5  
ATOM 4984  H HB1  . ALA A 1 27 ? 5.252  6.550   11.809 1.00 0.00 ? 27 ALA A HB1  5  
ATOM 4985  H HB2  . ALA A 1 27 ? 5.506  6.069   10.131 1.00 0.00 ? 27 ALA A HB2  5  
ATOM 4986  H HB3  . ALA A 1 27 ? 5.699  4.887   11.426 1.00 0.00 ? 27 ALA A HB3  5  
ATOM 4987  N N    . SER A 1 28 ? 8.656  5.995   13.260 1.00 0.00 ? 28 SER A N    5  
ATOM 4988  C CA   . SER A 1 28 ? 9.366  5.242   14.287 1.00 0.00 ? 28 SER A CA   5  
ATOM 4989  C C    . SER A 1 28 ? 8.442  4.913   15.455 1.00 0.00 ? 28 SER A C    5  
ATOM 4990  O O    . SER A 1 28 ? 7.952  5.806   16.146 1.00 0.00 ? 28 SER A O    5  
ATOM 4991  C CB   . SER A 1 28 ? 10.575 6.036   14.786 1.00 0.00 ? 28 SER A CB   5  
ATOM 4992  O OG   . SER A 1 28 ? 10.168 7.160   15.547 1.00 0.00 ? 28 SER A OG   5  
ATOM 4993  H H    . SER A 1 28 ? 8.665  6.974   13.292 1.00 0.00 ? 28 SER A H    5  
ATOM 4994  H HA   . SER A 1 28 ? 9.710  4.320   13.844 1.00 0.00 ? 28 SER A HA   5  
ATOM 4995  H HB2  . SER A 1 28 ? 11.189 5.400   15.406 1.00 0.00 ? 28 SER A HB2  5  
ATOM 4996  H HB3  . SER A 1 28 ? 11.152 6.378   13.939 1.00 0.00 ? 28 SER A HB3  5  
ATOM 4997  H HG   . SER A 1 28 ? 9.917  7.873   14.955 1.00 0.00 ? 28 SER A HG   5  
ATOM 4998  N N    . PHE A 1 29 ? 8.209  3.622   15.671 1.00 0.00 ? 29 PHE A N    5  
ATOM 4999  C CA   . PHE A 1 29 ? 7.343  3.172   16.755 1.00 0.00 ? 29 PHE A CA   5  
ATOM 5000  C C    . PHE A 1 29 ? 7.912  3.582   18.110 1.00 0.00 ? 29 PHE A C    5  
ATOM 5001  O O    . PHE A 1 29 ? 7.223  3.519   19.129 1.00 0.00 ? 29 PHE A O    5  
ATOM 5002  C CB   . PHE A 1 29 ? 7.169  1.653   16.700 1.00 0.00 ? 29 PHE A CB   5  
ATOM 5003  C CG   . PHE A 1 29 ? 6.861  1.135   15.324 1.00 0.00 ? 29 PHE A CG   5  
ATOM 5004  C CD1  . PHE A 1 29 ? 5.571  1.187   14.823 1.00 0.00 ? 29 PHE A CD1  5  
ATOM 5005  C CD2  . PHE A 1 29 ? 7.862  0.594   14.533 1.00 0.00 ? 29 PHE A CD2  5  
ATOM 5006  C CE1  . PHE A 1 29 ? 5.284  0.711   13.557 1.00 0.00 ? 29 PHE A CE1  5  
ATOM 5007  C CE2  . PHE A 1 29 ? 7.581  0.117   13.267 1.00 0.00 ? 29 PHE A CE2  5  
ATOM 5008  C CZ   . PHE A 1 29 ? 6.290  0.174   12.779 1.00 0.00 ? 29 PHE A CZ   5  
ATOM 5009  H H    . PHE A 1 29 ? 8.629  2.956   15.087 1.00 0.00 ? 29 PHE A H    5  
ATOM 5010  H HA   . PHE A 1 29 ? 6.381  3.642   16.625 1.00 0.00 ? 29 PHE A HA   5  
ATOM 5011  H HB2  . PHE A 1 29 ? 8.080  1.181   17.036 1.00 0.00 ? 29 PHE A HB2  5  
ATOM 5012  H HB3  . PHE A 1 29 ? 6.358  1.368   17.353 1.00 0.00 ? 29 PHE A HB3  5  
ATOM 5013  H HD1  . PHE A 1 29 ? 4.782  1.607   15.431 1.00 0.00 ? 29 PHE A HD1  5  
ATOM 5014  H HD2  . PHE A 1 29 ? 8.872  0.548   14.914 1.00 0.00 ? 29 PHE A HD2  5  
ATOM 5015  H HE1  . PHE A 1 29 ? 4.273  0.757   13.179 1.00 0.00 ? 29 PHE A HE1  5  
ATOM 5016  H HE2  . PHE A 1 29 ? 8.370  -0.302  12.660 1.00 0.00 ? 29 PHE A HE2  5  
ATOM 5017  H HZ   . PHE A 1 29 ? 6.069  -0.198  11.790 1.00 0.00 ? 29 PHE A HZ   5  
ATOM 5018  N N    . ILE A 1 30 ? 9.173  4.000   18.114 1.00 0.00 ? 30 ILE A N    5  
ATOM 5019  C CA   . ILE A 1 30 ? 9.834  4.420   19.344 1.00 0.00 ? 30 ILE A CA   5  
ATOM 5020  C C    . ILE A 1 30 ? 9.531  5.881   19.660 1.00 0.00 ? 30 ILE A C    5  
ATOM 5021  O O    . ILE A 1 30 ? 9.077  6.208   20.757 1.00 0.00 ? 30 ILE A O    5  
ATOM 5022  C CB   . ILE A 1 30 ? 11.360 4.232   19.255 1.00 0.00 ? 30 ILE A CB   5  
ATOM 5023  C CG1  . ILE A 1 30 ? 11.702 2.757   19.036 1.00 0.00 ? 30 ILE A CG1  5  
ATOM 5024  C CG2  . ILE A 1 30 ? 12.033 4.756   20.515 1.00 0.00 ? 30 ILE A CG2  5  
ATOM 5025  C CD1  . ILE A 1 30 ? 11.168 1.845   20.118 1.00 0.00 ? 30 ILE A CD1  5  
ATOM 5026  H H    . ILE A 1 30 ? 9.670  4.028   17.271 1.00 0.00 ? 30 ILE A H    5  
ATOM 5027  H HA   . ILE A 1 30 ? 9.462  3.804   20.149 1.00 0.00 ? 30 ILE A HA   5  
ATOM 5028  H HB   . ILE A 1 30 ? 11.723 4.807   18.417 1.00 0.00 ? 30 ILE A HB   5  
ATOM 5029  H HG12 . ILE A 1 30 ? 11.286 2.433   18.095 1.00 0.00 ? 30 ILE A HG12 5  
ATOM 5030  H HG13 . ILE A 1 30 ? 12.776 2.645   19.007 1.00 0.00 ? 30 ILE A HG13 5  
ATOM 5031  H HG21 . ILE A 1 30 ? 12.639 5.615   20.269 1.00 0.00 ? 30 ILE A HG21 5  
ATOM 5032  H HG22 . ILE A 1 30 ? 11.278 5.042   21.233 1.00 0.00 ? 30 ILE A HG22 5  
ATOM 5033  H HG23 . ILE A 1 30 ? 12.658 3.984   20.938 1.00 0.00 ? 30 ILE A HG23 5  
ATOM 5034  H HD11 . ILE A 1 30 ? 11.977 1.258   20.527 1.00 0.00 ? 30 ILE A HD11 5  
ATOM 5035  H HD12 . ILE A 1 30 ? 10.721 2.439   20.901 1.00 0.00 ? 30 ILE A HD12 5  
ATOM 5036  H HD13 . ILE A 1 30 ? 10.422 1.186   19.697 1.00 0.00 ? 30 ILE A HD13 5  
ATOM 5037  N N    . ASP A 1 31 ? 9.782  6.754   18.691 1.00 0.00 ? 31 ASP A N    5  
ATOM 5038  C CA   . ASP A 1 31 ? 9.533  8.181   18.864 1.00 0.00 ? 31 ASP A CA   5  
ATOM 5039  C C    . ASP A 1 31 ? 8.159  8.562   18.322 1.00 0.00 ? 31 ASP A C    5  
ATOM 5040  O O    . ASP A 1 31 ? 7.301  9.044   19.062 1.00 0.00 ? 31 ASP A O    5  
ATOM 5041  C CB   . ASP A 1 31 ? 10.618 8.998   18.161 1.00 0.00 ? 31 ASP A CB   5  
ATOM 5042  C CG   . ASP A 1 31 ? 10.756 10.394  18.738 1.00 0.00 ? 31 ASP A CG   5  
ATOM 5043  O OD1  . ASP A 1 31 ? 10.764 10.524  19.980 1.00 0.00 ? 31 ASP A OD1  5  
ATOM 5044  O OD2  . ASP A 1 31 ? 10.856 11.356  17.948 1.00 0.00 ? 31 ASP A OD2  5  
ATOM 5045  H H    . ASP A 1 31 ? 10.143 6.432   17.839 1.00 0.00 ? 31 ASP A H    5  
ATOM 5046  H HA   . ASP A 1 31 ? 9.562  8.396   19.922 1.00 0.00 ? 31 ASP A HA   5  
ATOM 5047  H HB2  . ASP A 1 31 ? 11.566 8.491   18.265 1.00 0.00 ? 31 ASP A HB2  5  
ATOM 5048  H HB3  . ASP A 1 31 ? 10.372 9.084   17.113 1.00 0.00 ? 31 ASP A HB3  5  
ATOM 5049  N N    . ASP A 1 32 ? 7.959  8.345   17.027 1.00 0.00 ? 32 ASP A N    5  
ATOM 5050  C CA   . ASP A 1 32 ? 6.689  8.666   16.385 1.00 0.00 ? 32 ASP A CA   5  
ATOM 5051  C C    . ASP A 1 32 ? 5.515  8.240   17.261 1.00 0.00 ? 32 ASP A C    5  
ATOM 5052  O O    . ASP A 1 32 ? 4.535  8.972   17.402 1.00 0.00 ? 32 ASP A O    5  
ATOM 5053  C CB   . ASP A 1 32 ? 6.597  7.984   15.020 1.00 0.00 ? 32 ASP A CB   5  
ATOM 5054  C CG   . ASP A 1 32 ? 5.658  8.706   14.074 1.00 0.00 ? 32 ASP A CG   5  
ATOM 5055  O OD1  . ASP A 1 32 ? 4.431  8.650   14.300 1.00 0.00 ? 32 ASP A OD1  5  
ATOM 5056  O OD2  . ASP A 1 32 ? 6.149  9.327   13.108 1.00 0.00 ? 32 ASP A OD2  5  
ATOM 5057  H H    . ASP A 1 32 ? 8.682  7.958   16.490 1.00 0.00 ? 32 ASP A H    5  
ATOM 5058  H HA   . ASP A 1 32 ? 6.649  9.736   16.247 1.00 0.00 ? 32 ASP A HA   5  
ATOM 5059  H HB2  . ASP A 1 32 ? 7.579  7.957   14.570 1.00 0.00 ? 32 ASP A HB2  5  
ATOM 5060  H HB3  . ASP A 1 32 ? 6.239  6.974   15.153 1.00 0.00 ? 32 ASP A HB3  5  
ATOM 5061  N N    . LEU A 1 33 ? 5.620  7.052   17.846 1.00 0.00 ? 33 LEU A N    5  
ATOM 5062  C CA   . LEU A 1 33 ? 4.566  6.527   18.707 1.00 0.00 ? 33 LEU A CA   5  
ATOM 5063  C C    . LEU A 1 33 ? 4.915  6.728   20.178 1.00 0.00 ? 33 LEU A C    5  
ATOM 5064  O O    . LEU A 1 33 ? 4.050  6.643   21.049 1.00 0.00 ? 33 LEU A O    5  
ATOM 5065  C CB   . LEU A 1 33 ? 4.340  5.041   18.423 1.00 0.00 ? 33 LEU A CB   5  
ATOM 5066  C CG   . LEU A 1 33 ? 3.940  4.685   16.991 1.00 0.00 ? 33 LEU A CG   5  
ATOM 5067  C CD1  . LEU A 1 33 ? 3.440  3.251   16.917 1.00 0.00 ? 33 LEU A CD1  5  
ATOM 5068  C CD2  . LEU A 1 33 ? 2.879  5.649   16.479 1.00 0.00 ? 33 LEU A CD2  5  
ATOM 5069  H H    . LEU A 1 33 ? 6.425  6.514   17.695 1.00 0.00 ? 33 LEU A H    5  
ATOM 5070  H HA   . LEU A 1 33 ? 3.658  7.069   18.488 1.00 0.00 ? 33 LEU A HA   5  
ATOM 5071  H HB2  . LEU A 1 33 ? 5.257  4.518   18.649 1.00 0.00 ? 33 LEU A HB2  5  
ATOM 5072  H HB3  . LEU A 1 33 ? 3.558  4.694   19.082 1.00 0.00 ? 33 LEU A HB3  5  
ATOM 5073  H HG   . LEU A 1 33 ? 4.807  4.769   16.350 1.00 0.00 ? 33 LEU A HG   5  
ATOM 5074  H HD11 . LEU A 1 33 ? 4.143  2.599   17.413 1.00 0.00 ? 33 LEU A HD11 5  
ATOM 5075  H HD12 . LEU A 1 33 ? 3.343  2.956   15.883 1.00 0.00 ? 33 LEU A HD12 5  
ATOM 5076  H HD13 . LEU A 1 33 ? 2.477  3.180   17.403 1.00 0.00 ? 33 LEU A HD13 5  
ATOM 5077  H HD21 . LEU A 1 33 ? 2.364  6.095   17.317 1.00 0.00 ? 33 LEU A HD21 5  
ATOM 5078  H HD22 . LEU A 1 33 ? 2.170  5.111   15.866 1.00 0.00 ? 33 LEU A HD22 5  
ATOM 5079  H HD23 . LEU A 1 33 ? 3.349  6.423   15.891 1.00 0.00 ? 33 LEU A HD23 5  
ATOM 5080  N N    . GLY A 1 34 ? 6.189  6.997   20.448 1.00 0.00 ? 34 GLY A N    5  
ATOM 5081  C CA   . GLY A 1 34 ? 6.630  7.207   21.815 1.00 0.00 ? 34 GLY A CA   5  
ATOM 5082  C C    . GLY A 1 34 ? 6.655  5.923   22.620 1.00 0.00 ? 34 GLY A C    5  
ATOM 5083  O O    . GLY A 1 34 ? 6.334  5.922   23.808 1.00 0.00 ? 34 GLY A O    5  
ATOM 5084  H H    . GLY A 1 34 ? 6.835  7.052   19.713 1.00 0.00 ? 34 GLY A H    5  
ATOM 5085  H HA2  . GLY A 1 34 ? 7.623  7.631   21.800 1.00 0.00 ? 34 GLY A HA2  5  
ATOM 5086  H HA3  . GLY A 1 34 ? 5.959  7.905   22.293 1.00 0.00 ? 34 GLY A HA3  5  
ATOM 5087  N N    . ALA A 1 35 ? 7.037  4.828   21.972 1.00 0.00 ? 35 ALA A N    5  
ATOM 5088  C CA   . ALA A 1 35 ? 7.104  3.532   22.636 1.00 0.00 ? 35 ALA A CA   5  
ATOM 5089  C C    . ALA A 1 35 ? 8.533  3.200   23.051 1.00 0.00 ? 35 ALA A C    5  
ATOM 5090  O O    . ALA A 1 35 ? 9.474  3.910   22.694 1.00 0.00 ? 35 ALA A O    5  
ATOM 5091  C CB   . ALA A 1 35 ? 6.550  2.444   21.727 1.00 0.00 ? 35 ALA A CB   5  
ATOM 5092  H H    . ALA A 1 35 ? 7.281  4.893   21.025 1.00 0.00 ? 35 ALA A H    5  
ATOM 5093  H HA   . ALA A 1 35 ? 6.484  3.578   23.520 1.00 0.00 ? 35 ALA A HA   5  
ATOM 5094  H HB1  . ALA A 1 35 ? 5.854  2.882   21.026 1.00 0.00 ? 35 ALA A HB1  5  
ATOM 5095  H HB2  . ALA A 1 35 ? 7.361  1.979   21.187 1.00 0.00 ? 35 ALA A HB2  5  
ATOM 5096  H HB3  . ALA A 1 35 ? 6.041  1.702   22.323 1.00 0.00 ? 35 ALA A HB3  5  
ATOM 5097  N N    . ASP A 1 36 ? 8.689  2.118   23.806 1.00 0.00 ? 36 ASP A N    5  
ATOM 5098  C CA   . ASP A 1 36 ? 10.005 1.692   24.269 1.00 0.00 ? 36 ASP A CA   5  
ATOM 5099  C C    . ASP A 1 36 ? 10.467 0.446   23.521 1.00 0.00 ? 36 ASP A C    5  
ATOM 5100  O O    . ASP A 1 36 ? 9.730  -0.111  22.707 1.00 0.00 ? 36 ASP A O    5  
ATOM 5101  C CB   . ASP A 1 36 ? 9.975  1.418   25.773 1.00 0.00 ? 36 ASP A CB   5  
ATOM 5102  C CG   . ASP A 1 36 ? 9.718  2.672   26.586 1.00 0.00 ? 36 ASP A CG   5  
ATOM 5103  O OD1  . ASP A 1 36 ? 10.517 3.625   26.473 1.00 0.00 ? 36 ASP A OD1  5  
ATOM 5104  O OD2  . ASP A 1 36 ? 8.719  2.700   27.334 1.00 0.00 ? 36 ASP A OD2  5  
ATOM 5105  H H    . ASP A 1 36 ? 7.900  1.593   24.057 1.00 0.00 ? 36 ASP A H    5  
ATOM 5106  H HA   . ASP A 1 36 ? 10.701 2.493   24.072 1.00 0.00 ? 36 ASP A HA   5  
ATOM 5107  H HB2  . ASP A 1 36 ? 9.191  0.706   25.987 1.00 0.00 ? 36 ASP A HB2  5  
ATOM 5108  H HB3  . ASP A 1 36 ? 10.925 1.003   26.076 1.00 0.00 ? 36 ASP A HB3  5  
ATOM 5109  N N    . SER A 1 37 ? 11.692 0.013   23.802 1.00 0.00 ? 37 SER A N    5  
ATOM 5110  C CA   . SER A 1 37 ? 12.254 -1.165  23.152 1.00 0.00 ? 37 SER A CA   5  
ATOM 5111  C C    . SER A 1 37 ? 11.306 -2.354  23.268 1.00 0.00 ? 37 SER A C    5  
ATOM 5112  O O    . SER A 1 37 ? 11.234 -3.195  22.371 1.00 0.00 ? 37 SER A O    5  
ATOM 5113  C CB   . SER A 1 37 ? 13.609 -1.516  23.770 1.00 0.00 ? 37 SER A CB   5  
ATOM 5114  O OG   . SER A 1 37 ? 14.042 -2.800  23.355 1.00 0.00 ? 37 SER A OG   5  
ATOM 5115  H H    . SER A 1 37 ? 12.231 0.500   24.460 1.00 0.00 ? 37 SER A H    5  
ATOM 5116  H HA   . SER A 1 37 ? 12.395 -0.931  22.107 1.00 0.00 ? 37 SER A HA   5  
ATOM 5117  H HB2  . SER A 1 37 ? 14.342 -0.786  23.463 1.00 0.00 ? 37 SER A HB2  5  
ATOM 5118  H HB3  . SER A 1 37 ? 13.523 -1.509  24.847 1.00 0.00 ? 37 SER A HB3  5  
ATOM 5119  H HG   . SER A 1 37 ? 14.474 -3.245  24.088 1.00 0.00 ? 37 SER A HG   5  
ATOM 5120  N N    . LEU A 1 38 ? 10.580 -2.417  24.379 1.00 0.00 ? 38 LEU A N    5  
ATOM 5121  C CA   . LEU A 1 38 ? 9.635  -3.503  24.614 1.00 0.00 ? 38 LEU A CA   5  
ATOM 5122  C C    . LEU A 1 38 ? 8.685  -3.664  23.432 1.00 0.00 ? 38 LEU A C    5  
ATOM 5123  O O    . LEU A 1 38 ? 8.599  -4.736  22.833 1.00 0.00 ? 38 LEU A O    5  
ATOM 5124  C CB   . LEU A 1 38 ? 8.837  -3.243  25.893 1.00 0.00 ? 38 LEU A CB   5  
ATOM 5125  C CG   . LEU A 1 38 ? 9.655  -3.094  27.176 1.00 0.00 ? 38 LEU A CG   5  
ATOM 5126  C CD1  . LEU A 1 38 ? 8.783  -2.571  28.307 1.00 0.00 ? 38 LEU A CD1  5  
ATOM 5127  C CD2  . LEU A 1 38 ? 10.289 -4.423  27.561 1.00 0.00 ? 38 LEU A CD2  5  
ATOM 5128  H H    . LEU A 1 38 ? 10.681 -1.718  25.057 1.00 0.00 ? 38 LEU A H    5  
ATOM 5129  H HA   . LEU A 1 38 ? 10.201 -4.415  24.732 1.00 0.00 ? 38 LEU A HA   5  
ATOM 5130  H HB2  . LEU A 1 38 ? 8.275  -2.333  25.752 1.00 0.00 ? 38 LEU A HB2  5  
ATOM 5131  H HB3  . LEU A 1 38 ? 8.153  -4.069  26.029 1.00 0.00 ? 38 LEU A HB3  5  
ATOM 5132  H HG   . LEU A 1 38 ? 10.449 -2.379  27.009 1.00 0.00 ? 38 LEU A HG   5  
ATOM 5133  H HD11 . LEU A 1 38 ? 8.183  -3.376  28.702 1.00 0.00 ? 38 LEU A HD11 5  
ATOM 5134  H HD12 . LEU A 1 38 ? 8.137  -1.791  27.932 1.00 0.00 ? 38 LEU A HD12 5  
ATOM 5135  H HD13 . LEU A 1 38 ? 9.411  -2.171  29.090 1.00 0.00 ? 38 LEU A HD13 5  
ATOM 5136  H HD21 . LEU A 1 38 ? 9.637  -4.949  28.242 1.00 0.00 ? 38 LEU A HD21 5  
ATOM 5137  H HD22 . LEU A 1 38 ? 11.240 -4.242  28.041 1.00 0.00 ? 38 LEU A HD22 5  
ATOM 5138  H HD23 . LEU A 1 38 ? 10.441 -5.019  26.674 1.00 0.00 ? 38 LEU A HD23 5  
ATOM 5139  N N    . ASP A 1 39 ? 7.975  -2.592  23.100 1.00 0.00 ? 39 ASP A N    5  
ATOM 5140  C CA   . ASP A 1 39 ? 7.033  -2.612  21.987 1.00 0.00 ? 39 ASP A CA   5  
ATOM 5141  C C    . ASP A 1 39 ? 7.718  -3.074  20.704 1.00 0.00 ? 39 ASP A C    5  
ATOM 5142  O O    . ASP A 1 39 ? 7.166  -3.872  19.945 1.00 0.00 ? 39 ASP A O    5  
ATOM 5143  C CB   . ASP A 1 39 ? 6.422  -1.225  21.782 1.00 0.00 ? 39 ASP A CB   5  
ATOM 5144  C CG   . ASP A 1 39 ? 4.911  -1.270  21.665 1.00 0.00 ? 39 ASP A CG   5  
ATOM 5145  O OD1  . ASP A 1 39 ? 4.411  -1.715  20.611 1.00 0.00 ? 39 ASP A OD1  5  
ATOM 5146  O OD2  . ASP A 1 39 ? 4.228  -0.860  22.628 1.00 0.00 ? 39 ASP A OD2  5  
ATOM 5147  H H    . ASP A 1 39 ? 8.087  -1.766  23.616 1.00 0.00 ? 39 ASP A H    5  
ATOM 5148  H HA   . ASP A 1 39 ? 6.246  -3.310  22.231 1.00 0.00 ? 39 ASP A HA   5  
ATOM 5149  H HB2  . ASP A 1 39 ? 6.680  -0.597  22.623 1.00 0.00 ? 39 ASP A HB2  5  
ATOM 5150  H HB3  . ASP A 1 39 ? 6.822  -0.792  20.878 1.00 0.00 ? 39 ASP A HB3  5  
ATOM 5151  N N    . THR A 1 40 ? 8.924  -2.567  20.468 1.00 0.00 ? 40 THR A N    5  
ATOM 5152  C CA   . THR A 1 40 ? 9.683  -2.926  19.276 1.00 0.00 ? 40 THR A CA   5  
ATOM 5153  C C    . THR A 1 40 ? 9.847  -4.437  19.163 1.00 0.00 ? 40 THR A C    5  
ATOM 5154  O O    . THR A 1 40 ? 9.401  -5.049  18.192 1.00 0.00 ? 40 THR A O    5  
ATOM 5155  C CB   . THR A 1 40 ? 11.076 -2.268  19.279 1.00 0.00 ? 40 THR A CB   5  
ATOM 5156  O OG1  . THR A 1 40 ? 11.041 -1.050  20.031 1.00 0.00 ? 40 THR A OG1  5  
ATOM 5157  C CG2  . THR A 1 40 ? 11.542 -1.981  17.860 1.00 0.00 ? 40 THR A CG2  5  
ATOM 5158  H H    . THR A 1 40 ? 9.310  -1.937  21.110 1.00 0.00 ? 40 THR A H    5  
ATOM 5159  H HA   . THR A 1 40 ? 9.140  -2.566  18.414 1.00 0.00 ? 40 THR A HA   5  
ATOM 5160  H HB   . THR A 1 40 ? 11.777 -2.948  19.742 1.00 0.00 ? 40 THR A HB   5  
ATOM 5161  H HG1  . THR A 1 40 ? 11.936 -0.724  20.154 1.00 0.00 ? 40 THR A HG1  5  
ATOM 5162  H HG21 . THR A 1 40 ? 12.617 -2.064  17.810 1.00 0.00 ? 40 THR A HG21 5  
ATOM 5163  H HG22 . THR A 1 40 ? 11.244 -0.981  17.579 1.00 0.00 ? 40 THR A HG22 5  
ATOM 5164  H HG23 . THR A 1 40 ? 11.094 -2.693  17.183 1.00 0.00 ? 40 THR A HG23 5  
ATOM 5165  N N    . VAL A 1 41 ? 10.489 -5.034  20.161 1.00 0.00 ? 41 VAL A N    5  
ATOM 5166  C CA   . VAL A 1 41 ? 10.711 -6.475  20.174 1.00 0.00 ? 41 VAL A CA   5  
ATOM 5167  C C    . VAL A 1 41 ? 9.389  -7.235  20.144 1.00 0.00 ? 41 VAL A C    5  
ATOM 5168  O O    . VAL A 1 41 ? 9.313  -8.347  19.624 1.00 0.00 ? 41 VAL A O    5  
ATOM 5169  C CB   . VAL A 1 41 ? 11.511 -6.909  21.417 1.00 0.00 ? 41 VAL A CB   5  
ATOM 5170  C CG1  . VAL A 1 41 ? 11.759 -8.410  21.395 1.00 0.00 ? 41 VAL A CG1  5  
ATOM 5171  C CG2  . VAL A 1 41 ? 12.824 -6.145  21.497 1.00 0.00 ? 41 VAL A CG2  5  
ATOM 5172  H H    . VAL A 1 41 ? 10.822 -4.493  20.908 1.00 0.00 ? 41 VAL A H    5  
ATOM 5173  H HA   . VAL A 1 41 ? 11.283 -6.733  19.295 1.00 0.00 ? 41 VAL A HA   5  
ATOM 5174  H HB   . VAL A 1 41 ? 10.929 -6.675  22.295 1.00 0.00 ? 41 VAL A HB   5  
ATOM 5175  H HG11 . VAL A 1 41 ? 10.851 -8.928  21.669 1.00 0.00 ? 41 VAL A HG11 5  
ATOM 5176  H HG12 . VAL A 1 41 ? 12.062 -8.711  20.403 1.00 0.00 ? 41 VAL A HG12 5  
ATOM 5177  H HG13 . VAL A 1 41 ? 12.539 -8.656  22.100 1.00 0.00 ? 41 VAL A HG13 5  
ATOM 5178  H HG21 . VAL A 1 41 ? 12.622 -5.085  21.518 1.00 0.00 ? 41 VAL A HG21 5  
ATOM 5179  H HG22 . VAL A 1 41 ? 13.352 -6.429  22.396 1.00 0.00 ? 41 VAL A HG22 5  
ATOM 5180  H HG23 . VAL A 1 41 ? 13.431 -6.379  20.635 1.00 0.00 ? 41 VAL A HG23 5  
ATOM 5181  N N    . GLU A 1 42 ? 8.350  -6.625  20.705 1.00 0.00 ? 42 GLU A N    5  
ATOM 5182  C CA   . GLU A 1 42 ? 7.030  -7.245  20.743 1.00 0.00 ? 42 GLU A CA   5  
ATOM 5183  C C    . GLU A 1 42 ? 6.433  -7.339  19.342 1.00 0.00 ? 42 GLU A C    5  
ATOM 5184  O O    . GLU A 1 42 ? 6.059  -8.420  18.885 1.00 0.00 ? 42 GLU A O    5  
ATOM 5185  C CB   . GLU A 1 42 ? 6.094  -6.449  21.655 1.00 0.00 ? 42 GLU A CB   5  
ATOM 5186  C CG   . GLU A 1 42 ? 4.633  -6.841  21.519 1.00 0.00 ? 42 GLU A CG   5  
ATOM 5187  C CD   . GLU A 1 42 ? 4.383  -8.294  21.874 1.00 0.00 ? 42 GLU A CD   5  
ATOM 5188  O OE1  . GLU A 1 42 ? 4.756  -8.703  22.994 1.00 0.00 ? 42 GLU A OE1  5  
ATOM 5189  O OE2  . GLU A 1 42 ? 3.815  -9.022  21.033 1.00 0.00 ? 42 GLU A OE2  5  
ATOM 5190  H H    . GLU A 1 42 ? 8.473  -5.738  21.104 1.00 0.00 ? 42 GLU A H    5  
ATOM 5191  H HA   . GLU A 1 42 ? 7.143  -8.242  21.140 1.00 0.00 ? 42 GLU A HA   5  
ATOM 5192  H HB2  . GLU A 1 42 ? 6.394  -6.605  22.681 1.00 0.00 ? 42 GLU A HB2  5  
ATOM 5193  H HB3  . GLU A 1 42 ? 6.187  -5.399  21.418 1.00 0.00 ? 42 GLU A HB3  5  
ATOM 5194  H HG2  . GLU A 1 42 ? 4.043  -6.219  22.176 1.00 0.00 ? 42 GLU A HG2  5  
ATOM 5195  H HG3  . GLU A 1 42 ? 4.323  -6.677  20.497 1.00 0.00 ? 42 GLU A HG3  5  
ATOM 5196  N N    . LEU A 1 43 ? 6.347  -6.199  18.664 1.00 0.00 ? 43 LEU A N    5  
ATOM 5197  C CA   . LEU A 1 43 ? 5.795  -6.151  17.315 1.00 0.00 ? 43 LEU A CA   5  
ATOM 5198  C C    . LEU A 1 43 ? 6.597  -7.037  16.367 1.00 0.00 ? 43 LEU A C    5  
ATOM 5199  O O    . LEU A 1 43 ? 6.030  -7.767  15.553 1.00 0.00 ? 43 LEU A O    5  
ATOM 5200  C CB   . LEU A 1 43 ? 5.783  -4.712  16.798 1.00 0.00 ? 43 LEU A CB   5  
ATOM 5201  C CG   . LEU A 1 43 ? 4.513  -4.270  16.071 1.00 0.00 ? 43 LEU A CG   5  
ATOM 5202  C CD1  . LEU A 1 43 ? 3.351  -4.160  17.045 1.00 0.00 ? 43 LEU A CD1  5  
ATOM 5203  C CD2  . LEU A 1 43 ? 4.740  -2.945  15.358 1.00 0.00 ? 43 LEU A CD2  5  
ATOM 5204  H H    . LEU A 1 43 ? 6.661  -5.370  19.080 1.00 0.00 ? 43 LEU A H    5  
ATOM 5205  H HA   . LEU A 1 43 ? 4.780  -6.518  17.359 1.00 0.00 ? 43 LEU A HA   5  
ATOM 5206  H HB2  . LEU A 1 43 ? 5.925  -4.056  17.643 1.00 0.00 ? 43 LEU A HB2  5  
ATOM 5207  H HB3  . LEU A 1 43 ? 6.613  -4.600  16.115 1.00 0.00 ? 43 LEU A HB3  5  
ATOM 5208  H HG   . LEU A 1 43 ? 4.255  -5.011  15.327 1.00 0.00 ? 43 LEU A HG   5  
ATOM 5209  H HD11 . LEU A 1 43 ? 3.707  -3.777  17.989 1.00 0.00 ? 43 LEU A HD11 5  
ATOM 5210  H HD12 . LEU A 1 43 ? 2.913  -5.136  17.195 1.00 0.00 ? 43 LEU A HD12 5  
ATOM 5211  H HD13 . LEU A 1 43 ? 2.605  -3.490  16.642 1.00 0.00 ? 43 LEU A HD13 5  
ATOM 5212  H HD21 . LEU A 1 43 ? 5.333  -2.296  15.985 1.00 0.00 ? 43 LEU A HD21 5  
ATOM 5213  H HD22 . LEU A 1 43 ? 3.787  -2.477  15.155 1.00 0.00 ? 43 LEU A HD22 5  
ATOM 5214  H HD23 . LEU A 1 43 ? 5.260  -3.121  14.428 1.00 0.00 ? 43 LEU A HD23 5  
ATOM 5215  N N    . VAL A 1 44 ? 7.920  -6.971  16.479 1.00 0.00 ? 44 VAL A N    5  
ATOM 5216  C CA   . VAL A 1 44 ? 8.800  -7.769  15.635 1.00 0.00 ? 44 VAL A CA   5  
ATOM 5217  C C    . VAL A 1 44 ? 8.567  -9.260  15.853 1.00 0.00 ? 44 VAL A C    5  
ATOM 5218  O O    . VAL A 1 44 ? 8.377  -10.014 14.899 1.00 0.00 ? 44 VAL A O    5  
ATOM 5219  C CB   . VAL A 1 44 ? 10.282 -7.447  15.906 1.00 0.00 ? 44 VAL A CB   5  
ATOM 5220  C CG1  . VAL A 1 44 ? 11.183 -8.294  15.021 1.00 0.00 ? 44 VAL A CG1  5  
ATOM 5221  C CG2  . VAL A 1 44 ? 10.552 -5.965  15.695 1.00 0.00 ? 44 VAL A CG2  5  
ATOM 5222  H H    . VAL A 1 44 ? 8.313  -6.371  17.147 1.00 0.00 ? 44 VAL A H    5  
ATOM 5223  H HA   . VAL A 1 44 ? 8.584  -7.527  14.604 1.00 0.00 ? 44 VAL A HA   5  
ATOM 5224  H HB   . VAL A 1 44 ? 10.499 -7.688  16.937 1.00 0.00 ? 44 VAL A HB   5  
ATOM 5225  H HG11 . VAL A 1 44 ? 10.996 -9.340  15.213 1.00 0.00 ? 44 VAL A HG11 5  
ATOM 5226  H HG12 . VAL A 1 44 ? 10.978 -8.074  13.983 1.00 0.00 ? 44 VAL A HG12 5  
ATOM 5227  H HG13 . VAL A 1 44 ? 12.217 -8.068  15.239 1.00 0.00 ? 44 VAL A HG13 5  
ATOM 5228  H HG21 . VAL A 1 44 ? 10.986 -5.548  16.591 1.00 0.00 ? 44 VAL A HG21 5  
ATOM 5229  H HG22 . VAL A 1 44 ? 11.239 -5.838  14.870 1.00 0.00 ? 44 VAL A HG22 5  
ATOM 5230  H HG23 . VAL A 1 44 ? 9.625  -5.458  15.472 1.00 0.00 ? 44 VAL A HG23 5  
ATOM 5231  N N    . MET A 1 45 ? 8.583  -9.678  17.114 1.00 0.00 ? 45 MET A N    5  
ATOM 5232  C CA   . MET A 1 45 ? 8.371  -11.079 17.457 1.00 0.00 ? 45 MET A CA   5  
ATOM 5233  C C    . MET A 1 45 ? 7.048  -11.584 16.890 1.00 0.00 ? 45 MET A C    5  
ATOM 5234  O O    . MET A 1 45 ? 6.999  -12.627 16.240 1.00 0.00 ? 45 MET A O    5  
ATOM 5235  C CB   . MET A 1 45 ? 8.392  -11.263 18.976 1.00 0.00 ? 45 MET A CB   5  
ATOM 5236  C CG   . MET A 1 45 ? 9.791  -11.261 19.570 1.00 0.00 ? 45 MET A CG   5  
ATOM 5237  S SD   . MET A 1 45 ? 10.544 -12.899 19.580 1.00 0.00 ? 45 MET A SD   5  
ATOM 5238  C CE   . MET A 1 45 ? 9.938  -13.540 21.139 1.00 0.00 ? 45 MET A CE   5  
ATOM 5239  H H    . MET A 1 45 ? 8.739  -9.029  17.832 1.00 0.00 ? 45 MET A H    5  
ATOM 5240  H HA   . MET A 1 45 ? 9.177  -11.651 17.024 1.00 0.00 ? 45 MET A HA   5  
ATOM 5241  H HB2  . MET A 1 45 ? 7.829  -10.462 19.432 1.00 0.00 ? 45 MET A HB2  5  
ATOM 5242  H HB3  . MET A 1 45 ? 7.923  -12.205 19.219 1.00 0.00 ? 45 MET A HB3  5  
ATOM 5243  H HG2  . MET A 1 45 ? 10.414 -10.598 18.988 1.00 0.00 ? 45 MET A HG2  5  
ATOM 5244  H HG3  . MET A 1 45 ? 9.735  -10.898 20.586 1.00 0.00 ? 45 MET A HG3  5  
ATOM 5245  H HE1  . MET A 1 45 ? 10.722 -14.097 21.629 1.00 0.00 ? 45 MET A HE1  5  
ATOM 5246  H HE2  . MET A 1 45 ? 9.630  -12.720 21.770 1.00 0.00 ? 45 MET A HE2  5  
ATOM 5247  H HE3  . MET A 1 45 ? 9.094  -14.191 20.956 1.00 0.00 ? 45 MET A HE3  5  
ATOM 5248  N N    . ALA A 1 46 ? 5.978  -10.837 17.142 1.00 0.00 ? 46 ALA A N    5  
ATOM 5249  C CA   . ALA A 1 46 ? 4.656  -11.209 16.654 1.00 0.00 ? 46 ALA A CA   5  
ATOM 5250  C C    . ALA A 1 46 ? 4.652  -11.359 15.137 1.00 0.00 ? 46 ALA A C    5  
ATOM 5251  O O    . ALA A 1 46 ? 4.135  -12.339 14.601 1.00 0.00 ? 46 ALA A O    5  
ATOM 5252  C CB   . ALA A 1 46 ? 3.625  -10.177 17.087 1.00 0.00 ? 46 ALA A CB   5  
ATOM 5253  H H    . ALA A 1 46 ? 6.081  -10.016 17.666 1.00 0.00 ? 46 ALA A H    5  
ATOM 5254  H HA   . ALA A 1 46 ? 4.390  -12.156 17.100 1.00 0.00 ? 46 ALA A HA   5  
ATOM 5255  H HB1  . ALA A 1 46 ? 3.303  -10.392 18.095 1.00 0.00 ? 46 ALA A HB1  5  
ATOM 5256  H HB2  . ALA A 1 46 ? 4.065  -9.191  17.052 1.00 0.00 ? 46 ALA A HB2  5  
ATOM 5257  H HB3  . ALA A 1 46 ? 2.775  -10.216 16.422 1.00 0.00 ? 46 ALA A HB3  5  
ATOM 5258  N N    . PHE A 1 47 ? 5.231  -10.381 14.449 1.00 0.00 ? 47 PHE A N    5  
ATOM 5259  C CA   . PHE A 1 47 ? 5.293  -10.404 12.992 1.00 0.00 ? 47 PHE A CA   5  
ATOM 5260  C C    . PHE A 1 47 ? 5.985  -11.671 12.497 1.00 0.00 ? 47 PHE A C    5  
ATOM 5261  O O    . PHE A 1 47 ? 5.507  -12.331 11.575 1.00 0.00 ? 47 PHE A O    5  
ATOM 5262  C CB   . PHE A 1 47 ? 6.033  -9.169  12.472 1.00 0.00 ? 47 PHE A CB   5  
ATOM 5263  C CG   . PHE A 1 47 ? 5.144  -7.974  12.282 1.00 0.00 ? 47 PHE A CG   5  
ATOM 5264  C CD1  . PHE A 1 47 ? 4.002  -8.060  11.502 1.00 0.00 ? 47 PHE A CD1  5  
ATOM 5265  C CD2  . PHE A 1 47 ? 5.450  -6.763  12.883 1.00 0.00 ? 47 PHE A CD2  5  
ATOM 5266  C CE1  . PHE A 1 47 ? 3.181  -6.962  11.326 1.00 0.00 ? 47 PHE A CE1  5  
ATOM 5267  C CE2  . PHE A 1 47 ? 4.633  -5.662  12.711 1.00 0.00 ? 47 PHE A CE2  5  
ATOM 5268  C CZ   . PHE A 1 47 ? 3.498  -5.761  11.930 1.00 0.00 ? 47 PHE A CZ   5  
ATOM 5269  H H    . PHE A 1 47 ? 5.627  -9.625  14.932 1.00 0.00 ? 47 PHE A H    5  
ATOM 5270  H HA   . PHE A 1 47 ? 4.281  -10.391 12.618 1.00 0.00 ? 47 PHE A HA   5  
ATOM 5271  H HB2  . PHE A 1 47 ? 6.806  -8.899  13.176 1.00 0.00 ? 47 PHE A HB2  5  
ATOM 5272  H HB3  . PHE A 1 47 ? 6.484  -9.403  11.520 1.00 0.00 ? 47 PHE A HB3  5  
ATOM 5273  H HD1  . PHE A 1 47 ? 3.753  -8.999  11.029 1.00 0.00 ? 47 PHE A HD1  5  
ATOM 5274  H HD2  . PHE A 1 47 ? 6.338  -6.684  13.493 1.00 0.00 ? 47 PHE A HD2  5  
ATOM 5275  H HE1  . PHE A 1 47 ? 2.294  -7.043  10.715 1.00 0.00 ? 47 PHE A HE1  5  
ATOM 5276  H HE2  . PHE A 1 47 ? 4.883  -4.724  13.184 1.00 0.00 ? 47 PHE A HE2  5  
ATOM 5277  H HZ   . PHE A 1 47 ? 2.858  -4.902  11.794 1.00 0.00 ? 47 PHE A HZ   5  
ATOM 5278  N N    . GLU A 1 48 ? 7.113  -12.003 13.116 1.00 0.00 ? 48 GLU A N    5  
ATOM 5279  C CA   . GLU A 1 48 ? 7.871  -13.189 12.738 1.00 0.00 ? 48 GLU A CA   5  
ATOM 5280  C C    . GLU A 1 48 ? 7.071  -14.458 13.016 1.00 0.00 ? 48 GLU A C    5  
ATOM 5281  O O    . GLU A 1 48 ? 7.148  -15.429 12.264 1.00 0.00 ? 48 GLU A O    5  
ATOM 5282  C CB   . GLU A 1 48 ? 9.200  -13.235 13.494 1.00 0.00 ? 48 GLU A CB   5  
ATOM 5283  C CG   . GLU A 1 48 ? 10.309 -12.438 12.828 1.00 0.00 ? 48 GLU A CG   5  
ATOM 5284  C CD   . GLU A 1 48 ? 9.830  -11.098 12.304 1.00 0.00 ? 48 GLU A CD   5  
ATOM 5285  O OE1  . GLU A 1 48 ? 9.177  -11.076 11.239 1.00 0.00 ? 48 GLU A OE1  5  
ATOM 5286  O OE2  . GLU A 1 48 ? 10.107 -10.072 12.959 1.00 0.00 ? 48 GLU A OE2  5  
ATOM 5287  H H    . GLU A 1 48 ? 7.444  -11.436 13.845 1.00 0.00 ? 48 GLU A H    5  
ATOM 5288  H HA   . GLU A 1 48 ? 8.073  -13.130 11.679 1.00 0.00 ? 48 GLU A HA   5  
ATOM 5289  H HB2  . GLU A 1 48 ? 9.049  -12.841 14.488 1.00 0.00 ? 48 GLU A HB2  5  
ATOM 5290  H HB3  . GLU A 1 48 ? 9.521  -14.264 13.570 1.00 0.00 ? 48 GLU A HB3  5  
ATOM 5291  H HG2  . GLU A 1 48 ? 11.094 -12.265 13.548 1.00 0.00 ? 48 GLU A HG2  5  
ATOM 5292  H HG3  . GLU A 1 48 ? 10.700 -13.012 12.001 1.00 0.00 ? 48 GLU A HG3  5  
ATOM 5293  N N    . GLU A 1 49 ? 6.303  -14.441 14.102 1.00 0.00 ? 49 GLU A N    5  
ATOM 5294  C CA   . GLU A 1 49 ? 5.490  -15.590 14.480 1.00 0.00 ? 49 GLU A CA   5  
ATOM 5295  C C    . GLU A 1 49 ? 4.255  -15.699 13.590 1.00 0.00 ? 49 GLU A C    5  
ATOM 5296  O O    . GLU A 1 49 ? 3.693  -16.781 13.421 1.00 0.00 ? 49 GLU A O    5  
ATOM 5297  C CB   . GLU A 1 49 ? 5.067  -15.484 15.946 1.00 0.00 ? 49 GLU A CB   5  
ATOM 5298  C CG   . GLU A 1 49 ? 4.516  -16.780 16.517 1.00 0.00 ? 49 GLU A CG   5  
ATOM 5299  C CD   . GLU A 1 49 ? 3.887  -16.594 17.884 1.00 0.00 ? 49 GLU A CD   5  
ATOM 5300  O OE1  . GLU A 1 49 ? 3.231  -15.555 18.100 1.00 0.00 ? 49 GLU A OE1  5  
ATOM 5301  O OE2  . GLU A 1 49 ? 4.052  -17.490 18.739 1.00 0.00 ? 49 GLU A OE2  5  
ATOM 5302  H H    . GLU A 1 49 ? 6.285  -13.637 14.661 1.00 0.00 ? 49 GLU A H    5  
ATOM 5303  H HA   . GLU A 1 49 ? 6.091  -16.478 14.352 1.00 0.00 ? 49 GLU A HA   5  
ATOM 5304  H HB2  . GLU A 1 49 ? 5.924  -15.190 16.535 1.00 0.00 ? 49 GLU A HB2  5  
ATOM 5305  H HB3  . GLU A 1 49 ? 4.305  -14.724 16.034 1.00 0.00 ? 49 GLU A HB3  5  
ATOM 5306  H HG2  . GLU A 1 49 ? 3.767  -17.165 15.842 1.00 0.00 ? 49 GLU A HG2  5  
ATOM 5307  H HG3  . GLU A 1 49 ? 5.323  -17.493 16.602 1.00 0.00 ? 49 GLU A HG3  5  
ATOM 5308  N N    . GLU A 1 50 ? 3.840  -14.571 13.023 1.00 0.00 ? 50 GLU A N    5  
ATOM 5309  C CA   . GLU A 1 50 ? 2.671  -14.540 12.152 1.00 0.00 ? 50 GLU A CA   5  
ATOM 5310  C C    . GLU A 1 50 ? 3.048  -14.915 10.722 1.00 0.00 ? 50 GLU A C    5  
ATOM 5311  O O    . GLU A 1 50 ? 2.378  -15.727 10.083 1.00 0.00 ? 50 GLU A O    5  
ATOM 5312  C CB   . GLU A 1 50 ? 2.028  -13.151 12.174 1.00 0.00 ? 50 GLU A CB   5  
ATOM 5313  C CG   . GLU A 1 50 ? 0.550  -13.159 11.818 1.00 0.00 ? 50 GLU A CG   5  
ATOM 5314  C CD   . GLU A 1 50 ? 0.304  -13.493 10.359 1.00 0.00 ? 50 GLU A CD   5  
ATOM 5315  O OE1  . GLU A 1 50 ? 0.552  -12.622 9.500  1.00 0.00 ? 50 GLU A OE1  5  
ATOM 5316  O OE2  . GLU A 1 50 ? -0.137 -14.627 10.078 1.00 0.00 ? 50 GLU A OE2  5  
ATOM 5317  H H    . GLU A 1 50 ? 4.330  -13.740 13.196 1.00 0.00 ? 50 GLU A H    5  
ATOM 5318  H HA   . GLU A 1 50 ? 1.960  -15.261 12.525 1.00 0.00 ? 50 GLU A HA   5  
ATOM 5319  H HB2  . GLU A 1 50 ? 2.136  -12.733 13.164 1.00 0.00 ? 50 GLU A HB2  5  
ATOM 5320  H HB3  . GLU A 1 50 ? 2.543  -12.518 11.467 1.00 0.00 ? 50 GLU A HB3  5  
ATOM 5321  H HG2  . GLU A 1 50 ? 0.050  -13.895 12.429 1.00 0.00 ? 50 GLU A HG2  5  
ATOM 5322  H HG3  . GLU A 1 50 ? 0.139  -12.182 12.023 1.00 0.00 ? 50 GLU A HG3  5  
ATOM 5323  N N    . PHE A 1 51 ? 4.126  -14.317 10.224 1.00 0.00 ? 51 PHE A N    5  
ATOM 5324  C CA   . PHE A 1 51 ? 4.593  -14.586 8.869  1.00 0.00 ? 51 PHE A CA   5  
ATOM 5325  C C    . PHE A 1 51 ? 5.377  -15.894 8.814  1.00 0.00 ? 51 PHE A C    5  
ATOM 5326  O O    . PHE A 1 51 ? 5.473  -16.529 7.765  1.00 0.00 ? 51 PHE A O    5  
ATOM 5327  C CB   . PHE A 1 51 ? 5.466  -13.434 8.370  1.00 0.00 ? 51 PHE A CB   5  
ATOM 5328  C CG   . PHE A 1 51 ? 4.687  -12.340 7.696  1.00 0.00 ? 51 PHE A CG   5  
ATOM 5329  C CD1  . PHE A 1 51 ? 4.116  -11.320 8.440  1.00 0.00 ? 51 PHE A CD1  5  
ATOM 5330  C CD2  . PHE A 1 51 ? 4.527  -12.331 6.320  1.00 0.00 ? 51 PHE A CD2  5  
ATOM 5331  C CE1  . PHE A 1 51 ? 3.398  -10.313 7.823  1.00 0.00 ? 51 PHE A CE1  5  
ATOM 5332  C CE2  . PHE A 1 51 ? 3.811  -11.326 5.698  1.00 0.00 ? 51 PHE A CE2  5  
ATOM 5333  C CZ   . PHE A 1 51 ? 3.247  -10.315 6.450  1.00 0.00 ? 51 PHE A CZ   5  
ATOM 5334  H H    . PHE A 1 51 ? 4.619  -13.679 10.782 1.00 0.00 ? 51 PHE A H    5  
ATOM 5335  H HA   . PHE A 1 51 ? 3.726  -14.673 8.232  1.00 0.00 ? 51 PHE A HA   5  
ATOM 5336  H HB2  . PHE A 1 51 ? 5.991  -12.999 9.207  1.00 0.00 ? 51 PHE A HB2  5  
ATOM 5337  H HB3  . PHE A 1 51 ? 6.184  -13.817 7.660  1.00 0.00 ? 51 PHE A HB3  5  
ATOM 5338  H HD1  . PHE A 1 51 ? 4.234  -11.316 9.514  1.00 0.00 ? 51 PHE A HD1  5  
ATOM 5339  H HD2  . PHE A 1 51 ? 4.969  -13.122 5.730  1.00 0.00 ? 51 PHE A HD2  5  
ATOM 5340  H HE1  . PHE A 1 51 ? 2.958  -9.523  8.414  1.00 0.00 ? 51 PHE A HE1  5  
ATOM 5341  H HE2  . PHE A 1 51 ? 3.695  -11.331 4.624  1.00 0.00 ? 51 PHE A HE2  5  
ATOM 5342  H HZ   . PHE A 1 51 ? 2.686  -9.529  5.966  1.00 0.00 ? 51 PHE A HZ   5  
ATOM 5343  N N    . GLY A 1 52 ? 5.936  -16.291 9.953  1.00 0.00 ? 52 GLY A N    5  
ATOM 5344  C CA   . GLY A 1 52 ? 6.705  -17.520 10.013 1.00 0.00 ? 52 GLY A CA   5  
ATOM 5345  C C    . GLY A 1 52 ? 8.115  -17.349 9.482  1.00 0.00 ? 52 GLY A C    5  
ATOM 5346  O O    . GLY A 1 52 ? 8.535  -18.064 8.573  1.00 0.00 ? 52 GLY A O    5  
ATOM 5347  H H    . GLY A 1 52 ? 5.826  -15.744 10.759 1.00 0.00 ? 52 GLY A H    5  
ATOM 5348  H HA2  . GLY A 1 52 ? 6.756  -17.850 11.040 1.00 0.00 ? 52 GLY A HA2  5  
ATOM 5349  H HA3  . GLY A 1 52 ? 6.202  -18.275 9.428  1.00 0.00 ? 52 GLY A HA3  5  
ATOM 5350  N N    . VAL A 1 53 ? 8.848  -16.396 10.050 1.00 0.00 ? 53 VAL A N    5  
ATOM 5351  C CA   . VAL A 1 53 ? 10.218 -16.132 9.628  1.00 0.00 ? 53 VAL A CA   5  
ATOM 5352  C C    . VAL A 1 53 ? 11.161 -16.078 10.825 1.00 0.00 ? 53 VAL A C    5  
ATOM 5353  O O    . VAL A 1 53 ? 10.776 -15.648 11.911 1.00 0.00 ? 53 VAL A O    5  
ATOM 5354  C CB   . VAL A 1 53 ? 10.320 -14.808 8.848  1.00 0.00 ? 53 VAL A CB   5  
ATOM 5355  C CG1  . VAL A 1 53 ? 9.608  -14.921 7.509  1.00 0.00 ? 53 VAL A CG1  5  
ATOM 5356  C CG2  . VAL A 1 53 ? 9.751  -13.661 9.669  1.00 0.00 ? 53 VAL A CG2  5  
ATOM 5357  H H    . VAL A 1 53 ? 8.458  -15.859 10.771 1.00 0.00 ? 53 VAL A H    5  
ATOM 5358  H HA   . VAL A 1 53 ? 10.527 -16.936 8.975  1.00 0.00 ? 53 VAL A HA   5  
ATOM 5359  H HB   . VAL A 1 53 ? 11.364 -14.605 8.659  1.00 0.00 ? 53 VAL A HB   5  
ATOM 5360  H HG11 . VAL A 1 53 ? 9.913  -14.106 6.869  1.00 0.00 ? 53 VAL A HG11 5  
ATOM 5361  H HG12 . VAL A 1 53 ? 9.862  -15.862 7.043  1.00 0.00 ? 53 VAL A HG12 5  
ATOM 5362  H HG13 . VAL A 1 53 ? 8.540  -14.874 7.664  1.00 0.00 ? 53 VAL A HG13 5  
ATOM 5363  H HG21 . VAL A 1 53 ? 9.570  -13.998 10.679 1.00 0.00 ? 53 VAL A HG21 5  
ATOM 5364  H HG22 . VAL A 1 53 ? 10.457 -12.843 9.683  1.00 0.00 ? 53 VAL A HG22 5  
ATOM 5365  H HG23 . VAL A 1 53 ? 8.823  -13.328 9.228  1.00 0.00 ? 53 VAL A HG23 5  
ATOM 5366  N N    . GLU A 1 54 ? 12.399 -16.517 10.616 1.00 0.00 ? 54 GLU A N    5  
ATOM 5367  C CA   . GLU A 1 54 ? 13.397 -16.518 11.679 1.00 0.00 ? 54 GLU A CA   5  
ATOM 5368  C C    . GLU A 1 54 ? 14.450 -15.440 11.438 1.00 0.00 ? 54 GLU A C    5  
ATOM 5369  O O    . GLU A 1 54 ? 15.153 -15.460 10.428 1.00 0.00 ? 54 GLU A O    5  
ATOM 5370  C CB   . GLU A 1 54 ? 14.068 -17.890 11.777 1.00 0.00 ? 54 GLU A CB   5  
ATOM 5371  C CG   . GLU A 1 54 ? 14.743 -18.330 10.488 1.00 0.00 ? 54 GLU A CG   5  
ATOM 5372  C CD   . GLU A 1 54 ? 15.179 -19.782 10.525 1.00 0.00 ? 54 GLU A CD   5  
ATOM 5373  O OE1  . GLU A 1 54 ? 14.421 -20.615 11.064 1.00 0.00 ? 54 GLU A OE1  5  
ATOM 5374  O OE2  . GLU A 1 54 ? 16.278 -20.085 10.015 1.00 0.00 ? 54 GLU A OE2  5  
ATOM 5375  H H    . GLU A 1 54 ? 12.646 -16.848 9.728  1.00 0.00 ? 54 GLU A H    5  
ATOM 5376  H HA   . GLU A 1 54 ? 12.891 -16.309 12.610 1.00 0.00 ? 54 GLU A HA   5  
ATOM 5377  H HB2  . GLU A 1 54 ? 14.814 -17.858 12.557 1.00 0.00 ? 54 GLU A HB2  5  
ATOM 5378  H HB3  . GLU A 1 54 ? 13.321 -18.625 12.036 1.00 0.00 ? 54 GLU A HB3  5  
ATOM 5379  H HG2  . GLU A 1 54 ? 14.050 -18.199 9.671  1.00 0.00 ? 54 GLU A HG2  5  
ATOM 5380  H HG3  . GLU A 1 54 ? 15.613 -17.712 10.323 1.00 0.00 ? 54 GLU A HG3  5  
ATOM 5381  N N    . ILE A 1 55 ? 14.552 -14.502 12.374 1.00 0.00 ? 55 ILE A N    5  
ATOM 5382  C CA   . ILE A 1 55 ? 15.518 -13.417 12.264 1.00 0.00 ? 55 ILE A CA   5  
ATOM 5383  C C    . ILE A 1 55 ? 16.394 -13.332 13.509 1.00 0.00 ? 55 ILE A C    5  
ATOM 5384  O O    . ILE A 1 55 ? 16.016 -13.772 14.595 1.00 0.00 ? 55 ILE A O    5  
ATOM 5385  C CB   . ILE A 1 55 ? 14.820 -12.061 12.048 1.00 0.00 ? 55 ILE A CB   5  
ATOM 5386  C CG1  . ILE A 1 55 ? 13.638 -11.913 13.008 1.00 0.00 ? 55 ILE A CG1  5  
ATOM 5387  C CG2  . ILE A 1 55 ? 14.357 -11.927 10.605 1.00 0.00 ? 55 ILE A CG2  5  
ATOM 5388  C CD1  . ILE A 1 55 ? 12.968 -10.558 12.937 1.00 0.00 ? 55 ILE A CD1  5  
ATOM 5389  H H    . ILE A 1 55 ? 13.964 -14.541 13.156 1.00 0.00 ? 55 ILE A H    5  
ATOM 5390  H HA   . ILE A 1 55 ? 16.147 -13.616 11.407 1.00 0.00 ? 55 ILE A HA   5  
ATOM 5391  H HB   . ILE A 1 55 ? 15.536 -11.277 12.245 1.00 0.00 ? 55 ILE A HB   5  
ATOM 5392  H HG12 . ILE A 1 55 ? 12.898 -12.661 12.776 1.00 0.00 ? 55 ILE A HG12 5  
ATOM 5393  H HG13 . ILE A 1 55 ? 13.986 -12.059 14.021 1.00 0.00 ? 55 ILE A HG13 5  
ATOM 5394  H HG21 . ILE A 1 55 ? 15.214 -11.955 9.948  1.00 0.00 ? 55 ILE A HG21 5  
ATOM 5395  H HG22 . ILE A 1 55 ? 13.693 -12.743 10.363 1.00 0.00 ? 55 ILE A HG22 5  
ATOM 5396  H HG23 . ILE A 1 55 ? 13.837 -10.990 10.479 1.00 0.00 ? 55 ILE A HG23 5  
ATOM 5397  H HD11 . ILE A 1 55 ? 12.475 -10.450 11.982 1.00 0.00 ? 55 ILE A HD11 5  
ATOM 5398  H HD12 . ILE A 1 55 ? 12.241 -10.474 13.731 1.00 0.00 ? 55 ILE A HD12 5  
ATOM 5399  H HD13 . ILE A 1 55 ? 13.712 -9.783  13.047 1.00 0.00 ? 55 ILE A HD13 5  
ATOM 5400  N N    . PRO A 1 56 ? 17.593 -12.752 13.351 1.00 0.00 ? 56 PRO A N    5  
ATOM 5401  C CA   . PRO A 1 56 ? 18.547 -12.594 14.452 1.00 0.00 ? 56 PRO A CA   5  
ATOM 5402  C C    . PRO A 1 56 ? 18.079 -11.571 15.482 1.00 0.00 ? 56 PRO A C    5  
ATOM 5403  O O    . PRO A 1 56 ? 17.084 -10.877 15.274 1.00 0.00 ? 56 PRO A O    5  
ATOM 5404  C CB   . PRO A 1 56 ? 19.818 -12.105 13.753 1.00 0.00 ? 56 PRO A CB   5  
ATOM 5405  C CG   . PRO A 1 56 ? 19.336 -11.445 12.508 1.00 0.00 ? 56 PRO A CG   5  
ATOM 5406  C CD   . PRO A 1 56 ? 18.109 -12.206 12.085 1.00 0.00 ? 56 PRO A CD   5  
ATOM 5407  H HA   . PRO A 1 56 ? 18.745 -13.535 14.945 1.00 0.00 ? 56 PRO A HA   5  
ATOM 5408  H HB2  . PRO A 1 56 ? 20.340 -11.408 14.394 1.00 0.00 ? 56 PRO A HB2  5  
ATOM 5409  H HB3  . PRO A 1 56 ? 20.458 -12.946 13.531 1.00 0.00 ? 56 PRO A HB3  5  
ATOM 5410  H HG2  . PRO A 1 56 ? 19.087 -10.415 12.711 1.00 0.00 ? 56 PRO A HG2  5  
ATOM 5411  H HG3  . PRO A 1 56 ? 20.096 -11.505 11.743 1.00 0.00 ? 56 PRO A HG3  5  
ATOM 5412  H HD2  . PRO A 1 56 ? 17.391 -11.540 11.630 1.00 0.00 ? 56 PRO A HD2  5  
ATOM 5413  H HD3  . PRO A 1 56 ? 18.375 -13.000 11.402 1.00 0.00 ? 56 PRO A HD3  5  
ATOM 5414  N N    . ASP A 1 57 ? 18.803 -11.484 16.593 1.00 0.00 ? 57 ASP A N    5  
ATOM 5415  C CA   . ASP A 1 57 ? 18.462 -10.545 17.655 1.00 0.00 ? 57 ASP A CA   5  
ATOM 5416  C C    . ASP A 1 57 ? 18.692 -9.106  17.203 1.00 0.00 ? 57 ASP A C    5  
ATOM 5417  O O    . ASP A 1 57 ? 17.885 -8.220  17.485 1.00 0.00 ? 57 ASP A O    5  
ATOM 5418  C CB   . ASP A 1 57 ? 19.290 -10.837 18.908 1.00 0.00 ? 57 ASP A CB   5  
ATOM 5419  C CG   . ASP A 1 57 ? 18.637 -10.308 20.170 1.00 0.00 ? 57 ASP A CG   5  
ATOM 5420  O OD1  . ASP A 1 57 ? 17.418 -10.039 20.138 1.00 0.00 ? 57 ASP A OD1  5  
ATOM 5421  O OD2  . ASP A 1 57 ? 19.345 -10.162 21.188 1.00 0.00 ? 57 ASP A OD2  5  
ATOM 5422  H H    . ASP A 1 57 ? 19.586 -12.064 16.701 1.00 0.00 ? 57 ASP A H    5  
ATOM 5423  H HA   . ASP A 1 57 ? 17.416 -10.673 17.888 1.00 0.00 ? 57 ASP A HA   5  
ATOM 5424  H HB2  . ASP A 1 57 ? 19.413 -11.905 19.010 1.00 0.00 ? 57 ASP A HB2  5  
ATOM 5425  H HB3  . ASP A 1 57 ? 20.261 -10.375 18.806 1.00 0.00 ? 57 ASP A HB3  5  
ATOM 5426  N N    . ASP A 1 58 ? 19.797 -8.881  16.501 1.00 0.00 ? 58 ASP A N    5  
ATOM 5427  C CA   . ASP A 1 58 ? 20.134 -7.550  16.010 1.00 0.00 ? 58 ASP A CA   5  
ATOM 5428  C C    . ASP A 1 58 ? 19.003 -6.985  15.156 1.00 0.00 ? 58 ASP A C    5  
ATOM 5429  O O    . ASP A 1 58 ? 18.853 -5.769  15.034 1.00 0.00 ? 58 ASP A O    5  
ATOM 5430  C CB   . ASP A 1 58 ? 21.429 -7.595  15.198 1.00 0.00 ? 58 ASP A CB   5  
ATOM 5431  C CG   . ASP A 1 58 ? 21.408 -8.675  14.134 1.00 0.00 ? 58 ASP A CG   5  
ATOM 5432  O OD1  . ASP A 1 58 ? 20.732 -8.479  13.102 1.00 0.00 ? 58 ASP A OD1  5  
ATOM 5433  O OD2  . ASP A 1 58 ? 22.069 -9.716  14.332 1.00 0.00 ? 58 ASP A OD2  5  
ATOM 5434  H H    . ASP A 1 58 ? 20.402 -9.629  16.309 1.00 0.00 ? 58 ASP A H    5  
ATOM 5435  H HA   . ASP A 1 58 ? 20.278 -6.907  16.865 1.00 0.00 ? 58 ASP A HA   5  
ATOM 5436  H HB2  . ASP A 1 58 ? 21.576 -6.641  14.712 1.00 0.00 ? 58 ASP A HB2  5  
ATOM 5437  H HB3  . ASP A 1 58 ? 22.257 -7.787  15.864 1.00 0.00 ? 58 ASP A HB3  5  
ATOM 5438  N N    . ALA A 1 59 ? 18.212 -7.875  14.566 1.00 0.00 ? 59 ALA A N    5  
ATOM 5439  C CA   . ALA A 1 59 ? 17.095 -7.464  13.724 1.00 0.00 ? 59 ALA A CA   5  
ATOM 5440  C C    . ALA A 1 59 ? 16.204 -6.458  14.446 1.00 0.00 ? 59 ALA A C    5  
ATOM 5441  O O    . ALA A 1 59 ? 15.948 -5.366  13.939 1.00 0.00 ? 59 ALA A O    5  
ATOM 5442  C CB   . ALA A 1 59 ? 16.283 -8.678  13.296 1.00 0.00 ? 59 ALA A CB   5  
ATOM 5443  H H    . ALA A 1 59 ? 18.383 -8.830  14.701 1.00 0.00 ? 59 ALA A H    5  
ATOM 5444  H HA   . ALA A 1 59 ? 17.499 -7.000  12.836 1.00 0.00 ? 59 ALA A HA   5  
ATOM 5445  H HB1  . ALA A 1 59 ? 15.431 -8.353  12.716 1.00 0.00 ? 59 ALA A HB1  5  
ATOM 5446  H HB2  . ALA A 1 59 ? 16.900 -9.330  12.696 1.00 0.00 ? 59 ALA A HB2  5  
ATOM 5447  H HB3  . ALA A 1 59 ? 15.942 -9.210  14.171 1.00 0.00 ? 59 ALA A HB3  5  
ATOM 5448  N N    . ALA A 1 60 ? 15.735 -6.834  15.631 1.00 0.00 ? 60 ALA A N    5  
ATOM 5449  C CA   . ALA A 1 60 ? 14.874 -5.963  16.423 1.00 0.00 ? 60 ALA A CA   5  
ATOM 5450  C C    . ALA A 1 60 ? 15.539 -4.614  16.673 1.00 0.00 ? 60 ALA A C    5  
ATOM 5451  O O    . ALA A 1 60 ? 14.862 -3.611  16.895 1.00 0.00 ? 60 ALA A O    5  
ATOM 5452  C CB   . ALA A 1 60 ? 14.518 -6.631  17.743 1.00 0.00 ? 60 ALA A CB   5  
ATOM 5453  H H    . ALA A 1 60 ? 15.974 -7.716  15.982 1.00 0.00 ? 60 ALA A H    5  
ATOM 5454  H HA   . ALA A 1 60 ? 13.960 -5.805  15.869 1.00 0.00 ? 60 ALA A HA   5  
ATOM 5455  H HB1  . ALA A 1 60 ? 13.503 -6.997  17.698 1.00 0.00 ? 60 ALA A HB1  5  
ATOM 5456  H HB2  . ALA A 1 60 ? 15.191 -7.457  17.921 1.00 0.00 ? 60 ALA A HB2  5  
ATOM 5457  H HB3  . ALA A 1 60 ? 14.608 -5.914  18.544 1.00 0.00 ? 60 ALA A HB3  5  
ATOM 5458  N N    . GLU A 1 61 ? 16.868 -4.598  16.636 1.00 0.00 ? 61 GLU A N    5  
ATOM 5459  C CA   . GLU A 1 61 ? 17.623 -3.371  16.860 1.00 0.00 ? 61 GLU A CA   5  
ATOM 5460  C C    . GLU A 1 61 ? 17.711 -2.544  15.581 1.00 0.00 ? 61 GLU A C    5  
ATOM 5461  O O    . GLU A 1 61 ? 17.861 -1.323  15.626 1.00 0.00 ? 61 GLU A O    5  
ATOM 5462  C CB   . GLU A 1 61 ? 19.030 -3.697  17.367 1.00 0.00 ? 61 GLU A CB   5  
ATOM 5463  C CG   . GLU A 1 61 ? 19.041 -4.568  18.613 1.00 0.00 ? 61 GLU A CG   5  
ATOM 5464  C CD   . GLU A 1 61 ? 18.829 -3.769  19.884 1.00 0.00 ? 61 GLU A CD   5  
ATOM 5465  O OE1  . GLU A 1 61 ? 19.703 -2.942  20.219 1.00 0.00 ? 61 GLU A OE1  5  
ATOM 5466  O OE2  . GLU A 1 61 ? 17.789 -3.971  20.544 1.00 0.00 ? 61 GLU A OE2  5  
ATOM 5467  H H    . GLU A 1 61 ? 17.351 -5.431  16.454 1.00 0.00 ? 61 GLU A H    5  
ATOM 5468  H HA   . GLU A 1 61 ? 17.105 -2.796  17.612 1.00 0.00 ? 61 GLU A HA   5  
ATOM 5469  H HB2  . GLU A 1 61 ? 19.570 -4.214  16.587 1.00 0.00 ? 61 GLU A HB2  5  
ATOM 5470  H HB3  . GLU A 1 61 ? 19.540 -2.773  17.595 1.00 0.00 ? 61 GLU A HB3  5  
ATOM 5471  H HG2  . GLU A 1 61 ? 18.254 -5.301  18.531 1.00 0.00 ? 61 GLU A HG2  5  
ATOM 5472  H HG3  . GLU A 1 61 ? 19.995 -5.071  18.676 1.00 0.00 ? 61 GLU A HG3  5  
ATOM 5473  N N    . THR A 1 62 ? 17.617 -3.219  14.439 1.00 0.00 ? 62 THR A N    5  
ATOM 5474  C CA   . THR A 1 62 ? 17.687 -2.549  13.147 1.00 0.00 ? 62 THR A CA   5  
ATOM 5475  C C    . THR A 1 62 ? 16.316 -2.042  12.716 1.00 0.00 ? 62 THR A C    5  
ATOM 5476  O O    . THR A 1 62 ? 16.209 -1.170  11.853 1.00 0.00 ? 62 THR A O    5  
ATOM 5477  C CB   . THR A 1 62 ? 18.241 -3.486  12.058 1.00 0.00 ? 62 THR A CB   5  
ATOM 5478  O OG1  . THR A 1 62 ? 17.381 -4.620  11.903 1.00 0.00 ? 62 THR A OG1  5  
ATOM 5479  C CG2  . THR A 1 62 ? 19.646 -3.952  12.409 1.00 0.00 ? 62 THR A CG2  5  
ATOM 5480  H H    . THR A 1 62 ? 17.498 -4.191  14.469 1.00 0.00 ? 62 THR A H    5  
ATOM 5481  H HA   . THR A 1 62 ? 18.357 -1.707  13.244 1.00 0.00 ? 62 THR A HA   5  
ATOM 5482  H HB   . THR A 1 62 ? 18.281 -2.943  11.124 1.00 0.00 ? 62 THR A HB   5  
ATOM 5483  H HG1  . THR A 1 62 ? 16.609 -4.368  11.390 1.00 0.00 ? 62 THR A HG1  5  
ATOM 5484  H HG21 . THR A 1 62 ? 19.588 -4.790  13.087 1.00 0.00 ? 62 THR A HG21 5  
ATOM 5485  H HG22 . THR A 1 62 ? 20.187 -3.144  12.879 1.00 0.00 ? 62 THR A HG22 5  
ATOM 5486  H HG23 . THR A 1 62 ? 20.160 -4.254  11.508 1.00 0.00 ? 62 THR A HG23 5  
ATOM 5487  N N    . ILE A 1 63 ? 15.269 -2.592  13.322 1.00 0.00 ? 63 ILE A N    5  
ATOM 5488  C CA   . ILE A 1 63 ? 13.904 -2.193  13.001 1.00 0.00 ? 63 ILE A CA   5  
ATOM 5489  C C    . ILE A 1 63 ? 13.457 -1.019  13.865 1.00 0.00 ? 63 ILE A C    5  
ATOM 5490  O O    . ILE A 1 63 ? 13.064 -1.197  15.019 1.00 0.00 ? 63 ILE A O    5  
ATOM 5491  C CB   . ILE A 1 63 ? 12.917 -3.360  13.189 1.00 0.00 ? 63 ILE A CB   5  
ATOM 5492  C CG1  . ILE A 1 63 ? 13.316 -4.542  12.303 1.00 0.00 ? 63 ILE A CG1  5  
ATOM 5493  C CG2  . ILE A 1 63 ? 11.499 -2.910  12.875 1.00 0.00 ? 63 ILE A CG2  5  
ATOM 5494  C CD1  . ILE A 1 63 ? 12.613 -5.832  12.663 1.00 0.00 ? 63 ILE A CD1  5  
ATOM 5495  H H    . ILE A 1 63 ? 15.418 -3.281  14.002 1.00 0.00 ? 63 ILE A H    5  
ATOM 5496  H HA   . ILE A 1 63 ? 13.881 -1.892  11.963 1.00 0.00 ? 63 ILE A HA   5  
ATOM 5497  H HB   . ILE A 1 63 ? 12.951 -3.667  14.223 1.00 0.00 ? 63 ILE A HB   5  
ATOM 5498  H HG12 . ILE A 1 63 ? 13.078 -4.311  11.277 1.00 0.00 ? 63 ILE A HG12 5  
ATOM 5499  H HG13 . ILE A 1 63 ? 14.380 -4.707  12.393 1.00 0.00 ? 63 ILE A HG13 5  
ATOM 5500  H HG21 . ILE A 1 63 ? 10.848 -3.771  12.839 1.00 0.00 ? 63 ILE A HG21 5  
ATOM 5501  H HG22 . ILE A 1 63 ? 11.157 -2.234  13.645 1.00 0.00 ? 63 ILE A HG22 5  
ATOM 5502  H HG23 . ILE A 1 63 ? 11.483 -2.407  11.920 1.00 0.00 ? 63 ILE A HG23 5  
ATOM 5503  H HD11 . ILE A 1 63 ? 11.545 -5.675  12.654 1.00 0.00 ? 63 ILE A HD11 5  
ATOM 5504  H HD12 . ILE A 1 63 ? 12.872 -6.596  11.947 1.00 0.00 ? 63 ILE A HD12 5  
ATOM 5505  H HD13 . ILE A 1 63 ? 12.921 -6.146  13.651 1.00 0.00 ? 63 ILE A HD13 5  
ATOM 5506  N N    . LEU A 1 64 ? 13.518 0.182   13.300 1.00 0.00 ? 64 LEU A N    5  
ATOM 5507  C CA   . LEU A 1 64 ? 13.117 1.386   14.018 1.00 0.00 ? 64 LEU A CA   5  
ATOM 5508  C C    . LEU A 1 64 ? 11.831 1.965   13.436 1.00 0.00 ? 64 LEU A C    5  
ATOM 5509  O O    . LEU A 1 64 ? 10.855 2.185   14.154 1.00 0.00 ? 64 LEU A O    5  
ATOM 5510  C CB   . LEU A 1 64 ? 14.231 2.433   13.961 1.00 0.00 ? 64 LEU A CB   5  
ATOM 5511  C CG   . LEU A 1 64 ? 15.658 1.901   14.100 1.00 0.00 ? 64 LEU A CG   5  
ATOM 5512  C CD1  . LEU A 1 64 ? 16.260 1.624   12.731 1.00 0.00 ? 64 LEU A CD1  5  
ATOM 5513  C CD2  . LEU A 1 64 ? 16.522 2.886   14.874 1.00 0.00 ? 64 LEU A CD2  5  
ATOM 5514  H H    . LEU A 1 64 ? 13.839 0.261   12.378 1.00 0.00 ? 64 LEU A H    5  
ATOM 5515  H HA   . LEU A 1 64 ? 12.941 1.115   15.048 1.00 0.00 ? 64 LEU A HA   5  
ATOM 5516  H HB2  . LEU A 1 64 ? 14.159 2.941   13.012 1.00 0.00 ? 64 LEU A HB2  5  
ATOM 5517  H HB3  . LEU A 1 64 ? 14.061 3.140   14.761 1.00 0.00 ? 64 LEU A HB3  5  
ATOM 5518  H HG   . LEU A 1 64 ? 15.637 0.970   14.649 1.00 0.00 ? 64 LEU A HG   5  
ATOM 5519  H HD11 . LEU A 1 64 ? 16.955 0.801   12.803 1.00 0.00 ? 64 LEU A HD11 5  
ATOM 5520  H HD12 . LEU A 1 64 ? 16.779 2.504   12.381 1.00 0.00 ? 64 LEU A HD12 5  
ATOM 5521  H HD13 . LEU A 1 64 ? 15.473 1.371   12.036 1.00 0.00 ? 64 LEU A HD13 5  
ATOM 5522  H HD21 . LEU A 1 64 ? 17.527 2.498   14.954 1.00 0.00 ? 64 LEU A HD21 5  
ATOM 5523  H HD22 . LEU A 1 64 ? 16.110 3.024   15.864 1.00 0.00 ? 64 LEU A HD22 5  
ATOM 5524  H HD23 . LEU A 1 64 ? 16.540 3.833   14.356 1.00 0.00 ? 64 LEU A HD23 5  
ATOM 5525  N N    . THR A 1 65 ? 11.836 2.208   12.129 1.00 0.00 ? 65 THR A N    5  
ATOM 5526  C CA   . THR A 1 65 ? 10.670 2.759   11.449 1.00 0.00 ? 65 THR A CA   5  
ATOM 5527  C C    . THR A 1 65 ? 9.853  1.660   10.780 1.00 0.00 ? 65 THR A C    5  
ATOM 5528  O O    . THR A 1 65 ? 10.327 0.537   10.607 1.00 0.00 ? 65 THR A O    5  
ATOM 5529  C CB   . THR A 1 65 ? 11.078 3.798   10.388 1.00 0.00 ? 65 THR A CB   5  
ATOM 5530  O OG1  . THR A 1 65 ? 12.002 3.216   9.462  1.00 0.00 ? 65 THR A OG1  5  
ATOM 5531  C CG2  . THR A 1 65 ? 11.708 5.019   11.041 1.00 0.00 ? 65 THR A CG2  5  
ATOM 5532  H H    . THR A 1 65 ? 12.644 2.011   11.610 1.00 0.00 ? 65 THR A H    5  
ATOM 5533  H HA   . THR A 1 65 ? 10.056 3.252   12.189 1.00 0.00 ? 65 THR A HA   5  
ATOM 5534  H HB   . THR A 1 65 ? 10.192 4.111   9.853  1.00 0.00 ? 65 THR A HB   5  
ATOM 5535  H HG1  . THR A 1 65 ? 12.094 3.791   8.698  1.00 0.00 ? 65 THR A HG1  5  
ATOM 5536  H HG21 . THR A 1 65 ? 12.161 5.640   10.281 1.00 0.00 ? 65 THR A HG21 5  
ATOM 5537  H HG22 . THR A 1 65 ? 12.464 4.702   11.744 1.00 0.00 ? 65 THR A HG22 5  
ATOM 5538  H HG23 . THR A 1 65 ? 10.947 5.583   11.559 1.00 0.00 ? 65 THR A HG23 5  
ATOM 5539  N N    . VAL A 1 66 ? 8.621  1.990   10.405 1.00 0.00 ? 66 VAL A N    5  
ATOM 5540  C CA   . VAL A 1 66 ? 7.738  1.031   9.753  1.00 0.00 ? 66 VAL A CA   5  
ATOM 5541  C C    . VAL A 1 66 ? 8.414  0.394   8.544  1.00 0.00 ? 66 VAL A C    5  
ATOM 5542  O O    . VAL A 1 66 ? 8.395  -0.825  8.379  1.00 0.00 ? 66 VAL A O    5  
ATOM 5543  C CB   . VAL A 1 66 ? 6.424  1.696   9.300  1.00 0.00 ? 66 VAL A CB   5  
ATOM 5544  C CG1  . VAL A 1 66 ? 5.525  0.684   8.606  1.00 0.00 ? 66 VAL A CG1  5  
ATOM 5545  C CG2  . VAL A 1 66 ? 5.711  2.328   10.487 1.00 0.00 ? 66 VAL A CG2  5  
ATOM 5546  H H    . VAL A 1 66 ? 8.299  2.901   10.570 1.00 0.00 ? 66 VAL A H    5  
ATOM 5547  H HA   . VAL A 1 66 ? 7.498  0.258   10.468 1.00 0.00 ? 66 VAL A HA   5  
ATOM 5548  H HB   . VAL A 1 66 ? 6.663  2.476   8.594  1.00 0.00 ? 66 VAL A HB   5  
ATOM 5549  H HG11 . VAL A 1 66 ? 5.581  0.828   7.536  1.00 0.00 ? 66 VAL A HG11 5  
ATOM 5550  H HG12 . VAL A 1 66 ? 5.850  -0.316  8.853  1.00 0.00 ? 66 VAL A HG12 5  
ATOM 5551  H HG13 . VAL A 1 66 ? 4.506  0.824   8.934  1.00 0.00 ? 66 VAL A HG13 5  
ATOM 5552  H HG21 . VAL A 1 66 ? 5.387  3.323   10.222 1.00 0.00 ? 66 VAL A HG21 5  
ATOM 5553  H HG22 . VAL A 1 66 ? 4.852  1.728   10.753 1.00 0.00 ? 66 VAL A HG22 5  
ATOM 5554  H HG23 . VAL A 1 66 ? 6.387  2.380   11.327 1.00 0.00 ? 66 VAL A HG23 5  
ATOM 5555  N N    . GLY A 1 67 ? 9.014  1.229   7.700  1.00 0.00 ? 67 GLY A N    5  
ATOM 5556  C CA   . GLY A 1 67 ? 9.689  0.729   6.517  1.00 0.00 ? 67 GLY A CA   5  
ATOM 5557  C C    . GLY A 1 67 ? 10.684 -0.369  6.838  1.00 0.00 ? 67 GLY A C    5  
ATOM 5558  O O    . GLY A 1 67 ? 10.905 -1.271  6.030  1.00 0.00 ? 67 GLY A O    5  
ATOM 5559  H H    . GLY A 1 67 ? 8.997  2.192   7.883  1.00 0.00 ? 67 GLY A H    5  
ATOM 5560  H HA2  . GLY A 1 67 ? 8.951  0.342   5.831  1.00 0.00 ? 67 GLY A HA2  5  
ATOM 5561  H HA3  . GLY A 1 67 ? 10.213 1.546   6.043  1.00 0.00 ? 67 GLY A HA3  5  
ATOM 5562  N N    . ASP A 1 68 ? 11.287 -0.292  8.019  1.00 0.00 ? 68 ASP A N    5  
ATOM 5563  C CA   . ASP A 1 68 ? 12.265 -1.286  8.444  1.00 0.00 ? 68 ASP A CA   5  
ATOM 5564  C C    . ASP A 1 68 ? 11.590 -2.623  8.735  1.00 0.00 ? 68 ASP A C    5  
ATOM 5565  O O    . ASP A 1 68 ? 11.953 -3.650  8.163  1.00 0.00 ? 68 ASP A O    5  
ATOM 5566  C CB   . ASP A 1 68 ? 13.014 -0.798  9.686  1.00 0.00 ? 68 ASP A CB   5  
ATOM 5567  C CG   . ASP A 1 68 ? 14.496 -1.111  9.628  1.00 0.00 ? 68 ASP A CG   5  
ATOM 5568  O OD1  . ASP A 1 68 ? 14.859 -2.295  9.785  1.00 0.00 ? 68 ASP A OD1  5  
ATOM 5569  O OD2  . ASP A 1 68 ? 15.294 -0.170  9.427  1.00 0.00 ? 68 ASP A OD2  5  
ATOM 5570  H H    . ASP A 1 68 ? 11.069 0.452   8.619  1.00 0.00 ? 68 ASP A H    5  
ATOM 5571  H HA   . ASP A 1 68 ? 12.972 -1.422  7.639  1.00 0.00 ? 68 ASP A HA   5  
ATOM 5572  H HB2  . ASP A 1 68 ? 12.894 0.272   9.773  1.00 0.00 ? 68 ASP A HB2  5  
ATOM 5573  H HB3  . ASP A 1 68 ? 12.597 -1.276  10.560 1.00 0.00 ? 68 ASP A HB3  5  
ATOM 5574  N N    . ALA A 1 69 ? 10.606 -2.601  9.628  1.00 0.00 ? 69 ALA A N    5  
ATOM 5575  C CA   . ALA A 1 69 ? 9.880  -3.811  9.994  1.00 0.00 ? 69 ALA A CA   5  
ATOM 5576  C C    . ALA A 1 69 ? 9.262  -4.472  8.767  1.00 0.00 ? 69 ALA A C    5  
ATOM 5577  O O    . ALA A 1 69 ? 9.345  -5.689  8.597  1.00 0.00 ? 69 ALA A O    5  
ATOM 5578  C CB   . ALA A 1 69 ? 8.804  -3.490  11.021 1.00 0.00 ? 69 ALA A CB   5  
ATOM 5579  H H    . ALA A 1 69 ? 10.363 -1.751  10.050 1.00 0.00 ? 69 ALA A H    5  
ATOM 5580  H HA   . ALA A 1 69 ? 10.581 -4.497  10.446 1.00 0.00 ? 69 ALA A HA   5  
ATOM 5581  H HB1  . ALA A 1 69 ? 9.028  -3.999  11.947 1.00 0.00 ? 69 ALA A HB1  5  
ATOM 5582  H HB2  . ALA A 1 69 ? 8.777  -2.424  11.193 1.00 0.00 ? 69 ALA A HB2  5  
ATOM 5583  H HB3  . ALA A 1 69 ? 7.844  -3.820  10.652 1.00 0.00 ? 69 ALA A HB3  5  
ATOM 5584  N N    . VAL A 1 70 ? 8.641  -3.664  7.913  1.00 0.00 ? 70 VAL A N    5  
ATOM 5585  C CA   . VAL A 1 70 ? 8.010  -4.171  6.701  1.00 0.00 ? 70 VAL A CA   5  
ATOM 5586  C C    . VAL A 1 70 ? 9.042  -4.772  5.754  1.00 0.00 ? 70 VAL A C    5  
ATOM 5587  O O    . VAL A 1 70 ? 8.883  -5.896  5.277  1.00 0.00 ? 70 VAL A O    5  
ATOM 5588  C CB   . VAL A 1 70 ? 7.238  -3.060  5.964  1.00 0.00 ? 70 VAL A CB   5  
ATOM 5589  C CG1  . VAL A 1 70 ? 6.614  -3.602  4.687  1.00 0.00 ? 70 VAL A CG1  5  
ATOM 5590  C CG2  . VAL A 1 70 ? 6.176  -2.458  6.872  1.00 0.00 ? 70 VAL A CG2  5  
ATOM 5591  H H    . VAL A 1 70 ? 8.609  -2.703  8.103  1.00 0.00 ? 70 VAL A H    5  
ATOM 5592  H HA   . VAL A 1 70 ? 7.307  -4.940  6.988  1.00 0.00 ? 70 VAL A HA   5  
ATOM 5593  H HB   . VAL A 1 70 ? 7.936  -2.282  5.695  1.00 0.00 ? 70 VAL A HB   5  
ATOM 5594  H HG11 . VAL A 1 70 ? 7.392  -3.974  4.036  1.00 0.00 ? 70 VAL A HG11 5  
ATOM 5595  H HG12 . VAL A 1 70 ? 5.931  -4.403  4.930  1.00 0.00 ? 70 VAL A HG12 5  
ATOM 5596  H HG13 . VAL A 1 70 ? 6.076  -2.810  4.186  1.00 0.00 ? 70 VAL A HG13 5  
ATOM 5597  H HG21 . VAL A 1 70 ? 5.199  -2.779  6.544  1.00 0.00 ? 70 VAL A HG21 5  
ATOM 5598  H HG22 . VAL A 1 70 ? 6.341  -2.787  7.888  1.00 0.00 ? 70 VAL A HG22 5  
ATOM 5599  H HG23 . VAL A 1 70 ? 6.234  -1.380  6.829  1.00 0.00 ? 70 VAL A HG23 5  
ATOM 5600  N N    . LYS A 1 71 ? 10.101 -4.016  5.485  1.00 0.00 ? 71 LYS A N    5  
ATOM 5601  C CA   . LYS A 1 71 ? 11.162 -4.473  4.595  1.00 0.00 ? 71 LYS A CA   5  
ATOM 5602  C C    . LYS A 1 71 ? 11.801 -5.753  5.125  1.00 0.00 ? 71 LYS A C    5  
ATOM 5603  O O    . LYS A 1 71 ? 12.273 -6.588  4.353  1.00 0.00 ? 71 LYS A O    5  
ATOM 5604  C CB   . LYS A 1 71 ? 12.227 -3.386  4.437  1.00 0.00 ? 71 LYS A CB   5  
ATOM 5605  C CG   . LYS A 1 71 ? 11.832 -2.285  3.468  1.00 0.00 ? 71 LYS A CG   5  
ATOM 5606  C CD   . LYS A 1 71 ? 12.747 -1.078  3.592  1.00 0.00 ? 71 LYS A CD   5  
ATOM 5607  C CE   . LYS A 1 71 ? 12.265 0.078   2.730  1.00 0.00 ? 71 LYS A CE   5  
ATOM 5608  N NZ   . LYS A 1 71 ? 13.251 1.193   2.696  1.00 0.00 ? 71 LYS A NZ   5  
ATOM 5609  H H    . LYS A 1 71 ? 10.171 -3.128  5.895  1.00 0.00 ? 71 LYS A H    5  
ATOM 5610  H HA   . LYS A 1 71 ? 10.721 -4.678  3.631  1.00 0.00 ? 71 LYS A HA   5  
ATOM 5611  H HB2  . LYS A 1 71 ? 12.413 -2.938  5.402  1.00 0.00 ? 71 LYS A HB2  5  
ATOM 5612  H HB3  . LYS A 1 71 ? 13.139 -3.842  4.079  1.00 0.00 ? 71 LYS A HB3  5  
ATOM 5613  H HG2  . LYS A 1 71 ? 11.893 -2.666  2.459  1.00 0.00 ? 71 LYS A HG2  5  
ATOM 5614  H HG3  . LYS A 1 71 ? 10.817 -1.979  3.679  1.00 0.00 ? 71 LYS A HG3  5  
ATOM 5615  H HD2  . LYS A 1 71 ? 12.769 -0.758  4.624  1.00 0.00 ? 71 LYS A HD2  5  
ATOM 5616  H HD3  . LYS A 1 71 ? 13.743 -1.359  3.280  1.00 0.00 ? 71 LYS A HD3  5  
ATOM 5617  H HE2  . LYS A 1 71 ? 12.106 -0.281  1.725  1.00 0.00 ? 71 LYS A HE2  5  
ATOM 5618  H HE3  . LYS A 1 71 ? 11.333 0.446   3.132  1.00 0.00 ? 71 LYS A HE3  5  
ATOM 5619  H HZ1  . LYS A 1 71 ? 12.844 2.044   3.135  1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 5620  H HZ2  . LYS A 1 71 ? 13.507 1.414   1.712  1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 5621  H HZ3  . LYS A 1 71 ? 14.112 0.926   3.215  1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 5622  N N    . PHE A 1 72 ? 11.813 -5.901  6.445  1.00 0.00 ? 72 PHE A N    5  
ATOM 5623  C CA   . PHE A 1 72 ? 12.394 -7.080  7.077  1.00 0.00 ? 72 PHE A CA   5  
ATOM 5624  C C    . PHE A 1 72 ? 11.510 -8.304  6.862  1.00 0.00 ? 72 PHE A C    5  
ATOM 5625  O O    . PHE A 1 72 ? 11.966 -9.331  6.358  1.00 0.00 ? 72 PHE A O    5  
ATOM 5626  C CB   . PHE A 1 72 ? 12.591 -6.836  8.575  1.00 0.00 ? 72 PHE A CB   5  
ATOM 5627  C CG   . PHE A 1 72 ? 13.873 -7.406  9.112  1.00 0.00 ? 72 PHE A CG   5  
ATOM 5628  C CD1  . PHE A 1 72 ? 14.266 -8.692  8.781  1.00 0.00 ? 72 PHE A CD1  5  
ATOM 5629  C CD2  . PHE A 1 72 ? 14.685 -6.654  9.945  1.00 0.00 ? 72 PHE A CD2  5  
ATOM 5630  C CE1  . PHE A 1 72 ? 15.445 -9.219  9.274  1.00 0.00 ? 72 PHE A CE1  5  
ATOM 5631  C CE2  . PHE A 1 72 ? 15.866 -7.175  10.441 1.00 0.00 ? 72 PHE A CE2  5  
ATOM 5632  C CZ   . PHE A 1 72 ? 16.246 -8.459  10.104 1.00 0.00 ? 72 PHE A CZ   5  
ATOM 5633  H H    . PHE A 1 72 ? 11.421 -5.200  7.008  1.00 0.00 ? 72 PHE A H    5  
ATOM 5634  H HA   . PHE A 1 72 ? 13.355 -7.259  6.621  1.00 0.00 ? 72 PHE A HA   5  
ATOM 5635  H HB2  . PHE A 1 72 ? 12.597 -5.773  8.762  1.00 0.00 ? 72 PHE A HB2  5  
ATOM 5636  H HB3  . PHE A 1 72 ? 11.773 -7.288  9.116  1.00 0.00 ? 72 PHE A HB3  5  
ATOM 5637  H HD1  . PHE A 1 72 ? 13.642 -9.288  8.132  1.00 0.00 ? 72 PHE A HD1  5  
ATOM 5638  H HD2  . PHE A 1 72 ? 14.388 -5.649  10.210 1.00 0.00 ? 72 PHE A HD2  5  
ATOM 5639  H HE1  . PHE A 1 72 ? 15.741 -10.223 9.009  1.00 0.00 ? 72 PHE A HE1  5  
ATOM 5640  H HE2  . PHE A 1 72 ? 16.489 -6.578  11.090 1.00 0.00 ? 72 PHE A HE2  5  
ATOM 5641  H HZ   . PHE A 1 72 ? 17.168 -8.868  10.491 1.00 0.00 ? 72 PHE A HZ   5  
ATOM 5642  N N    . ILE A 1 73 ? 10.244 -8.188  7.248  1.00 0.00 ? 73 ILE A N    5  
ATOM 5643  C CA   . ILE A 1 73 ? 9.296  -9.284  7.096  1.00 0.00 ? 73 ILE A CA   5  
ATOM 5644  C C    . ILE A 1 73 ? 9.186  -9.719  5.639  1.00 0.00 ? 73 ILE A C    5  
ATOM 5645  O O    . ILE A 1 73 ? 9.045  -10.906 5.343  1.00 0.00 ? 73 ILE A O    5  
ATOM 5646  C CB   . ILE A 1 73 ? 7.897  -8.895  7.611  1.00 0.00 ? 73 ILE A CB   5  
ATOM 5647  C CG1  . ILE A 1 73 ? 7.969  -8.479  9.082  1.00 0.00 ? 73 ILE A CG1  5  
ATOM 5648  C CG2  . ILE A 1 73 ? 6.925  -10.051 7.429  1.00 0.00 ? 73 ILE A CG2  5  
ATOM 5649  C CD1  . ILE A 1 73 ? 6.770  -7.680  9.543  1.00 0.00 ? 73 ILE A CD1  5  
ATOM 5650  H H    . ILE A 1 73 ? 9.940  -7.344  7.642  1.00 0.00 ? 73 ILE A H    5  
ATOM 5651  H HA   . ILE A 1 73 ? 9.654  -10.118 7.683  1.00 0.00 ? 73 ILE A HA   5  
ATOM 5652  H HB   . ILE A 1 73 ? 7.542  -8.061  7.025  1.00 0.00 ? 73 ILE A HB   5  
ATOM 5653  H HG12 . ILE A 1 73 ? 8.034  -9.363  9.697  1.00 0.00 ? 73 ILE A HG12 5  
ATOM 5654  H HG13 . ILE A 1 73 ? 8.851  -7.873  9.234  1.00 0.00 ? 73 ILE A HG13 5  
ATOM 5655  H HG21 . ILE A 1 73 ? 6.520  -10.336 8.389  1.00 0.00 ? 73 ILE A HG21 5  
ATOM 5656  H HG22 . ILE A 1 73 ? 6.120  -9.744  6.777  1.00 0.00 ? 73 ILE A HG22 5  
ATOM 5657  H HG23 . ILE A 1 73 ? 7.442  -10.891 6.992  1.00 0.00 ? 73 ILE A HG23 5  
ATOM 5658  H HD11 . ILE A 1 73 ? 6.602  -6.857  8.863  1.00 0.00 ? 73 ILE A HD11 5  
ATOM 5659  H HD12 . ILE A 1 73 ? 5.898  -8.316  9.562  1.00 0.00 ? 73 ILE A HD12 5  
ATOM 5660  H HD13 . ILE A 1 73 ? 6.955  -7.293  10.535 1.00 0.00 ? 73 ILE A HD13 5  
ATOM 5661  N N    . ASP A 1 74 ? 9.252  -8.750  4.732  1.00 0.00 ? 74 ASP A N    5  
ATOM 5662  C CA   . ASP A 1 74 ? 9.163  -9.033  3.304  1.00 0.00 ? 74 ASP A CA   5  
ATOM 5663  C C    . ASP A 1 74 ? 10.430 -9.721  2.806  1.00 0.00 ? 74 ASP A C    5  
ATOM 5664  O O    . ASP A 1 74 ? 10.366 -10.740 2.117  1.00 0.00 ? 74 ASP A O    5  
ATOM 5665  C CB   . ASP A 1 74 ? 8.928  -7.740  2.521  1.00 0.00 ? 74 ASP A CB   5  
ATOM 5666  C CG   . ASP A 1 74 ? 8.358  -7.995  1.140  1.00 0.00 ? 74 ASP A CG   5  
ATOM 5667  O OD1  . ASP A 1 74 ? 7.825  -9.102  0.914  1.00 0.00 ? 74 ASP A OD1  5  
ATOM 5668  O OD2  . ASP A 1 74 ? 8.444  -7.089  0.284  1.00 0.00 ? 74 ASP A OD2  5  
ATOM 5669  H H    . ASP A 1 74 ? 9.364  -7.823  5.030  1.00 0.00 ? 74 ASP A H    5  
ATOM 5670  H HA   . ASP A 1 74 ? 8.324  -9.694  3.148  1.00 0.00 ? 74 ASP A HA   5  
ATOM 5671  H HB2  . ASP A 1 74 ? 8.235  -7.116  3.066  1.00 0.00 ? 74 ASP A HB2  5  
ATOM 5672  H HB3  . ASP A 1 74 ? 9.867  -7.218  2.412  1.00 0.00 ? 74 ASP A HB3  5  
ATOM 5673  N N    . LYS A 1 75 ? 11.580 -9.158  3.158  1.00 0.00 ? 75 LYS A N    5  
ATOM 5674  C CA   . LYS A 1 75 ? 12.863 -9.717  2.748  1.00 0.00 ? 75 LYS A CA   5  
ATOM 5675  C C    . LYS A 1 75 ? 13.086 -11.088 3.378  1.00 0.00 ? 75 LYS A C    5  
ATOM 5676  O O    . LYS A 1 75 ? 13.817 -11.918 2.838  1.00 0.00 ? 75 LYS A O    5  
ATOM 5677  C CB   . LYS A 1 75 ? 14.002 -8.773  3.140  1.00 0.00 ? 75 LYS A CB   5  
ATOM 5678  C CG   . LYS A 1 75 ? 14.231 -7.649  2.145  1.00 0.00 ? 75 LYS A CG   5  
ATOM 5679  C CD   . LYS A 1 75 ? 15.540 -6.925  2.412  1.00 0.00 ? 75 LYS A CD   5  
ATOM 5680  C CE   . LYS A 1 75 ? 16.729 -7.705  1.873  1.00 0.00 ? 75 LYS A CE   5  
ATOM 5681  N NZ   . LYS A 1 75 ? 16.845 -7.586  0.393  1.00 0.00 ? 75 LYS A NZ   5  
ATOM 5682  H H    . LYS A 1 75 ? 11.566 -8.347  3.709  1.00 0.00 ? 75 LYS A H    5  
ATOM 5683  H HA   . LYS A 1 75 ? 12.850 -9.825  1.674  1.00 0.00 ? 75 LYS A HA   5  
ATOM 5684  H HB2  . LYS A 1 75 ? 13.776 -8.335  4.101  1.00 0.00 ? 75 LYS A HB2  5  
ATOM 5685  H HB3  . LYS A 1 75 ? 14.916 -9.345  3.221  1.00 0.00 ? 75 LYS A HB3  5  
ATOM 5686  H HG2  . LYS A 1 75 ? 14.259 -8.063  1.148  1.00 0.00 ? 75 LYS A HG2  5  
ATOM 5687  H HG3  . LYS A 1 75 ? 13.417 -6.942  2.220  1.00 0.00 ? 75 LYS A HG3  5  
ATOM 5688  H HD2  . LYS A 1 75 ? 15.511 -5.958  1.933  1.00 0.00 ? 75 LYS A HD2  5  
ATOM 5689  H HD3  . LYS A 1 75 ? 15.658 -6.796  3.479  1.00 0.00 ? 75 LYS A HD3  5  
ATOM 5690  H HE2  . LYS A 1 75 ? 17.630 -7.322  2.328  1.00 0.00 ? 75 LYS A HE2  5  
ATOM 5691  H HE3  . LYS A 1 75 ? 16.608 -8.746  2.134  1.00 0.00 ? 75 LYS A HE3  5  
ATOM 5692  H HZ1  . LYS A 1 75 ? 17.325 -8.423  0.005  1.00 0.00 ? 75 LYS A HZ1  5  
ATOM 5693  H HZ2  . LYS A 1 75 ? 17.395 -6.739  0.145  1.00 0.00 ? 75 LYS A HZ2  5  
ATOM 5694  H HZ3  . LYS A 1 75 ? 15.901 -7.512  -0.035 1.00 0.00 ? 75 LYS A HZ3  5  
ATOM 5695  N N    . ALA A 1 76 ? 12.449 -11.320 4.521  1.00 0.00 ? 76 ALA A N    5  
ATOM 5696  C CA   . ALA A 1 76 ? 12.575 -12.592 5.221  1.00 0.00 ? 76 ALA A CA   5  
ATOM 5697  C C    . ALA A 1 76 ? 11.545 -13.599 4.720  1.00 0.00 ? 76 ALA A C    5  
ATOM 5698  O O    . ALA A 1 76 ? 11.746 -14.809 4.822  1.00 0.00 ? 76 ALA A O    5  
ATOM 5699  C CB   . ALA A 1 76 ? 12.427 -12.386 6.721  1.00 0.00 ? 76 ALA A CB   5  
ATOM 5700  H H    . ALA A 1 76 ? 11.880 -10.619 4.902  1.00 0.00 ? 76 ALA A H    5  
ATOM 5701  H HA   . ALA A 1 76 ? 13.565 -12.981 5.032  1.00 0.00 ? 76 ALA A HA   5  
ATOM 5702  H HB1  . ALA A 1 76 ? 12.300 -13.343 7.205  1.00 0.00 ? 76 ALA A HB1  5  
ATOM 5703  H HB2  . ALA A 1 76 ? 13.311 -11.901 7.107  1.00 0.00 ? 76 ALA A HB2  5  
ATOM 5704  H HB3  . ALA A 1 76 ? 11.563 -11.767 6.916  1.00 0.00 ? 76 ALA A HB3  5  
ATOM 5705  N N    . SER A 1 77 ? 10.443 -13.091 4.178  1.00 0.00 ? 77 SER A N    5  
ATOM 5706  C CA   . SER A 1 77 ? 9.380  -13.947 3.665  1.00 0.00 ? 77 SER A CA   5  
ATOM 5707  C C    . SER A 1 77 ? 9.908  -14.875 2.575  1.00 0.00 ? 77 SER A C    5  
ATOM 5708  O O    . SER A 1 77 ? 9.400  -15.980 2.385  1.00 0.00 ? 77 SER A O    5  
ATOM 5709  C CB   . SER A 1 77 ? 8.233  -13.097 3.115  1.00 0.00 ? 77 SER A CB   5  
ATOM 5710  O OG   . SER A 1 77 ? 8.550  -12.579 1.835  1.00 0.00 ? 77 SER A OG   5  
ATOM 5711  H H    . SER A 1 77 ? 10.341 -12.118 4.125  1.00 0.00 ? 77 SER A H    5  
ATOM 5712  H HA   . SER A 1 77 ? 9.012  -14.546 4.484  1.00 0.00 ? 77 SER A HA   5  
ATOM 5713  H HB2  . SER A 1 77 ? 7.344  -13.705 3.034  1.00 0.00 ? 77 SER A HB2  5  
ATOM 5714  H HB3  . SER A 1 77 ? 8.045  -12.272 3.788  1.00 0.00 ? 77 SER A HB3  5  
ATOM 5715  H HG   . SER A 1 77 ? 8.729  -11.638 1.905  1.00 0.00 ? 77 SER A HG   5  
ATOM 5716  N N    . ALA A 1 78 ? 10.931 -14.417 1.861  1.00 0.00 ? 78 ALA A N    5  
ATOM 5717  C CA   . ALA A 1 78 ? 11.530 -15.205 0.791  1.00 0.00 ? 78 ALA A CA   5  
ATOM 5718  C C    . ALA A 1 78 ? 13.049 -15.074 0.797  1.00 0.00 ? 78 ALA A C    5  
ATOM 5719  O O    . ALA A 1 78 ? 13.587 -13.978 0.633  1.00 0.00 ? 78 ALA A O    5  
ATOM 5720  C CB   . ALA A 1 78 ? 10.966 -14.780 -0.557 1.00 0.00 ? 78 ALA A CB   5  
ATOM 5721  H H    . ALA A 1 78 ? 11.292 -13.528 2.059  1.00 0.00 ? 78 ALA A H    5  
ATOM 5722  H HA   . ALA A 1 78 ? 11.267 -16.241 0.953  1.00 0.00 ? 78 ALA A HA   5  
ATOM 5723  H HB1  . ALA A 1 78 ? 11.635 -14.067 -1.017 1.00 0.00 ? 78 ALA A HB1  5  
ATOM 5724  H HB2  . ALA A 1 78 ? 10.868 -15.646 -1.195 1.00 0.00 ? 78 ALA A HB2  5  
ATOM 5725  H HB3  . ALA A 1 78 ? 9.997  -14.326 -0.415 1.00 0.00 ? 78 ALA A HB3  5  
ATOM 5726  N N    . MET A 1 1  ? -0.173 -1.191  -4.489 1.00 0.00 ? 1  MET A N    6  
ATOM 5727  C CA   . MET A 1 1  ? 0.829  -2.197  -4.822 1.00 0.00 ? 1  MET A CA   6  
ATOM 5728  C C    . MET A 1 1  ? 1.627  -2.599  -3.585 1.00 0.00 ? 1  MET A C    6  
ATOM 5729  O O    . MET A 1 1  ? 2.845  -2.771  -3.650 1.00 0.00 ? 1  MET A O    6  
ATOM 5730  C CB   . MET A 1 1  ? 1.773  -1.669  -5.904 1.00 0.00 ? 1  MET A CB   6  
ATOM 5731  C CG   . MET A 1 1  ? 2.544  -0.428  -5.484 1.00 0.00 ? 1  MET A CG   6  
ATOM 5732  S SD   . MET A 1 1  ? 1.678  1.099   -5.894 1.00 0.00 ? 1  MET A SD   6  
ATOM 5733  C CE   . MET A 1 1  ? 3.041  2.126   -6.438 1.00 0.00 ? 1  MET A CE   6  
ATOM 5734  H H1   . MET A 1 1  ? -0.851 -0.954  -5.156 1.00 0.00 ? 1  MET A H1   6  
ATOM 5735  H HA   . MET A 1 1  ? 0.313  -3.066  -5.200 1.00 0.00 ? 1  MET A HA   6  
ATOM 5736  H HB2  . MET A 1 1  ? 2.485  -2.442  -6.152 1.00 0.00 ? 1  MET A HB2  6  
ATOM 5737  H HB3  . MET A 1 1  ? 1.195  -1.427  -6.783 1.00 0.00 ? 1  MET A HB3  6  
ATOM 5738  H HG2  . MET A 1 1  ? 2.701  -0.461  -4.416 1.00 0.00 ? 1  MET A HG2  6  
ATOM 5739  H HG3  . MET A 1 1  ? 3.501  -0.430  -5.986 1.00 0.00 ? 1  MET A HG3  6  
ATOM 5740  H HE1  . MET A 1 1  ? 3.854  1.498   -6.772 1.00 0.00 ? 1  MET A HE1  6  
ATOM 5741  H HE2  . MET A 1 1  ? 2.714  2.755   -7.253 1.00 0.00 ? 1  MET A HE2  6  
ATOM 5742  H HE3  . MET A 1 1  ? 3.377  2.743   -5.618 1.00 0.00 ? 1  MET A HE3  6  
ATOM 5743  N N    . SER A 1 2  ? 0.934  -2.746  -2.461 1.00 0.00 ? 2  SER A N    6  
ATOM 5744  C CA   . SER A 1 2  ? 1.580  -3.123  -1.209 1.00 0.00 ? 2  SER A CA   6  
ATOM 5745  C C    . SER A 1 2  ? 0.962  -4.397  -0.642 1.00 0.00 ? 2  SER A C    6  
ATOM 5746  O O    . SER A 1 2  ? -0.168 -4.389  -0.154 1.00 0.00 ? 2  SER A O    6  
ATOM 5747  C CB   . SER A 1 2  ? 1.464  -1.989  -0.189 1.00 0.00 ? 2  SER A CB   6  
ATOM 5748  O OG   . SER A 1 2  ? 0.188  -1.376  -0.250 1.00 0.00 ? 2  SER A OG   6  
ATOM 5749  H H    . SER A 1 2  ? -0.034 -2.594  -2.473 1.00 0.00 ? 2  SER A H    6  
ATOM 5750  H HA   . SER A 1 2  ? 2.624  -3.304  -1.416 1.00 0.00 ? 2  SER A HA   6  
ATOM 5751  H HB2  . SER A 1 2  ? 1.613  -2.384  0.804  1.00 0.00 ? 2  SER A HB2  6  
ATOM 5752  H HB3  . SER A 1 2  ? 2.219  -1.243  -0.396 1.00 0.00 ? 2  SER A HB3  6  
ATOM 5753  H HG   . SER A 1 2  ? -0.016 -0.975  0.598  1.00 0.00 ? 2  SER A HG   6  
ATOM 5754  N N    . ASP A 1 3  ? 1.712  -5.491  -0.709 1.00 0.00 ? 3  ASP A N    6  
ATOM 5755  C CA   . ASP A 1 3  ? 1.240  -6.775  -0.201 1.00 0.00 ? 3  ASP A CA   6  
ATOM 5756  C C    . ASP A 1 3  ? 1.677  -6.981  1.246  1.00 0.00 ? 3  ASP A C    6  
ATOM 5757  O O    . ASP A 1 3  ? 0.845  -7.096  2.147  1.00 0.00 ? 3  ASP A O    6  
ATOM 5758  C CB   . ASP A 1 3  ? 1.766  -7.916  -1.073 1.00 0.00 ? 3  ASP A CB   6  
ATOM 5759  C CG   . ASP A 1 3  ? 1.166  -9.257  -0.695 1.00 0.00 ? 3  ASP A CG   6  
ATOM 5760  O OD1  . ASP A 1 3  ? 0.333  -9.292  0.235  1.00 0.00 ? 3  ASP A OD1  6  
ATOM 5761  O OD2  . ASP A 1 3  ? 1.531  -10.270 -1.327 1.00 0.00 ? 3  ASP A OD2  6  
ATOM 5762  H H    . ASP A 1 3  ? 2.606  -5.435  -1.109 1.00 0.00 ? 3  ASP A H    6  
ATOM 5763  H HA   . ASP A 1 3  ? 0.162  -6.771  -0.241 1.00 0.00 ? 3  ASP A HA   6  
ATOM 5764  H HB2  . ASP A 1 3  ? 1.523  -7.713  -2.106 1.00 0.00 ? 3  ASP A HB2  6  
ATOM 5765  H HB3  . ASP A 1 3  ? 2.839  -7.979  -0.965 1.00 0.00 ? 3  ASP A HB3  6  
ATOM 5766  N N    . THR A 1 4  ? 2.988  -7.026  1.462  1.00 0.00 ? 4  THR A N    6  
ATOM 5767  C CA   . THR A 1 4  ? 3.535  -7.221  2.799  1.00 0.00 ? 4  THR A CA   6  
ATOM 5768  C C    . THR A 1 4  ? 3.240  -6.022  3.694  1.00 0.00 ? 4  THR A C    6  
ATOM 5769  O O    . THR A 1 4  ? 2.790  -6.179  4.829  1.00 0.00 ? 4  THR A O    6  
ATOM 5770  C CB   . THR A 1 4  ? 5.058  -7.450  2.755  1.00 0.00 ? 4  THR A CB   6  
ATOM 5771  O OG1  . THR A 1 4  ? 5.358  -8.592  1.945  1.00 0.00 ? 4  THR A OG1  6  
ATOM 5772  C CG2  . THR A 1 4  ? 5.615  -7.655  4.155  1.00 0.00 ? 4  THR A CG2  6  
ATOM 5773  H H    . THR A 1 4  ? 3.600  -6.928  0.704  1.00 0.00 ? 4  THR A H    6  
ATOM 5774  H HA   . THR A 1 4  ? 3.072  -8.099  3.225  1.00 0.00 ? 4  THR A HA   6  
ATOM 5775  H HB   . THR A 1 4  ? 5.526  -6.578  2.321  1.00 0.00 ? 4  THR A HB   6  
ATOM 5776  H HG1  . THR A 1 4  ? 4.735  -9.297  2.142  1.00 0.00 ? 4  THR A HG1  6  
ATOM 5777  H HG21 . THR A 1 4  ? 6.140  -8.598  4.200  1.00 0.00 ? 4  THR A HG21 6  
ATOM 5778  H HG22 . THR A 1 4  ? 4.804  -7.660  4.868  1.00 0.00 ? 4  THR A HG22 6  
ATOM 5779  H HG23 . THR A 1 4  ? 6.298  -6.853  4.391  1.00 0.00 ? 4  THR A HG23 6  
ATOM 5780  N N    . ALA A 1 5  ? 3.494  -4.826  3.175  1.00 0.00 ? 5  ALA A N    6  
ATOM 5781  C CA   . ALA A 1 5  ? 3.252  -3.600  3.927  1.00 0.00 ? 5  ALA A CA   6  
ATOM 5782  C C    . ALA A 1 5  ? 1.830  -3.565  4.477  1.00 0.00 ? 5  ALA A C    6  
ATOM 5783  O O    . ALA A 1 5  ? 1.619  -3.298  5.659  1.00 0.00 ? 5  ALA A O    6  
ATOM 5784  C CB   . ALA A 1 5  ? 3.511  -2.384  3.051  1.00 0.00 ? 5  ALA A CB   6  
ATOM 5785  H H    . ALA A 1 5  ? 3.852  -4.765  2.265  1.00 0.00 ? 5  ALA A H    6  
ATOM 5786  H HA   . ALA A 1 5  ? 3.948  -3.573  4.754  1.00 0.00 ? 5  ALA A HA   6  
ATOM 5787  H HB1  . ALA A 1 5  ? 4.309  -1.795  3.480  1.00 0.00 ? 5  ALA A HB1  6  
ATOM 5788  H HB2  . ALA A 1 5  ? 3.795  -2.707  2.061  1.00 0.00 ? 5  ALA A HB2  6  
ATOM 5789  H HB3  . ALA A 1 5  ? 2.614  -1.786  2.992  1.00 0.00 ? 5  ALA A HB3  6  
ATOM 5790  N N    . GLU A 1 6  ? 0.859  -3.837  3.611  1.00 0.00 ? 6  GLU A N    6  
ATOM 5791  C CA   . GLU A 1 6  ? -0.543 -3.834  4.011  1.00 0.00 ? 6  GLU A CA   6  
ATOM 5792  C C    . GLU A 1 6  ? -0.760 -4.713  5.240  1.00 0.00 ? 6  GLU A C    6  
ATOM 5793  O O    . GLU A 1 6  ? -1.443 -4.319  6.185  1.00 0.00 ? 6  GLU A O    6  
ATOM 5794  C CB   . GLU A 1 6  ? -1.426 -4.321  2.860  1.00 0.00 ? 6  GLU A CB   6  
ATOM 5795  C CG   . GLU A 1 6  ? -1.860 -3.214  1.915  1.00 0.00 ? 6  GLU A CG   6  
ATOM 5796  C CD   . GLU A 1 6  ? -2.739 -2.180  2.592  1.00 0.00 ? 6  GLU A CD   6  
ATOM 5797  O OE1  . GLU A 1 6  ? -3.912 -2.495  2.879  1.00 0.00 ? 6  GLU A OE1  6  
ATOM 5798  O OE2  . GLU A 1 6  ? -2.252 -1.056  2.834  1.00 0.00 ? 6  GLU A OE2  6  
ATOM 5799  H H    . GLU A 1 6  ? 1.090  -4.043  2.681  1.00 0.00 ? 6  GLU A H    6  
ATOM 5800  H HA   . GLU A 1 6  ? -0.816 -2.819  4.257  1.00 0.00 ? 6  GLU A HA   6  
ATOM 5801  H HB2  . GLU A 1 6  ? -0.881 -5.060  2.291  1.00 0.00 ? 6  GLU A HB2  6  
ATOM 5802  H HB3  . GLU A 1 6  ? -2.312 -4.781  3.273  1.00 0.00 ? 6  GLU A HB3  6  
ATOM 5803  H HG2  . GLU A 1 6  ? -0.980 -2.720  1.532  1.00 0.00 ? 6  GLU A HG2  6  
ATOM 5804  H HG3  . GLU A 1 6  ? -2.410 -3.652  1.096  1.00 0.00 ? 6  GLU A HG3  6  
ATOM 5805  N N    . ARG A 1 7  ? -0.174 -5.906  5.218  1.00 0.00 ? 7  ARG A N    6  
ATOM 5806  C CA   . ARG A 1 7  ? -0.304 -6.841  6.328  1.00 0.00 ? 7  ARG A CA   6  
ATOM 5807  C C    . ARG A 1 7  ? 0.306  -6.262  7.601  1.00 0.00 ? 7  ARG A C    6  
ATOM 5808  O O    . ARG A 1 7  ? -0.360 -6.160  8.631  1.00 0.00 ? 7  ARG A O    6  
ATOM 5809  C CB   . ARG A 1 7  ? 0.372  -8.170  5.985  1.00 0.00 ? 7  ARG A CB   6  
ATOM 5810  C CG   . ARG A 1 7  ? -0.471 -9.070  5.097  1.00 0.00 ? 7  ARG A CG   6  
ATOM 5811  C CD   . ARG A 1 7  ? -1.362 -9.988  5.919  1.00 0.00 ? 7  ARG A CD   6  
ATOM 5812  N NE   . ARG A 1 7  ? -2.459 -10.539 5.127  1.00 0.00 ? 7  ARG A NE   6  
ATOM 5813  C CZ   . ARG A 1 7  ? -3.182 -11.588 5.503  1.00 0.00 ? 7  ARG A CZ   6  
ATOM 5814  N NH1  . ARG A 1 7  ? -2.926 -12.196 6.653  1.00 0.00 ? 7  ARG A NH1  6  
ATOM 5815  N NH2  . ARG A 1 7  ? -4.164 -12.030 4.729  1.00 0.00 ? 7  ARG A NH2  6  
ATOM 5816  H H    . ARG A 1 7  ? 0.358  -6.163  4.436  1.00 0.00 ? 7  ARG A H    6  
ATOM 5817  H HA   . ARG A 1 7  ? -1.356 -7.015  6.495  1.00 0.00 ? 7  ARG A HA   6  
ATOM 5818  H HB2  . ARG A 1 7  ? 1.302  -7.967  5.475  1.00 0.00 ? 7  ARG A HB2  6  
ATOM 5819  H HB3  . ARG A 1 7  ? 0.583  -8.700  6.902  1.00 0.00 ? 7  ARG A HB3  6  
ATOM 5820  H HG2  . ARG A 1 7  ? -1.093 -8.455  4.463  1.00 0.00 ? 7  ARG A HG2  6  
ATOM 5821  H HG3  . ARG A 1 7  ? 0.185  -9.672  4.485  1.00 0.00 ? 7  ARG A HG3  6  
ATOM 5822  H HD2  . ARG A 1 7  ? -0.763 -10.801 6.301  1.00 0.00 ? 7  ARG A HD2  6  
ATOM 5823  H HD3  . ARG A 1 7  ? -1.772 -9.425  6.744  1.00 0.00 ? 7  ARG A HD3  6  
ATOM 5824  H HE   . ARG A 1 7  ? -2.665 -10.104 4.274  1.00 0.00 ? 7  ARG A HE   6  
ATOM 5825  H HH11 . ARG A 1 7  ? -2.187 -11.864 7.240  1.00 0.00 ? 7  ARG A HH11 6  
ATOM 5826  H HH12 . ARG A 1 7  ? -3.472 -12.985 6.935  1.00 0.00 ? 7  ARG A HH12 6  
ATOM 5827  H HH21 . ARG A 1 7  ? -4.361 -11.574 3.861  1.00 0.00 ? 7  ARG A HH21 6  
ATOM 5828  H HH22 . ARG A 1 7  ? -4.708 -12.819 5.012  1.00 0.00 ? 7  ARG A HH22 6  
ATOM 5829  N N    . VAL A 1 8  ? 1.579  -5.885  7.523  1.00 0.00 ? 8  VAL A N    6  
ATOM 5830  C CA   . VAL A 1 8  ? 2.279  -5.315  8.669  1.00 0.00 ? 8  VAL A CA   6  
ATOM 5831  C C    . VAL A 1 8  ? 1.492  -4.158  9.274  1.00 0.00 ? 8  VAL A C    6  
ATOM 5832  O O    . VAL A 1 8  ? 1.180  -4.161  10.465 1.00 0.00 ? 8  VAL A O    6  
ATOM 5833  C CB   . VAL A 1 8  ? 3.683  -4.818  8.277  1.00 0.00 ? 8  VAL A CB   6  
ATOM 5834  C CG1  . VAL A 1 8  ? 4.388  -4.208  9.479  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 5835  C CG2  . VAL A 1 8  ? 4.505  -5.954  7.687  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 5836  H H    . VAL A 1 8  ? 2.058  -5.991  6.675  1.00 0.00 ? 8  VAL A H    6  
ATOM 5837  H HA   . VAL A 1 8  ? 2.389  -6.091  9.412  1.00 0.00 ? 8  VAL A HA   6  
ATOM 5838  H HB   . VAL A 1 8  ? 3.574  -4.051  7.524  1.00 0.00 ? 8  VAL A HB   6  
ATOM 5839  H HG11 . VAL A 1 8  ? 3.863  -4.484  10.382 1.00 0.00 ? 8  VAL A HG11 6  
ATOM 5840  H HG12 . VAL A 1 8  ? 5.403  -4.572  9.525  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 5841  H HG13 . VAL A 1 8  ? 4.395  -3.132  9.384  1.00 0.00 ? 8  VAL A HG13 6  
ATOM 5842  H HG21 . VAL A 1 8  ? 4.450  -6.813  8.339  1.00 0.00 ? 8  VAL A HG21 6  
ATOM 5843  H HG22 . VAL A 1 8  ? 4.113  -6.215  6.714  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 5844  H HG23 . VAL A 1 8  ? 5.534  -5.641  7.588  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 5845  N N    . LYS A 1 9  ? 1.173  -3.170  8.446  1.00 0.00 ? 9  LYS A N    6  
ATOM 5846  C CA   . LYS A 1 9  ? 0.421  -2.005  8.897  1.00 0.00 ? 9  LYS A CA   6  
ATOM 5847  C C    . LYS A 1 9  ? -0.874 -2.427  9.585  1.00 0.00 ? 9  LYS A C    6  
ATOM 5848  O O    . LYS A 1 9  ? -1.189 -1.960  10.679 1.00 0.00 ? 9  LYS A O    6  
ATOM 5849  C CB   . LYS A 1 9  ? 0.107  -1.085  7.715  1.00 0.00 ? 9  LYS A CB   6  
ATOM 5850  C CG   . LYS A 1 9  ? 1.339  -0.643  6.945  1.00 0.00 ? 9  LYS A CG   6  
ATOM 5851  C CD   . LYS A 1 9  ? 1.001  -0.295  5.505  1.00 0.00 ? 9  LYS A CD   6  
ATOM 5852  C CE   . LYS A 1 9  ? 2.031  0.648   4.902  1.00 0.00 ? 9  LYS A CE   6  
ATOM 5853  N NZ   . LYS A 1 9  ? 1.638  1.102   3.540  1.00 0.00 ? 9  LYS A NZ   6  
ATOM 5854  H H    . LYS A 1 9  ? 1.450  -3.225  7.507  1.00 0.00 ? 9  LYS A H    6  
ATOM 5855  H HA   . LYS A 1 9  ? 1.033  -1.469  9.607  1.00 0.00 ? 9  LYS A HA   6  
ATOM 5856  H HB2  . LYS A 1 9  ? -0.550 -1.606  7.034  1.00 0.00 ? 9  LYS A HB2  6  
ATOM 5857  H HB3  . LYS A 1 9  ? -0.397 -0.204  8.085  1.00 0.00 ? 9  LYS A HB3  6  
ATOM 5858  H HG2  . LYS A 1 9  ? 1.759  0.229   7.425  1.00 0.00 ? 9  LYS A HG2  6  
ATOM 5859  H HG3  . LYS A 1 9  ? 2.064  -1.444  6.952  1.00 0.00 ? 9  LYS A HG3  6  
ATOM 5860  H HD2  . LYS A 1 9  ? 0.976  -1.203  4.920  1.00 0.00 ? 9  LYS A HD2  6  
ATOM 5861  H HD3  . LYS A 1 9  ? 0.030  0.179   5.476  1.00 0.00 ? 9  LYS A HD3  6  
ATOM 5862  H HE2  . LYS A 1 9  ? 2.130  1.509   5.545  1.00 0.00 ? 9  LYS A HE2  6  
ATOM 5863  H HE3  . LYS A 1 9  ? 2.979  0.134   4.842  1.00 0.00 ? 9  LYS A HE3  6  
ATOM 5864  H HZ1  . LYS A 1 9  ? 2.080  0.496   2.820  1.00 0.00 ? 9  LYS A HZ1  6  
ATOM 5865  H HZ2  . LYS A 1 9  ? 1.946  2.083   3.387  1.00 0.00 ? 9  LYS A HZ2  6  
ATOM 5866  H HZ3  . LYS A 1 9  ? 0.604  1.054   3.431  1.00 0.00 ? 9  LYS A HZ3  6  
ATOM 5867  N N    . LYS A 1 10 ? -1.621 -3.314  8.936  1.00 0.00 ? 10 LYS A N    6  
ATOM 5868  C CA   . LYS A 1 10 ? -2.880 -3.802  9.485  1.00 0.00 ? 10 LYS A CA   6  
ATOM 5869  C C    . LYS A 1 10 ? -2.691 -4.311  10.911 1.00 0.00 ? 10 LYS A C    6  
ATOM 5870  O O    . LYS A 1 10 ? -3.401 -3.895  11.827 1.00 0.00 ? 10 LYS A O    6  
ATOM 5871  C CB   . LYS A 1 10 ? -3.446 -4.918  8.604  1.00 0.00 ? 10 LYS A CB   6  
ATOM 5872  C CG   . LYS A 1 10 ? -4.273 -4.411  7.436  1.00 0.00 ? 10 LYS A CG   6  
ATOM 5873  C CD   . LYS A 1 10 ? -4.269 -5.397  6.280  1.00 0.00 ? 10 LYS A CD   6  
ATOM 5874  C CE   . LYS A 1 10 ? -5.327 -6.475  6.464  1.00 0.00 ? 10 LYS A CE   6  
ATOM 5875  N NZ   . LYS A 1 10 ? -6.676 -6.006  6.042  1.00 0.00 ? 10 LYS A NZ   6  
ATOM 5876  H H    . LYS A 1 10 ? -1.317 -3.650  8.066  1.00 0.00 ? 10 LYS A H    6  
ATOM 5877  H HA   . LYS A 1 10 ? -3.577 -2.978  9.499  1.00 0.00 ? 10 LYS A HA   6  
ATOM 5878  H HB2  . LYS A 1 10 ? -2.626 -5.502  8.212  1.00 0.00 ? 10 LYS A HB2  6  
ATOM 5879  H HB3  . LYS A 1 10 ? -4.073 -5.556  9.211  1.00 0.00 ? 10 LYS A HB3  6  
ATOM 5880  H HG2  . LYS A 1 10 ? -5.291 -4.262  7.764  1.00 0.00 ? 10 LYS A HG2  6  
ATOM 5881  H HG3  . LYS A 1 10 ? -3.861 -3.471  7.096  1.00 0.00 ? 10 LYS A HG3  6  
ATOM 5882  H HD2  . LYS A 1 10 ? -4.470 -4.865  5.362  1.00 0.00 ? 10 LYS A HD2  6  
ATOM 5883  H HD3  . LYS A 1 10 ? -3.297 -5.866  6.221  1.00 0.00 ? 10 LYS A HD3  6  
ATOM 5884  H HE2  . LYS A 1 10 ? -5.053 -7.335  5.872  1.00 0.00 ? 10 LYS A HE2  6  
ATOM 5885  H HE3  . LYS A 1 10 ? -5.361 -6.753  7.507  1.00 0.00 ? 10 LYS A HE3  6  
ATOM 5886  H HZ1  . LYS A 1 10 ? -6.666 -4.977  5.896  1.00 0.00 ? 10 LYS A HZ1  6  
ATOM 5887  H HZ2  . LYS A 1 10 ? -7.378 -6.235  6.774  1.00 0.00 ? 10 LYS A HZ2  6  
ATOM 5888  H HZ3  . LYS A 1 10 ? -6.953 -6.469  5.154  1.00 0.00 ? 10 LYS A HZ3  6  
ATOM 5889  N N    . ILE A 1 11 ? -1.731 -5.211  11.090 1.00 0.00 ? 11 ILE A N    6  
ATOM 5890  C CA   . ILE A 1 11 ? -1.448 -5.774  12.405 1.00 0.00 ? 11 ILE A CA   6  
ATOM 5891  C C    . ILE A 1 11 ? -1.041 -4.686  13.393 1.00 0.00 ? 11 ILE A C    6  
ATOM 5892  O O    . ILE A 1 11 ? -1.380 -4.747  14.575 1.00 0.00 ? 11 ILE A O    6  
ATOM 5893  C CB   . ILE A 1 11 ? -0.330 -6.832  12.335 1.00 0.00 ? 11 ILE A CB   6  
ATOM 5894  C CG1  . ILE A 1 11 ? -0.696 -7.927  11.331 1.00 0.00 ? 11 ILE A CG1  6  
ATOM 5895  C CG2  . ILE A 1 11 ? -0.081 -7.429  13.712 1.00 0.00 ? 11 ILE A CG2  6  
ATOM 5896  C CD1  . ILE A 1 11 ? 0.457  -8.845  10.992 1.00 0.00 ? 11 ILE A CD1  6  
ATOM 5897  H H    . ILE A 1 11 ? -1.199 -5.503  10.321 1.00 0.00 ? 11 ILE A H    6  
ATOM 5898  H HA   . ILE A 1 11 ? -2.348 -6.253  12.763 1.00 0.00 ? 11 ILE A HA   6  
ATOM 5899  H HB   . ILE A 1 11 ? 0.576  -6.344  12.011 1.00 0.00 ? 11 ILE A HB   6  
ATOM 5900  H HG12 . ILE A 1 11 ? -1.491 -8.531  11.741 1.00 0.00 ? 11 ILE A HG12 6  
ATOM 5901  H HG13 . ILE A 1 11 ? -1.036 -7.466  10.415 1.00 0.00 ? 11 ILE A HG13 6  
ATOM 5902  H HG21 . ILE A 1 11 ? 0.752  -8.115  13.661 1.00 0.00 ? 11 ILE A HG21 6  
ATOM 5903  H HG22 . ILE A 1 11 ? 0.148  -6.639  14.411 1.00 0.00 ? 11 ILE A HG22 6  
ATOM 5904  H HG23 . ILE A 1 11 ? -0.963 -7.958  14.041 1.00 0.00 ? 11 ILE A HG23 6  
ATOM 5905  H HD11 . ILE A 1 11 ? 0.089  -9.694  10.434 1.00 0.00 ? 11 ILE A HD11 6  
ATOM 5906  H HD12 . ILE A 1 11 ? 1.182  -8.309  10.398 1.00 0.00 ? 11 ILE A HD12 6  
ATOM 5907  H HD13 . ILE A 1 11 ? 0.923  -9.190  11.904 1.00 0.00 ? 11 ILE A HD13 6  
ATOM 5908  N N    . VAL A 1 12 ? -0.314 -3.688  12.900 1.00 0.00 ? 12 VAL A N    6  
ATOM 5909  C CA   . VAL A 1 12 ? 0.136  -2.583  13.739 1.00 0.00 ? 12 VAL A CA   6  
ATOM 5910  C C    . VAL A 1 12 ? -1.039 -1.725  14.194 1.00 0.00 ? 12 VAL A C    6  
ATOM 5911  O O    . VAL A 1 12 ? -1.021 -1.160  15.287 1.00 0.00 ? 12 VAL A O    6  
ATOM 5912  C CB   . VAL A 1 12 ? 1.151  -1.693  12.997 1.00 0.00 ? 12 VAL A CB   6  
ATOM 5913  C CG1  . VAL A 1 12 ? 1.582  -0.529  13.876 1.00 0.00 ? 12 VAL A CG1  6  
ATOM 5914  C CG2  . VAL A 1 12 ? 2.354  -2.513  12.555 1.00 0.00 ? 12 VAL A CG2  6  
ATOM 5915  H H    . VAL A 1 12 ? -0.076 -3.694  11.950 1.00 0.00 ? 12 VAL A H    6  
ATOM 5916  H HA   . VAL A 1 12 ? 0.623  -3.001  14.608 1.00 0.00 ? 12 VAL A HA   6  
ATOM 5917  H HB   . VAL A 1 12 ? 0.672  -1.292  12.116 1.00 0.00 ? 12 VAL A HB   6  
ATOM 5918  H HG11 . VAL A 1 12 ? 2.017  -0.909  14.789 1.00 0.00 ? 12 VAL A HG11 6  
ATOM 5919  H HG12 . VAL A 1 12 ? 2.312  0.068   13.349 1.00 0.00 ? 12 VAL A HG12 6  
ATOM 5920  H HG13 . VAL A 1 12 ? 0.722  0.080   14.114 1.00 0.00 ? 12 VAL A HG13 6  
ATOM 5921  H HG21 . VAL A 1 12 ? 3.249  -2.106  13.002 1.00 0.00 ? 12 VAL A HG21 6  
ATOM 5922  H HG22 . VAL A 1 12 ? 2.228  -3.538  12.871 1.00 0.00 ? 12 VAL A HG22 6  
ATOM 5923  H HG23 . VAL A 1 12 ? 2.440  -2.476  11.479 1.00 0.00 ? 12 VAL A HG23 6  
ATOM 5924  N N    . VAL A 1 13 ? -2.060 -1.632  13.348 1.00 0.00 ? 13 VAL A N    6  
ATOM 5925  C CA   . VAL A 1 13 ? -3.245 -0.843  13.663 1.00 0.00 ? 13 VAL A CA   6  
ATOM 5926  C C    . VAL A 1 13 ? -4.194 -1.617  14.572 1.00 0.00 ? 13 VAL A C    6  
ATOM 5927  O O    . VAL A 1 13 ? -4.884 -1.033  15.406 1.00 0.00 ? 13 VAL A O    6  
ATOM 5928  C CB   . VAL A 1 13 ? -3.999 -0.428  12.386 1.00 0.00 ? 13 VAL A CB   6  
ATOM 5929  C CG1  . VAL A 1 13 ? -5.235 0.387   12.737 1.00 0.00 ? 13 VAL A CG1  6  
ATOM 5930  C CG2  . VAL A 1 13 ? -3.082 0.353   11.457 1.00 0.00 ? 13 VAL A CG2  6  
ATOM 5931  H H    . VAL A 1 13 ? -2.015 -2.105  12.491 1.00 0.00 ? 13 VAL A H    6  
ATOM 5932  H HA   . VAL A 1 13 ? -2.923 0.053   14.174 1.00 0.00 ? 13 VAL A HA   6  
ATOM 5933  H HB   . VAL A 1 13 ? -4.319 -1.323  11.874 1.00 0.00 ? 13 VAL A HB   6  
ATOM 5934  H HG11 . VAL A 1 13 ? -5.251 1.289   12.143 1.00 0.00 ? 13 VAL A HG11 6  
ATOM 5935  H HG12 . VAL A 1 13 ? -6.121 -0.196  12.533 1.00 0.00 ? 13 VAL A HG12 6  
ATOM 5936  H HG13 . VAL A 1 13 ? -5.208 0.647   13.785 1.00 0.00 ? 13 VAL A HG13 6  
ATOM 5937  H HG21 . VAL A 1 13 ? -3.378 1.391   11.449 1.00 0.00 ? 13 VAL A HG21 6  
ATOM 5938  H HG22 . VAL A 1 13 ? -2.062 0.272   11.805 1.00 0.00 ? 13 VAL A HG22 6  
ATOM 5939  H HG23 . VAL A 1 13 ? -3.154 -0.050  10.458 1.00 0.00 ? 13 VAL A HG23 6  
ATOM 5940  N N    . GLU A 1 14 ? -4.222 -2.936  14.403 1.00 0.00 ? 14 GLU A N    6  
ATOM 5941  C CA   . GLU A 1 14 ? -5.087 -3.789  15.208 1.00 0.00 ? 14 GLU A CA   6  
ATOM 5942  C C    . GLU A 1 14 ? -4.456 -4.077  16.568 1.00 0.00 ? 14 GLU A C    6  
ATOM 5943  O O    . GLU A 1 14 ? -5.154 -4.366  17.540 1.00 0.00 ? 14 GLU A O    6  
ATOM 5944  C CB   . GLU A 1 14 ? -5.368 -5.103  14.476 1.00 0.00 ? 14 GLU A CB   6  
ATOM 5945  C CG   . GLU A 1 14 ? -6.325 -6.021  15.219 1.00 0.00 ? 14 GLU A CG   6  
ATOM 5946  C CD   . GLU A 1 14 ? -7.493 -6.465  14.359 1.00 0.00 ? 14 GLU A CD   6  
ATOM 5947  O OE1  . GLU A 1 14 ? -8.253 -5.591  13.893 1.00 0.00 ? 14 GLU A OE1  6  
ATOM 5948  O OE2  . GLU A 1 14 ? -7.646 -7.687  14.153 1.00 0.00 ? 14 GLU A OE2  6  
ATOM 5949  H H    . GLU A 1 14 ? -3.648 -3.343  13.721 1.00 0.00 ? 14 GLU A H    6  
ATOM 5950  H HA   . GLU A 1 14 ? -6.020 -3.267  15.361 1.00 0.00 ? 14 GLU A HA   6  
ATOM 5951  H HB2  . GLU A 1 14 ? -5.794 -4.879  13.510 1.00 0.00 ? 14 GLU A HB2  6  
ATOM 5952  H HB3  . GLU A 1 14 ? -4.436 -5.629  14.336 1.00 0.00 ? 14 GLU A HB3  6  
ATOM 5953  H HG2  . GLU A 1 14 ? -5.784 -6.897  15.544 1.00 0.00 ? 14 GLU A HG2  6  
ATOM 5954  H HG3  . GLU A 1 14 ? -6.711 -5.497  16.081 1.00 0.00 ? 14 GLU A HG3  6  
ATOM 5955  N N    . HIS A 1 15 ? -3.130 -3.995  16.627 1.00 0.00 ? 15 HIS A N    6  
ATOM 5956  C CA   . HIS A 1 15 ? -2.404 -4.246  17.867 1.00 0.00 ? 15 HIS A CA   6  
ATOM 5957  C C    . HIS A 1 15 ? -2.213 -2.954  18.656 1.00 0.00 ? 15 HIS A C    6  
ATOM 5958  O O    . HIS A 1 15 ? -2.488 -2.901  19.855 1.00 0.00 ? 15 HIS A O    6  
ATOM 5959  C CB   . HIS A 1 15 ? -1.045 -4.879  17.567 1.00 0.00 ? 15 HIS A CB   6  
ATOM 5960  C CG   . HIS A 1 15 ? -0.367 -5.444  18.777 1.00 0.00 ? 15 HIS A CG   6  
ATOM 5961  N ND1  . HIS A 1 15 ? 0.405  -4.685  19.630 1.00 0.00 ? 15 HIS A ND1  6  
ATOM 5962  C CD2  . HIS A 1 15 ? -0.351 -6.702  19.275 1.00 0.00 ? 15 HIS A CD2  6  
ATOM 5963  C CE1  . HIS A 1 15 ? 0.869  -5.452  20.601 1.00 0.00 ? 15 HIS A CE1  6  
ATOM 5964  N NE2  . HIS A 1 15 ? 0.424  -6.681  20.409 1.00 0.00 ? 15 HIS A NE2  6  
ATOM 5965  H H    . HIS A 1 15 ? -2.630 -3.760  15.818 1.00 0.00 ? 15 HIS A H    6  
ATOM 5966  H HA   . HIS A 1 15 ? -2.988 -4.933  18.460 1.00 0.00 ? 15 HIS A HA   6  
ATOM 5967  H HB2  . HIS A 1 15 ? -1.178 -5.682  16.856 1.00 0.00 ? 15 HIS A HB2  6  
ATOM 5968  H HB3  . HIS A 1 15 ? -0.393 -4.131  17.139 1.00 0.00 ? 15 HIS A HB3  6  
ATOM 5969  H HD1  . HIS A 1 15 ? 0.587  -3.727  19.537 1.00 0.00 ? 15 HIS A HD1  6  
ATOM 5970  H HD2  . HIS A 1 15 ? -0.853 -7.565  18.859 1.00 0.00 ? 15 HIS A HD2  6  
ATOM 5971  H HE1  . HIS A 1 15 ? 1.503  -5.130  21.413 1.00 0.00 ? 15 HIS A HE1  6  
ATOM 5972  N N    . LEU A 1 16 ? -1.740 -1.916  17.976 1.00 0.00 ? 16 LEU A N    6  
ATOM 5973  C CA   . LEU A 1 16 ? -1.512 -0.623  18.613 1.00 0.00 ? 16 LEU A CA   6  
ATOM 5974  C C    . LEU A 1 16 ? -2.820 0.146   18.767 1.00 0.00 ? 16 LEU A C    6  
ATOM 5975  O O    . LEU A 1 16 ? -2.997 0.904   19.720 1.00 0.00 ? 16 LEU A O    6  
ATOM 5976  C CB   . LEU A 1 16 ? -0.515 0.201   17.797 1.00 0.00 ? 16 LEU A CB   6  
ATOM 5977  C CG   . LEU A 1 16 ? 0.459  1.064   18.600 1.00 0.00 ? 16 LEU A CG   6  
ATOM 5978  C CD1  . LEU A 1 16 ? -0.294 2.114   19.401 1.00 0.00 ? 16 LEU A CD1  6  
ATOM 5979  C CD2  . LEU A 1 16 ? 1.307  0.197   19.518 1.00 0.00 ? 16 LEU A CD2  6  
ATOM 5980  H H    . LEU A 1 16 ? -1.540 -2.019  17.022 1.00 0.00 ? 16 LEU A H    6  
ATOM 5981  H HA   . LEU A 1 16 ? -1.098 -0.806  19.593 1.00 0.00 ? 16 LEU A HA   6  
ATOM 5982  H HB2  . LEU A 1 16 ? 0.066  -0.482  17.197 1.00 0.00 ? 16 LEU A HB2  6  
ATOM 5983  H HB3  . LEU A 1 16 ? -1.081 0.855   17.148 1.00 0.00 ? 16 LEU A HB3  6  
ATOM 5984  H HG   . LEU A 1 16 ? 1.122  1.578   17.917 1.00 0.00 ? 16 LEU A HG   6  
ATOM 5985  H HD11 . LEU A 1 16 ? -0.378 1.792   20.428 1.00 0.00 ? 16 LEU A HD11 6  
ATOM 5986  H HD12 . LEU A 1 16 ? -1.282 2.246   18.984 1.00 0.00 ? 16 LEU A HD12 6  
ATOM 5987  H HD13 . LEU A 1 16 ? 0.241  3.051   19.359 1.00 0.00 ? 16 LEU A HD13 6  
ATOM 5988  H HD21 . LEU A 1 16 ? 0.824  0.113   20.481 1.00 0.00 ? 16 LEU A HD21 6  
ATOM 5989  H HD22 . LEU A 1 16 ? 2.281  0.649   19.642 1.00 0.00 ? 16 LEU A HD22 6  
ATOM 5990  H HD23 . LEU A 1 16 ? 1.418  -0.786  19.084 1.00 0.00 ? 16 LEU A HD23 6  
ATOM 5991  N N    . GLY A 1 17 ? -3.735 -0.056  17.824 1.00 0.00 ? 17 GLY A N    6  
ATOM 5992  C CA   . GLY A 1 17 ? -5.016 0.625   17.875 1.00 0.00 ? 17 GLY A CA   6  
ATOM 5993  C C    . GLY A 1 17 ? -4.917 2.078   17.455 1.00 0.00 ? 17 GLY A C    6  
ATOM 5994  O O    . GLY A 1 17 ? -5.626 2.934   17.984 1.00 0.00 ? 17 GLY A O    6  
ATOM 5995  H H    . GLY A 1 17 ? -3.538 -0.672  17.087 1.00 0.00 ? 17 GLY A H    6  
ATOM 5996  H HA2  . GLY A 1 17 ? -5.707 0.117   17.219 1.00 0.00 ? 17 GLY A HA2  6  
ATOM 5997  H HA3  . GLY A 1 17 ? -5.394 0.579   18.885 1.00 0.00 ? 17 GLY A HA3  6  
ATOM 5998  N N    . VAL A 1 18 ? -4.035 2.358   16.501 1.00 0.00 ? 18 VAL A N    6  
ATOM 5999  C CA   . VAL A 1 18 ? -3.846 3.718   16.010 1.00 0.00 ? 18 VAL A CA   6  
ATOM 6000  C C    . VAL A 1 18 ? -4.442 3.888   14.618 1.00 0.00 ? 18 VAL A C    6  
ATOM 6001  O O    . VAL A 1 18 ? -5.026 2.956   14.063 1.00 0.00 ? 18 VAL A O    6  
ATOM 6002  C CB   . VAL A 1 18 ? -2.353 4.097   15.968 1.00 0.00 ? 18 VAL A CB   6  
ATOM 6003  C CG1  . VAL A 1 18 ? -1.802 4.254   17.377 1.00 0.00 ? 18 VAL A CG1  6  
ATOM 6004  C CG2  . VAL A 1 18 ? -1.562 3.056   15.190 1.00 0.00 ? 18 VAL A CG2  6  
ATOM 6005  H H    . VAL A 1 18 ? -3.499 1.633   16.118 1.00 0.00 ? 18 VAL A H    6  
ATOM 6006  H HA   . VAL A 1 18 ? -4.347 4.391   16.691 1.00 0.00 ? 18 VAL A HA   6  
ATOM 6007  H HB   . VAL A 1 18 ? -2.258 5.045   15.460 1.00 0.00 ? 18 VAL A HB   6  
ATOM 6008  H HG11 . VAL A 1 18 ? -1.854 5.293   17.669 1.00 0.00 ? 18 VAL A HG11 6  
ATOM 6009  H HG12 . VAL A 1 18 ? -2.386 3.656   18.061 1.00 0.00 ? 18 VAL A HG12 6  
ATOM 6010  H HG13 . VAL A 1 18 ? -0.773 3.926   17.399 1.00 0.00 ? 18 VAL A HG13 6  
ATOM 6011  H HG21 . VAL A 1 18 ? -0.927 3.552   14.470 1.00 0.00 ? 18 VAL A HG21 6  
ATOM 6012  H HG22 . VAL A 1 18 ? -0.952 2.483   15.873 1.00 0.00 ? 18 VAL A HG22 6  
ATOM 6013  H HG23 . VAL A 1 18 ? -2.244 2.396   14.675 1.00 0.00 ? 18 VAL A HG23 6  
ATOM 6014  N N    . ASP A 1 19 ? -4.290 5.082   14.057 1.00 0.00 ? 19 ASP A N    6  
ATOM 6015  C CA   . ASP A 1 19 ? -4.811 5.375   12.727 1.00 0.00 ? 19 ASP A CA   6  
ATOM 6016  C C    . ASP A 1 19 ? -3.813 4.963   11.649 1.00 0.00 ? 19 ASP A C    6  
ATOM 6017  O O    . ASP A 1 19 ? -2.607 5.148   11.804 1.00 0.00 ? 19 ASP A O    6  
ATOM 6018  C CB   . ASP A 1 19 ? -5.135 6.864   12.598 1.00 0.00 ? 19 ASP A CB   6  
ATOM 6019  C CG   . ASP A 1 19 ? -6.320 7.123   11.689 1.00 0.00 ? 19 ASP A CG   6  
ATOM 6020  O OD1  . ASP A 1 19 ? -6.303 6.637   10.540 1.00 0.00 ? 19 ASP A OD1  6  
ATOM 6021  O OD2  . ASP A 1 19 ? -7.265 7.813   12.128 1.00 0.00 ? 19 ASP A OD2  6  
ATOM 6022  H H    . ASP A 1 19 ? -3.814 5.784   14.549 1.00 0.00 ? 19 ASP A H    6  
ATOM 6023  H HA   . ASP A 1 19 ? -5.719 4.806   12.594 1.00 0.00 ? 19 ASP A HA   6  
ATOM 6024  H HB2  . ASP A 1 19 ? -5.361 7.262   13.577 1.00 0.00 ? 19 ASP A HB2  6  
ATOM 6025  H HB3  . ASP A 1 19 ? -4.275 7.379   12.195 1.00 0.00 ? 19 ASP A HB3  6  
ATOM 6026  N N    . ALA A 1 20 ? -4.326 4.404   10.558 1.00 0.00 ? 20 ALA A N    6  
ATOM 6027  C CA   . ALA A 1 20 ? -3.480 3.967   9.454  1.00 0.00 ? 20 ALA A CA   6  
ATOM 6028  C C    . ALA A 1 20 ? -2.801 5.154   8.779  1.00 0.00 ? 20 ALA A C    6  
ATOM 6029  O O    . ALA A 1 20 ? -1.679 5.041   8.284  1.00 0.00 ? 20 ALA A O    6  
ATOM 6030  C CB   . ALA A 1 20 ? -4.298 3.179   8.441  1.00 0.00 ? 20 ALA A CB   6  
ATOM 6031  H H    . ALA A 1 20 ? -5.296 4.284   10.493 1.00 0.00 ? 20 ALA A H    6  
ATOM 6032  H HA   . ALA A 1 20 ? -2.720 3.311   9.855  1.00 0.00 ? 20 ALA A HA   6  
ATOM 6033  H HB1  . ALA A 1 20 ? -3.633 2.698   7.739  1.00 0.00 ? 20 ALA A HB1  6  
ATOM 6034  H HB2  . ALA A 1 20 ? -4.883 2.431   8.955  1.00 0.00 ? 20 ALA A HB2  6  
ATOM 6035  H HB3  . ALA A 1 20 ? -4.957 3.851   7.911  1.00 0.00 ? 20 ALA A HB3  6  
ATOM 6036  N N    . ASP A 1 21 ? -3.487 6.292   8.763  1.00 0.00 ? 21 ASP A N    6  
ATOM 6037  C CA   . ASP A 1 21 ? -2.950 7.500   8.149  1.00 0.00 ? 21 ASP A CA   6  
ATOM 6038  C C    . ASP A 1 21 ? -1.576 7.836   8.721  1.00 0.00 ? 21 ASP A C    6  
ATOM 6039  O O    . ASP A 1 21 ? -0.746 8.450   8.051  1.00 0.00 ? 21 ASP A O    6  
ATOM 6040  C CB   . ASP A 1 21 ? -3.906 8.675   8.364  1.00 0.00 ? 21 ASP A CB   6  
ATOM 6041  C CG   . ASP A 1 21 ? -3.723 9.330   9.719  1.00 0.00 ? 21 ASP A CG   6  
ATOM 6042  O OD1  . ASP A 1 21 ? -2.755 10.103  9.878  1.00 0.00 ? 21 ASP A OD1  6  
ATOM 6043  O OD2  . ASP A 1 21 ? -4.547 9.069   10.620 1.00 0.00 ? 21 ASP A OD2  6  
ATOM 6044  H H    . ASP A 1 21 ? -4.377 6.319   9.174  1.00 0.00 ? 21 ASP A H    6  
ATOM 6045  H HA   . ASP A 1 21 ? -2.851 7.318   7.090  1.00 0.00 ? 21 ASP A HA   6  
ATOM 6046  H HB2  . ASP A 1 21 ? -3.731 9.418   7.599  1.00 0.00 ? 21 ASP A HB2  6  
ATOM 6047  H HB3  . ASP A 1 21 ? -4.924 8.321   8.289  1.00 0.00 ? 21 ASP A HB3  6  
ATOM 6048  N N    . LYS A 1 22 ? -1.343 7.429   9.964  1.00 0.00 ? 22 LYS A N    6  
ATOM 6049  C CA   . LYS A 1 22 ? -0.070 7.685   10.627 1.00 0.00 ? 22 LYS A CA   6  
ATOM 6050  C C    . LYS A 1 22 ? 0.923  6.560   10.352 1.00 0.00 ? 22 LYS A C    6  
ATOM 6051  O O    . LYS A 1 22 ? 2.136  6.764   10.399 1.00 0.00 ? 22 LYS A O    6  
ATOM 6052  C CB   . LYS A 1 22 ? -0.279 7.838   12.136 1.00 0.00 ? 22 LYS A CB   6  
ATOM 6053  C CG   . LYS A 1 22 ? -1.325 8.876   12.503 1.00 0.00 ? 22 LYS A CG   6  
ATOM 6054  C CD   . LYS A 1 22 ? -1.424 9.060   14.008 1.00 0.00 ? 22 LYS A CD   6  
ATOM 6055  C CE   . LYS A 1 22 ? -0.297 9.933   14.538 1.00 0.00 ? 22 LYS A CE   6  
ATOM 6056  N NZ   . LYS A 1 22 ? -0.323 11.296  13.939 1.00 0.00 ? 22 LYS A NZ   6  
ATOM 6057  H H    . LYS A 1 22 ? -2.045 6.943   10.447 1.00 0.00 ? 22 LYS A H    6  
ATOM 6058  H HA   . LYS A 1 22 ? 0.330  8.607   10.233 1.00 0.00 ? 22 LYS A HA   6  
ATOM 6059  H HB2  . LYS A 1 22 ? -0.588 6.886   12.542 1.00 0.00 ? 22 LYS A HB2  6  
ATOM 6060  H HB3  . LYS A 1 22 ? 0.658  8.126   12.589 1.00 0.00 ? 22 LYS A HB3  6  
ATOM 6061  H HG2  . LYS A 1 22 ? -1.056 9.820   12.053 1.00 0.00 ? 22 LYS A HG2  6  
ATOM 6062  H HG3  . LYS A 1 22 ? -2.285 8.556   12.124 1.00 0.00 ? 22 LYS A HG3  6  
ATOM 6063  H HD2  . LYS A 1 22 ? -2.368 9.528   14.243 1.00 0.00 ? 22 LYS A HD2  6  
ATOM 6064  H HD3  . LYS A 1 22 ? -1.372 8.091   14.484 1.00 0.00 ? 22 LYS A HD3  6  
ATOM 6065  H HE2  . LYS A 1 22 ? -0.399 10.018  15.609 1.00 0.00 ? 22 LYS A HE2  6  
ATOM 6066  H HE3  . LYS A 1 22 ? 0.646  9.463   14.302 1.00 0.00 ? 22 LYS A HE3  6  
ATOM 6067  H HZ1  . LYS A 1 22 ? -1.121 11.380  13.277 1.00 0.00 ? 22 LYS A HZ1  6  
ATOM 6068  H HZ2  . LYS A 1 22 ? 0.561  11.476  13.421 1.00 0.00 ? 22 LYS A HZ2  6  
ATOM 6069  H HZ3  . LYS A 1 22 ? -0.428 12.013  14.685 1.00 0.00 ? 22 LYS A HZ3  6  
ATOM 6070  N N    . VAL A 1 23 ? 0.400  5.372   10.064 1.00 0.00 ? 23 VAL A N    6  
ATOM 6071  C CA   . VAL A 1 23 ? 1.240  4.216   9.779  1.00 0.00 ? 23 VAL A CA   6  
ATOM 6072  C C    . VAL A 1 23 ? 1.973  4.383   8.453  1.00 0.00 ? 23 VAL A C    6  
ATOM 6073  O O    . VAL A 1 23 ? 1.505  3.924   7.410  1.00 0.00 ? 23 VAL A O    6  
ATOM 6074  C CB   . VAL A 1 23 ? 0.413  2.917   9.737  1.00 0.00 ? 23 VAL A CB   6  
ATOM 6075  C CG1  . VAL A 1 23 ? 1.317  1.715   9.512  1.00 0.00 ? 23 VAL A CG1  6  
ATOM 6076  C CG2  . VAL A 1 23 ? -0.392 2.757   11.017 1.00 0.00 ? 23 VAL A CG2  6  
ATOM 6077  H H    . VAL A 1 23 ? -0.575 5.272   10.043 1.00 0.00 ? 23 VAL A H    6  
ATOM 6078  H HA   . VAL A 1 23 ? 1.968  4.128   10.573 1.00 0.00 ? 23 VAL A HA   6  
ATOM 6079  H HB   . VAL A 1 23 ? -0.277 2.981   8.908  1.00 0.00 ? 23 VAL A HB   6  
ATOM 6080  H HG11 . VAL A 1 23 ? 1.885  1.857   8.604  1.00 0.00 ? 23 VAL A HG11 6  
ATOM 6081  H HG12 . VAL A 1 23 ? 1.993  1.611   10.348 1.00 0.00 ? 23 VAL A HG12 6  
ATOM 6082  H HG13 . VAL A 1 23 ? 0.714  0.823   9.423  1.00 0.00 ? 23 VAL A HG13 6  
ATOM 6083  H HG21 . VAL A 1 23 ? 0.266  2.840   11.869 1.00 0.00 ? 23 VAL A HG21 6  
ATOM 6084  H HG22 . VAL A 1 23 ? -1.146 3.530   11.068 1.00 0.00 ? 23 VAL A HG22 6  
ATOM 6085  H HG23 . VAL A 1 23 ? -0.870 1.789   11.024 1.00 0.00 ? 23 VAL A HG23 6  
ATOM 6086  N N    . THR A 1 24 ? 3.127  5.042   8.498  1.00 0.00 ? 24 THR A N    6  
ATOM 6087  C CA   . THR A 1 24 ? 3.924  5.270   7.300  1.00 0.00 ? 24 THR A CA   6  
ATOM 6088  C C    . THR A 1 24 ? 5.350  4.761   7.484  1.00 0.00 ? 24 THR A C    6  
ATOM 6089  O O    . THR A 1 24 ? 5.827  4.619   8.609  1.00 0.00 ? 24 THR A O    6  
ATOM 6090  C CB   . THR A 1 24 ? 3.969  6.765   6.932  1.00 0.00 ? 24 THR A CB   6  
ATOM 6091  O OG1  . THR A 1 24 ? 4.756  7.483   7.889  1.00 0.00 ? 24 THR A OG1  6  
ATOM 6092  C CG2  . THR A 1 24 ? 2.566  7.351   6.879  1.00 0.00 ? 24 THR A CG2  6  
ATOM 6093  H H    . THR A 1 24 ? 3.447  5.383   9.359  1.00 0.00 ? 24 THR A H    6  
ATOM 6094  H HA   . THR A 1 24 ? 3.463  4.733   6.485  1.00 0.00 ? 24 THR A HA   6  
ATOM 6095  H HB   . THR A 1 24 ? 4.422  6.866   5.956  1.00 0.00 ? 24 THR A HB   6  
ATOM 6096  H HG1  . THR A 1 24 ? 4.897  8.380   7.579  1.00 0.00 ? 24 THR A HG1  6  
ATOM 6097  H HG21 . THR A 1 24 ? 2.117  7.298   7.859  1.00 0.00 ? 24 THR A HG21 6  
ATOM 6098  H HG22 . THR A 1 24 ? 1.968  6.790   6.177  1.00 0.00 ? 24 THR A HG22 6  
ATOM 6099  H HG23 . THR A 1 24 ? 2.619  8.382   6.563  1.00 0.00 ? 24 THR A HG23 6  
ATOM 6100  N N    . GLU A 1 25 ? 6.024  4.488   6.371  1.00 0.00 ? 25 GLU A N    6  
ATOM 6101  C CA   . GLU A 1 25 ? 7.395  3.995   6.411  1.00 0.00 ? 25 GLU A CA   6  
ATOM 6102  C C    . GLU A 1 25 ? 8.274  4.898   7.270  1.00 0.00 ? 25 GLU A C    6  
ATOM 6103  O O    . GLU A 1 25 ? 9.244  4.445   7.876  1.00 0.00 ? 25 GLU A O    6  
ATOM 6104  C CB   . GLU A 1 25 ? 7.969  3.903   4.995  1.00 0.00 ? 25 GLU A CB   6  
ATOM 6105  C CG   . GLU A 1 25 ? 8.326  5.253   4.395  1.00 0.00 ? 25 GLU A CG   6  
ATOM 6106  C CD   . GLU A 1 25 ? 8.065  5.315   2.902  1.00 0.00 ? 25 GLU A CD   6  
ATOM 6107  O OE1  . GLU A 1 25 ? 6.937  5.679   2.511  1.00 0.00 ? 25 GLU A OE1  6  
ATOM 6108  O OE2  . GLU A 1 25 ? 8.990  4.998   2.126  1.00 0.00 ? 25 GLU A OE2  6  
ATOM 6109  H H    . GLU A 1 25 ? 5.588  4.622   5.503  1.00 0.00 ? 25 GLU A H    6  
ATOM 6110  H HA   . GLU A 1 25 ? 7.380  3.007   6.847  1.00 0.00 ? 25 GLU A HA   6  
ATOM 6111  H HB2  . GLU A 1 25 ? 8.862  3.296   5.020  1.00 0.00 ? 25 GLU A HB2  6  
ATOM 6112  H HB3  . GLU A 1 25 ? 7.240  3.429   4.355  1.00 0.00 ? 25 GLU A HB3  6  
ATOM 6113  H HG2  . GLU A 1 25 ? 7.735  6.016   4.879  1.00 0.00 ? 25 GLU A HG2  6  
ATOM 6114  H HG3  . GLU A 1 25 ? 9.374  5.445   4.571  1.00 0.00 ? 25 GLU A HG3  6  
ATOM 6115  N N    . GLY A 1 26 ? 7.926  6.181   7.318  1.00 0.00 ? 26 GLY A N    6  
ATOM 6116  C CA   . GLY A 1 26 ? 8.693  7.129   8.105  1.00 0.00 ? 26 GLY A CA   6  
ATOM 6117  C C    . GLY A 1 26 ? 8.131  7.312   9.501  1.00 0.00 ? 26 GLY A C    6  
ATOM 6118  O O    . GLY A 1 26 ? 8.253  8.385   10.091 1.00 0.00 ? 26 GLY A O    6  
ATOM 6119  H H    . GLY A 1 26 ? 7.142  6.486   6.815  1.00 0.00 ? 26 GLY A H    6  
ATOM 6120  H HA2  . GLY A 1 26 ? 9.711  6.777   8.181  1.00 0.00 ? 26 GLY A HA2  6  
ATOM 6121  H HA3  . GLY A 1 26 ? 8.689  8.084   7.601  1.00 0.00 ? 26 GLY A HA3  6  
ATOM 6122  N N    . ALA A 1 27 ? 7.512  6.262   10.031 1.00 0.00 ? 27 ALA A N    6  
ATOM 6123  C CA   . ALA A 1 27 ? 6.930  6.311   11.366 1.00 0.00 ? 27 ALA A CA   6  
ATOM 6124  C C    . ALA A 1 27 ? 7.720  5.445   12.342 1.00 0.00 ? 27 ALA A C    6  
ATOM 6125  O O    . ALA A 1 27 ? 7.731  4.220   12.230 1.00 0.00 ? 27 ALA A O    6  
ATOM 6126  C CB   . ALA A 1 27 ? 5.475  5.870   11.324 1.00 0.00 ? 27 ALA A CB   6  
ATOM 6127  H H    . ALA A 1 27 ? 7.447  5.433   9.512  1.00 0.00 ? 27 ALA A H    6  
ATOM 6128  H HA   . ALA A 1 27 ? 6.960  7.337   11.705 1.00 0.00 ? 27 ALA A HA   6  
ATOM 6129  H HB1  . ALA A 1 27 ? 5.404  4.837   11.631 1.00 0.00 ? 27 ALA A HB1  6  
ATOM 6130  H HB2  . ALA A 1 27 ? 4.892  6.486   11.993 1.00 0.00 ? 27 ALA A HB2  6  
ATOM 6131  H HB3  . ALA A 1 27 ? 5.096  5.973   10.318 1.00 0.00 ? 27 ALA A HB3  6  
ATOM 6132  N N    . SER A 1 28 ? 8.379  6.091   13.299 1.00 0.00 ? 28 SER A N    6  
ATOM 6133  C CA   . SER A 1 28 ? 9.175  5.379   14.292 1.00 0.00 ? 28 SER A CA   6  
ATOM 6134  C C    . SER A 1 28 ? 8.320  4.983   15.492 1.00 0.00 ? 28 SER A C    6  
ATOM 6135  O O    . SER A 1 28 ? 7.788  5.839   16.199 1.00 0.00 ? 28 SER A O    6  
ATOM 6136  C CB   . SER A 1 28 ? 10.349 6.246   14.752 1.00 0.00 ? 28 SER A CB   6  
ATOM 6137  O OG   . SER A 1 28 ? 11.500 6.007   13.960 1.00 0.00 ? 28 SER A OG   6  
ATOM 6138  H H    . SER A 1 28 ? 8.331  7.069   13.336 1.00 0.00 ? 28 SER A H    6  
ATOM 6139  H HA   . SER A 1 28 ? 9.560  4.483   13.828 1.00 0.00 ? 28 SER A HA   6  
ATOM 6140  H HB2  . SER A 1 28 ? 10.079 7.287   14.668 1.00 0.00 ? 28 SER A HB2  6  
ATOM 6141  H HB3  . SER A 1 28 ? 10.581 6.016   15.781 1.00 0.00 ? 28 SER A HB3  6  
ATOM 6142  H HG   . SER A 1 28 ? 12.197 5.641   14.509 1.00 0.00 ? 28 SER A HG   6  
ATOM 6143  N N    . PHE A 1 29 ? 8.192  3.680   15.715 1.00 0.00 ? 29 PHE A N    6  
ATOM 6144  C CA   . PHE A 1 29 ? 7.401  3.169   16.829 1.00 0.00 ? 29 PHE A CA   6  
ATOM 6145  C C    . PHE A 1 29 ? 7.988  3.618   18.164 1.00 0.00 ? 29 PHE A C    6  
ATOM 6146  O O    . PHE A 1 29 ? 7.343  3.504   19.207 1.00 0.00 ? 29 PHE A O    6  
ATOM 6147  C CB   . PHE A 1 29 ? 7.335  1.641   16.776 1.00 0.00 ? 29 PHE A CB   6  
ATOM 6148  C CG   . PHE A 1 29 ? 7.032  1.101   15.408 1.00 0.00 ? 29 PHE A CG   6  
ATOM 6149  C CD1  . PHE A 1 29 ? 5.729  1.065   14.936 1.00 0.00 ? 29 PHE A CD1  6  
ATOM 6150  C CD2  . PHE A 1 29 ? 8.048  0.629   14.594 1.00 0.00 ? 29 PHE A CD2  6  
ATOM 6151  C CE1  . PHE A 1 29 ? 5.446  0.568   13.677 1.00 0.00 ? 29 PHE A CE1  6  
ATOM 6152  C CE2  . PHE A 1 29 ? 7.772  0.132   13.334 1.00 0.00 ? 29 PHE A CE2  6  
ATOM 6153  C CZ   . PHE A 1 29 ? 6.469  0.101   12.875 1.00 0.00 ? 29 PHE A CZ   6  
ATOM 6154  H H    . PHE A 1 29 ? 8.641  3.046   15.116 1.00 0.00 ? 29 PHE A H    6  
ATOM 6155  H HA   . PHE A 1 29 ? 6.403  3.567   16.735 1.00 0.00 ? 29 PHE A HA   6  
ATOM 6156  H HB2  . PHE A 1 29 ? 8.285  1.235   17.089 1.00 0.00 ? 29 PHE A HB2  6  
ATOM 6157  H HB3  . PHE A 1 29 ? 6.563  1.298   17.448 1.00 0.00 ? 29 PHE A HB3  6  
ATOM 6158  H HD1  . PHE A 1 29 ? 4.928  1.430   15.563 1.00 0.00 ? 29 PHE A HD1  6  
ATOM 6159  H HD2  . PHE A 1 29 ? 9.068  0.652   14.951 1.00 0.00 ? 29 PHE A HD2  6  
ATOM 6160  H HE1  . PHE A 1 29 ? 4.427  0.545   13.322 1.00 0.00 ? 29 PHE A HE1  6  
ATOM 6161  H HE2  . PHE A 1 29 ? 8.573  -0.233  12.709 1.00 0.00 ? 29 PHE A HE2  6  
ATOM 6162  H HZ   . PHE A 1 29 ? 6.251  -0.287  11.892 1.00 0.00 ? 29 PHE A HZ   6  
ATOM 6163  N N    . ILE A 1 30 ? 9.214  4.128   18.123 1.00 0.00 ? 30 ILE A N    6  
ATOM 6164  C CA   . ILE A 1 30 ? 9.887  4.595   19.329 1.00 0.00 ? 30 ILE A CA   6  
ATOM 6165  C C    . ILE A 1 30 ? 9.487  6.028   19.661 1.00 0.00 ? 30 ILE A C    6  
ATOM 6166  O O    . ILE A 1 30 ? 9.051  6.319   20.775 1.00 0.00 ? 30 ILE A O    6  
ATOM 6167  C CB   . ILE A 1 30 ? 11.418 4.522   19.182 1.00 0.00 ? 30 ILE A CB   6  
ATOM 6168  C CG1  . ILE A 1 30 ? 11.861 3.077   18.942 1.00 0.00 ? 30 ILE A CG1  6  
ATOM 6169  C CG2  . ILE A 1 30 ? 12.096 5.090   20.420 1.00 0.00 ? 30 ILE A CG2  6  
ATOM 6170  C CD1  . ILE A 1 30 ? 11.441 2.125   20.039 1.00 0.00 ? 30 ILE A CD1  6  
ATOM 6171  H H    . ILE A 1 30 ? 9.676  4.193   17.262 1.00 0.00 ? 30 ILE A H    6  
ATOM 6172  H HA   . ILE A 1 30 ? 9.592  3.951   20.145 1.00 0.00 ? 30 ILE A HA   6  
ATOM 6173  H HB   . ILE A 1 30 ? 11.706 5.125   18.335 1.00 0.00 ? 30 ILE A HB   6  
ATOM 6174  H HG12 . ILE A 1 30 ? 11.433 2.725   18.016 1.00 0.00 ? 30 ILE A HG12 6  
ATOM 6175  H HG13 . ILE A 1 30 ? 12.939 3.046   18.870 1.00 0.00 ? 30 ILE A HG13 6  
ATOM 6176  H HG21 . ILE A 1 30 ? 12.789 4.363   20.817 1.00 0.00 ? 30 ILE A HG21 6  
ATOM 6177  H HG22 . ILE A 1 30 ? 12.633 5.989   20.155 1.00 0.00 ? 30 ILE A HG22 6  
ATOM 6178  H HG23 . ILE A 1 30 ? 11.351 5.321   21.165 1.00 0.00 ? 30 ILE A HG23 6  
ATOM 6179  H HD11 . ILE A 1 30 ? 11.611 2.586   21.001 1.00 0.00 ? 30 ILE A HD11 6  
ATOM 6180  H HD12 . ILE A 1 30 ? 10.392 1.891   19.932 1.00 0.00 ? 30 ILE A HD12 6  
ATOM 6181  H HD13 . ILE A 1 30 ? 12.021 1.216   19.969 1.00 0.00 ? 30 ILE A HD13 6  
ATOM 6182  N N    . ASP A 1 31 ? 9.638  6.920   18.688 1.00 0.00 ? 31 ASP A N    6  
ATOM 6183  C CA   . ASP A 1 31 ? 9.289  8.323   18.876 1.00 0.00 ? 31 ASP A CA   6  
ATOM 6184  C C    . ASP A 1 31 ? 7.873  8.603   18.383 1.00 0.00 ? 31 ASP A C    6  
ATOM 6185  O O    . ASP A 1 31 ? 7.007  9.017   19.154 1.00 0.00 ? 31 ASP A O    6  
ATOM 6186  C CB   . ASP A 1 31 ? 10.285 9.221   18.141 1.00 0.00 ? 31 ASP A CB   6  
ATOM 6187  C CG   . ASP A 1 31 ? 11.007 10.172  19.075 1.00 0.00 ? 31 ASP A CG   6  
ATOM 6188  O OD1  . ASP A 1 31 ? 10.449 11.249  19.372 1.00 0.00 ? 31 ASP A OD1  6  
ATOM 6189  O OD2  . ASP A 1 31 ? 12.130 9.840   19.509 1.00 0.00 ? 31 ASP A OD2  6  
ATOM 6190  H H    . ASP A 1 31 ? 9.991  6.626   17.822 1.00 0.00 ? 31 ASP A H    6  
ATOM 6191  H HA   . ASP A 1 31 ? 9.338  8.538   19.933 1.00 0.00 ? 31 ASP A HA   6  
ATOM 6192  H HB2  . ASP A 1 31 ? 11.022 8.602   17.648 1.00 0.00 ? 31 ASP A HB2  6  
ATOM 6193  H HB3  . ASP A 1 31 ? 9.757  9.803   17.401 1.00 0.00 ? 31 ASP A HB3  6  
ATOM 6194  N N    . ASP A 1 32 ? 7.645  8.374   17.094 1.00 0.00 ? 32 ASP A N    6  
ATOM 6195  C CA   . ASP A 1 32 ? 6.334  8.601   16.498 1.00 0.00 ? 32 ASP A CA   6  
ATOM 6196  C C    . ASP A 1 32 ? 5.226  8.082   17.408 1.00 0.00 ? 32 ASP A C    6  
ATOM 6197  O O    . ASP A 1 32 ? 4.197  8.736   17.587 1.00 0.00 ? 32 ASP A O    6  
ATOM 6198  C CB   . ASP A 1 32 ? 6.248  7.921   15.130 1.00 0.00 ? 32 ASP A CB   6  
ATOM 6199  C CG   . ASP A 1 32 ? 5.230  8.579   14.220 1.00 0.00 ? 32 ASP A CG   6  
ATOM 6200  O OD1  . ASP A 1 32 ? 4.032  8.246   14.332 1.00 0.00 ? 32 ASP A OD1  6  
ATOM 6201  O OD2  . ASP A 1 32 ? 5.632  9.427   13.395 1.00 0.00 ? 32 ASP A OD2  6  
ATOM 6202  H H    . ASP A 1 32 ? 8.376  8.043   16.531 1.00 0.00 ? 32 ASP A H    6  
ATOM 6203  H HA   . ASP A 1 32 ? 6.208  9.665   16.369 1.00 0.00 ? 32 ASP A HA   6  
ATOM 6204  H HB2  . ASP A 1 32 ? 7.215  7.967   14.651 1.00 0.00 ? 32 ASP A HB2  6  
ATOM 6205  H HB3  . ASP A 1 32 ? 5.967  6.887   15.267 1.00 0.00 ? 32 ASP A HB3  6  
ATOM 6206  N N    . LEU A 1 33 ? 5.441  6.903   17.981 1.00 0.00 ? 33 LEU A N    6  
ATOM 6207  C CA   . LEU A 1 33 ? 4.459  6.295   18.873 1.00 0.00 ? 33 LEU A CA   6  
ATOM 6208  C C    . LEU A 1 33 ? 4.844  6.509   20.333 1.00 0.00 ? 33 LEU A C    6  
ATOM 6209  O O    . LEU A 1 33 ? 4.022  6.344   21.233 1.00 0.00 ? 33 LEU A O    6  
ATOM 6210  C CB   . LEU A 1 33 ? 4.333  4.799   18.581 1.00 0.00 ? 33 LEU A CB   6  
ATOM 6211  C CG   . LEU A 1 33 ? 3.906  4.426   17.161 1.00 0.00 ? 33 LEU A CG   6  
ATOM 6212  C CD1  . LEU A 1 33 ? 3.505  2.960   17.091 1.00 0.00 ? 33 LEU A CD1  6  
ATOM 6213  C CD2  . LEU A 1 33 ? 2.763  5.316   16.696 1.00 0.00 ? 33 LEU A CD2  6  
ATOM 6214  H H    . LEU A 1 33 ? 6.279  6.429   17.801 1.00 0.00 ? 33 LEU A H    6  
ATOM 6215  H HA   . LEU A 1 33 ? 3.507  6.771   18.691 1.00 0.00 ? 33 LEU A HA   6  
ATOM 6216  H HB2  . LEU A 1 33 ? 5.294  4.344   18.767 1.00 0.00 ? 33 LEU A HB2  6  
ATOM 6217  H HB3  . LEU A 1 33 ? 3.604  4.390   19.265 1.00 0.00 ? 33 LEU A HB3  6  
ATOM 6218  H HG   . LEU A 1 33 ? 4.741  4.575   16.490 1.00 0.00 ? 33 LEU A HG   6  
ATOM 6219  H HD11 . LEU A 1 33 ? 3.142  2.733   16.101 1.00 0.00 ? 33 LEU A HD11 6  
ATOM 6220  H HD12 . LEU A 1 33 ? 2.727  2.766   17.814 1.00 0.00 ? 33 LEU A HD12 6  
ATOM 6221  H HD13 . LEU A 1 33 ? 4.363  2.342   17.311 1.00 0.00 ? 33 LEU A HD13 6  
ATOM 6222  H HD21 . LEU A 1 33 ? 2.076  4.736   16.098 1.00 0.00 ? 33 LEU A HD21 6  
ATOM 6223  H HD22 . LEU A 1 33 ? 3.157  6.129   16.104 1.00 0.00 ? 33 LEU A HD22 6  
ATOM 6224  H HD23 . LEU A 1 33 ? 2.245  5.714   17.556 1.00 0.00 ? 33 LEU A HD23 6  
ATOM 6225  N N    . GLY A 1 34 ? 6.101  6.880   20.560 1.00 0.00 ? 34 GLY A N    6  
ATOM 6226  C CA   . GLY A 1 34 ? 6.572  7.113   21.913 1.00 0.00 ? 34 GLY A CA   6  
ATOM 6227  C C    . GLY A 1 34 ? 6.743  5.827   22.697 1.00 0.00 ? 34 GLY A C    6  
ATOM 6228  O O    . GLY A 1 34 ? 6.517  5.795   23.906 1.00 0.00 ? 34 GLY A O    6  
ATOM 6229  H H    . GLY A 1 34 ? 6.712  6.997   19.803 1.00 0.00 ? 34 GLY A H    6  
ATOM 6230  H HA2  . GLY A 1 34 ? 7.522  7.624   21.868 1.00 0.00 ? 34 GLY A HA2  6  
ATOM 6231  H HA3  . GLY A 1 34 ? 5.860  7.742   22.427 1.00 0.00 ? 34 GLY A HA3  6  
ATOM 6232  N N    . ALA A 1 35 ? 7.142  4.764   22.006 1.00 0.00 ? 35 ALA A N    6  
ATOM 6233  C CA   . ALA A 1 35 ? 7.343  3.469   22.646 1.00 0.00 ? 35 ALA A CA   6  
ATOM 6234  C C    . ALA A 1 35 ? 8.825  3.201   22.889 1.00 0.00 ? 35 ALA A C    6  
ATOM 6235  O O    . ALA A 1 35 ? 9.684  3.961   22.442 1.00 0.00 ? 35 ALA A O    6  
ATOM 6236  C CB   . ALA A 1 35 ? 6.737  2.362   21.797 1.00 0.00 ? 35 ALA A CB   6  
ATOM 6237  H H    . ALA A 1 35 ? 7.306  4.852   21.045 1.00 0.00 ? 35 ALA A H    6  
ATOM 6238  H HA   . ALA A 1 35 ? 6.830  3.483   23.597 1.00 0.00 ? 35 ALA A HA   6  
ATOM 6239  H HB1  . ALA A 1 35 ? 6.242  1.647   22.440 1.00 0.00 ? 35 ALA A HB1  6  
ATOM 6240  H HB2  . ALA A 1 35 ? 6.020  2.786   21.110 1.00 0.00 ? 35 ALA A HB2  6  
ATOM 6241  H HB3  . ALA A 1 35 ? 7.518  1.865   21.242 1.00 0.00 ? 35 ALA A HB3  6  
ATOM 6242  N N    . ASP A 1 36 ? 9.116  2.117   23.599 1.00 0.00 ? 36 ASP A N    6  
ATOM 6243  C CA   . ASP A 1 36 ? 10.495 1.749   23.901 1.00 0.00 ? 36 ASP A CA   6  
ATOM 6244  C C    . ASP A 1 36 ? 10.907 0.502   23.125 1.00 0.00 ? 36 ASP A C    6  
ATOM 6245  O O    . ASP A 1 36 ? 10.106 -0.075  22.389 1.00 0.00 ? 36 ASP A O    6  
ATOM 6246  C CB   . ASP A 1 36 ? 10.664 1.510   25.402 1.00 0.00 ? 36 ASP A CB   6  
ATOM 6247  C CG   . ASP A 1 36 ? 10.308 2.731   26.227 1.00 0.00 ? 36 ASP A CG   6  
ATOM 6248  O OD1  . ASP A 1 36 ? 11.123 3.676   26.269 1.00 0.00 ? 36 ASP A OD1  6  
ATOM 6249  O OD2  . ASP A 1 36 ? 9.215  2.741   26.832 1.00 0.00 ? 36 ASP A OD2  6  
ATOM 6250  H H    . ASP A 1 36 ? 8.387  1.551   23.928 1.00 0.00 ? 36 ASP A H    6  
ATOM 6251  H HA   . ASP A 1 36 ? 11.130 2.569   23.603 1.00 0.00 ? 36 ASP A HA   6  
ATOM 6252  H HB2  . ASP A 1 36 ? 10.022 0.695   25.705 1.00 0.00 ? 36 ASP A HB2  6  
ATOM 6253  H HB3  . ASP A 1 36 ? 11.692 1.247   25.605 1.00 0.00 ? 36 ASP A HB3  6  
ATOM 6254  N N    . SER A 1 37 ? 12.160 0.093   23.294 1.00 0.00 ? 37 SER A N    6  
ATOM 6255  C CA   . SER A 1 37 ? 12.680 -1.082  22.605 1.00 0.00 ? 37 SER A CA   6  
ATOM 6256  C C    . SER A 1 37 ? 11.768 -2.286  22.822 1.00 0.00 ? 37 SER A C    6  
ATOM 6257  O O    . SER A 1 37 ? 11.603 -3.123  21.933 1.00 0.00 ? 37 SER A O    6  
ATOM 6258  C CB   . SER A 1 37 ? 14.093 -1.404  23.095 1.00 0.00 ? 37 SER A CB   6  
ATOM 6259  O OG   . SER A 1 37 ? 14.119 -1.572  24.502 1.00 0.00 ? 37 SER A OG   6  
ATOM 6260  H H    . SER A 1 37 ? 12.750 0.596   23.894 1.00 0.00 ? 37 SER A H    6  
ATOM 6261  H HA   . SER A 1 37 ? 12.716 -0.859  21.549 1.00 0.00 ? 37 SER A HA   6  
ATOM 6262  H HB2  . SER A 1 37 ? 14.434 -2.316  22.630 1.00 0.00 ? 37 SER A HB2  6  
ATOM 6263  H HB3  . SER A 1 37 ? 14.756 -0.593  22.829 1.00 0.00 ? 37 SER A HB3  6  
ATOM 6264  H HG   . SER A 1 37 ? 14.155 -2.508  24.712 1.00 0.00 ? 37 SER A HG   6  
ATOM 6265  N N    . LEU A 1 38 ? 11.178 -2.368  24.010 1.00 0.00 ? 38 LEU A N    6  
ATOM 6266  C CA   . LEU A 1 38 ? 10.283 -3.469  24.345 1.00 0.00 ? 38 LEU A CA   6  
ATOM 6267  C C    . LEU A 1 38 ? 9.191  -3.624  23.291 1.00 0.00 ? 38 LEU A C    6  
ATOM 6268  O O    . LEU A 1 38 ? 8.974  -4.715  22.764 1.00 0.00 ? 38 LEU A O    6  
ATOM 6269  C CB   . LEU A 1 38 ? 9.651  -3.238  25.719 1.00 0.00 ? 38 LEU A CB   6  
ATOM 6270  C CG   . LEU A 1 38 ? 10.425 -3.793  26.916 1.00 0.00 ? 38 LEU A CG   6  
ATOM 6271  C CD1  . LEU A 1 38 ? 11.480 -2.800  27.376 1.00 0.00 ? 38 LEU A CD1  6  
ATOM 6272  C CD2  . LEU A 1 38 ? 9.475  -4.132  28.055 1.00 0.00 ? 38 LEU A CD2  6  
ATOM 6273  H H    . LEU A 1 38 ? 11.349 -1.671  24.677 1.00 0.00 ? 38 LEU A H    6  
ATOM 6274  H HA   . LEU A 1 38 ? 10.869 -4.375  24.375 1.00 0.00 ? 38 LEU A HA   6  
ATOM 6275  H HB2  . LEU A 1 38 ? 9.546  -2.173  25.860 1.00 0.00 ? 38 LEU A HB2  6  
ATOM 6276  H HB3  . LEU A 1 38 ? 8.673  -3.697  25.714 1.00 0.00 ? 38 LEU A HB3  6  
ATOM 6277  H HG   . LEU A 1 38 ? 10.930 -4.702  26.619 1.00 0.00 ? 38 LEU A HG   6  
ATOM 6278  H HD11 . LEU A 1 38 ? 12.392 -2.959  26.820 1.00 0.00 ? 38 LEU A HD11 6  
ATOM 6279  H HD12 . LEU A 1 38 ? 11.672 -2.942  28.430 1.00 0.00 ? 38 LEU A HD12 6  
ATOM 6280  H HD13 . LEU A 1 38 ? 11.125 -1.794  27.208 1.00 0.00 ? 38 LEU A HD13 6  
ATOM 6281  H HD21 . LEU A 1 38 ? 8.590  -4.606  27.656 1.00 0.00 ? 38 LEU A HD21 6  
ATOM 6282  H HD22 . LEU A 1 38 ? 9.195  -3.225  28.572 1.00 0.00 ? 38 LEU A HD22 6  
ATOM 6283  H HD23 . LEU A 1 38 ? 9.964  -4.804  28.744 1.00 0.00 ? 38 LEU A HD23 6  
ATOM 6284  N N    . ASP A 1 39 ? 8.509  -2.525  22.987 1.00 0.00 ? 39 ASP A N    6  
ATOM 6285  C CA   . ASP A 1 39 ? 7.443  -2.538  21.993 1.00 0.00 ? 39 ASP A CA   6  
ATOM 6286  C C    . ASP A 1 39 ? 7.953  -3.063  20.655 1.00 0.00 ? 39 ASP A C    6  
ATOM 6287  O O    . ASP A 1 39 ? 7.323  -3.917  20.029 1.00 0.00 ? 39 ASP A O    6  
ATOM 6288  C CB   . ASP A 1 39 ? 6.864  -1.133  21.816 1.00 0.00 ? 39 ASP A CB   6  
ATOM 6289  C CG   . ASP A 1 39 ? 5.616  -1.124  20.956 1.00 0.00 ? 39 ASP A CG   6  
ATOM 6290  O OD1  . ASP A 1 39 ? 5.303  -2.173  20.356 1.00 0.00 ? 39 ASP A OD1  6  
ATOM 6291  O OD2  . ASP A 1 39 ? 4.953  -0.068  20.883 1.00 0.00 ? 39 ASP A OD2  6  
ATOM 6292  H H    . ASP A 1 39 ? 8.730  -1.685  23.442 1.00 0.00 ? 39 ASP A H    6  
ATOM 6293  H HA   . ASP A 1 39 ? 6.664  -3.195  22.350 1.00 0.00 ? 39 ASP A HA   6  
ATOM 6294  H HB2  . ASP A 1 39 ? 6.613  -0.729  22.787 1.00 0.00 ? 39 ASP A HB2  6  
ATOM 6295  H HB3  . ASP A 1 39 ? 7.606  -0.501  21.350 1.00 0.00 ? 39 ASP A HB3  6  
ATOM 6296  N N    . THR A 1 40 ? 9.098  -2.547  20.220 1.00 0.00 ? 40 THR A N    6  
ATOM 6297  C CA   . THR A 1 40 ? 9.692  -2.962  18.955 1.00 0.00 ? 40 THR A CA   6  
ATOM 6298  C C    . THR A 1 40 ? 9.918  -4.469  18.922 1.00 0.00 ? 40 THR A C    6  
ATOM 6299  O O    . THR A 1 40 ? 9.577  -5.137  17.946 1.00 0.00 ? 40 THR A O    6  
ATOM 6300  C CB   . THR A 1 40 ? 11.033 -2.247  18.703 1.00 0.00 ? 40 THR A CB   6  
ATOM 6301  O OG1  . THR A 1 40 ? 10.940 -0.875  19.101 1.00 0.00 ? 40 THR A OG1  6  
ATOM 6302  C CG2  . THR A 1 40 ? 11.422 -2.329  17.235 1.00 0.00 ? 40 THR A CG2  6  
ATOM 6303  H H    . THR A 1 40 ? 9.553  -1.870  20.763 1.00 0.00 ? 40 THR A H    6  
ATOM 6304  H HA   . THR A 1 40 ? 9.010  -2.692  18.162 1.00 0.00 ? 40 THR A HA   6  
ATOM 6305  H HB   . THR A 1 40 ? 11.799 -2.733  19.291 1.00 0.00 ? 40 THR A HB   6  
ATOM 6306  H HG1  . THR A 1 40 ? 11.577 -0.354  18.607 1.00 0.00 ? 40 THR A HG1  6  
ATOM 6307  H HG21 . THR A 1 40 ? 12.401 -2.777  17.146 1.00 0.00 ? 40 THR A HG21 6  
ATOM 6308  H HG22 . THR A 1 40 ? 11.441 -1.336  16.812 1.00 0.00 ? 40 THR A HG22 6  
ATOM 6309  H HG23 . THR A 1 40 ? 10.701 -2.932  16.705 1.00 0.00 ? 40 THR A HG23 6  
ATOM 6310  N N    . VAL A 1 41 ? 10.496 -4.999  19.996 1.00 0.00 ? 41 VAL A N    6  
ATOM 6311  C CA   . VAL A 1 41 ? 10.766 -6.429  20.090 1.00 0.00 ? 41 VAL A CA   6  
ATOM 6312  C C    . VAL A 1 41 ? 9.481  -7.240  19.971 1.00 0.00 ? 41 VAL A C    6  
ATOM 6313  O O    . VAL A 1 41 ? 9.380  -8.142  19.140 1.00 0.00 ? 41 VAL A O    6  
ATOM 6314  C CB   . VAL A 1 41 ? 11.462 -6.782  21.418 1.00 0.00 ? 41 VAL A CB   6  
ATOM 6315  C CG1  . VAL A 1 41 ? 11.794 -8.266  21.469 1.00 0.00 ? 41 VAL A CG1  6  
ATOM 6316  C CG2  . VAL A 1 41 ? 12.715 -5.940  21.603 1.00 0.00 ? 41 VAL A CG2  6  
ATOM 6317  H H    . VAL A 1 41 ? 10.745 -4.416  20.742 1.00 0.00 ? 41 VAL A H    6  
ATOM 6318  H HA   . VAL A 1 41 ? 11.427 -6.698  19.279 1.00 0.00 ? 41 VAL A HA   6  
ATOM 6319  H HB   . VAL A 1 41 ? 10.782 -6.560  22.228 1.00 0.00 ? 41 VAL A HB   6  
ATOM 6320  H HG11 . VAL A 1 41 ? 12.174 -8.582  20.509 1.00 0.00 ? 41 VAL A HG11 6  
ATOM 6321  H HG12 . VAL A 1 41 ? 12.542 -8.442  22.229 1.00 0.00 ? 41 VAL A HG12 6  
ATOM 6322  H HG13 . VAL A 1 41 ? 10.902 -8.826  21.705 1.00 0.00 ? 41 VAL A HG13 6  
ATOM 6323  H HG21 . VAL A 1 41 ? 12.553 -5.223  22.394 1.00 0.00 ? 41 VAL A HG21 6  
ATOM 6324  H HG22 . VAL A 1 41 ? 13.545 -6.581  21.863 1.00 0.00 ? 41 VAL A HG22 6  
ATOM 6325  H HG23 . VAL A 1 41 ? 12.938 -5.418  20.684 1.00 0.00 ? 41 VAL A HG23 6  
ATOM 6326  N N    . GLU A 1 42 ? 8.501  -6.913  20.808 1.00 0.00 ? 42 GLU A N    6  
ATOM 6327  C CA   . GLU A 1 42 ? 7.221  -7.612  20.796 1.00 0.00 ? 42 GLU A CA   6  
ATOM 6328  C C    . GLU A 1 42 ? 6.634  -7.648  19.388 1.00 0.00 ? 42 GLU A C    6  
ATOM 6329  O O    . GLU A 1 42 ? 6.221  -8.702  18.902 1.00 0.00 ? 42 GLU A O    6  
ATOM 6330  C CB   . GLU A 1 42 ? 6.237  -6.937  21.753 1.00 0.00 ? 42 GLU A CB   6  
ATOM 6331  C CG   . GLU A 1 42 ? 6.611  -7.089  23.218 1.00 0.00 ? 42 GLU A CG   6  
ATOM 6332  C CD   . GLU A 1 42 ? 5.465  -6.749  24.151 1.00 0.00 ? 42 GLU A CD   6  
ATOM 6333  O OE1  . GLU A 1 42 ? 4.902  -5.642  24.021 1.00 0.00 ? 42 GLU A OE1  6  
ATOM 6334  O OE2  . GLU A 1 42 ? 5.132  -7.591  25.012 1.00 0.00 ? 42 GLU A OE2  6  
ATOM 6335  H H    . GLU A 1 42 ? 8.642  -6.184  21.448 1.00 0.00 ? 42 GLU A H    6  
ATOM 6336  H HA   . GLU A 1 42 ? 7.394  -8.625  21.127 1.00 0.00 ? 42 GLU A HA   6  
ATOM 6337  H HB2  . GLU A 1 42 ? 6.193  -5.883  21.521 1.00 0.00 ? 42 GLU A HB2  6  
ATOM 6338  H HB3  . GLU A 1 42 ? 5.258  -7.369  21.607 1.00 0.00 ? 42 GLU A HB3  6  
ATOM 6339  H HG2  . GLU A 1 42 ? 6.908  -8.112  23.396 1.00 0.00 ? 42 GLU A HG2  6  
ATOM 6340  H HG3  . GLU A 1 42 ? 7.440  -6.432  23.435 1.00 0.00 ? 42 GLU A HG3  6  
ATOM 6341  N N    . LEU A 1 43 ? 6.600  -6.491  18.738 1.00 0.00 ? 43 LEU A N    6  
ATOM 6342  C CA   . LEU A 1 43 ? 6.063  -6.388  17.385 1.00 0.00 ? 43 LEU A CA   6  
ATOM 6343  C C    . LEU A 1 43 ? 6.798  -7.329  16.435 1.00 0.00 ? 43 LEU A C    6  
ATOM 6344  O O    . LEU A 1 43 ? 6.177  -8.122  15.727 1.00 0.00 ? 43 LEU A O    6  
ATOM 6345  C CB   . LEU A 1 43 ? 6.171  -4.949  16.880 1.00 0.00 ? 43 LEU A CB   6  
ATOM 6346  C CG   . LEU A 1 43 ? 4.969  -4.047  17.159 1.00 0.00 ? 43 LEU A CG   6  
ATOM 6347  C CD1  . LEU A 1 43 ? 5.234  -2.634  16.664 1.00 0.00 ? 43 LEU A CD1  6  
ATOM 6348  C CD2  . LEU A 1 43 ? 3.714  -4.615  16.511 1.00 0.00 ? 43 LEU A CD2  6  
ATOM 6349  H H    . LEU A 1 43 ? 6.943  -5.685  19.176 1.00 0.00 ? 43 LEU A H    6  
ATOM 6350  H HA   . LEU A 1 43 ? 5.022  -6.672  17.420 1.00 0.00 ? 43 LEU A HA   6  
ATOM 6351  H HB2  . LEU A 1 43 ? 7.036  -4.500  17.344 1.00 0.00 ? 43 LEU A HB2  6  
ATOM 6352  H HB3  . LEU A 1 43 ? 6.317  -4.985  15.809 1.00 0.00 ? 43 LEU A HB3  6  
ATOM 6353  H HG   . LEU A 1 43 ? 4.802  -4.000  18.227 1.00 0.00 ? 43 LEU A HG   6  
ATOM 6354  H HD11 . LEU A 1 43 ? 6.173  -2.283  17.065 1.00 0.00 ? 43 LEU A HD11 6  
ATOM 6355  H HD12 . LEU A 1 43 ? 4.437  -1.982  16.990 1.00 0.00 ? 43 LEU A HD12 6  
ATOM 6356  H HD13 . LEU A 1 43 ? 5.280  -2.634  15.585 1.00 0.00 ? 43 LEU A HD13 6  
ATOM 6357  H HD21 . LEU A 1 43 ? 2.930  -4.688  17.250 1.00 0.00 ? 43 LEU A HD21 6  
ATOM 6358  H HD22 . LEU A 1 43 ? 3.927  -5.596  16.114 1.00 0.00 ? 43 LEU A HD22 6  
ATOM 6359  H HD23 . LEU A 1 43 ? 3.396  -3.963  15.711 1.00 0.00 ? 43 LEU A HD23 6  
ATOM 6360  N N    . VAL A 1 44 ? 8.124  -7.237  16.427 1.00 0.00 ? 44 VAL A N    6  
ATOM 6361  C CA   . VAL A 1 44 ? 8.944  -8.082  15.567 1.00 0.00 ? 44 VAL A CA   6  
ATOM 6362  C C    . VAL A 1 44 ? 8.587  -9.554  15.742 1.00 0.00 ? 44 VAL A C    6  
ATOM 6363  O O    . VAL A 1 44 ? 8.396  -10.277 14.764 1.00 0.00 ? 44 VAL A O    6  
ATOM 6364  C CB   . VAL A 1 44 ? 10.444 -7.891  15.858 1.00 0.00 ? 44 VAL A CB   6  
ATOM 6365  C CG1  . VAL A 1 44 ? 11.280 -8.802  14.972 1.00 0.00 ? 44 VAL A CG1  6  
ATOM 6366  C CG2  . VAL A 1 44 ? 10.842 -6.436  15.666 1.00 0.00 ? 44 VAL A CG2  6  
ATOM 6367  H H    . VAL A 1 44 ? 8.561  -6.586  17.014 1.00 0.00 ? 44 VAL A H    6  
ATOM 6368  H HA   . VAL A 1 44 ? 8.758  -7.796  14.542 1.00 0.00 ? 44 VAL A HA   6  
ATOM 6369  H HB   . VAL A 1 44 ? 10.627 -8.160  16.888 1.00 0.00 ? 44 VAL A HB   6  
ATOM 6370  H HG11 . VAL A 1 44 ? 12.326 -8.566  15.099 1.00 0.00 ? 44 VAL A HG11 6  
ATOM 6371  H HG12 . VAL A 1 44 ? 11.106 -9.832  15.249 1.00 0.00 ? 44 VAL A HG12 6  
ATOM 6372  H HG13 . VAL A 1 44 ? 11.001 -8.655  13.939 1.00 0.00 ? 44 VAL A HG13 6  
ATOM 6373  H HG21 . VAL A 1 44 ? 9.980  -5.866  15.354 1.00 0.00 ? 44 VAL A HG21 6  
ATOM 6374  H HG22 . VAL A 1 44 ? 11.218 -6.039  16.598 1.00 0.00 ? 44 VAL A HG22 6  
ATOM 6375  H HG23 . VAL A 1 44 ? 11.611 -6.369  14.911 1.00 0.00 ? 44 VAL A HG23 6  
ATOM 6376  N N    . MET A 1 45 ? 8.498  -9.991  16.993 1.00 0.00 ? 45 MET A N    6  
ATOM 6377  C CA   . MET A 1 45 ? 8.162  -11.378 17.296 1.00 0.00 ? 45 MET A CA   6  
ATOM 6378  C C    . MET A 1 45 ? 6.794  -11.742 16.728 1.00 0.00 ? 45 MET A C    6  
ATOM 6379  O O    . MET A 1 45 ? 6.626  -12.797 16.117 1.00 0.00 ? 45 MET A O    6  
ATOM 6380  C CB   . MET A 1 45 ? 8.177  -11.610 18.808 1.00 0.00 ? 45 MET A CB   6  
ATOM 6381  C CG   . MET A 1 45 ? 9.544  -11.996 19.350 1.00 0.00 ? 45 MET A CG   6  
ATOM 6382  S SD   . MET A 1 45 ? 9.441  -13.069 20.795 1.00 0.00 ? 45 MET A SD   6  
ATOM 6383  C CE   . MET A 1 45 ? 9.419  -14.683 20.017 1.00 0.00 ? 45 MET A CE   6  
ATOM 6384  H H    . MET A 1 45 ? 8.661  -9.367  17.731 1.00 0.00 ? 45 MET A H    6  
ATOM 6385  H HA   . MET A 1 45 ? 8.909  -12.007 16.837 1.00 0.00 ? 45 MET A HA   6  
ATOM 6386  H HB2  . MET A 1 45 ? 7.860  -10.704 19.303 1.00 0.00 ? 45 MET A HB2  6  
ATOM 6387  H HB3  . MET A 1 45 ? 7.483  -12.403 19.046 1.00 0.00 ? 45 MET A HB3  6  
ATOM 6388  H HG2  . MET A 1 45 ? 10.092 -12.512 18.575 1.00 0.00 ? 45 MET A HG2  6  
ATOM 6389  H HG3  . MET A 1 45 ? 10.074 -11.096 19.624 1.00 0.00 ? 45 MET A HG3  6  
ATOM 6390  H HE1  . MET A 1 45 ? 8.674  -14.695 19.235 1.00 0.00 ? 45 MET A HE1  6  
ATOM 6391  H HE2  . MET A 1 45 ? 10.390 -14.891 19.594 1.00 0.00 ? 45 MET A HE2  6  
ATOM 6392  H HE3  . MET A 1 45 ? 9.178  -15.434 20.756 1.00 0.00 ? 45 MET A HE3  6  
ATOM 6393  N N    . ALA A 1 46 ? 5.819  -10.863 16.935 1.00 0.00 ? 46 ALA A N    6  
ATOM 6394  C CA   . ALA A 1 46 ? 4.466  -11.092 16.442 1.00 0.00 ? 46 ALA A CA   6  
ATOM 6395  C C    . ALA A 1 46 ? 4.465  -11.339 14.937 1.00 0.00 ? 46 ALA A C    6  
ATOM 6396  O O    . ALA A 1 46 ? 3.959  -12.357 14.465 1.00 0.00 ? 46 ALA A O    6  
ATOM 6397  C CB   . ALA A 1 46 ? 3.572  -9.910  16.785 1.00 0.00 ? 46 ALA A CB   6  
ATOM 6398  H H    . ALA A 1 46 ? 6.014  -10.040 17.430 1.00 0.00 ? 46 ALA A H    6  
ATOM 6399  H HA   . ALA A 1 46 ? 4.073  -11.967 16.940 1.00 0.00 ? 46 ALA A HA   6  
ATOM 6400  H HB1  . ALA A 1 46 ? 3.915  -9.455  17.703 1.00 0.00 ? 46 ALA A HB1  6  
ATOM 6401  H HB2  . ALA A 1 46 ? 3.612  -9.185  15.987 1.00 0.00 ? 46 ALA A HB2  6  
ATOM 6402  H HB3  . ALA A 1 46 ? 2.556  -10.253 16.911 1.00 0.00 ? 46 ALA A HB3  6  
ATOM 6403  N N    . PHE A 1 47 ? 5.035  -10.400 14.188 1.00 0.00 ? 47 PHE A N    6  
ATOM 6404  C CA   . PHE A 1 47 ? 5.098  -10.515 12.735 1.00 0.00 ? 47 PHE A CA   6  
ATOM 6405  C C    . PHE A 1 47 ? 5.836  -11.785 12.322 1.00 0.00 ? 47 PHE A C    6  
ATOM 6406  O O    . PHE A 1 47 ? 5.440  -12.464 11.375 1.00 0.00 ? 47 PHE A O    6  
ATOM 6407  C CB   . PHE A 1 47 ? 5.792  -9.291  12.135 1.00 0.00 ? 47 PHE A CB   6  
ATOM 6408  C CG   . PHE A 1 47 ? 5.219  -7.985  12.609 1.00 0.00 ? 47 PHE A CG   6  
ATOM 6409  C CD1  . PHE A 1 47 ? 3.849  -7.787  12.645 1.00 0.00 ? 47 PHE A CD1  6  
ATOM 6410  C CD2  . PHE A 1 47 ? 6.052  -6.956  13.018 1.00 0.00 ? 47 PHE A CD2  6  
ATOM 6411  C CE1  . PHE A 1 47 ? 3.319  -6.587  13.081 1.00 0.00 ? 47 PHE A CE1  6  
ATOM 6412  C CE2  . PHE A 1 47 ? 5.528  -5.755  13.455 1.00 0.00 ? 47 PHE A CE2  6  
ATOM 6413  C CZ   . PHE A 1 47 ? 4.160  -5.569  13.486 1.00 0.00 ? 47 PHE A CZ   6  
ATOM 6414  H H    . PHE A 1 47 ? 5.422  -9.611  14.622 1.00 0.00 ? 47 PHE A H    6  
ATOM 6415  H HA   . PHE A 1 47 ? 4.086  -10.564 12.363 1.00 0.00 ? 47 PHE A HA   6  
ATOM 6416  H HB2  . PHE A 1 47 ? 6.837  -9.311  12.403 1.00 0.00 ? 47 PHE A HB2  6  
ATOM 6417  H HB3  . PHE A 1 47 ? 5.699  -9.324  11.060 1.00 0.00 ? 47 PHE A HB3  6  
ATOM 6418  H HD1  . PHE A 1 47 ? 3.189  -8.583  12.329 1.00 0.00 ? 47 PHE A HD1  6  
ATOM 6419  H HD2  . PHE A 1 47 ? 7.123  -7.099  12.993 1.00 0.00 ? 47 PHE A HD2  6  
ATOM 6420  H HE1  . PHE A 1 47 ? 2.248  -6.446  13.104 1.00 0.00 ? 47 PHE A HE1  6  
ATOM 6421  H HE2  . PHE A 1 47 ? 6.188  -4.960  13.770 1.00 0.00 ? 47 PHE A HE2  6  
ATOM 6422  H HZ   . PHE A 1 47 ? 3.748  -4.631  13.827 1.00 0.00 ? 47 PHE A HZ   6  
ATOM 6423  N N    . GLU A 1 48 ? 6.910  -12.099 13.039 1.00 0.00 ? 48 GLU A N    6  
ATOM 6424  C CA   . GLU A 1 48 ? 7.704  -13.286 12.746 1.00 0.00 ? 48 GLU A CA   6  
ATOM 6425  C C    . GLU A 1 48 ? 6.869  -14.553 12.907 1.00 0.00 ? 48 GLU A C    6  
ATOM 6426  O O    . GLU A 1 48 ? 6.998  -15.496 12.128 1.00 0.00 ? 48 GLU A O    6  
ATOM 6427  C CB   . GLU A 1 48 ? 8.927  -13.348 13.663 1.00 0.00 ? 48 GLU A CB   6  
ATOM 6428  C CG   . GLU A 1 48 ? 10.190 -13.820 12.963 1.00 0.00 ? 48 GLU A CG   6  
ATOM 6429  C CD   . GLU A 1 48 ? 11.155 -14.515 13.904 1.00 0.00 ? 48 GLU A CD   6  
ATOM 6430  O OE1  . GLU A 1 48 ? 10.918 -14.476 15.130 1.00 0.00 ? 48 GLU A OE1  6  
ATOM 6431  O OE2  . GLU A 1 48 ? 12.145 -15.098 13.416 1.00 0.00 ? 48 GLU A OE2  6  
ATOM 6432  H H    . GLU A 1 48 ? 7.175  -11.518 13.782 1.00 0.00 ? 48 GLU A H    6  
ATOM 6433  H HA   . GLU A 1 48 ? 8.038  -13.217 11.721 1.00 0.00 ? 48 GLU A HA   6  
ATOM 6434  H HB2  . GLU A 1 48 ? 9.110  -12.364 14.067 1.00 0.00 ? 48 GLU A HB2  6  
ATOM 6435  H HB3  . GLU A 1 48 ? 8.717  -14.027 14.477 1.00 0.00 ? 48 GLU A HB3  6  
ATOM 6436  H HG2  . GLU A 1 48 ? 9.916  -14.510 12.179 1.00 0.00 ? 48 GLU A HG2  6  
ATOM 6437  H HG3  . GLU A 1 48 ? 10.687 -12.964 12.529 1.00 0.00 ? 48 GLU A HG3  6  
ATOM 6438  N N    . GLU A 1 49 ? 6.012  -14.564 13.923 1.00 0.00 ? 49 GLU A N    6  
ATOM 6439  C CA   . GLU A 1 49 ? 5.157  -15.715 14.188 1.00 0.00 ? 49 GLU A CA   6  
ATOM 6440  C C    . GLU A 1 49 ? 3.978  -15.750 13.219 1.00 0.00 ? 49 GLU A C    6  
ATOM 6441  O O    . GLU A 1 49 ? 3.452  -16.817 12.905 1.00 0.00 ? 49 GLU A O    6  
ATOM 6442  C CB   . GLU A 1 49 ? 4.646  -15.679 15.629 1.00 0.00 ? 49 GLU A CB   6  
ATOM 6443  C CG   . GLU A 1 49 ? 3.998  -16.978 16.078 1.00 0.00 ? 49 GLU A CG   6  
ATOM 6444  C CD   . GLU A 1 49 ? 4.998  -18.107 16.230 1.00 0.00 ? 49 GLU A CD   6  
ATOM 6445  O OE1  . GLU A 1 49 ? 5.669  -18.169 17.281 1.00 0.00 ? 49 GLU A OE1  6  
ATOM 6446  O OE2  . GLU A 1 49 ? 5.110  -18.929 15.296 1.00 0.00 ? 49 GLU A OE2  6  
ATOM 6447  H H    . GLU A 1 49 ? 5.955  -13.781 14.510 1.00 0.00 ? 49 GLU A H    6  
ATOM 6448  H HA   . GLU A 1 49 ? 5.748  -16.607 14.048 1.00 0.00 ? 49 GLU A HA   6  
ATOM 6449  H HB2  . GLU A 1 49 ? 5.476  -15.468 16.287 1.00 0.00 ? 49 GLU A HB2  6  
ATOM 6450  H HB3  . GLU A 1 49 ? 3.917  -14.888 15.720 1.00 0.00 ? 49 GLU A HB3  6  
ATOM 6451  H HG2  . GLU A 1 49 ? 3.516  -16.815 17.031 1.00 0.00 ? 49 GLU A HG2  6  
ATOM 6452  H HG3  . GLU A 1 49 ? 3.258  -17.268 15.347 1.00 0.00 ? 49 GLU A HG3  6  
ATOM 6453  N N    . GLU A 1 50 ? 3.568  -14.575 12.752 1.00 0.00 ? 50 GLU A N    6  
ATOM 6454  C CA   . GLU A 1 50 ? 2.451  -14.472 11.821 1.00 0.00 ? 50 GLU A CA   6  
ATOM 6455  C C    . GLU A 1 50 ? 2.859  -14.939 10.427 1.00 0.00 ? 50 GLU A C    6  
ATOM 6456  O O    . GLU A 1 50 ? 2.206  -15.796 9.831  1.00 0.00 ? 50 GLU A O    6  
ATOM 6457  C CB   . GLU A 1 50 ? 1.942  -13.030 11.759 1.00 0.00 ? 50 GLU A CB   6  
ATOM 6458  C CG   . GLU A 1 50 ? 1.126  -12.620 12.974 1.00 0.00 ? 50 GLU A CG   6  
ATOM 6459  C CD   . GLU A 1 50 ? 0.036  -11.622 12.634 1.00 0.00 ? 50 GLU A CD   6  
ATOM 6460  O OE1  . GLU A 1 50 ? -0.561 -11.743 11.544 1.00 0.00 ? 50 GLU A OE1  6  
ATOM 6461  O OE2  . GLU A 1 50 ? -0.220 -10.720 13.460 1.00 0.00 ? 50 GLU A OE2  6  
ATOM 6462  H H    . GLU A 1 50 ? 4.028  -13.759 13.040 1.00 0.00 ? 50 GLU A H    6  
ATOM 6463  H HA   . GLU A 1 50 ? 1.658  -15.108 12.183 1.00 0.00 ? 50 GLU A HA   6  
ATOM 6464  H HB2  . GLU A 1 50 ? 2.789  -12.365 11.678 1.00 0.00 ? 50 GLU A HB2  6  
ATOM 6465  H HB3  . GLU A 1 50 ? 1.322  -12.917 10.881 1.00 0.00 ? 50 GLU A HB3  6  
ATOM 6466  H HG2  . GLU A 1 50 ? 0.668  -13.500 13.398 1.00 0.00 ? 50 GLU A HG2  6  
ATOM 6467  H HG3  . GLU A 1 50 ? 1.788  -12.174 13.702 1.00 0.00 ? 50 GLU A HG3  6  
ATOM 6468  N N    . PHE A 1 51 ? 3.943  -14.368 9.912  1.00 0.00 ? 51 PHE A N    6  
ATOM 6469  C CA   . PHE A 1 51 ? 4.439  -14.724 8.587  1.00 0.00 ? 51 PHE A CA   6  
ATOM 6470  C C    . PHE A 1 51 ? 5.236  -16.025 8.636  1.00 0.00 ? 51 PHE A C    6  
ATOM 6471  O O    . PHE A 1 51 ? 5.358  -16.728 7.634  1.00 0.00 ? 51 PHE A O    6  
ATOM 6472  C CB   . PHE A 1 51 ? 5.310  -13.599 8.026  1.00 0.00 ? 51 PHE A CB   6  
ATOM 6473  C CG   . PHE A 1 51 ? 4.522  -12.493 7.386  1.00 0.00 ? 51 PHE A CG   6  
ATOM 6474  C CD1  . PHE A 1 51 ? 4.143  -12.574 6.055  1.00 0.00 ? 51 PHE A CD1  6  
ATOM 6475  C CD2  . PHE A 1 51 ? 4.160  -11.371 8.114  1.00 0.00 ? 51 PHE A CD2  6  
ATOM 6476  C CE1  . PHE A 1 51 ? 3.419  -11.557 5.463  1.00 0.00 ? 51 PHE A CE1  6  
ATOM 6477  C CE2  . PHE A 1 51 ? 3.435  -10.351 7.527  1.00 0.00 ? 51 PHE A CE2  6  
ATOM 6478  C CZ   . PHE A 1 51 ? 3.063  -10.445 6.200  1.00 0.00 ? 51 PHE A CZ   6  
ATOM 6479  H H    . PHE A 1 51 ? 4.421  -13.691 10.435 1.00 0.00 ? 51 PHE A H    6  
ATOM 6480  H HA   . PHE A 1 51 ? 3.585  -14.863 7.941  1.00 0.00 ? 51 PHE A HA   6  
ATOM 6481  H HB2  . PHE A 1 51 ? 5.892  -13.170 8.828  1.00 0.00 ? 51 PHE A HB2  6  
ATOM 6482  H HB3  . PHE A 1 51 ? 5.977  -14.007 7.282  1.00 0.00 ? 51 PHE A HB3  6  
ATOM 6483  H HD1  . PHE A 1 51 ? 4.420  -13.444 5.478  1.00 0.00 ? 51 PHE A HD1  6  
ATOM 6484  H HD2  . PHE A 1 51 ? 4.450  -11.297 9.152  1.00 0.00 ? 51 PHE A HD2  6  
ATOM 6485  H HE1  . PHE A 1 51 ? 3.129  -11.633 4.426  1.00 0.00 ? 51 PHE A HE1  6  
ATOM 6486  H HE2  . PHE A 1 51 ? 3.158  -9.482  8.107  1.00 0.00 ? 51 PHE A HE2  6  
ATOM 6487  H HZ   . PHE A 1 51 ? 2.497  -9.648  5.740  1.00 0.00 ? 51 PHE A HZ   6  
ATOM 6488  N N    . GLY A 1 52 ? 5.777  -16.336 9.810  1.00 0.00 ? 52 GLY A N    6  
ATOM 6489  C CA   . GLY A 1 52 ? 6.556  -17.550 9.968  1.00 0.00 ? 52 GLY A CA   6  
ATOM 6490  C C    . GLY A 1 52 ? 7.929  -17.445 9.334  1.00 0.00 ? 52 GLY A C    6  
ATOM 6491  O O    . GLY A 1 52 ? 8.270  -18.222 8.442  1.00 0.00 ? 52 GLY A O    6  
ATOM 6492  H H    . GLY A 1 52 ? 5.646  -15.737 10.574 1.00 0.00 ? 52 GLY A H    6  
ATOM 6493  H HA2  . GLY A 1 52 ? 6.672  -17.756 11.022 1.00 0.00 ? 52 GLY A HA2  6  
ATOM 6494  H HA3  . GLY A 1 52 ? 6.022  -18.370 9.509  1.00 0.00 ? 52 GLY A HA3  6  
ATOM 6495  N N    . VAL A 1 53 ? 8.719  -16.480 9.793  1.00 0.00 ? 53 VAL A N    6  
ATOM 6496  C CA   . VAL A 1 53 ? 10.062 -16.275 9.265  1.00 0.00 ? 53 VAL A CA   6  
ATOM 6497  C C    . VAL A 1 53 ? 11.113 -16.432 10.358 1.00 0.00 ? 53 VAL A C    6  
ATOM 6498  O O    . VAL A 1 53 ? 10.781 -16.608 11.530 1.00 0.00 ? 53 VAL A O    6  
ATOM 6499  C CB   . VAL A 1 53 ? 10.207 -14.881 8.626  1.00 0.00 ? 53 VAL A CB   6  
ATOM 6500  C CG1  . VAL A 1 53 ? 9.263  -14.735 7.442  1.00 0.00 ? 53 VAL A CG1  6  
ATOM 6501  C CG2  . VAL A 1 53 ? 9.953  -13.793 9.658  1.00 0.00 ? 53 VAL A CG2  6  
ATOM 6502  H H    . VAL A 1 53 ? 8.390  -15.892 10.505 1.00 0.00 ? 53 VAL A H    6  
ATOM 6503  H HA   . VAL A 1 53 ? 10.237 -17.018 8.501  1.00 0.00 ? 53 VAL A HA   6  
ATOM 6504  H HB   . VAL A 1 53 ? 11.220 -14.776 8.265  1.00 0.00 ? 53 VAL A HB   6  
ATOM 6505  H HG11 . VAL A 1 53 ? 9.532  -15.450 6.678  1.00 0.00 ? 53 VAL A HG11 6  
ATOM 6506  H HG12 . VAL A 1 53 ? 8.249  -14.917 7.765  1.00 0.00 ? 53 VAL A HG12 6  
ATOM 6507  H HG13 . VAL A 1 53 ? 9.340  -13.735 7.041  1.00 0.00 ? 53 VAL A HG13 6  
ATOM 6508  H HG21 . VAL A 1 53 ? 9.660  -12.883 9.156  1.00 0.00 ? 53 VAL A HG21 6  
ATOM 6509  H HG22 . VAL A 1 53 ? 9.162  -14.106 10.324 1.00 0.00 ? 53 VAL A HG22 6  
ATOM 6510  H HG23 . VAL A 1 53 ? 10.854 -13.618 10.227 1.00 0.00 ? 53 VAL A HG23 6  
ATOM 6511  N N    . GLU A 1 54 ? 12.381 -16.368 9.966  1.00 0.00 ? 54 GLU A N    6  
ATOM 6512  C CA   . GLU A 1 54 ? 13.481 -16.504 10.914 1.00 0.00 ? 54 GLU A CA   6  
ATOM 6513  C C    . GLU A 1 54 ? 14.401 -15.288 10.858 1.00 0.00 ? 54 GLU A C    6  
ATOM 6514  O O    . GLU A 1 54 ? 15.132 -15.094 9.887  1.00 0.00 ? 54 GLU A O    6  
ATOM 6515  C CB   . GLU A 1 54 ? 14.281 -17.776 10.622 1.00 0.00 ? 54 GLU A CB   6  
ATOM 6516  C CG   . GLU A 1 54 ? 14.738 -17.889 9.177  1.00 0.00 ? 54 GLU A CG   6  
ATOM 6517  C CD   . GLU A 1 54 ? 15.237 -19.278 8.831  1.00 0.00 ? 54 GLU A CD   6  
ATOM 6518  O OE1  . GLU A 1 54 ? 16.253 -19.707 9.418  1.00 0.00 ? 54 GLU A OE1  6  
ATOM 6519  O OE2  . GLU A 1 54 ? 14.613 -19.937 7.973  1.00 0.00 ? 54 GLU A OE2  6  
ATOM 6520  H H    . GLU A 1 54 ? 12.582 -16.227 9.017  1.00 0.00 ? 54 GLU A H    6  
ATOM 6521  H HA   . GLU A 1 54 ? 13.058 -16.576 11.904 1.00 0.00 ? 54 GLU A HA   6  
ATOM 6522  H HB2  . GLU A 1 54 ? 15.154 -17.791 11.257 1.00 0.00 ? 54 GLU A HB2  6  
ATOM 6523  H HB3  . GLU A 1 54 ? 13.665 -18.633 10.851 1.00 0.00 ? 54 GLU A HB3  6  
ATOM 6524  H HG2  . GLU A 1 54 ? 13.908 -17.650 8.530  1.00 0.00 ? 54 GLU A HG2  6  
ATOM 6525  H HG3  . GLU A 1 54 ? 15.538 -17.183 9.010  1.00 0.00 ? 54 GLU A HG3  6  
ATOM 6526  N N    . ILE A 1 55 ? 14.357 -14.472 11.906 1.00 0.00 ? 55 ILE A N    6  
ATOM 6527  C CA   . ILE A 1 55 ? 15.186 -13.276 11.977 1.00 0.00 ? 55 ILE A CA   6  
ATOM 6528  C C    . ILE A 1 55 ? 16.005 -13.250 13.263 1.00 0.00 ? 55 ILE A C    6  
ATOM 6529  O O    . ILE A 1 55 ? 15.623 -13.824 14.283 1.00 0.00 ? 55 ILE A O    6  
ATOM 6530  C CB   . ILE A 1 55 ? 14.335 -11.995 11.898 1.00 0.00 ? 55 ILE A CB   6  
ATOM 6531  C CG1  . ILE A 1 55 ? 13.326 -11.956 13.048 1.00 0.00 ? 55 ILE A CG1  6  
ATOM 6532  C CG2  . ILE A 1 55 ? 13.621 -11.916 10.557 1.00 0.00 ? 55 ILE A CG2  6  
ATOM 6533  C CD1  . ILE A 1 55 ? 13.852 -11.271 14.290 1.00 0.00 ? 55 ILE A CD1  6  
ATOM 6534  H H    . ILE A 1 55 ? 13.754 -14.681 12.649 1.00 0.00 ? 55 ILE A H    6  
ATOM 6535  H HA   . ILE A 1 55 ? 15.861 -13.288 11.133 1.00 0.00 ? 55 ILE A HA   6  
ATOM 6536  H HB   . ILE A 1 55 ? 14.994 -11.145 11.979 1.00 0.00 ? 55 ILE A HB   6  
ATOM 6537  H HG12 . ILE A 1 55 ? 12.443 -11.426 12.727 1.00 0.00 ? 55 ILE A HG12 6  
ATOM 6538  H HG13 . ILE A 1 55 ? 13.056 -12.968 13.315 1.00 0.00 ? 55 ILE A HG13 6  
ATOM 6539  H HG21 . ILE A 1 55 ? 14.334 -12.064 9.760  1.00 0.00 ? 55 ILE A HG21 6  
ATOM 6540  H HG22 . ILE A 1 55 ? 12.863 -12.683 10.508 1.00 0.00 ? 55 ILE A HG22 6  
ATOM 6541  H HG23 . ILE A 1 55 ? 13.159 -10.945 10.452 1.00 0.00 ? 55 ILE A HG23 6  
ATOM 6542  H HD11 . ILE A 1 55 ? 13.028 -10.846 14.844 1.00 0.00 ? 55 ILE A HD11 6  
ATOM 6543  H HD12 . ILE A 1 55 ? 14.368 -11.991 14.907 1.00 0.00 ? 55 ILE A HD12 6  
ATOM 6544  H HD13 . ILE A 1 55 ? 14.536 -10.485 14.005 1.00 0.00 ? 55 ILE A HD13 6  
ATOM 6545  N N    . PRO A 1 56 ? 17.159 -12.567 13.217 1.00 0.00 ? 56 PRO A N    6  
ATOM 6546  C CA   . PRO A 1 56 ? 18.055 -12.447 14.371 1.00 0.00 ? 56 PRO A CA   6  
ATOM 6547  C C    . PRO A 1 56 ? 17.468 -11.572 15.473 1.00 0.00 ? 56 PRO A C    6  
ATOM 6548  O O    . PRO A 1 56 ? 16.555 -10.782 15.231 1.00 0.00 ? 56 PRO A O    6  
ATOM 6549  C CB   . PRO A 1 56 ? 19.308 -11.795 13.780 1.00 0.00 ? 56 PRO A CB   6  
ATOM 6550  C CG   . PRO A 1 56 ? 18.821 -11.053 12.584 1.00 0.00 ? 56 PRO A CG   6  
ATOM 6551  C CD   . PRO A 1 56 ? 17.677 -11.858 12.034 1.00 0.00 ? 56 PRO A CD   6  
ATOM 6552  H HA   . PRO A 1 56 ? 18.309 -13.415 14.778 1.00 0.00 ? 56 PRO A HA   6  
ATOM 6553  H HB2  . PRO A 1 56 ? 19.747 -11.128 14.509 1.00 0.00 ? 56 PRO A HB2  6  
ATOM 6554  H HB3  . PRO A 1 56 ? 20.021 -12.559 13.508 1.00 0.00 ? 56 PRO A HB3  6  
ATOM 6555  H HG2  . PRO A 1 56 ? 18.482 -10.070 12.875 1.00 0.00 ? 56 PRO A HG2  6  
ATOM 6556  H HG3  . PRO A 1 56 ? 19.611 -10.977 11.852 1.00 0.00 ? 56 PRO A HG3  6  
ATOM 6557  H HD2  . PRO A 1 56 ? 16.924 -11.207 11.615 1.00 0.00 ? 56 PRO A HD2  6  
ATOM 6558  H HD3  . PRO A 1 56 ? 18.030 -12.558 11.291 1.00 0.00 ? 56 PRO A HD3  6  
ATOM 6559  N N    . ASP A 1 57 ? 17.997 -11.718 16.682 1.00 0.00 ? 57 ASP A N    6  
ATOM 6560  C CA   . ASP A 1 57 ? 17.526 -10.939 17.822 1.00 0.00 ? 57 ASP A CA   6  
ATOM 6561  C C    . ASP A 1 57 ? 17.978 -9.486  17.711 1.00 0.00 ? 57 ASP A C    6  
ATOM 6562  O O    . ASP A 1 57 ? 17.340 -8.584  18.253 1.00 0.00 ? 57 ASP A O    6  
ATOM 6563  C CB   . ASP A 1 57 ? 18.036 -11.547 19.129 1.00 0.00 ? 57 ASP A CB   6  
ATOM 6564  C CG   . ASP A 1 57 ? 17.410 -12.896 19.423 1.00 0.00 ? 57 ASP A CG   6  
ATOM 6565  O OD1  . ASP A 1 57 ? 16.169 -13.005 19.339 1.00 0.00 ? 57 ASP A OD1  6  
ATOM 6566  O OD2  . ASP A 1 57 ? 18.161 -13.843 19.736 1.00 0.00 ? 57 ASP A OD2  6  
ATOM 6567  H H    . ASP A 1 57 ? 18.722 -12.364 16.812 1.00 0.00 ? 57 ASP A H    6  
ATOM 6568  H HA   . ASP A 1 57 ? 16.447 -10.967 17.819 1.00 0.00 ? 57 ASP A HA   6  
ATOM 6569  H HB2  . ASP A 1 57 ? 19.107 -11.675 19.065 1.00 0.00 ? 57 ASP A HB2  6  
ATOM 6570  H HB3  . ASP A 1 57 ? 17.806 -10.877 19.944 1.00 0.00 ? 57 ASP A HB3  6  
ATOM 6571  N N    . ASP A 1 58 ? 19.084 -9.268  17.007 1.00 0.00 ? 58 ASP A N    6  
ATOM 6572  C CA   . ASP A 1 58 ? 19.622 -7.925  16.826 1.00 0.00 ? 58 ASP A CA   6  
ATOM 6573  C C    . ASP A 1 58 ? 18.728 -7.101  15.906 1.00 0.00 ? 58 ASP A C    6  
ATOM 6574  O O    . ASP A 1 58 ? 18.701 -5.873  15.986 1.00 0.00 ? 58 ASP A O    6  
ATOM 6575  C CB   . ASP A 1 58 ? 21.039 -7.994  16.253 1.00 0.00 ? 58 ASP A CB   6  
ATOM 6576  C CG   . ASP A 1 58 ? 22.097 -8.091  17.335 1.00 0.00 ? 58 ASP A CG   6  
ATOM 6577  O OD1  . ASP A 1 58 ? 22.512 -7.034  17.854 1.00 0.00 ? 58 ASP A OD1  6  
ATOM 6578  O OD2  . ASP A 1 58 ? 22.510 -9.223  17.661 1.00 0.00 ? 58 ASP A OD2  6  
ATOM 6579  H H    . ASP A 1 58 ? 19.548 -10.029 16.599 1.00 0.00 ? 58 ASP A H    6  
ATOM 6580  H HA   . ASP A 1 58 ? 19.658 -7.449  17.794 1.00 0.00 ? 58 ASP A HA   6  
ATOM 6581  H HB2  . ASP A 1 58 ? 21.121 -8.863  15.616 1.00 0.00 ? 58 ASP A HB2  6  
ATOM 6582  H HB3  . ASP A 1 58 ? 21.227 -7.105  15.669 1.00 0.00 ? 58 ASP A HB3  6  
ATOM 6583  N N    . ALA A 1 59 ? 17.997 -7.784  15.031 1.00 0.00 ? 59 ALA A N    6  
ATOM 6584  C CA   . ALA A 1 59 ? 17.100 -7.115  14.096 1.00 0.00 ? 59 ALA A CA   6  
ATOM 6585  C C    . ALA A 1 59 ? 16.169 -6.152  14.823 1.00 0.00 ? 59 ALA A C    6  
ATOM 6586  O O    . ALA A 1 59 ? 15.832 -5.088  14.303 1.00 0.00 ? 59 ALA A O    6  
ATOM 6587  C CB   . ALA A 1 59 ? 16.295 -8.141  13.312 1.00 0.00 ? 59 ALA A CB   6  
ATOM 6588  H H    . ALA A 1 59 ? 18.061 -8.762  15.015 1.00 0.00 ? 59 ALA A H    6  
ATOM 6589  H HA   . ALA A 1 59 ? 17.705 -6.557  13.396 1.00 0.00 ? 59 ALA A HA   6  
ATOM 6590  H HB1  . ALA A 1 59 ? 16.927 -8.599  12.566 1.00 0.00 ? 59 ALA A HB1  6  
ATOM 6591  H HB2  . ALA A 1 59 ? 15.925 -8.899  13.986 1.00 0.00 ? 59 ALA A HB2  6  
ATOM 6592  H HB3  . ALA A 1 59 ? 15.463 -7.651  12.828 1.00 0.00 ? 59 ALA A HB3  6  
ATOM 6593  N N    . ALA A 1 60 ? 15.756 -6.531  16.028 1.00 0.00 ? 60 ALA A N    6  
ATOM 6594  C CA   . ALA A 1 60 ? 14.864 -5.699  16.827 1.00 0.00 ? 60 ALA A CA   6  
ATOM 6595  C C    . ALA A 1 60 ? 15.435 -4.297  17.007 1.00 0.00 ? 60 ALA A C    6  
ATOM 6596  O O    . ALA A 1 60 ? 14.692 -3.331  17.171 1.00 0.00 ? 60 ALA A O    6  
ATOM 6597  C CB   . ALA A 1 60 ? 14.610 -6.346  18.181 1.00 0.00 ? 60 ALA A CB   6  
ATOM 6598  H H    . ALA A 1 60 ? 16.059 -7.390  16.389 1.00 0.00 ? 60 ALA A H    6  
ATOM 6599  H HA   . ALA A 1 60 ? 13.919 -5.628  16.307 1.00 0.00 ? 60 ALA A HA   6  
ATOM 6600  H HB1  . ALA A 1 60 ? 14.094 -7.284  18.039 1.00 0.00 ? 60 ALA A HB1  6  
ATOM 6601  H HB2  . ALA A 1 60 ? 15.553 -6.524  18.676 1.00 0.00 ? 60 ALA A HB2  6  
ATOM 6602  H HB3  . ALA A 1 60 ? 14.004 -5.689  18.785 1.00 0.00 ? 60 ALA A HB3  6  
ATOM 6603  N N    . GLU A 1 61 ? 16.760 -4.195  16.975 1.00 0.00 ? 61 GLU A N    6  
ATOM 6604  C CA   . GLU A 1 61 ? 17.430 -2.910  17.137 1.00 0.00 ? 61 GLU A CA   6  
ATOM 6605  C C    . GLU A 1 61 ? 17.608 -2.216  15.789 1.00 0.00 ? 61 GLU A C    6  
ATOM 6606  O O    . GLU A 1 61 ? 17.695 -0.989  15.716 1.00 0.00 ? 61 GLU A O    6  
ATOM 6607  C CB   . GLU A 1 61 ? 18.792 -3.100  17.808 1.00 0.00 ? 61 GLU A CB   6  
ATOM 6608  C CG   . GLU A 1 61 ? 18.700 -3.612  19.236 1.00 0.00 ? 61 GLU A CG   6  
ATOM 6609  C CD   . GLU A 1 61 ? 18.453 -2.502  20.239 1.00 0.00 ? 61 GLU A CD   6  
ATOM 6610  O OE1  . GLU A 1 61 ? 18.685 -1.326  19.892 1.00 0.00 ? 61 GLU A OE1  6  
ATOM 6611  O OE2  . GLU A 1 61 ? 18.027 -2.811  21.371 1.00 0.00 ? 61 GLU A OE2  6  
ATOM 6612  H H    . GLU A 1 61 ? 17.300 -5.002  16.841 1.00 0.00 ? 61 GLU A H    6  
ATOM 6613  H HA   . GLU A 1 61 ? 16.812 -2.290  17.768 1.00 0.00 ? 61 GLU A HA   6  
ATOM 6614  H HB2  . GLU A 1 61 ? 19.369 -3.807  17.230 1.00 0.00 ? 61 GLU A HB2  6  
ATOM 6615  H HB3  . GLU A 1 61 ? 19.309 -2.152  17.821 1.00 0.00 ? 61 GLU A HB3  6  
ATOM 6616  H HG2  . GLU A 1 61 ? 17.888 -4.321  19.299 1.00 0.00 ? 61 GLU A HG2  6  
ATOM 6617  H HG3  . GLU A 1 61 ? 19.627 -4.106  19.488 1.00 0.00 ? 61 GLU A HG3  6  
ATOM 6618  N N    . THR A 1 62 ? 17.663 -3.009  14.724 1.00 0.00 ? 62 THR A N    6  
ATOM 6619  C CA   . THR A 1 62 ? 17.832 -2.473  13.379 1.00 0.00 ? 62 THR A CA   6  
ATOM 6620  C C    . THR A 1 62 ? 16.524 -1.897  12.848 1.00 0.00 ? 62 THR A C    6  
ATOM 6621  O O    . THR A 1 62 ? 16.522 -1.106  11.905 1.00 0.00 ? 62 THR A O    6  
ATOM 6622  C CB   . THR A 1 62 ? 18.338 -3.552  12.404 1.00 0.00 ? 62 THR A CB   6  
ATOM 6623  O OG1  . THR A 1 62 ? 17.327 -4.546  12.205 1.00 0.00 ? 62 THR A OG1  6  
ATOM 6624  C CG2  . THR A 1 62 ? 19.604 -4.209  12.933 1.00 0.00 ? 62 THR A CG2  6  
ATOM 6625  H H    . THR A 1 62 ? 17.588 -3.978  14.847 1.00 0.00 ? 62 THR A H    6  
ATOM 6626  H HA   . THR A 1 62 ? 18.569 -1.685  13.425 1.00 0.00 ? 62 THR A HA   6  
ATOM 6627  H HB   . THR A 1 62 ? 18.563 -3.083  11.457 1.00 0.00 ? 62 THR A HB   6  
ATOM 6628  H HG1  . THR A 1 62 ? 16.618 -4.178  11.671 1.00 0.00 ? 62 THR A HG1  6  
ATOM 6629  H HG21 . THR A 1 62 ? 19.343 -5.093  13.497 1.00 0.00 ? 62 THR A HG21 6  
ATOM 6630  H HG22 . THR A 1 62 ? 20.129 -3.516  13.573 1.00 0.00 ? 62 THR A HG22 6  
ATOM 6631  H HG23 . THR A 1 62 ? 20.239 -4.486  12.105 1.00 0.00 ? 62 THR A HG23 6  
ATOM 6632  N N    . ILE A 1 63 ? 15.415 -2.298  13.460 1.00 0.00 ? 63 ILE A N    6  
ATOM 6633  C CA   . ILE A 1 63 ? 14.101 -1.820  13.049 1.00 0.00 ? 63 ILE A CA   6  
ATOM 6634  C C    . ILE A 1 63 ? 13.689 -0.589  13.849 1.00 0.00 ? 63 ILE A C    6  
ATOM 6635  O O    . ILE A 1 63 ? 13.377 -0.682  15.037 1.00 0.00 ? 63 ILE A O    6  
ATOM 6636  C CB   . ILE A 1 63 ? 13.027 -2.911  13.218 1.00 0.00 ? 63 ILE A CB   6  
ATOM 6637  C CG1  . ILE A 1 63 ? 13.393 -4.149  12.398 1.00 0.00 ? 63 ILE A CG1  6  
ATOM 6638  C CG2  . ILE A 1 63 ? 11.663 -2.379  12.804 1.00 0.00 ? 63 ILE A CG2  6  
ATOM 6639  C CD1  . ILE A 1 63 ? 12.523 -5.350  12.695 1.00 0.00 ? 63 ILE A CD1  6  
ATOM 6640  H H    . ILE A 1 63 ? 15.482 -2.930  14.206 1.00 0.00 ? 63 ILE A H    6  
ATOM 6641  H HA   . ILE A 1 63 ? 14.155 -1.555  12.003 1.00 0.00 ? 63 ILE A HA   6  
ATOM 6642  H HB   . ILE A 1 63 ? 12.980 -3.180  14.262 1.00 0.00 ? 63 ILE A HB   6  
ATOM 6643  H HG12 . ILE A 1 63 ? 13.294 -3.921  11.348 1.00 0.00 ? 63 ILE A HG12 6  
ATOM 6644  H HG13 . ILE A 1 63 ? 14.418 -4.421  12.608 1.00 0.00 ? 63 ILE A HG13 6  
ATOM 6645  H HG21 . ILE A 1 63 ? 10.955 -3.194  12.766 1.00 0.00 ? 63 ILE A HG21 6  
ATOM 6646  H HG22 . ILE A 1 63 ? 11.328 -1.648  13.525 1.00 0.00 ? 63 ILE A HG22 6  
ATOM 6647  H HG23 . ILE A 1 63 ? 11.735 -1.919  11.831 1.00 0.00 ? 63 ILE A HG23 6  
ATOM 6648  H HD11 . ILE A 1 63 ? 12.242 -5.830  11.769 1.00 0.00 ? 63 ILE A HD11 6  
ATOM 6649  H HD12 . ILE A 1 63 ? 13.069 -6.048  13.312 1.00 0.00 ? 63 ILE A HD12 6  
ATOM 6650  H HD13 . ILE A 1 63 ? 11.632 -5.029  13.217 1.00 0.00 ? 63 ILE A HD13 6  
ATOM 6651  N N    . LEU A 1 64 ? 13.689 0.565   13.190 1.00 0.00 ? 64 LEU A N    6  
ATOM 6652  C CA   . LEU A 1 64 ? 13.314 1.816   13.838 1.00 0.00 ? 64 LEU A CA   6  
ATOM 6653  C C    . LEU A 1 64 ? 11.962 2.308   13.332 1.00 0.00 ? 64 LEU A C    6  
ATOM 6654  O O    . LEU A 1 64 ? 11.020 2.478   14.107 1.00 0.00 ? 64 LEU A O    6  
ATOM 6655  C CB   . LEU A 1 64 ? 14.382 2.882   13.591 1.00 0.00 ? 64 LEU A CB   6  
ATOM 6656  C CG   . LEU A 1 64 ? 15.828 2.455   13.843 1.00 0.00 ? 64 LEU A CG   6  
ATOM 6657  C CD1  . LEU A 1 64 ? 16.790 3.338   13.063 1.00 0.00 ? 64 LEU A CD1  6  
ATOM 6658  C CD2  . LEU A 1 64 ? 16.146 2.500   15.330 1.00 0.00 ? 64 LEU A CD2  6  
ATOM 6659  H H    . LEU A 1 64 ? 13.947 0.576   12.245 1.00 0.00 ? 64 LEU A H    6  
ATOM 6660  H HA   . LEU A 1 64 ? 13.241 1.631   14.900 1.00 0.00 ? 64 LEU A HA   6  
ATOM 6661  H HB2  . LEU A 1 64 ? 14.305 3.195   12.561 1.00 0.00 ? 64 LEU A HB2  6  
ATOM 6662  H HB3  . LEU A 1 64 ? 14.167 3.722   14.237 1.00 0.00 ? 64 LEU A HB3  6  
ATOM 6663  H HG   . LEU A 1 64 ? 15.960 1.437   13.503 1.00 0.00 ? 64 LEU A HG   6  
ATOM 6664  H HD11 . LEU A 1 64 ? 17.156 4.125   13.705 1.00 0.00 ? 64 LEU A HD11 6  
ATOM 6665  H HD12 . LEU A 1 64 ? 16.276 3.771   12.218 1.00 0.00 ? 64 LEU A HD12 6  
ATOM 6666  H HD13 . LEU A 1 64 ? 17.620 2.743   12.712 1.00 0.00 ? 64 LEU A HD13 6  
ATOM 6667  H HD21 . LEU A 1 64 ? 16.986 3.158   15.499 1.00 0.00 ? 64 LEU A HD21 6  
ATOM 6668  H HD22 . LEU A 1 64 ? 16.393 1.507   15.676 1.00 0.00 ? 64 LEU A HD22 6  
ATOM 6669  H HD23 . LEU A 1 64 ? 15.287 2.867   15.871 1.00 0.00 ? 64 LEU A HD23 6  
ATOM 6670  N N    . THR A 1 65 ? 11.871 2.533   12.024 1.00 0.00 ? 65 THR A N    6  
ATOM 6671  C CA   . THR A 1 65 ? 10.635 3.003   11.413 1.00 0.00 ? 65 THR A CA   6  
ATOM 6672  C C    . THR A 1 65 ? 9.873  1.856   10.759 1.00 0.00 ? 65 THR A C    6  
ATOM 6673  O O    . THR A 1 65 ? 10.426 0.779   10.534 1.00 0.00 ? 65 THR A O    6  
ATOM 6674  C CB   . THR A 1 65 ? 10.908 4.091   10.358 1.00 0.00 ? 65 THR A CB   6  
ATOM 6675  O OG1  . THR A 1 65 ? 11.542 3.513   9.211  1.00 0.00 ? 65 THR A OG1  6  
ATOM 6676  C CG2  . THR A 1 65 ? 11.790 5.191   10.929 1.00 0.00 ? 65 THR A CG2  6  
ATOM 6677  H H    . THR A 1 65 ? 12.657 2.379   11.459 1.00 0.00 ? 65 THR A H    6  
ATOM 6678  H HA   . THR A 1 65 ? 10.021 3.433   12.191 1.00 0.00 ? 65 THR A HA   6  
ATOM 6679  H HB   . THR A 1 65 ? 9.965  4.526   10.058 1.00 0.00 ? 65 THR A HB   6  
ATOM 6680  H HG1  . THR A 1 65 ? 10.896 3.408   8.508  1.00 0.00 ? 65 THR A HG1  6  
ATOM 6681  H HG21 . THR A 1 65 ? 12.078 5.869   10.140 1.00 0.00 ? 65 THR A HG21 6  
ATOM 6682  H HG22 . THR A 1 65 ? 12.675 4.752   11.367 1.00 0.00 ? 65 THR A HG22 6  
ATOM 6683  H HG23 . THR A 1 65 ? 11.244 5.732   11.687 1.00 0.00 ? 65 THR A HG23 6  
ATOM 6684  N N    . VAL A 1 66 ? 8.602  2.094   10.454 1.00 0.00 ? 66 VAL A N    6  
ATOM 6685  C CA   . VAL A 1 66 ? 7.764  1.081   9.823  1.00 0.00 ? 66 VAL A CA   6  
ATOM 6686  C C    . VAL A 1 66 ? 8.439  0.505   8.583  1.00 0.00 ? 66 VAL A C    6  
ATOM 6687  O O    . VAL A 1 66 ? 8.394  -0.701  8.343  1.00 0.00 ? 66 VAL A O    6  
ATOM 6688  C CB   . VAL A 1 66 ? 6.391  1.654   9.428  1.00 0.00 ? 66 VAL A CB   6  
ATOM 6689  C CG1  . VAL A 1 66 ? 5.527  0.578   8.787  1.00 0.00 ? 66 VAL A CG1  6  
ATOM 6690  C CG2  . VAL A 1 66 ? 5.696  2.255   10.640 1.00 0.00 ? 66 VAL A CG2  6  
ATOM 6691  H H    . VAL A 1 66 ? 8.217  2.972   10.658 1.00 0.00 ? 66 VAL A H    6  
ATOM 6692  H HA   . VAL A 1 66 ? 7.607  0.286   10.538 1.00 0.00 ? 66 VAL A HA   6  
ATOM 6693  H HB   . VAL A 1 66 ? 6.546  2.439   8.702  1.00 0.00 ? 66 VAL A HB   6  
ATOM 6694  H HG11 . VAL A 1 66 ? 4.485  0.828   8.919  1.00 0.00 ? 66 VAL A HG11 6  
ATOM 6695  H HG12 . VAL A 1 66 ? 5.753  0.516   7.732  1.00 0.00 ? 66 VAL A HG12 6  
ATOM 6696  H HG13 . VAL A 1 66 ? 5.731  -0.373  9.256  1.00 0.00 ? 66 VAL A HG13 6  
ATOM 6697  H HG21 . VAL A 1 66 ? 5.367  3.257   10.406 1.00 0.00 ? 66 VAL A HG21 6  
ATOM 6698  H HG22 . VAL A 1 66 ? 4.841  1.649   10.903 1.00 0.00 ? 66 VAL A HG22 6  
ATOM 6699  H HG23 . VAL A 1 66 ? 6.384  2.287   11.471 1.00 0.00 ? 66 VAL A HG23 6  
ATOM 6700  N N    . GLY A 1 67 ? 9.064  1.376   7.798  1.00 0.00 ? 67 GLY A N    6  
ATOM 6701  C CA   . GLY A 1 67 ? 9.740  0.936   6.592  1.00 0.00 ? 67 GLY A CA   6  
ATOM 6702  C C    . GLY A 1 67 ? 10.715 -0.195  6.853  1.00 0.00 ? 67 GLY A C    6  
ATOM 6703  O O    . GLY A 1 67 ? 10.827 -1.125  6.054  1.00 0.00 ? 67 GLY A O    6  
ATOM 6704  H H    . GLY A 1 67 ? 9.067  2.326   8.040  1.00 0.00 ? 67 GLY A H    6  
ATOM 6705  H HA2  . GLY A 1 67 ? 9.001  0.602   5.879  1.00 0.00 ? 67 GLY A HA2  6  
ATOM 6706  H HA3  . GLY A 1 67 ? 10.280 1.771   6.170  1.00 0.00 ? 67 GLY A HA3  6  
ATOM 6707  N N    . ASP A 1 68 ? 11.424 -0.115  7.974  1.00 0.00 ? 68 ASP A N    6  
ATOM 6708  C CA   . ASP A 1 68 ? 12.396 -1.139  8.338  1.00 0.00 ? 68 ASP A CA   6  
ATOM 6709  C C    . ASP A 1 68 ? 11.700 -2.456  8.669  1.00 0.00 ? 68 ASP A C    6  
ATOM 6710  O O    . ASP A 1 68 ? 11.998 -3.492  8.077  1.00 0.00 ? 68 ASP A O    6  
ATOM 6711  C CB   . ASP A 1 68 ? 13.233 -0.677  9.532  1.00 0.00 ? 68 ASP A CB   6  
ATOM 6712  C CG   . ASP A 1 68 ? 14.391 0.210   9.119  1.00 0.00 ? 68 ASP A CG   6  
ATOM 6713  O OD1  . ASP A 1 68 ? 14.719 0.235   7.914  1.00 0.00 ? 68 ASP A OD1  6  
ATOM 6714  O OD2  . ASP A 1 68 ? 14.969 0.880   10.000 1.00 0.00 ? 68 ASP A OD2  6  
ATOM 6715  H H    . ASP A 1 68 ? 11.291 0.652   8.570  1.00 0.00 ? 68 ASP A H    6  
ATOM 6716  H HA   . ASP A 1 68 ? 13.048 -1.294  7.492  1.00 0.00 ? 68 ASP A HA   6  
ATOM 6717  H HB2  . ASP A 1 68 ? 12.603 -0.121  10.212 1.00 0.00 ? 68 ASP A HB2  6  
ATOM 6718  H HB3  . ASP A 1 68 ? 13.629 -1.542  10.042 1.00 0.00 ? 68 ASP A HB3  6  
ATOM 6719  N N    . ALA A 1 69 ? 10.772 -2.406  9.619  1.00 0.00 ? 69 ALA A N    6  
ATOM 6720  C CA   . ALA A 1 69 ? 10.033 -3.594  10.028 1.00 0.00 ? 69 ALA A CA   6  
ATOM 6721  C C    . ALA A 1 69 ? 9.401  -4.288  8.826  1.00 0.00 ? 69 ALA A C    6  
ATOM 6722  O O    . ALA A 1 69 ? 9.573  -5.491  8.630  1.00 0.00 ? 69 ALA A O    6  
ATOM 6723  C CB   . ALA A 1 69 ? 8.966  -3.227  11.048 1.00 0.00 ? 69 ALA A CB   6  
ATOM 6724  H H    . ALA A 1 69 ? 10.579 -1.550  10.055 1.00 0.00 ? 69 ALA A H    6  
ATOM 6725  H HA   . ALA A 1 69 ? 10.728 -4.274  10.499 1.00 0.00 ? 69 ALA A HA   6  
ATOM 6726  H HB1  . ALA A 1 69 ? 7.988  -3.417  10.630 1.00 0.00 ? 69 ALA A HB1  6  
ATOM 6727  H HB2  . ALA A 1 69 ? 9.099  -3.823  11.939 1.00 0.00 ? 69 ALA A HB2  6  
ATOM 6728  H HB3  . ALA A 1 69 ? 9.053  -2.180  11.299 1.00 0.00 ? 69 ALA A HB3  6  
ATOM 6729  N N    . VAL A 1 70 ? 8.668  -3.522  8.024  1.00 0.00 ? 70 VAL A N    6  
ATOM 6730  C CA   . VAL A 1 70 ? 8.011  -4.064  6.840  1.00 0.00 ? 70 VAL A CA   6  
ATOM 6731  C C    . VAL A 1 70 ? 9.025  -4.670  5.877  1.00 0.00 ? 70 VAL A C    6  
ATOM 6732  O O    . VAL A 1 70 ? 8.896  -5.824  5.467  1.00 0.00 ? 70 VAL A O    6  
ATOM 6733  C CB   . VAL A 1 70 ? 7.203  -2.980  6.102  1.00 0.00 ? 70 VAL A CB   6  
ATOM 6734  C CG1  . VAL A 1 70 ? 6.551  -3.557  4.855  1.00 0.00 ? 70 VAL A CG1  6  
ATOM 6735  C CG2  . VAL A 1 70 ? 6.160  -2.371  7.026  1.00 0.00 ? 70 VAL A CG2  6  
ATOM 6736  H H    . VAL A 1 70 ? 8.568  -2.570  8.232  1.00 0.00 ? 70 VAL A H    6  
ATOM 6737  H HA   . VAL A 1 70 ? 7.327  -4.836  7.162  1.00 0.00 ? 70 VAL A HA   6  
ATOM 6738  H HB   . VAL A 1 70 ? 7.883  -2.198  5.796  1.00 0.00 ? 70 VAL A HB   6  
ATOM 6739  H HG11 . VAL A 1 70 ? 5.854  -2.839  4.448  1.00 0.00 ? 70 VAL A HG11 6  
ATOM 6740  H HG12 . VAL A 1 70 ? 7.311  -3.779  4.120  1.00 0.00 ? 70 VAL A HG12 6  
ATOM 6741  H HG13 . VAL A 1 70 ? 6.023  -4.464  5.112  1.00 0.00 ? 70 VAL A HG13 6  
ATOM 6742  H HG21 . VAL A 1 70 ? 5.172  -2.598  6.653  1.00 0.00 ? 70 VAL A HG21 6  
ATOM 6743  H HG22 . VAL A 1 70 ? 6.273  -2.783  8.018  1.00 0.00 ? 70 VAL A HG22 6  
ATOM 6744  H HG23 . VAL A 1 70 ? 6.293  -1.300  7.064  1.00 0.00 ? 70 VAL A HG23 6  
ATOM 6745  N N    . LYS A 1 71 ? 10.037 -3.886  5.520  1.00 0.00 ? 71 LYS A N    6  
ATOM 6746  C CA   . LYS A 1 71 ? 11.076 -4.345  4.607  1.00 0.00 ? 71 LYS A CA   6  
ATOM 6747  C C    . LYS A 1 71 ? 11.740 -5.614  5.131  1.00 0.00 ? 71 LYS A C    6  
ATOM 6748  O O    . LYS A 1 71 ? 12.203 -6.451  4.356  1.00 0.00 ? 71 LYS A O    6  
ATOM 6749  C CB   . LYS A 1 71 ? 12.128 -3.252  4.407  1.00 0.00 ? 71 LYS A CB   6  
ATOM 6750  C CG   . LYS A 1 71 ? 11.711 -2.180  3.415  1.00 0.00 ? 71 LYS A CG   6  
ATOM 6751  C CD   . LYS A 1 71 ? 12.601 -0.952  3.513  1.00 0.00 ? 71 LYS A CD   6  
ATOM 6752  C CE   . LYS A 1 71 ? 12.310 0.038   2.396  1.00 0.00 ? 71 LYS A CE   6  
ATOM 6753  N NZ   . LYS A 1 71 ? 13.341 1.110   2.323  1.00 0.00 ? 71 LYS A NZ   6  
ATOM 6754  H H    . LYS A 1 71 ? 10.086 -2.975  5.881  1.00 0.00 ? 71 LYS A H    6  
ATOM 6755  H HA   . LYS A 1 71 ? 10.611 -4.563  3.657  1.00 0.00 ? 71 LYS A HA   6  
ATOM 6756  H HB2  . LYS A 1 71 ? 12.321 -2.777  5.358  1.00 0.00 ? 71 LYS A HB2  6  
ATOM 6757  H HB3  . LYS A 1 71 ? 13.041 -3.708  4.051  1.00 0.00 ? 71 LYS A HB3  6  
ATOM 6758  H HG2  . LYS A 1 71 ? 11.781 -2.582  2.415  1.00 0.00 ? 71 LYS A HG2  6  
ATOM 6759  H HG3  . LYS A 1 71 ? 10.690 -1.891  3.618  1.00 0.00 ? 71 LYS A HG3  6  
ATOM 6760  H HD2  . LYS A 1 71 ? 12.427 -0.468  4.462  1.00 0.00 ? 71 LYS A HD2  6  
ATOM 6761  H HD3  . LYS A 1 71 ? 13.635 -1.261  3.449  1.00 0.00 ? 71 LYS A HD3  6  
ATOM 6762  H HE2  . LYS A 1 71 ? 12.290 -0.495  1.457  1.00 0.00 ? 71 LYS A HE2  6  
ATOM 6763  H HE3  . LYS A 1 71 ? 11.345 0.489   2.574  1.00 0.00 ? 71 LYS A HE3  6  
ATOM 6764  H HZ1  . LYS A 1 71 ? 14.241 0.767   2.713  1.00 0.00 ? 71 LYS A HZ1  6  
ATOM 6765  H HZ2  . LYS A 1 71 ? 13.033 1.939   2.870  1.00 0.00 ? 71 LYS A HZ2  6  
ATOM 6766  H HZ3  . LYS A 1 71 ? 13.490 1.396   1.334  1.00 0.00 ? 71 LYS A HZ3  6  
ATOM 6767  N N    . PHE A 1 72 ? 11.781 -5.752  6.452  1.00 0.00 ? 72 PHE A N    6  
ATOM 6768  C CA   . PHE A 1 72 ? 12.388 -6.920  7.081  1.00 0.00 ? 72 PHE A CA   6  
ATOM 6769  C C    . PHE A 1 72 ? 11.513 -8.156  6.891  1.00 0.00 ? 72 PHE A C    6  
ATOM 6770  O O    . PHE A 1 72 ? 11.983 -9.198  6.434  1.00 0.00 ? 72 PHE A O    6  
ATOM 6771  C CB   . PHE A 1 72 ? 12.613 -6.664  8.572  1.00 0.00 ? 72 PHE A CB   6  
ATOM 6772  C CG   . PHE A 1 72 ? 13.901 -7.236  9.091  1.00 0.00 ? 72 PHE A CG   6  
ATOM 6773  C CD1  . PHE A 1 72 ? 14.261 -8.542  8.801  1.00 0.00 ? 72 PHE A CD1  6  
ATOM 6774  C CD2  . PHE A 1 72 ? 14.753 -6.467  9.868  1.00 0.00 ? 72 PHE A CD2  6  
ATOM 6775  C CE1  . PHE A 1 72 ? 15.446 -9.071  9.278  1.00 0.00 ? 72 PHE A CE1  6  
ATOM 6776  C CE2  . PHE A 1 72 ? 15.939 -6.990  10.347 1.00 0.00 ? 72 PHE A CE2  6  
ATOM 6777  C CZ   . PHE A 1 72 ? 16.286 -8.294  10.051 1.00 0.00 ? 72 PHE A CZ   6  
ATOM 6778  H H    . PHE A 1 72 ? 11.395 -5.051  7.019  1.00 0.00 ? 72 PHE A H    6  
ATOM 6779  H HA   . PHE A 1 72 ? 13.342 -7.093  6.606  1.00 0.00 ? 72 PHE A HA   6  
ATOM 6780  H HB2  . PHE A 1 72 ? 12.628 -5.599  8.749  1.00 0.00 ? 72 PHE A HB2  6  
ATOM 6781  H HB3  . PHE A 1 72 ? 11.803 -7.107  9.132  1.00 0.00 ? 72 PHE A HB3  6  
ATOM 6782  H HD1  . PHE A 1 72 ? 13.605 -9.151  8.196  1.00 0.00 ? 72 PHE A HD1  6  
ATOM 6783  H HD2  . PHE A 1 72 ? 14.482 -5.446  10.100 1.00 0.00 ? 72 PHE A HD2  6  
ATOM 6784  H HE1  . PHE A 1 72 ? 15.715 -10.090 9.045  1.00 0.00 ? 72 PHE A HE1  6  
ATOM 6785  H HE2  . PHE A 1 72 ? 16.594 -6.379  10.951 1.00 0.00 ? 72 PHE A HE2  6  
ATOM 6786  H HZ   . PHE A 1 72 ? 17.212 -8.704  10.425 1.00 0.00 ? 72 PHE A HZ   6  
ATOM 6787  N N    . ILE A 1 73 ? 10.239 -8.031  7.247  1.00 0.00 ? 73 ILE A N    6  
ATOM 6788  C CA   . ILE A 1 73 ? 9.298  -9.136  7.116  1.00 0.00 ? 73 ILE A CA   6  
ATOM 6789  C C    . ILE A 1 73 ? 9.192  -9.599  5.667  1.00 0.00 ? 73 ILE A C    6  
ATOM 6790  O O    . ILE A 1 73 ? 9.054  -10.792 5.394  1.00 0.00 ? 73 ILE A O    6  
ATOM 6791  C CB   . ILE A 1 73 ? 7.897  -8.746  7.622  1.00 0.00 ? 73 ILE A CB   6  
ATOM 6792  C CG1  . ILE A 1 73 ? 7.963  -8.310  9.087  1.00 0.00 ? 73 ILE A CG1  6  
ATOM 6793  C CG2  . ILE A 1 73 ? 6.929  -9.908  7.452  1.00 0.00 ? 73 ILE A CG2  6  
ATOM 6794  C CD1  . ILE A 1 73 ? 6.766  -7.497  9.531  1.00 0.00 ? 73 ILE A CD1  6  
ATOM 6795  H H    . ILE A 1 73 ? 9.924  -7.175  7.605  1.00 0.00 ? 73 ILE A H    6  
ATOM 6796  H HA   . ILE A 1 73 ? 9.661  -9.956  7.719  1.00 0.00 ? 73 ILE A HA   6  
ATOM 6797  H HB   . ILE A 1 73 ? 7.539  -7.921  7.024  1.00 0.00 ? 73 ILE A HB   6  
ATOM 6798  H HG12 . ILE A 1 73 ? 8.019  -9.186  9.714  1.00 0.00 ? 73 ILE A HG12 6  
ATOM 6799  H HG13 . ILE A 1 73 ? 8.848  -7.708  9.236  1.00 0.00 ? 73 ILE A HG13 6  
ATOM 6800  H HG21 . ILE A 1 73 ? 6.399  -10.073 8.379  1.00 0.00 ? 73 ILE A HG21 6  
ATOM 6801  H HG22 . ILE A 1 73 ? 6.222  -9.675  6.671  1.00 0.00 ? 73 ILE A HG22 6  
ATOM 6802  H HG23 . ILE A 1 73 ? 7.479  -10.798 7.188  1.00 0.00 ? 73 ILE A HG23 6  
ATOM 6803  H HD11 . ILE A 1 73 ? 6.695  -6.604  8.929  1.00 0.00 ? 73 ILE A HD11 6  
ATOM 6804  H HD12 . ILE A 1 73 ? 5.868  -8.085  9.414  1.00 0.00 ? 73 ILE A HD12 6  
ATOM 6805  H HD13 . ILE A 1 73 ? 6.883  -7.222  10.569 1.00 0.00 ? 73 ILE A HD13 6  
ATOM 6806  N N    . ASP A 1 74 ? 9.259  -8.649  4.742  1.00 0.00 ? 74 ASP A N    6  
ATOM 6807  C CA   . ASP A 1 74 ? 9.174  -8.959  3.319  1.00 0.00 ? 74 ASP A CA   6  
ATOM 6808  C C    . ASP A 1 74 ? 10.445 -9.650  2.837  1.00 0.00 ? 74 ASP A C    6  
ATOM 6809  O O    . ASP A 1 74 ? 10.390 -10.704 2.202  1.00 0.00 ? 74 ASP A O    6  
ATOM 6810  C CB   . ASP A 1 74 ? 8.934  -7.683  2.511  1.00 0.00 ? 74 ASP A CB   6  
ATOM 6811  C CG   . ASP A 1 74 ? 8.619  -7.970  1.056  1.00 0.00 ? 74 ASP A CG   6  
ATOM 6812  O OD1  . ASP A 1 74 ? 8.699  -9.150  0.652  1.00 0.00 ? 74 ASP A OD1  6  
ATOM 6813  O OD2  . ASP A 1 74 ? 8.291  -7.016  0.321  1.00 0.00 ? 74 ASP A OD2  6  
ATOM 6814  H H    . ASP A 1 74 ? 9.370  -7.716  5.022  1.00 0.00 ? 74 ASP A H    6  
ATOM 6815  H HA   . ASP A 1 74 ? 8.339  -9.627  3.175  1.00 0.00 ? 74 ASP A HA   6  
ATOM 6816  H HB2  . ASP A 1 74 ? 8.103  -7.143  2.940  1.00 0.00 ? 74 ASP A HB2  6  
ATOM 6817  H HB3  . ASP A 1 74 ? 9.820  -7.066  2.554  1.00 0.00 ? 74 ASP A HB3  6  
ATOM 6818  N N    . LYS A 1 75 ? 11.591 -9.050  3.141  1.00 0.00 ? 75 LYS A N    6  
ATOM 6819  C CA   . LYS A 1 75 ? 12.877 -9.607  2.739  1.00 0.00 ? 75 LYS A CA   6  
ATOM 6820  C C    . LYS A 1 75 ? 13.078 -10.997 3.335  1.00 0.00 ? 75 LYS A C    6  
ATOM 6821  O O    . LYS A 1 75 ? 13.731 -11.851 2.735  1.00 0.00 ? 75 LYS A O    6  
ATOM 6822  C CB   . LYS A 1 75 ? 14.016 -8.683  3.178  1.00 0.00 ? 75 LYS A CB   6  
ATOM 6823  C CG   . LYS A 1 75 ? 15.295 -8.873  2.381  1.00 0.00 ? 75 LYS A CG   6  
ATOM 6824  C CD   . LYS A 1 75 ? 15.211 -8.198  1.023  1.00 0.00 ? 75 LYS A CD   6  
ATOM 6825  C CE   . LYS A 1 75 ? 15.583 -6.726  1.109  1.00 0.00 ? 75 LYS A CE   6  
ATOM 6826  N NZ   . LYS A 1 75 ? 15.216 -5.988  -0.132 1.00 0.00 ? 75 LYS A NZ   6  
ATOM 6827  H H    . LYS A 1 75 ? 11.571 -8.212  3.650  1.00 0.00 ? 75 LYS A H    6  
ATOM 6828  H HA   . LYS A 1 75 ? 12.883 -9.686  1.663  1.00 0.00 ? 75 LYS A HA   6  
ATOM 6829  H HB2  . LYS A 1 75 ? 13.695 -7.658  3.066  1.00 0.00 ? 75 LYS A HB2  6  
ATOM 6830  H HB3  . LYS A 1 75 ? 14.234 -8.871  4.220  1.00 0.00 ? 75 LYS A HB3  6  
ATOM 6831  H HG2  . LYS A 1 75 ? 16.119 -8.446  2.933  1.00 0.00 ? 75 LYS A HG2  6  
ATOM 6832  H HG3  . LYS A 1 75 ? 15.465 -9.931  2.238  1.00 0.00 ? 75 LYS A HG3  6  
ATOM 6833  H HD2  . LYS A 1 75 ? 15.890 -8.690  0.343  1.00 0.00 ? 75 LYS A HD2  6  
ATOM 6834  H HD3  . LYS A 1 75 ? 14.200 -8.284  0.650  1.00 0.00 ? 75 LYS A HD3  6  
ATOM 6835  H HE2  . LYS A 1 75 ? 15.064 -6.285  1.946  1.00 0.00 ? 75 LYS A HE2  6  
ATOM 6836  H HE3  . LYS A 1 75 ? 16.649 -6.646  1.263  1.00 0.00 ? 75 LYS A HE3  6  
ATOM 6837  H HZ1  . LYS A 1 75 ? 14.199 -5.770  -0.130 1.00 0.00 ? 75 LYS A HZ1  6  
ATOM 6838  H HZ2  . LYS A 1 75 ? 15.433 -6.565  -0.968 1.00 0.00 ? 75 LYS A HZ2  6  
ATOM 6839  H HZ3  . LYS A 1 75 ? 15.751 -5.098  -0.190 1.00 0.00 ? 75 LYS A HZ3  6  
ATOM 6840  N N    . ALA A 1 76 ? 12.512 -11.217 4.517  1.00 0.00 ? 76 ALA A N    6  
ATOM 6841  C CA   . ALA A 1 76 ? 12.627 -12.504 5.191  1.00 0.00 ? 76 ALA A CA   6  
ATOM 6842  C C    . ALA A 1 76 ? 11.562 -13.478 4.698  1.00 0.00 ? 76 ALA A C    6  
ATOM 6843  O O    . ALA A 1 76 ? 11.749 -14.694 4.746  1.00 0.00 ? 76 ALA A O    6  
ATOM 6844  C CB   . ALA A 1 76 ? 12.522 -12.322 6.698  1.00 0.00 ? 76 ALA A CB   6  
ATOM 6845  H H    . ALA A 1 76 ? 12.005 -10.497 4.945  1.00 0.00 ? 76 ALA A H    6  
ATOM 6846  H HA   . ALA A 1 76 ? 13.603 -12.912 4.969  1.00 0.00 ? 76 ALA A HA   6  
ATOM 6847  H HB1  . ALA A 1 76 ? 12.704 -13.268 7.187  1.00 0.00 ? 76 ALA A HB1  6  
ATOM 6848  H HB2  . ALA A 1 76 ? 13.254 -11.600 7.025  1.00 0.00 ? 76 ALA A HB2  6  
ATOM 6849  H HB3  . ALA A 1 76 ? 11.532 -11.972 6.950  1.00 0.00 ? 76 ALA A HB3  6  
ATOM 6850  N N    . SER A 1 77 ? 10.443 -12.936 4.227  1.00 0.00 ? 77 SER A N    6  
ATOM 6851  C CA   . SER A 1 77 ? 9.346  -13.758 3.730  1.00 0.00 ? 77 SER A CA   6  
ATOM 6852  C C    . SER A 1 77 ? 9.809  -14.643 2.576  1.00 0.00 ? 77 SER A C    6  
ATOM 6853  O O    . SER A 1 77 ? 9.507  -15.835 2.533  1.00 0.00 ? 77 SER A O    6  
ATOM 6854  C CB   . SER A 1 77 ? 8.184  -12.874 3.274  1.00 0.00 ? 77 SER A CB   6  
ATOM 6855  O OG   . SER A 1 77 ? 7.325  -13.575 2.392  1.00 0.00 ? 77 SER A OG   6  
ATOM 6856  H H    . SER A 1 77 ? 10.353 -11.960 4.215  1.00 0.00 ? 77 SER A H    6  
ATOM 6857  H HA   . SER A 1 77 ? 9.011  -14.389 4.540  1.00 0.00 ? 77 SER A HA   6  
ATOM 6858  H HB2  . SER A 1 77 ? 7.616  -12.559 4.136  1.00 0.00 ? 77 SER A HB2  6  
ATOM 6859  H HB3  . SER A 1 77 ? 8.575  -12.006 2.764  1.00 0.00 ? 77 SER A HB3  6  
ATOM 6860  H HG   . SER A 1 77 ? 6.667  -14.056 2.900  1.00 0.00 ? 77 SER A HG   6  
ATOM 6861  N N    . ALA A 1 78 ? 10.545 -14.049 1.642  1.00 0.00 ? 78 ALA A N    6  
ATOM 6862  C CA   . ALA A 1 78 ? 11.052 -14.782 0.489  1.00 0.00 ? 78 ALA A CA   6  
ATOM 6863  C C    . ALA A 1 78 ? 12.379 -15.461 0.810  1.00 0.00 ? 78 ALA A C    6  
ATOM 6864  O O    . ALA A 1 78 ? 13.293 -14.835 1.350  1.00 0.00 ? 78 ALA A O    6  
ATOM 6865  C CB   . ALA A 1 78 ? 11.209 -13.848 -0.703 1.00 0.00 ? 78 ALA A CB   6  
ATOM 6866  H H    . ALA A 1 78 ? 10.753 -13.096 1.732  1.00 0.00 ? 78 ALA A H    6  
ATOM 6867  H HA   . ALA A 1 78 ? 10.326 -15.538 0.228  1.00 0.00 ? 78 ALA A HA   6  
ATOM 6868  H HB1  . ALA A 1 78 ? 10.869 -12.859 -0.431 1.00 0.00 ? 78 ALA A HB1  6  
ATOM 6869  H HB2  . ALA A 1 78 ? 12.249 -13.806 -0.991 1.00 0.00 ? 78 ALA A HB2  6  
ATOM 6870  H HB3  . ALA A 1 78 ? 10.620 -14.217 -1.529 1.00 0.00 ? 78 ALA A HB3  6  
ATOM 6871  N N    . MET A 1 1  ? 1.584  -3.101  -6.364 1.00 0.00 ? 1  MET A N    7  
ATOM 6872  C CA   . MET A 1 1  ? 0.993  -2.642  -5.112 1.00 0.00 ? 1  MET A CA   7  
ATOM 6873  C C    . MET A 1 1  ? 1.726  -3.239  -3.915 1.00 0.00 ? 1  MET A C    7  
ATOM 6874  O O    . MET A 1 1  ? 2.278  -4.336  -3.997 1.00 0.00 ? 1  MET A O    7  
ATOM 6875  C CB   . MET A 1 1  ? -0.489 -3.015  -5.055 1.00 0.00 ? 1  MET A CB   7  
ATOM 6876  C CG   . MET A 1 1  ? -1.327 -2.341  -6.130 1.00 0.00 ? 1  MET A CG   7  
ATOM 6877  S SD   . MET A 1 1  ? -3.059 -2.837  -6.074 1.00 0.00 ? 1  MET A SD   7  
ATOM 6878  C CE   . MET A 1 1  ? -3.262 -3.545  -7.707 1.00 0.00 ? 1  MET A CE   7  
ATOM 6879  H H1   . MET A 1 1  ? 1.012  -3.537  -7.030 1.00 0.00 ? 1  MET A H1   7  
ATOM 6880  H HA   . MET A 1 1  ? 1.086  -1.567  -5.076 1.00 0.00 ? 1  MET A HA   7  
ATOM 6881  H HB2  . MET A 1 1  ? -0.584 -4.084  -5.173 1.00 0.00 ? 1  MET A HB2  7  
ATOM 6882  H HB3  . MET A 1 1  ? -0.884 -2.731  -4.091 1.00 0.00 ? 1  MET A HB3  7  
ATOM 6883  H HG2  . MET A 1 1  ? -1.270 -1.271  -5.994 1.00 0.00 ? 1  MET A HG2  7  
ATOM 6884  H HG3  . MET A 1 1  ? -0.923 -2.600  -7.097 1.00 0.00 ? 1  MET A HG3  7  
ATOM 6885  H HE1  . MET A 1 1  ? -3.238 -4.623  -7.638 1.00 0.00 ? 1  MET A HE1  7  
ATOM 6886  H HE2  . MET A 1 1  ? -4.209 -3.232  -8.120 1.00 0.00 ? 1  MET A HE2  7  
ATOM 6887  H HE3  . MET A 1 1  ? -2.459 -3.208  -8.347 1.00 0.00 ? 1  MET A HE3  7  
ATOM 6888  N N    . SER A 1 2  ? 1.726  -2.510  -2.803 1.00 0.00 ? 2  SER A N    7  
ATOM 6889  C CA   . SER A 1 2  ? 2.395  -2.967  -1.590 1.00 0.00 ? 2  SER A CA   7  
ATOM 6890  C C    . SER A 1 2  ? 1.564  -4.031  -0.879 1.00 0.00 ? 2  SER A C    7  
ATOM 6891  O O    . SER A 1 2  ? 0.486  -3.746  -0.357 1.00 0.00 ? 2  SER A O    7  
ATOM 6892  C CB   . SER A 1 2  ? 2.649  -1.788  -0.648 1.00 0.00 ? 2  SER A CB   7  
ATOM 6893  O OG   . SER A 1 2  ? 3.194  -0.684  -1.349 1.00 0.00 ? 2  SER A OG   7  
ATOM 6894  H H    . SER A 1 2  ? 1.268  -1.644  -2.800 1.00 0.00 ? 2  SER A H    7  
ATOM 6895  H HA   . SER A 1 2  ? 3.342  -3.399  -1.876 1.00 0.00 ? 2  SER A HA   7  
ATOM 6896  H HB2  . SER A 1 2  ? 1.717  -1.487  -0.194 1.00 0.00 ? 2  SER A HB2  7  
ATOM 6897  H HB3  . SER A 1 2  ? 3.344  -2.090  0.122  1.00 0.00 ? 2  SER A HB3  7  
ATOM 6898  H HG   . SER A 1 2  ? 3.436  0.004   -0.724 1.00 0.00 ? 2  SER A HG   7  
ATOM 6899  N N    . ASP A 1 3  ? 2.073  -5.257  -0.863 1.00 0.00 ? 3  ASP A N    7  
ATOM 6900  C CA   . ASP A 1 3  ? 1.379  -6.365  -0.216 1.00 0.00 ? 3  ASP A CA   7  
ATOM 6901  C C    . ASP A 1 3  ? 1.844  -6.528  1.228  1.00 0.00 ? 3  ASP A C    7  
ATOM 6902  O O    . ASP A 1 3  ? 1.037  -6.761  2.129  1.00 0.00 ? 3  ASP A O    7  
ATOM 6903  C CB   . ASP A 1 3  ? 1.614  -7.663  -0.990 1.00 0.00 ? 3  ASP A CB   7  
ATOM 6904  C CG   . ASP A 1 3  ? 3.050  -8.141  -0.898 1.00 0.00 ? 3  ASP A CG   7  
ATOM 6905  O OD1  . ASP A 1 3  ? 3.933  -7.479  -1.482 1.00 0.00 ? 3  ASP A OD1  7  
ATOM 6906  O OD2  . ASP A 1 3  ? 3.290  -9.177  -0.242 1.00 0.00 ? 3  ASP A OD2  7  
ATOM 6907  H H    . ASP A 1 3  ? 2.937  -5.422  -1.297 1.00 0.00 ? 3  ASP A H    7  
ATOM 6908  H HA   . ASP A 1 3  ? 0.323  -6.142  -0.218 1.00 0.00 ? 3  ASP A HA   7  
ATOM 6909  H HB2  . ASP A 1 3  ? 0.972  -8.435  -0.590 1.00 0.00 ? 3  ASP A HB2  7  
ATOM 6910  H HB3  . ASP A 1 3  ? 1.373  -7.503  -2.030 1.00 0.00 ? 3  ASP A HB3  7  
ATOM 6911  N N    . THR A 1 4  ? 3.150  -6.403  1.441  1.00 0.00 ? 4  THR A N    7  
ATOM 6912  C CA   . THR A 1 4  ? 3.723  -6.539  2.775  1.00 0.00 ? 4  THR A CA   7  
ATOM 6913  C C    . THR A 1 4  ? 3.419  -5.314  3.631  1.00 0.00 ? 4  THR A C    7  
ATOM 6914  O O    . THR A 1 4  ? 3.065  -5.437  4.803  1.00 0.00 ? 4  THR A O    7  
ATOM 6915  C CB   . THR A 1 4  ? 5.248  -6.742  2.713  1.00 0.00 ? 4  THR A CB   7  
ATOM 6916  O OG1  . THR A 1 4  ? 5.572  -7.721  1.720  1.00 0.00 ? 4  THR A OG1  7  
ATOM 6917  C CG2  . THR A 1 4  ? 5.790  -7.184  4.064  1.00 0.00 ? 4  THR A CG2  7  
ATOM 6918  H H    . THR A 1 4  ? 3.742  -6.217  0.683  1.00 0.00 ? 4  THR A H    7  
ATOM 6919  H HA   . THR A 1 4  ? 3.283  -7.409  3.240  1.00 0.00 ? 4  THR A HA   7  
ATOM 6920  H HB   . THR A 1 4  ? 5.711  -5.802  2.446  1.00 0.00 ? 4  THR A HB   7  
ATOM 6921  H HG1  . THR A 1 4  ? 5.263  -8.583  2.007  1.00 0.00 ? 4  THR A HG1  7  
ATOM 6922  H HG21 . THR A 1 4  ? 6.274  -8.144  3.961  1.00 0.00 ? 4  THR A HG21 7  
ATOM 6923  H HG22 . THR A 1 4  ? 4.977  -7.265  4.769  1.00 0.00 ? 4  THR A HG22 7  
ATOM 6924  H HG23 . THR A 1 4  ? 6.505  -6.458  4.420  1.00 0.00 ? 4  THR A HG23 7  
ATOM 6925  N N    . ALA A 1 5  ? 3.559  -4.134  3.037  1.00 0.00 ? 5  ALA A N    7  
ATOM 6926  C CA   . ALA A 1 5  ? 3.296  -2.887  3.745  1.00 0.00 ? 5  ALA A CA   7  
ATOM 6927  C C    . ALA A 1 5  ? 1.897  -2.883  4.350  1.00 0.00 ? 5  ALA A C    7  
ATOM 6928  O O    . ALA A 1 5  ? 1.728  -2.635  5.543  1.00 0.00 ? 5  ALA A O    7  
ATOM 6929  C CB   . ALA A 1 5  ? 3.472  -1.701  2.807  1.00 0.00 ? 5  ALA A CB   7  
ATOM 6930  H H    . ALA A 1 5  ? 3.844  -4.101  2.100  1.00 0.00 ? 5  ALA A H    7  
ATOM 6931  H HA   . ALA A 1 5  ? 4.022  -2.796  4.540  1.00 0.00 ? 5  ALA A HA   7  
ATOM 6932  H HB1  . ALA A 1 5  ? 3.336  -0.783  3.361  1.00 0.00 ? 5  ALA A HB1  7  
ATOM 6933  H HB2  . ALA A 1 5  ? 4.464  -1.722  2.382  1.00 0.00 ? 5  ALA A HB2  7  
ATOM 6934  H HB3  . ALA A 1 5  ? 2.739  -1.757  2.016  1.00 0.00 ? 5  ALA A HB3  7  
ATOM 6935  N N    . GLU A 1 6  ? 0.897  -3.159  3.518  1.00 0.00 ? 6  GLU A N    7  
ATOM 6936  C CA   . GLU A 1 6  ? -0.489 -3.186  3.973  1.00 0.00 ? 6  GLU A CA   7  
ATOM 6937  C C    . GLU A 1 6  ? -0.656 -4.140  5.152  1.00 0.00 ? 6  GLU A C    7  
ATOM 6938  O O    . GLU A 1 6  ? -1.319 -3.815  6.137  1.00 0.00 ? 6  GLU A O    7  
ATOM 6939  C CB   . GLU A 1 6  ? -1.416 -3.603  2.829  1.00 0.00 ? 6  GLU A CB   7  
ATOM 6940  C CG   . GLU A 1 6  ? -1.713 -2.482  1.847  1.00 0.00 ? 6  GLU A CG   7  
ATOM 6941  C CD   . GLU A 1 6  ? -3.057 -2.647  1.164  1.00 0.00 ? 6  GLU A CD   7  
ATOM 6942  O OE1  . GLU A 1 6  ? -3.175 -3.537  0.295  1.00 0.00 ? 6  GLU A OE1  7  
ATOM 6943  O OE2  . GLU A 1 6  ? -3.989 -1.886  1.496  1.00 0.00 ? 6  GLU A OE2  7  
ATOM 6944  H H    . GLU A 1 6  ? 1.095  -3.349  2.577  1.00 0.00 ? 6  GLU A H    7  
ATOM 6945  H HA   . GLU A 1 6  ? -0.752 -2.189  4.292  1.00 0.00 ? 6  GLU A HA   7  
ATOM 6946  H HB2  . GLU A 1 6  ? -0.956 -4.416  2.287  1.00 0.00 ? 6  GLU A HB2  7  
ATOM 6947  H HB3  . GLU A 1 6  ? -2.351 -3.944  3.247  1.00 0.00 ? 6  GLU A HB3  7  
ATOM 6948  H HG2  . GLU A 1 6  ? -1.711 -1.543  2.380  1.00 0.00 ? 6  GLU A HG2  7  
ATOM 6949  H HG3  . GLU A 1 6  ? -0.941 -2.468  1.092  1.00 0.00 ? 6  GLU A HG3  7  
ATOM 6950  N N    . ARG A 1 7  ? -0.051 -5.318  5.042  1.00 0.00 ? 7  ARG A N    7  
ATOM 6951  C CA   . ARG A 1 7  ? -0.134 -6.320  6.098  1.00 0.00 ? 7  ARG A CA   7  
ATOM 6952  C C    . ARG A 1 7  ? 0.419  -5.775  7.411  1.00 0.00 ? 7  ARG A C    7  
ATOM 6953  O O    . ARG A 1 7  ? -0.271 -5.764  8.431  1.00 0.00 ? 7  ARG A O    7  
ATOM 6954  C CB   . ARG A 1 7  ? 0.632  -7.582  5.694  1.00 0.00 ? 7  ARG A CB   7  
ATOM 6955  C CG   . ARG A 1 7  ? 0.055  -8.859  6.282  1.00 0.00 ? 7  ARG A CG   7  
ATOM 6956  C CD   . ARG A 1 7  ? 0.268  -10.045 5.355  1.00 0.00 ? 7  ARG A CD   7  
ATOM 6957  N NE   . ARG A 1 7  ? 0.338  -11.307 6.088  1.00 0.00 ? 7  ARG A NE   7  
ATOM 6958  C CZ   . ARG A 1 7  ? 0.263  -12.499 5.507  1.00 0.00 ? 7  ARG A CZ   7  
ATOM 6959  N NH1  . ARG A 1 7  ? 0.116  -12.591 4.192  1.00 0.00 ? 7  ARG A NH1  7  
ATOM 6960  N NH2  . ARG A 1 7  ? 0.334  -13.602 6.241  1.00 0.00 ? 7  ARG A NH2  7  
ATOM 6961  H H    . ARG A 1 7  ? 0.463  -5.519  4.232  1.00 0.00 ? 7  ARG A H    7  
ATOM 6962  H HA   . ARG A 1 7  ? -1.175 -6.571  6.236  1.00 0.00 ? 7  ARG A HA   7  
ATOM 6963  H HB2  . ARG A 1 7  ? 0.617  -7.669  4.618  1.00 0.00 ? 7  ARG A HB2  7  
ATOM 6964  H HB3  . ARG A 1 7  ? 1.655  -7.488  6.026  1.00 0.00 ? 7  ARG A HB3  7  
ATOM 6965  H HG2  . ARG A 1 7  ? 0.541  -9.062  7.225  1.00 0.00 ? 7  ARG A HG2  7  
ATOM 6966  H HG3  . ARG A 1 7  ? -1.004 -8.724  6.443  1.00 0.00 ? 7  ARG A HG3  7  
ATOM 6967  H HD2  . ARG A 1 7  ? -0.553 -10.091 4.656  1.00 0.00 ? 7  ARG A HD2  7  
ATOM 6968  H HD3  . ARG A 1 7  ? 1.192  -9.901  4.815  1.00 0.00 ? 7  ARG A HD3  7  
ATOM 6969  H HE   . ARG A 1 7  ? 0.447  -11.262 7.060  1.00 0.00 ? 7  ARG A HE   7  
ATOM 6970  H HH11 . ARG A 1 7  ? 0.062  -11.762 3.636  1.00 0.00 ? 7  ARG A HH11 7  
ATOM 6971  H HH12 . ARG A 1 7  ? 0.060  -13.490 3.757  1.00 0.00 ? 7  ARG A HH12 7  
ATOM 6972  H HH21 . ARG A 1 7  ? 0.445  -13.536 7.232  1.00 0.00 ? 7  ARG A HH21 7  
ATOM 6973  H HH22 . ARG A 1 7  ? 0.277  -14.498 5.803  1.00 0.00 ? 7  ARG A HH22 7  
ATOM 6974  N N    . VAL A 1 8  ? 1.669  -5.323  7.378  1.00 0.00 ? 8  VAL A N    7  
ATOM 6975  C CA   . VAL A 1 8  ? 2.315  -4.775  8.565  1.00 0.00 ? 8  VAL A CA   7  
ATOM 6976  C C    . VAL A 1 8  ? 1.451  -3.699  9.213  1.00 0.00 ? 8  VAL A C    7  
ATOM 6977  O O    . VAL A 1 8  ? 1.105  -3.791  10.391 1.00 0.00 ? 8  VAL A O    7  
ATOM 6978  C CB   . VAL A 1 8  ? 3.694  -4.177  8.228  1.00 0.00 ? 8  VAL A CB   7  
ATOM 6979  C CG1  . VAL A 1 8  ? 4.337  -3.584  9.472  1.00 0.00 ? 8  VAL A CG1  7  
ATOM 6980  C CG2  . VAL A 1 8  ? 4.594  -5.234  7.604  1.00 0.00 ? 8  VAL A CG2  7  
ATOM 6981  H H    . VAL A 1 8  ? 2.168  -5.358  6.536  1.00 0.00 ? 8  VAL A H    7  
ATOM 6982  H HA   . VAL A 1 8  ? 2.458  -5.581  9.270  1.00 0.00 ? 8  VAL A HA   7  
ATOM 6983  H HB   . VAL A 1 8  ? 3.554  -3.384  7.509  1.00 0.00 ? 8  VAL A HB   7  
ATOM 6984  H HG11 . VAL A 1 8  ? 3.923  -4.057  10.351 1.00 0.00 ? 8  VAL A HG11 7  
ATOM 6985  H HG12 . VAL A 1 8  ? 5.404  -3.751  9.440  1.00 0.00 ? 8  VAL A HG12 7  
ATOM 6986  H HG13 . VAL A 1 8  ? 4.140  -2.523  9.508  1.00 0.00 ? 8  VAL A HG13 7  
ATOM 6987  H HG21 . VAL A 1 8  ? 4.663  -5.063  6.540  1.00 0.00 ? 8  VAL A HG21 7  
ATOM 6988  H HG22 . VAL A 1 8  ? 5.579  -5.173  8.043  1.00 0.00 ? 8  VAL A HG22 7  
ATOM 6989  H HG23 . VAL A 1 8  ? 4.179  -6.214  7.786  1.00 0.00 ? 8  VAL A HG23 7  
ATOM 6990  N N    . LYS A 1 9  ? 1.106  -2.678  8.437  1.00 0.00 ? 9  LYS A N    7  
ATOM 6991  C CA   . LYS A 1 9  ? 0.281  -1.583  8.933  1.00 0.00 ? 9  LYS A CA   7  
ATOM 6992  C C    . LYS A 1 9  ? -0.988 -2.114  9.592  1.00 0.00 ? 9  LYS A C    7  
ATOM 6993  O O    . LYS A 1 9  ? -1.379 -1.659  10.667 1.00 0.00 ? 9  LYS A O    7  
ATOM 6994  C CB   . LYS A 1 9  ? -0.084 -0.633  7.790  1.00 0.00 ? 9  LYS A CB   7  
ATOM 6995  C CG   . LYS A 1 9  ? 1.122  -0.073  7.056  1.00 0.00 ? 9  LYS A CG   7  
ATOM 6996  C CD   . LYS A 1 9  ? 0.798  0.233   5.604  1.00 0.00 ? 9  LYS A CD   7  
ATOM 6997  C CE   . LYS A 1 9  ? -0.079 1.468   5.476  1.00 0.00 ? 9  LYS A CE   7  
ATOM 6998  N NZ   . LYS A 1 9  ? -1.522 1.144   5.649  1.00 0.00 ? 9  LYS A NZ   7  
ATOM 6999  H H    . LYS A 1 9  ? 1.413  -2.661  7.505  1.00 0.00 ? 9  LYS A H    7  
ATOM 7000  H HA   . LYS A 1 9  ? 0.855  -1.042  9.670  1.00 0.00 ? 9  LYS A HA   7  
ATOM 7001  H HB2  . LYS A 1 9  ? -0.698 -1.165  7.078  1.00 0.00 ? 9  LYS A HB2  7  
ATOM 7002  H HB3  . LYS A 1 9  ? -0.650 0.195   8.193  1.00 0.00 ? 9  LYS A HB3  7  
ATOM 7003  H HG2  . LYS A 1 9  ? 1.437  0.838   7.543  1.00 0.00 ? 9  LYS A HG2  7  
ATOM 7004  H HG3  . LYS A 1 9  ? 1.923  -0.798  7.093  1.00 0.00 ? 9  LYS A HG3  7  
ATOM 7005  H HD2  . LYS A 1 9  ? 1.720  0.403   5.066  1.00 0.00 ? 9  LYS A HD2  7  
ATOM 7006  H HD3  . LYS A 1 9  ? 0.280  -0.613  5.174  1.00 0.00 ? 9  LYS A HD3  7  
ATOM 7007  H HE2  . LYS A 1 9  ? 0.214  2.181   6.231  1.00 0.00 ? 9  LYS A HE2  7  
ATOM 7008  H HE3  . LYS A 1 9  ? 0.069  1.899   4.497  1.00 0.00 ? 9  LYS A HE3  7  
ATOM 7009  H HZ1  . LYS A 1 9  ? -1.902 1.639   6.482  1.00 0.00 ? 9  LYS A HZ1  7  
ATOM 7010  H HZ2  . LYS A 1 9  ? -1.645 0.120   5.784  1.00 0.00 ? 9  LYS A HZ2  7  
ATOM 7011  H HZ3  . LYS A 1 9  ? -2.059 1.439   4.809  1.00 0.00 ? 9  LYS A HZ3  7  
ATOM 7012  N N    . LYS A 1 10 ? -1.628 -3.079  8.941  1.00 0.00 ? 10 LYS A N    7  
ATOM 7013  C CA   . LYS A 1 10 ? -2.852 -3.675  9.464  1.00 0.00 ? 10 LYS A CA   7  
ATOM 7014  C C    . LYS A 1 10 ? -2.627 -4.241  10.863 1.00 0.00 ? 10 LYS A C    7  
ATOM 7015  O O    . LYS A 1 10 ? -3.341 -3.895  11.804 1.00 0.00 ? 10 LYS A O    7  
ATOM 7016  C CB   . LYS A 1 10 ? -3.346 -4.781  8.529  1.00 0.00 ? 10 LYS A CB   7  
ATOM 7017  C CG   . LYS A 1 10 ? -4.673 -5.387  8.951  1.00 0.00 ? 10 LYS A CG   7  
ATOM 7018  C CD   . LYS A 1 10 ? -5.845 -4.525  8.510  1.00 0.00 ? 10 LYS A CD   7  
ATOM 7019  C CE   . LYS A 1 10 ? -6.343 -4.925  7.130  1.00 0.00 ? 10 LYS A CE   7  
ATOM 7020  N NZ   . LYS A 1 10 ? -7.090 -6.213  7.162  1.00 0.00 ? 10 LYS A NZ   7  
ATOM 7021  H H    . LYS A 1 10 ? -1.267 -3.401  8.088  1.00 0.00 ? 10 LYS A H    7  
ATOM 7022  H HA   . LYS A 1 10 ? -3.601 -2.900  9.519  1.00 0.00 ? 10 LYS A HA   7  
ATOM 7023  H HB2  . LYS A 1 10 ? -3.460 -4.371  7.536  1.00 0.00 ? 10 LYS A HB2  7  
ATOM 7024  H HB3  . LYS A 1 10 ? -2.607 -5.569  8.501  1.00 0.00 ? 10 LYS A HB3  7  
ATOM 7025  H HG2  . LYS A 1 10 ? -4.771 -6.364  8.503  1.00 0.00 ? 10 LYS A HG2  7  
ATOM 7026  H HG3  . LYS A 1 10 ? -4.690 -5.479  10.028 1.00 0.00 ? 10 LYS A HG3  7  
ATOM 7027  H HD2  . LYS A 1 10 ? -6.651 -4.640  9.219  1.00 0.00 ? 10 LYS A HD2  7  
ATOM 7028  H HD3  . LYS A 1 10 ? -5.530 -3.491  8.485  1.00 0.00 ? 10 LYS A HD3  7  
ATOM 7029  H HE2  . LYS A 1 10 ? -6.995 -4.149  6.759  1.00 0.00 ? 10 LYS A HE2  7  
ATOM 7030  H HE3  . LYS A 1 10 ? -5.493 -5.027  6.471  1.00 0.00 ? 10 LYS A HE3  7  
ATOM 7031  H HZ1  . LYS A 1 10 ? -6.740 -6.846  6.415  1.00 0.00 ? 10 LYS A HZ1  7  
ATOM 7032  H HZ2  . LYS A 1 10 ? -8.104 -6.042  7.008  1.00 0.00 ? 10 LYS A HZ2  7  
ATOM 7033  H HZ3  . LYS A 1 10 ? -6.963 -6.677  8.083  1.00 0.00 ? 10 LYS A HZ3  7  
ATOM 7034  N N    . ILE A 1 11 ? -1.630 -5.110  10.991 1.00 0.00 ? 11 ILE A N    7  
ATOM 7035  C CA   . ILE A 1 11 ? -1.310 -5.721  12.276 1.00 0.00 ? 11 ILE A CA   7  
ATOM 7036  C C    . ILE A 1 11 ? -0.938 -4.663  13.309 1.00 0.00 ? 11 ILE A C    7  
ATOM 7037  O O    . ILE A 1 11 ? -1.172 -4.840  14.505 1.00 0.00 ? 11 ILE A O    7  
ATOM 7038  C CB   . ILE A 1 11 ? -0.152 -6.728  12.147 1.00 0.00 ? 11 ILE A CB   7  
ATOM 7039  C CG1  . ILE A 1 11 ? -0.509 -7.823  11.141 1.00 0.00 ? 11 ILE A CG1  7  
ATOM 7040  C CG2  . ILE A 1 11 ? 0.175  -7.334  13.504 1.00 0.00 ? 11 ILE A CG2  7  
ATOM 7041  C CD1  . ILE A 1 11 ? 0.587  -8.847  10.948 1.00 0.00 ? 11 ILE A CD1  7  
ATOM 7042  H H    . ILE A 1 11 ? -1.097 -5.346  10.204 1.00 0.00 ? 11 ILE A H    7  
ATOM 7043  H HA   . ILE A 1 11 ? -2.187 -6.252  12.619 1.00 0.00 ? 11 ILE A HA   7  
ATOM 7044  H HB   . ILE A 1 11 ? 0.720  -6.197  11.797 1.00 0.00 ? 11 ILE A HB   7  
ATOM 7045  H HG12 . ILE A 1 11 ? -1.391 -8.343  11.481 1.00 0.00 ? 11 ILE A HG12 7  
ATOM 7046  H HG13 . ILE A 1 11 ? -0.713 -7.368  10.182 1.00 0.00 ? 11 ILE A HG13 7  
ATOM 7047  H HG21 . ILE A 1 11 ? 1.001  -8.022  13.401 1.00 0.00 ? 11 ILE A HG21 7  
ATOM 7048  H HG22 . ILE A 1 11 ? 0.447  -6.547  14.192 1.00 0.00 ? 11 ILE A HG22 7  
ATOM 7049  H HG23 . ILE A 1 11 ? -0.688 -7.861  13.881 1.00 0.00 ? 11 ILE A HG23 7  
ATOM 7050  H HD11 . ILE A 1 11 ? 0.808  -9.321  11.893 1.00 0.00 ? 11 ILE A HD11 7  
ATOM 7051  H HD12 . ILE A 1 11 ? 0.264  -9.592  10.237 1.00 0.00 ? 11 ILE A HD12 7  
ATOM 7052  H HD13 . ILE A 1 11 ? 1.476  -8.357  10.576 1.00 0.00 ? 11 ILE A HD13 7  
ATOM 7053  N N    . VAL A 1 12 ? -0.358 -3.563  12.840 1.00 0.00 ? 12 VAL A N    7  
ATOM 7054  C CA   . VAL A 1 12 ? 0.044  -2.475  13.723 1.00 0.00 ? 12 VAL A CA   7  
ATOM 7055  C C    . VAL A 1 12 ? -1.163 -1.669  14.188 1.00 0.00 ? 12 VAL A C    7  
ATOM 7056  O O    . VAL A 1 12 ? -1.197 -1.174  15.315 1.00 0.00 ? 12 VAL A O    7  
ATOM 7057  C CB   . VAL A 1 12 ? 1.043  -1.530  13.030 1.00 0.00 ? 12 VAL A CB   7  
ATOM 7058  C CG1  . VAL A 1 12 ? 1.424  -0.383  13.954 1.00 0.00 ? 12 VAL A CG1  7  
ATOM 7059  C CG2  . VAL A 1 12 ? 2.278  -2.296  12.581 1.00 0.00 ? 12 VAL A CG2  7  
ATOM 7060  H H    . VAL A 1 12 ? -0.198 -3.481  11.877 1.00 0.00 ? 12 VAL A H    7  
ATOM 7061  H HA   . VAL A 1 12 ? 0.530  -2.907  14.586 1.00 0.00 ? 12 VAL A HA   7  
ATOM 7062  H HB   . VAL A 1 12 ? 0.566  -1.113  12.155 1.00 0.00 ? 12 VAL A HB   7  
ATOM 7063  H HG11 . VAL A 1 12 ? 1.036  -0.576  14.944 1.00 0.00 ? 12 VAL A HG11 7  
ATOM 7064  H HG12 . VAL A 1 12 ? 2.500  -0.298  13.998 1.00 0.00 ? 12 VAL A HG12 7  
ATOM 7065  H HG13 . VAL A 1 12 ? 1.004  0.538   13.577 1.00 0.00 ? 12 VAL A HG13 7  
ATOM 7066  H HG21 . VAL A 1 12 ? 3.098  -2.078  13.248 1.00 0.00 ? 12 VAL A HG21 7  
ATOM 7067  H HG22 . VAL A 1 12 ? 2.071  -3.356  12.600 1.00 0.00 ? 12 VAL A HG22 7  
ATOM 7068  H HG23 . VAL A 1 12 ? 2.541  -1.999  11.577 1.00 0.00 ? 12 VAL A HG23 7  
ATOM 7069  N N    . VAL A 1 13 ? -2.155 -1.541  13.312 1.00 0.00 ? 13 VAL A N    7  
ATOM 7070  C CA   . VAL A 1 13 ? -3.367 -0.796  13.632 1.00 0.00 ? 13 VAL A CA   7  
ATOM 7071  C C    . VAL A 1 13 ? -4.272 -1.593  14.564 1.00 0.00 ? 13 VAL A C    7  
ATOM 7072  O O    . VAL A 1 13 ? -4.939 -1.028  15.430 1.00 0.00 ? 13 VAL A O    7  
ATOM 7073  C CB   . VAL A 1 13 ? -4.153 -0.430  12.359 1.00 0.00 ? 13 VAL A CB   7  
ATOM 7074  C CG1  . VAL A 1 13 ? -5.428 0.320   12.716 1.00 0.00 ? 13 VAL A CG1  7  
ATOM 7075  C CG2  . VAL A 1 13 ? -3.288 0.392   11.416 1.00 0.00 ? 13 VAL A CG2  7  
ATOM 7076  H H    . VAL A 1 13 ? -2.070 -1.958  12.429 1.00 0.00 ? 13 VAL A H    7  
ATOM 7077  H HA   . VAL A 1 13 ? -3.075 0.120   14.125 1.00 0.00 ? 13 VAL A HA   7  
ATOM 7078  H HB   . VAL A 1 13 ? -4.430 -1.344  11.856 1.00 0.00 ? 13 VAL A HB   7  
ATOM 7079  H HG11 . VAL A 1 13 ? -5.403 0.594   13.761 1.00 0.00 ? 13 VAL A HG11 7  
ATOM 7080  H HG12 . VAL A 1 13 ? -5.502 1.212   12.111 1.00 0.00 ? 13 VAL A HG12 7  
ATOM 7081  H HG13 . VAL A 1 13 ? -6.282 -0.314  12.531 1.00 0.00 ? 13 VAL A HG13 7  
ATOM 7082  H HG21 . VAL A 1 13 ? -3.361 -0.013  10.418 1.00 0.00 ? 13 VAL A HG21 7  
ATOM 7083  H HG22 . VAL A 1 13 ? -3.629 1.417   11.415 1.00 0.00 ? 13 VAL A HG22 7  
ATOM 7084  H HG23 . VAL A 1 13 ? -2.260 0.356   11.746 1.00 0.00 ? 13 VAL A HG23 7  
ATOM 7085  N N    . GLU A 1 14 ? -4.288 -2.910  14.381 1.00 0.00 ? 14 GLU A N    7  
ATOM 7086  C CA   . GLU A 1 14 ? -5.112 -3.785  15.206 1.00 0.00 ? 14 GLU A CA   7  
ATOM 7087  C C    . GLU A 1 14 ? -4.429 -4.078  16.539 1.00 0.00 ? 14 GLU A C    7  
ATOM 7088  O O    . GLU A 1 14 ? -5.089 -4.368  17.537 1.00 0.00 ? 14 GLU A O    7  
ATOM 7089  C CB   . GLU A 1 14 ? -5.401 -5.094  14.470 1.00 0.00 ? 14 GLU A CB   7  
ATOM 7090  C CG   . GLU A 1 14 ? -6.685 -5.774  14.916 1.00 0.00 ? 14 GLU A CG   7  
ATOM 7091  C CD   . GLU A 1 14 ? -6.828 -7.176  14.357 1.00 0.00 ? 14 GLU A CD   7  
ATOM 7092  O OE1  . GLU A 1 14 ? -5.985 -7.570  13.524 1.00 0.00 ? 14 GLU A OE1  7  
ATOM 7093  O OE2  . GLU A 1 14 ? -7.782 -7.878  14.752 1.00 0.00 ? 14 GLU A OE2  7  
ATOM 7094  H H    . GLU A 1 14 ? -3.734 -3.301  13.674 1.00 0.00 ? 14 GLU A H    7  
ATOM 7095  H HA   . GLU A 1 14 ? -6.046 -3.277  15.398 1.00 0.00 ? 14 GLU A HA   7  
ATOM 7096  H HB2  . GLU A 1 14 ? -5.475 -4.890  13.412 1.00 0.00 ? 14 GLU A HB2  7  
ATOM 7097  H HB3  . GLU A 1 14 ? -4.581 -5.776  14.638 1.00 0.00 ? 14 GLU A HB3  7  
ATOM 7098  H HG2  . GLU A 1 14 ? -6.691 -5.830  15.994 1.00 0.00 ? 14 GLU A HG2  7  
ATOM 7099  H HG3  . GLU A 1 14 ? -7.525 -5.182  14.583 1.00 0.00 ? 14 GLU A HG3  7  
ATOM 7100  N N    . HIS A 1 15 ? -3.102 -4.001  16.546 1.00 0.00 ? 15 HIS A N    7  
ATOM 7101  C CA   . HIS A 1 15 ? -2.328 -4.258  17.756 1.00 0.00 ? 15 HIS A CA   7  
ATOM 7102  C C    . HIS A 1 15 ? -2.148 -2.979  18.567 1.00 0.00 ? 15 HIS A C    7  
ATOM 7103  O O    . HIS A 1 15 ? -2.475 -2.933  19.754 1.00 0.00 ? 15 HIS A O    7  
ATOM 7104  C CB   . HIS A 1 15 ? -0.962 -4.845  17.397 1.00 0.00 ? 15 HIS A CB   7  
ATOM 7105  C CG   . HIS A 1 15 ? -0.211 -5.377  18.578 1.00 0.00 ? 15 HIS A CG   7  
ATOM 7106  N ND1  . HIS A 1 15 ? 1.164  -5.337  18.676 1.00 0.00 ? 15 HIS A ND1  7  
ATOM 7107  C CD2  . HIS A 1 15 ? -0.650 -5.963  19.717 1.00 0.00 ? 15 HIS A CD2  7  
ATOM 7108  C CE1  . HIS A 1 15 ? 1.538  -5.877  19.822 1.00 0.00 ? 15 HIS A CE1  7  
ATOM 7109  N NE2  . HIS A 1 15 ? 0.456  -6.264  20.473 1.00 0.00 ? 15 HIS A NE2  7  
ATOM 7110  H H    . HIS A 1 15 ? -2.632 -3.765  15.719 1.00 0.00 ? 15 HIS A H    7  
ATOM 7111  H HA   . HIS A 1 15 ? -2.873 -4.974  18.352 1.00 0.00 ? 15 HIS A HA   7  
ATOM 7112  H HB2  . HIS A 1 15 ? -1.099 -5.658  16.699 1.00 0.00 ? 15 HIS A HB2  7  
ATOM 7113  H HB3  . HIS A 1 15 ? -0.357 -4.078  16.936 1.00 0.00 ? 15 HIS A HB3  7  
ATOM 7114  H HD1  . HIS A 1 15 ? 1.775  -4.970  18.004 1.00 0.00 ? 15 HIS A HD1  7  
ATOM 7115  H HD2  . HIS A 1 15 ? -1.680 -6.158  19.982 1.00 0.00 ? 15 HIS A HD2  7  
ATOM 7116  H HE1  . HIS A 1 15 ? 2.555  -5.983  20.170 1.00 0.00 ? 15 HIS A HE1  7  
ATOM 7117  N N    . LEU A 1 16 ? -1.625 -1.943  17.921 1.00 0.00 ? 16 LEU A N    7  
ATOM 7118  C CA   . LEU A 1 16 ? -1.400 -0.662  18.583 1.00 0.00 ? 16 LEU A CA   7  
ATOM 7119  C C    . LEU A 1 16 ? -2.716 0.081   18.793 1.00 0.00 ? 16 LEU A C    7  
ATOM 7120  O O    . LEU A 1 16 ? -2.895 0.777   19.791 1.00 0.00 ? 16 LEU A O    7  
ATOM 7121  C CB   . LEU A 1 16 ? -0.441 0.199   17.759 1.00 0.00 ? 16 LEU A CB   7  
ATOM 7122  C CG   . LEU A 1 16 ? 0.476  1.130   18.553 1.00 0.00 ? 16 LEU A CG   7  
ATOM 7123  C CD1  . LEU A 1 16 ? -0.342 2.157   19.321 1.00 0.00 ? 16 LEU A CD1  7  
ATOM 7124  C CD2  . LEU A 1 16 ? 1.356  0.330   19.502 1.00 0.00 ? 16 LEU A CD2  7  
ATOM 7125  H H    . LEU A 1 16 ? -1.384 -2.040  16.976 1.00 0.00 ? 16 LEU A H    7  
ATOM 7126  H HA   . LEU A 1 16 ? -0.955 -0.861  19.546 1.00 0.00 ? 16 LEU A HA   7  
ATOM 7127  H HB2  . LEU A 1 16 ? 0.183  -0.464  17.179 1.00 0.00 ? 16 LEU A HB2  7  
ATOM 7128  H HB3  . LEU A 1 16 ? -1.035 0.807   17.091 1.00 0.00 ? 16 LEU A HB3  7  
ATOM 7129  H HG   . LEU A 1 16 ? 1.120  1.662   17.867 1.00 0.00 ? 16 LEU A HG   7  
ATOM 7130  H HD11 . LEU A 1 16 ? -1.329 2.227   18.888 1.00 0.00 ? 16 LEU A HD11 7  
ATOM 7131  H HD12 . LEU A 1 16 ? 0.145  3.119   19.264 1.00 0.00 ? 16 LEU A HD12 7  
ATOM 7132  H HD13 . LEU A 1 16 ? -0.422 1.854   20.354 1.00 0.00 ? 16 LEU A HD13 7  
ATOM 7133  H HD21 . LEU A 1 16 ? 2.359  0.730   19.485 1.00 0.00 ? 16 LEU A HD21 7  
ATOM 7134  H HD22 . LEU A 1 16 ? 1.376  -0.704  19.189 1.00 0.00 ? 16 LEU A HD22 7  
ATOM 7135  H HD23 . LEU A 1 16 ? 0.958  0.396   20.504 1.00 0.00 ? 16 LEU A HD23 7  
ATOM 7136  N N    . GLY A 1 17 ? -3.635 -0.074  17.845 1.00 0.00 ? 17 GLY A N    7  
ATOM 7137  C CA   . GLY A 1 17 ? -4.923 0.586   17.946 1.00 0.00 ? 17 GLY A CA   7  
ATOM 7138  C C    . GLY A 1 17 ? -4.873 2.029   17.484 1.00 0.00 ? 17 GLY A C    7  
ATOM 7139  O O    . GLY A 1 17 ? -5.680 2.854   17.913 1.00 0.00 ? 17 GLY A O    7  
ATOM 7140  H H    . GLY A 1 17 ? -3.437 -0.642  17.070 1.00 0.00 ? 17 GLY A H    7  
ATOM 7141  H HA2  . GLY A 1 17 ? -5.639 0.050   17.340 1.00 0.00 ? 17 GLY A HA2  7  
ATOM 7142  H HA3  . GLY A 1 17 ? -5.248 0.561   18.975 1.00 0.00 ? 17 GLY A HA3  7  
ATOM 7143  N N    . VAL A 1 18 ? -3.921 2.336   16.608 1.00 0.00 ? 18 VAL A N    7  
ATOM 7144  C CA   . VAL A 1 18 ? -3.768 3.689   16.089 1.00 0.00 ? 18 VAL A CA   7  
ATOM 7145  C C    . VAL A 1 18 ? -4.234 3.778   14.640 1.00 0.00 ? 18 VAL A C    7  
ATOM 7146  O O    . VAL A 1 18 ? -4.658 2.783   14.052 1.00 0.00 ? 18 VAL A O    7  
ATOM 7147  C CB   . VAL A 1 18 ? -2.305 4.162   16.176 1.00 0.00 ? 18 VAL A CB   7  
ATOM 7148  C CG1  . VAL A 1 18 ? -1.914 4.427   17.622 1.00 0.00 ? 18 VAL A CG1  7  
ATOM 7149  C CG2  . VAL A 1 18 ? -1.376 3.136   15.544 1.00 0.00 ? 18 VAL A CG2  7  
ATOM 7150  H H    . VAL A 1 18 ? -3.308 1.635   16.304 1.00 0.00 ? 18 VAL A H    7  
ATOM 7151  H HA   . VAL A 1 18 ? -4.374 4.349   16.692 1.00 0.00 ? 18 VAL A HA   7  
ATOM 7152  H HB   . VAL A 1 18 ? -2.213 5.087   15.626 1.00 0.00 ? 18 VAL A HB   7  
ATOM 7153  H HG11 . VAL A 1 18 ? -2.466 3.762   18.271 1.00 0.00 ? 18 VAL A HG11 7  
ATOM 7154  H HG12 . VAL A 1 18 ? -0.855 4.257   17.746 1.00 0.00 ? 18 VAL A HG12 7  
ATOM 7155  H HG13 . VAL A 1 18 ? -2.147 5.451   17.875 1.00 0.00 ? 18 VAL A HG13 7  
ATOM 7156  H HG21 . VAL A 1 18 ? -0.703 3.634   14.861 1.00 0.00 ? 18 VAL A HG21 7  
ATOM 7157  H HG22 . VAL A 1 18 ? -0.803 2.643   16.317 1.00 0.00 ? 18 VAL A HG22 7  
ATOM 7158  H HG23 . VAL A 1 18 ? -1.959 2.404   15.006 1.00 0.00 ? 18 VAL A HG23 7  
ATOM 7159  N N    . ASP A 1 19 ? -4.150 4.975   14.069 1.00 0.00 ? 19 ASP A N    7  
ATOM 7160  C CA   . ASP A 1 19 ? -4.561 5.194   12.688 1.00 0.00 ? 19 ASP A CA   7  
ATOM 7161  C C    . ASP A 1 19 ? -3.524 4.638   11.717 1.00 0.00 ? 19 ASP A C    7  
ATOM 7162  O O    . ASP A 1 19 ? -2.324 4.671   11.990 1.00 0.00 ? 19 ASP A O    7  
ATOM 7163  C CB   . ASP A 1 19 ? -4.775 6.685   12.427 1.00 0.00 ? 19 ASP A CB   7  
ATOM 7164  C CG   . ASP A 1 19 ? -5.816 6.943   11.355 1.00 0.00 ? 19 ASP A CG   7  
ATOM 7165  O OD1  . ASP A 1 19 ? -7.009 6.674   11.609 1.00 0.00 ? 19 ASP A OD1  7  
ATOM 7166  O OD2  . ASP A 1 19 ? -5.438 7.413   10.262 1.00 0.00 ? 19 ASP A OD2  7  
ATOM 7167  H H    . ASP A 1 19 ? -3.803 5.729   14.590 1.00 0.00 ? 19 ASP A H    7  
ATOM 7168  H HA   . ASP A 1 19 ? -5.495 4.673   12.533 1.00 0.00 ? 19 ASP A HA   7  
ATOM 7169  H HB2  . ASP A 1 19 ? -5.101 7.161   13.340 1.00 0.00 ? 19 ASP A HB2  7  
ATOM 7170  H HB3  . ASP A 1 19 ? -3.841 7.126   12.110 1.00 0.00 ? 19 ASP A HB3  7  
ATOM 7171  N N    . ALA A 1 20 ? -3.994 4.128   10.584 1.00 0.00 ? 20 ALA A N    7  
ATOM 7172  C CA   . ALA A 1 20 ? -3.107 3.566   9.573  1.00 0.00 ? 20 ALA A CA   7  
ATOM 7173  C C    . ALA A 1 20 ? -2.409 4.667   8.782  1.00 0.00 ? 20 ALA A C    7  
ATOM 7174  O O    . ALA A 1 20 ? -1.244 4.533   8.407  1.00 0.00 ? 20 ALA A O    7  
ATOM 7175  C CB   . ALA A 1 20 ? -3.884 2.653   8.637  1.00 0.00 ? 20 ALA A CB   7  
ATOM 7176  H H    . ALA A 1 20 ? -4.960 4.130   10.424 1.00 0.00 ? 20 ALA A H    7  
ATOM 7177  H HA   . ALA A 1 20 ? -2.360 2.971   10.078 1.00 0.00 ? 20 ALA A HA   7  
ATOM 7178  H HB1  . ALA A 1 20 ? -4.188 1.765   9.172  1.00 0.00 ? 20 ALA A HB1  7  
ATOM 7179  H HB2  . ALA A 1 20 ? -4.759 3.171   8.273  1.00 0.00 ? 20 ALA A HB2  7  
ATOM 7180  H HB3  . ALA A 1 20 ? -3.258 2.374   7.803  1.00 0.00 ? 20 ALA A HB3  7  
ATOM 7181  N N    . ASP A 1 21 ? -3.128 5.755   8.531  1.00 0.00 ? 21 ASP A N    7  
ATOM 7182  C CA   . ASP A 1 21 ? -2.578 6.880   7.784  1.00 0.00 ? 21 ASP A CA   7  
ATOM 7183  C C    . ASP A 1 21 ? -1.271 7.360   8.409  1.00 0.00 ? 21 ASP A C    7  
ATOM 7184  O O    . ASP A 1 21 ? -0.328 7.720   7.703  1.00 0.00 ? 21 ASP A O    7  
ATOM 7185  C CB   . ASP A 1 21 ? -3.586 8.030   7.736  1.00 0.00 ? 21 ASP A CB   7  
ATOM 7186  C CG   . ASP A 1 21 ? -4.809 7.693   6.906  1.00 0.00 ? 21 ASP A CG   7  
ATOM 7187  O OD1  . ASP A 1 21 ? -4.719 6.777   6.061  1.00 0.00 ? 21 ASP A OD1  7  
ATOM 7188  O OD2  . ASP A 1 21 ? -5.856 8.343   7.103  1.00 0.00 ? 21 ASP A OD2  7  
ATOM 7189  H H    . ASP A 1 21 ? -4.052 5.803   8.856  1.00 0.00 ? 21 ASP A H    7  
ATOM 7190  H HA   . ASP A 1 21 ? -2.379 6.545   6.778  1.00 0.00 ? 21 ASP A HA   7  
ATOM 7191  H HB2  . ASP A 1 21 ? -3.908 8.261   8.741  1.00 0.00 ? 21 ASP A HB2  7  
ATOM 7192  H HB3  . ASP A 1 21 ? -3.110 8.899   7.306  1.00 0.00 ? 21 ASP A HB3  7  
ATOM 7193  N N    . LYS A 1 22 ? -1.222 7.362   9.737  1.00 0.00 ? 22 LYS A N    7  
ATOM 7194  C CA   . LYS A 1 22 ? -0.031 7.796   10.457 1.00 0.00 ? 22 LYS A CA   7  
ATOM 7195  C C    . LYS A 1 22 ? 1.119  6.816   10.250 1.00 0.00 ? 22 LYS A C    7  
ATOM 7196  O O    . LYS A 1 22 ? 2.289  7.187   10.344 1.00 0.00 ? 22 LYS A O    7  
ATOM 7197  C CB   . LYS A 1 22 ? -0.335 7.933   11.951 1.00 0.00 ? 22 LYS A CB   7  
ATOM 7198  C CG   . LYS A 1 22 ? -1.453 8.915   12.257 1.00 0.00 ? 22 LYS A CG   7  
ATOM 7199  C CD   . LYS A 1 22 ? -1.560 9.191   13.747 1.00 0.00 ? 22 LYS A CD   7  
ATOM 7200  C CE   . LYS A 1 22 ? -0.373 9.997   14.252 1.00 0.00 ? 22 LYS A CE   7  
ATOM 7201  N NZ   . LYS A 1 22 ? -0.534 10.388  15.680 1.00 0.00 ? 22 LYS A NZ   7  
ATOM 7202  H H    . LYS A 1 22 ? -2.005 7.063   10.244 1.00 0.00 ? 22 LYS A H    7  
ATOM 7203  H HA   . LYS A 1 22 ? 0.259  8.761   10.069 1.00 0.00 ? 22 LYS A HA   7  
ATOM 7204  H HB2  . LYS A 1 22 ? -0.619 6.965   12.338 1.00 0.00 ? 22 LYS A HB2  7  
ATOM 7205  H HB3  . LYS A 1 22 ? 0.558  8.266   12.459 1.00 0.00 ? 22 LYS A HB3  7  
ATOM 7206  H HG2  . LYS A 1 22 ? -1.254 9.844   11.743 1.00 0.00 ? 22 LYS A HG2  7  
ATOM 7207  H HG3  . LYS A 1 22 ? -2.388 8.502   11.908 1.00 0.00 ? 22 LYS A HG3  7  
ATOM 7208  H HD2  . LYS A 1 22 ? -2.465 9.748   13.938 1.00 0.00 ? 22 LYS A HD2  7  
ATOM 7209  H HD3  . LYS A 1 22 ? -1.596 8.250   14.277 1.00 0.00 ? 22 LYS A HD3  7  
ATOM 7210  H HE2  . LYS A 1 22 ? 0.521  9.400   14.150 1.00 0.00 ? 22 LYS A HE2  7  
ATOM 7211  H HE3  . LYS A 1 22 ? -0.280 10.890  13.651 1.00 0.00 ? 22 LYS A HE3  7  
ATOM 7212  H HZ1  . LYS A 1 22 ? -0.483 11.422  15.775 1.00 0.00 ? 22 LYS A HZ1  7  
ATOM 7213  H HZ2  . LYS A 1 22 ? 0.220  9.961   16.254 1.00 0.00 ? 22 LYS A HZ2  7  
ATOM 7214  H HZ3  . LYS A 1 22 ? -1.454 10.062  16.038 1.00 0.00 ? 22 LYS A HZ3  7  
ATOM 7215  N N    . VAL A 1 23 ? 0.778  5.563   9.965  1.00 0.00 ? 23 VAL A N    7  
ATOM 7216  C CA   . VAL A 1 23 ? 1.782  4.530   9.741  1.00 0.00 ? 23 VAL A CA   7  
ATOM 7217  C C    . VAL A 1 23 ? 2.510  4.748   8.419  1.00 0.00 ? 23 VAL A C    7  
ATOM 7218  O O    . VAL A 1 23 ? 2.125  4.197   7.387  1.00 0.00 ? 23 VAL A O    7  
ATOM 7219  C CB   . VAL A 1 23 ? 1.152  3.125   9.742  1.00 0.00 ? 23 VAL A CB   7  
ATOM 7220  C CG1  . VAL A 1 23 ? 2.232  2.054   9.700  1.00 0.00 ? 23 VAL A CG1  7  
ATOM 7221  C CG2  . VAL A 1 23 ? 0.257  2.943   10.958 1.00 0.00 ? 23 VAL A CG2  7  
ATOM 7222  H H    . VAL A 1 23 ? -0.171 5.328   9.903  1.00 0.00 ? 23 VAL A H    7  
ATOM 7223  H HA   . VAL A 1 23 ? 2.499  4.580   10.548 1.00 0.00 ? 23 VAL A HA   7  
ATOM 7224  H HB   . VAL A 1 23 ? 0.543  3.025   8.855  1.00 0.00 ? 23 VAL A HB   7  
ATOM 7225  H HG11 . VAL A 1 23 ? 1.771  1.082   9.612  1.00 0.00 ? 23 VAL A HG11 7  
ATOM 7226  H HG12 . VAL A 1 23 ? 2.877  2.226   8.850  1.00 0.00 ? 23 VAL A HG12 7  
ATOM 7227  H HG13 . VAL A 1 23 ? 2.814  2.096   10.608 1.00 0.00 ? 23 VAL A HG13 7  
ATOM 7228  H HG21 . VAL A 1 23 ? 0.849  3.036   11.857 1.00 0.00 ? 23 VAL A HG21 7  
ATOM 7229  H HG22 . VAL A 1 23 ? -0.513 3.701   10.956 1.00 0.00 ? 23 VAL A HG22 7  
ATOM 7230  H HG23 . VAL A 1 23 ? -0.201 1.966   10.927 1.00 0.00 ? 23 VAL A HG23 7  
ATOM 7231  N N    . THR A 1 24 ? 3.565  5.555   8.456  1.00 0.00 ? 24 THR A N    7  
ATOM 7232  C CA   . THR A 1 24 ? 4.347  5.847   7.262  1.00 0.00 ? 24 THR A CA   7  
ATOM 7233  C C    . THR A 1 24 ? 5.755  5.272   7.372  1.00 0.00 ? 24 THR A C    7  
ATOM 7234  O O    . THR A 1 24 ? 6.201  4.905   8.458  1.00 0.00 ? 24 THR A O    7  
ATOM 7235  C CB   . THR A 1 24 ? 4.442  7.364   7.009  1.00 0.00 ? 24 THR A CB   7  
ATOM 7236  O OG1  . THR A 1 24 ? 5.305  7.969   7.980  1.00 0.00 ? 24 THR A OG1  7  
ATOM 7237  C CG2  . THR A 1 24 ? 3.067  8.011   7.073  1.00 0.00 ? 24 THR A CG2  7  
ATOM 7238  H H    . THR A 1 24 ? 3.823  5.964   9.309  1.00 0.00 ? 24 THR A H    7  
ATOM 7239  H HA   . THR A 1 24 ? 3.848  5.394   6.417  1.00 0.00 ? 24 THR A HA   7  
ATOM 7240  H HB   . THR A 1 24 ? 4.854  7.524   6.023  1.00 0.00 ? 24 THR A HB   7  
ATOM 7241  H HG1  . THR A 1 24 ? 4.800  8.180   8.769  1.00 0.00 ? 24 THR A HG1  7  
ATOM 7242  H HG21 . THR A 1 24 ? 2.867  8.333   8.084  1.00 0.00 ? 24 THR A HG21 7  
ATOM 7243  H HG22 . THR A 1 24 ? 2.318  7.295   6.768  1.00 0.00 ? 24 THR A HG22 7  
ATOM 7244  H HG23 . THR A 1 24 ? 3.040  8.864   6.412  1.00 0.00 ? 24 THR A HG23 7  
ATOM 7245  N N    . GLU A 1 25 ? 6.449  5.198   6.240  1.00 0.00 ? 25 GLU A N    7  
ATOM 7246  C CA   . GLU A 1 25 ? 7.806  4.667   6.211  1.00 0.00 ? 25 GLU A CA   7  
ATOM 7247  C C    . GLU A 1 25 ? 8.694  5.388   7.221  1.00 0.00 ? 25 GLU A C    7  
ATOM 7248  O O    . GLU A 1 25 ? 9.607  4.796   7.796  1.00 0.00 ? 25 GLU A O    7  
ATOM 7249  C CB   . GLU A 1 25 ? 8.400  4.801   4.807  1.00 0.00 ? 25 GLU A CB   7  
ATOM 7250  C CG   . GLU A 1 25 ? 7.741  3.896   3.779  1.00 0.00 ? 25 GLU A CG   7  
ATOM 7251  C CD   . GLU A 1 25 ? 6.483  4.504   3.189  1.00 0.00 ? 25 GLU A CD   7  
ATOM 7252  O OE1  . GLU A 1 25 ? 6.601  5.317   2.248  1.00 0.00 ? 25 GLU A OE1  7  
ATOM 7253  O OE2  . GLU A 1 25 ? 5.380  4.166   3.669  1.00 0.00 ? 25 GLU A OE2  7  
ATOM 7254  H H    . GLU A 1 25 ? 6.038  5.507   5.406  1.00 0.00 ? 25 GLU A H    7  
ATOM 7255  H HA   . GLU A 1 25 ? 7.759  3.621   6.474  1.00 0.00 ? 25 GLU A HA   7  
ATOM 7256  H HB2  . GLU A 1 25 ? 8.292  5.824   4.479  1.00 0.00 ? 25 GLU A HB2  7  
ATOM 7257  H HB3  . GLU A 1 25 ? 9.451  4.555   4.849  1.00 0.00 ? 25 GLU A HB3  7  
ATOM 7258  H HG2  . GLU A 1 25 ? 8.442  3.711   2.979  1.00 0.00 ? 25 GLU A HG2  7  
ATOM 7259  H HG3  . GLU A 1 25 ? 7.483  2.961   4.254  1.00 0.00 ? 25 GLU A HG3  7  
ATOM 7260  N N    . GLY A 1 26 ? 8.420  6.672   7.431  1.00 0.00 ? 26 GLY A N    7  
ATOM 7261  C CA   . GLY A 1 26 ? 9.202  7.454   8.371  1.00 0.00 ? 26 GLY A CA   7  
ATOM 7262  C C    . GLY A 1 26 ? 8.550  7.541   9.737  1.00 0.00 ? 26 GLY A C    7  
ATOM 7263  O O    . GLY A 1 26 ? 8.686  8.546   10.434 1.00 0.00 ? 26 GLY A O    7  
ATOM 7264  H H    . GLY A 1 26 ? 7.680  7.092   6.944  1.00 0.00 ? 26 GLY A H    7  
ATOM 7265  H HA2  . GLY A 1 26 ? 10.176 7.001   8.476  1.00 0.00 ? 26 GLY A HA2  7  
ATOM 7266  H HA3  . GLY A 1 26 ? 9.322  8.453   7.978  1.00 0.00 ? 26 GLY A HA3  7  
ATOM 7267  N N    . ALA A 1 27 ? 7.839  6.485   10.119 1.00 0.00 ? 27 ALA A N    7  
ATOM 7268  C CA   . ALA A 1 27 ? 7.164  6.446   11.411 1.00 0.00 ? 27 ALA A CA   7  
ATOM 7269  C C    . ALA A 1 27 ? 7.909  5.549   12.393 1.00 0.00 ? 27 ALA A C    7  
ATOM 7270  O O    . ALA A 1 27 ? 7.925  4.328   12.244 1.00 0.00 ? 27 ALA A O    7  
ATOM 7271  C CB   . ALA A 1 27 ? 5.729  5.970   11.242 1.00 0.00 ? 27 ALA A CB   7  
ATOM 7272  H H    . ALA A 1 27 ? 7.768  5.714   9.519  1.00 0.00 ? 27 ALA A H    7  
ATOM 7273  H HA   . ALA A 1 27 ? 7.139  7.452   11.805 1.00 0.00 ? 27 ALA A HA   7  
ATOM 7274  H HB1  . ALA A 1 27 ? 5.281  5.828   12.215 1.00 0.00 ? 27 ALA A HB1  7  
ATOM 7275  H HB2  . ALA A 1 27 ? 5.167  6.708   10.690 1.00 0.00 ? 27 ALA A HB2  7  
ATOM 7276  H HB3  . ALA A 1 27 ? 5.722  5.034   10.703 1.00 0.00 ? 27 ALA A HB3  7  
ATOM 7277  N N    . SER A 1 28 ? 8.527  6.164   13.397 1.00 0.00 ? 28 SER A N    7  
ATOM 7278  C CA   . SER A 1 28 ? 9.279  5.420   14.401 1.00 0.00 ? 28 SER A CA   7  
ATOM 7279  C C    . SER A 1 28 ? 8.387  5.047   15.581 1.00 0.00 ? 28 SER A C    7  
ATOM 7280  O O    . SER A 1 28 ? 7.883  5.916   16.293 1.00 0.00 ? 28 SER A O    7  
ATOM 7281  C CB   . SER A 1 28 ? 10.471 6.245   14.890 1.00 0.00 ? 28 SER A CB   7  
ATOM 7282  O OG   . SER A 1 28 ? 11.376 6.510   13.832 1.00 0.00 ? 28 SER A OG   7  
ATOM 7283  H H    . SER A 1 28 ? 8.478  7.141   13.462 1.00 0.00 ? 28 SER A H    7  
ATOM 7284  H HA   . SER A 1 28 ? 9.643  4.515   13.940 1.00 0.00 ? 28 SER A HA   7  
ATOM 7285  H HB2  . SER A 1 28 ? 10.118 7.183   15.289 1.00 0.00 ? 28 SER A HB2  7  
ATOM 7286  H HB3  . SER A 1 28 ? 10.991 5.698   15.663 1.00 0.00 ? 28 SER A HB3  7  
ATOM 7287  H HG   . SER A 1 28 ? 11.197 7.380   13.468 1.00 0.00 ? 28 SER A HG   7  
ATOM 7288  N N    . PHE A 1 29 ? 8.195  3.748   15.782 1.00 0.00 ? 29 PHE A N    7  
ATOM 7289  C CA   . PHE A 1 29 ? 7.363  3.257   16.875 1.00 0.00 ? 29 PHE A CA   7  
ATOM 7290  C C    . PHE A 1 29 ? 7.946  3.660   18.226 1.00 0.00 ? 29 PHE A C    7  
ATOM 7291  O O    . PHE A 1 29 ? 7.280  3.558   19.256 1.00 0.00 ? 29 PHE A O    7  
ATOM 7292  C CB   . PHE A 1 29 ? 7.228  1.735   16.798 1.00 0.00 ? 29 PHE A CB   7  
ATOM 7293  C CG   . PHE A 1 29 ? 6.906  1.230   15.420 1.00 0.00 ? 29 PHE A CG   7  
ATOM 7294  C CD1  . PHE A 1 29 ? 5.605  1.254   14.946 1.00 0.00 ? 29 PHE A CD1  7  
ATOM 7295  C CD2  . PHE A 1 29 ? 7.905  0.733   14.599 1.00 0.00 ? 29 PHE A CD2  7  
ATOM 7296  C CE1  . PHE A 1 29 ? 5.305  0.790   13.679 1.00 0.00 ? 29 PHE A CE1  7  
ATOM 7297  C CE2  . PHE A 1 29 ? 7.612  0.267   13.331 1.00 0.00 ? 29 PHE A CE2  7  
ATOM 7298  C CZ   . PHE A 1 29 ? 6.311  0.297   12.870 1.00 0.00 ? 29 PHE A CZ   7  
ATOM 7299  H H    . PHE A 1 29 ? 8.623  3.103   15.180 1.00 0.00 ? 29 PHE A H    7  
ATOM 7300  H HA   . PHE A 1 29 ? 6.385  3.702   16.771 1.00 0.00 ? 29 PHE A HA   7  
ATOM 7301  H HB2  . PHE A 1 29 ? 8.158  1.282   17.107 1.00 0.00 ? 29 PHE A HB2  7  
ATOM 7302  H HB3  . PHE A 1 29 ? 6.439  1.417   17.462 1.00 0.00 ? 29 PHE A HB3  7  
ATOM 7303  H HD1  . PHE A 1 29 ? 4.817  1.641   15.577 1.00 0.00 ? 29 PHE A HD1  7  
ATOM 7304  H HD2  . PHE A 1 29 ? 8.924  0.709   14.959 1.00 0.00 ? 29 PHE A HD2  7  
ATOM 7305  H HE1  . PHE A 1 29 ? 4.287  0.814   13.321 1.00 0.00 ? 29 PHE A HE1  7  
ATOM 7306  H HE2  . PHE A 1 29 ? 8.401  -0.118  12.702 1.00 0.00 ? 29 PHE A HE2  7  
ATOM 7307  H HZ   . PHE A 1 29 ? 6.079  -0.067  11.880 1.00 0.00 ? 29 PHE A HZ   7  
ATOM 7308  N N    . ILE A 1 30 ? 9.194  4.117   18.212 1.00 0.00 ? 30 ILE A N    7  
ATOM 7309  C CA   . ILE A 1 30 ? 9.867  4.535   19.435 1.00 0.00 ? 30 ILE A CA   7  
ATOM 7310  C C    . ILE A 1 30 ? 9.522  5.979   19.786 1.00 0.00 ? 30 ILE A C    7  
ATOM 7311  O O    . ILE A 1 30 ? 9.081  6.269   20.898 1.00 0.00 ? 30 ILE A O    7  
ATOM 7312  C CB   . ILE A 1 30 ? 11.396 4.401   19.311 1.00 0.00 ? 30 ILE A CB   7  
ATOM 7313  C CG1  . ILE A 1 30 ? 11.782 2.943   19.051 1.00 0.00 ? 30 ILE A CG1  7  
ATOM 7314  C CG2  . ILE A 1 30 ? 12.078 4.919   20.568 1.00 0.00 ? 30 ILE A CG2  7  
ATOM 7315  C CD1  . ILE A 1 30 ? 11.299 1.990   20.121 1.00 0.00 ? 30 ILE A CD1  7  
ATOM 7316  H H    . ILE A 1 30 ? 9.673  4.175   17.359 1.00 0.00 ? 30 ILE A H    7  
ATOM 7317  H HA   . ILE A 1 30 ? 9.533  3.891   20.236 1.00 0.00 ? 30 ILE A HA   7  
ATOM 7318  H HB   . ILE A 1 30 ? 11.722 5.006   18.478 1.00 0.00 ? 30 ILE A HB   7  
ATOM 7319  H HG12 . ILE A 1 30 ? 11.359 2.627   18.111 1.00 0.00 ? 30 ILE A HG12 7  
ATOM 7320  H HG13 . ILE A 1 30 ? 12.859 2.867   19.000 1.00 0.00 ? 30 ILE A HG13 7  
ATOM 7321  H HG21 . ILE A 1 30 ? 11.330 5.167   21.306 1.00 0.00 ? 30 ILE A HG21 7  
ATOM 7322  H HG22 . ILE A 1 30 ? 12.732 4.156   20.963 1.00 0.00 ? 30 ILE A HG22 7  
ATOM 7323  H HG23 . ILE A 1 30 ? 12.655 5.799   20.329 1.00 0.00 ? 30 ILE A HG23 7  
ATOM 7324  H HD11 . ILE A 1 30 ? 10.540 1.340   19.710 1.00 0.00 ? 30 ILE A HD11 7  
ATOM 7325  H HD12 . ILE A 1 30 ? 12.127 1.397   20.477 1.00 0.00 ? 30 ILE A HD12 7  
ATOM 7326  H HD13 . ILE A 1 30 ? 10.881 2.554   20.943 1.00 0.00 ? 30 ILE A HD13 7  
ATOM 7327  N N    . ASP A 1 31 ? 9.725  6.879   18.831 1.00 0.00 ? 31 ASP A N    7  
ATOM 7328  C CA   . ASP A 1 31 ? 9.433  8.292   19.037 1.00 0.00 ? 31 ASP A CA   7  
ATOM 7329  C C    . ASP A 1 31 ? 8.037  8.638   18.530 1.00 0.00 ? 31 ASP A C    7  
ATOM 7330  O O    . ASP A 1 31 ? 7.179  9.079   19.296 1.00 0.00 ? 31 ASP A O    7  
ATOM 7331  C CB   . ASP A 1 31 ? 10.476 9.159   18.330 1.00 0.00 ? 31 ASP A CB   7  
ATOM 7332  C CG   . ASP A 1 31 ? 10.338 10.629  18.676 1.00 0.00 ? 31 ASP A CG   7  
ATOM 7333  O OD1  . ASP A 1 31 ? 9.517  11.315  18.032 1.00 0.00 ? 31 ASP A OD1  7  
ATOM 7334  O OD2  . ASP A 1 31 ? 11.051 11.093  19.590 1.00 0.00 ? 31 ASP A OD2  7  
ATOM 7335  H H    . ASP A 1 31 ? 10.080 6.585   17.965 1.00 0.00 ? 31 ASP A H    7  
ATOM 7336  H HA   . ASP A 1 31 ? 9.476  8.488   20.098 1.00 0.00 ? 31 ASP A HA   7  
ATOM 7337  H HB2  . ASP A 1 31 ? 11.463 8.832   18.619 1.00 0.00 ? 31 ASP A HB2  7  
ATOM 7338  H HB3  . ASP A 1 31 ? 10.362 9.047   17.261 1.00 0.00 ? 31 ASP A HB3  7  
ATOM 7339  N N    . ASP A 1 32 ? 7.816  8.437   17.236 1.00 0.00 ? 32 ASP A N    7  
ATOM 7340  C CA   . ASP A 1 32 ? 6.524  8.727   16.626 1.00 0.00 ? 32 ASP A CA   7  
ATOM 7341  C C    . ASP A 1 32 ? 5.382  8.249   17.518 1.00 0.00 ? 32 ASP A C    7  
ATOM 7342  O O    . ASP A 1 32 ? 4.381  8.946   17.690 1.00 0.00 ? 32 ASP A O    7  
ATOM 7343  C CB   . ASP A 1 32 ? 6.424  8.065   15.251 1.00 0.00 ? 32 ASP A CB   7  
ATOM 7344  C CG   . ASP A 1 32 ? 5.442  8.772   14.338 1.00 0.00 ? 32 ASP A CG   7  
ATOM 7345  O OD1  . ASP A 1 32 ? 5.845  9.753   13.679 1.00 0.00 ? 32 ASP A OD1  7  
ATOM 7346  O OD2  . ASP A 1 32 ? 4.270  8.345   14.282 1.00 0.00 ? 32 ASP A OD2  7  
ATOM 7347  H H    . ASP A 1 32 ? 8.540  8.083   16.677 1.00 0.00 ? 32 ASP A H    7  
ATOM 7348  H HA   . ASP A 1 32 ? 6.446  9.797   16.507 1.00 0.00 ? 32 ASP A HA   7  
ATOM 7349  H HB2  . ASP A 1 32 ? 7.397  8.078   14.781 1.00 0.00 ? 32 ASP A HB2  7  
ATOM 7350  H HB3  . ASP A 1 32 ? 6.102  7.042   15.374 1.00 0.00 ? 32 ASP A HB3  7  
ATOM 7351  N N    . LEU A 1 33 ? 5.539  7.057   18.083 1.00 0.00 ? 33 LEU A N    7  
ATOM 7352  C CA   . LEU A 1 33 ? 4.521  6.484   18.957 1.00 0.00 ? 33 LEU A CA   7  
ATOM 7353  C C    . LEU A 1 33 ? 4.896  6.669   20.423 1.00 0.00 ? 33 LEU A C    7  
ATOM 7354  O O    . LEU A 1 33 ? 4.054  6.541   21.311 1.00 0.00 ? 33 LEU A O    7  
ATOM 7355  C CB   . LEU A 1 33 ? 4.334  4.998   18.649 1.00 0.00 ? 33 LEU A CB   7  
ATOM 7356  C CG   . LEU A 1 33 ? 3.914  4.656   17.219 1.00 0.00 ? 33 LEU A CG   7  
ATOM 7357  C CD1  . LEU A 1 33 ? 3.457  3.208   17.129 1.00 0.00 ? 33 LEU A CD1  7  
ATOM 7358  C CD2  . LEU A 1 33 ? 2.812  5.594   16.748 1.00 0.00 ? 33 LEU A CD2  7  
ATOM 7359  H H    . LEU A 1 33 ? 6.358  6.549   17.908 1.00 0.00 ? 33 LEU A H    7  
ATOM 7360  H HA   . LEU A 1 33 ? 3.592  7.002   18.767 1.00 0.00 ? 33 LEU A HA   7  
ATOM 7361  H HB2  . LEU A 1 33 ? 5.270  4.499   18.846 1.00 0.00 ? 33 LEU A HB2  7  
ATOM 7362  H HB3  . LEU A 1 33 ? 3.576  4.615   19.318 1.00 0.00 ? 33 LEU A HB3  7  
ATOM 7363  H HG   . LEU A 1 33 ? 4.763  4.779   16.562 1.00 0.00 ? 33 LEU A HG   7  
ATOM 7364  H HD11 . LEU A 1 33 ? 3.055  3.018   16.145 1.00 0.00 ? 33 LEU A HD11 7  
ATOM 7365  H HD12 . LEU A 1 33 ? 2.695  3.024   17.872 1.00 0.00 ? 33 LEU A HD12 7  
ATOM 7366  H HD13 . LEU A 1 33 ? 4.298  2.554   17.307 1.00 0.00 ? 33 LEU A HD13 7  
ATOM 7367  H HD21 . LEU A 1 33 ? 2.109  5.046   16.139 1.00 0.00 ? 33 LEU A HD21 7  
ATOM 7368  H HD22 . LEU A 1 33 ? 3.246  6.394   16.165 1.00 0.00 ? 33 LEU A HD22 7  
ATOM 7369  H HD23 . LEU A 1 33 ? 2.301  6.008   17.605 1.00 0.00 ? 33 LEU A HD23 7  
ATOM 7370  N N    . GLY A 1 34 ? 6.167  6.972   20.670 1.00 0.00 ? 34 GLY A N    7  
ATOM 7371  C CA   . GLY A 1 34 ? 6.631  7.171   22.031 1.00 0.00 ? 34 GLY A CA   7  
ATOM 7372  C C    . GLY A 1 34 ? 6.722  5.873   22.809 1.00 0.00 ? 34 GLY A C    7  
ATOM 7373  O O    . GLY A 1 34 ? 6.445  5.840   24.007 1.00 0.00 ? 34 GLY A O    7  
ATOM 7374  H H    . GLY A 1 34 ? 6.795  7.061   19.923 1.00 0.00 ? 34 GLY A H    7  
ATOM 7375  H HA2  . GLY A 1 34 ? 7.608  7.630   22.003 1.00 0.00 ? 34 GLY A HA2  7  
ATOM 7376  H HA3  . GLY A 1 34 ? 5.947  7.835   22.539 1.00 0.00 ? 34 GLY A HA3  7  
ATOM 7377  N N    . ALA A 1 35 ? 7.108  4.801   22.125 1.00 0.00 ? 35 ALA A N    7  
ATOM 7378  C CA   . ALA A 1 35 ? 7.234  3.495   22.760 1.00 0.00 ? 35 ALA A CA   7  
ATOM 7379  C C    . ALA A 1 35 ? 8.684  3.202   23.129 1.00 0.00 ? 35 ALA A C    7  
ATOM 7380  O O    . ALA A 1 35 ? 9.556  4.059   22.989 1.00 0.00 ? 35 ALA A O    7  
ATOM 7381  C CB   . ALA A 1 35 ? 6.691  2.408   21.843 1.00 0.00 ? 35 ALA A CB   7  
ATOM 7382  H H    . ALA A 1 35 ? 7.315  4.891   21.172 1.00 0.00 ? 35 ALA A H    7  
ATOM 7383  H HA   . ALA A 1 35 ? 6.638  3.503   23.661 1.00 0.00 ? 35 ALA A HA   7  
ATOM 7384  H HB1  . ALA A 1 35 ? 6.113  1.704   22.425 1.00 0.00 ? 35 ALA A HB1  7  
ATOM 7385  H HB2  . ALA A 1 35 ? 6.061  2.856   21.089 1.00 0.00 ? 35 ALA A HB2  7  
ATOM 7386  H HB3  . ALA A 1 35 ? 7.513  1.894   21.368 1.00 0.00 ? 35 ALA A HB3  7  
ATOM 7387  N N    . ASP A 1 36 ? 8.935  1.986   23.602 1.00 0.00 ? 36 ASP A N    7  
ATOM 7388  C CA   . ASP A 1 36 ? 10.280 1.579   23.992 1.00 0.00 ? 36 ASP A CA   7  
ATOM 7389  C C    . ASP A 1 36 ? 10.717 0.336   23.223 1.00 0.00 ? 36 ASP A C    7  
ATOM 7390  O O    . ASP A 1 36 ? 9.943  -0.233  22.453 1.00 0.00 ? 36 ASP A O    7  
ATOM 7391  C CB   . ASP A 1 36 ? 10.339 1.310   25.496 1.00 0.00 ? 36 ASP A CB   7  
ATOM 7392  C CG   . ASP A 1 36 ? 10.177 2.574   26.317 1.00 0.00 ? 36 ASP A CG   7  
ATOM 7393  O OD1  . ASP A 1 36 ? 11.078 3.437   26.262 1.00 0.00 ? 36 ASP A OD1  7  
ATOM 7394  O OD2  . ASP A 1 36 ? 9.149  2.701   27.016 1.00 0.00 ? 36 ASP A OD2  7  
ATOM 7395  H H    . ASP A 1 36 ? 8.198  1.346   23.690 1.00 0.00 ? 36 ASP A H    7  
ATOM 7396  H HA   . ASP A 1 36 ? 10.953 2.389   23.754 1.00 0.00 ? 36 ASP A HA   7  
ATOM 7397  H HB2  . ASP A 1 36 ? 9.547  0.625   25.764 1.00 0.00 ? 36 ASP A HB2  7  
ATOM 7398  H HB3  . ASP A 1 36 ? 11.292 0.865   25.739 1.00 0.00 ? 36 ASP A HB3  7  
ATOM 7399  N N    . SER A 1 37 ? 11.961 -0.079  23.436 1.00 0.00 ? 37 SER A N    7  
ATOM 7400  C CA   . SER A 1 37 ? 12.502 -1.252  22.759 1.00 0.00 ? 37 SER A CA   7  
ATOM 7401  C C    . SER A 1 37 ? 11.577 -2.452  22.929 1.00 0.00 ? 37 SER A C    7  
ATOM 7402  O O    . SER A 1 37 ? 11.421 -3.265  22.017 1.00 0.00 ? 37 SER A O    7  
ATOM 7403  C CB   . SER A 1 37 ? 13.893 -1.584  23.303 1.00 0.00 ? 37 SER A CB   7  
ATOM 7404  O OG   . SER A 1 37 ? 14.675 -2.253  22.329 1.00 0.00 ? 37 SER A OG   7  
ATOM 7405  H H    . SER A 1 37 ? 12.530 0.417   24.062 1.00 0.00 ? 37 SER A H    7  
ATOM 7406  H HA   . SER A 1 37 ? 12.583 -1.020  21.708 1.00 0.00 ? 37 SER A HA   7  
ATOM 7407  H HB2  . SER A 1 37 ? 14.394 -0.671  23.585 1.00 0.00 ? 37 SER A HB2  7  
ATOM 7408  H HB3  . SER A 1 37 ? 13.794 -2.223  24.169 1.00 0.00 ? 37 SER A HB3  7  
ATOM 7409  H HG   . SER A 1 37 ? 15.000 -3.081  22.692 1.00 0.00 ? 37 SER A HG   7  
ATOM 7410  N N    . LEU A 1 38 ? 10.964 -2.557  24.103 1.00 0.00 ? 38 LEU A N    7  
ATOM 7411  C CA   . LEU A 1 38 ? 10.053 -3.659  24.395 1.00 0.00 ? 38 LEU A CA   7  
ATOM 7412  C C    . LEU A 1 38 ? 8.981  -3.779  23.316 1.00 0.00 ? 38 LEU A C    7  
ATOM 7413  O O    . LEU A 1 38 ? 8.748  -4.860  22.776 1.00 0.00 ? 38 LEU A O    7  
ATOM 7414  C CB   . LEU A 1 38 ? 9.397  -3.455  25.762 1.00 0.00 ? 38 LEU A CB   7  
ATOM 7415  C CG   . LEU A 1 38 ? 10.349 -3.230  26.936 1.00 0.00 ? 38 LEU A CG   7  
ATOM 7416  C CD1  . LEU A 1 38 ? 9.570  -2.892  28.198 1.00 0.00 ? 38 LEU A CD1  7  
ATOM 7417  C CD2  . LEU A 1 38 ? 11.222 -4.456  27.159 1.00 0.00 ? 38 LEU A CD2  7  
ATOM 7418  H H    . LEU A 1 38 ? 11.128 -1.879  24.791 1.00 0.00 ? 38 LEU A H    7  
ATOM 7419  H HA   . LEU A 1 38 ? 10.631 -4.571  24.414 1.00 0.00 ? 38 LEU A HA   7  
ATOM 7420  H HB2  . LEU A 1 38 ? 8.748  -2.595  25.692 1.00 0.00 ? 38 LEU A HB2  7  
ATOM 7421  H HB3  . LEU A 1 38 ? 8.805  -4.334  25.978 1.00 0.00 ? 38 LEU A HB3  7  
ATOM 7422  H HG   . LEU A 1 38 ? 10.997 -2.393  26.711 1.00 0.00 ? 38 LEU A HG   7  
ATOM 7423  H HD11 . LEU A 1 38 ? 10.124 -2.173  28.782 1.00 0.00 ? 38 LEU A HD11 7  
ATOM 7424  H HD12 . LEU A 1 38 ? 9.421  -3.790  28.780 1.00 0.00 ? 38 LEU A HD12 7  
ATOM 7425  H HD13 . LEU A 1 38 ? 8.610  -2.475  27.928 1.00 0.00 ? 38 LEU A HD13 7  
ATOM 7426  H HD21 . LEU A 1 38 ? 10.620 -5.348  27.063 1.00 0.00 ? 38 LEU A HD21 7  
ATOM 7427  H HD22 . LEU A 1 38 ? 11.652 -4.417  28.149 1.00 0.00 ? 38 LEU A HD22 7  
ATOM 7428  H HD23 . LEU A 1 38 ? 12.011 -4.474  26.422 1.00 0.00 ? 38 LEU A HD23 7  
ATOM 7429  N N    . ASP A 1 39 ? 8.334  -2.661  23.006 1.00 0.00 ? 39 ASP A N    7  
ATOM 7430  C CA   . ASP A 1 39 ? 7.289  -2.640  21.989 1.00 0.00 ? 39 ASP A CA   7  
ATOM 7431  C C    . ASP A 1 39 ? 7.811  -3.181  20.662 1.00 0.00 ? 39 ASP A C    7  
ATOM 7432  O O    . ASP A 1 39 ? 7.205  -4.067  20.058 1.00 0.00 ? 39 ASP A O    7  
ATOM 7433  C CB   . ASP A 1 39 ? 6.759  -1.218  21.801 1.00 0.00 ? 39 ASP A CB   7  
ATOM 7434  C CG   . ASP A 1 39 ? 5.469  -0.975  22.560 1.00 0.00 ? 39 ASP A CG   7  
ATOM 7435  O OD1  . ASP A 1 39 ? 5.463  -1.163  23.795 1.00 0.00 ? 39 ASP A OD1  7  
ATOM 7436  O OD2  . ASP A 1 39 ? 4.465  -0.599  21.920 1.00 0.00 ? 39 ASP A OD2  7  
ATOM 7437  H H    . ASP A 1 39 ? 8.565  -1.830  23.472 1.00 0.00 ? 39 ASP A H    7  
ATOM 7438  H HA   . ASP A 1 39 ? 6.482  -3.273  22.329 1.00 0.00 ? 39 ASP A HA   7  
ATOM 7439  H HB2  . ASP A 1 39 ? 7.500  -0.515  22.154 1.00 0.00 ? 39 ASP A HB2  7  
ATOM 7440  H HB3  . ASP A 1 39 ? 6.576  -1.044  20.751 1.00 0.00 ? 39 ASP A HB3  7  
ATOM 7441  N N    . THR A 1 40 ? 8.940  -2.641  20.212 1.00 0.00 ? 40 THR A N    7  
ATOM 7442  C CA   . THR A 1 40 ? 9.542  -3.068  18.955 1.00 0.00 ? 40 THR A CA   7  
ATOM 7443  C C    . THR A 1 40 ? 9.736  -4.580  18.923 1.00 0.00 ? 40 THR A C    7  
ATOM 7444  O O    . THR A 1 40 ? 9.342  -5.246  17.966 1.00 0.00 ? 40 THR A O    7  
ATOM 7445  C CB   . THR A 1 40 ? 10.902 -2.382  18.723 1.00 0.00 ? 40 THR A CB   7  
ATOM 7446  O OG1  . THR A 1 40 ? 10.806 -0.987  19.031 1.00 0.00 ? 40 THR A OG1  7  
ATOM 7447  C CG2  . THR A 1 40 ? 11.359 -2.559  17.283 1.00 0.00 ? 40 THR A CG2  7  
ATOM 7448  H H    . THR A 1 40 ? 9.376  -1.939  20.738 1.00 0.00 ? 40 THR A H    7  
ATOM 7449  H HA   . THR A 1 40 ? 8.878  -2.783  18.153 1.00 0.00 ? 40 THR A HA   7  
ATOM 7450  H HB   . THR A 1 40 ? 11.634 -2.838  19.376 1.00 0.00 ? 40 THR A HB   7  
ATOM 7451  H HG1  . THR A 1 40 ? 11.660 -0.569  18.893 1.00 0.00 ? 40 THR A HG1  7  
ATOM 7452  H HG21 . THR A 1 40 ? 11.649 -3.587  17.121 1.00 0.00 ? 40 THR A HG21 7  
ATOM 7453  H HG22 . THR A 1 40 ? 12.202 -1.912  17.091 1.00 0.00 ? 40 THR A HG22 7  
ATOM 7454  H HG23 . THR A 1 40 ? 10.550 -2.304  16.616 1.00 0.00 ? 40 THR A HG23 7  
ATOM 7455  N N    . VAL A 1 41 ? 10.345 -5.116  19.976 1.00 0.00 ? 41 VAL A N    7  
ATOM 7456  C CA   . VAL A 1 41 ? 10.590 -6.550  20.070 1.00 0.00 ? 41 VAL A CA   7  
ATOM 7457  C C    . VAL A 1 41 ? 9.293  -7.339  19.929 1.00 0.00 ? 41 VAL A C    7  
ATOM 7458  O O    . VAL A 1 41 ? 9.199  -8.258  19.116 1.00 0.00 ? 41 VAL A O    7  
ATOM 7459  C CB   . VAL A 1 41 ? 11.260 -6.919  21.406 1.00 0.00 ? 41 VAL A CB   7  
ATOM 7460  C CG1  . VAL A 1 41 ? 11.477 -8.422  21.498 1.00 0.00 ? 41 VAL A CG1  7  
ATOM 7461  C CG2  . VAL A 1 41 ? 12.575 -6.172  21.567 1.00 0.00 ? 41 VAL A CG2  7  
ATOM 7462  H H    . VAL A 1 41 ? 10.636 -4.533  20.708 1.00 0.00 ? 41 VAL A H    7  
ATOM 7463  H HA   . VAL A 1 41 ? 11.258 -6.828  19.267 1.00 0.00 ? 41 VAL A HA   7  
ATOM 7464  H HB   . VAL A 1 41 ? 10.602 -6.623  22.210 1.00 0.00 ? 41 VAL A HB   7  
ATOM 7465  H HG11 . VAL A 1 41 ? 11.808 -8.797  20.540 1.00 0.00 ? 41 VAL A HG11 7  
ATOM 7466  H HG12 . VAL A 1 41 ? 12.226 -8.633  22.247 1.00 0.00 ? 41 VAL A HG12 7  
ATOM 7467  H HG13 . VAL A 1 41 ? 10.549 -8.903  21.771 1.00 0.00 ? 41 VAL A HG13 7  
ATOM 7468  H HG21 . VAL A 1 41 ? 12.457 -5.157  21.216 1.00 0.00 ? 41 VAL A HG21 7  
ATOM 7469  H HG22 . VAL A 1 41 ? 12.859 -6.162  22.609 1.00 0.00 ? 41 VAL A HG22 7  
ATOM 7470  H HG23 . VAL A 1 41 ? 13.343 -6.666  20.990 1.00 0.00 ? 41 VAL A HG23 7  
ATOM 7471  N N    . GLU A 1 42 ? 8.294  -6.972  20.726 1.00 0.00 ? 42 GLU A N    7  
ATOM 7472  C CA   . GLU A 1 42 ? 7.002  -7.647  20.691 1.00 0.00 ? 42 GLU A CA   7  
ATOM 7473  C C    . GLU A 1 42 ? 6.458  -7.704  19.266 1.00 0.00 ? 42 GLU A C    7  
ATOM 7474  O O    . GLU A 1 42 ? 6.094  -8.772  18.771 1.00 0.00 ? 42 GLU A O    7  
ATOM 7475  C CB   . GLU A 1 42 ? 6.003  -6.931  21.602 1.00 0.00 ? 42 GLU A CB   7  
ATOM 7476  C CG   . GLU A 1 42 ? 6.391  -6.958  23.070 1.00 0.00 ? 42 GLU A CG   7  
ATOM 7477  C CD   . GLU A 1 42 ? 5.943  -8.226  23.770 1.00 0.00 ? 42 GLU A CD   7  
ATOM 7478  O OE1  . GLU A 1 42 ? 6.538  -9.291  23.504 1.00 0.00 ? 42 GLU A OE1  7  
ATOM 7479  O OE2  . GLU A 1 42 ? 4.997  -8.154  24.581 1.00 0.00 ? 42 GLU A OE2  7  
ATOM 7480  H H    . GLU A 1 42 ? 8.430  -6.232  21.354 1.00 0.00 ? 42 GLU A H    7  
ATOM 7481  H HA   . GLU A 1 42 ? 7.144  -8.655  21.049 1.00 0.00 ? 42 GLU A HA   7  
ATOM 7482  H HB2  . GLU A 1 42 ? 5.923  -5.900  21.290 1.00 0.00 ? 42 GLU A HB2  7  
ATOM 7483  H HB3  . GLU A 1 42 ? 5.037  -7.404  21.498 1.00 0.00 ? 42 GLU A HB3  7  
ATOM 7484  H HG2  . GLU A 1 42 ? 7.465  -6.883  23.147 1.00 0.00 ? 42 GLU A HG2  7  
ATOM 7485  H HG3  . GLU A 1 42 ? 5.937  -6.112  23.565 1.00 0.00 ? 42 GLU A HG3  7  
ATOM 7486  N N    . LEU A 1 43 ? 6.404  -6.549  18.613 1.00 0.00 ? 43 LEU A N    7  
ATOM 7487  C CA   . LEU A 1 43 ? 5.903  -6.466  17.245 1.00 0.00 ? 43 LEU A CA   7  
ATOM 7488  C C    . LEU A 1 43 ? 6.654  -7.429  16.331 1.00 0.00 ? 43 LEU A C    7  
ATOM 7489  O O    . LEU A 1 43 ? 6.046  -8.221  15.612 1.00 0.00 ? 43 LEU A O    7  
ATOM 7490  C CB   . LEU A 1 43 ? 6.037  -5.036  16.718 1.00 0.00 ? 43 LEU A CB   7  
ATOM 7491  C CG   . LEU A 1 43 ? 4.851  -4.108  16.987 1.00 0.00 ? 43 LEU A CG   7  
ATOM 7492  C CD1  . LEU A 1 43 ? 5.264  -2.654  16.827 1.00 0.00 ? 43 LEU A CD1  7  
ATOM 7493  C CD2  . LEU A 1 43 ? 3.692  -4.441  16.059 1.00 0.00 ? 43 LEU A CD2  7  
ATOM 7494  H H    . LEU A 1 43 ? 6.707  -5.732  19.060 1.00 0.00 ? 43 LEU A H    7  
ATOM 7495  H HA   . LEU A 1 43 ? 4.859  -6.741  17.257 1.00 0.00 ? 43 LEU A HA   7  
ATOM 7496  H HB2  . LEU A 1 43 ? 6.910  -4.596  17.174 1.00 0.00 ? 43 LEU A HB2  7  
ATOM 7497  H HB3  . LEU A 1 43 ? 6.179  -5.090  15.648 1.00 0.00 ? 43 LEU A HB3  7  
ATOM 7498  H HG   . LEU A 1 43 ? 4.516  -4.249  18.006 1.00 0.00 ? 43 LEU A HG   7  
ATOM 7499  H HD11 . LEU A 1 43 ? 5.762  -2.320  17.724 1.00 0.00 ? 43 LEU A HD11 7  
ATOM 7500  H HD12 . LEU A 1 43 ? 4.387  -2.047  16.654 1.00 0.00 ? 43 LEU A HD12 7  
ATOM 7501  H HD13 . LEU A 1 43 ? 5.936  -2.561  15.986 1.00 0.00 ? 43 LEU A HD13 7  
ATOM 7502  H HD21 . LEU A 1 43 ? 3.256  -5.384  16.353 1.00 0.00 ? 43 LEU A HD21 7  
ATOM 7503  H HD22 . LEU A 1 43 ? 4.054  -4.513  15.043 1.00 0.00 ? 43 LEU A HD22 7  
ATOM 7504  H HD23 . LEU A 1 43 ? 2.946  -3.664  16.122 1.00 0.00 ? 43 LEU A HD23 7  
ATOM 7505  N N    . VAL A 1 44 ? 7.981  -7.356  16.366 1.00 0.00 ? 44 VAL A N    7  
ATOM 7506  C CA   . VAL A 1 44 ? 8.816  -8.223  15.543 1.00 0.00 ? 44 VAL A CA   7  
ATOM 7507  C C    . VAL A 1 44 ? 8.428  -9.687  15.719 1.00 0.00 ? 44 VAL A C    7  
ATOM 7508  O O    . VAL A 1 44 ? 8.219  -10.405 14.741 1.00 0.00 ? 44 VAL A O    7  
ATOM 7509  C CB   . VAL A 1 44 ? 10.308 -8.055  15.886 1.00 0.00 ? 44 VAL A CB   7  
ATOM 7510  C CG1  . VAL A 1 44 ? 11.159 -8.992  15.042 1.00 0.00 ? 44 VAL A CG1  7  
ATOM 7511  C CG2  . VAL A 1 44 ? 10.739 -6.609  15.692 1.00 0.00 ? 44 VAL A CG2  7  
ATOM 7512  H H    . VAL A 1 44 ? 8.409  -6.704  16.960 1.00 0.00 ? 44 VAL A H    7  
ATOM 7513  H HA   . VAL A 1 44 ? 8.672  -7.944  14.510 1.00 0.00 ? 44 VAL A HA   7  
ATOM 7514  H HB   . VAL A 1 44 ? 10.450 -8.314  16.925 1.00 0.00 ? 44 VAL A HB   7  
ATOM 7515  H HG11 . VAL A 1 44 ? 10.527 -9.523  14.345 1.00 0.00 ? 44 VAL A HG11 7  
ATOM 7516  H HG12 . VAL A 1 44 ? 11.894 -8.418  14.497 1.00 0.00 ? 44 VAL A HG12 7  
ATOM 7517  H HG13 . VAL A 1 44 ? 11.660 -9.701  15.684 1.00 0.00 ? 44 VAL A HG13 7  
ATOM 7518  H HG21 . VAL A 1 44 ? 9.865  -5.980  15.619 1.00 0.00 ? 44 VAL A HG21 7  
ATOM 7519  H HG22 . VAL A 1 44 ? 11.339 -6.295  16.534 1.00 0.00 ? 44 VAL A HG22 7  
ATOM 7520  H HG23 . VAL A 1 44 ? 11.321 -6.525  14.786 1.00 0.00 ? 44 VAL A HG23 7  
ATOM 7521  N N    . MET A 1 45 ? 8.333  -10.123 16.971 1.00 0.00 ? 45 MET A N    7  
ATOM 7522  C CA   . MET A 1 45 ? 7.967  -11.502 17.274 1.00 0.00 ? 45 MET A CA   7  
ATOM 7523  C C    . MET A 1 45 ? 6.623  -11.858 16.647 1.00 0.00 ? 45 MET A C    7  
ATOM 7524  O O    . MET A 1 45 ? 6.489  -12.890 15.990 1.00 0.00 ? 45 MET A O    7  
ATOM 7525  C CB   . MET A 1 45 ? 7.910  -11.715 18.788 1.00 0.00 ? 45 MET A CB   7  
ATOM 7526  C CG   . MET A 1 45 ? 9.278  -11.873 19.431 1.00 0.00 ? 45 MET A CG   7  
ATOM 7527  S SD   . MET A 1 45 ? 9.222  -12.832 20.957 1.00 0.00 ? 45 MET A SD   7  
ATOM 7528  C CE   . MET A 1 45 ? 9.179  -14.500 20.307 1.00 0.00 ? 45 MET A CE   7  
ATOM 7529  H H    . MET A 1 45 ? 8.512  -9.503  17.708 1.00 0.00 ? 45 MET A H    7  
ATOM 7530  H HA   . MET A 1 45 ? 8.728  -12.145 16.857 1.00 0.00 ? 45 MET A HA   7  
ATOM 7531  H HB2  . MET A 1 45 ? 7.418  -10.868 19.241 1.00 0.00 ? 45 MET A HB2  7  
ATOM 7532  H HB3  . MET A 1 45 ? 7.336  -12.607 18.992 1.00 0.00 ? 45 MET A HB3  7  
ATOM 7533  H HG2  . MET A 1 45 ? 9.935  -12.372 18.734 1.00 0.00 ? 45 MET A HG2  7  
ATOM 7534  H HG3  . MET A 1 45 ? 9.671  -10.891 19.653 1.00 0.00 ? 45 MET A HG3  7  
ATOM 7535  H HE1  . MET A 1 45 ? 8.358  -14.595 19.611 1.00 0.00 ? 45 MET A HE1  7  
ATOM 7536  H HE2  . MET A 1 45 ? 10.108 -14.712 19.799 1.00 0.00 ? 45 MET A HE2  7  
ATOM 7537  H HE3  . MET A 1 45 ? 9.044  -15.199 21.120 1.00 0.00 ? 45 MET A HE3  7  
ATOM 7538  N N    . ALA A 1 46 ? 5.631  -10.999 16.856 1.00 0.00 ? 46 ALA A N    7  
ATOM 7539  C CA   . ALA A 1 46 ? 4.299  -11.223 16.309 1.00 0.00 ? 46 ALA A CA   7  
ATOM 7540  C C    . ALA A 1 46 ? 4.355  -11.456 14.803 1.00 0.00 ? 46 ALA A C    7  
ATOM 7541  O O    . ALA A 1 46 ? 3.763  -12.405 14.289 1.00 0.00 ? 46 ALA A O    7  
ATOM 7542  C CB   . ALA A 1 46 ? 3.392  -10.044 16.630 1.00 0.00 ? 46 ALA A CB   7  
ATOM 7543  H H    . ALA A 1 46 ? 5.800  -10.194 17.388 1.00 0.00 ? 46 ALA A H    7  
ATOM 7544  H HA   . ALA A 1 46 ? 3.887  -12.102 16.784 1.00 0.00 ? 46 ALA A HA   7  
ATOM 7545  H HB1  . ALA A 1 46 ? 2.517  -10.397 17.158 1.00 0.00 ? 46 ALA A HB1  7  
ATOM 7546  H HB2  . ALA A 1 46 ? 3.925  -9.338  17.248 1.00 0.00 ? 46 ALA A HB2  7  
ATOM 7547  H HB3  . ALA A 1 46 ? 3.089  -9.563  15.712 1.00 0.00 ? 46 ALA A HB3  7  
ATOM 7548  N N    . PHE A 1 47 ? 5.068  -10.582 14.101 1.00 0.00 ? 47 PHE A N    7  
ATOM 7549  C CA   . PHE A 1 47 ? 5.200  -10.692 12.652 1.00 0.00 ? 47 PHE A CA   7  
ATOM 7550  C C    . PHE A 1 47 ? 5.872  -12.006 12.265 1.00 0.00 ? 47 PHE A C    7  
ATOM 7551  O O    . PHE A 1 47 ? 5.465  -12.664 11.309 1.00 0.00 ? 47 PHE A O    7  
ATOM 7552  C CB   . PHE A 1 47 ? 6.004  -9.513  12.101 1.00 0.00 ? 47 PHE A CB   7  
ATOM 7553  C CG   . PHE A 1 47 ? 5.272  -8.203  12.171 1.00 0.00 ? 47 PHE A CG   7  
ATOM 7554  C CD1  . PHE A 1 47 ? 4.086  -8.019  11.479 1.00 0.00 ? 47 PHE A CD1  7  
ATOM 7555  C CD2  . PHE A 1 47 ? 5.770  -7.155  12.930 1.00 0.00 ? 47 PHE A CD2  7  
ATOM 7556  C CE1  . PHE A 1 47 ? 3.411  -6.815  11.541 1.00 0.00 ? 47 PHE A CE1  7  
ATOM 7557  C CE2  . PHE A 1 47 ? 5.099  -5.949  12.996 1.00 0.00 ? 47 PHE A CE2  7  
ATOM 7558  C CZ   . PHE A 1 47 ? 3.917  -5.779  12.301 1.00 0.00 ? 47 PHE A CZ   7  
ATOM 7559  H H    . PHE A 1 47 ? 5.517  -9.846  14.567 1.00 0.00 ? 47 PHE A H    7  
ATOM 7560  H HA   . PHE A 1 47 ? 4.208  -10.670 12.228 1.00 0.00 ? 47 PHE A HA   7  
ATOM 7561  H HB2  . PHE A 1 47 ? 6.917  -9.412  12.669 1.00 0.00 ? 47 PHE A HB2  7  
ATOM 7562  H HB3  . PHE A 1 47 ? 6.247  -9.704  11.067 1.00 0.00 ? 47 PHE A HB3  7  
ATOM 7563  H HD1  . PHE A 1 47 ? 3.688  -8.829  10.885 1.00 0.00 ? 47 PHE A HD1  7  
ATOM 7564  H HD2  . PHE A 1 47 ? 6.695  -7.288  13.474 1.00 0.00 ? 47 PHE A HD2  7  
ATOM 7565  H HE1  . PHE A 1 47 ? 2.487  -6.685  10.998 1.00 0.00 ? 47 PHE A HE1  7  
ATOM 7566  H HE2  . PHE A 1 47 ? 5.498  -5.141  13.591 1.00 0.00 ? 47 PHE A HE2  7  
ATOM 7567  H HZ   . PHE A 1 47 ? 3.392  -4.837  12.351 1.00 0.00 ? 47 PHE A HZ   7  
ATOM 7568  N N    . GLU A 1 48 ? 6.904  -12.379 13.016 1.00 0.00 ? 48 GLU A N    7  
ATOM 7569  C CA   . GLU A 1 48 ? 7.634  -13.613 12.750 1.00 0.00 ? 48 GLU A CA   7  
ATOM 7570  C C    . GLU A 1 48 ? 6.716  -14.826 12.877 1.00 0.00 ? 48 GLU A C    7  
ATOM 7571  O O    . GLU A 1 48 ? 6.799  -15.765 12.086 1.00 0.00 ? 48 GLU A O    7  
ATOM 7572  C CB   . GLU A 1 48 ? 8.815  -13.751 13.713 1.00 0.00 ? 48 GLU A CB   7  
ATOM 7573  C CG   . GLU A 1 48 ? 9.930  -12.751 13.454 1.00 0.00 ? 48 GLU A CG   7  
ATOM 7574  C CD   . GLU A 1 48 ? 10.971 -12.740 14.557 1.00 0.00 ? 48 GLU A CD   7  
ATOM 7575  O OE1  . GLU A 1 48 ? 11.860 -13.617 14.541 1.00 0.00 ? 48 GLU A OE1  7  
ATOM 7576  O OE2  . GLU A 1 48 ? 10.896 -11.856 15.435 1.00 0.00 ? 48 GLU A OE2  7  
ATOM 7577  H H    . GLU A 1 48 ? 7.181  -11.812 13.765 1.00 0.00 ? 48 GLU A H    7  
ATOM 7578  H HA   . GLU A 1 48 ? 8.009  -13.566 11.739 1.00 0.00 ? 48 GLU A HA   7  
ATOM 7579  H HB2  . GLU A 1 48 ? 8.460  -13.610 14.723 1.00 0.00 ? 48 GLU A HB2  7  
ATOM 7580  H HB3  . GLU A 1 48 ? 9.225  -14.746 13.621 1.00 0.00 ? 48 GLU A HB3  7  
ATOM 7581  H HG2  . GLU A 1 48 ? 10.416 -13.005 12.524 1.00 0.00 ? 48 GLU A HG2  7  
ATOM 7582  H HG3  . GLU A 1 48 ? 9.500  -11.764 13.376 1.00 0.00 ? 48 GLU A HG3  7  
ATOM 7583  N N    . GLU A 1 49 ? 5.843  -14.798 13.879 1.00 0.00 ? 49 GLU A N    7  
ATOM 7584  C CA   . GLU A 1 49 ? 4.911  -15.895 14.111 1.00 0.00 ? 49 GLU A CA   7  
ATOM 7585  C C    . GLU A 1 49 ? 3.744  -15.834 13.129 1.00 0.00 ? 49 GLU A C    7  
ATOM 7586  O O    . GLU A 1 49 ? 3.127  -16.853 12.820 1.00 0.00 ? 49 GLU A O    7  
ATOM 7587  C CB   . GLU A 1 49 ? 4.386  -15.853 15.548 1.00 0.00 ? 49 GLU A CB   7  
ATOM 7588  C CG   . GLU A 1 49 ? 3.918  -17.203 16.064 1.00 0.00 ? 49 GLU A CG   7  
ATOM 7589  C CD   . GLU A 1 49 ? 5.029  -18.235 16.088 1.00 0.00 ? 49 GLU A CD   7  
ATOM 7590  O OE1  . GLU A 1 49 ? 5.806  -18.247 17.066 1.00 0.00 ? 49 GLU A OE1  7  
ATOM 7591  O OE2  . GLU A 1 49 ? 5.121  -19.031 15.130 1.00 0.00 ? 49 GLU A OE2  7  
ATOM 7592  H H    . GLU A 1 49 ? 5.825  -14.021 14.476 1.00 0.00 ? 49 GLU A H    7  
ATOM 7593  H HA   . GLU A 1 49 ? 5.445  -16.821 13.959 1.00 0.00 ? 49 GLU A HA   7  
ATOM 7594  H HB2  . GLU A 1 49 ? 5.173  -15.495 16.195 1.00 0.00 ? 49 GLU A HB2  7  
ATOM 7595  H HB3  . GLU A 1 49 ? 3.554  -15.166 15.594 1.00 0.00 ? 49 GLU A HB3  7  
ATOM 7596  H HG2  . GLU A 1 49 ? 3.542  -17.079 17.068 1.00 0.00 ? 49 GLU A HG2  7  
ATOM 7597  H HG3  . GLU A 1 49 ? 3.125  -17.564 15.426 1.00 0.00 ? 49 GLU A HG3  7  
ATOM 7598  N N    . GLU A 1 50 ? 3.448  -14.632 12.645 1.00 0.00 ? 50 GLU A N    7  
ATOM 7599  C CA   . GLU A 1 50 ? 2.354  -14.439 11.700 1.00 0.00 ? 50 GLU A CA   7  
ATOM 7600  C C    . GLU A 1 50 ? 2.756  -14.896 10.301 1.00 0.00 ? 50 GLU A C    7  
ATOM 7601  O O    . GLU A 1 50 ? 2.080  -15.722 9.688  1.00 0.00 ? 50 GLU A O    7  
ATOM 7602  C CB   . GLU A 1 50 ? 1.935  -12.967 11.666 1.00 0.00 ? 50 GLU A CB   7  
ATOM 7603  C CG   . GLU A 1 50 ? 0.778  -12.643 12.597 1.00 0.00 ? 50 GLU A CG   7  
ATOM 7604  C CD   . GLU A 1 50 ? 1.050  -13.054 14.031 1.00 0.00 ? 50 GLU A CD   7  
ATOM 7605  O OE1  . GLU A 1 50 ? 1.074  -14.273 14.303 1.00 0.00 ? 50 GLU A OE1  7  
ATOM 7606  O OE2  . GLU A 1 50 ? 1.238  -12.159 14.880 1.00 0.00 ? 50 GLU A OE2  7  
ATOM 7607  H H    . GLU A 1 50 ? 3.977  -13.858 12.930 1.00 0.00 ? 50 GLU A H    7  
ATOM 7608  H HA   . GLU A 1 50 ? 1.518  -15.034 12.034 1.00 0.00 ? 50 GLU A HA   7  
ATOM 7609  H HB2  . GLU A 1 50 ? 2.780  -12.358 11.949 1.00 0.00 ? 50 GLU A HB2  7  
ATOM 7610  H HB3  . GLU A 1 50 ? 1.640  -12.713 10.659 1.00 0.00 ? 50 GLU A HB3  7  
ATOM 7611  H HG2  . GLU A 1 50 ? 0.601  -11.578 12.572 1.00 0.00 ? 50 GLU A HG2  7  
ATOM 7612  H HG3  . GLU A 1 50 ? -0.103 -13.161 12.249 1.00 0.00 ? 50 GLU A HG3  7  
ATOM 7613  N N    . PHE A 1 51 ? 3.862  -14.354 9.802  1.00 0.00 ? 51 PHE A N    7  
ATOM 7614  C CA   . PHE A 1 51 ? 4.354  -14.705 8.475  1.00 0.00 ? 51 PHE A CA   7  
ATOM 7615  C C    . PHE A 1 51 ? 5.103  -16.033 8.507  1.00 0.00 ? 51 PHE A C    7  
ATOM 7616  O O    . PHE A 1 51 ? 5.208  -16.724 7.494  1.00 0.00 ? 51 PHE A O    7  
ATOM 7617  C CB   . PHE A 1 51 ? 5.271  -13.602 7.940  1.00 0.00 ? 51 PHE A CB   7  
ATOM 7618  C CG   . PHE A 1 51 ? 4.534  -12.363 7.517  1.00 0.00 ? 51 PHE A CG   7  
ATOM 7619  C CD1  . PHE A 1 51 ? 4.192  -11.394 8.446  1.00 0.00 ? 51 PHE A CD1  7  
ATOM 7620  C CD2  . PHE A 1 51 ? 4.185  -12.168 6.191  1.00 0.00 ? 51 PHE A CD2  7  
ATOM 7621  C CE1  . PHE A 1 51 ? 3.514  -10.253 8.059  1.00 0.00 ? 51 PHE A CE1  7  
ATOM 7622  C CE2  . PHE A 1 51 ? 3.507  -11.029 5.798  1.00 0.00 ? 51 PHE A CE2  7  
ATOM 7623  C CZ   . PHE A 1 51 ? 3.172  -10.070 6.733  1.00 0.00 ? 51 PHE A CZ   7  
ATOM 7624  H H    . PHE A 1 51 ? 4.358  -13.701 10.339 1.00 0.00 ? 51 PHE A H    7  
ATOM 7625  H HA   . PHE A 1 51 ? 3.502  -14.801 7.821  1.00 0.00 ? 51 PHE A HA   7  
ATOM 7626  H HB2  . PHE A 1 51 ? 5.973  -13.323 8.710  1.00 0.00 ? 51 PHE A HB2  7  
ATOM 7627  H HB3  . PHE A 1 51 ? 5.811  -13.977 7.084  1.00 0.00 ? 51 PHE A HB3  7  
ATOM 7628  H HD1  . PHE A 1 51 ? 4.460  -11.535 9.483  1.00 0.00 ? 51 PHE A HD1  7  
ATOM 7629  H HD2  . PHE A 1 51 ? 4.447  -12.918 5.457  1.00 0.00 ? 51 PHE A HD2  7  
ATOM 7630  H HE1  . PHE A 1 51 ? 3.253  -9.505  8.792  1.00 0.00 ? 51 PHE A HE1  7  
ATOM 7631  H HE2  . PHE A 1 51 ? 3.241  -10.890 4.760  1.00 0.00 ? 51 PHE A HE2  7  
ATOM 7632  H HZ   . PHE A 1 51 ? 2.642  -9.180  6.429  1.00 0.00 ? 51 PHE A HZ   7  
ATOM 7633  N N    . GLY A 1 52 ? 5.624  -16.385 9.679  1.00 0.00 ? 52 GLY A N    7  
ATOM 7634  C CA   . GLY A 1 52 ? 6.357  -17.629 9.822  1.00 0.00 ? 52 GLY A CA   7  
ATOM 7635  C C    . GLY A 1 52 ? 7.833  -17.471 9.512  1.00 0.00 ? 52 GLY A C    7  
ATOM 7636  O O    . GLY A 1 52 ? 8.519  -18.447 9.208  1.00 0.00 ? 52 GLY A O    7  
ATOM 7637  H H    . GLY A 1 52 ? 5.509  -15.795 10.453 1.00 0.00 ? 52 GLY A H    7  
ATOM 7638  H HA2  . GLY A 1 52 ? 6.249  -17.984 10.836 1.00 0.00 ? 52 GLY A HA2  7  
ATOM 7639  H HA3  . GLY A 1 52 ? 5.937  -18.361 9.148  1.00 0.00 ? 52 GLY A HA3  7  
ATOM 7640  N N    . VAL A 1 53 ? 8.323  -16.238 9.587  1.00 0.00 ? 53 VAL A N    7  
ATOM 7641  C CA   . VAL A 1 53 ? 9.726  -15.955 9.311  1.00 0.00 ? 53 VAL A CA   7  
ATOM 7642  C C    . VAL A 1 53 ? 10.554 -15.980 10.592 1.00 0.00 ? 53 VAL A C    7  
ATOM 7643  O O    . VAL A 1 53 ? 10.094 -15.546 11.647 1.00 0.00 ? 53 VAL A O    7  
ATOM 7644  C CB   . VAL A 1 53 ? 9.899  -14.585 8.628  1.00 0.00 ? 53 VAL A CB   7  
ATOM 7645  C CG1  . VAL A 1 53 ? 9.224  -14.578 7.266  1.00 0.00 ? 53 VAL A CG1  7  
ATOM 7646  C CG2  . VAL A 1 53 ? 9.347  -13.476 9.512  1.00 0.00 ? 53 VAL A CG2  7  
ATOM 7647  H H    . VAL A 1 53 ? 7.726  -15.500 9.834  1.00 0.00 ? 53 VAL A H    7  
ATOM 7648  H HA   . VAL A 1 53 ? 10.095 -16.717 8.641  1.00 0.00 ? 53 VAL A HA   7  
ATOM 7649  H HB   . VAL A 1 53 ? 10.955 -14.408 8.483  1.00 0.00 ? 53 VAL A HB   7  
ATOM 7650  H HG11 . VAL A 1 53 ? 9.564  -13.724 6.699  1.00 0.00 ? 53 VAL A HG11 7  
ATOM 7651  H HG12 . VAL A 1 53 ? 9.473  -15.486 6.736  1.00 0.00 ? 53 VAL A HG12 7  
ATOM 7652  H HG13 . VAL A 1 53 ? 8.153  -14.520 7.395  1.00 0.00 ? 53 VAL A HG13 7  
ATOM 7653  H HG21 . VAL A 1 53 ? 8.281  -13.604 9.624  1.00 0.00 ? 53 VAL A HG21 7  
ATOM 7654  H HG22 . VAL A 1 53 ? 9.819  -13.520 10.483 1.00 0.00 ? 53 VAL A HG22 7  
ATOM 7655  H HG23 . VAL A 1 53 ? 9.550  -12.518 9.057  1.00 0.00 ? 53 VAL A HG23 7  
ATOM 7656  N N    . GLU A 1 54 ? 11.777 -16.491 10.490 1.00 0.00 ? 54 GLU A N    7  
ATOM 7657  C CA   . GLU A 1 54 ? 12.668 -16.572 11.641 1.00 0.00 ? 54 GLU A CA   7  
ATOM 7658  C C    . GLU A 1 54 ? 13.864 -15.641 11.470 1.00 0.00 ? 54 GLU A C    7  
ATOM 7659  O O    . GLU A 1 54 ? 14.681 -15.821 10.566 1.00 0.00 ? 54 GLU A O    7  
ATOM 7660  C CB   . GLU A 1 54 ? 13.152 -18.010 11.838 1.00 0.00 ? 54 GLU A CB   7  
ATOM 7661  C CG   . GLU A 1 54 ? 13.607 -18.681 10.553 1.00 0.00 ? 54 GLU A CG   7  
ATOM 7662  C CD   . GLU A 1 54 ? 14.144 -20.080 10.784 1.00 0.00 ? 54 GLU A CD   7  
ATOM 7663  O OE1  . GLU A 1 54 ? 13.491 -20.852 11.517 1.00 0.00 ? 54 GLU A OE1  7  
ATOM 7664  O OE2  . GLU A 1 54 ? 15.216 -20.404 10.232 1.00 0.00 ? 54 GLU A OE2  7  
ATOM 7665  H H    . GLU A 1 54 ? 12.086 -16.820 9.621  1.00 0.00 ? 54 GLU A H    7  
ATOM 7666  H HA   . GLU A 1 54 ? 12.111 -16.267 12.514 1.00 0.00 ? 54 GLU A HA   7  
ATOM 7667  H HB2  . GLU A 1 54 ? 13.980 -18.007 12.532 1.00 0.00 ? 54 GLU A HB2  7  
ATOM 7668  H HB3  . GLU A 1 54 ? 12.346 -18.594 12.257 1.00 0.00 ? 54 GLU A HB3  7  
ATOM 7669  H HG2  . GLU A 1 54 ? 12.768 -18.741 9.876  1.00 0.00 ? 54 GLU A HG2  7  
ATOM 7670  H HG3  . GLU A 1 54 ? 14.387 -18.082 10.106 1.00 0.00 ? 54 GLU A HG3  7  
ATOM 7671  N N    . ILE A 1 55 ? 13.960 -14.644 12.344 1.00 0.00 ? 55 ILE A N    7  
ATOM 7672  C CA   . ILE A 1 55 ? 15.056 -13.685 12.290 1.00 0.00 ? 55 ILE A CA   7  
ATOM 7673  C C    . ILE A 1 55 ? 15.773 -13.593 13.633 1.00 0.00 ? 55 ILE A C    7  
ATOM 7674  O O    . ILE A 1 55 ? 15.212 -13.896 14.686 1.00 0.00 ? 55 ILE A O    7  
ATOM 7675  C CB   . ILE A 1 55 ? 14.558 -12.283 11.890 1.00 0.00 ? 55 ILE A CB   7  
ATOM 7676  C CG1  . ILE A 1 55 ? 13.291 -11.927 12.669 1.00 0.00 ? 55 ILE A CG1  7  
ATOM 7677  C CG2  . ILE A 1 55 ? 14.301 -12.220 10.392 1.00 0.00 ? 55 ILE A CG2  7  
ATOM 7678  C CD1  . ILE A 1 55 ? 12.900 -10.470 12.553 1.00 0.00 ? 55 ILE A CD1  7  
ATOM 7679  H H    . ILE A 1 55 ? 13.279 -14.553 13.042 1.00 0.00 ? 55 ILE A H    7  
ATOM 7680  H HA   . ILE A 1 55 ? 15.759 -14.023 11.542 1.00 0.00 ? 55 ILE A HA   7  
ATOM 7681  H HB   . ILE A 1 55 ? 15.332 -11.569 12.129 1.00 0.00 ? 55 ILE A HB   7  
ATOM 7682  H HG12 . ILE A 1 55 ? 12.470 -12.521 12.300 1.00 0.00 ? 55 ILE A HG12 7  
ATOM 7683  H HG13 . ILE A 1 55 ? 13.446 -12.147 13.716 1.00 0.00 ? 55 ILE A HG13 7  
ATOM 7684  H HG21 . ILE A 1 55 ? 13.844 -13.143 10.066 1.00 0.00 ? 55 ILE A HG21 7  
ATOM 7685  H HG22 . ILE A 1 55 ? 13.639 -11.395 10.175 1.00 0.00 ? 55 ILE A HG22 7  
ATOM 7686  H HG23 . ILE A 1 55 ? 15.236 -12.079 9.872  1.00 0.00 ? 55 ILE A HG23 7  
ATOM 7687  H HD11 . ILE A 1 55 ? 11.837 -10.395 12.375 1.00 0.00 ? 55 ILE A HD11 7  
ATOM 7688  H HD12 . ILE A 1 55 ? 13.149 -9.956  13.469 1.00 0.00 ? 55 ILE A HD12 7  
ATOM 7689  H HD13 . ILE A 1 55 ? 13.435 -10.019 11.730 1.00 0.00 ? 55 ILE A HD13 7  
ATOM 7690  N N    . PRO A 1 56 ? 17.043 -13.164 13.598 1.00 0.00 ? 56 PRO A N    7  
ATOM 7691  C CA   . PRO A 1 56 ? 17.864 -13.019 14.804 1.00 0.00 ? 56 PRO A CA   7  
ATOM 7692  C C    . PRO A 1 56 ? 17.396 -11.869 15.689 1.00 0.00 ? 56 PRO A C    7  
ATOM 7693  O O    . PRO A 1 56 ? 16.566 -11.057 15.281 1.00 0.00 ? 56 PRO A O    7  
ATOM 7694  C CB   . PRO A 1 56 ? 19.262 -12.734 14.250 1.00 0.00 ? 56 PRO A CB   7  
ATOM 7695  C CG   . PRO A 1 56 ? 19.022 -12.131 12.909 1.00 0.00 ? 56 PRO A CG   7  
ATOM 7696  C CD   . PRO A 1 56 ? 17.776 -12.785 12.378 1.00 0.00 ? 56 PRO A CD   7  
ATOM 7697  H HA   . PRO A 1 56 ? 17.883 -13.932 15.382 1.00 0.00 ? 56 PRO A HA   7  
ATOM 7698  H HB2  . PRO A 1 56 ? 19.778 -12.047 14.906 1.00 0.00 ? 56 PRO A HB2  7  
ATOM 7699  H HB3  . PRO A 1 56 ? 19.818 -13.656 14.174 1.00 0.00 ? 56 PRO A HB3  7  
ATOM 7700  H HG2  . PRO A 1 56 ? 18.874 -11.066 13.005 1.00 0.00 ? 56 PRO A HG2  7  
ATOM 7701  H HG3  . PRO A 1 56 ? 19.859 -12.338 12.258 1.00 0.00 ? 56 PRO A HG3  7  
ATOM 7702  H HD2  . PRO A 1 56 ? 17.205 -12.085 11.787 1.00 0.00 ? 56 PRO A HD2  7  
ATOM 7703  H HD3  . PRO A 1 56 ? 18.027 -13.658 11.794 1.00 0.00 ? 56 PRO A HD3  7  
ATOM 7704  N N    . ASP A 1 57 ? 17.935 -11.805 16.902 1.00 0.00 ? 57 ASP A N    7  
ATOM 7705  C CA   . ASP A 1 57 ? 17.574 -10.753 17.844 1.00 0.00 ? 57 ASP A CA   7  
ATOM 7706  C C    . ASP A 1 57 ? 18.080 -9.396  17.364 1.00 0.00 ? 57 ASP A C    7  
ATOM 7707  O O    . ASP A 1 57 ? 17.441 -8.369  17.590 1.00 0.00 ? 57 ASP A O    7  
ATOM 7708  C CB   . ASP A 1 57 ? 18.143 -11.062 19.230 1.00 0.00 ? 57 ASP A CB   7  
ATOM 7709  C CG   . ASP A 1 57 ? 17.713 -10.049 20.272 1.00 0.00 ? 57 ASP A CG   7  
ATOM 7710  O OD1  . ASP A 1 57 ? 18.243 -8.919  20.256 1.00 0.00 ? 57 ASP A OD1  7  
ATOM 7711  O OD2  . ASP A 1 57 ? 16.844 -10.386 21.104 1.00 0.00 ? 57 ASP A OD2  7  
ATOM 7712  H H    . ASP A 1 57 ? 18.592 -12.482 17.169 1.00 0.00 ? 57 ASP A H    7  
ATOM 7713  H HA   . ASP A 1 57 ? 16.497 -10.719 17.907 1.00 0.00 ? 57 ASP A HA   7  
ATOM 7714  H HB2  . ASP A 1 57 ? 17.802 -12.039 19.542 1.00 0.00 ? 57 ASP A HB2  7  
ATOM 7715  H HB3  . ASP A 1 57 ? 19.222 -11.062 19.177 1.00 0.00 ? 57 ASP A HB3  7  
ATOM 7716  N N    . ASP A 1 58 ? 19.232 -9.401  16.703 1.00 0.00 ? 58 ASP A N    7  
ATOM 7717  C CA   . ASP A 1 58 ? 19.825 -8.171  16.191 1.00 0.00 ? 58 ASP A CA   7  
ATOM 7718  C C    . ASP A 1 58 ? 18.841 -7.427  15.293 1.00 0.00 ? 58 ASP A C    7  
ATOM 7719  O O    . ASP A 1 58 ? 18.915 -6.206  15.153 1.00 0.00 ? 58 ASP A O    7  
ATOM 7720  C CB   . ASP A 1 58 ? 21.107 -8.481  15.417 1.00 0.00 ? 58 ASP A CB   7  
ATOM 7721  C CG   . ASP A 1 58 ? 22.236 -8.931  16.323 1.00 0.00 ? 58 ASP A CG   7  
ATOM 7722  O OD1  . ASP A 1 58 ? 22.650 -8.138  17.194 1.00 0.00 ? 58 ASP A OD1  7  
ATOM 7723  O OD2  . ASP A 1 58 ? 22.704 -10.078 16.162 1.00 0.00 ? 58 ASP A OD2  7  
ATOM 7724  H H    . ASP A 1 58 ? 19.695 -10.252 16.554 1.00 0.00 ? 58 ASP A H    7  
ATOM 7725  H HA   . ASP A 1 58 ? 20.068 -7.543  17.035 1.00 0.00 ? 58 ASP A HA   7  
ATOM 7726  H HB2  . ASP A 1 58 ? 20.908 -9.267  14.703 1.00 0.00 ? 58 ASP A HB2  7  
ATOM 7727  H HB3  . ASP A 1 58 ? 21.425 -7.593  14.889 1.00 0.00 ? 58 ASP A HB3  7  
ATOM 7728  N N    . ALA A 1 59 ? 17.923 -8.171  14.686 1.00 0.00 ? 59 ALA A N    7  
ATOM 7729  C CA   . ALA A 1 59 ? 16.924 -7.581  13.802 1.00 0.00 ? 59 ALA A CA   7  
ATOM 7730  C C    . ALA A 1 59 ? 16.145 -6.480  14.512 1.00 0.00 ? 59 ALA A C    7  
ATOM 7731  O O    . ALA A 1 59 ? 15.691 -5.524  13.884 1.00 0.00 ? 59 ALA A O    7  
ATOM 7732  C CB   . ALA A 1 59 ? 15.976 -8.654  13.288 1.00 0.00 ? 59 ALA A CB   7  
ATOM 7733  H H    . ALA A 1 59 ? 17.915 -9.138  14.837 1.00 0.00 ? 59 ALA A H    7  
ATOM 7734  H HA   . ALA A 1 59 ? 17.440 -7.154  12.954 1.00 0.00 ? 59 ALA A HA   7  
ATOM 7735  H HB1  . ALA A 1 59 ? 16.511 -9.319  12.626 1.00 0.00 ? 59 ALA A HB1  7  
ATOM 7736  H HB2  . ALA A 1 59 ? 15.581 -9.215  14.121 1.00 0.00 ? 59 ALA A HB2  7  
ATOM 7737  H HB3  . ALA A 1 59 ? 15.164 -8.188  12.750 1.00 0.00 ? 59 ALA A HB3  7  
ATOM 7738  N N    . ALA A 1 60 ? 15.992 -6.620  15.825 1.00 0.00 ? 60 ALA A N    7  
ATOM 7739  C CA   . ALA A 1 60 ? 15.269 -5.636  16.620 1.00 0.00 ? 60 ALA A CA   7  
ATOM 7740  C C    . ALA A 1 60 ? 16.056 -4.335  16.733 1.00 0.00 ? 60 ALA A C    7  
ATOM 7741  O O    . ALA A 1 60 ? 15.480 -3.266  16.932 1.00 0.00 ? 60 ALA A O    7  
ATOM 7742  C CB   . ALA A 1 60 ? 14.967 -6.194  18.003 1.00 0.00 ? 60 ALA A CB   7  
ATOM 7743  H H    . ALA A 1 60 ? 16.377 -7.404  16.269 1.00 0.00 ? 60 ALA A H    7  
ATOM 7744  H HA   . ALA A 1 60 ? 14.329 -5.435  16.127 1.00 0.00 ? 60 ALA A HA   7  
ATOM 7745  H HB1  . ALA A 1 60 ? 13.974 -5.890  18.304 1.00 0.00 ? 60 ALA A HB1  7  
ATOM 7746  H HB2  . ALA A 1 60 ? 15.021 -7.272  17.976 1.00 0.00 ? 60 ALA A HB2  7  
ATOM 7747  H HB3  . ALA A 1 60 ? 15.689 -5.814  18.710 1.00 0.00 ? 60 ALA A HB3  7  
ATOM 7748  N N    . GLU A 1 61 ? 17.376 -4.434  16.604 1.00 0.00 ? 61 GLU A N    7  
ATOM 7749  C CA   . GLU A 1 61 ? 18.241 -3.264  16.693 1.00 0.00 ? 61 GLU A CA   7  
ATOM 7750  C C    . GLU A 1 61 ? 18.393 -2.595  15.330 1.00 0.00 ? 61 GLU A C    7  
ATOM 7751  O O    . GLU A 1 61 ? 19.168 -1.650  15.172 1.00 0.00 ? 61 GLU A O    7  
ATOM 7752  C CB   . GLU A 1 61 ? 19.616 -3.660  17.235 1.00 0.00 ? 61 GLU A CB   7  
ATOM 7753  C CG   . GLU A 1 61 ? 19.559 -4.388  18.568 1.00 0.00 ? 61 GLU A CG   7  
ATOM 7754  C CD   . GLU A 1 61 ? 19.106 -3.491  19.704 1.00 0.00 ? 61 GLU A CD   7  
ATOM 7755  O OE1  . GLU A 1 61 ? 17.917 -3.112  19.723 1.00 0.00 ? 61 GLU A OE1  7  
ATOM 7756  O OE2  . GLU A 1 61 ? 19.943 -3.170  20.574 1.00 0.00 ? 61 GLU A OE2  7  
ATOM 7757  H H    . GLU A 1 61 ? 17.776 -5.315  16.446 1.00 0.00 ? 61 GLU A H    7  
ATOM 7758  H HA   . GLU A 1 61 ? 17.783 -2.564  17.375 1.00 0.00 ? 61 GLU A HA   7  
ATOM 7759  H HB2  . GLU A 1 61 ? 20.102 -4.303  16.517 1.00 0.00 ? 61 GLU A HB2  7  
ATOM 7760  H HB3  . GLU A 1 61 ? 20.210 -2.766  17.363 1.00 0.00 ? 61 GLU A HB3  7  
ATOM 7761  H HG2  . GLU A 1 61 ? 18.867 -5.212  18.483 1.00 0.00 ? 61 GLU A HG2  7  
ATOM 7762  H HG3  . GLU A 1 61 ? 20.543 -4.768  18.799 1.00 0.00 ? 61 GLU A HG3  7  
ATOM 7763  N N    . THR A 1 62 ? 17.648 -3.091  14.347 1.00 0.00 ? 62 THR A N    7  
ATOM 7764  C CA   . THR A 1 62 ? 17.700 -2.543  12.998 1.00 0.00 ? 62 THR A CA   7  
ATOM 7765  C C    . THR A 1 62 ? 16.355 -1.953  12.592 1.00 0.00 ? 62 THR A C    7  
ATOM 7766  O O    . THR A 1 62 ? 16.274 -1.152  11.659 1.00 0.00 ? 62 THR A O    7  
ATOM 7767  C CB   . THR A 1 62 ? 18.108 -3.617  11.971 1.00 0.00 ? 62 THR A CB   7  
ATOM 7768  O OG1  . THR A 1 62 ? 17.030 -4.537  11.771 1.00 0.00 ? 62 THR A OG1  7  
ATOM 7769  C CG2  . THR A 1 62 ? 19.345 -4.370  12.438 1.00 0.00 ? 62 THR A CG2  7  
ATOM 7770  H H    . THR A 1 62 ? 17.050 -3.844  14.536 1.00 0.00 ? 62 THR A H    7  
ATOM 7771  H HA   . THR A 1 62 ? 18.445 -1.760  12.984 1.00 0.00 ? 62 THR A HA   7  
ATOM 7772  H HB   . THR A 1 62 ? 18.334 -3.129  11.034 1.00 0.00 ? 62 THR A HB   7  
ATOM 7773  H HG1  . THR A 1 62 ? 16.460 -4.215  11.068 1.00 0.00 ? 62 THR A HG1  7  
ATOM 7774  H HG21 . THR A 1 62 ? 19.861 -4.779  11.582 1.00 0.00 ? 62 THR A HG21 7  
ATOM 7775  H HG22 . THR A 1 62 ? 19.050 -5.171  13.098 1.00 0.00 ? 62 THR A HG22 7  
ATOM 7776  H HG23 . THR A 1 62 ? 20.001 -3.693  12.964 1.00 0.00 ? 62 THR A HG23 7  
ATOM 7777  N N    . ILE A 1 63 ? 15.302 -2.352  13.297 1.00 0.00 ? 63 ILE A N    7  
ATOM 7778  C CA   . ILE A 1 63 ? 13.960 -1.860  13.010 1.00 0.00 ? 63 ILE A CA   7  
ATOM 7779  C C    . ILE A 1 63 ? 13.622 -0.650  13.874 1.00 0.00 ? 63 ILE A C    7  
ATOM 7780  O O    . ILE A 1 63 ? 13.324 -0.785  15.062 1.00 0.00 ? 63 ILE A O    7  
ATOM 7781  C CB   . ILE A 1 63 ? 12.899 -2.953  13.238 1.00 0.00 ? 63 ILE A CB   7  
ATOM 7782  C CG1  . ILE A 1 63 ? 13.190 -4.168  12.356 1.00 0.00 ? 63 ILE A CG1  7  
ATOM 7783  C CG2  . ILE A 1 63 ? 11.507 -2.407  12.955 1.00 0.00 ? 63 ILE A CG2  7  
ATOM 7784  C CD1  . ILE A 1 63 ? 12.340 -5.374  12.689 1.00 0.00 ? 63 ILE A CD1  7  
ATOM 7785  H H    . ILE A 1 63 ? 15.430 -2.991  14.028 1.00 0.00 ? 63 ILE A H    7  
ATOM 7786  H HA   . ILE A 1 63 ? 13.928 -1.566  11.970 1.00 0.00 ? 63 ILE A HA   7  
ATOM 7787  H HB   . ILE A 1 63 ? 12.939 -3.251  14.274 1.00 0.00 ? 63 ILE A HB   7  
ATOM 7788  H HG12 . ILE A 1 63 ? 13.007 -3.909  11.325 1.00 0.00 ? 63 ILE A HG12 7  
ATOM 7789  H HG13 . ILE A 1 63 ? 14.227 -4.449  12.473 1.00 0.00 ? 63 ILE A HG13 7  
ATOM 7790  H HG21 . ILE A 1 63 ? 10.791 -3.215  12.984 1.00 0.00 ? 63 ILE A HG21 7  
ATOM 7791  H HG22 . ILE A 1 63 ? 11.250 -1.673  13.704 1.00 0.00 ? 63 ILE A HG22 7  
ATOM 7792  H HG23 . ILE A 1 63 ? 11.492 -1.947  11.979 1.00 0.00 ? 63 ILE A HG23 7  
ATOM 7793  H HD11 . ILE A 1 63 ? 11.860 -5.736  11.792 1.00 0.00 ? 63 ILE A HD11 7  
ATOM 7794  H HD12 . ILE A 1 63 ? 12.964 -6.152  13.104 1.00 0.00 ? 63 ILE A HD12 7  
ATOM 7795  H HD13 . ILE A 1 63 ? 11.587 -5.095  13.412 1.00 0.00 ? 63 ILE A HD13 7  
ATOM 7796  N N    . LEU A 1 64 ? 13.667 0.533   13.271 1.00 0.00 ? 64 LEU A N    7  
ATOM 7797  C CA   . LEU A 1 64 ? 13.363 1.768   13.984 1.00 0.00 ? 64 LEU A CA   7  
ATOM 7798  C C    . LEU A 1 64 ? 12.048 2.368   13.498 1.00 0.00 ? 64 LEU A C    7  
ATOM 7799  O O    . LEU A 1 64 ? 11.229 2.827   14.295 1.00 0.00 ? 64 LEU A O    7  
ATOM 7800  C CB   . LEU A 1 64 ? 14.497 2.778   13.801 1.00 0.00 ? 64 LEU A CB   7  
ATOM 7801  C CG   . LEU A 1 64 ? 15.906 2.268   14.104 1.00 0.00 ? 64 LEU A CG   7  
ATOM 7802  C CD1  . LEU A 1 64 ? 16.950 3.220   13.542 1.00 0.00 ? 64 LEU A CD1  7  
ATOM 7803  C CD2  . LEU A 1 64 ? 16.097 2.088   15.603 1.00 0.00 ? 64 LEU A CD2  7  
ATOM 7804  H H    . LEU A 1 64 ? 13.910 0.577   12.323 1.00 0.00 ? 64 LEU A H    7  
ATOM 7805  H HA   . LEU A 1 64 ? 13.269 1.530   15.034 1.00 0.00 ? 64 LEU A HA   7  
ATOM 7806  H HB2  . LEU A 1 64 ? 14.479 3.112   12.775 1.00 0.00 ? 64 LEU A HB2  7  
ATOM 7807  H HB3  . LEU A 1 64 ? 14.300 3.617   14.454 1.00 0.00 ? 64 LEU A HB3  7  
ATOM 7808  H HG   . LEU A 1 64 ? 16.043 1.306   13.630 1.00 0.00 ? 64 LEU A HG   7  
ATOM 7809  H HD11 . LEU A 1 64 ? 17.077 4.053   14.216 1.00 0.00 ? 64 LEU A HD11 7  
ATOM 7810  H HD12 . LEU A 1 64 ? 16.626 3.582   12.578 1.00 0.00 ? 64 LEU A HD12 7  
ATOM 7811  H HD13 . LEU A 1 64 ? 17.890 2.699   13.433 1.00 0.00 ? 64 LEU A HD13 7  
ATOM 7812  H HD21 . LEU A 1 64 ? 15.213 2.429   16.122 1.00 0.00 ? 64 LEU A HD21 7  
ATOM 7813  H HD22 . LEU A 1 64 ? 16.950 2.664   15.929 1.00 0.00 ? 64 LEU A HD22 7  
ATOM 7814  H HD23 . LEU A 1 64 ? 16.263 1.043   15.822 1.00 0.00 ? 64 LEU A HD23 7  
ATOM 7815  N N    . THR A 1 65 ? 11.850 2.361   12.183 1.00 0.00 ? 65 THR A N    7  
ATOM 7816  C CA   . THR A 1 65 ? 10.634 2.903   11.590 1.00 0.00 ? 65 THR A CA   7  
ATOM 7817  C C    . THR A 1 65 ? 9.832  1.814   10.887 1.00 0.00 ? 65 THR A C    7  
ATOM 7818  O O    . THR A 1 65 ? 10.320 0.702   10.684 1.00 0.00 ? 65 THR A O    7  
ATOM 7819  C CB   . THR A 1 65 ? 10.953 4.023   10.581 1.00 0.00 ? 65 THR A CB   7  
ATOM 7820  O OG1  . THR A 1 65 ? 11.684 3.489   9.472  1.00 0.00 ? 65 THR A OG1  7  
ATOM 7821  C CG2  . THR A 1 65 ? 11.758 5.132   11.240 1.00 0.00 ? 65 THR A CG2  7  
ATOM 7822  H H    . THR A 1 65 ? 12.539 1.981   11.600 1.00 0.00 ? 65 THR A H    7  
ATOM 7823  H HA   . THR A 1 65 ? 10.034 3.323   12.384 1.00 0.00 ? 65 THR A HA   7  
ATOM 7824  H HB   . THR A 1 65 ? 10.022 4.438   10.222 1.00 0.00 ? 65 THR A HB   7  
ATOM 7825  H HG1  . THR A 1 65 ? 12.564 3.234   9.762  1.00 0.00 ? 65 THR A HG1  7  
ATOM 7826  H HG21 . THR A 1 65 ? 12.609 5.376   10.621 1.00 0.00 ? 65 THR A HG21 7  
ATOM 7827  H HG22 . THR A 1 65 ? 12.100 4.801   12.210 1.00 0.00 ? 65 THR A HG22 7  
ATOM 7828  H HG23 . THR A 1 65 ? 11.136 6.007   11.357 1.00 0.00 ? 65 THR A HG23 7  
ATOM 7829  N N    . VAL A 1 66 ? 8.598  2.140   10.517 1.00 0.00 ? 66 VAL A N    7  
ATOM 7830  C CA   . VAL A 1 66 ? 7.728  1.190   9.834  1.00 0.00 ? 66 VAL A CA   7  
ATOM 7831  C C    . VAL A 1 66 ? 8.426  0.575   8.626  1.00 0.00 ? 66 VAL A C    7  
ATOM 7832  O O    . VAL A 1 66 ? 8.407  -0.640  8.437  1.00 0.00 ? 66 VAL A O    7  
ATOM 7833  C CB   . VAL A 1 66 ? 6.420  1.858   9.372  1.00 0.00 ? 66 VAL A CB   7  
ATOM 7834  C CG1  . VAL A 1 66 ? 5.550  0.865   8.616  1.00 0.00 ? 66 VAL A CG1  7  
ATOM 7835  C CG2  . VAL A 1 66 ? 5.669  2.439   10.561 1.00 0.00 ? 66 VAL A CG2  7  
ATOM 7836  H H    . VAL A 1 66 ? 8.264  3.042   10.706 1.00 0.00 ? 66 VAL A H    7  
ATOM 7837  H HA   . VAL A 1 66 ? 7.479  0.404   10.532 1.00 0.00 ? 66 VAL A HA   7  
ATOM 7838  H HB   . VAL A 1 66 ? 6.670  2.667   8.700  1.00 0.00 ? 66 VAL A HB   7  
ATOM 7839  H HG11 . VAL A 1 66 ? 5.871  -0.141  8.845  1.00 0.00 ? 66 VAL A HG11 7  
ATOM 7840  H HG12 . VAL A 1 66 ? 4.519  0.991   8.911  1.00 0.00 ? 66 VAL A HG12 7  
ATOM 7841  H HG13 . VAL A 1 66 ? 5.645  1.038   7.554  1.00 0.00 ? 66 VAL A HG13 7  
ATOM 7842  H HG21 . VAL A 1 66 ? 6.377  2.840   11.271 1.00 0.00 ? 66 VAL A HG21 7  
ATOM 7843  H HG22 . VAL A 1 66 ? 5.014  3.229   10.222 1.00 0.00 ? 66 VAL A HG22 7  
ATOM 7844  H HG23 . VAL A 1 66 ? 5.085  1.664   11.032 1.00 0.00 ? 66 VAL A HG23 7  
ATOM 7845  N N    . GLY A 1 67 ? 9.044  1.425   7.811  1.00 0.00 ? 67 GLY A N    7  
ATOM 7846  C CA   . GLY A 1 67 ? 9.741  0.946   6.631  1.00 0.00 ? 67 GLY A CA   7  
ATOM 7847  C C    . GLY A 1 67 ? 10.728 -0.160  6.949  1.00 0.00 ? 67 GLY A C    7  
ATOM 7848  O O    . GLY A 1 67 ? 10.843 -1.132  6.202  1.00 0.00 ? 67 GLY A O    7  
ATOM 7849  H H    . GLY A 1 67 ? 9.027  2.384   8.012  1.00 0.00 ? 67 GLY A H    7  
ATOM 7850  H HA2  . GLY A 1 67 ? 9.015  0.575   5.924  1.00 0.00 ? 67 GLY A HA2  7  
ATOM 7851  H HA3  . GLY A 1 67 ? 10.276 1.772   6.184  1.00 0.00 ? 67 GLY A HA3  7  
ATOM 7852  N N    . ASP A 1 68 ? 11.443 -0.011  8.059  1.00 0.00 ? 68 ASP A N    7  
ATOM 7853  C CA   . ASP A 1 68 ? 12.426 -1.006  8.474  1.00 0.00 ? 68 ASP A CA   7  
ATOM 7854  C C    . ASP A 1 68 ? 11.755 -2.344  8.766  1.00 0.00 ? 68 ASP A C    7  
ATOM 7855  O O    . ASP A 1 68 ? 12.115 -3.369  8.188  1.00 0.00 ? 68 ASP A O    7  
ATOM 7856  C CB   . ASP A 1 68 ? 13.183 -0.520  9.711  1.00 0.00 ? 68 ASP A CB   7  
ATOM 7857  C CG   . ASP A 1 68 ? 13.902 0.793   9.471  1.00 0.00 ? 68 ASP A CG   7  
ATOM 7858  O OD1  . ASP A 1 68 ? 14.043 1.187   8.294  1.00 0.00 ? 68 ASP A OD1  7  
ATOM 7859  O OD2  . ASP A 1 68 ? 14.323 1.427   10.461 1.00 0.00 ? 68 ASP A OD2  7  
ATOM 7860  H H    . ASP A 1 68 ? 11.306 0.786   8.613  1.00 0.00 ? 68 ASP A H    7  
ATOM 7861  H HA   . ASP A 1 68 ? 13.126 -1.138  7.663  1.00 0.00 ? 68 ASP A HA   7  
ATOM 7862  H HB2  . ASP A 1 68 ? 12.483 -0.383  10.522 1.00 0.00 ? 68 ASP A HB2  7  
ATOM 7863  H HB3  . ASP A 1 68 ? 13.914 -1.264  9.992  1.00 0.00 ? 68 ASP A HB3  7  
ATOM 7864  N N    . ALA A 1 69 ? 10.777 -2.326  9.666  1.00 0.00 ? 69 ALA A N    7  
ATOM 7865  C CA   . ALA A 1 69 ? 10.055 -3.538  10.034 1.00 0.00 ? 69 ALA A CA   7  
ATOM 7866  C C    . ALA A 1 69 ? 9.428  -4.196  8.810  1.00 0.00 ? 69 ALA A C    7  
ATOM 7867  O O    . ALA A 1 69 ? 9.636  -5.382  8.555  1.00 0.00 ? 69 ALA A O    7  
ATOM 7868  C CB   . ALA A 1 69 ? 8.988  -3.222  11.071 1.00 0.00 ? 69 ALA A CB   7  
ATOM 7869  H H    . ALA A 1 69 ? 10.535 -1.478  10.092 1.00 0.00 ? 69 ALA A H    7  
ATOM 7870  H HA   . ALA A 1 69 ? 10.761 -4.226  10.477 1.00 0.00 ? 69 ALA A HA   7  
ATOM 7871  H HB1  . ALA A 1 69 ? 8.015  -3.470  10.673 1.00 0.00 ? 69 ALA A HB1  7  
ATOM 7872  H HB2  . ALA A 1 69 ? 9.171  -3.803  11.963 1.00 0.00 ? 69 ALA A HB2  7  
ATOM 7873  H HB3  . ALA A 1 69 ? 9.021  -2.170  11.313 1.00 0.00 ? 69 ALA A HB3  7  
ATOM 7874  N N    . VAL A 1 70 ? 8.657  -3.418  8.056  1.00 0.00 ? 70 VAL A N    7  
ATOM 7875  C CA   . VAL A 1 70 ? 7.999  -3.926  6.857  1.00 0.00 ? 70 VAL A CA   7  
ATOM 7876  C C    . VAL A 1 70 ? 9.011  -4.516  5.883  1.00 0.00 ? 70 VAL A C    7  
ATOM 7877  O O    . VAL A 1 70 ? 8.875  -5.659  5.445  1.00 0.00 ? 70 VAL A O    7  
ATOM 7878  C CB   . VAL A 1 70 ? 7.201  -2.818  6.144  1.00 0.00 ? 70 VAL A CB   7  
ATOM 7879  C CG1  . VAL A 1 70 ? 6.544  -3.361  4.884  1.00 0.00 ? 70 VAL A CG1  7  
ATOM 7880  C CG2  . VAL A 1 70 ? 6.163  -2.221  7.082  1.00 0.00 ? 70 VAL A CG2  7  
ATOM 7881  H H    . VAL A 1 70 ? 8.529  -2.481  8.310  1.00 0.00 ? 70 VAL A H    7  
ATOM 7882  H HA   . VAL A 1 70 ? 7.309  -4.701  7.158  1.00 0.00 ? 70 VAL A HA   7  
ATOM 7883  H HB   . VAL A 1 70 ? 7.888  -2.036  5.856  1.00 0.00 ? 70 VAL A HB   7  
ATOM 7884  H HG11 . VAL A 1 70 ? 7.303  -3.751  4.222  1.00 0.00 ? 70 VAL A HG11 7  
ATOM 7885  H HG12 . VAL A 1 70 ? 5.855  -4.150  5.148  1.00 0.00 ? 70 VAL A HG12 7  
ATOM 7886  H HG13 . VAL A 1 70 ? 6.008  -2.566  4.387  1.00 0.00 ? 70 VAL A HG13 7  
ATOM 7887  H HG21 . VAL A 1 70 ? 6.318  -2.605  8.079  1.00 0.00 ? 70 VAL A HG21 7  
ATOM 7888  H HG22 . VAL A 1 70 ? 6.262  -1.145  7.091  1.00 0.00 ? 70 VAL A HG22 7  
ATOM 7889  H HG23 . VAL A 1 70 ? 5.174  -2.489  6.742  1.00 0.00 ? 70 VAL A HG23 7  
ATOM 7890  N N    . LYS A 1 71 ? 10.028 -3.730  5.546  1.00 0.00 ? 71 LYS A N    7  
ATOM 7891  C CA   . LYS A 1 71 ? 11.067 -4.175  4.623  1.00 0.00 ? 71 LYS A CA   7  
ATOM 7892  C C    . LYS A 1 71 ? 11.717 -5.463  5.117  1.00 0.00 ? 71 LYS A C    7  
ATOM 7893  O O    . LYS A 1 71 ? 12.102 -6.320  4.321  1.00 0.00 ? 71 LYS A O    7  
ATOM 7894  C CB   . LYS A 1 71 ? 12.129 -3.086  4.456  1.00 0.00 ? 71 LYS A CB   7  
ATOM 7895  C CG   . LYS A 1 71 ? 11.695 -1.948  3.548  1.00 0.00 ? 71 LYS A CG   7  
ATOM 7896  C CD   . LYS A 1 71 ? 12.756 -0.862  3.470  1.00 0.00 ? 71 LYS A CD   7  
ATOM 7897  C CE   . LYS A 1 71 ? 13.935 -1.297  2.613  1.00 0.00 ? 71 LYS A CE   7  
ATOM 7898  N NZ   . LYS A 1 71 ? 14.949 -0.215  2.477  1.00 0.00 ? 71 LYS A NZ   7  
ATOM 7899  H H    . LYS A 1 71 ? 10.082 -2.829  5.928  1.00 0.00 ? 71 LYS A H    7  
ATOM 7900  H HA   . LYS A 1 71 ? 10.602 -4.363  3.667  1.00 0.00 ? 71 LYS A HA   7  
ATOM 7901  H HB2  . LYS A 1 71 ? 12.362 -2.675  5.427  1.00 0.00 ? 71 LYS A HB2  7  
ATOM 7902  H HB3  . LYS A 1 71 ? 13.021 -3.531  4.039  1.00 0.00 ? 71 LYS A HB3  7  
ATOM 7903  H HG2  . LYS A 1 71 ? 11.520 -2.337  2.557  1.00 0.00 ? 71 LYS A HG2  7  
ATOM 7904  H HG3  . LYS A 1 71 ? 10.782 -1.518  3.936  1.00 0.00 ? 71 LYS A HG3  7  
ATOM 7905  H HD2  . LYS A 1 71 ? 12.319 0.025   3.037  1.00 0.00 ? 71 LYS A HD2  7  
ATOM 7906  H HD3  . LYS A 1 71 ? 13.108 -0.642  4.468  1.00 0.00 ? 71 LYS A HD3  7  
ATOM 7907  H HE2  . LYS A 1 71 ? 14.399 -2.157  3.072  1.00 0.00 ? 71 LYS A HE2  7  
ATOM 7908  H HE3  . LYS A 1 71 ? 13.572 -1.564  1.632  1.00 0.00 ? 71 LYS A HE3  7  
ATOM 7909  H HZ1  . LYS A 1 71 ? 15.842 -0.606  2.112  1.00 0.00 ? 71 LYS A HZ1  7  
ATOM 7910  H HZ2  . LYS A 1 71 ? 15.129 0.225   3.401  1.00 0.00 ? 71 LYS A HZ2  7  
ATOM 7911  H HZ3  . LYS A 1 71 ? 14.608 0.514   1.818  1.00 0.00 ? 71 LYS A HZ3  7  
ATOM 7912  N N    . PHE A 1 72 ? 11.836 -5.594  6.434  1.00 0.00 ? 72 PHE A N    7  
ATOM 7913  C CA   . PHE A 1 72 ? 12.440 -6.779  7.033  1.00 0.00 ? 72 PHE A CA   7  
ATOM 7914  C C    . PHE A 1 72 ? 11.577 -8.013  6.787  1.00 0.00 ? 72 PHE A C    7  
ATOM 7915  O O    . PHE A 1 72 ? 12.053 -9.022  6.266  1.00 0.00 ? 72 PHE A O    7  
ATOM 7916  C CB   . PHE A 1 72 ? 12.637 -6.572  8.536  1.00 0.00 ? 72 PHE A CB   7  
ATOM 7917  C CG   . PHE A 1 72 ? 13.859 -7.254  9.080  1.00 0.00 ? 72 PHE A CG   7  
ATOM 7918  C CD1  . PHE A 1 72 ? 14.147 -8.565  8.737  1.00 0.00 ? 72 PHE A CD1  7  
ATOM 7919  C CD2  . PHE A 1 72 ? 14.721 -6.584  9.933  1.00 0.00 ? 72 PHE A CD2  7  
ATOM 7920  C CE1  . PHE A 1 72 ? 15.271 -9.196  9.237  1.00 0.00 ? 72 PHE A CE1  7  
ATOM 7921  C CE2  . PHE A 1 72 ? 15.847 -7.209  10.436 1.00 0.00 ? 72 PHE A CE2  7  
ATOM 7922  C CZ   . PHE A 1 72 ? 16.123 -8.517  10.086 1.00 0.00 ? 72 PHE A CZ   7  
ATOM 7923  H H    . PHE A 1 72 ? 11.510 -4.876  7.017  1.00 0.00 ? 72 PHE A H    7  
ATOM 7924  H HA   . PHE A 1 72 ? 13.403 -6.929  6.570  1.00 0.00 ? 72 PHE A HA   7  
ATOM 7925  H HB2  . PHE A 1 72 ? 12.730 -5.515  8.738  1.00 0.00 ? 72 PHE A HB2  7  
ATOM 7926  H HB3  . PHE A 1 72 ? 11.777 -6.960  9.061  1.00 0.00 ? 72 PHE A HB3  7  
ATOM 7927  H HD1  . PHE A 1 72 ? 13.483 -9.097  8.072  1.00 0.00 ? 72 PHE A HD1  7  
ATOM 7928  H HD2  . PHE A 1 72 ? 14.506 -5.561  10.207 1.00 0.00 ? 72 PHE A HD2  7  
ATOM 7929  H HE1  . PHE A 1 72 ? 15.485 -10.218 8.961  1.00 0.00 ? 72 PHE A HE1  7  
ATOM 7930  H HE2  . PHE A 1 72 ? 16.510 -6.675  11.100 1.00 0.00 ? 72 PHE A HE2  7  
ATOM 7931  H HZ   . PHE A 1 72 ? 17.001 -9.007  10.478 1.00 0.00 ? 72 PHE A HZ   7  
ATOM 7932  N N    . ILE A 1 73 ? 10.306 -7.923  7.165  1.00 0.00 ? 73 ILE A N    7  
ATOM 7933  C CA   . ILE A 1 73 ? 9.377  -9.032  6.985  1.00 0.00 ? 73 ILE A CA   7  
ATOM 7934  C C    . ILE A 1 73 ? 9.278  -9.434  5.518  1.00 0.00 ? 73 ILE A C    7  
ATOM 7935  O O    . ILE A 1 73 ? 9.165  -10.617 5.194  1.00 0.00 ? 73 ILE A O    7  
ATOM 7936  C CB   . ILE A 1 73 ? 7.971  -8.677  7.504  1.00 0.00 ? 73 ILE A CB   7  
ATOM 7937  C CG1  . ILE A 1 73 ? 8.029  -8.304  8.987  1.00 0.00 ? 73 ILE A CG1  7  
ATOM 7938  C CG2  . ILE A 1 73 ? 7.015  -9.840  7.282  1.00 0.00 ? 73 ILE A CG2  7  
ATOM 7939  C CD1  . ILE A 1 73 ? 6.827  -7.518  9.460  1.00 0.00 ? 73 ILE A CD1  7  
ATOM 7940  H H    . ILE A 1 73 ? 9.986  -7.093  7.574  1.00 0.00 ? 73 ILE A H    7  
ATOM 7941  H HA   . ILE A 1 73 ? 9.747  -9.873  7.554  1.00 0.00 ? 73 ILE A HA   7  
ATOM 7942  H HB   . ILE A 1 73 ? 7.607  -7.831  6.942  1.00 0.00 ? 73 ILE A HB   7  
ATOM 7943  H HG12 . ILE A 1 73 ? 8.088  -9.206  9.576  1.00 0.00 ? 73 ILE A HG12 7  
ATOM 7944  H HG13 . ILE A 1 73 ? 8.910  -7.705  9.165  1.00 0.00 ? 73 ILE A HG13 7  
ATOM 7945  H HG21 . ILE A 1 73 ? 6.213  -9.790  8.004  1.00 0.00 ? 73 ILE A HG21 7  
ATOM 7946  H HG22 . ILE A 1 73 ? 6.605  -9.782  6.285  1.00 0.00 ? 73 ILE A HG22 7  
ATOM 7947  H HG23 . ILE A 1 73 ? 7.548  -10.771 7.399  1.00 0.00 ? 73 ILE A HG23 7  
ATOM 7948  H HD11 . ILE A 1 73 ? 7.049  -7.057  10.411 1.00 0.00 ? 73 ILE A HD11 7  
ATOM 7949  H HD12 . ILE A 1 73 ? 6.588  -6.754  8.736  1.00 0.00 ? 73 ILE A HD12 7  
ATOM 7950  H HD13 . ILE A 1 73 ? 5.983  -8.184  9.572  1.00 0.00 ? 73 ILE A HD13 7  
ATOM 7951  N N    . ASP A 1 74 ? 9.325  -8.443  4.634  1.00 0.00 ? 74 ASP A N    7  
ATOM 7952  C CA   . ASP A 1 74 ? 9.244  -8.694  3.200  1.00 0.00 ? 74 ASP A CA   7  
ATOM 7953  C C    . ASP A 1 74 ? 10.527 -9.343  2.688  1.00 0.00 ? 74 ASP A C    7  
ATOM 7954  O O    . ASP A 1 74 ? 10.489 -10.240 1.846  1.00 0.00 ? 74 ASP A O    7  
ATOM 7955  C CB   . ASP A 1 74 ? 8.982  -7.389  2.446  1.00 0.00 ? 74 ASP A CB   7  
ATOM 7956  C CG   . ASP A 1 74 ? 9.164  -7.538  0.949  1.00 0.00 ? 74 ASP A CG   7  
ATOM 7957  O OD1  . ASP A 1 74 ? 8.216  -8.001  0.280  1.00 0.00 ? 74 ASP A OD1  7  
ATOM 7958  O OD2  . ASP A 1 74 ? 10.254 -7.194  0.445  1.00 0.00 ? 74 ASP A OD2  7  
ATOM 7959  H H    . ASP A 1 74 ? 9.417  -7.521  4.954  1.00 0.00 ? 74 ASP A H    7  
ATOM 7960  H HA   . ASP A 1 74 ? 8.420  -9.370  3.027  1.00 0.00 ? 74 ASP A HA   7  
ATOM 7961  H HB2  . ASP A 1 74 ? 7.969  -7.068  2.637  1.00 0.00 ? 74 ASP A HB2  7  
ATOM 7962  H HB3  . ASP A 1 74 ? 9.668  -6.633  2.801  1.00 0.00 ? 74 ASP A HB3  7  
ATOM 7963  N N    . LYS A 1 75 ? 11.662 -8.882  3.202  1.00 0.00 ? 75 LYS A N    7  
ATOM 7964  C CA   . LYS A 1 75 ? 12.957 -9.416  2.799  1.00 0.00 ? 75 LYS A CA   7  
ATOM 7965  C C    . LYS A 1 75 ? 13.139 -10.844 3.306  1.00 0.00 ? 75 LYS A C    7  
ATOM 7966  O O    . LYS A 1 75 ? 13.710 -11.689 2.617  1.00 0.00 ? 75 LYS A O    7  
ATOM 7967  C CB   . LYS A 1 75 ? 14.086 -8.528  3.328  1.00 0.00 ? 75 LYS A CB   7  
ATOM 7968  C CG   . LYS A 1 75 ? 14.482 -7.415  2.374  1.00 0.00 ? 75 LYS A CG   7  
ATOM 7969  C CD   . LYS A 1 75 ? 15.784 -6.755  2.796  1.00 0.00 ? 75 LYS A CD   7  
ATOM 7970  C CE   . LYS A 1 75 ? 16.551 -6.219  1.597  1.00 0.00 ? 75 LYS A CE   7  
ATOM 7971  N NZ   . LYS A 1 75 ? 15.771 -5.191  0.854  1.00 0.00 ? 75 LYS A NZ   7  
ATOM 7972  H H    . LYS A 1 75 ? 11.628 -8.165  3.871  1.00 0.00 ? 75 LYS A H    7  
ATOM 7973  H HA   . LYS A 1 75 ? 12.992 -9.423  1.720  1.00 0.00 ? 75 LYS A HA   7  
ATOM 7974  H HB2  . LYS A 1 75 ? 13.769 -8.081  4.259  1.00 0.00 ? 75 LYS A HB2  7  
ATOM 7975  H HB3  . LYS A 1 75 ? 14.955 -9.143  3.511  1.00 0.00 ? 75 LYS A HB3  7  
ATOM 7976  H HG2  . LYS A 1 75 ? 14.604 -7.828  1.384  1.00 0.00 ? 75 LYS A HG2  7  
ATOM 7977  H HG3  . LYS A 1 75 ? 13.699 -6.669  2.361  1.00 0.00 ? 75 LYS A HG3  7  
ATOM 7978  H HD2  . LYS A 1 75 ? 15.563 -5.936  3.464  1.00 0.00 ? 75 LYS A HD2  7  
ATOM 7979  H HD3  . LYS A 1 75 ? 16.397 -7.484  3.308  1.00 0.00 ? 75 LYS A HD3  7  
ATOM 7980  H HE2  . LYS A 1 75 ? 17.473 -5.778  1.944  1.00 0.00 ? 75 LYS A HE2  7  
ATOM 7981  H HE3  . LYS A 1 75 ? 16.773 -7.040  0.932  1.00 0.00 ? 75 LYS A HE3  7  
ATOM 7982  H HZ1  . LYS A 1 75 ? 14.792 -5.162  1.207  1.00 0.00 ? 75 LYS A HZ1  7  
ATOM 7983  H HZ2  . LYS A 1 75 ? 15.755 -5.418  -0.160 1.00 0.00 ? 75 LYS A HZ2  7  
ATOM 7984  H HZ3  . LYS A 1 75 ? 16.202 -4.253  0.982  1.00 0.00 ? 75 LYS A HZ3  7  
ATOM 7985  N N    . ALA A 1 76 ? 12.649 -11.105 4.513  1.00 0.00 ? 76 ALA A N    7  
ATOM 7986  C CA   . ALA A 1 76 ? 12.755 -12.430 5.110  1.00 0.00 ? 76 ALA A CA   7  
ATOM 7987  C C    . ALA A 1 76 ? 11.679 -13.364 4.567  1.00 0.00 ? 76 ALA A C    7  
ATOM 7988  O O    . ALA A 1 76 ? 11.846 -14.584 4.563  1.00 0.00 ? 76 ALA A O    7  
ATOM 7989  C CB   . ALA A 1 76 ? 12.658 -12.336 6.626  1.00 0.00 ? 76 ALA A CB   7  
ATOM 7990  H H    . ALA A 1 76 ? 12.205 -10.389 5.014  1.00 0.00 ? 76 ALA A H    7  
ATOM 7991  H HA   . ALA A 1 76 ? 13.726 -12.832 4.861  1.00 0.00 ? 76 ALA A HA   7  
ATOM 7992  H HB1  . ALA A 1 76 ? 12.949 -13.279 7.064  1.00 0.00 ? 76 ALA A HB1  7  
ATOM 7993  H HB2  . ALA A 1 76 ? 13.315 -11.556 6.980  1.00 0.00 ? 76 ALA A HB2  7  
ATOM 7994  H HB3  . ALA A 1 76 ? 11.641 -12.106 6.908  1.00 0.00 ? 76 ALA A HB3  7  
ATOM 7995  N N    . SER A 1 77 ? 10.574 -12.784 4.109  1.00 0.00 ? 77 SER A N    7  
ATOM 7996  C CA   . SER A 1 77 ? 9.468  -13.565 3.568  1.00 0.00 ? 77 SER A CA   7  
ATOM 7997  C C    . SER A 1 77 ? 9.901  -14.326 2.318  1.00 0.00 ? 77 SER A C    7  
ATOM 7998  O O    . SER A 1 77 ? 9.567  -15.497 2.144  1.00 0.00 ? 77 SER A O    7  
ATOM 7999  C CB   . SER A 1 77 ? 8.284  -12.653 3.239  1.00 0.00 ? 77 SER A CB   7  
ATOM 8000  O OG   . SER A 1 77 ? 7.367  -13.300 2.374  1.00 0.00 ? 77 SER A OG   7  
ATOM 8001  H H    . SER A 1 77 ? 10.500 -11.807 4.139  1.00 0.00 ? 77 SER A H    7  
ATOM 8002  H HA   . SER A 1 77 ? 9.165  -14.277 4.321  1.00 0.00 ? 77 SER A HA   7  
ATOM 8003  H HB2  . SER A 1 77 ? 7.774  -12.388 4.152  1.00 0.00 ? 77 SER A HB2  7  
ATOM 8004  H HB3  . SER A 1 77 ? 8.647  -11.758 2.755  1.00 0.00 ? 77 SER A HB3  7  
ATOM 8005  H HG   . SER A 1 77 ? 6.929  -14.012 2.846  1.00 0.00 ? 77 SER A HG   7  
ATOM 8006  N N    . ALA A 1 78 ? 10.648 -13.650 1.451  1.00 0.00 ? 78 ALA A N    7  
ATOM 8007  C CA   . ALA A 1 78 ? 11.129 -14.261 0.218  1.00 0.00 ? 78 ALA A CA   7  
ATOM 8008  C C    . ALA A 1 78 ? 12.600 -14.647 0.334  1.00 0.00 ? 78 ALA A C    7  
ATOM 8009  O O    . ALA A 1 78 ? 13.255 -14.943 -0.666 1.00 0.00 ? 78 ALA A O    7  
ATOM 8010  C CB   . ALA A 1 78 ? 10.921 -13.316 -0.956 1.00 0.00 ? 78 ALA A CB   7  
ATOM 8011  H H    . ALA A 1 78 ? 10.882 -12.719 1.646  1.00 0.00 ? 78 ALA A H    7  
ATOM 8012  H HA   . ALA A 1 78 ? 10.547 -15.153 0.038  1.00 0.00 ? 78 ALA A HA   7  
ATOM 8013  H HB1  . ALA A 1 78 ? 10.015 -12.747 -0.803 1.00 0.00 ? 78 ALA A HB1  7  
ATOM 8014  H HB2  . ALA A 1 78 ? 11.761 -12.642 -1.029 1.00 0.00 ? 78 ALA A HB2  7  
ATOM 8015  H HB3  . ALA A 1 78 ? 10.837 -13.888 -1.868 1.00 0.00 ? 78 ALA A HB3  7  
ATOM 8016  N N    . MET A 1 1  ? 0.600  0.099   -2.693 1.00 0.00 ? 1  MET A N    8  
ATOM 8017  C CA   . MET A 1 1  ? 0.948  -0.806  -3.782 1.00 0.00 ? 1  MET A CA   8  
ATOM 8018  C C    . MET A 1 1  ? 1.871  -1.917  -3.292 1.00 0.00 ? 1  MET A C    8  
ATOM 8019  O O    . MET A 1 1  ? 2.720  -2.406  -4.037 1.00 0.00 ? 1  MET A O    8  
ATOM 8020  C CB   . MET A 1 1  ? 1.619  -0.035  -4.921 1.00 0.00 ? 1  MET A CB   8  
ATOM 8021  C CG   . MET A 1 1  ? 0.674  0.895   -5.665 1.00 0.00 ? 1  MET A CG   8  
ATOM 8022  S SD   . MET A 1 1  ? -0.193 0.070   -7.013 1.00 0.00 ? 1  MET A SD   8  
ATOM 8023  C CE   . MET A 1 1  ? -1.754 0.947   -6.998 1.00 0.00 ? 1  MET A CE   8  
ATOM 8024  H H1   . MET A 1 1  ? 1.205  0.840   -2.477 1.00 0.00 ? 1  MET A H1   8  
ATOM 8025  H HA   . MET A 1 1  ? 0.034  -1.249  -4.149 1.00 0.00 ? 1  MET A HA   8  
ATOM 8026  H HB2  . MET A 1 1  ? 2.425  0.556   -4.513 1.00 0.00 ? 1  MET A HB2  8  
ATOM 8027  H HB3  . MET A 1 1  ? 2.025  -0.742  -5.629 1.00 0.00 ? 1  MET A HB3  8  
ATOM 8028  H HG2  . MET A 1 1  ? -0.056 1.278   -4.968 1.00 0.00 ? 1  MET A HG2  8  
ATOM 8029  H HG3  . MET A 1 1  ? 1.246  1.716   -6.071 1.00 0.00 ? 1  MET A HG3  8  
ATOM 8030  H HE1  . MET A 1 1  ? -1.657 1.845   -6.406 1.00 0.00 ? 1  MET A HE1  8  
ATOM 8031  H HE2  . MET A 1 1  ? -2.028 1.211   -8.009 1.00 0.00 ? 1  MET A HE2  8  
ATOM 8032  H HE3  . MET A 1 1  ? -2.519 0.315   -6.571 1.00 0.00 ? 1  MET A HE3  8  
ATOM 8033  N N    . SER A 1 2  ? 1.698  -2.312  -2.034 1.00 0.00 ? 2  SER A N    8  
ATOM 8034  C CA   . SER A 1 2  ? 2.518  -3.363  -1.444 1.00 0.00 ? 2  SER A CA   8  
ATOM 8035  C C    . SER A 1 2  ? 1.646  -4.437  -0.802 1.00 0.00 ? 2  SER A C    8  
ATOM 8036  O O    . SER A 1 2  ? 0.530  -4.163  -0.359 1.00 0.00 ? 2  SER A O    8  
ATOM 8037  C CB   . SER A 1 2  ? 3.469  -2.772  -0.401 1.00 0.00 ? 2  SER A CB   8  
ATOM 8038  O OG   . SER A 1 2  ? 4.622  -2.222  -1.015 1.00 0.00 ? 2  SER A OG   8  
ATOM 8039  H H    . SER A 1 2  ? 1.004  -1.884  -1.491 1.00 0.00 ? 2  SER A H    8  
ATOM 8040  H HA   . SER A 1 2  ? 3.100  -3.813  -2.234 1.00 0.00 ? 2  SER A HA   8  
ATOM 8041  H HB2  . SER A 1 2  ? 2.960  -1.991  0.144  1.00 0.00 ? 2  SER A HB2  8  
ATOM 8042  H HB3  . SER A 1 2  ? 3.776  -3.549  0.284  1.00 0.00 ? 2  SER A HB3  8  
ATOM 8043  H HG   . SER A 1 2  ? 5.274  -2.012  -0.343 1.00 0.00 ? 2  SER A HG   8  
ATOM 8044  N N    . ASP A 1 3  ? 2.162  -5.660  -0.755 1.00 0.00 ? 3  ASP A N    8  
ATOM 8045  C CA   . ASP A 1 3  ? 1.432  -6.777  -0.167 1.00 0.00 ? 3  ASP A CA   8  
ATOM 8046  C C    . ASP A 1 3  ? 1.819  -6.969  1.296  1.00 0.00 ? 3  ASP A C    8  
ATOM 8047  O O    . ASP A 1 3  ? 0.960  -7.156  2.159  1.00 0.00 ? 3  ASP A O    8  
ATOM 8048  C CB   . ASP A 1 3  ? 1.703  -8.061  -0.952 1.00 0.00 ? 3  ASP A CB   8  
ATOM 8049  C CG   . ASP A 1 3  ? 1.519  -7.876  -2.445 1.00 0.00 ? 3  ASP A CG   8  
ATOM 8050  O OD1  . ASP A 1 3  ? 2.449  -7.357  -3.098 1.00 0.00 ? 3  ASP A OD1  8  
ATOM 8051  O OD2  . ASP A 1 3  ? 0.446  -8.252  -2.962 1.00 0.00 ? 3  ASP A OD2  8  
ATOM 8052  H H    . ASP A 1 3  ? 3.057  -5.816  -1.125 1.00 0.00 ? 3  ASP A H    8  
ATOM 8053  H HA   . ASP A 1 3  ? 0.378  -6.549  -0.220 1.00 0.00 ? 3  ASP A HA   8  
ATOM 8054  H HB2  . ASP A 1 3  ? 2.719  -8.380  -0.770 1.00 0.00 ? 3  ASP A HB2  8  
ATOM 8055  H HB3  . ASP A 1 3  ? 1.023  -8.831  -0.616 1.00 0.00 ? 3  ASP A HB3  8  
ATOM 8056  N N    . THR A 1 4  ? 3.120  -6.923  1.570  1.00 0.00 ? 4  THR A N    8  
ATOM 8057  C CA   . THR A 1 4  ? 3.621  -7.094  2.928  1.00 0.00 ? 4  THR A CA   8  
ATOM 8058  C C    . THR A 1 4  ? 3.305  -5.876  3.788  1.00 0.00 ? 4  THR A C    8  
ATOM 8059  O O    . THR A 1 4  ? 2.862  -6.008  4.928  1.00 0.00 ? 4  THR A O    8  
ATOM 8060  C CB   . THR A 1 4  ? 5.143  -7.335  2.938  1.00 0.00 ? 4  THR A CB   8  
ATOM 8061  O OG1  . THR A 1 4  ? 5.467  -8.452  2.104  1.00 0.00 ? 4  THR A OG1  8  
ATOM 8062  C CG2  . THR A 1 4  ? 5.641  -7.590  4.353  1.00 0.00 ? 4  THR A CG2  8  
ATOM 8063  H H    . THR A 1 4  ? 3.755  -6.771  0.840  1.00 0.00 ? 4  THR A H    8  
ATOM 8064  H HA   . THR A 1 4  ? 3.138  -7.960  3.355  1.00 0.00 ? 4  THR A HA   8  
ATOM 8065  H HB   . THR A 1 4  ? 5.634  -6.453  2.553  1.00 0.00 ? 4  THR A HB   8  
ATOM 8066  H HG1  . THR A 1 4  ? 5.896  -8.140  1.303  1.00 0.00 ? 4  THR A HG1  8  
ATOM 8067  H HG21 . THR A 1 4  ? 6.716  -7.692  4.343  1.00 0.00 ? 4  THR A HG21 8  
ATOM 8068  H HG22 . THR A 1 4  ? 5.196  -8.497  4.733  1.00 0.00 ? 4  THR A HG22 8  
ATOM 8069  H HG23 . THR A 1 4  ? 5.364  -6.760  4.986  1.00 0.00 ? 4  THR A HG23 8  
ATOM 8070  N N    . ALA A 1 5  ? 3.536  -4.690  3.234  1.00 0.00 ? 5  ALA A N    8  
ATOM 8071  C CA   . ALA A 1 5  ? 3.273  -3.448  3.951  1.00 0.00 ? 5  ALA A CA   8  
ATOM 8072  C C    . ALA A 1 5  ? 1.856  -3.428  4.513  1.00 0.00 ? 5  ALA A C    8  
ATOM 8073  O O    . ALA A 1 5  ? 1.651  -3.146  5.693  1.00 0.00 ? 5  ALA A O    8  
ATOM 8074  C CB   . ALA A 1 5  ? 3.496  -2.253  3.036  1.00 0.00 ? 5  ALA A CB   8  
ATOM 8075  H H    . ALA A 1 5  ? 3.890  -4.649  2.322  1.00 0.00 ? 5  ALA A H    8  
ATOM 8076  H HA   . ALA A 1 5  ? 3.975  -3.380  4.769  1.00 0.00 ? 5  ALA A HA   8  
ATOM 8077  H HB1  . ALA A 1 5  ? 2.929  -2.387  2.126  1.00 0.00 ? 5  ALA A HB1  8  
ATOM 8078  H HB2  . ALA A 1 5  ? 3.171  -1.352  3.534  1.00 0.00 ? 5  ALA A HB2  8  
ATOM 8079  H HB3  . ALA A 1 5  ? 4.546  -2.174  2.797  1.00 0.00 ? 5  ALA A HB3  8  
ATOM 8080  N N    . GLU A 1 6  ? 0.881  -3.730  3.661  1.00 0.00 ? 6  GLU A N    8  
ATOM 8081  C CA   . GLU A 1 6  ? -0.517 -3.745  4.074  1.00 0.00 ? 6  GLU A CA   8  
ATOM 8082  C C    . GLU A 1 6  ? -0.708 -4.608  5.318  1.00 0.00 ? 6  GLU A C    8  
ATOM 8083  O O    . GLU A 1 6  ? -1.354 -4.195  6.280  1.00 0.00 ? 6  GLU A O    8  
ATOM 8084  C CB   . GLU A 1 6  ? -1.402 -4.264  2.939  1.00 0.00 ? 6  GLU A CB   8  
ATOM 8085  C CG   . GLU A 1 6  ? -1.630 -3.248  1.832  1.00 0.00 ? 6  GLU A CG   8  
ATOM 8086  C CD   . GLU A 1 6  ? -2.708 -2.240  2.178  1.00 0.00 ? 6  GLU A CD   8  
ATOM 8087  O OE1  . GLU A 1 6  ? -2.538 -1.510  3.177  1.00 0.00 ? 6  GLU A OE1  8  
ATOM 8088  O OE2  . GLU A 1 6  ? -3.722 -2.180  1.451  1.00 0.00 ? 6  GLU A OE2  8  
ATOM 8089  H H    . GLU A 1 6  ? 1.108  -3.946  2.732  1.00 0.00 ? 6  GLU A H    8  
ATOM 8090  H HA   . GLU A 1 6  ? -0.805 -2.731  4.307  1.00 0.00 ? 6  GLU A HA   8  
ATOM 8091  H HB2  . GLU A 1 6  ? -0.938 -5.138  2.508  1.00 0.00 ? 6  GLU A HB2  8  
ATOM 8092  H HB3  . GLU A 1 6  ? -2.363 -4.542  3.347  1.00 0.00 ? 6  GLU A HB3  8  
ATOM 8093  H HG2  . GLU A 1 6  ? -0.707 -2.718  1.652  1.00 0.00 ? 6  GLU A HG2  8  
ATOM 8094  H HG3  . GLU A 1 6  ? -1.923 -3.773  0.934  1.00 0.00 ? 6  GLU A HG3  8  
ATOM 8095  N N    . ARG A 1 7  ? -0.141 -5.810  5.289  1.00 0.00 ? 7  ARG A N    8  
ATOM 8096  C CA   . ARG A 1 7  ? -0.249 -6.733  6.412  1.00 0.00 ? 7  ARG A CA   8  
ATOM 8097  C C    . ARG A 1 7  ? 0.336  -6.117  7.680  1.00 0.00 ? 7  ARG A C    8  
ATOM 8098  O O    . ARG A 1 7  ? -0.340 -6.019  8.704  1.00 0.00 ? 7  ARG A O    8  
ATOM 8099  C CB   . ARG A 1 7  ? 0.468  -8.046  6.092  1.00 0.00 ? 7  ARG A CB   8  
ATOM 8100  C CG   . ARG A 1 7  ? -0.229 -8.876  5.026  1.00 0.00 ? 7  ARG A CG   8  
ATOM 8101  C CD   . ARG A 1 7  ? -1.318 -9.751  5.625  1.00 0.00 ? 7  ARG A CD   8  
ATOM 8102  N NE   . ARG A 1 7  ? -1.814 -10.739 4.670  1.00 0.00 ? 7  ARG A NE   8  
ATOM 8103  C CZ   . ARG A 1 7  ? -1.124 -11.811 4.298  1.00 0.00 ? 7  ARG A CZ   8  
ATOM 8104  N NH1  . ARG A 1 7  ? 0.084  -12.033 4.797  1.00 0.00 ? 7  ARG A NH1  8  
ATOM 8105  N NH2  . ARG A 1 7  ? -1.642 -12.664 3.424  1.00 0.00 ? 7  ARG A NH2  8  
ATOM 8106  H H    . ARG A 1 7  ? 0.362  -6.083  4.493  1.00 0.00 ? 7  ARG A H    8  
ATOM 8107  H HA   . ARG A 1 7  ? -1.297 -6.935  6.576  1.00 0.00 ? 7  ARG A HA   8  
ATOM 8108  H HB2  . ARG A 1 7  ? 1.467  -7.822  5.747  1.00 0.00 ? 7  ARG A HB2  8  
ATOM 8109  H HB3  . ARG A 1 7  ? 0.530  -8.637  6.994  1.00 0.00 ? 7  ARG A HB3  8  
ATOM 8110  H HG2  . ARG A 1 7  ? -0.675 -8.211  4.300  1.00 0.00 ? 7  ARG A HG2  8  
ATOM 8111  H HG3  . ARG A 1 7  ? 0.501  -9.506  4.540  1.00 0.00 ? 7  ARG A HG3  8  
ATOM 8112  H HD2  . ARG A 1 7  ? -0.916 -10.266 6.485  1.00 0.00 ? 7  ARG A HD2  8  
ATOM 8113  H HD3  . ARG A 1 7  ? -2.138 -9.120  5.935  1.00 0.00 ? 7  ARG A HD3  8  
ATOM 8114  H HE   . ARG A 1 7  ? -2.704 -10.594 4.289  1.00 0.00 ? 7  ARG A HE   8  
ATOM 8115  H HH11 . ARG A 1 7  ? 0.477  -11.392 5.456  1.00 0.00 ? 7  ARG A HH11 8  
ATOM 8116  H HH12 . ARG A 1 7  ? 0.601  -12.841 4.515  1.00 0.00 ? 7  ARG A HH12 8  
ATOM 8117  H HH21 . ARG A 1 7  ? -2.553 -12.500 3.045  1.00 0.00 ? 7  ARG A HH21 8  
ATOM 8118  H HH22 . ARG A 1 7  ? -1.123 -13.470 3.144  1.00 0.00 ? 7  ARG A HH22 8  
ATOM 8119  N N    . VAL A 1 8  ? 1.598  -5.705  7.604  1.00 0.00 ? 8  VAL A N    8  
ATOM 8120  C CA   . VAL A 1 8  ? 2.274  -5.099  8.744  1.00 0.00 ? 8  VAL A CA   8  
ATOM 8121  C C    . VAL A 1 8  ? 1.452  -3.955  9.326  1.00 0.00 ? 8  VAL A C    8  
ATOM 8122  O O    . VAL A 1 8  ? 1.152  -3.936  10.520 1.00 0.00 ? 8  VAL A O    8  
ATOM 8123  C CB   . VAL A 1 8  ? 3.667  -4.569  8.354  1.00 0.00 ? 8  VAL A CB   8  
ATOM 8124  C CG1  . VAL A 1 8  ? 4.344  -3.916  9.549  1.00 0.00 ? 8  VAL A CG1  8  
ATOM 8125  C CG2  . VAL A 1 8  ? 4.526  -5.692  7.792  1.00 0.00 ? 8  VAL A CG2  8  
ATOM 8126  H H    . VAL A 1 8  ? 2.085  -5.810  6.760  1.00 0.00 ? 8  VAL A H    8  
ATOM 8127  H HA   . VAL A 1 8  ? 2.401  -5.860  9.501  1.00 0.00 ? 8  VAL A HA   8  
ATOM 8128  H HB   . VAL A 1 8  ? 3.543  -3.820  7.585  1.00 0.00 ? 8  VAL A HB   8  
ATOM 8129  H HG11 . VAL A 1 8  ? 4.510  -2.869  9.341  1.00 0.00 ? 8  VAL A HG11 8  
ATOM 8130  H HG12 . VAL A 1 8  ? 3.713  -4.015  10.420 1.00 0.00 ? 8  VAL A HG12 8  
ATOM 8131  H HG13 . VAL A 1 8  ? 5.292  -4.400  9.734  1.00 0.00 ? 8  VAL A HG13 8  
ATOM 8132  H HG21 . VAL A 1 8  ? 5.566  -5.408  7.841  1.00 0.00 ? 8  VAL A HG21 8  
ATOM 8133  H HG22 . VAL A 1 8  ? 4.370  -6.590  8.372  1.00 0.00 ? 8  VAL A HG22 8  
ATOM 8134  H HG23 . VAL A 1 8  ? 4.251  -5.876  6.764  1.00 0.00 ? 8  VAL A HG23 8  
ATOM 8135  N N    . LYS A 1 9  ? 1.090  -3.001  8.475  1.00 0.00 ? 9  LYS A N    8  
ATOM 8136  C CA   . LYS A 1 9  ? 0.300  -1.852  8.903  1.00 0.00 ? 9  LYS A CA   8  
ATOM 8137  C C    . LYS A 1 9  ? -0.949 -2.301  9.655  1.00 0.00 ? 9  LYS A C    8  
ATOM 8138  O O    . LYS A 1 9  ? -1.218 -1.839  10.764 1.00 0.00 ? 9  LYS A O    8  
ATOM 8139  C CB   . LYS A 1 9  ? -0.097 -1.002  7.694  1.00 0.00 ? 9  LYS A CB   8  
ATOM 8140  C CG   . LYS A 1 9  ? 1.087  -0.523  6.872  1.00 0.00 ? 9  LYS A CG   8  
ATOM 8141  C CD   . LYS A 1 9  ? 0.722  -0.368  5.406  1.00 0.00 ? 9  LYS A CD   8  
ATOM 8142  C CE   . LYS A 1 9  ? 0.203  1.029   5.105  1.00 0.00 ? 9  LYS A CE   8  
ATOM 8143  N NZ   . LYS A 1 9  ? -1.263 1.140   5.340  1.00 0.00 ? 9  LYS A NZ   8  
ATOM 8144  H H    . LYS A 1 9  ? 1.360  -3.072  7.535  1.00 0.00 ? 9  LYS A H    8  
ATOM 8145  H HA   . LYS A 1 9  ? 0.911  -1.258  9.566  1.00 0.00 ? 9  LYS A HA   8  
ATOM 8146  H HB2  . LYS A 1 9  ? -0.741 -1.586  7.054  1.00 0.00 ? 9  LYS A HB2  8  
ATOM 8147  H HB3  . LYS A 1 9  ? -0.640 -0.135  8.042  1.00 0.00 ? 9  LYS A HB3  8  
ATOM 8148  H HG2  . LYS A 1 9  ? 1.415  0.433   7.253  1.00 0.00 ? 9  LYS A HG2  8  
ATOM 8149  H HG3  . LYS A 1 9  ? 1.889  -1.242  6.960  1.00 0.00 ? 9  LYS A HG3  8  
ATOM 8150  H HD2  . LYS A 1 9  ? 1.599  -0.552  4.803  1.00 0.00 ? 9  LYS A HD2  8  
ATOM 8151  H HD3  . LYS A 1 9  ? -0.045 -1.089  5.157  1.00 0.00 ? 9  LYS A HD3  8  
ATOM 8152  H HE2  . LYS A 1 9  ? 0.715  1.734   5.742  1.00 0.00 ? 9  LYS A HE2  8  
ATOM 8153  H HE3  . LYS A 1 9  ? 0.412  1.262   4.071  1.00 0.00 ? 9  LYS A HE3  8  
ATOM 8154  H HZ1  . LYS A 1 9  ? -1.450 1.324   6.346  1.00 0.00 ? 9  LYS A HZ1  8  
ATOM 8155  H HZ2  . LYS A 1 9  ? -1.736 0.255   5.067  1.00 0.00 ? 9  LYS A HZ2  8  
ATOM 8156  H HZ3  . LYS A 1 9  ? -1.658 1.919   4.776  1.00 0.00 ? 9  LYS A HZ3  8  
ATOM 8157  N N    . LYS A 1 10 ? -1.709 -3.204  9.045  1.00 0.00 ? 10 LYS A N    8  
ATOM 8158  C CA   . LYS A 1 10 ? -2.928 -3.718  9.657  1.00 0.00 ? 10 LYS A CA   8  
ATOM 8159  C C    . LYS A 1 10 ? -2.655 -4.230  11.068 1.00 0.00 ? 10 LYS A C    8  
ATOM 8160  O O    . LYS A 1 10 ? -3.251 -3.756  12.036 1.00 0.00 ? 10 LYS A O    8  
ATOM 8161  C CB   . LYS A 1 10 ? -3.519 -4.841  8.801  1.00 0.00 ? 10 LYS A CB   8  
ATOM 8162  C CG   . LYS A 1 10 ? -4.807 -5.419  9.361  1.00 0.00 ? 10 LYS A CG   8  
ATOM 8163  C CD   . LYS A 1 10 ? -5.964 -4.444  9.220  1.00 0.00 ? 10 LYS A CD   8  
ATOM 8164  C CE   . LYS A 1 10 ? -6.508 -4.428  7.800  1.00 0.00 ? 10 LYS A CE   8  
ATOM 8165  N NZ   . LYS A 1 10 ? -7.558 -5.465  7.596  1.00 0.00 ? 10 LYS A NZ   8  
ATOM 8166  H H    . LYS A 1 10 ? -1.442 -3.535  8.161  1.00 0.00 ? 10 LYS A H    8  
ATOM 8167  H HA   . LYS A 1 10 ? -3.639 -2.907  9.712  1.00 0.00 ? 10 LYS A HA   8  
ATOM 8168  H HB2  . LYS A 1 10 ? -3.722 -4.455  7.813  1.00 0.00 ? 10 LYS A HB2  8  
ATOM 8169  H HB3  . LYS A 1 10 ? -2.794 -5.639  8.725  1.00 0.00 ? 10 LYS A HB3  8  
ATOM 8170  H HG2  . LYS A 1 10 ? -5.047 -6.326  8.826  1.00 0.00 ? 10 LYS A HG2  8  
ATOM 8171  H HG3  . LYS A 1 10 ? -4.664 -5.644  10.409 1.00 0.00 ? 10 LYS A HG3  8  
ATOM 8172  H HD2  . LYS A 1 10 ? -6.755 -4.738  9.893  1.00 0.00 ? 10 LYS A HD2  8  
ATOM 8173  H HD3  . LYS A 1 10 ? -5.620 -3.452  9.476  1.00 0.00 ? 10 LYS A HD3  8  
ATOM 8174  H HE2  . LYS A 1 10 ? -6.932 -3.456  7.602  1.00 0.00 ? 10 LYS A HE2  8  
ATOM 8175  H HE3  . LYS A 1 10 ? -5.694 -4.612  7.114  1.00 0.00 ? 10 LYS A HE3  8  
ATOM 8176  H HZ1  . LYS A 1 10 ? -7.184 -6.241  7.013  1.00 0.00 ? 10 LYS A HZ1  8  
ATOM 8177  H HZ2  . LYS A 1 10 ? -8.381 -5.051  7.115  1.00 0.00 ? 10 LYS A HZ2  8  
ATOM 8178  H HZ3  . LYS A 1 10 ? -7.862 -5.850  8.513  1.00 0.00 ? 10 LYS A HZ3  8  
ATOM 8179  N N    . ILE A 1 11 ? -1.751 -5.197  11.177 1.00 0.00 ? 11 ILE A N    8  
ATOM 8180  C CA   . ILE A 1 11 ? -1.398 -5.770  12.470 1.00 0.00 ? 11 ILE A CA   8  
ATOM 8181  C C    . ILE A 1 11 ? -1.030 -4.681  13.471 1.00 0.00 ? 11 ILE A C    8  
ATOM 8182  O O    . ILE A 1 11 ? -1.381 -4.760  14.648 1.00 0.00 ? 11 ILE A O    8  
ATOM 8183  C CB   . ILE A 1 11 ? -0.223 -6.757  12.346 1.00 0.00 ? 11 ILE A CB   8  
ATOM 8184  C CG1  . ILE A 1 11 ? -0.575 -7.885  11.373 1.00 0.00 ? 11 ILE A CG1  8  
ATOM 8185  C CG2  . ILE A 1 11 ? 0.140  -7.322  13.711 1.00 0.00 ? 11 ILE A CG2  8  
ATOM 8186  C CD1  . ILE A 1 11 ? 0.566  -8.845  11.122 1.00 0.00 ? 11 ILE A CD1  8  
ATOM 8187  H H    . ILE A 1 11 ? -1.311 -5.533  10.369 1.00 0.00 ? 11 ILE A H    8  
ATOM 8188  H HA   . ILE A 1 11 ? -2.258 -6.310  12.841 1.00 0.00 ? 11 ILE A HA   8  
ATOM 8189  H HB   . ILE A 1 11 ? 0.632  -6.219  11.967 1.00 0.00 ? 11 ILE A HB   8  
ATOM 8190  H HG12 . ILE A 1 11 ? -1.402 -8.450  11.772 1.00 0.00 ? 11 ILE A HG12 8  
ATOM 8191  H HG13 . ILE A 1 11 ? -0.863 -7.455  10.425 1.00 0.00 ? 11 ILE A HG13 8  
ATOM 8192  H HG21 . ILE A 1 11 ? -0.706 -7.858  14.115 1.00 0.00 ? 11 ILE A HG21 8  
ATOM 8193  H HG22 . ILE A 1 11 ? 0.977  -7.997  13.610 1.00 0.00 ? 11 ILE A HG22 8  
ATOM 8194  H HG23 . ILE A 1 11 ? 0.406  -6.515  14.376 1.00 0.00 ? 11 ILE A HG23 8  
ATOM 8195  H HD11 . ILE A 1 11 ? 0.902  -9.259  12.061 1.00 0.00 ? 11 ILE A HD11 8  
ATOM 8196  H HD12 . ILE A 1 11 ? 0.232  -9.641  10.475 1.00 0.00 ? 11 ILE A HD12 8  
ATOM 8197  H HD13 . ILE A 1 11 ? 1.383  -8.317  10.651 1.00 0.00 ? 11 ILE A HD13 8  
ATOM 8198  N N    . VAL A 1 12 ? -0.320 -3.663  12.996 1.00 0.00 ? 12 VAL A N    8  
ATOM 8199  C CA   . VAL A 1 12 ? 0.095  -2.555  13.848 1.00 0.00 ? 12 VAL A CA   8  
ATOM 8200  C C    . VAL A 1 12 ? -1.104 -1.723  14.290 1.00 0.00 ? 12 VAL A C    8  
ATOM 8201  O O    . VAL A 1 12 ? -1.160 -1.248  15.424 1.00 0.00 ? 12 VAL A O    8  
ATOM 8202  C CB   . VAL A 1 12 ? 1.103  -1.640  13.129 1.00 0.00 ? 12 VAL A CB   8  
ATOM 8203  C CG1  . VAL A 1 12 ? 1.497  -0.473  14.022 1.00 0.00 ? 12 VAL A CG1  8  
ATOM 8204  C CG2  . VAL A 1 12 ? 2.330  -2.432  12.701 1.00 0.00 ? 12 VAL A CG2  8  
ATOM 8205  H H    . VAL A 1 12 ? -0.069 -3.656  12.048 1.00 0.00 ? 12 VAL A H    8  
ATOM 8206  H HA   . VAL A 1 12 ? 0.576  -2.969  14.723 1.00 0.00 ? 12 VAL A HA   8  
ATOM 8207  H HB   . VAL A 1 12 ? 0.630  -1.242  12.244 1.00 0.00 ? 12 VAL A HB   8  
ATOM 8208  H HG11 . VAL A 1 12 ? 1.935  -0.851  14.935 1.00 0.00 ? 12 VAL A HG11 8  
ATOM 8209  H HG12 . VAL A 1 12 ? 2.215  0.148   13.508 1.00 0.00 ? 12 VAL A HG12 8  
ATOM 8210  H HG13 . VAL A 1 12 ? 0.620  0.110   14.260 1.00 0.00 ? 12 VAL A HG13 8  
ATOM 8211  H HG21 . VAL A 1 12 ? 2.597  -2.162  11.690 1.00 0.00 ? 12 VAL A HG21 8  
ATOM 8212  H HG22 . VAL A 1 12 ? 3.153  -2.207  13.363 1.00 0.00 ? 12 VAL A HG22 8  
ATOM 8213  H HG23 . VAL A 1 12 ? 2.110  -3.488  12.746 1.00 0.00 ? 12 VAL A HG23 8  
ATOM 8214  N N    . VAL A 1 13 ? -2.064 -1.552  13.386 1.00 0.00 ? 13 VAL A N    8  
ATOM 8215  C CA   . VAL A 1 13 ? -3.264 -0.779  13.683 1.00 0.00 ? 13 VAL A CA   8  
ATOM 8216  C C    . VAL A 1 13 ? -4.121 -1.475  14.734 1.00 0.00 ? 13 VAL A C    8  
ATOM 8217  O O    . VAL A 1 13 ? -4.686 -0.829  15.615 1.00 0.00 ? 13 VAL A O    8  
ATOM 8218  C CB   . VAL A 1 13 ? -4.111 -0.549  12.417 1.00 0.00 ? 13 VAL A CB   8  
ATOM 8219  C CG1  . VAL A 1 13 ? -5.371 0.234   12.752 1.00 0.00 ? 13 VAL A CG1  8  
ATOM 8220  C CG2  . VAL A 1 13 ? -3.294 0.170   11.354 1.00 0.00 ? 13 VAL A CG2  8  
ATOM 8221  H H    . VAL A 1 13 ? -1.963 -1.956  12.499 1.00 0.00 ? 13 VAL A H    8  
ATOM 8222  H HA   . VAL A 1 13 ? -2.955 0.184   14.064 1.00 0.00 ? 13 VAL A HA   8  
ATOM 8223  H HB   . VAL A 1 13 ? -4.405 -1.512  12.025 1.00 0.00 ? 13 VAL A HB   8  
ATOM 8224  H HG11 . VAL A 1 13 ? -5.299 0.618   13.759 1.00 0.00 ? 13 VAL A HG11 8  
ATOM 8225  H HG12 . VAL A 1 13 ? -5.481 1.055   12.059 1.00 0.00 ? 13 VAL A HG12 8  
ATOM 8226  H HG13 . VAL A 1 13 ? -6.229 -0.418  12.677 1.00 0.00 ? 13 VAL A HG13 8  
ATOM 8227  H HG21 . VAL A 1 13 ? -3.430 -0.323  10.402 1.00 0.00 ? 13 VAL A HG21 8  
ATOM 8228  H HG22 . VAL A 1 13 ? -3.624 1.196   11.278 1.00 0.00 ? 13 VAL A HG22 8  
ATOM 8229  H HG23 . VAL A 1 13 ? -2.249 0.147   11.625 1.00 0.00 ? 13 VAL A HG23 8  
ATOM 8230  N N    . GLU A 1 14 ? -4.211 -2.798  14.635 1.00 0.00 ? 14 GLU A N    8  
ATOM 8231  C CA   . GLU A 1 14 ? -4.999 -3.582  15.578 1.00 0.00 ? 14 GLU A CA   8  
ATOM 8232  C C    . GLU A 1 14 ? -4.218 -3.832  16.865 1.00 0.00 ? 14 GLU A C    8  
ATOM 8233  O O    . GLU A 1 14 ? -4.802 -4.029  17.931 1.00 0.00 ? 14 GLU A O    8  
ATOM 8234  C CB   . GLU A 1 14 ? -5.409 -4.916  14.950 1.00 0.00 ? 14 GLU A CB   8  
ATOM 8235  C CG   . GLU A 1 14 ? -6.726 -5.458  15.477 1.00 0.00 ? 14 GLU A CG   8  
ATOM 8236  C CD   . GLU A 1 14 ? -7.308 -6.542  14.590 1.00 0.00 ? 14 GLU A CD   8  
ATOM 8237  O OE1  . GLU A 1 14 ? -6.950 -7.723  14.783 1.00 0.00 ? 14 GLU A OE1  8  
ATOM 8238  O OE2  . GLU A 1 14 ? -8.121 -6.209  13.703 1.00 0.00 ? 14 GLU A OE2  8  
ATOM 8239  H H    . GLU A 1 14 ? -3.737 -3.257  13.910 1.00 0.00 ? 14 GLU A H    8  
ATOM 8240  H HA   . GLU A 1 14 ? -5.889 -3.019  15.815 1.00 0.00 ? 14 GLU A HA   8  
ATOM 8241  H HB2  . GLU A 1 14 ? -5.498 -4.784  13.882 1.00 0.00 ? 14 GLU A HB2  8  
ATOM 8242  H HB3  . GLU A 1 14 ? -4.638 -5.645  15.150 1.00 0.00 ? 14 GLU A HB3  8  
ATOM 8243  H HG2  . GLU A 1 14 ? -6.563 -5.870  16.462 1.00 0.00 ? 14 GLU A HG2  8  
ATOM 8244  H HG3  . GLU A 1 14 ? -7.436 -4.646  15.541 1.00 0.00 ? 14 GLU A HG3  8  
ATOM 8245  N N    . HIS A 1 15 ? -2.893 -3.822  16.757 1.00 0.00 ? 15 HIS A N    8  
ATOM 8246  C CA   . HIS A 1 15 ? -2.031 -4.048  17.911 1.00 0.00 ? 15 HIS A CA   8  
ATOM 8247  C C    . HIS A 1 15 ? -1.896 -2.777  18.745 1.00 0.00 ? 15 HIS A C    8  
ATOM 8248  O O    . HIS A 1 15 ? -2.243 -2.758  19.927 1.00 0.00 ? 15 HIS A O    8  
ATOM 8249  C CB   . HIS A 1 15 ? -0.650 -4.523  17.458 1.00 0.00 ? 15 HIS A CB   8  
ATOM 8250  C CG   . HIS A 1 15 ? -0.591 -5.988  17.153 1.00 0.00 ? 15 HIS A CG   8  
ATOM 8251  N ND1  . HIS A 1 15 ? -1.710 -6.746  16.880 1.00 0.00 ? 15 HIS A ND1  8  
ATOM 8252  C CD2  . HIS A 1 15 ? 0.463  -6.835  17.078 1.00 0.00 ? 15 HIS A CD2  8  
ATOM 8253  C CE1  . HIS A 1 15 ? -1.348 -7.995  16.652 1.00 0.00 ? 15 HIS A CE1  8  
ATOM 8254  N NE2  . HIS A 1 15 ? -0.034 -8.076  16.766 1.00 0.00 ? 15 HIS A NE2  8  
ATOM 8255  H H    . HIS A 1 15 ? -2.486 -3.659  15.881 1.00 0.00 ? 15 HIS A H    8  
ATOM 8256  H HA   . HIS A 1 15 ? -2.484 -4.816  18.519 1.00 0.00 ? 15 HIS A HA   8  
ATOM 8257  H HB2  . HIS A 1 15 ? -0.368 -3.987  16.563 1.00 0.00 ? 15 HIS A HB2  8  
ATOM 8258  H HB3  . HIS A 1 15 ? 0.069  -4.316  18.237 1.00 0.00 ? 15 HIS A HB3  8  
ATOM 8259  H HD1  . HIS A 1 15 ? -2.632 -6.417  16.858 1.00 0.00 ? 15 HIS A HD1  8  
ATOM 8260  H HD2  . HIS A 1 15 ? 1.502  -6.582  17.236 1.00 0.00 ? 15 HIS A HD2  8  
ATOM 8261  H HE1  . HIS A 1 15 ? -2.012 -8.812  16.412 1.00 0.00 ? 15 HIS A HE1  8  
ATOM 8262  N N    . LEU A 1 16 ? -1.389 -1.718  18.124 1.00 0.00 ? 16 LEU A N    8  
ATOM 8263  C CA   . LEU A 1 16 ? -1.208 -0.443  18.808 1.00 0.00 ? 16 LEU A CA   8  
ATOM 8264  C C    . LEU A 1 16 ? -2.545 0.263   19.009 1.00 0.00 ? 16 LEU A C    8  
ATOM 8265  O O    . LEU A 1 16 ? -2.758 0.938   20.015 1.00 0.00 ? 16 LEU A O    8  
ATOM 8266  C CB   . LEU A 1 16 ? -0.258 0.455   18.013 1.00 0.00 ? 16 LEU A CB   8  
ATOM 8267  C CG   . LEU A 1 16 ? 1.235  0.197   18.215 1.00 0.00 ? 16 LEU A CG   8  
ATOM 8268  C CD1  . LEU A 1 16 ? 1.623  0.412   19.670 1.00 0.00 ? 16 LEU A CD1  8  
ATOM 8269  C CD2  . LEU A 1 16 ? 1.599  -1.211  17.767 1.00 0.00 ? 16 LEU A CD2  8  
ATOM 8270  H H    . LEU A 1 16 ? -1.131 -1.794  17.182 1.00 0.00 ? 16 LEU A H    8  
ATOM 8271  H HA   . LEU A 1 16 ? -0.773 -0.646  19.776 1.00 0.00 ? 16 LEU A HA   8  
ATOM 8272  H HB2  . LEU A 1 16 ? -0.478 0.322   16.965 1.00 0.00 ? 16 LEU A HB2  8  
ATOM 8273  H HB3  . LEU A 1 16 ? -0.459 1.479   18.295 1.00 0.00 ? 16 LEU A HB3  8  
ATOM 8274  H HG   . LEU A 1 16 ? 1.799  0.897   17.613 1.00 0.00 ? 16 LEU A HG   8  
ATOM 8275  H HD11 . LEU A 1 16 ? 1.489  -0.509  20.217 1.00 0.00 ? 16 LEU A HD11 8  
ATOM 8276  H HD12 . LEU A 1 16 ? 0.997  1.180   20.099 1.00 0.00 ? 16 LEU A HD12 8  
ATOM 8277  H HD13 . LEU A 1 16 ? 2.657  0.718   19.725 1.00 0.00 ? 16 LEU A HD13 8  
ATOM 8278  H HD21 . LEU A 1 16 ? 0.960  -1.503  16.946 1.00 0.00 ? 16 LEU A HD21 8  
ATOM 8279  H HD22 . LEU A 1 16 ? 1.463  -1.897  18.590 1.00 0.00 ? 16 LEU A HD22 8  
ATOM 8280  H HD23 . LEU A 1 16 ? 2.630  -1.232  17.446 1.00 0.00 ? 16 LEU A HD23 8  
ATOM 8281  N N    . GLY A 1 17 ? -3.445 0.099   18.044 1.00 0.00 ? 17 GLY A N    8  
ATOM 8282  C CA   . GLY A 1 17 ? -4.751 0.725   18.134 1.00 0.00 ? 17 GLY A CA   8  
ATOM 8283  C C    . GLY A 1 17 ? -4.745 2.155   17.632 1.00 0.00 ? 17 GLY A C    8  
ATOM 8284  O O    . GLY A 1 17 ? -5.529 2.986   18.092 1.00 0.00 ? 17 GLY A O    8  
ATOM 8285  H H    . GLY A 1 17 ? -3.220 -0.450  17.264 1.00 0.00 ? 17 GLY A H    8  
ATOM 8286  H HA2  . GLY A 1 17 ? -5.454 0.152   17.548 1.00 0.00 ? 17 GLY A HA2  8  
ATOM 8287  H HA3  . GLY A 1 17 ? -5.070 0.719   19.166 1.00 0.00 ? 17 GLY A HA3  8  
ATOM 8288  N N    . VAL A 1 18 ? -3.856 2.446   16.687 1.00 0.00 ? 18 VAL A N    8  
ATOM 8289  C CA   . VAL A 1 18 ? -3.750 3.786   16.123 1.00 0.00 ? 18 VAL A CA   8  
ATOM 8290  C C    . VAL A 1 18 ? -4.310 3.831   14.706 1.00 0.00 ? 18 VAL A C    8  
ATOM 8291  O O    . VAL A 1 18 ? -4.725 2.810   14.158 1.00 0.00 ? 18 VAL A O    8  
ATOM 8292  C CB   . VAL A 1 18 ? -2.289 4.272   16.103 1.00 0.00 ? 18 VAL A CB   8  
ATOM 8293  C CG1  . VAL A 1 18 ? -1.689 4.221   17.500 1.00 0.00 ? 18 VAL A CG1  8  
ATOM 8294  C CG2  . VAL A 1 18 ? -1.466 3.442   15.129 1.00 0.00 ? 18 VAL A CG2  8  
ATOM 8295  H H    . VAL A 1 18 ? -3.258 1.741   16.361 1.00 0.00 ? 18 VAL A H    8  
ATOM 8296  H HA   . VAL A 1 18 ? -4.322 4.457   16.747 1.00 0.00 ? 18 VAL A HA   8  
ATOM 8297  H HB   . VAL A 1 18 ? -2.277 5.299   15.767 1.00 0.00 ? 18 VAL A HB   8  
ATOM 8298  H HG11 . VAL A 1 18 ? -2.388 4.644   18.206 1.00 0.00 ? 18 VAL A HG11 8  
ATOM 8299  H HG12 . VAL A 1 18 ? -1.482 3.195   17.765 1.00 0.00 ? 18 VAL A HG12 8  
ATOM 8300  H HG13 . VAL A 1 18 ? -0.772 4.791   17.518 1.00 0.00 ? 18 VAL A HG13 8  
ATOM 8301  H HG21 . VAL A 1 18 ? -0.514 3.202   15.579 1.00 0.00 ? 18 VAL A HG21 8  
ATOM 8302  H HG22 . VAL A 1 18 ? -1.995 2.529   14.897 1.00 0.00 ? 18 VAL A HG22 8  
ATOM 8303  H HG23 . VAL A 1 18 ? -1.304 4.005   14.222 1.00 0.00 ? 18 VAL A HG23 8  
ATOM 8304  N N    . ASP A 1 19 ? -4.318 5.022   14.117 1.00 0.00 ? 19 ASP A N    8  
ATOM 8305  C CA   . ASP A 1 19 ? -4.825 5.201   12.761 1.00 0.00 ? 19 ASP A CA   8  
ATOM 8306  C C    . ASP A 1 19 ? -3.825 4.681   11.734 1.00 0.00 ? 19 ASP A C    8  
ATOM 8307  O O    . ASP A 1 19 ? -2.618 4.676   11.975 1.00 0.00 ? 19 ASP A O    8  
ATOM 8308  C CB   . ASP A 1 19 ? -5.125 6.678   12.497 1.00 0.00 ? 19 ASP A CB   8  
ATOM 8309  C CG   . ASP A 1 19 ? -6.210 6.871   11.456 1.00 0.00 ? 19 ASP A CG   8  
ATOM 8310  O OD1  . ASP A 1 19 ? -7.281 6.244   11.592 1.00 0.00 ? 19 ASP A OD1  8  
ATOM 8311  O OD2  . ASP A 1 19 ? -5.987 7.647   10.503 1.00 0.00 ? 19 ASP A OD2  8  
ATOM 8312  H H    . ASP A 1 19 ? -3.974 5.799   14.605 1.00 0.00 ? 19 ASP A H    8  
ATOM 8313  H HA   . ASP A 1 19 ? -5.740 4.636   12.672 1.00 0.00 ? 19 ASP A HA   8  
ATOM 8314  H HB2  . ASP A 1 19 ? -5.449 7.143   13.417 1.00 0.00 ? 19 ASP A HB2  8  
ATOM 8315  H HB3  . ASP A 1 19 ? -4.226 7.165   12.150 1.00 0.00 ? 19 ASP A HB3  8  
ATOM 8316  N N    . ALA A 1 20 ? -4.335 4.244   10.587 1.00 0.00 ? 20 ALA A N    8  
ATOM 8317  C CA   . ALA A 1 20 ? -3.487 3.723   9.523  1.00 0.00 ? 20 ALA A CA   8  
ATOM 8318  C C    . ALA A 1 20 ? -2.790 4.853   8.773  1.00 0.00 ? 20 ALA A C    8  
ATOM 8319  O O    . ALA A 1 20 ? -1.655 4.703   8.320  1.00 0.00 ? 20 ALA A O    8  
ATOM 8320  C CB   . ALA A 1 20 ? -4.307 2.876   8.561  1.00 0.00 ? 20 ALA A CB   8  
ATOM 8321  H H    . ALA A 1 20 ? -5.305 4.274   10.454 1.00 0.00 ? 20 ALA A H    8  
ATOM 8322  H HA   . ALA A 1 20 ? -2.738 3.088   9.974  1.00 0.00 ? 20 ALA A HA   8  
ATOM 8323  H HB1  . ALA A 1 20 ? -4.850 2.125   9.117  1.00 0.00 ? 20 ALA A HB1  8  
ATOM 8324  H HB2  . ALA A 1 20 ? -5.005 3.507   8.031  1.00 0.00 ? 20 ALA A HB2  8  
ATOM 8325  H HB3  . ALA A 1 20 ? -3.648 2.395   7.854  1.00 0.00 ? 20 ALA A HB3  8  
ATOM 8326  N N    . ASP A 1 21 ? -3.475 5.984   8.646  1.00 0.00 ? 21 ASP A N    8  
ATOM 8327  C CA   . ASP A 1 21 ? -2.922 7.140   7.952  1.00 0.00 ? 21 ASP A CA   8  
ATOM 8328  C C    . ASP A 1 21 ? -1.580 7.545   8.554  1.00 0.00 ? 21 ASP A C    8  
ATOM 8329  O O    . ASP A 1 21 ? -0.712 8.079   7.863  1.00 0.00 ? 21 ASP A O    8  
ATOM 8330  C CB   . ASP A 1 21 ? -3.898 8.315   8.015  1.00 0.00 ? 21 ASP A CB   8  
ATOM 8331  C CG   . ASP A 1 21 ? -3.636 9.345   6.933  1.00 0.00 ? 21 ASP A CG   8  
ATOM 8332  O OD1  . ASP A 1 21 ? -2.474 9.453   6.486  1.00 0.00 ? 21 ASP A OD1  8  
ATOM 8333  O OD2  . ASP A 1 21 ? -4.591 10.041  6.533  1.00 0.00 ? 21 ASP A OD2  8  
ATOM 8334  H H    . ASP A 1 21 ? -4.376 6.042   9.030  1.00 0.00 ? 21 ASP A H    8  
ATOM 8335  H HA   . ASP A 1 21 ? -2.770 6.865   6.919  1.00 0.00 ? 21 ASP A HA   8  
ATOM 8336  H HB2  . ASP A 1 21 ? -4.906 7.945   7.895  1.00 0.00 ? 21 ASP A HB2  8  
ATOM 8337  H HB3  . ASP A 1 21 ? -3.808 8.799   8.976  1.00 0.00 ? 21 ASP A HB3  8  
ATOM 8338  N N    . LYS A 1 22 ? -1.416 7.287   9.847  1.00 0.00 ? 22 LYS A N    8  
ATOM 8339  C CA   . LYS A 1 22 ? -0.180 7.623   10.544 1.00 0.00 ? 22 LYS A CA   8  
ATOM 8340  C C    . LYS A 1 22 ? 0.894  6.572   10.286 1.00 0.00 ? 22 LYS A C    8  
ATOM 8341  O O    . LYS A 1 22 ? 2.089  6.860   10.359 1.00 0.00 ? 22 LYS A O    8  
ATOM 8342  C CB   . LYS A 1 22 ? -0.436 7.747   12.048 1.00 0.00 ? 22 LYS A CB   8  
ATOM 8343  C CG   . LYS A 1 22 ? -1.597 8.664   12.394 1.00 0.00 ? 22 LYS A CG   8  
ATOM 8344  C CD   . LYS A 1 22 ? -1.758 8.817   13.897 1.00 0.00 ? 22 LYS A CD   8  
ATOM 8345  C CE   . LYS A 1 22 ? -2.502 10.095  14.251 1.00 0.00 ? 22 LYS A CE   8  
ATOM 8346  N NZ   . LYS A 1 22 ? -3.850 10.144  13.621 1.00 0.00 ? 22 LYS A NZ   8  
ATOM 8347  H H    . LYS A 1 22 ? -2.144 6.859   10.345 1.00 0.00 ? 22 LYS A H    8  
ATOM 8348  H HA   . LYS A 1 22 ? 0.165  8.574   10.167 1.00 0.00 ? 22 LYS A HA   8  
ATOM 8349  H HB2  . LYS A 1 22 ? -0.649 6.766   12.447 1.00 0.00 ? 22 LYS A HB2  8  
ATOM 8350  H HB3  . LYS A 1 22 ? 0.454  8.134   12.522 1.00 0.00 ? 22 LYS A HB3  8  
ATOM 8351  H HG2  . LYS A 1 22 ? -1.417 9.637   11.962 1.00 0.00 ? 22 LYS A HG2  8  
ATOM 8352  H HG3  . LYS A 1 22 ? -2.507 8.248   11.984 1.00 0.00 ? 22 LYS A HG3  8  
ATOM 8353  H HD2  . LYS A 1 22 ? -2.313 7.973   14.279 1.00 0.00 ? 22 LYS A HD2  8  
ATOM 8354  H HD3  . LYS A 1 22 ? -0.778 8.842   14.355 1.00 0.00 ? 22 LYS A HD3  8  
ATOM 8355  H HE2  . LYS A 1 22 ? -2.613 10.147  15.323 1.00 0.00 ? 22 LYS A HE2  8  
ATOM 8356  H HE3  . LYS A 1 22 ? -1.923 10.940  13.908 1.00 0.00 ? 22 LYS A HE3  8  
ATOM 8357  H HZ1  . LYS A 1 22 ? -4.049 9.247   13.134 1.00 0.00 ? 22 LYS A HZ1  8  
ATOM 8358  H HZ2  . LYS A 1 22 ? -3.893 10.919  12.929 1.00 0.00 ? 22 LYS A HZ2  8  
ATOM 8359  H HZ3  . LYS A 1 22 ? -4.578 10.301  14.347 1.00 0.00 ? 22 LYS A HZ3  8  
ATOM 8360  N N    . VAL A 1 23 ? 0.461  5.353   9.981  1.00 0.00 ? 23 VAL A N    8  
ATOM 8361  C CA   . VAL A 1 23 ? 1.386  4.259   9.709  1.00 0.00 ? 23 VAL A CA   8  
ATOM 8362  C C    . VAL A 1 23 ? 2.167  4.507   8.423  1.00 0.00 ? 23 VAL A C    8  
ATOM 8363  O O    . VAL A 1 23 ? 1.750  4.096   7.340  1.00 0.00 ? 23 VAL A O    8  
ATOM 8364  C CB   . VAL A 1 23 ? 0.646  2.913   9.595  1.00 0.00 ? 23 VAL A CB   8  
ATOM 8365  C CG1  . VAL A 1 23 ? 1.638  1.766   9.473  1.00 0.00 ? 23 VAL A CG1  8  
ATOM 8366  C CG2  . VAL A 1 23 ? -0.274 2.709   10.789 1.00 0.00 ? 23 VAL A CG2  8  
ATOM 8367  H H    . VAL A 1 23 ? -0.503 5.185   9.938  1.00 0.00 ? 23 VAL A H    8  
ATOM 8368  H HA   . VAL A 1 23 ? 2.080  4.195   10.534 1.00 0.00 ? 23 VAL A HA   8  
ATOM 8369  H HB   . VAL A 1 23 ? 0.041  2.933   8.700  1.00 0.00 ? 23 VAL A HB   8  
ATOM 8370  H HG11 . VAL A 1 23 ? 2.343  1.813   10.290 1.00 0.00 ? 23 VAL A HG11 8  
ATOM 8371  H HG12 . VAL A 1 23 ? 1.108  0.826   9.506  1.00 0.00 ? 23 VAL A HG12 8  
ATOM 8372  H HG13 . VAL A 1 23 ? 2.169  1.848   8.536  1.00 0.00 ? 23 VAL A HG13 8  
ATOM 8373  H HG21 . VAL A 1 23 ? 0.313  2.687   11.695 1.00 0.00 ? 23 VAL A HG21 8  
ATOM 8374  H HG22 . VAL A 1 23 ? -0.984 3.521   10.840 1.00 0.00 ? 23 VAL A HG22 8  
ATOM 8375  H HG23 . VAL A 1 23 ? -0.804 1.774   10.679 1.00 0.00 ? 23 VAL A HG23 8  
ATOM 8376  N N    . THR A 1 24 ? 3.305  5.183   8.550  1.00 0.00 ? 24 THR A N    8  
ATOM 8377  C CA   . THR A 1 24 ? 4.146  5.488   7.399  1.00 0.00 ? 24 THR A CA   8  
ATOM 8378  C C    . THR A 1 24 ? 5.534  4.878   7.555  1.00 0.00 ? 24 THR A C    8  
ATOM 8379  O O    . THR A 1 24 ? 6.004  4.663   8.672  1.00 0.00 ? 24 THR A O    8  
ATOM 8380  C CB   . THR A 1 24 ? 4.285  7.008   7.191  1.00 0.00 ? 24 THR A CB   8  
ATOM 8381  O OG1  . THR A 1 24 ? 5.097  7.571   8.227  1.00 0.00 ? 24 THR A OG1  8  
ATOM 8382  C CG2  . THR A 1 24 ? 2.920  7.680   7.187  1.00 0.00 ? 24 THR A CG2  8  
ATOM 8383  H H    . THR A 1 24 ? 3.584  5.485   9.440  1.00 0.00 ? 24 THR A H    8  
ATOM 8384  H HA   . THR A 1 24 ? 3.675  5.067   6.522  1.00 0.00 ? 24 THR A HA   8  
ATOM 8385  H HB   . THR A 1 24 ? 4.759  7.183   6.236  1.00 0.00 ? 24 THR A HB   8  
ATOM 8386  H HG1  . THR A 1 24 ? 5.189  8.516   8.082  1.00 0.00 ? 24 THR A HG1  8  
ATOM 8387  H HG21 . THR A 1 24 ? 2.600  7.852   8.204  1.00 0.00 ? 24 THR A HG21 8  
ATOM 8388  H HG22 . THR A 1 24 ? 2.206  7.043   6.687  1.00 0.00 ? 24 THR A HG22 8  
ATOM 8389  H HG23 . THR A 1 24 ? 2.986  8.624   6.666  1.00 0.00 ? 24 THR A HG23 8  
ATOM 8390  N N    . GLU A 1 25 ? 6.186  4.604   6.429  1.00 0.00 ? 25 GLU A N    8  
ATOM 8391  C CA   . GLU A 1 25 ? 7.521  4.019   6.444  1.00 0.00 ? 25 GLU A CA   8  
ATOM 8392  C C    . GLU A 1 25 ? 8.460  4.827   7.336  1.00 0.00 ? 25 GLU A C    8  
ATOM 8393  O O    . GLU A 1 25 ? 9.396  4.286   7.922  1.00 0.00 ? 25 GLU A O    8  
ATOM 8394  C CB   . GLU A 1 25 ? 8.086  3.948   5.023  1.00 0.00 ? 25 GLU A CB   8  
ATOM 8395  C CG   . GLU A 1 25 ? 8.533  5.294   4.478  1.00 0.00 ? 25 GLU A CG   8  
ATOM 8396  C CD   . GLU A 1 25 ? 8.307  5.421   2.984  1.00 0.00 ? 25 GLU A CD   8  
ATOM 8397  O OE1  . GLU A 1 25 ? 9.176  4.965   2.212  1.00 0.00 ? 25 GLU A OE1  8  
ATOM 8398  O OE2  . GLU A 1 25 ? 7.262  5.978   2.586  1.00 0.00 ? 25 GLU A OE2  8  
ATOM 8399  H H    . GLU A 1 25 ? 5.758  4.799   5.570  1.00 0.00 ? 25 GLU A H    8  
ATOM 8400  H HA   . GLU A 1 25 ? 7.441  3.018   6.840  1.00 0.00 ? 25 GLU A HA   8  
ATOM 8401  H HB2  . GLU A 1 25 ? 8.935  3.281   5.019  1.00 0.00 ? 25 GLU A HB2  8  
ATOM 8402  H HB3  . GLU A 1 25 ? 7.326  3.551   4.367  1.00 0.00 ? 25 GLU A HB3  8  
ATOM 8403  H HG2  . GLU A 1 25 ? 7.978  6.073   4.978  1.00 0.00 ? 25 GLU A HG2  8  
ATOM 8404  H HG3  . GLU A 1 25 ? 9.587  5.418   4.679  1.00 0.00 ? 25 GLU A HG3  8  
ATOM 8405  N N    . GLY A 1 26 ? 8.201  6.128   7.432  1.00 0.00 ? 26 GLY A N    8  
ATOM 8406  C CA   . GLY A 1 26 ? 9.031  6.990   8.253  1.00 0.00 ? 26 GLY A CA   8  
ATOM 8407  C C    . GLY A 1 26 ? 8.458  7.194   9.642  1.00 0.00 ? 26 GLY A C    8  
ATOM 8408  O O    . GLY A 1 26 ? 8.642  8.250   10.247 1.00 0.00 ? 26 GLY A O    8  
ATOM 8409  H H    . GLY A 1 26 ? 7.441  6.505   6.942  1.00 0.00 ? 26 GLY A H    8  
ATOM 8410  H HA2  . GLY A 1 26 ? 10.013 6.549   8.341  1.00 0.00 ? 26 GLY A HA2  8  
ATOM 8411  H HA3  . GLY A 1 26 ? 9.121  7.951   7.769  1.00 0.00 ? 26 GLY A HA3  8  
ATOM 8412  N N    . ALA A 1 27 ? 7.761  6.183   10.147 1.00 0.00 ? 27 ALA A N    8  
ATOM 8413  C CA   . ALA A 1 27 ? 7.160  6.256   11.473 1.00 0.00 ? 27 ALA A CA   8  
ATOM 8414  C C    . ALA A 1 27 ? 7.918  5.385   12.469 1.00 0.00 ? 27 ALA A C    8  
ATOM 8415  O O    . ALA A 1 27 ? 7.901  4.158   12.374 1.00 0.00 ? 27 ALA A O    8  
ATOM 8416  C CB   . ALA A 1 27 ? 5.697  5.841   11.414 1.00 0.00 ? 27 ALA A CB   8  
ATOM 8417  H H    . ALA A 1 27 ? 7.649  5.367   9.616  1.00 0.00 ? 27 ALA A H    8  
ATOM 8418  H HA   . ALA A 1 27 ? 7.204  7.284   11.803 1.00 0.00 ? 27 ALA A HA   8  
ATOM 8419  H HB1  . ALA A 1 27 ? 5.610  4.796   11.673 1.00 0.00 ? 27 ALA A HB1  8  
ATOM 8420  H HB2  . ALA A 1 27 ? 5.126  6.434   12.112 1.00 0.00 ? 27 ALA A HB2  8  
ATOM 8421  H HB3  . ALA A 1 27 ? 5.320  5.997   10.414 1.00 0.00 ? 27 ALA A HB3  8  
ATOM 8422  N N    . SER A 1 28 ? 8.585  6.028   13.423 1.00 0.00 ? 28 SER A N    8  
ATOM 8423  C CA   . SER A 1 28 ? 9.354  5.312   14.433 1.00 0.00 ? 28 SER A CA   8  
ATOM 8424  C C    . SER A 1 28 ? 8.473  4.935   15.620 1.00 0.00 ? 28 SER A C    8  
ATOM 8425  O O    . SER A 1 28 ? 7.960  5.802   16.328 1.00 0.00 ? 28 SER A O    8  
ATOM 8426  C CB   . SER A 1 28 ? 10.532 6.165   14.908 1.00 0.00 ? 28 SER A CB   8  
ATOM 8427  O OG   . SER A 1 28 ? 10.082 7.295   15.636 1.00 0.00 ? 28 SER A OG   8  
ATOM 8428  H H    . SER A 1 28 ? 8.561  7.008   13.445 1.00 0.00 ? 28 SER A H    8  
ATOM 8429  H HA   . SER A 1 28 ? 9.735  4.408   13.981 1.00 0.00 ? 28 SER A HA   8  
ATOM 8430  H HB2  . SER A 1 28 ? 11.169 5.572   15.546 1.00 0.00 ? 28 SER A HB2  8  
ATOM 8431  H HB3  . SER A 1 28 ? 11.095 6.505   14.051 1.00 0.00 ? 28 SER A HB3  8  
ATOM 8432  H HG   . SER A 1 28 ? 10.493 8.087   15.284 1.00 0.00 ? 28 SER A HG   8  
ATOM 8433  N N    . PHE A 1 29 ? 8.301  3.634   15.832 1.00 0.00 ? 29 PHE A N    8  
ATOM 8434  C CA   . PHE A 1 29 ? 7.482  3.141   16.933 1.00 0.00 ? 29 PHE A CA   8  
ATOM 8435  C C    . PHE A 1 29 ? 8.062  3.569   18.278 1.00 0.00 ? 29 PHE A C    8  
ATOM 8436  O O    . PHE A 1 29 ? 7.398  3.474   19.310 1.00 0.00 ? 29 PHE A O    8  
ATOM 8437  C CB   . PHE A 1 29 ? 7.375  1.615   16.873 1.00 0.00 ? 29 PHE A CB   8  
ATOM 8438  C CG   . PHE A 1 29 ? 7.031  1.092   15.508 1.00 0.00 ? 29 PHE A CG   8  
ATOM 8439  C CD1  . PHE A 1 29 ? 5.716  1.071   15.071 1.00 0.00 ? 29 PHE A CD1  8  
ATOM 8440  C CD2  . PHE A 1 29 ? 8.022  0.619   14.663 1.00 0.00 ? 29 PHE A CD2  8  
ATOM 8441  C CE1  . PHE A 1 29 ? 5.396  0.590   13.815 1.00 0.00 ? 29 PHE A CE1  8  
ATOM 8442  C CE2  . PHE A 1 29 ? 7.707  0.137   13.406 1.00 0.00 ? 29 PHE A CE2  8  
ATOM 8443  C CZ   . PHE A 1 29 ? 6.393  0.122   12.982 1.00 0.00 ? 29 PHE A CZ   8  
ATOM 8444  H H    . PHE A 1 29 ? 8.736  2.991   15.234 1.00 0.00 ? 29 PHE A H    8  
ATOM 8445  H HA   . PHE A 1 29 ? 6.496  3.566   16.828 1.00 0.00 ? 29 PHE A HA   8  
ATOM 8446  H HB2  . PHE A 1 29 ? 8.320  1.184   17.165 1.00 0.00 ? 29 PHE A HB2  8  
ATOM 8447  H HB3  . PHE A 1 29 ? 6.608  1.288   17.559 1.00 0.00 ? 29 PHE A HB3  8  
ATOM 8448  H HD1  . PHE A 1 29 ? 4.935  1.438   15.722 1.00 0.00 ? 29 PHE A HD1  8  
ATOM 8449  H HD2  . PHE A 1 29 ? 9.050  0.629   14.993 1.00 0.00 ? 29 PHE A HD2  8  
ATOM 8450  H HE1  . PHE A 1 29 ? 4.367  0.580   13.487 1.00 0.00 ? 29 PHE A HE1  8  
ATOM 8451  H HE2  . PHE A 1 29 ? 8.489  -0.229  12.757 1.00 0.00 ? 29 PHE A HE2  8  
ATOM 8452  H HZ   . PHE A 1 29 ? 6.145  -0.254  12.001 1.00 0.00 ? 29 PHE A HZ   8  
ATOM 8453  N N    . ILE A 1 30 ? 9.304  4.039   18.257 1.00 0.00 ? 30 ILE A N    8  
ATOM 8454  C CA   . ILE A 1 30 ? 9.973  4.483   19.473 1.00 0.00 ? 30 ILE A CA   8  
ATOM 8455  C C    . ILE A 1 30 ? 9.622  5.930   19.798 1.00 0.00 ? 30 ILE A C    8  
ATOM 8456  O O    . ILE A 1 30 ? 9.185  6.240   20.907 1.00 0.00 ? 30 ILE A O    8  
ATOM 8457  C CB   . ILE A 1 30 ? 11.503 4.352   19.353 1.00 0.00 ? 30 ILE A CB   8  
ATOM 8458  C CG1  . ILE A 1 30 ? 11.896 2.891   19.127 1.00 0.00 ? 30 ILE A CG1  8  
ATOM 8459  C CG2  . ILE A 1 30 ? 12.181 4.902   20.600 1.00 0.00 ? 30 ILE A CG2  8  
ATOM 8460  C CD1  . ILE A 1 30 ? 11.413 1.959   20.217 1.00 0.00 ? 30 ILE A CD1  8  
ATOM 8461  H H    . ILE A 1 30 ? 9.781  4.091   17.403 1.00 0.00 ? 30 ILE A H    8  
ATOM 8462  H HA   . ILE A 1 30 ? 9.641  3.852   20.285 1.00 0.00 ? 30 ILE A HA   8  
ATOM 8463  H HB   . ILE A 1 30 ? 11.827 4.940   18.508 1.00 0.00 ? 30 ILE A HB   8  
ATOM 8464  H HG12 . ILE A 1 30 ? 11.477 2.552   18.193 1.00 0.00 ? 30 ILE A HG12 8  
ATOM 8465  H HG13 . ILE A 1 30 ? 12.973 2.819   19.081 1.00 0.00 ? 30 ILE A HG13 8  
ATOM 8466  H HG21 . ILE A 1 30 ? 11.431 5.157   21.334 1.00 0.00 ? 30 ILE A HG21 8  
ATOM 8467  H HG22 . ILE A 1 30 ? 12.844 4.154   21.008 1.00 0.00 ? 30 ILE A HG22 8  
ATOM 8468  H HG23 . ILE A 1 30 ? 12.748 5.784   20.343 1.00 0.00 ? 30 ILE A HG23 8  
ATOM 8469  H HD11 . ILE A 1 30 ? 12.241 1.366   20.577 1.00 0.00 ? 30 ILE A HD11 8  
ATOM 8470  H HD12 . ILE A 1 30 ? 11.003 2.539   21.031 1.00 0.00 ? 30 ILE A HD12 8  
ATOM 8471  H HD13 . ILE A 1 30 ? 10.649 1.307   19.820 1.00 0.00 ? 30 ILE A HD13 8  
ATOM 8472  N N    . ASP A 1 31 ? 9.814  6.813   18.824 1.00 0.00 ? 31 ASP A N    8  
ATOM 8473  C CA   . ASP A 1 31 ? 9.514  8.228   19.004 1.00 0.00 ? 31 ASP A CA   8  
ATOM 8474  C C    . ASP A 1 31 ? 8.111  8.555   18.502 1.00 0.00 ? 31 ASP A C    8  
ATOM 8475  O O    . ASP A 1 31 ? 7.255  8.999   19.267 1.00 0.00 ? 31 ASP A O    8  
ATOM 8476  C CB   . ASP A 1 31 ? 10.545 9.087   18.271 1.00 0.00 ? 31 ASP A CB   8  
ATOM 8477  C CG   . ASP A 1 31 ? 11.076 10.217  19.132 1.00 0.00 ? 31 ASP A CG   8  
ATOM 8478  O OD1  . ASP A 1 31 ? 11.875 9.937   20.050 1.00 0.00 ? 31 ASP A OD1  8  
ATOM 8479  O OD2  . ASP A 1 31 ? 10.691 11.380  18.889 1.00 0.00 ? 31 ASP A OD2  8  
ATOM 8480  H H    . ASP A 1 31 ? 10.165 6.504   17.962 1.00 0.00 ? 31 ASP A H    8  
ATOM 8481  H HA   . ASP A 1 31 ? 9.564  8.446   20.061 1.00 0.00 ? 31 ASP A HA   8  
ATOM 8482  H HB2  . ASP A 1 31 ? 11.377 8.465   17.974 1.00 0.00 ? 31 ASP A HB2  8  
ATOM 8483  H HB3  . ASP A 1 31 ? 10.088 9.514   17.391 1.00 0.00 ? 31 ASP A HB3  8  
ATOM 8484  N N    . ASP A 1 32 ? 7.884  8.334   17.212 1.00 0.00 ? 32 ASP A N    8  
ATOM 8485  C CA   . ASP A 1 32 ? 6.585  8.605   16.607 1.00 0.00 ? 32 ASP A CA   8  
ATOM 8486  C C    . ASP A 1 32 ? 5.454  8.132   17.513 1.00 0.00 ? 32 ASP A C    8  
ATOM 8487  O O    . ASP A 1 32 ? 4.452  8.827   17.689 1.00 0.00 ? 32 ASP A O    8  
ATOM 8488  C CB   . ASP A 1 32 ? 6.482  7.922   15.242 1.00 0.00 ? 32 ASP A CB   8  
ATOM 8489  C CG   . ASP A 1 32 ? 5.966  8.856   14.165 1.00 0.00 ? 32 ASP A CG   8  
ATOM 8490  O OD1  . ASP A 1 32 ? 4.731  8.961   14.013 1.00 0.00 ? 32 ASP A OD1  8  
ATOM 8491  O OD2  . ASP A 1 32 ? 6.797  9.481   13.473 1.00 0.00 ? 32 ASP A OD2  8  
ATOM 8492  H H    . ASP A 1 32 ? 8.607  7.980   16.653 1.00 0.00 ? 32 ASP A H    8  
ATOM 8493  H HA   . ASP A 1 32 ? 6.499  9.673   16.472 1.00 0.00 ? 32 ASP A HA   8  
ATOM 8494  H HB2  . ASP A 1 32 ? 7.460  7.570   14.948 1.00 0.00 ? 32 ASP A HB2  8  
ATOM 8495  H HB3  . ASP A 1 32 ? 5.809  7.082   15.318 1.00 0.00 ? 32 ASP A HB3  8  
ATOM 8496  N N    . LEU A 1 33 ? 5.619  6.944   18.086 1.00 0.00 ? 33 LEU A N    8  
ATOM 8497  C CA   . LEU A 1 33 ? 4.611  6.376   18.974 1.00 0.00 ? 33 LEU A CA   8  
ATOM 8498  C C    . LEU A 1 33 ? 4.991  6.589   20.436 1.00 0.00 ? 33 LEU A C    8  
ATOM 8499  O O    . LEU A 1 33 ? 4.153  6.474   21.329 1.00 0.00 ? 33 LEU A O    8  
ATOM 8500  C CB   . LEU A 1 33 ? 4.438  4.883   18.692 1.00 0.00 ? 33 LEU A CB   8  
ATOM 8501  C CG   . LEU A 1 33 ? 4.017  4.512   17.270 1.00 0.00 ? 33 LEU A CG   8  
ATOM 8502  C CD1  . LEU A 1 33 ? 3.568  3.061   17.207 1.00 0.00 ? 33 LEU A CD1  8  
ATOM 8503  C CD2  . LEU A 1 33 ? 2.911  5.437   16.783 1.00 0.00 ? 33 LEU A CD2  8  
ATOM 8504  H H    . LEU A 1 33 ? 6.438  6.437   17.908 1.00 0.00 ? 33 LEU A H    8  
ATOM 8505  H HA   . LEU A 1 33 ? 3.677  6.881   18.781 1.00 0.00 ? 33 LEU A HA   8  
ATOM 8506  H HB2  . LEU A 1 33 ? 5.380  4.397   18.895 1.00 0.00 ? 33 LEU A HB2  8  
ATOM 8507  H HB3  . LEU A 1 33 ? 3.686  4.504   19.370 1.00 0.00 ? 33 LEU A HB3  8  
ATOM 8508  H HG   . LEU A 1 33 ? 4.866  4.627   16.609 1.00 0.00 ? 33 LEU A HG   8  
ATOM 8509  H HD11 . LEU A 1 33 ? 3.403  2.779   16.178 1.00 0.00 ? 33 LEU A HD11 8  
ATOM 8510  H HD12 . LEU A 1 33 ? 2.649  2.944   17.763 1.00 0.00 ? 33 LEU A HD12 8  
ATOM 8511  H HD13 . LEU A 1 33 ? 4.331  2.429   17.637 1.00 0.00 ? 33 LEU A HD13 8  
ATOM 8512  H HD21 . LEU A 1 33 ? 3.342  6.235   16.196 1.00 0.00 ? 33 LEU A HD21 8  
ATOM 8513  H HD22 . LEU A 1 33 ? 2.392  5.856   17.633 1.00 0.00 ? 33 LEU A HD22 8  
ATOM 8514  H HD23 . LEU A 1 33 ? 2.216  4.877   16.175 1.00 0.00 ? 33 LEU A HD23 8  
ATOM 8515  N N    . GLY A 1 34 ? 6.262  6.902   20.672 1.00 0.00 ? 34 GLY A N    8  
ATOM 8516  C CA   . GLY A 1 34 ? 6.731  7.128   22.027 1.00 0.00 ? 34 GLY A CA   8  
ATOM 8517  C C    . GLY A 1 34 ? 6.879  5.839   22.812 1.00 0.00 ? 34 GLY A C    8  
ATOM 8518  O O    . GLY A 1 34 ? 6.694  5.821   24.028 1.00 0.00 ? 34 GLY A O    8  
ATOM 8519  H H    . GLY A 1 34 ? 6.886  6.979   19.920 1.00 0.00 ? 34 GLY A H    8  
ATOM 8520  H HA2  . GLY A 1 34 ? 7.688  7.625   21.987 1.00 0.00 ? 34 GLY A HA2  8  
ATOM 8521  H HA3  . GLY A 1 34 ? 6.025  7.767   22.538 1.00 0.00 ? 34 GLY A HA3  8  
ATOM 8522  N N    . ALA A 1 35 ? 7.213  4.759   22.114 1.00 0.00 ? 35 ALA A N    8  
ATOM 8523  C CA   . ALA A 1 35 ? 7.387  3.460   22.753 1.00 0.00 ? 35 ALA A CA   8  
ATOM 8524  C C    . ALA A 1 35 ? 8.861  3.163   23.002 1.00 0.00 ? 35 ALA A C    8  
ATOM 8525  O O    . ALA A 1 35 ? 9.736  3.920   22.581 1.00 0.00 ? 35 ALA A O    8  
ATOM 8526  C CB   . ALA A 1 35 ? 6.762  2.365   21.902 1.00 0.00 ? 35 ALA A CB   8  
ATOM 8527  H H    . ALA A 1 35 ? 7.347  4.837   21.147 1.00 0.00 ? 35 ALA A H    8  
ATOM 8528  H HA   . ALA A 1 35 ? 6.870  3.483   23.702 1.00 0.00 ? 35 ALA A HA   8  
ATOM 8529  H HB1  . ALA A 1 35 ? 6.315  1.621   22.545 1.00 0.00 ? 35 ALA A HB1  8  
ATOM 8530  H HB2  . ALA A 1 35 ? 6.003  2.794   21.265 1.00 0.00 ? 35 ALA A HB2  8  
ATOM 8531  H HB3  . ALA A 1 35 ? 7.525  1.903   21.293 1.00 0.00 ? 35 ALA A HB3  8  
ATOM 8532  N N    . ASP A 1 36 ? 9.130  2.058   23.688 1.00 0.00 ? 36 ASP A N    8  
ATOM 8533  C CA   . ASP A 1 36 ? 10.500 1.661   23.992 1.00 0.00 ? 36 ASP A CA   8  
ATOM 8534  C C    . ASP A 1 36 ? 10.873 0.382   23.250 1.00 0.00 ? 36 ASP A C    8  
ATOM 8535  O O    . ASP A 1 36 ? 10.070 -0.164  22.492 1.00 0.00 ? 36 ASP A O    8  
ATOM 8536  C CB   . ASP A 1 36 ? 10.672 1.459   25.499 1.00 0.00 ? 36 ASP A CB   8  
ATOM 8537  C CG   . ASP A 1 36 ? 9.566  0.615   26.100 1.00 0.00 ? 36 ASP A CG   8  
ATOM 8538  O OD1  . ASP A 1 36 ? 8.988  -0.215  25.368 1.00 0.00 ? 36 ASP A OD1  8  
ATOM 8539  O OD2  . ASP A 1 36 ? 9.278  0.784   27.304 1.00 0.00 ? 36 ASP A OD2  8  
ATOM 8540  H H    . ASP A 1 36 ? 8.389  1.495   23.997 1.00 0.00 ? 36 ASP A H    8  
ATOM 8541  H HA   . ASP A 1 36 ? 11.155 2.455   23.668 1.00 0.00 ? 36 ASP A HA   8  
ATOM 8542  H HB2  . ASP A 1 36 ? 11.616 0.967   25.684 1.00 0.00 ? 36 ASP A HB2  8  
ATOM 8543  H HB3  . ASP A 1 36 ? 10.671 2.423   25.987 1.00 0.00 ? 36 ASP A HB3  8  
ATOM 8544  N N    . SER A 1 37 ? 12.095 -0.091  23.471 1.00 0.00 ? 37 SER A N    8  
ATOM 8545  C CA   . SER A 1 37 ? 12.576 -1.303  22.819 1.00 0.00 ? 37 SER A CA   8  
ATOM 8546  C C    . SER A 1 37 ? 11.586 -2.448  23.003 1.00 0.00 ? 37 SER A C    8  
ATOM 8547  O O    . SER A 1 37 ? 11.446 -3.310  22.134 1.00 0.00 ? 37 SER A O    8  
ATOM 8548  C CB   . SER A 1 37 ? 13.943 -1.700  23.379 1.00 0.00 ? 37 SER A CB   8  
ATOM 8549  O OG   . SER A 1 37 ? 14.416 -2.891  22.773 1.00 0.00 ? 37 SER A OG   8  
ATOM 8550  H H    . SER A 1 37 ? 12.688 0.390   24.086 1.00 0.00 ? 37 SER A H    8  
ATOM 8551  H HA   . SER A 1 37 ? 12.676 -1.094  21.764 1.00 0.00 ? 37 SER A HA   8  
ATOM 8552  H HB2  . SER A 1 37 ? 14.651 -0.909  23.189 1.00 0.00 ? 37 SER A HB2  8  
ATOM 8553  H HB3  . SER A 1 37 ? 13.860 -1.861  24.444 1.00 0.00 ? 37 SER A HB3  8  
ATOM 8554  H HG   . SER A 1 37 ? 14.222 -3.639  23.343 1.00 0.00 ? 37 SER A HG   8  
ATOM 8555  N N    . LEU A 1 38 ? 10.900 -2.452  24.141 1.00 0.00 ? 38 LEU A N    8  
ATOM 8556  C CA   . LEU A 1 38 ? 9.921  -3.491  24.441 1.00 0.00 ? 38 LEU A CA   8  
ATOM 8557  C C    . LEU A 1 38 ? 8.890  -3.607  23.323 1.00 0.00 ? 38 LEU A C    8  
ATOM 8558  O O    . LEU A 1 38 ? 8.644  -4.695  22.802 1.00 0.00 ? 38 LEU A O    8  
ATOM 8559  C CB   . LEU A 1 38 ? 9.220  -3.191  25.767 1.00 0.00 ? 38 LEU A CB   8  
ATOM 8560  C CG   . LEU A 1 38 ? 8.694  -4.403  26.537 1.00 0.00 ? 38 LEU A CG   8  
ATOM 8561  C CD1  . LEU A 1 38 ? 8.621  -4.100  28.026 1.00 0.00 ? 38 LEU A CD1  8  
ATOM 8562  C CD2  . LEU A 1 38 ? 7.329  -4.819  26.008 1.00 0.00 ? 38 LEU A CD2  8  
ATOM 8563  H H    . LEU A 1 38 ? 11.054 -1.739  24.795 1.00 0.00 ? 38 LEU A H    8  
ATOM 8564  H HA   . LEU A 1 38 ? 10.449 -4.429  24.526 1.00 0.00 ? 38 LEU A HA   8  
ATOM 8565  H HB2  . LEU A 1 38 ? 9.923  -2.676  26.403 1.00 0.00 ? 38 LEU A HB2  8  
ATOM 8566  H HB3  . LEU A 1 38 ? 8.383  -2.541  25.559 1.00 0.00 ? 38 LEU A HB3  8  
ATOM 8567  H HG   . LEU A 1 38 ? 9.374  -5.233  26.399 1.00 0.00 ? 38 LEU A HG   8  
ATOM 8568  H HD11 . LEU A 1 38 ? 9.523  -3.594  28.334 1.00 0.00 ? 38 LEU A HD11 8  
ATOM 8569  H HD12 . LEU A 1 38 ? 8.519  -5.023  28.577 1.00 0.00 ? 38 LEU A HD12 8  
ATOM 8570  H HD13 . LEU A 1 38 ? 7.768  -3.467  28.222 1.00 0.00 ? 38 LEU A HD13 8  
ATOM 8571  H HD21 . LEU A 1 38 ? 7.100  -4.251  25.119 1.00 0.00 ? 38 LEU A HD21 8  
ATOM 8572  H HD22 . LEU A 1 38 ? 6.578  -4.628  26.761 1.00 0.00 ? 38 LEU A HD22 8  
ATOM 8573  H HD23 . LEU A 1 38 ? 7.341  -5.873  25.770 1.00 0.00 ? 38 LEU A HD23 8  
ATOM 8574  N N    . ASP A 1 39 ? 8.291  -2.479  22.958 1.00 0.00 ? 39 ASP A N    8  
ATOM 8575  C CA   . ASP A 1 39 ? 7.288  -2.453  21.900 1.00 0.00 ? 39 ASP A CA   8  
ATOM 8576  C C    . ASP A 1 39 ? 7.841  -3.059  20.613 1.00 0.00 ? 39 ASP A C    8  
ATOM 8577  O O    . ASP A 1 39 ? 7.215  -3.927  20.004 1.00 0.00 ? 39 ASP A O    8  
ATOM 8578  C CB   . ASP A 1 39 ? 6.823  -1.019  21.644 1.00 0.00 ? 39 ASP A CB   8  
ATOM 8579  C CG   . ASP A 1 39 ? 5.951  -0.905  20.408 1.00 0.00 ? 39 ASP A CG   8  
ATOM 8580  O OD1  . ASP A 1 39 ? 4.998  -1.701  20.279 1.00 0.00 ? 39 ASP A OD1  8  
ATOM 8581  O OD2  . ASP A 1 39 ? 6.222  -0.018  19.572 1.00 0.00 ? 39 ASP A OD2  8  
ATOM 8582  H H    . ASP A 1 39 ? 8.529  -1.643  23.412 1.00 0.00 ? 39 ASP A H    8  
ATOM 8583  H HA   . ASP A 1 39 ? 6.445  -3.042  22.227 1.00 0.00 ? 39 ASP A HA   8  
ATOM 8584  H HB2  . ASP A 1 39 ? 6.254  -0.674  22.495 1.00 0.00 ? 39 ASP A HB2  8  
ATOM 8585  H HB3  . ASP A 1 39 ? 7.687  -0.385  21.513 1.00 0.00 ? 39 ASP A HB3  8  
ATOM 8586  N N    . THR A 1 40 ? 9.017  -2.595  20.204 1.00 0.00 ? 40 THR A N    8  
ATOM 8587  C CA   . THR A 1 40 ? 9.653  -3.088  18.989 1.00 0.00 ? 40 THR A CA   8  
ATOM 8588  C C    . THR A 1 40 ? 9.777  -4.608  19.012 1.00 0.00 ? 40 THR A C    8  
ATOM 8589  O O    . THR A 1 40 ? 9.380  -5.287  18.065 1.00 0.00 ? 40 THR A O    8  
ATOM 8590  C CB   . THR A 1 40 ? 11.052 -2.474  18.798 1.00 0.00 ? 40 THR A CB   8  
ATOM 8591  O OG1  . THR A 1 40 ? 11.027 -1.083  19.137 1.00 0.00 ? 40 THR A OG1  8  
ATOM 8592  C CG2  . THR A 1 40 ? 11.526 -2.642  17.362 1.00 0.00 ? 40 THR A CG2  8  
ATOM 8593  H H    . THR A 1 40 ? 9.467  -1.902  20.732 1.00 0.00 ? 40 THR A H    8  
ATOM 8594  H HA   . THR A 1 40 ? 9.038  -2.799  18.149 1.00 0.00 ? 40 THR A HA   8  
ATOM 8595  H HB   . THR A 1 40 ? 11.746 -2.984  19.452 1.00 0.00 ? 40 THR A HB   8  
ATOM 8596  H HG1  . THR A 1 40 ? 11.923 -0.775  19.295 1.00 0.00 ? 40 THR A HG1  8  
ATOM 8597  H HG21 . THR A 1 40 ? 10.879 -2.083  16.702 1.00 0.00 ? 40 THR A HG21 8  
ATOM 8598  H HG22 . THR A 1 40 ? 11.497 -3.687  17.094 1.00 0.00 ? 40 THR A HG22 8  
ATOM 8599  H HG23 . THR A 1 40 ? 12.537 -2.274  17.271 1.00 0.00 ? 40 THR A HG23 8  
ATOM 8600  N N    . VAL A 1 41 ? 10.329 -5.136  20.099 1.00 0.00 ? 41 VAL A N    8  
ATOM 8601  C CA   . VAL A 1 41 ? 10.504 -6.576  20.246 1.00 0.00 ? 41 VAL A CA   8  
ATOM 8602  C C    . VAL A 1 41 ? 9.177  -7.309  20.084 1.00 0.00 ? 41 VAL A C    8  
ATOM 8603  O O    . VAL A 1 41 ? 9.078  -8.272  19.325 1.00 0.00 ? 41 VAL A O    8  
ATOM 8604  C CB   . VAL A 1 41 ? 11.110 -6.931  21.617 1.00 0.00 ? 41 VAL A CB   8  
ATOM 8605  C CG1  . VAL A 1 41 ? 11.244 -8.439  21.767 1.00 0.00 ? 41 VAL A CG1  8  
ATOM 8606  C CG2  . VAL A 1 41 ? 12.457 -6.247  21.797 1.00 0.00 ? 41 VAL A CG2  8  
ATOM 8607  H H    . VAL A 1 41 ? 10.626 -4.542  20.821 1.00 0.00 ? 41 VAL A H    8  
ATOM 8608  H HA   . VAL A 1 41 ? 11.185 -6.910  19.477 1.00 0.00 ? 41 VAL A HA   8  
ATOM 8609  H HB   . VAL A 1 41 ? 10.442 -6.573  22.387 1.00 0.00 ? 41 VAL A HB   8  
ATOM 8610  H HG11 . VAL A 1 41 ? 11.104 -8.910  20.805 1.00 0.00 ? 41 VAL A HG11 8  
ATOM 8611  H HG12 . VAL A 1 41 ? 12.226 -8.677  22.147 1.00 0.00 ? 41 VAL A HG12 8  
ATOM 8612  H HG13 . VAL A 1 41 ? 10.494 -8.799  22.456 1.00 0.00 ? 41 VAL A HG13 8  
ATOM 8613  H HG21 . VAL A 1 41 ? 13.220 -6.819  21.290 1.00 0.00 ? 41 VAL A HG21 8  
ATOM 8614  H HG22 . VAL A 1 41 ? 12.415 -5.252  21.377 1.00 0.00 ? 41 VAL A HG22 8  
ATOM 8615  H HG23 . VAL A 1 41 ? 12.691 -6.184  22.849 1.00 0.00 ? 41 VAL A HG23 8  
ATOM 8616  N N    . GLU A 1 42 ? 8.159  -6.845  20.802 1.00 0.00 ? 42 GLU A N    8  
ATOM 8617  C CA   . GLU A 1 42 ? 6.837  -7.458  20.738 1.00 0.00 ? 42 GLU A CA   8  
ATOM 8618  C C    . GLU A 1 42 ? 6.349  -7.548  19.295 1.00 0.00 ? 42 GLU A C    8  
ATOM 8619  O O    . GLU A 1 42 ? 5.952  -8.616  18.827 1.00 0.00 ? 42 GLU A O    8  
ATOM 8620  C CB   . GLU A 1 42 ? 5.838  -6.659  21.577 1.00 0.00 ? 42 GLU A CB   8  
ATOM 8621  C CG   . GLU A 1 42 ? 5.927  -6.947  23.066 1.00 0.00 ? 42 GLU A CG   8  
ATOM 8622  C CD   . GLU A 1 42 ? 4.608  -6.732  23.782 1.00 0.00 ? 42 GLU A CD   8  
ATOM 8623  O OE1  . GLU A 1 42 ? 4.047  -5.622  23.671 1.00 0.00 ? 42 GLU A OE1  8  
ATOM 8624  O OE2  . GLU A 1 42 ? 4.136  -7.674  24.453 1.00 0.00 ? 42 GLU A OE2  8  
ATOM 8625  H H    . GLU A 1 42 ? 8.300  -6.074  21.390 1.00 0.00 ? 42 GLU A H    8  
ATOM 8626  H HA   . GLU A 1 42 ? 6.915  -8.457  21.141 1.00 0.00 ? 42 GLU A HA   8  
ATOM 8627  H HB2  . GLU A 1 42 ? 6.019  -5.605  21.423 1.00 0.00 ? 42 GLU A HB2  8  
ATOM 8628  H HB3  . GLU A 1 42 ? 4.838  -6.896  21.245 1.00 0.00 ? 42 GLU A HB3  8  
ATOM 8629  H HG2  . GLU A 1 42 ? 6.231  -7.974  23.204 1.00 0.00 ? 42 GLU A HG2  8  
ATOM 8630  H HG3  . GLU A 1 42 ? 6.667  -6.292  23.503 1.00 0.00 ? 42 GLU A HG3  8  
ATOM 8631  N N    . LEU A 1 43 ? 6.382  -6.420  18.595 1.00 0.00 ? 43 LEU A N    8  
ATOM 8632  C CA   . LEU A 1 43 ? 5.942  -6.369  17.204 1.00 0.00 ? 43 LEU A CA   8  
ATOM 8633  C C    . LEU A 1 43 ? 6.683  -7.401  16.361 1.00 0.00 ? 43 LEU A C    8  
ATOM 8634  O O    . LEU A 1 43 ? 6.069  -8.180  15.633 1.00 0.00 ? 43 LEU A O    8  
ATOM 8635  C CB   . LEU A 1 43 ? 6.165  -4.969  16.629 1.00 0.00 ? 43 LEU A CB   8  
ATOM 8636  C CG   . LEU A 1 43 ? 5.005  -3.985  16.790 1.00 0.00 ? 43 LEU A CG   8  
ATOM 8637  C CD1  . LEU A 1 43 ? 5.496  -2.553  16.646 1.00 0.00 ? 43 LEU A CD1  8  
ATOM 8638  C CD2  . LEU A 1 43 ? 3.911  -4.280  15.774 1.00 0.00 ? 43 LEU A CD2  8  
ATOM 8639  H H    . LEU A 1 43 ? 6.709  -5.601  19.021 1.00 0.00 ? 43 LEU A H    8  
ATOM 8640  H HA   . LEU A 1 43 ? 4.886  -6.595  17.182 1.00 0.00 ? 43 LEU A HA   8  
ATOM 8641  H HB2  . LEU A 1 43 ? 7.028  -4.544  17.118 1.00 0.00 ? 43 LEU A HB2  8  
ATOM 8642  H HB3  . LEU A 1 43 ? 6.367  -5.075  15.573 1.00 0.00 ? 43 LEU A HB3  8  
ATOM 8643  H HG   . LEU A 1 43 ? 4.582  -4.095  17.779 1.00 0.00 ? 43 LEU A HG   8  
ATOM 8644  H HD11 . LEU A 1 43 ? 4.675  -1.873  16.813 1.00 0.00 ? 43 LEU A HD11 8  
ATOM 8645  H HD12 . LEU A 1 43 ? 5.890  -2.406  15.652 1.00 0.00 ? 43 LEU A HD12 8  
ATOM 8646  H HD13 . LEU A 1 43 ? 6.273  -2.365  17.372 1.00 0.00 ? 43 LEU A HD13 8  
ATOM 8647  H HD21 . LEU A 1 43 ? 3.163  -3.502  15.814 1.00 0.00 ? 43 LEU A HD21 8  
ATOM 8648  H HD22 . LEU A 1 43 ? 3.453  -5.231  16.004 1.00 0.00 ? 43 LEU A HD22 8  
ATOM 8649  H HD23 . LEU A 1 43 ? 4.340  -4.317  14.784 1.00 0.00 ? 43 LEU A HD23 8  
ATOM 8650  N N    . VAL A 1 44 ? 8.009  -7.402  16.466 1.00 0.00 ? 44 VAL A N    8  
ATOM 8651  C CA   . VAL A 1 44 ? 8.834  -8.341  15.716 1.00 0.00 ? 44 VAL A CA   8  
ATOM 8652  C C    . VAL A 1 44 ? 8.374  -9.777  15.938 1.00 0.00 ? 44 VAL A C    8  
ATOM 8653  O O    . VAL A 1 44 ? 8.180  -10.532 14.986 1.00 0.00 ? 44 VAL A O    8  
ATOM 8654  C CB   . VAL A 1 44 ? 10.318 -8.223  16.110 1.00 0.00 ? 44 VAL A CB   8  
ATOM 8655  C CG1  . VAL A 1 44 ? 11.174 -9.142  15.252 1.00 0.00 ? 44 VAL A CG1  8  
ATOM 8656  C CG2  . VAL A 1 44 ? 10.787 -6.780  15.992 1.00 0.00 ? 44 VAL A CG2  8  
ATOM 8657  H H    . VAL A 1 44 ? 8.441  -6.757  17.063 1.00 0.00 ? 44 VAL A H    8  
ATOM 8658  H HA   . VAL A 1 44 ? 8.742  -8.102  14.666 1.00 0.00 ? 44 VAL A HA   8  
ATOM 8659  H HB   . VAL A 1 44 ? 10.422 -8.529  17.141 1.00 0.00 ? 44 VAL A HB   8  
ATOM 8660  H HG11 . VAL A 1 44 ? 12.103 -8.646  15.010 1.00 0.00 ? 44 VAL A HG11 8  
ATOM 8661  H HG12 . VAL A 1 44 ? 11.381 -10.052 15.795 1.00 0.00 ? 44 VAL A HG12 8  
ATOM 8662  H HG13 . VAL A 1 44 ? 10.645 -9.378  14.340 1.00 0.00 ? 44 VAL A HG13 8  
ATOM 8663  H HG21 . VAL A 1 44 ? 11.095 -6.422  16.963 1.00 0.00 ? 44 VAL A HG21 8  
ATOM 8664  H HG22 . VAL A 1 44 ? 11.622 -6.727  15.308 1.00 0.00 ? 44 VAL A HG22 8  
ATOM 8665  H HG23 . VAL A 1 44 ? 9.979  -6.168  15.621 1.00 0.00 ? 44 VAL A HG23 8  
ATOM 8666  N N    . MET A 1 45 ? 8.200  -10.148 17.202 1.00 0.00 ? 45 MET A N    8  
ATOM 8667  C CA   . MET A 1 45 ? 7.760  -11.494 17.550 1.00 0.00 ? 45 MET A CA   8  
ATOM 8668  C C    . MET A 1 45 ? 6.436  -11.826 16.869 1.00 0.00 ? 45 MET A C    8  
ATOM 8669  O O    . MET A 1 45 ? 6.302  -12.867 16.226 1.00 0.00 ? 45 MET A O    8  
ATOM 8670  C CB   . MET A 1 45 ? 7.615  -11.631 19.067 1.00 0.00 ? 45 MET A CB   8  
ATOM 8671  C CG   . MET A 1 45 ? 8.933  -11.525 19.815 1.00 0.00 ? 45 MET A CG   8  
ATOM 8672  S SD   . MET A 1 45 ? 9.779  -13.111 19.959 1.00 0.00 ? 45 MET A SD   8  
ATOM 8673  C CE   . MET A 1 45 ? 11.473 -12.572 20.182 1.00 0.00 ? 45 MET A CE   8  
ATOM 8674  H H    . MET A 1 45 ? 8.370  -9.501  17.919 1.00 0.00 ? 45 MET A H    8  
ATOM 8675  H HA   . MET A 1 45 ? 8.512  -12.188 17.206 1.00 0.00 ? 45 MET A HA   8  
ATOM 8676  H HB2  . MET A 1 45 ? 6.959  -10.852 19.425 1.00 0.00 ? 45 MET A HB2  8  
ATOM 8677  H HB3  . MET A 1 45 ? 7.175  -12.592 19.290 1.00 0.00 ? 45 MET A HB3  8  
ATOM 8678  H HG2  . MET A 1 45 ? 9.577  -10.837 19.289 1.00 0.00 ? 45 MET A HG2  8  
ATOM 8679  H HG3  . MET A 1 45 ? 8.738  -11.146 20.808 1.00 0.00 ? 45 MET A HG3  8  
ATOM 8680  H HE1  . MET A 1 45 ? 11.594 -12.167 21.176 1.00 0.00 ? 45 MET A HE1  8  
ATOM 8681  H HE2  . MET A 1 45 ? 12.138 -13.413 20.053 1.00 0.00 ? 45 MET A HE2  8  
ATOM 8682  H HE3  . MET A 1 45 ? 11.707 -11.811 19.452 1.00 0.00 ? 45 MET A HE3  8  
ATOM 8683  N N    . ALA A 1 46 ? 5.461  -10.935 17.014 1.00 0.00 ? 46 ALA A N    8  
ATOM 8684  C CA   . ALA A 1 46 ? 4.149  -11.134 16.411 1.00 0.00 ? 46 ALA A CA   8  
ATOM 8685  C C    . ALA A 1 46 ? 4.268  -11.416 14.918 1.00 0.00 ? 46 ALA A C    8  
ATOM 8686  O O    . ALA A 1 46 ? 3.668  -12.361 14.405 1.00 0.00 ? 46 ALA A O    8  
ATOM 8687  C CB   . ALA A 1 46 ? 3.268  -9.916  16.652 1.00 0.00 ? 46 ALA A CB   8  
ATOM 8688  H H    . ALA A 1 46 ? 5.628  -10.125 17.538 1.00 0.00 ? 46 ALA A H    8  
ATOM 8689  H HA   . ALA A 1 46 ? 3.685  -11.983 16.893 1.00 0.00 ? 46 ALA A HA   8  
ATOM 8690  H HB1  . ALA A 1 46 ? 2.330  -10.232 17.085 1.00 0.00 ? 46 ALA A HB1  8  
ATOM 8691  H HB2  . ALA A 1 46 ? 3.768  -9.239  17.328 1.00 0.00 ? 46 ALA A HB2  8  
ATOM 8692  H HB3  . ALA A 1 46 ? 3.081  -9.417  15.713 1.00 0.00 ? 46 ALA A HB3  8  
ATOM 8693  N N    . PHE A 1 47 ? 5.045  -10.591 14.224 1.00 0.00 ? 47 PHE A N    8  
ATOM 8694  C CA   . PHE A 1 47 ? 5.241  -10.751 12.788 1.00 0.00 ? 47 PHE A CA   8  
ATOM 8695  C C    . PHE A 1 47 ? 5.936  -12.074 12.478 1.00 0.00 ? 47 PHE A C    8  
ATOM 8696  O O    . PHE A 1 47 ? 5.663  -12.706 11.459 1.00 0.00 ? 47 PHE A O    8  
ATOM 8697  C CB   . PHE A 1 47 ? 6.063  -9.587  12.231 1.00 0.00 ? 47 PHE A CB   8  
ATOM 8698  C CG   . PHE A 1 47 ? 5.353  -8.265  12.299 1.00 0.00 ? 47 PHE A CG   8  
ATOM 8699  C CD1  . PHE A 1 47 ? 4.091  -8.113  11.747 1.00 0.00 ? 47 PHE A CD1  8  
ATOM 8700  C CD2  . PHE A 1 47 ? 5.947  -7.175  12.914 1.00 0.00 ? 47 PHE A CD2  8  
ATOM 8701  C CE1  . PHE A 1 47 ? 3.436  -6.897  11.807 1.00 0.00 ? 47 PHE A CE1  8  
ATOM 8702  C CE2  . PHE A 1 47 ? 5.297  -5.957  12.978 1.00 0.00 ? 47 PHE A CE2  8  
ATOM 8703  C CZ   . PHE A 1 47 ? 4.039  -5.819  12.424 1.00 0.00 ? 47 PHE A CZ   8  
ATOM 8704  H H    . PHE A 1 47 ? 5.496  -9.855  14.689 1.00 0.00 ? 47 PHE A H    8  
ATOM 8705  H HA   . PHE A 1 47 ? 4.269  -10.751 12.320 1.00 0.00 ? 47 PHE A HA   8  
ATOM 8706  H HB2  . PHE A 1 47 ? 6.979  -9.500  12.796 1.00 0.00 ? 47 PHE A HB2  8  
ATOM 8707  H HB3  . PHE A 1 47 ? 6.300  -9.786  11.197 1.00 0.00 ? 47 PHE A HB3  8  
ATOM 8708  H HD1  . PHE A 1 47 ? 3.618  -8.955  11.265 1.00 0.00 ? 47 PHE A HD1  8  
ATOM 8709  H HD2  . PHE A 1 47 ? 6.932  -7.283  13.348 1.00 0.00 ? 47 PHE A HD2  8  
ATOM 8710  H HE1  . PHE A 1 47 ? 2.453  -6.791  11.373 1.00 0.00 ? 47 PHE A HE1  8  
ATOM 8711  H HE2  . PHE A 1 47 ? 5.771  -5.116  13.461 1.00 0.00 ? 47 PHE A HE2  8  
ATOM 8712  H HZ   . PHE A 1 47 ? 3.530  -4.868  12.472 1.00 0.00 ? 47 PHE A HZ   8  
ATOM 8713  N N    . GLU A 1 48 ? 6.836  -12.485 13.366 1.00 0.00 ? 48 GLU A N    8  
ATOM 8714  C CA   . GLU A 1 48 ? 7.571  -13.731 13.187 1.00 0.00 ? 48 GLU A CA   8  
ATOM 8715  C C    . GLU A 1 48 ? 6.631  -14.932 13.254 1.00 0.00 ? 48 GLU A C    8  
ATOM 8716  O O    . GLU A 1 48 ? 6.748  -15.868 12.465 1.00 0.00 ? 48 GLU A O    8  
ATOM 8717  C CB   . GLU A 1 48 ? 8.662  -13.863 14.252 1.00 0.00 ? 48 GLU A CB   8  
ATOM 8718  C CG   . GLU A 1 48 ? 9.804  -12.876 14.079 1.00 0.00 ? 48 GLU A CG   8  
ATOM 8719  C CD   . GLU A 1 48 ? 10.893 -13.399 13.163 1.00 0.00 ? 48 GLU A CD   8  
ATOM 8720  O OE1  . GLU A 1 48 ? 11.622 -14.326 13.575 1.00 0.00 ? 48 GLU A OE1  8  
ATOM 8721  O OE2  . GLU A 1 48 ? 11.016 -12.881 12.033 1.00 0.00 ? 48 GLU A OE2  8  
ATOM 8722  H H    . GLU A 1 48 ? 7.009  -11.937 14.160 1.00 0.00 ? 48 GLU A H    8  
ATOM 8723  H HA   . GLU A 1 48 ? 8.034  -13.706 12.212 1.00 0.00 ? 48 GLU A HA   8  
ATOM 8724  H HB2  . GLU A 1 48 ? 8.220  -13.705 15.225 1.00 0.00 ? 48 GLU A HB2  8  
ATOM 8725  H HB3  . GLU A 1 48 ? 9.069  -14.863 14.210 1.00 0.00 ? 48 GLU A HB3  8  
ATOM 8726  H HG2  . GLU A 1 48 ? 9.412  -11.961 13.661 1.00 0.00 ? 48 GLU A HG2  8  
ATOM 8727  H HG3  . GLU A 1 48 ? 10.236 -12.672 15.048 1.00 0.00 ? 48 GLU A HG3  8  
ATOM 8728  N N    . GLU A 1 49 ? 5.701  -14.895 14.203 1.00 0.00 ? 49 GLU A N    8  
ATOM 8729  C CA   . GLU A 1 49 ? 4.742  -15.980 14.374 1.00 0.00 ? 49 GLU A CA   8  
ATOM 8730  C C    . GLU A 1 49 ? 3.627  -15.890 13.336 1.00 0.00 ? 49 GLU A C    8  
ATOM 8731  O O    . GLU A 1 49 ? 3.008  -16.894 12.987 1.00 0.00 ? 49 GLU A O    8  
ATOM 8732  C CB   . GLU A 1 49 ? 4.146  -15.947 15.783 1.00 0.00 ? 49 GLU A CB   8  
ATOM 8733  C CG   . GLU A 1 49 ? 3.281  -17.154 16.107 1.00 0.00 ? 49 GLU A CG   8  
ATOM 8734  C CD   . GLU A 1 49 ? 2.291  -16.879 17.222 1.00 0.00 ? 49 GLU A CD   8  
ATOM 8735  O OE1  . GLU A 1 49 ? 2.720  -16.820 18.394 1.00 0.00 ? 49 GLU A OE1  8  
ATOM 8736  O OE2  . GLU A 1 49 ? 1.089  -16.724 16.924 1.00 0.00 ? 49 GLU A OE2  8  
ATOM 8737  H H    . GLU A 1 49 ? 5.658  -14.121 14.802 1.00 0.00 ? 49 GLU A H    8  
ATOM 8738  H HA   . GLU A 1 49 ? 5.269  -16.913 14.238 1.00 0.00 ? 49 GLU A HA   8  
ATOM 8739  H HB2  . GLU A 1 49 ? 4.952  -15.904 16.501 1.00 0.00 ? 49 GLU A HB2  8  
ATOM 8740  H HB3  . GLU A 1 49 ? 3.540  -15.059 15.883 1.00 0.00 ? 49 GLU A HB3  8  
ATOM 8741  H HG2  . GLU A 1 49 ? 2.732  -17.435 15.221 1.00 0.00 ? 49 GLU A HG2  8  
ATOM 8742  H HG3  . GLU A 1 49 ? 3.922  -17.970 16.406 1.00 0.00 ? 49 GLU A HG3  8  
ATOM 8743  N N    . GLU A 1 50 ? 3.377  -14.679 12.848 1.00 0.00 ? 50 GLU A N    8  
ATOM 8744  C CA   . GLU A 1 50 ? 2.336  -14.457 11.851 1.00 0.00 ? 50 GLU A CA   8  
ATOM 8745  C C    . GLU A 1 50 ? 2.814  -14.875 10.463 1.00 0.00 ? 50 GLU A C    8  
ATOM 8746  O O    . GLU A 1 50 ? 2.182  -15.695 9.798  1.00 0.00 ? 50 GLU A O    8  
ATOM 8747  C CB   . GLU A 1 50 ? 1.918  -12.986 11.837 1.00 0.00 ? 50 GLU A CB   8  
ATOM 8748  C CG   . GLU A 1 50 ? 0.580  -12.740 11.160 1.00 0.00 ? 50 GLU A CG   8  
ATOM 8749  C CD   . GLU A 1 50 ? -0.522 -13.627 11.706 1.00 0.00 ? 50 GLU A CD   8  
ATOM 8750  O OE1  . GLU A 1 50 ? -0.631 -13.743 12.945 1.00 0.00 ? 50 GLU A OE1  8  
ATOM 8751  O OE2  . GLU A 1 50 ? -1.274 -14.207 10.895 1.00 0.00 ? 50 GLU A OE2  8  
ATOM 8752  H H    . GLU A 1 50 ? 3.905  -13.917 13.166 1.00 0.00 ? 50 GLU A H    8  
ATOM 8753  H HA   . GLU A 1 50 ? 1.484  -15.062 12.122 1.00 0.00 ? 50 GLU A HA   8  
ATOM 8754  H HB2  . GLU A 1 50 ? 1.853  -12.632 12.856 1.00 0.00 ? 50 GLU A HB2  8  
ATOM 8755  H HB3  . GLU A 1 50 ? 2.671  -12.415 11.315 1.00 0.00 ? 50 GLU A HB3  8  
ATOM 8756  H HG2  . GLU A 1 50 ? 0.298  -11.709 11.312 1.00 0.00 ? 50 GLU A HG2  8  
ATOM 8757  H HG3  . GLU A 1 50 ? 0.685  -12.931 10.103 1.00 0.00 ? 50 GLU A HG3  8  
ATOM 8758  N N    . PHE A 1 51 ? 3.934  -14.304 10.033 1.00 0.00 ? 51 PHE A N    8  
ATOM 8759  C CA   . PHE A 1 51 ? 4.496  -14.614 8.724  1.00 0.00 ? 51 PHE A CA   8  
ATOM 8760  C C    . PHE A 1 51 ? 5.263  -15.933 8.761  1.00 0.00 ? 51 PHE A C    8  
ATOM 8761  O O    . PHE A 1 51 ? 5.428  -16.597 7.738  1.00 0.00 ? 51 PHE A O    8  
ATOM 8762  C CB   . PHE A 1 51 ? 5.421  -13.486 8.262  1.00 0.00 ? 51 PHE A CB   8  
ATOM 8763  C CG   . PHE A 1 51 ? 4.686  -12.267 7.783  1.00 0.00 ? 51 PHE A CG   8  
ATOM 8764  C CD1  . PHE A 1 51 ? 4.131  -11.376 8.688  1.00 0.00 ? 51 PHE A CD1  8  
ATOM 8765  C CD2  . PHE A 1 51 ? 4.551  -12.011 6.428  1.00 0.00 ? 51 PHE A CD2  8  
ATOM 8766  C CE1  . PHE A 1 51 ? 3.453  -10.254 8.249  1.00 0.00 ? 51 PHE A CE1  8  
ATOM 8767  C CE2  . PHE A 1 51 ? 3.874  -10.890 5.984  1.00 0.00 ? 51 PHE A CE2  8  
ATOM 8768  C CZ   . PHE A 1 51 ? 3.326  -10.010 6.896  1.00 0.00 ? 51 PHE A CZ   8  
ATOM 8769  H H    . PHE A 1 51 ? 4.393  -13.657 10.609 1.00 0.00 ? 51 PHE A H    8  
ATOM 8770  H HA   . PHE A 1 51 ? 3.679  -14.707 8.026  1.00 0.00 ? 51 PHE A HA   8  
ATOM 8771  H HB2  . PHE A 1 51 ? 6.054  -13.189 9.084  1.00 0.00 ? 51 PHE A HB2  8  
ATOM 8772  H HB3  . PHE A 1 51 ? 6.036  -13.845 7.450  1.00 0.00 ? 51 PHE A HB3  8  
ATOM 8773  H HD1  . PHE A 1 51 ? 4.230  -11.565 9.746  1.00 0.00 ? 51 PHE A HD1  8  
ATOM 8774  H HD2  . PHE A 1 51 ? 4.980  -12.699 5.713  1.00 0.00 ? 51 PHE A HD2  8  
ATOM 8775  H HE1  . PHE A 1 51 ? 3.026  -9.568  8.965  1.00 0.00 ? 51 PHE A HE1  8  
ATOM 8776  H HE2  . PHE A 1 51 ? 3.777  -10.703 4.925  1.00 0.00 ? 51 PHE A HE2  8  
ATOM 8777  H HZ   . PHE A 1 51 ? 2.797  -9.135  6.551  1.00 0.00 ? 51 PHE A HZ   8  
ATOM 8778  N N    . GLY A 1 52 ? 5.732  -16.306 9.948  1.00 0.00 ? 52 GLY A N    8  
ATOM 8779  C CA   . GLY A 1 52 ? 6.476  -17.542 10.097 1.00 0.00 ? 52 GLY A CA   8  
ATOM 8780  C C    . GLY A 1 52 ? 7.913  -17.414 9.629  1.00 0.00 ? 52 GLY A C    8  
ATOM 8781  O O    . GLY A 1 52 ? 8.447  -18.318 8.988  1.00 0.00 ? 52 GLY A O    8  
ATOM 8782  H H    . GLY A 1 52 ? 5.570  -15.736 10.729 1.00 0.00 ? 52 GLY A H    8  
ATOM 8783  H HA2  . GLY A 1 52 ? 6.472  -17.829 11.138 1.00 0.00 ? 52 GLY A HA2  8  
ATOM 8784  H HA3  . GLY A 1 52 ? 5.989  -18.314 9.519  1.00 0.00 ? 52 GLY A HA3  8  
ATOM 8785  N N    . VAL A 1 53 ? 8.539  -16.286 9.950  1.00 0.00 ? 53 VAL A N    8  
ATOM 8786  C CA   . VAL A 1 53 ? 9.922  -16.042 9.557  1.00 0.00 ? 53 VAL A CA   8  
ATOM 8787  C C    . VAL A 1 53 ? 10.849 -16.066 10.768 1.00 0.00 ? 53 VAL A C    8  
ATOM 8788  O O    . VAL A 1 53 ? 10.405 -15.904 11.904 1.00 0.00 ? 53 VAL A O    8  
ATOM 8789  C CB   . VAL A 1 53 ? 10.071 -14.689 8.837  1.00 0.00 ? 53 VAL A CB   8  
ATOM 8790  C CG1  . VAL A 1 53 ? 9.419  -14.740 7.464  1.00 0.00 ? 53 VAL A CG1  8  
ATOM 8791  C CG2  . VAL A 1 53 ? 9.474  -13.570 9.678  1.00 0.00 ? 53 VAL A CG2  8  
ATOM 8792  H H    . VAL A 1 53 ? 8.060  -15.602 10.462 1.00 0.00 ? 53 VAL A H    8  
ATOM 8793  H HA   . VAL A 1 53 ? 10.218 -16.824 8.874  1.00 0.00 ? 53 VAL A HA   8  
ATOM 8794  H HB   . VAL A 1 53 ? 11.124 -14.488 8.705  1.00 0.00 ? 53 VAL A HB   8  
ATOM 8795  H HG11 . VAL A 1 53 ? 9.741  -15.632 6.947  1.00 0.00 ? 53 VAL A HG11 8  
ATOM 8796  H HG12 . VAL A 1 53 ? 8.345  -14.754 7.575  1.00 0.00 ? 53 VAL A HG12 8  
ATOM 8797  H HG13 . VAL A 1 53 ? 9.712  -13.870 6.894  1.00 0.00 ? 53 VAL A HG13 8  
ATOM 8798  H HG21 . VAL A 1 53 ? 9.296  -13.930 10.681 1.00 0.00 ? 53 VAL A HG21 8  
ATOM 8799  H HG22 . VAL A 1 53 ? 10.163 -12.738 9.711  1.00 0.00 ? 53 VAL A HG22 8  
ATOM 8800  H HG23 . VAL A 1 53 ? 8.542  -13.248 9.240  1.00 0.00 ? 53 VAL A HG23 8  
ATOM 8801  N N    . GLU A 1 54 ? 12.138 -16.269 10.515 1.00 0.00 ? 54 GLU A N    8  
ATOM 8802  C CA   . GLU A 1 54 ? 13.128 -16.314 11.585 1.00 0.00 ? 54 GLU A CA   8  
ATOM 8803  C C    . GLU A 1 54 ? 14.161 -15.204 11.418 1.00 0.00 ? 54 GLU A C    8  
ATOM 8804  O O    . GLU A 1 54 ? 14.859 -15.139 10.405 1.00 0.00 ? 54 GLU A O    8  
ATOM 8805  C CB   . GLU A 1 54 ? 13.825 -17.676 11.608 1.00 0.00 ? 54 GLU A CB   8  
ATOM 8806  C CG   . GLU A 1 54 ? 12.955 -18.796 12.153 1.00 0.00 ? 54 GLU A CG   8  
ATOM 8807  C CD   . GLU A 1 54 ? 13.702 -20.111 12.268 1.00 0.00 ? 54 GLU A CD   8  
ATOM 8808  O OE1  . GLU A 1 54 ? 14.023 -20.705 11.218 1.00 0.00 ? 54 GLU A OE1  8  
ATOM 8809  O OE2  . GLU A 1 54 ? 13.964 -20.546 13.410 1.00 0.00 ? 54 GLU A OE2  8  
ATOM 8810  H H    . GLU A 1 54 ? 12.430 -16.392 9.588  1.00 0.00 ? 54 GLU A H    8  
ATOM 8811  H HA   . GLU A 1 54 ? 12.610 -16.170 12.522 1.00 0.00 ? 54 GLU A HA   8  
ATOM 8812  H HB2  . GLU A 1 54 ? 14.119 -17.934 10.601 1.00 0.00 ? 54 GLU A HB2  8  
ATOM 8813  H HB3  . GLU A 1 54 ? 14.709 -17.604 12.223 1.00 0.00 ? 54 GLU A HB3  8  
ATOM 8814  H HG2  . GLU A 1 54 ? 12.601 -18.515 13.134 1.00 0.00 ? 54 GLU A HG2  8  
ATOM 8815  H HG3  . GLU A 1 54 ? 12.112 -18.935 11.493 1.00 0.00 ? 54 GLU A HG3  8  
ATOM 8816  N N    . ILE A 1 55 ? 14.253 -14.334 12.418 1.00 0.00 ? 55 ILE A N    8  
ATOM 8817  C CA   . ILE A 1 55 ? 15.200 -13.227 12.382 1.00 0.00 ? 55 ILE A CA   8  
ATOM 8818  C C    . ILE A 1 55 ? 16.080 -13.216 13.627 1.00 0.00 ? 55 ILE A C    8  
ATOM 8819  O O    . ILE A 1 55 ? 15.694 -13.692 14.695 1.00 0.00 ? 55 ILE A O    8  
ATOM 8820  C CB   . ILE A 1 55 ? 14.479 -11.871 12.265 1.00 0.00 ? 55 ILE A CB   8  
ATOM 8821  C CG1  . ILE A 1 55 ? 13.536 -11.667 13.453 1.00 0.00 ? 55 ILE A CG1  8  
ATOM 8822  C CG2  . ILE A 1 55 ? 13.712 -11.791 10.953 1.00 0.00 ? 55 ILE A CG2  8  
ATOM 8823  C CD1  . ILE A 1 55 ? 14.184 -10.962 14.624 1.00 0.00 ? 55 ILE A CD1  8  
ATOM 8824  H H    . ILE A 1 55 ? 13.669 -14.439 13.198 1.00 0.00 ? 55 ILE A H    8  
ATOM 8825  H HA   . ILE A 1 55 ? 15.828 -13.354 11.511 1.00 0.00 ? 55 ILE A HA   8  
ATOM 8826  H HB   . ILE A 1 55 ? 15.224 -11.091 12.267 1.00 0.00 ? 55 ILE A HB   8  
ATOM 8827  H HG12 . ILE A 1 55 ? 12.692 -11.075 13.137 1.00 0.00 ? 55 ILE A HG12 8  
ATOM 8828  H HG13 . ILE A 1 55 ? 13.187 -12.630 13.796 1.00 0.00 ? 55 ILE A HG13 8  
ATOM 8829  H HG21 . ILE A 1 55 ? 13.000 -12.601 10.902 1.00 0.00 ? 55 ILE A HG21 8  
ATOM 8830  H HG22 . ILE A 1 55 ? 13.188 -10.848 10.901 1.00 0.00 ? 55 ILE A HG22 8  
ATOM 8831  H HG23 . ILE A 1 55 ? 14.403 -11.865 10.127 1.00 0.00 ? 55 ILE A HG23 8  
ATOM 8832  H HD11 . ILE A 1 55 ? 14.690 -11.686 15.246 1.00 0.00 ? 55 ILE A HD11 8  
ATOM 8833  H HD12 . ILE A 1 55 ? 14.898 -10.239 14.260 1.00 0.00 ? 55 ILE A HD12 8  
ATOM 8834  H HD13 . ILE A 1 55 ? 13.426 -10.458 15.205 1.00 0.00 ? 55 ILE A HD13 8  
ATOM 8835  N N    . PRO A 1 56 ? 17.293 -12.659 13.490 1.00 0.00 ? 56 PRO A N    8  
ATOM 8836  C CA   . PRO A 1 56 ? 18.252 -12.570 14.595 1.00 0.00 ? 56 PRO A CA   8  
ATOM 8837  C C    . PRO A 1 56 ? 17.811 -11.581 15.668 1.00 0.00 ? 56 PRO A C    8  
ATOM 8838  O O    . PRO A 1 56 ? 16.963 -10.723 15.424 1.00 0.00 ? 56 PRO A O    8  
ATOM 8839  C CB   . PRO A 1 56 ? 19.534 -12.084 13.913 1.00 0.00 ? 56 PRO A CB   8  
ATOM 8840  C CG   . PRO A 1 56 ? 19.065 -11.360 12.698 1.00 0.00 ? 56 PRO A CG   8  
ATOM 8841  C CD   . PRO A 1 56 ? 17.820 -12.072 12.247 1.00 0.00 ? 56 PRO A CD   8  
ATOM 8842  H HA   . PRO A 1 56 ? 18.428 -13.536 15.047 1.00 0.00 ? 56 PRO A HA   8  
ATOM 8843  H HB2  . PRO A 1 56 ? 20.073 -11.427 14.581 1.00 0.00 ? 56 PRO A HB2  8  
ATOM 8844  H HB3  . PRO A 1 56 ? 20.152 -12.930 13.654 1.00 0.00 ? 56 PRO A HB3  8  
ATOM 8845  H HG2  . PRO A 1 56 ? 18.841 -10.334 12.945 1.00 0.00 ? 56 PRO A HG2  8  
ATOM 8846  H HG3  . PRO A 1 56 ? 19.822 -11.406 11.929 1.00 0.00 ? 56 PRO A HG3  8  
ATOM 8847  H HD2  . PRO A 1 56 ? 17.117 -11.371 11.823 1.00 0.00 ? 56 PRO A HD2  8  
ATOM 8848  H HD3  . PRO A 1 56 ? 18.064 -12.843 11.531 1.00 0.00 ? 56 PRO A HD3  8  
ATOM 8849  N N    . ASP A 1 57 ? 18.392 -11.707 16.856 1.00 0.00 ? 57 ASP A N    8  
ATOM 8850  C CA   . ASP A 1 57 ? 18.059 -10.822 17.967 1.00 0.00 ? 57 ASP A CA   8  
ATOM 8851  C C    . ASP A 1 57 ? 18.659 -9.435  17.755 1.00 0.00 ? 57 ASP A C    8  
ATOM 8852  O O    . ASP A 1 57 ? 18.131 -8.438  18.249 1.00 0.00 ? 57 ASP A O    8  
ATOM 8853  C CB   . ASP A 1 57 ? 18.562 -11.413 19.285 1.00 0.00 ? 57 ASP A CB   8  
ATOM 8854  C CG   . ASP A 1 57 ? 17.807 -10.877 20.485 1.00 0.00 ? 57 ASP A CG   8  
ATOM 8855  O OD1  . ASP A 1 57 ? 16.582 -10.660 20.367 1.00 0.00 ? 57 ASP A OD1  8  
ATOM 8856  O OD2  . ASP A 1 57 ? 18.440 -10.675 21.542 1.00 0.00 ? 57 ASP A OD2  8  
ATOM 8857  H H    . ASP A 1 57 ? 19.061 -12.411 16.989 1.00 0.00 ? 57 ASP A H    8  
ATOM 8858  H HA   . ASP A 1 57 ? 16.985 -10.733 18.010 1.00 0.00 ? 57 ASP A HA   8  
ATOM 8859  H HB2  . ASP A 1 57 ? 18.445 -12.486 19.259 1.00 0.00 ? 57 ASP A HB2  8  
ATOM 8860  H HB3  . ASP A 1 57 ? 19.609 -11.172 19.404 1.00 0.00 ? 57 ASP A HB3  8  
ATOM 8861  N N    . ASP A 1 58 ? 19.763 -9.379  17.019 1.00 0.00 ? 58 ASP A N    8  
ATOM 8862  C CA   . ASP A 1 58 ? 20.434 -8.115  16.742 1.00 0.00 ? 58 ASP A CA   8  
ATOM 8863  C C    . ASP A 1 58 ? 19.639 -7.287  15.737 1.00 0.00 ? 58 ASP A C    8  
ATOM 8864  O O    . ASP A 1 58 ? 19.733 -6.060  15.716 1.00 0.00 ? 58 ASP A O    8  
ATOM 8865  C CB   . ASP A 1 58 ? 21.846 -8.368  16.210 1.00 0.00 ? 58 ASP A CB   8  
ATOM 8866  C CG   . ASP A 1 58 ? 22.784 -7.209  16.485 1.00 0.00 ? 58 ASP A CG   8  
ATOM 8867  O OD1  . ASP A 1 58 ? 22.785 -6.704  17.627 1.00 0.00 ? 58 ASP A OD1  8  
ATOM 8868  O OD2  . ASP A 1 58 ? 23.519 -6.809  15.558 1.00 0.00 ? 58 ASP A OD2  8  
ATOM 8869  H H    . ASP A 1 58 ? 20.135 -10.209 16.652 1.00 0.00 ? 58 ASP A H    8  
ATOM 8870  H HA   . ASP A 1 58 ? 20.502 -7.565  17.668 1.00 0.00 ? 58 ASP A HA   8  
ATOM 8871  H HB2  . ASP A 1 58 ? 22.248 -9.252  16.682 1.00 0.00 ? 58 ASP A HB2  8  
ATOM 8872  H HB3  . ASP A 1 58 ? 21.798 -8.525  15.142 1.00 0.00 ? 58 ASP A HB3  8  
ATOM 8873  N N    . ALA A 1 59 ? 18.858 -7.967  14.904 1.00 0.00 ? 59 ALA A N    8  
ATOM 8874  C CA   . ALA A 1 59 ? 18.047 -7.294  13.897 1.00 0.00 ? 59 ALA A CA   8  
ATOM 8875  C C    . ALA A 1 59 ? 17.139 -6.246  14.533 1.00 0.00 ? 59 ALA A C    8  
ATOM 8876  O O    . ALA A 1 59 ? 16.772 -5.260  13.896 1.00 0.00 ? 59 ALA A O    8  
ATOM 8877  C CB   . ALA A 1 59 ? 17.220 -8.309  13.121 1.00 0.00 ? 59 ALA A CB   8  
ATOM 8878  H H    . ALA A 1 59 ? 18.826 -8.944  14.969 1.00 0.00 ? 59 ALA A H    8  
ATOM 8879  H HA   . ALA A 1 59 ? 18.714 -6.804  13.203 1.00 0.00 ? 59 ALA A HA   8  
ATOM 8880  H HB1  . ALA A 1 59 ? 17.698 -8.512  12.174 1.00 0.00 ? 59 ALA A HB1  8  
ATOM 8881  H HB2  . ALA A 1 59 ? 17.146 -9.223  13.690 1.00 0.00 ? 59 ALA A HB2  8  
ATOM 8882  H HB3  . ALA A 1 59 ? 16.232 -7.911  12.948 1.00 0.00 ? 59 ALA A HB3  8  
ATOM 8883  N N    . ALA A 1 60 ? 16.781 -6.468  15.794 1.00 0.00 ? 60 ALA A N    8  
ATOM 8884  C CA   . ALA A 1 60 ? 15.918 -5.542  16.516 1.00 0.00 ? 60 ALA A CA   8  
ATOM 8885  C C    . ALA A 1 60 ? 16.515 -4.139  16.539 1.00 0.00 ? 60 ALA A C    8  
ATOM 8886  O O    . ALA A 1 60 ? 15.796 -3.151  16.683 1.00 0.00 ? 60 ALA A O    8  
ATOM 8887  C CB   . ALA A 1 60 ? 15.679 -6.039  17.934 1.00 0.00 ? 60 ALA A CB   8  
ATOM 8888  H H    . ALA A 1 60 ? 17.106 -7.272  16.249 1.00 0.00 ? 60 ALA A H    8  
ATOM 8889  H HA   . ALA A 1 60 ? 14.965 -5.508  16.008 1.00 0.00 ? 60 ALA A HA   8  
ATOM 8890  H HB1  . ALA A 1 60 ? 16.616 -6.051  18.473 1.00 0.00 ? 60 ALA A HB1  8  
ATOM 8891  H HB2  . ALA A 1 60 ? 14.984 -5.381  18.434 1.00 0.00 ? 60 ALA A HB2  8  
ATOM 8892  H HB3  . ALA A 1 60 ? 15.270 -7.038  17.901 1.00 0.00 ? 60 ALA A HB3  8  
ATOM 8893  N N    . GLU A 1 61 ? 17.835 -4.060  16.398 1.00 0.00 ? 61 GLU A N    8  
ATOM 8894  C CA   . GLU A 1 61 ? 18.527 -2.777  16.405 1.00 0.00 ? 61 GLU A CA   8  
ATOM 8895  C C    . GLU A 1 61 ? 18.450 -2.109  15.034 1.00 0.00 ? 61 GLU A C    8  
ATOM 8896  O O    . GLU A 1 61 ? 18.526 -0.886  14.921 1.00 0.00 ? 61 GLU A O    8  
ATOM 8897  C CB   . GLU A 1 61 ? 19.991 -2.964  16.810 1.00 0.00 ? 61 GLU A CB   8  
ATOM 8898  C CG   . GLU A 1 61 ? 20.196 -3.077  18.312 1.00 0.00 ? 61 GLU A CG   8  
ATOM 8899  C CD   . GLU A 1 61 ? 19.842 -1.800  19.047 1.00 0.00 ? 61 GLU A CD   8  
ATOM 8900  O OE1  . GLU A 1 61 ? 20.735 -0.944  19.216 1.00 0.00 ? 61 GLU A OE1  8  
ATOM 8901  O OE2  . GLU A 1 61 ? 18.670 -1.656  19.454 1.00 0.00 ? 61 GLU A OE2  8  
ATOM 8902  H H    . GLU A 1 61 ? 18.354 -4.883  16.287 1.00 0.00 ? 61 GLU A H    8  
ATOM 8903  H HA   . GLU A 1 61 ? 18.042 -2.141  17.129 1.00 0.00 ? 61 GLU A HA   8  
ATOM 8904  H HB2  . GLU A 1 61 ? 20.368 -3.864  16.347 1.00 0.00 ? 61 GLU A HB2  8  
ATOM 8905  H HB3  . GLU A 1 61 ? 20.562 -2.120  16.453 1.00 0.00 ? 61 GLU A HB3  8  
ATOM 8906  H HG2  . GLU A 1 61 ? 19.574 -3.876  18.688 1.00 0.00 ? 61 GLU A HG2  8  
ATOM 8907  H HG3  . GLU A 1 61 ? 21.233 -3.310  18.503 1.00 0.00 ? 61 GLU A HG3  8  
ATOM 8908  N N    . THR A 1 62 ? 18.298 -2.923  13.994 1.00 0.00 ? 62 THR A N    8  
ATOM 8909  C CA   . THR A 1 62 ? 18.212 -2.414  12.631 1.00 0.00 ? 62 THR A CA   8  
ATOM 8910  C C    . THR A 1 62 ? 16.829 -1.837  12.346 1.00 0.00 ? 62 THR A C    8  
ATOM 8911  O O    . THR A 1 62 ? 16.651 -1.064  11.405 1.00 0.00 ? 62 THR A O    8  
ATOM 8912  C CB   . THR A 1 62 ? 18.518 -3.515  11.599 1.00 0.00 ? 62 THR A CB   8  
ATOM 8913  O OG1  . THR A 1 62 ? 17.421 -4.431  11.519 1.00 0.00 ? 62 THR A OG1  8  
ATOM 8914  C CG2  . THR A 1 62 ? 19.787 -4.267  11.971 1.00 0.00 ? 62 THR A CG2  8  
ATOM 8915  H H    . THR A 1 62 ? 18.243 -3.889  14.148 1.00 0.00 ? 62 THR A H    8  
ATOM 8916  H HA   . THR A 1 62 ? 18.948 -1.631  12.521 1.00 0.00 ? 62 THR A HA   8  
ATOM 8917  H HB   . THR A 1 62 ? 18.662 -3.052  10.633 1.00 0.00 ? 62 THR A HB   8  
ATOM 8918  H HG1  . THR A 1 62 ? 16.940 -4.284  10.702 1.00 0.00 ? 62 THR A HG1  8  
ATOM 8919  H HG21 . THR A 1 62 ? 20.105 -4.874  11.136 1.00 0.00 ? 62 THR A HG21 8  
ATOM 8920  H HG22 . THR A 1 62 ? 19.593 -4.901  12.824 1.00 0.00 ? 62 THR A HG22 8  
ATOM 8921  H HG23 . THR A 1 62 ? 20.565 -3.560  12.218 1.00 0.00 ? 62 THR A HG23 8  
ATOM 8922  N N    . ILE A 1 63 ? 15.855 -2.217  13.165 1.00 0.00 ? 63 ILE A N    8  
ATOM 8923  C CA   . ILE A 1 63 ? 14.489 -1.736  13.001 1.00 0.00 ? 63 ILE A CA   8  
ATOM 8924  C C    . ILE A 1 63 ? 14.300 -0.379  13.671 1.00 0.00 ? 63 ILE A C    8  
ATOM 8925  O O    . ILE A 1 63 ? 14.341 -0.268  14.897 1.00 0.00 ? 63 ILE A O    8  
ATOM 8926  C CB   . ILE A 1 63 ? 13.467 -2.730  13.585 1.00 0.00 ? 63 ILE A CB   8  
ATOM 8927  C CG1  . ILE A 1 63 ? 13.610 -4.096  12.911 1.00 0.00 ? 63 ILE A CG1  8  
ATOM 8928  C CG2  . ILE A 1 63 ? 12.053 -2.195  13.418 1.00 0.00 ? 63 ILE A CG2  8  
ATOM 8929  C CD1  . ILE A 1 63 ? 12.745 -5.170  13.533 1.00 0.00 ? 63 ILE A CD1  8  
ATOM 8930  H H    . ILE A 1 63 ? 16.059 -2.835  13.897 1.00 0.00 ? 63 ILE A H    8  
ATOM 8931  H HA   . ILE A 1 63 ? 14.296 -1.633  11.943 1.00 0.00 ? 63 ILE A HA   8  
ATOM 8932  H HB   . ILE A 1 63 ? 13.664 -2.835  14.641 1.00 0.00 ? 63 ILE A HB   8  
ATOM 8933  H HG12 . ILE A 1 63 ? 13.333 -4.008  11.872 1.00 0.00 ? 63 ILE A HG12 8  
ATOM 8934  H HG13 . ILE A 1 63 ? 14.639 -4.417  12.979 1.00 0.00 ? 63 ILE A HG13 8  
ATOM 8935  H HG21 . ILE A 1 63 ? 11.913 -1.860  12.401 1.00 0.00 ? 63 ILE A HG21 8  
ATOM 8936  H HG22 . ILE A 1 63 ? 11.344 -2.979  13.638 1.00 0.00 ? 63 ILE A HG22 8  
ATOM 8937  H HG23 . ILE A 1 63 ? 11.898 -1.368  14.095 1.00 0.00 ? 63 ILE A HG23 8  
ATOM 8938  H HD11 . ILE A 1 63 ? 13.374 -5.916  13.996 1.00 0.00 ? 63 ILE A HD11 8  
ATOM 8939  H HD12 . ILE A 1 63 ? 12.101 -4.728  14.277 1.00 0.00 ? 63 ILE A HD12 8  
ATOM 8940  H HD13 . ILE A 1 63 ? 12.142 -5.635  12.766 1.00 0.00 ? 63 ILE A HD13 8  
ATOM 8941  N N    . LEU A 1 64 ? 14.092 0.652   12.858 1.00 0.00 ? 64 LEU A N    8  
ATOM 8942  C CA   . LEU A 1 64 ? 13.895 2.003   13.372 1.00 0.00 ? 64 LEU A CA   8  
ATOM 8943  C C    . LEU A 1 64 ? 12.455 2.461   13.160 1.00 0.00 ? 64 LEU A C    8  
ATOM 8944  O O    . LEU A 1 64 ? 11.748 2.784   14.115 1.00 0.00 ? 64 LEU A O    8  
ATOM 8945  C CB   . LEU A 1 64 ? 14.857 2.975   12.687 1.00 0.00 ? 64 LEU A CB   8  
ATOM 8946  C CG   . LEU A 1 64 ? 16.337 2.593   12.726 1.00 0.00 ? 64 LEU A CG   8  
ATOM 8947  C CD1  . LEU A 1 64 ? 17.090 3.260   11.585 1.00 0.00 ? 64 LEU A CD1  8  
ATOM 8948  C CD2  . LEU A 1 64 ? 16.951 2.972   14.066 1.00 0.00 ? 64 LEU A CD2  8  
ATOM 8949  H H    . LEU A 1 64 ? 14.070 0.501   11.891 1.00 0.00 ? 64 LEU A H    8  
ATOM 8950  H HA   . LEU A 1 64 ? 14.103 1.989   14.431 1.00 0.00 ? 64 LEU A HA   8  
ATOM 8951  H HB2  . LEU A 1 64 ? 14.564 3.057   11.652 1.00 0.00 ? 64 LEU A HB2  8  
ATOM 8952  H HB3  . LEU A 1 64 ? 14.750 3.938   13.167 1.00 0.00 ? 64 LEU A HB3  8  
ATOM 8953  H HG   . LEU A 1 64 ? 16.429 1.523   12.605 1.00 0.00 ? 64 LEU A HG   8  
ATOM 8954  H HD11 . LEU A 1 64 ? 17.925 2.640   11.294 1.00 0.00 ? 64 LEU A HD11 8  
ATOM 8955  H HD12 . LEU A 1 64 ? 17.453 4.224   11.908 1.00 0.00 ? 64 LEU A HD12 8  
ATOM 8956  H HD13 . LEU A 1 64 ? 16.427 3.389   10.743 1.00 0.00 ? 64 LEU A HD13 8  
ATOM 8957  H HD21 . LEU A 1 64 ? 16.207 2.874   14.842 1.00 0.00 ? 64 LEU A HD21 8  
ATOM 8958  H HD22 . LEU A 1 64 ? 17.298 3.994   14.027 1.00 0.00 ? 64 LEU A HD22 8  
ATOM 8959  H HD23 . LEU A 1 64 ? 17.782 2.317   14.279 1.00 0.00 ? 64 LEU A HD23 8  
ATOM 8960  N N    . THR A 1 65 ? 12.026 2.485   11.902 1.00 0.00 ? 65 THR A N    8  
ATOM 8961  C CA   . THR A 1 65 ? 10.671 2.902   11.565 1.00 0.00 ? 65 THR A CA   8  
ATOM 8962  C C    . THR A 1 65 ? 9.904  1.777   10.879 1.00 0.00 ? 65 THR A C    8  
ATOM 8963  O O    . THR A 1 65 ? 10.442 0.693   10.654 1.00 0.00 ? 65 THR A O    8  
ATOM 8964  C CB   . THR A 1 65 ? 10.676 4.139   10.646 1.00 0.00 ? 65 THR A CB   8  
ATOM 8965  O OG1  . THR A 1 65 ? 11.508 3.899   9.506  1.00 0.00 ? 65 THR A OG1  8  
ATOM 8966  C CG2  . THR A 1 65 ? 11.174 5.366   11.394 1.00 0.00 ? 65 THR A CG2  8  
ATOM 8967  H H    . THR A 1 65 ? 12.637 2.216   11.185 1.00 0.00 ? 65 THR A H    8  
ATOM 8968  H HA   . THR A 1 65 ? 10.164 3.163   12.482 1.00 0.00 ? 65 THR A HA   8  
ATOM 8969  H HB   . THR A 1 65 ? 9.665  4.324   10.313 1.00 0.00 ? 65 THR A HB   8  
ATOM 8970  H HG1  . THR A 1 65 ? 11.358 4.585   8.851  1.00 0.00 ? 65 THR A HG1  8  
ATOM 8971  H HG21 . THR A 1 65 ? 10.398 6.117   11.410 1.00 0.00 ? 65 THR A HG21 8  
ATOM 8972  H HG22 . THR A 1 65 ? 12.048 5.760   10.898 1.00 0.00 ? 65 THR A HG22 8  
ATOM 8973  H HG23 . THR A 1 65 ? 11.429 5.091   12.407 1.00 0.00 ? 65 THR A HG23 8  
ATOM 8974  N N    . VAL A 1 66 ? 8.644  2.042   10.548 1.00 0.00 ? 66 VAL A N    8  
ATOM 8975  C CA   . VAL A 1 66 ? 7.804  1.052   9.885  1.00 0.00 ? 66 VAL A CA   8  
ATOM 8976  C C    . VAL A 1 66 ? 8.494  0.481   8.652  1.00 0.00 ? 66 VAL A C    8  
ATOM 8977  O O    . VAL A 1 66 ? 8.456  -0.724  8.407  1.00 0.00 ? 66 VAL A O    8  
ATOM 8978  C CB   . VAL A 1 66 ? 6.449  1.654   9.469  1.00 0.00 ? 66 VAL A CB   8  
ATOM 8979  C CG1  . VAL A 1 66 ? 5.587  0.606   8.781  1.00 0.00 ? 66 VAL A CG1  8  
ATOM 8980  C CG2  . VAL A 1 66 ? 5.731  2.237   10.677 1.00 0.00 ? 66 VAL A CG2  8  
ATOM 8981  H H    . VAL A 1 66 ? 8.271  2.924   10.753 1.00 0.00 ? 66 VAL A H    8  
ATOM 8982  H HA   . VAL A 1 66 ? 7.617  0.250   10.585 1.00 0.00 ? 66 VAL A HA   8  
ATOM 8983  H HB   . VAL A 1 66 ? 6.633  2.454   8.767  1.00 0.00 ? 66 VAL A HB   8  
ATOM 8984  H HG11 . VAL A 1 66 ? 4.544  0.847   8.926  1.00 0.00 ? 66 VAL A HG11 8  
ATOM 8985  H HG12 . VAL A 1 66 ? 5.811  0.593   7.724  1.00 0.00 ? 66 VAL A HG12 8  
ATOM 8986  H HG13 . VAL A 1 66 ? 5.794  -0.365  9.206  1.00 0.00 ? 66 VAL A HG13 8  
ATOM 8987  H HG21 . VAL A 1 66 ? 4.886  1.613   10.928 1.00 0.00 ? 66 VAL A HG21 8  
ATOM 8988  H HG22 . VAL A 1 66 ? 6.411  2.276   11.516 1.00 0.00 ? 66 VAL A HG22 8  
ATOM 8989  H HG23 . VAL A 1 66 ? 5.388  3.234   10.446 1.00 0.00 ? 66 VAL A HG23 8  
ATOM 8990  N N    . GLY A 1 67 ? 9.127  1.357   7.876  1.00 0.00 ? 67 GLY A N    8  
ATOM 8991  C CA   . GLY A 1 67 ? 9.818  0.922   6.677  1.00 0.00 ? 67 GLY A CA   8  
ATOM 8992  C C    . GLY A 1 67 ? 10.790 -0.210  6.946  1.00 0.00 ? 67 GLY A C    8  
ATOM 8993  O O    . GLY A 1 67 ? 10.924 -1.128  6.136  1.00 0.00 ? 67 GLY A O    8  
ATOM 8994  H H    . GLY A 1 67 ? 9.124  2.306   8.121  1.00 0.00 ? 67 GLY A H    8  
ATOM 8995  H HA2  . GLY A 1 67 ? 9.088  0.591   5.953  1.00 0.00 ? 67 GLY A HA2  8  
ATOM 8996  H HA3  . GLY A 1 67 ? 10.364 1.759   6.266  1.00 0.00 ? 67 GLY A HA3  8  
ATOM 8997  N N    . ASP A 1 68 ? 11.470 -0.145  8.085  1.00 0.00 ? 68 ASP A N    8  
ATOM 8998  C CA   . ASP A 1 68 ? 12.435 -1.173  8.459  1.00 0.00 ? 68 ASP A CA   8  
ATOM 8999  C C    . ASP A 1 68 ? 11.735 -2.497  8.748  1.00 0.00 ? 68 ASP A C    8  
ATOM 9000  O O    . ASP A 1 68 ? 12.051 -3.522  8.145  1.00 0.00 ? 68 ASP A O    8  
ATOM 9001  C CB   . ASP A 1 68 ? 13.237 -0.728  9.683  1.00 0.00 ? 68 ASP A CB   8  
ATOM 9002  C CG   . ASP A 1 68 ? 14.075 0.506   9.409  1.00 0.00 ? 68 ASP A CG   8  
ATOM 9003  O OD1  . ASP A 1 68 ? 13.486 1.574   9.139  1.00 0.00 ? 68 ASP A OD1  8  
ATOM 9004  O OD2  . ASP A 1 68 ? 15.318 0.403   9.463  1.00 0.00 ? 68 ASP A OD2  8  
ATOM 9005  H H    . ASP A 1 68 ? 11.318 0.611   8.690  1.00 0.00 ? 68 ASP A H    8  
ATOM 9006  H HA   . ASP A 1 68 ? 13.110 -1.311  7.628  1.00 0.00 ? 68 ASP A HA   8  
ATOM 9007  H HB2  . ASP A 1 68 ? 12.555 -0.505  10.491 1.00 0.00 ? 68 ASP A HB2  8  
ATOM 9008  H HB3  . ASP A 1 68 ? 13.896 -1.529  9.984  1.00 0.00 ? 68 ASP A HB3  8  
ATOM 9009  N N    . ALA A 1 69 ? 10.783 -2.467  9.675  1.00 0.00 ? 69 ALA A N    8  
ATOM 9010  C CA   . ALA A 1 69 ? 10.037 -3.664  10.043 1.00 0.00 ? 69 ALA A CA   8  
ATOM 9011  C C    . ALA A 1 69 ? 9.408  -4.318  8.818  1.00 0.00 ? 69 ALA A C    8  
ATOM 9012  O O    . ALA A 1 69 ? 9.573  -5.515  8.586  1.00 0.00 ? 69 ALA A O    8  
ATOM 9013  C CB   . ALA A 1 69 ? 8.968  -3.324  11.071 1.00 0.00 ? 69 ALA A CB   8  
ATOM 9014  H H    . ALA A 1 69 ? 10.576 -1.619  10.120 1.00 0.00 ? 69 ALA A H    8  
ATOM 9015  H HA   . ALA A 1 69 ? 10.728 -4.361  10.496 1.00 0.00 ? 69 ALA A HA   8  
ATOM 9016  H HB1  . ALA A 1 69 ? 8.076  -3.899  10.864 1.00 0.00 ? 69 ALA A HB1  8  
ATOM 9017  H HB2  . ALA A 1 69 ? 9.330  -3.563  12.059 1.00 0.00 ? 69 ALA A HB2  8  
ATOM 9018  H HB3  . ALA A 1 69 ? 8.738  -2.271  11.016 1.00 0.00 ? 69 ALA A HB3  8  
ATOM 9019  N N    . VAL A 1 70 ? 8.684  -3.523  8.035  1.00 0.00 ? 70 VAL A N    8  
ATOM 9020  C CA   . VAL A 1 70 ? 8.030  -4.025  6.833  1.00 0.00 ? 70 VAL A CA   8  
ATOM 9021  C C    . VAL A 1 70 ? 9.043  -4.626  5.866  1.00 0.00 ? 70 VAL A C    8  
ATOM 9022  O O    . VAL A 1 70 ? 8.919  -5.781  5.457  1.00 0.00 ? 70 VAL A O    8  
ATOM 9023  C CB   . VAL A 1 70 ? 7.248  -2.910  6.112  1.00 0.00 ? 70 VAL A CB   8  
ATOM 9024  C CG1  . VAL A 1 70 ? 6.600  -3.445  4.845  1.00 0.00 ? 70 VAL A CG1  8  
ATOM 9025  C CG2  . VAL A 1 70 ? 6.205  -2.306  7.040  1.00 0.00 ? 70 VAL A CG2  8  
ATOM 9026  H H    . VAL A 1 70 ? 8.589  -2.577  8.272  1.00 0.00 ? 70 VAL A H    8  
ATOM 9027  H HA   . VAL A 1 70 ? 7.330  -4.793  7.129  1.00 0.00 ? 70 VAL A HA   8  
ATOM 9028  H HB   . VAL A 1 70 ? 7.944  -2.133  5.834  1.00 0.00 ? 70 VAL A HB   8  
ATOM 9029  H HG11 . VAL A 1 70 ? 6.118  -4.388  5.058  1.00 0.00 ? 70 VAL A HG11 8  
ATOM 9030  H HG12 . VAL A 1 70 ? 5.867  -2.737  4.488  1.00 0.00 ? 70 VAL A HG12 8  
ATOM 9031  H HG13 . VAL A 1 70 ? 7.357  -3.592  4.088  1.00 0.00 ? 70 VAL A HG13 8  
ATOM 9032  H HG21 . VAL A 1 70 ? 5.224  -2.655  6.754  1.00 0.00 ? 70 VAL A HG21 8  
ATOM 9033  H HG22 . VAL A 1 70 ? 6.411  -2.606  8.058  1.00 0.00 ? 70 VAL A HG22 8  
ATOM 9034  H HG23 . VAL A 1 70 ? 6.239  -1.229  6.970  1.00 0.00 ? 70 VAL A HG23 8  
ATOM 9035  N N    . LYS A 1 71 ? 10.048 -3.836  5.503  1.00 0.00 ? 71 LYS A N    8  
ATOM 9036  C CA   . LYS A 1 71 ? 11.086 -4.289  4.585  1.00 0.00 ? 71 LYS A CA   8  
ATOM 9037  C C    . LYS A 1 71 ? 11.727 -5.580  5.083  1.00 0.00 ? 71 LYS A C    8  
ATOM 9038  O O    . LYS A 1 71 ? 12.155 -6.419  4.290  1.00 0.00 ? 71 LYS A O    8  
ATOM 9039  C CB   . LYS A 1 71 ? 12.155 -3.207  4.417  1.00 0.00 ? 71 LYS A CB   8  
ATOM 9040  C CG   . LYS A 1 71 ? 11.727 -2.064  3.514  1.00 0.00 ? 71 LYS A CG   8  
ATOM 9041  C CD   . LYS A 1 71 ? 12.777 -0.966  3.468  1.00 0.00 ? 71 LYS A CD   8  
ATOM 9042  C CE   . LYS A 1 71 ? 12.478 0.046   2.373  1.00 0.00 ? 71 LYS A CE   8  
ATOM 9043  N NZ   . LYS A 1 71 ? 12.662 -0.535  1.015  1.00 0.00 ? 71 LYS A NZ   8  
ATOM 9044  H H    . LYS A 1 71 ? 10.092 -2.924  5.862  1.00 0.00 ? 71 LYS A H    8  
ATOM 9045  H HA   . LYS A 1 71 ? 10.623 -4.477  3.628  1.00 0.00 ? 71 LYS A HA   8  
ATOM 9046  H HB2  . LYS A 1 71 ? 12.394 -2.801  5.389  1.00 0.00 ? 71 LYS A HB2  8  
ATOM 9047  H HB3  . LYS A 1 71 ? 13.043 -3.658  3.997  1.00 0.00 ? 71 LYS A HB3  8  
ATOM 9048  H HG2  . LYS A 1 71 ? 11.576 -2.443  2.514  1.00 0.00 ? 71 LYS A HG2  8  
ATOM 9049  H HG3  . LYS A 1 71 ? 10.802 -1.649  3.887  1.00 0.00 ? 71 LYS A HG3  8  
ATOM 9050  H HD2  . LYS A 1 71 ? 12.794 -0.456  4.420  1.00 0.00 ? 71 LYS A HD2  8  
ATOM 9051  H HD3  . LYS A 1 71 ? 13.744 -1.412  3.280  1.00 0.00 ? 71 LYS A HD3  8  
ATOM 9052  H HE2  . LYS A 1 71 ? 11.457 0.379   2.478  1.00 0.00 ? 71 LYS A HE2  8  
ATOM 9053  H HE3  . LYS A 1 71 ? 13.145 0.889   2.489  1.00 0.00 ? 71 LYS A HE3  8  
ATOM 9054  H HZ1  . LYS A 1 71 ? 13.531 -1.106  0.986  1.00 0.00 ? 71 LYS A HZ1  8  
ATOM 9055  H HZ2  . LYS A 1 71 ? 12.736 0.224   0.308  1.00 0.00 ? 71 LYS A HZ2  8  
ATOM 9056  H HZ3  . LYS A 1 71 ? 11.853 -1.142  0.773  1.00 0.00 ? 71 LYS A HZ3  8  
ATOM 9057  N N    . PHE A 1 72 ? 11.789 -5.734  6.402  1.00 0.00 ? 72 PHE A N    8  
ATOM 9058  C CA   . PHE A 1 72 ? 12.377 -6.923  7.006  1.00 0.00 ? 72 PHE A CA   8  
ATOM 9059  C C    . PHE A 1 72 ? 11.499 -8.148  6.764  1.00 0.00 ? 72 PHE A C    8  
ATOM 9060  O O    . PHE A 1 72 ? 11.947 -9.144  6.195  1.00 0.00 ? 72 PHE A O    8  
ATOM 9061  C CB   . PHE A 1 72 ? 12.576 -6.713  8.508  1.00 0.00 ? 72 PHE A CB   8  
ATOM 9062  C CG   . PHE A 1 72 ? 13.787 -7.413  9.056  1.00 0.00 ? 72 PHE A CG   8  
ATOM 9063  C CD1  . PHE A 1 72 ? 14.057 -8.729  8.714  1.00 0.00 ? 72 PHE A CD1  8  
ATOM 9064  C CD2  . PHE A 1 72 ? 14.655 -6.756  9.913  1.00 0.00 ? 72 PHE A CD2  8  
ATOM 9065  C CE1  . PHE A 1 72 ? 15.170 -9.375  9.218  1.00 0.00 ? 72 PHE A CE1  8  
ATOM 9066  C CE2  . PHE A 1 72 ? 15.769 -7.398  10.420 1.00 0.00 ? 72 PHE A CE2  8  
ATOM 9067  C CZ   . PHE A 1 72 ? 16.028 -8.709  10.071 1.00 0.00 ? 72 PHE A CZ   8  
ATOM 9068  H H    . PHE A 1 72 ? 11.430 -5.030  6.982  1.00 0.00 ? 72 PHE A H    8  
ATOM 9069  H HA   . PHE A 1 72 ? 13.338 -7.088  6.544  1.00 0.00 ? 72 PHE A HA   8  
ATOM 9070  H HB2  . PHE A 1 72 ? 12.687 -5.658  8.705  1.00 0.00 ? 72 PHE A HB2  8  
ATOM 9071  H HB3  . PHE A 1 72 ? 11.710 -7.085  9.034  1.00 0.00 ? 72 PHE A HB3  8  
ATOM 9072  H HD1  . PHE A 1 72 ? 13.388 -9.251  8.046  1.00 0.00 ? 72 PHE A HD1  8  
ATOM 9073  H HD2  . PHE A 1 72 ? 14.453 -5.730  10.187 1.00 0.00 ? 72 PHE A HD2  8  
ATOM 9074  H HE1  . PHE A 1 72 ? 15.370 -10.400 8.943  1.00 0.00 ? 72 PHE A HE1  8  
ATOM 9075  H HE2  . PHE A 1 72 ? 16.438 -6.873  11.087 1.00 0.00 ? 72 PHE A HE2  8  
ATOM 9076  H HZ   . PHE A 1 72 ? 16.897 -9.212  10.466 1.00 0.00 ? 72 PHE A HZ   8  
ATOM 9077  N N    . ILE A 1 73 ? 10.247 -8.065  7.200  1.00 0.00 ? 73 ILE A N    8  
ATOM 9078  C CA   . ILE A 1 73 ? 9.305  -9.165  7.031  1.00 0.00 ? 73 ILE A CA   8  
ATOM 9079  C C    . ILE A 1 73 ? 9.194  -9.573  5.566  1.00 0.00 ? 73 ILE A C    8  
ATOM 9080  O O    . ILE A 1 73 ? 9.053  -10.754 5.249  1.00 0.00 ? 73 ILE A O    8  
ATOM 9081  C CB   . ILE A 1 73 ? 7.906  -8.794  7.556  1.00 0.00 ? 73 ILE A CB   8  
ATOM 9082  C CG1  . ILE A 1 73 ? 7.977  -8.414  9.036  1.00 0.00 ? 73 ILE A CG1  8  
ATOM 9083  C CG2  . ILE A 1 73 ? 6.938  -9.949  7.346  1.00 0.00 ? 73 ILE A CG2  8  
ATOM 9084  C CD1  . ILE A 1 73 ? 6.786  -7.613  9.512  1.00 0.00 ? 73 ILE A CD1  8  
ATOM 9085  H H    . ILE A 1 73 ? 9.949  -7.245  7.645  1.00 0.00 ? 73 ILE A H    8  
ATOM 9086  H HA   . ILE A 1 73 ? 9.671  -10.007 7.601  1.00 0.00 ? 73 ILE A HA   8  
ATOM 9087  H HB   . ILE A 1 73 ? 7.546  -7.948  6.991  1.00 0.00 ? 73 ILE A HB   8  
ATOM 9088  H HG12 . ILE A 1 73 ? 8.031  -9.313  9.630  1.00 0.00 ? 73 ILE A HG12 8  
ATOM 9089  H HG13 . ILE A 1 73 ? 8.865  -7.822  9.206  1.00 0.00 ? 73 ILE A HG13 8  
ATOM 9090  H HG21 . ILE A 1 73 ? 6.055  -9.793  7.948  1.00 0.00 ? 73 ILE A HG21 8  
ATOM 9091  H HG22 . ILE A 1 73 ? 6.658  -9.999  6.305  1.00 0.00 ? 73 ILE A HG22 8  
ATOM 9092  H HG23 . ILE A 1 73 ? 7.413  -10.874 7.636  1.00 0.00 ? 73 ILE A HG23 8  
ATOM 9093  H HD11 . ILE A 1 73 ? 6.639  -6.763  8.862  1.00 0.00 ? 73 ILE A HD11 8  
ATOM 9094  H HD12 . ILE A 1 73 ? 5.904  -8.235  9.497  1.00 0.00 ? 73 ILE A HD12 8  
ATOM 9095  H HD13 . ILE A 1 73 ? 6.964  -7.267  10.521 1.00 0.00 ? 73 ILE A HD13 8  
ATOM 9096  N N    . ASP A 1 74 ? 9.261  -8.589  4.676  1.00 0.00 ? 74 ASP A N    8  
ATOM 9097  C CA   . ASP A 1 74 ? 9.172  -8.845  3.243  1.00 0.00 ? 74 ASP A CA   8  
ATOM 9098  C C    . ASP A 1 74 ? 10.448 -9.503  2.728  1.00 0.00 ? 74 ASP A C    8  
ATOM 9099  O O    . ASP A 1 74 ? 10.398 -10.435 1.926  1.00 0.00 ? 74 ASP A O    8  
ATOM 9100  C CB   . ASP A 1 74 ? 8.913  -7.542  2.486  1.00 0.00 ? 74 ASP A CB   8  
ATOM 9101  C CG   . ASP A 1 74 ? 8.749  -7.762  0.995  1.00 0.00 ? 74 ASP A CG   8  
ATOM 9102  O OD1  . ASP A 1 74 ? 7.622  -8.085  0.563  1.00 0.00 ? 74 ASP A OD1  8  
ATOM 9103  O OD2  . ASP A 1 74 ? 9.747  -7.610  0.260  1.00 0.00 ? 74 ASP A OD2  8  
ATOM 9104  H H    . ASP A 1 74 ? 9.375  -7.667  4.991  1.00 0.00 ? 74 ASP A H    8  
ATOM 9105  H HA   . ASP A 1 74 ? 8.343  -9.517  3.078  1.00 0.00 ? 74 ASP A HA   8  
ATOM 9106  H HB2  . ASP A 1 74 ? 8.009  -7.086  2.865  1.00 0.00 ? 74 ASP A HB2  8  
ATOM 9107  H HB3  . ASP A 1 74 ? 9.744  -6.870  2.644  1.00 0.00 ? 74 ASP A HB3  8  
ATOM 9108  N N    . LYS A 1 75 ? 11.591 -9.010  3.193  1.00 0.00 ? 75 LYS A N    8  
ATOM 9109  C CA   . LYS A 1 75 ? 12.881 -9.548  2.780  1.00 0.00 ? 75 LYS A CA   8  
ATOM 9110  C C    . LYS A 1 75 ? 13.032 -11.000 3.224  1.00 0.00 ? 75 LYS A C    8  
ATOM 9111  O O    . LYS A 1 75 ? 13.566 -11.831 2.490  1.00 0.00 ? 75 LYS A O    8  
ATOM 9112  C CB   . LYS A 1 75 ? 14.019 -8.706  3.362  1.00 0.00 ? 75 LYS A CB   8  
ATOM 9113  C CG   . LYS A 1 75 ? 14.460 -7.571  2.455  1.00 0.00 ? 75 LYS A CG   8  
ATOM 9114  C CD   . LYS A 1 75 ? 15.240 -8.086  1.256  1.00 0.00 ? 75 LYS A CD   8  
ATOM 9115  C CE   . LYS A 1 75 ? 15.528 -6.974  0.259  1.00 0.00 ? 75 LYS A CE   8  
ATOM 9116  N NZ   . LYS A 1 75 ? 16.469 -7.416  -0.808 1.00 0.00 ? 75 LYS A NZ   8  
ATOM 9117  H H    . LYS A 1 75 ? 11.566 -8.265  3.831  1.00 0.00 ? 75 LYS A H    8  
ATOM 9118  H HA   . LYS A 1 75 ? 12.929 -9.507  1.703  1.00 0.00 ? 75 LYS A HA   8  
ATOM 9119  H HB2  . LYS A 1 75 ? 13.693 -8.283  4.301  1.00 0.00 ? 75 LYS A HB2  8  
ATOM 9120  H HB3  . LYS A 1 75 ? 14.870 -9.347  3.542  1.00 0.00 ? 75 LYS A HB3  8  
ATOM 9121  H HG2  . LYS A 1 75 ? 13.587 -7.043  2.102  1.00 0.00 ? 75 LYS A HG2  8  
ATOM 9122  H HG3  . LYS A 1 75 ? 15.088 -6.895  3.018  1.00 0.00 ? 75 LYS A HG3  8  
ATOM 9123  H HD2  . LYS A 1 75 ? 16.177 -8.499  1.598  1.00 0.00 ? 75 LYS A HD2  8  
ATOM 9124  H HD3  . LYS A 1 75 ? 14.662 -8.857  0.766  1.00 0.00 ? 75 LYS A HD3  8  
ATOM 9125  H HE2  . LYS A 1 75 ? 14.599 -6.667  -0.196 1.00 0.00 ? 75 LYS A HE2  8  
ATOM 9126  H HE3  . LYS A 1 75 ? 15.964 -6.139  0.788  1.00 0.00 ? 75 LYS A HE3  8  
ATOM 9127  H HZ1  . LYS A 1 75 ? 17.185 -8.056  -0.409 1.00 0.00 ? 75 LYS A HZ1  8  
ATOM 9128  H HZ2  . LYS A 1 75 ? 16.949 -6.593  -1.224 1.00 0.00 ? 75 LYS A HZ2  8  
ATOM 9129  H HZ3  . LYS A 1 75 ? 15.949 -7.917  -1.557 1.00 0.00 ? 75 LYS A HZ3  8  
ATOM 9130  N N    . ALA A 1 76 ? 12.556 -11.299 4.428  1.00 0.00 ? 76 ALA A N    8  
ATOM 9131  C CA   . ALA A 1 76 ? 12.634 -12.651 4.967  1.00 0.00 ? 76 ALA A CA   8  
ATOM 9132  C C    . ALA A 1 76 ? 11.507 -13.524 4.426  1.00 0.00 ? 76 ALA A C    8  
ATOM 9133  O O    . ALA A 1 76 ? 11.646 -14.743 4.327  1.00 0.00 ? 76 ALA A O    8  
ATOM 9134  C CB   . ALA A 1 76 ? 12.594 -12.616 6.488  1.00 0.00 ? 76 ALA A CB   8  
ATOM 9135  H H    . ALA A 1 76 ? 12.140 -10.593 4.966  1.00 0.00 ? 76 ALA A H    8  
ATOM 9136  H HA   . ALA A 1 76 ? 13.581 -13.075 4.666  1.00 0.00 ? 76 ALA A HA   8  
ATOM 9137  H HB1  . ALA A 1 76 ? 13.568 -12.342 6.866  1.00 0.00 ? 76 ALA A HB1  8  
ATOM 9138  H HB2  . ALA A 1 76 ? 11.864 -11.890 6.812  1.00 0.00 ? 76 ALA A HB2  8  
ATOM 9139  H HB3  . ALA A 1 76 ? 12.323 -13.591 6.863  1.00 0.00 ? 76 ALA A HB3  8  
ATOM 9140  N N    . SER A 1 77 ? 10.391 -12.892 4.077  1.00 0.00 ? 77 SER A N    8  
ATOM 9141  C CA   . SER A 1 77 ? 9.238  -13.613 3.550  1.00 0.00 ? 77 SER A CA   8  
ATOM 9142  C C    . SER A 1 77 ? 9.609  -14.381 2.285  1.00 0.00 ? 77 SER A C    8  
ATOM 9143  O O    . SER A 1 77 ? 9.036  -15.430 1.992  1.00 0.00 ? 77 SER A O    8  
ATOM 9144  C CB   . SER A 1 77 ? 8.095  -12.640 3.253  1.00 0.00 ? 77 SER A CB   8  
ATOM 9145  O OG   . SER A 1 77 ? 7.105  -13.250 2.443  1.00 0.00 ? 77 SER A OG   8  
ATOM 9146  H H    . SER A 1 77 ? 10.341 -11.919 4.179  1.00 0.00 ? 77 SER A H    8  
ATOM 9147  H HA   . SER A 1 77 ? 8.915  -14.316 4.302  1.00 0.00 ? 77 SER A HA   8  
ATOM 9148  H HB2  . SER A 1 77 ? 7.641  -12.328 4.181  1.00 0.00 ? 77 SER A HB2  8  
ATOM 9149  H HB3  . SER A 1 77 ? 8.486  -11.777 2.734  1.00 0.00 ? 77 SER A HB3  8  
ATOM 9150  H HG   . SER A 1 77 ? 6.414  -12.612 2.247  1.00 0.00 ? 77 SER A HG   8  
ATOM 9151  N N    . ALA A 1 78 ? 10.572 -13.850 1.539  1.00 0.00 ? 78 ALA A N    8  
ATOM 9152  C CA   . ALA A 1 78 ? 11.022 -14.485 0.307  1.00 0.00 ? 78 ALA A CA   8  
ATOM 9153  C C    . ALA A 1 78 ? 12.116 -15.511 0.585  1.00 0.00 ? 78 ALA A C    8  
ATOM 9154  O O    . ALA A 1 78 ? 13.008 -15.720 -0.238 1.00 0.00 ? 78 ALA A O    8  
ATOM 9155  C CB   . ALA A 1 78 ? 11.518 -13.436 -0.678 1.00 0.00 ? 78 ALA A CB   8  
ATOM 9156  H H    . ALA A 1 78 ? 10.991 -13.011 1.825  1.00 0.00 ? 78 ALA A H    8  
ATOM 9157  H HA   . ALA A 1 78 ? 10.175 -14.989 -0.138 1.00 0.00 ? 78 ALA A HA   8  
ATOM 9158  H HB1  . ALA A 1 78 ? 11.390 -13.801 -1.686 1.00 0.00 ? 78 ALA A HB1  8  
ATOM 9159  H HB2  . ALA A 1 78 ? 10.951 -12.526 -0.549 1.00 0.00 ? 78 ALA A HB2  8  
ATOM 9160  H HB3  . ALA A 1 78 ? 12.564 -13.239 -0.496 1.00 0.00 ? 78 ALA A HB3  8  
ATOM 9161  N N    . MET A 1 1  ? 0.546  -0.369  -4.370 1.00 0.00 ? 1  MET A N    9  
ATOM 9162  C CA   . MET A 1 1  ? 0.541  -1.735  -4.880 1.00 0.00 ? 1  MET A CA   9  
ATOM 9163  C C    . MET A 1 1  ? 1.445  -2.633  -4.041 1.00 0.00 ? 1  MET A C    9  
ATOM 9164  O O    . MET A 1 1  ? 2.094  -3.538  -4.564 1.00 0.00 ? 1  MET A O    9  
ATOM 9165  C CB   . MET A 1 1  ? 0.994  -1.758  -6.341 1.00 0.00 ? 1  MET A CB   9  
ATOM 9166  C CG   . MET A 1 1  ? 2.403  -1.226  -6.548 1.00 0.00 ? 1  MET A CG   9  
ATOM 9167  S SD   . MET A 1 1  ? 2.437  0.549   -6.864 1.00 0.00 ? 1  MET A SD   9  
ATOM 9168  C CE   . MET A 1 1  ? 2.569  0.573   -8.650 1.00 0.00 ? 1  MET A CE   9  
ATOM 9169  H H1   . MET A 1 1  ? -0.308 0.083   -4.206 1.00 0.00 ? 1  MET A H1   9  
ATOM 9170  H HA   . MET A 1 1  ? -0.471 -2.107  -4.821 1.00 0.00 ? 1  MET A HA   9  
ATOM 9171  H HB2  . MET A 1 1  ? 0.960  -2.775  -6.701 1.00 0.00 ? 1  MET A HB2  9  
ATOM 9172  H HB3  . MET A 1 1  ? 0.316  -1.155  -6.926 1.00 0.00 ? 1  MET A HB3  9  
ATOM 9173  H HG2  . MET A 1 1  ? 2.985  -1.430  -5.662 1.00 0.00 ? 1  MET A HG2  9  
ATOM 9174  H HG3  . MET A 1 1  ? 2.845  -1.737  -7.391 1.00 0.00 ? 1  MET A HG3  9  
ATOM 9175  H HE1  . MET A 1 1  ? 2.592  -0.440  -9.023 1.00 0.00 ? 1  MET A HE1  9  
ATOM 9176  H HE2  . MET A 1 1  ? 1.718  1.091   -9.066 1.00 0.00 ? 1  MET A HE2  9  
ATOM 9177  H HE3  . MET A 1 1  ? 3.477  1.083   -8.936 1.00 0.00 ? 1  MET A HE3  9  
ATOM 9178  N N    . SER A 1 2  ? 1.481  -2.375  -2.738 1.00 0.00 ? 2  SER A N    9  
ATOM 9179  C CA   . SER A 1 2  ? 2.309  -3.158  -1.827 1.00 0.00 ? 2  SER A CA   9  
ATOM 9180  C C    . SER A 1 2  ? 1.532  -4.349  -1.274 1.00 0.00 ? 2  SER A C    9  
ATOM 9181  O O    . SER A 1 2  ? 0.321  -4.271  -1.064 1.00 0.00 ? 2  SER A O    9  
ATOM 9182  C CB   . SER A 1 2  ? 2.807  -2.282  -0.676 1.00 0.00 ? 2  SER A CB   9  
ATOM 9183  O OG   . SER A 1 2  ? 3.919  -1.499  -1.076 1.00 0.00 ? 2  SER A OG   9  
ATOM 9184  H H    . SER A 1 2  ? 0.941  -1.640  -2.380 1.00 0.00 ? 2  SER A H    9  
ATOM 9185  H HA   . SER A 1 2  ? 3.159  -3.524  -2.383 1.00 0.00 ? 2  SER A HA   9  
ATOM 9186  H HB2  . SER A 1 2  ? 2.013  -1.622  -0.359 1.00 0.00 ? 2  SER A HB2  9  
ATOM 9187  H HB3  . SER A 1 2  ? 3.103  -2.912  0.150  1.00 0.00 ? 2  SER A HB3  9  
ATOM 9188  H HG   . SER A 1 2  ? 3.875  -0.640  -0.650 1.00 0.00 ? 2  SER A HG   9  
ATOM 9189  N N    . ASP A 1 3  ? 2.237  -5.451  -1.042 1.00 0.00 ? 3  ASP A N    9  
ATOM 9190  C CA   . ASP A 1 3  ? 1.615  -6.659  -0.513 1.00 0.00 ? 3  ASP A CA   9  
ATOM 9191  C C    . ASP A 1 3  ? 1.946  -6.838  0.966  1.00 0.00 ? 3  ASP A C    9  
ATOM 9192  O O    . ASP A 1 3  ? 1.068  -7.125  1.780  1.00 0.00 ? 3  ASP A O    9  
ATOM 9193  C CB   . ASP A 1 3  ? 2.078  -7.884  -1.303 1.00 0.00 ? 3  ASP A CB   9  
ATOM 9194  C CG   . ASP A 1 3  ? 1.051  -9.000  -1.294 1.00 0.00 ? 3  ASP A CG   9  
ATOM 9195  O OD1  . ASP A 1 3  ? 0.894  -9.654  -0.242 1.00 0.00 ? 3  ASP A OD1  9  
ATOM 9196  O OD2  . ASP A 1 3  ? 0.404  -9.218  -2.340 1.00 0.00 ? 3  ASP A OD2  9  
ATOM 9197  H H    . ASP A 1 3  ? 3.199  -5.451  -1.229 1.00 0.00 ? 3  ASP A H    9  
ATOM 9198  H HA   . ASP A 1 3  ? 0.546  -6.556  -0.619 1.00 0.00 ? 3  ASP A HA   9  
ATOM 9199  H HB2  . ASP A 1 3  ? 2.259  -7.595  -2.328 1.00 0.00 ? 3  ASP A HB2  9  
ATOM 9200  H HB3  . ASP A 1 3  ? 2.994  -8.258  -0.871 1.00 0.00 ? 3  ASP A HB3  9  
ATOM 9201  N N    . THR A 1 4  ? 3.220  -6.666  1.307  1.00 0.00 ? 4  THR A N    9  
ATOM 9202  C CA   . THR A 1 4  ? 3.667  -6.811  2.687  1.00 0.00 ? 4  THR A CA   9  
ATOM 9203  C C    . THR A 1 4  ? 3.351  -5.562  3.501  1.00 0.00 ? 4  THR A C    9  
ATOM 9204  O O    . THR A 1 4  ? 2.969  -5.650  4.668  1.00 0.00 ? 4  THR A O    9  
ATOM 9205  C CB   . THR A 1 4  ? 5.181  -7.088  2.760  1.00 0.00 ? 4  THR A CB   9  
ATOM 9206  O OG1  . THR A 1 4  ? 5.528  -8.149  1.863  1.00 0.00 ? 4  THR A OG1  9  
ATOM 9207  C CG2  . THR A 1 4  ? 5.595  -7.459  4.176  1.00 0.00 ? 4  THR A CG2  9  
ATOM 9208  H H    . THR A 1 4  ? 3.873  -6.438  0.613  1.00 0.00 ? 4  THR A H    9  
ATOM 9209  H HA   . THR A 1 4  ? 3.147  -7.653  3.120  1.00 0.00 ? 4  THR A HA   9  
ATOM 9210  H HB   . THR A 1 4  ? 5.710  -6.192  2.469  1.00 0.00 ? 4  THR A HB   9  
ATOM 9211  H HG1  . THR A 1 4  ? 4.812  -8.787  1.829  1.00 0.00 ? 4  THR A HG1  9  
ATOM 9212  H HG21 . THR A 1 4  ? 6.246  -8.320  4.147  1.00 0.00 ? 4  THR A HG21 9  
ATOM 9213  H HG22 . THR A 1 4  ? 4.716  -7.691  4.759  1.00 0.00 ? 4  THR A HG22 9  
ATOM 9214  H HG23 . THR A 1 4  ? 6.117  -6.629  4.627  1.00 0.00 ? 4  THR A HG23 9  
ATOM 9215  N N    . ALA A 1 5  ? 3.512  -4.399  2.878  1.00 0.00 ? 5  ALA A N    9  
ATOM 9216  C CA   . ALA A 1 5  ? 3.240  -3.131  3.545  1.00 0.00 ? 5  ALA A CA   9  
ATOM 9217  C C    . ALA A 1 5  ? 1.851  -3.128  4.174  1.00 0.00 ? 5  ALA A C    9  
ATOM 9218  O O    . ALA A 1 5  ? 1.701  -2.868  5.367  1.00 0.00 ? 5  ALA A O    9  
ATOM 9219  C CB   . ALA A 1 5  ? 3.380  -1.978  2.563  1.00 0.00 ? 5  ALA A CB   9  
ATOM 9220  H H    . ALA A 1 5  ? 3.819  -4.393  1.948  1.00 0.00 ? 5  ALA A H    9  
ATOM 9221  H HA   . ALA A 1 5  ? 3.977  -2.999  4.324  1.00 0.00 ? 5  ALA A HA   9  
ATOM 9222  H HB1  . ALA A 1 5  ? 2.470  -1.883  1.989  1.00 0.00 ? 5  ALA A HB1  9  
ATOM 9223  H HB2  . ALA A 1 5  ? 3.560  -1.062  3.106  1.00 0.00 ? 5  ALA A HB2  9  
ATOM 9224  H HB3  . ALA A 1 5  ? 4.208  -2.170  1.897  1.00 0.00 ? 5  ALA A HB3  9  
ATOM 9225  N N    . GLU A 1 6  ? 0.839  -3.417  3.362  1.00 0.00 ? 6  GLU A N    9  
ATOM 9226  C CA   . GLU A 1 6  ? -0.539 -3.446  3.840  1.00 0.00 ? 6  GLU A CA   9  
ATOM 9227  C C    . GLU A 1 6  ? -0.668 -4.334  5.074  1.00 0.00 ? 6  GLU A C    9  
ATOM 9228  O O    . GLU A 1 6  ? -1.172 -3.904  6.112  1.00 0.00 ? 6  GLU A O    9  
ATOM 9229  C CB   . GLU A 1 6  ? -1.474 -3.946  2.738  1.00 0.00 ? 6  GLU A CB   9  
ATOM 9230  C CG   . GLU A 1 6  ? -1.836 -2.881  1.717  1.00 0.00 ? 6  GLU A CG   9  
ATOM 9231  C CD   . GLU A 1 6  ? -3.184 -3.129  1.067  1.00 0.00 ? 6  GLU A CD   9  
ATOM 9232  O OE1  . GLU A 1 6  ? -3.703 -4.259  1.189  1.00 0.00 ? 6  GLU A OE1  9  
ATOM 9233  O OE2  . GLU A 1 6  ? -3.720 -2.193  0.438  1.00 0.00 ? 6  GLU A OE2  9  
ATOM 9234  H H    . GLU A 1 6  ? 1.022  -3.616  2.420  1.00 0.00 ? 6  GLU A H    9  
ATOM 9235  H HA   . GLU A 1 6  ? -0.818 -2.438  4.107  1.00 0.00 ? 6  GLU A HA   9  
ATOM 9236  H HB2  . GLU A 1 6  ? -0.996 -4.765  2.220  1.00 0.00 ? 6  GLU A HB2  9  
ATOM 9237  H HB3  . GLU A 1 6  ? -2.387 -4.304  3.192  1.00 0.00 ? 6  GLU A HB3  9  
ATOM 9238  H HG2  . GLU A 1 6  ? -1.864 -1.921  2.211  1.00 0.00 ? 6  GLU A HG2  9  
ATOM 9239  H HG3  . GLU A 1 6  ? -1.079 -2.867  0.947  1.00 0.00 ? 6  GLU A HG3  9  
ATOM 9240  N N    . ARG A 1 7  ? -0.210 -5.576  4.953  1.00 0.00 ? 7  ARG A N    9  
ATOM 9241  C CA   . ARG A 1 7  ? -0.276 -6.526  6.057  1.00 0.00 ? 7  ARG A CA   9  
ATOM 9242  C C    . ARG A 1 7  ? 0.360  -5.942  7.315  1.00 0.00 ? 7  ARG A C    9  
ATOM 9243  O O    . ARG A 1 7  ? -0.249 -5.934  8.385  1.00 0.00 ? 7  ARG A O    9  
ATOM 9244  C CB   . ARG A 1 7  ? 0.425  -7.831  5.677  1.00 0.00 ? 7  ARG A CB   9  
ATOM 9245  C CG   . ARG A 1 7  ? 0.079  -8.997  6.589  1.00 0.00 ? 7  ARG A CG   9  
ATOM 9246  C CD   . ARG A 1 7  ? -1.365 -9.437  6.407  1.00 0.00 ? 7  ARG A CD   9  
ATOM 9247  N NE   . ARG A 1 7  ? -2.268 -8.746  7.323  1.00 0.00 ? 7  ARG A NE   9  
ATOM 9248  C CZ   . ARG A 1 7  ? -2.436 -9.096  8.593  1.00 0.00 ? 7  ARG A CZ   9  
ATOM 9249  N NH1  . ARG A 1 7  ? -1.765 -10.124 9.095  1.00 0.00 ? 7  ARG A NH1  9  
ATOM 9250  N NH2  . ARG A 1 7  ? -3.276 -8.417  9.365  1.00 0.00 ? 7  ARG A NH2  9  
ATOM 9251  H H    . ARG A 1 7  ? 0.181  -5.860  4.100  1.00 0.00 ? 7  ARG A H    9  
ATOM 9252  H HA   . ARG A 1 7  ? -1.317 -6.732  6.256  1.00 0.00 ? 7  ARG A HA   9  
ATOM 9253  H HB2  . ARG A 1 7  ? 0.144  -8.097  4.668  1.00 0.00 ? 7  ARG A HB2  9  
ATOM 9254  H HB3  . ARG A 1 7  ? 1.493  -7.677  5.716  1.00 0.00 ? 7  ARG A HB3  9  
ATOM 9255  H HG2  . ARG A 1 7  ? 0.729  -9.828  6.359  1.00 0.00 ? 7  ARG A HG2  9  
ATOM 9256  H HG3  . ARG A 1 7  ? 0.228  -8.694  7.615  1.00 0.00 ? 7  ARG A HG3  9  
ATOM 9257  H HD2  . ARG A 1 7  ? -1.666 -9.226  5.392  1.00 0.00 ? 7  ARG A HD2  9  
ATOM 9258  H HD3  . ARG A 1 7  ? -1.428 -10.500 6.587  1.00 0.00 ? 7  ARG A HD3  9  
ATOM 9259  H HE   . ARG A 1 7  ? -2.773 -7.983  6.973  1.00 0.00 ? 7  ARG A HE   9  
ATOM 9260  H HH11 . ARG A 1 7  ? -1.131 -10.636 8.517  1.00 0.00 ? 7  ARG A HH11 9  
ATOM 9261  H HH12 . ARG A 1 7  ? -1.893 -10.385 10.053 1.00 0.00 ? 7  ARG A HH12 9  
ATOM 9262  H HH21 . ARG A 1 7  ? -3.783 -7.642  8.990  1.00 0.00 ? 7  ARG A HH21 9  
ATOM 9263  H HH22 . ARG A 1 7  ? -3.402 -8.682  10.320 1.00 0.00 ? 7  ARG A HH22 9  
ATOM 9264  N N    . VAL A 1 8  ? 1.589  -5.454  7.179  1.00 0.00 ? 8  VAL A N    9  
ATOM 9265  C CA   . VAL A 1 8  ? 2.308  -4.868  8.304  1.00 0.00 ? 8  VAL A CA   9  
ATOM 9266  C C    . VAL A 1 8  ? 1.466  -3.805  9.000  1.00 0.00 ? 8  VAL A C    9  
ATOM 9267  O O    . VAL A 1 8  ? 1.112  -3.945  10.171 1.00 0.00 ? 8  VAL A O    9  
ATOM 9268  C CB   . VAL A 1 8  ? 3.639  -4.238  7.853  1.00 0.00 ? 8  VAL A CB   9  
ATOM 9269  C CG1  . VAL A 1 8  ? 4.358  -3.604  9.034  1.00 0.00 ? 8  VAL A CG1  9  
ATOM 9270  C CG2  . VAL A 1 8  ? 4.519  -5.279  7.178  1.00 0.00 ? 8  VAL A CG2  9  
ATOM 9271  H H    . VAL A 1 8  ? 2.023  -5.488  6.301  1.00 0.00 ? 8  VAL A H    9  
ATOM 9272  H HA   . VAL A 1 8  ? 2.528  -5.657  9.008  1.00 0.00 ? 8  VAL A HA   9  
ATOM 9273  H HB   . VAL A 1 8  ? 3.421  -3.461  7.134  1.00 0.00 ? 8  VAL A HB   9  
ATOM 9274  H HG11 . VAL A 1 8  ? 4.163  -2.542  9.046  1.00 0.00 ? 8  VAL A HG11 9  
ATOM 9275  H HG12 . VAL A 1 8  ? 4.002  -4.048  9.952  1.00 0.00 ? 8  VAL A HG12 9  
ATOM 9276  H HG13 . VAL A 1 8  ? 5.421  -3.773  8.941  1.00 0.00 ? 8  VAL A HG13 9  
ATOM 9277  H HG21 . VAL A 1 8  ? 4.046  -6.248  7.246  1.00 0.00 ? 8  VAL A HG21 9  
ATOM 9278  H HG22 . VAL A 1 8  ? 4.656  -5.017  6.139  1.00 0.00 ? 8  VAL A HG22 9  
ATOM 9279  H HG23 . VAL A 1 8  ? 5.480  -5.312  7.670  1.00 0.00 ? 8  VAL A HG23 9  
ATOM 9280  N N    . LYS A 1 9  ? 1.146  -2.740  8.272  1.00 0.00 ? 9  LYS A N    9  
ATOM 9281  C CA   . LYS A 1 9  ? 0.343  -1.652  8.818  1.00 0.00 ? 9  LYS A CA   9  
ATOM 9282  C C    . LYS A 1 9  ? -0.940 -2.186  9.447  1.00 0.00 ? 9  LYS A C    9  
ATOM 9283  O O    . LYS A 1 9  ? -1.437 -1.636  10.430 1.00 0.00 ? 9  LYS A O    9  
ATOM 9284  C CB   . LYS A 1 9  ? 0.004  -0.641  7.720  1.00 0.00 ? 9  LYS A CB   9  
ATOM 9285  C CG   . LYS A 1 9  ? 1.226  -0.058  7.032  1.00 0.00 ? 9  LYS A CG   9  
ATOM 9286  C CD   . LYS A 1 9  ? 0.890  1.229   6.296  1.00 0.00 ? 9  LYS A CD   9  
ATOM 9287  C CE   . LYS A 1 9  ? 1.959  1.581   5.273  1.00 0.00 ? 9  LYS A CE   9  
ATOM 9288  N NZ   . LYS A 1 9  ? 3.103  2.304   5.894  1.00 0.00 ? 9  LYS A NZ   9  
ATOM 9289  H H    . LYS A 1 9  ? 1.458  -2.685  7.344  1.00 0.00 ? 9  LYS A H    9  
ATOM 9290  H HA   . LYS A 1 9  ? 0.927  -1.160  9.581  1.00 0.00 ? 9  LYS A HA   9  
ATOM 9291  H HB2  . LYS A 1 9  ? -0.606 -1.129  6.974  1.00 0.00 ? 9  LYS A HB2  9  
ATOM 9292  H HB3  . LYS A 1 9  ? -0.559 0.171   8.157  1.00 0.00 ? 9  LYS A HB3  9  
ATOM 9293  H HG2  . LYS A 1 9  ? 1.981  0.152   7.775  1.00 0.00 ? 9  LYS A HG2  9  
ATOM 9294  H HG3  . LYS A 1 9  ? 1.606  -0.779  6.322  1.00 0.00 ? 9  LYS A HG3  9  
ATOM 9295  H HD2  . LYS A 1 9  ? -0.054 1.106   5.785  1.00 0.00 ? 9  LYS A HD2  9  
ATOM 9296  H HD3  . LYS A 1 9  ? 0.811  2.033   7.014  1.00 0.00 ? 9  LYS A HD3  9  
ATOM 9297  H HE2  . LYS A 1 9  ? 2.322  0.670   4.823  1.00 0.00 ? 9  LYS A HE2  9  
ATOM 9298  H HE3  . LYS A 1 9  ? 1.518  2.208   4.512  1.00 0.00 ? 9  LYS A HE3  9  
ATOM 9299  H HZ1  . LYS A 1 9  ? 3.895  2.363   5.222  1.00 0.00 ? 9  LYS A HZ1  9  
ATOM 9300  H HZ2  . LYS A 1 9  ? 3.424  1.802   6.746  1.00 0.00 ? 9  LYS A HZ2  9  
ATOM 9301  H HZ3  . LYS A 1 9  ? 2.816  3.268   6.159  1.00 0.00 ? 9  LYS A HZ3  9  
ATOM 9302  N N    . LYS A 1 10 ? -1.472 -3.260  8.874  1.00 0.00 ? 10 LYS A N    9  
ATOM 9303  C CA   . LYS A 1 10 ? -2.696 -3.871  9.380  1.00 0.00 ? 10 LYS A CA   9  
ATOM 9304  C C    . LYS A 1 10 ? -2.501 -4.382  10.804 1.00 0.00 ? 10 LYS A C    9  
ATOM 9305  O O    . LYS A 1 10 ? -3.203 -3.965  11.725 1.00 0.00 ? 10 LYS A O    9  
ATOM 9306  C CB   . LYS A 1 10 ? -3.131 -5.020  8.469  1.00 0.00 ? 10 LYS A CB   9  
ATOM 9307  C CG   . LYS A 1 10 ? -4.627 -5.284  8.494  1.00 0.00 ? 10 LYS A CG   9  
ATOM 9308  C CD   . LYS A 1 10 ? -5.087 -6.006  7.239  1.00 0.00 ? 10 LYS A CD   9  
ATOM 9309  C CE   . LYS A 1 10 ? -5.267 -5.043  6.075  1.00 0.00 ? 10 LYS A CE   9  
ATOM 9310  N NZ   . LYS A 1 10 ? -5.681 -5.749  4.831  1.00 0.00 ? 10 LYS A NZ   9  
ATOM 9311  H H    . LYS A 1 10 ? -1.029 -3.653  8.092  1.00 0.00 ? 10 LYS A H    9  
ATOM 9312  H HA   . LYS A 1 10 ? -3.466 -3.114  9.384  1.00 0.00 ? 10 LYS A HA   9  
ATOM 9313  H HB2  . LYS A 1 10 ? -2.844 -4.788  7.454  1.00 0.00 ? 10 LYS A HB2  9  
ATOM 9314  H HB3  . LYS A 1 10 ? -2.623 -5.922  8.779  1.00 0.00 ? 10 LYS A HB3  9  
ATOM 9315  H HG2  . LYS A 1 10 ? -4.861 -5.893  9.354  1.00 0.00 ? 10 LYS A HG2  9  
ATOM 9316  H HG3  . LYS A 1 10 ? -5.148 -4.339  8.566  1.00 0.00 ? 10 LYS A HG3  9  
ATOM 9317  H HD2  . LYS A 1 10 ? -4.348 -6.746  6.968  1.00 0.00 ? 10 LYS A HD2  9  
ATOM 9318  H HD3  . LYS A 1 10 ? -6.030 -6.494  7.440  1.00 0.00 ? 10 LYS A HD3  9  
ATOM 9319  H HE2  . LYS A 1 10 ? -6.024 -4.320  6.338  1.00 0.00 ? 10 LYS A HE2  9  
ATOM 9320  H HE3  . LYS A 1 10 ? -4.330 -4.536  5.897  1.00 0.00 ? 10 LYS A HE3  9  
ATOM 9321  H HZ1  . LYS A 1 10 ? -6.209 -5.100  4.212  1.00 0.00 ? 10 LYS A HZ1  9  
ATOM 9322  H HZ2  . LYS A 1 10 ? -6.290 -6.559  5.065  1.00 0.00 ? 10 LYS A HZ2  9  
ATOM 9323  H HZ3  . LYS A 1 10 ? -4.844 -6.094  4.320  1.00 0.00 ? 10 LYS A HZ3  9  
ATOM 9324  N N    . ILE A 1 11 ? -1.542 -5.286  10.976 1.00 0.00 ? 11 ILE A N    9  
ATOM 9325  C CA   . ILE A 1 11 ? -1.254 -5.851  12.289 1.00 0.00 ? 11 ILE A CA   9  
ATOM 9326  C C    . ILE A 1 11 ? -0.830 -4.767  13.274 1.00 0.00 ? 11 ILE A C    9  
ATOM 9327  O O    . ILE A 1 11 ? -1.073 -4.876  14.476 1.00 0.00 ? 11 ILE A O    9  
ATOM 9328  C CB   . ILE A 1 11 ? -0.146 -6.919  12.210 1.00 0.00 ? 11 ILE A CB   9  
ATOM 9329  C CG1  . ILE A 1 11 ? -0.561 -8.047  11.263 1.00 0.00 ? 11 ILE A CG1  9  
ATOM 9330  C CG2  . ILE A 1 11 ? 0.158  -7.469  13.596 1.00 0.00 ? 11 ILE A CG2  9  
ATOM 9331  C CD1  . ILE A 1 11 ? 0.527  -9.072  11.031 1.00 0.00 ? 11 ILE A CD1  9  
ATOM 9332  H H    . ILE A 1 11 ? -1.016 -5.579  10.204 1.00 0.00 ? 11 ILE A H    9  
ATOM 9333  H HA   . ILE A 1 11 ? -2.155 -6.322  12.653 1.00 0.00 ? 11 ILE A HA   9  
ATOM 9334  H HB   . ILE A 1 11 ? 0.749  -6.450  11.831 1.00 0.00 ? 11 ILE A HB   9  
ATOM 9335  H HG12 . ILE A 1 11 ? -1.416 -8.559  11.675 1.00 0.00 ? 11 ILE A HG12 9  
ATOM 9336  H HG13 . ILE A 1 11 ? -0.828 -7.622  10.306 1.00 0.00 ? 11 ILE A HG13 9  
ATOM 9337  H HG21 . ILE A 1 11 ? -0.587 -7.117  14.294 1.00 0.00 ? 11 ILE A HG21 9  
ATOM 9338  H HG22 . ILE A 1 11 ? 0.140  -8.548  13.566 1.00 0.00 ? 11 ILE A HG22 9  
ATOM 9339  H HG23 . ILE A 1 11 ? 1.134  -7.133  13.911 1.00 0.00 ? 11 ILE A HG23 9  
ATOM 9340  H HD11 . ILE A 1 11 ? 0.984  -8.901  10.067 1.00 0.00 ? 11 ILE A HD11 9  
ATOM 9341  H HD12 . ILE A 1 11 ? 1.274  -8.986  11.805 1.00 0.00 ? 11 ILE A HD12 9  
ATOM 9342  H HD13 . ILE A 1 11 ? 0.098  -10.063 11.054 1.00 0.00 ? 11 ILE A HD13 9  
ATOM 9343  N N    . VAL A 1 12 ? -0.197 -3.719  12.756 1.00 0.00 ? 12 VAL A N    9  
ATOM 9344  C CA   . VAL A 1 12 ? 0.258  -2.613  13.589 1.00 0.00 ? 12 VAL A CA   9  
ATOM 9345  C C    . VAL A 1 12 ? -0.921 -1.808  14.125 1.00 0.00 ? 12 VAL A C    9  
ATOM 9346  O O    . VAL A 1 12 ? -0.935 -1.408  15.289 1.00 0.00 ? 12 VAL A O    9  
ATOM 9347  C CB   . VAL A 1 12 ? 1.195  -1.672  12.809 1.00 0.00 ? 12 VAL A CB   9  
ATOM 9348  C CG1  . VAL A 1 12 ? 1.624  -0.501  13.682 1.00 0.00 ? 12 VAL A CG1  9  
ATOM 9349  C CG2  . VAL A 1 12 ? 2.406  -2.434  12.293 1.00 0.00 ? 12 VAL A CG2  9  
ATOM 9350  H H    . VAL A 1 12 ? -0.033 -3.689  11.790 1.00 0.00 ? 12 VAL A H    9  
ATOM 9351  H HA   . VAL A 1 12 ? 0.808  -3.026  14.422 1.00 0.00 ? 12 VAL A HA   9  
ATOM 9352  H HB   . VAL A 1 12 ? 0.654  -1.280  11.960 1.00 0.00 ? 12 VAL A HB   9  
ATOM 9353  H HG11 . VAL A 1 12 ? 2.269  0.153   13.114 1.00 0.00 ? 12 VAL A HG11 9  
ATOM 9354  H HG12 . VAL A 1 12 ? 0.750  0.045   14.006 1.00 0.00 ? 12 VAL A HG12 9  
ATOM 9355  H HG13 . VAL A 1 12 ? 2.157  -0.873  14.544 1.00 0.00 ? 12 VAL A HG13 9  
ATOM 9356  H HG21 . VAL A 1 12 ? 2.433  -2.380  11.215 1.00 0.00 ? 12 VAL A HG21 9  
ATOM 9357  H HG22 . VAL A 1 12 ? 3.307  -1.997  12.698 1.00 0.00 ? 12 VAL A HG22 9  
ATOM 9358  H HG23 . VAL A 1 12 ? 2.339  -3.467  12.601 1.00 0.00 ? 12 VAL A HG23 9  
ATOM 9359  N N    . VAL A 1 13 ? -1.909 -1.573  13.268 1.00 0.00 ? 13 VAL A N    9  
ATOM 9360  C CA   . VAL A 1 13 ? -3.094 -0.817  13.655 1.00 0.00 ? 13 VAL A CA   9  
ATOM 9361  C C    . VAL A 1 13 ? -4.017 -1.654  14.534 1.00 0.00 ? 13 VAL A C    9  
ATOM 9362  O O    . VAL A 1 13 ? -4.716 -1.125  15.398 1.00 0.00 ? 13 VAL A O    9  
ATOM 9363  C CB   . VAL A 1 13 ? -3.879 -0.332  12.422 1.00 0.00 ? 13 VAL A CB   9  
ATOM 9364  C CG1  . VAL A 1 13 ? -5.132 0.418   12.847 1.00 0.00 ? 13 VAL A CG1  9  
ATOM 9365  C CG2  . VAL A 1 13 ? -2.998 0.540   11.540 1.00 0.00 ? 13 VAL A CG2  9  
ATOM 9366  H H    . VAL A 1 13 ? -1.840 -1.918  12.353 1.00 0.00 ? 13 VAL A H    9  
ATOM 9367  H HA   . VAL A 1 13 ? -2.770 0.049   14.213 1.00 0.00 ? 13 VAL A HA   9  
ATOM 9368  H HB   . VAL A 1 13 ? -4.181 -1.197  11.849 1.00 0.00 ? 13 VAL A HB   9  
ATOM 9369  H HG11 . VAL A 1 13 ? -5.178 1.364   12.328 1.00 0.00 ? 13 VAL A HG11 9  
ATOM 9370  H HG12 . VAL A 1 13 ? -6.004 -0.170  12.602 1.00 0.00 ? 13 VAL A HG12 9  
ATOM 9371  H HG13 . VAL A 1 13 ? -5.102 0.593   13.912 1.00 0.00 ? 13 VAL A HG13 9  
ATOM 9372  H HG21 . VAL A 1 13 ? -3.085 0.217   10.514 1.00 0.00 ? 13 VAL A HG21 9  
ATOM 9373  H HG22 . VAL A 1 13 ? -3.316 1.570   11.621 1.00 0.00 ? 13 VAL A HG22 9  
ATOM 9374  H HG23 . VAL A 1 13 ? -1.971 0.455   11.860 1.00 0.00 ? 13 VAL A HG23 9  
ATOM 9375  N N    . GLU A 1 14 ? -4.014 -2.964  14.308 1.00 0.00 ? 14 GLU A N    9  
ATOM 9376  C CA   . GLU A 1 14 ? -4.851 -3.874  15.080 1.00 0.00 ? 14 GLU A CA   9  
ATOM 9377  C C    . GLU A 1 14 ? -4.202 -4.207  16.420 1.00 0.00 ? 14 GLU A C    9  
ATOM 9378  O O    . GLU A 1 14 ? -4.884 -4.559  17.383 1.00 0.00 ? 14 GLU A O    9  
ATOM 9379  C CB   . GLU A 1 14 ? -5.107 -5.160  14.291 1.00 0.00 ? 14 GLU A CB   9  
ATOM 9380  C CG   . GLU A 1 14 ? -6.107 -6.093  14.954 1.00 0.00 ? 14 GLU A CG   9  
ATOM 9381  C CD   . GLU A 1 14 ? -7.425 -6.161  14.207 1.00 0.00 ? 14 GLU A CD   9  
ATOM 9382  O OE1  . GLU A 1 14 ? -7.462 -6.784  13.125 1.00 0.00 ? 14 GLU A OE1  9  
ATOM 9383  O OE2  . GLU A 1 14 ? -8.419 -5.592  14.705 1.00 0.00 ? 14 GLU A OE2  9  
ATOM 9384  H H    . GLU A 1 14 ? -3.435 -3.327  13.605 1.00 0.00 ? 14 GLU A H    9  
ATOM 9385  H HA   . GLU A 1 14 ? -5.794 -3.382  15.263 1.00 0.00 ? 14 GLU A HA   9  
ATOM 9386  H HB2  . GLU A 1 14 ? -5.483 -4.900  13.312 1.00 0.00 ? 14 GLU A HB2  9  
ATOM 9387  H HB3  . GLU A 1 14 ? -4.173 -5.691  14.178 1.00 0.00 ? 14 GLU A HB3  9  
ATOM 9388  H HG2  . GLU A 1 14 ? -5.683 -7.084  14.996 1.00 0.00 ? 14 GLU A HG2  9  
ATOM 9389  H HG3  . GLU A 1 14 ? -6.297 -5.741  15.958 1.00 0.00 ? 14 GLU A HG3  9  
ATOM 9390  N N    . HIS A 1 15 ? -2.878 -4.095  16.474 1.00 0.00 ? 15 HIS A N    9  
ATOM 9391  C CA   . HIS A 1 15 ? -2.136 -4.383  17.695 1.00 0.00 ? 15 HIS A CA   9  
ATOM 9392  C C    . HIS A 1 15 ? -2.059 -3.149  18.589 1.00 0.00 ? 15 HIS A C    9  
ATOM 9393  O O    . HIS A 1 15 ? -2.474 -3.183  19.749 1.00 0.00 ? 15 HIS A O    9  
ATOM 9394  C CB   . HIS A 1 15 ? -0.726 -4.870  17.357 1.00 0.00 ? 15 HIS A CB   9  
ATOM 9395  C CG   . HIS A 1 15 ? 0.095  -5.211  18.562 1.00 0.00 ? 15 HIS A CG   9  
ATOM 9396  N ND1  . HIS A 1 15 ? -0.400 -5.926  19.633 1.00 0.00 ? 15 HIS A ND1  9  
ATOM 9397  C CD2  . HIS A 1 15 ? 1.385  -4.932  18.862 1.00 0.00 ? 15 HIS A CD2  9  
ATOM 9398  C CE1  . HIS A 1 15 ? 0.550  -6.070  20.540 1.00 0.00 ? 15 HIS A CE1  9  
ATOM 9399  N NE2  . HIS A 1 15 ? 1.643  -5.476  20.096 1.00 0.00 ? 15 HIS A NE2  9  
ATOM 9400  H H    . HIS A 1 15 ? -2.390 -3.810  15.673 1.00 0.00 ? 15 HIS A H    9  
ATOM 9401  H HA   . HIS A 1 15 ? -2.660 -5.164  18.225 1.00 0.00 ? 15 HIS A HA   9  
ATOM 9402  H HB2  . HIS A 1 15 ? -0.797 -5.756  16.743 1.00 0.00 ? 15 HIS A HB2  9  
ATOM 9403  H HB3  . HIS A 1 15 ? -0.207 -4.098  16.808 1.00 0.00 ? 15 HIS A HB3  9  
ATOM 9404  H HD1  . HIS A 1 15 ? -1.312 -6.274  19.716 1.00 0.00 ? 15 HIS A HD1  9  
ATOM 9405  H HD2  . HIS A 1 15 ? 2.083  -4.382  18.246 1.00 0.00 ? 15 HIS A HD2  9  
ATOM 9406  H HE1  . HIS A 1 15 ? 0.450  -6.586  21.483 1.00 0.00 ? 15 HIS A HE1  9  
ATOM 9407  N N    . LEU A 1 16 ? -1.526 -2.062  18.043 1.00 0.00 ? 16 LEU A N    9  
ATOM 9408  C CA   . LEU A 1 16 ? -1.395 -0.816  18.792 1.00 0.00 ? 16 LEU A CA   9  
ATOM 9409  C C    . LEU A 1 16 ? -2.747 -0.128  18.945 1.00 0.00 ? 16 LEU A C    9  
ATOM 9410  O O    . LEU A 1 16 ? -2.972 0.617   19.899 1.00 0.00 ? 16 LEU A O    9  
ATOM 9411  C CB   . LEU A 1 16 ? -0.410 0.121   18.091 1.00 0.00 ? 16 LEU A CB   9  
ATOM 9412  C CG   . LEU A 1 16 ? 1.073  -0.155  18.343 1.00 0.00 ? 16 LEU A CG   9  
ATOM 9413  C CD1  . LEU A 1 16 ? 1.388  -0.067  19.828 1.00 0.00 ? 16 LEU A CD1  9  
ATOM 9414  C CD2  . LEU A 1 16 ? 1.463  -1.519  17.793 1.00 0.00 ? 16 LEU A CD2  9  
ATOM 9415  H H    . LEU A 1 16 ? -1.214 -2.096  17.116 1.00 0.00 ? 16 LEU A H    9  
ATOM 9416  H HA   . LEU A 1 16 ? -1.014 -1.058  19.773 1.00 0.00 ? 16 LEU A HA   9  
ATOM 9417  H HB2  . LEU A 1 16 ? -0.583 0.049   17.029 1.00 0.00 ? 16 LEU A HB2  9  
ATOM 9418  H HB3  . LEU A 1 16 ? -0.621 1.128   18.421 1.00 0.00 ? 16 LEU A HB3  9  
ATOM 9419  H HG   . LEU A 1 16 ? 1.664  0.594   17.833 1.00 0.00 ? 16 LEU A HG   9  
ATOM 9420  H HD11 . LEU A 1 16 ? 0.977  -0.927  20.335 1.00 0.00 ? 16 LEU A HD11 9  
ATOM 9421  H HD12 . LEU A 1 16 ? 0.952  0.833   20.236 1.00 0.00 ? 16 LEU A HD12 9  
ATOM 9422  H HD13 . LEU A 1 16 ? 2.459  -0.043  19.968 1.00 0.00 ? 16 LEU A HD13 9  
ATOM 9423  H HD21 . LEU A 1 16 ? 2.486  -1.489  17.449 1.00 0.00 ? 16 LEU A HD21 9  
ATOM 9424  H HD22 . LEU A 1 16 ? 0.813  -1.773  16.968 1.00 0.00 ? 16 LEU A HD22 9  
ATOM 9425  H HD23 . LEU A 1 16 ? 1.367  -2.261  18.571 1.00 0.00 ? 16 LEU A HD23 9  
ATOM 9426  N N    . GLY A 1 17 ? -3.647 -0.384  18.001 1.00 0.00 ? 17 GLY A N    9  
ATOM 9427  C CA   . GLY A 1 17 ? -4.967 0.217   18.051 1.00 0.00 ? 17 GLY A CA   9  
ATOM 9428  C C    . GLY A 1 17 ? -4.942 1.699   17.736 1.00 0.00 ? 17 GLY A C    9  
ATOM 9429  O O    . GLY A 1 17 ? -5.711 2.475   18.303 1.00 0.00 ? 17 GLY A O    9  
ATOM 9430  H H    . GLY A 1 17 ? -3.413 -0.986  17.264 1.00 0.00 ? 17 GLY A H    9  
ATOM 9431  H HA2  . GLY A 1 17 ? -5.605 -0.282  17.336 1.00 0.00 ? 17 GLY A HA2  9  
ATOM 9432  H HA3  . GLY A 1 17 ? -5.376 0.078   19.041 1.00 0.00 ? 17 GLY A HA3  9  
ATOM 9433  N N    . VAL A 1 18 ? -4.053 2.095   16.830 1.00 0.00 ? 18 VAL A N    9  
ATOM 9434  C CA   . VAL A 1 18 ? -3.930 3.495   16.441 1.00 0.00 ? 18 VAL A CA   9  
ATOM 9435  C C    . VAL A 1 18 ? -4.500 3.730   15.046 1.00 0.00 ? 18 VAL A C    9  
ATOM 9436  O O    . VAL A 1 18 ? -5.092 2.832   14.447 1.00 0.00 ? 18 VAL A O    9  
ATOM 9437  C CB   . VAL A 1 18 ? -2.461 3.957   16.468 1.00 0.00 ? 18 VAL A CB   9  
ATOM 9438  C CG1  . VAL A 1 18 ? -1.847 3.706   17.837 1.00 0.00 ? 18 VAL A CG1  9  
ATOM 9439  C CG2  . VAL A 1 18 ? -1.662 3.257   15.380 1.00 0.00 ? 18 VAL A CG2  9  
ATOM 9440  H H    . VAL A 1 18 ? -3.468 1.430   16.412 1.00 0.00 ? 18 VAL A H    9  
ATOM 9441  H HA   . VAL A 1 18 ? -4.486 4.089   17.151 1.00 0.00 ? 18 VAL A HA   9  
ATOM 9442  H HB   . VAL A 1 18 ? -2.436 5.020   16.276 1.00 0.00 ? 18 VAL A HB   9  
ATOM 9443  H HG11 . VAL A 1 18 ? -2.403 4.252   18.586 1.00 0.00 ? 18 VAL A HG11 9  
ATOM 9444  H HG12 . VAL A 1 18 ? -1.882 2.650   18.059 1.00 0.00 ? 18 VAL A HG12 9  
ATOM 9445  H HG13 . VAL A 1 18 ? -0.820 4.041   17.837 1.00 0.00 ? 18 VAL A HG13 9  
ATOM 9446  H HG21 . VAL A 1 18 ? -2.108 2.297   15.168 1.00 0.00 ? 18 VAL A HG21 9  
ATOM 9447  H HG22 . VAL A 1 18 ? -1.666 3.861   14.484 1.00 0.00 ? 18 VAL A HG22 9  
ATOM 9448  H HG23 . VAL A 1 18 ? -0.645 3.116   15.713 1.00 0.00 ? 18 VAL A HG23 9  
ATOM 9449  N N    . ASP A 1 19 ? -4.316 4.942   14.535 1.00 0.00 ? 19 ASP A N    9  
ATOM 9450  C CA   . ASP A 1 19 ? -4.811 5.296   13.210 1.00 0.00 ? 19 ASP A CA   9  
ATOM 9451  C C    . ASP A 1 19 ? -3.820 4.873   12.130 1.00 0.00 ? 19 ASP A C    9  
ATOM 9452  O O    . ASP A 1 19 ? -2.608 4.894   12.342 1.00 0.00 ? 19 ASP A O    9  
ATOM 9453  C CB   . ASP A 1 19 ? -5.067 6.801   13.123 1.00 0.00 ? 19 ASP A CB   9  
ATOM 9454  C CG   . ASP A 1 19 ? -6.151 7.147   12.121 1.00 0.00 ? 19 ASP A CG   9  
ATOM 9455  O OD1  . ASP A 1 19 ? -7.114 6.362   11.993 1.00 0.00 ? 19 ASP A OD1  9  
ATOM 9456  O OD2  . ASP A 1 19 ? -6.037 8.203   11.464 1.00 0.00 ? 19 ASP A OD2  9  
ATOM 9457  H H    . ASP A 1 19 ? -3.836 5.616   15.062 1.00 0.00 ? 19 ASP A H    9  
ATOM 9458  H HA   . ASP A 1 19 ? -5.741 4.772   13.052 1.00 0.00 ? 19 ASP A HA   9  
ATOM 9459  H HB2  . ASP A 1 19 ? -5.372 7.165   14.093 1.00 0.00 ? 19 ASP A HB2  9  
ATOM 9460  H HB3  . ASP A 1 19 ? -4.156 7.299   12.826 1.00 0.00 ? 19 ASP A HB3  9  
ATOM 9461  N N    . ALA A 1 20 ? -4.344 4.489   10.971 1.00 0.00 ? 20 ALA A N    9  
ATOM 9462  C CA   . ALA A 1 20 ? -3.506 4.062   9.857  1.00 0.00 ? 20 ALA A CA   9  
ATOM 9463  C C    . ALA A 1 20 ? -2.842 5.256   9.181  1.00 0.00 ? 20 ALA A C    9  
ATOM 9464  O O    . ALA A 1 20 ? -1.769 5.129   8.591  1.00 0.00 ? 20 ALA A O    9  
ATOM 9465  C CB   . ALA A 1 20 ? -4.329 3.272   8.850  1.00 0.00 ? 20 ALA A CB   9  
ATOM 9466  H H    . ALA A 1 20 ? -5.318 4.493   10.862 1.00 0.00 ? 20 ALA A H    9  
ATOM 9467  H HA   . ALA A 1 20 ? -2.739 3.409   10.248 1.00 0.00 ? 20 ALA A HA   9  
ATOM 9468  H HB1  . ALA A 1 20 ? -3.667 2.791   8.144  1.00 0.00 ? 20 ALA A HB1  9  
ATOM 9469  H HB2  . ALA A 1 20 ? -4.911 2.524   9.367  1.00 0.00 ? 20 ALA A HB2  9  
ATOM 9470  H HB3  . ALA A 1 20 ? -4.991 3.943   8.322  1.00 0.00 ? 20 ALA A HB3  9  
ATOM 9471  N N    . ASP A 1 21 ? -3.486 6.414   9.270  1.00 0.00 ? 21 ASP A N    9  
ATOM 9472  C CA   . ASP A 1 21 ? -2.957 7.632   8.666  1.00 0.00 ? 21 ASP A CA   9  
ATOM 9473  C C    . ASP A 1 21 ? -1.596 7.984   9.258  1.00 0.00 ? 21 ASP A C    9  
ATOM 9474  O O    . ASP A 1 21 ? -0.773 8.632   8.610  1.00 0.00 ? 21 ASP A O    9  
ATOM 9475  C CB   . ASP A 1 21 ? -3.932 8.792   8.870  1.00 0.00 ? 21 ASP A CB   9  
ATOM 9476  C CG   . ASP A 1 21 ? -3.375 10.111  8.368  1.00 0.00 ? 21 ASP A CG   9  
ATOM 9477  O OD1  . ASP A 1 21 ? -3.477 10.374  7.152  1.00 0.00 ? 21 ASP A OD1  9  
ATOM 9478  O OD2  . ASP A 1 21 ? -2.838 10.879  9.193  1.00 0.00 ? 21 ASP A OD2  9  
ATOM 9479  H H    . ASP A 1 21 ? -4.338 6.451   9.754  1.00 0.00 ? 21 ASP A H    9  
ATOM 9480  H HA   . ASP A 1 21 ? -2.840 7.454   7.608  1.00 0.00 ? 21 ASP A HA   9  
ATOM 9481  H HB2  . ASP A 1 21 ? -4.847 8.583   8.336  1.00 0.00 ? 21 ASP A HB2  9  
ATOM 9482  H HB3  . ASP A 1 21 ? -4.149 8.891   9.923  1.00 0.00 ? 21 ASP A HB3  9  
ATOM 9483  N N    . LYS A 1 22 ? -1.365 7.555   10.494 1.00 0.00 ? 22 LYS A N    9  
ATOM 9484  C CA   . LYS A 1 22 ? -0.104 7.825   11.175 1.00 0.00 ? 22 LYS A CA   9  
ATOM 9485  C C    . LYS A 1 22 ? 0.961  6.812   10.768 1.00 0.00 ? 22 LYS A C    9  
ATOM 9486  O O    . LYS A 1 22 ? 2.158  7.097   10.826 1.00 0.00 ? 22 LYS A O    9  
ATOM 9487  C CB   . LYS A 1 22 ? -0.302 7.791   12.692 1.00 0.00 ? 22 LYS A CB   9  
ATOM 9488  C CG   . LYS A 1 22 ? -1.434 8.680   13.178 1.00 0.00 ? 22 LYS A CG   9  
ATOM 9489  C CD   . LYS A 1 22 ? -1.781 8.397   14.630 1.00 0.00 ? 22 LYS A CD   9  
ATOM 9490  C CE   . LYS A 1 22 ? -0.830 9.109   15.579 1.00 0.00 ? 22 LYS A CE   9  
ATOM 9491  N NZ   . LYS A 1 22 ? -1.332 9.096   16.981 1.00 0.00 ? 22 LYS A NZ   9  
ATOM 9492  H H    . LYS A 1 22 ? -2.060 7.043   10.960 1.00 0.00 ? 22 LYS A H    9  
ATOM 9493  H HA   . LYS A 1 22 ? 0.225  8.811   10.886 1.00 0.00 ? 22 LYS A HA   9  
ATOM 9494  H HB2  . LYS A 1 22 ? -0.516 6.775   12.992 1.00 0.00 ? 22 LYS A HB2  9  
ATOM 9495  H HB3  . LYS A 1 22 ? 0.612  8.114   13.170 1.00 0.00 ? 22 LYS A HB3  9  
ATOM 9496  H HG2  . LYS A 1 22 ? -1.133 9.713   13.085 1.00 0.00 ? 22 LYS A HG2  9  
ATOM 9497  H HG3  . LYS A 1 22 ? -2.307 8.501   12.566 1.00 0.00 ? 22 LYS A HG3  9  
ATOM 9498  H HD2  . LYS A 1 22 ? -2.787 8.739   14.823 1.00 0.00 ? 22 LYS A HD2  9  
ATOM 9499  H HD3  . LYS A 1 22 ? -1.721 7.332   14.804 1.00 0.00 ? 22 LYS A HD3  9  
ATOM 9500  H HE2  . LYS A 1 22 ? 0.129  8.614   15.545 1.00 0.00 ? 22 LYS A HE2  9  
ATOM 9501  H HE3  . LYS A 1 22 ? -0.718 10.133  15.255 1.00 0.00 ? 22 LYS A HE3  9  
ATOM 9502  H HZ1  . LYS A 1 22 ? -1.076 8.200   17.444 1.00 0.00 ? 22 LYS A HZ1  9  
ATOM 9503  H HZ2  . LYS A 1 22 ? -2.368 9.193   16.990 1.00 0.00 ? 22 LYS A HZ2  9  
ATOM 9504  H HZ3  . LYS A 1 22 ? -0.916 9.883   17.517 1.00 0.00 ? 22 LYS A HZ3  9  
ATOM 9505  N N    . VAL A 1 23 ? 0.519  5.628   10.355 1.00 0.00 ? 23 VAL A N    9  
ATOM 9506  C CA   . VAL A 1 23 ? 1.435  4.574   9.935  1.00 0.00 ? 23 VAL A CA   9  
ATOM 9507  C C    . VAL A 1 23 ? 2.136  4.941   8.633  1.00 0.00 ? 23 VAL A C    9  
ATOM 9508  O O    . VAL A 1 23 ? 1.662  4.613   7.544  1.00 0.00 ? 23 VAL A O    9  
ATOM 9509  C CB   . VAL A 1 23 ? 0.700  3.233   9.750  1.00 0.00 ? 23 VAL A CB   9  
ATOM 9510  C CG1  . VAL A 1 23 ? 1.691  2.116   9.460  1.00 0.00 ? 23 VAL A CG1  9  
ATOM 9511  C CG2  . VAL A 1 23 ? -0.137 2.910   10.979 1.00 0.00 ? 23 VAL A CG2  9  
ATOM 9512  H H    . VAL A 1 23 ? -0.446 5.461   10.330 1.00 0.00 ? 23 VAL A H    9  
ATOM 9513  H HA   . VAL A 1 23 ? 2.177  4.449   10.710 1.00 0.00 ? 23 VAL A HA   9  
ATOM 9514  H HB   . VAL A 1 23 ? 0.036  3.324   8.902  1.00 0.00 ? 23 VAL A HB   9  
ATOM 9515  H HG11 . VAL A 1 23 ? 2.440  2.090   10.237 1.00 0.00 ? 23 VAL A HG11 9  
ATOM 9516  H HG12 . VAL A 1 23 ? 1.169  1.171   9.429  1.00 0.00 ? 23 VAL A HG12 9  
ATOM 9517  H HG13 . VAL A 1 23 ? 2.167  2.296   8.508  1.00 0.00 ? 23 VAL A HG13 9  
ATOM 9518  H HG21 . VAL A 1 23 ? -0.582 1.933   10.863 1.00 0.00 ? 23 VAL A HG21 9  
ATOM 9519  H HG22 . VAL A 1 23 ? 0.494  2.916   11.856 1.00 0.00 ? 23 VAL A HG22 9  
ATOM 9520  H HG23 . VAL A 1 23 ? -0.915 3.650   11.090 1.00 0.00 ? 23 VAL A HG23 9  
ATOM 9521  N N    . THR A 1 24 ? 3.271  5.624   8.750  1.00 0.00 ? 24 THR A N    9  
ATOM 9522  C CA   . THR A 1 24 ? 4.039  6.037   7.582  1.00 0.00 ? 24 THR A CA   9  
ATOM 9523  C C    . THR A 1 24 ? 5.396  5.344   7.543  1.00 0.00 ? 24 THR A C    9  
ATOM 9524  O O    . THR A 1 24 ? 5.885  4.861   8.563  1.00 0.00 ? 24 THR A O    9  
ATOM 9525  C CB   . THR A 1 24 ? 4.253  7.562   7.561  1.00 0.00 ? 24 THR A CB   9  
ATOM 9526  O OG1  . THR A 1 24 ? 5.021  7.964   8.701  1.00 0.00 ? 24 THR A OG1  9  
ATOM 9527  C CG2  . THR A 1 24 ? 2.921  8.296   7.556  1.00 0.00 ? 24 THR A CG2  9  
ATOM 9528  H H    . THR A 1 24 ? 3.598  5.856   9.644  1.00 0.00 ? 24 THR A H    9  
ATOM 9529  H HA   . THR A 1 24 ? 3.479  5.761   6.700  1.00 0.00 ? 24 THR A HA   9  
ATOM 9530  H HB   . THR A 1 24 ? 4.794  7.822   6.663  1.00 0.00 ? 24 THR A HB   9  
ATOM 9531  H HG1  . THR A 1 24 ? 5.801  8.443   8.409  1.00 0.00 ? 24 THR A HG1  9  
ATOM 9532  H HG21 . THR A 1 24 ? 2.538  8.340   6.547  1.00 0.00 ? 24 THR A HG21 9  
ATOM 9533  H HG22 . THR A 1 24 ? 3.061  9.299   7.933  1.00 0.00 ? 24 THR A HG22 9  
ATOM 9534  H HG23 . THR A 1 24 ? 2.219  7.770   8.185  1.00 0.00 ? 24 THR A HG23 9  
ATOM 9535  N N    . GLU A 1 25 ? 5.998  5.298   6.358  1.00 0.00 ? 25 GLU A N    9  
ATOM 9536  C CA   . GLU A 1 25 ? 7.299  4.663   6.188  1.00 0.00 ? 25 GLU A CA   9  
ATOM 9537  C C    . GLU A 1 25 ? 8.305  5.202   7.201  1.00 0.00 ? 25 GLU A C    9  
ATOM 9538  O O    . GLU A 1 25 ? 9.086  4.447   7.779  1.00 0.00 ? 25 GLU A O    9  
ATOM 9539  C CB   . GLU A 1 25 ? 7.820  4.890   4.767  1.00 0.00 ? 25 GLU A CB   9  
ATOM 9540  C CG   . GLU A 1 25 ? 7.388  3.816   3.782  1.00 0.00 ? 25 GLU A CG   9  
ATOM 9541  C CD   . GLU A 1 25 ? 5.880  3.686   3.685  1.00 0.00 ? 25 GLU A CD   9  
ATOM 9542  O OE1  . GLU A 1 25 ? 5.208  4.720   3.490  1.00 0.00 ? 25 GLU A OE1  9  
ATOM 9543  O OE2  . GLU A 1 25 ? 5.373  2.551   3.804  1.00 0.00 ? 25 GLU A OE2  9  
ATOM 9544  H H    . GLU A 1 25 ? 5.557  5.701   5.581  1.00 0.00 ? 25 GLU A H    9  
ATOM 9545  H HA   . GLU A 1 25 ? 7.175  3.603   6.351  1.00 0.00 ? 25 GLU A HA   9  
ATOM 9546  H HB2  . GLU A 1 25 ? 7.457  5.843   4.411  1.00 0.00 ? 25 GLU A HB2  9  
ATOM 9547  H HB3  . GLU A 1 25 ? 8.899  4.912   4.792  1.00 0.00 ? 25 GLU A HB3  9  
ATOM 9548  H HG2  . GLU A 1 25 ? 7.776  4.065   2.805  1.00 0.00 ? 25 GLU A HG2  9  
ATOM 9549  H HG3  . GLU A 1 25 ? 7.797  2.868   4.100  1.00 0.00 ? 25 GLU A HG3  9  
ATOM 9550  N N    . GLY A 1 26 ? 8.279  6.515   7.412  1.00 0.00 ? 26 GLY A N    9  
ATOM 9551  C CA   . GLY A 1 26 ? 9.193  7.133   8.354  1.00 0.00 ? 26 GLY A CA   9  
ATOM 9552  C C    . GLY A 1 26 ? 8.584  7.289   9.734  1.00 0.00 ? 26 GLY A C    9  
ATOM 9553  O O    . GLY A 1 26 ? 8.893  8.240   10.452 1.00 0.00 ? 26 GLY A O    9  
ATOM 9554  H H    . GLY A 1 26 ? 7.635  7.068   6.922  1.00 0.00 ? 26 GLY A H    9  
ATOM 9555  H HA2  . GLY A 1 26 ? 10.081 6.524   8.431  1.00 0.00 ? 26 GLY A HA2  9  
ATOM 9556  H HA3  . GLY A 1 26 ? 9.469  8.109   7.983  1.00 0.00 ? 26 GLY A HA3  9  
ATOM 9557  N N    . ALA A 1 27 ? 7.716  6.354   10.105 1.00 0.00 ? 27 ALA A N    9  
ATOM 9558  C CA   . ALA A 1 27 ? 7.063  6.391   11.408 1.00 0.00 ? 27 ALA A CA   9  
ATOM 9559  C C    . ALA A 1 27 ? 7.775  5.484   12.405 1.00 0.00 ? 27 ALA A C    9  
ATOM 9560  O O    . ALA A 1 27 ? 7.727  4.259   12.289 1.00 0.00 ? 27 ALA A O    9  
ATOM 9561  C CB   . ALA A 1 27 ? 5.601  5.991   11.277 1.00 0.00 ? 27 ALA A CB   9  
ATOM 9562  H H    . ALA A 1 27 ? 7.512  5.620   9.489  1.00 0.00 ? 27 ALA A H    9  
ATOM 9563  H HA   . ALA A 1 27 ? 7.102  7.408   11.771 1.00 0.00 ? 27 ALA A HA   9  
ATOM 9564  H HB1  . ALA A 1 27 ? 5.097  6.685   10.620 1.00 0.00 ? 27 ALA A HB1  9  
ATOM 9565  H HB2  . ALA A 1 27 ? 5.536  4.994   10.867 1.00 0.00 ? 27 ALA A HB2  9  
ATOM 9566  H HB3  . ALA A 1 27 ? 5.134  6.012   12.251 1.00 0.00 ? 27 ALA A HB3  9  
ATOM 9567  N N    . SER A 1 28 ? 8.436  6.092   13.385 1.00 0.00 ? 28 SER A N    9  
ATOM 9568  C CA   . SER A 1 28 ? 9.162  5.338   14.401 1.00 0.00 ? 28 SER A CA   9  
ATOM 9569  C C    . SER A 1 28 ? 8.238  4.945   15.550 1.00 0.00 ? 28 SER A C    9  
ATOM 9570  O O    . SER A 1 28 ? 7.707  5.802   16.256 1.00 0.00 ? 28 SER A O    9  
ATOM 9571  C CB   . SER A 1 28 ? 10.336 6.160   14.934 1.00 0.00 ? 28 SER A CB   9  
ATOM 9572  O OG   . SER A 1 28 ? 11.448 6.089   14.058 1.00 0.00 ? 28 SER A OG   9  
ATOM 9573  H H    . SER A 1 28 ? 8.437  7.071   13.425 1.00 0.00 ? 28 SER A H    9  
ATOM 9574  H HA   . SER A 1 28 ? 9.543  4.440   13.938 1.00 0.00 ? 28 SER A HA   9  
ATOM 9575  H HB2  . SER A 1 28 ? 10.035 7.192   15.032 1.00 0.00 ? 28 SER A HB2  9  
ATOM 9576  H HB3  . SER A 1 28 ? 10.630 5.777   15.901 1.00 0.00 ? 28 SER A HB3  9  
ATOM 9577  H HG   . SER A 1 28 ? 11.665 6.970   13.745 1.00 0.00 ? 28 SER A HG   9  
ATOM 9578  N N    . PHE A 1 29 ? 8.050  3.642   15.730 1.00 0.00 ? 29 PHE A N    9  
ATOM 9579  C CA   . PHE A 1 29 ? 7.189  3.133   16.792 1.00 0.00 ? 29 PHE A CA   9  
ATOM 9580  C C    . PHE A 1 29 ? 7.725  3.533   18.164 1.00 0.00 ? 29 PHE A C    9  
ATOM 9581  O O    . PHE A 1 29 ? 7.025  3.423   19.171 1.00 0.00 ? 29 PHE A O    9  
ATOM 9582  C CB   . PHE A 1 29 ? 7.076  1.610   16.700 1.00 0.00 ? 29 PHE A CB   9  
ATOM 9583  C CG   . PHE A 1 29 ? 6.761  1.115   15.318 1.00 0.00 ? 29 PHE A CG   9  
ATOM 9584  C CD1  . PHE A 1 29 ? 5.470  1.183   14.821 1.00 0.00 ? 29 PHE A CD1  9  
ATOM 9585  C CD2  . PHE A 1 29 ? 7.757  0.581   14.516 1.00 0.00 ? 29 PHE A CD2  9  
ATOM 9586  C CE1  . PHE A 1 29 ? 5.177  0.728   13.549 1.00 0.00 ? 29 PHE A CE1  9  
ATOM 9587  C CE2  . PHE A 1 29 ? 7.470  0.125   13.243 1.00 0.00 ? 29 PHE A CE2  9  
ATOM 9588  C CZ   . PHE A 1 29 ? 6.178  0.198   12.759 1.00 0.00 ? 29 PHE A CZ   9  
ATOM 9589  H H    . PHE A 1 29 ? 8.500  3.007   15.134 1.00 0.00 ? 29 PHE A H    9  
ATOM 9590  H HA   . PHE A 1 29 ? 6.210  3.567   16.661 1.00 0.00 ? 29 PHE A HA   9  
ATOM 9591  H HB2  . PHE A 1 29 ? 8.012  1.168   17.006 1.00 0.00 ? 29 PHE A HB2  9  
ATOM 9592  H HB3  . PHE A 1 29 ? 6.291  1.275   17.361 1.00 0.00 ? 29 PHE A HB3  9  
ATOM 9593  H HD1  . PHE A 1 29 ? 4.685  1.598   15.438 1.00 0.00 ? 29 PHE A HD1  9  
ATOM 9594  H HD2  . PHE A 1 29 ? 8.767  0.522   14.893 1.00 0.00 ? 29 PHE A HD2  9  
ATOM 9595  H HE1  . PHE A 1 29 ? 4.165  0.786   13.174 1.00 0.00 ? 29 PHE A HE1  9  
ATOM 9596  H HE2  . PHE A 1 29 ? 8.254  -0.289  12.628 1.00 0.00 ? 29 PHE A HE2  9  
ATOM 9597  H HZ   . PHE A 1 29 ? 5.951  -0.157  11.765 1.00 0.00 ? 29 PHE A HZ   9  
ATOM 9598  N N    . ILE A 1 30 ? 8.970  3.996   18.195 1.00 0.00 ? 30 ILE A N    9  
ATOM 9599  C CA   . ILE A 1 30 ? 9.599  4.412   19.442 1.00 0.00 ? 30 ILE A CA   9  
ATOM 9600  C C    . ILE A 1 30 ? 9.244  5.856   19.781 1.00 0.00 ? 30 ILE A C    9  
ATOM 9601  O O    . ILE A 1 30 ? 8.767  6.147   20.878 1.00 0.00 ? 30 ILE A O    9  
ATOM 9602  C CB   . ILE A 1 30 ? 11.131 4.275   19.372 1.00 0.00 ? 30 ILE A CB   9  
ATOM 9603  C CG1  . ILE A 1 30 ? 11.524 2.819   19.114 1.00 0.00 ? 30 ILE A CG1  9  
ATOM 9604  C CG2  . ILE A 1 30 ? 11.767 4.780   20.659 1.00 0.00 ? 30 ILE A CG2  9  
ATOM 9605  C CD1  . ILE A 1 30 ? 10.985 1.856   20.149 1.00 0.00 ? 30 ILE A CD1  9  
ATOM 9606  H H    . ILE A 1 30 ? 9.477  4.060   17.359 1.00 0.00 ? 30 ILE A H    9  
ATOM 9607  H HA   . ILE A 1 30 ? 9.235  3.769   20.229 1.00 0.00 ? 30 ILE A HA   9  
ATOM 9608  H HB   . ILE A 1 30 ? 11.489 4.887   18.558 1.00 0.00 ? 30 ILE A HB   9  
ATOM 9609  H HG12 . ILE A 1 30 ? 11.145 2.516   18.151 1.00 0.00 ? 30 ILE A HG12 9  
ATOM 9610  H HG13 . ILE A 1 30 ? 12.601 2.739   19.114 1.00 0.00 ? 30 ILE A HG13 9  
ATOM 9611  H HG21 . ILE A 1 30 ? 12.369 5.652   20.445 1.00 0.00 ? 30 ILE A HG21 9  
ATOM 9612  H HG22 . ILE A 1 30 ? 10.993 5.043   21.364 1.00 0.00 ? 30 ILE A HG22 9  
ATOM 9613  H HG23 . ILE A 1 30 ? 12.391 4.007   21.080 1.00 0.00 ? 30 ILE A HG23 9  
ATOM 9614  H HD11 . ILE A 1 30 ? 10.583 2.411   20.984 1.00 0.00 ? 30 ILE A HD11 9  
ATOM 9615  H HD12 . ILE A 1 30 ? 10.206 1.252   19.708 1.00 0.00 ? 30 ILE A HD12 9  
ATOM 9616  H HD13 . ILE A 1 30 ? 11.784 1.216   20.495 1.00 0.00 ? 30 ILE A HD13 9  
ATOM 9617  N N    . ASP A 1 31 ? 9.479  6.756   18.833 1.00 0.00 ? 31 ASP A N    9  
ATOM 9618  C CA   . ASP A 1 31 ? 9.181  8.170   19.030 1.00 0.00 ? 31 ASP A CA   9  
ATOM 9619  C C    . ASP A 1 31 ? 7.799  8.516   18.484 1.00 0.00 ? 31 ASP A C    9  
ATOM 9620  O O    . ASP A 1 31 ? 6.917  8.947   19.227 1.00 0.00 ? 31 ASP A O    9  
ATOM 9621  C CB   . ASP A 1 31 ? 10.243 9.036   18.350 1.00 0.00 ? 31 ASP A CB   9  
ATOM 9622  C CG   . ASP A 1 31 ? 10.284 10.445  18.907 1.00 0.00 ? 31 ASP A CG   9  
ATOM 9623  O OD1  . ASP A 1 31 ? 9.388  10.794  19.704 1.00 0.00 ? 31 ASP A OD1  9  
ATOM 9624  O OD2  . ASP A 1 31 ? 11.212 11.199  18.547 1.00 0.00 ? 31 ASP A OD2  9  
ATOM 9625  H H    . ASP A 1 31 ? 9.860  6.462   17.979 1.00 0.00 ? 31 ASP A H    9  
ATOM 9626  H HA   . ASP A 1 31 ? 9.195  8.367   20.091 1.00 0.00 ? 31 ASP A HA   9  
ATOM 9627  H HB2  . ASP A 1 31 ? 11.213 8.583   18.493 1.00 0.00 ? 31 ASP A HB2  9  
ATOM 9628  H HB3  . ASP A 1 31 ? 10.029 9.092   17.293 1.00 0.00 ? 31 ASP A HB3  9  
ATOM 9629  N N    . ASP A 1 32 ? 7.618  8.324   17.182 1.00 0.00 ? 32 ASP A N    9  
ATOM 9630  C CA   . ASP A 1 32 ? 6.343  8.615   16.536 1.00 0.00 ? 32 ASP A CA   9  
ATOM 9631  C C    . ASP A 1 32 ? 5.177  8.151   17.403 1.00 0.00 ? 32 ASP A C    9  
ATOM 9632  O O    . ASP A 1 32 ? 4.170  8.848   17.532 1.00 0.00 ? 32 ASP A O    9  
ATOM 9633  C CB   . ASP A 1 32 ? 6.276  7.942   15.165 1.00 0.00 ? 32 ASP A CB   9  
ATOM 9634  C CG   . ASP A 1 32 ? 5.471  8.746   14.164 1.00 0.00 ? 32 ASP A CG   9  
ATOM 9635  O OD1  . ASP A 1 32 ? 4.243  8.532   14.080 1.00 0.00 ? 32 ASP A OD1  9  
ATOM 9636  O OD2  . ASP A 1 32 ? 6.068  9.590   13.464 1.00 0.00 ? 32 ASP A OD2  9  
ATOM 9637  H H    . ASP A 1 32 ? 8.359  7.978   16.642 1.00 0.00 ? 32 ASP A H    9  
ATOM 9638  H HA   . ASP A 1 32 ? 6.274  9.685   16.406 1.00 0.00 ? 32 ASP A HA   9  
ATOM 9639  H HB2  . ASP A 1 32 ? 7.279  7.823   14.780 1.00 0.00 ? 32 ASP A HB2  9  
ATOM 9640  H HB3  . ASP A 1 32 ? 5.818  6.970   15.271 1.00 0.00 ? 32 ASP A HB3  9  
ATOM 9641  N N    . LEU A 1 33 ? 5.318  6.969   17.993 1.00 0.00 ? 33 LEU A N    9  
ATOM 9642  C CA   . LEU A 1 33 ? 4.276  6.410   18.846 1.00 0.00 ? 33 LEU A CA   9  
ATOM 9643  C C    . LEU A 1 33 ? 4.606  6.624   20.320 1.00 0.00 ? 33 LEU A C    9  
ATOM 9644  O O    . LEU A 1 33 ? 3.723  6.591   21.176 1.00 0.00 ? 33 LEU A O    9  
ATOM 9645  C CB   . LEU A 1 33 ? 4.103  4.917   18.562 1.00 0.00 ? 33 LEU A CB   9  
ATOM 9646  C CG   . LEU A 1 33 ? 3.742  4.545   17.124 1.00 0.00 ? 33 LEU A CG   9  
ATOM 9647  C CD1  . LEU A 1 33 ? 3.295  3.094   17.044 1.00 0.00 ? 33 LEU A CD1  9  
ATOM 9648  C CD2  . LEU A 1 33 ? 2.657  5.470   16.590 1.00 0.00 ? 33 LEU A CD2  9  
ATOM 9649  H H    . LEU A 1 33 ? 6.143  6.460   17.852 1.00 0.00 ? 33 LEU A H    9  
ATOM 9650  H HA   . LEU A 1 33 ? 3.352  6.921   18.619 1.00 0.00 ? 33 LEU A HA   9  
ATOM 9651  H HB2  . LEU A 1 33 ? 5.030  4.424   18.808 1.00 0.00 ? 33 LEU A HB2  9  
ATOM 9652  H HB3  . LEU A 1 33 ? 3.318  4.547   19.207 1.00 0.00 ? 33 LEU A HB3  9  
ATOM 9653  H HG   . LEU A 1 33 ? 4.617  4.659   16.499 1.00 0.00 ? 33 LEU A HG   9  
ATOM 9654  H HD11 . LEU A 1 33 ? 2.987  2.867   16.034 1.00 0.00 ? 33 LEU A HD11 9  
ATOM 9655  H HD12 . LEU A 1 33 ? 2.465  2.935   17.717 1.00 0.00 ? 33 LEU A HD12 9  
ATOM 9656  H HD13 . LEU A 1 33 ? 4.114  2.449   17.325 1.00 0.00 ? 33 LEU A HD13 9  
ATOM 9657  H HD21 . LEU A 1 33 ? 2.118  5.907   17.417 1.00 0.00 ? 33 LEU A HD21 9  
ATOM 9658  H HD22 . LEU A 1 33 ? 1.973  4.904   15.974 1.00 0.00 ? 33 LEU A HD22 9  
ATOM 9659  H HD23 . LEU A 1 33 ? 3.110  6.253   16.000 1.00 0.00 ? 33 LEU A HD23 9  
ATOM 9660  N N    . GLY A 1 34 ? 5.885  6.846   20.609 1.00 0.00 ? 34 GLY A N    9  
ATOM 9661  C CA   . GLY A 1 34 ? 6.309  7.064   21.980 1.00 0.00 ? 34 GLY A CA   9  
ATOM 9662  C C    . GLY A 1 34 ? 6.489  5.767   22.744 1.00 0.00 ? 34 GLY A C    9  
ATOM 9663  O O    . GLY A 1 34 ? 6.452  5.754   23.974 1.00 0.00 ? 34 GLY A O    9  
ATOM 9664  H H    . GLY A 1 34 ? 6.546  6.861   19.885 1.00 0.00 ? 34 GLY A H    9  
ATOM 9665  H HA2  . GLY A 1 34 ? 7.246  7.600   21.974 1.00 0.00 ? 34 GLY A HA2  9  
ATOM 9666  H HA3  . GLY A 1 34 ? 5.565  7.665   22.483 1.00 0.00 ? 34 GLY A HA3  9  
ATOM 9667  N N    . ALA A 1 35 ? 6.682  4.674   22.014 1.00 0.00 ? 35 ALA A N    9  
ATOM 9668  C CA   . ALA A 1 35 ? 6.869  3.367   22.632 1.00 0.00 ? 35 ALA A CA   9  
ATOM 9669  C C    . ALA A 1 35 ? 8.338  3.115   22.950 1.00 0.00 ? 35 ALA A C    9  
ATOM 9670  O O    . ALA A 1 35 ? 9.214  3.869   22.526 1.00 0.00 ? 35 ALA A O    9  
ATOM 9671  C CB   . ALA A 1 35 ? 6.328  2.272   21.723 1.00 0.00 ? 35 ALA A CB   9  
ATOM 9672  H H    . ALA A 1 35 ? 6.701  4.748   21.038 1.00 0.00 ? 35 ALA A H    9  
ATOM 9673  H HA   . ALA A 1 35 ? 6.303  3.348   23.552 1.00 0.00 ? 35 ALA A HA   9  
ATOM 9674  H HB1  . ALA A 1 35 ? 5.844  1.515   22.322 1.00 0.00 ? 35 ALA A HB1  9  
ATOM 9675  H HB2  . ALA A 1 35 ? 5.615  2.697   21.033 1.00 0.00 ? 35 ALA A HB2  9  
ATOM 9676  H HB3  . ALA A 1 35 ? 7.143  1.828   21.171 1.00 0.00 ? 35 ALA A HB3  9  
ATOM 9677  N N    . ASP A 1 36 ? 8.602  2.050   23.700 1.00 0.00 ? 36 ASP A N    9  
ATOM 9678  C CA   . ASP A 1 36 ? 9.967  1.698   24.075 1.00 0.00 ? 36 ASP A CA   9  
ATOM 9679  C C    . ASP A 1 36 ? 10.417 0.429   23.360 1.00 0.00 ? 36 ASP A C    9  
ATOM 9680  O O    . ASP A 1 36 ? 9.689  -0.122  22.535 1.00 0.00 ? 36 ASP A O    9  
ATOM 9681  C CB   . ASP A 1 36 ? 10.069 1.509   25.590 1.00 0.00 ? 36 ASP A CB   9  
ATOM 9682  C CG   . ASP A 1 36 ? 9.423  2.643   26.360 1.00 0.00 ? 36 ASP A CG   9  
ATOM 9683  O OD1  . ASP A 1 36 ? 10.109 3.656   26.613 1.00 0.00 ? 36 ASP A OD1  9  
ATOM 9684  O OD2  . ASP A 1 36 ? 8.231  2.519   26.710 1.00 0.00 ? 36 ASP A OD2  9  
ATOM 9685  H H    . ASP A 1 36 ? 7.861  1.487   24.008 1.00 0.00 ? 36 ASP A H    9  
ATOM 9686  H HA   . ASP A 1 36 ? 10.612 2.512   23.779 1.00 0.00 ? 36 ASP A HA   9  
ATOM 9687  H HB2  . ASP A 1 36 ? 9.578  0.587   25.864 1.00 0.00 ? 36 ASP A HB2  9  
ATOM 9688  H HB3  . ASP A 1 36 ? 11.111 1.454   25.869 1.00 0.00 ? 36 ASP A HB3  9  
ATOM 9689  N N    . SER A 1 37 ? 11.623 -0.029  23.681 1.00 0.00 ? 37 SER A N    9  
ATOM 9690  C CA   . SER A 1 37 ? 12.173 -1.231  23.065 1.00 0.00 ? 37 SER A CA   9  
ATOM 9691  C C    . SER A 1 37 ? 11.190 -2.393  23.168 1.00 0.00 ? 37 SER A C    9  
ATOM 9692  O O    . SER A 1 37 ? 11.156 -3.272  22.305 1.00 0.00 ? 37 SER A O    9  
ATOM 9693  C CB   . SER A 1 37 ? 13.498 -1.610  23.729 1.00 0.00 ? 37 SER A CB   9  
ATOM 9694  O OG   . SER A 1 37 ? 14.530 -0.712  23.357 1.00 0.00 ? 37 SER A OG   9  
ATOM 9695  H H    . SER A 1 37 ? 12.156 0.454   24.346 1.00 0.00 ? 37 SER A H    9  
ATOM 9696  H HA   . SER A 1 37 ? 12.351 -1.017  22.022 1.00 0.00 ? 37 SER A HA   9  
ATOM 9697  H HB2  . SER A 1 37 ? 13.382 -1.580  24.802 1.00 0.00 ? 37 SER A HB2  9  
ATOM 9698  H HB3  . SER A 1 37 ? 13.778 -2.608  23.424 1.00 0.00 ? 37 SER A HB3  9  
ATOM 9699  H HG   . SER A 1 37 ? 14.838 -0.926  22.473 1.00 0.00 ? 37 SER A HG   9  
ATOM 9700  N N    . LEU A 1 38 ? 10.390 -2.391  24.229 1.00 0.00 ? 38 LEU A N    9  
ATOM 9701  C CA   . LEU A 1 38 ? 9.405  -3.444  24.447 1.00 0.00 ? 38 LEU A CA   9  
ATOM 9702  C C    . LEU A 1 38 ? 8.530  -3.636  23.212 1.00 0.00 ? 38 LEU A C    9  
ATOM 9703  O O    . LEU A 1 38 ? 8.348  -4.756  22.736 1.00 0.00 ? 38 LEU A O    9  
ATOM 9704  C CB   . LEU A 1 38 ? 8.532  -3.110  25.658 1.00 0.00 ? 38 LEU A CB   9  
ATOM 9705  C CG   . LEU A 1 38 ? 9.276  -2.766  26.948 1.00 0.00 ? 38 LEU A CG   9  
ATOM 9706  C CD1  . LEU A 1 38 ? 8.296  -2.361  28.038 1.00 0.00 ? 38 LEU A CD1  9  
ATOM 9707  C CD2  . LEU A 1 38 ? 10.127 -3.943  27.403 1.00 0.00 ? 38 LEU A CD2  9  
ATOM 9708  H H    . LEU A 1 38 ? 10.464 -1.664  24.882 1.00 0.00 ? 38 LEU A H    9  
ATOM 9709  H HA   . LEU A 1 38 ? 9.939  -4.363  24.641 1.00 0.00 ? 38 LEU A HA   9  
ATOM 9710  H HB2  . LEU A 1 38 ? 7.914  -2.265  25.397 1.00 0.00 ? 38 LEU A HB2  9  
ATOM 9711  H HB3  . LEU A 1 38 ? 7.902  -3.966  25.856 1.00 0.00 ? 38 LEU A HB3  9  
ATOM 9712  H HG   . LEU A 1 38 ? 9.935  -1.928  26.764 1.00 0.00 ? 38 LEU A HG   9  
ATOM 9713  H HD11 . LEU A 1 38 ? 7.940  -1.359  27.848 1.00 0.00 ? 38 LEU A HD11 9  
ATOM 9714  H HD12 . LEU A 1 38 ? 8.792  -2.391  28.997 1.00 0.00 ? 38 LEU A HD12 9  
ATOM 9715  H HD13 . LEU A 1 38 ? 7.461  -3.046  28.044 1.00 0.00 ? 38 LEU A HD13 9  
ATOM 9716  H HD21 . LEU A 1 38 ? 10.481 -3.763  28.407 1.00 0.00 ? 38 LEU A HD21 9  
ATOM 9717  H HD22 . LEU A 1 38 ? 10.971 -4.055  26.739 1.00 0.00 ? 38 LEU A HD22 9  
ATOM 9718  H HD23 . LEU A 1 38 ? 9.532  -4.844  27.387 1.00 0.00 ? 38 LEU A HD23 9  
ATOM 9719  N N    . ASP A 1 39 ? 7.993  -2.535  22.698 1.00 0.00 ? 39 ASP A N    9  
ATOM 9720  C CA   . ASP A 1 39 ? 7.140  -2.581  21.516 1.00 0.00 ? 39 ASP A CA   9  
ATOM 9721  C C    . ASP A 1 39 ? 7.924  -3.064  20.299 1.00 0.00 ? 39 ASP A C    9  
ATOM 9722  O O    . ASP A 1 39 ? 7.394  -3.782  19.451 1.00 0.00 ? 39 ASP A O    9  
ATOM 9723  C CB   . ASP A 1 39 ? 6.543  -1.200  21.238 1.00 0.00 ? 39 ASP A CB   9  
ATOM 9724  C CG   . ASP A 1 39 ? 5.821  -1.139  19.906 1.00 0.00 ? 39 ASP A CG   9  
ATOM 9725  O OD1  . ASP A 1 39 ? 4.610  -1.442  19.873 1.00 0.00 ? 39 ASP A OD1  9  
ATOM 9726  O OD2  . ASP A 1 39 ? 6.467  -0.788  18.897 1.00 0.00 ? 39 ASP A OD2  9  
ATOM 9727  H H    . ASP A 1 39 ? 8.176  -1.670  23.123 1.00 0.00 ? 39 ASP A H    9  
ATOM 9728  H HA   . ASP A 1 39 ? 6.339  -3.277  21.712 1.00 0.00 ? 39 ASP A HA   9  
ATOM 9729  H HB2  . ASP A 1 39 ? 5.838  -0.956  22.019 1.00 0.00 ? 39 ASP A HB2  9  
ATOM 9730  H HB3  . ASP A 1 39 ? 7.336  -0.467  21.232 1.00 0.00 ? 39 ASP A HB3  9  
ATOM 9731  N N    . THR A 1 40 ? 9.189  -2.664  20.219 1.00 0.00 ? 40 THR A N    9  
ATOM 9732  C CA   . THR A 1 40 ? 10.045 -3.054  19.105 1.00 0.00 ? 40 THR A CA   9  
ATOM 9733  C C    . THR A 1 40 ? 10.195 -4.569  19.032 1.00 0.00 ? 40 THR A C    9  
ATOM 9734  O O    . THR A 1 40 ? 9.824  -5.193  18.038 1.00 0.00 ? 40 THR A O    9  
ATOM 9735  C CB   . THR A 1 40 ? 11.441 -2.415  19.220 1.00 0.00 ? 40 THR A CB   9  
ATOM 9736  O OG1  . THR A 1 40 ? 11.320 -1.031  19.566 1.00 0.00 ? 40 THR A OG1  9  
ATOM 9737  C CG2  . THR A 1 40 ? 12.207 -2.550  17.912 1.00 0.00 ? 40 THR A CG2  9  
ATOM 9738  H H    . THR A 1 40 ? 9.554  -2.092  20.926 1.00 0.00 ? 40 THR A H    9  
ATOM 9739  H HA   . THR A 1 40 ? 9.585  -2.703  18.192 1.00 0.00 ? 40 THR A HA   9  
ATOM 9740  H HB   . THR A 1 40 ? 11.992 -2.926  19.997 1.00 0.00 ? 40 THR A HB   9  
ATOM 9741  H HG1  . THR A 1 40 ? 11.294 -0.501  18.766 1.00 0.00 ? 40 THR A HG1  9  
ATOM 9742  H HG21 . THR A 1 40 ? 11.617 -2.141  17.105 1.00 0.00 ? 40 THR A HG21 9  
ATOM 9743  H HG22 . THR A 1 40 ? 12.408 -3.593  17.719 1.00 0.00 ? 40 THR A HG22 9  
ATOM 9744  H HG23 . THR A 1 40 ? 13.140 -2.012  17.984 1.00 0.00 ? 40 THR A HG23 9  
ATOM 9745  N N    . VAL A 1 41 ? 10.743 -5.156  20.091 1.00 0.00 ? 41 VAL A N    9  
ATOM 9746  C CA   . VAL A 1 41 ? 10.941 -6.600  20.148 1.00 0.00 ? 41 VAL A CA   9  
ATOM 9747  C C    . VAL A 1 41 ? 9.609  -7.340  20.102 1.00 0.00 ? 41 VAL A C    9  
ATOM 9748  O O    . VAL A 1 41 ? 9.504  -8.410  19.505 1.00 0.00 ? 41 VAL A O    9  
ATOM 9749  C CB   . VAL A 1 41 ? 11.702 -7.012  21.422 1.00 0.00 ? 41 VAL A CB   9  
ATOM 9750  C CG1  . VAL A 1 41 ? 11.952 -8.513  21.433 1.00 0.00 ? 41 VAL A CG1  9  
ATOM 9751  C CG2  . VAL A 1 41 ? 13.010 -6.244  21.533 1.00 0.00 ? 41 VAL A CG2  9  
ATOM 9752  H H    . VAL A 1 41 ? 11.019 -4.606  20.854 1.00 0.00 ? 41 VAL A H    9  
ATOM 9753  H HA   . VAL A 1 41 ? 11.533 -6.889  19.291 1.00 0.00 ? 41 VAL A HA   9  
ATOM 9754  H HB   . VAL A 1 41 ? 11.091 -6.766  22.278 1.00 0.00 ? 41 VAL A HB   9  
ATOM 9755  H HG11 . VAL A 1 41 ? 12.511 -8.790  20.551 1.00 0.00 ? 41 VAL A HG11 9  
ATOM 9756  H HG12 . VAL A 1 41 ? 12.515 -8.778  22.316 1.00 0.00 ? 41 VAL A HG12 9  
ATOM 9757  H HG13 . VAL A 1 41 ? 11.007 -9.035  21.438 1.00 0.00 ? 41 VAL A HG13 9  
ATOM 9758  H HG21 . VAL A 1 41 ? 13.500 -6.228  20.571 1.00 0.00 ? 41 VAL A HG21 9  
ATOM 9759  H HG22 . VAL A 1 41 ? 12.808 -5.232  21.851 1.00 0.00 ? 41 VAL A HG22 9  
ATOM 9760  H HG23 . VAL A 1 41 ? 13.651 -6.727  22.256 1.00 0.00 ? 41 VAL A HG23 9  
ATOM 9761  N N    . GLU A 1 42 ? 8.595  -6.761  20.737 1.00 0.00 ? 42 GLU A N    9  
ATOM 9762  C CA   . GLU A 1 42 ? 7.269  -7.367  20.769 1.00 0.00 ? 42 GLU A CA   9  
ATOM 9763  C C    . GLU A 1 42 ? 6.669  -7.437  19.367 1.00 0.00 ? 42 GLU A C    9  
ATOM 9764  O O    . GLU A 1 42 ? 6.174  -8.482  18.943 1.00 0.00 ? 42 GLU A O    9  
ATOM 9765  C CB   . GLU A 1 42 ? 6.343  -6.572  21.692 1.00 0.00 ? 42 GLU A CB   9  
ATOM 9766  C CG   . GLU A 1 42 ? 4.877  -6.945  21.551 1.00 0.00 ? 42 GLU A CG   9  
ATOM 9767  C CD   . GLU A 1 42 ? 4.203  -7.180  22.889 1.00 0.00 ? 42 GLU A CD   9  
ATOM 9768  O OE1  . GLU A 1 42 ? 4.375  -6.338  23.795 1.00 0.00 ? 42 GLU A OE1  9  
ATOM 9769  O OE2  . GLU A 1 42 ? 3.504  -8.205  23.030 1.00 0.00 ? 42 GLU A OE2  9  
ATOM 9770  H H    . GLU A 1 42 ? 8.742  -5.907  21.195 1.00 0.00 ? 42 GLU A H    9  
ATOM 9771  H HA   . GLU A 1 42 ? 7.372  -8.370  21.154 1.00 0.00 ? 42 GLU A HA   9  
ATOM 9772  H HB2  . GLU A 1 42 ? 6.640  -6.745  22.716 1.00 0.00 ? 42 GLU A HB2  9  
ATOM 9773  H HB3  . GLU A 1 42 ? 6.448  -5.521  21.469 1.00 0.00 ? 42 GLU A HB3  9  
ATOM 9774  H HG2  . GLU A 1 42 ? 4.362  -6.144  21.042 1.00 0.00 ? 42 GLU A HG2  9  
ATOM 9775  H HG3  . GLU A 1 42 ? 4.803  -7.849  20.964 1.00 0.00 ? 42 GLU A HG3  9  
ATOM 9776  N N    . LEU A 1 43 ? 6.718  -6.318  18.653 1.00 0.00 ? 43 LEU A N    9  
ATOM 9777  C CA   . LEU A 1 43 ? 6.179  -6.252  17.299 1.00 0.00 ? 43 LEU A CA   9  
ATOM 9778  C C    . LEU A 1 43 ? 6.926  -7.201  16.368 1.00 0.00 ? 43 LEU A C    9  
ATOM 9779  O O    . LEU A 1 43 ? 6.315  -7.947  15.603 1.00 0.00 ? 43 LEU A O    9  
ATOM 9780  C CB   . LEU A 1 43 ? 6.267  -4.821  16.764 1.00 0.00 ? 43 LEU A CB   9  
ATOM 9781  C CG   . LEU A 1 43 ? 5.356  -4.490  15.581 1.00 0.00 ? 43 LEU A CG   9  
ATOM 9782  C CD1  . LEU A 1 43 ? 3.982  -4.060  16.070 1.00 0.00 ? 43 LEU A CD1  9  
ATOM 9783  C CD2  . LEU A 1 43 ? 5.980  -3.405  14.715 1.00 0.00 ? 43 LEU A CD2  9  
ATOM 9784  H H    . LEU A 1 43 ? 7.124  -5.518  19.044 1.00 0.00 ? 43 LEU A H    9  
ATOM 9785  H HA   . LEU A 1 43 ? 5.142  -6.549  17.340 1.00 0.00 ? 43 LEU A HA   9  
ATOM 9786  H HB2  . LEU A 1 43 ? 6.017  -4.150  17.571 1.00 0.00 ? 43 LEU A HB2  9  
ATOM 9787  H HB3  . LEU A 1 43 ? 7.288  -4.646  16.456 1.00 0.00 ? 43 LEU A HB3  9  
ATOM 9788  H HG   . LEU A 1 43 ? 5.231  -5.374  14.972 1.00 0.00 ? 43 LEU A HG   9  
ATOM 9789  H HD11 . LEU A 1 43 ? 3.231  -4.717  15.658 1.00 0.00 ? 43 LEU A HD11 9  
ATOM 9790  H HD12 . LEU A 1 43 ? 3.787  -3.046  15.751 1.00 0.00 ? 43 LEU A HD12 9  
ATOM 9791  H HD13 . LEU A 1 43 ? 3.952  -4.109  17.148 1.00 0.00 ? 43 LEU A HD13 9  
ATOM 9792  H HD21 . LEU A 1 43 ? 5.206  -2.742  14.357 1.00 0.00 ? 43 LEU A HD21 9  
ATOM 9793  H HD22 . LEU A 1 43 ? 6.482  -3.860  13.874 1.00 0.00 ? 43 LEU A HD22 9  
ATOM 9794  H HD23 . LEU A 1 43 ? 6.693  -2.843  15.300 1.00 0.00 ? 43 LEU A HD23 9  
ATOM 9795  N N    . VAL A 1 44 ? 8.253  -7.169  16.440 1.00 0.00 ? 44 VAL A N    9  
ATOM 9796  C CA   . VAL A 1 44 ? 9.085  -8.029  15.606 1.00 0.00 ? 44 VAL A CA   9  
ATOM 9797  C C    . VAL A 1 44 ? 8.762  -9.501  15.841 1.00 0.00 ? 44 VAL A C    9  
ATOM 9798  O O    . VAL A 1 44 ? 8.614  -10.273 14.894 1.00 0.00 ? 44 VAL A O    9  
ATOM 9799  C CB   . VAL A 1 44 ? 10.583 -7.795  15.877 1.00 0.00 ? 44 VAL A CB   9  
ATOM 9800  C CG1  . VAL A 1 44 ? 11.432 -8.722  15.020 1.00 0.00 ? 44 VAL A CG1  9  
ATOM 9801  C CG2  . VAL A 1 44 ? 10.948 -6.340  15.625 1.00 0.00 ? 44 VAL A CG2  9  
ATOM 9802  H H    . VAL A 1 44 ? 8.683  -6.553  17.069 1.00 0.00 ? 44 VAL A H    9  
ATOM 9803  H HA   . VAL A 1 44 ? 8.885  -7.787  14.572 1.00 0.00 ? 44 VAL A HA   9  
ATOM 9804  H HB   . VAL A 1 44 ? 10.780 -8.019  16.915 1.00 0.00 ? 44 VAL A HB   9  
ATOM 9805  H HG11 . VAL A 1 44 ? 12.306 -8.190  14.673 1.00 0.00 ? 44 VAL A HG11 9  
ATOM 9806  H HG12 . VAL A 1 44 ? 11.737 -9.576  15.606 1.00 0.00 ? 44 VAL A HG12 9  
ATOM 9807  H HG13 . VAL A 1 44 ? 10.854 -9.056  14.170 1.00 0.00 ? 44 VAL A HG13 9  
ATOM 9808  H HG21 . VAL A 1 44 ? 11.655 -6.282  14.811 1.00 0.00 ? 44 VAL A HG21 9  
ATOM 9809  H HG22 . VAL A 1 44 ? 10.057 -5.784  15.368 1.00 0.00 ? 44 VAL A HG22 9  
ATOM 9810  H HG23 . VAL A 1 44 ? 11.389 -5.919  16.516 1.00 0.00 ? 44 VAL A HG23 9  
ATOM 9811  N N    . MET A 1 45 ? 8.653  -9.882  17.109 1.00 0.00 ? 45 MET A N    9  
ATOM 9812  C CA   . MET A 1 45 ? 8.345  -11.262 17.468 1.00 0.00 ? 45 MET A CA   9  
ATOM 9813  C C    . MET A 1 45 ? 6.984  -11.676 16.917 1.00 0.00 ? 45 MET A C    9  
ATOM 9814  O O    . MET A 1 45 ? 6.848  -12.738 16.310 1.00 0.00 ? 45 MET A O    9  
ATOM 9815  C CB   . MET A 1 45 ? 8.365  -11.432 18.988 1.00 0.00 ? 45 MET A CB   9  
ATOM 9816  C CG   . MET A 1 45 ? 9.725  -11.833 19.536 1.00 0.00 ? 45 MET A CG   9  
ATOM 9817  S SD   . MET A 1 45 ? 9.693  -12.149 21.311 1.00 0.00 ? 45 MET A SD   9  
ATOM 9818  C CE   . MET A 1 45 ? 9.001  -13.801 21.349 1.00 0.00 ? 45 MET A CE   9  
ATOM 9819  H H    . MET A 1 45 ? 8.781  -9.221  17.821 1.00 0.00 ? 45 MET A H    9  
ATOM 9820  H HA   . MET A 1 45 ? 9.104  -11.894 17.034 1.00 0.00 ? 45 MET A HA   9  
ATOM 9821  H HB2  . MET A 1 45 ? 8.078  -10.498 19.447 1.00 0.00 ? 45 MET A HB2  9  
ATOM 9822  H HB3  . MET A 1 45 ? 7.652  -12.194 19.263 1.00 0.00 ? 45 MET A HB3  9  
ATOM 9823  H HG2  . MET A 1 45 ? 10.052 -12.731 19.032 1.00 0.00 ? 45 MET A HG2  9  
ATOM 9824  H HG3  . MET A 1 45 ? 10.427 -11.037 19.338 1.00 0.00 ? 45 MET A HG3  9  
ATOM 9825  H HE1  . MET A 1 45 ? 8.141  -13.846 20.698 1.00 0.00 ? 45 MET A HE1  9  
ATOM 9826  H HE2  . MET A 1 45 ? 9.744  -14.509 21.013 1.00 0.00 ? 45 MET A HE2  9  
ATOM 9827  H HE3  . MET A 1 45 ? 8.702  -14.042 22.359 1.00 0.00 ? 45 MET A HE3  9  
ATOM 9828  N N    . ALA A 1 46 ? 5.981  -10.832 17.133 1.00 0.00 ? 46 ALA A N    9  
ATOM 9829  C CA   . ALA A 1 46 ? 4.632  -11.110 16.656 1.00 0.00 ? 46 ALA A CA   9  
ATOM 9830  C C    . ALA A 1 46 ? 4.623  -11.366 15.153 1.00 0.00 ? 46 ALA A C    9  
ATOM 9831  O O    . ALA A 1 46 ? 4.127  -12.393 14.690 1.00 0.00 ? 46 ALA A O    9  
ATOM 9832  C CB   . ALA A 1 46 ? 3.701  -9.958  17.003 1.00 0.00 ? 46 ALA A CB   9  
ATOM 9833  H H    . ALA A 1 46 ? 6.152  -10.001 17.623 1.00 0.00 ? 46 ALA A H    9  
ATOM 9834  H HA   . ALA A 1 46 ? 4.275  -11.995 17.163 1.00 0.00 ? 46 ALA A HA   9  
ATOM 9835  H HB1  . ALA A 1 46 ? 4.286  -9.106  17.318 1.00 0.00 ? 46 ALA A HB1  9  
ATOM 9836  H HB2  . ALA A 1 46 ? 3.117  -9.693  16.134 1.00 0.00 ? 46 ALA A HB2  9  
ATOM 9837  H HB3  . ALA A 1 46 ? 3.041  -10.258 17.803 1.00 0.00 ? 46 ALA A HB3  9  
ATOM 9838  N N    . PHE A 1 47 ? 5.174  -10.424 14.394 1.00 0.00 ? 47 PHE A N    9  
ATOM 9839  C CA   . PHE A 1 47 ? 5.228  -10.547 12.942 1.00 0.00 ? 47 PHE A CA   9  
ATOM 9840  C C    . PHE A 1 47 ? 5.948  -11.827 12.530 1.00 0.00 ? 47 PHE A C    9  
ATOM 9841  O O    . PHE A 1 47 ? 5.497  -12.546 11.639 1.00 0.00 ? 47 PHE A O    9  
ATOM 9842  C CB   . PHE A 1 47 ? 5.933  -9.333  12.332 1.00 0.00 ? 47 PHE A CB   9  
ATOM 9843  C CG   . PHE A 1 47 ? 5.021  -8.161  12.107 1.00 0.00 ? 47 PHE A CG   9  
ATOM 9844  C CD1  . PHE A 1 47 ? 3.948  -8.258  11.236 1.00 0.00 ? 47 PHE A CD1  9  
ATOM 9845  C CD2  . PHE A 1 47 ? 5.238  -6.962  12.767 1.00 0.00 ? 47 PHE A CD2  9  
ATOM 9846  C CE1  . PHE A 1 47 ? 3.107  -7.181  11.027 1.00 0.00 ? 47 PHE A CE1  9  
ATOM 9847  C CE2  . PHE A 1 47 ? 4.400  -5.882  12.562 1.00 0.00 ? 47 PHE A CE2  9  
ATOM 9848  C CZ   . PHE A 1 47 ? 3.334  -5.991  11.691 1.00 0.00 ? 47 PHE A CZ   9  
ATOM 9849  H H    . PHE A 1 47 ? 5.553  -9.627  14.821 1.00 0.00 ? 47 PHE A H    9  
ATOM 9850  H HA   . PHE A 1 47 ? 4.214  -10.585 12.575 1.00 0.00 ? 47 PHE A HA   9  
ATOM 9851  H HB2  . PHE A 1 47 ? 6.724  -9.015  12.994 1.00 0.00 ? 47 PHE A HB2  9  
ATOM 9852  H HB3  . PHE A 1 47 ? 6.356  -9.613  11.379 1.00 0.00 ? 47 PHE A HB3  9  
ATOM 9853  H HD1  . PHE A 1 47 ? 3.770  -9.188  10.716 1.00 0.00 ? 47 PHE A HD1  9  
ATOM 9854  H HD2  . PHE A 1 47 ? 6.071  -6.874  13.448 1.00 0.00 ? 47 PHE A HD2  9  
ATOM 9855  H HE1  . PHE A 1 47 ? 2.275  -7.270  10.345 1.00 0.00 ? 47 PHE A HE1  9  
ATOM 9856  H HE2  . PHE A 1 47 ? 4.580  -4.953  13.082 1.00 0.00 ? 47 PHE A HE2  9  
ATOM 9857  H HZ   . PHE A 1 47 ? 2.678  -5.149  11.529 1.00 0.00 ? 47 PHE A HZ   9  
ATOM 9858  N N    . GLU A 1 48 ? 7.071  -12.105 13.187 1.00 0.00 ? 48 GLU A N    9  
ATOM 9859  C CA   . GLU A 1 48 ? 7.854  -13.298 12.888 1.00 0.00 ? 48 GLU A CA   9  
ATOM 9860  C C    . GLU A 1 48 ? 7.021  -14.561 13.089 1.00 0.00 ? 48 GLU A C    9  
ATOM 9861  O O    . GLU A 1 48 ? 7.112  -15.507 12.308 1.00 0.00 ? 48 GLU A O    9  
ATOM 9862  C CB   . GLU A 1 48 ? 9.102  -13.350 13.772 1.00 0.00 ? 48 GLU A CB   9  
ATOM 9863  C CG   . GLU A 1 48 ? 10.338 -13.859 13.051 1.00 0.00 ? 48 GLU A CG   9  
ATOM 9864  C CD   . GLU A 1 48 ? 11.331 -14.519 13.989 1.00 0.00 ? 48 GLU A CD   9  
ATOM 9865  O OE1  . GLU A 1 48 ? 11.206 -15.739 14.220 1.00 0.00 ? 48 GLU A OE1  9  
ATOM 9866  O OE2  . GLU A 1 48 ? 12.232 -13.815 14.491 1.00 0.00 ? 48 GLU A OE2  9  
ATOM 9867  H H    . GLU A 1 48 ? 7.379  -11.493 13.887 1.00 0.00 ? 48 GLU A H    9  
ATOM 9868  H HA   . GLU A 1 48 ? 8.160  -13.244 11.854 1.00 0.00 ? 48 GLU A HA   9  
ATOM 9869  H HB2  . GLU A 1 48 ? 9.308  -12.357 14.142 1.00 0.00 ? 48 GLU A HB2  9  
ATOM 9870  H HB3  . GLU A 1 48 ? 8.906  -14.003 14.611 1.00 0.00 ? 48 GLU A HB3  9  
ATOM 9871  H HG2  . GLU A 1 48 ? 10.035 -14.580 12.308 1.00 0.00 ? 48 GLU A HG2  9  
ATOM 9872  H HG3  . GLU A 1 48 ? 10.824 -13.025 12.565 1.00 0.00 ? 48 GLU A HG3  9  
ATOM 9873  N N    . GLU A 1 49 ? 6.211  -14.566 14.143 1.00 0.00 ? 49 GLU A N    9  
ATOM 9874  C CA   . GLU A 1 49 ? 5.363  -15.713 14.448 1.00 0.00 ? 49 GLU A CA   9  
ATOM 9875  C C    . GLU A 1 49 ? 4.158  -15.762 13.513 1.00 0.00 ? 49 GLU A C    9  
ATOM 9876  O O    . GLU A 1 49 ? 3.603  -16.829 13.254 1.00 0.00 ? 49 GLU A O    9  
ATOM 9877  C CB   . GLU A 1 49 ? 4.892  -15.655 15.902 1.00 0.00 ? 49 GLU A CB   9  
ATOM 9878  C CG   . GLU A 1 49 ? 4.161  -16.907 16.356 1.00 0.00 ? 49 GLU A CG   9  
ATOM 9879  C CD   . GLU A 1 49 ? 3.879  -16.911 17.846 1.00 0.00 ? 49 GLU A CD   9  
ATOM 9880  O OE1  . GLU A 1 49 ? 3.403  -15.877 18.361 1.00 0.00 ? 49 GLU A OE1  9  
ATOM 9881  O OE2  . GLU A 1 49 ? 4.134  -17.946 18.496 1.00 0.00 ? 49 GLU A OE2  9  
ATOM 9882  H H    . GLU A 1 49 ? 6.183  -13.781 14.729 1.00 0.00 ? 49 GLU A H    9  
ATOM 9883  H HA   . GLU A 1 49 ? 5.950  -16.607 14.305 1.00 0.00 ? 49 GLU A HA   9  
ATOM 9884  H HB2  . GLU A 1 49 ? 5.751  -15.513 16.541 1.00 0.00 ? 49 GLU A HB2  9  
ATOM 9885  H HB3  . GLU A 1 49 ? 4.226  -14.813 16.019 1.00 0.00 ? 49 GLU A HB3  9  
ATOM 9886  H HG2  . GLU A 1 49 ? 3.222  -16.972 15.827 1.00 0.00 ? 49 GLU A HG2  9  
ATOM 9887  H HG3  . GLU A 1 49 ? 4.767  -17.769 16.117 1.00 0.00 ? 49 GLU A HG3  9  
ATOM 9888  N N    . GLU A 1 50 ? 3.758  -14.597 13.011 1.00 0.00 ? 50 GLU A N    9  
ATOM 9889  C CA   . GLU A 1 50 ? 2.617  -14.508 12.106 1.00 0.00 ? 50 GLU A CA   9  
ATOM 9890  C C    . GLU A 1 50 ? 2.990  -14.998 10.710 1.00 0.00 ? 50 GLU A C    9  
ATOM 9891  O O    . GLU A 1 50 ? 2.308  -15.847 10.135 1.00 0.00 ? 50 GLU A O    9  
ATOM 9892  C CB   . GLU A 1 50 ? 2.108  -13.067 12.034 1.00 0.00 ? 50 GLU A CB   9  
ATOM 9893  C CG   . GLU A 1 50 ? 0.613  -12.961 11.784 1.00 0.00 ? 50 GLU A CG   9  
ATOM 9894  C CD   . GLU A 1 50 ? -0.192 -12.939 13.069 1.00 0.00 ? 50 GLU A CD   9  
ATOM 9895  O OE1  . GLU A 1 50 ? 0.201  -12.211 14.004 1.00 0.00 ? 50 GLU A OE1  9  
ATOM 9896  O OE2  . GLU A 1 50 ? -1.217 -13.650 13.138 1.00 0.00 ? 50 GLU A OE2  9  
ATOM 9897  H H    . GLU A 1 50 ? 4.240  -13.780 13.255 1.00 0.00 ? 50 GLU A H    9  
ATOM 9898  H HA   . GLU A 1 50 ? 1.833  -15.137 12.498 1.00 0.00 ? 50 GLU A HA   9  
ATOM 9899  H HB2  . GLU A 1 50 ? 2.333  -12.570 12.966 1.00 0.00 ? 50 GLU A HB2  9  
ATOM 9900  H HB3  . GLU A 1 50 ? 2.622  -12.557 11.232 1.00 0.00 ? 50 GLU A HB3  9  
ATOM 9901  H HG2  . GLU A 1 50 ? 0.415  -12.052 11.238 1.00 0.00 ? 50 GLU A HG2  9  
ATOM 9902  H HG3  . GLU A 1 50 ? 0.299  -13.810 11.194 1.00 0.00 ? 50 GLU A HG3  9  
ATOM 9903  N N    . PHE A 1 51 ? 4.078  -14.457 10.171 1.00 0.00 ? 51 PHE A N    9  
ATOM 9904  C CA   . PHE A 1 51 ? 4.542  -14.838 8.841  1.00 0.00 ? 51 PHE A CA   9  
ATOM 9905  C C    . PHE A 1 51 ? 5.306  -16.157 8.889  1.00 0.00 ? 51 PHE A C    9  
ATOM 9906  O O    . PHE A 1 51 ? 5.394  -16.873 7.892  1.00 0.00 ? 51 PHE A O    9  
ATOM 9907  C CB   . PHE A 1 51 ? 5.432  -13.740 8.255  1.00 0.00 ? 51 PHE A CB   9  
ATOM 9908  C CG   . PHE A 1 51 ? 4.663  -12.641 7.579  1.00 0.00 ? 51 PHE A CG   9  
ATOM 9909  C CD1  . PHE A 1 51 ? 4.319  -12.740 6.241  1.00 0.00 ? 51 PHE A CD1  9  
ATOM 9910  C CD2  . PHE A 1 51 ? 4.282  -11.510 8.283  1.00 0.00 ? 51 PHE A CD2  9  
ATOM 9911  C CE1  . PHE A 1 51 ? 3.612  -11.730 5.617  1.00 0.00 ? 51 PHE A CE1  9  
ATOM 9912  C CE2  . PHE A 1 51 ? 3.575  -10.496 7.664  1.00 0.00 ? 51 PHE A CE2  9  
ATOM 9913  C CZ   . PHE A 1 51 ? 3.238  -10.607 6.329  1.00 0.00 ? 51 PHE A CZ   9  
ATOM 9914  H H    . PHE A 1 51 ? 4.580  -13.785 10.678 1.00 0.00 ? 51 PHE A H    9  
ATOM 9915  H HA   . PHE A 1 51 ? 3.674  -14.961 8.211  1.00 0.00 ? 51 PHE A HA   9  
ATOM 9916  H HB2  . PHE A 1 51 ? 6.014  -13.297 9.049  1.00 0.00 ? 51 PHE A HB2  9  
ATOM 9917  H HB3  . PHE A 1 51 ? 6.098  -14.177 7.527  1.00 0.00 ? 51 PHE A HB3  9  
ATOM 9918  H HD1  . PHE A 1 51 ? 4.610  -13.617 5.682  1.00 0.00 ? 51 PHE A HD1  9  
ATOM 9919  H HD2  . PHE A 1 51 ? 4.545  -11.422 9.328  1.00 0.00 ? 51 PHE A HD2  9  
ATOM 9920  H HE1  . PHE A 1 51 ? 3.350  -11.819 4.573  1.00 0.00 ? 51 PHE A HE1  9  
ATOM 9921  H HE2  . PHE A 1 51 ? 3.284  -9.620  8.225  1.00 0.00 ? 51 PHE A HE2  9  
ATOM 9922  H HZ   . PHE A 1 51 ? 2.686  -9.817  5.844  1.00 0.00 ? 51 PHE A HZ   9  
ATOM 9923  N N    . GLY A 1 52 ? 5.859  -16.472 10.057 1.00 0.00 ? 52 GLY A N    9  
ATOM 9924  C CA   . GLY A 1 52 ? 6.610  -17.704 10.214 1.00 0.00 ? 52 GLY A CA   9  
ATOM 9925  C C    . GLY A 1 52 ? 7.997  -17.618 9.608  1.00 0.00 ? 52 GLY A C    9  
ATOM 9926  O O    . GLY A 1 52 ? 8.380  -18.459 8.794  1.00 0.00 ? 52 GLY A O    9  
ATOM 9927  H H    . GLY A 1 52 ? 5.757  -15.863 10.818 1.00 0.00 ? 52 GLY A H    9  
ATOM 9928  H HA2  . GLY A 1 52 ? 6.701  -17.925 11.267 1.00 0.00 ? 52 GLY A HA2  9  
ATOM 9929  H HA3  . GLY A 1 52 ? 6.069  -18.505 9.733  1.00 0.00 ? 52 GLY A HA3  9  
ATOM 9930  N N    . VAL A 1 53 ? 8.753  -16.599 10.005 1.00 0.00 ? 53 VAL A N    9  
ATOM 9931  C CA   . VAL A 1 53 ? 10.105 -16.406 9.496  1.00 0.00 ? 53 VAL A CA   9  
ATOM 9932  C C    . VAL A 1 53 ? 11.133 -16.500 10.617 1.00 0.00 ? 53 VAL A C    9  
ATOM 9933  O O    . VAL A 1 53 ? 10.781 -16.695 11.780 1.00 0.00 ? 53 VAL A O    9  
ATOM 9934  C CB   . VAL A 1 53 ? 10.251 -15.044 8.792  1.00 0.00 ? 53 VAL A CB   9  
ATOM 9935  C CG1  . VAL A 1 53 ? 9.226  -14.906 7.677  1.00 0.00 ? 53 VAL A CG1  9  
ATOM 9936  C CG2  . VAL A 1 53 ? 10.116 -13.909 9.796  1.00 0.00 ? 53 VAL A CG2  9  
ATOM 9937  H H    . VAL A 1 53 ? 8.392  -15.962 10.657 1.00 0.00 ? 53 VAL A H    9  
ATOM 9938  H HA   . VAL A 1 53 ? 10.304 -17.184 8.773  1.00 0.00 ? 53 VAL A HA   9  
ATOM 9939  H HB   . VAL A 1 53 ? 11.237 -14.992 8.353  1.00 0.00 ? 53 VAL A HB   9  
ATOM 9940  H HG11 . VAL A 1 53 ? 9.367  -13.961 7.174  1.00 0.00 ? 53 VAL A HG11 9  
ATOM 9941  H HG12 . VAL A 1 53 ? 9.350  -15.714 6.971  1.00 0.00 ? 53 VAL A HG12 9  
ATOM 9942  H HG13 . VAL A 1 53 ? 8.231  -14.943 8.097  1.00 0.00 ? 53 VAL A HG13 9  
ATOM 9943  H HG21 . VAL A 1 53 ? 9.887  -12.992 9.274  1.00 0.00 ? 53 VAL A HG21 9  
ATOM 9944  H HG22 . VAL A 1 53 ? 9.319  -14.135 10.491 1.00 0.00 ? 53 VAL A HG22 9  
ATOM 9945  H HG23 . VAL A 1 53 ? 11.042 -13.794 10.338 1.00 0.00 ? 53 VAL A HG23 9  
ATOM 9946  N N    . GLU A 1 54 ? 12.406 -16.358 10.260 1.00 0.00 ? 54 GLU A N    9  
ATOM 9947  C CA   . GLU A 1 54 ? 13.486 -16.427 11.238 1.00 0.00 ? 54 GLU A CA   9  
ATOM 9948  C C    . GLU A 1 54 ? 14.485 -15.293 11.025 1.00 0.00 ? 54 GLU A C    9  
ATOM 9949  O O    . GLU A 1 54 ? 15.185 -15.249 10.013 1.00 0.00 ? 54 GLU A O    9  
ATOM 9950  C CB   . GLU A 1 54 ? 14.202 -17.776 11.146 1.00 0.00 ? 54 GLU A CB   9  
ATOM 9951  C CG   . GLU A 1 54 ? 13.328 -18.956 11.533 1.00 0.00 ? 54 GLU A CG   9  
ATOM 9952  C CD   . GLU A 1 54 ? 14.055 -20.282 11.423 1.00 0.00 ? 54 GLU A CD   9  
ATOM 9953  O OE1  . GLU A 1 54 ? 14.593 -20.576 10.335 1.00 0.00 ? 54 GLU A OE1  9  
ATOM 9954  O OE2  . GLU A 1 54 ? 14.087 -21.026 12.426 1.00 0.00 ? 54 GLU A OE2  9  
ATOM 9955  H H    . GLU A 1 54 ? 12.624 -16.204 9.317  1.00 0.00 ? 54 GLU A H    9  
ATOM 9956  H HA   . GLU A 1 54 ? 13.050 -16.327 12.220 1.00 0.00 ? 54 GLU A HA   9  
ATOM 9957  H HB2  . GLU A 1 54 ? 14.540 -17.922 10.130 1.00 0.00 ? 54 GLU A HB2  9  
ATOM 9958  H HB3  . GLU A 1 54 ? 15.059 -17.759 11.802 1.00 0.00 ? 54 GLU A HB3  9  
ATOM 9959  H HG2  . GLU A 1 54 ? 13.001 -18.827 12.554 1.00 0.00 ? 54 GLU A HG2  9  
ATOM 9960  H HG3  . GLU A 1 54 ? 12.467 -18.980 10.881 1.00 0.00 ? 54 GLU A HG3  9  
ATOM 9961  N N    . ILE A 1 55 ? 14.544 -14.377 11.986 1.00 0.00 ? 55 ILE A N    9  
ATOM 9962  C CA   . ILE A 1 55 ? 15.457 -13.243 11.905 1.00 0.00 ? 55 ILE A CA   9  
ATOM 9963  C C    . ILE A 1 55 ? 16.330 -13.151 13.152 1.00 0.00 ? 55 ILE A C    9  
ATOM 9964  O O    . ILE A 1 55 ? 15.975 -13.637 14.226 1.00 0.00 ? 55 ILE A O    9  
ATOM 9965  C CB   . ILE A 1 55 ? 14.693 -11.918 11.727 1.00 0.00 ? 55 ILE A CB   9  
ATOM 9966  C CG1  . ILE A 1 55 ? 13.510 -11.851 12.696 1.00 0.00 ? 55 ILE A CG1  9  
ATOM 9967  C CG2  . ILE A 1 55 ? 14.218 -11.769 10.290 1.00 0.00 ? 55 ILE A CG2  9  
ATOM 9968  C CD1  . ILE A 1 55 ? 12.859 -10.487 12.761 1.00 0.00 ? 55 ILE A CD1  9  
ATOM 9969  H H    . ILE A 1 55 ? 13.961 -14.466 12.768 1.00 0.00 ? 55 ILE A H    9  
ATOM 9970  H HA   . ILE A 1 55 ? 16.092 -13.388 11.043 1.00 0.00 ? 55 ILE A HA   9  
ATOM 9971  H HB   . ILE A 1 55 ? 15.371 -11.106 11.942 1.00 0.00 ? 55 ILE A HB   9  
ATOM 9972  H HG12 . ILE A 1 55 ? 12.760 -12.562 12.387 1.00 0.00 ? 55 ILE A HG12 9  
ATOM 9973  H HG13 . ILE A 1 55 ? 13.853 -12.104 13.689 1.00 0.00 ? 55 ILE A HG13 9  
ATOM 9974  H HG21 . ILE A 1 55 ? 13.495 -12.541 10.069 1.00 0.00 ? 55 ILE A HG21 9  
ATOM 9975  H HG22 . ILE A 1 55 ? 13.759 -10.800 10.161 1.00 0.00 ? 55 ILE A HG22 9  
ATOM 9976  H HG23 . ILE A 1 55 ? 15.059 -11.861 9.621  1.00 0.00 ? 55 ILE A HG23 9  
ATOM 9977  H HD11 . ILE A 1 55 ? 13.052 -9.951  11.844 1.00 0.00 ? 55 ILE A HD11 9  
ATOM 9978  H HD12 . ILE A 1 55 ? 11.794 -10.602 12.895 1.00 0.00 ? 55 ILE A HD12 9  
ATOM 9979  H HD13 . ILE A 1 55 ? 13.268 -9.933  13.594 1.00 0.00 ? 55 ILE A HD13 9  
ATOM 9980  N N    . PRO A 1 56 ? 17.500 -12.510 13.009 1.00 0.00 ? 56 PRO A N    9  
ATOM 9981  C CA   . PRO A 1 56 ? 18.448 -12.336 14.113 1.00 0.00 ? 56 PRO A CA   9  
ATOM 9982  C C    . PRO A 1 56 ? 17.934 -11.365 15.170 1.00 0.00 ? 56 PRO A C    9  
ATOM 9983  O O    . PRO A 1 56 ? 16.911 -10.708 14.978 1.00 0.00 ? 56 PRO A O    9  
ATOM 9984  C CB   . PRO A 1 56 ? 19.693 -11.770 13.426 1.00 0.00 ? 56 PRO A CB   9  
ATOM 9985  C CG   . PRO A 1 56 ? 19.177 -11.100 12.199 1.00 0.00 ? 56 PRO A CG   9  
ATOM 9986  C CD   . PRO A 1 56 ? 17.987 -11.906 11.757 1.00 0.00 ? 56 PRO A CD   9  
ATOM 9987  H HA   . PRO A 1 56 ? 18.690 -13.280 14.580 1.00 0.00 ? 56 PRO A HA   9  
ATOM 9988  H HB2  . PRO A 1 56 ? 20.182 -11.066 14.086 1.00 0.00 ? 56 PRO A HB2  9  
ATOM 9989  H HB3  . PRO A 1 56 ? 20.371 -12.573 13.182 1.00 0.00 ? 56 PRO A HB3  9  
ATOM 9990  H HG2  . PRO A 1 56 ? 18.880 -10.089 12.430 1.00 0.00 ? 56 PRO A HG2  9  
ATOM 9991  H HG3  . PRO A 1 56 ? 19.937 -11.104 11.433 1.00 0.00 ? 56 PRO A HG3  9  
ATOM 9992  H HD2  . PRO A 1 56 ? 17.237 -11.264 11.321 1.00 0.00 ? 56 PRO A HD2  9  
ATOM 9993  H HD3  . PRO A 1 56 ? 18.288 -12.669 11.054 1.00 0.00 ? 56 PRO A HD3  9  
ATOM 9994  N N    . ASP A 1 57 ? 18.650 -11.279 16.286 1.00 0.00 ? 57 ASP A N    9  
ATOM 9995  C CA   . ASP A 1 57 ? 18.267 -10.387 17.374 1.00 0.00 ? 57 ASP A CA   9  
ATOM 9996  C C    . ASP A 1 57 ? 18.546 -8.932  17.007 1.00 0.00 ? 57 ASP A C    9  
ATOM 9997  O O    . ASP A 1 57 ? 17.820 -8.028  17.419 1.00 0.00 ? 57 ASP A O    9  
ATOM 9998  C CB   . ASP A 1 57 ? 19.018 -10.756 18.654 1.00 0.00 ? 57 ASP A CB   9  
ATOM 9999  C CG   . ASP A 1 57 ? 18.850 -12.217 19.023 1.00 0.00 ? 57 ASP A CG   9  
ATOM 10000 O OD1  . ASP A 1 57 ? 17.773 -12.781 18.735 1.00 0.00 ? 57 ASP A OD1  9  
ATOM 10001 O OD2  . ASP A 1 57 ? 19.794 -12.796 19.600 1.00 0.00 ? 57 ASP A OD2  9  
ATOM 10002 H H    . ASP A 1 57 ? 19.456 -11.829 16.380 1.00 0.00 ? 57 ASP A H    9  
ATOM 10003 H HA   . ASP A 1 57 ? 17.207 -10.505 17.542 1.00 0.00 ? 57 ASP A HA   9  
ATOM 10004 H HB2  . ASP A 1 57 ? 20.071 -10.558 18.515 1.00 0.00 ? 57 ASP A HB2  9  
ATOM 10005 H HB3  . ASP A 1 57 ? 18.647 -10.152 19.468 1.00 0.00 ? 57 ASP A HB3  9  
ATOM 10006 N N    . ASP A 1 58 ? 19.603 -8.715  16.232 1.00 0.00 ? 58 ASP A N    9  
ATOM 10007 C CA   . ASP A 1 58 ? 19.979 -7.371  15.810 1.00 0.00 ? 58 ASP A CA   9  
ATOM 10008 C C    . ASP A 1 58 ? 18.848 -6.712  15.027 1.00 0.00 ? 58 ASP A C    9  
ATOM 10009 O O    . ASP A 1 58 ? 18.748 -5.486  14.975 1.00 0.00 ? 58 ASP A O    9  
ATOM 10010 C CB   . ASP A 1 58 ? 21.247 -7.417  14.957 1.00 0.00 ? 58 ASP A CB   9  
ATOM 10011 C CG   . ASP A 1 58 ? 22.482 -7.748  15.772 1.00 0.00 ? 58 ASP A CG   9  
ATOM 10012 O OD1  . ASP A 1 58 ? 22.545 -7.331  16.947 1.00 0.00 ? 58 ASP A OD1  9  
ATOM 10013 O OD2  . ASP A 1 58 ? 23.385 -8.422  15.235 1.00 0.00 ? 58 ASP A OD2  9  
ATOM 10014 H H    . ASP A 1 58 ? 20.143 -9.478  15.936 1.00 0.00 ? 58 ASP A H    9  
ATOM 10015 H HA   . ASP A 1 58 ? 20.174 -6.787  16.697 1.00 0.00 ? 58 ASP A HA   9  
ATOM 10016 H HB2  . ASP A 1 58 ? 21.132 -8.171  14.192 1.00 0.00 ? 58 ASP A HB2  9  
ATOM 10017 H HB3  . ASP A 1 58 ? 21.394 -6.455  14.489 1.00 0.00 ? 58 ASP A HB3  9  
ATOM 10018 N N    . ALA A 1 59 ? 17.999 -7.533  14.418 1.00 0.00 ? 59 ALA A N    9  
ATOM 10019 C CA   . ALA A 1 59 ? 16.875 -7.030  13.638 1.00 0.00 ? 59 ALA A CA   9  
ATOM 10020 C C    . ALA A 1 59 ? 16.054 -6.028  14.443 1.00 0.00 ? 59 ALA A C    9  
ATOM 10021 O O    . ALA A 1 59 ? 15.761 -4.930  13.971 1.00 0.00 ? 59 ALA A O    9  
ATOM 10022 C CB   . ALA A 1 59 ? 15.997 -8.182  13.173 1.00 0.00 ? 59 ALA A CB   9  
ATOM 10023 H H    . ALA A 1 59 ? 18.131 -8.501  14.496 1.00 0.00 ? 59 ALA A H    9  
ATOM 10024 H HA   . ALA A 1 59 ? 17.271 -6.535  12.763 1.00 0.00 ? 59 ALA A HA   9  
ATOM 10025 H HB1  . ALA A 1 59 ? 15.160 -7.793  12.612 1.00 0.00 ? 59 ALA A HB1  9  
ATOM 10026 H HB2  . ALA A 1 59 ? 16.575 -8.844  12.545 1.00 0.00 ? 59 ALA A HB2  9  
ATOM 10027 H HB3  . ALA A 1 59 ? 15.633 -8.727  14.032 1.00 0.00 ? 59 ALA A HB3  9  
ATOM 10028 N N    . ALA A 1 60 ? 15.684 -6.415  15.659 1.00 0.00 ? 60 ALA A N    9  
ATOM 10029 C CA   . ALA A 1 60 ? 14.898 -5.549  16.530 1.00 0.00 ? 60 ALA A CA   9  
ATOM 10030 C C    . ALA A 1 60 ? 15.575 -4.196  16.715 1.00 0.00 ? 60 ALA A C    9  
ATOM 10031 O O    . ALA A 1 60 ? 14.913 -3.192  16.979 1.00 0.00 ? 60 ALA A O    9  
ATOM 10032 C CB   . ALA A 1 60 ? 14.674 -6.219  17.877 1.00 0.00 ? 60 ALA A CB   9  
ATOM 10033 H H    . ALA A 1 60 ? 15.948 -7.302  15.980 1.00 0.00 ? 60 ALA A H    9  
ATOM 10034 H HA   . ALA A 1 60 ? 13.933 -5.398  16.066 1.00 0.00 ? 60 ALA A HA   9  
ATOM 10035 H HB1  . ALA A 1 60 ? 15.264 -5.716  18.630 1.00 0.00 ? 60 ALA A HB1  9  
ATOM 10036 H HB2  . ALA A 1 60 ? 13.629 -6.160  18.140 1.00 0.00 ? 60 ALA A HB2  9  
ATOM 10037 H HB3  . ALA A 1 60 ? 14.973 -7.255  17.818 1.00 0.00 ? 60 ALA A HB3  9  
ATOM 10038 N N    . GLU A 1 61 ? 16.896 -4.176  16.576 1.00 0.00 ? 61 GLU A N    9  
ATOM 10039 C CA   . GLU A 1 61 ? 17.662 -2.944  16.730 1.00 0.00 ? 61 GLU A CA   9  
ATOM 10040 C C    . GLU A 1 61 ? 17.717 -2.170  15.416 1.00 0.00 ? 61 GLU A C    9  
ATOM 10041 O O    . GLU A 1 61 ? 17.871 -0.948  15.407 1.00 0.00 ? 61 GLU A O    9  
ATOM 10042 C CB   . GLU A 1 61 ? 19.081 -3.256  17.210 1.00 0.00 ? 61 GLU A CB   9  
ATOM 10043 C CG   . GLU A 1 61 ? 19.140 -3.767  18.640 1.00 0.00 ? 61 GLU A CG   9  
ATOM 10044 C CD   . GLU A 1 61 ? 18.933 -5.266  18.733 1.00 0.00 ? 61 GLU A CD   9  
ATOM 10045 O OE1  . GLU A 1 61 ? 17.766 -5.708  18.689 1.00 0.00 ? 61 GLU A OE1  9  
ATOM 10046 O OE2  . GLU A 1 61 ? 19.938 -5.998  18.851 1.00 0.00 ? 61 GLU A OE2  9  
ATOM 10047 H H    . GLU A 1 61 ? 17.368 -5.009  16.365 1.00 0.00 ? 61 GLU A H    9  
ATOM 10048 H HA   . GLU A 1 61 ? 17.166 -2.337  17.471 1.00 0.00 ? 61 GLU A HA   9  
ATOM 10049 H HB2  . GLU A 1 61 ? 19.510 -4.007  16.563 1.00 0.00 ? 61 GLU A HB2  9  
ATOM 10050 H HB3  . GLU A 1 61 ? 19.675 -2.357  17.147 1.00 0.00 ? 61 GLU A HB3  9  
ATOM 10051 H HG2  . GLU A 1 61 ? 20.108 -3.527  19.055 1.00 0.00 ? 61 GLU A HG2  9  
ATOM 10052 H HG3  . GLU A 1 61 ? 18.371 -3.275  19.217 1.00 0.00 ? 61 GLU A HG3  9  
ATOM 10053 N N    . THR A 1 62 ? 17.590 -2.890  14.306 1.00 0.00 ? 62 THR A N    9  
ATOM 10054 C CA   . THR A 1 62 ? 17.627 -2.273  12.986 1.00 0.00 ? 62 THR A CA   9  
ATOM 10055 C C    . THR A 1 62 ? 16.241 -1.805  12.559 1.00 0.00 ? 62 THR A C    9  
ATOM 10056 O O    . THR A 1 62 ? 16.106 -0.969  11.664 1.00 0.00 ? 62 THR A O    9  
ATOM 10057 C CB   . THR A 1 62 ? 18.177 -3.246  11.926 1.00 0.00 ? 62 THR A CB   9  
ATOM 10058 O OG1  . THR A 1 62 ? 17.202 -4.252  11.632 1.00 0.00 ? 62 THR A OG1  9  
ATOM 10059 C CG2  . THR A 1 62 ? 19.462 -3.902  12.408 1.00 0.00 ? 62 THR A CG2  9  
ATOM 10060 H H    . THR A 1 62 ? 17.470 -3.860  14.377 1.00 0.00 ? 62 THR A H    9  
ATOM 10061 H HA   . THR A 1 62 ? 18.286 -1.418  13.036 1.00 0.00 ? 62 THR A HA   9  
ATOM 10062 H HB   . THR A 1 62 ? 18.391 -2.689  11.025 1.00 0.00 ? 62 THR A HB   9  
ATOM 10063 H HG1  . THR A 1 62 ? 17.102 -4.333  10.680 1.00 0.00 ? 62 THR A HG1  9  
ATOM 10064 H HG21 . THR A 1 62 ? 20.236 -3.767  11.667 1.00 0.00 ? 62 THR A HG21 9  
ATOM 10065 H HG22 . THR A 1 62 ? 19.291 -4.957  12.563 1.00 0.00 ? 62 THR A HG22 9  
ATOM 10066 H HG23 . THR A 1 62 ? 19.772 -3.447  13.337 1.00 0.00 ? 62 THR A HG23 9  
ATOM 10067 N N    . ILE A 1 63 ? 15.214 -2.347  13.204 1.00 0.00 ? 63 ILE A N    9  
ATOM 10068 C CA   . ILE A 1 63 ? 13.837 -1.983  12.891 1.00 0.00 ? 63 ILE A CA   9  
ATOM 10069 C C    . ILE A 1 63 ? 13.356 -0.840  13.779 1.00 0.00 ? 63 ILE A C    9  
ATOM 10070 O O    . ILE A 1 63 ? 12.960 -1.053  14.925 1.00 0.00 ? 63 ILE A O    9  
ATOM 10071 C CB   . ILE A 1 63 ? 12.886 -3.182  13.058 1.00 0.00 ? 63 ILE A CB   9  
ATOM 10072 C CG1  . ILE A 1 63 ? 13.311 -4.329  12.139 1.00 0.00 ? 63 ILE A CG1  9  
ATOM 10073 C CG2  . ILE A 1 63 ? 11.452 -2.765  12.765 1.00 0.00 ? 63 ILE A CG2  9  
ATOM 10074 C CD1  . ILE A 1 63 ? 12.675 -5.655  12.494 1.00 0.00 ? 63 ILE A CD1  9  
ATOM 10075 H H    . ILE A 1 63 ? 15.385 -3.007  13.907 1.00 0.00 ? 63 ILE A H    9  
ATOM 10076 H HA   . ILE A 1 63 ? 13.804 -1.662  11.860 1.00 0.00 ? 63 ILE A HA   9  
ATOM 10077 H HB   . ILE A 1 63 ? 12.937 -3.514  14.083 1.00 0.00 ? 63 ILE A HB   9  
ATOM 10078 H HG12 . ILE A 1 63 ? 13.034 -4.091  11.124 1.00 0.00 ? 63 ILE A HG12 9  
ATOM 10079 H HG13 . ILE A 1 63 ? 14.383 -4.448  12.196 1.00 0.00 ? 63 ILE A HG13 9  
ATOM 10080 H HG21 . ILE A 1 63 ? 11.136 -2.031  13.492 1.00 0.00 ? 63 ILE A HG21 9  
ATOM 10081 H HG22 . ILE A 1 63 ? 11.397 -2.338  11.775 1.00 0.00 ? 63 ILE A HG22 9  
ATOM 10082 H HG23 . ILE A 1 63 ? 10.807 -3.629  12.822 1.00 0.00 ? 63 ILE A HG23 9  
ATOM 10083 H HD11 . ILE A 1 63 ? 12.514 -6.230  11.594 1.00 0.00 ? 63 ILE A HD11 9  
ATOM 10084 H HD12 . ILE A 1 63 ? 13.327 -6.201  13.159 1.00 0.00 ? 63 ILE A HD12 9  
ATOM 10085 H HD13 . ILE A 1 63 ? 11.727 -5.480  12.983 1.00 0.00 ? 63 ILE A HD13 9  
ATOM 10086 N N    . LEU A 1 64 ? 13.392 0.375   13.241 1.00 0.00 ? 64 LEU A N    9  
ATOM 10087 C CA   . LEU A 1 64 ? 12.957 1.553   13.983 1.00 0.00 ? 64 LEU A CA   9  
ATOM 10088 C C    . LEU A 1 64 ? 11.651 2.102   13.417 1.00 0.00 ? 64 LEU A C    9  
ATOM 10089 O O    . LEU A 1 64 ? 10.665 2.254   14.138 1.00 0.00 ? 64 LEU A O    9  
ATOM 10090 C CB   . LEU A 1 64 ? 14.039 2.634   13.940 1.00 0.00 ? 64 LEU A CB   9  
ATOM 10091 C CG   . LEU A 1 64 ? 15.485 2.140   14.005 1.00 0.00 ? 64 LEU A CG   9  
ATOM 10092 C CD1  . LEU A 1 64 ? 16.040 1.930   12.604 1.00 0.00 ? 64 LEU A CD1  9  
ATOM 10093 C CD2  . LEU A 1 64 ? 16.350 3.122   14.782 1.00 0.00 ? 64 LEU A CD2  9  
ATOM 10094 H H    . LEU A 1 64 ? 13.717 0.482   12.323 1.00 0.00 ? 64 LEU A H    9  
ATOM 10095 H HA   . LEU A 1 64 ? 12.795 1.258   15.008 1.00 0.00 ? 64 LEU A HA   9  
ATOM 10096 H HB2  . LEU A 1 64 ? 13.919 3.186   13.020 1.00 0.00 ? 64 LEU A HB2  9  
ATOM 10097 H HB3  . LEU A 1 64 ? 13.877 3.296   14.779 1.00 0.00 ? 64 LEU A HB3  9  
ATOM 10098 H HG   . LEU A 1 64 ? 15.511 1.189   14.519 1.00 0.00 ? 64 LEU A HG   9  
ATOM 10099 H HD11 . LEU A 1 64 ? 16.717 1.089   12.608 1.00 0.00 ? 64 LEU A HD11 9  
ATOM 10100 H HD12 . LEU A 1 64 ? 16.569 2.818   12.291 1.00 0.00 ? 64 LEU A HD12 9  
ATOM 10101 H HD13 . LEU A 1 64 ? 15.227 1.736   11.920 1.00 0.00 ? 64 LEU A HD13 9  
ATOM 10102 H HD21 . LEU A 1 64 ? 17.348 2.721   14.880 1.00 0.00 ? 64 LEU A HD21 9  
ATOM 10103 H HD22 . LEU A 1 64 ? 15.925 3.276   15.763 1.00 0.00 ? 64 LEU A HD22 9  
ATOM 10104 H HD23 . LEU A 1 64 ? 16.389 4.063   14.254 1.00 0.00 ? 64 LEU A HD23 9  
ATOM 10105 N N    . THR A 1 65 ? 11.651 2.396   12.121 1.00 0.00 ? 65 THR A N    9  
ATOM 10106 C CA   . THR A 1 65 ? 10.467 2.927   11.457 1.00 0.00 ? 65 THR A CA   9  
ATOM 10107 C C    . THR A 1 65 ? 9.640  1.809   10.831 1.00 0.00 ? 65 THR A C    9  
ATOM 10108 O O    . THR A 1 65 ? 10.073 0.658   10.780 1.00 0.00 ? 65 THR A O    9  
ATOM 10109 C CB   . THR A 1 65 ? 10.843 3.946   10.365 1.00 0.00 ? 65 THR A CB   9  
ATOM 10110 O OG1  . THR A 1 65 ? 11.424 3.270   9.244  1.00 0.00 ? 65 THR A OG1  9  
ATOM 10111 C CG2  . THR A 1 65 ? 11.822 4.979   10.903 1.00 0.00 ? 65 THR A CG2  9  
ATOM 10112 H H    . THR A 1 65 ? 12.468 2.253   11.599 1.00 0.00 ? 65 THR A H    9  
ATOM 10113 H HA   . THR A 1 65 ? 9.867  3.432   12.200 1.00 0.00 ? 65 THR A HA   9  
ATOM 10114 H HB   . THR A 1 65 ? 9.946  4.454   10.044 1.00 0.00 ? 65 THR A HB   9  
ATOM 10115 H HG1  . THR A 1 65 ? 10.798 3.262   8.516  1.00 0.00 ? 65 THR A HG1  9  
ATOM 10116 H HG21 . THR A 1 65 ? 12.070 5.681   10.121 1.00 0.00 ? 65 THR A HG21 9  
ATOM 10117 H HG22 . THR A 1 65 ? 12.720 4.483   11.241 1.00 0.00 ? 65 THR A HG22 9  
ATOM 10118 H HG23 . THR A 1 65 ? 11.369 5.506   11.729 1.00 0.00 ? 65 THR A HG23 9  
ATOM 10119 N N    . VAL A 1 66 ? 8.449  2.157   10.354 1.00 0.00 ? 66 VAL A N    9  
ATOM 10120 C CA   . VAL A 1 66 ? 7.562  1.183   9.729  1.00 0.00 ? 66 VAL A CA   9  
ATOM 10121 C C    . VAL A 1 66 ? 8.213  0.556   8.501  1.00 0.00 ? 66 VAL A C    9  
ATOM 10122 O O    . VAL A 1 66 ? 8.218  -0.664  8.343  1.00 0.00 ? 66 VAL A O    9  
ATOM 10123 C CB   . VAL A 1 66 ? 6.225  1.825   9.316  1.00 0.00 ? 66 VAL A CB   9  
ATOM 10124 C CG1  . VAL A 1 66 ? 5.338  0.808   8.614  1.00 0.00 ? 66 VAL A CG1  9  
ATOM 10125 C CG2  . VAL A 1 66 ? 5.520  2.414   10.528 1.00 0.00 ? 66 VAL A CG2  9  
ATOM 10126 H H    . VAL A 1 66 ? 8.160  3.090   10.424 1.00 0.00 ? 66 VAL A H    9  
ATOM 10127 H HA   . VAL A 1 66 ? 7.357  0.406   10.452 1.00 0.00 ? 66 VAL A HA   9  
ATOM 10128 H HB   . VAL A 1 66 ? 6.433  2.627   8.623  1.00 0.00 ? 66 VAL A HB   9  
ATOM 10129 H HG11 . VAL A 1 66 ? 5.434  0.924   7.545  1.00 0.00 ? 66 VAL A HG11 9  
ATOM 10130 H HG12 . VAL A 1 66 ? 5.640  -0.189  8.898  1.00 0.00 ? 66 VAL A HG12 9  
ATOM 10131 H HG13 . VAL A 1 66 ? 4.309  0.969   8.902  1.00 0.00 ? 66 VAL A HG13 9  
ATOM 10132 H HG21 . VAL A 1 66 ? 6.255  2.785   11.226 1.00 0.00 ? 66 VAL A HG21 9  
ATOM 10133 H HG22 . VAL A 1 66 ? 4.879  3.225   10.214 1.00 0.00 ? 66 VAL A HG22 9  
ATOM 10134 H HG23 . VAL A 1 66 ? 4.924  1.649   11.005 1.00 0.00 ? 66 VAL A HG23 9  
ATOM 10135 N N    . GLY A 1 67 ? 8.763  1.400   7.633  1.00 0.00 ? 67 GLY A N    9  
ATOM 10136 C CA   . GLY A 1 67 ? 9.410  0.910   6.430  1.00 0.00 ? 67 GLY A CA   9  
ATOM 10137 C C    . GLY A 1 67 ? 10.447 -0.157  6.723  1.00 0.00 ? 67 GLY A C    9  
ATOM 10138 O O    . GLY A 1 67 ? 10.667 -1.057  5.913  1.00 0.00 ? 67 GLY A O    9  
ATOM 10139 H H    . GLY A 1 67 ? 8.729  2.363   7.812  1.00 0.00 ? 67 GLY A H    9  
ATOM 10140 H HA2  . GLY A 1 67 ? 8.659  0.497   5.774  1.00 0.00 ? 67 GLY A HA2  9  
ATOM 10141 H HA3  . GLY A 1 67 ? 9.893  1.738   5.932  1.00 0.00 ? 67 GLY A HA3  9  
ATOM 10142 N N    . ASP A 1 68 ? 11.087 -0.054  7.882  1.00 0.00 ? 68 ASP A N    9  
ATOM 10143 C CA   . ASP A 1 68 ? 12.108 -1.018  8.280  1.00 0.00 ? 68 ASP A CA   9  
ATOM 10144 C C    . ASP A 1 68 ? 11.485 -2.378  8.576  1.00 0.00 ? 68 ASP A C    9  
ATOM 10145 O O    . ASP A 1 68 ? 11.869 -3.389  7.989  1.00 0.00 ? 68 ASP A O    9  
ATOM 10146 C CB   . ASP A 1 68 ? 12.866 -0.512  9.507  1.00 0.00 ? 68 ASP A CB   9  
ATOM 10147 C CG   . ASP A 1 68 ? 13.789 0.646   9.181  1.00 0.00 ? 68 ASP A CG   9  
ATOM 10148 O OD1  . ASP A 1 68 ? 14.460 0.592   8.129  1.00 0.00 ? 68 ASP A OD1  9  
ATOM 10149 O OD2  . ASP A 1 68 ? 13.841 1.607   9.978  1.00 0.00 ? 68 ASP A OD2  9  
ATOM 10150 H H    . ASP A 1 68 ? 10.868 0.686   8.486  1.00 0.00 ? 68 ASP A H    9  
ATOM 10151 H HA   . ASP A 1 68 ? 12.800 -1.124  7.459  1.00 0.00 ? 68 ASP A HA   9  
ATOM 10152 H HB2  . ASP A 1 68 ? 12.156 -0.182  10.251 1.00 0.00 ? 68 ASP A HB2  9  
ATOM 10153 H HB3  . ASP A 1 68 ? 13.459 -1.318  9.914  1.00 0.00 ? 68 ASP A HB3  9  
ATOM 10154 N N    . ALA A 1 69 ? 10.521 -2.395  9.492  1.00 0.00 ? 69 ALA A N    9  
ATOM 10155 C CA   . ALA A 1 69 ? 9.845  -3.631  9.866  1.00 0.00 ? 69 ALA A CA   9  
ATOM 10156 C C    . ALA A 1 69 ? 9.193  -4.288  8.654  1.00 0.00 ? 69 ALA A C    9  
ATOM 10157 O O    . ALA A 1 69 ? 9.216  -5.511  8.511  1.00 0.00 ? 69 ALA A O    9  
ATOM 10158 C CB   . ALA A 1 69 ? 8.806  -3.358  10.944 1.00 0.00 ? 69 ALA A CB   9  
ATOM 10159 H H    . ALA A 1 69 ? 10.259 -1.556  9.925  1.00 0.00 ? 69 ALA A H    9  
ATOM 10160 H HA   . ALA A 1 69 ? 10.583 -4.305  10.275 1.00 0.00 ? 69 ALA A HA   9  
ATOM 10161 H HB1  . ALA A 1 69 ? 7.829  -3.646  10.582 1.00 0.00 ? 69 ALA A HB1  9  
ATOM 10162 H HB2  . ALA A 1 69 ? 9.046  -3.930  11.828 1.00 0.00 ? 69 ALA A HB2  9  
ATOM 10163 H HB3  . ALA A 1 69 ? 8.805  -2.306  11.184 1.00 0.00 ? 69 ALA A HB3  9  
ATOM 10164 N N    . VAL A 1 70 ? 8.611  -3.469  7.784  1.00 0.00 ? 70 VAL A N    9  
ATOM 10165 C CA   . VAL A 1 70 ? 7.952  -3.971  6.584  1.00 0.00 ? 70 VAL A CA   9  
ATOM 10166 C C    . VAL A 1 70 ? 8.957  -4.612  5.634  1.00 0.00 ? 70 VAL A C    9  
ATOM 10167 O O    . VAL A 1 70 ? 8.801  -5.766  5.233  1.00 0.00 ? 70 VAL A O    9  
ATOM 10168 C CB   . VAL A 1 70 ? 7.205  -2.847  5.842  1.00 0.00 ? 70 VAL A CB   9  
ATOM 10169 C CG1  . VAL A 1 70 ? 6.560  -3.382  4.573  1.00 0.00 ? 70 VAL A CG1  9  
ATOM 10170 C CG2  . VAL A 1 70 ? 6.165  -2.209  6.750  1.00 0.00 ? 70 VAL A CG2  9  
ATOM 10171 H H    . VAL A 1 70 ? 8.625  -2.504  7.953  1.00 0.00 ? 70 VAL A H    9  
ATOM 10172 H HA   . VAL A 1 70 ? 7.230  -4.716  6.886  1.00 0.00 ? 70 VAL A HA   9  
ATOM 10173 H HB   . VAL A 1 70 ? 7.922  -2.089  5.563  1.00 0.00 ? 70 VAL A HB   9  
ATOM 10174 H HG11 . VAL A 1 70 ? 5.948  -2.611  4.128  1.00 0.00 ? 70 VAL A HG11 9  
ATOM 10175 H HG12 . VAL A 1 70 ? 7.329  -3.680  3.875  1.00 0.00 ? 70 VAL A HG12 9  
ATOM 10176 H HG13 . VAL A 1 70 ? 5.943  -4.235  4.815  1.00 0.00 ? 70 VAL A HG13 9  
ATOM 10177 H HG21 . VAL A 1 70 ? 5.184  -2.578  6.488  1.00 0.00 ? 70 VAL A HG21 9  
ATOM 10178 H HG22 . VAL A 1 70 ? 6.380  -2.462  7.779  1.00 0.00 ? 70 VAL A HG22 9  
ATOM 10179 H HG23 . VAL A 1 70 ? 6.191  -1.137  6.631  1.00 0.00 ? 70 VAL A HG23 9  
ATOM 10180 N N    . LYS A 1 71 ? 9.989  -3.857  5.275  1.00 0.00 ? 71 LYS A N    9  
ATOM 10181 C CA   . LYS A 1 71 ? 11.023 -4.350  4.373  1.00 0.00 ? 71 LYS A CA   9  
ATOM 10182 C C    . LYS A 1 71 ? 11.673 -5.613  4.929  1.00 0.00 ? 71 LYS A C    9  
ATOM 10183 O O    . LYS A 1 71 ? 12.069 -6.503  4.175  1.00 0.00 ? 71 LYS A O    9  
ATOM 10184 C CB   . LYS A 1 71 ? 12.086 -3.274  4.145  1.00 0.00 ? 71 LYS A CB   9  
ATOM 10185 C CG   . LYS A 1 71 ? 11.618 -2.134  3.257  1.00 0.00 ? 71 LYS A CG   9  
ATOM 10186 C CD   . LYS A 1 71 ? 12.678 -1.052  3.133  1.00 0.00 ? 71 LYS A CD   9  
ATOM 10187 C CE   . LYS A 1 71 ? 12.192 0.108   2.279  1.00 0.00 ? 71 LYS A CE   9  
ATOM 10188 N NZ   . LYS A 1 71 ? 12.217 -0.223  0.827  1.00 0.00 ? 71 LYS A NZ   9  
ATOM 10189 H H    . LYS A 1 71 ? 10.059 -2.944  5.628  1.00 0.00 ? 71 LYS A H    9  
ATOM 10190 H HA   . LYS A 1 71 ? 10.554 -4.587  3.429  1.00 0.00 ? 71 LYS A HA   9  
ATOM 10191 H HB2  . LYS A 1 71 ? 12.376 -2.863  5.101  1.00 0.00 ? 71 LYS A HB2  9  
ATOM 10192 H HB3  . LYS A 1 71 ? 12.950 -3.731  3.683  1.00 0.00 ? 71 LYS A HB3  9  
ATOM 10193 H HG2  . LYS A 1 71 ? 11.399 -2.522  2.274  1.00 0.00 ? 71 LYS A HG2  9  
ATOM 10194 H HG3  . LYS A 1 71 ? 10.724 -1.702  3.683  1.00 0.00 ? 71 LYS A HG3  9  
ATOM 10195 H HD2  . LYS A 1 71 ? 12.919 -0.682  4.119  1.00 0.00 ? 71 LYS A HD2  9  
ATOM 10196 H HD3  . LYS A 1 71 ? 13.562 -1.477  2.680  1.00 0.00 ? 71 LYS A HD3  9  
ATOM 10197 H HE2  . LYS A 1 71 ? 11.181 0.352   2.566  1.00 0.00 ? 71 LYS A HE2  9  
ATOM 10198 H HE3  . LYS A 1 71 ? 12.831 0.961   2.456  1.00 0.00 ? 71 LYS A HE3  9  
ATOM 10199 H HZ1  . LYS A 1 71 ? 11.470 -0.913  0.605  1.00 0.00 ? 71 LYS A HZ1  9  
ATOM 10200 H HZ2  . LYS A 1 71 ? 13.138 -0.632  0.570  1.00 0.00 ? 71 LYS A HZ2  9  
ATOM 10201 H HZ3  . LYS A 1 71 ? 12.061 0.635   0.261  1.00 0.00 ? 71 LYS A HZ3  9  
ATOM 10202 N N    . PHE A 1 72 ? 11.778 -5.686  6.251  1.00 0.00 ? 72 PHE A N    9  
ATOM 10203 C CA   . PHE A 1 72 ? 12.380 -6.840  6.908  1.00 0.00 ? 72 PHE A CA   9  
ATOM 10204 C C    . PHE A 1 72 ? 11.501 -8.077  6.747  1.00 0.00 ? 72 PHE A C    9  
ATOM 10205 O O    . PHE A 1 72 ? 11.938 -9.096  6.209  1.00 0.00 ? 72 PHE A O    9  
ATOM 10206 C CB   . PHE A 1 72 ? 12.603 -6.550  8.394  1.00 0.00 ? 72 PHE A CB   9  
ATOM 10207 C CG   . PHE A 1 72 ? 13.876 -7.136  8.935  1.00 0.00 ? 72 PHE A CG   9  
ATOM 10208 C CD1  . PHE A 1 72 ? 14.232 -8.442  8.641  1.00 0.00 ? 72 PHE A CD1  9  
ATOM 10209 C CD2  . PHE A 1 72 ? 14.715 -6.381  9.738  1.00 0.00 ? 72 PHE A CD2  9  
ATOM 10210 C CE1  . PHE A 1 72 ? 15.403 -8.985  9.137  1.00 0.00 ? 72 PHE A CE1  9  
ATOM 10211 C CE2  . PHE A 1 72 ? 15.887 -6.918  10.237 1.00 0.00 ? 72 PHE A CE2  9  
ATOM 10212 C CZ   . PHE A 1 72 ? 16.231 -8.222  9.937  1.00 0.00 ? 72 PHE A CZ   9  
ATOM 10213 H H    . PHE A 1 72 ? 11.444 -4.944  6.799  1.00 0.00 ? 72 PHE A H    9  
ATOM 10214 H HA   . PHE A 1 72 ? 13.334 -7.027  6.440  1.00 0.00 ? 72 PHE A HA   9  
ATOM 10215 H HB2  . PHE A 1 72 ? 12.641 -5.481  8.543  1.00 0.00 ? 72 PHE A HB2  9  
ATOM 10216 H HB3  . PHE A 1 72 ? 11.780 -6.959  8.960  1.00 0.00 ? 72 PHE A HB3  9  
ATOM 10217 H HD1  . PHE A 1 72 ? 13.585 -9.040  8.015  1.00 0.00 ? 72 PHE A HD1  9  
ATOM 10218 H HD2  . PHE A 1 72 ? 14.447 -5.362  9.975  1.00 0.00 ? 72 PHE A HD2  9  
ATOM 10219 H HE1  . PHE A 1 72 ? 15.668 -10.004 8.900  1.00 0.00 ? 72 PHE A HE1  9  
ATOM 10220 H HE2  . PHE A 1 72 ? 16.533 -6.320  10.862 1.00 0.00 ? 72 PHE A HE2  9  
ATOM 10221 H HZ   . PHE A 1 72 ? 17.146 -8.643  10.324 1.00 0.00 ? 72 PHE A HZ   9  
ATOM 10222 N N    . ILE A 1 73 ? 10.262 -7.980  7.216  1.00 0.00 ? 73 ILE A N    9  
ATOM 10223 C CA   . ILE A 1 73 ? 9.322  -9.090  7.123  1.00 0.00 ? 73 ILE A CA   9  
ATOM 10224 C C    . ILE A 1 73 ? 9.165  -9.559  5.681  1.00 0.00 ? 73 ILE A C    9  
ATOM 10225 O O    . ILE A 1 73 ? 9.025  -10.754 5.417  1.00 0.00 ? 73 ILE A O    9  
ATOM 10226 C CB   . ILE A 1 73 ? 7.938  -8.704  7.679  1.00 0.00 ? 73 ILE A CB   9  
ATOM 10227 C CG1  . ILE A 1 73 ? 8.056  -8.266  9.140  1.00 0.00 ? 73 ILE A CG1  9  
ATOM 10228 C CG2  . ILE A 1 73 ? 6.970  -9.869  7.546  1.00 0.00 ? 73 ILE A CG2  9  
ATOM 10229 C CD1  . ILE A 1 73 ? 6.890  -7.427  9.615  1.00 0.00 ? 73 ILE A CD1  9  
ATOM 10230 H H    . ILE A 1 73 ? 9.973  -7.143  7.634  1.00 0.00 ? 73 ILE A H    9  
ATOM 10231 H HA   . ILE A 1 73 ? 9.711  -9.906  7.716  1.00 0.00 ? 73 ILE A HA   9  
ATOM 10232 H HB   . ILE A 1 73 ? 7.557  -7.881  7.094  1.00 0.00 ? 73 ILE A HB   9  
ATOM 10233 H HG12 . ILE A 1 73 ? 8.111  -9.141  9.769  1.00 0.00 ? 73 ILE A HG12 9  
ATOM 10234 H HG13 . ILE A 1 73 ? 8.957  -7.683  9.262  1.00 0.00 ? 73 ILE A HG13 9  
ATOM 10235 H HG21 . ILE A 1 73 ? 6.018  -9.597  7.977  1.00 0.00 ? 73 ILE A HG21 9  
ATOM 10236 H HG22 . ILE A 1 73 ? 6.836  -10.108 6.501  1.00 0.00 ? 73 ILE A HG22 9  
ATOM 10237 H HG23 . ILE A 1 73 ? 7.367  -10.729 8.063  1.00 0.00 ? 73 ILE A HG23 9  
ATOM 10238 H HD11 . ILE A 1 73 ? 7.035  -7.162  10.652 1.00 0.00 ? 73 ILE A HD11 9  
ATOM 10239 H HD12 . ILE A 1 73 ? 6.825  -6.530  9.019  1.00 0.00 ? 73 ILE A HD12 9  
ATOM 10240 H HD13 . ILE A 1 73 ? 5.975  -7.993  9.514  1.00 0.00 ? 73 ILE A HD13 9  
ATOM 10241 N N    . ASP A 1 74 ? 9.192  -8.611  4.751  1.00 0.00 ? 74 ASP A N    9  
ATOM 10242 C CA   . ASP A 1 74 ? 9.055  -8.927  3.333  1.00 0.00 ? 74 ASP A CA   9  
ATOM 10243 C C    . ASP A 1 74 ? 10.303 -9.634  2.812  1.00 0.00 ? 74 ASP A C    9  
ATOM 10244 O O    . ASP A 1 74 ? 10.211 -10.596 2.049  1.00 0.00 ? 74 ASP A O    9  
ATOM 10245 C CB   . ASP A 1 74 ? 8.802  -7.652  2.527  1.00 0.00 ? 74 ASP A CB   9  
ATOM 10246 C CG   . ASP A 1 74 ? 8.533  -7.937  1.062  1.00 0.00 ? 74 ASP A CG   9  
ATOM 10247 O OD1  . ASP A 1 74 ? 7.813  -8.915  0.771  1.00 0.00 ? 74 ASP A OD1  9  
ATOM 10248 O OD2  . ASP A 1 74 ? 9.044  -7.183  0.208  1.00 0.00 ? 74 ASP A OD2  9  
ATOM 10249 H H    . ASP A 1 74 ? 9.306  -7.677  5.023  1.00 0.00 ? 74 ASP A H    9  
ATOM 10250 H HA   . ASP A 1 74 ? 8.209  -9.587  3.220  1.00 0.00 ? 74 ASP A HA   9  
ATOM 10251 H HB2  . ASP A 1 74 ? 7.944  -7.139  2.938  1.00 0.00 ? 74 ASP A HB2  9  
ATOM 10252 H HB3  . ASP A 1 74 ? 9.668  -7.011  2.598  1.00 0.00 ? 74 ASP A HB3  9  
ATOM 10253 N N    . LYS A 1 75 ? 11.468 -9.149  3.227  1.00 0.00 ? 75 LYS A N    9  
ATOM 10254 C CA   . LYS A 1 75 ? 12.735 -9.733  2.802  1.00 0.00 ? 75 LYS A CA   9  
ATOM 10255 C C    . LYS A 1 75 ? 12.852 -11.179 3.274  1.00 0.00 ? 75 LYS A C    9  
ATOM 10256 O O    . LYS A 1 75 ? 13.265 -12.057 2.517  1.00 0.00 ? 75 LYS A O    9  
ATOM 10257 C CB   . LYS A 1 75 ? 13.906 -8.912  3.346  1.00 0.00 ? 75 LYS A CB   9  
ATOM 10258 C CG   . LYS A 1 75 ? 15.239 -9.251  2.700  1.00 0.00 ? 75 LYS A CG   9  
ATOM 10259 C CD   . LYS A 1 75 ? 16.378 -8.466  3.327  1.00 0.00 ? 75 LYS A CD   9  
ATOM 10260 C CE   . LYS A 1 75 ? 17.727 -8.912  2.784  1.00 0.00 ? 75 LYS A CE   9  
ATOM 10261 N NZ   . LYS A 1 75 ? 17.937 -10.376 2.952  1.00 0.00 ? 75 LYS A NZ   9  
ATOM 10262 H H    . LYS A 1 75 ? 11.476 -8.379  3.834  1.00 0.00 ? 75 LYS A H    9  
ATOM 10263 H HA   . LYS A 1 75 ? 12.764 -9.716  1.724  1.00 0.00 ? 75 LYS A HA   9  
ATOM 10264 H HB2  . LYS A 1 75 ? 13.705 -7.864  3.177  1.00 0.00 ? 75 LYS A HB2  9  
ATOM 10265 H HB3  . LYS A 1 75 ? 13.991 -9.087  4.409  1.00 0.00 ? 75 LYS A HB3  9  
ATOM 10266 H HG2  . LYS A 1 75 ? 15.431 -10.306 2.826  1.00 0.00 ? 75 LYS A HG2  9  
ATOM 10267 H HG3  . LYS A 1 75 ? 15.188 -9.016  1.646  1.00 0.00 ? 75 LYS A HG3  9  
ATOM 10268 H HD2  . LYS A 1 75 ? 16.244 -7.417  3.109  1.00 0.00 ? 75 LYS A HD2  9  
ATOM 10269 H HD3  . LYS A 1 75 ? 16.363 -8.618  4.397  1.00 0.00 ? 75 LYS A HD3  9  
ATOM 10270 H HE2  . LYS A 1 75 ? 17.776 -8.668  1.733  1.00 0.00 ? 75 LYS A HE2  9  
ATOM 10271 H HE3  . LYS A 1 75 ? 18.506 -8.382  3.312  1.00 0.00 ? 75 LYS A HE3  9  
ATOM 10272 H HZ1  . LYS A 1 75 ? 18.924 -10.623 2.737  1.00 0.00 ? 75 LYS A HZ1  9  
ATOM 10273 H HZ2  . LYS A 1 75 ? 17.312 -10.903 2.309  1.00 0.00 ? 75 LYS A HZ2  9  
ATOM 10274 H HZ3  . LYS A 1 75 ? 17.726 -10.658 3.931  1.00 0.00 ? 75 LYS A HZ3  9  
ATOM 10275 N N    . ALA A 1 76 ? 12.486 -11.419 4.529  1.00 0.00 ? 76 ALA A N    9  
ATOM 10276 C CA   . ALA A 1 76 ? 12.547 -12.759 5.099  1.00 0.00 ? 76 ALA A CA   9  
ATOM 10277 C C    . ALA A 1 76 ? 11.372 -13.610 4.629  1.00 0.00 ? 76 ALA A C    9  
ATOM 10278 O O    . ALA A 1 76 ? 11.457 -14.838 4.596  1.00 0.00 ? 76 ALA A O    9  
ATOM 10279 C CB   . ALA A 1 76 ? 12.572 -12.685 6.619  1.00 0.00 ? 76 ALA A CB   9  
ATOM 10280 H H    . ALA A 1 76 ? 12.165 -10.678 5.083  1.00 0.00 ? 76 ALA A H    9  
ATOM 10281 H HA   . ALA A 1 76 ? 13.467 -13.220 4.771  1.00 0.00 ? 76 ALA A HA   9  
ATOM 10282 H HB1  . ALA A 1 76 ? 13.542 -12.340 6.945  1.00 0.00 ? 76 ALA A HB1  9  
ATOM 10283 H HB2  . ALA A 1 76 ? 11.812 -11.997 6.958  1.00 0.00 ? 76 ALA A HB2  9  
ATOM 10284 H HB3  . ALA A 1 76 ? 12.381 -13.665 7.030  1.00 0.00 ? 76 ALA A HB3  9  
ATOM 10285 N N    . SER A 1 77 ? 10.277 -12.950 4.266  1.00 0.00 ? 77 SER A N    9  
ATOM 10286 C CA   . SER A 1 77 ? 9.083  -13.647 3.801  1.00 0.00 ? 77 SER A CA   9  
ATOM 10287 C C    . SER A 1 77 ? 9.395  -14.501 2.576  1.00 0.00 ? 77 SER A C    9  
ATOM 10288 O O    . SER A 1 77 ? 8.739  -15.512 2.328  1.00 0.00 ? 77 SER A O    9  
ATOM 10289 C CB   . SER A 1 77 ? 7.978  -12.643 3.469  1.00 0.00 ? 77 SER A CB   9  
ATOM 10290 O OG   . SER A 1 77 ? 7.105  -13.156 2.478  1.00 0.00 ? 77 SER A OG   9  
ATOM 10291 H H    . SER A 1 77 ? 10.271 -11.971 4.315  1.00 0.00 ? 77 SER A H    9  
ATOM 10292 H HA   . SER A 1 77 ? 8.745  -14.292 4.599  1.00 0.00 ? 77 SER A HA   9  
ATOM 10293 H HB2  . SER A 1 77 ? 7.407  -12.432 4.360  1.00 0.00 ? 77 SER A HB2  9  
ATOM 10294 H HB3  . SER A 1 77 ? 8.424  -11.730 3.102  1.00 0.00 ? 77 SER A HB3  9  
ATOM 10295 H HG   . SER A 1 77 ? 7.091  -12.561 1.724  1.00 0.00 ? 77 SER A HG   9  
ATOM 10296 N N    . ALA A 1 78 ? 10.402 -14.087 1.815  1.00 0.00 ? 78 ALA A N    9  
ATOM 10297 C CA   . ALA A 1 78 ? 10.804 -14.814 0.617  1.00 0.00 ? 78 ALA A CA   9  
ATOM 10298 C C    . ALA A 1 78 ? 11.684 -16.008 0.969  1.00 0.00 ? 78 ALA A C    9  
ATOM 10299 O O    . ALA A 1 78 ? 12.129 -16.149 2.109  1.00 0.00 ? 78 ALA A O    9  
ATOM 10300 C CB   . ALA A 1 78 ? 11.529 -13.886 -0.346 1.00 0.00 ? 78 ALA A CB   9  
ATOM 10301 H H    . ALA A 1 78 ? 10.888 -13.274 2.065  1.00 0.00 ? 78 ALA A H    9  
ATOM 10302 H HA   . ALA A 1 78 ? 9.909  -15.171 0.128  1.00 0.00 ? 78 ALA A HA   9  
ATOM 10303 H HB1  . ALA A 1 78 ? 12.088 -14.474 -1.059 1.00 0.00 ? 78 ALA A HB1  9  
ATOM 10304 H HB2  . ALA A 1 78 ? 10.809 -13.274 -0.868 1.00 0.00 ? 78 ALA A HB2  9  
ATOM 10305 H HB3  . ALA A 1 78 ? 12.206 -13.252 0.207  1.00 0.00 ? 78 ALA A HB3  9  
ATOM 10306 N N    . MET A 1 1  ? 1.328  -1.833  -5.892 1.00 0.00 ? 1  MET A N    10 
ATOM 10307 C CA   . MET A 1 1  ? 0.555  -2.474  -4.834 1.00 0.00 ? 1  MET A CA   10 
ATOM 10308 C C    . MET A 1 1  ? 1.467  -2.958  -3.712 1.00 0.00 ? 1  MET A C    10 
ATOM 10309 O O    . MET A 1 1  ? 2.627  -3.299  -3.944 1.00 0.00 ? 1  MET A O    10 
ATOM 10310 C CB   . MET A 1 1  ? -0.246 -3.649  -5.399 1.00 0.00 ? 1  MET A CB   10 
ATOM 10311 C CG   . MET A 1 1  ? -1.580 -3.242  -6.001 1.00 0.00 ? 1  MET A CG   10 
ATOM 10312 S SD   . MET A 1 1  ? -2.134 -4.372  -7.292 1.00 0.00 ? 1  MET A SD   10 
ATOM 10313 C CE   . MET A 1 1  ? -3.840 -4.626  -6.812 1.00 0.00 ? 1  MET A CE   10 
ATOM 10314 H H1   . MET A 1 1  ? 1.782  -2.392  -6.558 1.00 0.00 ? 1  MET A H1   10 
ATOM 10315 H HA   . MET A 1 1  ? -0.131 -1.742  -4.435 1.00 0.00 ? 1  MET A HA   10 
ATOM 10316 H HB2  . MET A 1 1  ? 0.340  -4.132  -6.167 1.00 0.00 ? 1  MET A HB2  10 
ATOM 10317 H HB3  . MET A 1 1  ? -0.435 -4.356  -4.604 1.00 0.00 ? 1  MET A HB3  10 
ATOM 10318 H HG2  . MET A 1 1  ? -2.323 -3.222  -5.218 1.00 0.00 ? 1  MET A HG2  10 
ATOM 10319 H HG3  . MET A 1 1  ? -1.481 -2.253  -6.425 1.00 0.00 ? 1  MET A HG3  10 
ATOM 10320 H HE1  . MET A 1 1  ? -4.100 -5.666  -6.941 1.00 0.00 ? 1  MET A HE1  10 
ATOM 10321 H HE2  . MET A 1 1  ? -3.967 -4.349  -5.776 1.00 0.00 ? 1  MET A HE2  10 
ATOM 10322 H HE3  . MET A 1 1  ? -4.483 -4.015  -7.430 1.00 0.00 ? 1  MET A HE3  10 
ATOM 10323 N N    . SER A 1 2  ? 0.936  -2.984  -2.493 1.00 0.00 ? 2  SER A N    10 
ATOM 10324 C CA   . SER A 1 2  ? 1.704  -3.422  -1.334 1.00 0.00 ? 2  SER A CA   10 
ATOM 10325 C C    . SER A 1 2  ? 1.039  -4.620  -0.663 1.00 0.00 ? 2  SER A C    10 
ATOM 10326 O O    . SER A 1 2  ? -0.098 -4.534  -0.199 1.00 0.00 ? 2  SER A O    10 
ATOM 10327 C CB   . SER A 1 2  ? 1.849  -2.277  -0.330 1.00 0.00 ? 2  SER A CB   10 
ATOM 10328 O OG   . SER A 1 2  ? 2.221  -1.073  -0.979 1.00 0.00 ? 2  SER A OG   10 
ATOM 10329 H H    . SER A 1 2  ? 0.006  -2.699  -2.372 1.00 0.00 ? 2  SER A H    10 
ATOM 10330 H HA   . SER A 1 2  ? 2.685  -3.715  -1.677 1.00 0.00 ? 2  SER A HA   10 
ATOM 10331 H HB2  . SER A 1 2  ? 0.908  -2.123  0.176  1.00 0.00 ? 2  SER A HB2  10 
ATOM 10332 H HB3  . SER A 1 2  ? 2.609  -2.531  0.395  1.00 0.00 ? 2  SER A HB3  10 
ATOM 10333 H HG   . SER A 1 2  ? 1.843  -0.326  -0.509 1.00 0.00 ? 2  SER A HG   10 
ATOM 10334 N N    . ASP A 1 3  ? 1.757  -5.737  -0.616 1.00 0.00 ? 3  ASP A N    10 
ATOM 10335 C CA   . ASP A 1 3  ? 1.239  -6.954  -0.002 1.00 0.00 ? 3  ASP A CA   10 
ATOM 10336 C C    . ASP A 1 3  ? 1.729  -7.087  1.437  1.00 0.00 ? 3  ASP A C    10 
ATOM 10337 O O    . ASP A 1 3  ? 0.932  -7.132  2.374  1.00 0.00 ? 3  ASP A O    10 
ATOM 10338 C CB   . ASP A 1 3  ? 1.661  -8.180  -0.813 1.00 0.00 ? 3  ASP A CB   10 
ATOM 10339 C CG   . ASP A 1 3  ? 1.190  -9.478  -0.188 1.00 0.00 ? 3  ASP A CG   10 
ATOM 10340 O OD1  . ASP A 1 3  ? -0.022 -9.771  -0.269 1.00 0.00 ? 3  ASP A OD1  10 
ATOM 10341 O OD2  . ASP A 1 3  ? 2.033  -10.202 0.382  1.00 0.00 ? 3  ASP A OD2  10 
ATOM 10342 H H    . ASP A 1 3  ? 2.658  -5.743  -1.004 1.00 0.00 ? 3  ASP A H    10 
ATOM 10343 H HA   . ASP A 1 3  ? 0.161  -6.890  0.002  1.00 0.00 ? 3  ASP A HA   10 
ATOM 10344 H HB2  . ASP A 1 3  ? 1.242  -8.108  -1.807 1.00 0.00 ? 3  ASP A HB2  10 
ATOM 10345 H HB3  . ASP A 1 3  ? 2.738  -8.204  -0.882 1.00 0.00 ? 3  ASP A HB3  10 
ATOM 10346 N N    . THR A 1 4  ? 3.046  -7.152  1.604  1.00 0.00 ? 4  THR A N    10 
ATOM 10347 C CA   . THR A 1 4  ? 3.642  -7.282  2.928  1.00 0.00 ? 4  THR A CA   10 
ATOM 10348 C C    . THR A 1 4  ? 3.389  -6.038  3.770  1.00 0.00 ? 4  THR A C    10 
ATOM 10349 O O    . THR A 1 4  ? 2.965  -6.132  4.922  1.00 0.00 ? 4  THR A O    10 
ATOM 10350 C CB   . THR A 1 4  ? 5.160  -7.528  2.838  1.00 0.00 ? 4  THR A CB   10 
ATOM 10351 O OG1  . THR A 1 4  ? 5.419  -8.736  2.115  1.00 0.00 ? 4  THR A OG1  10 
ATOM 10352 C CG2  . THR A 1 4  ? 5.777  -7.619  4.226  1.00 0.00 ? 4  THR A CG2  10 
ATOM 10353 H H    . THR A 1 4  ? 3.629  -7.111  0.818  1.00 0.00 ? 4  THR A H    10 
ATOM 10354 H HA   . THR A 1 4  ? 3.189  -8.134  3.415  1.00 0.00 ? 4  THR A HA   10 
ATOM 10355 H HB   . THR A 1 4  ? 5.613  -6.699  2.313  1.00 0.00 ? 4  THR A HB   10 
ATOM 10356 H HG1  . THR A 1 4  ? 4.844  -8.780  1.348  1.00 0.00 ? 4  THR A HG1  10 
ATOM 10357 H HG21 . THR A 1 4  ? 5.167  -8.256  4.850  1.00 0.00 ? 4  THR A HG21 10 
ATOM 10358 H HG22 . THR A 1 4  ? 5.830  -6.633  4.662  1.00 0.00 ? 4  THR A HG22 10 
ATOM 10359 H HG23 . THR A 1 4  ? 6.770  -8.034  4.151  1.00 0.00 ? 4  THR A HG23 10 
ATOM 10360 N N    . ALA A 1 5  ? 3.651  -4.872  3.189  1.00 0.00 ? 5  ALA A N    10 
ATOM 10361 C CA   . ALA A 1 5  ? 3.449  -3.608  3.886  1.00 0.00 ? 5  ALA A CA   10 
ATOM 10362 C C    . ALA A 1 5  ? 2.045  -3.525  4.476  1.00 0.00 ? 5  ALA A C    10 
ATOM 10363 O O    . ALA A 1 5  ? 1.878  -3.268  5.668  1.00 0.00 ? 5  ALA A O    10 
ATOM 10364 C CB   . ALA A 1 5  ? 3.697  -2.439  2.943  1.00 0.00 ? 5  ALA A CB   10 
ATOM 10365 H H    . ALA A 1 5  ? 3.988  -4.862  2.268  1.00 0.00 ? 5  ALA A H    10 
ATOM 10366 H HA   . ALA A 1 5  ? 4.170  -3.550  4.688  1.00 0.00 ? 5  ALA A HA   10 
ATOM 10367 H HB1  . ALA A 1 5  ? 4.262  -1.676  3.458  1.00 0.00 ? 5  ALA A HB1  10 
ATOM 10368 H HB2  . ALA A 1 5  ? 4.254  -2.782  2.084  1.00 0.00 ? 5  ALA A HB2  10 
ATOM 10369 H HB3  . ALA A 1 5  ? 2.751  -2.031  2.620  1.00 0.00 ? 5  ALA A HB3  10 
ATOM 10370 N N    . GLU A 1 6  ? 1.040  -3.743  3.634  1.00 0.00 ? 6  GLU A N    10 
ATOM 10371 C CA   . GLU A 1 6  ? -0.349 -3.691  4.073  1.00 0.00 ? 6  GLU A CA   10 
ATOM 10372 C C    . GLU A 1 6  ? -0.567 -4.579  5.295  1.00 0.00 ? 6  GLU A C    10 
ATOM 10373 O O    . GLU A 1 6  ? -1.252 -4.193  6.242  1.00 0.00 ? 6  GLU A O    10 
ATOM 10374 C CB   . GLU A 1 6  ? -1.282 -4.124  2.941  1.00 0.00 ? 6  GLU A CB   10 
ATOM 10375 C CG   . GLU A 1 6  ? -1.622 -3.005  1.971  1.00 0.00 ? 6  GLU A CG   10 
ATOM 10376 C CD   . GLU A 1 6  ? -2.782 -3.356  1.059  1.00 0.00 ? 6  GLU A CD   10 
ATOM 10377 O OE1  . GLU A 1 6  ? -3.280 -4.497  1.147  1.00 0.00 ? 6  GLU A OE1  10 
ATOM 10378 O OE2  . GLU A 1 6  ? -3.190 -2.490  0.257  1.00 0.00 ? 6  GLU A OE2  10 
ATOM 10379 H H    . GLU A 1 6  ? 1.238  -3.942  2.695  1.00 0.00 ? 6  GLU A H    10 
ATOM 10380 H HA   . GLU A 1 6  ? -0.574 -2.669  4.342  1.00 0.00 ? 6  GLU A HA   10 
ATOM 10381 H HB2  . GLU A 1 6  ? -0.810 -4.922  2.387  1.00 0.00 ? 6  GLU A HB2  10 
ATOM 10382 H HB3  . GLU A 1 6  ? -2.202 -4.491  3.370  1.00 0.00 ? 6  GLU A HB3  10 
ATOM 10383 H HG2  . GLU A 1 6  ? -1.883 -2.123  2.536  1.00 0.00 ? 6  GLU A HG2  10 
ATOM 10384 H HG3  . GLU A 1 6  ? -0.755 -2.797  1.362  1.00 0.00 ? 6  GLU A HG3  10 
ATOM 10385 N N    . ARG A 1 7  ? 0.020  -5.771  5.264  1.00 0.00 ? 7  ARG A N    10 
ATOM 10386 C CA   . ARG A 1 7  ? -0.110 -6.716  6.367  1.00 0.00 ? 7  ARG A CA   10 
ATOM 10387 C C    . ARG A 1 7  ? 0.479  -6.138  7.650  1.00 0.00 ? 7  ARG A C    10 
ATOM 10388 O O    . ARG A 1 7  ? -0.165 -6.147  8.700  1.00 0.00 ? 7  ARG A O    10 
ATOM 10389 C CB   . ARG A 1 7  ? 0.585  -8.034  6.022  1.00 0.00 ? 7  ARG A CB   10 
ATOM 10390 C CG   . ARG A 1 7  ? -0.290 -8.997  5.235  1.00 0.00 ? 7  ARG A CG   10 
ATOM 10391 C CD   . ARG A 1 7  ? -1.350 -9.635  6.119  1.00 0.00 ? 7  ARG A CD   10 
ATOM 10392 N NE   . ARG A 1 7  ? -2.478 -10.142 5.342  1.00 0.00 ? 7  ARG A NE   10 
ATOM 10393 C CZ   . ARG A 1 7  ? -3.400 -10.961 5.834  1.00 0.00 ? 7  ARG A CZ   10 
ATOM 10394 N NH1  . ARG A 1 7  ? -3.329 -11.364 7.095  1.00 0.00 ? 7  ARG A NH1  10 
ATOM 10395 N NH2  . ARG A 1 7  ? -4.396 -11.379 5.064  1.00 0.00 ? 7  ARG A NH2  10 
ATOM 10396 H H    . ARG A 1 7  ? 0.554  -6.022  4.481  1.00 0.00 ? 7  ARG A H    10 
ATOM 10397 H HA   . ARG A 1 7  ? -1.162 -6.903  6.520  1.00 0.00 ? 7  ARG A HA   10 
ATOM 10398 H HB2  . ARG A 1 7  ? 1.466  -7.821  5.434  1.00 0.00 ? 7  ARG A HB2  10 
ATOM 10399 H HB3  . ARG A 1 7  ? 0.883  -8.520  6.939  1.00 0.00 ? 7  ARG A HB3  10 
ATOM 10400 H HG2  . ARG A 1 7  ? -0.779 -8.455  4.439  1.00 0.00 ? 7  ARG A HG2  10 
ATOM 10401 H HG3  . ARG A 1 7  ? 0.333  -9.773  4.816  1.00 0.00 ? 7  ARG A HG3  10 
ATOM 10402 H HD2  . ARG A 1 7  ? -0.902 -10.454 6.662  1.00 0.00 ? 7  ARG A HD2  10 
ATOM 10403 H HD3  . ARG A 1 7  ? -1.710 -8.895  6.818  1.00 0.00 ? 7  ARG A HD3  10 
ATOM 10404 H HE   . ARG A 1 7  ? -2.549 -9.857  4.407  1.00 0.00 ? 7  ARG A HE   10 
ATOM 10405 H HH11 . ARG A 1 7  ? -2.580 -11.050 7.678  1.00 0.00 ? 7  ARG A HH11 10 
ATOM 10406 H HH12 . ARG A 1 7  ? -4.026 -11.980 7.463  1.00 0.00 ? 7  ARG A HH12 10 
ATOM 10407 H HH21 . ARG A 1 7  ? -4.453 -11.078 4.112  1.00 0.00 ? 7  ARG A HH21 10 
ATOM 10408 H HH22 . ARG A 1 7  ? -5.090 -11.996 5.435  1.00 0.00 ? 7  ARG A HH22 10 
ATOM 10409 N N    . VAL A 1 8  ? 1.707  -5.637  7.559  1.00 0.00 ? 8  VAL A N    10 
ATOM 10410 C CA   . VAL A 1 8  ? 2.383  -5.055  8.712  1.00 0.00 ? 8  VAL A CA   10 
ATOM 10411 C C    . VAL A 1 8  ? 1.567  -3.913  9.308  1.00 0.00 ? 8  VAL A C    10 
ATOM 10412 O O    . VAL A 1 8  ? 1.172  -3.959  10.473 1.00 0.00 ? 8  VAL A O    10 
ATOM 10413 C CB   . VAL A 1 8  ? 3.782  -4.531  8.337  1.00 0.00 ? 8  VAL A CB   10 
ATOM 10414 C CG1  . VAL A 1 8  ? 4.469  -3.926  9.552  1.00 0.00 ? 8  VAL A CG1  10 
ATOM 10415 C CG2  . VAL A 1 8  ? 4.625  -5.647  7.738  1.00 0.00 ? 8  VAL A CG2  10 
ATOM 10416 H H    . VAL A 1 8  ? 2.169  -5.659  6.695  1.00 0.00 ? 8  VAL A H    10 
ATOM 10417 H HA   . VAL A 1 8  ? 2.499  -5.829  9.457  1.00 0.00 ? 8  VAL A HA   10 
ATOM 10418 H HB   . VAL A 1 8  ? 3.667  -3.757  7.593  1.00 0.00 ? 8  VAL A HB   10 
ATOM 10419 H HG11 . VAL A 1 8  ? 4.091  -4.394  10.449 1.00 0.00 ? 8  VAL A HG11 10 
ATOM 10420 H HG12 . VAL A 1 8  ? 5.534  -4.088  9.481  1.00 0.00 ? 8  VAL A HG12 10 
ATOM 10421 H HG13 . VAL A 1 8  ? 4.267  -2.866  9.588  1.00 0.00 ? 8  VAL A HG13 10 
ATOM 10422 H HG21 . VAL A 1 8  ? 4.414  -6.572  8.253  1.00 0.00 ? 8  VAL A HG21 10 
ATOM 10423 H HG22 . VAL A 1 8  ? 4.386  -5.756  6.690  1.00 0.00 ? 8  VAL A HG22 10 
ATOM 10424 H HG23 . VAL A 1 8  ? 5.672  -5.405  7.845  1.00 0.00 ? 8  VAL A HG23 10 
ATOM 10425 N N    . LYS A 1 9  ? 1.318  -2.887  8.501  1.00 0.00 ? 9  LYS A N    10 
ATOM 10426 C CA   . LYS A 1 9  ? 0.548  -1.732  8.946  1.00 0.00 ? 9  LYS A CA   10 
ATOM 10427 C C    . LYS A 1 9  ? -0.777 -2.167  9.564  1.00 0.00 ? 9  LYS A C    10 
ATOM 10428 O O    . LYS A 1 9  ? -1.196 -1.639  10.595 1.00 0.00 ? 9  LYS A O    10 
ATOM 10429 C CB   . LYS A 1 9  ? 0.289  -0.783  7.774  1.00 0.00 ? 9  LYS A CB   10 
ATOM 10430 C CG   . LYS A 1 9  ? 1.553  -0.344  7.056  1.00 0.00 ? 9  LYS A CG   10 
ATOM 10431 C CD   . LYS A 1 9  ? 1.239  0.566   5.880  1.00 0.00 ? 9  LYS A CD   10 
ATOM 10432 C CE   . LYS A 1 9  ? 1.080  -0.225  4.590  1.00 0.00 ? 9  LYS A CE   10 
ATOM 10433 N NZ   . LYS A 1 9  ? 1.117  0.657   3.391  1.00 0.00 ? 9  LYS A NZ   10 
ATOM 10434 H H    . LYS A 1 9  ? 1.660  -2.908  7.582  1.00 0.00 ? 9  LYS A H    10 
ATOM 10435 H HA   . LYS A 1 9  ? 1.129  -1.215  9.695  1.00 0.00 ? 9  LYS A HA   10 
ATOM 10436 H HB2  . LYS A 1 9  ? -0.352 -1.279  7.060  1.00 0.00 ? 9  LYS A HB2  10 
ATOM 10437 H HB3  . LYS A 1 9  ? -0.214 0.098   8.144  1.00 0.00 ? 9  LYS A HB3  10 
ATOM 10438 H HG2  . LYS A 1 9  ? 2.185  0.189   7.751  1.00 0.00 ? 9  LYS A HG2  10 
ATOM 10439 H HG3  . LYS A 1 9  ? 2.073  -1.219  6.693  1.00 0.00 ? 9  LYS A HG3  10 
ATOM 10440 H HD2  . LYS A 1 9  ? 0.319  1.095   6.080  1.00 0.00 ? 9  LYS A HD2  10 
ATOM 10441 H HD3  . LYS A 1 9  ? 2.046  1.276   5.760  1.00 0.00 ? 9  LYS A HD3  10 
ATOM 10442 H HE2  . LYS A 1 9  ? 1.882  -0.944  4.523  1.00 0.00 ? 9  LYS A HE2  10 
ATOM 10443 H HE3  . LYS A 1 9  ? 0.133  -0.743  4.616  1.00 0.00 ? 9  LYS A HE3  10 
ATOM 10444 H HZ1  . LYS A 1 9  ? 0.150  0.866   3.071  1.00 0.00 ? 9  LYS A HZ1  10 
ATOM 10445 H HZ2  . LYS A 1 9  ? 1.632  0.188   2.619  1.00 0.00 ? 9  LYS A HZ2  10 
ATOM 10446 H HZ3  . LYS A 1 9  ? 1.596  1.552   3.619  1.00 0.00 ? 9  LYS A HZ3  10 
ATOM 10447 N N    . LYS A 1 10 ? -1.432 -3.133  8.930  1.00 0.00 ? 10 LYS A N    10 
ATOM 10448 C CA   . LYS A 1 10 ? -2.708 -3.642  9.418  1.00 0.00 ? 10 LYS A CA   10 
ATOM 10449 C C    . LYS A 1 10 ? -2.577 -4.156  10.849 1.00 0.00 ? 10 LYS A C    10 
ATOM 10450 O O    . LYS A 1 10 ? -3.263 -3.681  11.754 1.00 0.00 ? 10 LYS A O    10 
ATOM 10451 C CB   . LYS A 1 10 ? -3.217 -4.761  8.507  1.00 0.00 ? 10 LYS A CB   10 
ATOM 10452 C CG   . LYS A 1 10 ? -4.642 -5.191  8.810  1.00 0.00 ? 10 LYS A CG   10 
ATOM 10453 C CD   . LYS A 1 10 ? -5.234 -6.001  7.669  1.00 0.00 ? 10 LYS A CD   10 
ATOM 10454 C CE   . LYS A 1 10 ? -6.746 -5.854  7.607  1.00 0.00 ? 10 LYS A CE   10 
ATOM 10455 N NZ   . LYS A 1 10 ? -7.424 -6.635  8.679  1.00 0.00 ? 10 LYS A NZ   10 
ATOM 10456 H H    . LYS A 1 10 ? -1.046 -3.515  8.113  1.00 0.00 ? 10 LYS A H    10 
ATOM 10457 H HA   . LYS A 1 10 ? -3.416 -2.828  9.405  1.00 0.00 ? 10 LYS A HA   10 
ATOM 10458 H HB2  . LYS A 1 10 ? -3.175 -4.422  7.483  1.00 0.00 ? 10 LYS A HB2  10 
ATOM 10459 H HB3  . LYS A 1 10 ? -2.572 -5.621  8.619  1.00 0.00 ? 10 LYS A HB3  10 
ATOM 10460 H HG2  . LYS A 1 10 ? -4.644 -5.795  9.705  1.00 0.00 ? 10 LYS A HG2  10 
ATOM 10461 H HG3  . LYS A 1 10 ? -5.248 -4.310  8.966  1.00 0.00 ? 10 LYS A HG3  10 
ATOM 10462 H HD2  . LYS A 1 10 ? -4.811 -5.657  6.737  1.00 0.00 ? 10 LYS A HD2  10 
ATOM 10463 H HD3  . LYS A 1 10 ? -4.988 -7.044  7.814  1.00 0.00 ? 10 LYS A HD3  10 
ATOM 10464 H HE2  . LYS A 1 10 ? -6.998 -4.811  7.719  1.00 0.00 ? 10 LYS A HE2  10 
ATOM 10465 H HE3  . LYS A 1 10 ? -7.089 -6.206  6.645  1.00 0.00 ? 10 LYS A HE3  10 
ATOM 10466 H HZ1  . LYS A 1 10 ? -7.064 -7.610  8.692  1.00 0.00 ? 10 LYS A HZ1  10 
ATOM 10467 H HZ2  . LYS A 1 10 ? -8.450 -6.659  8.509  1.00 0.00 ? 10 LYS A HZ2  10 
ATOM 10468 H HZ3  . LYS A 1 10 ? -7.246 -6.198  9.605  1.00 0.00 ? 10 LYS A HZ3  10 
ATOM 10469 N N    . ILE A 1 11 ? -1.692 -5.128  11.044 1.00 0.00 ? 11 ILE A N    10 
ATOM 10470 C CA   . ILE A 1 11 ? -1.470 -5.704  12.365 1.00 0.00 ? 11 ILE A CA   10 
ATOM 10471 C C    . ILE A 1 11 ? -1.087 -4.629  13.376 1.00 0.00 ? 11 ILE A C    10 
ATOM 10472 O O    . ILE A 1 11 ? -1.438 -4.714  14.553 1.00 0.00 ? 11 ILE A O    10 
ATOM 10473 C CB   . ILE A 1 11 ? -0.368 -6.779  12.332 1.00 0.00 ? 11 ILE A CB   10 
ATOM 10474 C CG1  . ILE A 1 11 ? -0.721 -7.872  11.322 1.00 0.00 ? 11 ILE A CG1  10 
ATOM 10475 C CG2  . ILE A 1 11 ? -0.169 -7.375  13.718 1.00 0.00 ? 11 ILE A CG2  10 
ATOM 10476 C CD1  . ILE A 1 11 ? 0.439  -8.784  10.988 1.00 0.00 ? 11 ILE A CD1  10 
ATOM 10477 H H    . ILE A 1 11 ? -1.175 -5.464  10.283 1.00 0.00 ? 11 ILE A H    10 
ATOM 10478 H HA   . ILE A 1 11 ? -2.391 -6.170  12.684 1.00 0.00 ? 11 ILE A HA   10 
ATOM 10479 H HB   . ILE A 1 11 ? 0.556  -6.307  12.034 1.00 0.00 ? 11 ILE A HB   10 
ATOM 10480 H HG12 . ILE A 1 11 ? -1.516 -8.480  11.722 1.00 0.00 ? 11 ILE A HG12 10 
ATOM 10481 H HG13 . ILE A 1 11 ? -1.054 -7.409  10.404 1.00 0.00 ? 11 ILE A HG13 10 
ATOM 10482 H HG21 . ILE A 1 11 ? 0.124  -6.596  14.406 1.00 0.00 ? 11 ILE A HG21 10 
ATOM 10483 H HG22 . ILE A 1 11 ? -1.092 -7.822  14.053 1.00 0.00 ? 11 ILE A HG22 10 
ATOM 10484 H HG23 . ILE A 1 11 ? 0.603  -8.129  13.678 1.00 0.00 ? 11 ILE A HG23 10 
ATOM 10485 H HD11 . ILE A 1 11 ? 0.772  -9.286  11.885 1.00 0.00 ? 11 ILE A HD11 10 
ATOM 10486 H HD12 . ILE A 1 11 ? 0.124  -9.516  10.260 1.00 0.00 ? 11 ILE A HD12 10 
ATOM 10487 H HD13 . ILE A 1 11 ? 1.252  -8.199  10.582 1.00 0.00 ? 11 ILE A HD13 10 
ATOM 10488 N N    . VAL A 1 12 ? -0.365 -3.615  12.909 1.00 0.00 ? 12 VAL A N    10 
ATOM 10489 C CA   . VAL A 1 12 ? 0.064  -2.520  13.771 1.00 0.00 ? 12 VAL A CA   10 
ATOM 10490 C C    . VAL A 1 12 ? -1.119 -1.655  14.191 1.00 0.00 ? 12 VAL A C    10 
ATOM 10491 O O    . VAL A 1 12 ? -1.226 -1.249  15.348 1.00 0.00 ? 12 VAL A O    10 
ATOM 10492 C CB   . VAL A 1 12 ? 1.113  -1.634  13.074 1.00 0.00 ? 12 VAL A CB   10 
ATOM 10493 C CG1  . VAL A 1 12 ? 1.521  -0.479  13.975 1.00 0.00 ? 12 VAL A CG1  10 
ATOM 10494 C CG2  . VAL A 1 12 ? 2.325  -2.460  12.671 1.00 0.00 ? 12 VAL A CG2  10 
ATOM 10495 H H    . VAL A 1 12 ? -0.116 -3.602  11.961 1.00 0.00 ? 12 VAL A H    10 
ATOM 10496 H HA   . VAL A 1 12 ? 0.516  -2.948  14.654 1.00 0.00 ? 12 VAL A HA   10 
ATOM 10497 H HB   . VAL A 1 12 ? 0.670  -1.224  12.178 1.00 0.00 ? 12 VAL A HB   10 
ATOM 10498 H HG11 . VAL A 1 12 ? 2.249  0.135   13.466 1.00 0.00 ? 12 VAL A HG11 10 
ATOM 10499 H HG12 . VAL A 1 12 ? 0.651  0.116   14.214 1.00 0.00 ? 12 VAL A HG12 10 
ATOM 10500 H HG13 . VAL A 1 12 ? 1.953  -0.868  14.885 1.00 0.00 ? 12 VAL A HG13 10 
ATOM 10501 H HG21 . VAL A 1 12 ? 2.523  -2.319  11.619 1.00 0.00 ? 12 VAL A HG21 10 
ATOM 10502 H HG22 . VAL A 1 12 ? 3.184  -2.143  13.244 1.00 0.00 ? 12 VAL A HG22 10 
ATOM 10503 H HG23 . VAL A 1 12 ? 2.130  -3.504  12.864 1.00 0.00 ? 12 VAL A HG23 10 
ATOM 10504 N N    . VAL A 1 13 ? -2.006 -1.375  13.241 1.00 0.00 ? 13 VAL A N    10 
ATOM 10505 C CA   . VAL A 1 13 ? -3.184 -0.559  13.512 1.00 0.00 ? 13 VAL A CA   10 
ATOM 10506 C C    . VAL A 1 13 ? -4.154 -1.284  14.438 1.00 0.00 ? 13 VAL A C    10 
ATOM 10507 O O    . VAL A 1 13 ? -4.810 -0.663  15.273 1.00 0.00 ? 13 VAL A O    10 
ATOM 10508 C CB   . VAL A 1 13 ? -3.917 -0.182  12.211 1.00 0.00 ? 13 VAL A CB   10 
ATOM 10509 C CG1  . VAL A 1 13 ? -5.158 0.642   12.517 1.00 0.00 ? 13 VAL A CG1  10 
ATOM 10510 C CG2  . VAL A 1 13 ? -2.985 0.571   11.274 1.00 0.00 ? 13 VAL A CG2  10 
ATOM 10511 H H    . VAL A 1 13 ? -1.866 -1.727  12.338 1.00 0.00 ? 13 VAL A H    10 
ATOM 10512 H HA   . VAL A 1 13 ? -2.855 0.352   13.992 1.00 0.00 ? 13 VAL A HA   10 
ATOM 10513 H HB   . VAL A 1 13 ? -4.227 -1.092  11.720 1.00 0.00 ? 13 VAL A HB   10 
ATOM 10514 H HG11 . VAL A 1 13 ? -5.189 0.867   13.573 1.00 0.00 ? 13 VAL A HG11 10 
ATOM 10515 H HG12 . VAL A 1 13 ? -5.128 1.562   11.952 1.00 0.00 ? 13 VAL A HG12 10 
ATOM 10516 H HG13 . VAL A 1 13 ? -6.039 0.080   12.243 1.00 0.00 ? 13 VAL A HG13 10 
ATOM 10517 H HG21 . VAL A 1 13 ? -3.080 0.172   10.275 1.00 0.00 ? 13 VAL A HG21 10 
ATOM 10518 H HG22 . VAL A 1 13 ? -3.247 1.619   11.269 1.00 0.00 ? 13 VAL A HG22 10 
ATOM 10519 H HG23 . VAL A 1 13 ? -1.965 0.458   11.612 1.00 0.00 ? 13 VAL A HG23 10 
ATOM 10520 N N    . GLU A 1 14 ? -4.239 -2.601  14.282 1.00 0.00 ? 14 GLU A N    10 
ATOM 10521 C CA   . GLU A 1 14 ? -5.131 -3.411  15.105 1.00 0.00 ? 14 GLU A CA   10 
ATOM 10522 C C    . GLU A 1 14 ? -4.497 -3.711  16.460 1.00 0.00 ? 14 GLU A C    10 
ATOM 10523 O O    . GLU A 1 14 ? -5.196 -3.947  17.446 1.00 0.00 ? 14 GLU A O    10 
ATOM 10524 C CB   . GLU A 1 14 ? -5.474 -4.719  14.388 1.00 0.00 ? 14 GLU A CB   10 
ATOM 10525 C CG   . GLU A 1 14 ? -6.804 -5.316  14.817 1.00 0.00 ? 14 GLU A CG   10 
ATOM 10526 C CD   . GLU A 1 14 ? -6.707 -6.078  16.125 1.00 0.00 ? 14 GLU A CD   10 
ATOM 10527 O OE1  . GLU A 1 14 ? -5.861 -6.992  16.219 1.00 0.00 ? 14 GLU A OE1  10 
ATOM 10528 O OE2  . GLU A 1 14 ? -7.477 -5.758  17.055 1.00 0.00 ? 14 GLU A OE2  10 
ATOM 10529 H H    . GLU A 1 14 ? -3.690 -3.039  13.598 1.00 0.00 ? 14 GLU A H    10 
ATOM 10530 H HA   . GLU A 1 14 ? -6.039 -2.849  15.262 1.00 0.00 ? 14 GLU A HA   10 
ATOM 10531 H HB2  . GLU A 1 14 ? -5.511 -4.534  13.325 1.00 0.00 ? 14 GLU A HB2  10 
ATOM 10532 H HB3  . GLU A 1 14 ? -4.697 -5.441  14.592 1.00 0.00 ? 14 GLU A HB3  10 
ATOM 10533 H HG2  . GLU A 1 14 ? -7.521 -4.518  14.935 1.00 0.00 ? 14 GLU A HG2  10 
ATOM 10534 H HG3  . GLU A 1 14 ? -7.144 -5.994  14.047 1.00 0.00 ? 14 GLU A HG3  10 
ATOM 10535 N N    . HIS A 1 15 ? -3.169 -3.702  16.501 1.00 0.00 ? 15 HIS A N    10 
ATOM 10536 C CA   . HIS A 1 15 ? -2.440 -3.973  17.735 1.00 0.00 ? 15 HIS A CA   10 
ATOM 10537 C C    . HIS A 1 15 ? -2.329 -2.714  18.588 1.00 0.00 ? 15 HIS A C    10 
ATOM 10538 O O    . HIS A 1 15 ? -2.762 -2.692  19.741 1.00 0.00 ? 15 HIS A O    10 
ATOM 10539 C CB   . HIS A 1 15 ? -1.045 -4.515  17.420 1.00 0.00 ? 15 HIS A CB   10 
ATOM 10540 C CG   . HIS A 1 15 ? -0.296 -4.982  18.630 1.00 0.00 ? 15 HIS A CG   10 
ATOM 10541 N ND1  . HIS A 1 15 ? -0.728 -6.021  19.427 1.00 0.00 ? 15 HIS A ND1  10 
ATOM 10542 C CD2  . HIS A 1 15 ? 0.863  -4.547  19.176 1.00 0.00 ? 15 HIS A CD2  10 
ATOM 10543 C CE1  . HIS A 1 15 ? 0.132  -6.203  20.413 1.00 0.00 ? 15 HIS A CE1  10 
ATOM 10544 N NE2  . HIS A 1 15 ? 1.108  -5.322  20.283 1.00 0.00 ? 15 HIS A NE2  10 
ATOM 10545 H H    . HIS A 1 15 ? -2.667 -3.508  15.682 1.00 0.00 ? 15 HIS A H    10 
ATOM 10546 H HA   . HIS A 1 15 ? -2.990 -4.720  18.287 1.00 0.00 ? 15 HIS A HA   10 
ATOM 10547 H HB2  . HIS A 1 15 ? -1.136 -5.352  16.743 1.00 0.00 ? 15 HIS A HB2  10 
ATOM 10548 H HB3  . HIS A 1 15 ? -0.462 -3.737  16.947 1.00 0.00 ? 15 HIS A HB3  10 
ATOM 10549 H HD1  . HIS A 1 15 ? -1.545 -6.545  19.292 1.00 0.00 ? 15 HIS A HD1  10 
ATOM 10550 H HD2  . HIS A 1 15 ? 1.482  -3.740  18.810 1.00 0.00 ? 15 HIS A HD2  10 
ATOM 10551 H HE1  . HIS A 1 15 ? 0.053  -6.946  21.192 1.00 0.00 ? 15 HIS A HE1  10 
ATOM 10552 N N    . LEU A 1 16 ? -1.745 -1.667  18.016 1.00 0.00 ? 16 LEU A N    10 
ATOM 10553 C CA   . LEU A 1 16 ? -1.576 -0.403  18.724 1.00 0.00 ? 16 LEU A CA   10 
ATOM 10554 C C    . LEU A 1 16 ? -2.901 0.344   18.830 1.00 0.00 ? 16 LEU A C    10 
ATOM 10555 O O    . LEU A 1 16 ? -3.140 1.071   19.793 1.00 0.00 ? 16 LEU A O    10 
ATOM 10556 C CB   . LEU A 1 16 ? -0.541 0.470   18.011 1.00 0.00 ? 16 LEU A CB   10 
ATOM 10557 C CG   . LEU A 1 16 ? 0.919  0.232   18.397 1.00 0.00 ? 16 LEU A CG   10 
ATOM 10558 C CD1  . LEU A 1 16 ? 1.160  0.632   19.844 1.00 0.00 ? 16 LEU A CD1  10 
ATOM 10559 C CD2  . LEU A 1 16 ? 1.299  -1.225  18.174 1.00 0.00 ? 16 LEU A CD2  10 
ATOM 10560 H H    . LEU A 1 16 ? -1.419 -1.745  17.095 1.00 0.00 ? 16 LEU A H    10 
ATOM 10561 H HA   . LEU A 1 16 ? -1.221 -0.626  19.720 1.00 0.00 ? 16 LEU A HA   10 
ATOM 10562 H HB2  . LEU A 1 16 ? -0.635 0.294   16.950 1.00 0.00 ? 16 LEU A HB2  10 
ATOM 10563 H HB3  . LEU A 1 16 ? -0.777 1.503   18.225 1.00 0.00 ? 16 LEU A HB3  10 
ATOM 10564 H HG   . LEU A 1 16 ? 1.555  0.843   17.772 1.00 0.00 ? 16 LEU A HG   10 
ATOM 10565 H HD11 . LEU A 1 16 ? 1.485  -0.231  20.407 1.00 0.00 ? 16 LEU A HD11 10 
ATOM 10566 H HD12 . LEU A 1 16 ? 0.245  1.015   20.269 1.00 0.00 ? 16 LEU A HD12 10 
ATOM 10567 H HD13 . LEU A 1 16 ? 1.923  1.396   19.884 1.00 0.00 ? 16 LEU A HD13 10 
ATOM 10568 H HD21 . LEU A 1 16 ? 1.022  -1.806  19.042 1.00 0.00 ? 16 LEU A HD21 10 
ATOM 10569 H HD22 . LEU A 1 16 ? 2.365  -1.299  18.017 1.00 0.00 ? 16 LEU A HD22 10 
ATOM 10570 H HD23 . LEU A 1 16 ? 0.779  -1.604  17.307 1.00 0.00 ? 16 LEU A HD23 10 
ATOM 10571 N N    . GLY A 1 17 ? -3.762 0.156   17.834 1.00 0.00 ? 17 GLY A N    10 
ATOM 10572 C CA   . GLY A 1 17 ? -5.054 0.816   17.836 1.00 0.00 ? 17 GLY A CA   10 
ATOM 10573 C C    . GLY A 1 17 ? -4.963 2.268   17.410 1.00 0.00 ? 17 GLY A C    10 
ATOM 10574 O O    . GLY A 1 17 ? -5.712 3.114   17.899 1.00 0.00 ? 17 GLY A O    10 
ATOM 10575 H H    . GLY A 1 17 ? -3.517 -0.436  17.092 1.00 0.00 ? 17 GLY A H    10 
ATOM 10576 H HA2  . GLY A 1 17 ? -5.714 0.294   17.159 1.00 0.00 ? 17 GLY A HA2  10 
ATOM 10577 H HA3  . GLY A 1 17 ? -5.468 0.771   18.832 1.00 0.00 ? 17 GLY A HA3  10 
ATOM 10578 N N    . VAL A 1 18 ? -4.042 2.559   16.497 1.00 0.00 ? 18 VAL A N    10 
ATOM 10579 C CA   . VAL A 1 18 ? -3.856 3.919   16.006 1.00 0.00 ? 18 VAL A CA   10 
ATOM 10580 C C    . VAL A 1 18 ? -4.387 4.068   14.585 1.00 0.00 ? 18 VAL A C    10 
ATOM 10581 O O    . VAL A 1 18 ? -4.919 3.120   14.007 1.00 0.00 ? 18 VAL A O    10 
ATOM 10582 C CB   . VAL A 1 18 ? -2.370 4.327   16.032 1.00 0.00 ? 18 VAL A CB   10 
ATOM 10583 C CG1  . VAL A 1 18 ? -1.799 4.172   17.433 1.00 0.00 ? 18 VAL A CG1  10 
ATOM 10584 C CG2  . VAL A 1 18 ? -1.575 3.505   15.029 1.00 0.00 ? 18 VAL A CG2  10 
ATOM 10585 H H    . VAL A 1 18 ? -3.475 1.842   16.145 1.00 0.00 ? 18 VAL A H    10 
ATOM 10586 H HA   . VAL A 1 18 ? -4.402 4.587   16.656 1.00 0.00 ? 18 VAL A HA   10 
ATOM 10587 H HB   . VAL A 1 18 ? -2.298 5.367   15.752 1.00 0.00 ? 18 VAL A HB   10 
ATOM 10588 H HG11 . VAL A 1 18 ? -2.072 3.204   17.828 1.00 0.00 ? 18 VAL A HG11 10 
ATOM 10589 H HG12 . VAL A 1 18 ? -0.723 4.256   17.395 1.00 0.00 ? 18 VAL A HG12 10 
ATOM 10590 H HG13 . VAL A 1 18 ? -2.198 4.945   18.072 1.00 0.00 ? 18 VAL A HG13 10 
ATOM 10591 H HG21 . VAL A 1 18 ? -2.044 2.541   14.902 1.00 0.00 ? 18 VAL A HG21 10 
ATOM 10592 H HG22 . VAL A 1 18 ? -1.550 4.021   14.080 1.00 0.00 ? 18 VAL A HG22 10 
ATOM 10593 H HG23 . VAL A 1 18 ? -0.567 3.371   15.392 1.00 0.00 ? 18 VAL A HG23 10 
ATOM 10594 N N    . ASP A 1 19 ? -4.238 5.264   14.026 1.00 0.00 ? 19 ASP A N    10 
ATOM 10595 C CA   . ASP A 1 19 ? -4.702 5.538   12.670 1.00 0.00 ? 19 ASP A CA   10 
ATOM 10596 C C    . ASP A 1 19 ? -3.669 5.087   11.642 1.00 0.00 ? 19 ASP A C    10 
ATOM 10597 O O    . ASP A 1 19 ? -2.465 5.171   11.879 1.00 0.00 ? 19 ASP A O    10 
ATOM 10598 C CB   . ASP A 1 19 ? -4.993 7.029   12.499 1.00 0.00 ? 19 ASP A CB   10 
ATOM 10599 C CG   . ASP A 1 19 ? -6.025 7.298   11.421 1.00 0.00 ? 19 ASP A CG   10 
ATOM 10600 O OD1  . ASP A 1 19 ? -6.664 6.330   10.957 1.00 0.00 ? 19 ASP A OD1  10 
ATOM 10601 O OD2  . ASP A 1 19 ? -6.193 8.476   11.042 1.00 0.00 ? 19 ASP A OD2  10 
ATOM 10602 H H    . ASP A 1 19 ? -3.806 5.980   14.537 1.00 0.00 ? 19 ASP A H    10 
ATOM 10603 H HA   . ASP A 1 19 ? -5.614 4.982   12.513 1.00 0.00 ? 19 ASP A HA   10 
ATOM 10604 H HB2  . ASP A 1 19 ? -5.365 7.427   13.433 1.00 0.00 ? 19 ASP A HB2  10 
ATOM 10605 H HB3  . ASP A 1 19 ? -4.079 7.540   12.234 1.00 0.00 ? 19 ASP A HB3  10 
ATOM 10606 N N    . ALA A 1 20 ? -4.150 4.608   10.499 1.00 0.00 ? 20 ALA A N    10 
ATOM 10607 C CA   . ALA A 1 20 ? -3.269 4.146   9.434  1.00 0.00 ? 20 ALA A CA   10 
ATOM 10608 C C    . ALA A 1 20 ? -2.611 5.320   8.717  1.00 0.00 ? 20 ALA A C    10 
ATOM 10609 O O    . ALA A 1 20 ? -1.478 5.216   8.246  1.00 0.00 ? 20 ALA A O    10 
ATOM 10610 C CB   . ALA A 1 20 ? -4.042 3.287   8.445  1.00 0.00 ? 20 ALA A CB   10 
ATOM 10611 H H    . ALA A 1 20 ? -5.120 4.567   10.369 1.00 0.00 ? 20 ALA A H    10 
ATOM 10612 H HA   . ALA A 1 20 ? -2.499 3.532   9.880  1.00 0.00 ? 20 ALA A HA   10 
ATOM 10613 H HB1  . ALA A 1 20 ? -3.546 2.334   8.332  1.00 0.00 ? 20 ALA A HB1  10 
ATOM 10614 H HB2  . ALA A 1 20 ? -5.045 3.130   8.812  1.00 0.00 ? 20 ALA A HB2  10 
ATOM 10615 H HB3  . ALA A 1 20 ? -4.083 3.787   7.489  1.00 0.00 ? 20 ALA A HB3  10 
ATOM 10616 N N    . ASP A 1 21 ? -3.328 6.435   8.637  1.00 0.00 ? 21 ASP A N    10 
ATOM 10617 C CA   . ASP A 1 21 ? -2.813 7.629   7.977  1.00 0.00 ? 21 ASP A CA   10 
ATOM 10618 C C    . ASP A 1 21 ? -1.469 8.040   8.569  1.00 0.00 ? 21 ASP A C    10 
ATOM 10619 O O    . ASP A 1 21 ? -0.646 8.663   7.897  1.00 0.00 ? 21 ASP A O    10 
ATOM 10620 C CB   . ASP A 1 21 ? -3.813 8.779   8.104  1.00 0.00 ? 21 ASP A CB   10 
ATOM 10621 C CG   . ASP A 1 21 ? -5.151 8.456   7.468  1.00 0.00 ? 21 ASP A CG   10 
ATOM 10622 O OD1  . ASP A 1 21 ? -5.250 7.410   6.793  1.00 0.00 ? 21 ASP A OD1  10 
ATOM 10623 O OD2  . ASP A 1 21 ? -6.099 9.249   7.646  1.00 0.00 ? 21 ASP A OD2  10 
ATOM 10624 H H    . ASP A 1 21 ? -4.225 6.456   9.032  1.00 0.00 ? 21 ASP A H    10 
ATOM 10625 H HA   . ASP A 1 21 ? -2.676 7.398   6.932  1.00 0.00 ? 21 ASP A HA   10 
ATOM 10626 H HB2  . ASP A 1 21 ? -3.976 8.993   9.151  1.00 0.00 ? 21 ASP A HB2  10 
ATOM 10627 H HB3  . ASP A 1 21 ? -3.407 9.656   7.621  1.00 0.00 ? 21 ASP A HB3  10 
ATOM 10628 N N    . LYS A 1 22 ? -1.252 7.689   9.832  1.00 0.00 ? 22 LYS A N    10 
ATOM 10629 C CA   . LYS A 1 22 ? -0.007 8.020   10.516 1.00 0.00 ? 22 LYS A CA   10 
ATOM 10630 C C    . LYS A 1 22 ? 1.053  6.953   10.264 1.00 0.00 ? 22 LYS A C    10 
ATOM 10631 O O    . LYS A 1 22 ? 2.252  7.231   10.311 1.00 0.00 ? 22 LYS A O    10 
ATOM 10632 C CB   . LYS A 1 22 ? -0.251 8.167   12.019 1.00 0.00 ? 22 LYS A CB   10 
ATOM 10633 C CG   . LYS A 1 22 ? -1.452 9.032   12.359 1.00 0.00 ? 22 LYS A CG   10 
ATOM 10634 C CD   . LYS A 1 22 ? -1.566 9.265   13.857 1.00 0.00 ? 22 LYS A CD   10 
ATOM 10635 C CE   . LYS A 1 22 ? -2.244 10.591  14.165 1.00 0.00 ? 22 LYS A CE   10 
ATOM 10636 N NZ   . LYS A 1 22 ? -2.535 10.741  15.617 1.00 0.00 ? 22 LYS A NZ   10 
ATOM 10637 H H    . LYS A 1 22 ? -1.945 7.193   10.316 1.00 0.00 ? 22 LYS A H    10 
ATOM 10638 H HA   . LYS A 1 22 ? 0.346  8.962   10.124 1.00 0.00 ? 22 LYS A HA   10 
ATOM 10639 H HB2  . LYS A 1 22 ? -0.408 7.186   12.444 1.00 0.00 ? 22 LYS A HB2  10 
ATOM 10640 H HB3  . LYS A 1 22 ? 0.624  8.609   12.472 1.00 0.00 ? 22 LYS A HB3  10 
ATOM 10641 H HG2  . LYS A 1 22 ? -1.349 9.986   11.865 1.00 0.00 ? 22 LYS A HG2  10 
ATOM 10642 H HG3  . LYS A 1 22 ? -2.349 8.539   12.011 1.00 0.00 ? 22 LYS A HG3  10 
ATOM 10643 H HD2  . LYS A 1 22 ? -2.148 8.467   14.293 1.00 0.00 ? 22 LYS A HD2  10 
ATOM 10644 H HD3  . LYS A 1 22 ? -0.575 9.268   14.288 1.00 0.00 ? 22 LYS A HD3  10 
ATOM 10645 H HE2  . LYS A 1 22 ? -1.593 11.394  13.852 1.00 0.00 ? 22 LYS A HE2  10 
ATOM 10646 H HE3  . LYS A 1 22 ? -3.171 10.643  13.613 1.00 0.00 ? 22 LYS A HE3  10 
ATOM 10647 H HZ1  . LYS A 1 22 ? -2.768 9.816   16.032 1.00 0.00 ? 22 LYS A HZ1  10 
ATOM 10648 H HZ2  . LYS A 1 22 ? -3.341 11.383  15.756 1.00 0.00 ? 22 LYS A HZ2  10 
ATOM 10649 H HZ3  . LYS A 1 22 ? -1.706 11.131  16.110 1.00 0.00 ? 22 LYS A HZ3  10 
ATOM 10650 N N    . VAL A 1 23 ? 0.605  5.731   9.994  1.00 0.00 ? 23 VAL A N    10 
ATOM 10651 C CA   . VAL A 1 23 ? 1.515  4.623   9.732  1.00 0.00 ? 23 VAL A CA   10 
ATOM 10652 C C    . VAL A 1 23 ? 2.318  4.861   8.458  1.00 0.00 ? 23 VAL A C    10 
ATOM 10653 O O    . VAL A 1 23 ? 1.883  4.510   7.361  1.00 0.00 ? 23 VAL A O    10 
ATOM 10654 C CB   . VAL A 1 23 ? 0.754  3.290   9.604  1.00 0.00 ? 23 VAL A CB   10 
ATOM 10655 C CG1  . VAL A 1 23 ? 1.727  2.136   9.411  1.00 0.00 ? 23 VAL A CG1  10 
ATOM 10656 C CG2  . VAL A 1 23 ? -0.124 3.059   10.825 1.00 0.00 ? 23 VAL A CG2  10 
ATOM 10657 H H    . VAL A 1 23 ? -0.362 5.572   9.971  1.00 0.00 ? 23 VAL A H    10 
ATOM 10658 H HA   . VAL A 1 23 ? 2.196  4.546   10.567 1.00 0.00 ? 23 VAL A HA   10 
ATOM 10659 H HB   . VAL A 1 23 ? 0.117  3.344   8.734  1.00 0.00 ? 23 VAL A HB   10 
ATOM 10660 H HG11 . VAL A 1 23 ? 2.553  2.244   10.098 1.00 0.00 ? 23 VAL A HG11 10 
ATOM 10661 H HG12 . VAL A 1 23 ? 1.219  1.202   9.599  1.00 0.00 ? 23 VAL A HG12 10 
ATOM 10662 H HG13 . VAL A 1 23 ? 2.100  2.147   8.397  1.00 0.00 ? 23 VAL A HG13 10 
ATOM 10663 H HG21 . VAL A 1 23 ? 0.500  2.868   11.685 1.00 0.00 ? 23 VAL A HG21 10 
ATOM 10664 H HG22 . VAL A 1 23 ? -0.728 3.936   11.006 1.00 0.00 ? 23 VAL A HG22 10 
ATOM 10665 H HG23 . VAL A 1 23 ? -0.767 2.209   10.651 1.00 0.00 ? 23 VAL A HG23 10 
ATOM 10666 N N    . THR A 1 24 ? 3.495  5.461   8.610  1.00 0.00 ? 24 THR A N    10 
ATOM 10667 C CA   . THR A 1 24 ? 4.359  5.747   7.473  1.00 0.00 ? 24 THR A CA   10 
ATOM 10668 C C    . THR A 1 24 ? 5.741  5.132   7.663  1.00 0.00 ? 24 THR A C    10 
ATOM 10669 O O    . THR A 1 24 ? 6.183  4.915   8.791  1.00 0.00 ? 24 THR A O    10 
ATOM 10670 C CB   . THR A 1 24 ? 4.512  7.264   7.250  1.00 0.00 ? 24 THR A CB   10 
ATOM 10671 O OG1  . THR A 1 24 ? 5.105  7.871   8.403  1.00 0.00 ? 24 THR A OG1  10 
ATOM 10672 C CG2  . THR A 1 24 ? 3.162  7.908   6.969  1.00 0.00 ? 24 THR A CG2  10 
ATOM 10673 H H    . THR A 1 24 ? 3.787  5.717   9.510  1.00 0.00 ? 24 THR A H    10 
ATOM 10674 H HA   . THR A 1 24 ? 3.904  5.319   6.591  1.00 0.00 ? 24 THR A HA   10 
ATOM 10675 H HB   . THR A 1 24 ? 5.155  7.424   6.397  1.00 0.00 ? 24 THR A HB   10 
ATOM 10676 H HG1  . THR A 1 24 ? 5.774  8.500   8.125  1.00 0.00 ? 24 THR A HG1  10 
ATOM 10677 H HG21 . THR A 1 24 ? 2.404  7.433   7.574  1.00 0.00 ? 24 THR A HG21 10 
ATOM 10678 H HG22 . THR A 1 24 ? 2.917  7.788   5.924  1.00 0.00 ? 24 THR A HG22 10 
ATOM 10679 H HG23 . THR A 1 24 ? 3.208  8.959   7.210  1.00 0.00 ? 24 THR A HG23 10 
ATOM 10680 N N    . GLU A 1 25 ? 6.419  4.854   6.554  1.00 0.00 ? 25 GLU A N    10 
ATOM 10681 C CA   . GLU A 1 25 ? 7.751  4.264   6.601  1.00 0.00 ? 25 GLU A CA   10 
ATOM 10682 C C    . GLU A 1 25 ? 8.670  5.066   7.518  1.00 0.00 ? 25 GLU A C    10 
ATOM 10683 O O    . GLU A 1 25 ? 9.588  4.519   8.127  1.00 0.00 ? 25 GLU A O    10 
ATOM 10684 C CB   . GLU A 1 25 ? 8.351  4.192   5.195  1.00 0.00 ? 25 GLU A CB   10 
ATOM 10685 C CG   . GLU A 1 25 ? 8.816  5.537   4.663  1.00 0.00 ? 25 GLU A CG   10 
ATOM 10686 C CD   . GLU A 1 25 ? 8.600  5.679   3.169  1.00 0.00 ? 25 GLU A CD   10 
ATOM 10687 O OE1  . GLU A 1 25 ? 9.334  5.025   2.399  1.00 0.00 ? 25 GLU A OE1  10 
ATOM 10688 O OE2  . GLU A 1 25 ? 7.698  6.445   2.769  1.00 0.00 ? 25 GLU A OE2  10 
ATOM 10689 H H    . GLU A 1 25 ? 6.013  5.051   5.684  1.00 0.00 ? 25 GLU A H    10 
ATOM 10690 H HA   . GLU A 1 25 ? 7.656  3.262   6.993  1.00 0.00 ? 25 GLU A HA   10 
ATOM 10691 H HB2  . GLU A 1 25 ? 9.198  3.522   5.212  1.00 0.00 ? 25 GLU A HB2  10 
ATOM 10692 H HB3  . GLU A 1 25 ? 7.607  3.799   4.519  1.00 0.00 ? 25 GLU A HB3  10 
ATOM 10693 H HG2  . GLU A 1 25 ? 8.267  6.319   5.166  1.00 0.00 ? 25 GLU A HG2  10 
ATOM 10694 H HG3  . GLU A 1 25 ? 9.870  5.648   4.872  1.00 0.00 ? 25 GLU A HG3  10 
ATOM 10695 N N    . GLY A 1 26 ? 8.414  6.367   7.611  1.00 0.00 ? 26 GLY A N    10 
ATOM 10696 C CA   . GLY A 1 26 ? 9.227  7.225   8.454  1.00 0.00 ? 26 GLY A CA   10 
ATOM 10697 C C    . GLY A 1 26 ? 8.634  7.407   9.837  1.00 0.00 ? 26 GLY A C    10 
ATOM 10698 O O    . GLY A 1 26 ? 8.802  8.456   10.459 1.00 0.00 ? 26 GLY A O    10 
ATOM 10699 H H    . GLY A 1 26 ? 7.668  6.749   7.102  1.00 0.00 ? 26 GLY A H    10 
ATOM 10700 H HA2  . GLY A 1 26 ? 10.210 6.790   8.550  1.00 0.00 ? 26 GLY A HA2  10 
ATOM 10701 H HA3  . GLY A 1 26 ? 9.316  8.193   7.983  1.00 0.00 ? 26 GLY A HA3  10 
ATOM 10702 N N    . ALA A 1 27 ? 7.936  6.384   10.320 1.00 0.00 ? 27 ALA A N    10 
ATOM 10703 C CA   . ALA A 1 27 ? 7.317  6.436   11.638 1.00 0.00 ? 27 ALA A CA   10 
ATOM 10704 C C    . ALA A 1 27 ? 8.023  5.501   12.614 1.00 0.00 ? 27 ALA A C    10 
ATOM 10705 O O    . ALA A 1 27 ? 7.969  4.280   12.467 1.00 0.00 ? 27 ALA A O    10 
ATOM 10706 C CB   . ALA A 1 27 ? 5.840  6.083   11.541 1.00 0.00 ? 27 ALA A CB   10 
ATOM 10707 H H    . ALA A 1 27 ? 7.837  5.574   9.777  1.00 0.00 ? 27 ALA A H    10 
ATOM 10708 H HA   . ALA A 1 27 ? 7.396  7.449   12.005 1.00 0.00 ? 27 ALA A HA   10 
ATOM 10709 H HB1  . ALA A 1 27 ? 5.496  6.251   10.531 1.00 0.00 ? 27 ALA A HB1  10 
ATOM 10710 H HB2  . ALA A 1 27 ? 5.700  5.045   11.802 1.00 0.00 ? 27 ALA A HB2  10 
ATOM 10711 H HB3  . ALA A 1 27 ? 5.276  6.705   12.221 1.00 0.00 ? 27 ALA A HB3  10 
ATOM 10712 N N    . SER A 1 28 ? 8.684  6.082   13.610 1.00 0.00 ? 28 SER A N    10 
ATOM 10713 C CA   . SER A 1 28 ? 9.405  5.300   14.608 1.00 0.00 ? 28 SER A CA   10 
ATOM 10714 C C    . SER A 1 28 ? 8.486  4.912   15.761 1.00 0.00 ? 28 SER A C    10 
ATOM 10715 O O    . SER A 1 28 ? 7.976  5.771   16.480 1.00 0.00 ? 28 SER A O    10 
ATOM 10716 C CB   . SER A 1 28 ? 10.603 6.091   15.138 1.00 0.00 ? 28 SER A CB   10 
ATOM 10717 O OG   . SER A 1 28 ? 11.512 6.400   14.096 1.00 0.00 ? 28 SER A OG   10 
ATOM 10718 H H    . SER A 1 28 ? 8.690  7.060   13.673 1.00 0.00 ? 28 SER A H    10 
ATOM 10719 H HA   . SER A 1 28 ? 9.762  4.400   14.129 1.00 0.00 ? 28 SER A HA   10 
ATOM 10720 H HB2  . SER A 1 28 ? 10.255 7.011   15.581 1.00 0.00 ? 28 SER A HB2  10 
ATOM 10721 H HB3  . SER A 1 28 ? 11.116 5.503   15.885 1.00 0.00 ? 28 SER A HB3  10 
ATOM 10722 H HG   . SER A 1 28 ? 11.826 7.301   14.202 1.00 0.00 ? 28 SER A HG   10 
ATOM 10723 N N    . PHE A 1 29 ? 8.279  3.610   15.933 1.00 0.00 ? 29 PHE A N    10 
ATOM 10724 C CA   . PHE A 1 29 ? 7.420  3.106   16.998 1.00 0.00 ? 29 PHE A CA   10 
ATOM 10725 C C    . PHE A 1 29 ? 7.979  3.478   18.369 1.00 0.00 ? 29 PHE A C    10 
ATOM 10726 O O    . PHE A 1 29 ? 7.291  3.364   19.383 1.00 0.00 ? 29 PHE A O    10 
ATOM 10727 C CB   . PHE A 1 29 ? 7.275  1.587   16.889 1.00 0.00 ? 29 PHE A CB   10 
ATOM 10728 C CG   . PHE A 1 29 ? 6.987  1.111   15.494 1.00 0.00 ? 29 PHE A CG   10 
ATOM 10729 C CD1  . PHE A 1 29 ? 5.699  1.159   14.984 1.00 0.00 ? 29 PHE A CD1  10 
ATOM 10730 C CD2  . PHE A 1 29 ? 8.003  0.616   14.693 1.00 0.00 ? 29 PHE A CD2  10 
ATOM 10731 C CE1  . PHE A 1 29 ? 5.432  0.721   13.700 1.00 0.00 ? 29 PHE A CE1  10 
ATOM 10732 C CE2  . PHE A 1 29 ? 7.742  0.177   13.409 1.00 0.00 ? 29 PHE A CE2  10 
ATOM 10733 C CZ   . PHE A 1 29 ? 6.454  0.230   12.912 1.00 0.00 ? 29 PHE A CZ   10 
ATOM 10734 H H    . PHE A 1 29 ? 8.714  2.974   15.327 1.00 0.00 ? 29 PHE A H    10 
ATOM 10735 H HA   . PHE A 1 29 ? 6.449  3.562   16.883 1.00 0.00 ? 29 PHE A HA   10 
ATOM 10736 H HB2  . PHE A 1 29 ? 8.192  1.120   17.216 1.00 0.00 ? 29 PHE A HB2  10 
ATOM 10737 H HB3  . PHE A 1 29 ? 6.465  1.264   17.525 1.00 0.00 ? 29 PHE A HB3  10 
ATOM 10738 H HD1  . PHE A 1 29 ? 4.899  1.543   15.599 1.00 0.00 ? 29 PHE A HD1  10 
ATOM 10739 H HD2  . PHE A 1 29 ? 9.011  0.575   15.081 1.00 0.00 ? 29 PHE A HD2  10 
ATOM 10740 H HE1  . PHE A 1 29 ? 4.424  0.764   13.314 1.00 0.00 ? 29 PHE A HE1  10 
ATOM 10741 H HE2  . PHE A 1 29 ? 8.543  -0.205  12.795 1.00 0.00 ? 29 PHE A HE2  10 
ATOM 10742 H HZ   . PHE A 1 29 ? 6.247  -0.113  11.909 1.00 0.00 ? 29 PHE A HZ   10 
ATOM 10743 N N    . ILE A 1 30 ? 9.232  3.922   18.390 1.00 0.00 ? 30 ILE A N    10 
ATOM 10744 C CA   . ILE A 1 30 ? 9.883  4.311   19.634 1.00 0.00 ? 30 ILE A CA   10 
ATOM 10745 C C    . ILE A 1 30 ? 9.547  5.751   20.004 1.00 0.00 ? 30 ILE A C    10 
ATOM 10746 O O    . ILE A 1 30 ? 9.082  6.027   21.110 1.00 0.00 ? 30 ILE A O    10 
ATOM 10747 C CB   . ILE A 1 30 ? 11.413 4.160   19.540 1.00 0.00 ? 30 ILE A CB   10 
ATOM 10748 C CG1  . ILE A 1 30 ? 11.787 2.705   19.254 1.00 0.00 ? 30 ILE A CG1  10 
ATOM 10749 C CG2  . ILE A 1 30 ? 12.072 4.641   20.824 1.00 0.00 ? 30 ILE A CG2  10 
ATOM 10750 C CD1  . ILE A 1 30 ? 11.268 1.733   20.290 1.00 0.00 ? 30 ILE A CD1  10 
ATOM 10751 H H    . ILE A 1 30 ? 9.729  3.990   17.548 1.00 0.00 ? 30 ILE A H    10 
ATOM 10752 H HA   . ILE A 1 30 ? 9.525  3.657   20.416 1.00 0.00 ? 30 ILE A HA   10 
ATOM 10753 H HB   . ILE A 1 30 ? 11.764 4.781   18.729 1.00 0.00 ? 30 ILE A HB   10 
ATOM 10754 H HG12 . ILE A 1 30 ? 11.383 2.416   18.297 1.00 0.00 ? 30 ILE A HG12 10 
ATOM 10755 H HG13 . ILE A 1 30 ? 12.864 2.617   19.227 1.00 0.00 ? 30 ILE A HG13 10 
ATOM 10756 H HG21 . ILE A 1 30 ? 12.700 3.857   21.221 1.00 0.00 ? 30 ILE A HG21 10 
ATOM 10757 H HG22 . ILE A 1 30 ? 12.675 5.512   20.614 1.00 0.00 ? 30 ILE A HG22 10 
ATOM 10758 H HG23 . ILE A 1 30 ? 11.312 4.894   21.547 1.00 0.00 ? 30 ILE A HG23 10 
ATOM 10759 H HD11 . ILE A 1 30 ? 12.085 1.136   20.667 1.00 0.00 ? 30 ILE A HD11 10 
ATOM 10760 H HD12 . ILE A 1 30 ? 10.816 2.280   21.103 1.00 0.00 ? 30 ILE A HD12 10 
ATOM 10761 H HD13 . ILE A 1 30 ? 10.529 1.086   19.838 1.00 0.00 ? 30 ILE A HD13 10 
ATOM 10762 N N    . ASP A 1 31 ? 9.783  6.666   19.070 1.00 0.00 ? 31 ASP A N    10 
ATOM 10763 C CA   . ASP A 1 31 ? 9.503  8.079   19.296 1.00 0.00 ? 31 ASP A CA   10 
ATOM 10764 C C    . ASP A 1 31 ? 8.125  8.453   18.759 1.00 0.00 ? 31 ASP A C    10 
ATOM 10765 O O    . ASP A 1 31 ? 7.252  8.888   19.510 1.00 0.00 ? 31 ASP A O    10 
ATOM 10766 C CB   . ASP A 1 31 ? 10.574 8.946   18.634 1.00 0.00 ? 31 ASP A CB   10 
ATOM 10767 C CG   . ASP A 1 31 ? 10.156 10.399  18.521 1.00 0.00 ? 31 ASP A CG   10 
ATOM 10768 O OD1  . ASP A 1 31 ? 10.114 11.088  19.562 1.00 0.00 ? 31 ASP A OD1  10 
ATOM 10769 O OD2  . ASP A 1 31 ? 9.871  10.848  17.391 1.00 0.00 ? 31 ASP A OD2  10 
ATOM 10770 H H    . ASP A 1 31 ? 10.155 6.385   18.208 1.00 0.00 ? 31 ASP A H    10 
ATOM 10771 H HA   . ASP A 1 31 ? 9.519  8.255   20.362 1.00 0.00 ? 31 ASP A HA   10 
ATOM 10772 H HB2  . ASP A 1 31 ? 11.481 8.897   19.219 1.00 0.00 ? 31 ASP A HB2  10 
ATOM 10773 H HB3  . ASP A 1 31 ? 10.771 8.568   17.641 1.00 0.00 ? 31 ASP A HB3  10 
ATOM 10774 N N    . ASP A 1 32 ? 7.937  8.280   17.455 1.00 0.00 ? 32 ASP A N    10 
ATOM 10775 C CA   . ASP A 1 32 ? 6.666  8.599   16.817 1.00 0.00 ? 32 ASP A CA   10 
ATOM 10776 C C    . ASP A 1 32 ? 5.495  8.116   17.667 1.00 0.00 ? 32 ASP A C    10 
ATOM 10777 O O    . ASP A 1 32 ? 4.493  8.817   17.819 1.00 0.00 ? 32 ASP A O    10 
ATOM 10778 C CB   . ASP A 1 32 ? 6.597  7.968   15.425 1.00 0.00 ? 32 ASP A CB   10 
ATOM 10779 C CG   . ASP A 1 32 ? 5.656  8.712   14.498 1.00 0.00 ? 32 ASP A CG   10 
ATOM 10780 O OD1  . ASP A 1 32 ? 4.426  8.570   14.662 1.00 0.00 ? 32 ASP A OD1  10 
ATOM 10781 O OD2  . ASP A 1 32 ? 6.150  9.436   13.609 1.00 0.00 ? 32 ASP A OD2  10 
ATOM 10782 H H    . ASP A 1 32 ? 8.672  7.929   16.909 1.00 0.00 ? 32 ASP A H    10 
ATOM 10783 H HA   . ASP A 1 32 ? 6.604  9.672   16.718 1.00 0.00 ? 32 ASP A HA   10 
ATOM 10784 H HB2  . ASP A 1 32 ? 7.584  7.972   14.986 1.00 0.00 ? 32 ASP A HB2  10 
ATOM 10785 H HB3  . ASP A 1 32 ? 6.253  6.948   15.516 1.00 0.00 ? 32 ASP A HB3  10 
ATOM 10786 N N    . LEU A 1 33 ? 5.626  6.914   18.217 1.00 0.00 ? 33 LEU A N    10 
ATOM 10787 C CA   . LEU A 1 33 ? 4.579  6.336   19.051 1.00 0.00 ? 33 LEU A CA   10 
ATOM 10788 C C    . LEU A 1 33 ? 4.916  6.485   20.531 1.00 0.00 ? 33 LEU A C    10 
ATOM 10789 O O    . LEU A 1 33 ? 4.049  6.349   21.393 1.00 0.00 ? 33 LEU A O    10 
ATOM 10790 C CB   . LEU A 1 33 ? 4.383  4.858   18.707 1.00 0.00 ? 33 LEU A CB   10 
ATOM 10791 C CG   . LEU A 1 33 ? 3.994  4.551   17.261 1.00 0.00 ? 33 LEU A CG   10 
ATOM 10792 C CD1  . LEU A 1 33 ? 3.521  3.112   17.129 1.00 0.00 ? 33 LEU A CD1  10 
ATOM 10793 C CD2  . LEU A 1 33 ? 2.918  5.514   16.782 1.00 0.00 ? 33 LEU A CD2  10 
ATOM 10794 H H    . LEU A 1 33 ? 6.447  6.403   18.059 1.00 0.00 ? 33 LEU A H    10 
ATOM 10795 H HA   . LEU A 1 33 ? 3.662  6.868   18.848 1.00 0.00 ? 33 LEU A HA   10 
ATOM 10796 H HB2  . LEU A 1 33 ? 5.309  4.345   18.917 1.00 0.00 ? 33 LEU A HB2  10 
ATOM 10797 H HB3  . LEU A 1 33 ? 3.605  4.470   19.350 1.00 0.00 ? 33 LEU A HB3  10 
ATOM 10798 H HG   . LEU A 1 33 ? 4.861  4.676   16.627 1.00 0.00 ? 33 LEU A HG   10 
ATOM 10799 H HD11 . LEU A 1 33 ? 2.582  2.993   17.648 1.00 0.00 ? 33 LEU A HD11 10 
ATOM 10800 H HD12 . LEU A 1 33 ? 4.257  2.450   17.561 1.00 0.00 ? 33 LEU A HD12 10 
ATOM 10801 H HD13 . LEU A 1 33 ? 3.389  2.871   16.084 1.00 0.00 ? 33 LEU A HD13 10 
ATOM 10802 H HD21 . LEU A 1 33 ? 2.390  5.916   17.635 1.00 0.00 ? 33 LEU A HD21 10 
ATOM 10803 H HD22 . LEU A 1 33 ? 2.223  4.989   16.144 1.00 0.00 ? 33 LEU A HD22 10 
ATOM 10804 H HD23 . LEU A 1 33 ? 3.376  6.321   16.230 1.00 0.00 ? 33 LEU A HD23 10 
ATOM 10805 N N    . GLY A 1 34 ? 6.184  6.768   20.818 1.00 0.00 ? 34 GLY A N    10 
ATOM 10806 C CA   . GLY A 1 34 ? 6.613  6.933   22.194 1.00 0.00 ? 34 GLY A CA   10 
ATOM 10807 C C    . GLY A 1 34 ? 6.666  5.619   22.947 1.00 0.00 ? 34 GLY A C    10 
ATOM 10808 O O    . GLY A 1 34 ? 6.354  5.564   24.136 1.00 0.00 ? 34 GLY A O    10 
ATOM 10809 H H    . GLY A 1 34 ? 6.832  6.865   20.090 1.00 0.00 ? 34 GLY A H    10 
ATOM 10810 H HA2  . GLY A 1 34 ? 7.596  7.380   22.202 1.00 0.00 ? 34 GLY A HA2  10 
ATOM 10811 H HA3  . GLY A 1 34 ? 5.924  7.595   22.698 1.00 0.00 ? 34 GLY A HA3  10 
ATOM 10812 N N    . ALA A 1 35 ? 7.061  4.556   22.253 1.00 0.00 ? 35 ALA A N    10 
ATOM 10813 C CA   . ALA A 1 35 ? 7.154  3.236   22.863 1.00 0.00 ? 35 ALA A CA   10 
ATOM 10814 C C    . ALA A 1 35 ? 8.596  2.900   23.228 1.00 0.00 ? 35 ALA A C    10 
ATOM 10815 O O    . ALA A 1 35 ? 9.521  3.638   22.887 1.00 0.00 ? 35 ALA A O    10 
ATOM 10816 C CB   . ALA A 1 35 ? 6.585  2.180   21.927 1.00 0.00 ? 35 ALA A CB   10 
ATOM 10817 H H    . ALA A 1 35 ? 7.297  4.664   21.308 1.00 0.00 ? 35 ALA A H    10 
ATOM 10818 H HA   . ALA A 1 35 ? 6.557  3.242   23.764 1.00 0.00 ? 35 ALA A HA   10 
ATOM 10819 H HB1  . ALA A 1 35 ? 7.383  1.757   21.335 1.00 0.00 ? 35 ALA A HB1  10 
ATOM 10820 H HB2  . ALA A 1 35 ? 6.114  1.401   22.507 1.00 0.00 ? 35 ALA A HB2  10 
ATOM 10821 H HB3  . ALA A 1 35 ? 5.854  2.635   21.274 1.00 0.00 ? 35 ALA A HB3  10 
ATOM 10822 N N    . ASP A 1 36 ? 8.780  1.783   23.923 1.00 0.00 ? 36 ASP A N    10 
ATOM 10823 C CA   . ASP A 1 36 ? 10.111 1.349   24.334 1.00 0.00 ? 36 ASP A CA   10 
ATOM 10824 C C    . ASP A 1 36 ? 10.558 0.133   23.529 1.00 0.00 ? 36 ASP A C    10 
ATOM 10825 O O    . ASP A 1 36 ? 9.807  -0.390  22.706 1.00 0.00 ? 36 ASP A O    10 
ATOM 10826 C CB   . ASP A 1 36 ? 10.125 1.021   25.828 1.00 0.00 ? 36 ASP A CB   10 
ATOM 10827 C CG   . ASP A 1 36 ? 9.247  1.958   26.634 1.00 0.00 ? 36 ASP A CG   10 
ATOM 10828 O OD1  . ASP A 1 36 ? 9.645  3.127   26.825 1.00 0.00 ? 36 ASP A OD1  10 
ATOM 10829 O OD2  . ASP A 1 36 ? 8.163  1.523   27.075 1.00 0.00 ? 36 ASP A OD2  10 
ATOM 10830 H H    . ASP A 1 36 ? 8.003  1.237   24.165 1.00 0.00 ? 36 ASP A H    10 
ATOM 10831 H HA   . ASP A 1 36 ? 10.797 2.161   24.147 1.00 0.00 ? 36 ASP A HA   10 
ATOM 10832 H HB2  . ASP A 1 36 ? 9.768  0.012   25.971 1.00 0.00 ? 36 ASP A HB2  10 
ATOM 10833 H HB3  . ASP A 1 36 ? 11.137 1.097   26.197 1.00 0.00 ? 36 ASP A HB3  10 
ATOM 10834 N N    . SER A 1 37 ? 11.787 -0.311  23.772 1.00 0.00 ? 37 SER A N    10 
ATOM 10835 C CA   . SER A 1 37 ? 12.337 -1.463  23.066 1.00 0.00 ? 37 SER A CA   10 
ATOM 10836 C C    . SER A 1 37 ? 11.389 -2.656  23.152 1.00 0.00 ? 37 SER A C    10 
ATOM 10837 O O    . SER A 1 37 ? 11.305 -3.464  22.226 1.00 0.00 ? 37 SER A O    10 
ATOM 10838 C CB   . SER A 1 37 ? 13.702 -1.839  23.646 1.00 0.00 ? 37 SER A CB   10 
ATOM 10839 O OG   . SER A 1 37 ? 14.705 -0.936  23.216 1.00 0.00 ? 37 SER A OG   10 
ATOM 10840 H H    . SER A 1 37 ? 12.338 0.148   24.440 1.00 0.00 ? 37 SER A H    10 
ATOM 10841 H HA   . SER A 1 37 ? 12.459 -1.189  22.029 1.00 0.00 ? 37 SER A HA   10 
ATOM 10842 H HB2  . SER A 1 37 ? 13.651 -1.815  24.724 1.00 0.00 ? 37 SER A HB2  10 
ATOM 10843 H HB3  . SER A 1 37 ? 13.966 -2.835  23.320 1.00 0.00 ? 37 SER A HB3  10 
ATOM 10844 H HG   . SER A 1 37 ? 14.964 -1.150  22.317 1.00 0.00 ? 37 SER A HG   10 
ATOM 10845 N N    . LEU A 1 38 ? 10.677 -2.759  24.269 1.00 0.00 ? 38 LEU A N    10 
ATOM 10846 C CA   . LEU A 1 38 ? 9.735  -3.852  24.477 1.00 0.00 ? 38 LEU A CA   10 
ATOM 10847 C C    . LEU A 1 38 ? 8.769  -3.970  23.302 1.00 0.00 ? 38 LEU A C    10 
ATOM 10848 O O    . LEU A 1 38 ? 8.654  -5.029  22.684 1.00 0.00 ? 38 LEU A O    10 
ATOM 10849 C CB   . LEU A 1 38 ? 8.953  -3.637  25.774 1.00 0.00 ? 38 LEU A CB   10 
ATOM 10850 C CG   . LEU A 1 38 ? 7.901  -4.696  26.107 1.00 0.00 ? 38 LEU A CG   10 
ATOM 10851 C CD1  . LEU A 1 38 ? 8.554  -5.916  26.738 1.00 0.00 ? 38 LEU A CD1  10 
ATOM 10852 C CD2  . LEU A 1 38 ? 6.838  -4.120  27.030 1.00 0.00 ? 38 LEU A CD2  10 
ATOM 10853 H H    . LEU A 1 38 ? 10.788 -2.084  24.970 1.00 0.00 ? 38 LEU A H    10 
ATOM 10854 H HA   . LEU A 1 38 ? 10.301 -4.768  24.555 1.00 0.00 ? 38 LEU A HA   10 
ATOM 10855 H HB2  . LEU A 1 38 ? 9.662  -3.609  26.587 1.00 0.00 ? 38 LEU A HB2  10 
ATOM 10856 H HB3  . LEU A 1 38 ? 8.451  -2.683  25.703 1.00 0.00 ? 38 LEU A HB3  10 
ATOM 10857 H HG   . LEU A 1 38 ? 7.417  -5.013  25.194 1.00 0.00 ? 38 LEU A HG   10 
ATOM 10858 H HD11 . LEU A 1 38 ? 8.634  -6.703  26.003 1.00 0.00 ? 38 LEU A HD11 10 
ATOM 10859 H HD12 . LEU A 1 38 ? 7.951  -6.259  27.567 1.00 0.00 ? 38 LEU A HD12 10 
ATOM 10860 H HD13 . LEU A 1 38 ? 9.539  -5.654  27.095 1.00 0.00 ? 38 LEU A HD13 10 
ATOM 10861 H HD21 . LEU A 1 38 ? 7.293  -3.827  27.965 1.00 0.00 ? 38 LEU A HD21 10 
ATOM 10862 H HD22 . LEU A 1 38 ? 6.081  -4.868  27.218 1.00 0.00 ? 38 LEU A HD22 10 
ATOM 10863 H HD23 . LEU A 1 38 ? 6.385  -3.258  26.564 1.00 0.00 ? 38 LEU A HD23 10 
ATOM 10864 N N    . ASP A 1 39 ? 8.080  -2.876  22.997 1.00 0.00 ? 39 ASP A N    10 
ATOM 10865 C CA   . ASP A 1 39 ? 7.127  -2.856  21.894 1.00 0.00 ? 39 ASP A CA   10 
ATOM 10866 C C    . ASP A 1 39 ? 7.811  -3.214  20.578 1.00 0.00 ? 39 ASP A C    10 
ATOM 10867 O O    . ASP A 1 39 ? 7.227  -3.881  19.723 1.00 0.00 ? 39 ASP A O    10 
ATOM 10868 C CB   . ASP A 1 39 ? 6.471  -1.478  21.783 1.00 0.00 ? 39 ASP A CB   10 
ATOM 10869 C CG   . ASP A 1 39 ? 5.332  -1.457  20.784 1.00 0.00 ? 39 ASP A CG   10 
ATOM 10870 O OD1  . ASP A 1 39 ? 4.593  -2.461  20.706 1.00 0.00 ? 39 ASP A OD1  10 
ATOM 10871 O OD2  . ASP A 1 39 ? 5.179  -0.438  20.078 1.00 0.00 ? 39 ASP A OD2  10 
ATOM 10872 H H    . ASP A 1 39 ? 8.216  -2.063  23.527 1.00 0.00 ? 39 ASP A H    10 
ATOM 10873 H HA   . ASP A 1 39 ? 6.364  -3.591  22.100 1.00 0.00 ? 39 ASP A HA   10 
ATOM 10874 H HB2  . ASP A 1 39 ? 6.082  -1.193  22.750 1.00 0.00 ? 39 ASP A HB2  10 
ATOM 10875 H HB3  . ASP A 1 39 ? 7.213  -0.758  21.472 1.00 0.00 ? 39 ASP A HB3  10 
ATOM 10876 N N    . THR A 1 40 ? 9.053  -2.765  20.421 1.00 0.00 ? 40 THR A N    10 
ATOM 10877 C CA   . THR A 1 40 ? 9.816  -3.036  19.209 1.00 0.00 ? 40 THR A CA   10 
ATOM 10878 C C    . THR A 1 40 ? 9.971  -4.535  18.981 1.00 0.00 ? 40 THR A C    10 
ATOM 10879 O O    . THR A 1 40 ? 9.527  -5.068  17.964 1.00 0.00 ? 40 THR A O    10 
ATOM 10880 C CB   . THR A 1 40 ? 11.213 -2.390  19.269 1.00 0.00 ? 40 THR A CB   10 
ATOM 10881 O OG1  . THR A 1 40 ? 11.150 -1.153  19.988 1.00 0.00 ? 40 THR A OG1  10 
ATOM 10882 C CG2  . THR A 1 40 ? 11.755 -2.142  17.869 1.00 0.00 ? 40 THR A CG2  10 
ATOM 10883 H H    . THR A 1 40 ? 9.464  -2.239  21.138 1.00 0.00 ? 40 THR A H    10 
ATOM 10884 H HA   . THR A 1 40 ? 9.279  -2.608  18.375 1.00 0.00 ? 40 THR A HA   10 
ATOM 10885 H HB   . THR A 1 40 ? 11.883 -3.064  19.784 1.00 0.00 ? 40 THR A HB   10 
ATOM 10886 H HG1  . THR A 1 40 ? 12.032 -0.778  20.057 1.00 0.00 ? 40 THR A HG1  10 
ATOM 10887 H HG21 . THR A 1 40 ? 12.781 -1.813  17.934 1.00 0.00 ? 40 THR A HG21 10 
ATOM 10888 H HG22 . THR A 1 40 ? 11.162 -1.381  17.384 1.00 0.00 ? 40 THR A HG22 10 
ATOM 10889 H HG23 . THR A 1 40 ? 11.705 -3.056  17.297 1.00 0.00 ? 40 THR A HG23 10 
ATOM 10890 N N    . VAL A 1 41 ? 10.604 -5.212  19.934 1.00 0.00 ? 41 VAL A N    10 
ATOM 10891 C CA   . VAL A 1 41 ? 10.816 -6.651  19.838 1.00 0.00 ? 41 VAL A CA   10 
ATOM 10892 C C    . VAL A 1 41 ? 9.489  -7.400  19.783 1.00 0.00 ? 41 VAL A C    10 
ATOM 10893 O O    . VAL A 1 41 ? 9.382  -8.446  19.145 1.00 0.00 ? 41 VAL A O    10 
ATOM 10894 C CB   . VAL A 1 41 ? 11.642 -7.178  21.026 1.00 0.00 ? 41 VAL A CB   10 
ATOM 10895 C CG1  . VAL A 1 41 ? 11.847 -8.681  20.910 1.00 0.00 ? 41 VAL A CG1  10 
ATOM 10896 C CG2  . VAL A 1 41 ? 12.977 -6.454  21.109 1.00 0.00 ? 41 VAL A CG2  10 
ATOM 10897 H H    . VAL A 1 41 ? 10.935 -4.732  20.722 1.00 0.00 ? 41 VAL A H    10 
ATOM 10898 H HA   . VAL A 1 41 ? 11.367 -6.847  18.929 1.00 0.00 ? 41 VAL A HA   10 
ATOM 10899 H HB   . VAL A 1 41 ? 11.093 -6.981  21.935 1.00 0.00 ? 41 VAL A HB   10 
ATOM 10900 H HG11 . VAL A 1 41 ? 12.119 -8.929  19.895 1.00 0.00 ? 41 VAL A HG11 10 
ATOM 10901 H HG12 . VAL A 1 41 ? 12.635 -8.990  21.582 1.00 0.00 ? 41 VAL A HG12 10 
ATOM 10902 H HG13 . VAL A 1 41 ? 10.931 -9.190  21.171 1.00 0.00 ? 41 VAL A HG13 10 
ATOM 10903 H HG21 . VAL A 1 41 ? 12.807 -5.410  21.327 1.00 0.00 ? 41 VAL A HG21 10 
ATOM 10904 H HG22 . VAL A 1 41 ? 13.577 -6.892  21.894 1.00 0.00 ? 41 VAL A HG22 10 
ATOM 10905 H HG23 . VAL A 1 41 ? 13.496 -6.546  20.167 1.00 0.00 ? 41 VAL A HG23 10 
ATOM 10906 N N    . GLU A 1 42 ? 8.481  -6.856  20.457 1.00 0.00 ? 42 GLU A N    10 
ATOM 10907 C CA   . GLU A 1 42 ? 7.160  -7.474  20.485 1.00 0.00 ? 42 GLU A CA   10 
ATOM 10908 C C    . GLU A 1 42 ? 6.516  -7.443  19.102 1.00 0.00 ? 42 GLU A C    10 
ATOM 10909 O O    . GLU A 1 42 ? 6.121  -8.479  18.565 1.00 0.00 ? 42 GLU A O    10 
ATOM 10910 C CB   . GLU A 1 42 ? 6.260  -6.759  21.496 1.00 0.00 ? 42 GLU A CB   10 
ATOM 10911 C CG   . GLU A 1 42 ? 4.793  -7.139  21.379 1.00 0.00 ? 42 GLU A CG   10 
ATOM 10912 C CD   . GLU A 1 42 ? 4.552  -8.616  21.619 1.00 0.00 ? 42 GLU A CD   10 
ATOM 10913 O OE1  . GLU A 1 42 ? 4.898  -9.102  22.716 1.00 0.00 ? 42 GLU A OE1  10 
ATOM 10914 O OE2  . GLU A 1 42 ? 4.018  -9.286  20.711 1.00 0.00 ? 42 GLU A OE2  10 
ATOM 10915 H H    . GLU A 1 42 ? 8.629  -6.020  20.947 1.00 0.00 ? 42 GLU A H    10 
ATOM 10916 H HA   . GLU A 1 42 ? 7.282  -8.502  20.789 1.00 0.00 ? 42 GLU A HA   10 
ATOM 10917 H HB2  . GLU A 1 42 ? 6.596  -7.002  22.493 1.00 0.00 ? 42 GLU A HB2  10 
ATOM 10918 H HB3  . GLU A 1 42 ? 6.347  -5.693  21.346 1.00 0.00 ? 42 GLU A HB3  10 
ATOM 10919 H HG2  . GLU A 1 42 ? 4.230  -6.575  22.107 1.00 0.00 ? 42 GLU A HG2  10 
ATOM 10920 H HG3  . GLU A 1 42 ? 4.448  -6.889  20.386 1.00 0.00 ? 42 GLU A HG3  10 
ATOM 10921 N N    . LEU A 1 43 ? 6.411  -6.248  18.531 1.00 0.00 ? 43 LEU A N    10 
ATOM 10922 C CA   . LEU A 1 43 ? 5.814  -6.080  17.211 1.00 0.00 ? 43 LEU A CA   10 
ATOM 10923 C C    . LEU A 1 43 ? 6.571  -6.891  16.164 1.00 0.00 ? 43 LEU A C    10 
ATOM 10924 O O    . LEU A 1 43 ? 5.978  -7.676  15.424 1.00 0.00 ? 43 LEU A O    10 
ATOM 10925 C CB   . LEU A 1 43 ? 5.804  -4.602  16.818 1.00 0.00 ? 43 LEU A CB   10 
ATOM 10926 C CG   . LEU A 1 43 ? 4.631  -3.775  17.346 1.00 0.00 ? 43 LEU A CG   10 
ATOM 10927 C CD1  . LEU A 1 43 ? 4.993  -2.298  17.384 1.00 0.00 ? 43 LEU A CD1  10 
ATOM 10928 C CD2  . LEU A 1 43 ? 3.392  -4.001  16.492 1.00 0.00 ? 43 LEU A CD2  10 
ATOM 10929 H H    . LEU A 1 43 ? 6.744  -5.459  19.008 1.00 0.00 ? 43 LEU A H    10 
ATOM 10930 H HA   . LEU A 1 43 ? 4.797  -6.438  17.260 1.00 0.00 ? 43 LEU A HA   10 
ATOM 10931 H HB2  . LEU A 1 43 ? 6.715  -4.156  17.187 1.00 0.00 ? 43 LEU A HB2  10 
ATOM 10932 H HB3  . LEU A 1 43 ? 5.789  -4.547  15.739 1.00 0.00 ? 43 LEU A HB3  10 
ATOM 10933 H HG   . LEU A 1 43 ? 4.404  -4.088  18.356 1.00 0.00 ? 43 LEU A HG   10 
ATOM 10934 H HD11 . LEU A 1 43 ? 4.913  -1.883  16.391 1.00 0.00 ? 43 LEU A HD11 10 
ATOM 10935 H HD12 . LEU A 1 43 ? 6.006  -2.185  17.741 1.00 0.00 ? 43 LEU A HD12 10 
ATOM 10936 H HD13 . LEU A 1 43 ? 4.317  -1.779  18.048 1.00 0.00 ? 43 LEU A HD13 10 
ATOM 10937 H HD21 . LEU A 1 43 ? 2.509  -3.808  17.082 1.00 0.00 ? 43 LEU A HD21 10 
ATOM 10938 H HD22 . LEU A 1 43 ? 3.376  -5.024  16.144 1.00 0.00 ? 43 LEU A HD22 10 
ATOM 10939 H HD23 . LEU A 1 43 ? 3.413  -3.332  15.644 1.00 0.00 ? 43 LEU A HD23 10 
ATOM 10940 N N    . VAL A 1 44 ? 7.885  -6.697  16.109 1.00 0.00 ? 44 VAL A N    10 
ATOM 10941 C CA   . VAL A 1 44 ? 8.724  -7.413  15.155 1.00 0.00 ? 44 VAL A CA   10 
ATOM 10942 C C    . VAL A 1 44 ? 8.530  -8.920  15.276 1.00 0.00 ? 44 VAL A C    10 
ATOM 10943 O O    . VAL A 1 44 ? 8.250  -9.600  14.289 1.00 0.00 ? 44 VAL A O    10 
ATOM 10944 C CB   . VAL A 1 44 ? 10.214 -7.080  15.358 1.00 0.00 ? 44 VAL A CB   10 
ATOM 10945 C CG1  . VAL A 1 44 ? 11.071 -7.825  14.346 1.00 0.00 ? 44 VAL A CG1  10 
ATOM 10946 C CG2  . VAL A 1 44 ? 10.443 -5.579  15.260 1.00 0.00 ? 44 VAL A CG2  10 
ATOM 10947 H H    . VAL A 1 44 ? 8.300  -6.058  16.725 1.00 0.00 ? 44 VAL A H    10 
ATOM 10948 H HA   . VAL A 1 44 ? 8.440  -7.101  14.161 1.00 0.00 ? 44 VAL A HA   10 
ATOM 10949 H HB   . VAL A 1 44 ? 10.503 -7.403  16.348 1.00 0.00 ? 44 VAL A HB   10 
ATOM 10950 H HG11 . VAL A 1 44 ? 12.113 -7.608  14.528 1.00 0.00 ? 44 VAL A HG11 10 
ATOM 10951 H HG12 . VAL A 1 44 ? 10.900 -8.887  14.442 1.00 0.00 ? 44 VAL A HG12 10 
ATOM 10952 H HG13 . VAL A 1 44 ? 10.807 -7.506  13.348 1.00 0.00 ? 44 VAL A HG13 10 
ATOM 10953 H HG21 . VAL A 1 44 ? 9.490  -5.073  15.211 1.00 0.00 ? 44 VAL A HG21 10 
ATOM 10954 H HG22 . VAL A 1 44 ? 10.985 -5.239  16.131 1.00 0.00 ? 44 VAL A HG22 10 
ATOM 10955 H HG23 . VAL A 1 44 ? 11.015 -5.359  14.371 1.00 0.00 ? 44 VAL A HG23 10 
ATOM 10956 N N    . MET A 1 45 ? 8.681  -9.435  16.491 1.00 0.00 ? 45 MET A N    10 
ATOM 10957 C CA   . MET A 1 45 ? 8.521  -10.863 16.741 1.00 0.00 ? 45 MET A CA   10 
ATOM 10958 C C    . MET A 1 45 ? 7.151  -11.346 16.275 1.00 0.00 ? 45 MET A C    10 
ATOM 10959 O O    . MET A 1 45 ? 7.025  -12.431 15.710 1.00 0.00 ? 45 MET A O    10 
ATOM 10960 C CB   . MET A 1 45 ? 8.702  -11.165 18.230 1.00 0.00 ? 45 MET A CB   10 
ATOM 10961 C CG   . MET A 1 45 ? 10.157 -11.228 18.665 1.00 0.00 ? 45 MET A CG   10 
ATOM 10962 S SD   . MET A 1 45 ? 10.847 -12.890 18.548 1.00 0.00 ? 45 MET A SD   10 
ATOM 10963 C CE   . MET A 1 45 ? 12.480 -12.534 17.903 1.00 0.00 ? 45 MET A CE   10 
ATOM 10964 H H    . MET A 1 45 ? 8.905  -8.842  17.239 1.00 0.00 ? 45 MET A H    10 
ATOM 10965 H HA   . MET A 1 45 ? 9.283  -11.384 16.182 1.00 0.00 ? 45 MET A HA   10 
ATOM 10966 H HB2  . MET A 1 45 ? 8.210  -10.395 18.804 1.00 0.00 ? 45 MET A HB2  10 
ATOM 10967 H HB3  . MET A 1 45 ? 8.242  -12.117 18.451 1.00 0.00 ? 45 MET A HB3  10 
ATOM 10968 H HG2  . MET A 1 45 ? 10.736 -10.569 18.035 1.00 0.00 ? 45 MET A HG2  10 
ATOM 10969 H HG3  . MET A 1 45 ? 10.226 -10.895 19.690 1.00 0.00 ? 45 MET A HG3  10 
ATOM 10970 H HE1  . MET A 1 45 ? 12.884 -11.667 18.404 1.00 0.00 ? 45 MET A HE1  10 
ATOM 10971 H HE2  . MET A 1 45 ? 13.126 -13.382 18.074 1.00 0.00 ? 45 MET A HE2  10 
ATOM 10972 H HE3  . MET A 1 45 ? 12.413 -12.339 16.843 1.00 0.00 ? 45 MET A HE3  10 
ATOM 10973 N N    . ALA A 1 46 ? 6.128  -10.533 16.517 1.00 0.00 ? 46 ALA A N    10 
ATOM 10974 C CA   . ALA A 1 46 ? 4.768  -10.877 16.121 1.00 0.00 ? 46 ALA A CA   10 
ATOM 10975 C C    . ALA A 1 46 ? 4.668  -11.067 14.611 1.00 0.00 ? 46 ALA A C    10 
ATOM 10976 O O    . ALA A 1 46 ? 4.211  -12.106 14.135 1.00 0.00 ? 46 ALA A O    10 
ATOM 10977 C CB   . ALA A 1 46 ? 3.795  -9.803  16.585 1.00 0.00 ? 46 ALA A CB   10 
ATOM 10978 H H    . ALA A 1 46 ? 6.292  -9.680  16.972 1.00 0.00 ? 46 ALA A H    10 
ATOM 10979 H HA   . ALA A 1 46 ? 4.503  -11.804 16.608 1.00 0.00 ? 46 ALA A HA   10 
ATOM 10980 H HB1  . ALA A 1 46 ? 3.110  -10.227 17.305 1.00 0.00 ? 46 ALA A HB1  10 
ATOM 10981 H HB2  . ALA A 1 46 ? 4.344  -8.994  17.043 1.00 0.00 ? 46 ALA A HB2  10 
ATOM 10982 H HB3  . ALA A 1 46 ? 3.241  -9.429  15.737 1.00 0.00 ? 46 ALA A HB3  10 
ATOM 10983 N N    . PHE A 1 47 ? 5.097  -10.056 13.862 1.00 0.00 ? 47 PHE A N    10 
ATOM 10984 C CA   . PHE A 1 47 ? 5.054  -10.112 12.406 1.00 0.00 ? 47 PHE A CA   10 
ATOM 10985 C C    . PHE A 1 47 ? 5.817  -11.327 11.885 1.00 0.00 ? 47 PHE A C    10 
ATOM 10986 O O    . PHE A 1 47 ? 5.346  -12.032 10.993 1.00 0.00 ? 47 PHE A O    10 
ATOM 10987 C CB   . PHE A 1 47 ? 5.642  -8.832  11.808 1.00 0.00 ? 47 PHE A CB   10 
ATOM 10988 C CG   . PHE A 1 47 ? 5.070  -7.576  12.400 1.00 0.00 ? 47 PHE A CG   10 
ATOM 10989 C CD1  . PHE A 1 47 ? 3.705  -7.445  12.595 1.00 0.00 ? 47 PHE A CD1  10 
ATOM 10990 C CD2  . PHE A 1 47 ? 5.898  -6.526  12.763 1.00 0.00 ? 47 PHE A CD2  10 
ATOM 10991 C CE1  . PHE A 1 47 ? 3.176  -6.290  13.140 1.00 0.00 ? 47 PHE A CE1  10 
ATOM 10992 C CE2  . PHE A 1 47 ? 5.376  -5.368  13.309 1.00 0.00 ? 47 PHE A CE2  10 
ATOM 10993 C CZ   . PHE A 1 47 ? 4.013  -5.251  13.498 1.00 0.00 ? 47 PHE A CZ   10 
ATOM 10994 H H    . PHE A 1 47 ? 5.451  -9.254  14.300 1.00 0.00 ? 47 PHE A H    10 
ATOM 10995 H HA   . PHE A 1 47 ? 4.021  -10.196 12.108 1.00 0.00 ? 47 PHE A HA   10 
ATOM 10996 H HB2  . PHE A 1 47 ? 6.709  -8.822  11.975 1.00 0.00 ? 47 PHE A HB2  10 
ATOM 10997 H HB3  . PHE A 1 47 ? 5.448  -8.818  10.746 1.00 0.00 ? 47 PHE A HB3  10 
ATOM 10998 H HD1  . PHE A 1 47 ? 3.049  -8.258  12.317 1.00 0.00 ? 47 PHE A HD1  10 
ATOM 10999 H HD2  . PHE A 1 47 ? 6.966  -6.617  12.615 1.00 0.00 ? 47 PHE A HD2  10 
ATOM 11000 H HE1  . PHE A 1 47 ? 2.110  -6.201  13.287 1.00 0.00 ? 47 PHE A HE1  10 
ATOM 11001 H HE2  . PHE A 1 47 ? 6.033  -4.558  13.587 1.00 0.00 ? 47 PHE A HE2  10 
ATOM 11002 H HZ   . PHE A 1 47 ? 3.602  -4.348  13.923 1.00 0.00 ? 47 PHE A HZ   10 
ATOM 11003 N N    . GLU A 1 48 ? 6.997  -11.563 12.449 1.00 0.00 ? 48 GLU A N    10 
ATOM 11004 C CA   . GLU A 1 48 ? 7.826  -12.692 12.040 1.00 0.00 ? 48 GLU A CA   10 
ATOM 11005 C C    . GLU A 1 48 ? 7.087  -14.011 12.246 1.00 0.00 ? 48 GLU A C    10 
ATOM 11006 O O    . GLU A 1 48 ? 7.095  -14.881 11.375 1.00 0.00 ? 48 GLU A O    10 
ATOM 11007 C CB   . GLU A 1 48 ? 9.138  -12.701 12.827 1.00 0.00 ? 48 GLU A CB   10 
ATOM 11008 C CG   . GLU A 1 48 ? 10.253 -11.914 12.159 1.00 0.00 ? 48 GLU A CG   10 
ATOM 11009 C CD   . GLU A 1 48 ? 9.775  -10.593 11.588 1.00 0.00 ? 48 GLU A CD   10 
ATOM 11010 O OE1  . GLU A 1 48 ? 9.225  -10.597 10.467 1.00 0.00 ? 48 GLU A OE1  10 
ATOM 11011 O OE2  . GLU A 1 48 ? 9.951  -9.557  12.262 1.00 0.00 ? 48 GLU A OE2  10 
ATOM 11012 H H    . GLU A 1 48 ? 7.319  -10.965 13.155 1.00 0.00 ? 48 GLU A H    10 
ATOM 11013 H HA   . GLU A 1 48 ? 8.047  -12.578 10.990 1.00 0.00 ? 48 GLU A HA   10 
ATOM 11014 H HB2  . GLU A 1 48 ? 8.961  -12.276 13.804 1.00 0.00 ? 48 GLU A HB2  10 
ATOM 11015 H HB3  . GLU A 1 48 ? 9.467  -13.723 12.943 1.00 0.00 ? 48 GLU A HB3  10 
ATOM 11016 H HG2  . GLU A 1 48 ? 11.024 -11.716 12.888 1.00 0.00 ? 48 GLU A HG2  10 
ATOM 11017 H HG3  . GLU A 1 48 ? 10.665 -12.509 11.356 1.00 0.00 ? 48 GLU A HG3  10 
ATOM 11018 N N    . GLU A 1 49 ? 6.452  -14.152 13.405 1.00 0.00 ? 49 GLU A N    10 
ATOM 11019 C CA   . GLU A 1 49 ? 5.710  -15.366 13.726 1.00 0.00 ? 49 GLU A CA   10 
ATOM 11020 C C    . GLU A 1 49 ? 4.449  -15.475 12.874 1.00 0.00 ? 49 GLU A C    10 
ATOM 11021 O O    . GLU A 1 49 ? 3.959  -16.572 12.610 1.00 0.00 ? 49 GLU A O    10 
ATOM 11022 C CB   . GLU A 1 49 ? 5.339  -15.386 15.210 1.00 0.00 ? 49 GLU A CB   10 
ATOM 11023 C CG   . GLU A 1 49 ? 4.964  -16.766 15.725 1.00 0.00 ? 49 GLU A CG   10 
ATOM 11024 C CD   . GLU A 1 49 ? 5.117  -16.888 17.229 1.00 0.00 ? 49 GLU A CD   10 
ATOM 11025 O OE1  . GLU A 1 49 ? 4.338  -16.238 17.958 1.00 0.00 ? 49 GLU A OE1  10 
ATOM 11026 O OE2  . GLU A 1 49 ? 6.014  -17.632 17.677 1.00 0.00 ? 49 GLU A OE2  10 
ATOM 11027 H H    . GLU A 1 49 ? 6.482  -13.423 14.059 1.00 0.00 ? 49 GLU A H    10 
ATOM 11028 H HA   . GLU A 1 49 ? 6.348  -16.210 13.513 1.00 0.00 ? 49 GLU A HA   10 
ATOM 11029 H HB2  . GLU A 1 49 ? 6.180  -15.026 15.784 1.00 0.00 ? 49 GLU A HB2  10 
ATOM 11030 H HB3  . GLU A 1 49 ? 4.498  -14.726 15.367 1.00 0.00 ? 49 GLU A HB3  10 
ATOM 11031 H HG2  . GLU A 1 49 ? 3.935  -16.966 15.466 1.00 0.00 ? 49 GLU A HG2  10 
ATOM 11032 H HG3  . GLU A 1 49 ? 5.602  -17.498 15.253 1.00 0.00 ? 49 GLU A HG3  10 
ATOM 11033 N N    . GLU A 1 50 ? 3.929  -14.328 12.447 1.00 0.00 ? 50 GLU A N    10 
ATOM 11034 C CA   . GLU A 1 50 ? 2.725  -14.294 11.626 1.00 0.00 ? 50 GLU A CA   10 
ATOM 11035 C C    . GLU A 1 50 ? 3.045  -14.642 10.176 1.00 0.00 ? 50 GLU A C    10 
ATOM 11036 O O    . GLU A 1 50 ? 2.274  -15.328 9.505  1.00 0.00 ? 50 GLU A O    10 
ATOM 11037 C CB   . GLU A 1 50 ? 2.070  -12.913 11.698 1.00 0.00 ? 50 GLU A CB   10 
ATOM 11038 C CG   . GLU A 1 50 ? 0.575  -12.933 11.430 1.00 0.00 ? 50 GLU A CG   10 
ATOM 11039 C CD   . GLU A 1 50 ? -0.168 -13.893 12.338 1.00 0.00 ? 50 GLU A CD   10 
ATOM 11040 O OE1  . GLU A 1 50 ? -0.358 -13.558 13.526 1.00 0.00 ? 50 GLU A OE1  10 
ATOM 11041 O OE2  . GLU A 1 50 ? -0.559 -14.979 11.862 1.00 0.00 ? 50 GLU A OE2  10 
ATOM 11042 H H    . GLU A 1 50 ? 4.366  -13.485 12.691 1.00 0.00 ? 50 GLU A H    10 
ATOM 11043 H HA   . GLU A 1 50 ? 2.037  -15.028 12.016 1.00 0.00 ? 50 GLU A HA   10 
ATOM 11044 H HB2  . GLU A 1 50 ? 2.233  -12.501 12.683 1.00 0.00 ? 50 GLU A HB2  10 
ATOM 11045 H HB3  . GLU A 1 50 ? 2.537  -12.269 10.968 1.00 0.00 ? 50 GLU A HB3  10 
ATOM 11046 H HG2  . GLU A 1 50 ? 0.181  -11.939 11.583 1.00 0.00 ? 50 GLU A HG2  10 
ATOM 11047 H HG3  . GLU A 1 50 ? 0.410  -13.230 10.404 1.00 0.00 ? 50 GLU A HG3  10 
ATOM 11048 N N    . PHE A 1 51 ? 4.188  -14.163 9.697  1.00 0.00 ? 51 PHE A N    10 
ATOM 11049 C CA   . PHE A 1 51 ? 4.611  -14.421 8.325  1.00 0.00 ? 51 PHE A CA   10 
ATOM 11050 C C    . PHE A 1 51 ? 5.306  -15.776 8.217  1.00 0.00 ? 51 PHE A C    10 
ATOM 11051 O O    . PHE A 1 51 ? 5.340  -16.384 7.148  1.00 0.00 ? 51 PHE A O    10 
ATOM 11052 C CB   . PHE A 1 51 ? 5.550  -13.314 7.841  1.00 0.00 ? 51 PHE A CB   10 
ATOM 11053 C CG   . PHE A 1 51 ? 4.832  -12.141 7.239  1.00 0.00 ? 51 PHE A CG   10 
ATOM 11054 C CD1  . PHE A 1 51 ? 4.106  -11.271 8.037  1.00 0.00 ? 51 PHE A CD1  10 
ATOM 11055 C CD2  . PHE A 1 51 ? 4.883  -11.907 5.874  1.00 0.00 ? 51 PHE A CD2  10 
ATOM 11056 C CE1  . PHE A 1 51 ? 3.444  -10.191 7.484  1.00 0.00 ? 51 PHE A CE1  10 
ATOM 11057 C CE2  . PHE A 1 51 ? 4.223  -10.828 5.316  1.00 0.00 ? 51 PHE A CE2  10 
ATOM 11058 C CZ   . PHE A 1 51 ? 3.503  -9.969  6.123  1.00 0.00 ? 51 PHE A CZ   10 
ATOM 11059 H H    . PHE A 1 51 ? 4.761  -13.622 10.280 1.00 0.00 ? 51 PHE A H    10 
ATOM 11060 H HA   . PHE A 1 51 ? 3.729  -14.431 7.704  1.00 0.00 ? 51 PHE A HA   10 
ATOM 11061 H HB2  . PHE A 1 51 ? 6.131  -12.954 8.677  1.00 0.00 ? 51 PHE A HB2  10 
ATOM 11062 H HB3  . PHE A 1 51 ? 6.215  -13.718 7.093  1.00 0.00 ? 51 PHE A HB3  10 
ATOM 11063 H HD1  . PHE A 1 51 ? 4.060  -11.443 9.102  1.00 0.00 ? 51 PHE A HD1  10 
ATOM 11064 H HD2  . PHE A 1 51 ? 5.446  -12.579 5.242  1.00 0.00 ? 51 PHE A HD2  10 
ATOM 11065 H HE1  . PHE A 1 51 ? 2.882  -9.520  8.117  1.00 0.00 ? 51 PHE A HE1  10 
ATOM 11066 H HE2  . PHE A 1 51 ? 4.272  -10.658 4.251  1.00 0.00 ? 51 PHE A HE2  10 
ATOM 11067 H HZ   . PHE A 1 51 ? 2.987  -9.126  5.689  1.00 0.00 ? 51 PHE A HZ   10 
ATOM 11068 N N    . GLY A 1 52 ? 5.858  -16.242 9.332  1.00 0.00 ? 52 GLY A N    10 
ATOM 11069 C CA   . GLY A 1 52 ? 6.545  -17.521 9.342  1.00 0.00 ? 52 GLY A CA   10 
ATOM 11070 C C    . GLY A 1 52 ? 8.032  -17.382 9.080  1.00 0.00 ? 52 GLY A C    10 
ATOM 11071 O O    . GLY A 1 52 ? 8.651  -18.268 8.490  1.00 0.00 ? 52 GLY A O    10 
ATOM 11072 H H    . GLY A 1 52 ? 5.799  -15.714 10.156 1.00 0.00 ? 52 GLY A H    10 
ATOM 11073 H HA2  . GLY A 1 52 ? 6.402  -17.987 10.305 1.00 0.00 ? 52 GLY A HA2  10 
ATOM 11074 H HA3  . GLY A 1 52 ? 6.115  -18.153 8.579  1.00 0.00 ? 52 GLY A HA3  10 
ATOM 11075 N N    . VAL A 1 53 ? 8.607  -16.267 9.517  1.00 0.00 ? 53 VAL A N    10 
ATOM 11076 C CA   . VAL A 1 53 ? 10.030 -16.015 9.326  1.00 0.00 ? 53 VAL A CA   10 
ATOM 11077 C C    . VAL A 1 53 ? 10.748 -15.875 10.664 1.00 0.00 ? 53 VAL A C    10 
ATOM 11078 O O    . VAL A 1 53 ? 10.124 -15.599 11.688 1.00 0.00 ? 53 VAL A O    10 
ATOM 11079 C CB   . VAL A 1 53 ? 10.268 -14.741 8.494  1.00 0.00 ? 53 VAL A CB   10 
ATOM 11080 C CG1  . VAL A 1 53 ? 9.702  -14.906 7.092  1.00 0.00 ? 53 VAL A CG1  10 
ATOM 11081 C CG2  . VAL A 1 53 ? 9.657  -13.531 9.185  1.00 0.00 ? 53 VAL A CG2  10 
ATOM 11082 H H    . VAL A 1 53 ? 8.061  -15.598 9.980  1.00 0.00 ? 53 VAL A H    10 
ATOM 11083 H HA   . VAL A 1 53 ? 10.449 -16.854 8.790  1.00 0.00 ? 53 VAL A HA   10 
ATOM 11084 H HB   . VAL A 1 53 ? 11.333 -14.583 8.411  1.00 0.00 ? 53 VAL A HB   10 
ATOM 11085 H HG11 . VAL A 1 53 ? 8.622  -14.879 7.134  1.00 0.00 ? 53 VAL A HG11 10 
ATOM 11086 H HG12 . VAL A 1 53 ? 10.059 -14.104 6.462  1.00 0.00 ? 53 VAL A HG12 10 
ATOM 11087 H HG13 . VAL A 1 53 ? 10.021 -15.854 6.684  1.00 0.00 ? 53 VAL A HG13 10 
ATOM 11088 H HG21 . VAL A 1 53 ? 9.451  -13.774 10.217 1.00 0.00 ? 53 VAL A HG21 10 
ATOM 11089 H HG22 . VAL A 1 53 ? 10.351 -12.703 9.142  1.00 0.00 ? 53 VAL A HG22 10 
ATOM 11090 H HG23 . VAL A 1 53 ? 8.739  -13.257 8.688  1.00 0.00 ? 53 VAL A HG23 10 
ATOM 11091 N N    . GLU A 1 54 ? 12.063 -16.069 10.647 1.00 0.00 ? 54 GLU A N    10 
ATOM 11092 C CA   . GLU A 1 54 ? 12.866 -15.965 11.860 1.00 0.00 ? 54 GLU A CA   10 
ATOM 11093 C C    . GLU A 1 54 ? 14.008 -14.971 11.673 1.00 0.00 ? 54 GLU A C    10 
ATOM 11094 O O    . GLU A 1 54 ? 14.739 -15.028 10.683 1.00 0.00 ? 54 GLU A O    10 
ATOM 11095 C CB   . GLU A 1 54 ? 13.425 -17.335 12.247 1.00 0.00 ? 54 GLU A CB   10 
ATOM 11096 C CG   . GLU A 1 54 ? 12.357 -18.400 12.426 1.00 0.00 ? 54 GLU A CG   10 
ATOM 11097 C CD   . GLU A 1 54 ? 12.879 -19.800 12.168 1.00 0.00 ? 54 GLU A CD   10 
ATOM 11098 O OE1  . GLU A 1 54 ? 13.781 -20.244 12.909 1.00 0.00 ? 54 GLU A OE1  10 
ATOM 11099 O OE2  . GLU A 1 54 ? 12.386 -20.452 11.223 1.00 0.00 ? 54 GLU A OE2  10 
ATOM 11100 H H    . GLU A 1 54 ? 12.503 -16.287 9.799  1.00 0.00 ? 54 GLU A H    10 
ATOM 11101 H HA   . GLU A 1 54 ? 12.224 -15.612 12.653 1.00 0.00 ? 54 GLU A HA   10 
ATOM 11102 H HB2  . GLU A 1 54 ? 14.106 -17.663 11.476 1.00 0.00 ? 54 GLU A HB2  10 
ATOM 11103 H HB3  . GLU A 1 54 ? 13.968 -17.239 13.176 1.00 0.00 ? 54 GLU A HB3  10 
ATOM 11104 H HG2  . GLU A 1 54 ? 11.986 -18.353 13.439 1.00 0.00 ? 54 GLU A HG2  10 
ATOM 11105 H HG3  . GLU A 1 54 ? 11.549 -18.201 11.738 1.00 0.00 ? 54 GLU A HG3  10 
ATOM 11106 N N    . ILE A 1 55 ? 14.155 -14.060 12.629 1.00 0.00 ? 55 ILE A N    10 
ATOM 11107 C CA   . ILE A 1 55 ? 15.209 -13.055 12.571 1.00 0.00 ? 55 ILE A CA   10 
ATOM 11108 C C    . ILE A 1 55 ? 16.048 -13.062 13.844 1.00 0.00 ? 55 ILE A C    10 
ATOM 11109 O O    . ILE A 1 55 ? 15.586 -13.442 14.920 1.00 0.00 ? 55 ILE A O    10 
ATOM 11110 C CB   . ILE A 1 55 ? 14.628 -11.644 12.361 1.00 0.00 ? 55 ILE A CB   10 
ATOM 11111 C CG1  . ILE A 1 55 ? 13.661 -11.292 13.493 1.00 0.00 ? 55 ILE A CG1  10 
ATOM 11112 C CG2  . ILE A 1 55 ? 13.929 -11.554 11.013 1.00 0.00 ? 55 ILE A CG2  10 
ATOM 11113 C CD1  . ILE A 1 55 ? 14.259 -10.371 14.534 1.00 0.00 ? 55 ILE A CD1  10 
ATOM 11114 H H    . ILE A 1 55 ? 13.542 -14.066 13.393 1.00 0.00 ? 55 ILE A H    10 
ATOM 11115 H HA   . ILE A 1 55 ? 15.846 -13.289 11.730 1.00 0.00 ? 55 ILE A HA   10 
ATOM 11116 H HB   . ILE A 1 55 ? 15.446 -10.939 12.363 1.00 0.00 ? 55 ILE A HB   10 
ATOM 11117 H HG12 . ILE A 1 55 ? 12.793 -10.805 13.079 1.00 0.00 ? 55 ILE A HG12 10 
ATOM 11118 H HG13 . ILE A 1 55 ? 13.356 -12.202 13.990 1.00 0.00 ? 55 ILE A HG13 10 
ATOM 11119 H HG21 . ILE A 1 55 ? 14.654 -11.676 10.222 1.00 0.00 ? 55 ILE A HG21 10 
ATOM 11120 H HG22 . ILE A 1 55 ? 13.185 -12.333 10.941 1.00 0.00 ? 55 ILE A HG22 10 
ATOM 11121 H HG23 . ILE A 1 55 ? 13.451 -10.590 10.918 1.00 0.00 ? 55 ILE A HG23 10 
ATOM 11122 H HD11 . ILE A 1 55 ? 14.716 -10.959 15.316 1.00 0.00 ? 55 ILE A HD11 10 
ATOM 11123 H HD12 . ILE A 1 55 ? 15.005 -9.741  14.072 1.00 0.00 ? 55 ILE A HD12 10 
ATOM 11124 H HD13 . ILE A 1 55 ? 13.479 -9.754  14.957 1.00 0.00 ? 55 ILE A HD13 10 
ATOM 11125 N N    . PRO A 1 56 ? 17.312 -12.632 13.721 1.00 0.00 ? 56 PRO A N    10 
ATOM 11126 C CA   . PRO A 1 56 ? 18.243 -12.577 14.853 1.00 0.00 ? 56 PRO A CA   10 
ATOM 11127 C C    . PRO A 1 56 ? 17.868 -11.495 15.860 1.00 0.00 ? 56 PRO A C    10 
ATOM 11128 O O    . PRO A 1 56 ? 17.070 -10.606 15.562 1.00 0.00 ? 56 PRO A O    10 
ATOM 11129 C CB   . PRO A 1 56 ? 19.585 -12.251 14.192 1.00 0.00 ? 56 PRO A CB   10 
ATOM 11130 C CG   . PRO A 1 56 ? 19.225 -11.551 12.928 1.00 0.00 ? 56 PRO A CG   10 
ATOM 11131 C CD   . PRO A 1 56 ? 17.931 -12.164 12.469 1.00 0.00 ? 56 PRO A CD   10 
ATOM 11132 H HA   . PRO A 1 56 ? 18.310 -13.529 15.357 1.00 0.00 ? 56 PRO A HA   10 
ATOM 11133 H HB2  . PRO A 1 56 ? 20.165 -11.615 14.846 1.00 0.00 ? 56 PRO A HB2  10 
ATOM 11134 H HB3  . PRO A 1 56 ? 20.126 -13.165 13.997 1.00 0.00 ? 56 PRO A HB3  10 
ATOM 11135 H HG2  . PRO A 1 56 ? 19.095 -10.496 13.116 1.00 0.00 ? 56 PRO A HG2  10 
ATOM 11136 H HG3  . PRO A 1 56 ? 19.997 -11.709 12.188 1.00 0.00 ? 56 PRO A HG3  10 
ATOM 11137 H HD2  . PRO A 1 56 ? 17.312 -11.422 11.987 1.00 0.00 ? 56 PRO A HD2  10 
ATOM 11138 H HD3  . PRO A 1 56 ? 18.120 -12.991 11.801 1.00 0.00 ? 56 PRO A HD3  10 
ATOM 11139 N N    . ASP A 1 57 ? 18.449 -11.577 17.052 1.00 0.00 ? 57 ASP A N    10 
ATOM 11140 C CA   . ASP A 1 57 ? 18.177 -10.603 18.103 1.00 0.00 ? 57 ASP A CA   10 
ATOM 11141 C C    . ASP A 1 57 ? 18.664 -9.216  17.698 1.00 0.00 ? 57 ASP A C    10 
ATOM 11142 O O    . ASP A 1 57 ? 18.057 -8.205  18.054 1.00 0.00 ? 57 ASP A O    10 
ATOM 11143 C CB   . ASP A 1 57 ? 18.847 -11.031 19.410 1.00 0.00 ? 57 ASP A CB   10 
ATOM 11144 C CG   . ASP A 1 57 ? 20.307 -10.627 19.471 1.00 0.00 ? 57 ASP A CG   10 
ATOM 11145 O OD1  . ASP A 1 57 ? 21.161 -11.424 19.029 1.00 0.00 ? 57 ASP A OD1  10 
ATOM 11146 O OD2  . ASP A 1 57 ? 20.595 -9.516  19.961 1.00 0.00 ? 57 ASP A OD2  10 
ATOM 11147 H H    . ASP A 1 57 ? 19.076 -12.309 17.229 1.00 0.00 ? 57 ASP A H    10 
ATOM 11148 H HA   . ASP A 1 57 ? 17.108 -10.566 18.252 1.00 0.00 ? 57 ASP A HA   10 
ATOM 11149 H HB2  . ASP A 1 57 ? 18.330 -10.570 20.239 1.00 0.00 ? 57 ASP A HB2  10 
ATOM 11150 H HB3  . ASP A 1 57 ? 18.784 -12.105 19.504 1.00 0.00 ? 57 ASP A HB3  10 
ATOM 11151 N N    . ASP A 1 58 ? 19.762 -9.174  16.953 1.00 0.00 ? 58 ASP A N    10 
ATOM 11152 C CA   . ASP A 1 58 ? 20.331 -7.911  16.499 1.00 0.00 ? 58 ASP A CA   10 
ATOM 11153 C C    . ASP A 1 58 ? 19.418 -7.238  15.479 1.00 0.00 ? 58 ASP A C    10 
ATOM 11154 O O    . ASP A 1 58 ? 19.333 -6.012  15.419 1.00 0.00 ? 58 ASP A O    10 
ATOM 11155 C CB   . ASP A 1 58 ? 21.716 -8.139  15.889 1.00 0.00 ? 58 ASP A CB   10 
ATOM 11156 C CG   . ASP A 1 58 ? 22.783 -8.357  16.943 1.00 0.00 ? 58 ASP A CG   10 
ATOM 11157 O OD1  . ASP A 1 58 ? 22.570 -9.203  17.837 1.00 0.00 ? 58 ASP A OD1  10 
ATOM 11158 O OD2  . ASP A 1 58 ? 23.831 -7.681  16.875 1.00 0.00 ? 58 ASP A OD2  10 
ATOM 11159 H H    . ASP A 1 58 ? 20.201 -10.014 16.701 1.00 0.00 ? 58 ASP A H    10 
ATOM 11160 H HA   . ASP A 1 58 ? 20.429 -7.263  17.357 1.00 0.00 ? 58 ASP A HA   10 
ATOM 11161 H HB2  . ASP A 1 58 ? 21.682 -9.012  15.253 1.00 0.00 ? 58 ASP A HB2  10 
ATOM 11162 H HB3  . ASP A 1 58 ? 21.988 -7.278  15.298 1.00 0.00 ? 58 ASP A HB3  10 
ATOM 11163 N N    . ALA A 1 59 ? 18.737 -8.050  14.676 1.00 0.00 ? 59 ALA A N    10 
ATOM 11164 C CA   . ALA A 1 59 ? 17.829 -7.534  13.660 1.00 0.00 ? 59 ALA A CA   10 
ATOM 11165 C C    . ALA A 1 59 ? 16.740 -6.668  14.284 1.00 0.00 ? 59 ALA A C    10 
ATOM 11166 O O    . ALA A 1 59 ? 16.201 -5.770  13.637 1.00 0.00 ? 59 ALA A O    10 
ATOM 11167 C CB   . ALA A 1 59 ? 17.208 -8.681  12.875 1.00 0.00 ? 59 ALA A CB   10 
ATOM 11168 H H    . ALA A 1 59 ? 18.846 -9.019  14.772 1.00 0.00 ? 59 ALA A H    10 
ATOM 11169 H HA   . ALA A 1 59 ? 18.405 -6.931  12.972 1.00 0.00 ? 59 ALA A HA   10 
ATOM 11170 H HB1  . ALA A 1 59 ? 17.876 -8.974  12.078 1.00 0.00 ? 59 ALA A HB1  10 
ATOM 11171 H HB2  . ALA A 1 59 ? 17.043 -9.520  13.535 1.00 0.00 ? 59 ALA A HB2  10 
ATOM 11172 H HB3  . ALA A 1 59 ? 16.266 -8.361  12.456 1.00 0.00 ? 59 ALA A HB3  10 
ATOM 11173 N N    . ALA A 1 60 ? 16.422 -6.943  15.545 1.00 0.00 ? 60 ALA A N    10 
ATOM 11174 C CA   . ALA A 1 60 ? 15.399 -6.187  16.256 1.00 0.00 ? 60 ALA A CA   10 
ATOM 11175 C C    . ALA A 1 60 ? 15.860 -4.759  16.527 1.00 0.00 ? 60 ALA A C    10 
ATOM 11176 O O    . ALA A 1 60 ? 15.042 -3.853  16.683 1.00 0.00 ? 60 ALA A O    10 
ATOM 11177 C CB   . ALA A 1 60 ? 15.039 -6.884  17.560 1.00 0.00 ? 60 ALA A CB   10 
ATOM 11178 H H    . ALA A 1 60 ? 16.888 -7.670  16.007 1.00 0.00 ? 60 ALA A H    10 
ATOM 11179 H HA   . ALA A 1 60 ? 14.514 -6.157  15.636 1.00 0.00 ? 60 ALA A HA   10 
ATOM 11180 H HB1  . ALA A 1 60 ? 14.037 -6.605  17.852 1.00 0.00 ? 60 ALA A HB1  10 
ATOM 11181 H HB2  . ALA A 1 60 ? 15.089 -7.954  17.422 1.00 0.00 ? 60 ALA A HB2  10 
ATOM 11182 H HB3  . ALA A 1 60 ? 15.735 -6.587  18.330 1.00 0.00 ? 60 ALA A HB3  10 
ATOM 11183 N N    . GLU A 1 61 ? 17.174 -4.567  16.582 1.00 0.00 ? 61 GLU A N    10 
ATOM 11184 C CA   . GLU A 1 61 ? 17.743 -3.248  16.836 1.00 0.00 ? 61 GLU A CA   10 
ATOM 11185 C C    . GLU A 1 61 ? 17.788 -2.419  15.556 1.00 0.00 ? 61 GLU A C    10 
ATOM 11186 O O    . GLU A 1 61 ? 17.767 -1.189  15.597 1.00 0.00 ? 61 GLU A O    10 
ATOM 11187 C CB   . GLU A 1 61 ? 19.150 -3.379  17.422 1.00 0.00 ? 61 GLU A CB   10 
ATOM 11188 C CG   . GLU A 1 61 ? 19.194 -4.145  18.734 1.00 0.00 ? 61 GLU A CG   10 
ATOM 11189 C CD   . GLU A 1 61 ? 19.006 -3.246  19.941 1.00 0.00 ? 61 GLU A CD   10 
ATOM 11190 O OE1  . GLU A 1 61 ? 19.671 -2.192  20.005 1.00 0.00 ? 61 GLU A OE1  10 
ATOM 11191 O OE2  . GLU A 1 61 ? 18.194 -3.599  20.821 1.00 0.00 ? 61 GLU A OE2  10 
ATOM 11192 H H    . GLU A 1 61 ? 17.775 -5.329  16.450 1.00 0.00 ? 61 GLU A H    10 
ATOM 11193 H HA   . GLU A 1 61 ? 17.110 -2.747  17.553 1.00 0.00 ? 61 GLU A HA   10 
ATOM 11194 H HB2  . GLU A 1 61 ? 19.778 -3.891  16.708 1.00 0.00 ? 61 GLU A HB2  10 
ATOM 11195 H HB3  . GLU A 1 61 ? 19.548 -2.390  17.594 1.00 0.00 ? 61 GLU A HB3  10 
ATOM 11196 H HG2  . GLU A 1 61 ? 18.409 -4.886  18.730 1.00 0.00 ? 61 GLU A HG2  10 
ATOM 11197 H HG3  . GLU A 1 61 ? 20.152 -4.638  18.816 1.00 0.00 ? 61 GLU A HG3  10 
ATOM 11198 N N    . THR A 1 62 ? 17.851 -3.103  14.417 1.00 0.00 ? 62 THR A N    10 
ATOM 11199 C CA   . THR A 1 62 ? 17.902 -2.432  13.125 1.00 0.00 ? 62 THR A CA   10 
ATOM 11200 C C    . THR A 1 62 ? 16.523 -1.929  12.712 1.00 0.00 ? 62 THR A C    10 
ATOM 11201 O O    . THR A 1 62 ? 16.402 -1.058  11.851 1.00 0.00 ? 62 THR A O    10 
ATOM 11202 C CB   . THR A 1 62 ? 18.445 -3.366  12.027 1.00 0.00 ? 62 THR A CB   10 
ATOM 11203 O OG1  . THR A 1 62 ? 17.486 -4.389  11.736 1.00 0.00 ? 62 THR A OG1  10 
ATOM 11204 C CG2  . THR A 1 62 ? 19.757 -4.002  12.459 1.00 0.00 ? 62 THR A CG2  10 
ATOM 11205 H H    . THR A 1 62 ? 17.865 -4.082  14.449 1.00 0.00 ? 62 THR A H    10 
ATOM 11206 H HA   . THR A 1 62 ? 18.570 -1.588  13.213 1.00 0.00 ? 62 THR A HA   10 
ATOM 11207 H HB   . THR A 1 62 ? 18.621 -2.784  11.134 1.00 0.00 ? 62 THR A HB   10 
ATOM 11208 H HG1  . THR A 1 62 ? 17.554 -5.087  12.392 1.00 0.00 ? 62 THR A HG1  10 
ATOM 11209 H HG21 . THR A 1 62 ? 20.503 -3.233  12.594 1.00 0.00 ? 62 THR A HG21 10 
ATOM 11210 H HG22 . THR A 1 62 ? 20.088 -4.696  11.700 1.00 0.00 ? 62 THR A HG22 10 
ATOM 11211 H HG23 . THR A 1 62 ? 19.612 -4.529  13.390 1.00 0.00 ? 62 THR A HG23 10 
ATOM 11212 N N    . ILE A 1 63 ? 15.487 -2.483  13.332 1.00 0.00 ? 63 ILE A N    10 
ATOM 11213 C CA   . ILE A 1 63 ? 14.116 -2.089  13.029 1.00 0.00 ? 63 ILE A CA   10 
ATOM 11214 C C    . ILE A 1 63 ? 13.660 -0.949  13.934 1.00 0.00 ? 63 ILE A C    10 
ATOM 11215 O O    . ILE A 1 63 ? 13.285 -1.169  15.087 1.00 0.00 ? 63 ILE A O    10 
ATOM 11216 C CB   . ILE A 1 63 ? 13.143 -3.273  13.183 1.00 0.00 ? 63 ILE A CB   10 
ATOM 11217 C CG1  . ILE A 1 63 ? 13.556 -4.424  12.264 1.00 0.00 ? 63 ILE A CG1  10 
ATOM 11218 C CG2  . ILE A 1 63 ? 11.719 -2.830  12.880 1.00 0.00 ? 63 ILE A CG2  10 
ATOM 11219 C CD1  . ILE A 1 63 ? 12.863 -5.730  12.582 1.00 0.00 ? 63 ILE A CD1  10 
ATOM 11220 H H    . ILE A 1 63 ? 15.647 -3.173  14.009 1.00 0.00 ? 63 ILE A H    10 
ATOM 11221 H HA   . ILE A 1 63 ? 14.085 -1.754  12.003 1.00 0.00 ? 63 ILE A HA   10 
ATOM 11222 H HB   . ILE A 1 63 ? 13.179 -3.609  14.208 1.00 0.00 ? 63 ILE A HB   10 
ATOM 11223 H HG12 . ILE A 1 63 ? 13.321 -4.164  11.244 1.00 0.00 ? 63 ILE A HG12 10 
ATOM 11224 H HG13 . ILE A 1 63 ? 14.621 -4.582  12.354 1.00 0.00 ? 63 ILE A HG13 10 
ATOM 11225 H HG21 . ILE A 1 63 ? 11.734 -2.072  12.111 1.00 0.00 ? 63 ILE A HG21 10 
ATOM 11226 H HG22 . ILE A 1 63 ? 11.145 -3.678  12.538 1.00 0.00 ? 63 ILE A HG22 10 
ATOM 11227 H HG23 . ILE A 1 63 ? 11.269 -2.427  13.775 1.00 0.00 ? 63 ILE A HG23 10 
ATOM 11228 H HD11 . ILE A 1 63 ? 13.142 -6.054  13.573 1.00 0.00 ? 63 ILE A HD11 10 
ATOM 11229 H HD12 . ILE A 1 63 ? 11.793 -5.591  12.535 1.00 0.00 ? 63 ILE A HD12 10 
ATOM 11230 H HD13 . ILE A 1 63 ? 13.160 -6.480  11.862 1.00 0.00 ? 63 ILE A HD13 10 
ATOM 11231 N N    . LEU A 1 64 ? 13.692 0.268   13.404 1.00 0.00 ? 64 LEU A N    10 
ATOM 11232 C CA   . LEU A 1 64 ? 13.279 1.444   14.162 1.00 0.00 ? 64 LEU A CA   10 
ATOM 11233 C C    . LEU A 1 64 ? 11.975 2.015   13.614 1.00 0.00 ? 64 LEU A C    10 
ATOM 11234 O O    . LEU A 1 64 ? 10.979 2.116   14.331 1.00 0.00 ? 64 LEU A O    10 
ATOM 11235 C CB   . LEU A 1 64 ? 14.374 2.512   14.121 1.00 0.00 ? 64 LEU A CB   10 
ATOM 11236 C CG   . LEU A 1 64 ? 15.811 2.004   14.238 1.00 0.00 ? 64 LEU A CG   10 
ATOM 11237 C CD1  . LEU A 1 64 ? 16.798 3.116   13.918 1.00 0.00 ? 64 LEU A CD1  10 
ATOM 11238 C CD2  . LEU A 1 64 ? 16.068 1.445   15.630 1.00 0.00 ? 64 LEU A CD2  10 
ATOM 11239 H H    . LEU A 1 64 ? 14.000 0.380   12.480 1.00 0.00 ? 64 LEU A H    10 
ATOM 11240 H HA   . LEU A 1 64 ? 13.123 1.140   15.186 1.00 0.00 ? 64 LEU A HA   10 
ATOM 11241 H HB2  . LEU A 1 64 ? 14.285 3.040   13.184 1.00 0.00 ? 64 LEU A HB2  10 
ATOM 11242 H HB3  . LEU A 1 64 ? 14.197 3.198   14.937 1.00 0.00 ? 64 LEU A HB3  10 
ATOM 11243 H HG   . LEU A 1 64 ? 15.964 1.207   13.523 1.00 0.00 ? 64 LEU A HG   10 
ATOM 11244 H HD11 . LEU A 1 64 ? 16.257 4.010   13.645 1.00 0.00 ? 64 LEU A HD11 10 
ATOM 11245 H HD12 . LEU A 1 64 ? 17.429 2.812   13.096 1.00 0.00 ? 64 LEU A HD12 10 
ATOM 11246 H HD13 . LEU A 1 64 ? 17.410 3.315   14.786 1.00 0.00 ? 64 LEU A HD13 10 
ATOM 11247 H HD21 . LEU A 1 64 ? 17.132 1.371   15.797 1.00 0.00 ? 64 LEU A HD21 10 
ATOM 11248 H HD22 . LEU A 1 64 ? 15.622 0.464   15.711 1.00 0.00 ? 64 LEU A HD22 10 
ATOM 11249 H HD23 . LEU A 1 64 ? 15.632 2.102   16.367 1.00 0.00 ? 64 LEU A HD23 10 
ATOM 11250 N N    . THR A 1 65 ? 11.987 2.386   12.338 1.00 0.00 ? 65 THR A N    10 
ATOM 11251 C CA   . THR A 1 65 ? 10.806 2.946   11.693 1.00 0.00 ? 65 THR A CA   10 
ATOM 11252 C C    . THR A 1 65 ? 10.009 1.866   10.972 1.00 0.00 ? 65 THR A C    10 
ATOM 11253 O O    . THR A 1 65 ? 10.512 0.769   10.726 1.00 0.00 ? 65 THR A O    10 
ATOM 11254 C CB   . THR A 1 65 ? 11.185 4.048   10.686 1.00 0.00 ? 65 THR A CB   10 
ATOM 11255 O OG1  . THR A 1 65 ? 11.896 3.478   9.581  1.00 0.00 ? 65 THR A OG1  10 
ATOM 11256 C CG2  . THR A 1 65 ? 12.040 5.117   11.349 1.00 0.00 ? 65 THR A CG2  10 
ATOM 11257 H H    . THR A 1 65 ? 12.812 2.281   11.819 1.00 0.00 ? 65 THR A H    10 
ATOM 11258 H HA   . THR A 1 65 ? 10.185 3.387   12.460 1.00 0.00 ? 65 THR A HA   10 
ATOM 11259 H HB   . THR A 1 65 ? 10.278 4.509   10.321 1.00 0.00 ? 65 THR A HB   10 
ATOM 11260 H HG1  . THR A 1 65 ? 12.834 3.450   9.785  1.00 0.00 ? 65 THR A HG1  10 
ATOM 11261 H HG21 . THR A 1 65 ? 12.263 4.822   12.363 1.00 0.00 ? 65 THR A HG21 10 
ATOM 11262 H HG22 . THR A 1 65 ? 11.503 6.054   11.356 1.00 0.00 ? 65 THR A HG22 10 
ATOM 11263 H HG23 . THR A 1 65 ? 12.961 5.234   10.798 1.00 0.00 ? 65 THR A HG23 10 
ATOM 11264 N N    . VAL A 1 66 ? 8.763  2.182   10.633 1.00 0.00 ? 66 VAL A N    10 
ATOM 11265 C CA   . VAL A 1 66 ? 7.897  1.238   9.937  1.00 0.00 ? 66 VAL A CA   10 
ATOM 11266 C C    . VAL A 1 66 ? 8.584  0.671   8.700  1.00 0.00 ? 66 VAL A C    10 
ATOM 11267 O O    . VAL A 1 66 ? 8.526  -0.530  8.440  1.00 0.00 ? 66 VAL A O    10 
ATOM 11268 C CB   . VAL A 1 66 ? 6.571  1.898   9.517  1.00 0.00 ? 66 VAL A CB   10 
ATOM 11269 C CG1  . VAL A 1 66 ? 5.676  0.895   8.805  1.00 0.00 ? 66 VAL A CG1  10 
ATOM 11270 C CG2  . VAL A 1 66 ? 5.864  2.491   10.726 1.00 0.00 ? 66 VAL A CG2  10 
ATOM 11271 H H    . VAL A 1 66 ? 8.419  3.072   10.855 1.00 0.00 ? 66 VAL A H    10 
ATOM 11272 H HA   . VAL A 1 66 ? 7.673  0.428   10.616 1.00 0.00 ? 66 VAL A HA   10 
ATOM 11273 H HB   . VAL A 1 66 ? 6.793  2.700   8.828  1.00 0.00 ? 66 VAL A HB   10 
ATOM 11274 H HG11 . VAL A 1 66 ? 5.802  -0.080  9.253  1.00 0.00 ? 66 VAL A HG11 10 
ATOM 11275 H HG12 . VAL A 1 66 ? 4.645  1.203   8.896  1.00 0.00 ? 66 VAL A HG12 10 
ATOM 11276 H HG13 . VAL A 1 66 ? 5.948  0.847   7.761  1.00 0.00 ? 66 VAL A HG13 10 
ATOM 11277 H HG21 . VAL A 1 66 ? 6.525  2.460   11.579 1.00 0.00 ? 66 VAL A HG21 10 
ATOM 11278 H HG22 . VAL A 1 66 ? 5.593  3.516   10.519 1.00 0.00 ? 66 VAL A HG22 10 
ATOM 11279 H HG23 . VAL A 1 66 ? 4.973  1.920   10.939 1.00 0.00 ? 66 VAL A HG23 10 
ATOM 11280 N N    . GLY A 1 67 ? 9.236  1.544   7.939  1.00 0.00 ? 67 GLY A N    10 
ATOM 11281 C CA   . GLY A 1 67 ? 9.926  1.112   6.737  1.00 0.00 ? 67 GLY A CA   10 
ATOM 11282 C C    . GLY A 1 67 ? 10.881 -0.036  6.999  1.00 0.00 ? 67 GLY A C    10 
ATOM 11283 O O    . GLY A 1 67 ? 11.039 -0.924  6.161  1.00 0.00 ? 67 GLY A O    10 
ATOM 11284 H H    . GLY A 1 67 ? 9.249  2.490   8.195  1.00 0.00 ? 67 GLY A H    10 
ATOM 11285 H HA2  . GLY A 1 67 ? 9.194  0.798   6.008  1.00 0.00 ? 67 GLY A HA2  10 
ATOM 11286 H HA3  . GLY A 1 67 ? 10.485 1.945   6.337  1.00 0.00 ? 67 GLY A HA3  10 
ATOM 11287 N N    . ASP A 1 68 ? 11.522 -0.017  8.163  1.00 0.00 ? 68 ASP A N    10 
ATOM 11288 C CA   . ASP A 1 68 ? 12.467 -1.064  8.532  1.00 0.00 ? 68 ASP A CA   10 
ATOM 11289 C C    . ASP A 1 68 ? 11.746 -2.384  8.782  1.00 0.00 ? 68 ASP A C    10 
ATOM 11290 O O    . ASP A 1 68 ? 12.061 -3.402  8.165  1.00 0.00 ? 68 ASP A O    10 
ATOM 11291 C CB   . ASP A 1 68 ? 13.254 -0.654  9.778  1.00 0.00 ? 68 ASP A CB   10 
ATOM 11292 C CG   . ASP A 1 68 ? 14.035 0.629   9.573  1.00 0.00 ? 68 ASP A CG   10 
ATOM 11293 O OD1  . ASP A 1 68 ? 14.859 0.678   8.636  1.00 0.00 ? 68 ASP A OD1  10 
ATOM 11294 O OD2  . ASP A 1 68 ? 13.825 1.583   10.351 1.00 0.00 ? 68 ASP A OD2  10 
ATOM 11295 H H    . ASP A 1 68 ? 11.354 0.718   8.789  1.00 0.00 ? 68 ASP A H    10 
ATOM 11296 H HA   . ASP A 1 68 ? 13.155 -1.194  7.710  1.00 0.00 ? 68 ASP A HA   10 
ATOM 11297 H HB2  . ASP A 1 68 ? 12.566 -0.507  10.598 1.00 0.00 ? 68 ASP A HB2  10 
ATOM 11298 H HB3  . ASP A 1 68 ? 13.948 -1.441  10.033 1.00 0.00 ? 68 ASP A HB3  10 
ATOM 11299 N N    . ALA A 1 69 ? 10.777 -2.360  9.692  1.00 0.00 ? 69 ALA A N    10 
ATOM 11300 C CA   . ALA A 1 69 ? 10.011 -3.555  10.023 1.00 0.00 ? 69 ALA A CA   10 
ATOM 11301 C C    . ALA A 1 69 ? 9.388  -4.171  8.775  1.00 0.00 ? 69 ALA A C    10 
ATOM 11302 O O    . ALA A 1 69 ? 9.481  -5.379  8.554  1.00 0.00 ? 69 ALA A O    10 
ATOM 11303 C CB   . ALA A 1 69 ? 8.933  -3.224  11.045 1.00 0.00 ? 69 ALA A CB   10 
ATOM 11304 H H    . ALA A 1 69 ? 10.573 -1.519  10.150 1.00 0.00 ? 69 ALA A H    10 
ATOM 11305 H HA   . ALA A 1 69 ? 10.686 -4.272  10.468 1.00 0.00 ? 69 ALA A HA   10 
ATOM 11306 H HB1  . ALA A 1 69 ? 9.169  -2.285  11.525 1.00 0.00 ? 69 ALA A HB1  10 
ATOM 11307 H HB2  . ALA A 1 69 ? 7.978  -3.145  10.548 1.00 0.00 ? 69 ALA A HB2  10 
ATOM 11308 H HB3  . ALA A 1 69 ? 8.889  -4.007  11.788 1.00 0.00 ? 69 ALA A HB3  10 
ATOM 11309 N N    . VAL A 1 70 ? 8.752  -3.334  7.962  1.00 0.00 ? 70 VAL A N    10 
ATOM 11310 C CA   . VAL A 1 70 ? 8.113  -3.796  6.736  1.00 0.00 ? 70 VAL A CA   10 
ATOM 11311 C C    . VAL A 1 70 ? 9.135  -4.397  5.777  1.00 0.00 ? 70 VAL A C    10 
ATOM 11312 O O    . VAL A 1 70 ? 8.992  -5.537  5.334  1.00 0.00 ? 70 VAL A O    10 
ATOM 11313 C CB   . VAL A 1 70 ? 7.369  -2.651  6.024  1.00 0.00 ? 70 VAL A CB   10 
ATOM 11314 C CG1  . VAL A 1 70 ? 6.738  -3.146  4.731  1.00 0.00 ? 70 VAL A CG1  10 
ATOM 11315 C CG2  . VAL A 1 70 ? 6.319  -2.046  6.943  1.00 0.00 ? 70 VAL A CG2  10 
ATOM 11316 H H    . VAL A 1 70 ? 8.711  -2.382  8.192  1.00 0.00 ? 70 VAL A H    10 
ATOM 11317 H HA   . VAL A 1 70 ? 7.392  -4.556  7.001  1.00 0.00 ? 70 VAL A HA   10 
ATOM 11318 H HB   . VAL A 1 70 ? 8.087  -1.882  5.776  1.00 0.00 ? 70 VAL A HB   10 
ATOM 11319 H HG11 . VAL A 1 70 ? 7.515  -3.382  4.019  1.00 0.00 ? 70 VAL A HG11 10 
ATOM 11320 H HG12 . VAL A 1 70 ? 6.151  -4.030  4.933  1.00 0.00 ? 70 VAL A HG12 10 
ATOM 11321 H HG13 . VAL A 1 70 ? 6.100  -2.375  4.324  1.00 0.00 ? 70 VAL A HG13 10 
ATOM 11322 H HG21 . VAL A 1 70 ? 6.475  -0.980  7.014  1.00 0.00 ? 70 VAL A HG21 10 
ATOM 11323 H HG22 . VAL A 1 70 ? 5.334  -2.239  6.541  1.00 0.00 ? 70 VAL A HG22 10 
ATOM 11324 H HG23 . VAL A 1 70 ? 6.400  -2.490  7.924  1.00 0.00 ? 70 VAL A HG23 10 
ATOM 11325 N N    . LYS A 1 71 ? 10.167 -3.623  5.460  1.00 0.00 ? 71 LYS A N    10 
ATOM 11326 C CA   . LYS A 1 71 ? 11.216 -4.079  4.555  1.00 0.00 ? 71 LYS A CA   10 
ATOM 11327 C C    . LYS A 1 71 ? 11.807 -5.403  5.029  1.00 0.00 ? 71 LYS A C    10 
ATOM 11328 O O    . LYS A 1 71 ? 12.211 -6.238  4.220  1.00 0.00 ? 71 LYS A O    10 
ATOM 11329 C CB   . LYS A 1 71 ? 12.320 -3.024  4.450  1.00 0.00 ? 71 LYS A CB   10 
ATOM 11330 C CG   . LYS A 1 71 ? 11.965 -1.860  3.541  1.00 0.00 ? 71 LYS A CG   10 
ATOM 11331 C CD   . LYS A 1 71 ? 13.056 -0.803  3.536  1.00 0.00 ? 71 LYS A CD   10 
ATOM 11332 C CE   . LYS A 1 71 ? 12.926 0.127   2.340  1.00 0.00 ? 71 LYS A CE   10 
ATOM 11333 N NZ   . LYS A 1 71 ? 11.652 0.896   2.371  1.00 0.00 ? 71 LYS A NZ   10 
ATOM 11334 H H    . LYS A 1 71 ? 10.226 -2.724  5.846  1.00 0.00 ? 71 LYS A H    10 
ATOM 11335 H HA   . LYS A 1 71 ? 10.774 -4.223  3.581  1.00 0.00 ? 71 LYS A HA   10 
ATOM 11336 H HB2  . LYS A 1 71 ? 12.525 -2.634  5.436  1.00 0.00 ? 71 LYS A HB2  10 
ATOM 11337 H HB3  . LYS A 1 71 ? 13.214 -3.494  4.065  1.00 0.00 ? 71 LYS A HB3  10 
ATOM 11338 H HG2  . LYS A 1 71 ? 11.831 -2.228  2.535  1.00 0.00 ? 71 LYS A HG2  10 
ATOM 11339 H HG3  . LYS A 1 71 ? 11.044 -1.413  3.888  1.00 0.00 ? 71 LYS A HG3  10 
ATOM 11340 H HD2  . LYS A 1 71 ? 12.984 -0.218  4.442  1.00 0.00 ? 71 LYS A HD2  10 
ATOM 11341 H HD3  . LYS A 1 71 ? 14.019 -1.292  3.498  1.00 0.00 ? 71 LYS A HD3  10 
ATOM 11342 H HE2  . LYS A 1 71 ? 13.755 0.819   2.346  1.00 0.00 ? 71 LYS A HE2  10 
ATOM 11343 H HE3  . LYS A 1 71 ? 12.958 -0.464  1.436  1.00 0.00 ? 71 LYS A HE3  10 
ATOM 11344 H HZ1  . LYS A 1 71 ? 10.845 0.257   2.221  1.00 0.00 ? 71 LYS A HZ1  10 
ATOM 11345 H HZ2  . LYS A 1 71 ? 11.651 1.618   1.622  1.00 0.00 ? 71 LYS A HZ2  10 
ATOM 11346 H HZ3  . LYS A 1 71 ? 11.541 1.367   3.292  1.00 0.00 ? 71 LYS A HZ3  10 
ATOM 11347 N N    . PHE A 1 72 ? 11.852 -5.588  6.344  1.00 0.00 ? 72 PHE A N    10 
ATOM 11348 C CA   . PHE A 1 72 ? 12.393 -6.812  6.925  1.00 0.00 ? 72 PHE A CA   10 
ATOM 11349 C C    . PHE A 1 72 ? 11.467 -7.995  6.660  1.00 0.00 ? 72 PHE A C    10 
ATOM 11350 O O    . PHE A 1 72 ? 11.876 -8.996  6.069  1.00 0.00 ? 72 PHE A O    10 
ATOM 11351 C CB   . PHE A 1 72 ? 12.599 -6.638  8.432  1.00 0.00 ? 72 PHE A CB   10 
ATOM 11352 C CG   . PHE A 1 72 ? 13.908 -7.184  8.925  1.00 0.00 ? 72 PHE A CG   10 
ATOM 11353 C CD1  . PHE A 1 72 ? 14.320 -8.459  8.571  1.00 0.00 ? 72 PHE A CD1  10 
ATOM 11354 C CD2  . PHE A 1 72 ? 14.728 -6.421  9.741  1.00 0.00 ? 72 PHE A CD2  10 
ATOM 11355 C CE1  . PHE A 1 72 ? 15.524 -8.963  9.024  1.00 0.00 ? 72 PHE A CE1  10 
ATOM 11356 C CE2  . PHE A 1 72 ? 15.934 -6.920  10.197 1.00 0.00 ? 72 PHE A CE2  10 
ATOM 11357 C CZ   . PHE A 1 72 ? 16.333 -8.193  9.837  1.00 0.00 ? 72 PHE A CZ   10 
ATOM 11358 H H    . PHE A 1 72 ? 11.515 -4.885  6.938  1.00 0.00 ? 72 PHE A H    10 
ATOM 11359 H HA   . PHE A 1 72 ? 13.347 -7.005  6.460  1.00 0.00 ? 72 PHE A HA   10 
ATOM 11360 H HB2  . PHE A 1 72 ? 12.566 -5.587  8.674  1.00 0.00 ? 72 PHE A HB2  10 
ATOM 11361 H HB3  . PHE A 1 72 ? 11.806 -7.149  8.957  1.00 0.00 ? 72 PHE A HB3  10 
ATOM 11362 H HD1  . PHE A 1 72 ? 13.690 -9.062  7.934  1.00 0.00 ? 72 PHE A HD1  10 
ATOM 11363 H HD2  . PHE A 1 72 ? 14.416 -5.425  10.023 1.00 0.00 ? 72 PHE A HD2  10 
ATOM 11364 H HE1  . PHE A 1 72 ? 15.834 -9.958  8.741  1.00 0.00 ? 72 PHE A HE1  10 
ATOM 11365 H HE2  . PHE A 1 72 ? 16.563 -6.315  10.832 1.00 0.00 ? 72 PHE A HE2  10 
ATOM 11366 H HZ   . PHE A 1 72 ? 17.274 -8.585  10.192 1.00 0.00 ? 72 PHE A HZ   10 
ATOM 11367 N N    . ILE A 1 73 ? 10.220 -7.874  7.101  1.00 0.00 ? 73 ILE A N    10 
ATOM 11368 C CA   . ILE A 1 73 ? 9.236  -8.932  6.911  1.00 0.00 ? 73 ILE A CA   10 
ATOM 11369 C C    . ILE A 1 73 ? 9.103  -9.301  5.437  1.00 0.00 ? 73 ILE A C    10 
ATOM 11370 O O    . ILE A 1 73 ? 8.881  -10.462 5.095  1.00 0.00 ? 73 ILE A O    10 
ATOM 11371 C CB   . ILE A 1 73 ? 7.854  -8.521  7.452  1.00 0.00 ? 73 ILE A CB   10 
ATOM 11372 C CG1  . ILE A 1 73 ? 7.941  -8.208  8.947  1.00 0.00 ? 73 ILE A CG1  10 
ATOM 11373 C CG2  . ILE A 1 73 ? 6.836  -9.621  7.194  1.00 0.00 ? 73 ILE A CG2  10 
ATOM 11374 C CD1  . ILE A 1 73 ? 6.947  -7.163  9.404  1.00 0.00 ? 73 ILE A CD1  10 
ATOM 11375 H H    . ILE A 1 73 ? 9.955  -7.052  7.564  1.00 0.00 ? 73 ILE A H    10 
ATOM 11376 H HA   . ILE A 1 73 ? 9.572  -9.801  7.459  1.00 0.00 ? 73 ILE A HA   10 
ATOM 11377 H HB   . ILE A 1 73 ? 7.535  -7.636  6.924  1.00 0.00 ? 73 ILE A HB   10 
ATOM 11378 H HG12 . ILE A 1 73 ? 7.755  -9.109  9.509  1.00 0.00 ? 73 ILE A HG12 10 
ATOM 11379 H HG13 . ILE A 1 73 ? 8.933  -7.845  9.175  1.00 0.00 ? 73 ILE A HG13 10 
ATOM 11380 H HG21 . ILE A 1 73 ? 6.561  -9.619  6.149  1.00 0.00 ? 73 ILE A HG21 10 
ATOM 11381 H HG22 . ILE A 1 73 ? 7.266  -10.577 7.451  1.00 0.00 ? 73 ILE A HG22 10 
ATOM 11382 H HG23 . ILE A 1 73 ? 5.957  -9.447  7.797  1.00 0.00 ? 73 ILE A HG23 10 
ATOM 11383 H HD11 . ILE A 1 73 ? 7.029  -7.031  10.473 1.00 0.00 ? 73 ILE A HD11 10 
ATOM 11384 H HD12 . ILE A 1 73 ? 7.154  -6.227  8.908  1.00 0.00 ? 73 ILE A HD12 10 
ATOM 11385 H HD13 . ILE A 1 73 ? 5.946  -7.487  9.158  1.00 0.00 ? 73 ILE A HD13 10 
ATOM 11386 N N    . ASP A 1 74 ? 9.242  -8.305  4.569  1.00 0.00 ? 74 ASP A N    10 
ATOM 11387 C CA   . ASP A 1 74 ? 9.140  -8.524  3.131  1.00 0.00 ? 74 ASP A CA   10 
ATOM 11388 C C    . ASP A 1 74 ? 10.420 -9.149  2.585  1.00 0.00 ? 74 ASP A C    10 
ATOM 11389 O O    . ASP A 1 74 ? 10.379 -9.981  1.678  1.00 0.00 ? 74 ASP A O    10 
ATOM 11390 C CB   . ASP A 1 74 ? 8.855  -7.205  2.411  1.00 0.00 ? 74 ASP A CB   10 
ATOM 11391 C CG   . ASP A 1 74 ? 8.752  -7.376  0.908  1.00 0.00 ? 74 ASP A CG   10 
ATOM 11392 O OD1  . ASP A 1 74 ? 9.808  -7.468  0.249  1.00 0.00 ? 74 ASP A OD1  10 
ATOM 11393 O OD2  . ASP A 1 74 ? 7.616  -7.417  0.392  1.00 0.00 ? 74 ASP A OD2  10 
ATOM 11394 H H    . ASP A 1 74 ? 9.417  -7.400  4.904  1.00 0.00 ? 74 ASP A H    10 
ATOM 11395 H HA   . ASP A 1 74 ? 8.319  -9.203  2.956  1.00 0.00 ? 74 ASP A HA   10 
ATOM 11396 H HB2  . ASP A 1 74 ? 7.921  -6.799  2.773  1.00 0.00 ? 74 ASP A HB2  10 
ATOM 11397 H HB3  . ASP A 1 74 ? 9.652  -6.507  2.623  1.00 0.00 ? 74 ASP A HB3  10 
ATOM 11398 N N    . LYS A 1 75 ? 11.555 -8.743  3.142  1.00 0.00 ? 75 LYS A N    10 
ATOM 11399 C CA   . LYS A 1 75 ? 12.848 -9.263  2.712  1.00 0.00 ? 75 LYS A CA   10 
ATOM 11400 C C    . LYS A 1 75 ? 12.949 -10.761 2.982  1.00 0.00 ? 75 LYS A C    10 
ATOM 11401 O O    . LYS A 1 75 ? 13.398 -11.526 2.129  1.00 0.00 ? 75 LYS A O    10 
ATOM 11402 C CB   . LYS A 1 75 ? 13.981 -8.527  3.431  1.00 0.00 ? 75 LYS A CB   10 
ATOM 11403 C CG   . LYS A 1 75 ? 15.367 -8.972  2.996  1.00 0.00 ? 75 LYS A CG   10 
ATOM 11404 C CD   . LYS A 1 75 ? 15.882 -10.113 3.857  1.00 0.00 ? 75 LYS A CD   10 
ATOM 11405 C CE   . LYS A 1 75 ? 17.386 -10.285 3.713  1.00 0.00 ? 75 LYS A CE   10 
ATOM 11406 N NZ   . LYS A 1 75 ? 17.775 -10.622 2.316  1.00 0.00 ? 75 LYS A NZ   10 
ATOM 11407 H H    . LYS A 1 75 ? 11.523 -8.078  3.862  1.00 0.00 ? 75 LYS A H    10 
ATOM 11408 H HA   . LYS A 1 75 ? 12.937 -9.094  1.650  1.00 0.00 ? 75 LYS A HA   10 
ATOM 11409 H HB2  . LYS A 1 75 ? 13.888 -7.469  3.236  1.00 0.00 ? 75 LYS A HB2  10 
ATOM 11410 H HB3  . LYS A 1 75 ? 13.888 -8.698  4.494  1.00 0.00 ? 75 LYS A HB3  10 
ATOM 11411 H HG2  . LYS A 1 75 ? 15.324 -9.302  1.969  1.00 0.00 ? 75 LYS A HG2  10 
ATOM 11412 H HG3  . LYS A 1 75 ? 16.046 -8.135  3.079  1.00 0.00 ? 75 LYS A HG3  10 
ATOM 11413 H HD2  . LYS A 1 75 ? 15.652 -9.904  4.892  1.00 0.00 ? 75 LYS A HD2  10 
ATOM 11414 H HD3  . LYS A 1 75 ? 15.393 -11.029 3.556  1.00 0.00 ? 75 LYS A HD3  10 
ATOM 11415 H HE2  . LYS A 1 75 ? 17.870 -9.363  4.000  1.00 0.00 ? 75 LYS A HE2  10 
ATOM 11416 H HE3  . LYS A 1 75 ? 17.709 -11.079 4.370  1.00 0.00 ? 75 LYS A HE3  10 
ATOM 11417 H HZ1  . LYS A 1 75 ? 18.605 -11.249 2.318  1.00 0.00 ? 75 LYS A HZ1  10 
ATOM 11418 H HZ2  . LYS A 1 75 ? 18.010 -9.755  1.792  1.00 0.00 ? 75 LYS A HZ2  10 
ATOM 11419 H HZ3  . LYS A 1 75 ? 16.991 -11.105 1.833  1.00 0.00 ? 75 LYS A HZ3  10 
ATOM 11420 N N    . ALA A 1 76 ? 12.527 -11.173 4.173  1.00 0.00 ? 76 ALA A N    10 
ATOM 11421 C CA   . ALA A 1 76 ? 12.567 -12.580 4.553  1.00 0.00 ? 76 ALA A CA   10 
ATOM 11422 C C    . ALA A 1 76 ? 11.297 -13.303 4.116  1.00 0.00 ? 76 ALA A C    10 
ATOM 11423 O O    . ALA A 1 76 ? 11.095 -14.472 4.442  1.00 0.00 ? 76 ALA A O    10 
ATOM 11424 C CB   . ALA A 1 76 ? 12.764 -12.716 6.055  1.00 0.00 ? 76 ALA A CB   10 
ATOM 11425 H H    . ALA A 1 76 ? 12.180 -10.516 4.811  1.00 0.00 ? 76 ALA A H    10 
ATOM 11426 H HA   . ALA A 1 76 ? 13.415 -13.035 4.061  1.00 0.00 ? 76 ALA A HA   10 
ATOM 11427 H HB1  . ALA A 1 76 ? 12.848 -13.761 6.313  1.00 0.00 ? 76 ALA A HB1  10 
ATOM 11428 H HB2  . ALA A 1 76 ? 13.666 -12.198 6.348  1.00 0.00 ? 76 ALA A HB2  10 
ATOM 11429 H HB3  . ALA A 1 76 ? 11.918 -12.285 6.569  1.00 0.00 ? 76 ALA A HB3  10 
ATOM 11430 N N    . SER A 1 77 ? 10.445 -12.598 3.379  1.00 0.00 ? 77 SER A N    10 
ATOM 11431 C CA   . SER A 1 77 ? 9.192  -13.172 2.902  1.00 0.00 ? 77 SER A CA   10 
ATOM 11432 C C    . SER A 1 77 ? 9.455  -14.329 1.943  1.00 0.00 ? 77 SER A C    10 
ATOM 11433 O O    . SER A 1 77 ? 8.686  -15.288 1.884  1.00 0.00 ? 77 SER A O    10 
ATOM 11434 C CB   . SER A 1 77 ? 8.348  -12.101 2.207  1.00 0.00 ? 77 SER A CB   10 
ATOM 11435 O OG   . SER A 1 77 ? 7.007  -12.531 2.052  1.00 0.00 ? 77 SER A OG   10 
ATOM 11436 H H    . SER A 1 77 ? 10.663 -11.670 3.152  1.00 0.00 ? 77 SER A H    10 
ATOM 11437 H HA   . SER A 1 77 ? 8.651  -13.545 3.758  1.00 0.00 ? 77 SER A HA   10 
ATOM 11438 H HB2  . SER A 1 77 ? 8.358  -11.199 2.799  1.00 0.00 ? 77 SER A HB2  10 
ATOM 11439 H HB3  . SER A 1 77 ? 8.764  -11.896 1.231  1.00 0.00 ? 77 SER A HB3  10 
ATOM 11440 H HG   . SER A 1 77 ? 6.657  -12.194 1.224  1.00 0.00 ? 77 SER A HG   10 
ATOM 11441 N N    . ALA A 1 78 ? 10.547 -14.231 1.192  1.00 0.00 ? 78 ALA A N    10 
ATOM 11442 C CA   . ALA A 1 78 ? 10.914 -15.270 0.237  1.00 0.00 ? 78 ALA A CA   10 
ATOM 11443 C C    . ALA A 1 78 ? 12.428 -15.428 0.153  1.00 0.00 ? 78 ALA A C    10 
ATOM 11444 O O    . ALA A 1 78 ? 13.127 -14.547 -0.349 1.00 0.00 ? 78 ALA A O    10 
ATOM 11445 C CB   . ALA A 1 78 ? 10.337 -14.953 -1.134 1.00 0.00 ? 78 ALA A CB   10 
ATOM 11446 H H    . ALA A 1 78 ? 11.121 -13.443 1.284  1.00 0.00 ? 78 ALA A H    10 
ATOM 11447 H HA   . ALA A 1 78 ? 10.483 -16.201 0.575  1.00 0.00 ? 78 ALA A HA   10 
ATOM 11448 H HB1  . ALA A 1 78 ? 9.357  -15.399 -1.224 1.00 0.00 ? 78 ALA A HB1  10 
ATOM 11449 H HB2  . ALA A 1 78 ? 10.257 -13.883 -1.252 1.00 0.00 ? 78 ALA A HB2  10 
ATOM 11450 H HB3  . ALA A 1 78 ? 10.986 -15.353 -1.899 1.00 0.00 ? 78 ALA A HB3  10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  ALA 5  5  5  ALA ALA A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ARG 7  7  7  ARG ARG A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 LYS 10 10 10 LYS LYS A . n 
A 1 11 ILE 11 11 11 ILE ILE A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 VAL 13 13 13 VAL VAL A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 HIS 15 15 15 HIS HIS A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 THR 24 24 24 THR THR A . n 
A 1 25 GLU 25 25 25 GLU GLU A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 ALA 27 27 27 ALA ALA A . n 
A 1 28 SER 28 28 28 SER SER A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 ILE 30 30 30 ILE ILE A . n 
A 1 31 ASP 31 31 31 ASP ASP A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 SER 37 37 37 SER SER A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ASP 39 39 39 ASP ASP A . n 
A 1 40 THR 40 40 40 THR THR A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 VAL 44 44 44 VAL VAL A . n 
A 1 45 MET 45 45 45 MET MET A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
A 1 47 PHE 47 47 47 PHE PHE A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 GLU 49 49 49 GLU GLU A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 PHE 51 51 51 PHE PHE A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 VAL 53 53 53 VAL VAL A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 ILE 55 55 55 ILE ILE A . n 
A 1 56 PRO 56 56 56 PRO PRO A . n 
A 1 57 ASP 57 57 57 ASP ASP A . n 
A 1 58 ASP 58 58 58 ASP ASP A . n 
A 1 59 ALA 59 59 59 ALA ALA A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 THR 62 62 62 THR THR A . n 
A 1 63 ILE 63 63 63 ILE ILE A . n 
A 1 64 LEU 64 64 64 LEU LEU A . n 
A 1 65 THR 65 65 65 THR THR A . n 
A 1 66 VAL 66 66 66 VAL VAL A . n 
A 1 67 GLY 67 67 67 GLY GLY A . n 
A 1 68 ASP 68 68 68 ASP ASP A . n 
A 1 69 ALA 69 69 69 ALA ALA A . n 
A 1 70 VAL 70 70 70 VAL VAL A . n 
A 1 71 LYS 71 71 71 LYS LYS A . n 
A 1 72 PHE 72 72 72 PHE PHE A . n 
A 1 73 ILE 73 73 73 ILE ILE A . n 
A 1 74 ASP 74 74 74 ASP ASP A . n 
A 1 75 LYS 75 75 75 LYS LYS A . n 
A 1 76 ALA 76 76 76 ALA ALA A . n 
A 1 77 SER 77 77 77 SER SER A . n 
A 1 78 ALA 78 78 78 ALA ALA A . n 
# 
_pdbx_SG_project.full_name_of_center   'Seattle Structural Genomics Center for Infectious Disease' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     SSGCID 
_pdbx_SG_project.project_name          'NIAID, National Institute of Allergy and Infectious Diseases' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-07-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_nmr_exptl_sample.component             'Acyl carrier protein-1' 
_pdbx_nmr_exptl_sample.concentration         ? 
_pdbx_nmr_exptl_sample.concentration_range   1.2-1.4 
_pdbx_nmr_exptl_sample.concentration_units   mM 
_pdbx_nmr_exptl_sample.isotopic_labeling     '[U-95% 13C; U-95% 15N]' 
_pdbx_nmr_exptl_sample.solution_id           1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASP A 31 ? ? -94.79 -60.88 
2  2  ASP A 31 ? ? -94.95 -60.73 
3  3  ASP A 31 ? ? -94.79 -60.79 
4  3  ILE A 63 ? ? -65.91 91.54  
5  4  ASP A 31 ? ? -94.81 -60.90 
6  5  VAL A 23 ? ? -61.74 94.97  
7  5  ASP A 31 ? ? -94.80 -60.98 
8  6  ASP A 3  ? ? -92.75 -62.30 
9  6  VAL A 23 ? ? -68.76 85.96  
10 6  ASP A 31 ? ? -94.84 -60.92 
11 7  ASP A 31 ? ? -94.75 -60.82 
12 8  VAL A 23 ? ? -66.93 88.97  
13 8  ASP A 31 ? ? -94.58 -61.22 
14 9  VAL A 23 ? ? -68.48 88.65  
15 9  ASP A 31 ? ? -94.46 -61.34 
16 10 ASP A 3  ? ? -96.75 -60.34 
17 10 VAL A 23 ? ? -64.61 92.06  
18 10 ASP A 31 ? ? -94.97 -60.85 
#