data_2N5T
# 
_entry.id   2N5T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104458   RCSB  
2N5T         PDB   
25731        BMRB  
D_1000104458 WWPDB 
# 
_pdbx_database_related.db_id          25731 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N5T 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-28 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Venditti, V.'     1 
'Schwieters, C.D.' 2 
'Grishaev, A.'     3 
'Clore, G.'        4 
# 
_citation.id                        primary 
_citation.title                     
;Dynamic equilibrium between closed and partially closed states of the bacterial Enzyme I unveiled by solution NMR and X-ray scattering.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            112 
_citation.page_first                11565 
_citation.page_last                 11570 
_citation.year                      2015 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26305976 
_citation.pdbx_database_id_DOI      10.1073/pnas.1515366112 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Venditti, V.'     1 ? 
primary 'Schwieters, C.D.' 2 ? 
primary 'Grishaev, A.'     3 ? 
primary 'Clore, G.M.'      4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Phosphoenolpyruvate-protein phosphotransferase' 
_entity.formula_weight             63635.645 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    2.7.3.9 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphotransferase system, enzyme I' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAV
AEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVR
ALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDE
LMTLVNKFIEEKTIC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAV
AEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVR
ALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDE
LMTLVNKFIEEKTIC
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   SER n 
1 4   GLY n 
1 5   ILE n 
1 6   LEU n 
1 7   ALA n 
1 8   SER n 
1 9   PRO n 
1 10  GLY n 
1 11  ILE n 
1 12  ALA n 
1 13  PHE n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  LEU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  GLU n 
1 22  ASP n 
1 23  GLU n 
1 24  ILE n 
1 25  VAL n 
1 26  ILE n 
1 27  ASP n 
1 28  ARG n 
1 29  LYS n 
1 30  LYS n 
1 31  ILE n 
1 32  SER n 
1 33  ALA n 
1 34  ASP n 
1 35  GLN n 
1 36  VAL n 
1 37  ASP n 
1 38  GLN n 
1 39  GLU n 
1 40  VAL n 
1 41  GLU n 
1 42  ARG n 
1 43  PHE n 
1 44  LEU n 
1 45  SER n 
1 46  GLY n 
1 47  ARG n 
1 48  ALA n 
1 49  LYS n 
1 50  ALA n 
1 51  SER n 
1 52  ALA n 
1 53  GLN n 
1 54  LEU n 
1 55  GLU n 
1 56  THR n 
1 57  ILE n 
1 58  LYS n 
1 59  THR n 
1 60  LYS n 
1 61  ALA n 
1 62  GLY n 
1 63  GLU n 
1 64  THR n 
1 65  PHE n 
1 66  GLY n 
1 67  GLU n 
1 68  GLU n 
1 69  LYS n 
1 70  GLU n 
1 71  ALA n 
1 72  ILE n 
1 73  PHE n 
1 74  GLU n 
1 75  GLY n 
1 76  HIS n 
1 77  ILE n 
1 78  MET n 
1 79  LEU n 
1 80  LEU n 
1 81  GLU n 
1 82  ASP n 
1 83  GLU n 
1 84  GLU n 
1 85  LEU n 
1 86  GLU n 
1 87  GLN n 
1 88  GLU n 
1 89  ILE n 
1 90  ILE n 
1 91  ALA n 
1 92  LEU n 
1 93  ILE n 
1 94  LYS n 
1 95  ASP n 
1 96  LYS n 
1 97  HIS n 
1 98  MET n 
1 99  THR n 
1 100 ALA n 
1 101 ASP n 
1 102 ALA n 
1 103 ALA n 
1 104 ALA n 
1 105 HIS n 
1 106 GLU n 
1 107 VAL n 
1 108 ILE n 
1 109 GLU n 
1 110 GLY n 
1 111 GLN n 
1 112 ALA n 
1 113 SER n 
1 114 ALA n 
1 115 LEU n 
1 116 GLU n 
1 117 GLU n 
1 118 LEU n 
1 119 ASP n 
1 120 ASP n 
1 121 GLU n 
1 122 TYR n 
1 123 LEU n 
1 124 LYS n 
1 125 GLU n 
1 126 ARG n 
1 127 ALA n 
1 128 ALA n 
1 129 ASP n 
1 130 VAL n 
1 131 ARG n 
1 132 ASP n 
1 133 ILE n 
1 134 GLY n 
1 135 LYS n 
1 136 ARG n 
1 137 LEU n 
1 138 LEU n 
1 139 ARG n 
1 140 ASN n 
1 141 ILE n 
1 142 LEU n 
1 143 GLY n 
1 144 LEU n 
1 145 LYS n 
1 146 ILE n 
1 147 ILE n 
1 148 ASP n 
1 149 LEU n 
1 150 SER n 
1 151 ALA n 
1 152 ILE n 
1 153 GLN n 
1 154 ASP n 
1 155 GLU n 
1 156 VAL n 
1 157 ILE n 
1 158 LEU n 
1 159 VAL n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 LEU n 
1 164 THR n 
1 165 PRO n 
1 166 SER n 
1 167 GLU n 
1 168 THR n 
1 169 ALA n 
1 170 GLN n 
1 171 LEU n 
1 172 ASN n 
1 173 LEU n 
1 174 LYS n 
1 175 LYS n 
1 176 VAL n 
1 177 LEU n 
1 178 GLY n 
1 179 PHE n 
1 180 ILE n 
1 181 THR n 
1 182 ASP n 
1 183 ALA n 
1 184 GLY n 
1 185 GLY n 
1 186 ARG n 
1 187 THR n 
1 188 SER n 
1 189 HIS n 
1 190 THR n 
1 191 SER n 
1 192 ILE n 
1 193 MET n 
1 194 ALA n 
1 195 ARG n 
1 196 SER n 
1 197 LEU n 
1 198 GLU n 
1 199 LEU n 
1 200 PRO n 
1 201 ALA n 
1 202 ILE n 
1 203 VAL n 
1 204 GLY n 
1 205 THR n 
1 206 GLY n 
1 207 SER n 
1 208 VAL n 
1 209 THR n 
1 210 SER n 
1 211 GLN n 
1 212 VAL n 
1 213 LYS n 
1 214 ASN n 
1 215 ASP n 
1 216 ASP n 
1 217 TYR n 
1 218 LEU n 
1 219 ILE n 
1 220 LEU n 
1 221 ASP n 
1 222 ALA n 
1 223 VAL n 
1 224 ASN n 
1 225 ASN n 
1 226 GLN n 
1 227 VAL n 
1 228 TYR n 
1 229 VAL n 
1 230 ASN n 
1 231 PRO n 
1 232 THR n 
1 233 ASN n 
1 234 GLU n 
1 235 VAL n 
1 236 ILE n 
1 237 ASP n 
1 238 LYS n 
1 239 MET n 
1 240 ARG n 
1 241 ALA n 
1 242 VAL n 
1 243 GLN n 
1 244 GLU n 
1 245 GLN n 
1 246 VAL n 
1 247 ALA n 
1 248 SER n 
1 249 GLU n 
1 250 LYS n 
1 251 ALA n 
1 252 GLU n 
1 253 LEU n 
1 254 ALA n 
1 255 LYS n 
1 256 LEU n 
1 257 LYS n 
1 258 ASP n 
1 259 LEU n 
1 260 PRO n 
1 261 ALA n 
1 262 ILE n 
1 263 THR n 
1 264 LEU n 
1 265 ASP n 
1 266 GLY n 
1 267 HIS n 
1 268 GLN n 
1 269 VAL n 
1 270 GLU n 
1 271 VAL n 
1 272 CYS n 
1 273 ALA n 
1 274 ASN n 
1 275 ILE n 
1 276 GLY n 
1 277 THR n 
1 278 VAL n 
1 279 ARG n 
1 280 ASP n 
1 281 VAL n 
1 282 GLU n 
1 283 GLY n 
1 284 ALA n 
1 285 GLU n 
1 286 ARG n 
1 287 ASN n 
1 288 GLY n 
1 289 ALA n 
1 290 GLU n 
1 291 GLY n 
1 292 VAL n 
1 293 GLY n 
1 294 LEU n 
1 295 TYR n 
1 296 ARG n 
1 297 THR n 
1 298 GLU n 
1 299 PHE n 
1 300 LEU n 
1 301 PHE n 
1 302 MET n 
1 303 ASP n 
1 304 ARG n 
1 305 ASP n 
1 306 ALA n 
1 307 LEU n 
1 308 PRO n 
1 309 THR n 
1 310 GLU n 
1 311 GLU n 
1 312 GLU n 
1 313 GLN n 
1 314 PHE n 
1 315 ALA n 
1 316 ALA n 
1 317 TYR n 
1 318 LYS n 
1 319 ALA n 
1 320 VAL n 
1 321 ALA n 
1 322 GLU n 
1 323 ALA n 
1 324 CYS n 
1 325 GLY n 
1 326 SER n 
1 327 GLN n 
1 328 ALA n 
1 329 VAL n 
1 330 ILE n 
1 331 VAL n 
1 332 ARG n 
1 333 THR n 
1 334 MET n 
1 335 ASP n 
1 336 ILE n 
1 337 GLY n 
1 338 GLY n 
1 339 ASP n 
1 340 LYS n 
1 341 GLU n 
1 342 LEU n 
1 343 PRO n 
1 344 TYR n 
1 345 MET n 
1 346 ASN n 
1 347 PHE n 
1 348 PRO n 
1 349 LYS n 
1 350 GLU n 
1 351 GLU n 
1 352 ASN n 
1 353 PRO n 
1 354 PHE n 
1 355 LEU n 
1 356 GLY n 
1 357 TRP n 
1 358 ARG n 
1 359 ALA n 
1 360 ILE n 
1 361 ARG n 
1 362 ILE n 
1 363 ALA n 
1 364 MET n 
1 365 ASP n 
1 366 ARG n 
1 367 ARG n 
1 368 GLU n 
1 369 ILE n 
1 370 LEU n 
1 371 ARG n 
1 372 ASP n 
1 373 GLN n 
1 374 LEU n 
1 375 ARG n 
1 376 ALA n 
1 377 ILE n 
1 378 LEU n 
1 379 ARG n 
1 380 ALA n 
1 381 SER n 
1 382 ALA n 
1 383 PHE n 
1 384 GLY n 
1 385 LYS n 
1 386 LEU n 
1 387 ARG n 
1 388 ILE n 
1 389 MET n 
1 390 PHE n 
1 391 PRO n 
1 392 MET n 
1 393 ILE n 
1 394 ILE n 
1 395 SER n 
1 396 VAL n 
1 397 GLU n 
1 398 GLU n 
1 399 VAL n 
1 400 ARG n 
1 401 ALA n 
1 402 LEU n 
1 403 ARG n 
1 404 LYS n 
1 405 GLU n 
1 406 ILE n 
1 407 GLU n 
1 408 ILE n 
1 409 TYR n 
1 410 LYS n 
1 411 GLN n 
1 412 GLU n 
1 413 LEU n 
1 414 ARG n 
1 415 ASP n 
1 416 GLU n 
1 417 GLY n 
1 418 LYS n 
1 419 ALA n 
1 420 PHE n 
1 421 ASP n 
1 422 GLU n 
1 423 SER n 
1 424 ILE n 
1 425 GLU n 
1 426 ILE n 
1 427 GLY n 
1 428 VAL n 
1 429 MET n 
1 430 VAL n 
1 431 GLU n 
1 432 THR n 
1 433 PRO n 
1 434 ALA n 
1 435 ALA n 
1 436 ALA n 
1 437 THR n 
1 438 ILE n 
1 439 ALA n 
1 440 ARG n 
1 441 HIS n 
1 442 LEU n 
1 443 ALA n 
1 444 LYS n 
1 445 GLU n 
1 446 VAL n 
1 447 ASP n 
1 448 PHE n 
1 449 PHE n 
1 450 SER n 
1 451 ILE n 
1 452 GLY n 
1 453 THR n 
1 454 ASN n 
1 455 ASP n 
1 456 LEU n 
1 457 THR n 
1 458 GLN n 
1 459 TYR n 
1 460 THR n 
1 461 LEU n 
1 462 ALA n 
1 463 VAL n 
1 464 ASP n 
1 465 ARG n 
1 466 GLY n 
1 467 ASN n 
1 468 ASP n 
1 469 MET n 
1 470 ILE n 
1 471 SER n 
1 472 HIS n 
1 473 LEU n 
1 474 TYR n 
1 475 GLN n 
1 476 PRO n 
1 477 MET n 
1 478 SER n 
1 479 PRO n 
1 480 SER n 
1 481 VAL n 
1 482 LEU n 
1 483 ASN n 
1 484 LEU n 
1 485 ILE n 
1 486 LYS n 
1 487 GLN n 
1 488 VAL n 
1 489 ILE n 
1 490 ASP n 
1 491 ALA n 
1 492 SER n 
1 493 HIS n 
1 494 ALA n 
1 495 GLU n 
1 496 GLY n 
1 497 LYS n 
1 498 TRP n 
1 499 THR n 
1 500 GLY n 
1 501 MET n 
1 502 CYS n 
1 503 GLY n 
1 504 GLU n 
1 505 LEU n 
1 506 ALA n 
1 507 GLY n 
1 508 ASP n 
1 509 GLU n 
1 510 ARG n 
1 511 ALA n 
1 512 THR n 
1 513 LEU n 
1 514 LEU n 
1 515 LEU n 
1 516 LEU n 
1 517 GLY n 
1 518 MET n 
1 519 GLY n 
1 520 LEU n 
1 521 ASP n 
1 522 GLU n 
1 523 PHE n 
1 524 SER n 
1 525 MET n 
1 526 SER n 
1 527 ALA n 
1 528 ILE n 
1 529 SER n 
1 530 ILE n 
1 531 PRO n 
1 532 ARG n 
1 533 ILE n 
1 534 LYS n 
1 535 LYS n 
1 536 ILE n 
1 537 ILE n 
1 538 ARG n 
1 539 ASN n 
1 540 THR n 
1 541 ASN n 
1 542 PHE n 
1 543 GLU n 
1 544 ASP n 
1 545 ALA n 
1 546 LYS n 
1 547 VAL n 
1 548 LEU n 
1 549 ALA n 
1 550 GLU n 
1 551 GLN n 
1 552 ALA n 
1 553 LEU n 
1 554 ALA n 
1 555 GLN n 
1 556 PRO n 
1 557 THR n 
1 558 THR n 
1 559 ASP n 
1 560 GLU n 
1 561 LEU n 
1 562 MET n 
1 563 THR n 
1 564 LEU n 
1 565 VAL n 
1 566 ASN n 
1 567 LYS n 
1 568 PHE n 
1 569 ILE n 
1 570 GLU n 
1 571 GLU n 
1 572 LYS n 
1 573 THR n 
1 574 ILE n 
1 575 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ptsI, b2416, JW2409' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET11 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PT1_ECOLI 
_struct_ref.pdbx_db_accession          P08839 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKAGETFGEEKEAIFEGHIMLL
EDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVA
ADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAV
AEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVR
ALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDE
LMTLVNKFIEEKTIC
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2N5T A 1 ? 575 ? P08839 1 ? 575 ? 1 575 
2 1 2N5T B 1 ? 575 ? P08839 1 ? 575 ? 1 575 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 ARTSY            
1 2 1 '2D 1H-15N HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.4 
_pdbx_nmr_exptl_sample_conditions.pressure               ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.temperature            310 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
# 
_pdbx_nmr_sample_details.contents         
'0.4 mM [U-13C; U-15N; U-2H] EIA, 20 mM TRIS, 1 mM EDTA, 100 mM sodium chloride, 2 mM DTT, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2N5T 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;The deposited structures represent two-membered ensembles with varying weights which must be considered together to properly reproduce the  
RDC and SAXS data. The first members of 10 ensembles are reported in models 1-10 which were allowed rigid-body motion of subunits,  
arbitrary motion of linker regions and torsion degrees of freedom for sidechains. The second member of each ensemble is represented in model 11, which was fixed in the calculations.  The ten pairs of weights for the ten ensemble members are   
 Ensemble 1:  
   MODEL 1, weight: 0.503  
   MODEL 11, weight: 0.497  
 Ensemble 2:  
   MODEL 2, weight: 0.518  
   MODEL 11, weight: 0.482  
 Ensemble 3:  
   MODEL 3, weight: 0.526  
   MODEL 11, weight: 0.474  
 Ensemble 4:  
   MODEL 4, weight: 0.520  
   MODEL 11, weight: 0.480  
 Ensemble 5:  
   MODEL 5, weight: 0.508  
   MODEL 11, weight: 0.492  
 Ensemble 6:  
   MODEL 6, weight: 0.531  
   MODEL 11, weight: 0.469  
 Ensemble 7:  
   MODEL 7, weight: 0.498  
   MODEL 11, weight: 0.501  
 Ensemble 8:  
   MODEL 8, weight: 0.524  
   MODEL 11, weight: 0.476  
 Ensemble 9:  
   MODEL 9, weight: 0.514  
   MODEL 11, weight: 0.486  
 Ensemble 10:  
   MODEL 10, weight: 0.526  
   MODEL 11, weight: 0.474
;
_pdbx_nmr_refine.software_ordinal   2 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             11 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N5T 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    19.4 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N5T 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Goddard                                             'chemical shift assignment' Sparky    ? 1 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  Xplor-NIH ? 2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe   ? 3 
'Bruker Biospin'                                    collection                  TopSpin   ? 4 
# 
loop_
_exptl.absorpt_coefficient_mu 
_exptl.absorpt_correction_T_max 
_exptl.absorpt_correction_T_min 
_exptl.absorpt_correction_type 
_exptl.absorpt_process_details 
_exptl.crystals_number 
_exptl.details 
_exptl.entry_id 
_exptl.method 
_exptl.method_details 
? ? ? ? ? ? 
;Ensemble Solution structure of the phosphoenolpyruvate-Enzyme I complex from the bacterial hosphotransferase system as determined by NMR residual dipolar couplings and solution X-ray scattering
;
2N5T 'SOLUTION NMR'        ? 
? ? ? ? ? ? ? 2N5T 'SOLUTION SCATTERING' ? 
# 
_struct.entry_id                  2N5T 
_struct.title                     
'Ensemble solution structure of the phosphoenolpyruvate-Enzyme I complex from the bacterial phosphotransferase system' 
_struct.pdbx_descriptor           'Phosphoenolpyruvate-protein phosphotransferase (E.C.2.7.3.9)' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N5T 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 32  ? PHE A 65  ? SER A 32  PHE A 65  1 ? 34 
HELX_P HELX_P2  2  GLY A 66  ? GLU A 81  ? GLY A 66  GLU A 81  1 ? 16 
HELX_P HELX_P3  3  ASP A 82  ? HIS A 97  ? ASP A 82  HIS A 97  1 ? 16 
HELX_P HELX_P4  4  THR A 99  ? GLU A 117 ? THR A 99  GLU A 117 1 ? 19 
HELX_P HELX_P5  5  ASP A 120 ? GLY A 143 ? ASP A 120 GLY A 143 1 ? 24 
HELX_P HELX_P6  6  THR A 164 ? GLN A 170 ? THR A 164 GLN A 170 1 ? 7  
HELX_P HELX_P7  7  SER A 188 ? GLU A 198 ? SER A 188 GLU A 198 1 ? 11 
HELX_P HELX_P8  8  THR A 232 ? ALA A 254 ? THR A 232 ALA A 254 1 ? 23 
HELX_P HELX_P9  9  VAL A 278 ? ASN A 287 ? VAL A 278 ASN A 287 1 ? 10 
HELX_P HELX_P10 10 THR A 297 ? MET A 302 ? THR A 297 MET A 302 1 ? 6  
HELX_P HELX_P11 11 THR A 309 ? CYS A 324 ? THR A 309 CYS A 324 1 ? 16 
HELX_P HELX_P12 12 LEU A 342 ? ASN A 346 ? LEU A 342 ASN A 346 5 ? 5  
HELX_P HELX_P13 13 ASN A 352 ? GLY A 356 ? ASN A 352 GLY A 356 5 ? 5  
HELX_P HELX_P14 14 ALA A 359 ? MET A 364 ? ALA A 359 MET A 364 1 ? 6  
HELX_P HELX_P15 15 ARG A 366 ? SER A 381 ? ARG A 366 SER A 381 1 ? 16 
HELX_P HELX_P16 16 SER A 395 ? GLU A 416 ? SER A 395 GLU A 416 1 ? 22 
HELX_P HELX_P17 17 THR A 432 ? ILE A 438 ? THR A 432 ILE A 438 1 ? 7  
HELX_P HELX_P18 18 ILE A 438 ? LYS A 444 ? ILE A 438 LYS A 444 1 ? 7  
HELX_P HELX_P19 19 GLY A 452 ? LEU A 461 ? GLY A 452 LEU A 461 1 ? 10 
HELX_P HELX_P20 20 ASN A 467 ? TYR A 474 ? ASN A 467 TYR A 474 5 ? 8  
HELX_P HELX_P21 21 SER A 478 ? GLU A 495 ? SER A 478 GLU A 495 1 ? 18 
HELX_P HELX_P22 22 ALA A 511 ? MET A 518 ? ALA A 511 MET A 518 1 ? 8  
HELX_P HELX_P23 23 SER A 526 ? ILE A 528 ? SER A 526 ILE A 528 5 ? 3  
HELX_P HELX_P24 24 SER A 529 ? ASN A 539 ? SER A 529 ASN A 539 1 ? 11 
HELX_P HELX_P25 25 ASN A 541 ? GLN A 555 ? ASN A 541 GLN A 555 1 ? 15 
HELX_P HELX_P26 26 THR A 557 ? THR A 573 ? THR A 557 THR A 573 1 ? 17 
HELX_P HELX_P27 27 SER B 32  ? PHE B 65  ? SER B 32  PHE B 65  1 ? 34 
HELX_P HELX_P28 28 GLY B 66  ? GLU B 81  ? GLY B 66  GLU B 81  1 ? 16 
HELX_P HELX_P29 29 ASP B 82  ? HIS B 97  ? ASP B 82  HIS B 97  1 ? 16 
HELX_P HELX_P30 30 THR B 99  ? GLU B 117 ? THR B 99  GLU B 117 1 ? 19 
HELX_P HELX_P31 31 ASP B 120 ? GLY B 143 ? ASP B 120 GLY B 143 1 ? 24 
HELX_P HELX_P32 32 THR B 164 ? GLN B 170 ? THR B 164 GLN B 170 1 ? 7  
HELX_P HELX_P33 33 SER B 188 ? GLU B 198 ? SER B 188 GLU B 198 1 ? 11 
HELX_P HELX_P34 34 THR B 232 ? ALA B 254 ? THR B 232 ALA B 254 1 ? 23 
HELX_P HELX_P35 35 VAL B 278 ? ASN B 287 ? VAL B 278 ASN B 287 1 ? 10 
HELX_P HELX_P36 36 THR B 297 ? MET B 302 ? THR B 297 MET B 302 1 ? 6  
HELX_P HELX_P37 37 THR B 309 ? CYS B 324 ? THR B 309 CYS B 324 1 ? 16 
HELX_P HELX_P38 38 LEU B 342 ? ASN B 346 ? LEU B 342 ASN B 346 5 ? 5  
HELX_P HELX_P39 39 ASN B 352 ? GLY B 356 ? ASN B 352 GLY B 356 5 ? 5  
HELX_P HELX_P40 40 ALA B 359 ? MET B 364 ? ALA B 359 MET B 364 1 ? 6  
HELX_P HELX_P41 41 ARG B 366 ? SER B 381 ? ARG B 366 SER B 381 1 ? 16 
HELX_P HELX_P42 42 SER B 395 ? GLU B 416 ? SER B 395 GLU B 416 1 ? 22 
HELX_P HELX_P43 43 THR B 432 ? ILE B 438 ? THR B 432 ILE B 438 1 ? 7  
HELX_P HELX_P44 44 ILE B 438 ? LYS B 444 ? ILE B 438 LYS B 444 1 ? 7  
HELX_P HELX_P45 45 GLY B 452 ? LEU B 461 ? GLY B 452 LEU B 461 1 ? 10 
HELX_P HELX_P46 46 ASN B 467 ? TYR B 474 ? ASN B 467 TYR B 474 5 ? 8  
HELX_P HELX_P47 47 SER B 478 ? GLU B 495 ? SER B 478 GLU B 495 1 ? 18 
HELX_P HELX_P48 48 ALA B 511 ? MET B 518 ? ALA B 511 MET B 518 1 ? 8  
HELX_P HELX_P49 49 SER B 526 ? ILE B 528 ? SER B 526 ILE B 528 5 ? 3  
HELX_P HELX_P50 50 SER B 529 ? ASN B 539 ? SER B 529 ASN B 539 1 ? 11 
HELX_P HELX_P51 51 ASN B 541 ? GLN B 555 ? ASN B 541 GLN B 555 1 ? 15 
HELX_P HELX_P52 52 THR B 557 ? THR B 573 ? THR B 557 THR B 573 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 9 ? 
C ? 6 ? 
D ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? parallel      
D 8 9 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 201 ? ILE A 202 ? ALA A 201 ILE A 202 
A 2 VAL A 176 ? THR A 181 ? VAL A 176 THR A 181 
A 3 VAL A 156 ? ALA A 160 ? VAL A 156 ALA A 160 
A 4 ALA A 12  ? LEU A 18  ? ALA A 12  LEU A 18  
A 5 ASP A 216 ? LEU A 220 ? ASP A 216 LEU A 220 
A 6 VAL A 227 ? VAL A 229 ? VAL A 227 VAL A 229 
B 1 GLU A 270 ? ILE A 275 ? GLU A 270 ILE A 275 
B 2 VAL A 292 ? ARG A 296 ? VAL A 292 ARG A 296 
B 3 VAL A 329 ? ARG A 332 ? VAL A 329 ARG A 332 
B 4 LEU A 386 ? PHE A 390 ? LEU A 386 PHE A 390 
B 5 GLU A 425 ? VAL A 430 ? GLU A 425 VAL A 430 
B 6 PHE A 448 ? ILE A 451 ? PHE A 448 ILE A 451 
B 7 TRP A 498 ? MET A 501 ? TRP A 498 MET A 501 
B 8 GLU A 522 ? MET A 525 ? GLU A 522 MET A 525 
B 9 GLU A 270 ? ILE A 275 ? GLU A 270 ILE A 275 
C 1 ALA B 201 ? ILE B 202 ? ALA B 201 ILE B 202 
C 2 VAL B 176 ? THR B 181 ? VAL B 176 THR B 181 
C 3 VAL B 156 ? ALA B 160 ? VAL B 156 ALA B 160 
C 4 ALA B 12  ? LEU B 18  ? ALA B 12  LEU B 18  
C 5 ASP B 216 ? LEU B 220 ? ASP B 216 LEU B 220 
C 6 VAL B 227 ? VAL B 229 ? VAL B 227 VAL B 229 
D 1 GLU B 270 ? ILE B 275 ? GLU B 270 ILE B 275 
D 2 VAL B 292 ? ARG B 296 ? VAL B 292 ARG B 296 
D 3 VAL B 329 ? ARG B 332 ? VAL B 329 ARG B 332 
D 4 LEU B 386 ? PHE B 390 ? LEU B 386 PHE B 390 
D 5 GLU B 425 ? VAL B 430 ? GLU B 425 VAL B 430 
D 6 PHE B 448 ? ILE B 451 ? PHE B 448 ILE B 451 
D 7 TRP B 498 ? MET B 501 ? TRP B 498 MET B 501 
D 8 GLU B 522 ? MET B 525 ? GLU B 522 MET B 525 
D 9 GLU B 270 ? ILE B 275 ? GLU B 270 ILE B 275 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 202 ? O ILE A 202 N THR A 181 ? N THR A 181 
A 2 3 O ILE A 180 ? O ILE A 180 N LEU A 158 ? N LEU A 158 
A 3 4 O ILE A 157 ? O ILE A 157 N LYS A 15  ? N LYS A 15  
A 4 5 N ALA A 12  ? N ALA A 12  O LEU A 220 ? O LEU A 220 
A 5 6 N ILE A 219 ? N ILE A 219 O TYR A 228 ? O TYR A 228 
B 1 2 N ILE A 275 ? N ILE A 275 O LEU A 294 ? O LEU A 294 
B 2 3 N TYR A 295 ? N TYR A 295 O ILE A 330 ? O ILE A 330 
B 3 4 N VAL A 331 ? N VAL A 331 O ARG A 387 ? O ARG A 387 
B 4 5 N PHE A 390 ? N PHE A 390 O MET A 429 ? O MET A 429 
B 5 6 N VAL A 430 ? N VAL A 430 O SER A 450 ? O SER A 450 
B 6 7 N PHE A 449 ? N PHE A 449 O GLY A 500 ? O GLY A 500 
B 7 8 N MET A 501 ? N MET A 501 O SER A 524 ? O SER A 524 
B 8 9 O PHE A 523 ? O PHE A 523 N CYS A 272 ? N CYS A 272 
C 1 2 O ILE B 202 ? O ILE B 202 N THR B 181 ? N THR B 181 
C 2 3 O ILE B 180 ? O ILE B 180 N LEU B 158 ? N LEU B 158 
C 3 4 O ILE B 157 ? O ILE B 157 N LYS B 15  ? N LYS B 15  
C 4 5 N ALA B 12  ? N ALA B 12  O LEU B 220 ? O LEU B 220 
C 5 6 N ILE B 219 ? N ILE B 219 O TYR B 228 ? O TYR B 228 
D 1 2 N ILE B 275 ? N ILE B 275 O LEU B 294 ? O LEU B 294 
D 2 3 N TYR B 295 ? N TYR B 295 O ILE B 330 ? O ILE B 330 
D 3 4 N VAL B 331 ? N VAL B 331 O ARG B 387 ? O ARG B 387 
D 4 5 N PHE B 390 ? N PHE B 390 O MET B 429 ? O MET B 429 
D 5 6 N VAL B 430 ? N VAL B 430 O SER B 450 ? O SER B 450 
D 6 7 N PHE B 449 ? N PHE B 449 O GLY B 500 ? O GLY B 500 
D 7 8 N MET B 501 ? N MET B 501 O SER B 524 ? O SER B 524 
D 8 9 O PHE B 523 ? O PHE B 523 N CYS B 272 ? N CYS B 272 
# 
_atom_sites.entry_id                    2N5T 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? 4.716   4.299   -33.733 1.00 0.00 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? 5.013   3.094   -32.903 1.00 0.00 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? 5.424   3.533   -31.492 1.00 0.00 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? 6.580   3.462   -31.120 1.00 0.00 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? 6.156   2.299   -33.559 1.00 0.00 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? 5.758   1.864   -34.990 1.00 0.00 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? 4.258   0.849   -34.936 1.00 0.00 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? 4.960   -0.585  -34.074 1.00 0.00 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? 5.194   5.127   -33.325 1.00 0.00 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? 3.689   4.464   -33.748 1.00 0.00 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? 5.058   4.145   -34.702 1.00 0.00 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? 4.132   2.473   -32.843 1.00 0.00 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? 7.040   2.919   -33.606 1.00 0.00 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? 6.366   1.421   -32.967 1.00 0.00 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? 5.574   2.741   -35.593 1.00 0.00 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? 6.563   1.293   -35.428 1.00 0.00 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? 5.990   -0.718  -34.378 1.00 0.00 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? 4.397   -1.469  -34.325 1.00 0.00 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? 4.913   -0.421  -33.006 1.00 0.00 ? 1   MET A HE3  1  
ATOM 20     N N    . ILE A 1 2   ? 4.475   3.978   -30.702 1.00 0.00 ? 2   ILE A N    1  
ATOM 21     C CA   . ILE A 1 2   ? 4.778   4.424   -29.302 1.00 0.00 ? 2   ILE A CA   1  
ATOM 22     C C    . ILE A 1 2   ? 4.226   3.389   -28.320 1.00 0.00 ? 2   ILE A C    1  
ATOM 23     O O    . ILE A 1 2   ? 3.082   2.989   -28.414 1.00 0.00 ? 2   ILE A O    1  
ATOM 24     C CB   . ILE A 1 2   ? 4.094   5.767   -29.032 1.00 0.00 ? 2   ILE A CB   1  
ATOM 25     C CG1  . ILE A 1 2   ? 4.511   6.796   -30.097 1.00 0.00 ? 2   ILE A CG1  1  
ATOM 26     C CG2  . ILE A 1 2   ? 4.508   6.262   -27.646 1.00 0.00 ? 2   ILE A CG2  1  
ATOM 27     C CD1  . ILE A 1 2   ? 3.419   6.922   -31.199 1.00 0.00 ? 2   ILE A CD1  1  
ATOM 28     H H    . ILE A 1 2   ? 3.553   4.016   -31.030 1.00 0.00 ? 2   ILE A H    1  
ATOM 29     H HA   . ILE A 1 2   ? 5.846   4.522   -29.171 1.00 0.00 ? 2   ILE A HA   1  
ATOM 30     H HB   . ILE A 1 2   ? 3.021   5.633   -29.058 1.00 0.00 ? 2   ILE A HB   1  
ATOM 31     H HG12 . ILE A 1 2   ? 4.652   7.758   -29.625 1.00 0.00 ? 2   ILE A HG12 1  
ATOM 32     H HG13 . ILE A 1 2   ? 5.439   6.483   -30.551 1.00 0.00 ? 2   ILE A HG13 1  
ATOM 33     H HG21 . ILE A 1 2   ? 4.040   5.650   -26.890 1.00 0.00 ? 2   ILE A HG21 1  
ATOM 34     H HG22 . ILE A 1 2   ? 4.196   7.289   -27.523 1.00 0.00 ? 2   ILE A HG22 1  
ATOM 35     H HG23 . ILE A 1 2   ? 5.582   6.199   -27.547 1.00 0.00 ? 2   ILE A HG23 1  
ATOM 36     H HD11 . ILE A 1 2   ? 2.981   5.952   -31.384 1.00 0.00 ? 2   ILE A HD11 1  
ATOM 37     H HD12 . ILE A 1 2   ? 3.867   7.294   -32.108 1.00 0.00 ? 2   ILE A HD12 1  
ATOM 38     H HD13 . ILE A 1 2   ? 2.652   7.608   -30.869 1.00 0.00 ? 2   ILE A HD13 1  
ATOM 39     N N    . SER A 1 3   ? 5.027   2.938   -27.382 1.00 0.00 ? 3   SER A N    1  
ATOM 40     C CA   . SER A 1 3   ? 4.548   1.914   -26.392 1.00 0.00 ? 3   SER A CA   1  
ATOM 41     C C    . SER A 1 3   ? 4.869   2.358   -24.962 1.00 0.00 ? 3   SER A C    1  
ATOM 42     O O    . SER A 1 3   ? 5.918   2.910   -24.691 1.00 0.00 ? 3   SER A O    1  
ATOM 43     C CB   . SER A 1 3   ? 5.253   0.587   -26.669 1.00 0.00 ? 3   SER A CB   1  
ATOM 44     O OG   . SER A 1 3   ? 4.822   -0.385  -25.722 1.00 0.00 ? 3   SER A OG   1  
ATOM 45     H H    . SER A 1 3   ? 5.948   3.270   -27.330 1.00 0.00 ? 3   SER A H    1  
ATOM 46     H HA   . SER A 1 3   ? 3.482   1.782   -26.497 1.00 0.00 ? 3   SER A HA   1  
ATOM 47     H HB2  . SER A 1 3   ? 5.007   0.247   -27.661 1.00 0.00 ? 3   SER A HB2  1  
ATOM 48     H HB3  . SER A 1 3   ? 6.323   0.727   -26.595 1.00 0.00 ? 3   SER A HB3  1  
ATOM 49     H HG   . SER A 1 3   ? 5.021   -0.052  -24.844 1.00 0.00 ? 3   SER A HG   1  
ATOM 50     N N    . GLY A 1 4   ? 3.970   2.102   -24.036 1.00 0.00 ? 4   GLY A N    1  
ATOM 51     C CA   . GLY A 1 4   ? 4.194   2.477   -22.603 1.00 0.00 ? 4   GLY A CA   1  
ATOM 52     C C    . GLY A 1 4   ? 4.068   1.212   -21.748 1.00 0.00 ? 4   GLY A C    1  
ATOM 53     O O    . GLY A 1 4   ? 4.216   0.111   -22.240 1.00 0.00 ? 4   GLY A O    1  
ATOM 54     H H    . GLY A 1 4   ? 3.140   1.645   -24.287 1.00 0.00 ? 4   GLY A H    1  
ATOM 55     H HA2  . GLY A 1 4   ? 5.182   2.900   -22.489 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 56     H HA3  . GLY A 1 4   ? 3.450   3.196   -22.294 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 57     N N    . ILE A 1 5   ? 3.821   1.347   -20.469 1.00 0.00 ? 5   ILE A N    1  
ATOM 58     C CA   . ILE A 1 5   ? 3.724   0.131   -19.597 1.00 0.00 ? 5   ILE A CA   1  
ATOM 59     C C    . ILE A 1 5   ? 2.265   -0.311  -19.438 1.00 0.00 ? 5   ILE A C    1  
ATOM 60     O O    . ILE A 1 5   ? 1.999   -1.390  -18.945 1.00 0.00 ? 5   ILE A O    1  
ATOM 61     C CB   . ILE A 1 5   ? 4.290   0.466   -18.218 1.00 0.00 ? 5   ILE A CB   1  
ATOM 62     C CG1  . ILE A 1 5   ? 4.867   -0.813  -17.593 1.00 0.00 ? 5   ILE A CG1  1  
ATOM 63     C CG2  . ILE A 1 5   ? 3.172   1.036   -17.328 1.00 0.00 ? 5   ILE A CG2  1  
ATOM 64     C CD1  . ILE A 1 5   ? 5.511   -0.514  -16.224 1.00 0.00 ? 5   ILE A CD1  1  
ATOM 65     H H    . ILE A 1 5   ? 3.721   2.241   -20.079 1.00 0.00 ? 5   ILE A H    1  
ATOM 66     H HA   . ILE A 1 5   ? 4.298   -0.672  -20.034 1.00 0.00 ? 5   ILE A HA   1  
ATOM 67     H HB   . ILE A 1 5   ? 5.074   1.203   -18.323 1.00 0.00 ? 5   ILE A HB   1  
ATOM 68     H HG12 . ILE A 1 5   ? 4.073   -1.534  -17.463 1.00 0.00 ? 5   ILE A HG12 1  
ATOM 69     H HG13 . ILE A 1 5   ? 5.616   -1.225  -18.255 1.00 0.00 ? 5   ILE A HG13 1  
ATOM 70     H HG21 . ILE A 1 5   ? 2.547   0.230   -16.973 1.00 0.00 ? 5   ILE A HG21 1  
ATOM 71     H HG22 . ILE A 1 5   ? 2.574   1.730   -17.901 1.00 0.00 ? 5   ILE A HG22 1  
ATOM 72     H HG23 . ILE A 1 5   ? 3.610   1.550   -16.485 1.00 0.00 ? 5   ILE A HG23 1  
ATOM 73     H HD11 . ILE A 1 5   ? 5.347   0.523   -15.968 1.00 0.00 ? 5   ILE A HD11 1  
ATOM 74     H HD12 . ILE A 1 5   ? 6.572   -0.708  -16.275 1.00 0.00 ? 5   ILE A HD12 1  
ATOM 75     H HD13 . ILE A 1 5   ? 5.064   -1.146  -15.471 1.00 0.00 ? 5   ILE A HD13 1  
ATOM 76     N N    . LEU A 1 6   ? 1.321   0.502   -19.837 1.00 0.00 ? 6   LEU A N    1  
ATOM 77     C CA   . LEU A 1 6   ? -0.116  0.108   -19.692 1.00 0.00 ? 6   LEU A CA   1  
ATOM 78     C C    . LEU A 1 6   ? -0.394  -0.291  -18.238 1.00 0.00 ? 6   LEU A C    1  
ATOM 79     O O    . LEU A 1 6   ? -0.039  -1.364  -17.796 1.00 0.00 ? 6   LEU A O    1  
ATOM 80     C CB   . LEU A 1 6   ? -0.420  -1.067  -20.635 1.00 0.00 ? 6   LEU A CB   1  
ATOM 81     C CG   . LEU A 1 6   ? -0.926  -0.564  -22.000 1.00 0.00 ? 6   LEU A CG   1  
ATOM 82     C CD1  . LEU A 1 6   ? 0.138   0.335   -22.661 1.00 0.00 ? 6   LEU A CD1  1  
ATOM 83     C CD2  . LEU A 1 6   ? -1.262  -1.780  -22.918 1.00 0.00 ? 6   LEU A CD2  1  
ATOM 84     H H    . LEU A 1 6   ? 1.554   1.369   -20.228 1.00 0.00 ? 6   LEU A H    1  
ATOM 85     H HA   . LEU A 1 6   ? -0.743  0.948   -19.956 1.00 0.00 ? 6   LEU A HA   1  
ATOM 86     H HB2  . LEU A 1 6   ? 0.480   -1.645  -20.782 1.00 0.00 ? 6   LEU A HB2  1  
ATOM 87     H HB3  . LEU A 1 6   ? -1.176  -1.695  -20.187 1.00 0.00 ? 6   LEU A HB3  1  
ATOM 88     H HG   . LEU A 1 6   ? -1.824  0.018   -21.844 1.00 0.00 ? 6   LEU A HG   1  
ATOM 89     H HD11 . LEU A 1 6   ? 1.040   -0.236  -22.825 1.00 0.00 ? 6   LEU A HD11 1  
ATOM 90     H HD12 . LEU A 1 6   ? 0.355   1.173   -22.013 1.00 0.00 ? 6   LEU A HD12 1  
ATOM 91     H HD13 . LEU A 1 6   ? -0.236  0.700   -23.607 1.00 0.00 ? 6   LEU A HD13 1  
ATOM 92     H HD21 . LEU A 1 6   ? -1.857  -1.444  -23.756 1.00 0.00 ? 6   LEU A HD21 1  
ATOM 93     H HD22 . LEU A 1 6   ? -1.818  -2.515  -22.355 1.00 0.00 ? 6   LEU A HD22 1  
ATOM 94     H HD23 . LEU A 1 6   ? -0.345  -2.222  -23.280 1.00 0.00 ? 6   LEU A HD23 1  
ATOM 95     N N    . ALA A 1 7   ? -1.039  0.572   -17.490 1.00 0.00 ? 7   ALA A N    1  
ATOM 96     C CA   . ALA A 1 7   ? -1.348  0.257   -16.063 1.00 0.00 ? 7   ALA A CA   1  
ATOM 97     C C    . ALA A 1 7   ? -2.762  -0.316  -15.953 1.00 0.00 ? 7   ALA A C    1  
ATOM 98     O O    . ALA A 1 7   ? -3.072  -1.045  -15.032 1.00 0.00 ? 7   ALA A O    1  
ATOM 99     C CB   . ALA A 1 7   ? -1.263  1.542   -15.244 1.00 0.00 ? 7   ALA A CB   1  
ATOM 100    H H    . ALA A 1 7   ? -1.321  1.430   -17.871 1.00 0.00 ? 7   ALA A H    1  
ATOM 101    H HA   . ALA A 1 7   ? -0.634  -0.460  -15.685 1.00 0.00 ? 7   ALA A HA   1  
ATOM 102    H HB1  . ALA A 1 7   ? -1.883  2.300   -15.698 1.00 0.00 ? 7   ALA A HB1  1  
ATOM 103    H HB2  . ALA A 1 7   ? -0.239  1.884   -15.216 1.00 0.00 ? 7   ALA A HB2  1  
ATOM 104    H HB3  . ALA A 1 7   ? -1.606  1.351   -14.237 1.00 0.00 ? 7   ALA A HB3  1  
ATOM 105    N N    . SER A 1 8   ? -3.624  0.013   -16.882 1.00 0.00 ? 8   SER A N    1  
ATOM 106    C CA   . SER A 1 8   ? -5.022  -0.516  -16.833 1.00 0.00 ? 8   SER A CA   1  
ATOM 107    C C    . SER A 1 8   ? -5.487  -0.839  -18.265 1.00 0.00 ? 8   SER A C    1  
ATOM 108    O O    . SER A 1 8   ? -5.418  0.011   -19.132 1.00 0.00 ? 8   SER A O    1  
ATOM 109    C CB   . SER A 1 8   ? -5.935  0.554   -16.228 1.00 0.00 ? 8   SER A CB   1  
ATOM 110    O OG   . SER A 1 8   ? -5.473  1.837   -16.625 1.00 0.00 ? 8   SER A OG   1  
ATOM 111    H H    . SER A 1 8   ? -3.352  0.606   -17.613 1.00 0.00 ? 8   SER A H    1  
ATOM 112    H HA   . SER A 1 8   ? -5.054  -1.410  -16.227 1.00 0.00 ? 8   SER A HA   1  
ATOM 113    H HB2  . SER A 1 8   ? -6.943  0.413   -16.581 1.00 0.00 ? 8   SER A HB2  1  
ATOM 114    H HB3  . SER A 1 8   ? -5.919  0.471   -15.149 1.00 0.00 ? 8   SER A HB3  1  
ATOM 115    H HG   . SER A 1 8   ? -4.903  2.175   -15.931 1.00 0.00 ? 8   SER A HG   1  
ATOM 116    N N    . PRO A 1 9   ? -5.953  -2.043  -18.530 1.00 0.00 ? 9   PRO A N    1  
ATOM 117    C CA   . PRO A 1 9   ? -6.423  -2.426  -19.890 1.00 0.00 ? 9   PRO A CA   1  
ATOM 118    C C    . PRO A 1 9   ? -7.846  -1.916  -20.165 1.00 0.00 ? 9   PRO A C    1  
ATOM 119    O O    . PRO A 1 9   ? -8.687  -1.900  -19.292 1.00 0.00 ? 9   PRO A O    1  
ATOM 120    C CB   . PRO A 1 9   ? -6.395  -3.956  -19.848 1.00 0.00 ? 9   PRO A CB   1  
ATOM 121    C CG   . PRO A 1 9   ? -6.708  -4.288  -18.424 1.00 0.00 ? 9   PRO A CG   1  
ATOM 122    C CD   . PRO A 1 9   ? -6.091  -3.170  -17.583 1.00 0.00 ? 9   PRO A CD   1  
ATOM 123    H HA   . PRO A 1 9   ? -5.740  -2.069  -20.642 1.00 0.00 ? 9   PRO A HA   1  
ATOM 124    H HB2  . PRO A 1 9   ? -7.146  -4.366  -20.511 1.00 0.00 ? 9   PRO A HB2  1  
ATOM 125    H HB3  . PRO A 1 9   ? -5.415  -4.324  -20.109 1.00 0.00 ? 9   PRO A HB3  1  
ATOM 126    H HG2  . PRO A 1 9   ? -7.780  -4.321  -18.278 1.00 0.00 ? 9   PRO A HG2  1  
ATOM 127    H HG3  . PRO A 1 9   ? -6.264  -5.233  -18.154 1.00 0.00 ? 9   PRO A HG3  1  
ATOM 128    H HD2  . PRO A 1 9   ? -6.746  -2.904  -16.764 1.00 0.00 ? 9   PRO A HD2  1  
ATOM 129    H HD3  . PRO A 1 9   ? -5.121  -3.467  -17.214 1.00 0.00 ? 9   PRO A HD3  1  
ATOM 130    N N    . GLY A 1 10  ? -8.113  -1.502  -21.370 1.00 0.00 ? 10  GLY A N    1  
ATOM 131    C CA   . GLY A 1 10  ? -9.476  -0.991  -21.702 1.00 0.00 ? 10  GLY A CA   1  
ATOM 132    C C    . GLY A 1 10  ? -9.396  -0.203  -23.007 1.00 0.00 ? 10  GLY A C    1  
ATOM 133    O O    . GLY A 1 10  ? -8.459  -0.342  -23.755 1.00 0.00 ? 10  GLY A O    1  
ATOM 134    H H    . GLY A 1 10  ? -7.417  -1.523  -22.060 1.00 0.00 ? 10  GLY A H    1  
ATOM 135    H HA2  . GLY A 1 10  ? -10.157 -1.823  -21.818 1.00 0.00 ? 10  GLY A HA2  1  
ATOM 136    H HA3  . GLY A 1 10  ? -9.824  -0.343  -20.913 1.00 0.00 ? 10  GLY A HA3  1  
ATOM 137    N N    . ILE A 1 11  ? -10.362 0.637   -23.283 1.00 0.00 ? 11  ILE A N    1  
ATOM 138    C CA   . ILE A 1 11  ? -10.326 1.458   -24.538 1.00 0.00 ? 11  ILE A CA   1  
ATOM 139    C C    . ILE A 1 11  ? -11.048 2.781   -24.262 1.00 0.00 ? 11  ILE A C    1  
ATOM 140    O O    . ILE A 1 11  ? -11.957 2.842   -23.457 1.00 0.00 ? 11  ILE A O    1  
ATOM 141    C CB   . ILE A 1 11  ? -11.011 0.738   -25.719 1.00 0.00 ? 11  ILE A CB   1  
ATOM 142    C CG1  . ILE A 1 11  ? -11.841 1.744   -26.545 1.00 0.00 ? 11  ILE A CG1  1  
ATOM 143    C CG2  . ILE A 1 11  ? -11.939 -0.368  -25.168 1.00 0.00 ? 11  ILE A CG2  1  
ATOM 144    C CD1  . ILE A 1 11  ? -10.918 2.796   -27.212 1.00 0.00 ? 11  ILE A CD1  1  
ATOM 145    H H    . ILE A 1 11  ? -11.108 0.742   -22.656 1.00 0.00 ? 11  ILE A H    1  
ATOM 146    H HA   . ILE A 1 11  ? -9.295  1.665   -24.793 1.00 0.00 ? 11  ILE A HA   1  
ATOM 147    H HB   . ILE A 1 11  ? -10.255 0.288   -26.349 1.00 0.00 ? 11  ILE A HB   1  
ATOM 148    H HG12 . ILE A 1 11  ? -12.386 1.211   -27.311 1.00 0.00 ? 11  ILE A HG12 1  
ATOM 149    H HG13 . ILE A 1 11  ? -12.541 2.247   -25.895 1.00 0.00 ? 11  ILE A HG13 1  
ATOM 150    H HG21 . ILE A 1 11  ? -12.897 0.060   -24.912 1.00 0.00 ? 11  ILE A HG21 1  
ATOM 151    H HG22 . ILE A 1 11  ? -11.494 -0.806  -24.287 1.00 0.00 ? 11  ILE A HG22 1  
ATOM 152    H HG23 . ILE A 1 11  ? -12.074 -1.132  -25.919 1.00 0.00 ? 11  ILE A HG23 1  
ATOM 153    H HD11 . ILE A 1 11  ? -9.916  2.698   -26.817 1.00 0.00 ? 11  ILE A HD11 1  
ATOM 154    H HD12 . ILE A 1 11  ? -11.292 3.787   -27.002 1.00 0.00 ? 11  ILE A HD12 1  
ATOM 155    H HD13 . ILE A 1 11  ? -10.902 2.635   -28.280 1.00 0.00 ? 11  ILE A HD13 1  
ATOM 156    N N    . ALA A 1 12  ? -10.665 3.850   -24.920 1.00 0.00 ? 12  ALA A N    1  
ATOM 157    C CA   . ALA A 1 12  ? -11.360 5.147   -24.663 1.00 0.00 ? 12  ALA A CA   1  
ATOM 158    C C    . ALA A 1 12  ? -11.222 6.096   -25.861 1.00 0.00 ? 12  ALA A C    1  
ATOM 159    O O    . ALA A 1 12  ? -10.283 6.021   -26.630 1.00 0.00 ? 12  ALA A O    1  
ATOM 160    C CB   . ALA A 1 12  ? -10.740 5.800   -23.430 1.00 0.00 ? 12  ALA A CB   1  
ATOM 161    H H    . ALA A 1 12  ? -9.934  3.797   -25.572 1.00 0.00 ? 12  ALA A H    1  
ATOM 162    H HA   . ALA A 1 12  ? -12.407 4.960   -24.476 1.00 0.00 ? 12  ALA A HA   1  
ATOM 163    H HB1  . ALA A 1 12  ? -11.470 6.438   -22.954 1.00 0.00 ? 12  ALA A HB1  1  
ATOM 164    H HB2  . ALA A 1 12  ? -9.885  6.390   -23.726 1.00 0.00 ? 12  ALA A HB2  1  
ATOM 165    H HB3  . ALA A 1 12  ? -10.426 5.034   -22.737 1.00 0.00 ? 12  ALA A HB3  1  
ATOM 166    N N    . PHE A 1 13  ? -12.154 7.006   -26.001 1.00 0.00 ? 13  PHE A N    1  
ATOM 167    C CA   . PHE A 1 13  ? -12.109 7.999   -27.119 1.00 0.00 ? 13  PHE A CA   1  
ATOM 168    C C    . PHE A 1 13  ? -12.400 9.389   -26.537 1.00 0.00 ? 13  PHE A C    1  
ATOM 169    O O    . PHE A 1 13  ? -13.402 9.577   -25.875 1.00 0.00 ? 13  PHE A O    1  
ATOM 170    C CB   . PHE A 1 13  ? -13.196 7.667   -28.156 1.00 0.00 ? 13  PHE A CB   1  
ATOM 171    C CG   . PHE A 1 13  ? -13.135 6.211   -28.551 1.00 0.00 ? 13  PHE A CG   1  
ATOM 172    C CD1  . PHE A 1 13  ? -13.589 5.219   -27.660 1.00 0.00 ? 13  PHE A CD1  1  
ATOM 173    C CD2  . PHE A 1 13  ? -12.635 5.843   -29.816 1.00 0.00 ? 13  PHE A CD2  1  
ATOM 174    C CE1  . PHE A 1 13  ? -13.548 3.862   -28.037 1.00 0.00 ? 13  PHE A CE1  1  
ATOM 175    C CE2  . PHE A 1 13  ? -12.589 4.488   -30.190 1.00 0.00 ? 13  PHE A CE2  1  
ATOM 176    C CZ   . PHE A 1 13  ? -13.046 3.496   -29.298 1.00 0.00 ? 13  PHE A CZ   1  
ATOM 177    H H    . PHE A 1 13  ? -12.887 7.046   -25.352 1.00 0.00 ? 13  PHE A H    1  
ATOM 178    H HA   . PHE A 1 13  ? -11.135 7.989   -27.586 1.00 0.00 ? 13  PHE A HA   1  
ATOM 179    H HB2  . PHE A 1 13  ? -14.167 7.880   -27.732 1.00 0.00 ? 13  PHE A HB2  1  
ATOM 180    H HB3  . PHE A 1 13  ? -13.049 8.281   -29.033 1.00 0.00 ? 13  PHE A HB3  1  
ATOM 181    H HD1  . PHE A 1 13  ? -13.973 5.499   -26.690 1.00 0.00 ? 13  PHE A HD1  1  
ATOM 182    H HD2  . PHE A 1 13  ? -12.285 6.602   -30.499 1.00 0.00 ? 13  PHE A HD2  1  
ATOM 183    H HE1  . PHE A 1 13  ? -13.896 3.101   -27.354 1.00 0.00 ? 13  PHE A HE1  1  
ATOM 184    H HE2  . PHE A 1 13  ? -12.205 4.208   -31.159 1.00 0.00 ? 13  PHE A HE2  1  
ATOM 185    H HZ   . PHE A 1 13  ? -13.016 2.456   -29.586 1.00 0.00 ? 13  PHE A HZ   1  
ATOM 186    N N    . GLY A 1 14  ? -11.565 10.375  -26.766 1.00 0.00 ? 14  GLY A N    1  
ATOM 187    C CA   . GLY A 1 14  ? -11.874 11.722  -26.193 1.00 0.00 ? 14  GLY A CA   1  
ATOM 188    C C    . GLY A 1 14  ? -10.786 12.741  -26.572 1.00 0.00 ? 14  GLY A C    1  
ATOM 189    O O    . GLY A 1 14  ? -9.818  12.423  -27.234 1.00 0.00 ? 14  GLY A O    1  
ATOM 190    H H    . GLY A 1 14  ? -10.759 10.233  -27.304 1.00 0.00 ? 14  GLY A H    1  
ATOM 191    H HA2  . GLY A 1 14  ? -12.828 12.059  -26.575 1.00 0.00 ? 14  GLY A HA2  1  
ATOM 192    H HA3  . GLY A 1 14  ? -11.928 11.646  -25.118 1.00 0.00 ? 14  GLY A HA3  1  
ATOM 193    N N    . LYS A 1 15  ? -10.961 13.963  -26.147 1.00 0.00 ? 15  LYS A N    1  
ATOM 194    C CA   . LYS A 1 15  ? -9.965  15.034  -26.464 1.00 0.00 ? 15  LYS A CA   1  
ATOM 195    C C    . LYS A 1 15  ? -8.780  14.913  -25.509 1.00 0.00 ? 15  LYS A C    1  
ATOM 196    O O    . LYS A 1 15  ? -8.869  14.286  -24.471 1.00 0.00 ? 15  LYS A O    1  
ATOM 197    C CB   . LYS A 1 15  ? -10.624 16.404  -26.313 1.00 0.00 ? 15  LYS A CB   1  
ATOM 198    C CG   . LYS A 1 15  ? -11.705 16.560  -27.386 1.00 0.00 ? 15  LYS A CG   1  
ATOM 199    C CD   . LYS A 1 15  ? -12.375 17.932  -27.257 1.00 0.00 ? 15  LYS A CD   1  
ATOM 200    C CE   . LYS A 1 15  ? -13.447 18.076  -28.335 1.00 0.00 ? 15  LYS A CE   1  
ATOM 201    N NZ   . LYS A 1 15  ? -14.108 19.405  -28.213 1.00 0.00 ? 15  LYS A NZ   1  
ATOM 202    H H    . LYS A 1 15  ? -11.755 14.183  -25.617 1.00 0.00 ? 15  LYS A H    1  
ATOM 203    H HA   . LYS A 1 15  ? -9.619  14.911  -27.480 1.00 0.00 ? 15  LYS A HA   1  
ATOM 204    H HB2  . LYS A 1 15  ? -11.072 16.484  -25.333 1.00 0.00 ? 15  LYS A HB2  1  
ATOM 205    H HB3  . LYS A 1 15  ? -9.882  17.178  -26.436 1.00 0.00 ? 15  LYS A HB3  1  
ATOM 206    H HG2  . LYS A 1 15  ? -11.254 16.471  -28.365 1.00 0.00 ? 15  LYS A HG2  1  
ATOM 207    H HG3  . LYS A 1 15  ? -12.449 15.787  -27.261 1.00 0.00 ? 15  LYS A HG3  1  
ATOM 208    H HD2  . LYS A 1 15  ? -12.829 18.021  -26.280 1.00 0.00 ? 15  LYS A HD2  1  
ATOM 209    H HD3  . LYS A 1 15  ? -11.634 18.709  -27.381 1.00 0.00 ? 15  LYS A HD3  1  
ATOM 210    H HE2  . LYS A 1 15  ? -12.990 17.991  -29.309 1.00 0.00 ? 15  LYS A HE2  1  
ATOM 211    H HE3  . LYS A 1 15  ? -14.184 17.296  -28.215 1.00 0.00 ? 15  LYS A HE3  1  
ATOM 212    H HZ1  . LYS A 1 15  ? -13.469 20.067  -27.728 1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 213    H HZ2  . LYS A 1 15  ? -14.986 19.305  -27.665 1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 214    H HZ3  . LYS A 1 15  ? -14.329 19.772  -29.160 1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 215    N N    . ALA A 1 16  ? -7.651  15.477  -25.871 1.00 0.00 ? 16  ALA A N    1  
ATOM 216    C CA   . ALA A 1 16  ? -6.433  15.365  -24.998 1.00 0.00 ? 16  ALA A CA   1  
ATOM 217    C C    . ALA A 1 16  ? -6.163  16.679  -24.252 1.00 0.00 ? 16  ALA A C    1  
ATOM 218    O O    . ALA A 1 16  ? -6.090  17.741  -24.839 1.00 0.00 ? 16  ALA A O    1  
ATOM 219    C CB   . ALA A 1 16  ? -5.227  15.008  -25.883 1.00 0.00 ? 16  ALA A CB   1  
ATOM 220    H H    . ALA A 1 16  ? -7.596  15.953  -26.726 1.00 0.00 ? 16  ALA A H    1  
ATOM 221    H HA   . ALA A 1 16  ? -6.586  14.574  -24.278 1.00 0.00 ? 16  ALA A HA   1  
ATOM 222    H HB1  . ALA A 1 16  ? -5.569  14.489  -26.766 1.00 0.00 ? 16  ALA A HB1  1  
ATOM 223    H HB2  . ALA A 1 16  ? -4.550  14.372  -25.331 1.00 0.00 ? 16  ALA A HB2  1  
ATOM 224    H HB3  . ALA A 1 16  ? -4.713  15.914  -26.174 1.00 0.00 ? 16  ALA A HB3  1  
ATOM 225    N N    . LEU A 1 17  ? -5.986  16.597  -22.956 1.00 0.00 ? 17  LEU A N    1  
ATOM 226    C CA   . LEU A 1 17  ? -5.694  17.816  -22.148 1.00 0.00 ? 17  LEU A CA   1  
ATOM 227    C C    . LEU A 1 17  ? -4.186  17.841  -21.868 1.00 0.00 ? 17  LEU A C    1  
ATOM 228    O O    . LEU A 1 17  ? -3.608  16.836  -21.514 1.00 0.00 ? 17  LEU A O    1  
ATOM 229    C CB   . LEU A 1 17  ? -6.470  17.748  -20.826 1.00 0.00 ? 17  LEU A CB   1  
ATOM 230    C CG   . LEU A 1 17  ? -6.132  18.954  -19.938 1.00 0.00 ? 17  LEU A CG   1  
ATOM 231    C CD1  . LEU A 1 17  ? -6.521  20.259  -20.648 1.00 0.00 ? 17  LEU A CD1  1  
ATOM 232    C CD2  . LEU A 1 17  ? -6.915  18.842  -18.628 1.00 0.00 ? 17  LEU A CD2  1  
ATOM 233    H H    . LEU A 1 17  ? -6.030  15.723  -22.516 1.00 0.00 ? 17  LEU A H    1  
ATOM 234    H HA   . LEU A 1 17  ? -5.980  18.700  -22.700 1.00 0.00 ? 17  LEU A HA   1  
ATOM 235    H HB2  . LEU A 1 17  ? -7.530  17.746  -21.034 1.00 0.00 ? 17  LEU A HB2  1  
ATOM 236    H HB3  . LEU A 1 17  ? -6.208  16.839  -20.305 1.00 0.00 ? 17  LEU A HB3  1  
ATOM 237    H HG   . LEU A 1 17  ? -5.072  18.960  -19.727 1.00 0.00 ? 17  LEU A HG   1  
ATOM 238    H HD11 . LEU A 1 17  ? -7.396  20.090  -21.257 1.00 0.00 ? 17  LEU A HD11 1  
ATOM 239    H HD12 . LEU A 1 17  ? -5.704  20.586  -21.274 1.00 0.00 ? 17  LEU A HD12 1  
ATOM 240    H HD13 . LEU A 1 17  ? -6.736  21.019  -19.912 1.00 0.00 ? 17  LEU A HD13 1  
ATOM 241    H HD21 . LEU A 1 17  ? -6.274  18.435  -17.859 1.00 0.00 ? 17  LEU A HD21 1  
ATOM 242    H HD22 . LEU A 1 17  ? -7.764  18.190  -18.770 1.00 0.00 ? 17  LEU A HD22 1  
ATOM 243    H HD23 . LEU A 1 17  ? -7.258  19.821  -18.328 1.00 0.00 ? 17  LEU A HD23 1  
ATOM 244    N N    . LEU A 1 18  ? -3.542  18.976  -22.029 1.00 0.00 ? 18  LEU A N    1  
ATOM 245    C CA   . LEU A 1 18  ? -2.060  19.055  -21.787 1.00 0.00 ? 18  LEU A CA   1  
ATOM 246    C C    . LEU A 1 18  ? -1.752  20.012  -20.629 1.00 0.00 ? 18  LEU A C    1  
ATOM 247    O O    . LEU A 1 18  ? -2.113  21.172  -20.651 1.00 0.00 ? 18  LEU A O    1  
ATOM 248    C CB   . LEU A 1 18  ? -1.386  19.567  -23.067 1.00 0.00 ? 18  LEU A CB   1  
ATOM 249    C CG   . LEU A 1 18  ? 0.135   19.663  -22.881 1.00 0.00 ? 18  LEU A CG   1  
ATOM 250    C CD1  . LEU A 1 18  ? 0.721   18.279  -22.545 1.00 0.00 ? 18  LEU A CD1  1  
ATOM 251    C CD2  . LEU A 1 18  ? 0.775   20.195  -24.182 1.00 0.00 ? 18  LEU A CD2  1  
ATOM 252    H H    . LEU A 1 18  ? -4.030  19.774  -22.320 1.00 0.00 ? 18  LEU A H    1  
ATOM 253    H HA   . LEU A 1 18  ? -1.681  18.073  -21.552 1.00 0.00 ? 18  LEU A HA   1  
ATOM 254    H HB2  . LEU A 1 18  ? -1.603  18.888  -23.879 1.00 0.00 ? 18  LEU A HB2  1  
ATOM 255    H HB3  . LEU A 1 18  ? -1.776  20.546  -23.308 1.00 0.00 ? 18  LEU A HB3  1  
ATOM 256    H HG   . LEU A 1 18  ? 0.351   20.345  -22.072 1.00 0.00 ? 18  LEU A HG   1  
ATOM 257    H HD11 . LEU A 1 18  ? 1.751   18.236  -22.867 1.00 0.00 ? 18  LEU A HD11 1  
ATOM 258    H HD12 . LEU A 1 18  ? 0.152   17.513  -23.052 1.00 0.00 ? 18  LEU A HD12 1  
ATOM 259    H HD13 . LEU A 1 18  ? 0.671   18.116  -21.478 1.00 0.00 ? 18  LEU A HD13 1  
ATOM 260    H HD21 . LEU A 1 18  ? 1.736   20.634  -23.956 1.00 0.00 ? 18  LEU A HD21 1  
ATOM 261    H HD22 . LEU A 1 18  ? 0.131   20.943  -24.620 1.00 0.00 ? 18  LEU A HD22 1  
ATOM 262    H HD23 . LEU A 1 18  ? 0.906   19.381  -24.879 1.00 0.00 ? 18  LEU A HD23 1  
ATOM 263    N N    . LEU A 1 19  ? -1.086  19.518  -19.616 1.00 0.00 ? 19  LEU A N    1  
ATOM 264    C CA   . LEU A 1 19  ? -0.748  20.383  -18.446 1.00 0.00 ? 19  LEU A CA   1  
ATOM 265    C C    . LEU A 1 19  ? 0.583   21.110  -18.688 1.00 0.00 ? 19  LEU A C    1  
ATOM 266    O O    . LEU A 1 19  ? 1.646   20.528  -18.575 1.00 0.00 ? 19  LEU A O    1  
ATOM 267    C CB   . LEU A 1 19  ? -0.624  19.525  -17.183 1.00 0.00 ? 19  LEU A CB   1  
ATOM 268    C CG   . LEU A 1 19  ? -1.894  18.689  -16.973 1.00 0.00 ? 19  LEU A CG   1  
ATOM 269    C CD1  . LEU A 1 19  ? -1.736  17.841  -15.707 1.00 0.00 ? 19  LEU A CD1  1  
ATOM 270    C CD2  . LEU A 1 19  ? -3.113  19.610  -16.825 1.00 0.00 ? 19  LEU A CD2  1  
ATOM 271    H H    . LEU A 1 19  ? -0.811  18.577  -19.624 1.00 0.00 ? 19  LEU A H    1  
ATOM 272    H HA   . LEU A 1 19  ? -1.532  21.113  -18.305 1.00 0.00 ? 19  LEU A HA   1  
ATOM 273    H HB2  . LEU A 1 19  ? 0.226   18.865  -17.283 1.00 0.00 ? 19  LEU A HB2  1  
ATOM 274    H HB3  . LEU A 1 19  ? -0.476  20.169  -16.328 1.00 0.00 ? 19  LEU A HB3  1  
ATOM 275    H HG   . LEU A 1 19  ? -2.036  18.037  -17.824 1.00 0.00 ? 19  LEU A HG   1  
ATOM 276    H HD11 . LEU A 1 19  ? -2.351  16.957  -15.788 1.00 0.00 ? 19  LEU A HD11 1  
ATOM 277    H HD12 . LEU A 1 19  ? -2.043  18.417  -14.847 1.00 0.00 ? 19  LEU A HD12 1  
ATOM 278    H HD13 . LEU A 1 19  ? -0.701  17.551  -15.596 1.00 0.00 ? 19  LEU A HD13 1  
ATOM 279    H HD21 . LEU A 1 19  ? -2.831  20.496  -16.274 1.00 0.00 ? 19  LEU A HD21 1  
ATOM 280    H HD22 . LEU A 1 19  ? -3.896  19.089  -16.294 1.00 0.00 ? 19  LEU A HD22 1  
ATOM 281    H HD23 . LEU A 1 19  ? -3.470  19.894  -17.804 1.00 0.00 ? 19  LEU A HD23 1  
ATOM 282    N N    . LYS A 1 20  ? 0.581   22.283  -19.227 1.00 0.00 ? 20  LYS A N    1  
ATOM 283    C CA   . LYS A 1 20  ? 1.905   22.849  -19.607 1.00 0.00 ? 20  LYS A CA   1  
ATOM 284    C C    . LYS A 1 20  ? 2.737   23.168  -18.376 1.00 0.00 ? 20  LYS A C    1  
ATOM 285    O O    . LYS A 1 20  ? 2.489   24.107  -17.647 1.00 0.00 ? 20  LYS A O    1  
ATOM 286    C CB   . LYS A 1 20  ? 1.726   24.060  -20.514 1.00 0.00 ? 20  LYS A CB   1  
ATOM 287    C CG   . LYS A 1 20  ? 1.101   23.596  -21.841 1.00 0.00 ? 20  LYS A CG   1  
ATOM 288    C CD   . LYS A 1 20  ? 0.927   24.787  -22.783 1.00 0.00 ? 20  LYS A CD   1  
ATOM 289    C CE   . LYS A 1 20  ? 0.315   24.323  -24.105 1.00 0.00 ? 20  LYS A CE   1  
ATOM 290    N NZ   . LYS A 1 20  ? 0.152   25.499  -25.008 1.00 0.00 ? 20  LYS A NZ   1  
ATOM 291    H H    . LYS A 1 20  ? -0.255  22.721  -19.489 1.00 0.00 ? 20  LYS A H    1  
ATOM 292    H HA   . LYS A 1 20  ? 2.435   22.089  -20.165 1.00 0.00 ? 20  LYS A HA   1  
ATOM 293    H HB2  . LYS A 1 20  ? 1.084   24.769  -20.041 1.00 0.00 ? 20  LYS A HB2  1  
ATOM 294    H HB3  . LYS A 1 20  ? 2.682   24.510  -20.710 1.00 0.00 ? 20  LYS A HB3  1  
ATOM 295    H HG2  . LYS A 1 20  ? 1.746   22.865  -22.303 1.00 0.00 ? 20  LYS A HG2  1  
ATOM 296    H HG3  . LYS A 1 20  ? 0.136   23.152  -21.646 1.00 0.00 ? 20  LYS A HG3  1  
ATOM 297    H HD2  . LYS A 1 20  ? 0.264   25.496  -22.326 1.00 0.00 ? 20  LYS A HD2  1  
ATOM 298    H HD3  . LYS A 1 20  ? 1.884   25.250  -22.971 1.00 0.00 ? 20  LYS A HD3  1  
ATOM 299    H HE2  . LYS A 1 20  ? 0.965   23.598  -24.569 1.00 0.00 ? 20  LYS A HE2  1  
ATOM 300    H HE3  . LYS A 1 20  ? -0.650  23.875  -23.919 1.00 0.00 ? 20  LYS A HE3  1  
ATOM 301    H HZ1  . LYS A 1 20  ? 1.056   26.003  -25.087 1.00 0.00 ? 20  LYS A HZ1  1  
ATOM 302    H HZ2  . LYS A 1 20  ? -0.570  26.137  -24.616 1.00 0.00 ? 20  LYS A HZ2  1  
ATOM 303    H HZ3  . LYS A 1 20  ? -0.146  25.175  -25.951 1.00 0.00 ? 20  LYS A HZ3  1  
ATOM 304    N N    . GLU A 1 21  ? 3.733   22.352  -18.156 1.00 0.00 ? 21  GLU A N    1  
ATOM 305    C CA   . GLU A 1 21  ? 4.631   22.529  -16.988 1.00 0.00 ? 21  GLU A CA   1  
ATOM 306    C C    . GLU A 1 21  ? 5.186   23.950  -16.992 1.00 0.00 ? 21  GLU A C    1  
ATOM 307    O O    . GLU A 1 21  ? 5.875   24.340  -16.071 1.00 0.00 ? 21  GLU A O    1  
ATOM 308    C CB   . GLU A 1 21  ? 5.797   21.517  -17.066 1.00 0.00 ? 21  GLU A CB   1  
ATOM 309    C CG   . GLU A 1 21  ? 6.732   21.868  -18.229 1.00 0.00 ? 21  GLU A CG   1  
ATOM 310    C CD   . GLU A 1 21  ? 7.715   22.960  -17.793 1.00 0.00 ? 21  GLU A CD   1  
ATOM 311    O OE1  . GLU A 1 21  ? 7.927   23.098  -16.600 1.00 0.00 ? 21  GLU A OE1  1  
ATOM 312    O OE2  . GLU A 1 21  ? 8.238   23.639  -18.662 1.00 0.00 ? 21  GLU A OE2  1  
ATOM 313    H H    . GLU A 1 21  ? 3.888   21.608  -18.772 1.00 0.00 ? 21  GLU A H    1  
ATOM 314    H HA   . GLU A 1 21  ? 4.072   22.366  -16.077 1.00 0.00 ? 21  GLU A HA   1  
ATOM 315    H HB2  . GLU A 1 21  ? 6.361   21.528  -16.142 1.00 0.00 ? 21  GLU A HB2  1  
ATOM 316    H HB3  . GLU A 1 21  ? 5.398   20.525  -17.223 1.00 0.00 ? 21  GLU A HB3  1  
ATOM 317    H HG2  . GLU A 1 21  ? 7.285   20.986  -18.520 1.00 0.00 ? 21  GLU A HG2  1  
ATOM 318    H HG3  . GLU A 1 21  ? 6.152   22.219  -19.069 1.00 0.00 ? 21  GLU A HG3  1  
ATOM 319    N N    . ASP A 1 22  ? 4.919   24.709  -18.107 1.00 0.00 ? 22  ASP A N    1  
ATOM 320    C CA   . ASP A 1 22  ? 5.408   26.129  -18.382 1.00 0.00 ? 22  ASP A CA   1  
ATOM 321    C C    . ASP A 1 22  ? 5.520   27.088  -17.164 1.00 0.00 ? 22  ASP A C    1  
ATOM 322    O O    . ASP A 1 22  ? 4.992   26.816  -16.086 1.00 0.00 ? 22  ASP A O    1  
ATOM 323    C CB   . ASP A 1 22  ? 4.410   26.839  -19.295 1.00 0.00 ? 22  ASP A CB   1  
ATOM 324    C CG   . ASP A 1 22  ? 4.405   26.347  -20.738 1.00 0.00 ? 22  ASP A CG   1  
ATOM 325    O OD1  . ASP A 1 22  ? 5.317   25.663  -21.172 1.00 0.00 ? 22  ASP A OD1  1  
ATOM 326    O OD2  . ASP A 1 22  ? 3.403   26.634  -21.373 1.00 0.00 ? 22  ASP A OD2  1  
ATOM 327    H H    . ASP A 1 22  ? 4.394   24.282  -18.814 1.00 0.00 ? 22  ASP A H    1  
ATOM 328    H HA   . ASP A 1 22  ? 6.357   26.085  -18.888 1.00 0.00 ? 22  ASP A HA   1  
ATOM 329    H HB2  . ASP A 1 22  ? 3.420   26.702  -18.889 1.00 0.00 ? 22  ASP A HB2  1  
ATOM 330    H HB3  . ASP A 1 22  ? 4.637   27.896  -19.290 1.00 0.00 ? 22  ASP A HB3  1  
ATOM 331    N N    . GLU A 1 23  ? 6.252   28.236  -17.383 1.00 0.00 ? 23  GLU A N    1  
ATOM 332    C CA   . GLU A 1 23  ? 6.475   29.262  -16.324 1.00 0.00 ? 23  GLU A CA   1  
ATOM 333    C C    . GLU A 1 23  ? 6.405   30.739  -16.879 1.00 0.00 ? 23  GLU A C    1  
ATOM 334    O O    . GLU A 1 23  ? 6.682   30.980  -18.055 1.00 0.00 ? 23  GLU A O    1  
ATOM 335    C CB   . GLU A 1 23  ? 7.843   29.010  -15.673 1.00 0.00 ? 23  GLU A CB   1  
ATOM 336    C CG   . GLU A 1 23  ? 7.905   29.682  -14.294 1.00 0.00 ? 23  GLU A CG   1  
ATOM 337    C CD   . GLU A 1 23  ? 6.957   28.919  -13.370 1.00 0.00 ? 23  GLU A CD   1  
ATOM 338    O OE1  . GLU A 1 23  ? 6.503   27.877  -13.814 1.00 0.00 ? 23  GLU A OE1  1  
ATOM 339    O OE2  . GLU A 1 23  ? 6.620   29.412  -12.307 1.00 0.00 ? 23  GLU A OE2  1  
ATOM 340    H H    . GLU A 1 23  ? 6.649   28.379  -18.267 1.00 0.00 ? 23  GLU A H    1  
ATOM 341    H HA   . GLU A 1 23  ? 5.705   29.149  -15.581 1.00 0.00 ? 23  GLU A HA   1  
ATOM 342    H HB2  . GLU A 1 23  ? 8.002   27.946  -15.568 1.00 0.00 ? 23  GLU A HB2  1  
ATOM 343    H HB3  . GLU A 1 23  ? 8.617   29.423  -16.303 1.00 0.00 ? 23  GLU A HB3  1  
ATOM 344    H HG2  . GLU A 1 23  ? 8.914   29.636  -13.909 1.00 0.00 ? 23  GLU A HG2  1  
ATOM 345    H HG3  . GLU A 1 23  ? 7.586   30.710  -14.372 1.00 0.00 ? 23  GLU A HG3  1  
ATOM 346    N N    . ILE A 1 24  ? 6.000   31.706  -16.003 1.00 0.00 ? 24  ILE A N    1  
ATOM 347    C CA   . ILE A 1 24  ? 5.841   33.172  -16.346 1.00 0.00 ? 24  ILE A CA   1  
ATOM 348    C C    . ILE A 1 24  ? 7.201   33.904  -16.464 1.00 0.00 ? 24  ILE A C    1  
ATOM 349    O O    . ILE A 1 24  ? 8.008   33.830  -15.538 1.00 0.00 ? 24  ILE A O    1  
ATOM 350    C CB   . ILE A 1 24  ? 5.057   33.831  -15.201 1.00 0.00 ? 24  ILE A CB   1  
ATOM 351    C CG1  . ILE A 1 24  ? 3.674   33.185  -15.093 1.00 0.00 ? 24  ILE A CG1  1  
ATOM 352    C CG2  . ILE A 1 24  ? 4.888   35.342  -15.441 1.00 0.00 ? 24  ILE A CG2  1  
ATOM 353    C CD1  . ILE A 1 24  ? 2.992   33.648  -13.802 1.00 0.00 ? 24  ILE A CD1  1  
ATOM 354    H H    . ILE A 1 24  ? 5.780   31.428  -15.089 1.00 0.00 ? 24  ILE A H    1  
ATOM 355    H HA   . ILE A 1 24  ? 5.287   33.276  -17.265 1.00 0.00 ? 24  ILE A HA   1  
ATOM 356    H HB   . ILE A 1 24  ? 5.592   33.679  -14.275 1.00 0.00 ? 24  ILE A HB   1  
ATOM 357    H HG12 . ILE A 1 24  ? 3.073   33.477  -15.941 1.00 0.00 ? 24  ILE A HG12 1  
ATOM 358    H HG13 . ILE A 1 24  ? 3.777   32.111  -15.077 1.00 0.00 ? 24  ILE A HG13 1  
ATOM 359    H HG21 . ILE A 1 24  ? 5.780   35.768  -15.863 1.00 0.00 ? 24  ILE A HG21 1  
ATOM 360    H HG22 . ILE A 1 24  ? 4.691   35.825  -14.498 1.00 0.00 ? 24  ILE A HG22 1  
ATOM 361    H HG23 . ILE A 1 24  ? 4.061   35.506  -16.115 1.00 0.00 ? 24  ILE A HG23 1  
ATOM 362    H HD11 . ILE A 1 24  ? 2.994   32.840  -13.085 1.00 0.00 ? 24  ILE A HD11 1  
ATOM 363    H HD12 . ILE A 1 24  ? 1.975   33.936  -14.017 1.00 0.00 ? 24  ILE A HD12 1  
ATOM 364    H HD13 . ILE A 1 24  ? 3.527   34.493  -13.393 1.00 0.00 ? 24  ILE A HD13 1  
ATOM 365    N N    . VAL A 1 25  ? 7.440   34.633  -17.548 1.00 0.00 ? 25  VAL A N    1  
ATOM 366    C CA   . VAL A 1 25  ? 8.657   35.393  -17.723 1.00 0.00 ? 25  VAL A CA   1  
ATOM 367    C C    . VAL A 1 25  ? 8.234   36.843  -17.756 1.00 0.00 ? 25  VAL A C    1  
ATOM 368    O O    . VAL A 1 25  ? 7.348   37.236  -18.517 1.00 0.00 ? 25  VAL A O    1  
ATOM 369    C CB   . VAL A 1 25  ? 9.418   35.011  -19.022 1.00 0.00 ? 25  VAL A CB   1  
ATOM 370    C CG1  . VAL A 1 25  ? 10.687  35.870  -19.169 1.00 0.00 ? 25  VAL A CG1  1  
ATOM 371    C CG2  . VAL A 1 25  ? 9.772   33.510  -19.030 1.00 0.00 ? 25  VAL A CG2  1  
ATOM 372    H H    . VAL A 1 25  ? 6.717   34.753  -18.199 1.00 0.00 ? 25  VAL A H    1  
ATOM 373    H HA   . VAL A 1 25  ? 9.300   35.231  -16.868 1.00 0.00 ? 25  VAL A HA   1  
ATOM 374    H HB   . VAL A 1 25  ? 8.772   35.219  -19.864 1.00 0.00 ? 25  VAL A HB   1  
ATOM 375    H HG11 . VAL A 1 25  ? 11.200  35.601  -20.081 1.00 0.00 ? 25  VAL A HG11 1  
ATOM 376    H HG12 . VAL A 1 25  ? 11.339  35.697  -18.325 1.00 0.00 ? 25  VAL A HG12 1  
ATOM 377    H HG13 . VAL A 1 25  ? 10.413  36.914  -19.204 1.00 0.00 ? 25  VAL A HG13 1  
ATOM 378    H HG21 . VAL A 1 25  ? 10.656  33.346  -18.432 1.00 0.00 ? 25  VAL A HG21 1  
ATOM 379    H HG22 . VAL A 1 25  ? 9.958   33.190  -20.044 1.00 0.00 ? 25  VAL A HG22 1  
ATOM 380    H HG23 . VAL A 1 25  ? 8.949   32.944  -18.619 1.00 0.00 ? 25  VAL A HG23 1  
ATOM 381    N N    . ILE A 1 26  ? 8.855   37.631  -16.896 1.00 0.00 ? 26  ILE A N    1  
ATOM 382    C CA   . ILE A 1 26  ? 8.496   39.031  -16.757 1.00 0.00 ? 26  ILE A CA   1  
ATOM 383    C C    . ILE A 1 26  ? 9.316   39.833  -17.746 1.00 0.00 ? 26  ILE A C    1  
ATOM 384    O O    . ILE A 1 26  ? 10.510  39.581  -17.882 1.00 0.00 ? 26  ILE A O    1  
ATOM 385    C CB   . ILE A 1 26  ? 8.794   39.540  -15.323 1.00 0.00 ? 26  ILE A CB   1  
ATOM 386    C CG1  . ILE A 1 26  ? 8.070   38.693  -14.258 1.00 0.00 ? 26  ILE A CG1  1  
ATOM 387    C CG2  . ILE A 1 26  ? 8.473   41.037  -15.188 1.00 0.00 ? 26  ILE A CG2  1  
ATOM 388    C CD1  . ILE A 1 26  ? 6.543   38.662  -14.373 1.00 0.00 ? 26  ILE A CD1  1  
ATOM 389    H H    . ILE A 1 26  ? 9.535   37.250  -16.302 1.00 0.00 ? 26  ILE A H    1  
ATOM 390    H HA   . ILE A 1 26  ? 7.446   39.157  -16.972 1.00 0.00 ? 26  ILE A HA   1  
ATOM 391    H HB   . ILE A 1 26  ? 9.861   39.429  -15.163 1.00 0.00 ? 26  ILE A HB   1  
ATOM 392    H HG12 . ILE A 1 26  ? 8.431   37.679  -14.329 1.00 0.00 ? 26  ILE A HG12 1  
ATOM 393    H HG13 . ILE A 1 26  ? 8.334   39.078  -13.282 1.00 0.00 ? 26  ILE A HG13 1  
ATOM 394    H HG21 . ILE A 1 26  ? 9.127   41.605  -15.834 1.00 0.00 ? 26  ILE A HG21 1  
ATOM 395    H HG22 . ILE A 1 26  ? 8.622   41.347  -14.164 1.00 0.00 ? 26  ILE A HG22 1  
ATOM 396    H HG23 . ILE A 1 26  ? 7.446   41.212  -15.472 1.00 0.00 ? 26  ILE A HG23 1  
ATOM 397    H HD11 . ILE A 1 26  ? 6.259   38.069  -15.231 1.00 0.00 ? 26  ILE A HD11 1  
ATOM 398    H HD12 . ILE A 1 26  ? 6.171   39.669  -14.492 1.00 0.00 ? 26  ILE A HD12 1  
ATOM 399    H HD13 . ILE A 1 26  ? 6.123   38.226  -13.479 1.00 0.00 ? 26  ILE A HD13 1  
ATOM 400    N N    . ASP A 1 27  ? 8.693   40.782  -18.442 1.00 0.00 ? 27  ASP A N    1  
ATOM 401    C CA   . ASP A 1 27  ? 9.459   41.680  -19.308 1.00 0.00 ? 27  ASP A CA   1  
ATOM 402    C C    . ASP A 1 27  ? 9.857   42.954  -18.569 1.00 0.00 ? 27  ASP A C    1  
ATOM 403    O O    . ASP A 1 27  ? 9.085   43.921  -18.472 1.00 0.00 ? 27  ASP A O    1  
ATOM 404    C CB   . ASP A 1 27  ? 8.741   41.982  -20.625 1.00 0.00 ? 27  ASP A CB   1  
ATOM 405    C CG   . ASP A 1 27  ? 9.516   42.969  -21.503 1.00 0.00 ? 27  ASP A CG   1  
ATOM 406    O OD1  . ASP A 1 27  ? 10.583  43.471  -21.099 1.00 0.00 ? 27  ASP A OD1  1  
ATOM 407    O OD2  . ASP A 1 27  ? 9.049   43.254  -22.616 1.00 0.00 ? 27  ASP A OD2  1  
ATOM 408    H H    . ASP A 1 27  ? 7.736   40.939  -18.303 1.00 0.00 ? 27  ASP A H    1  
ATOM 409    H HA   . ASP A 1 27  ? 10.378  41.165  -19.555 1.00 0.00 ? 27  ASP A HA   1  
ATOM 410    H HB2  . ASP A 1 27  ? 8.611   41.060  -21.170 1.00 0.00 ? 27  ASP A HB2  1  
ATOM 411    H HB3  . ASP A 1 27  ? 7.768   42.397  -20.404 1.00 0.00 ? 27  ASP A HB3  1  
ATOM 412    N N    . ARG A 1 28  ? 11.089  42.939  -18.070 1.00 0.00 ? 28  ARG A N    1  
ATOM 413    C CA   . ARG A 1 28  ? 11.588  44.000  -17.200 1.00 0.00 ? 28  ARG A CA   1  
ATOM 414    C C    . ARG A 1 28  ? 12.039  45.238  -17.962 1.00 0.00 ? 28  ARG A C    1  
ATOM 415    O O    . ARG A 1 28  ? 12.008  46.338  -17.401 1.00 0.00 ? 28  ARG A O    1  
ATOM 416    C CB   . ARG A 1 28  ? 12.684  43.489  -16.244 1.00 0.00 ? 28  ARG A CB   1  
ATOM 417    C CG   . ARG A 1 28  ? 12.167  42.487  -15.215 1.00 0.00 ? 28  ARG A CG   1  
ATOM 418    C CD   . ARG A 1 28  ? 13.257  41.881  -14.327 1.00 0.00 ? 28  ARG A CD   1  
ATOM 419    N NE   . ARG A 1 28  ? 12.676  40.933  -13.358 1.00 0.00 ? 28  ARG A NE   1  
ATOM 420    C CZ   . ARG A 1 28  ? 12.346  39.662  -13.613 1.00 0.00 ? 28  ARG A CZ   1  
ATOM 421    N NH1  . ARG A 1 28  ? 12.518  39.126  -14.817 1.00 0.00 ? 28  ARG A NH1  1  
ATOM 422    N NH2  . ARG A 1 28  ? 11.821  38.916  -12.652 1.00 0.00 ? 28  ARG A NH2  1  
ATOM 423    H H    . ARG A 1 28  ? 11.642  42.140  -18.204 1.00 0.00 ? 28  ARG A H    1  
ATOM 424    H HA   . ARG A 1 28  ? 10.755  44.307  -16.583 1.00 0.00 ? 28  ARG A HA   1  
ATOM 425    H HB2  . ARG A 1 28  ? 13.458  43.015  -16.827 1.00 0.00 ? 28  ARG A HB2  1  
ATOM 426    H HB3  . ARG A 1 28  ? 13.112  44.336  -15.725 1.00 0.00 ? 28  ARG A HB3  1  
ATOM 427    H HG2  . ARG A 1 28  ? 11.450  42.985  -14.581 1.00 0.00 ? 28  ARG A HG2  1  
ATOM 428    H HG3  . ARG A 1 28  ? 11.663  41.687  -15.739 1.00 0.00 ? 28  ARG A HG3  1  
ATOM 429    H HD2  . ARG A 1 28  ? 13.972  41.361  -14.946 1.00 0.00 ? 28  ARG A HD2  1  
ATOM 430    H HD3  . ARG A 1 28  ? 13.761  42.674  -13.793 1.00 0.00 ? 28  ARG A HD3  1  
ATOM 431    H HE   . ARG A 1 28  ? 12.514  41.264  -12.450 1.00 0.00 ? 28  ARG A HE   1  
ATOM 432    H HH11 . ARG A 1 28  ? 12.902  39.677  -15.559 1.00 0.00 ? 28  ARG A HH11 1  
ATOM 433    H HH12 . ARG A 1 28  ? 12.263  38.173  -14.982 1.00 0.00 ? 28  ARG A HH12 1  
ATOM 434    H HH21 . ARG A 1 28  ? 11.673  39.305  -11.743 1.00 0.00 ? 28  ARG A HH21 1  
ATOM 435    H HH22 . ARG A 1 28  ? 11.572  37.965  -12.836 1.00 0.00 ? 28  ARG A HH22 1  
ATOM 436    N N    . LYS A 1 29  ? 12.431  45.047  -19.228 1.00 0.00 ? 29  LYS A N    1  
ATOM 437    C CA   . LYS A 1 29  ? 12.867  46.128  -20.120 1.00 0.00 ? 29  LYS A CA   1  
ATOM 438    C C    . LYS A 1 29  ? 11.798  47.205  -20.235 1.00 0.00 ? 29  LYS A C    1  
ATOM 439    O O    . LYS A 1 29  ? 10.633  46.901  -20.519 1.00 0.00 ? 29  LYS A O    1  
ATOM 440    C CB   . LYS A 1 29  ? 13.153  45.621  -21.543 1.00 0.00 ? 29  LYS A CB   1  
ATOM 441    C CG   . LYS A 1 29  ? 14.359  44.709  -21.760 1.00 0.00 ? 29  LYS A CG   1  
ATOM 442    C CD   . LYS A 1 29  ? 14.626  44.537  -23.282 1.00 0.00 ? 29  LYS A CD   1  
ATOM 443    C CE   . LYS A 1 29  ? 13.551  43.697  -24.000 1.00 0.00 ? 29  LYS A CE   1  
ATOM 444    N NZ   . LYS A 1 29  ? 13.362  42.314  -23.445 1.00 0.00 ? 29  LYS A NZ   1  
ATOM 445    H H    . LYS A 1 29  ? 12.407  44.134  -19.586 1.00 0.00 ? 29  LYS A H    1  
ATOM 446    H HA   . LYS A 1 29  ? 13.768  46.569  -19.721 1.00 0.00 ? 29  LYS A HA   1  
ATOM 447    H HB2  . LYS A 1 29  ? 12.282  45.083  -21.879 1.00 0.00 ? 29  LYS A HB2  1  
ATOM 448    H HB3  . LYS A 1 29  ? 13.268  46.489  -22.180 1.00 0.00 ? 29  LYS A HB3  1  
ATOM 449    H HG2  . LYS A 1 29  ? 15.227  45.147  -21.289 1.00 0.00 ? 29  LYS A HG2  1  
ATOM 450    H HG3  . LYS A 1 29  ? 14.162  43.742  -21.322 1.00 0.00 ? 29  LYS A HG3  1  
ATOM 451    H HD2  . LYS A 1 29  ? 14.663  45.513  -23.740 1.00 0.00 ? 29  LYS A HD2  1  
ATOM 452    H HD3  . LYS A 1 29  ? 15.587  44.058  -23.411 1.00 0.00 ? 29  LYS A HD3  1  
ATOM 453    H HE2  . LYS A 1 29  ? 12.609  44.218  -23.932 1.00 0.00 ? 29  LYS A HE2  1  
ATOM 454    H HE3  . LYS A 1 29  ? 13.822  43.619  -25.044 1.00 0.00 ? 29  LYS A HE3  1  
ATOM 455    H HZ1  . LYS A 1 29  ? 13.336  41.628  -24.226 1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 456    H HZ2  . LYS A 1 29  ? 12.466  42.273  -22.916 1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 457    H HZ3  . LYS A 1 29  ? 14.152  42.084  -22.810 1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 458    N N    . LYS A 1 30  ? 12.204  48.457  -20.030 1.00 0.00 ? 30  LYS A N    1  
ATOM 459    C CA   . LYS A 1 30  ? 11.296  49.587  -20.167 1.00 0.00 ? 30  LYS A CA   1  
ATOM 460    C C    . LYS A 1 30  ? 10.631  49.535  -21.527 1.00 0.00 ? 30  LYS A C    1  
ATOM 461    O O    . LYS A 1 30  ? 11.252  49.195  -22.521 1.00 0.00 ? 30  LYS A O    1  
ATOM 462    C CB   . LYS A 1 30  ? 12.011  50.938  -19.984 1.00 0.00 ? 30  LYS A CB   1  
ATOM 463    C CG   . LYS A 1 30  ? 12.767  51.109  -18.657 1.00 0.00 ? 30  LYS A CG   1  
ATOM 464    C CD   . LYS A 1 30  ? 11.858  51.052  -17.438 1.00 0.00 ? 30  LYS A CD   1  
ATOM 465    C CE   . LYS A 1 30  ? 12.677  51.311  -16.180 1.00 0.00 ? 30  LYS A CE   1  
ATOM 466    N NZ   . LYS A 1 30  ? 11.899  51.264  -14.910 1.00 0.00 ? 30  LYS A NZ   1  
ATOM 467    H H    . LYS A 1 30  ? 13.146  48.625  -19.818 1.00 0.00 ? 30  LYS A H    1  
ATOM 468    H HA   . LYS A 1 30  ? 10.528  49.500  -19.410 1.00 0.00 ? 30  LYS A HA   1  
ATOM 469    H HB2  . LYS A 1 30  ? 12.719  51.058  -20.789 1.00 0.00 ? 30  LYS A HB2  1  
ATOM 470    H HB3  . LYS A 1 30  ? 11.273  51.724  -20.062 1.00 0.00 ? 30  LYS A HB3  1  
ATOM 471    H HG2  . LYS A 1 30  ? 13.503  50.324  -18.574 1.00 0.00 ? 30  LYS A HG2  1  
ATOM 472    H HG3  . LYS A 1 30  ? 13.277  52.062  -18.670 1.00 0.00 ? 30  LYS A HG3  1  
ATOM 473    H HD2  . LYS A 1 30  ? 11.087  51.804  -17.528 1.00 0.00 ? 30  LYS A HD2  1  
ATOM 474    H HD3  . LYS A 1 30  ? 11.402  50.076  -17.373 1.00 0.00 ? 30  LYS A HD3  1  
ATOM 475    H HE2  . LYS A 1 30  ? 13.459  50.571  -16.123 1.00 0.00 ? 30  LYS A HE2  1  
ATOM 476    H HE3  . LYS A 1 30  ? 13.138  52.286  -16.270 1.00 0.00 ? 30  LYS A HE3  1  
ATOM 477    H HZ1  . LYS A 1 30  ? 11.178  52.012  -14.917 1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 478    H HZ2  . LYS A 1 30  ? 12.541  51.408  -14.104 1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 479    H HZ3  . LYS A 1 30  ? 11.434  50.339  -14.821 1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 480    N N    . ILE A 1 31  ? 9.346   49.853  -21.541 1.00 0.00 ? 31  ILE A N    1  
ATOM 481    C CA   . ILE A 1 31  ? 8.552   49.893  -22.751 1.00 0.00 ? 31  ILE A CA   1  
ATOM 482    C C    . ILE A 1 31  ? 8.722   51.246  -23.416 1.00 0.00 ? 31  ILE A C    1  
ATOM 483    O O    . ILE A 1 31  ? 9.207   52.193  -22.798 1.00 0.00 ? 31  ILE A O    1  
ATOM 484    C CB   . ILE A 1 31  ? 7.045   49.605  -22.449 1.00 0.00 ? 31  ILE A CB   1  
ATOM 485    C CG1  . ILE A 1 31  ? 6.436   50.703  -21.553 1.00 0.00 ? 31  ILE A CG1  1  
ATOM 486    C CG2  . ILE A 1 31  ? 6.900   48.212  -21.852 1.00 0.00 ? 31  ILE A CG2  1  
ATOM 487    C CD1  . ILE A 1 31  ? 5.014   50.460  -21.124 1.00 0.00 ? 31  ILE A CD1  1  
ATOM 488    H H    . ILE A 1 31  ? 8.917   50.095  -20.695 1.00 0.00 ? 31  ILE A H    1  
ATOM 489    H HA   . ILE A 1 31  ? 8.919   49.132  -23.426 1.00 0.00 ? 31  ILE A HA   1  
ATOM 490    H HB   . ILE A 1 31  ? 6.518   49.608  -23.397 1.00 0.00 ? 31  ILE A HB   1  
ATOM 491    H HG12 . ILE A 1 31  ? 7.042   50.793  -20.667 1.00 0.00 ? 31  ILE A HG12 1  
ATOM 492    H HG13 . ILE A 1 31  ? 6.480   51.641  -22.091 1.00 0.00 ? 31  ILE A HG13 1  
ATOM 493    H HG21 . ILE A 1 31  ? 6.423   48.282  -20.886 1.00 0.00 ? 31  ILE A HG21 1  
ATOM 494    H HG22 . ILE A 1 31  ? 7.878   47.765  -21.740 1.00 0.00 ? 31  ILE A HG22 1  
ATOM 495    H HG23 . ILE A 1 31  ? 6.298   47.600  -22.507 1.00 0.00 ? 31  ILE A HG23 1  
ATOM 496    H HD11 . ILE A 1 31  ? 4.411   50.230  -21.989 1.00 0.00 ? 31  ILE A HD11 1  
ATOM 497    H HD12 . ILE A 1 31  ? 4.629   51.346  -20.641 1.00 0.00 ? 31  ILE A HD12 1  
ATOM 498    H HD13 . ILE A 1 31  ? 4.983   49.630  -20.434 1.00 0.00 ? 31  ILE A HD13 1  
ATOM 499    N N    . SER A 1 32  ? 8.330   51.325  -24.680 1.00 0.00 ? 32  SER A N    1  
ATOM 500    C CA   . SER A 1 32  ? 8.352   52.583  -25.412 1.00 0.00 ? 32  SER A CA   1  
ATOM 501    C C    . SER A 1 32  ? 7.084   53.375  -25.127 1.00 0.00 ? 32  SER A C    1  
ATOM 502    O O    . SER A 1 32  ? 6.122   52.835  -24.607 1.00 0.00 ? 32  SER A O    1  
ATOM 503    C CB   . SER A 1 32  ? 8.487   52.317  -26.905 1.00 0.00 ? 32  SER A CB   1  
ATOM 504    O OG   . SER A 1 32  ? 8.405   53.544  -27.600 1.00 0.00 ? 32  SER A OG   1  
ATOM 505    H H    . SER A 1 32  ? 7.959   50.528  -25.114 1.00 0.00 ? 32  SER A H    1  
ATOM 506    H HA   . SER A 1 32  ? 9.203   53.160  -25.084 1.00 0.00 ? 32  SER A HA   1  
ATOM 507    H HB2  . SER A 1 32  ? 9.440   51.857  -27.108 1.00 0.00 ? 32  SER A HB2  1  
ATOM 508    H HB3  . SER A 1 32  ? 7.693   51.656  -27.227 1.00 0.00 ? 32  SER A HB3  1  
ATOM 509    H HG   . SER A 1 32  ? 8.884   54.204  -27.093 1.00 0.00 ? 32  SER A HG   1  
ATOM 510    N N    . ALA A 1 33  ? 7.105   54.658  -25.398 1.00 0.00 ? 33  ALA A N    1  
ATOM 511    C CA   . ALA A 1 33  ? 5.924   55.521  -25.101 1.00 0.00 ? 33  ALA A CA   1  
ATOM 512    C C    . ALA A 1 33  ? 4.720   55.046  -25.902 1.00 0.00 ? 33  ALA A C    1  
ATOM 513    O O    . ALA A 1 33  ? 3.638   54.883  -25.375 1.00 0.00 ? 33  ALA A O    1  
ATOM 514    C CB   . ALA A 1 33  ? 6.244   56.968  -25.477 1.00 0.00 ? 33  ALA A CB   1  
ATOM 515    H H    . ALA A 1 33  ? 7.919   55.062  -25.769 1.00 0.00 ? 33  ALA A H    1  
ATOM 516    H HA   . ALA A 1 33  ? 5.697   55.469  -24.046 1.00 0.00 ? 33  ALA A HA   1  
ATOM 517    H HB1  . ALA A 1 33  ? 7.238   57.219  -25.138 1.00 0.00 ? 33  ALA A HB1  1  
ATOM 518    H HB2  . ALA A 1 33  ? 5.527   57.629  -25.012 1.00 0.00 ? 33  ALA A HB2  1  
ATOM 519    H HB3  . ALA A 1 33  ? 6.193   57.080  -26.551 1.00 0.00 ? 33  ALA A HB3  1  
ATOM 520    N N    . ASP A 1 34  ? 4.895   54.811  -27.170 1.00 0.00 ? 34  ASP A N    1  
ATOM 521    C CA   . ASP A 1 34  ? 3.750   54.335  -27.982 1.00 0.00 ? 34  ASP A CA   1  
ATOM 522    C C    . ASP A 1 34  ? 3.205   53.083  -27.307 1.00 0.00 ? 34  ASP A C    1  
ATOM 523    O O    . ASP A 1 34  ? 2.012   52.845  -27.264 1.00 0.00 ? 34  ASP A O    1  
ATOM 524    C CB   . ASP A 1 34  ? 4.227   53.998  -29.401 1.00 0.00 ? 34  ASP A CB   1  
ATOM 525    C CG   . ASP A 1 34  ? 4.494   55.291  -30.172 1.00 0.00 ? 34  ASP A CG   1  
ATOM 526    O OD1  . ASP A 1 34  ? 4.083   56.338  -29.698 1.00 0.00 ? 34  ASP A OD1  1  
ATOM 527    O OD2  . ASP A 1 34  ? 5.110   55.213  -31.222 1.00 0.00 ? 34  ASP A OD2  1  
ATOM 528    H H    . ASP A 1 34  ? 5.775   54.939  -27.582 1.00 0.00 ? 34  ASP A H    1  
ATOM 529    H HA   . ASP A 1 34  ? 2.983   55.096  -28.020 1.00 0.00 ? 34  ASP A HA   1  
ATOM 530    H HB2  . ASP A 1 34  ? 5.138   53.415  -29.352 1.00 0.00 ? 34  ASP A HB2  1  
ATOM 531    H HB3  . ASP A 1 34  ? 3.463   53.431  -29.911 1.00 0.00 ? 34  ASP A HB3  1  
ATOM 532    N N    . GLN A 1 35  ? 4.085   52.282  -26.774 1.00 0.00 ? 35  GLN A N    1  
ATOM 533    C CA   . GLN A 1 35  ? 3.650   51.039  -26.092 1.00 0.00 ? 35  GLN A CA   1  
ATOM 534    C C    . GLN A 1 35  ? 2.901   51.369  -24.797 1.00 0.00 ? 35  GLN A C    1  
ATOM 535    O O    . GLN A 1 35  ? 1.994   50.650  -24.428 1.00 0.00 ? 35  GLN A O    1  
ATOM 536    C CB   . GLN A 1 35  ? 4.866   50.169  -25.767 1.00 0.00 ? 35  GLN A CB   1  
ATOM 537    C CG   . GLN A 1 35  ? 5.462   49.610  -27.060 1.00 0.00 ? 35  GLN A CG   1  
ATOM 538    C CD   . GLN A 1 35  ? 6.690   48.764  -26.719 1.00 0.00 ? 35  GLN A CD   1  
ATOM 539    O OE1  . GLN A 1 35  ? 7.609   49.235  -26.082 1.00 0.00 ? 35  GLN A OE1  1  
ATOM 540    N NE2  . GLN A 1 35  ? 6.730   47.517  -27.099 1.00 0.00 ? 35  GLN A NE2  1  
ATOM 541    H H    . GLN A 1 35  ? 5.037   52.503  -26.823 1.00 0.00 ? 35  GLN A H    1  
ATOM 542    H HA   . GLN A 1 35  ? 2.995   50.494  -26.750 1.00 0.00 ? 35  GLN A HA   1  
ATOM 543    H HB2  . GLN A 1 35  ? 5.608   50.759  -25.257 1.00 0.00 ? 35  GLN A HB2  1  
ATOM 544    H HB3  . GLN A 1 35  ? 4.561   49.352  -25.132 1.00 0.00 ? 35  GLN A HB3  1  
ATOM 545    H HG2  . GLN A 1 35  ? 4.727   49.001  -27.562 1.00 0.00 ? 35  GLN A HG2  1  
ATOM 546    H HG3  . GLN A 1 35  ? 5.753   50.425  -27.702 1.00 0.00 ? 35  GLN A HG3  1  
ATOM 547    H HE21 . GLN A 1 35  ? 5.977   47.129  -27.590 1.00 0.00 ? 35  GLN A HE21 1  
ATOM 548    H HE22 . GLN A 1 35  ? 7.512   46.965  -26.885 1.00 0.00 ? 35  GLN A HE22 1  
ATOM 549    N N    . VAL A 1 36  ? 3.327   52.394  -24.062 1.00 0.00 ? 36  VAL A N    1  
ATOM 550    C CA   . VAL A 1 36  ? 2.610   52.602  -22.775 1.00 0.00 ? 36  VAL A CA   1  
ATOM 551    C C    . VAL A 1 36  ? 1.118   52.350  -23.000 1.00 0.00 ? 36  VAL A C    1  
ATOM 552    O O    . VAL A 1 36  ? 0.492   51.578  -22.298 1.00 0.00 ? 36  VAL A O    1  
ATOM 553    C CB   . VAL A 1 36  ? 2.847   54.041  -22.280 1.00 0.00 ? 36  VAL A CB   1  
ATOM 554    C CG1  . VAL A 1 36  ? 1.818   54.409  -21.206 1.00 0.00 ? 36  VAL A CG1  1  
ATOM 555    C CG2  . VAL A 1 36  ? 4.253   54.142  -21.679 1.00 0.00 ? 36  VAL A CG2  1  
ATOM 556    H H    . VAL A 1 36  ? 4.133   52.820  -24.421 1.00 0.00 ? 36  VAL A H    1  
ATOM 557    H HA   . VAL A 1 36  ? 2.983   51.902  -22.040 1.00 0.00 ? 36  VAL A HA   1  
ATOM 558    H HB   . VAL A 1 36  ? 2.760   54.726  -23.112 1.00 0.00 ? 36  VAL A HB   1  
ATOM 559    H HG11 . VAL A 1 36  ? 2.129   55.313  -20.705 1.00 0.00 ? 36  VAL A HG11 1  
ATOM 560    H HG12 . VAL A 1 36  ? 1.746   53.606  -20.488 1.00 0.00 ? 36  VAL A HG12 1  
ATOM 561    H HG13 . VAL A 1 36  ? 0.855   54.566  -21.669 1.00 0.00 ? 36  VAL A HG13 1  
ATOM 562    H HG21 . VAL A 1 36  ? 4.586   55.169  -21.712 1.00 0.00 ? 36  VAL A HG21 1  
ATOM 563    H HG22 . VAL A 1 36  ? 4.933   53.525  -22.246 1.00 0.00 ? 36  VAL A HG22 1  
ATOM 564    H HG23 . VAL A 1 36  ? 4.230   53.804  -20.653 1.00 0.00 ? 36  VAL A HG23 1  
ATOM 565    N N    . ASP A 1 37  ? 0.539   52.996  -23.966 1.00 0.00 ? 37  ASP A N    1  
ATOM 566    C CA   . ASP A 1 37  ? -0.908  52.802  -24.238 1.00 0.00 ? 37  ASP A CA   1  
ATOM 567    C C    . ASP A 1 37  ? -1.187  51.338  -24.580 1.00 0.00 ? 37  ASP A C    1  
ATOM 568    O O    . ASP A 1 37  ? -2.192  50.782  -24.184 1.00 0.00 ? 37  ASP A O    1  
ATOM 569    C CB   . ASP A 1 37  ? -1.333  53.689  -25.407 1.00 0.00 ? 37  ASP A CB   1  
ATOM 570    C CG   . ASP A 1 37  ? -1.345  55.154  -24.960 1.00 0.00 ? 37  ASP A CG   1  
ATOM 571    O OD1  . ASP A 1 37  ? -1.277  55.389  -23.767 1.00 0.00 ? 37  ASP A OD1  1  
ATOM 572    O OD2  . ASP A 1 37  ? -1.426  56.016  -25.821 1.00 0.00 ? 37  ASP A OD2  1  
ATOM 573    H H    . ASP A 1 37  ? 1.060   53.617  -24.518 1.00 0.00 ? 37  ASP A H    1  
ATOM 574    H HA   . ASP A 1 37  ? -1.474  53.076  -23.360 1.00 0.00 ? 37  ASP A HA   1  
ATOM 575    H HB2  . ASP A 1 37  ? -0.637  53.566  -26.224 1.00 0.00 ? 37  ASP A HB2  1  
ATOM 576    H HB3  . ASP A 1 37  ? -2.323  53.407  -25.732 1.00 0.00 ? 37  ASP A HB3  1  
ATOM 577    N N    . GLN A 1 38  ? -0.329  50.710  -25.334 1.00 0.00 ? 38  GLN A N    1  
ATOM 578    C CA   . GLN A 1 38  ? -0.582  49.289  -25.714 1.00 0.00 ? 38  GLN A CA   1  
ATOM 579    C C    . GLN A 1 38  ? -0.460  48.373  -24.494 1.00 0.00 ? 38  GLN A C    1  
ATOM 580    O O    . GLN A 1 38  ? -1.222  47.441  -24.339 1.00 0.00 ? 38  GLN A O    1  
ATOM 581    C CB   . GLN A 1 38  ? 0.411   48.837  -26.785 1.00 0.00 ? 38  GLN A CB   1  
ATOM 582    C CG   . GLN A 1 38  ? 0.149   49.586  -28.103 1.00 0.00 ? 38  GLN A CG   1  
ATOM 583    C CD   . GLN A 1 38  ? 1.270   49.287  -29.106 1.00 0.00 ? 38  GLN A CD   1  
ATOM 584    O OE1  . GLN A 1 38  ? 2.398   49.045  -28.722 1.00 0.00 ? 38  GLN A OE1  1  
ATOM 585    N NE2  . GLN A 1 38  ? 0.998   49.284  -30.379 1.00 0.00 ? 38  GLN A NE2  1  
ATOM 586    H H    . GLN A 1 38  ? 0.468   51.174  -25.665 1.00 0.00 ? 38  GLN A H    1  
ATOM 587    H HA   . GLN A 1 38  ? -1.584  49.209  -26.111 1.00 0.00 ? 38  GLN A HA   1  
ATOM 588    H HB2  . GLN A 1 38  ? 1.417   49.044  -26.449 1.00 0.00 ? 38  GLN A HB2  1  
ATOM 589    H HB3  . GLN A 1 38  ? 0.301   47.775  -26.950 1.00 0.00 ? 38  GLN A HB3  1  
ATOM 590    H HG2  . GLN A 1 38  ? -0.797  49.264  -28.516 1.00 0.00 ? 38  GLN A HG2  1  
ATOM 591    H HG3  . GLN A 1 38  ? 0.115   50.647  -27.912 1.00 0.00 ? 38  GLN A HG3  1  
ATOM 592    H HE21 . GLN A 1 38  ? 0.087   49.472  -30.685 1.00 0.00 ? 38  GLN A HE21 1  
ATOM 593    H HE22 . GLN A 1 38  ? 1.705   49.095  -31.031 1.00 0.00 ? 38  GLN A HE22 1  
ATOM 594    N N    . GLU A 1 39  ? 0.493   48.607  -23.638 1.00 0.00 ? 39  GLU A N    1  
ATOM 595    C CA   . GLU A 1 39  ? 0.639   47.713  -22.456 1.00 0.00 ? 39  GLU A CA   1  
ATOM 596    C C    . GLU A 1 39  ? -0.577  47.848  -21.545 1.00 0.00 ? 39  GLU A C    1  
ATOM 597    O O    . GLU A 1 39  ? -1.077  46.872  -21.023 1.00 0.00 ? 39  GLU A O    1  
ATOM 598    C CB   . GLU A 1 39  ? 1.915   48.067  -21.697 1.00 0.00 ? 39  GLU A CB   1  
ATOM 599    C CG   . GLU A 1 39  ? 3.125   47.658  -22.537 1.00 0.00 ? 39  GLU A CG   1  
ATOM 600    C CD   . GLU A 1 39  ? 3.128   46.140  -22.723 1.00 0.00 ? 39  GLU A CD   1  
ATOM 601    O OE1  . GLU A 1 39  ? 2.967   45.440  -21.734 1.00 0.00 ? 39  GLU A OE1  1  
ATOM 602    O OE2  . GLU A 1 39  ? 3.283   45.698  -23.848 1.00 0.00 ? 39  GLU A OE2  1  
ATOM 603    H H    . GLU A 1 39  ? 1.114   49.353  -23.778 1.00 0.00 ? 39  GLU A H    1  
ATOM 604    H HA   . GLU A 1 39  ? 0.706   46.690  -22.798 1.00 0.00 ? 39  GLU A HA   1  
ATOM 605    H HB2  . GLU A 1 39  ? 1.943   49.132  -21.514 1.00 0.00 ? 39  GLU A HB2  1  
ATOM 606    H HB3  . GLU A 1 39  ? 1.936   47.537  -20.756 1.00 0.00 ? 39  GLU A HB3  1  
ATOM 607    H HG2  . GLU A 1 39  ? 3.071   48.140  -23.503 1.00 0.00 ? 39  GLU A HG2  1  
ATOM 608    H HG3  . GLU A 1 39  ? 4.031   47.960  -22.034 1.00 0.00 ? 39  GLU A HG3  1  
ATOM 609    N N    . VAL A 1 40  ? -1.080  49.038  -21.356 1.00 0.00 ? 40  VAL A N    1  
ATOM 610    C CA   . VAL A 1 40  ? -2.280  49.191  -20.497 1.00 0.00 ? 40  VAL A CA   1  
ATOM 611    C C    . VAL A 1 40  ? -3.425  48.377  -21.105 1.00 0.00 ? 40  VAL A C    1  
ATOM 612    O O    . VAL A 1 40  ? -4.104  47.639  -20.422 1.00 0.00 ? 40  VAL A O    1  
ATOM 613    C CB   . VAL A 1 40  ? -2.656  50.674  -20.402 1.00 0.00 ? 40  VAL A CB   1  
ATOM 614    C CG1  . VAL A 1 40  ? -4.022  50.834  -19.712 1.00 0.00 ? 40  VAL A CG1  1  
ATOM 615    C CG2  . VAL A 1 40  ? -1.578  51.406  -19.593 1.00 0.00 ? 40  VAL A CG2  1  
ATOM 616    H H    . VAL A 1 40  ? -0.680  49.819  -21.793 1.00 0.00 ? 40  VAL A H    1  
ATOM 617    H HA   . VAL A 1 40  ? -2.061  48.813  -19.509 1.00 0.00 ? 40  VAL A HA   1  
ATOM 618    H HB   . VAL A 1 40  ? -2.706  51.095  -21.397 1.00 0.00 ? 40  VAL A HB   1  
ATOM 619    H HG11 . VAL A 1 40  ? -4.808  50.563  -20.402 1.00 0.00 ? 40  VAL A HG11 1  
ATOM 620    H HG12 . VAL A 1 40  ? -4.152  51.861  -19.404 1.00 0.00 ? 40  VAL A HG12 1  
ATOM 621    H HG13 . VAL A 1 40  ? -4.066  50.189  -18.847 1.00 0.00 ? 40  VAL A HG13 1  
ATOM 622    H HG21 . VAL A 1 40  ? -1.877  52.432  -19.439 1.00 0.00 ? 40  VAL A HG21 1  
ATOM 623    H HG22 . VAL A 1 40  ? -0.643  51.381  -20.132 1.00 0.00 ? 40  VAL A HG22 1  
ATOM 624    H HG23 . VAL A 1 40  ? -1.454  50.919  -18.636 1.00 0.00 ? 40  VAL A HG23 1  
ATOM 625    N N    . GLU A 1 41  ? -3.633  48.501  -22.388 1.00 0.00 ? 41  GLU A N    1  
ATOM 626    C CA   . GLU A 1 41  ? -4.726  47.730  -23.042 1.00 0.00 ? 41  GLU A CA   1  
ATOM 627    C C    . GLU A 1 41  ? -4.472  46.228  -22.855 1.00 0.00 ? 41  GLU A C    1  
ATOM 628    O O    . GLU A 1 41  ? -5.382  45.472  -22.568 1.00 0.00 ? 41  GLU A O    1  
ATOM 629    C CB   . GLU A 1 41  ? -4.760  48.065  -24.540 1.00 0.00 ? 41  GLU A CB   1  
ATOM 630    C CG   . GLU A 1 41  ? -5.891  47.291  -25.224 1.00 0.00 ? 41  GLU A CG   1  
ATOM 631    C CD   . GLU A 1 41  ? -7.232  47.713  -24.627 1.00 0.00 ? 41  GLU A CD   1  
ATOM 632    O OE1  . GLU A 1 41  ? -7.300  48.803  -24.081 1.00 0.00 ? 41  GLU A OE1  1  
ATOM 633    O OE2  . GLU A 1 41  ? -8.172  46.942  -24.724 1.00 0.00 ? 41  GLU A OE2  1  
ATOM 634    H H    . GLU A 1 41  ? -3.067  49.098  -22.921 1.00 0.00 ? 41  GLU A H    1  
ATOM 635    H HA   . GLU A 1 41  ? -5.672  47.993  -22.592 1.00 0.00 ? 41  GLU A HA   1  
ATOM 636    H HB2  . GLU A 1 41  ? -4.923  49.126  -24.665 1.00 0.00 ? 41  GLU A HB2  1  
ATOM 637    H HB3  . GLU A 1 41  ? -3.816  47.792  -24.989 1.00 0.00 ? 41  GLU A HB3  1  
ATOM 638    H HG2  . GLU A 1 41  ? -5.884  47.504  -26.283 1.00 0.00 ? 41  GLU A HG2  1  
ATOM 639    H HG3  . GLU A 1 41  ? -5.748  46.231  -25.068 1.00 0.00 ? 41  GLU A HG3  1  
ATOM 640    N N    . ARG A 1 42  ? -3.246  45.789  -22.988 1.00 0.00 ? 42  ARG A N    1  
ATOM 641    C CA   . ARG A 1 42  ? -2.971  44.337  -22.788 1.00 0.00 ? 42  ARG A CA   1  
ATOM 642    C C    . ARG A 1 42  ? -3.377  43.964  -21.367 1.00 0.00 ? 42  ARG A C    1  
ATOM 643    O O    . ARG A 1 42  ? -4.023  42.962  -21.134 1.00 0.00 ? 42  ARG A O    1  
ATOM 644    C CB   . ARG A 1 42  ? -1.481  44.036  -23.005 1.00 0.00 ? 42  ARG A CB   1  
ATOM 645    C CG   . ARG A 1 42  ? -1.140  44.166  -24.494 1.00 0.00 ? 42  ARG A CG   1  
ATOM 646    C CD   . ARG A 1 42  ? 0.358   43.915  -24.700 1.00 0.00 ? 42  ARG A CD   1  
ATOM 647    N NE   . ARG A 1 42  ? 0.689   44.027  -26.151 1.00 0.00 ? 42  ARG A NE   1  
ATOM 648    C CZ   . ARG A 1 42  ? 1.920   43.855  -26.561 1.00 0.00 ? 42  ARG A CZ   1  
ATOM 649    N NH1  . ARG A 1 42  ? 2.866   43.602  -25.696 1.00 0.00 ? 42  ARG A NH1  1  
ATOM 650    N NH2  . ARG A 1 42  ? 2.203   43.930  -27.831 1.00 0.00 ? 42  ARG A NH2  1  
ATOM 651    H H    . ARG A 1 42  ? -2.518  46.408  -23.201 1.00 0.00 ? 42  ARG A H    1  
ATOM 652    H HA   . ARG A 1 42  ? -3.560  43.762  -23.490 1.00 0.00 ? 42  ARG A HA   1  
ATOM 653    H HB2  . ARG A 1 42  ? -0.887  44.737  -22.436 1.00 0.00 ? 42  ARG A HB2  1  
ATOM 654    H HB3  . ARG A 1 42  ? -1.265  43.031  -22.674 1.00 0.00 ? 42  ARG A HB3  1  
ATOM 655    H HG2  . ARG A 1 42  ? -1.708  43.440  -25.058 1.00 0.00 ? 42  ARG A HG2  1  
ATOM 656    H HG3  . ARG A 1 42  ? -1.386  45.160  -24.835 1.00 0.00 ? 42  ARG A HG3  1  
ATOM 657    H HD2  . ARG A 1 42  ? 0.925   44.647  -24.144 1.00 0.00 ? 42  ARG A HD2  1  
ATOM 658    H HD3  . ARG A 1 42  ? 0.609   42.924  -24.350 1.00 0.00 ? 42  ARG A HD3  1  
ATOM 659    H HE   . ARG A 1 42  ? -0.020  44.221  -26.799 1.00 0.00 ? 42  ARG A HE   1  
ATOM 660    H HH11 . ARG A 1 42  ? 2.650   43.541  -24.722 1.00 0.00 ? 42  ARG A HH11 1  
ATOM 661    H HH12 . ARG A 1 42  ? 3.808   43.470  -26.009 1.00 0.00 ? 42  ARG A HH12 1  
ATOM 662    H HH21 . ARG A 1 42  ? 1.480   44.120  -28.494 1.00 0.00 ? 42  ARG A HH21 1  
ATOM 663    H HH22 . ARG A 1 42  ? 3.144   43.797  -28.142 1.00 0.00 ? 42  ARG A HH22 1  
ATOM 664    N N    . PHE A 1 43  ? -3.023  44.785  -20.416 1.00 0.00 ? 43  PHE A N    1  
ATOM 665    C CA   . PHE A 1 43  ? -3.409  44.506  -19.007 1.00 0.00 ? 43  PHE A CA   1  
ATOM 666    C C    . PHE A 1 43  ? -4.936  44.476  -18.911 1.00 0.00 ? 43  PHE A C    1  
ATOM 667    O O    . PHE A 1 43  ? -5.516  43.547  -18.384 1.00 0.00 ? 43  PHE A O    1  
ATOM 668    C CB   . PHE A 1 43  ? -2.862  45.613  -18.101 1.00 0.00 ? 43  PHE A CB   1  
ATOM 669    C CG   . PHE A 1 43  ? -3.834  45.879  -16.978 1.00 0.00 ? 43  PHE A CG   1  
ATOM 670    C CD1  . PHE A 1 43  ? -3.877  45.022  -15.865 1.00 0.00 ? 43  PHE A CD1  1  
ATOM 671    C CD2  . PHE A 1 43  ? -4.689  46.994  -17.045 1.00 0.00 ? 43  PHE A CD2  1  
ATOM 672    C CE1  . PHE A 1 43  ? -4.778  45.279  -14.819 1.00 0.00 ? 43  PHE A CE1  1  
ATOM 673    C CE2  . PHE A 1 43  ? -5.593  47.251  -15.994 1.00 0.00 ? 43  PHE A CE2  1  
ATOM 674    C CZ   . PHE A 1 43  ? -5.637  46.392  -14.884 1.00 0.00 ? 43  PHE A CZ   1  
ATOM 675    H H    . PHE A 1 43  ? -2.520  45.598  -20.634 1.00 0.00 ? 43  PHE A H    1  
ATOM 676    H HA   . PHE A 1 43  ? -3.006  43.552  -18.701 1.00 0.00 ? 43  PHE A HA   1  
ATOM 677    H HB2  . PHE A 1 43  ? -1.913  45.303  -17.689 1.00 0.00 ? 43  PHE A HB2  1  
ATOM 678    H HB3  . PHE A 1 43  ? -2.725  46.515  -18.678 1.00 0.00 ? 43  PHE A HB3  1  
ATOM 679    H HD1  . PHE A 1 43  ? -3.220  44.166  -15.814 1.00 0.00 ? 43  PHE A HD1  1  
ATOM 680    H HD2  . PHE A 1 43  ? -4.653  47.652  -17.901 1.00 0.00 ? 43  PHE A HD2  1  
ATOM 681    H HE1  . PHE A 1 43  ? -4.813  44.621  -13.962 1.00 0.00 ? 43  PHE A HE1  1  
ATOM 682    H HE2  . PHE A 1 43  ? -6.252  48.105  -16.045 1.00 0.00 ? 43  PHE A HE2  1  
ATOM 683    H HZ   . PHE A 1 43  ? -6.330  46.588  -14.078 1.00 0.00 ? 43  PHE A HZ   1  
ATOM 684    N N    . LEU A 1 44  ? -5.590  45.476  -19.437 1.00 0.00 ? 44  LEU A N    1  
ATOM 685    C CA   . LEU A 1 44  ? -7.076  45.504  -19.397 1.00 0.00 ? 44  LEU A CA   1  
ATOM 686    C C    . LEU A 1 44  ? -7.614  44.287  -20.166 1.00 0.00 ? 44  LEU A C    1  
ATOM 687    O O    . LEU A 1 44  ? -8.523  43.616  -19.720 1.00 0.00 ? 44  LEU A O    1  
ATOM 688    C CB   . LEU A 1 44  ? -7.564  46.816  -20.036 1.00 0.00 ? 44  LEU A CB   1  
ATOM 689    C CG   . LEU A 1 44  ? -9.106  46.917  -20.020 1.00 0.00 ? 44  LEU A CG   1  
ATOM 690    C CD1  . LEU A 1 44  ? -9.554  48.353  -19.660 1.00 0.00 ? 44  LEU A CD1  1  
ATOM 691    C CD2  . LEU A 1 44  ? -9.648  46.545  -21.410 1.00 0.00 ? 44  LEU A CD2  1  
ATOM 692    H H    . LEU A 1 44  ? -5.100  46.205  -19.871 1.00 0.00 ? 44  LEU A H    1  
ATOM 693    H HA   . LEU A 1 44  ? -7.409  45.456  -18.369 1.00 0.00 ? 44  LEU A HA   1  
ATOM 694    H HB2  . LEU A 1 44  ? -7.151  47.650  -19.489 1.00 0.00 ? 44  LEU A HB2  1  
ATOM 695    H HB3  . LEU A 1 44  ? -7.219  46.860  -21.058 1.00 0.00 ? 44  LEU A HB3  1  
ATOM 696    H HG   . LEU A 1 44  ? -9.499  46.228  -19.286 1.00 0.00 ? 44  LEU A HG   1  
ATOM 697    H HD11 . LEU A 1 44  ? -8.932  49.066  -20.183 1.00 0.00 ? 44  LEU A HD11 1  
ATOM 698    H HD12 . LEU A 1 44  ? -9.457  48.504  -18.594 1.00 0.00 ? 44  LEU A HD12 1  
ATOM 699    H HD13 . LEU A 1 44  ? -10.585 48.492  -19.950 1.00 0.00 ? 44  LEU A HD13 1  
ATOM 700    H HD21 . LEU A 1 44  ? -9.133  45.669  -21.775 1.00 0.00 ? 44  LEU A HD21 1  
ATOM 701    H HD22 . LEU A 1 44  ? -9.488  47.367  -22.091 1.00 0.00 ? 44  LEU A HD22 1  
ATOM 702    H HD23 . LEU A 1 44  ? -10.706 46.337  -21.340 1.00 0.00 ? 44  LEU A HD23 1  
ATOM 703    N N    . SER A 1 45  ? -7.067  44.000  -21.316 1.00 0.00 ? 45  SER A N    1  
ATOM 704    C CA   . SER A 1 45  ? -7.560  42.823  -22.095 1.00 0.00 ? 45  SER A CA   1  
ATOM 705    C C    . SER A 1 45  ? -7.269  41.542  -21.307 1.00 0.00 ? 45  SER A C    1  
ATOM 706    O O    . SER A 1 45  ? -8.104  40.667  -21.193 1.00 0.00 ? 45  SER A O    1  
ATOM 707    C CB   . SER A 1 45  ? -6.848  42.764  -23.441 1.00 0.00 ? 45  SER A CB   1  
ATOM 708    O OG   . SER A 1 45  ? -7.208  43.896  -24.221 1.00 0.00 ? 45  SER A OG   1  
ATOM 709    H H    . SER A 1 45  ? -6.336  44.552  -21.666 1.00 0.00 ? 45  SER A H    1  
ATOM 710    H HA   . SER A 1 45  ? -8.625  42.915  -22.253 1.00 0.00 ? 45  SER A HA   1  
ATOM 711    H HB2  . SER A 1 45  ? -5.782  42.767  -23.286 1.00 0.00 ? 45  SER A HB2  1  
ATOM 712    H HB3  . SER A 1 45  ? -7.131  41.855  -23.956 1.00 0.00 ? 45  SER A HB3  1  
ATOM 713    H HG   . SER A 1 45  ? -7.767  44.461  -23.682 1.00 0.00 ? 45  SER A HG   1  
ATOM 714    N N    . GLY A 1 46  ? -6.092  41.433  -20.742 1.00 0.00 ? 46  GLY A N    1  
ATOM 715    C CA   . GLY A 1 46  ? -5.759  40.218  -19.946 1.00 0.00 ? 46  GLY A CA   1  
ATOM 716    C C    . GLY A 1 46  ? -6.596  40.223  -18.667 1.00 0.00 ? 46  GLY A C    1  
ATOM 717    O O    . GLY A 1 46  ? -7.116  39.208  -18.237 1.00 0.00 ? 46  GLY A O    1  
ATOM 718    H H    . GLY A 1 46  ? -5.436  42.155  -20.832 1.00 0.00 ? 46  GLY A H    1  
ATOM 719    H HA2  . GLY A 1 46  ? -5.982  39.332  -20.526 1.00 0.00 ? 46  GLY A HA2  1  
ATOM 720    H HA3  . GLY A 1 46  ? -4.711  40.229  -19.688 1.00 0.00 ? 46  GLY A HA3  1  
ATOM 721    N N    . ARG A 1 47  ? -6.752  41.372  -18.075 1.00 0.00 ? 47  ARG A N    1  
ATOM 722    C CA   . ARG A 1 47  ? -7.575  41.481  -16.841 1.00 0.00 ? 47  ARG A CA   1  
ATOM 723    C C    . ARG A 1 47  ? -9.019  41.162  -17.207 1.00 0.00 ? 47  ARG A C    1  
ATOM 724    O O    . ARG A 1 47  ? -9.772  40.625  -16.418 1.00 0.00 ? 47  ARG A O    1  
ATOM 725    C CB   . ARG A 1 47  ? -7.472  42.907  -16.306 1.00 0.00 ? 47  ARG A CB   1  
ATOM 726    C CG   . ARG A 1 47  ? -8.523  43.138  -15.222 1.00 0.00 ? 47  ARG A CG   1  
ATOM 727    C CD   . ARG A 1 47  ? -8.185  44.410  -14.456 1.00 0.00 ? 47  ARG A CD   1  
ATOM 728    N NE   . ARG A 1 47  ? -7.103  44.068  -13.468 1.00 0.00 ? 47  ARG A NE   1  
ATOM 729    C CZ   . ARG A 1 47  ? -6.883  44.757  -12.394 1.00 0.00 ? 47  ARG A CZ   1  
ATOM 730    N NH1  . ARG A 1 47  ? -7.597  45.818  -12.125 1.00 0.00 ? 47  ARG A NH1  1  
ATOM 731    N NH2  . ARG A 1 47  ? -5.939  44.392  -11.576 1.00 0.00 ? 47  ARG A NH2  1  
ATOM 732    H H    . ARG A 1 47  ? -6.339  42.175  -18.456 1.00 0.00 ? 47  ARG A H    1  
ATOM 733    H HA   . ARG A 1 47  ? -7.220  40.782  -16.099 1.00 0.00 ? 47  ARG A HA   1  
ATOM 734    H HB2  . ARG A 1 47  ? -6.488  43.062  -15.889 1.00 0.00 ? 47  ARG A HB2  1  
ATOM 735    H HB3  . ARG A 1 47  ? -7.633  43.605  -17.114 1.00 0.00 ? 47  ARG A HB3  1  
ATOM 736    H HG2  . ARG A 1 47  ? -9.496  43.240  -15.680 1.00 0.00 ? 47  ARG A HG2  1  
ATOM 737    H HG3  . ARG A 1 47  ? -8.529  42.301  -14.542 1.00 0.00 ? 47  ARG A HG3  1  
ATOM 738    H HD2  . ARG A 1 47  ? -7.833  45.169  -15.142 1.00 0.00 ? 47  ARG A HD2  1  
ATOM 739    H HD3  . ARG A 1 47  ? -9.058  44.766  -13.930 1.00 0.00 ? 47  ARG A HD3  1  
ATOM 740    H HE   . ARG A 1 47  ? -6.542  43.284  -13.643 1.00 0.00 ? 47  ARG A HE   1  
ATOM 741    H HH11 . ARG A 1 47  ? -8.321  46.106  -12.751 1.00 0.00 ? 47  ARG A HH11 1  
ATOM 742    H HH12 . ARG A 1 47  ? -7.418  46.343  -11.292 1.00 0.00 ? 47  ARG A HH12 1  
ATOM 743    H HH21 . ARG A 1 47  ? -5.387  43.583  -11.779 1.00 0.00 ? 47  ARG A HH21 1  
ATOM 744    H HH22 . ARG A 1 47  ? -5.766  44.921  -10.745 1.00 0.00 ? 47  ARG A HH22 1  
ATOM 745    N N    . ALA A 1 48  ? -9.409  41.493  -18.407 1.00 0.00 ? 48  ALA A N    1  
ATOM 746    C CA   . ALA A 1 48  ? -10.800 41.214  -18.843 1.00 0.00 ? 48  ALA A CA   1  
ATOM 747    C C    . ALA A 1 48  ? -11.054 39.708  -18.763 1.00 0.00 ? 48  ALA A C    1  
ATOM 748    O O    . ALA A 1 48  ? -12.102 39.271  -18.328 1.00 0.00 ? 48  ALA A O    1  
ATOM 749    C CB   . ALA A 1 48  ? -10.992 41.726  -20.286 1.00 0.00 ? 48  ALA A CB   1  
ATOM 750    H H    . ALA A 1 48  ? -8.781  41.925  -19.023 1.00 0.00 ? 48  ALA A H    1  
ATOM 751    H HA   . ALA A 1 48  ? -11.489 41.727  -18.187 1.00 0.00 ? 48  ALA A HA   1  
ATOM 752    H HB1  . ALA A 1 48  ? -12.042 41.699  -20.541 1.00 0.00 ? 48  ALA A HB1  1  
ATOM 753    H HB2  . ALA A 1 48  ? -10.439 41.098  -20.968 1.00 0.00 ? 48  ALA A HB2  1  
ATOM 754    H HB3  . ALA A 1 48  ? -10.630 42.742  -20.359 1.00 0.00 ? 48  ALA A HB3  1  
ATOM 755    N N    . LYS A 1 49  ? -10.108 38.903  -19.158 1.00 0.00 ? 49  LYS A N    1  
ATOM 756    C CA   . LYS A 1 49  ? -10.330 37.437  -19.072 1.00 0.00 ? 49  LYS A CA   1  
ATOM 757    C C    . LYS A 1 49  ? -10.483 37.066  -17.602 1.00 0.00 ? 49  LYS A C    1  
ATOM 758    O O    . LYS A 1 49  ? -11.567 36.743  -17.159 1.00 0.00 ? 49  LYS A O    1  
ATOM 759    C CB   . LYS A 1 49  ? -9.144  36.702  -19.700 1.00 0.00 ? 49  LYS A CB   1  
ATOM 760    C CG   . LYS A 1 49  ? -8.841  37.284  -21.100 1.00 0.00 ? 49  LYS A CG   1  
ATOM 761    C CD   . LYS A 1 49  ? -10.026 37.104  -22.102 1.00 0.00 ? 49  LYS A CD   1  
ATOM 762    C CE   . LYS A 1 49  ? -9.648  37.472  -23.547 1.00 0.00 ? 49  LYS A CE   1  
ATOM 763    N NZ   . LYS A 1 49  ? -8.568  36.564  -24.033 1.00 0.00 ? 49  LYS A NZ   1  
ATOM 764    H H    . LYS A 1 49  ? -9.260  39.259  -19.496 1.00 0.00 ? 49  LYS A H    1  
ATOM 765    H HA   . LYS A 1 49  ? -11.237 37.180  -19.602 1.00 0.00 ? 49  LYS A HA   1  
ATOM 766    H HB2  . LYS A 1 49  ? -8.275  36.818  -19.067 1.00 0.00 ? 49  LYS A HB2  1  
ATOM 767    H HB3  . LYS A 1 49  ? -9.381  35.653  -19.795 1.00 0.00 ? 49  LYS A HB3  1  
ATOM 768    H HG2  . LYS A 1 49  ? -8.629  38.338  -20.999 1.00 0.00 ? 49  LYS A HG2  1  
ATOM 769    H HG3  . LYS A 1 49  ? -7.967  36.790  -21.500 1.00 0.00 ? 49  LYS A HG3  1  
ATOM 770    H HD2  . LYS A 1 49  ? -10.347 36.074  -22.080 1.00 0.00 ? 49  LYS A HD2  1  
ATOM 771    H HD3  . LYS A 1 49  ? -10.847 37.731  -21.783 1.00 0.00 ? 49  LYS A HD3  1  
ATOM 772    H HE2  . LYS A 1 49  ? -10.516 37.370  -24.183 1.00 0.00 ? 49  LYS A HE2  1  
ATOM 773    H HE3  . LYS A 1 49  ? -9.299  38.494  -23.578 1.00 0.00 ? 49  LYS A HE3  1  
ATOM 774    H HZ1  . LYS A 1 49  ? -7.781  37.130  -24.409 1.00 0.00 ? 49  LYS A HZ1  1  
ATOM 775    H HZ2  . LYS A 1 49  ? -8.944  35.950  -24.785 1.00 0.00 ? 49  LYS A HZ2  1  
ATOM 776    H HZ3  . LYS A 1 49  ? -8.226  35.978  -23.246 1.00 0.00 ? 49  LYS A HZ3  1  
ATOM 777    N N    . ALA A 1 50  ? -9.414  37.080  -16.840 1.00 0.00 ? 50  ALA A N    1  
ATOM 778    C CA   . ALA A 1 50  ? -9.496  36.696  -15.394 1.00 0.00 ? 50  ALA A CA   1  
ATOM 779    C C    . ALA A 1 50  ? -10.785 37.218  -14.756 1.00 0.00 ? 50  ALA A C    1  
ATOM 780    O O    . ALA A 1 50  ? -11.349 36.581  -13.890 1.00 0.00 ? 50  ALA A O    1  
ATOM 781    C CB   . ALA A 1 50  ? -8.297  37.281  -14.635 1.00 0.00 ? 50  ALA A CB   1  
ATOM 782    H H    . ALA A 1 50  ? -8.547  37.326  -17.226 1.00 0.00 ? 50  ALA A H    1  
ATOM 783    H HA   . ALA A 1 50  ? -9.473  35.620  -15.312 1.00 0.00 ? 50  ALA A HA   1  
ATOM 784    H HB1  . ALA A 1 50  ? -7.393  37.103  -15.199 1.00 0.00 ? 50  ALA A HB1  1  
ATOM 785    H HB2  . ALA A 1 50  ? -8.217  36.808  -13.667 1.00 0.00 ? 50  ALA A HB2  1  
ATOM 786    H HB3  . ALA A 1 50  ? -8.438  38.344  -14.506 1.00 0.00 ? 50  ALA A HB3  1  
ATOM 787    N N    . SER A 1 51  ? -11.267 38.354  -15.166 1.00 0.00 ? 51  SER A N    1  
ATOM 788    C CA   . SER A 1 51  ? -12.520 38.855  -14.552 1.00 0.00 ? 51  SER A CA   1  
ATOM 789    C C    . SER A 1 51  ? -13.611 37.811  -14.773 1.00 0.00 ? 51  SER A C    1  
ATOM 790    O O    . SER A 1 51  ? -14.238 37.345  -13.848 1.00 0.00 ? 51  SER A O    1  
ATOM 791    C CB   . SER A 1 51  ? -12.928 40.173  -15.211 1.00 0.00 ? 51  SER A CB   1  
ATOM 792    O OG   . SER A 1 51  ? -14.141 40.635  -14.627 1.00 0.00 ? 51  SER A OG   1  
ATOM 793    H H    . SER A 1 51  ? -10.815 38.865  -15.869 1.00 0.00 ? 51  SER A H    1  
ATOM 794    H HA   . SER A 1 51  ? -12.370 39.007  -13.493 1.00 0.00 ? 51  SER A HA   1  
ATOM 795    H HB2  . SER A 1 51  ? -12.157 40.910  -15.057 1.00 0.00 ? 51  SER A HB2  1  
ATOM 796    H HB3  . SER A 1 51  ? -13.066 40.015  -16.274 1.00 0.00 ? 51  SER A HB3  1  
ATOM 797    H HG   . SER A 1 51  ? -13.946 41.436  -14.136 1.00 0.00 ? 51  SER A HG   1  
ATOM 798    N N    . ALA A 1 52  ? -13.845 37.455  -16.000 1.00 0.00 ? 52  ALA A N    1  
ATOM 799    C CA   . ALA A 1 52  ? -14.906 36.455  -16.307 1.00 0.00 ? 52  ALA A CA   1  
ATOM 800    C C    . ALA A 1 52  ? -14.507 35.050  -15.822 1.00 0.00 ? 52  ALA A C    1  
ATOM 801    O O    . ALA A 1 52  ? -15.335 34.313  -15.316 1.00 0.00 ? 52  ALA A O    1  
ATOM 802    C CB   . ALA A 1 52  ? -15.140 36.432  -17.816 1.00 0.00 ? 52  ALA A CB   1  
ATOM 803    H H    . ALA A 1 52  ? -13.328 37.856  -16.730 1.00 0.00 ? 52  ALA A H    1  
ATOM 804    H HA   . ALA A 1 52  ? -15.820 36.750  -15.815 1.00 0.00 ? 52  ALA A HA   1  
ATOM 805    H HB1  . ALA A 1 52  ? -14.204 36.248  -18.323 1.00 0.00 ? 52  ALA A HB1  1  
ATOM 806    H HB2  . ALA A 1 52  ? -15.539 37.386  -18.132 1.00 0.00 ? 52  ALA A HB2  1  
ATOM 807    H HB3  . ALA A 1 52  ? -15.842 35.649  -18.060 1.00 0.00 ? 52  ALA A HB3  1  
ATOM 808    N N    . GLN A 1 53  ? -13.270 34.659  -15.979 1.00 0.00 ? 53  GLN A N    1  
ATOM 809    C CA   . GLN A 1 53  ? -12.875 33.289  -15.525 1.00 0.00 ? 53  GLN A CA   1  
ATOM 810    C C    . GLN A 1 53  ? -12.952 33.193  -13.999 1.00 0.00 ? 53  GLN A C    1  
ATOM 811    O O    . GLN A 1 53  ? -13.404 32.203  -13.454 1.00 0.00 ? 53  GLN A O    1  
ATOM 812    C CB   . GLN A 1 53  ? -11.453 32.951  -15.986 1.00 0.00 ? 53  GLN A CB   1  
ATOM 813    C CG   . GLN A 1 53  ? -11.120 31.507  -15.613 1.00 0.00 ? 53  GLN A CG   1  
ATOM 814    C CD   . GLN A 1 53  ? -9.731  31.149  -16.146 1.00 0.00 ? 53  GLN A CD   1  
ATOM 815    O OE1  . GLN A 1 53  ? -9.097  31.946  -16.808 1.00 0.00 ? 53  GLN A OE1  1  
ATOM 816    N NE2  . GLN A 1 53  ? -9.237  29.965  -15.898 1.00 0.00 ? 53  GLN A NE2  1  
ATOM 817    H H    . GLN A 1 53  ? -12.612 35.252  -16.398 1.00 0.00 ? 53  GLN A H    1  
ATOM 818    H HA   . GLN A 1 53  ? -13.561 32.572  -15.952 1.00 0.00 ? 53  GLN A HA   1  
ATOM 819    H HB2  . GLN A 1 53  ? -11.385 33.071  -17.059 1.00 0.00 ? 53  GLN A HB2  1  
ATOM 820    H HB3  . GLN A 1 53  ? -10.750 33.616  -15.505 1.00 0.00 ? 53  GLN A HB3  1  
ATOM 821    H HG2  . GLN A 1 53  ? -11.133 31.401  -14.538 1.00 0.00 ? 53  GLN A HG2  1  
ATOM 822    H HG3  . GLN A 1 53  ? -11.852 30.844  -16.050 1.00 0.00 ? 53  GLN A HG3  1  
ATOM 823    H HE21 . GLN A 1 53  ? -9.756  29.318  -15.377 1.00 0.00 ? 53  GLN A HE21 1  
ATOM 824    H HE22 . GLN A 1 53  ? -8.349  29.725  -16.234 1.00 0.00 ? 53  GLN A HE22 1  
ATOM 825    N N    . LEU A 1 54  ? -12.537 34.213  -13.295 1.00 0.00 ? 54  LEU A N    1  
ATOM 826    C CA   . LEU A 1 54  ? -12.622 34.160  -11.807 1.00 0.00 ? 54  LEU A CA   1  
ATOM 827    C C    . LEU A 1 54  ? -14.086 34.030  -11.402 1.00 0.00 ? 54  LEU A C    1  
ATOM 828    O O    . LEU A 1 54  ? -14.429 33.296  -10.497 1.00 0.00 ? 54  LEU A O    1  
ATOM 829    C CB   . LEU A 1 54  ? -12.024 35.431  -11.192 1.00 0.00 ? 54  LEU A CB   1  
ATOM 830    C CG   . LEU A 1 54  ? -13.008 36.055  -10.188 1.00 0.00 ? 54  LEU A CG   1  
ATOM 831    C CD1  . LEU A 1 54  ? -14.140 36.746  -10.953 1.00 0.00 ? 54  LEU A CD1  1  
ATOM 832    C CD2  . LEU A 1 54  ? -13.604 34.966  -9.265  1.00 0.00 ? 54  LEU A CD2  1  
ATOM 833    H H    . LEU A 1 54  ? -12.188 35.012  -13.742 1.00 0.00 ? 54  LEU A H    1  
ATOM 834    H HA   . LEU A 1 54  ? -12.076 33.299  -11.451 1.00 0.00 ? 54  LEU A HA   1  
ATOM 835    H HB2  . LEU A 1 54  ? -11.104 35.181  -10.683 1.00 0.00 ? 54  LEU A HB2  1  
ATOM 836    H HB3  . LEU A 1 54  ? -11.816 36.144  -11.975 1.00 0.00 ? 54  LEU A HB3  1  
ATOM 837    H HG   . LEU A 1 54  ? -12.485 36.788  -9.589  1.00 0.00 ? 54  LEU A HG   1  
ATOM 838    H HD11 . LEU A 1 54  ? -14.241 36.295  -11.930 1.00 0.00 ? 54  LEU A HD11 1  
ATOM 839    H HD12 . LEU A 1 54  ? -13.912 37.796  -11.064 1.00 0.00 ? 54  LEU A HD12 1  
ATOM 840    H HD13 . LEU A 1 54  ? -15.065 36.634  -10.407 1.00 0.00 ? 54  LEU A HD13 1  
ATOM 841    H HD21 . LEU A 1 54  ? -13.145 34.014  -9.488  1.00 0.00 ? 54  LEU A HD21 1  
ATOM 842    H HD22 . LEU A 1 54  ? -14.669 34.899  -9.429  1.00 0.00 ? 54  LEU A HD22 1  
ATOM 843    H HD23 . LEU A 1 54  ? -13.415 35.225  -8.233  1.00 0.00 ? 54  LEU A HD23 1  
ATOM 844    N N    . GLU A 1 55  ? -14.952 34.736  -12.072 1.00 0.00 ? 55  GLU A N    1  
ATOM 845    C CA   . GLU A 1 55  ? -16.401 34.651  -11.744 1.00 0.00 ? 55  GLU A CA   1  
ATOM 846    C C    . GLU A 1 55  ? -16.899 33.219  -11.950 1.00 0.00 ? 55  GLU A C    1  
ATOM 847    O O    . GLU A 1 55  ? -17.710 32.720  -11.200 1.00 0.00 ? 55  GLU A O    1  
ATOM 848    C CB   . GLU A 1 55  ? -17.187 35.600  -12.649 1.00 0.00 ? 55  GLU A CB   1  
ATOM 849    C CG   . GLU A 1 55  ? -18.667 35.568  -12.260 1.00 0.00 ? 55  GLU A CG   1  
ATOM 850    C CD   . GLU A 1 55  ? -19.442 36.561  -13.125 1.00 0.00 ? 55  GLU A CD   1  
ATOM 851    O OE1  . GLU A 1 55  ? -18.821 37.202  -13.957 1.00 0.00 ? 55  GLU A OE1  1  
ATOM 852    O OE2  . GLU A 1 55  ? -20.646 36.656  -12.947 1.00 0.00 ? 55  GLU A OE2  1  
ATOM 853    H H    . GLU A 1 55  ? -14.649 35.317  -12.800 1.00 0.00 ? 55  GLU A H    1  
ATOM 854    H HA   . GLU A 1 55  ? -16.550 34.936  -10.713 1.00 0.00 ? 55  GLU A HA   1  
ATOM 855    H HB2  . GLU A 1 55  ? -16.805 36.605  -12.535 1.00 0.00 ? 55  GLU A HB2  1  
ATOM 856    H HB3  . GLU A 1 55  ? -17.081 35.288  -13.677 1.00 0.00 ? 55  GLU A HB3  1  
ATOM 857    H HG2  . GLU A 1 55  ? -19.059 34.573  -12.413 1.00 0.00 ? 55  GLU A HG2  1  
ATOM 858    H HG3  . GLU A 1 55  ? -18.773 35.841  -11.221 1.00 0.00 ? 55  GLU A HG3  1  
ATOM 859    N N    . THR A 1 56  ? -16.421 32.552  -12.967 1.00 0.00 ? 56  THR A N    1  
ATOM 860    C CA   . THR A 1 56  ? -16.878 31.157  -13.219 1.00 0.00 ? 56  THR A CA   1  
ATOM 861    C C    . THR A 1 56  ? -16.466 30.272  -12.038 1.00 0.00 ? 56  THR A C    1  
ATOM 862    O O    . THR A 1 56  ? -17.216 29.429  -11.587 1.00 0.00 ? 56  THR A O    1  
ATOM 863    C CB   . THR A 1 56  ? -16.224 30.642  -14.511 1.00 0.00 ? 56  THR A CB   1  
ATOM 864    O OG1  . THR A 1 56  ? -16.628 31.473  -15.592 1.00 0.00 ? 56  THR A OG1  1  
ATOM 865    C CG2  . THR A 1 56  ? -16.662 29.190  -14.811 1.00 0.00 ? 56  THR A CG2  1  
ATOM 866    H H    . THR A 1 56  ? -15.769 32.971  -13.566 1.00 0.00 ? 56  THR A H    1  
ATOM 867    H HA   . THR A 1 56  ? -17.953 31.141  -13.326 1.00 0.00 ? 56  THR A HA   1  
ATOM 868    H HB   . THR A 1 56  ? -15.150 30.677  -14.411 1.00 0.00 ? 56  THR A HB   1  
ATOM 869    H HG1  . THR A 1 56  ? -16.255 32.346  -15.450 1.00 0.00 ? 56  THR A HG1  1  
ATOM 870    H HG21 . THR A 1 56  ? -16.209 28.861  -15.735 1.00 0.00 ? 56  THR A HG21 1  
ATOM 871    H HG22 . THR A 1 56  ? -17.737 29.150  -14.903 1.00 0.00 ? 56  THR A HG22 1  
ATOM 872    H HG23 . THR A 1 56  ? -16.346 28.546  -14.004 1.00 0.00 ? 56  THR A HG23 1  
ATOM 873    N N    . ILE A 1 57  ? -15.275 30.454  -11.533 1.00 0.00 ? 57  ILE A N    1  
ATOM 874    C CA   . ILE A 1 57  ? -14.811 29.629  -10.379 1.00 0.00 ? 57  ILE A CA   1  
ATOM 875    C C    . ILE A 1 57  ? -15.712 29.887  -9.167  1.00 0.00 ? 57  ILE A C    1  
ATOM 876    O O    . ILE A 1 57  ? -16.035 28.987  -8.416  1.00 0.00 ? 57  ILE A O    1  
ATOM 877    C CB   . ILE A 1 57  ? -13.360 29.983  -10.043 1.00 0.00 ? 57  ILE A CB   1  
ATOM 878    C CG1  . ILE A 1 57  ? -13.350 31.082  -8.972  1.00 0.00 ? 57  ILE A CG1  1  
ATOM 879    C CG2  . ILE A 1 57  ? -12.656 30.501  -11.301 1.00 0.00 ? 57  ILE A CG2  1  
ATOM 880    C CD1  . ILE A 1 57  ? -11.928 31.669  -8.789  1.00 0.00 ? 57  ILE A CD1  1  
ATOM 881    H H    . ILE A 1 57  ? -14.684 31.138  -11.912 1.00 0.00 ? 57  ILE A H    1  
ATOM 882    H HA   . ILE A 1 57  ? -14.869 28.583  -10.645 1.00 0.00 ? 57  ILE A HA   1  
ATOM 883    H HB   . ILE A 1 57  ? -12.846 29.108  -9.673  1.00 0.00 ? 57  ILE A HB   1  
ATOM 884    H HG12 . ILE A 1 57  ? -14.024 31.872  -9.268  1.00 0.00 ? 57  ILE A HG12 1  
ATOM 885    H HG13 . ILE A 1 57  ? -13.683 30.665  -8.033  1.00 0.00 ? 57  ILE A HG13 1  
ATOM 886    H HG21 . ILE A 1 57  ? -13.034 31.482  -11.546 1.00 0.00 ? 57  ILE A HG21 1  
ATOM 887    H HG22 . ILE A 1 57  ? -12.846 29.826  -12.122 1.00 0.00 ? 57  ILE A HG22 1  
ATOM 888    H HG23 . ILE A 1 57  ? -11.593 30.559  -11.120 1.00 0.00 ? 57  ILE A HG23 1  
ATOM 889    H HD11 . ILE A 1 57  ? -11.525 31.942  -9.754  1.00 0.00 ? 57  ILE A HD11 1  
ATOM 890    H HD12 . ILE A 1 57  ? -11.289 30.929  -8.329  1.00 0.00 ? 57  ILE A HD12 1  
ATOM 891    H HD13 . ILE A 1 57  ? -11.979 32.544  -8.158  1.00 0.00 ? 57  ILE A HD13 1  
ATOM 892    N N    . LYS A 1 58  ? -16.109 31.114  -8.972  1.00 0.00 ? 58  LYS A N    1  
ATOM 893    C CA   . LYS A 1 58  ? -16.983 31.458  -7.810  1.00 0.00 ? 58  LYS A CA   1  
ATOM 894    C C    . LYS A 1 58  ? -18.260 30.616  -7.856  1.00 0.00 ? 58  LYS A C    1  
ATOM 895    O O    . LYS A 1 58  ? -18.652 30.009  -6.880  1.00 0.00 ? 58  LYS A O    1  
ATOM 896    C CB   . LYS A 1 58  ? -17.364 32.944  -7.942  1.00 0.00 ? 58  LYS A CB   1  
ATOM 897    C CG   . LYS A 1 58  ? -18.264 33.393  -6.780  1.00 0.00 ? 58  LYS A CG   1  
ATOM 898    C CD   . LYS A 1 58  ? -18.593 34.890  -6.923  1.00 0.00 ? 58  LYS A CD   1  
ATOM 899    C CE   . LYS A 1 58  ? -19.477 35.364  -5.756  1.00 0.00 ? 58  LYS A CE   1  
ATOM 900    N NZ   . LYS A 1 58  ? -20.779 34.640  -5.800  1.00 0.00 ? 58  LYS A NZ   1  
ATOM 901    H H    . LYS A 1 58  ? -15.827 31.819  -9.592  1.00 0.00 ? 58  LYS A H    1  
ATOM 902    H HA   . LYS A 1 58  ? -16.457 31.293  -6.883  1.00 0.00 ? 58  LYS A HA   1  
ATOM 903    H HB2  . LYS A 1 58  ? -16.464 33.541  -7.943  1.00 0.00 ? 58  LYS A HB2  1  
ATOM 904    H HB3  . LYS A 1 58  ? -17.888 33.093  -8.874  1.00 0.00 ? 58  LYS A HB3  1  
ATOM 905    H HG2  . LYS A 1 58  ? -19.180 32.820  -6.794  1.00 0.00 ? 58  LYS A HG2  1  
ATOM 906    H HG3  . LYS A 1 58  ? -17.751 33.227  -5.845  1.00 0.00 ? 58  LYS A HG3  1  
ATOM 907    H HD2  . LYS A 1 58  ? -17.673 35.457  -6.927  1.00 0.00 ? 58  LYS A HD2  1  
ATOM 908    H HD3  . LYS A 1 58  ? -19.116 35.053  -7.854  1.00 0.00 ? 58  LYS A HD3  1  
ATOM 909    H HE2  . LYS A 1 58  ? -18.981 35.158  -4.819  1.00 0.00 ? 58  LYS A HE2  1  
ATOM 910    H HE3  . LYS A 1 58  ? -19.652 36.427  -5.845  1.00 0.00 ? 58  LYS A HE3  1  
ATOM 911    H HZ1  . LYS A 1 58  ? -21.372 35.039  -6.554  1.00 0.00 ? 58  LYS A HZ1  1  
ATOM 912    H HZ2  . LYS A 1 58  ? -21.263 34.743  -4.884  1.00 0.00 ? 58  LYS A HZ2  1  
ATOM 913    H HZ3  . LYS A 1 58  ? -20.609 33.633  -5.992  1.00 0.00 ? 58  LYS A HZ3  1  
ATOM 914    N N    . THR A 1 59  ? -18.930 30.606  -8.972  1.00 0.00 ? 59  THR A N    1  
ATOM 915    C CA   . THR A 1 59  ? -20.205 29.843  -9.078  1.00 0.00 ? 59  THR A CA   1  
ATOM 916    C C    . THR A 1 59  ? -19.971 28.361  -8.767  1.00 0.00 ? 59  THR A C    1  
ATOM 917    O O    . THR A 1 59  ? -20.825 27.699  -8.207  1.00 0.00 ? 59  THR A O    1  
ATOM 918    C CB   . THR A 1 59  ? -20.760 29.998  -10.503 1.00 0.00 ? 59  THR A CB   1  
ATOM 919    O OG1  . THR A 1 59  ? -21.009 31.374  -10.754 1.00 0.00 ? 59  THR A OG1  1  
ATOM 920    C CG2  . THR A 1 59  ? -22.080 29.222  -10.649 1.00 0.00 ? 59  THR A CG2  1  
ATOM 921    H H    . THR A 1 59  ? -18.607 31.125  -9.739  1.00 0.00 ? 59  THR A H    1  
ATOM 922    H HA   . THR A 1 59  ? -20.918 30.245  -8.375  1.00 0.00 ? 59  THR A HA   1  
ATOM 923    H HB   . THR A 1 59  ? -20.042 29.622  -11.216 1.00 0.00 ? 59  THR A HB   1  
ATOM 924    H HG1  . THR A 1 59  ? -20.323 31.884  -10.316 1.00 0.00 ? 59  THR A HG1  1  
ATOM 925    H HG21 . THR A 1 59  ? -21.878 28.161  -10.619 1.00 0.00 ? 59  THR A HG21 1  
ATOM 926    H HG22 . THR A 1 59  ? -22.543 29.474  -11.591 1.00 0.00 ? 59  THR A HG22 1  
ATOM 927    H HG23 . THR A 1 59  ? -22.743 29.486  -9.839  1.00 0.00 ? 59  THR A HG23 1  
ATOM 928    N N    . LYS A 1 60  ? -18.835 27.830  -9.111  1.00 0.00 ? 60  LYS A N    1  
ATOM 929    C CA   . LYS A 1 60  ? -18.573 26.388  -8.825  1.00 0.00 ? 60  LYS A CA   1  
ATOM 930    C C    . LYS A 1 60  ? -18.414 26.195  -7.321  1.00 0.00 ? 60  LYS A C    1  
ATOM 931    O O    . LYS A 1 60  ? -18.844 25.207  -6.759  1.00 0.00 ? 60  LYS A O    1  
ATOM 932    C CB   . LYS A 1 60  ? -17.296 25.936  -9.529  1.00 0.00 ? 60  LYS A CB   1  
ATOM 933    C CG   . LYS A 1 60  ? -17.526 25.931  -11.040 1.00 0.00 ? 60  LYS A CG   1  
ATOM 934    C CD   . LYS A 1 60  ? -18.105 24.582  -11.468 1.00 0.00 ? 60  LYS A CD   1  
ATOM 935    C CE   . LYS A 1 60  ? -18.308 24.568  -12.986 1.00 0.00 ? 60  LYS A CE   1  
ATOM 936    N NZ   . LYS A 1 60  ? -16.993 24.726  -13.666 1.00 0.00 ? 60  LYS A NZ   1  
ATOM 937    H H    . LYS A 1 60  ? -18.153 28.374  -9.559  1.00 0.00 ? 60  LYS A H    1  
ATOM 938    H HA   . LYS A 1 60  ? -19.405 25.796  -9.177  1.00 0.00 ? 60  LYS A HA   1  
ATOM 939    H HB2  . LYS A 1 60  ? -16.491 26.615  -9.288  1.00 0.00 ? 60  LYS A HB2  1  
ATOM 940    H HB3  . LYS A 1 60  ? -17.037 24.939  -9.203  1.00 0.00 ? 60  LYS A HB3  1  
ATOM 941    H HG2  . LYS A 1 60  ? -18.217 26.719  -11.300 1.00 0.00 ? 60  LYS A HG2  1  
ATOM 942    H HG3  . LYS A 1 60  ? -16.587 26.093  -11.547 1.00 0.00 ? 60  LYS A HG3  1  
ATOM 943    H HD2  . LYS A 1 60  ? -17.422 23.793  -11.188 1.00 0.00 ? 60  LYS A HD2  1  
ATOM 944    H HD3  . LYS A 1 60  ? -19.055 24.426  -10.979 1.00 0.00 ? 60  LYS A HD3  1  
ATOM 945    H HE2  . LYS A 1 60  ? -18.754 23.630  -13.281 1.00 0.00 ? 60  LYS A HE2  1  
ATOM 946    H HE3  . LYS A 1 60  ? -18.959 25.383  -13.270 1.00 0.00 ? 60  LYS A HE3  1  
ATOM 947    H HZ1  . LYS A 1 60  ? -16.707 25.726  -13.641 1.00 0.00 ? 60  LYS A HZ1  1  
ATOM 948    H HZ2  . LYS A 1 60  ? -17.074 24.413  -14.655 1.00 0.00 ? 60  LYS A HZ2  1  
ATOM 949    H HZ3  . LYS A 1 60  ? -16.278 24.151  -13.177 1.00 0.00 ? 60  LYS A HZ3  1  
ATOM 950    N N    . ALA A 1 61  ? -17.798 27.134  -6.669  1.00 0.00 ? 61  ALA A N    1  
ATOM 951    C CA   . ALA A 1 61  ? -17.604 27.016  -5.202  1.00 0.00 ? 61  ALA A CA   1  
ATOM 952    C C    . ALA A 1 61  ? -18.965 27.050  -4.502  1.00 0.00 ? 61  ALA A C    1  
ATOM 953    O O    . ALA A 1 61  ? -19.227 26.288  -3.593  1.00 0.00 ? 61  ALA A O    1  
ATOM 954    C CB   . ALA A 1 61  ? -16.732 28.186  -4.726  1.00 0.00 ? 61  ALA A CB   1  
ATOM 955    H H    . ALA A 1 61  ? -17.459 27.920  -7.145  1.00 0.00 ? 61  ALA A H    1  
ATOM 956    H HA   . ALA A 1 61  ? -17.108 26.083  -4.979  1.00 0.00 ? 61  ALA A HA   1  
ATOM 957    H HB1  . ALA A 1 61  ? -17.347 28.904  -4.203  1.00 0.00 ? 61  ALA A HB1  1  
ATOM 958    H HB2  . ALA A 1 61  ? -16.271 28.661  -5.579  1.00 0.00 ? 61  ALA A HB2  1  
ATOM 959    H HB3  . ALA A 1 61  ? -15.965 27.816  -4.061  1.00 0.00 ? 61  ALA A HB3  1  
ATOM 960    N N    . GLY A 1 62  ? -19.826 27.941  -4.908  1.00 0.00 ? 62  GLY A N    1  
ATOM 961    C CA   . GLY A 1 62  ? -21.163 28.038  -4.260  1.00 0.00 ? 62  GLY A CA   1  
ATOM 962    C C    . GLY A 1 62  ? -21.926 26.725  -4.415  1.00 0.00 ? 62  GLY A C    1  
ATOM 963    O O    . GLY A 1 62  ? -22.429 26.179  -3.452  1.00 0.00 ? 62  GLY A O    1  
ATOM 964    H H    . GLY A 1 62  ? -19.589 28.554  -5.635  1.00 0.00 ? 62  GLY A H    1  
ATOM 965    H HA2  . GLY A 1 62  ? -21.035 28.256  -3.210  1.00 0.00 ? 62  GLY A HA2  1  
ATOM 966    H HA3  . GLY A 1 62  ? -21.728 28.833  -4.724  1.00 0.00 ? 62  GLY A HA3  1  
ATOM 967    N N    . GLU A 1 63  ? -22.027 26.215  -5.602  1.00 0.00 ? 63  GLU A N    1  
ATOM 968    C CA   . GLU A 1 63  ? -22.775 24.943  -5.787  1.00 0.00 ? 63  GLU A CA   1  
ATOM 969    C C    . GLU A 1 63  ? -21.986 23.789  -5.166  1.00 0.00 ? 63  GLU A C    1  
ATOM 970    O O    . GLU A 1 63  ? -22.541 22.935  -4.506  1.00 0.00 ? 63  GLU A O    1  
ATOM 971    C CB   . GLU A 1 63  ? -22.970 24.683  -7.278  1.00 0.00 ? 63  GLU A CB   1  
ATOM 972    C CG   . GLU A 1 63  ? -23.866 23.462  -7.468  1.00 0.00 ? 63  GLU A CG   1  
ATOM 973    C CD   . GLU A 1 63  ? -23.039 22.191  -7.285  1.00 0.00 ? 63  GLU A CD   1  
ATOM 974    O OE1  . GLU A 1 63  ? -21.853 22.233  -7.577  1.00 0.00 ? 63  GLU A OE1  1  
ATOM 975    O OE2  . GLU A 1 63  ? -23.601 21.197  -6.859  1.00 0.00 ? 63  GLU A OE2  1  
ATOM 976    H H    . GLU A 1 63  ? -21.622 26.667  -6.371  1.00 0.00 ? 63  GLU A H    1  
ATOM 977    H HA   . GLU A 1 63  ? -23.739 25.020  -5.307  1.00 0.00 ? 63  GLU A HA   1  
ATOM 978    H HB2  . GLU A 1 63  ? -23.433 25.546  -7.737  1.00 0.00 ? 63  GLU A HB2  1  
ATOM 979    H HB3  . GLU A 1 63  ? -22.012 24.500  -7.741  1.00 0.00 ? 63  GLU A HB3  1  
ATOM 980    H HG2  . GLU A 1 63  ? -24.663 23.483  -6.738  1.00 0.00 ? 63  GLU A HG2  1  
ATOM 981    H HG3  . GLU A 1 63  ? -24.287 23.475  -8.462  1.00 0.00 ? 63  GLU A HG3  1  
ATOM 982    N N    . THR A 1 64  ? -20.708 23.735  -5.413  1.00 0.00 ? 64  THR A N    1  
ATOM 983    C CA   . THR A 1 64  ? -19.875 22.616  -4.885  1.00 0.00 ? 64  THR A CA   1  
ATOM 984    C C    . THR A 1 64  ? -19.790 22.637  -3.353  1.00 0.00 ? 64  THR A C    1  
ATOM 985    O O    . THR A 1 64  ? -20.202 21.704  -2.693  1.00 0.00 ? 64  THR A O    1  
ATOM 986    C CB   . THR A 1 64  ? -18.463 22.769  -5.465  1.00 0.00 ? 64  THR A CB   1  
ATOM 987    O OG1  . THR A 1 64  ? -18.536 22.735  -6.884  1.00 0.00 ? 64  THR A OG1  1  
ATOM 988    C CG2  . THR A 1 64  ? -17.565 21.633  -4.975  1.00 0.00 ? 64  THR A CG2  1  
ATOM 989    H H    . THR A 1 64  ? -20.295 24.420  -5.978  1.00 0.00 ? 64  THR A H    1  
ATOM 990    H HA   . THR A 1 64  ? -20.289 21.674  -5.209  1.00 0.00 ? 64  THR A HA   1  
ATOM 991    H HB   . THR A 1 64  ? -18.046 23.713  -5.149  1.00 0.00 ? 64  THR A HB   1  
ATOM 992    H HG1  . THR A 1 64  ? -17.672 22.970  -7.231  1.00 0.00 ? 64  THR A HG1  1  
ATOM 993    H HG21 . THR A 1 64  ? -18.045 20.685  -5.170  1.00 0.00 ? 64  THR A HG21 1  
ATOM 994    H HG22 . THR A 1 64  ? -17.397 21.739  -3.913  1.00 0.00 ? 64  THR A HG22 1  
ATOM 995    H HG23 . THR A 1 64  ? -16.619 21.673  -5.495  1.00 0.00 ? 64  THR A HG23 1  
ATOM 996    N N    . PHE A 1 65  ? -19.217 23.670  -2.779  1.00 0.00 ? 65  PHE A N    1  
ATOM 997    C CA   . PHE A 1 65  ? -19.067 23.712  -1.286  1.00 0.00 ? 65  PHE A CA   1  
ATOM 998    C C    . PHE A 1 65  ? -20.199 24.507  -0.625  1.00 0.00 ? 65  PHE A C    1  
ATOM 999    O O    . PHE A 1 65  ? -20.803 24.041  0.318   1.00 0.00 ? 65  PHE A O    1  
ATOM 1000   C CB   . PHE A 1 65  ? -17.714 24.340  -0.948  1.00 0.00 ? 65  PHE A CB   1  
ATOM 1001   C CG   . PHE A 1 65  ? -16.611 23.442  -1.460  1.00 0.00 ? 65  PHE A CG   1  
ATOM 1002   C CD1  . PHE A 1 65  ? -16.131 22.391  -0.654  1.00 0.00 ? 65  PHE A CD1  1  
ATOM 1003   C CD2  . PHE A 1 65  ? -16.055 23.657  -2.738  1.00 0.00 ? 65  PHE A CD2  1  
ATOM 1004   C CE1  . PHE A 1 65  ? -15.097 21.557  -1.126  1.00 0.00 ? 65  PHE A CE1  1  
ATOM 1005   C CE2  . PHE A 1 65  ? -15.025 22.822  -3.208  1.00 0.00 ? 65  PHE A CE2  1  
ATOM 1006   C CZ   . PHE A 1 65  ? -14.547 21.772  -2.400  1.00 0.00 ? 65  PHE A CZ   1  
ATOM 1007   H H    . PHE A 1 65  ? -18.860 24.399  -3.328  1.00 0.00 ? 65  PHE A H    1  
ATOM 1008   H HA   . PHE A 1 65  ? -19.085 22.701  -0.906  1.00 0.00 ? 65  PHE A HA   1  
ATOM 1009   H HB2  . PHE A 1 65  ? -17.639 25.310  -1.418  1.00 0.00 ? 65  PHE A HB2  1  
ATOM 1010   H HB3  . PHE A 1 65  ? -17.623 24.448  0.123   1.00 0.00 ? 65  PHE A HB3  1  
ATOM 1011   H HD1  . PHE A 1 65  ? -16.554 22.225  0.326   1.00 0.00 ? 65  PHE A HD1  1  
ATOM 1012   H HD2  . PHE A 1 65  ? -16.421 24.462  -3.357  1.00 0.00 ? 65  PHE A HD2  1  
ATOM 1013   H HE1  . PHE A 1 65  ? -14.729 20.752  -0.508  1.00 0.00 ? 65  PHE A HE1  1  
ATOM 1014   H HE2  . PHE A 1 65  ? -14.599 22.988  -4.187  1.00 0.00 ? 65  PHE A HE2  1  
ATOM 1015   H HZ   . PHE A 1 65  ? -13.757 21.131  -2.762  1.00 0.00 ? 65  PHE A HZ   1  
ATOM 1016   N N    . GLY A 1 66  ? -20.509 25.692  -1.100  1.00 0.00 ? 66  GLY A N    1  
ATOM 1017   C CA   . GLY A 1 66  ? -21.621 26.479  -0.466  1.00 0.00 ? 66  GLY A CA   1  
ATOM 1018   C C    . GLY A 1 66  ? -21.291 27.978  -0.416  1.00 0.00 ? 66  GLY A C    1  
ATOM 1019   O O    . GLY A 1 66  ? -20.325 28.436  -1.034  1.00 0.00 ? 66  GLY A O    1  
ATOM 1020   H H    . GLY A 1 66  ? -20.020 26.059  -1.866  1.00 0.00 ? 66  GLY A H    1  
ATOM 1021   H HA2  . GLY A 1 66  ? -22.526 26.336  -1.038  1.00 0.00 ? 66  GLY A HA2  1  
ATOM 1022   H HA3  . GLY A 1 66  ? -21.779 26.119  0.540   1.00 0.00 ? 66  GLY A HA3  1  
ATOM 1023   N N    . GLU A 1 67  ? -22.083 28.719  0.315   1.00 0.00 ? 67  GLU A N    1  
ATOM 1024   C CA   . GLU A 1 67  ? -21.866 30.195  0.437   1.00 0.00 ? 67  GLU A CA   1  
ATOM 1025   C C    . GLU A 1 67  ? -20.604 30.474  1.255   1.00 0.00 ? 67  GLU A C    1  
ATOM 1026   O O    . GLU A 1 67  ? -19.987 31.528  1.109   1.00 0.00 ? 67  GLU A O    1  
ATOM 1027   C CB   . GLU A 1 67  ? -23.079 30.841  1.120   1.00 0.00 ? 67  GLU A CB   1  
ATOM 1028   C CG   . GLU A 1 67  ? -23.139 30.410  2.596   1.00 0.00 ? 67  GLU A CG   1  
ATOM 1029   C CD   . GLU A 1 67  ? -23.230 28.893  2.706   1.00 0.00 ? 67  GLU A CD   1  
ATOM 1030   O OE1  . GLU A 1 67  ? -24.330 28.384  2.669   1.00 0.00 ? 67  GLU A OE1  1  
ATOM 1031   O OE2  . GLU A 1 67  ? -22.191 28.266  2.833   1.00 0.00 ? 67  GLU A OE2  1  
ATOM 1032   H H    . GLU A 1 67  ? -22.833 28.303  0.788   1.00 0.00 ? 67  GLU A H    1  
ATOM 1033   H HA   . GLU A 1 67  ? -21.748 30.618  -0.551  1.00 0.00 ? 67  GLU A HA   1  
ATOM 1034   H HB2  . GLU A 1 67  ? -22.992 31.917  1.062   1.00 0.00 ? 67  GLU A HB2  1  
ATOM 1035   H HB3  . GLU A 1 67  ? -23.982 30.526  0.619   1.00 0.00 ? 67  GLU A HB3  1  
ATOM 1036   H HG2  . GLU A 1 67  ? -22.249 30.752  3.104   1.00 0.00 ? 67  GLU A HG2  1  
ATOM 1037   H HG3  . GLU A 1 67  ? -24.008 30.853  3.061   1.00 0.00 ? 67  GLU A HG3  1  
ATOM 1038   N N    . GLU A 1 68  ? -20.220 29.550  2.091   1.00 0.00 ? 68  GLU A N    1  
ATOM 1039   C CA   . GLU A 1 68  ? -19.001 29.736  2.927   1.00 0.00 ? 68  GLU A CA   1  
ATOM 1040   C C    . GLU A 1 68  ? -17.774 29.901  2.022   1.00 0.00 ? 68  GLU A C    1  
ATOM 1041   O O    . GLU A 1 68  ? -16.863 30.663  2.330   1.00 0.00 ? 68  GLU A O    1  
ATOM 1042   C CB   . GLU A 1 68  ? -18.814 28.506  3.823   1.00 0.00 ? 68  GLU A CB   1  
ATOM 1043   C CG   . GLU A 1 68  ? -17.804 28.821  4.931   1.00 0.00 ? 68  GLU A CG   1  
ATOM 1044   C CD   . GLU A 1 68  ? -16.387 28.776  4.380   1.00 0.00 ? 68  GLU A CD   1  
ATOM 1045   O OE1  . GLU A 1 68  ? -16.152 28.000  3.465   1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1046   O OE2  . GLU A 1 68  ? -15.558 29.508  4.875   1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1047   H H    . GLU A 1 68  ? -20.740 28.723  2.170   1.00 0.00 ? 68  GLU A H    1  
ATOM 1048   H HA   . GLU A 1 68  ? -19.117 30.615  3.543   1.00 0.00 ? 68  GLU A HA   1  
ATOM 1049   H HB2  . GLU A 1 68  ? -19.763 28.237  4.266   1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1050   H HB3  . GLU A 1 68  ? -18.448 27.682  3.229   1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1051   H HG2  . GLU A 1 68  ? -18.003 29.807  5.327   1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1052   H HG3  . GLU A 1 68  ? -17.902 28.092  5.722   1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1053   N N    . LYS A 1 69  ? -17.744 29.192  0.924   1.00 0.00 ? 69  LYS A N    1  
ATOM 1054   C CA   . LYS A 1 69  ? -16.579 29.284  -0.014  1.00 0.00 ? 69  LYS A CA   1  
ATOM 1055   C C    . LYS A 1 69  ? -16.886 30.241  -1.163  1.00 0.00 ? 69  LYS A C    1  
ATOM 1056   O O    . LYS A 1 69  ? -15.965 30.732  -1.815  1.00 0.00 ? 69  LYS A O    1  
ATOM 1057   C CB   . LYS A 1 69  ? -16.244 27.890  -0.550  1.00 0.00 ? 69  LYS A CB   1  
ATOM 1058   C CG   . LYS A 1 69  ? -15.909 26.965  0.629   1.00 0.00 ? 69  LYS A CG   1  
ATOM 1059   C CD   . LYS A 1 69  ? -14.536 27.336  1.211   1.00 0.00 ? 69  LYS A CD   1  
ATOM 1060   C CE   . LYS A 1 69  ? -14.075 26.245  2.180   1.00 0.00 ? 69  LYS A CE   1  
ATOM 1061   N NZ   . LYS A 1 69  ? -12.745 26.622  2.739   1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1062   H H    . LYS A 1 69  ? -18.488 28.590  0.715   1.00 0.00 ? 69  LYS A H    1  
ATOM 1063   H HA   . LYS A 1 69  ? -15.726 29.662  0.531   1.00 0.00 ? 69  LYS A HA   1  
ATOM 1064   H HB2  . LYS A 1 69  ? -17.093 27.497  -1.090  1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1065   H HB3  . LYS A 1 69  ? -15.391 27.952  -1.211  1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1066   H HG2  . LYS A 1 69  ? -16.665 27.071  1.394   1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1067   H HG3  . LYS A 1 69  ? -15.886 25.941  0.286   1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1068   H HD2  . LYS A 1 69  ? -13.819 27.431  0.408   1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1069   H HD3  . LYS A 1 69  ? -14.611 28.275  1.739   1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1070   H HE2  . LYS A 1 69  ? -14.792 26.149  2.984   1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1071   H HE3  . LYS A 1 69  ? -13.993 25.305  1.654   1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1072   H HZ1  . LYS A 1 69  ? -12.733 26.434  3.761   1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1073   H HZ2  . LYS A 1 69  ? -12.573 27.634  2.569   1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1074   H HZ3  . LYS A 1 69  ? -12.003 26.060  2.277   1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1075   N N    . GLU A 1 70  ? -18.134 30.495  -1.428  1.00 0.00 ? 70  GLU A N    1  
ATOM 1076   C CA   . GLU A 1 70  ? -18.485 31.406  -2.556  1.00 0.00 ? 70  GLU A CA   1  
ATOM 1077   C C    . GLU A 1 70  ? -18.038 32.842  -2.255  1.00 0.00 ? 70  GLU A C    1  
ATOM 1078   O O    . GLU A 1 70  ? -17.525 33.539  -3.115  1.00 0.00 ? 70  GLU A O    1  
ATOM 1079   C CB   . GLU A 1 70  ? -20.000 31.408  -2.739  1.00 0.00 ? 70  GLU A CB   1  
ATOM 1080   C CG   . GLU A 1 70  ? -20.366 32.160  -4.016  1.00 0.00 ? 70  GLU A CG   1  
ATOM 1081   C CD   . GLU A 1 70  ? -21.884 32.124  -4.219  1.00 0.00 ? 70  GLU A CD   1  
ATOM 1082   O OE1  . GLU A 1 70  ? -22.590 32.626  -3.362  1.00 0.00 ? 70  GLU A OE1  1  
ATOM 1083   O OE2  . GLU A 1 70  ? -22.310 31.583  -5.225  1.00 0.00 ? 70  GLU A OE2  1  
ATOM 1084   H H    . GLU A 1 70  ? -18.844 30.077  -0.897  1.00 0.00 ? 70  GLU A H    1  
ATOM 1085   H HA   . GLU A 1 70  ? -18.014 31.060  -3.463  1.00 0.00 ? 70  GLU A HA   1  
ATOM 1086   H HB2  . GLU A 1 70  ? -20.355 30.389  -2.807  1.00 0.00 ? 70  GLU A HB2  1  
ATOM 1087   H HB3  . GLU A 1 70  ? -20.464 31.893  -1.892  1.00 0.00 ? 70  GLU A HB3  1  
ATOM 1088   H HG2  . GLU A 1 70  ? -20.038 33.187  -3.934  1.00 0.00 ? 70  GLU A HG2  1  
ATOM 1089   H HG3  . GLU A 1 70  ? -19.881 31.693  -4.860  1.00 0.00 ? 70  GLU A HG3  1  
ATOM 1090   N N    . ALA A 1 71  ? -18.265 33.301  -1.058  1.00 0.00 ? 71  ALA A N    1  
ATOM 1091   C CA   . ALA A 1 71  ? -17.899 34.708  -0.724  1.00 0.00 ? 71  ALA A CA   1  
ATOM 1092   C C    . ALA A 1 71  ? -16.382 34.897  -0.708  1.00 0.00 ? 71  ALA A C    1  
ATOM 1093   O O    . ALA A 1 71  ? -15.892 35.982  -0.962  1.00 0.00 ? 71  ALA A O    1  
ATOM 1094   C CB   . ALA A 1 71  ? -18.492 35.096  0.631   1.00 0.00 ? 71  ALA A CB   1  
ATOM 1095   H H    . ALA A 1 71  ? -18.705 32.735  -0.390  1.00 0.00 ? 71  ALA A H    1  
ATOM 1096   H HA   . ALA A 1 71  ? -18.316 35.358  -1.480  1.00 0.00 ? 71  ALA A HA   1  
ATOM 1097   H HB1  . ALA A 1 71  ? -19.562 34.953  0.610   1.00 0.00 ? 71  ALA A HB1  1  
ATOM 1098   H HB2  . ALA A 1 71  ? -18.271 36.133  0.837   1.00 0.00 ? 71  ALA A HB2  1  
ATOM 1099   H HB3  . ALA A 1 71  ? -18.061 34.475  1.403   1.00 0.00 ? 71  ALA A HB3  1  
ATOM 1100   N N    . ILE A 1 72  ? -15.613 33.882  -0.413  1.00 0.00 ? 72  ILE A N    1  
ATOM 1101   C CA   . ILE A 1 72  ? -14.137 34.102  -0.408  1.00 0.00 ? 72  ILE A CA   1  
ATOM 1102   C C    . ILE A 1 72  ? -13.712 34.568  -1.803  1.00 0.00 ? 72  ILE A C    1  
ATOM 1103   O O    . ILE A 1 72  ? -12.875 35.437  -1.939  1.00 0.00 ? 72  ILE A O    1  
ATOM 1104   C CB   . ILE A 1 72  ? -13.346 32.837  -0.007  1.00 0.00 ? 72  ILE A CB   1  
ATOM 1105   C CG1  . ILE A 1 72  ? -13.600 32.538  1.484   1.00 0.00 ? 72  ILE A CG1  1  
ATOM 1106   C CG2  . ILE A 1 72  ? -11.827 33.080  -0.253  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 1107   C CD1  . ILE A 1 72  ? -13.069 31.150  1.876   1.00 0.00 ? 72  ILE A CD1  1  
ATOM 1108   H H    . ILE A 1 72  ? -15.993 33.003  -0.203  1.00 0.00 ? 72  ILE A H    1  
ATOM 1109   H HA   . ILE A 1 72  ? -13.914 34.892  0.297   1.00 0.00 ? 72  ILE A HA   1  
ATOM 1110   H HB   . ILE A 1 72  ? -13.677 32.002  -0.608  1.00 0.00 ? 72  ILE A HB   1  
ATOM 1111   H HG12 . ILE A 1 72  ? -13.106 33.287  2.085   1.00 0.00 ? 72  ILE A HG12 1  
ATOM 1112   H HG13 . ILE A 1 72  ? -14.663 32.577  1.675   1.00 0.00 ? 72  ILE A HG13 1  
ATOM 1113   H HG21 . ILE A 1 72  ? -11.253 32.327  0.267   1.00 0.00 ? 72  ILE A HG21 1  
ATOM 1114   H HG22 . ILE A 1 72  ? -11.554 34.058  0.116   1.00 0.00 ? 72  ILE A HG22 1  
ATOM 1115   H HG23 . ILE A 1 72  ? -11.621 33.024  -1.312  1.00 0.00 ? 72  ILE A HG23 1  
ATOM 1116   H HD11 . ILE A 1 72  ? -13.329 30.435  1.109   1.00 0.00 ? 72  ILE A HD11 1  
ATOM 1117   H HD12 . ILE A 1 72  ? -13.510 30.846  2.814   1.00 0.00 ? 72  ILE A HD12 1  
ATOM 1118   H HD13 . ILE A 1 72  ? -11.995 31.191  1.980   1.00 0.00 ? 72  ILE A HD13 1  
ATOM 1119   N N    . PHE A 1 73  ? -14.284 34.015  -2.834  1.00 0.00 ? 73  PHE A N    1  
ATOM 1120   C CA   . PHE A 1 73  ? -13.905 34.452  -4.211  1.00 0.00 ? 73  PHE A CA   1  
ATOM 1121   C C    . PHE A 1 73  ? -14.328 35.902  -4.422  1.00 0.00 ? 73  PHE A C    1  
ATOM 1122   O O    . PHE A 1 73  ? -13.622 36.680  -5.039  1.00 0.00 ? 73  PHE A O    1  
ATOM 1123   C CB   . PHE A 1 73  ? -14.575 33.559  -5.248  1.00 0.00 ? 73  PHE A CB   1  
ATOM 1124   C CG   . PHE A 1 73  ? -13.805 32.269  -5.346  1.00 0.00 ? 73  PHE A CG   1  
ATOM 1125   C CD1  . PHE A 1 73  ? -12.453 32.288  -5.731  1.00 0.00 ? 73  PHE A CD1  1  
ATOM 1126   C CD2  . PHE A 1 73  ? -14.429 31.054  -5.021  1.00 0.00 ? 73  PHE A CD2  1  
ATOM 1127   C CE1  . PHE A 1 73  ? -11.722 31.090  -5.800  1.00 0.00 ? 73  PHE A CE1  1  
ATOM 1128   C CE2  . PHE A 1 73  ? -13.700 29.853  -5.082  1.00 0.00 ? 73  PHE A CE2  1  
ATOM 1129   C CZ   . PHE A 1 73  ? -12.346 29.874  -5.472  1.00 0.00 ? 73  PHE A CZ   1  
ATOM 1130   H H    . PHE A 1 73  ? -14.965 33.322  -2.708  1.00 0.00 ? 73  PHE A H    1  
ATOM 1131   H HA   . PHE A 1 73  ? -12.833 34.379  -4.320  1.00 0.00 ? 73  PHE A HA   1  
ATOM 1132   H HB2  . PHE A 1 73  ? -15.592 33.353  -4.946  1.00 0.00 ? 73  PHE A HB2  1  
ATOM 1133   H HB3  . PHE A 1 73  ? -14.574 34.054  -6.207  1.00 0.00 ? 73  PHE A HB3  1  
ATOM 1134   H HD1  . PHE A 1 73  ? -11.978 33.225  -5.983  1.00 0.00 ? 73  PHE A HD1  1  
ATOM 1135   H HD2  . PHE A 1 73  ? -15.467 31.042  -4.725  1.00 0.00 ? 73  PHE A HD2  1  
ATOM 1136   H HE1  . PHE A 1 73  ? -10.684 31.104  -6.098  1.00 0.00 ? 73  PHE A HE1  1  
ATOM 1137   H HE2  . PHE A 1 73  ? -14.177 28.916  -4.833  1.00 0.00 ? 73  PHE A HE2  1  
ATOM 1138   H HZ   . PHE A 1 73  ? -11.785 28.952  -5.519  1.00 0.00 ? 73  PHE A HZ   1  
ATOM 1139   N N    . GLU A 1 74  ? -15.465 36.287  -3.923  1.00 0.00 ? 74  GLU A N    1  
ATOM 1140   C CA   . GLU A 1 74  ? -15.905 37.694  -4.116  1.00 0.00 ? 74  GLU A CA   1  
ATOM 1141   C C    . GLU A 1 74  ? -14.868 38.630  -3.493  1.00 0.00 ? 74  GLU A C    1  
ATOM 1142   O O    . GLU A 1 74  ? -14.537 39.659  -4.050  1.00 0.00 ? 74  GLU A O    1  
ATOM 1143   C CB   . GLU A 1 74  ? -17.267 37.905  -3.455  1.00 0.00 ? 74  GLU A CB   1  
ATOM 1144   C CG   . GLU A 1 74  ? -17.073 38.543  -2.076  1.00 0.00 ? 74  GLU A CG   1  
ATOM 1145   C CD   . GLU A 1 74  ? -16.770 40.033  -2.236  1.00 0.00 ? 74  GLU A CD   1  
ATOM 1146   O OE1  . GLU A 1 74  ? -17.246 40.614  -3.195  1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1147   O OE2  . GLU A 1 74  ? -16.058 40.569  -1.400  1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1148   H H    . GLU A 1 74  ? -16.027 35.655  -3.427  1.00 0.00 ? 74  GLU A H    1  
ATOM 1149   H HA   . GLU A 1 74  ? -15.982 37.901  -5.174  1.00 0.00 ? 74  GLU A HA   1  
ATOM 1150   H HB2  . GLU A 1 74  ? -17.869 38.556  -4.072  1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1151   H HB3  . GLU A 1 74  ? -17.765 36.954  -3.342  1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1152   H HG2  . GLU A 1 74  ? -17.974 38.420  -1.492  1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1153   H HG3  . GLU A 1 74  ? -16.249 38.063  -1.570  1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1154   N N    . GLY A 1 75  ? -14.341 38.284  -2.353  1.00 0.00 ? 75  GLY A N    1  
ATOM 1155   C CA   . GLY A 1 75  ? -13.314 39.158  -1.724  1.00 0.00 ? 75  GLY A CA   1  
ATOM 1156   C C    . GLY A 1 75  ? -12.098 39.230  -2.647  1.00 0.00 ? 75  GLY A C    1  
ATOM 1157   O O    . GLY A 1 75  ? -11.584 40.295  -2.933  1.00 0.00 ? 75  GLY A O    1  
ATOM 1158   H H    . GLY A 1 75  ? -14.609 37.447  -1.920  1.00 0.00 ? 75  GLY A H    1  
ATOM 1159   H HA2  . GLY A 1 75  ? -13.722 40.149  -1.579  1.00 0.00 ? 75  GLY A HA2  1  
ATOM 1160   H HA3  . GLY A 1 75  ? -13.018 38.744  -0.773  1.00 0.00 ? 75  GLY A HA3  1  
ATOM 1161   N N    . HIS A 1 76  ? -11.642 38.103  -3.117  1.00 0.00 ? 76  HIS A N    1  
ATOM 1162   C CA   . HIS A 1 76  ? -10.465 38.097  -4.026  1.00 0.00 ? 76  HIS A CA   1  
ATOM 1163   C C    . HIS A 1 76  ? -10.801 38.897  -5.280  1.00 0.00 ? 76  HIS A C    1  
ATOM 1164   O O    . HIS A 1 76  ? -10.025 39.716  -5.732  1.00 0.00 ? 76  HIS A O    1  
ATOM 1165   C CB   . HIS A 1 76  ? -10.128 36.657  -4.417  1.00 0.00 ? 76  HIS A CB   1  
ATOM 1166   C CG   . HIS A 1 76  ? -9.346  35.991  -3.313  1.00 0.00 ? 76  HIS A CG   1  
ATOM 1167   N ND1  . HIS A 1 76  ? -9.021  36.655  -2.140  1.00 0.00 ? 76  HIS A ND1  1  
ATOM 1168   C CD2  . HIS A 1 76  ? -8.810  34.728  -3.187  1.00 0.00 ? 76  HIS A CD2  1  
ATOM 1169   C CE1  . HIS A 1 76  ? -8.320  35.806  -1.367  1.00 0.00 ? 76  HIS A CE1  1  
ATOM 1170   N NE2  . HIS A 1 76  ? -8.167  34.620  -1.960  1.00 0.00 ? 76  HIS A NE2  1  
ATOM 1171   H H    . HIS A 1 76  ? -12.077 37.260  -2.874  1.00 0.00 ? 76  HIS A H    1  
ATOM 1172   H HA   . HIS A 1 76  ? -9.619  38.545  -3.526  1.00 0.00 ? 76  HIS A HA   1  
ATOM 1173   H HB2  . HIS A 1 76  ? -11.043 36.109  -4.588  1.00 0.00 ? 76  HIS A HB2  1  
ATOM 1174   H HB3  . HIS A 1 76  ? -9.538  36.660  -5.322  1.00 0.00 ? 76  HIS A HB3  1  
ATOM 1175   H HD1  . HIS A 1 76  ? -9.260  37.578  -1.914  1.00 0.00 ? 76  HIS A HD1  1  
ATOM 1176   H HD2  . HIS A 1 76  ? -8.879  33.945  -3.926  1.00 0.00 ? 76  HIS A HD2  1  
ATOM 1177   H HE1  . HIS A 1 76  ? -7.931  36.053  -0.391  1.00 0.00 ? 76  HIS A HE1  1  
ATOM 1178   H HE2  . HIS A 1 76  ? -7.698  33.836  -1.604  1.00 0.00 ? 76  HIS A HE2  1  
ATOM 1179   N N    . ILE A 1 77  ? -11.958 38.674  -5.843  1.00 0.00 ? 77  ILE A N    1  
ATOM 1180   C CA   . ILE A 1 77  ? -12.340 39.435  -7.065  1.00 0.00 ? 77  ILE A CA   1  
ATOM 1181   C C    . ILE A 1 77  ? -12.518 40.912  -6.699  1.00 0.00 ? 77  ILE A C    1  
ATOM 1182   O O    . ILE A 1 77  ? -12.031 41.790  -7.385  1.00 0.00 ? 77  ILE A O    1  
ATOM 1183   C CB   . ILE A 1 77  ? -13.654 38.875  -7.642  1.00 0.00 ? 77  ILE A CB   1  
ATOM 1184   C CG1  . ILE A 1 77  ? -13.658 37.340  -7.498  1.00 0.00 ? 77  ILE A CG1  1  
ATOM 1185   C CG2  . ILE A 1 77  ? -13.760 39.254  -9.126  1.00 0.00 ? 77  ILE A CG2  1  
ATOM 1186   C CD1  . ILE A 1 77  ? -12.215 36.796  -7.328  1.00 0.00 ? 77  ILE A CD1  1  
ATOM 1187   H H    . ILE A 1 77  ? -12.574 38.016  -5.461  1.00 0.00 ? 77  ILE A H    1  
ATOM 1188   H HA   . ILE A 1 77  ? -11.556 39.342  -7.802  1.00 0.00 ? 77  ILE A HA   1  
ATOM 1189   H HB   . ILE A 1 77  ? -14.491 39.293  -7.103  1.00 0.00 ? 77  ILE A HB   1  
ATOM 1190   H HG12 . ILE A 1 77  ? -14.245 37.067  -6.633  1.00 0.00 ? 77  ILE A HG12 1  
ATOM 1191   H HG13 . ILE A 1 77  ? -14.101 36.901  -8.380  1.00 0.00 ? 77  ILE A HG13 1  
ATOM 1192   H HG21 . ILE A 1 77  ? -13.821 40.329  -9.219  1.00 0.00 ? 77  ILE A HG21 1  
ATOM 1193   H HG22 . ILE A 1 77  ? -14.646 38.806  -9.549  1.00 0.00 ? 77  ILE A HG22 1  
ATOM 1194   H HG23 . ILE A 1 77  ? -12.888 38.895  -9.652  1.00 0.00 ? 77  ILE A HG23 1  
ATOM 1195   H HD11 . ILE A 1 77  ? -11.555 37.309  -8.012  1.00 0.00 ? 77  ILE A HD11 1  
ATOM 1196   H HD12 . ILE A 1 77  ? -12.201 35.738  -7.541  1.00 0.00 ? 77  ILE A HD12 1  
ATOM 1197   H HD13 . ILE A 1 77  ? -11.884 36.963  -6.313  1.00 0.00 ? 77  ILE A HD13 1  
ATOM 1198   N N    . MET A 1 78  ? -13.220 41.194  -5.635  1.00 0.00 ? 78  MET A N    1  
ATOM 1199   C CA   . MET A 1 78  ? -13.437 42.612  -5.240  1.00 0.00 ? 78  MET A CA   1  
ATOM 1200   C C    . MET A 1 78  ? -12.093 43.287  -4.970  1.00 0.00 ? 78  MET A C    1  
ATOM 1201   O O    . MET A 1 78  ? -11.873 44.425  -5.337  1.00 0.00 ? 78  MET A O    1  
ATOM 1202   C CB   . MET A 1 78  ? -14.316 42.637  -3.982  1.00 0.00 ? 78  MET A CB   1  
ATOM 1203   C CG   . MET A 1 78  ? -14.665 44.077  -3.616  1.00 0.00 ? 78  MET A CG   1  
ATOM 1204   S SD   . MET A 1 78  ? -15.710 44.784  -4.919  1.00 0.00 ? 78  MET A SD   1  
ATOM 1205   C CE   . MET A 1 78  ? -15.063 46.473  -4.885  1.00 0.00 ? 78  MET A CE   1  
ATOM 1206   H H    . MET A 1 78  ? -13.612 40.472  -5.101  1.00 0.00 ? 78  MET A H    1  
ATOM 1207   H HA   . MET A 1 78  ? -13.944 43.133  -6.039  1.00 0.00 ? 78  MET A HA   1  
ATOM 1208   H HB2  . MET A 1 78  ? -15.225 42.085  -4.169  1.00 0.00 ? 78  MET A HB2  1  
ATOM 1209   H HB3  . MET A 1 78  ? -13.781 42.180  -3.162  1.00 0.00 ? 78  MET A HB3  1  
ATOM 1210   H HG2  . MET A 1 78  ? -15.198 44.092  -2.677  1.00 0.00 ? 78  MET A HG2  1  
ATOM 1211   H HG3  . MET A 1 78  ? -13.759 44.657  -3.527  1.00 0.00 ? 78  MET A HG3  1  
ATOM 1212   H HE1  . MET A 1 78  ? -15.718 47.120  -5.454  1.00 0.00 ? 78  MET A HE1  1  
ATOM 1213   H HE2  . MET A 1 78  ? -14.077 46.492  -5.321  1.00 0.00 ? 78  MET A HE2  1  
ATOM 1214   H HE3  . MET A 1 78  ? -15.009 46.816  -3.861  1.00 0.00 ? 78  MET A HE3  1  
ATOM 1215   N N    . LEU A 1 79  ? -11.186 42.593  -4.349  1.00 0.00 ? 79  LEU A N    1  
ATOM 1216   C CA   . LEU A 1 79  ? -9.853  43.194  -4.072  1.00 0.00 ? 79  LEU A CA   1  
ATOM 1217   C C    . LEU A 1 79  ? -9.128  43.449  -5.386  1.00 0.00 ? 79  LEU A C    1  
ATOM 1218   O O    . LEU A 1 79  ? -8.473  44.451  -5.557  1.00 0.00 ? 79  LEU A O    1  
ATOM 1219   C CB   . LEU A 1 79  ? -9.015  42.220  -3.231  1.00 0.00 ? 79  LEU A CB   1  
ATOM 1220   C CG   . LEU A 1 79  ? -8.037  42.994  -2.321  1.00 0.00 ? 79  LEU A CG   1  
ATOM 1221   C CD1  . LEU A 1 79  ? -7.133  43.922  -3.177  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1222   C CD2  . LEU A 1 79  ? -8.840  43.782  -1.230  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1223   H H    . LEU A 1 79  ? -11.376 41.673  -4.072  1.00 0.00 ? 79  LEU A H    1  
ATOM 1224   H HA   . LEU A 1 79  ? -9.975  44.123  -3.536  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1225   H HB2  . LEU A 1 79  ? -9.674  41.621  -2.618  1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1226   H HB3  . LEU A 1 79  ? -8.453  41.574  -3.889  1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1227   H HG   . LEU A 1 79  ? -7.400  42.273  -1.826  1.00 0.00 ? 79  LEU A HG   1  
ATOM 1228   H HD11 . LEU A 1 79  ? -7.664  44.836  -3.399  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1229   H HD12 . LEU A 1 79  ? -6.875  43.422  -4.099  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1230   H HD13 . LEU A 1 79  ? -6.232  44.153  -2.628  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1231   H HD21 . LEU A 1 79  ? -8.739  44.844  -1.406  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1232   H HD22 . LEU A 1 79  ? -8.451  43.542  -0.252  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1233   H HD23 . LEU A 1 79  ? -9.883  43.505  -1.280  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1234   N N    . LEU A 1 80  ? -9.241  42.543  -6.304  1.00 0.00 ? 80  LEU A N    1  
ATOM 1235   C CA   . LEU A 1 80  ? -8.548  42.711  -7.602  1.00 0.00 ? 80  LEU A CA   1  
ATOM 1236   C C    . LEU A 1 80  ? -9.091  43.941  -8.328  1.00 0.00 ? 80  LEU A C    1  
ATOM 1237   O O    . LEU A 1 80  ? -8.355  44.678  -8.960  1.00 0.00 ? 80  LEU A O    1  
ATOM 1238   C CB   . LEU A 1 80  ? -8.759  41.455  -8.458  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1239   C CG   . LEU A 1 80  ? -8.312  41.713  -9.906  1.00 0.00 ? 80  LEU A CG   1  
ATOM 1240   C CD1  . LEU A 1 80  ? -6.838  42.149  -9.938  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1241   C CD2  . LEU A 1 80  ? -8.482  40.415  -10.705 1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1242   H H    . LEU A 1 80  ? -9.776  41.738  -6.135  1.00 0.00 ? 80  LEU A H    1  
ATOM 1243   H HA   . LEU A 1 80  ? -7.491  42.844  -7.423  1.00 0.00 ? 80  LEU A HA   1  
ATOM 1244   H HB2  . LEU A 1 80  ? -8.181  40.641  -8.045  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1245   H HB3  . LEU A 1 80  ? -9.806  41.189  -8.451  1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1246   H HG   . LEU A 1 80  ? -8.927  42.487  -10.340 1.00 0.00 ? 80  LEU A HG   1  
ATOM 1247   H HD11 . LEU A 1 80  ? -6.751  43.150  -9.541  1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1248   H HD12 . LEU A 1 80  ? -6.481  42.133  -10.957 1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1249   H HD13 . LEU A 1 80  ? -6.248  41.470  -9.339  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1250   H HD21 . LEU A 1 80  ? -7.692  39.726  -10.443 1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1251   H HD22 . LEU A 1 80  ? -8.434  40.634  -11.761 1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1252   H HD23 . LEU A 1 80  ? -9.439  39.972  -10.472 1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1253   N N    . GLU A 1 81  ? -10.373 44.167  -8.261  1.00 0.00 ? 81  GLU A N    1  
ATOM 1254   C CA   . GLU A 1 81  ? -10.969 45.342  -8.961  1.00 0.00 ? 81  GLU A CA   1  
ATOM 1255   C C    . GLU A 1 81  ? -10.813 46.602  -8.095  1.00 0.00 ? 81  GLU A C    1  
ATOM 1256   O O    . GLU A 1 81  ? -11.328 47.652  -8.426  1.00 0.00 ? 81  GLU A O    1  
ATOM 1257   C CB   . GLU A 1 81  ? -12.458 45.082  -9.210  1.00 0.00 ? 81  GLU A CB   1  
ATOM 1258   C CG   . GLU A 1 81  ? -12.630 43.830  -10.079 1.00 0.00 ? 81  GLU A CG   1  
ATOM 1259   C CD   . GLU A 1 81  ? -12.053 44.093  -11.468 1.00 0.00 ? 81  GLU A CD   1  
ATOM 1260   O OE1  . GLU A 1 81  ? -11.913 45.254  -11.820 1.00 0.00 ? 81  GLU A OE1  1  
ATOM 1261   O OE2  . GLU A 1 81  ? -11.759 43.130  -12.160 1.00 0.00 ? 81  GLU A OE2  1  
ATOM 1262   H H    . GLU A 1 81  ? -10.950 43.556  -7.756  1.00 0.00 ? 81  GLU A H    1  
ATOM 1263   H HA   . GLU A 1 81  ? -10.467 45.490  -9.906  1.00 0.00 ? 81  GLU A HA   1  
ATOM 1264   H HB2  . GLU A 1 81  ? -12.959 44.935  -8.264  1.00 0.00 ? 81  GLU A HB2  1  
ATOM 1265   H HB3  . GLU A 1 81  ? -12.890 45.931  -9.718  1.00 0.00 ? 81  GLU A HB3  1  
ATOM 1266   H HG2  . GLU A 1 81  ? -12.109 43.000  -9.623  1.00 0.00 ? 81  GLU A HG2  1  
ATOM 1267   H HG3  . GLU A 1 81  ? -13.680 43.594  -10.166 1.00 0.00 ? 81  GLU A HG3  1  
ATOM 1268   N N    . ASP A 1 82  ? -10.125 46.508  -6.992  1.00 0.00 ? 82  ASP A N    1  
ATOM 1269   C CA   . ASP A 1 82  ? -9.958  47.713  -6.122  1.00 0.00 ? 82  ASP A CA   1  
ATOM 1270   C C    . ASP A 1 82  ? -9.466  48.894  -6.967  1.00 0.00 ? 82  ASP A C    1  
ATOM 1271   O O    . ASP A 1 82  ? -8.532  48.777  -7.736  1.00 0.00 ? 82  ASP A O    1  
ATOM 1272   C CB   . ASP A 1 82  ? -8.940  47.414  -5.020  1.00 0.00 ? 82  ASP A CB   1  
ATOM 1273   C CG   . ASP A 1 82  ? -8.860  48.602  -4.062  1.00 0.00 ? 82  ASP A CG   1  
ATOM 1274   O OD1  . ASP A 1 82  ? -9.437  49.630  -4.371  1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1275   O OD2  . ASP A 1 82  ? -8.223  48.462  -3.031  1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1276   H H    . ASP A 1 82  ? -9.723  45.652  -6.733  1.00 0.00 ? 82  ASP A H    1  
ATOM 1277   H HA   . ASP A 1 82  ? -10.909 47.966  -5.674  1.00 0.00 ? 82  ASP A HA   1  
ATOM 1278   H HB2  . ASP A 1 82  ? -9.248  46.532  -4.476  1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1279   H HB3  . ASP A 1 82  ? -7.970  47.244  -5.462  1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1280   N N    . GLU A 1 83  ? -10.111 50.023  -6.848  1.00 0.00 ? 83  GLU A N    1  
ATOM 1281   C CA   . GLU A 1 83  ? -9.712  51.217  -7.655  1.00 0.00 ? 83  GLU A CA   1  
ATOM 1282   C C    . GLU A 1 83  ? -8.275  51.627  -7.336  1.00 0.00 ? 83  GLU A C    1  
ATOM 1283   O O    . GLU A 1 83  ? -7.637  52.314  -8.107  1.00 0.00 ? 83  GLU A O    1  
ATOM 1284   C CB   . GLU A 1 83  ? -10.651 52.383  -7.336  1.00 0.00 ? 83  GLU A CB   1  
ATOM 1285   C CG   . GLU A 1 83  ? -10.436 53.505  -8.349  1.00 0.00 ? 83  GLU A CG   1  
ATOM 1286   C CD   . GLU A 1 83  ? -10.910 53.044  -9.730  1.00 0.00 ? 83  GLU A CD   1  
ATOM 1287   O OE1  . GLU A 1 83  ? -11.672 52.093  -9.780  1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1288   O OE2  . GLU A 1 83  ? -10.501 53.644  -10.709 1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1289   H H    . GLU A 1 83  ? -10.874 50.083  -6.237  1.00 0.00 ? 83  GLU A H    1  
ATOM 1290   H HA   . GLU A 1 83  ? -9.788  50.979  -8.706  1.00 0.00 ? 83  GLU A HA   1  
ATOM 1291   H HB2  . GLU A 1 83  ? -11.676 52.043  -7.386  1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1292   H HB3  . GLU A 1 83  ? -10.442 52.752  -6.343  1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1293   H HG2  . GLU A 1 83  ? -11.000 54.376  -8.045  1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1294   H HG3  . GLU A 1 83  ? -9.387  53.753  -8.395  1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1295   N N    . GLU A 1 84  ? -7.747  51.205  -6.223  1.00 0.00 ? 84  GLU A N    1  
ATOM 1296   C CA   . GLU A 1 84  ? -6.340  51.567  -5.886  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1297   C C    . GLU A 1 84  ? -5.381  50.799  -6.807  1.00 0.00 ? 84  GLU A C    1  
ATOM 1298   O O    . GLU A 1 84  ? -4.358  51.299  -7.218  1.00 0.00 ? 84  GLU A O    1  
ATOM 1299   C CB   . GLU A 1 84  ? -6.055  51.191  -4.427  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1300   C CG   . GLU A 1 84  ? -6.929  52.038  -3.506  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1301   C CD   . GLU A 1 84  ? -6.475  53.498  -3.562  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1302   O OE1  . GLU A 1 84  ? -5.374  53.739  -4.024  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1303   O OE2  . GLU A 1 84  ? -7.240  54.353  -3.142  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1304   H H    . GLU A 1 84  ? -8.268  50.640  -5.615  1.00 0.00 ? 84  GLU A H    1  
ATOM 1305   H HA   . GLU A 1 84  ? -6.198  52.629  -6.020  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1306   H HB2  . GLU A 1 84  ? -6.277  50.145  -4.275  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1307   H HB3  . GLU A 1 84  ? -5.015  51.376  -4.204  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1308   H HG2  . GLU A 1 84  ? -7.960  51.967  -3.824  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1309   H HG3  . GLU A 1 84  ? -6.841  51.674  -2.493  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1310   N N    . LEU A 1 85  ? -5.727  49.585  -7.134  1.00 0.00 ? 85  LEU A N    1  
ATOM 1311   C CA   . LEU A 1 85  ? -4.857  48.768  -8.033  1.00 0.00 ? 85  LEU A CA   1  
ATOM 1312   C C    . LEU A 1 85  ? -4.898  49.329  -9.449  1.00 0.00 ? 85  LEU A C    1  
ATOM 1313   O O    . LEU A 1 85  ? -3.898  49.382  -10.140 1.00 0.00 ? 85  LEU A O    1  
ATOM 1314   C CB   . LEU A 1 85  ? -5.369  47.330  -8.063  1.00 0.00 ? 85  LEU A CB   1  
ATOM 1315   C CG   . LEU A 1 85  ? -5.172  46.678  -6.690  1.00 0.00 ? 85  LEU A CG   1  
ATOM 1316   C CD1  . LEU A 1 85  ? -5.962  45.370  -6.644  1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1317   C CD2  . LEU A 1 85  ? -3.689  46.370  -6.448  1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1318   H H    . LEU A 1 85  ? -6.565  49.209  -6.792  1.00 0.00 ? 85  LEU A H    1  
ATOM 1319   H HA   . LEU A 1 85  ? -3.841  48.781  -7.666  1.00 0.00 ? 85  LEU A HA   1  
ATOM 1320   H HB2  . LEU A 1 85  ? -6.420  47.329  -8.315  1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1321   H HB3  . LEU A 1 85  ? -4.821  46.770  -8.806  1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1322   H HG   . LEU A 1 85  ? -5.536  47.345  -5.920  1.00 0.00 ? 85  LEU A HG   1  
ATOM 1323   H HD11 . LEU A 1 85  ? -5.502  44.648  -7.302  1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1324   H HD12 . LEU A 1 85  ? -6.978  45.551  -6.962  1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1325   H HD13 . LEU A 1 85  ? -5.964  44.986  -5.634  1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1326   H HD21 . LEU A 1 85  ? -3.599  45.593  -5.703  1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1327   H HD22 . LEU A 1 85  ? -3.188  47.261  -6.099  1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1328   H HD23 . LEU A 1 85  ? -3.234  46.040  -7.370  1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1329   N N    . GLU A 1 86  ? -6.047  49.740  -9.892  1.00 0.00 ? 86  GLU A N    1  
ATOM 1330   C CA   . GLU A 1 86  ? -6.161  50.278  -11.272 1.00 0.00 ? 86  GLU A CA   1  
ATOM 1331   C C    . GLU A 1 86  ? -5.260  51.506  -11.414 1.00 0.00 ? 86  GLU A C    1  
ATOM 1332   O O    . GLU A 1 86  ? -4.515  51.632  -12.367 1.00 0.00 ? 86  GLU A O    1  
ATOM 1333   C CB   . GLU A 1 86  ? -7.616  50.676  -11.538 1.00 0.00 ? 86  GLU A CB   1  
ATOM 1334   C CG   . GLU A 1 86  ? -7.774  51.123  -12.990 1.00 0.00 ? 86  GLU A CG   1  
ATOM 1335   C CD   . GLU A 1 86  ? -7.286  52.565  -13.141 1.00 0.00 ? 86  GLU A CD   1  
ATOM 1336   O OE1  . GLU A 1 86  ? -7.385  53.302  -12.176 1.00 0.00 ? 86  GLU A OE1  1  
ATOM 1337   O OE2  . GLU A 1 86  ? -6.825  52.903  -14.218 1.00 0.00 ? 86  GLU A OE2  1  
ATOM 1338   H H    . GLU A 1 86  ? -6.842  49.682  -9.322  1.00 0.00 ? 86  GLU A H    1  
ATOM 1339   H HA   . GLU A 1 86  ? -5.857  49.522  -11.981 1.00 0.00 ? 86  GLU A HA   1  
ATOM 1340   H HB2  . GLU A 1 86  ? -8.260  49.827  -11.351 1.00 0.00 ? 86  GLU A HB2  1  
ATOM 1341   H HB3  . GLU A 1 86  ? -7.892  51.488  -10.882 1.00 0.00 ? 86  GLU A HB3  1  
ATOM 1342   H HG2  . GLU A 1 86  ? -7.192  50.477  -13.631 1.00 0.00 ? 86  GLU A HG2  1  
ATOM 1343   H HG3  . GLU A 1 86  ? -8.814  51.067  -13.272 1.00 0.00 ? 86  GLU A HG3  1  
ATOM 1344   N N    . GLN A 1 87  ? -5.336  52.418  -10.490 1.00 0.00 ? 87  GLN A N    1  
ATOM 1345   C CA   . GLN A 1 87  ? -4.492  53.643  -10.577 1.00 0.00 ? 87  GLN A CA   1  
ATOM 1346   C C    . GLN A 1 87  ? -3.012  53.306  -10.340 1.00 0.00 ? 87  GLN A C    1  
ATOM 1347   O O    . GLN A 1 87  ? -2.135  53.832  -10.996 1.00 0.00 ? 87  GLN A O    1  
ATOM 1348   C CB   . GLN A 1 87  ? -4.957  54.643  -9.516  1.00 0.00 ? 87  GLN A CB   1  
ATOM 1349   C CG   . GLN A 1 87  ? -6.337  55.189  -9.888  1.00 0.00 ? 87  GLN A CG   1  
ATOM 1350   C CD   . GLN A 1 87  ? -6.215  56.091  -11.118 1.00 0.00 ? 87  GLN A CD   1  
ATOM 1351   O OE1  . GLN A 1 87  ? -5.235  56.796  -11.275 1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1352   N NE2  . GLN A 1 87  ? -7.174  56.103  -12.002 1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1353   H H    . GLN A 1 87  ? -5.955  52.302  -9.739  1.00 0.00 ? 87  GLN A H    1  
ATOM 1354   H HA   . GLN A 1 87  ? -4.606  54.085  -11.556 1.00 0.00 ? 87  GLN A HA   1  
ATOM 1355   H HB2  . GLN A 1 87  ? -5.011  54.149  -8.557  1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1356   H HB3  . GLN A 1 87  ? -4.252  55.460  -9.460  1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1357   H HG2  . GLN A 1 87  ? -7.002  54.366  -10.107 1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1358   H HG3  . GLN A 1 87  ? -6.732  55.761  -9.062  1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1359   H HE21 . GLN A 1 87  ? -7.964  55.537  -11.876 1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1360   H HE22 . GLN A 1 87  ? -7.104  56.678  -12.793 1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1361   N N    . GLU A 1 88  ? -2.723  52.448  -9.394  1.00 0.00 ? 88  GLU A N    1  
ATOM 1362   C CA   . GLU A 1 88  ? -1.297  52.098  -9.102  1.00 0.00 ? 88  GLU A CA   1  
ATOM 1363   C C    . GLU A 1 88  ? -0.670  51.267  -10.229 1.00 0.00 ? 88  GLU A C    1  
ATOM 1364   O O    . GLU A 1 88  ? 0.472   51.469  -10.590 1.00 0.00 ? 88  GLU A O    1  
ATOM 1365   C CB   . GLU A 1 88  ? -1.227  51.315  -7.789  1.00 0.00 ? 88  GLU A CB   1  
ATOM 1366   C CG   . GLU A 1 88  ? -1.618  52.239  -6.634  1.00 0.00 ? 88  GLU A CG   1  
ATOM 1367   C CD   . GLU A 1 88  ? -0.515  53.274  -6.411  1.00 0.00 ? 88  GLU A CD   1  
ATOM 1368   O OE1  . GLU A 1 88  ? 0.570   53.078  -6.930  1.00 0.00 ? 88  GLU A OE1  1  
ATOM 1369   O OE2  . GLU A 1 88  ? -0.777  54.250  -5.726  1.00 0.00 ? 88  GLU A OE2  1  
ATOM 1370   H H    . GLU A 1 88  ? -3.443  52.044  -8.865  1.00 0.00 ? 88  GLU A H    1  
ATOM 1371   H HA   . GLU A 1 88  ? -0.733  53.012  -8.991  1.00 0.00 ? 88  GLU A HA   1  
ATOM 1372   H HB2  . GLU A 1 88  ? -1.910  50.478  -7.831  1.00 0.00 ? 88  GLU A HB2  1  
ATOM 1373   H HB3  . GLU A 1 88  ? -0.221  50.954  -7.635  1.00 0.00 ? 88  GLU A HB3  1  
ATOM 1374   H HG2  . GLU A 1 88  ? -2.543  52.744  -6.874  1.00 0.00 ? 88  GLU A HG2  1  
ATOM 1375   H HG3  . GLU A 1 88  ? -1.749  51.656  -5.735  1.00 0.00 ? 88  GLU A HG3  1  
ATOM 1376   N N    . ILE A 1 89  ? -1.394  50.344  -10.789 1.00 0.00 ? 89  ILE A N    1  
ATOM 1377   C CA   . ILE A 1 89  ? -0.812  49.523  -11.889 1.00 0.00 ? 89  ILE A CA   1  
ATOM 1378   C C    . ILE A 1 89  ? -0.581  50.414  -13.113 1.00 0.00 ? 89  ILE A C    1  
ATOM 1379   O O    . ILE A 1 89  ? 0.458   50.374  -13.740 1.00 0.00 ? 89  ILE A O    1  
ATOM 1380   C CB   . ILE A 1 89  ? -1.773  48.376  -12.240 1.00 0.00 ? 89  ILE A CB   1  
ATOM 1381   C CG1  . ILE A 1 89  ? -0.950  47.193  -12.768 1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1382   C CG2  . ILE A 1 89  ? -2.772  48.836  -13.313 1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1383   C CD1  . ILE A 1 89  ? -0.073  47.622  -13.953 1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1384   H H    . ILE A 1 89  ? -2.315  50.191  -10.492 1.00 0.00 ? 89  ILE A H    1  
ATOM 1385   H HA   . ILE A 1 89  ? 0.133   49.111  -11.565 1.00 0.00 ? 89  ILE A HA   1  
ATOM 1386   H HB   . ILE A 1 89  ? -2.311  48.074  -11.353 1.00 0.00 ? 89  ILE A HB   1  
ATOM 1387   H HG12 . ILE A 1 89  ? -0.318  46.818  -11.976 1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1388   H HG13 . ILE A 1 89  ? -1.620  46.409  -13.089 1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1389   H HG21 . ILE A 1 89  ? -3.501  48.058  -13.483 1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1390   H HG22 . ILE A 1 89  ? -2.244  49.042  -14.232 1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1391   H HG23 . ILE A 1 89  ? -3.273  49.732  -12.977 1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1392   H HD11 . ILE A 1 89  ? 0.813   48.117  -13.583 1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1393   H HD12 . ILE A 1 89  ? -0.628  48.301  -14.584 1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1394   H HD13 . ILE A 1 89  ? 0.212   46.751  -14.523 1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1395   N N    . ILE A 1 90  ? -1.551  51.213  -13.446 1.00 0.00 ? 90  ILE A N    1  
ATOM 1396   C CA   . ILE A 1 90  ? -1.432  52.117  -14.622 1.00 0.00 ? 90  ILE A CA   1  
ATOM 1397   C C    . ILE A 1 90  ? -0.379  53.205  -14.371 1.00 0.00 ? 90  ILE A C    1  
ATOM 1398   O O    . ILE A 1 90  ? 0.358   53.580  -15.259 1.00 0.00 ? 90  ILE A O    1  
ATOM 1399   C CB   . ILE A 1 90  ? -2.807  52.751  -14.886 1.00 0.00 ? 90  ILE A CB   1  
ATOM 1400   C CG1  . ILE A 1 90  ? -3.268  53.481  -13.610 1.00 0.00 ? 90  ILE A CG1  1  
ATOM 1401   C CG2  . ILE A 1 90  ? -3.824  51.669  -15.272 1.00 0.00 ? 90  ILE A CG2  1  
ATOM 1402   C CD1  . ILE A 1 90  ? -2.900  54.969  -13.663 1.00 0.00 ? 90  ILE A CD1  1  
ATOM 1403   H H    . ILE A 1 90  ? -2.375  51.218  -12.916 1.00 0.00 ? 90  ILE A H    1  
ATOM 1404   H HA   . ILE A 1 90  ? -1.140  51.538  -15.485 1.00 0.00 ? 90  ILE A HA   1  
ATOM 1405   H HB   . ILE A 1 90  ? -2.721  53.462  -15.695 1.00 0.00 ? 90  ILE A HB   1  
ATOM 1406   H HG12 . ILE A 1 90  ? -4.340  53.385  -13.515 1.00 0.00 ? 90  ILE A HG12 1  
ATOM 1407   H HG13 . ILE A 1 90  ? -2.794  53.028  -12.752 1.00 0.00 ? 90  ILE A HG13 1  
ATOM 1408   H HG21 . ILE A 1 90  ? -3.336  50.913  -15.871 1.00 0.00 ? 90  ILE A HG21 1  
ATOM 1409   H HG22 . ILE A 1 90  ? -4.626  52.116  -15.841 1.00 0.00 ? 90  ILE A HG22 1  
ATOM 1410   H HG23 . ILE A 1 90  ? -4.226  51.217  -14.378 1.00 0.00 ? 90  ILE A HG23 1  
ATOM 1411   H HD11 . ILE A 1 90  ? -2.705  55.327  -12.663 1.00 0.00 ? 90  ILE A HD11 1  
ATOM 1412   H HD12 . ILE A 1 90  ? -3.717  55.529  -14.093 1.00 0.00 ? 90  ILE A HD12 1  
ATOM 1413   H HD13 . ILE A 1 90  ? -2.016  55.100  -14.271 1.00 0.00 ? 90  ILE A HD13 1  
ATOM 1414   N N    . ALA A 1 91  ? -0.322  53.729  -13.180 1.00 0.00 ? 91  ALA A N    1  
ATOM 1415   C CA   . ALA A 1 91  ? 0.667   54.809  -12.893 1.00 0.00 ? 91  ALA A CA   1  
ATOM 1416   C C    . ALA A 1 91  ? 2.107   54.318  -13.123 1.00 0.00 ? 91  ALA A C    1  
ATOM 1417   O O    . ALA A 1 91  ? 2.894   54.990  -13.758 1.00 0.00 ? 91  ALA A O    1  
ATOM 1418   C CB   . ALA A 1 91  ? 0.508   55.269  -11.445 1.00 0.00 ? 91  ALA A CB   1  
ATOM 1419   H H    . ALA A 1 91  ? -0.938  53.427  -12.480 1.00 0.00 ? 91  ALA A H    1  
ATOM 1420   H HA   . ALA A 1 91  ? 0.472   55.646  -13.548 1.00 0.00 ? 91  ALA A HA   1  
ATOM 1421   H HB1  . ALA A 1 91  ? -0.437  55.778  -11.331 1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1422   H HB2  . ALA A 1 91  ? 1.313   55.942  -11.191 1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1423   H HB3  . ALA A 1 91  ? 0.536   54.410  -10.790 1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1424   N N    . LEU A 1 92  ? 2.460   53.175  -12.610 1.00 0.00 ? 92  LEU A N    1  
ATOM 1425   C CA   . LEU A 1 92  ? 3.855   52.675  -12.803 1.00 0.00 ? 92  LEU A CA   1  
ATOM 1426   C C    . LEU A 1 92  ? 4.142   52.492  -14.296 1.00 0.00 ? 92  LEU A C    1  
ATOM 1427   O O    . LEU A 1 92  ? 5.171   52.908  -14.798 1.00 0.00 ? 92  LEU A O    1  
ATOM 1428   C CB   . LEU A 1 92  ? 4.009   51.329  -12.078 1.00 0.00 ? 92  LEU A CB   1  
ATOM 1429   C CG   . LEU A 1 92  ? 3.765   51.505  -10.565 1.00 0.00 ? 92  LEU A CG   1  
ATOM 1430   C CD1  . LEU A 1 92  ? 3.875   50.144  -9.872  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1431   C CD2  . LEU A 1 92  ? 4.816   52.457  -9.958  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1432   H H    . LEU A 1 92  ? 1.816   52.649  -12.091 1.00 0.00 ? 92  LEU A H    1  
ATOM 1433   H HA   . LEU A 1 92  ? 4.553   53.387  -12.387 1.00 0.00 ? 92  LEU A HA   1  
ATOM 1434   H HB2  . LEU A 1 92  ? 3.292   50.625  -12.477 1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1435   H HB3  . LEU A 1 92  ? 5.007   50.950  -12.236 1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1436   H HG   . LEU A 1 92  ? 2.775   51.910  -10.406 1.00 0.00 ? 92  LEU A HG   1  
ATOM 1437   H HD11 . LEU A 1 92  ? 3.039   49.524  -10.161 1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1438   H HD12 . LEU A 1 92  ? 3.868   50.283  -8.801  1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1439   H HD13 . LEU A 1 92  ? 4.797   49.664  -10.166 1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1440   H HD21 . LEU A 1 92  ? 5.700   52.461  -10.580 1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1441   H HD22 . LEU A 1 92  ? 5.076   52.121  -8.965  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1442   H HD23 . LEU A 1 92  ? 4.409   53.456  -9.905  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1443   N N    . ILE A 1 93  ? 3.236   51.886  -15.019 1.00 0.00 ? 93  ILE A N    1  
ATOM 1444   C CA   . ILE A 1 93  ? 3.459   51.701  -16.481 1.00 0.00 ? 93  ILE A CA   1  
ATOM 1445   C C    . ILE A 1 93  ? 3.582   53.078  -17.129 1.00 0.00 ? 93  ILE A C    1  
ATOM 1446   O O    . ILE A 1 93  ? 4.491   53.349  -17.883 1.00 0.00 ? 93  ILE A O    1  
ATOM 1447   C CB   . ILE A 1 93  ? 2.262   50.965  -17.095 1.00 0.00 ? 93  ILE A CB   1  
ATOM 1448   C CG1  . ILE A 1 93  ? 2.177   49.540  -16.508 1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1449   C CG2  . ILE A 1 93  ? 2.451   50.896  -18.624 1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1450   C CD1  . ILE A 1 93  ? 0.864   48.867  -16.938 1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1451   H H    . ILE A 1 93  ? 2.409   51.566  -14.602 1.00 0.00 ? 93  ILE A H    1  
ATOM 1452   H HA   . ILE A 1 93  ? 4.363   51.134  -16.646 1.00 0.00 ? 93  ILE A HA   1  
ATOM 1453   H HB   . ILE A 1 93  ? 1.354   51.506  -16.869 1.00 0.00 ? 93  ILE A HB   1  
ATOM 1454   H HG12 . ILE A 1 93  ? 3.013   48.956  -16.866 1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1455   H HG13 . ILE A 1 93  ? 2.214   49.594  -15.431 1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1456   H HG21 . ILE A 1 93  ? 3.438   50.519  -18.849 1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1457   H HG22 . ILE A 1 93  ? 2.339   51.884  -19.046 1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1458   H HG23 . ILE A 1 93  ? 1.707   50.236  -19.050 1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1459   H HD11 . ILE A 1 93  ? 0.888   48.676  -18.001 1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1460   H HD12 . ILE A 1 93  ? 0.034   49.520  -16.709 1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1461   H HD13 . ILE A 1 93  ? 0.746   47.935  -16.406 1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1462   N N    . LYS A 1 94  ? 2.665   53.952  -16.832 1.00 0.00 ? 94  LYS A N    1  
ATOM 1463   C CA   . LYS A 1 94  ? 2.716   55.321  -17.426 1.00 0.00 ? 94  LYS A CA   1  
ATOM 1464   C C    . LYS A 1 94  ? 3.895   56.115  -16.848 1.00 0.00 ? 94  LYS A C    1  
ATOM 1465   O O    . LYS A 1 94  ? 4.574   56.831  -17.558 1.00 0.00 ? 94  LYS A O    1  
ATOM 1466   C CB   . LYS A 1 94  ? 1.418   56.097  -17.137 1.00 0.00 ? 94  LYS A CB   1  
ATOM 1467   C CG   . LYS A 1 94  ? 0.249   55.517  -17.953 1.00 0.00 ? 94  LYS A CG   1  
ATOM 1468   C CD   . LYS A 1 94  ? -1.056  56.334  -17.699 1.00 0.00 ? 94  LYS A CD   1  
ATOM 1469   C CE   . LYS A 1 94  ? -2.207  55.773  -18.546 1.00 0.00 ? 94  LYS A CE   1  
ATOM 1470   N NZ   . LYS A 1 94  ? -3.447  56.566  -18.304 1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1471   H H    . LYS A 1 94  ? 1.940   53.712  -16.218 1.00 0.00 ? 94  LYS A H    1  
ATOM 1472   H HA   . LYS A 1 94  ? 2.842   55.235  -18.495 1.00 0.00 ? 94  LYS A HA   1  
ATOM 1473   H HB2  . LYS A 1 94  ? 1.187   56.026  -16.083 1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1474   H HB3  . LYS A 1 94  ? 1.556   57.135  -17.402 1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1475   H HG2  . LYS A 1 94  ? 0.495   55.555  -19.005 1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1476   H HG3  . LYS A 1 94  ? 0.086   54.490  -17.662 1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1477   H HD2  . LYS A 1 94  ? -1.318  56.272  -16.653 1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1478   H HD3  . LYS A 1 94  ? -0.887  57.368  -17.963 1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1479   H HE2  . LYS A 1 94  ? -1.943  55.831  -19.592 1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1480   H HE3  . LYS A 1 94  ? -2.381  54.742  -18.277 1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1481   H HZ1  . LYS A 1 94  ? -3.289  57.554  -18.585 1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1482   H HZ2  . LYS A 1 94  ? -3.691  56.528  -17.292 1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1483   H HZ3  . LYS A 1 94  ? -4.228  56.170  -18.864 1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1484   N N    . ASP A 1 95  ? 4.133   56.023  -15.567 1.00 0.00 ? 95  ASP A N    1  
ATOM 1485   C CA   . ASP A 1 95  ? 5.250   56.813  -14.964 1.00 0.00 ? 95  ASP A CA   1  
ATOM 1486   C C    . ASP A 1 95  ? 6.610   56.127  -15.148 1.00 0.00 ? 95  ASP A C    1  
ATOM 1487   O O    . ASP A 1 95  ? 7.570   56.746  -15.563 1.00 0.00 ? 95  ASP A O    1  
ATOM 1488   C CB   . ASP A 1 95  ? 4.987   57.005  -13.472 1.00 0.00 ? 95  ASP A CB   1  
ATOM 1489   C CG   . ASP A 1 95  ? 6.072   57.911  -12.887 1.00 0.00 ? 95  ASP A CG   1  
ATOM 1490   O OD1  . ASP A 1 95  ? 7.019   58.202  -13.600 1.00 0.00 ? 95  ASP A OD1  1  
ATOM 1491   O OD2  . ASP A 1 95  ? 5.935   58.303  -11.739 1.00 0.00 ? 95  ASP A OD2  1  
ATOM 1492   H H    . ASP A 1 95  ? 3.567   55.460  -15.000 1.00 0.00 ? 95  ASP A H    1  
ATOM 1493   H HA   . ASP A 1 95  ? 5.285   57.784  -15.436 1.00 0.00 ? 95  ASP A HA   1  
ATOM 1494   H HB2  . ASP A 1 95  ? 4.018   57.462  -13.332 1.00 0.00 ? 95  ASP A HB2  1  
ATOM 1495   H HB3  . ASP A 1 95  ? 5.012   56.047  -12.973 1.00 0.00 ? 95  ASP A HB3  1  
ATOM 1496   N N    . LYS A 1 96  ? 6.717   54.873  -14.798 1.00 0.00 ? 96  LYS A N    1  
ATOM 1497   C CA   . LYS A 1 96  ? 8.045   54.184  -14.917 1.00 0.00 ? 96  LYS A CA   1  
ATOM 1498   C C    . LYS A 1 96  ? 8.222   53.488  -16.275 1.00 0.00 ? 96  LYS A C    1  
ATOM 1499   O O    . LYS A 1 96  ? 9.263   52.917  -16.540 1.00 0.00 ? 96  LYS A O    1  
ATOM 1500   C CB   . LYS A 1 96  ? 8.208   53.168  -13.774 1.00 0.00 ? 96  LYS A CB   1  
ATOM 1501   C CG   . LYS A 1 96  ? 8.200   53.903  -12.398 1.00 0.00 ? 96  LYS A CG   1  
ATOM 1502   C CD   . LYS A 1 96  ? 8.585   52.938  -11.257 1.00 0.00 ? 96  LYS A CD   1  
ATOM 1503   C CE   . LYS A 1 96  ? 8.567   53.675  -9.915  1.00 0.00 ? 96  LYS A CE   1  
ATOM 1504   N NZ   . LYS A 1 96  ? 7.173   54.094  -9.604  1.00 0.00 ? 96  LYS A NZ   1  
ATOM 1505   H H    . LYS A 1 96  ? 5.944   54.396  -14.431 1.00 0.00 ? 96  LYS A H    1  
ATOM 1506   H HA   . LYS A 1 96  ? 8.820   54.929  -14.818 1.00 0.00 ? 96  LYS A HA   1  
ATOM 1507   H HB2  . LYS A 1 96  ? 7.393   52.458  -13.807 1.00 0.00 ? 96  LYS A HB2  1  
ATOM 1508   H HB3  . LYS A 1 96  ? 9.144   52.644  -13.891 1.00 0.00 ? 96  LYS A HB3  1  
ATOM 1509   H HG2  . LYS A 1 96  ? 8.908   54.719  -12.427 1.00 0.00 ? 96  LYS A HG2  1  
ATOM 1510   H HG3  . LYS A 1 96  ? 7.211   54.298  -12.211 1.00 0.00 ? 96  LYS A HG3  1  
ATOM 1511   H HD2  . LYS A 1 96  ? 7.879   52.120  -11.227 1.00 0.00 ? 96  LYS A HD2  1  
ATOM 1512   H HD3  . LYS A 1 96  ? 9.577   52.548  -11.437 1.00 0.00 ? 96  LYS A HD3  1  
ATOM 1513   H HE2  . LYS A 1 96  ? 8.928   53.017  -9.137  1.00 0.00 ? 96  LYS A HE2  1  
ATOM 1514   H HE3  . LYS A 1 96  ? 9.201   54.547  -9.974  1.00 0.00 ? 96  LYS A HE3  1  
ATOM 1515   H HZ1  . LYS A 1 96  ? 6.698   54.397  -10.478 1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 1516   H HZ2  . LYS A 1 96  ? 7.192   54.885  -8.927  1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 1517   H HZ3  . LYS A 1 96  ? 6.654   53.294  -9.190  1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 1518   N N    . HIS A 1 97  ? 7.236   53.526  -17.133 1.00 0.00 ? 97  HIS A N    1  
ATOM 1519   C CA   . HIS A 1 97  ? 7.374   52.868  -18.472 1.00 0.00 ? 97  HIS A CA   1  
ATOM 1520   C C    . HIS A 1 97  ? 7.754   51.393  -18.289 1.00 0.00 ? 97  HIS A C    1  
ATOM 1521   O O    . HIS A 1 97  ? 8.564   50.839  -19.007 1.00 0.00 ? 97  HIS A O    1  
ATOM 1522   C CB   . HIS A 1 97  ? 8.427   53.615  -19.295 1.00 0.00 ? 97  HIS A CB   1  
ATOM 1523   C CG   . HIS A 1 97  ? 7.979   55.035  -19.510 1.00 0.00 ? 97  HIS A CG   1  
ATOM 1524   N ND1  . HIS A 1 97  ? 8.823   56.008  -20.018 1.00 0.00 ? 97  HIS A ND1  1  
ATOM 1525   C CD2  . HIS A 1 97  ? 6.778   55.661  -19.282 1.00 0.00 ? 97  HIS A CD2  1  
ATOM 1526   C CE1  . HIS A 1 97  ? 8.127   57.160  -20.081 1.00 0.00 ? 97  HIS A CE1  1  
ATOM 1527   N NE2  . HIS A 1 97  ? 6.873   57.002  -19.645 1.00 0.00 ? 97  HIS A NE2  1  
ATOM 1528   H H    . HIS A 1 97  ? 6.405   53.991  -16.902 1.00 0.00 ? 97  HIS A H    1  
ATOM 1529   H HA   . HIS A 1 97  ? 6.424   52.921  -18.986 1.00 0.00 ? 97  HIS A HA   1  
ATOM 1530   H HB2  . HIS A 1 97  ? 9.368   53.610  -18.765 1.00 0.00 ? 97  HIS A HB2  1  
ATOM 1531   H HB3  . HIS A 1 97  ? 8.549   53.128  -20.251 1.00 0.00 ? 97  HIS A HB3  1  
ATOM 1532   H HD1  . HIS A 1 97  ? 9.758   55.882  -20.285 1.00 0.00 ? 97  HIS A HD1  1  
ATOM 1533   H HD2  . HIS A 1 97  ? 5.894   55.185  -18.882 1.00 0.00 ? 97  HIS A HD2  1  
ATOM 1534   H HE1  . HIS A 1 97  ? 8.531   58.095  -20.439 1.00 0.00 ? 97  HIS A HE1  1  
ATOM 1535   H HE2  . HIS A 1 97  ? 6.170   57.684  -19.594 1.00 0.00 ? 97  HIS A HE2  1  
ATOM 1536   N N    . MET A 1 98  ? 7.173   50.773  -17.299 1.00 0.00 ? 98  MET A N    1  
ATOM 1537   C CA   . MET A 1 98  ? 7.470   49.334  -17.007 1.00 0.00 ? 98  MET A CA   1  
ATOM 1538   C C    . MET A 1 98  ? 6.446   48.442  -17.723 1.00 0.00 ? 98  MET A C    1  
ATOM 1539   O O    . MET A 1 98  ? 5.463   48.920  -18.250 1.00 0.00 ? 98  MET A O    1  
ATOM 1540   C CB   . MET A 1 98  ? 7.388   49.108  -15.497 1.00 0.00 ? 98  MET A CB   1  
ATOM 1541   C CG   . MET A 1 98  ? 8.575   49.804  -14.822 1.00 0.00 ? 98  MET A CG   1  
ATOM 1542   S SD   . MET A 1 98  ? 8.366   49.770  -13.018 1.00 0.00 ? 98  MET A SD   1  
ATOM 1543   C CE   . MET A 1 98  ? 8.616   47.991  -12.762 1.00 0.00 ? 98  MET A CE   1  
ATOM 1544   H H    . MET A 1 98  ? 6.539   51.258  -16.732 1.00 0.00 ? 98  MET A H    1  
ATOM 1545   H HA   . MET A 1 98  ? 8.464   49.093  -17.355 1.00 0.00 ? 98  MET A HA   1  
ATOM 1546   H HB2  . MET A 1 98  ? 6.463   49.520  -15.120 1.00 0.00 ? 98  MET A HB2  1  
ATOM 1547   H HB3  . MET A 1 98  ? 7.426   48.050  -15.286 1.00 0.00 ? 98  MET A HB3  1  
ATOM 1548   H HG2  . MET A 1 98  ? 9.488   49.293  -15.087 1.00 0.00 ? 98  MET A HG2  1  
ATOM 1549   H HG3  . MET A 1 98  ? 8.627   50.830  -15.159 1.00 0.00 ? 98  MET A HG3  1  
ATOM 1550   H HE1  . MET A 1 98  ? 9.412   47.644  -13.407 1.00 0.00 ? 98  MET A HE1  1  
ATOM 1551   H HE2  . MET A 1 98  ? 7.707   47.461  -12.997 1.00 0.00 ? 98  MET A HE2  1  
ATOM 1552   H HE3  . MET A 1 98  ? 8.878   47.811  -11.728 1.00 0.00 ? 98  MET A HE3  1  
ATOM 1553   N N    . THR A 1 99  ? 6.671   47.154  -17.745 1.00 0.00 ? 99  THR A N    1  
ATOM 1554   C CA   . THR A 1 99  ? 5.711   46.237  -18.431 1.00 0.00 ? 99  THR A CA   1  
ATOM 1555   C C    . THR A 1 99  ? 4.519   45.945  -17.507 1.00 0.00 ? 99  THR A C    1  
ATOM 1556   O O    . THR A 1 99  ? 4.597   46.117  -16.307 1.00 0.00 ? 99  THR A O    1  
ATOM 1557   C CB   . THR A 1 99  ? 6.425   44.925  -18.783 1.00 0.00 ? 99  THR A CB   1  
ATOM 1558   O OG1  . THR A 1 99  ? 7.115   44.438  -17.645 1.00 0.00 ? 99  THR A OG1  1  
ATOM 1559   C CG2  . THR A 1 99  ? 7.424   45.166  -19.922 1.00 0.00 ? 99  THR A CG2  1  
ATOM 1560   H H    . THR A 1 99  ? 7.472   46.790  -17.313 1.00 0.00 ? 99  THR A H    1  
ATOM 1561   H HA   . THR A 1 99  ? 5.355   46.706  -19.338 1.00 0.00 ? 99  THR A HA   1  
ATOM 1562   H HB   . THR A 1 99  ? 5.696   44.194  -19.101 1.00 0.00 ? 99  THR A HB   1  
ATOM 1563   H HG1  . THR A 1 99  ? 6.748   44.867  -16.869 1.00 0.00 ? 99  THR A HG1  1  
ATOM 1564   H HG21 . THR A 1 99  ? 6.951   45.748  -20.699 1.00 0.00 ? 99  THR A HG21 1  
ATOM 1565   H HG22 . THR A 1 99  ? 7.744   44.218  -20.328 1.00 0.00 ? 99  THR A HG22 1  
ATOM 1566   H HG23 . THR A 1 99  ? 8.281   45.702  -19.541 1.00 0.00 ? 99  THR A HG23 1  
ATOM 1567   N N    . ALA A 1 100 ? 3.413   45.511  -18.060 1.00 0.00 ? 100 ALA A N    1  
ATOM 1568   C CA   . ALA A 1 100 ? 2.218   45.219  -17.218 1.00 0.00 ? 100 ALA A CA   1  
ATOM 1569   C C    . ALA A 1 100 ? 2.470   44.009  -16.322 1.00 0.00 ? 100 ALA A C    1  
ATOM 1570   O O    . ALA A 1 100 ? 2.082   43.992  -15.170 1.00 0.00 ? 100 ALA A O    1  
ATOM 1571   C CB   . ALA A 1 100 ? 1.024   44.920  -18.124 1.00 0.00 ? 100 ALA A CB   1  
ATOM 1572   H H    . ALA A 1 100 ? 3.370   45.385  -19.030 1.00 0.00 ? 100 ALA A H    1  
ATOM 1573   H HA   . ALA A 1 100 ? 1.992   46.078  -16.605 1.00 0.00 ? 100 ALA A HA   1  
ATOM 1574   H HB1  . ALA A 1 100 ? 1.347   44.312  -18.957 1.00 0.00 ? 100 ALA A HB1  1  
ATOM 1575   H HB2  . ALA A 1 100 ? 0.611   45.847  -18.493 1.00 0.00 ? 100 ALA A HB2  1  
ATOM 1576   H HB3  . ALA A 1 100 ? 0.270   44.389  -17.561 1.00 0.00 ? 100 ALA A HB3  1  
ATOM 1577   N N    . ASP A 1 101 ? 3.115   42.992  -16.824 1.00 0.00 ? 101 ASP A N    1  
ATOM 1578   C CA   . ASP A 1 101 ? 3.374   41.801  -15.971 1.00 0.00 ? 101 ASP A CA   1  
ATOM 1579   C C    . ASP A 1 101 ? 4.418   42.150  -14.903 1.00 0.00 ? 101 ASP A C    1  
ATOM 1580   O O    . ASP A 1 101 ? 4.355   41.672  -13.787 1.00 0.00 ? 101 ASP A O    1  
ATOM 1581   C CB   . ASP A 1 101 ? 3.855   40.626  -16.829 1.00 0.00 ? 101 ASP A CB   1  
ATOM 1582   C CG   . ASP A 1 101 ? 4.619   41.137  -18.048 1.00 0.00 ? 101 ASP A CG   1  
ATOM 1583   O OD1  . ASP A 1 101 ? 5.374   42.084  -17.889 1.00 0.00 ? 101 ASP A OD1  1  
ATOM 1584   O OD2  . ASP A 1 101 ? 4.444   40.575  -19.117 1.00 0.00 ? 101 ASP A OD2  1  
ATOM 1585   H H    . ASP A 1 101 ? 3.425   43.012  -17.753 1.00 0.00 ? 101 ASP A H    1  
ATOM 1586   H HA   . ASP A 1 101 ? 2.454   41.522  -15.477 1.00 0.00 ? 101 ASP A HA   1  
ATOM 1587   H HB2  . ASP A 1 101 ? 4.505   39.996  -16.239 1.00 0.00 ? 101 ASP A HB2  1  
ATOM 1588   H HB3  . ASP A 1 101 ? 3.002   40.051  -17.157 1.00 0.00 ? 101 ASP A HB3  1  
ATOM 1589   N N    . ALA A 1 102 ? 5.367   42.994  -15.220 1.00 0.00 ? 102 ALA A N    1  
ATOM 1590   C CA   . ALA A 1 102 ? 6.388   43.370  -14.199 1.00 0.00 ? 102 ALA A CA   1  
ATOM 1591   C C    . ALA A 1 102 ? 5.811   44.442  -13.269 1.00 0.00 ? 102 ALA A C    1  
ATOM 1592   O O    . ALA A 1 102 ? 6.024   44.422  -12.076 1.00 0.00 ? 102 ALA A O    1  
ATOM 1593   C CB   . ALA A 1 102 ? 7.643   43.920  -14.882 1.00 0.00 ? 102 ALA A CB   1  
ATOM 1594   H H    . ALA A 1 102 ? 5.400   43.385  -16.118 1.00 0.00 ? 102 ALA A H    1  
ATOM 1595   H HA   . ALA A 1 102 ? 6.649   42.498  -13.619 1.00 0.00 ? 102 ALA A HA   1  
ATOM 1596   H HB1  . ALA A 1 102 ? 8.505   43.727  -14.260 1.00 0.00 ? 102 ALA A HB1  1  
ATOM 1597   H HB2  . ALA A 1 102 ? 7.536   44.984  -15.029 1.00 0.00 ? 102 ALA A HB2  1  
ATOM 1598   H HB3  . ALA A 1 102 ? 7.773   43.435  -15.839 1.00 0.00 ? 102 ALA A HB3  1  
ATOM 1599   N N    . ALA A 1 103 ? 5.087   45.383  -13.815 1.00 0.00 ? 103 ALA A N    1  
ATOM 1600   C CA   . ALA A 1 103 ? 4.503   46.460  -12.967 1.00 0.00 ? 103 ALA A CA   1  
ATOM 1601   C C    . ALA A 1 103 ? 3.384   45.888  -12.089 1.00 0.00 ? 103 ALA A C    1  
ATOM 1602   O O    . ALA A 1 103 ? 3.312   46.158  -10.905 1.00 0.00 ? 103 ALA A O    1  
ATOM 1603   C CB   . ALA A 1 103 ? 3.939   47.569  -13.862 1.00 0.00 ? 103 ALA A CB   1  
ATOM 1604   H H    . ALA A 1 103 ? 4.933   45.383  -14.783 1.00 0.00 ? 103 ALA A H    1  
ATOM 1605   H HA   . ALA A 1 103 ? 5.275   46.873  -12.335 1.00 0.00 ? 103 ALA A HA   1  
ATOM 1606   H HB1  . ALA A 1 103 ? 4.706   47.908  -14.541 1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1607   H HB2  . ALA A 1 103 ? 3.609   48.395  -13.248 1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1608   H HB3  . ALA A 1 103 ? 3.102   47.184  -14.428 1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1609   N N    . ALA A 1 104 ? 2.505   45.106  -12.659 1.00 0.00 ? 104 ALA A N    1  
ATOM 1610   C CA   . ALA A 1 104 ? 1.391   44.523  -11.857 1.00 0.00 ? 104 ALA A CA   1  
ATOM 1611   C C    . ALA A 1 104 ? 1.962   43.637  -10.743 1.00 0.00 ? 104 ALA A C    1  
ATOM 1612   O O    . ALA A 1 104 ? 1.450   43.601  -9.641  1.00 0.00 ? 104 ALA A O    1  
ATOM 1613   C CB   . ALA A 1 104 ? 0.484   43.692  -12.773 1.00 0.00 ? 104 ALA A CB   1  
ATOM 1614   H H    . ALA A 1 104 ? 2.576   44.905  -13.615 1.00 0.00 ? 104 ALA A H    1  
ATOM 1615   H HA   . ALA A 1 104 ? 0.815   45.323  -11.415 1.00 0.00 ? 104 ALA A HA   1  
ATOM 1616   H HB1  . ALA A 1 104 ? 1.078   42.955  -13.296 1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1617   H HB2  . ALA A 1 104 ? 0.003   44.341  -13.489 1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1618   H HB3  . ALA A 1 104 ? -0.266  43.192  -12.179 1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1619   N N    . HIS A 1 105 ? 2.998   42.903  -11.036 1.00 0.00 ? 105 HIS A N    1  
ATOM 1620   C CA   . HIS A 1 105 ? 3.587   42.000  -10.002 1.00 0.00 ? 105 HIS A CA   1  
ATOM 1621   C C    . HIS A 1 105 ? 4.043   42.821  -8.796  1.00 0.00 ? 105 HIS A C    1  
ATOM 1622   O O    . HIS A 1 105 ? 3.884   42.413  -7.661  1.00 0.00 ? 105 HIS A O    1  
ATOM 1623   C CB   . HIS A 1 105 ? 4.804   41.284  -10.589 1.00 0.00 ? 105 HIS A CB   1  
ATOM 1624   C CG   . HIS A 1 105 ? 5.178   40.135  -9.696  1.00 0.00 ? 105 HIS A CG   1  
ATOM 1625   N ND1  . HIS A 1 105 ? 5.870   40.319  -8.506  1.00 0.00 ? 105 HIS A ND1  1  
ATOM 1626   C CD2  . HIS A 1 105 ? 4.966   38.782  -9.801  1.00 0.00 ? 105 HIS A CD2  1  
ATOM 1627   C CE1  . HIS A 1 105 ? 6.045   39.109  -7.949  1.00 0.00 ? 105 HIS A CE1  1  
ATOM 1628   N NE2  . HIS A 1 105 ? 5.513   38.141  -8.697  1.00 0.00 ? 105 HIS A NE2  1  
ATOM 1629   H H    . HIS A 1 105 ? 3.381   42.933  -11.937 1.00 0.00 ? 105 HIS A H    1  
ATOM 1630   H HA   . HIS A 1 105 ? 2.852   41.273  -9.692  1.00 0.00 ? 105 HIS A HA   1  
ATOM 1631   H HB2  . HIS A 1 105 ? 4.564   40.914  -11.576 1.00 0.00 ? 105 HIS A HB2  1  
ATOM 1632   H HB3  . HIS A 1 105 ? 5.633   41.974  -10.654 1.00 0.00 ? 105 HIS A HB3  1  
ATOM 1633   H HD1  . HIS A 1 105 ? 6.176   41.175  -8.141  1.00 0.00 ? 105 HIS A HD1  1  
ATOM 1634   H HD2  . HIS A 1 105 ? 4.453   38.293  -10.616 1.00 0.00 ? 105 HIS A HD2  1  
ATOM 1635   H HE1  . HIS A 1 105 ? 6.553   38.940  -7.011  1.00 0.00 ? 105 HIS A HE1  1  
ATOM 1636   H HE2  . HIS A 1 105 ? 5.509   37.179  -8.507  1.00 0.00 ? 105 HIS A HE2  1  
ATOM 1637   N N    . GLU A 1 106 ? 4.616   43.961  -9.032  1.00 0.00 ? 106 GLU A N    1  
ATOM 1638   C CA   . GLU A 1 106 ? 5.105   44.803  -7.901  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1639   C C    . GLU A 1 106 ? 3.927   45.257  -7.031  1.00 0.00 ? 106 GLU A C    1  
ATOM 1640   O O    . GLU A 1 106 ? 4.030   45.318  -5.820  1.00 0.00 ? 106 GLU A O    1  
ATOM 1641   C CB   . GLU A 1 106 ? 5.829   46.021  -8.479  1.00 0.00 ? 106 GLU A CB   1  
ATOM 1642   C CG   . GLU A 1 106 ? 6.397   46.882  -7.350  1.00 0.00 ? 106 GLU A CG   1  
ATOM 1643   C CD   . GLU A 1 106 ? 7.164   48.065  -7.946  1.00 0.00 ? 106 GLU A CD   1  
ATOM 1644   O OE1  . GLU A 1 106 ? 7.218   48.160  -9.163  1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1645   O OE2  . GLU A 1 106 ? 7.690   48.855  -7.181  1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1646   H H    . GLU A 1 106 ? 4.741   44.263  -9.956  1.00 0.00 ? 106 GLU A H    1  
ATOM 1647   H HA   . GLU A 1 106 ? 5.795   44.230  -7.300  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1648   H HB2  . GLU A 1 106 ? 6.637   45.688  -9.116  1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1649   H HB3  . GLU A 1 106 ? 5.133   46.608  -9.060  1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1650   H HG2  . GLU A 1 106 ? 5.586   47.250  -6.735  1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1651   H HG3  . GLU A 1 106 ? 7.067   46.289  -6.745  1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1652   N N    . VAL A 1 107 ? 2.831   45.611  -7.637  1.00 0.00 ? 107 VAL A N    1  
ATOM 1653   C CA   . VAL A 1 107 ? 1.665   46.095  -6.844  1.00 0.00 ? 107 VAL A CA   1  
ATOM 1654   C C    . VAL A 1 107 ? 1.125   44.996  -5.923  1.00 0.00 ? 107 VAL A C    1  
ATOM 1655   O O    . VAL A 1 107 ? 1.010   45.187  -4.730  1.00 0.00 ? 107 VAL A O    1  
ATOM 1656   C CB   . VAL A 1 107 ? 0.568   46.554  -7.806  1.00 0.00 ? 107 VAL A CB   1  
ATOM 1657   C CG1  . VAL A 1 107 ? -0.668  46.970  -7.006  1.00 0.00 ? 107 VAL A CG1  1  
ATOM 1658   C CG2  . VAL A 1 107 ? 1.075   47.748  -8.617  1.00 0.00 ? 107 VAL A CG2  1  
ATOM 1659   H H    . VAL A 1 107 ? 2.781   45.580  -8.615  1.00 0.00 ? 107 VAL A H    1  
ATOM 1660   H HA   . VAL A 1 107 ? 1.975   46.935  -6.242  1.00 0.00 ? 107 VAL A HA   1  
ATOM 1661   H HB   . VAL A 1 107 ? 0.310   45.743  -8.474  1.00 0.00 ? 107 VAL A HB   1  
ATOM 1662   H HG11 . VAL A 1 107 ? -0.380  47.680  -6.244  1.00 0.00 ? 107 VAL A HG11 1  
ATOM 1663   H HG12 . VAL A 1 107 ? -1.105  46.099  -6.539  1.00 0.00 ? 107 VAL A HG12 1  
ATOM 1664   H HG13 . VAL A 1 107 ? -1.390  47.424  -7.668  1.00 0.00 ? 107 VAL A HG13 1  
ATOM 1665   H HG21 . VAL A 1 107 ? 1.862   47.423  -9.283  1.00 0.00 ? 107 VAL A HG21 1  
ATOM 1666   H HG22 . VAL A 1 107 ? 1.460   48.501  -7.945  1.00 0.00 ? 107 VAL A HG22 1  
ATOM 1667   H HG23 . VAL A 1 107 ? 0.263   48.162  -9.195  1.00 0.00 ? 107 VAL A HG23 1  
ATOM 1668   N N    . ILE A 1 108 ? 0.799   43.851  -6.450  1.00 0.00 ? 108 ILE A N    1  
ATOM 1669   C CA   . ILE A 1 108 ? 0.267   42.753  -5.585  1.00 0.00 ? 108 ILE A CA   1  
ATOM 1670   C C    . ILE A 1 108 ? 1.388   42.248  -4.674  1.00 0.00 ? 108 ILE A C    1  
ATOM 1671   O O    . ILE A 1 108 ? 1.178   41.985  -3.504  1.00 0.00 ? 108 ILE A O    1  
ATOM 1672   C CB   . ILE A 1 108 ? -0.228  41.600  -6.461  1.00 0.00 ? 108 ILE A CB   1  
ATOM 1673   C CG1  . ILE A 1 108 ? 0.893   41.149  -7.423  1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1674   C CG2  . ILE A 1 108 ? -1.475  42.044  -7.258  1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1675   C CD1  . ILE A 1 108 ? 1.561   39.854  -6.935  1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1676   H H    . ILE A 1 108 ? 0.901   43.709  -7.415  1.00 0.00 ? 108 ILE A H    1  
ATOM 1677   H HA   . ILE A 1 108 ? -0.548  43.129  -4.985  1.00 0.00 ? 108 ILE A HA   1  
ATOM 1678   H HB   . ILE A 1 108 ? -0.501  40.771  -5.822  1.00 0.00 ? 108 ILE A HB   1  
ATOM 1679   H HG12 . ILE A 1 108 ? 0.471   40.980  -8.404  1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1680   H HG13 . ILE A 1 108 ? 1.637   41.928  -7.489  1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1681   H HG21 . ILE A 1 108 ? -1.668  41.336  -8.051  1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1682   H HG22 . ILE A 1 108 ? -1.302  43.022  -7.683  1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1683   H HG23 . ILE A 1 108 ? -2.329  42.086  -6.597  1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1684   H HD11 . ILE A 1 108 ? 2.439   40.098  -6.357  1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1685   H HD12 . ILE A 1 108 ? 1.845   39.253  -7.786  1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1686   H HD13 . ILE A 1 108 ? 0.866   39.301  -6.319  1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1687   N N    . GLU A 1 109 ? 2.573   42.122  -5.194  1.00 0.00 ? 109 GLU A N    1  
ATOM 1688   C CA   . GLU A 1 109 ? 3.713   41.658  -4.356  1.00 0.00 ? 109 GLU A CA   1  
ATOM 1689   C C    . GLU A 1 109 ? 3.986   42.704  -3.282  1.00 0.00 ? 109 GLU A C    1  
ATOM 1690   O O    . GLU A 1 109 ? 4.287   42.388  -2.146  1.00 0.00 ? 109 GLU A O    1  
ATOM 1691   C CB   . GLU A 1 109 ? 4.960   41.482  -5.228  1.00 0.00 ? 109 GLU A CB   1  
ATOM 1692   C CG   . GLU A 1 109 ? 6.116   40.943  -4.378  1.00 0.00 ? 109 GLU A CG   1  
ATOM 1693   C CD   . GLU A 1 109 ? 7.354   40.772  -5.261  1.00 0.00 ? 109 GLU A CD   1  
ATOM 1694   O OE1  . GLU A 1 109 ? 7.266   41.092  -6.436  1.00 0.00 ? 109 GLU A OE1  1  
ATOM 1695   O OE2  . GLU A 1 109 ? 8.366   40.329  -4.749  1.00 0.00 ? 109 GLU A OE2  1  
ATOM 1696   H H    . GLU A 1 109 ? 2.720   42.349  -6.136  1.00 0.00 ? 109 GLU A H    1  
ATOM 1697   H HA   . GLU A 1 109 ? 3.461   40.716  -3.890  1.00 0.00 ? 109 GLU A HA   1  
ATOM 1698   H HB2  . GLU A 1 109 ? 4.745   40.785  -6.025  1.00 0.00 ? 109 GLU A HB2  1  
ATOM 1699   H HB3  . GLU A 1 109 ? 5.242   42.435  -5.650  1.00 0.00 ? 109 GLU A HB3  1  
ATOM 1700   H HG2  . GLU A 1 109 ? 6.333   41.640  -3.581  1.00 0.00 ? 109 GLU A HG2  1  
ATOM 1701   H HG3  . GLU A 1 109 ? 5.840   39.987  -3.958  1.00 0.00 ? 109 GLU A HG3  1  
ATOM 1702   N N    . GLY A 1 110 ? 3.891   43.956  -3.642  1.00 0.00 ? 110 GLY A N    1  
ATOM 1703   C CA   . GLY A 1 110 ? 4.155   45.047  -2.662  1.00 0.00 ? 110 GLY A CA   1  
ATOM 1704   C C    . GLY A 1 110 ? 3.216   44.912  -1.463  1.00 0.00 ? 110 GLY A C    1  
ATOM 1705   O O    . GLY A 1 110 ? 3.646   44.949  -0.326  1.00 0.00 ? 110 GLY A O    1  
ATOM 1706   H H    . GLY A 1 110 ? 3.655   44.180  -4.567  1.00 0.00 ? 110 GLY A H    1  
ATOM 1707   H HA2  . GLY A 1 110 ? 5.181   44.984  -2.325  1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1708   H HA3  . GLY A 1 110 ? 3.991   46.003  -3.137  1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1709   N N    . GLN A 1 111 ? 1.934   44.749  -1.687  1.00 0.00 ? 111 GLN A N    1  
ATOM 1710   C CA   . GLN A 1 111 ? 1.009   44.618  -0.525  1.00 0.00 ? 111 GLN A CA   1  
ATOM 1711   C C    . GLN A 1 111 ? 1.298   43.305  0.203   1.00 0.00 ? 111 GLN A C    1  
ATOM 1712   O O    . GLN A 1 111 ? 1.524   43.293  1.393   1.00 0.00 ? 111 GLN A O    1  
ATOM 1713   C CB   . GLN A 1 111 ? -0.445  44.622  -0.997  1.00 0.00 ? 111 GLN A CB   1  
ATOM 1714   C CG   . GLN A 1 111 ? -1.389  44.548  0.208   1.00 0.00 ? 111 GLN A CG   1  
ATOM 1715   C CD   . GLN A 1 111 ? -2.847  44.565  -0.272  1.00 0.00 ? 111 GLN A CD   1  
ATOM 1716   O OE1  . GLN A 1 111 ? -3.256  43.723  -1.045  1.00 0.00 ? 111 GLN A OE1  1  
ATOM 1717   N NE2  . GLN A 1 111 ? -3.643  45.508  0.149   1.00 0.00 ? 111 GLN A NE2  1  
ATOM 1718   H H    . GLN A 1 111 ? 1.590   44.715  -2.604  1.00 0.00 ? 111 GLN A H    1  
ATOM 1719   H HA   . GLN A 1 111 ? 1.168   45.444  0.153   1.00 0.00 ? 111 GLN A HA   1  
ATOM 1720   H HB2  . GLN A 1 111 ? -0.640  45.530  -1.550  1.00 0.00 ? 111 GLN A HB2  1  
ATOM 1721   H HB3  . GLN A 1 111 ? -0.617  43.769  -1.636  1.00 0.00 ? 111 GLN A HB3  1  
ATOM 1722   H HG2  . GLN A 1 111 ? -1.201  43.636  0.755   1.00 0.00 ? 111 GLN A HG2  1  
ATOM 1723   H HG3  . GLN A 1 111 ? -1.215  45.396  0.853   1.00 0.00 ? 111 GLN A HG3  1  
ATOM 1724   H HE21 . GLN A 1 111 ? -3.309  46.195  0.763   1.00 0.00 ? 111 GLN A HE21 1  
ATOM 1725   H HE22 . GLN A 1 111 ? -4.577  45.531  -0.150  1.00 0.00 ? 111 GLN A HE22 1  
ATOM 1726   N N    . ALA A 1 112 ? 1.308   42.205  -0.500  1.00 0.00 ? 112 ALA A N    1  
ATOM 1727   C CA   . ALA A 1 112 ? 1.591   40.904  0.167   1.00 0.00 ? 112 ALA A CA   1  
ATOM 1728   C C    . ALA A 1 112 ? 2.924   41.008  0.907   1.00 0.00 ? 112 ALA A C    1  
ATOM 1729   O O    . ALA A 1 112 ? 3.077   40.511  2.006   1.00 0.00 ? 112 ALA A O    1  
ATOM 1730   C CB   . ALA A 1 112 ? 1.673   39.794  -0.882  1.00 0.00 ? 112 ALA A CB   1  
ATOM 1731   H H    . ALA A 1 112 ? 1.134   42.236  -1.464  1.00 0.00 ? 112 ALA A H    1  
ATOM 1732   H HA   . ALA A 1 112 ? 0.803   40.680  0.871   1.00 0.00 ? 112 ALA A HA   1  
ATOM 1733   H HB1  . ALA A 1 112 ? 1.050   40.050  -1.726  1.00 0.00 ? 112 ALA A HB1  1  
ATOM 1734   H HB2  . ALA A 1 112 ? 1.330   38.865  -0.450  1.00 0.00 ? 112 ALA A HB2  1  
ATOM 1735   H HB3  . ALA A 1 112 ? 2.696   39.683  -1.208  1.00 0.00 ? 112 ALA A HB3  1  
ATOM 1736   N N    . SER A 1 113 ? 3.892   41.645  0.312   1.00 0.00 ? 113 SER A N    1  
ATOM 1737   C CA   . SER A 1 113 ? 5.213   41.774  0.983   1.00 0.00 ? 113 SER A CA   1  
ATOM 1738   C C    . SER A 1 113 ? 5.025   42.504  2.311   1.00 0.00 ? 113 SER A C    1  
ATOM 1739   O O    . SER A 1 113 ? 5.617   42.156  3.311   1.00 0.00 ? 113 SER A O    1  
ATOM 1740   C CB   . SER A 1 113 ? 6.172   42.561  0.088   1.00 0.00 ? 113 SER A CB   1  
ATOM 1741   O OG   . SER A 1 113 ? 6.441   41.809  -1.088  1.00 0.00 ? 113 SER A OG   1  
ATOM 1742   H H    . SER A 1 113 ? 3.752   42.036  -0.576  1.00 0.00 ? 113 SER A H    1  
ATOM 1743   H HA   . SER A 1 113 ? 5.620   40.790  1.170   1.00 0.00 ? 113 SER A HA   1  
ATOM 1744   H HB2  . SER A 1 113 ? 5.722   43.500  -0.188  1.00 0.00 ? 113 SER A HB2  1  
ATOM 1745   H HB3  . SER A 1 113 ? 7.092   42.751  0.626   1.00 0.00 ? 113 SER A HB3  1  
ATOM 1746   H HG   . SER A 1 113 ? 7.156   42.242  -1.560  1.00 0.00 ? 113 SER A HG   1  
ATOM 1747   N N    . ALA A 1 114 ? 4.197   43.512  2.332   1.00 0.00 ? 114 ALA A N    1  
ATOM 1748   C CA   . ALA A 1 114 ? 3.964   44.247  3.607   1.00 0.00 ? 114 ALA A CA   1  
ATOM 1749   C C    . ALA A 1 114 ? 3.321   43.300  4.619   1.00 0.00 ? 114 ALA A C    1  
ATOM 1750   O O    . ALA A 1 114 ? 3.635   43.328  5.792   1.00 0.00 ? 114 ALA A O    1  
ATOM 1751   C CB   . ALA A 1 114 ? 3.034   45.439  3.366   1.00 0.00 ? 114 ALA A CB   1  
ATOM 1752   H H    . ALA A 1 114 ? 3.722   43.777  1.516   1.00 0.00 ? 114 ALA A H    1  
ATOM 1753   H HA   . ALA A 1 114 ? 4.909   44.600  3.995   1.00 0.00 ? 114 ALA A HA   1  
ATOM 1754   H HB1  . ALA A 1 114 ? 2.027   45.083  3.210   1.00 0.00 ? 114 ALA A HB1  1  
ATOM 1755   H HB2  . ALA A 1 114 ? 3.364   45.982  2.492   1.00 0.00 ? 114 ALA A HB2  1  
ATOM 1756   H HB3  . ALA A 1 114 ? 3.056   46.092  4.226   1.00 0.00 ? 114 ALA A HB3  1  
ATOM 1757   N N    . LEU A 1 115 ? 2.413   42.472  4.177   1.00 0.00 ? 115 LEU A N    1  
ATOM 1758   C CA   . LEU A 1 115 ? 1.741   41.539  5.121   1.00 0.00 ? 115 LEU A CA   1  
ATOM 1759   C C    . LEU A 1 115 ? 2.772   40.565  5.710   1.00 0.00 ? 115 LEU A C    1  
ATOM 1760   O O    . LEU A 1 115 ? 2.722   40.241  6.879   1.00 0.00 ? 115 LEU A O    1  
ATOM 1761   C CB   . LEU A 1 115 ? 0.647   40.759  4.385   1.00 0.00 ? 115 LEU A CB   1  
ATOM 1762   C CG   . LEU A 1 115 ? -0.710  41.465  4.547   1.00 0.00 ? 115 LEU A CG   1  
ATOM 1763   C CD1  . LEU A 1 115 ? -1.181  41.333  5.994   1.00 0.00 ? 115 LEU A CD1  1  
ATOM 1764   C CD2  . LEU A 1 115 ? -0.587  42.953  4.177   1.00 0.00 ? 115 LEU A CD2  1  
ATOM 1765   H H    . LEU A 1 115 ? 2.166   42.474  3.228   1.00 0.00 ? 115 LEU A H    1  
ATOM 1766   H HA   . LEU A 1 115 ? 1.294   42.109  5.923   1.00 0.00 ? 115 LEU A HA   1  
ATOM 1767   H HB2  . LEU A 1 115 ? 0.897   40.697  3.336   1.00 0.00 ? 115 LEU A HB2  1  
ATOM 1768   H HB3  . LEU A 1 115 ? 0.581   39.762  4.796   1.00 0.00 ? 115 LEU A HB3  1  
ATOM 1769   H HG   . LEU A 1 115 ? -1.433  40.993  3.896   1.00 0.00 ? 115 LEU A HG   1  
ATOM 1770   H HD11 . LEU A 1 115 ? -0.470  40.741  6.552   1.00 0.00 ? 115 LEU A HD11 1  
ATOM 1771   H HD12 . LEU A 1 115 ? -2.147  40.851  6.016   1.00 0.00 ? 115 LEU A HD12 1  
ATOM 1772   H HD13 . LEU A 1 115 ? -1.260  42.315  6.439   1.00 0.00 ? 115 LEU A HD13 1  
ATOM 1773   H HD21 . LEU A 1 115 ? -1.521  43.299  3.759   1.00 0.00 ? 115 LEU A HD21 1  
ATOM 1774   H HD22 . LEU A 1 115 ? 0.201   43.079  3.450   1.00 0.00 ? 115 LEU A HD22 1  
ATOM 1775   H HD23 . LEU A 1 115 ? -0.355  43.526  5.063   1.00 0.00 ? 115 LEU A HD23 1  
ATOM 1776   N N    . GLU A 1 116 ? 3.699   40.082  4.926   1.00 0.00 ? 116 GLU A N    1  
ATOM 1777   C CA   . GLU A 1 116 ? 4.708   39.127  5.474   1.00 0.00 ? 116 GLU A CA   1  
ATOM 1778   C C    . GLU A 1 116 ? 5.486   39.795  6.605   1.00 0.00 ? 116 GLU A C    1  
ATOM 1779   O O    . GLU A 1 116 ? 5.853   39.163  7.574   1.00 0.00 ? 116 GLU A O    1  
ATOM 1780   C CB   . GLU A 1 116 ? 5.676   38.709  4.368   1.00 0.00 ? 116 GLU A CB   1  
ATOM 1781   C CG   . GLU A 1 116 ? 6.581   37.579  4.863   1.00 0.00 ? 116 GLU A CG   1  
ATOM 1782   C CD   . GLU A 1 116 ? 7.687   38.165  5.744   1.00 0.00 ? 116 GLU A CD   1  
ATOM 1783   O OE1  . GLU A 1 116 ? 8.055   39.304  5.521   1.00 0.00 ? 116 GLU A OE1  1  
ATOM 1784   O OE2  . GLU A 1 116 ? 8.152   37.455  6.622   1.00 0.00 ? 116 GLU A OE2  1  
ATOM 1785   H H    . GLU A 1 116 ? 3.730   40.340  3.981   1.00 0.00 ? 116 GLU A H    1  
ATOM 1786   H HA   . GLU A 1 116 ? 4.202   38.253  5.856   1.00 0.00 ? 116 GLU A HA   1  
ATOM 1787   H HB2  . GLU A 1 116 ? 5.114   38.369  3.510   1.00 0.00 ? 116 GLU A HB2  1  
ATOM 1788   H HB3  . GLU A 1 116 ? 6.285   39.556  4.085   1.00 0.00 ? 116 GLU A HB3  1  
ATOM 1789   H HG2  . GLU A 1 116 ? 5.997   36.874  5.438   1.00 0.00 ? 116 GLU A HG2  1  
ATOM 1790   H HG3  . GLU A 1 116 ? 7.026   37.075  4.018   1.00 0.00 ? 116 GLU A HG3  1  
ATOM 1791   N N    . GLU A 1 117 ? 5.741   41.068  6.494   1.00 0.00 ? 117 GLU A N    1  
ATOM 1792   C CA   . GLU A 1 117 ? 6.496   41.757  7.577   1.00 0.00 ? 117 GLU A CA   1  
ATOM 1793   C C    . GLU A 1 117 ? 5.768   41.531  8.903   1.00 0.00 ? 117 GLU A C    1  
ATOM 1794   O O    . GLU A 1 117 ? 6.336   41.675  9.965   1.00 0.00 ? 117 GLU A O    1  
ATOM 1795   C CB   . GLU A 1 117 ? 6.574   43.254  7.286   1.00 0.00 ? 117 GLU A CB   1  
ATOM 1796   C CG   . GLU A 1 117 ? 7.350   43.486  5.989   1.00 0.00 ? 117 GLU A CG   1  
ATOM 1797   C CD   . GLU A 1 117 ? 8.815   43.086  6.187   1.00 0.00 ? 117 GLU A CD   1  
ATOM 1798   O OE1  . GLU A 1 117 ? 9.233   43.004  7.330   1.00 0.00 ? 117 GLU A OE1  1  
ATOM 1799   O OE2  . GLU A 1 117 ? 9.489   42.875  5.197   1.00 0.00 ? 117 GLU A OE2  1  
ATOM 1800   H H    . GLU A 1 117 ? 5.439   41.567  5.707   1.00 0.00 ? 117 GLU A H    1  
ATOM 1801   H HA   . GLU A 1 117 ? 7.494   41.346  7.639   1.00 0.00 ? 117 GLU A HA   1  
ATOM 1802   H HB2  . GLU A 1 117 ? 5.575   43.652  7.184   1.00 0.00 ? 117 GLU A HB2  1  
ATOM 1803   H HB3  . GLU A 1 117 ? 7.080   43.753  8.098   1.00 0.00 ? 117 GLU A HB3  1  
ATOM 1804   H HG2  . GLU A 1 117 ? 6.916   42.889  5.199   1.00 0.00 ? 117 GLU A HG2  1  
ATOM 1805   H HG3  . GLU A 1 117 ? 7.297   44.531  5.721   1.00 0.00 ? 117 GLU A HG3  1  
ATOM 1806   N N    . LEU A 1 118 ? 4.506   41.192  8.849   1.00 0.00 ? 118 LEU A N    1  
ATOM 1807   C CA   . LEU A 1 118 ? 3.739   40.970  10.106  1.00 0.00 ? 118 LEU A CA   1  
ATOM 1808   C C    . LEU A 1 118 ? 4.341   39.793  10.871  1.00 0.00 ? 118 LEU A C    1  
ATOM 1809   O O    . LEU A 1 118 ? 4.849   38.858  10.290  1.00 0.00 ? 118 LEU A O    1  
ATOM 1810   C CB   . LEU A 1 118 ? 2.290   40.632  9.766   1.00 0.00 ? 118 LEU A CB   1  
ATOM 1811   C CG   . LEU A 1 118 ? 1.485   41.921  9.584   1.00 0.00 ? 118 LEU A CG   1  
ATOM 1812   C CD1  . LEU A 1 118 ? 1.275   42.588  10.944  1.00 0.00 ? 118 LEU A CD1  1  
ATOM 1813   C CD2  . LEU A 1 118 ? 2.229   42.886  8.640   1.00 0.00 ? 118 LEU A CD2  1  
ATOM 1814   H H    . LEU A 1 118 ? 4.062   41.092  7.981   1.00 0.00 ? 118 LEU A H    1  
ATOM 1815   H HA   . LEU A 1 118 ? 3.771   41.860  10.717  1.00 0.00 ? 118 LEU A HA   1  
ATOM 1816   H HB2  . LEU A 1 118 ? 2.260   40.056  8.852   1.00 0.00 ? 118 LEU A HB2  1  
ATOM 1817   H HB3  . LEU A 1 118 ? 1.858   40.052  10.569  1.00 0.00 ? 118 LEU A HB3  1  
ATOM 1818   H HG   . LEU A 1 118 ? 0.520   41.678  9.159   1.00 0.00 ? 118 LEU A HG   1  
ATOM 1819   H HD11 . LEU A 1 118 ? 1.768   43.549  10.954  1.00 0.00 ? 118 LEU A HD11 1  
ATOM 1820   H HD12 . LEU A 1 118 ? 1.692   41.962  11.720  1.00 0.00 ? 118 LEU A HD12 1  
ATOM 1821   H HD13 . LEU A 1 118 ? 0.218   42.724  11.120  1.00 0.00 ? 118 LEU A HD13 1  
ATOM 1822   H HD21 . LEU A 1 118 ? 3.002   43.403  9.189   1.00 0.00 ? 118 LEU A HD21 1  
ATOM 1823   H HD22 . LEU A 1 118 ? 1.532   43.606  8.237   1.00 0.00 ? 118 LEU A HD22 1  
ATOM 1824   H HD23 . LEU A 1 118 ? 2.675   42.326  7.830   1.00 0.00 ? 118 LEU A HD23 1  
ATOM 1825   N N    . ASP A 1 119 ? 4.287   39.837  12.176  1.00 0.00 ? 119 ASP A N    1  
ATOM 1826   C CA   . ASP A 1 119 ? 4.856   38.726  12.999  1.00 0.00 ? 119 ASP A CA   1  
ATOM 1827   C C    . ASP A 1 119 ? 3.736   37.770  13.438  1.00 0.00 ? 119 ASP A C    1  
ATOM 1828   O O    . ASP A 1 119 ? 3.718   37.306  14.562  1.00 0.00 ? 119 ASP A O    1  
ATOM 1829   C CB   . ASP A 1 119 ? 5.542   39.336  14.234  1.00 0.00 ? 119 ASP A CB   1  
ATOM 1830   C CG   . ASP A 1 119 ? 6.352   38.265  14.973  1.00 0.00 ? 119 ASP A CG   1  
ATOM 1831   O OD1  . ASP A 1 119 ? 7.276   37.734  14.377  1.00 0.00 ? 119 ASP A OD1  1  
ATOM 1832   O OD2  . ASP A 1 119 ? 6.034   37.990  16.118  1.00 0.00 ? 119 ASP A OD2  1  
ATOM 1833   H H    . ASP A 1 119 ? 3.871   40.606  12.619  1.00 0.00 ? 119 ASP A H    1  
ATOM 1834   H HA   . ASP A 1 119 ? 5.585   38.183  12.415  1.00 0.00 ? 119 ASP A HA   1  
ATOM 1835   H HB2  . ASP A 1 119 ? 6.202   40.131  13.921  1.00 0.00 ? 119 ASP A HB2  1  
ATOM 1836   H HB3  . ASP A 1 119 ? 4.791   39.736  14.899  1.00 0.00 ? 119 ASP A HB3  1  
ATOM 1837   N N    . ASP A 1 120 ? 2.800   37.476  12.558  1.00 0.00 ? 120 ASP A N    1  
ATOM 1838   C CA   . ASP A 1 120 ? 1.674   36.552  12.925  1.00 0.00 ? 120 ASP A CA   1  
ATOM 1839   C C    . ASP A 1 120 ? 1.489   35.481  11.839  1.00 0.00 ? 120 ASP A C    1  
ATOM 1840   O O    . ASP A 1 120 ? 1.463   35.771  10.660  1.00 0.00 ? 120 ASP A O    1  
ATOM 1841   C CB   . ASP A 1 120 ? 0.381   37.369  13.062  1.00 0.00 ? 120 ASP A CB   1  
ATOM 1842   C CG   . ASP A 1 120 ? -0.717  36.495  13.677  1.00 0.00 ? 120 ASP A CG   1  
ATOM 1843   O OD1  . ASP A 1 120 ? -0.530  35.289  13.724  1.00 0.00 ? 120 ASP A OD1  1  
ATOM 1844   O OD2  . ASP A 1 120 ? -1.724  37.046  14.086  1.00 0.00 ? 120 ASP A OD2  1  
ATOM 1845   H H    . ASP A 1 120 ? 2.838   37.864  11.659  1.00 0.00 ? 120 ASP A H    1  
ATOM 1846   H HA   . ASP A 1 120 ? 1.896   36.073  13.867  1.00 0.00 ? 120 ASP A HA   1  
ATOM 1847   H HB2  . ASP A 1 120 ? 0.561   38.224  13.699  1.00 0.00 ? 120 ASP A HB2  1  
ATOM 1848   H HB3  . ASP A 1 120 ? 0.064   37.708  12.087  1.00 0.00 ? 120 ASP A HB3  1  
ATOM 1849   N N    . GLU A 1 121 ? 1.347   34.248  12.251  1.00 0.00 ? 121 GLU A N    1  
ATOM 1850   C CA   . GLU A 1 121 ? 1.146   33.124  11.278  1.00 0.00 ? 121 GLU A CA   1  
ATOM 1851   C C    . GLU A 1 121 ? -0.238  33.216  10.632  1.00 0.00 ? 121 GLU A C    1  
ATOM 1852   O O    . GLU A 1 121 ? -0.437  32.816  9.504   1.00 0.00 ? 121 GLU A O    1  
ATOM 1853   C CB   . GLU A 1 121 ? 1.266   31.786  12.015  1.00 0.00 ? 121 GLU A CB   1  
ATOM 1854   C CG   . GLU A 1 121 ? 0.152   31.661  13.054  1.00 0.00 ? 121 GLU A CG   1  
ATOM 1855   C CD   . GLU A 1 121 ? 0.374   30.401  13.891  1.00 0.00 ? 121 GLU A CD   1  
ATOM 1856   O OE1  . GLU A 1 121 ? 1.347   29.712  13.638  1.00 0.00 ? 121 GLU A OE1  1  
ATOM 1857   O OE2  . GLU A 1 121 ? -0.431  30.149  14.775  1.00 0.00 ? 121 GLU A OE2  1  
ATOM 1858   H H    . GLU A 1 121 ? 1.365   34.056  13.211  1.00 0.00 ? 121 GLU A H    1  
ATOM 1859   H HA   . GLU A 1 121 ? 1.903   33.176  10.510  1.00 0.00 ? 121 GLU A HA   1  
ATOM 1860   H HB2  . GLU A 1 121 ? 1.185   30.976  11.303  1.00 0.00 ? 121 GLU A HB2  1  
ATOM 1861   H HB3  . GLU A 1 121 ? 2.224   31.734  12.510  1.00 0.00 ? 121 GLU A HB3  1  
ATOM 1862   H HG2  . GLU A 1 121 ? 0.163   32.529  13.698  1.00 0.00 ? 121 GLU A HG2  1  
ATOM 1863   H HG3  . GLU A 1 121 ? -0.802  31.596  12.554  1.00 0.00 ? 121 GLU A HG3  1  
ATOM 1864   N N    . TYR A 1 122 ? -1.196  33.751  11.343  1.00 0.00 ? 122 TYR A N    1  
ATOM 1865   C CA   . TYR A 1 122 ? -2.581  33.887  10.799  1.00 0.00 ? 122 TYR A CA   1  
ATOM 1866   C C    . TYR A 1 122 ? -2.632  34.980  9.718   1.00 0.00 ? 122 TYR A C    1  
ATOM 1867   O O    . TYR A 1 122 ? -3.287  34.835  8.697   1.00 0.00 ? 122 TYR A O    1  
ATOM 1868   C CB   . TYR A 1 122 ? -3.508  34.241  11.978  1.00 0.00 ? 122 TYR A CB   1  
ATOM 1869   C CG   . TYR A 1 122 ? -3.714  33.059  12.907  1.00 0.00 ? 122 TYR A CG   1  
ATOM 1870   C CD1  . TYR A 1 122 ? -4.775  32.158  12.676  1.00 0.00 ? 122 TYR A CD1  1  
ATOM 1871   C CD2  . TYR A 1 122 ? -2.856  32.865  14.007  1.00 0.00 ? 122 TYR A CD2  1  
ATOM 1872   C CE1  . TYR A 1 122 ? -4.972  31.066  13.539  1.00 0.00 ? 122 TYR A CE1  1  
ATOM 1873   C CE2  . TYR A 1 122 ? -3.058  31.772  14.870  1.00 0.00 ? 122 TYR A CE2  1  
ATOM 1874   C CZ   . TYR A 1 122 ? -4.115  30.878  14.635  1.00 0.00 ? 122 TYR A CZ   1  
ATOM 1875   O OH   . TYR A 1 122 ? -4.315  29.816  15.480  1.00 0.00 ? 122 TYR A OH   1  
ATOM 1876   H H    . TYR A 1 122 ? -1.002  34.070  12.249  1.00 0.00 ? 122 TYR A H    1  
ATOM 1877   H HA   . TYR A 1 122 ? -2.893  32.946  10.371  1.00 0.00 ? 122 TYR A HA   1  
ATOM 1878   H HB2  . TYR A 1 122 ? -3.071  35.054  12.538  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 1879   H HB3  . TYR A 1 122 ? -4.466  34.556  11.591  1.00 0.00 ? 122 TYR A HB3  1  
ATOM 1880   H HD1  . TYR A 1 122 ? -5.434  32.304  11.832  1.00 0.00 ? 122 TYR A HD1  1  
ATOM 1881   H HD2  . TYR A 1 122 ? -2.043  33.553  14.187  1.00 0.00 ? 122 TYR A HD2  1  
ATOM 1882   H HE1  . TYR A 1 122 ? -5.784  30.376  13.362  1.00 0.00 ? 122 TYR A HE1  1  
ATOM 1883   H HE2  . TYR A 1 122 ? -2.401  31.622  15.714  1.00 0.00 ? 122 TYR A HE2  1  
ATOM 1884   H HH   . TYR A 1 122 ? -3.620  29.828  16.141  1.00 0.00 ? 122 TYR A HH   1  
ATOM 1885   N N    . LEU A 1 123 ? -1.946  36.065  9.925   1.00 0.00 ? 123 LEU A N    1  
ATOM 1886   C CA   . LEU A 1 123 ? -1.957  37.151  8.911   1.00 0.00 ? 123 LEU A CA   1  
ATOM 1887   C C    . LEU A 1 123 ? -1.108  36.716  7.717   1.00 0.00 ? 123 LEU A C    1  
ATOM 1888   O O    . LEU A 1 123 ? -1.394  37.033  6.583   1.00 0.00 ? 123 LEU A O    1  
ATOM 1889   C CB   . LEU A 1 123 ? -1.388  38.433  9.534   1.00 0.00 ? 123 LEU A CB   1  
ATOM 1890   C CG   . LEU A 1 123 ? -2.460  39.082  10.424  1.00 0.00 ? 123 LEU A CG   1  
ATOM 1891   C CD1  . LEU A 1 123 ? -3.050  38.038  11.390  1.00 0.00 ? 123 LEU A CD1  1  
ATOM 1892   C CD2  . LEU A 1 123 ? -1.844  40.250  11.222  1.00 0.00 ? 123 LEU A CD2  1  
ATOM 1893   H H    . LEU A 1 123 ? -1.420  36.165  10.746  1.00 0.00 ? 123 LEU A H    1  
ATOM 1894   H HA   . LEU A 1 123 ? -2.972  37.327  8.584   1.00 0.00 ? 123 LEU A HA   1  
ATOM 1895   H HB2  . LEU A 1 123 ? -0.519  38.190  10.130  1.00 0.00 ? 123 LEU A HB2  1  
ATOM 1896   H HB3  . LEU A 1 123 ? -1.107  39.123  8.751   1.00 0.00 ? 123 LEU A HB3  1  
ATOM 1897   H HG   . LEU A 1 123 ? -3.253  39.462  9.795   1.00 0.00 ? 123 LEU A HG   1  
ATOM 1898   H HD11 . LEU A 1 123 ? -2.249  37.458  11.827  1.00 0.00 ? 123 LEU A HD11 1  
ATOM 1899   H HD12 . LEU A 1 123 ? -3.716  37.381  10.849  1.00 0.00 ? 123 LEU A HD12 1  
ATOM 1900   H HD13 . LEU A 1 123 ? -3.598  38.541  12.173  1.00 0.00 ? 123 LEU A HD13 1  
ATOM 1901   H HD21 . LEU A 1 123 ? -1.678  41.089  10.561  1.00 0.00 ? 123 LEU A HD21 1  
ATOM 1902   H HD22 . LEU A 1 123 ? -0.903  39.937  11.651  1.00 0.00 ? 123 LEU A HD22 1  
ATOM 1903   H HD23 . LEU A 1 123 ? -2.520  40.542  12.013  1.00 0.00 ? 123 LEU A HD23 1  
ATOM 1904   N N    . LYS A 1 124 ? -0.058  35.982  7.978   1.00 0.00 ? 124 LYS A N    1  
ATOM 1905   C CA   . LYS A 1 124 ? 0.826   35.512  6.875   1.00 0.00 ? 124 LYS A CA   1  
ATOM 1906   C C    . LYS A 1 124 ? 0.048   34.601  5.912   1.00 0.00 ? 124 LYS A C    1  
ATOM 1907   O O    . LYS A 1 124 ? 0.193   34.701  4.712   1.00 0.00 ? 124 LYS A O    1  
ATOM 1908   C CB   . LYS A 1 124 ? 2.009   34.754  7.487   1.00 0.00 ? 124 LYS A CB   1  
ATOM 1909   C CG   . LYS A 1 124 ? 2.961   34.286  6.386   1.00 0.00 ? 124 LYS A CG   1  
ATOM 1910   C CD   . LYS A 1 124 ? 2.753   32.786  6.136   1.00 0.00 ? 124 LYS A CD   1  
ATOM 1911   C CE   . LYS A 1 124 ? 3.677   32.302  5.002   1.00 0.00 ? 124 LYS A CE   1  
ATOM 1912   N NZ   . LYS A 1 124 ? 5.099   32.438  5.433   1.00 0.00 ? 124 LYS A NZ   1  
ATOM 1913   H H    . LYS A 1 124 ? 0.148   35.739  8.905   1.00 0.00 ? 124 LYS A H    1  
ATOM 1914   H HA   . LYS A 1 124 ? 1.198   36.367  6.330   1.00 0.00 ? 124 LYS A HA   1  
ATOM 1915   H HB2  . LYS A 1 124 ? 2.540   35.407  8.166   1.00 0.00 ? 124 LYS A HB2  1  
ATOM 1916   H HB3  . LYS A 1 124 ? 1.642   33.896  8.029   1.00 0.00 ? 124 LYS A HB3  1  
ATOM 1917   H HG2  . LYS A 1 124 ? 2.760   34.836  5.477   1.00 0.00 ? 124 LYS A HG2  1  
ATOM 1918   H HG3  . LYS A 1 124 ? 3.982   34.460  6.693   1.00 0.00 ? 124 LYS A HG3  1  
ATOM 1919   H HD2  . LYS A 1 124 ? 2.978   32.238  7.040   1.00 0.00 ? 124 LYS A HD2  1  
ATOM 1920   H HD3  . LYS A 1 124 ? 1.725   32.609  5.858   1.00 0.00 ? 124 LYS A HD3  1  
ATOM 1921   H HE2  . LYS A 1 124 ? 3.465   31.266  4.780   1.00 0.00 ? 124 LYS A HE2  1  
ATOM 1922   H HE3  . LYS A 1 124 ? 3.509   32.902  4.120   1.00 0.00 ? 124 LYS A HE3  1  
ATOM 1923   H HZ1  . LYS A 1 124 ? 5.136   32.861  6.382   1.00 0.00 ? 124 LYS A HZ1  1  
ATOM 1924   H HZ2  . LYS A 1 124 ? 5.608   33.048  4.761   1.00 0.00 ? 124 LYS A HZ2  1  
ATOM 1925   H HZ3  . LYS A 1 124 ? 5.545   31.499  5.457   1.00 0.00 ? 124 LYS A HZ3  1  
ATOM 1926   N N    . GLU A 1 125 ? -0.779  33.715  6.413   1.00 0.00 ? 125 GLU A N    1  
ATOM 1927   C CA   . GLU A 1 125 ? -1.547  32.823  5.486   1.00 0.00 ? 125 GLU A CA   1  
ATOM 1928   C C    . GLU A 1 125 ? -2.432  33.665  4.569   1.00 0.00 ? 125 GLU A C    1  
ATOM 1929   O O    . GLU A 1 125 ? -2.495  33.439  3.377   1.00 0.00 ? 125 GLU A O    1  
ATOM 1930   C CB   . GLU A 1 125 ? -2.433  31.852  6.273   1.00 0.00 ? 125 GLU A CB   1  
ATOM 1931   C CG   . GLU A 1 125 ? -1.568  30.838  7.024   1.00 0.00 ? 125 GLU A CG   1  
ATOM 1932   C CD   . GLU A 1 125 ? -0.903  29.905  6.012   1.00 0.00 ? 125 GLU A CD   1  
ATOM 1933   O OE1  . GLU A 1 125 ? -1.366  29.859  4.884   1.00 0.00 ? 125 GLU A OE1  1  
ATOM 1934   O OE2  . GLU A 1 125 ? 0.063   29.257  6.378   1.00 0.00 ? 125 GLU A OE2  1  
ATOM 1935   H H    . GLU A 1 125 ? -0.895  33.639  7.383   1.00 0.00 ? 125 GLU A H    1  
ATOM 1936   H HA   . GLU A 1 125 ? -0.851  32.258  4.883   1.00 0.00 ? 125 GLU A HA   1  
ATOM 1937   H HB2  . GLU A 1 125 ? -3.031  32.407  6.981   1.00 0.00 ? 125 GLU A HB2  1  
ATOM 1938   H HB3  . GLU A 1 125 ? -3.084  31.328  5.589   1.00 0.00 ? 125 GLU A HB3  1  
ATOM 1939   H HG2  . GLU A 1 125 ? -0.810  31.360  7.591   1.00 0.00 ? 125 GLU A HG2  1  
ATOM 1940   H HG3  . GLU A 1 125 ? -2.186  30.260  7.694   1.00 0.00 ? 125 GLU A HG3  1  
ATOM 1941   N N    . ARG A 1 126 ? -3.112  34.644  5.101   1.00 0.00 ? 126 ARG A N    1  
ATOM 1942   C CA   . ARG A 1 126 ? -3.974  35.485  4.223   1.00 0.00 ? 126 ARG A CA   1  
ATOM 1943   C C    . ARG A 1 126 ? -3.092  36.140  3.163   1.00 0.00 ? 126 ARG A C    1  
ATOM 1944   O O    . ARG A 1 126 ? -3.484  36.283  2.021   1.00 0.00 ? 126 ARG A O    1  
ATOM 1945   C CB   . ARG A 1 126 ? -4.719  36.543  5.063   1.00 0.00 ? 126 ARG A CB   1  
ATOM 1946   C CG   . ARG A 1 126 ? -5.654  37.359  4.149   1.00 0.00 ? 126 ARG A CG   1  
ATOM 1947   C CD   . ARG A 1 126 ? -6.439  38.391  4.967   1.00 0.00 ? 126 ARG A CD   1  
ATOM 1948   N NE   . ARG A 1 126 ? -7.346  39.162  4.073   1.00 0.00 ? 126 ARG A NE   1  
ATOM 1949   C CZ   . ARG A 1 126 ? -6.885  40.169  3.380   1.00 0.00 ? 126 ARG A CZ   1  
ATOM 1950   N NH1  . ARG A 1 126 ? -5.643  40.535  3.513   1.00 0.00 ? 126 ARG A NH1  1  
ATOM 1951   N NH2  . ARG A 1 126 ? -7.666  40.816  2.560   1.00 0.00 ? 126 ARG A NH2  1  
ATOM 1952   H H    . ARG A 1 126 ? -3.052  34.828  6.062   1.00 0.00 ? 126 ARG A H    1  
ATOM 1953   H HA   . ARG A 1 126 ? -4.697  34.849  3.731   1.00 0.00 ? 126 ARG A HA   1  
ATOM 1954   H HB2  . ARG A 1 126 ? -5.302  36.050  5.829   1.00 0.00 ? 126 ARG A HB2  1  
ATOM 1955   H HB3  . ARG A 1 126 ? -4.003  37.207  5.526   1.00 0.00 ? 126 ARG A HB3  1  
ATOM 1956   H HG2  . ARG A 1 126 ? -5.064  37.870  3.401   1.00 0.00 ? 126 ARG A HG2  1  
ATOM 1957   H HG3  . ARG A 1 126 ? -6.347  36.690  3.660   1.00 0.00 ? 126 ARG A HG3  1  
ATOM 1958   H HD2  . ARG A 1 126 ? -7.024  37.883  5.720   1.00 0.00 ? 126 ARG A HD2  1  
ATOM 1959   H HD3  . ARG A 1 126 ? -5.747  39.068  5.447   1.00 0.00 ? 126 ARG A HD3  1  
ATOM 1960   H HE   . ARG A 1 126 ? -8.287  38.900  3.990   1.00 0.00 ? 126 ARG A HE   1  
ATOM 1961   H HH11 . ARG A 1 126 ? -5.041  40.045  4.144   1.00 0.00 ? 126 ARG A HH11 1  
ATOM 1962   H HH12 . ARG A 1 126 ? -5.289  41.305  2.983   1.00 0.00 ? 126 ARG A HH12 1  
ATOM 1963   H HH21 . ARG A 1 126 ? -8.622  40.542  2.459   1.00 0.00 ? 126 ARG A HH21 1  
ATOM 1964   H HH22 . ARG A 1 126 ? -7.308  41.587  2.033   1.00 0.00 ? 126 ARG A HH22 1  
ATOM 1965   N N    . ALA A 1 127 ? -1.897  36.508  3.521   1.00 0.00 ? 127 ALA A N    1  
ATOM 1966   C CA   . ALA A 1 127 ? -0.983  37.114  2.519   1.00 0.00 ? 127 ALA A CA   1  
ATOM 1967   C C    . ALA A 1 127 ? -0.739  36.084  1.416   1.00 0.00 ? 127 ALA A C    1  
ATOM 1968   O O    . ALA A 1 127 ? -0.459  36.423  0.282   1.00 0.00 ? 127 ALA A O    1  
ATOM 1969   C CB   . ALA A 1 127 ? 0.345   37.482  3.187   1.00 0.00 ? 127 ALA A CB   1  
ATOM 1970   H H    . ALA A 1 127 ? -1.592  36.362  4.441   1.00 0.00 ? 127 ALA A H    1  
ATOM 1971   H HA   . ALA A 1 127 ? -1.439  37.999  2.098   1.00 0.00 ? 127 ALA A HA   1  
ATOM 1972   H HB1  . ALA A 1 127 ? 0.675   38.446  2.827   1.00 0.00 ? 127 ALA A HB1  1  
ATOM 1973   H HB2  . ALA A 1 127 ? 1.087   36.734  2.949   1.00 0.00 ? 127 ALA A HB2  1  
ATOM 1974   H HB3  . ALA A 1 127 ? 0.209   37.525  4.258   1.00 0.00 ? 127 ALA A HB3  1  
ATOM 1975   N N    . ALA A 1 128 ? -0.866  34.822  1.742   1.00 0.00 ? 128 ALA A N    1  
ATOM 1976   C CA   . ALA A 1 128 ? -0.670  33.758  0.714   1.00 0.00 ? 128 ALA A CA   1  
ATOM 1977   C C    . ALA A 1 128 ? -1.841  33.805  -0.270  1.00 0.00 ? 128 ALA A C    1  
ATOM 1978   O O    . ALA A 1 128 ? -1.672  33.648  -1.464  1.00 0.00 ? 128 ALA A O    1  
ATOM 1979   C CB   . ALA A 1 128 ? -0.618  32.391  1.397   1.00 0.00 ? 128 ALA A CB   1  
ATOM 1980   H H    . ALA A 1 128 ? -1.108  34.576  2.659   1.00 0.00 ? 128 ALA A H    1  
ATOM 1981   H HA   . ALA A 1 128 ? 0.255   33.935  0.183   1.00 0.00 ? 128 ALA A HA   1  
ATOM 1982   H HB1  . ALA A 1 128 ? -0.030  32.462  2.300   1.00 0.00 ? 128 ALA A HB1  1  
ATOM 1983   H HB2  . ALA A 1 128 ? -0.167  31.672  0.729   1.00 0.00 ? 128 ALA A HB2  1  
ATOM 1984   H HB3  . ALA A 1 128 ? -1.621  32.074  1.644   1.00 0.00 ? 128 ALA A HB3  1  
ATOM 1985   N N    . ASP A 1 129 ? -3.029  34.020  0.230   1.00 0.00 ? 129 ASP A N    1  
ATOM 1986   C CA   . ASP A 1 129 ? -4.219  34.081  -0.668  1.00 0.00 ? 129 ASP A CA   1  
ATOM 1987   C C    . ASP A 1 129 ? -4.109  35.308  -1.570  1.00 0.00 ? 129 ASP A C    1  
ATOM 1988   O O    . ASP A 1 129 ? -4.423  35.253  -2.746  1.00 0.00 ? 129 ASP A O    1  
ATOM 1989   C CB   . ASP A 1 129 ? -5.501  34.176  0.176   1.00 0.00 ? 129 ASP A CB   1  
ATOM 1990   C CG   . ASP A 1 129 ? -5.736  32.838  0.882   1.00 0.00 ? 129 ASP A CG   1  
ATOM 1991   O OD1  . ASP A 1 129 ? -5.099  31.869  0.503   1.00 0.00 ? 129 ASP A OD1  1  
ATOM 1992   O OD2  . ASP A 1 129 ? -6.557  32.807  1.785   1.00 0.00 ? 129 ASP A OD2  1  
ATOM 1993   H H    . ASP A 1 129 ? -3.140  34.144  1.196   1.00 0.00 ? 129 ASP A H    1  
ATOM 1994   H HA   . ASP A 1 129 ? -4.255  33.190  -1.277  1.00 0.00 ? 129 ASP A HA   1  
ATOM 1995   H HB2  . ASP A 1 129 ? -5.391  34.960  0.913   1.00 0.00 ? 129 ASP A HB2  1  
ATOM 1996   H HB3  . ASP A 1 129 ? -6.341  34.397  -0.464  1.00 0.00 ? 129 ASP A HB3  1  
ATOM 1997   N N    . VAL A 1 130 ? -3.656  36.407  -1.039  1.00 0.00 ? 130 VAL A N    1  
ATOM 1998   C CA   . VAL A 1 130 ? -3.519  37.637  -1.873  1.00 0.00 ? 130 VAL A CA   1  
ATOM 1999   C C    . VAL A 1 130 ? -2.402  37.416  -2.899  1.00 0.00 ? 130 VAL A C    1  
ATOM 2000   O O    . VAL A 1 130 ? -2.524  37.790  -4.049  1.00 0.00 ? 130 VAL A O    1  
ATOM 2001   C CB   . VAL A 1 130 ? -3.186  38.832  -0.966  1.00 0.00 ? 130 VAL A CB   1  
ATOM 2002   C CG1  . VAL A 1 130 ? -4.022  38.762  0.310   1.00 0.00 ? 130 VAL A CG1  1  
ATOM 2003   C CG2  . VAL A 1 130 ? -1.698  38.782  -0.603  1.00 0.00 ? 130 VAL A CG2  1  
ATOM 2004   H H    . VAL A 1 130 ? -3.400  36.424  -0.092  1.00 0.00 ? 130 VAL A H    1  
ATOM 2005   H HA   . VAL A 1 130 ? -4.449  37.824  -2.391  1.00 0.00 ? 130 VAL A HA   1  
ATOM 2006   H HB   . VAL A 1 130 ? -3.401  39.753  -1.490  1.00 0.00 ? 130 VAL A HB   1  
ATOM 2007   H HG11 . VAL A 1 130 ? -4.847  38.079  0.164   1.00 0.00 ? 130 VAL A HG11 1  
ATOM 2008   H HG12 . VAL A 1 130 ? -4.406  39.744  0.544   1.00 0.00 ? 130 VAL A HG12 1  
ATOM 2009   H HG13 . VAL A 1 130 ? -3.406  38.413  1.126   1.00 0.00 ? 130 VAL A HG13 1  
ATOM 2010   H HG21 . VAL A 1 130 ? -1.420  37.766  -0.364  1.00 0.00 ? 130 VAL A HG21 1  
ATOM 2011   H HG22 . VAL A 1 130 ? -1.515  39.415  0.253   1.00 0.00 ? 130 VAL A HG22 1  
ATOM 2012   H HG23 . VAL A 1 130 ? -1.111  39.129  -1.440  1.00 0.00 ? 130 VAL A HG23 1  
ATOM 2013   N N    . ARG A 1 131 ? -1.337  36.789  -2.499  1.00 0.00 ? 131 ARG A N    1  
ATOM 2014   C CA   . ARG A 1 131 ? -0.213  36.514  -3.444  1.00 0.00 ? 131 ARG A CA   1  
ATOM 2015   C C    . ARG A 1 131 ? -0.724  35.650  -4.601  1.00 0.00 ? 131 ARG A C    1  
ATOM 2016   O O    . ARG A 1 131 ? -0.353  35.828  -5.744  1.00 0.00 ? 131 ARG A O    1  
ATOM 2017   C CB   . ARG A 1 131 ? 0.895   35.760  -2.716  1.00 0.00 ? 131 ARG A CB   1  
ATOM 2018   C CG   . ARG A 1 131 ? 2.100   35.591  -3.645  1.00 0.00 ? 131 ARG A CG   1  
ATOM 2019   C CD   . ARG A 1 131 ? 3.201   34.824  -2.919  1.00 0.00 ? 131 ARG A CD   1  
ATOM 2020   N NE   . ARG A 1 131 ? 3.649   35.618  -1.739  1.00 0.00 ? 131 ARG A NE   1  
ATOM 2021   C CZ   . ARG A 1 131 ? 4.524   36.576  -1.884  1.00 0.00 ? 131 ARG A CZ   1  
ATOM 2022   N NH1  . ARG A 1 131 ? 4.964   36.886  -3.074  1.00 0.00 ? 131 ARG A NH1  1  
ATOM 2023   N NH2  . ARG A 1 131 ? 4.952   37.236  -0.843  1.00 0.00 ? 131 ARG A NH2  1  
ATOM 2024   H H    . ARG A 1 131 ? -1.275  36.480  -1.571  1.00 0.00 ? 131 ARG A H    1  
ATOM 2025   H HA   . ARG A 1 131 ? 0.174   37.445  -3.830  1.00 0.00 ? 131 ARG A HA   1  
ATOM 2026   H HB2  . ARG A 1 131 ? 1.191   36.317  -1.838  1.00 0.00 ? 131 ARG A HB2  1  
ATOM 2027   H HB3  . ARG A 1 131 ? 0.534   34.787  -2.419  1.00 0.00 ? 131 ARG A HB3  1  
ATOM 2028   H HG2  . ARG A 1 131 ? 1.800   35.045  -4.527  1.00 0.00 ? 131 ARG A HG2  1  
ATOM 2029   H HG3  . ARG A 1 131 ? 2.472   36.563  -3.932  1.00 0.00 ? 131 ARG A HG3  1  
ATOM 2030   H HD2  . ARG A 1 131 ? 2.818   33.869  -2.588  1.00 0.00 ? 131 ARG A HD2  1  
ATOM 2031   H HD3  . ARG A 1 131 ? 4.035   34.668  -3.588  1.00 0.00 ? 131 ARG A HD3  1  
ATOM 2032   H HE   . ARG A 1 131 ? 3.300   35.406  -0.848  1.00 0.00 ? 131 ARG A HE   1  
ATOM 2033   H HH11 . ARG A 1 131 ? 4.629   36.390  -3.875  1.00 0.00 ? 131 ARG A HH11 1  
ATOM 2034   H HH12 . ARG A 1 131 ? 5.634   37.620  -3.183  1.00 0.00 ? 131 ARG A HH12 1  
ATOM 2035   H HH21 . ARG A 1 131 ? 4.610   37.009  0.068   1.00 0.00 ? 131 ARG A HH21 1  
ATOM 2036   H HH22 . ARG A 1 131 ? 5.622   37.970  -0.957  1.00 0.00 ? 131 ARG A HH22 1  
ATOM 2037   N N    . ASP A 1 132 ? -1.558  34.694  -4.296  1.00 0.00 ? 132 ASP A N    1  
ATOM 2038   C CA   . ASP A 1 132 ? -2.096  33.781  -5.346  1.00 0.00 ? 132 ASP A CA   1  
ATOM 2039   C C    . ASP A 1 132 ? -2.858  34.578  -6.402  1.00 0.00 ? 132 ASP A C    1  
ATOM 2040   O O    . ASP A 1 132 ? -2.792  34.290  -7.579  1.00 0.00 ? 132 ASP A O    1  
ATOM 2041   C CB   . ASP A 1 132 ? -3.041  32.770  -4.686  1.00 0.00 ? 132 ASP A CB   1  
ATOM 2042   C CG   . ASP A 1 132 ? -3.522  31.761  -5.730  1.00 0.00 ? 132 ASP A CG   1  
ATOM 2043   O OD1  . ASP A 1 132 ? -3.250  31.969  -6.897  1.00 0.00 ? 132 ASP A OD1  1  
ATOM 2044   O OD2  . ASP A 1 132 ? -4.157  30.792  -5.340  1.00 0.00 ? 132 ASP A OD2  1  
ATOM 2045   H H    . ASP A 1 132 ? -1.822  34.563  -3.361  1.00 0.00 ? 132 ASP A H    1  
ATOM 2046   H HA   . ASP A 1 132 ? -1.280  33.253  -5.816  1.00 0.00 ? 132 ASP A HA   1  
ATOM 2047   H HB2  . ASP A 1 132 ? -2.516  32.250  -3.897  1.00 0.00 ? 132 ASP A HB2  1  
ATOM 2048   H HB3  . ASP A 1 132 ? -3.892  33.289  -4.272  1.00 0.00 ? 132 ASP A HB3  1  
ATOM 2049   N N    . ILE A 1 133 ? -3.602  35.567  -5.990  1.00 0.00 ? 133 ILE A N    1  
ATOM 2050   C CA   . ILE A 1 133 ? -4.385  36.363  -6.976  1.00 0.00 ? 133 ILE A CA   1  
ATOM 2051   C C    . ILE A 1 133 ? -3.440  37.007  -7.992  1.00 0.00 ? 133 ILE A C    1  
ATOM 2052   O O    . ILE A 1 133 ? -3.683  36.981  -9.181  1.00 0.00 ? 133 ILE A O    1  
ATOM 2053   C CB   . ILE A 1 133 ? -5.172  37.453  -6.239  1.00 0.00 ? 133 ILE A CB   1  
ATOM 2054   C CG1  . ILE A 1 133 ? -6.394  37.847  -7.085  1.00 0.00 ? 133 ILE A CG1  1  
ATOM 2055   C CG2  . ILE A 1 133 ? -4.271  38.681  -6.024  1.00 0.00 ? 133 ILE A CG2  1  
ATOM 2056   C CD1  . ILE A 1 133 ? -7.414  36.693  -7.123  1.00 0.00 ? 133 ILE A CD1  1  
ATOM 2057   H H    . ILE A 1 133 ? -3.658  35.775  -5.034  1.00 0.00 ? 133 ILE A H    1  
ATOM 2058   H HA   . ILE A 1 133 ? -5.075  35.713  -7.493  1.00 0.00 ? 133 ILE A HA   1  
ATOM 2059   H HB   . ILE A 1 133 ? -5.500  37.074  -5.282  1.00 0.00 ? 133 ILE A HB   1  
ATOM 2060   H HG12 . ILE A 1 133 ? -6.860  38.722  -6.655  1.00 0.00 ? 133 ILE A HG12 1  
ATOM 2061   H HG13 . ILE A 1 133 ? -6.074  38.072  -8.093  1.00 0.00 ? 133 ILE A HG13 1  
ATOM 2062   H HG21 . ILE A 1 133 ? -4.701  39.314  -5.262  1.00 0.00 ? 133 ILE A HG21 1  
ATOM 2063   H HG22 . ILE A 1 133 ? -4.190  39.234  -6.948  1.00 0.00 ? 133 ILE A HG22 1  
ATOM 2064   H HG23 . ILE A 1 133 ? -3.289  38.357  -5.711  1.00 0.00 ? 133 ILE A HG23 1  
ATOM 2065   H HD11 . ILE A 1 133 ? -7.209  36.059  -7.973  1.00 0.00 ? 133 ILE A HD11 1  
ATOM 2066   H HD12 . ILE A 1 133 ? -8.413  37.097  -7.208  1.00 0.00 ? 133 ILE A HD12 1  
ATOM 2067   H HD13 . ILE A 1 133 ? -7.336  36.114  -6.214  1.00 0.00 ? 133 ILE A HD13 1  
ATOM 2068   N N    . GLY A 1 134 ? -2.364  37.589  -7.540  1.00 0.00 ? 134 GLY A N    1  
ATOM 2069   C CA   . GLY A 1 134 ? -1.411  38.237  -8.491  1.00 0.00 ? 134 GLY A CA   1  
ATOM 2070   C C    . GLY A 1 134 ? -0.654  37.176  -9.294  1.00 0.00 ? 134 GLY A C    1  
ATOM 2071   O O    . GLY A 1 134 ? -0.318  37.382  -10.445 1.00 0.00 ? 134 GLY A O    1  
ATOM 2072   H H    . GLY A 1 134 ? -2.182  37.603  -6.576  1.00 0.00 ? 134 GLY A H    1  
ATOM 2073   H HA2  . GLY A 1 134 ? -1.962  38.874  -9.168  1.00 0.00 ? 134 GLY A HA2  1  
ATOM 2074   H HA3  . GLY A 1 134 ? -0.703  38.834  -7.935  1.00 0.00 ? 134 GLY A HA3  1  
ATOM 2075   N N    . LYS A 1 135 ? -0.364  36.058  -8.691  1.00 0.00 ? 135 LYS A N    1  
ATOM 2076   C CA   . LYS A 1 135 ? 0.388   34.985  -9.406  1.00 0.00 ? 135 LYS A CA   1  
ATOM 2077   C C    . LYS A 1 135 ? -0.405  34.544  -10.647 1.00 0.00 ? 135 LYS A C    1  
ATOM 2078   O O    . LYS A 1 135 ? 0.126   34.434  -11.739 1.00 0.00 ? 135 LYS A O    1  
ATOM 2079   C CB   . LYS A 1 135 ? 0.562   33.798  -8.448  1.00 0.00 ? 135 LYS A CB   1  
ATOM 2080   C CG   . LYS A 1 135 ? 1.368   32.677  -9.122  1.00 0.00 ? 135 LYS A CG   1  
ATOM 2081   C CD   . LYS A 1 135 ? 1.619   31.551  -8.103  1.00 0.00 ? 135 LYS A CD   1  
ATOM 2082   C CE   . LYS A 1 135 ? 2.429   30.421  -8.750  1.00 0.00 ? 135 LYS A CE   1  
ATOM 2083   N NZ   . LYS A 1 135 ? 1.629   29.810  -9.851  1.00 0.00 ? 135 LYS A NZ   1  
ATOM 2084   H H    . LYS A 1 135 ? -0.631  35.926  -7.757  1.00 0.00 ? 135 LYS A H    1  
ATOM 2085   H HA   . LYS A 1 135 ? 1.357   35.356  -9.705  1.00 0.00 ? 135 LYS A HA   1  
ATOM 2086   H HB2  . LYS A 1 135 ? 1.083   34.129  -7.561  1.00 0.00 ? 135 LYS A HB2  1  
ATOM 2087   H HB3  . LYS A 1 135 ? -0.410  33.419  -8.169  1.00 0.00 ? 135 LYS A HB3  1  
ATOM 2088   H HG2  . LYS A 1 135 ? 0.811   32.289  -9.963  1.00 0.00 ? 135 LYS A HG2  1  
ATOM 2089   H HG3  . LYS A 1 135 ? 2.314   33.068  -9.464  1.00 0.00 ? 135 LYS A HG3  1  
ATOM 2090   H HD2  . LYS A 1 135 ? 2.167   31.947  -7.260  1.00 0.00 ? 135 LYS A HD2  1  
ATOM 2091   H HD3  . LYS A 1 135 ? 0.671   31.160  -7.761  1.00 0.00 ? 135 LYS A HD3  1  
ATOM 2092   H HE2  . LYS A 1 135 ? 3.350   30.820  -9.150  1.00 0.00 ? 135 LYS A HE2  1  
ATOM 2093   H HE3  . LYS A 1 135 ? 2.654   29.668  -8.008  1.00 0.00 ? 135 LYS A HE3  1  
ATOM 2094   H HZ1  . LYS A 1 135 ? 1.736   30.379  -10.714 1.00 0.00 ? 135 LYS A HZ1  1  
ATOM 2095   H HZ2  . LYS A 1 135 ? 0.626   29.780  -9.575  1.00 0.00 ? 135 LYS A HZ2  1  
ATOM 2096   H HZ3  . LYS A 1 135 ? 1.970   28.844  -10.033 1.00 0.00 ? 135 LYS A HZ3  1  
ATOM 2097   N N    . ARG A 1 136 ? -1.674  34.291  -10.488 1.00 0.00 ? 136 ARG A N    1  
ATOM 2098   C CA   . ARG A 1 136 ? -2.507  33.852  -11.644 1.00 0.00 ? 136 ARG A CA   1  
ATOM 2099   C C    . ARG A 1 136 ? -2.695  35.010  -12.621 1.00 0.00 ? 136 ARG A C    1  
ATOM 2100   O O    . ARG A 1 136 ? -2.827  34.816  -13.816 1.00 0.00 ? 136 ARG A O    1  
ATOM 2101   C CB   . ARG A 1 136 ? -3.871  33.408  -11.126 1.00 0.00 ? 136 ARG A CB   1  
ATOM 2102   C CG   . ARG A 1 136 ? -3.683  32.322  -10.066 1.00 0.00 ? 136 ARG A CG   1  
ATOM 2103   C CD   . ARG A 1 136 ? -3.364  30.998  -10.757 1.00 0.00 ? 136 ARG A CD   1  
ATOM 2104   N NE   . ARG A 1 136 ? -3.332  29.917  -9.735  1.00 0.00 ? 136 ARG A NE   1  
ATOM 2105   C CZ   . ARG A 1 136 ? -2.227  29.644  -9.105  1.00 0.00 ? 136 ARG A CZ   1  
ATOM 2106   N NH1  . ARG A 1 136 ? -1.164  30.374  -9.313  1.00 0.00 ? 136 ARG A NH1  1  
ATOM 2107   N NH2  . ARG A 1 136 ? -2.185  28.659  -8.254  1.00 0.00 ? 136 ARG A NH2  1  
ATOM 2108   H H    . ARG A 1 136 ? -2.082  34.387  -9.602  1.00 0.00 ? 136 ARG A H    1  
ATOM 2109   H HA   . ARG A 1 136 ? -2.026  33.027  -12.147 1.00 0.00 ? 136 ARG A HA   1  
ATOM 2110   H HB2  . ARG A 1 136 ? -4.382  34.254  -10.690 1.00 0.00 ? 136 ARG A HB2  1  
ATOM 2111   H HB3  . ARG A 1 136 ? -4.456  33.013  -11.942 1.00 0.00 ? 136 ARG A HB3  1  
ATOM 2112   H HG2  . ARG A 1 136 ? -2.867  32.594  -9.409  1.00 0.00 ? 136 ARG A HG2  1  
ATOM 2113   H HG3  . ARG A 1 136 ? -4.591  32.217  -9.491  1.00 0.00 ? 136 ARG A HG3  1  
ATOM 2114   H HD2  . ARG A 1 136 ? -4.127  30.781  -11.491 1.00 0.00 ? 136 ARG A HD2  1  
ATOM 2115   H HD3  . ARG A 1 136 ? -2.402  31.066  -11.242 1.00 0.00 ? 136 ARG A HD3  1  
ATOM 2116   H HE   . ARG A 1 136 ? -4.140  29.394  -9.553  1.00 0.00 ? 136 ARG A HE   1  
ATOM 2117   H HH11 . ARG A 1 136 ? -1.200  31.139  -9.956  1.00 0.00 ? 136 ARG A HH11 1  
ATOM 2118   H HH12 . ARG A 1 136 ? -0.313  30.166  -8.830  1.00 0.00 ? 136 ARG A HH12 1  
ATOM 2119   H HH21 . ARG A 1 136 ? -3.003  28.110  -8.083  1.00 0.00 ? 136 ARG A HH21 1  
ATOM 2120   H HH22 . ARG A 1 136 ? -1.334  28.451  -7.771  1.00 0.00 ? 136 ARG A HH22 1  
ATOM 2121   N N    . LEU A 1 137 ? -2.717  36.211  -12.129 1.00 0.00 ? 137 LEU A N    1  
ATOM 2122   C CA   . LEU A 1 137 ? -2.909  37.377  -13.026 1.00 0.00 ? 137 LEU A CA   1  
ATOM 2123   C C    . LEU A 1 137 ? -1.801  37.376  -14.076 1.00 0.00 ? 137 LEU A C    1  
ATOM 2124   O O    . LEU A 1 137 ? -2.038  37.604  -15.243 1.00 0.00 ? 137 LEU A O    1  
ATOM 2125   C CB   . LEU A 1 137 ? -2.848  38.663  -12.188 1.00 0.00 ? 137 LEU A CB   1  
ATOM 2126   C CG   . LEU A 1 137 ? -4.196  38.956  -11.512 1.00 0.00 ? 137 LEU A CG   1  
ATOM 2127   C CD1  . LEU A 1 137 ? -4.045  40.135  -10.529 1.00 0.00 ? 137 LEU A CD1  1  
ATOM 2128   C CD2  . LEU A 1 137 ? -5.262  39.279  -12.600 1.00 0.00 ? 137 LEU A CD2  1  
ATOM 2129   H H    . LEU A 1 137 ? -2.616  36.347  -11.164 1.00 0.00 ? 137 LEU A H    1  
ATOM 2130   H HA   . LEU A 1 137 ? -3.871  37.307  -13.513 1.00 0.00 ? 137 LEU A HA   1  
ATOM 2131   H HB2  . LEU A 1 137 ? -2.088  38.554  -11.429 1.00 0.00 ? 137 LEU A HB2  1  
ATOM 2132   H HB3  . LEU A 1 137 ? -2.587  39.492  -12.831 1.00 0.00 ? 137 LEU A HB3  1  
ATOM 2133   H HG   . LEU A 1 137 ? -4.508  38.080  -10.961 1.00 0.00 ? 137 LEU A HG   1  
ATOM 2134   H HD11 . LEU A 1 137 ? -3.001  40.405  -10.448 1.00 0.00 ? 137 LEU A HD11 1  
ATOM 2135   H HD12 . LEU A 1 137 ? -4.416  39.843  -9.558  1.00 0.00 ? 137 LEU A HD12 1  
ATOM 2136   H HD13 . LEU A 1 137 ? -4.610  40.981  -10.891 1.00 0.00 ? 137 LEU A HD13 1  
ATOM 2137   H HD21 . LEU A 1 137 ? -4.768  39.468  -13.542 1.00 0.00 ? 137 LEU A HD21 1  
ATOM 2138   H HD22 . LEU A 1 137 ? -5.822  40.154  -12.307 1.00 0.00 ? 137 LEU A HD22 1  
ATOM 2139   H HD23 . LEU A 1 137 ? -5.934  38.440  -12.706 1.00 0.00 ? 137 LEU A HD23 1  
ATOM 2140   N N    . LEU A 1 138 ? -0.597  37.097  -13.676 1.00 0.00 ? 138 LEU A N    1  
ATOM 2141   C CA   . LEU A 1 138 ? 0.519   37.058  -14.657 1.00 0.00 ? 138 LEU A CA   1  
ATOM 2142   C C    . LEU A 1 138 ? 0.236   35.982  -15.702 1.00 0.00 ? 138 LEU A C    1  
ATOM 2143   O O    . LEU A 1 138 ? 0.477   36.169  -16.876 1.00 0.00 ? 138 LEU A O    1  
ATOM 2144   C CB   . LEU A 1 138 ? 1.824   36.743  -13.935 1.00 0.00 ? 138 LEU A CB   1  
ATOM 2145   C CG   . LEU A 1 138 ? 2.447   38.029  -13.378 1.00 0.00 ? 138 LEU A CG   1  
ATOM 2146   C CD1  . LEU A 1 138 ? 3.122   38.791  -14.521 1.00 0.00 ? 138 LEU A CD1  1  
ATOM 2147   C CD2  . LEU A 1 138 ? 1.356   38.910  -12.750 1.00 0.00 ? 138 LEU A CD2  1  
ATOM 2148   H H    . LEU A 1 138 ? -0.427  36.897  -12.732 1.00 0.00 ? 138 LEU A H    1  
ATOM 2149   H HA   . LEU A 1 138 ? 0.602   38.019  -15.145 1.00 0.00 ? 138 LEU A HA   1  
ATOM 2150   H HB2  . LEU A 1 138 ? 1.625   36.060  -13.121 1.00 0.00 ? 138 LEU A HB2  1  
ATOM 2151   H HB3  . LEU A 1 138 ? 2.514   36.283  -14.627 1.00 0.00 ? 138 LEU A HB3  1  
ATOM 2152   H HG   . LEU A 1 138 ? 3.185   37.776  -12.630 1.00 0.00 ? 138 LEU A HG   1  
ATOM 2153   H HD11 . LEU A 1 138 ? 2.377   39.338  -15.080 1.00 0.00 ? 138 LEU A HD11 1  
ATOM 2154   H HD12 . LEU A 1 138 ? 3.621   38.092  -15.175 1.00 0.00 ? 138 LEU A HD12 1  
ATOM 2155   H HD13 . LEU A 1 138 ? 3.846   39.483  -14.115 1.00 0.00 ? 138 LEU A HD13 1  
ATOM 2156   H HD21 . LEU A 1 138 ? 0.855   39.470  -13.526 1.00 0.00 ? 138 LEU A HD21 1  
ATOM 2157   H HD22 . LEU A 1 138 ? 1.806   39.593  -12.046 1.00 0.00 ? 138 LEU A HD22 1  
ATOM 2158   H HD23 . LEU A 1 138 ? 0.639   38.285  -12.238 1.00 0.00 ? 138 LEU A HD23 1  
ATOM 2159   N N    . ARG A 1 139 ? -0.288  34.860  -15.287 1.00 0.00 ? 139 ARG A N    1  
ATOM 2160   C CA   . ARG A 1 139 ? -0.590  33.798  -16.286 1.00 0.00 ? 139 ARG A CA   1  
ATOM 2161   C C    . ARG A 1 139 ? -1.730  34.286  -17.189 1.00 0.00 ? 139 ARG A C    1  
ATOM 2162   O O    . ARG A 1 139 ? -1.734  34.064  -18.385 1.00 0.00 ? 139 ARG A O    1  
ATOM 2163   C CB   . ARG A 1 139 ? -1.023  32.508  -15.575 1.00 0.00 ? 139 ARG A CB   1  
ATOM 2164   C CG   . ARG A 1 139 ? 0.185   31.856  -14.871 1.00 0.00 ? 139 ARG A CG   1  
ATOM 2165   C CD   . ARG A 1 139 ? -0.041  30.339  -14.711 1.00 0.00 ? 139 ARG A CD   1  
ATOM 2166   N NE   . ARG A 1 139 ? -0.965  30.094  -13.562 1.00 0.00 ? 139 ARG A NE   1  
ATOM 2167   C CZ   . ARG A 1 139 ? -1.024  28.912  -13.005 1.00 0.00 ? 139 ARG A CZ   1  
ATOM 2168   N NH1  . ARG A 1 139 ? -0.201  27.970  -13.380 1.00 0.00 ? 139 ARG A NH1  1  
ATOM 2169   N NH2  . ARG A 1 139 ? -1.891  28.678  -12.060 1.00 0.00 ? 139 ARG A NH2  1  
ATOM 2170   H H    . ARG A 1 139 ? -0.488  34.723  -14.337 1.00 0.00 ? 139 ARG A H    1  
ATOM 2171   H HA   . ARG A 1 139 ? 0.289   33.605  -16.886 1.00 0.00 ? 139 ARG A HA   1  
ATOM 2172   H HB2  . ARG A 1 139 ? -1.782  32.742  -14.842 1.00 0.00 ? 139 ARG A HB2  1  
ATOM 2173   H HB3  . ARG A 1 139 ? -1.427  31.817  -16.301 1.00 0.00 ? 139 ARG A HB3  1  
ATOM 2174   H HG2  . ARG A 1 139 ? 1.075   32.025  -15.459 1.00 0.00 ? 139 ARG A HG2  1  
ATOM 2175   H HG3  . ARG A 1 139 ? 0.313   32.301  -13.895 1.00 0.00 ? 139 ARG A HG3  1  
ATOM 2176   H HD2  . ARG A 1 139 ? -0.477  29.943  -15.616 1.00 0.00 ? 139 ARG A HD2  1  
ATOM 2177   H HD3  . ARG A 1 139 ? 0.905   29.852  -14.523 1.00 0.00 ? 139 ARG A HD3  1  
ATOM 2178   H HE   . ARG A 1 139 ? -1.553  30.812  -13.247 1.00 0.00 ? 139 ARG A HE   1  
ATOM 2179   H HH11 . ARG A 1 139 ? 0.476   28.152  -14.093 1.00 0.00 ? 139 ARG A HH11 1  
ATOM 2180   H HH12 . ARG A 1 139 ? -0.247  27.067  -12.953 1.00 0.00 ? 139 ARG A HH12 1  
ATOM 2181   H HH21 . ARG A 1 139 ? -2.511  29.402  -11.760 1.00 0.00 ? 139 ARG A HH21 1  
ATOM 2182   H HH22 . ARG A 1 139 ? -1.936  27.774  -11.635 1.00 0.00 ? 139 ARG A HH22 1  
ATOM 2183   N N    . ASN A 1 140 ? -2.701  34.944  -16.614 1.00 0.00 ? 140 ASN A N    1  
ATOM 2184   C CA   . ASN A 1 140 ? -3.863  35.453  -17.402 1.00 0.00 ? 140 ASN A CA   1  
ATOM 2185   C C    . ASN A 1 140 ? -3.415  36.471  -18.456 1.00 0.00 ? 140 ASN A C    1  
ATOM 2186   O O    . ASN A 1 140 ? -3.933  36.491  -19.558 1.00 0.00 ? 140 ASN A O    1  
ATOM 2187   C CB   . ASN A 1 140 ? -4.871  36.109  -16.451 1.00 0.00 ? 140 ASN A CB   1  
ATOM 2188   C CG   . ASN A 1 140 ? -5.538  35.025  -15.600 1.00 0.00 ? 140 ASN A CG   1  
ATOM 2189   O OD1  . ASN A 1 140 ? -5.423  35.030  -14.392 1.00 0.00 ? 140 ASN A OD1  1  
ATOM 2190   N ND2  . ASN A 1 140 ? -6.240  34.091  -16.182 1.00 0.00 ? 140 ASN A ND2  1  
ATOM 2191   H H    . ASN A 1 140 ? -2.670  35.101  -15.647 1.00 0.00 ? 140 ASN A H    1  
ATOM 2192   H HA   . ASN A 1 140 ? -4.342  34.622  -17.899 1.00 0.00 ? 140 ASN A HA   1  
ATOM 2193   H HB2  . ASN A 1 140 ? -4.357  36.809  -15.808 1.00 0.00 ? 140 ASN A HB2  1  
ATOM 2194   H HB3  . ASN A 1 140 ? -5.624  36.628  -17.025 1.00 0.00 ? 140 ASN A HB3  1  
ATOM 2195   H HD21 . ASN A 1 140 ? -6.337  34.087  -17.158 1.00 0.00 ? 140 ASN A HD21 1  
ATOM 2196   H HD22 . ASN A 1 140 ? -6.669  33.394  -15.644 1.00 0.00 ? 140 ASN A HD22 1  
ATOM 2197   N N    . ILE A 1 141 ? -2.466  37.316  -18.161 1.00 0.00 ? 141 ILE A N    1  
ATOM 2198   C CA   . ILE A 1 141 ? -2.022  38.301  -19.186 1.00 0.00 ? 141 ILE A CA   1  
ATOM 2199   C C    . ILE A 1 141 ? -1.256  37.542  -20.267 1.00 0.00 ? 141 ILE A C    1  
ATOM 2200   O O    . ILE A 1 141 ? -1.434  37.765  -21.446 1.00 0.00 ? 141 ILE A O    1  
ATOM 2201   C CB   . ILE A 1 141 ? -1.110  39.346  -18.513 1.00 0.00 ? 141 ILE A CB   1  
ATOM 2202   C CG1  . ILE A 1 141 ? -1.953  40.175  -17.529 1.00 0.00 ? 141 ILE A CG1  1  
ATOM 2203   C CG2  . ILE A 1 141 ? -0.453  40.275  -19.569 1.00 0.00 ? 141 ILE A CG2  1  
ATOM 2204   C CD1  . ILE A 1 141 ? -1.035  41.032  -16.654 1.00 0.00 ? 141 ILE A CD1  1  
ATOM 2205   H H    . ILE A 1 141 ? -2.045  37.298  -17.276 1.00 0.00 ? 141 ILE A H    1  
ATOM 2206   H HA   . ILE A 1 141 ? -2.882  38.789  -19.622 1.00 0.00 ? 141 ILE A HA   1  
ATOM 2207   H HB   . ILE A 1 141 ? -0.332  38.832  -17.967 1.00 0.00 ? 141 ILE A HB   1  
ATOM 2208   H HG12 . ILE A 1 141 ? -2.624  40.816  -18.083 1.00 0.00 ? 141 ILE A HG12 1  
ATOM 2209   H HG13 . ILE A 1 141 ? -2.528  39.510  -16.901 1.00 0.00 ? 141 ILE A HG13 1  
ATOM 2210   H HG21 . ILE A 1 141 ? -1.213  40.659  -20.233 1.00 0.00 ? 141 ILE A HG21 1  
ATOM 2211   H HG22 . ILE A 1 141 ? 0.273   39.714  -20.140 1.00 0.00 ? 141 ILE A HG22 1  
ATOM 2212   H HG23 . ILE A 1 141 ? 0.039   41.097  -19.069 1.00 0.00 ? 141 ILE A HG23 1  
ATOM 2213   H HD11 . ILE A 1 141 ? -1.622  41.783  -16.144 1.00 0.00 ? 141 ILE A HD11 1  
ATOM 2214   H HD12 . ILE A 1 141 ? -0.293  41.515  -17.273 1.00 0.00 ? 141 ILE A HD12 1  
ATOM 2215   H HD13 . ILE A 1 141 ? -0.543  40.404  -15.926 1.00 0.00 ? 141 ILE A HD13 1  
ATOM 2216   N N    . LEU A 1 142 ? -0.406  36.640  -19.867 1.00 0.00 ? 142 LEU A N    1  
ATOM 2217   C CA   . LEU A 1 142 ? 0.367   35.859  -20.861 1.00 0.00 ? 142 LEU A CA   1  
ATOM 2218   C C    . LEU A 1 142 ? -0.573  34.882  -21.577 1.00 0.00 ? 142 LEU A C    1  
ATOM 2219   O O    . LEU A 1 142 ? -0.394  34.565  -22.736 1.00 0.00 ? 142 LEU A O    1  
ATOM 2220   C CB   . LEU A 1 142 ? 1.483   35.081  -20.150 1.00 0.00 ? 142 LEU A CB   1  
ATOM 2221   C CG   . LEU A 1 142 ? 2.749   35.947  -20.025 1.00 0.00 ? 142 LEU A CG   1  
ATOM 2222   C CD1  . LEU A 1 142 ? 2.404   37.241  -19.283 1.00 0.00 ? 142 LEU A CD1  1  
ATOM 2223   C CD2  . LEU A 1 142 ? 3.841   35.187  -19.256 1.00 0.00 ? 142 LEU A CD2  1  
ATOM 2224   H H    . LEU A 1 142 ? -0.280  36.474  -18.909 1.00 0.00 ? 142 LEU A H    1  
ATOM 2225   H HA   . LEU A 1 142 ? 0.803   36.532  -21.585 1.00 0.00 ? 142 LEU A HA   1  
ATOM 2226   H HB2  . LEU A 1 142 ? 1.147   34.797  -19.164 1.00 0.00 ? 142 LEU A HB2  1  
ATOM 2227   H HB3  . LEU A 1 142 ? 1.714   34.192  -20.717 1.00 0.00 ? 142 LEU A HB3  1  
ATOM 2228   H HG   . LEU A 1 142 ? 3.111   36.191  -21.015 1.00 0.00 ? 142 LEU A HG   1  
ATOM 2229   H HD11 . LEU A 1 142 ? 1.966   37.000  -18.325 1.00 0.00 ? 142 LEU A HD11 1  
ATOM 2230   H HD12 . LEU A 1 142 ? 1.700   37.814  -19.867 1.00 0.00 ? 142 LEU A HD12 1  
ATOM 2231   H HD13 . LEU A 1 142 ? 3.304   37.821  -19.133 1.00 0.00 ? 142 LEU A HD13 1  
ATOM 2232   H HD21 . LEU A 1 142 ? 4.644   35.866  -19.007 1.00 0.00 ? 142 LEU A HD21 1  
ATOM 2233   H HD22 . LEU A 1 142 ? 4.224   34.386  -19.871 1.00 0.00 ? 142 LEU A HD22 1  
ATOM 2234   H HD23 . LEU A 1 142 ? 3.423   34.777  -18.349 1.00 0.00 ? 142 LEU A HD23 1  
ATOM 2235   N N    . GLY A 1 143 ? -1.567  34.388  -20.885 1.00 0.00 ? 143 GLY A N    1  
ATOM 2236   C CA   . GLY A 1 143 ? -2.462  33.416  -21.489 1.00 0.00 ? 143 GLY A CA   1  
ATOM 2237   C C    . GLY A 1 143 ? -2.008  31.993  -21.162 1.00 0.00 ? 143 GLY A C    1  
ATOM 2238   O O    . GLY A 1 143 ? -2.502  31.029  -21.746 1.00 0.00 ? 143 GLY A O    1  
ATOM 2239   H H    . GLY A 1 143 ? -1.688  34.646  -19.948 1.00 0.00 ? 143 GLY A H    1  
ATOM 2240   H HA2  . GLY A 1 143 ? -3.461  33.569  -21.105 1.00 0.00 ? 143 GLY A HA2  1  
ATOM 2241   H HA3  . GLY A 1 143 ? -2.471  33.547  -22.560 1.00 0.00 ? 143 GLY A HA3  1  
ATOM 2242   N N    . LEU A 1 144 ? -1.071  31.860  -20.211 1.00 0.00 ? 144 LEU A N    1  
ATOM 2243   C CA   . LEU A 1 144 ? -0.589  30.535  -19.823 1.00 0.00 ? 144 LEU A CA   1  
ATOM 2244   C C    . LEU A 1 144 ? -1.749  29.750  -19.268 1.00 0.00 ? 144 LEU A C    1  
ATOM 2245   O O    . LEU A 1 144 ? -2.737  30.318  -18.803 1.00 0.00 ? 144 LEU A O    1  
ATOM 2246   C CB   . LEU A 1 144 ? 0.520   30.594  -18.769 1.00 0.00 ? 144 LEU A CB   1  
ATOM 2247   C CG   . LEU A 1 144 ? 1.715   31.357  -19.319 1.00 0.00 ? 144 LEU A CG   1  
ATOM 2248   C CD1  . LEU A 1 144 ? 2.792   31.459  -18.242 1.00 0.00 ? 144 LEU A CD1  1  
ATOM 2249   C CD2  . LEU A 1 144 ? 2.281   30.634  -20.547 1.00 0.00 ? 144 LEU A CD2  1  
ATOM 2250   H H    . LEU A 1 144 ? -0.714  32.656  -19.765 1.00 0.00 ? 144 LEU A H    1  
ATOM 2251   H HA   . LEU A 1 144 ? -0.219  30.026  -20.700 1.00 0.00 ? 144 LEU A HA   1  
ATOM 2252   H HB2  . LEU A 1 144 ? 0.149   31.097  -17.887 1.00 0.00 ? 144 LEU A HB2  1  
ATOM 2253   H HB3  . LEU A 1 144 ? 0.824   29.591  -18.506 1.00 0.00 ? 144 LEU A HB3  1  
ATOM 2254   H HG   . LEU A 1 144 ? 1.395   32.340  -19.594 1.00 0.00 ? 144 LEU A HG   1  
ATOM 2255   H HD11 . LEU A 1 144 ? 2.432   31.007  -17.329 1.00 0.00 ? 144 LEU A HD11 1  
ATOM 2256   H HD12 . LEU A 1 144 ? 3.023   32.497  -18.063 1.00 0.00 ? 144 LEU A HD12 1  
ATOM 2257   H HD13 . LEU A 1 144 ? 3.681   30.944  -18.573 1.00 0.00 ? 144 LEU A HD13 1  
ATOM 2258   H HD21 . LEU A 1 144 ? 1.782   30.990  -21.436 1.00 0.00 ? 144 LEU A HD21 1  
ATOM 2259   H HD22 . LEU A 1 144 ? 2.122   29.571  -20.446 1.00 0.00 ? 144 LEU A HD22 1  
ATOM 2260   H HD23 . LEU A 1 144 ? 3.340   30.833  -20.625 1.00 0.00 ? 144 LEU A HD23 1  
ATOM 2261   N N    . LYS A 1 145 ? -1.676  28.448  -19.424 1.00 0.00 ? 145 LYS A N    1  
ATOM 2262   C CA   . LYS A 1 145 ? -2.780  27.609  -19.038 1.00 0.00 ? 145 LYS A CA   1  
ATOM 2263   C C    . LYS A 1 145 ? -2.800  27.460  -17.506 1.00 0.00 ? 145 LYS A C    1  
ATOM 2264   O O    . LYS A 1 145 ? -1.765  27.214  -16.889 1.00 0.00 ? 145 LYS A O    1  
ATOM 2265   C CB   . LYS A 1 145 ? -2.547  26.249  -19.697 1.00 0.00 ? 145 LYS A CB   1  
ATOM 2266   C CG   . LYS A 1 145 ? -2.238  26.438  -21.199 1.00 0.00 ? 145 LYS A CG   1  
ATOM 2267   C CD   . LYS A 1 145 ? -3.334  27.174  -21.980 1.00 0.00 ? 145 LYS A CD   1  
ATOM 2268   C CE   . LYS A 1 145 ? -2.870  27.252  -23.439 1.00 0.00 ? 145 LYS A CE   1  
ATOM 2269   N NZ   . LYS A 1 145 ? -3.853  28.011  -24.260 1.00 0.00 ? 145 LYS A NZ   1  
ATOM 2270   H H    . LYS A 1 145 ? -0.900  28.054  -19.874 1.00 0.00 ? 145 LYS A H    1  
ATOM 2271   H HA   . LYS A 1 145 ? -3.712  28.028  -19.375 1.00 0.00 ? 145 LYS A HA   1  
ATOM 2272   H HB2  . LYS A 1 145 ? -1.704  25.768  -19.222 1.00 0.00 ? 145 LYS A HB2  1  
ATOM 2273   H HB3  . LYS A 1 145 ? -3.418  25.637  -19.587 1.00 0.00 ? 145 LYS A HB3  1  
ATOM 2274   H HG2  . LYS A 1 145 ? -1.319  26.992  -21.299 1.00 0.00 ? 145 LYS A HG2  1  
ATOM 2275   H HG3  . LYS A 1 145 ? -2.098  25.462  -21.642 1.00 0.00 ? 145 LYS A HG3  1  
ATOM 2276   H HD2  . LYS A 1 145 ? -4.266  26.629  -21.916 1.00 0.00 ? 145 LYS A HD2  1  
ATOM 2277   H HD3  . LYS A 1 145 ? -3.463  28.173  -21.598 1.00 0.00 ? 145 LYS A HD3  1  
ATOM 2278   H HE2  . LYS A 1 145 ? -1.911  27.746  -23.482 1.00 0.00 ? 145 LYS A HE2  1  
ATOM 2279   H HE3  . LYS A 1 145 ? -2.773  26.251  -23.835 1.00 0.00 ? 145 LYS A HE3  1  
ATOM 2280   H HZ1  . LYS A 1 145 ? -3.345  28.531  -25.006 1.00 0.00 ? 145 LYS A HZ1  1  
ATOM 2281   H HZ2  . LYS A 1 145 ? -4.362  28.686  -23.654 1.00 0.00 ? 145 LYS A HZ2  1  
ATOM 2282   H HZ3  . LYS A 1 145 ? -4.527  27.355  -24.697 1.00 0.00 ? 145 LYS A HZ3  1  
ATOM 2283   N N    . ILE A 1 146 ? -3.983  27.606  -16.902 1.00 0.00 ? 146 ILE A N    1  
ATOM 2284   C CA   . ILE A 1 146 ? -4.129  27.482  -15.440 1.00 0.00 ? 146 ILE A CA   1  
ATOM 2285   C C    . ILE A 1 146 ? -5.058  26.318  -15.123 1.00 0.00 ? 146 ILE A C    1  
ATOM 2286   O O    . ILE A 1 146 ? -6.231  26.515  -14.807 1.00 0.00 ? 146 ILE A O    1  
ATOM 2287   C CB   . ILE A 1 146 ? -4.739  28.787  -14.897 1.00 0.00 ? 146 ILE A CB   1  
ATOM 2288   C CG1  . ILE A 1 146 ? -4.288  29.978  -15.753 1.00 0.00 ? 146 ILE A CG1  1  
ATOM 2289   C CG2  . ILE A 1 146 ? -4.332  29.010  -13.452 1.00 0.00 ? 146 ILE A CG2  1  
ATOM 2290   C CD1  . ILE A 1 146 ? -5.325  30.250  -16.846 1.00 0.00 ? 146 ILE A CD1  1  
ATOM 2291   H H    . ILE A 1 146 ? -4.776  27.799  -17.446 1.00 0.00 ? 146 ILE A H    1  
ATOM 2292   H HA   . ILE A 1 146 ? -3.162  27.315  -14.994 1.00 0.00 ? 146 ILE A HA   1  
ATOM 2293   H HB   . ILE A 1 146 ? -5.815  28.723  -14.942 1.00 0.00 ? 146 ILE A HB   1  
ATOM 2294   H HG12 . ILE A 1 146 ? -4.196  30.852  -15.123 1.00 0.00 ? 146 ILE A HG12 1  
ATOM 2295   H HG13 . ILE A 1 146 ? -3.333  29.764  -16.206 1.00 0.00 ? 146 ILE A HG13 1  
ATOM 2296   H HG21 . ILE A 1 146 ? -5.183  29.388  -12.907 1.00 0.00 ? 146 ILE A HG21 1  
ATOM 2297   H HG22 . ILE A 1 146 ? -3.528  29.727  -13.420 1.00 0.00 ? 146 ILE A HG22 1  
ATOM 2298   H HG23 . ILE A 1 146 ? -4.010  28.079  -13.011 1.00 0.00 ? 146 ILE A HG23 1  
ATOM 2299   H HD11 . ILE A 1 146 ? -4.854  30.767  -17.668 1.00 0.00 ? 146 ILE A HD11 1  
ATOM 2300   H HD12 . ILE A 1 146 ? -6.119  30.862  -16.444 1.00 0.00 ? 146 ILE A HD12 1  
ATOM 2301   H HD13 . ILE A 1 146 ? -5.735  29.314  -17.197 1.00 0.00 ? 146 ILE A HD13 1  
ATOM 2302   N N    . ILE A 1 147 ? -4.617  25.115  -15.435 1.00 0.00 ? 147 ILE A N    1  
ATOM 2303   C CA   . ILE A 1 147 ? -5.553  24.047  -15.396 1.00 0.00 ? 147 ILE A CA   1  
ATOM 2304   C C    . ILE A 1 147 ? -5.738  23.695  -13.954 1.00 0.00 ? 147 ILE A C    1  
ATOM 2305   O O    . ILE A 1 147 ? -5.292  22.666  -13.540 1.00 0.00 ? 147 ILE A O    1  
ATOM 2306   C CB   . ILE A 1 147 ? -5.028  22.790  -16.134 1.00 0.00 ? 147 ILE A CB   1  
ATOM 2307   C CG1  . ILE A 1 147 ? -4.295  23.158  -17.417 1.00 0.00 ? 147 ILE A CG1  1  
ATOM 2308   C CG2  . ILE A 1 147 ? -6.197  21.887  -16.510 1.00 0.00 ? 147 ILE A CG2  1  
ATOM 2309   C CD1  . ILE A 1 147 ? -5.169  24.031  -18.332 1.00 0.00 ? 147 ILE A CD1  1  
ATOM 2310   H H    . ILE A 1 147 ? -3.778  25.024  -15.928 1.00 0.00 ? 147 ILE A H    1  
ATOM 2311   H HA   . ILE A 1 147 ? -6.491  24.362  -15.820 1.00 0.00 ? 147 ILE A HA   1  
ATOM 2312   H HB   . ILE A 1 147 ? -4.354  22.246  -15.487 1.00 0.00 ? 147 ILE A HB   1  
ATOM 2313   H HG12 . ILE A 1 147 ? -3.410  23.682  -17.156 1.00 0.00 ? 147 ILE A HG12 1  
ATOM 2314   H HG13 . ILE A 1 147 ? -4.027  22.253  -17.940 1.00 0.00 ? 147 ILE A HG13 1  
ATOM 2315   H HG21 . ILE A 1 147 ? -5.819  20.952  -16.901 1.00 0.00 ? 147 ILE A HG21 1  
ATOM 2316   H HG22 . ILE A 1 147 ? -6.804  22.374  -17.262 1.00 0.00 ? 147 ILE A HG22 1  
ATOM 2317   H HG23 . ILE A 1 147 ? -6.789  21.695  -15.641 1.00 0.00 ? 147 ILE A HG23 1  
ATOM 2318   H HD11 . ILE A 1 147 ? -5.039  25.069  -18.068 1.00 0.00 ? 147 ILE A HD11 1  
ATOM 2319   H HD12 . ILE A 1 147 ? -6.209  23.762  -18.224 1.00 0.00 ? 147 ILE A HD12 1  
ATOM 2320   H HD13 . ILE A 1 147 ? -4.867  23.881  -19.358 1.00 0.00 ? 147 ILE A HD13 1  
ATOM 2321   N N    . ASP A 1 148 ? -6.483  24.450  -13.171 1.00 0.00 ? 148 ASP A N    1  
ATOM 2322   C CA   . ASP A 1 148 ? -6.745  23.895  -11.831 1.00 0.00 ? 148 ASP A CA   1  
ATOM 2323   C C    . ASP A 1 148 ? -7.374  22.667  -12.393 1.00 0.00 ? 148 ASP A C    1  
ATOM 2324   O O    . ASP A 1 148 ? -8.081  22.808  -13.376 1.00 0.00 ? 148 ASP A O    1  
ATOM 2325   C CB   . ASP A 1 148 ? -7.750  24.745  -11.046 1.00 0.00 ? 148 ASP A CB   1  
ATOM 2326   C CG   . ASP A 1 148 ? -7.872  24.212  -9.618  1.00 0.00 ? 148 ASP A CG   1  
ATOM 2327   O OD1  . ASP A 1 148 ? -7.343  23.143  -9.358  1.00 0.00 ? 148 ASP A OD1  1  
ATOM 2328   O OD2  . ASP A 1 148 ? -8.491  24.881  -8.807  1.00 0.00 ? 148 ASP A OD2  1  
ATOM 2329   H H    . ASP A 1 148 ? -6.938  25.252  -13.500 1.00 0.00 ? 148 ASP A H    1  
ATOM 2330   H HA   . ASP A 1 148 ? -5.832  23.676  -11.285 1.00 0.00 ? 148 ASP A HA   1  
ATOM 2331   H HB2  . ASP A 1 148 ? -7.408  25.769  -11.020 1.00 0.00 ? 148 ASP A HB2  1  
ATOM 2332   H HB3  . ASP A 1 148 ? -8.715  24.698  -11.527 1.00 0.00 ? 148 ASP A HB3  1  
ATOM 2333   N N    . LEU A 1 149 ? -7.152  21.482  -11.969 1.00 0.00 ? 149 LEU A N    1  
ATOM 2334   C CA   . LEU A 1 149 ? -7.805  20.434  -12.798 1.00 0.00 ? 149 LEU A CA   1  
ATOM 2335   C C    . LEU A 1 149 ? -9.301  20.367  -12.484 1.00 0.00 ? 149 LEU A C    1  
ATOM 2336   O O    . LEU A 1 149 ? -10.025 19.576  -13.048 1.00 0.00 ? 149 LEU A O    1  
ATOM 2337   C CB   . LEU A 1 149 ? -7.154  19.080  -12.492 1.00 0.00 ? 149 LEU A CB   1  
ATOM 2338   C CG   . LEU A 1 149 ? -6.209  18.665  -13.634 1.00 0.00 ? 149 LEU A CG   1  
ATOM 2339   C CD1  . LEU A 1 149 ? -7.010  18.529  -14.927 1.00 0.00 ? 149 LEU A CD1  1  
ATOM 2340   C CD2  . LEU A 1 149 ? -5.110  19.716  -13.830 1.00 0.00 ? 149 LEU A CD2  1  
ATOM 2341   H H    . LEU A 1 149 ? -6.616  21.222  -11.191 1.00 0.00 ? 149 LEU A H    1  
ATOM 2342   H HA   . LEU A 1 149 ? -7.668  20.667  -13.843 1.00 0.00 ? 149 LEU A HA   1  
ATOM 2343   H HB2  . LEU A 1 149 ? -6.591  19.155  -11.573 1.00 0.00 ? 149 LEU A HB2  1  
ATOM 2344   H HB3  . LEU A 1 149 ? -7.924  18.332  -12.378 1.00 0.00 ? 149 LEU A HB3  1  
ATOM 2345   H HG   . LEU A 1 149 ? -5.758  17.712  -13.393 1.00 0.00 ? 149 LEU A HG   1  
ATOM 2346   H HD11 . LEU A 1 149 ? -8.066  18.522  -14.698 1.00 0.00 ? 149 LEU A HD11 1  
ATOM 2347   H HD12 . LEU A 1 149 ? -6.742  17.606  -15.420 1.00 0.00 ? 149 LEU A HD12 1  
ATOM 2348   H HD13 . LEU A 1 149 ? -6.788  19.363  -15.577 1.00 0.00 ? 149 LEU A HD13 1  
ATOM 2349   H HD21 . LEU A 1 149 ? -5.149  20.433  -13.023 1.00 0.00 ? 149 LEU A HD21 1  
ATOM 2350   H HD22 . LEU A 1 149 ? -5.261  20.224  -14.771 1.00 0.00 ? 149 LEU A HD22 1  
ATOM 2351   H HD23 . LEU A 1 149 ? -4.144  19.230  -13.834 1.00 0.00 ? 149 LEU A HD23 1  
ATOM 2352   N N    . SER A 1 150 ? -9.779  21.172  -11.579 1.00 0.00 ? 150 SER A N    1  
ATOM 2353   C CA   . SER A 1 150 ? -11.231 21.129  -11.246 1.00 0.00 ? 150 SER A CA   1  
ATOM 2354   C C    . SER A 1 150 ? -12.025 22.020  -12.222 1.00 0.00 ? 150 SER A C    1  
ATOM 2355   O O    . SER A 1 150 ? -13.236 21.956  -12.287 1.00 0.00 ? 150 SER A O    1  
ATOM 2356   C CB   . SER A 1 150 ? -11.426 21.626  -9.804  1.00 0.00 ? 150 SER A CB   1  
ATOM 2357   O OG   . SER A 1 150 ? -11.117 23.010  -9.729  1.00 0.00 ? 150 SER A OG   1  
ATOM 2358   H H    . SER A 1 150 ? -9.185  21.801  -11.117 1.00 0.00 ? 150 SER A H    1  
ATOM 2359   H HA   . SER A 1 150 ? -11.585 20.111  -11.323 1.00 0.00 ? 150 SER A HA   1  
ATOM 2360   H HB2  . SER A 1 150 ? -12.450 21.477  -9.507  1.00 0.00 ? 150 SER A HB2  1  
ATOM 2361   H HB3  . SER A 1 150 ? -10.778 21.065  -9.143  1.00 0.00 ? 150 SER A HB3  1  
ATOM 2362   H HG   . SER A 1 150 ? -11.614 23.386  -8.999  1.00 0.00 ? 150 SER A HG   1  
ATOM 2363   N N    . ALA A 1 151 ? -11.355 22.874  -12.953 1.00 0.00 ? 151 ALA A N    1  
ATOM 2364   C CA   . ALA A 1 151 ? -12.074 23.797  -13.892 1.00 0.00 ? 151 ALA A CA   1  
ATOM 2365   C C    . ALA A 1 151 ? -12.401 23.098  -15.220 1.00 0.00 ? 151 ALA A C    1  
ATOM 2366   O O    . ALA A 1 151 ? -12.494 23.729  -16.254 1.00 0.00 ? 151 ALA A O    1  
ATOM 2367   C CB   . ALA A 1 151 ? -11.180 25.020  -14.155 1.00 0.00 ? 151 ALA A CB   1  
ATOM 2368   H H    . ALA A 1 151 ? -10.380 22.930  -12.867 1.00 0.00 ? 151 ALA A H    1  
ATOM 2369   H HA   . ALA A 1 151 ? -12.992 24.126  -13.430 1.00 0.00 ? 151 ALA A HA   1  
ATOM 2370   H HB1  . ALA A 1 151 ? -11.165 25.650  -13.278 1.00 0.00 ? 151 ALA A HB1  1  
ATOM 2371   H HB2  . ALA A 1 151 ? -11.570 25.578  -14.994 1.00 0.00 ? 151 ALA A HB2  1  
ATOM 2372   H HB3  . ALA A 1 151 ? -10.175 24.690  -14.378 1.00 0.00 ? 151 ALA A HB3  1  
ATOM 2373   N N    . ILE A 1 152 ? -12.580 21.810  -15.218 1.00 0.00 ? 152 ILE A N    1  
ATOM 2374   C CA   . ILE A 1 152 ? -12.896 21.114  -16.503 1.00 0.00 ? 152 ILE A CA   1  
ATOM 2375   C C    . ILE A 1 152 ? -14.415 21.083  -16.722 1.00 0.00 ? 152 ILE A C    1  
ATOM 2376   O O    . ILE A 1 152 ? -15.153 20.523  -15.937 1.00 0.00 ? 152 ILE A O    1  
ATOM 2377   C CB   . ILE A 1 152 ? -12.359 19.683  -16.431 1.00 0.00 ? 152 ILE A CB   1  
ATOM 2378   C CG1  . ILE A 1 152 ? -10.875 19.729  -16.046 1.00 0.00 ? 152 ILE A CG1  1  
ATOM 2379   C CG2  . ILE A 1 152 ? -12.546 18.962  -17.784 1.00 0.00 ? 152 ILE A CG2  1  
ATOM 2380   C CD1  . ILE A 1 152 ? -10.065 20.564  -17.051 1.00 0.00 ? 152 ILE A CD1  1  
ATOM 2381   H H    . ILE A 1 152 ? -12.505 21.301  -14.384 1.00 0.00 ? 152 ILE A H    1  
ATOM 2382   H HA   . ILE A 1 152 ? -12.423 21.635  -17.322 1.00 0.00 ? 152 ILE A HA   1  
ATOM 2383   H HB   . ILE A 1 152 ? -12.905 19.143  -15.669 1.00 0.00 ? 152 ILE A HB   1  
ATOM 2384   H HG12 . ILE A 1 152 ? -10.777 20.167  -15.063 1.00 0.00 ? 152 ILE A HG12 1  
ATOM 2385   H HG13 . ILE A 1 152 ? -10.484 18.722  -16.025 1.00 0.00 ? 152 ILE A HG13 1  
ATOM 2386   H HG21 . ILE A 1 152 ? -13.597 18.925  -18.030 1.00 0.00 ? 152 ILE A HG21 1  
ATOM 2387   H HG22 . ILE A 1 152 ? -12.157 17.957  -17.712 1.00 0.00 ? 152 ILE A HG22 1  
ATOM 2388   H HG23 . ILE A 1 152 ? -12.014 19.500  -18.555 1.00 0.00 ? 152 ILE A HG23 1  
ATOM 2389   H HD11 . ILE A 1 152 ? -10.423 20.370  -18.052 1.00 0.00 ? 152 ILE A HD11 1  
ATOM 2390   H HD12 . ILE A 1 152 ? -9.021  20.294  -16.985 1.00 0.00 ? 152 ILE A HD12 1  
ATOM 2391   H HD13 . ILE A 1 152 ? -10.180 21.613  -16.824 1.00 0.00 ? 152 ILE A HD13 1  
ATOM 2392   N N    . GLN A 1 153 ? -14.887 21.671  -17.802 1.00 0.00 ? 153 GLN A N    1  
ATOM 2393   C CA   . GLN A 1 153 ? -16.361 21.671  -18.094 1.00 0.00 ? 153 GLN A CA   1  
ATOM 2394   C C    . GLN A 1 153 ? -16.699 20.604  -19.147 1.00 0.00 ? 153 GLN A C    1  
ATOM 2395   O O    . GLN A 1 153 ? -17.856 20.298  -19.362 1.00 0.00 ? 153 GLN A O    1  
ATOM 2396   C CB   . GLN A 1 153 ? -16.800 23.038  -18.634 1.00 0.00 ? 153 GLN A CB   1  
ATOM 2397   C CG   . GLN A 1 153 ? -16.707 24.098  -17.539 1.00 0.00 ? 153 GLN A CG   1  
ATOM 2398   C CD   . GLN A 1 153 ? -16.940 25.473  -18.166 1.00 0.00 ? 153 GLN A CD   1  
ATOM 2399   O OE1  . GLN A 1 153 ? -16.635 25.684  -19.324 1.00 0.00 ? 153 GLN A OE1  1  
ATOM 2400   N NE2  . GLN A 1 153 ? -17.473 26.422  -17.454 1.00 0.00 ? 153 GLN A NE2  1  
ATOM 2401   H H    . GLN A 1 153 ? -14.269 22.106  -18.426 1.00 0.00 ? 153 GLN A H    1  
ATOM 2402   H HA   . GLN A 1 153 ? -16.903 21.456  -17.185 1.00 0.00 ? 153 GLN A HA   1  
ATOM 2403   H HB2  . GLN A 1 153 ? -16.160 23.319  -19.457 1.00 0.00 ? 153 GLN A HB2  1  
ATOM 2404   H HB3  . GLN A 1 153 ? -17.820 22.974  -18.981 1.00 0.00 ? 153 GLN A HB3  1  
ATOM 2405   H HG2  . GLN A 1 153 ? -17.460 23.908  -16.786 1.00 0.00 ? 153 GLN A HG2  1  
ATOM 2406   H HG3  . GLN A 1 153 ? -15.727 24.069  -17.088 1.00 0.00 ? 153 GLN A HG3  1  
ATOM 2407   H HE21 . GLN A 1 153 ? -17.723 26.255  -16.522 1.00 0.00 ? 153 GLN A HE21 1  
ATOM 2408   H HE22 . GLN A 1 153 ? -17.625 27.305  -17.851 1.00 0.00 ? 153 GLN A HE22 1  
ATOM 2409   N N    . ASP A 1 154 ? -15.714 20.053  -19.823 1.00 0.00 ? 154 ASP A N    1  
ATOM 2410   C CA   . ASP A 1 154 ? -16.008 19.029  -20.886 1.00 0.00 ? 154 ASP A CA   1  
ATOM 2411   C C    . ASP A 1 154 ? -15.189 17.756  -20.653 1.00 0.00 ? 154 ASP A C    1  
ATOM 2412   O O    . ASP A 1 154 ? -14.105 17.787  -20.102 1.00 0.00 ? 154 ASP A O    1  
ATOM 2413   C CB   . ASP A 1 154 ? -15.633 19.607  -22.255 1.00 0.00 ? 154 ASP A CB   1  
ATOM 2414   C CG   . ASP A 1 154 ? -16.624 20.707  -22.631 1.00 0.00 ? 154 ASP A CG   1  
ATOM 2415   O OD1  . ASP A 1 154 ? -17.659 20.795  -21.987 1.00 0.00 ? 154 ASP A OD1  1  
ATOM 2416   O OD2  . ASP A 1 154 ? -16.334 21.447  -23.555 1.00 0.00 ? 154 ASP A OD2  1  
ATOM 2417   H H    . ASP A 1 154 ? -14.789 20.325  -19.650 1.00 0.00 ? 154 ASP A H    1  
ATOM 2418   H HA   . ASP A 1 154 ? -17.061 18.787  -20.874 1.00 0.00 ? 154 ASP A HA   1  
ATOM 2419   H HB2  . ASP A 1 154 ? -14.635 20.019  -22.211 1.00 0.00 ? 154 ASP A HB2  1  
ATOM 2420   H HB3  . ASP A 1 154 ? -15.667 18.825  -22.998 1.00 0.00 ? 154 ASP A HB3  1  
ATOM 2421   N N    . GLU A 1 155 ? -15.708 16.635  -21.083 1.00 0.00 ? 155 GLU A N    1  
ATOM 2422   C CA   . GLU A 1 155 ? -14.974 15.352  -20.907 1.00 0.00 ? 155 GLU A CA   1  
ATOM 2423   C C    . GLU A 1 155 ? -13.679 15.415  -21.719 1.00 0.00 ? 155 GLU A C    1  
ATOM 2424   O O    . GLU A 1 155 ? -13.674 15.815  -22.864 1.00 0.00 ? 155 GLU A O    1  
ATOM 2425   C CB   . GLU A 1 155 ? -15.843 14.190  -21.406 1.00 0.00 ? 155 GLU A CB   1  
ATOM 2426   C CG   . GLU A 1 155 ? -17.030 13.995  -20.460 1.00 0.00 ? 155 GLU A CG   1  
ATOM 2427   C CD   . GLU A 1 155 ? -17.990 12.957  -21.048 1.00 0.00 ? 155 GLU A CD   1  
ATOM 2428   O OE1  . GLU A 1 155 ? -17.827 12.615  -22.207 1.00 0.00 ? 155 GLU A OE1  1  
ATOM 2429   O OE2  . GLU A 1 155 ? -18.861 12.506  -20.319 1.00 0.00 ? 155 GLU A OE2  1  
ATOM 2430   H H    . GLU A 1 155 ? -16.580 16.641  -21.530 1.00 0.00 ? 155 GLU A H    1  
ATOM 2431   H HA   . GLU A 1 155 ? -14.740 15.209  -19.863 1.00 0.00 ? 155 GLU A HA   1  
ATOM 2432   H HB2  . GLU A 1 155 ? -16.206 14.413  -22.399 1.00 0.00 ? 155 GLU A HB2  1  
ATOM 2433   H HB3  . GLU A 1 155 ? -15.254 13.286  -21.432 1.00 0.00 ? 155 GLU A HB3  1  
ATOM 2434   H HG2  . GLU A 1 155 ? -16.673 13.654  -19.500 1.00 0.00 ? 155 GLU A HG2  1  
ATOM 2435   H HG3  . GLU A 1 155 ? -17.551 14.934  -20.337 1.00 0.00 ? 155 GLU A HG3  1  
ATOM 2436   N N    . VAL A 1 156 ? -12.587 15.015  -21.132 1.00 0.00 ? 156 VAL A N    1  
ATOM 2437   C CA   . VAL A 1 156 ? -11.288 15.046  -21.861 1.00 0.00 ? 156 VAL A CA   1  
ATOM 2438   C C    . VAL A 1 156 ? -10.356 13.957  -21.322 1.00 0.00 ? 156 VAL A C    1  
ATOM 2439   O O    . VAL A 1 156 ? -10.558 13.440  -20.243 1.00 0.00 ? 156 VAL A O    1  
ATOM 2440   C CB   . VAL A 1 156 ? -10.634 16.413  -21.652 1.00 0.00 ? 156 VAL A CB   1  
ATOM 2441   C CG1  . VAL A 1 156 ? -11.508 17.506  -22.273 1.00 0.00 ? 156 VAL A CG1  1  
ATOM 2442   C CG2  . VAL A 1 156 ? -10.475 16.678  -20.151 1.00 0.00 ? 156 VAL A CG2  1  
ATOM 2443   H H    . VAL A 1 156 ? -12.620 14.691  -20.208 1.00 0.00 ? 156 VAL A H    1  
ATOM 2444   H HA   . VAL A 1 156 ? -11.460 14.887  -22.915 1.00 0.00 ? 156 VAL A HA   1  
ATOM 2445   H HB   . VAL A 1 156 ? -9.662  16.420  -22.124 1.00 0.00 ? 156 VAL A HB   1  
ATOM 2446   H HG11 . VAL A 1 156 ? -12.373 17.673  -21.649 1.00 0.00 ? 156 VAL A HG11 1  
ATOM 2447   H HG12 . VAL A 1 156 ? -11.827 17.196  -23.258 1.00 0.00 ? 156 VAL A HG12 1  
ATOM 2448   H HG13 . VAL A 1 156 ? -10.939 18.421  -22.352 1.00 0.00 ? 156 VAL A HG13 1  
ATOM 2449   H HG21 . VAL A 1 156 ? -10.079 17.673  -20.001 1.00 0.00 ? 156 VAL A HG21 1  
ATOM 2450   H HG22 . VAL A 1 156 ? -9.795  15.953  -19.727 1.00 0.00 ? 156 VAL A HG22 1  
ATOM 2451   H HG23 . VAL A 1 156 ? -11.437 16.596  -19.667 1.00 0.00 ? 156 VAL A HG23 1  
ATOM 2452   N N    . ILE A 1 157 ? -9.300  13.653  -22.032 1.00 0.00 ? 157 ILE A N    1  
ATOM 2453   C CA   . ILE A 1 157 ? -8.322  12.649  -21.523 1.00 0.00 ? 157 ILE A CA   1  
ATOM 2454   C C    . ILE A 1 157 ? -7.242  13.463  -20.814 1.00 0.00 ? 157 ILE A C    1  
ATOM 2455   O O    . ILE A 1 157 ? -6.959  14.581  -21.192 1.00 0.00 ? 157 ILE A O    1  
ATOM 2456   C CB   . ILE A 1 157 ? -7.725  11.838  -22.688 1.00 0.00 ? 157 ILE A CB   1  
ATOM 2457   C CG1  . ILE A 1 157 ? -8.861  11.057  -23.380 1.00 0.00 ? 157 ILE A CG1  1  
ATOM 2458   C CG2  . ILE A 1 157 ? -6.672  10.841  -22.144 1.00 0.00 ? 157 ILE A CG2  1  
ATOM 2459   C CD1  . ILE A 1 157 ? -8.368  10.423  -24.709 1.00 0.00 ? 157 ILE A CD1  1  
ATOM 2460   H H    . ILE A 1 157 ? -9.129  14.117  -22.878 1.00 0.00 ? 157 ILE A H    1  
ATOM 2461   H HA   . ILE A 1 157 ? -8.808  11.989  -20.816 1.00 0.00 ? 157 ILE A HA   1  
ATOM 2462   H HB   . ILE A 1 157 ? -7.259  12.508  -23.395 1.00 0.00 ? 157 ILE A HB   1  
ATOM 2463   H HG12 . ILE A 1 157 ? -9.207  10.275  -22.721 1.00 0.00 ? 157 ILE A HG12 1  
ATOM 2464   H HG13 . ILE A 1 157 ? -9.678  11.731  -23.591 1.00 0.00 ? 157 ILE A HG13 1  
ATOM 2465   H HG21 . ILE A 1 157 ? -5.886  11.386  -21.642 1.00 0.00 ? 157 ILE A HG21 1  
ATOM 2466   H HG22 . ILE A 1 157 ? -6.252  10.278  -22.964 1.00 0.00 ? 157 ILE A HG22 1  
ATOM 2467   H HG23 . ILE A 1 157 ? -7.144  10.164  -21.446 1.00 0.00 ? 157 ILE A HG23 1  
ATOM 2468   H HD11 . ILE A 1 157 ? -8.465  9.348   -24.653 1.00 0.00 ? 157 ILE A HD11 1  
ATOM 2469   H HD12 . ILE A 1 157 ? -7.332  10.682  -24.871 1.00 0.00 ? 157 ILE A HD12 1  
ATOM 2470   H HD13 . ILE A 1 157 ? -8.965  10.796  -25.529 1.00 0.00 ? 157 ILE A HD13 1  
ATOM 2471   N N    . LEU A 1 158 ? -6.660  12.938  -19.773 1.00 0.00 ? 158 LEU A N    1  
ATOM 2472   C CA   . LEU A 1 158 ? -5.631  13.713  -19.019 1.00 0.00 ? 158 LEU A CA   1  
ATOM 2473   C C    . LEU A 1 158 ? -4.222  13.282  -19.440 1.00 0.00 ? 158 LEU A C    1  
ATOM 2474   O O    . LEU A 1 158 ? -3.829  12.147  -19.255 1.00 0.00 ? 158 LEU A O    1  
ATOM 2475   C CB   . LEU A 1 158 ? -5.843  13.443  -17.529 1.00 0.00 ? 158 LEU A CB   1  
ATOM 2476   C CG   . LEU A 1 158 ? -4.788  14.175  -16.692 1.00 0.00 ? 158 LEU A CG   1  
ATOM 2477   C CD1  . LEU A 1 158 ? -4.879  15.694  -16.935 1.00 0.00 ? 158 LEU A CD1  1  
ATOM 2478   C CD2  . LEU A 1 158 ? -5.045  13.866  -15.212 1.00 0.00 ? 158 LEU A CD2  1  
ATOM 2479   H H    . LEU A 1 158 ? -6.920  12.043  -19.466 1.00 0.00 ? 158 LEU A H    1  
ATOM 2480   H HA   . LEU A 1 158 ? -5.759  14.767  -19.214 1.00 0.00 ? 158 LEU A HA   1  
ATOM 2481   H HB2  . LEU A 1 158 ? -6.827  13.785  -17.242 1.00 0.00 ? 158 LEU A HB2  1  
ATOM 2482   H HB3  . LEU A 1 158 ? -5.768  12.381  -17.346 1.00 0.00 ? 158 LEU A HB3  1  
ATOM 2483   H HG   . LEU A 1 158 ? -3.804  13.826  -16.969 1.00 0.00 ? 158 LEU A HG   1  
ATOM 2484   H HD11 . LEU A 1 158 ? -4.219  15.969  -17.745 1.00 0.00 ? 158 LEU A HD11 1  
ATOM 2485   H HD12 . LEU A 1 158 ? -4.585  16.220  -16.038 1.00 0.00 ? 158 LEU A HD12 1  
ATOM 2486   H HD13 . LEU A 1 158 ? -5.894  15.958  -17.192 1.00 0.00 ? 158 LEU A HD13 1  
ATOM 2487   H HD21 . LEU A 1 158 ? -5.311  14.775  -14.695 1.00 0.00 ? 158 LEU A HD21 1  
ATOM 2488   H HD22 . LEU A 1 158 ? -4.151  13.450  -14.772 1.00 0.00 ? 158 LEU A HD22 1  
ATOM 2489   H HD23 . LEU A 1 158 ? -5.852  13.153  -15.128 1.00 0.00 ? 158 LEU A HD23 1  
ATOM 2490   N N    . VAL A 1 159 ? -3.458  14.194  -20.000 1.00 0.00 ? 159 VAL A N    1  
ATOM 2491   C CA   . VAL A 1 159 ? -2.062  13.869  -20.439 1.00 0.00 ? 159 VAL A CA   1  
ATOM 2492   C C    . VAL A 1 159 ? -1.083  14.797  -19.702 1.00 0.00 ? 159 VAL A C    1  
ATOM 2493   O O    . VAL A 1 159 ? -1.266  15.999  -19.668 1.00 0.00 ? 159 VAL A O    1  
ATOM 2494   C CB   . VAL A 1 159 ? -1.950  14.091  -21.953 1.00 0.00 ? 159 VAL A CB   1  
ATOM 2495   C CG1  . VAL A 1 159 ? -0.518  13.817  -22.415 1.00 0.00 ? 159 VAL A CG1  1  
ATOM 2496   C CG2  . VAL A 1 159 ? -2.913  13.146  -22.674 1.00 0.00 ? 159 VAL A CG2  1  
ATOM 2497   H H    . VAL A 1 159 ? -3.804  15.101  -20.128 1.00 0.00 ? 159 VAL A H    1  
ATOM 2498   H HA   . VAL A 1 159 ? -1.835  12.839  -20.203 1.00 0.00 ? 159 VAL A HA   1  
ATOM 2499   H HB   . VAL A 1 159 ? -2.210  15.115  -22.183 1.00 0.00 ? 159 VAL A HB   1  
ATOM 2500   H HG11 . VAL A 1 159 ? 0.029   14.747  -22.463 1.00 0.00 ? 159 VAL A HG11 1  
ATOM 2501   H HG12 . VAL A 1 159 ? -0.537  13.360  -23.394 1.00 0.00 ? 159 VAL A HG12 1  
ATOM 2502   H HG13 . VAL A 1 159 ? -0.036  13.150  -21.716 1.00 0.00 ? 159 VAL A HG13 1  
ATOM 2503   H HG21 . VAL A 1 159 ? -3.821  13.048  -22.097 1.00 0.00 ? 159 VAL A HG21 1  
ATOM 2504   H HG22 . VAL A 1 159 ? -2.451  12.176  -22.784 1.00 0.00 ? 159 VAL A HG22 1  
ATOM 2505   H HG23 . VAL A 1 159 ? -3.147  13.545  -23.650 1.00 0.00 ? 159 VAL A HG23 1  
ATOM 2506   N N    . ALA A 1 160 ? -0.055  14.254  -19.101 1.00 0.00 ? 160 ALA A N    1  
ATOM 2507   C CA   . ALA A 1 160 ? 0.920   15.111  -18.360 1.00 0.00 ? 160 ALA A CA   1  
ATOM 2508   C C    . ALA A 1 160 ? 2.255   14.376  -18.252 1.00 0.00 ? 160 ALA A C    1  
ATOM 2509   O O    . ALA A 1 160 ? 2.320   13.172  -18.369 1.00 0.00 ? 160 ALA A O    1  
ATOM 2510   C CB   . ALA A 1 160 ? 0.384   15.375  -16.952 1.00 0.00 ? 160 ALA A CB   1  
ATOM 2511   H H    . ALA A 1 160 ? 0.072   13.283  -19.130 1.00 0.00 ? 160 ALA A H    1  
ATOM 2512   H HA   . ALA A 1 160 ? 1.056   16.047  -18.881 1.00 0.00 ? 160 ALA A HA   1  
ATOM 2513   H HB1  . ALA A 1 160 ? 0.965   16.159  -16.488 1.00 0.00 ? 160 ALA A HB1  1  
ATOM 2514   H HB2  . ALA A 1 160 ? 0.460   14.473  -16.363 1.00 0.00 ? 160 ALA A HB2  1  
ATOM 2515   H HB3  . ALA A 1 160 ? -0.651  15.680  -17.012 1.00 0.00 ? 160 ALA A HB3  1  
ATOM 2516   N N    . ALA A 1 161 ? 3.322   15.066  -17.989 1.00 0.00 ? 161 ALA A N    1  
ATOM 2517   C CA   . ALA A 1 161 ? 4.617   14.352  -17.845 1.00 0.00 ? 161 ALA A CA   1  
ATOM 2518   C C    . ALA A 1 161 ? 4.550   13.509  -16.567 1.00 0.00 ? 161 ALA A C    1  
ATOM 2519   O O    . ALA A 1 161 ? 5.033   12.399  -16.511 1.00 0.00 ? 161 ALA A O    1  
ATOM 2520   C CB   . ALA A 1 161 ? 5.766   15.352  -17.754 1.00 0.00 ? 161 ALA A CB   1  
ATOM 2521   H H    . ALA A 1 161 ? 3.271   16.037  -17.862 1.00 0.00 ? 161 ALA A H    1  
ATOM 2522   H HA   . ALA A 1 161 ? 4.766   13.703  -18.697 1.00 0.00 ? 161 ALA A HA   1  
ATOM 2523   H HB1  . ALA A 1 161 ? 6.643   14.859  -17.362 1.00 0.00 ? 161 ALA A HB1  1  
ATOM 2524   H HB2  . ALA A 1 161 ? 5.485   16.163  -17.098 1.00 0.00 ? 161 ALA A HB2  1  
ATOM 2525   H HB3  . ALA A 1 161 ? 5.981   15.744  -18.738 1.00 0.00 ? 161 ALA A HB3  1  
ATOM 2526   N N    . ASP A 1 162 ? 3.920   14.038  -15.550 1.00 0.00 ? 162 ASP A N    1  
ATOM 2527   C CA   . ASP A 1 162 ? 3.771   13.285  -14.271 1.00 0.00 ? 162 ASP A CA   1  
ATOM 2528   C C    . ASP A 1 162 ? 2.795   14.046  -13.362 1.00 0.00 ? 162 ASP A C    1  
ATOM 2529   O O    . ASP A 1 162 ? 2.733   15.259  -13.389 1.00 0.00 ? 162 ASP A O    1  
ATOM 2530   C CB   . ASP A 1 162 ? 5.136   13.140  -13.581 1.00 0.00 ? 162 ASP A CB   1  
ATOM 2531   C CG   . ASP A 1 162 ? 5.382   14.311  -12.636 1.00 0.00 ? 162 ASP A CG   1  
ATOM 2532   O OD1  . ASP A 1 162 ? 5.934   15.306  -13.086 1.00 0.00 ? 162 ASP A OD1  1  
ATOM 2533   O OD2  . ASP A 1 162 ? 5.023   14.192  -11.475 1.00 0.00 ? 162 ASP A OD2  1  
ATOM 2534   H H    . ASP A 1 162 ? 3.523   14.930  -15.637 1.00 0.00 ? 162 ASP A H    1  
ATOM 2535   H HA   . ASP A 1 162 ? 3.370   12.305  -14.481 1.00 0.00 ? 162 ASP A HA   1  
ATOM 2536   H HB2  . ASP A 1 162 ? 5.155   12.218  -13.019 1.00 0.00 ? 162 ASP A HB2  1  
ATOM 2537   H HB3  . ASP A 1 162 ? 5.914   13.118  -14.330 1.00 0.00 ? 162 ASP A HB3  1  
ATOM 2538   N N    . LEU A 1 163 ? 2.025   13.340  -12.567 1.00 0.00 ? 163 LEU A N    1  
ATOM 2539   C CA   . LEU A 1 163 ? 1.030   14.011  -11.661 1.00 0.00 ? 163 LEU A CA   1  
ATOM 2540   C C    . LEU A 1 163 ? 1.442   13.823  -10.197 1.00 0.00 ? 163 LEU A C    1  
ATOM 2541   O O    . LEU A 1 163 ? 1.849   12.750  -9.791  1.00 0.00 ? 163 LEU A O    1  
ATOM 2542   C CB   . LEU A 1 163 ? -0.345  13.361  -11.875 1.00 0.00 ? 163 LEU A CB   1  
ATOM 2543   C CG   . LEU A 1 163 ? -1.397  14.445  -12.188 1.00 0.00 ? 163 LEU A CG   1  
ATOM 2544   C CD1  . LEU A 1 163 ? -1.115  15.122  -13.559 1.00 0.00 ? 163 LEU A CD1  1  
ATOM 2545   C CD2  . LEU A 1 163 ? -2.804  13.826  -12.203 1.00 0.00 ? 163 LEU A CD2  1  
ATOM 2546   H H    . LEU A 1 163 ? 2.091   12.363  -12.573 1.00 0.00 ? 163 LEU A H    1  
ATOM 2547   H HA   . LEU A 1 163 ? 0.974   15.063  -11.893 1.00 0.00 ? 163 LEU A HA   1  
ATOM 2548   H HB2  . LEU A 1 163 ? -0.288  12.666  -12.701 1.00 0.00 ? 163 LEU A HB2  1  
ATOM 2549   H HB3  . LEU A 1 163 ? -0.634  12.831  -10.980 1.00 0.00 ? 163 LEU A HB3  1  
ATOM 2550   H HG   . LEU A 1 163 ? -1.355  15.201  -11.415 1.00 0.00 ? 163 LEU A HG   1  
ATOM 2551   H HD11 . LEU A 1 163 ? -0.157  14.792  -13.933 1.00 0.00 ? 163 LEU A HD11 1  
ATOM 2552   H HD12 . LEU A 1 163 ? -1.103  16.194  -13.435 1.00 0.00 ? 163 LEU A HD12 1  
ATOM 2553   H HD13 . LEU A 1 163 ? -1.891  14.849  -14.261 1.00 0.00 ? 163 LEU A HD13 1  
ATOM 2554   H HD21 . LEU A 1 163 ? -2.776  12.880  -12.725 1.00 0.00 ? 163 LEU A HD21 1  
ATOM 2555   H HD22 . LEU A 1 163 ? -3.487  14.494  -12.707 1.00 0.00 ? 163 LEU A HD22 1  
ATOM 2556   H HD23 . LEU A 1 163 ? -3.139  13.667  -11.188 1.00 0.00 ? 163 LEU A HD23 1  
ATOM 2557   N N    . THR A 1 164 ? 1.321   14.855  -9.395  1.00 0.00 ? 164 THR A N    1  
ATOM 2558   C CA   . THR A 1 164 ? 1.687   14.739  -7.951  1.00 0.00 ? 164 THR A CA   1  
ATOM 2559   C C    . THR A 1 164 ? 0.419   14.395  -7.145  1.00 0.00 ? 164 THR A C    1  
ATOM 2560   O O    . THR A 1 164 ? -0.660  14.836  -7.488  1.00 0.00 ? 164 THR A O    1  
ATOM 2561   C CB   . THR A 1 164 ? 2.252   16.079  -7.459  1.00 0.00 ? 164 THR A CB   1  
ATOM 2562   O OG1  . THR A 1 164 ? 2.474   16.008  -6.057  1.00 0.00 ? 164 THR A OG1  1  
ATOM 2563   C CG2  . THR A 1 164 ? 1.259   17.205  -7.760  1.00 0.00 ? 164 THR A CG2  1  
ATOM 2564   H H    . THR A 1 164 ? 0.977   15.703  -9.743  1.00 0.00 ? 164 THR A H    1  
ATOM 2565   H HA   . THR A 1 164 ? 2.424   13.960  -7.823  1.00 0.00 ? 164 THR A HA   1  
ATOM 2566   H HB   . THR A 1 164 ? 3.185   16.283  -7.962  1.00 0.00 ? 164 THR A HB   1  
ATOM 2567   H HG1  . THR A 1 164 ? 2.574   16.905  -5.727  1.00 0.00 ? 164 THR A HG1  1  
ATOM 2568   H HG21 . THR A 1 164 ? 0.311   16.984  -7.291  1.00 0.00 ? 164 THR A HG21 1  
ATOM 2569   H HG22 . THR A 1 164 ? 1.122   17.289  -8.828  1.00 0.00 ? 164 THR A HG22 1  
ATOM 2570   H HG23 . THR A 1 164 ? 1.644   18.138  -7.373  1.00 0.00 ? 164 THR A HG23 1  
ATOM 2571   N N    . PRO A 1 165 ? 0.528   13.626  -6.084  1.00 0.00 ? 165 PRO A N    1  
ATOM 2572   C CA   . PRO A 1 165 ? -0.651  13.250  -5.247  1.00 0.00 ? 165 PRO A CA   1  
ATOM 2573   C C    . PRO A 1 165 ? -1.632  14.415  -5.054  1.00 0.00 ? 165 PRO A C    1  
ATOM 2574   O O    . PRO A 1 165 ? -2.835  14.228  -5.002  1.00 0.00 ? 165 PRO A O    1  
ATOM 2575   C CB   . PRO A 1 165 ? -0.016  12.844  -3.912  1.00 0.00 ? 165 PRO A CB   1  
ATOM 2576   C CG   . PRO A 1 165 ? 1.330   12.296  -4.279  1.00 0.00 ? 165 PRO A CG   1  
ATOM 2577   C CD   . PRO A 1 165 ? 1.774   13.025  -5.556  1.00 0.00 ? 165 PRO A CD   1  
ATOM 2578   H HA   . PRO A 1 165 ? -1.158  12.401  -5.676  1.00 0.00 ? 165 PRO A HA   1  
ATOM 2579   H HB2  . PRO A 1 165 ? 0.087   13.707  -3.269  1.00 0.00 ? 165 PRO A HB2  1  
ATOM 2580   H HB3  . PRO A 1 165 ? -0.607  12.081  -3.430  1.00 0.00 ? 165 PRO A HB3  1  
ATOM 2581   H HG2  . PRO A 1 165 ? 2.033   12.483  -3.479  1.00 0.00 ? 165 PRO A HG2  1  
ATOM 2582   H HG3  . PRO A 1 165 ? 1.259   11.238  -4.473  1.00 0.00 ? 165 PRO A HG3  1  
ATOM 2583   H HD2  . PRO A 1 165 ? 2.500   13.793  -5.325  1.00 0.00 ? 165 PRO A HD2  1  
ATOM 2584   H HD3  . PRO A 1 165 ? 2.178   12.321  -6.267  1.00 0.00 ? 165 PRO A HD3  1  
ATOM 2585   N N    . SER A 1 166 ? -1.129  15.613  -4.926  1.00 0.00 ? 166 SER A N    1  
ATOM 2586   C CA   . SER A 1 166 ? -2.026  16.784  -4.714  1.00 0.00 ? 166 SER A CA   1  
ATOM 2587   C C    . SER A 1 166 ? -2.999  16.927  -5.888  1.00 0.00 ? 166 SER A C    1  
ATOM 2588   O O    . SER A 1 166 ? -4.157  17.248  -5.709  1.00 0.00 ? 166 SER A O    1  
ATOM 2589   C CB   . SER A 1 166 ? -1.191  18.064  -4.603  1.00 0.00 ? 166 SER A CB   1  
ATOM 2590   O OG   . SER A 1 166 ? -0.397  18.001  -3.425  1.00 0.00 ? 166 SER A OG   1  
ATOM 2591   H H    . SER A 1 166 ? -0.157  15.740  -4.954  1.00 0.00 ? 166 SER A H    1  
ATOM 2592   H HA   . SER A 1 166 ? -2.586  16.644  -3.801  1.00 0.00 ? 166 SER A HA   1  
ATOM 2593   H HB2  . SER A 1 166 ? -0.546  18.153  -5.461  1.00 0.00 ? 166 SER A HB2  1  
ATOM 2594   H HB3  . SER A 1 166 ? -1.851  18.921  -4.560  1.00 0.00 ? 166 SER A HB3  1  
ATOM 2595   H HG   . SER A 1 166 ? 0.091   17.174  -3.441  1.00 0.00 ? 166 SER A HG   1  
ATOM 2596   N N    . GLU A 1 167 ? -2.540  16.717  -7.089  1.00 0.00 ? 167 GLU A N    1  
ATOM 2597   C CA   . GLU A 1 167 ? -3.451  16.870  -8.254  1.00 0.00 ? 167 GLU A CA   1  
ATOM 2598   C C    . GLU A 1 167 ? -4.498  15.753  -8.248  1.00 0.00 ? 167 GLU A C    1  
ATOM 2599   O O    . GLU A 1 167 ? -5.649  15.974  -8.561  1.00 0.00 ? 167 GLU A O    1  
ATOM 2600   C CB   . GLU A 1 167 ? -2.633  16.802  -9.548  1.00 0.00 ? 167 GLU A CB   1  
ATOM 2601   C CG   . GLU A 1 167 ? -2.386  18.223  -10.067 1.00 0.00 ? 167 GLU A CG   1  
ATOM 2602   C CD   . GLU A 1 167 ? -1.787  19.089  -8.957  1.00 0.00 ? 167 GLU A CD   1  
ATOM 2603   O OE1  . GLU A 1 167 ? -0.726  18.738  -8.464  1.00 0.00 ? 167 GLU A OE1  1  
ATOM 2604   O OE2  . GLU A 1 167 ? -2.398  20.087  -8.614  1.00 0.00 ? 167 GLU A OE2  1  
ATOM 2605   H H    . GLU A 1 167 ? -1.599  16.477  -7.224  1.00 0.00 ? 167 GLU A H    1  
ATOM 2606   H HA   . GLU A 1 167 ? -3.948  17.827  -8.195  1.00 0.00 ? 167 GLU A HA   1  
ATOM 2607   H HB2  . GLU A 1 167 ? -1.687  16.318  -9.351  1.00 0.00 ? 167 GLU A HB2  1  
ATOM 2608   H HB3  . GLU A 1 167 ? -3.179  16.240  -10.290 1.00 0.00 ? 167 GLU A HB3  1  
ATOM 2609   H HG2  . GLU A 1 167 ? -1.700  18.185  -10.901 1.00 0.00 ? 167 GLU A HG2  1  
ATOM 2610   H HG3  . GLU A 1 167 ? -3.321  18.654  -10.392 1.00 0.00 ? 167 GLU A HG3  1  
ATOM 2611   N N    . THR A 1 168 ? -4.102  14.550  -7.932  1.00 0.00 ? 168 THR A N    1  
ATOM 2612   C CA   . THR A 1 168 ? -5.070  13.410  -7.950  1.00 0.00 ? 168 THR A CA   1  
ATOM 2613   C C    . THR A 1 168 ? -6.293  13.691  -7.068  1.00 0.00 ? 168 THR A C    1  
ATOM 2614   O O    . THR A 1 168 ? -7.377  13.217  -7.345  1.00 0.00 ? 168 THR A O    1  
ATOM 2615   C CB   . THR A 1 168 ? -4.385  12.121  -7.474  1.00 0.00 ? 168 THR A CB   1  
ATOM 2616   O OG1  . THR A 1 168 ? -3.287  11.787  -8.327  1.00 0.00 ? 168 THR A OG1  1  
ATOM 2617   C CG2  . THR A 1 168 ? -5.393  10.972  -7.470  1.00 0.00 ? 168 THR A CG2  1  
ATOM 2618   H H    . THR A 1 168 ? -3.161  14.387  -7.710  1.00 0.00 ? 168 THR A H    1  
ATOM 2619   H HA   . THR A 1 168 ? -5.408  13.265  -8.966  1.00 0.00 ? 168 THR A HA   1  
ATOM 2620   H HB   . THR A 1 168 ? -4.019  12.267  -6.470  1.00 0.00 ? 168 THR A HB   1  
ATOM 2621   H HG1  . THR A 1 168 ? -3.119  12.537  -8.902  1.00 0.00 ? 168 THR A HG1  1  
ATOM 2622   H HG21 . THR A 1 168 ? -4.869  10.034  -7.361  1.00 0.00 ? 168 THR A HG21 1  
ATOM 2623   H HG22 . THR A 1 168 ? -5.944  10.972  -8.400  1.00 0.00 ? 168 THR A HG22 1  
ATOM 2624   H HG23 . THR A 1 168 ? -6.080  11.098  -6.645  1.00 0.00 ? 168 THR A HG23 1  
ATOM 2625   N N    . ALA A 1 169 ? -6.141  14.435  -6.014  1.00 0.00 ? 169 ALA A N    1  
ATOM 2626   C CA   . ALA A 1 169 ? -7.320  14.716  -5.133  1.00 0.00 ? 169 ALA A CA   1  
ATOM 2627   C C    . ALA A 1 169 ? -8.264  15.706  -5.808  1.00 0.00 ? 169 ALA A C    1  
ATOM 2628   O O    . ALA A 1 169 ? -9.451  15.469  -5.931  1.00 0.00 ? 169 ALA A O    1  
ATOM 2629   C CB   . ALA A 1 169 ? -6.843  15.313  -3.815  1.00 0.00 ? 169 ALA A CB   1  
ATOM 2630   H H    . ALA A 1 169 ? -5.261  14.805  -5.793  1.00 0.00 ? 169 ALA A H    1  
ATOM 2631   H HA   . ALA A 1 169 ? -7.847  13.795  -4.937  1.00 0.00 ? 169 ALA A HA   1  
ATOM 2632   H HB1  . ALA A 1 169 ? -7.652  15.300  -3.099  1.00 0.00 ? 169 ALA A HB1  1  
ATOM 2633   H HB2  . ALA A 1 169 ? -6.522  16.333  -3.976  1.00 0.00 ? 169 ALA A HB2  1  
ATOM 2634   H HB3  . ALA A 1 169 ? -6.016  14.732  -3.434  1.00 0.00 ? 169 ALA A HB3  1  
ATOM 2635   N N    . GLN A 1 170 ? -7.747  16.821  -6.237  1.00 0.00 ? 170 GLN A N    1  
ATOM 2636   C CA   . GLN A 1 170 ? -8.602  17.847  -6.893  1.00 0.00 ? 170 GLN A CA   1  
ATOM 2637   C C    . GLN A 1 170 ? -8.745  17.502  -8.366  1.00 0.00 ? 170 GLN A C    1  
ATOM 2638   O O    . GLN A 1 170 ? -8.775  18.370  -9.218  1.00 0.00 ? 170 GLN A O    1  
ATOM 2639   C CB   . GLN A 1 170 ? -7.949  19.225  -6.750  1.00 0.00 ? 170 GLN A CB   1  
ATOM 2640   C CG   . GLN A 1 170 ? -7.736  19.541  -5.268  1.00 0.00 ? 170 GLN A CG   1  
ATOM 2641   C CD   . GLN A 1 170 ? -9.085  19.553  -4.545  1.00 0.00 ? 170 GLN A CD   1  
ATOM 2642   O OE1  . GLN A 1 170 ? -9.976  20.297  -4.904  1.00 0.00 ? 170 GLN A OE1  1  
ATOM 2643   N NE2  . GLN A 1 170 ? -9.274  18.753  -3.532  1.00 0.00 ? 170 GLN A NE2  1  
ATOM 2644   H H    . GLN A 1 170 ? -6.790  16.991  -6.118  1.00 0.00 ? 170 GLN A H    1  
ATOM 2645   H HA   . GLN A 1 170 ? -9.577  17.859  -6.427  1.00 0.00 ? 170 GLN A HA   1  
ATOM 2646   H HB2  . GLN A 1 170 ? -6.996  19.224  -7.259  1.00 0.00 ? 170 GLN A HB2  1  
ATOM 2647   H HB3  . GLN A 1 170 ? -8.590  19.975  -7.187  1.00 0.00 ? 170 GLN A HB3  1  
ATOM 2648   H HG2  . GLN A 1 170 ? -7.098  18.787  -4.828  1.00 0.00 ? 170 GLN A HG2  1  
ATOM 2649   H HG3  . GLN A 1 170 ? -7.269  20.509  -5.169  1.00 0.00 ? 170 GLN A HG3  1  
ATOM 2650   H HE21 . GLN A 1 170 ? -8.556  18.153  -3.241  1.00 0.00 ? 170 GLN A HE21 1  
ATOM 2651   H HE22 . GLN A 1 170 ? -10.135 18.753  -3.062  1.00 0.00 ? 170 GLN A HE22 1  
ATOM 2652   N N    . LEU A 1 171 ? -8.835  16.238  -8.676  1.00 0.00 ? 171 LEU A N    1  
ATOM 2653   C CA   . LEU A 1 171 ? -8.978  15.802  -10.095 1.00 0.00 ? 171 LEU A CA   1  
ATOM 2654   C C    . LEU A 1 171 ? -10.422 15.349  -10.348 1.00 0.00 ? 171 LEU A C    1  
ATOM 2655   O O    . LEU A 1 171 ? -11.022 14.677  -9.532  1.00 0.00 ? 171 LEU A O    1  
ATOM 2656   C CB   . LEU A 1 171 ? -8.003  14.638  -10.313 1.00 0.00 ? 171 LEU A CB   1  
ATOM 2657   C CG   . LEU A 1 171 ? -8.128  14.021  -11.716 1.00 0.00 ? 171 LEU A CG   1  
ATOM 2658   C CD1  . LEU A 1 171 ? -7.805  15.070  -12.791 1.00 0.00 ? 171 LEU A CD1  1  
ATOM 2659   C CD2  . LEU A 1 171 ? -7.138  12.855  -11.824 1.00 0.00 ? 171 LEU A CD2  1  
ATOM 2660   H H    . LEU A 1 171 ? -8.808  15.563  -7.964  1.00 0.00 ? 171 LEU A H    1  
ATOM 2661   H HA   . LEU A 1 171 ? -8.727  16.618  -10.757 1.00 0.00 ? 171 LEU A HA   1  
ATOM 2662   H HB2  . LEU A 1 171 ? -6.993  14.998  -10.180 1.00 0.00 ? 171 LEU A HB2  1  
ATOM 2663   H HB3  . LEU A 1 171 ? -8.201  13.874  -9.575  1.00 0.00 ? 171 LEU A HB3  1  
ATOM 2664   H HG   . LEU A 1 171 ? -9.135  13.655  -11.859 1.00 0.00 ? 171 LEU A HG   1  
ATOM 2665   H HD11 . LEU A 1 171 ? -6.977  15.680  -12.461 1.00 0.00 ? 171 LEU A HD11 1  
ATOM 2666   H HD12 . LEU A 1 171 ? -8.670  15.696  -12.955 1.00 0.00 ? 171 LEU A HD12 1  
ATOM 2667   H HD13 . LEU A 1 171 ? -7.542  14.572  -13.713 1.00 0.00 ? 171 LEU A HD13 1  
ATOM 2668   H HD21 . LEU A 1 171 ? -7.102  12.506  -12.845 1.00 0.00 ? 171 LEU A HD21 1  
ATOM 2669   H HD22 . LEU A 1 171 ? -7.458  12.049  -11.180 1.00 0.00 ? 171 LEU A HD22 1  
ATOM 2670   H HD23 . LEU A 1 171 ? -6.155  13.187  -11.523 1.00 0.00 ? 171 LEU A HD23 1  
ATOM 2671   N N    . ASN A 1 172 ? -10.983 15.702  -11.478 1.00 0.00 ? 172 ASN A N    1  
ATOM 2672   C CA   . ASN A 1 172 ? -12.388 15.283  -11.789 1.00 0.00 ? 172 ASN A CA   1  
ATOM 2673   C C    . ASN A 1 172 ? -12.380 13.877  -12.401 1.00 0.00 ? 172 ASN A C    1  
ATOM 2674   O O    . ASN A 1 172 ? -12.066 13.699  -13.561 1.00 0.00 ? 172 ASN A O    1  
ATOM 2675   C CB   . ASN A 1 172 ? -13.005 16.256  -12.795 1.00 0.00 ? 172 ASN A CB   1  
ATOM 2676   C CG   . ASN A 1 172 ? -13.249 17.612  -12.126 1.00 0.00 ? 172 ASN A CG   1  
ATOM 2677   O OD1  . ASN A 1 172 ? -13.321 17.697  -10.913 1.00 0.00 ? 172 ASN A OD1  1  
ATOM 2678   N ND2  . ASN A 1 172 ? -13.375 18.678  -12.864 1.00 0.00 ? 172 ASN A ND2  1  
ATOM 2679   H H    . ASN A 1 172 ? -10.479 16.238  -12.126 1.00 0.00 ? 172 ASN A H    1  
ATOM 2680   H HA   . ASN A 1 172 ? -12.974 15.280  -10.882 1.00 0.00 ? 172 ASN A HA   1  
ATOM 2681   H HB2  . ASN A 1 172 ? -12.331 16.384  -13.629 1.00 0.00 ? 172 ASN A HB2  1  
ATOM 2682   H HB3  . ASN A 1 172 ? -13.944 15.859  -13.149 1.00 0.00 ? 172 ASN A HB3  1  
ATOM 2683   H HD21 . ASN A 1 172 ? -13.314 18.608  -13.839 1.00 0.00 ? 172 ASN A HD21 1  
ATOM 2684   H HD22 . ASN A 1 172 ? -13.531 19.549  -12.443 1.00 0.00 ? 172 ASN A HD22 1  
ATOM 2685   N N    . LEU A 1 173 ? -12.716 12.874  -11.630 1.00 0.00 ? 173 LEU A N    1  
ATOM 2686   C CA   . LEU A 1 173 ? -12.717 11.481  -12.171 1.00 0.00 ? 173 LEU A CA   1  
ATOM 2687   C C    . LEU A 1 173 ? -13.779 11.328  -13.263 1.00 0.00 ? 173 LEU A C    1  
ATOM 2688   O O    . LEU A 1 173 ? -13.563 10.651  -14.251 1.00 0.00 ? 173 LEU A O    1  
ATOM 2689   C CB   . LEU A 1 173 ? -13.035 10.487  -11.045 1.00 0.00 ? 173 LEU A CB   1  
ATOM 2690   C CG   . LEU A 1 173 ? -13.175 9.054   -11.594 1.00 0.00 ? 173 LEU A CG   1  
ATOM 2691   C CD1  . LEU A 1 173 ? -11.882 8.656   -12.371 1.00 0.00 ? 173 LEU A CD1  1  
ATOM 2692   C CD2  . LEU A 1 173 ? -13.434 8.068   -10.431 1.00 0.00 ? 173 LEU A CD2  1  
ATOM 2693   H H    . LEU A 1 173 ? -12.962 13.036  -10.695 1.00 0.00 ? 173 LEU A H    1  
ATOM 2694   H HA   . LEU A 1 173 ? -11.744 11.255  -12.582 1.00 0.00 ? 173 LEU A HA   1  
ATOM 2695   H HB2  . LEU A 1 173 ? -12.237 10.510  -10.316 1.00 0.00 ? 173 LEU A HB2  1  
ATOM 2696   H HB3  . LEU A 1 173 ? -13.960 10.776  -10.569 1.00 0.00 ? 173 LEU A HB3  1  
ATOM 2697   H HG   . LEU A 1 173 ? -14.014 9.024   -12.278 1.00 0.00 ? 173 LEU A HG   1  
ATOM 2698   H HD11 . LEU A 1 173 ? -11.918 9.071   -13.367 1.00 0.00 ? 173 LEU A HD11 1  
ATOM 2699   H HD12 . LEU A 1 173 ? -11.814 7.580   -12.430 1.00 0.00 ? 173 LEU A HD12 1  
ATOM 2700   H HD13 . LEU A 1 173 ? -11.017 9.042   -11.850 1.00 0.00 ? 173 LEU A HD13 1  
ATOM 2701   H HD21 . LEU A 1 173 ? -14.478 8.104   -10.154 1.00 0.00 ? 173 LEU A HD21 1  
ATOM 2702   H HD22 . LEU A 1 173 ? -12.827 8.346   -9.581  1.00 0.00 ? 173 LEU A HD22 1  
ATOM 2703   H HD23 . LEU A 1 173 ? -13.178 7.067   -10.744 1.00 0.00 ? 173 LEU A HD23 1  
ATOM 2704   N N    . LYS A 1 174 ? -14.942 11.899  -13.087 1.00 0.00 ? 174 LYS A N    1  
ATOM 2705   C CA   . LYS A 1 174 ? -16.026 11.733  -14.100 1.00 0.00 ? 174 LYS A CA   1  
ATOM 2706   C C    . LYS A 1 174 ? -15.711 12.462  -15.405 1.00 0.00 ? 174 LYS A C    1  
ATOM 2707   O O    . LYS A 1 174 ? -16.166 12.060  -16.457 1.00 0.00 ? 174 LYS A O    1  
ATOM 2708   C CB   . LYS A 1 174 ? -17.333 12.310  -13.542 1.00 0.00 ? 174 LYS A CB   1  
ATOM 2709   C CG   . LYS A 1 174 ? -17.862 11.425  -12.410 1.00 0.00 ? 174 LYS A CG   1  
ATOM 2710   C CD   . LYS A 1 174 ? -19.011 12.153  -11.704 1.00 0.00 ? 174 LYS A CD   1  
ATOM 2711   C CE   . LYS A 1 174 ? -20.241 12.213  -12.622 1.00 0.00 ? 174 LYS A CE   1  
ATOM 2712   N NZ   . LYS A 1 174 ? -21.419 12.680  -11.836 1.00 0.00 ? 174 LYS A NZ   1  
ATOM 2713   H H    . LYS A 1 174 ? -15.115 12.411  -12.270 1.00 0.00 ? 174 LYS A H    1  
ATOM 2714   H HA   . LYS A 1 174 ? -16.166 10.683  -14.303 1.00 0.00 ? 174 LYS A HA   1  
ATOM 2715   H HB2  . LYS A 1 174 ? -17.151 13.305  -13.162 1.00 0.00 ? 174 LYS A HB2  1  
ATOM 2716   H HB3  . LYS A 1 174 ? -18.068 12.357  -14.331 1.00 0.00 ? 174 LYS A HB3  1  
ATOM 2717   H HG2  . LYS A 1 174 ? -18.220 10.491  -12.819 1.00 0.00 ? 174 LYS A HG2  1  
ATOM 2718   H HG3  . LYS A 1 174 ? -17.070 11.231  -11.701 1.00 0.00 ? 174 LYS A HG3  1  
ATOM 2719   H HD2  . LYS A 1 174 ? -19.266 11.625  -10.797 1.00 0.00 ? 174 LYS A HD2  1  
ATOM 2720   H HD3  . LYS A 1 174 ? -18.700 13.158  -11.459 1.00 0.00 ? 174 LYS A HD3  1  
ATOM 2721   H HE2  . LYS A 1 174 ? -20.052 12.902  -13.433 1.00 0.00 ? 174 LYS A HE2  1  
ATOM 2722   H HE3  . LYS A 1 174 ? -20.441 11.230  -13.022 1.00 0.00 ? 174 LYS A HE3  1  
ATOM 2723   H HZ1  . LYS A 1 174 ? -21.306 12.398  -10.842 1.00 0.00 ? 174 LYS A HZ1  1  
ATOM 2724   H HZ2  . LYS A 1 174 ? -22.285 12.252  -12.223 1.00 0.00 ? 174 LYS A HZ2  1  
ATOM 2725   H HZ3  . LYS A 1 174 ? -21.487 13.715  -11.894 1.00 0.00 ? 174 LYS A HZ3  1  
ATOM 2726   N N    . LYS A 1 175 ? -14.970 13.540  -15.363 1.00 0.00 ? 175 LYS A N    1  
ATOM 2727   C CA   . LYS A 1 175 ? -14.694 14.283  -16.633 1.00 0.00 ? 175 LYS A CA   1  
ATOM 2728   C C    . LYS A 1 175 ? -13.380 13.809  -17.252 1.00 0.00 ? 175 LYS A C    1  
ATOM 2729   O O    . LYS A 1 175 ? -13.059 14.152  -18.373 1.00 0.00 ? 175 LYS A O    1  
ATOM 2730   C CB   . LYS A 1 175 ? -14.651 15.787  -16.336 1.00 0.00 ? 175 LYS A CB   1  
ATOM 2731   C CG   . LYS A 1 175 ? -15.973 16.177  -15.665 1.00 0.00 ? 175 LYS A CG   1  
ATOM 2732   C CD   . LYS A 1 175 ? -17.139 15.991  -16.635 1.00 0.00 ? 175 LYS A CD   1  
ATOM 2733   C CE   . LYS A 1 175 ? -18.309 16.862  -16.169 1.00 0.00 ? 175 LYS A CE   1  
ATOM 2734   N NZ   . LYS A 1 175 ? -18.738 16.445  -14.802 1.00 0.00 ? 175 LYS A NZ   1  
ATOM 2735   H H    . LYS A 1 175 ? -14.624 13.873  -14.509 1.00 0.00 ? 175 LYS A H    1  
ATOM 2736   H HA   . LYS A 1 175 ? -15.496 14.089  -17.330 1.00 0.00 ? 175 LYS A HA   1  
ATOM 2737   H HB2  . LYS A 1 175 ? -13.825 16.005  -15.673 1.00 0.00 ? 175 LYS A HB2  1  
ATOM 2738   H HB3  . LYS A 1 175 ? -14.537 16.339  -17.257 1.00 0.00 ? 175 LYS A HB3  1  
ATOM 2739   H HG2  . LYS A 1 175 ? -16.128 15.554  -14.796 1.00 0.00 ? 175 LYS A HG2  1  
ATOM 2740   H HG3  . LYS A 1 175 ? -15.926 17.212  -15.359 1.00 0.00 ? 175 LYS A HG3  1  
ATOM 2741   H HD2  . LYS A 1 175 ? -16.835 16.289  -17.628 1.00 0.00 ? 175 LYS A HD2  1  
ATOM 2742   H HD3  . LYS A 1 175 ? -17.443 14.955  -16.644 1.00 0.00 ? 175 LYS A HD3  1  
ATOM 2743   H HE2  . LYS A 1 175 ? -18.000 17.897  -16.147 1.00 0.00 ? 175 LYS A HE2  1  
ATOM 2744   H HE3  . LYS A 1 175 ? -19.136 16.749  -16.855 1.00 0.00 ? 175 LYS A HE3  1  
ATOM 2745   H HZ1  . LYS A 1 175 ? -19.151 17.258  -14.304 1.00 0.00 ? 175 LYS A HZ1  1  
ATOM 2746   H HZ2  . LYS A 1 175 ? -17.912 16.096  -14.272 1.00 0.00 ? 175 LYS A HZ2  1  
ATOM 2747   H HZ3  . LYS A 1 175 ? -19.447 15.689  -14.876 1.00 0.00 ? 175 LYS A HZ3  1  
ATOM 2748   N N    . VAL A 1 176 ? -12.640 12.984  -16.556 1.00 0.00 ? 176 VAL A N    1  
ATOM 2749   C CA   . VAL A 1 176 ? -11.370 12.437  -17.133 1.00 0.00 ? 176 VAL A CA   1  
ATOM 2750   C C    . VAL A 1 176 ? -11.654 11.008  -17.594 1.00 0.00 ? 176 VAL A C    1  
ATOM 2751   O O    . VAL A 1 176 ? -11.956 10.139  -16.802 1.00 0.00 ? 176 VAL A O    1  
ATOM 2752   C CB   . VAL A 1 176 ? -10.266 12.430  -16.063 1.00 0.00 ? 176 VAL A CB   1  
ATOM 2753   C CG1  . VAL A 1 176 ? -10.738 11.584  -14.871 1.00 0.00 ? 176 VAL A CG1  1  
ATOM 2754   C CG2  . VAL A 1 176 ? -8.942  11.854  -16.655 1.00 0.00 ? 176 VAL A CG2  1  
ATOM 2755   H H    . VAL A 1 176 ? -12.937 12.692  -15.668 1.00 0.00 ? 176 VAL A H    1  
ATOM 2756   H HA   . VAL A 1 176 ? -11.063 13.039  -17.976 1.00 0.00 ? 176 VAL A HA   1  
ATOM 2757   H HB   . VAL A 1 176 ? -10.096 13.445  -15.727 1.00 0.00 ? 176 VAL A HB   1  
ATOM 2758   H HG11 . VAL A 1 176 ? -11.803 11.708  -14.741 1.00 0.00 ? 176 VAL A HG11 1  
ATOM 2759   H HG12 . VAL A 1 176 ? -10.226 11.906  -13.976 1.00 0.00 ? 176 VAL A HG12 1  
ATOM 2760   H HG13 . VAL A 1 176 ? -10.516 10.543  -15.057 1.00 0.00 ? 176 VAL A HG13 1  
ATOM 2761   H HG21 . VAL A 1 176 ? -8.850  12.156  -17.688 1.00 0.00 ? 176 VAL A HG21 1  
ATOM 2762   H HG22 . VAL A 1 176 ? -8.960  10.777  -16.596 1.00 0.00 ? 176 VAL A HG22 1  
ATOM 2763   H HG23 . VAL A 1 176 ? -8.102  12.232  -16.091 1.00 0.00 ? 176 VAL A HG23 1  
ATOM 2764   N N    . LEU A 1 177 ? -11.602 10.762  -18.873 1.00 0.00 ? 177 LEU A N    1  
ATOM 2765   C CA   . LEU A 1 177 ? -11.920 9.393   -19.386 1.00 0.00 ? 177 LEU A CA   1  
ATOM 2766   C C    . LEU A 1 177 ? -10.690 8.494   -19.322 1.00 0.00 ? 177 LEU A C    1  
ATOM 2767   O O    . LEU A 1 177 ? -10.709 7.375   -19.793 1.00 0.00 ? 177 LEU A O    1  
ATOM 2768   C CB   . LEU A 1 177 ? -12.413 9.497   -20.830 1.00 0.00 ? 177 LEU A CB   1  
ATOM 2769   C CG   . LEU A 1 177 ? -13.945 9.424   -20.867 1.00 0.00 ? 177 LEU A CG   1  
ATOM 2770   C CD1  . LEU A 1 177 ? -14.388 8.015   -20.484 1.00 0.00 ? 177 LEU A CD1  1  
ATOM 2771   C CD2  . LEU A 1 177 ? -14.551 10.431  -19.878 1.00 0.00 ? 177 LEU A CD2  1  
ATOM 2772   H H    . LEU A 1 177 ? -11.387 11.482  -19.501 1.00 0.00 ? 177 LEU A H    1  
ATOM 2773   H HA   . LEU A 1 177 ? -12.702 8.963   -18.777 1.00 0.00 ? 177 LEU A HA   1  
ATOM 2774   H HB2  . LEU A 1 177 ? -12.087 10.438  -21.253 1.00 0.00 ? 177 LEU A HB2  1  
ATOM 2775   H HB3  . LEU A 1 177 ? -12.002 8.683   -21.409 1.00 0.00 ? 177 LEU A HB3  1  
ATOM 2776   H HG   . LEU A 1 177 ? -14.289 9.647   -21.867 1.00 0.00 ? 177 LEU A HG   1  
ATOM 2777   H HD11 . LEU A 1 177 ? -15.002 8.059   -19.596 1.00 0.00 ? 177 LEU A HD11 1  
ATOM 2778   H HD12 . LEU A 1 177 ? -13.519 7.404   -20.290 1.00 0.00 ? 177 LEU A HD12 1  
ATOM 2779   H HD13 . LEU A 1 177 ? -14.957 7.583   -21.295 1.00 0.00 ? 177 LEU A HD13 1  
ATOM 2780   H HD21 . LEU A 1 177 ? -15.432 10.879  -20.315 1.00 0.00 ? 177 LEU A HD21 1  
ATOM 2781   H HD22 . LEU A 1 177 ? -13.826 11.201  -19.658 1.00 0.00 ? 177 LEU A HD22 1  
ATOM 2782   H HD23 . LEU A 1 177 ? -14.821 9.921   -18.965 1.00 0.00 ? 177 LEU A HD23 1  
ATOM 2783   N N    . GLY A 1 178 ? -9.629  8.955   -18.738 1.00 0.00 ? 178 GLY A N    1  
ATOM 2784   C CA   . GLY A 1 178 ? -8.420  8.094   -18.643 1.00 0.00 ? 178 GLY A CA   1  
ATOM 2785   C C    . GLY A 1 178 ? -7.240  8.934   -18.177 1.00 0.00 ? 178 GLY A C    1  
ATOM 2786   O O    . GLY A 1 178 ? -7.341  10.138  -18.030 1.00 0.00 ? 178 GLY A O    1  
ATOM 2787   H H    . GLY A 1 178 ? -9.627  9.855   -18.352 1.00 0.00 ? 178 GLY A H    1  
ATOM 2788   H HA2  . GLY A 1 178 ? -8.600  7.297   -17.936 1.00 0.00 ? 178 GLY A HA2  1  
ATOM 2789   H HA3  . GLY A 1 178 ? -8.198  7.674   -19.613 1.00 0.00 ? 178 GLY A HA3  1  
ATOM 2790   N N    . PHE A 1 179 ? -6.118  8.311   -17.939 1.00 0.00 ? 179 PHE A N    1  
ATOM 2791   C CA   . PHE A 1 179 ? -4.918  9.063   -17.479 1.00 0.00 ? 179 PHE A CA   1  
ATOM 2792   C C    . PHE A 1 179 ? -3.711  8.584   -18.284 1.00 0.00 ? 179 PHE A C    1  
ATOM 2793   O O    . PHE A 1 179 ? -3.454  7.403   -18.380 1.00 0.00 ? 179 PHE A O    1  
ATOM 2794   C CB   . PHE A 1 179 ? -4.669  8.773   -15.990 1.00 0.00 ? 179 PHE A CB   1  
ATOM 2795   C CG   . PHE A 1 179 ? -3.406  9.458   -15.516 1.00 0.00 ? 179 PHE A CG   1  
ATOM 2796   C CD1  . PHE A 1 179 ? -3.281  10.857  -15.608 1.00 0.00 ? 179 PHE A CD1  1  
ATOM 2797   C CD2  . PHE A 1 179 ? -2.344  8.692   -14.996 1.00 0.00 ? 179 PHE A CD2  1  
ATOM 2798   C CE1  . PHE A 1 179 ? -2.099  11.484  -15.177 1.00 0.00 ? 179 PHE A CE1  1  
ATOM 2799   C CE2  . PHE A 1 179 ? -1.163  9.322   -14.566 1.00 0.00 ? 179 PHE A CE2  1  
ATOM 2800   C CZ   . PHE A 1 179 ? -1.040  10.720  -14.656 1.00 0.00 ? 179 PHE A CZ   1  
ATOM 2801   H H    . PHE A 1 179 ? -6.064  7.340   -18.065 1.00 0.00 ? 179 PHE A H    1  
ATOM 2802   H HA   . PHE A 1 179 ? -5.065  10.122  -17.629 1.00 0.00 ? 179 PHE A HA   1  
ATOM 2803   H HB2  . PHE A 1 179 ? -5.507  9.133   -15.412 1.00 0.00 ? 179 PHE A HB2  1  
ATOM 2804   H HB3  . PHE A 1 179 ? -4.571  7.706   -15.847 1.00 0.00 ? 179 PHE A HB3  1  
ATOM 2805   H HD1  . PHE A 1 179 ? -4.092  11.448  -16.006 1.00 0.00 ? 179 PHE A HD1  1  
ATOM 2806   H HD2  . PHE A 1 179 ? -2.437  7.618   -14.926 1.00 0.00 ? 179 PHE A HD2  1  
ATOM 2807   H HE1  . PHE A 1 179 ? -2.004  12.558  -15.247 1.00 0.00 ? 179 PHE A HE1  1  
ATOM 2808   H HE2  . PHE A 1 179 ? -0.350  8.734   -14.167 1.00 0.00 ? 179 PHE A HE2  1  
ATOM 2809   H HZ   . PHE A 1 179 ? -0.134  11.206  -14.326 1.00 0.00 ? 179 PHE A HZ   1  
ATOM 2810   N N    . ILE A 1 180 ? -2.962  9.494   -18.846 1.00 0.00 ? 180 ILE A N    1  
ATOM 2811   C CA   . ILE A 1 180 ? -1.755  9.099   -19.630 1.00 0.00 ? 180 ILE A CA   1  
ATOM 2812   C C    . ILE A 1 180 ? -0.573  9.958   -19.189 1.00 0.00 ? 180 ILE A C    1  
ATOM 2813   O O    . ILE A 1 180 ? -0.637  11.165  -19.176 1.00 0.00 ? 180 ILE A O    1  
ATOM 2814   C CB   . ILE A 1 180 ? -2.032  9.293   -21.119 1.00 0.00 ? 180 ILE A CB   1  
ATOM 2815   C CG1  . ILE A 1 180 ? -0.848  10.058  -21.734 1.00 0.00 ? 180 ILE A CG1  1  
ATOM 2816   C CG2  . ILE A 1 180 ? -3.321  10.101  -21.302 1.00 0.00 ? 180 ILE A CG2  1  
ATOM 2817   C CD1  . ILE A 1 180 ? -0.965  10.117  -23.273 1.00 0.00 ? 180 ILE A CD1  1  
ATOM 2818   H H    . ILE A 1 180 ? -3.187  10.443  -18.741 1.00 0.00 ? 180 ILE A H    1  
ATOM 2819   H HA   . ILE A 1 180 ? -1.531  8.060   -19.439 1.00 0.00 ? 180 ILE A HA   1  
ATOM 2820   H HB   . ILE A 1 180 ? -2.134  8.331   -21.599 1.00 0.00 ? 180 ILE A HB   1  
ATOM 2821   H HG12 . ILE A 1 180 ? -0.833  11.063  -21.341 1.00 0.00 ? 180 ILE A HG12 1  
ATOM 2822   H HG13 . ILE A 1 180 ? 0.072   9.559   -21.468 1.00 0.00 ? 180 ILE A HG13 1  
ATOM 2823   H HG21 . ILE A 1 180 ? -3.559  10.166  -22.354 1.00 0.00 ? 180 ILE A HG21 1  
ATOM 2824   H HG22 . ILE A 1 180 ? -3.183  11.095  -20.903 1.00 0.00 ? 180 ILE A HG22 1  
ATOM 2825   H HG23 . ILE A 1 180 ? -4.131  9.612   -20.780 1.00 0.00 ? 180 ILE A HG23 1  
ATOM 2826   H HD11 . ILE A 1 180 ? -1.984  9.911   -23.565 1.00 0.00 ? 180 ILE A HD11 1  
ATOM 2827   H HD12 . ILE A 1 180 ? -0.309  9.380   -23.713 1.00 0.00 ? 180 ILE A HD12 1  
ATOM 2828   H HD13 . ILE A 1 180 ? -0.683  11.102  -23.618 1.00 0.00 ? 180 ILE A HD13 1  
ATOM 2829   N N    . THR A 1 181 ? 0.513   9.341   -18.814 1.00 0.00 ? 181 THR A N    1  
ATOM 2830   C CA   . THR A 1 181 ? 1.694   10.132  -18.363 1.00 0.00 ? 181 THR A CA   1  
ATOM 2831   C C    . THR A 1 181 ? 2.993   9.399   -18.673 1.00 0.00 ? 181 THR A C    1  
ATOM 2832   O O    . THR A 1 181 ? 3.014   8.211   -18.921 1.00 0.00 ? 181 THR A O    1  
ATOM 2833   C CB   . THR A 1 181 ? 1.617   10.365  -16.853 1.00 0.00 ? 181 THR A CB   1  
ATOM 2834   O OG1  . THR A 1 181 ? 0.561   9.584   -16.311 1.00 0.00 ? 181 THR A OG1  1  
ATOM 2835   C CG2  . THR A 1 181 ? 1.360   11.840  -16.575 1.00 0.00 ? 181 THR A CG2  1  
ATOM 2836   H H    . THR A 1 181 ? 0.550   8.362   -18.821 1.00 0.00 ? 181 THR A H    1  
ATOM 2837   H HA   . THR A 1 181 ? 1.696   11.087  -18.867 1.00 0.00 ? 181 THR A HA   1  
ATOM 2838   H HB   . THR A 1 181 ? 2.550   10.074  -16.396 1.00 0.00 ? 181 THR A HB   1  
ATOM 2839   H HG1  . THR A 1 181 ? -0.270  10.003  -16.549 1.00 0.00 ? 181 THR A HG1  1  
ATOM 2840   H HG21 . THR A 1 181 ? 0.629   12.216  -17.275 1.00 0.00 ? 181 THR A HG21 1  
ATOM 2841   H HG22 . THR A 1 181 ? 2.282   12.392  -16.685 1.00 0.00 ? 181 THR A HG22 1  
ATOM 2842   H HG23 . THR A 1 181 ? 0.988   11.956  -15.569 1.00 0.00 ? 181 THR A HG23 1  
ATOM 2843   N N    . ASP A 1 182 ? 4.085   10.121  -18.663 1.00 0.00 ? 182 ASP A N    1  
ATOM 2844   C CA   . ASP A 1 182 ? 5.418   9.507   -18.958 1.00 0.00 ? 182 ASP A CA   1  
ATOM 2845   C C    . ASP A 1 182 ? 6.205   9.341   -17.646 1.00 0.00 ? 182 ASP A C    1  
ATOM 2846   O O    . ASP A 1 182 ? 7.421   9.319   -17.649 1.00 0.00 ? 182 ASP A O    1  
ATOM 2847   C CB   . ASP A 1 182 ? 6.206   10.407  -19.952 1.00 0.00 ? 182 ASP A CB   1  
ATOM 2848   C CG   . ASP A 1 182 ? 5.272   11.396  -20.664 1.00 0.00 ? 182 ASP A CG   1  
ATOM 2849   O OD1  . ASP A 1 182 ? 4.125   11.037  -20.882 1.00 0.00 ? 182 ASP A OD1  1  
ATOM 2850   O OD2  . ASP A 1 182 ? 5.708   12.493  -20.960 1.00 0.00 ? 182 ASP A OD2  1  
ATOM 2851   H H    . ASP A 1 182 ? 4.029   11.079  -18.463 1.00 0.00 ? 182 ASP A H    1  
ATOM 2852   H HA   . ASP A 1 182 ? 5.267   8.534   -19.403 1.00 0.00 ? 182 ASP A HA   1  
ATOM 2853   H HB2  . ASP A 1 182 ? 6.958   10.960  -19.409 1.00 0.00 ? 182 ASP A HB2  1  
ATOM 2854   H HB3  . ASP A 1 182 ? 6.690   9.782   -20.689 1.00 0.00 ? 182 ASP A HB3  1  
ATOM 2855   N N    . ALA A 1 183 ? 5.537   9.247   -16.521 1.00 0.00 ? 183 ALA A N    1  
ATOM 2856   C CA   . ALA A 1 183 ? 6.266   9.108   -15.223 1.00 0.00 ? 183 ALA A CA   1  
ATOM 2857   C C    . ALA A 1 183 ? 7.229   7.906   -15.248 1.00 0.00 ? 183 ALA A C    1  
ATOM 2858   O O    . ALA A 1 183 ? 7.573   7.386   -16.289 1.00 0.00 ? 183 ALA A O    1  
ATOM 2859   C CB   . ALA A 1 183 ? 5.224   8.932   -14.103 1.00 0.00 ? 183 ALA A CB   1  
ATOM 2860   H H    . ALA A 1 183 ? 4.558   9.283   -16.529 1.00 0.00 ? 183 ALA A H    1  
ATOM 2861   H HA   . ALA A 1 183 ? 6.830   10.009  -15.038 1.00 0.00 ? 183 ALA A HA   1  
ATOM 2862   H HB1  . ALA A 1 183 ? 4.661   9.846   -13.988 1.00 0.00 ? 183 ALA A HB1  1  
ATOM 2863   H HB2  . ALA A 1 183 ? 5.727   8.700   -13.175 1.00 0.00 ? 183 ALA A HB2  1  
ATOM 2864   H HB3  . ALA A 1 183 ? 4.553   8.125   -14.359 1.00 0.00 ? 183 ALA A HB3  1  
ATOM 2865   N N    . GLY A 1 184 ? 7.672   7.480   -14.087 1.00 0.00 ? 184 GLY A N    1  
ATOM 2866   C CA   . GLY A 1 184 ? 8.621   6.333   -13.998 1.00 0.00 ? 184 GLY A CA   1  
ATOM 2867   C C    . GLY A 1 184 ? 7.893   5.012   -14.257 1.00 0.00 ? 184 GLY A C    1  
ATOM 2868   O O    . GLY A 1 184 ? 8.300   4.232   -15.095 1.00 0.00 ? 184 GLY A O    1  
ATOM 2869   H H    . GLY A 1 184 ? 7.381   7.930   -13.265 1.00 0.00 ? 184 GLY A H    1  
ATOM 2870   H HA2  . GLY A 1 184 ? 9.404   6.461   -14.733 1.00 0.00 ? 184 GLY A HA2  1  
ATOM 2871   H HA3  . GLY A 1 184 ? 9.059   6.309   -13.011 1.00 0.00 ? 184 GLY A HA3  1  
ATOM 2872   N N    . GLY A 1 185 ? 6.827   4.739   -13.549 1.00 0.00 ? 185 GLY A N    1  
ATOM 2873   C CA   . GLY A 1 185 ? 6.111   3.450   -13.785 1.00 0.00 ? 185 GLY A CA   1  
ATOM 2874   C C    . GLY A 1 185 ? 5.029   3.232   -12.723 1.00 0.00 ? 185 GLY A C    1  
ATOM 2875   O O    . GLY A 1 185 ? 4.384   4.158   -12.269 1.00 0.00 ? 185 GLY A O    1  
ATOM 2876   H H    . GLY A 1 185 ? 6.507   5.369   -12.870 1.00 0.00 ? 185 GLY A H    1  
ATOM 2877   H HA2  . GLY A 1 185 ? 5.652   3.472   -14.763 1.00 0.00 ? 185 GLY A HA2  1  
ATOM 2878   H HA3  . GLY A 1 185 ? 6.818   2.635   -13.742 1.00 0.00 ? 185 GLY A HA3  1  
ATOM 2879   N N    . ARG A 1 186 ? 4.828   2.003   -12.330 1.00 0.00 ? 186 ARG A N    1  
ATOM 2880   C CA   . ARG A 1 186 ? 3.789   1.700   -11.305 1.00 0.00 ? 186 ARG A CA   1  
ATOM 2881   C C    . ARG A 1 186 ? 4.185   2.328   -9.973  1.00 0.00 ? 186 ARG A C    1  
ATOM 2882   O O    . ARG A 1 186 ? 3.332   2.592   -9.131  1.00 0.00 ? 186 ARG A O    1  
ATOM 2883   C CB   . ARG A 1 186 ? 3.615   0.181   -11.144 1.00 0.00 ? 186 ARG A CB   1  
ATOM 2884   C CG   . ARG A 1 186 ? 4.869   -0.427  -10.500 1.00 0.00 ? 186 ARG A CG   1  
ATOM 2885   C CD   . ARG A 1 186 ? 4.800   -1.953  -10.578 1.00 0.00 ? 186 ARG A CD   1  
ATOM 2886   N NE   . ARG A 1 186 ? 3.635   -2.449  -9.834  1.00 0.00 ? 186 ARG A NE   1  
ATOM 2887   C CZ   . ARG A 1 186 ? 3.701   -2.722  -8.541  1.00 0.00 ? 186 ARG A CZ   1  
ATOM 2888   N NH1  . ARG A 1 186 ? 4.790   -2.491  -7.888  1.00 0.00 ? 186 ARG A NH1  1  
ATOM 2889   N NH2  . ARG A 1 186 ? 2.672   -3.208  -7.928  1.00 0.00 ? 186 ARG A NH2  1  
ATOM 2890   H H    . ARG A 1 186 ? 5.360   1.275   -12.715 1.00 0.00 ? 186 ARG A H    1  
ATOM 2891   H HA   . ARG A 1 186 ? 2.850   2.129   -11.626 1.00 0.00 ? 186 ARG A HA   1  
ATOM 2892   H HB2  . ARG A 1 186 ? 2.758   -0.016  -10.516 1.00 0.00 ? 186 ARG A HB2  1  
ATOM 2893   H HB3  . ARG A 1 186 ? 3.459   -0.267  -12.114 1.00 0.00 ? 186 ARG A HB3  1  
ATOM 2894   H HG2  . ARG A 1 186 ? 5.747   -0.079  -11.024 1.00 0.00 ? 186 ARG A HG2  1  
ATOM 2895   H HG3  . ARG A 1 186 ? 4.924   -0.124  -9.465  1.00 0.00 ? 186 ARG A HG3  1  
ATOM 2896   H HD2  . ARG A 1 186 ? 4.717   -2.254  -11.611 1.00 0.00 ? 186 ARG A HD2  1  
ATOM 2897   H HD3  . ARG A 1 186 ? 5.702   -2.372  -10.155 1.00 0.00 ? 186 ARG A HD3  1  
ATOM 2898   H HE   . ARG A 1 186 ? 2.793   -2.602  -10.312 1.00 0.00 ? 186 ARG A HE   1  
ATOM 2899   H HH11 . ARG A 1 186 ? 5.584   -2.106  -8.359  1.00 0.00 ? 186 ARG A HH11 1  
ATOM 2900   H HH12 . ARG A 1 186 ? 4.840   -2.697  -6.910  1.00 0.00 ? 186 ARG A HH12 1  
ATOM 2901   H HH21 . ARG A 1 186 ? 1.825   -3.379  -8.430  1.00 0.00 ? 186 ARG A HH21 1  
ATOM 2902   H HH22 . ARG A 1 186 ? 2.723   -3.413  -6.951  1.00 0.00 ? 186 ARG A HH22 1  
ATOM 2903   N N    . THR A 1 187 ? 5.452   2.541   -9.760  1.00 0.00 ? 187 THR A N    1  
ATOM 2904   C CA   . THR A 1 187 ? 5.892   3.131   -8.469  1.00 0.00 ? 187 THR A CA   1  
ATOM 2905   C C    . THR A 1 187 ? 5.348   4.555   -8.357  1.00 0.00 ? 187 THR A C    1  
ATOM 2906   O O    . THR A 1 187 ? 5.629   5.251   -7.386  1.00 0.00 ? 187 THR A O    1  
ATOM 2907   C CB   . THR A 1 187 ? 7.419   3.159   -8.388  1.00 0.00 ? 187 THR A CB   1  
ATOM 2908   O OG1  . THR A 1 187 ? 7.933   3.918   -9.474  1.00 0.00 ? 187 THR A OG1  1  
ATOM 2909   C CG2  . THR A 1 187 ? 7.970   1.736   -8.463  1.00 0.00 ? 187 THR A CG2  1  
ATOM 2910   H H    . THR A 1 187 ? 6.114   2.300   -10.441 1.00 0.00 ? 187 THR A H    1  
ATOM 2911   H HA   . THR A 1 187 ? 5.501   2.537   -7.656  1.00 0.00 ? 187 THR A HA   1  
ATOM 2912   H HB   . THR A 1 187 ? 7.723   3.611   -7.456  1.00 0.00 ? 187 THR A HB   1  
ATOM 2913   H HG1  . THR A 1 187 ? 7.341   4.659   -9.626  1.00 0.00 ? 187 THR A HG1  1  
ATOM 2914   H HG21 . THR A 1 187 ? 8.940   1.698   -7.988  1.00 0.00 ? 187 THR A HG21 1  
ATOM 2915   H HG22 . THR A 1 187 ? 8.065   1.441   -9.498  1.00 0.00 ? 187 THR A HG22 1  
ATOM 2916   H HG23 . THR A 1 187 ? 7.296   1.061   -7.957  1.00 0.00 ? 187 THR A HG23 1  
ATOM 2917   N N    . SER A 1 188 ? 4.577   4.983   -9.325  1.00 0.00 ? 188 SER A N    1  
ATOM 2918   C CA   . SER A 1 188 ? 4.005   6.362   -9.288  1.00 0.00 ? 188 SER A CA   1  
ATOM 2919   C C    . SER A 1 188 ? 2.619   6.345   -8.619  1.00 0.00 ? 188 SER A C    1  
ATOM 2920   O O    . SER A 1 188 ? 1.775   5.513   -8.949  1.00 0.00 ? 188 SER A O    1  
ATOM 2921   C CB   . SER A 1 188 ? 3.879   6.913   -10.709 1.00 0.00 ? 188 SER A CB   1  
ATOM 2922   O OG   . SER A 1 188 ? 2.583   6.617   -11.211 1.00 0.00 ? 188 SER A OG   1  
ATOM 2923   H H    . SER A 1 188 ? 4.373   4.392   -10.081 1.00 0.00 ? 188 SER A H    1  
ATOM 2924   H HA   . SER A 1 188 ? 4.664   7.001   -8.718  1.00 0.00 ? 188 SER A HA   1  
ATOM 2925   H HB2  . SER A 1 188 ? 4.020   7.981   -10.697 1.00 0.00 ? 188 SER A HB2  1  
ATOM 2926   H HB3  . SER A 1 188 ? 4.633   6.459   -11.339 1.00 0.00 ? 188 SER A HB3  1  
ATOM 2927   H HG   . SER A 1 188 ? 2.228   7.416   -11.608 1.00 0.00 ? 188 SER A HG   1  
ATOM 2928   N N    . HIS A 1 189 ? 2.389   7.237   -7.689  1.00 0.00 ? 189 HIS A N    1  
ATOM 2929   C CA   . HIS A 1 189 ? 1.081   7.289   -6.960  1.00 0.00 ? 189 HIS A CA   1  
ATOM 2930   C C    . HIS A 1 189 ? -0.098  7.230   -7.947  1.00 0.00 ? 189 HIS A C    1  
ATOM 2931   O O    . HIS A 1 189 ? -0.981  6.394   -7.807  1.00 0.00 ? 189 HIS A O    1  
ATOM 2932   C CB   . HIS A 1 189 ? 0.989   8.580   -6.142  1.00 0.00 ? 189 HIS A CB   1  
ATOM 2933   C CG   . HIS A 1 189 ? 1.943   8.520   -4.981  1.00 0.00 ? 189 HIS A CG   1  
ATOM 2934   N ND1  . HIS A 1 189 ? 1.699   7.735   -3.865  1.00 0.00 ? 189 HIS A ND1  1  
ATOM 2935   C CD2  . HIS A 1 189 ? 3.134   9.154   -4.739  1.00 0.00 ? 189 HIS A CD2  1  
ATOM 2936   C CE1  . HIS A 1 189 ? 2.723   7.918   -3.010  1.00 0.00 ? 189 HIS A CE1  1  
ATOM 2937   N NE2  . HIS A 1 189 ? 3.627   8.776   -3.495  1.00 0.00 ? 189 HIS A NE2  1  
ATOM 2938   H H    . HIS A 1 189 ? 3.094   7.876   -7.453  1.00 0.00 ? 189 HIS A H    1  
ATOM 2939   H HA   . HIS A 1 189 ? 1.020   6.444   -6.291  1.00 0.00 ? 189 HIS A HA   1  
ATOM 2940   H HB2  . HIS A 1 189 ? 1.242   9.422   -6.769  1.00 0.00 ? 189 HIS A HB2  1  
ATOM 2941   H HB3  . HIS A 1 189 ? -0.018  8.699   -5.772  1.00 0.00 ? 189 HIS A HB3  1  
ATOM 2942   H HD1  . HIS A 1 189 ? 0.924   7.152   -3.724  1.00 0.00 ? 189 HIS A HD1  1  
ATOM 2943   H HD2  . HIS A 1 189 ? 3.618   9.843   -5.416  1.00 0.00 ? 189 HIS A HD2  1  
ATOM 2944   H HE1  . HIS A 1 189 ? 2.805   7.430   -2.050  1.00 0.00 ? 189 HIS A HE1  1  
ATOM 2945   H HE2  . HIS A 1 189 ? 4.457   9.075   -3.066  1.00 0.00 ? 189 HIS A HE2  1  
ATOM 2946   N N    . THR A 1 190 ? -0.125  8.111   -8.903  1.00 0.00 ? 190 THR A N    1  
ATOM 2947   C CA   . THR A 1 190 ? -1.257  8.124   -9.872  1.00 0.00 ? 190 THR A CA   1  
ATOM 2948   C C    . THR A 1 190 ? -1.412  6.759   -10.556 1.00 0.00 ? 190 THR A C    1  
ATOM 2949   O O    . THR A 1 190 ? -2.525  6.345   -10.855 1.00 0.00 ? 190 THR A O    1  
ATOM 2950   C CB   . THR A 1 190 ? -1.017  9.199   -10.937 1.00 0.00 ? 190 THR A CB   1  
ATOM 2951   O OG1  . THR A 1 190 ? -0.709  10.425  -10.300 1.00 0.00 ? 190 THR A OG1  1  
ATOM 2952   C CG2  . THR A 1 190 ? -2.279  9.378   -11.781 1.00 0.00 ? 190 THR A CG2  1  
ATOM 2953   H H    . THR A 1 190 ? 0.589   8.779   -8.974  1.00 0.00 ? 190 THR A H    1  
ATOM 2954   H HA   . THR A 1 190 ? -2.169  8.356   -9.342  1.00 0.00 ? 190 THR A HA   1  
ATOM 2955   H HB   . THR A 1 190 ? -0.198  8.903   -11.575 1.00 0.00 ? 190 THR A HB   1  
ATOM 2956   H HG1  . THR A 1 190 ? -1.480  10.994  -10.362 1.00 0.00 ? 190 THR A HG1  1  
ATOM 2957   H HG21 . THR A 1 190 ? -3.136  9.471   -11.130 1.00 0.00 ? 190 THR A HG21 1  
ATOM 2958   H HG22 . THR A 1 190 ? -2.406  8.519   -12.424 1.00 0.00 ? 190 THR A HG22 1  
ATOM 2959   H HG23 . THR A 1 190 ? -2.185  10.269  -12.384 1.00 0.00 ? 190 THR A HG23 1  
ATOM 2960   N N    . SER A 1 191 ? -0.332  6.071   -10.818 1.00 0.00 ? 191 SER A N    1  
ATOM 2961   C CA   . SER A 1 191 ? -0.439  4.745   -11.497 1.00 0.00 ? 191 SER A CA   1  
ATOM 2962   C C    . SER A 1 191 ? -1.278  3.775   -10.654 1.00 0.00 ? 191 SER A C    1  
ATOM 2963   O O    . SER A 1 191 ? -2.087  3.023   -11.204 1.00 0.00 ? 191 SER A O    1  
ATOM 2964   C CB   . SER A 1 191 ? 0.949   4.149   -11.736 1.00 0.00 ? 191 SER A CB   1  
ATOM 2965   O OG   . SER A 1 191 ? 1.558   3.848   -10.491 1.00 0.00 ? 191 SER A OG   1  
ATOM 2966   H H    . SER A 1 191 ? 0.548   6.430   -10.579 1.00 0.00 ? 191 SER A H    1  
ATOM 2967   H HA   . SER A 1 191 ? -0.927  4.884   -12.451 1.00 0.00 ? 191 SER A HA   1  
ATOM 2968   H HB2  . SER A 1 191 ? 0.859   3.243   -12.313 1.00 0.00 ? 191 SER A HB2  1  
ATOM 2969   H HB3  . SER A 1 191 ? 1.555   4.861   -12.282 1.00 0.00 ? 191 SER A HB3  1  
ATOM 2970   H HG   . SER A 1 191 ? 2.172   4.556   -10.282 1.00 0.00 ? 191 SER A HG   1  
ATOM 2971   N N    . ILE A 1 192 ? -1.107  3.786   -9.364  1.00 0.00 ? 192 ILE A N    1  
ATOM 2972   C CA   . ILE A 1 192 ? -1.895  2.869   -8.495  1.00 0.00 ? 192 ILE A CA   1  
ATOM 2973   C C    . ILE A 1 192 ? -3.382  3.211   -8.623  1.00 0.00 ? 192 ILE A C    1  
ATOM 2974   O O    . ILE A 1 192 ? -4.227  2.309   -8.622  1.00 0.00 ? 192 ILE A O    1  
ATOM 2975   C CB   . ILE A 1 192 ? -1.433  2.963   -7.035  1.00 0.00 ? 192 ILE A CB   1  
ATOM 2976   C CG1  . ILE A 1 192 ? -1.587  1.590   -6.372  1.00 0.00 ? 192 ILE A CG1  1  
ATOM 2977   C CG2  . ILE A 1 192 ? -2.273  3.987   -6.268  1.00 0.00 ? 192 ILE A CG2  1  
ATOM 2978   C CD1  . ILE A 1 192 ? -1.084  1.657   -4.931  1.00 0.00 ? 192 ILE A CD1  1  
ATOM 2979   H H    . ILE A 1 192 ? -0.458  4.401   -8.963  1.00 0.00 ? 192 ILE A H    1  
ATOM 2980   H HA   . ILE A 1 192 ? -1.746  1.856   -8.844  1.00 0.00 ? 192 ILE A HA   1  
ATOM 2981   H HB   . ILE A 1 192 ? -0.394  3.259   -7.007  1.00 0.00 ? 192 ILE A HB   1  
ATOM 2982   H HG12 . ILE A 1 192 ? -2.630  1.304   -6.378  1.00 0.00 ? 192 ILE A HG12 1  
ATOM 2983   H HG13 . ILE A 1 192 ? -1.010  0.860   -6.920  1.00 0.00 ? 192 ILE A HG13 1  
ATOM 2984   H HG21 . ILE A 1 192 ? -1.783  4.229   -5.336  1.00 0.00 ? 192 ILE A HG21 1  
ATOM 2985   H HG22 . ILE A 1 192 ? -3.249  3.572   -6.064  1.00 0.00 ? 192 ILE A HG22 1  
ATOM 2986   H HG23 . ILE A 1 192 ? -2.379  4.883   -6.862  1.00 0.00 ? 192 ILE A HG23 1  
ATOM 2987   H HD11 . ILE A 1 192 ? -0.188  2.259   -4.891  1.00 0.00 ? 192 ILE A HD11 1  
ATOM 2988   H HD12 . ILE A 1 192 ? -0.864  0.660   -4.580  1.00 0.00 ? 192 ILE A HD12 1  
ATOM 2989   H HD13 . ILE A 1 192 ? -1.843  2.101   -4.304  1.00 0.00 ? 192 ILE A HD13 1  
ATOM 2990   N N    . MET A 1 193 ? -3.708  4.469   -8.721  1.00 0.00 ? 193 MET A N    1  
ATOM 2991   C CA   . MET A 1 193 ? -5.143  4.861   -8.833  1.00 0.00 ? 193 MET A CA   1  
ATOM 2992   C C    . MET A 1 193 ? -5.776  4.243   -10.082 1.00 0.00 ? 193 MET A C    1  
ATOM 2993   O O    . MET A 1 193 ? -6.915  3.774   -10.015 1.00 0.00 ? 193 MET A O    1  
ATOM 2994   C CB   . MET A 1 193 ? -5.281  6.393   -8.849  1.00 0.00 ? 193 MET A CB   1  
ATOM 2995   C CG   . MET A 1 193 ? -5.305  6.921   -10.288 1.00 0.00 ? 193 MET A CG   1  
ATOM 2996   S SD   . MET A 1 193 ? -6.966  6.730   -10.976 1.00 0.00 ? 193 MET A SD   1  
ATOM 2997   C CE   . MET A 1 193 ? -6.562  7.195   -12.675 1.00 0.00 ? 193 MET A CE   1  
ATOM 2998   H H    . MET A 1 193 ? -3.010  5.158   -8.712  1.00 0.00 ? 193 MET A H    1  
ATOM 2999   H HA   . MET A 1 193 ? -5.666  4.480   -7.966  1.00 0.00 ? 193 MET A HA   1  
ATOM 3000   H HB2  . MET A 1 193 ? -6.199  6.672   -8.353  1.00 0.00 ? 193 MET A HB2  1  
ATOM 3001   H HB3  . MET A 1 193 ? -4.445  6.831   -8.323  1.00 0.00 ? 193 MET A HB3  1  
ATOM 3002   H HG2  . MET A 1 193 ? -5.032  7.966   -10.291 1.00 0.00 ? 193 MET A HG2  1  
ATOM 3003   H HG3  . MET A 1 193 ? -4.600  6.364   -10.888 1.00 0.00 ? 193 MET A HG3  1  
ATOM 3004   H HE1  . MET A 1 193 ? -7.442  7.088   -13.295 1.00 0.00 ? 193 MET A HE1  1  
ATOM 3005   H HE2  . MET A 1 193 ? -5.781  6.552   -13.050 1.00 0.00 ? 193 MET A HE2  1  
ATOM 3006   H HE3  . MET A 1 193 ? -6.222  8.221   -12.696 1.00 0.00 ? 193 MET A HE3  1  
ATOM 3007   N N    . ALA A 1 194 ? -5.081  4.217   -11.186 1.00 0.00 ? 194 ALA A N    1  
ATOM 3008   C CA   . ALA A 1 194 ? -5.678  3.617   -12.412 1.00 0.00 ? 194 ALA A CA   1  
ATOM 3009   C C    . ALA A 1 194 ? -6.044  2.168   -12.111 1.00 0.00 ? 194 ALA A C    1  
ATOM 3010   O O    . ALA A 1 194 ? -7.113  1.703   -12.507 1.00 0.00 ? 194 ALA A O    1  
ATOM 3011   C CB   . ALA A 1 194 ? -4.676  3.677   -13.570 1.00 0.00 ? 194 ALA A CB   1  
ATOM 3012   H H    . ALA A 1 194 ? -4.174  4.587   -11.208 1.00 0.00 ? 194 ALA A H    1  
ATOM 3013   H HA   . ALA A 1 194 ? -6.571  4.163   -12.679 1.00 0.00 ? 194 ALA A HA   1  
ATOM 3014   H HB1  . ALA A 1 194 ? -3.762  3.178   -13.281 1.00 0.00 ? 194 ALA A HB1  1  
ATOM 3015   H HB2  . ALA A 1 194 ? -4.464  4.708   -13.809 1.00 0.00 ? 194 ALA A HB2  1  
ATOM 3016   H HB3  . ALA A 1 194 ? -5.097  3.185   -14.435 1.00 0.00 ? 194 ALA A HB3  1  
ATOM 3017   N N    . ARG A 1 195 ? -5.184  1.468   -11.427 1.00 0.00 ? 195 ARG A N    1  
ATOM 3018   C CA   . ARG A 1 195 ? -5.483  0.046   -11.099 1.00 0.00 ? 195 ARG A CA   1  
ATOM 3019   C C    . ARG A 1 195 ? -6.760  -0.025  -10.255 1.00 0.00 ? 195 ARG A C    1  
ATOM 3020   O O    . ARG A 1 195 ? -7.715  -0.688  -10.631 1.00 0.00 ? 195 ARG A O    1  
ATOM 3021   C CB   . ARG A 1 195 ? -4.315  -0.577  -10.333 1.00 0.00 ? 195 ARG A CB   1  
ATOM 3022   C CG   . ARG A 1 195 ? -4.647  -2.038  -10.010 1.00 0.00 ? 195 ARG A CG   1  
ATOM 3023   C CD   . ARG A 1 195 ? -3.415  -2.727  -9.427  1.00 0.00 ? 195 ARG A CD   1  
ATOM 3024   N NE   . ARG A 1 195 ? -2.386  -2.863  -10.462 1.00 0.00 ? 195 ARG A NE   1  
ATOM 3025   C CZ   . ARG A 1 195 ? -1.206  -3.390  -10.202 1.00 0.00 ? 195 ARG A CZ   1  
ATOM 3026   N NH1  . ARG A 1 195 ? -0.941  -3.825  -9.016  1.00 0.00 ? 195 ARG A NH1  1  
ATOM 3027   N NH2  . ARG A 1 195 ? -0.319  -3.475  -11.136 1.00 0.00 ? 195 ARG A NH2  1  
ATOM 3028   H H    . ARG A 1 195 ? -4.345  1.876   -11.129 1.00 0.00 ? 195 ARG A H    1  
ATOM 3029   H HA   . ARG A 1 195 ? -5.638  -0.501  -12.018 1.00 0.00 ? 195 ARG A HA   1  
ATOM 3030   H HB2  . ARG A 1 195 ? -3.421  -0.534  -10.939 1.00 0.00 ? 195 ARG A HB2  1  
ATOM 3031   H HB3  . ARG A 1 195 ? -4.154  -0.034  -9.413  1.00 0.00 ? 195 ARG A HB3  1  
ATOM 3032   H HG2  . ARG A 1 195 ? -5.453  -2.072  -9.290  1.00 0.00 ? 195 ARG A HG2  1  
ATOM 3033   H HG3  . ARG A 1 195 ? -4.948  -2.547  -10.913 1.00 0.00 ? 195 ARG A HG3  1  
ATOM 3034   H HD2  . ARG A 1 195 ? -3.026  -2.138  -8.611  1.00 0.00 ? 195 ARG A HD2  1  
ATOM 3035   H HD3  . ARG A 1 195 ? -3.692  -3.706  -9.063  1.00 0.00 ? 195 ARG A HD3  1  
ATOM 3036   H HE   . ARG A 1 195 ? -2.578  -2.547  -11.370 1.00 0.00 ? 195 ARG A HE   1  
ATOM 3037   H HH11 . ARG A 1 195 ? -1.631  -3.762  -8.295  1.00 0.00 ? 195 ARG A HH11 1  
ATOM 3038   H HH12 . ARG A 1 195 ? -0.046  -4.224  -8.818  1.00 0.00 ? 195 ARG A HH12 1  
ATOM 3039   H HH21 . ARG A 1 195 ? -0.528  -3.141  -12.055 1.00 0.00 ? 195 ARG A HH21 1  
ATOM 3040   H HH22 . ARG A 1 195 ? 0.577   -3.874  -10.940 1.00 0.00 ? 195 ARG A HH22 1  
ATOM 3041   N N    . SER A 1 196 ? -6.767  0.629   -9.128  1.00 0.00 ? 196 SER A N    1  
ATOM 3042   C CA   . SER A 1 196 ? -7.956  0.604   -8.226  1.00 0.00 ? 196 SER A CA   1  
ATOM 3043   C C    . SER A 1 196 ? -9.186  1.224   -8.897  1.00 0.00 ? 196 SER A C    1  
ATOM 3044   O O    . SER A 1 196 ? -10.298 0.724   -8.713  1.00 0.00 ? 196 SER A O    1  
ATOM 3045   C CB   . SER A 1 196 ? -7.641  1.367   -6.940  1.00 0.00 ? 196 SER A CB   1  
ATOM 3046   O OG   . SER A 1 196 ? -6.630  0.676   -6.218  1.00 0.00 ? 196 SER A OG   1  
ATOM 3047   H H    . SER A 1 196 ? -5.972  1.136   -8.861  1.00 0.00 ? 196 SER A H    1  
ATOM 3048   H HA   . SER A 1 196 ? -8.178  -0.423  -7.974  1.00 0.00 ? 196 SER A HA   1  
ATOM 3049   H HB2  . SER A 1 196 ? -7.291  2.356   -7.182  1.00 0.00 ? 196 SER A HB2  1  
ATOM 3050   H HB3  . SER A 1 196 ? -8.538  1.443   -6.339  1.00 0.00 ? 196 SER A HB3  1  
ATOM 3051   H HG   . SER A 1 196 ? -6.000  1.325   -5.896  1.00 0.00 ? 196 SER A HG   1  
ATOM 3052   N N    . LEU A 1 197 ? -9.019  2.291   -9.627  1.00 0.00 ? 197 LEU A N    1  
ATOM 3053   C CA   . LEU A 1 197 ? -10.201 2.929   -10.283 1.00 0.00 ? 197 LEU A CA   1  
ATOM 3054   C C    . LEU A 1 197 ? -10.697 2.038   -11.417 1.00 0.00 ? 197 LEU A C    1  
ATOM 3055   O O    . LEU A 1 197 ? -11.856 2.141   -11.817 1.00 0.00 ? 197 LEU A O    1  
ATOM 3056   C CB   . LEU A 1 197 ? -9.838  4.316   -10.820 1.00 0.00 ? 197 LEU A CB   1  
ATOM 3057   C CG   . LEU A 1 197 ? -10.119 5.376   -9.750  1.00 0.00 ? 197 LEU A CG   1  
ATOM 3058   C CD1  . LEU A 1 197 ? -9.148  5.215   -8.580  1.00 0.00 ? 197 LEU A CD1  1  
ATOM 3059   C CD2  . LEU A 1 197 ? -9.949  6.767   -10.356 1.00 0.00 ? 197 LEU A CD2  1  
ATOM 3060   H H    . LEU A 1 197 ? -8.125  2.679   -9.737  1.00 0.00 ? 197 LEU A H    1  
ATOM 3061   H HA   . LEU A 1 197 ? -10.990 3.031   -9.551  1.00 0.00 ? 197 LEU A HA   1  
ATOM 3062   H HB2  . LEU A 1 197 ? -8.789  4.336   -11.081 1.00 0.00 ? 197 LEU A HB2  1  
ATOM 3063   H HB3  . LEU A 1 197 ? -10.430 4.528   -11.698 1.00 0.00 ? 197 LEU A HB3  1  
ATOM 3064   H HG   . LEU A 1 197 ? -11.131 5.262   -9.392  1.00 0.00 ? 197 LEU A HG   1  
ATOM 3065   H HD11 . LEU A 1 197 ? -8.142  5.416   -8.916  1.00 0.00 ? 197 LEU A HD11 1  
ATOM 3066   H HD12 . LEU A 1 197 ? -9.206  4.205   -8.201  1.00 0.00 ? 197 LEU A HD12 1  
ATOM 3067   H HD13 . LEU A 1 197 ? -9.412  5.910   -7.795  1.00 0.00 ? 197 LEU A HD13 1  
ATOM 3068   H HD21 . LEU A 1 197 ? -9.601  6.676   -11.374 1.00 0.00 ? 197 LEU A HD21 1  
ATOM 3069   H HD22 . LEU A 1 197 ? -9.228  7.326   -9.777  1.00 0.00 ? 197 LEU A HD22 1  
ATOM 3070   H HD23 . LEU A 1 197 ? -10.898 7.284   -10.345 1.00 0.00 ? 197 LEU A HD23 1  
ATOM 3071   N N    . GLU A 1 198 ? -9.836  1.203   -11.937 1.00 0.00 ? 198 GLU A N    1  
ATOM 3072   C CA   . GLU A 1 198 ? -10.212 0.303   -13.067 1.00 0.00 ? 198 GLU A CA   1  
ATOM 3073   C C    . GLU A 1 198 ? -10.545 1.127   -14.311 1.00 0.00 ? 198 GLU A C    1  
ATOM 3074   O O    . GLU A 1 198 ? -11.569 0.912   -14.966 1.00 0.00 ? 198 GLU A O    1  
ATOM 3075   C CB   . GLU A 1 198 ? -11.409 -0.572  -12.674 1.00 0.00 ? 198 GLU A CB   1  
ATOM 3076   C CG   . GLU A 1 198 ? -11.509 -1.772  -13.633 1.00 0.00 ? 198 GLU A CG   1  
ATOM 3077   C CD   . GLU A 1 198 ? -10.352 -2.746  -13.411 1.00 0.00 ? 198 GLU A CD   1  
ATOM 3078   O OE1  . GLU A 1 198 ? -9.711  -2.664  -12.376 1.00 0.00 ? 198 GLU A OE1  1  
ATOM 3079   O OE2  . GLU A 1 198 ? -10.121 -3.559  -14.284 1.00 0.00 ? 198 GLU A OE2  1  
ATOM 3080   H H    . GLU A 1 198 ? -8.921  1.179   -11.589 1.00 0.00 ? 198 GLU A H    1  
ATOM 3081   H HA   . GLU A 1 198 ? -9.371  -0.337  -13.292 1.00 0.00 ? 198 GLU A HA   1  
ATOM 3082   H HB2  . GLU A 1 198 ? -11.277 -0.928  -11.662 1.00 0.00 ? 198 GLU A HB2  1  
ATOM 3083   H HB3  . GLU A 1 198 ? -12.317 0.011   -12.735 1.00 0.00 ? 198 GLU A HB3  1  
ATOM 3084   H HG2  . GLU A 1 198 ? -12.444 -2.286  -13.461 1.00 0.00 ? 198 GLU A HG2  1  
ATOM 3085   H HG3  . GLU A 1 198 ? -11.482 -1.415  -14.652 1.00 0.00 ? 198 GLU A HG3  1  
ATOM 3086   N N    . LEU A 1 199 ? -9.682  2.049   -14.660 1.00 0.00 ? 199 LEU A N    1  
ATOM 3087   C CA   . LEU A 1 199 ? -9.901  2.889   -15.883 1.00 0.00 ? 199 LEU A CA   1  
ATOM 3088   C C    . LEU A 1 199 ? -8.642  2.772   -16.765 1.00 0.00 ? 199 LEU A C    1  
ATOM 3089   O O    . LEU A 1 199 ? -7.552  2.685   -16.253 1.00 0.00 ? 199 LEU A O    1  
ATOM 3090   C CB   . LEU A 1 199 ? -10.100 4.356   -15.462 1.00 0.00 ? 199 LEU A CB   1  
ATOM 3091   C CG   . LEU A 1 199 ? -11.594 4.704   -15.439 1.00 0.00 ? 199 LEU A CG   1  
ATOM 3092   C CD1  . LEU A 1 199 ? -12.312 3.812   -14.419 1.00 0.00 ? 199 LEU A CD1  1  
ATOM 3093   C CD2  . LEU A 1 199 ? -11.795 6.183   -15.057 1.00 0.00 ? 199 LEU A CD2  1  
ATOM 3094   H H    . LEU A 1 199 ? -8.872  2.178   -14.124 1.00 0.00 ? 199 LEU A H    1  
ATOM 3095   H HA   . LEU A 1 199 ? -10.767 2.536   -16.425 1.00 0.00 ? 199 LEU A HA   1  
ATOM 3096   H HB2  . LEU A 1 199 ? -9.684  4.504   -14.476 1.00 0.00 ? 199 LEU A HB2  1  
ATOM 3097   H HB3  . LEU A 1 199 ? -9.595  5.002   -16.164 1.00 0.00 ? 199 LEU A HB3  1  
ATOM 3098   H HG   . LEU A 1 199 ? -12.012 4.527   -16.420 1.00 0.00 ? 199 LEU A HG   1  
ATOM 3099   H HD11 . LEU A 1 199 ? -13.069 4.388   -13.906 1.00 0.00 ? 199 LEU A HD11 1  
ATOM 3100   H HD12 . LEU A 1 199 ? -11.597 3.437   -13.701 1.00 0.00 ? 199 LEU A HD12 1  
ATOM 3101   H HD13 . LEU A 1 199 ? -12.777 2.981   -14.931 1.00 0.00 ? 199 LEU A HD13 1  
ATOM 3102   H HD21 . LEU A 1 199 ? -11.744 6.794   -15.946 1.00 0.00 ? 199 LEU A HD21 1  
ATOM 3103   H HD22 . LEU A 1 199 ? -11.021 6.485   -14.368 1.00 0.00 ? 199 LEU A HD22 1  
ATOM 3104   H HD23 . LEU A 1 199 ? -12.761 6.305   -14.590 1.00 0.00 ? 199 LEU A HD23 1  
ATOM 3105   N N    . PRO A 1 200 ? -8.775  2.760   -18.078 1.00 0.00 ? 200 PRO A N    1  
ATOM 3106   C CA   . PRO A 1 200 ? -7.592  2.638   -18.994 1.00 0.00 ? 200 PRO A CA   1  
ATOM 3107   C C    . PRO A 1 200 ? -6.583  3.779   -18.792 1.00 0.00 ? 200 PRO A C    1  
ATOM 3108   O O    . PRO A 1 200 ? -6.955  4.925   -18.644 1.00 0.00 ? 200 PRO A O    1  
ATOM 3109   C CB   . PRO A 1 200 ? -8.199  2.658   -20.418 1.00 0.00 ? 200 PRO A CB   1  
ATOM 3110   C CG   . PRO A 1 200 ? -9.602  3.177   -20.270 1.00 0.00 ? 200 PRO A CG   1  
ATOM 3111   C CD   . PRO A 1 200 ? -10.041 2.863   -18.825 1.00 0.00 ? 200 PRO A CD   1  
ATOM 3112   H HA   . PRO A 1 200 ? -7.104  1.691   -18.831 1.00 0.00 ? 200 PRO A HA   1  
ATOM 3113   H HB2  . PRO A 1 200 ? -7.624  3.313   -21.058 1.00 0.00 ? 200 PRO A HB2  1  
ATOM 3114   H HB3  . PRO A 1 200 ? -8.219  1.660   -20.828 1.00 0.00 ? 200 PRO A HB3  1  
ATOM 3115   H HG2  . PRO A 1 200 ? -9.619  4.245   -20.443 1.00 0.00 ? 200 PRO A HG2  1  
ATOM 3116   H HG3  . PRO A 1 200 ? -10.258 2.677   -20.965 1.00 0.00 ? 200 PRO A HG3  1  
ATOM 3117   H HD2  . PRO A 1 200 ? -10.650 3.668   -18.435 1.00 0.00 ? 200 PRO A HD2  1  
ATOM 3118   H HD3  . PRO A 1 200 ? -10.576 1.927   -18.782 1.00 0.00 ? 200 PRO A HD3  1  
ATOM 3119   N N    . ALA A 1 201 ? -5.303  3.476   -18.775 1.00 0.00 ? 201 ALA A N    1  
ATOM 3120   C CA   . ALA A 1 201 ? -4.292  4.565   -18.574 1.00 0.00 ? 201 ALA A CA   1  
ATOM 3121   C C    . ALA A 1 201 ? -2.855  4.053   -18.801 1.00 0.00 ? 201 ALA A C    1  
ATOM 3122   O O    . ALA A 1 201 ? -2.542  2.901   -18.555 1.00 0.00 ? 201 ALA A O    1  
ATOM 3123   C CB   . ALA A 1 201 ? -4.427  5.092   -17.130 1.00 0.00 ? 201 ALA A CB   1  
ATOM 3124   H H    . ALA A 1 201 ? -5.013  2.547   -18.889 1.00 0.00 ? 201 ALA A H    1  
ATOM 3125   H HA   . ALA A 1 201 ? -4.496  5.371   -19.262 1.00 0.00 ? 201 ALA A HA   1  
ATOM 3126   H HB1  . ALA A 1 201 ? -5.256  5.781   -17.075 1.00 0.00 ? 201 ALA A HB1  1  
ATOM 3127   H HB2  . ALA A 1 201 ? -3.517  5.600   -16.846 1.00 0.00 ? 201 ALA A HB2  1  
ATOM 3128   H HB3  . ALA A 1 201 ? -4.601  4.263   -16.459 1.00 0.00 ? 201 ALA A HB3  1  
ATOM 3129   N N    . ILE A 1 202 ? -1.982  4.937   -19.237 1.00 0.00 ? 202 ILE A N    1  
ATOM 3130   C CA   . ILE A 1 202 ? -0.539  4.579   -19.459 1.00 0.00 ? 202 ILE A CA   1  
ATOM 3131   C C    . ILE A 1 202 ? 0.314   5.519   -18.597 1.00 0.00 ? 202 ILE A C    1  
ATOM 3132   O O    . ILE A 1 202 ? -0.060  6.646   -18.352 1.00 0.00 ? 202 ILE A O    1  
ATOM 3133   C CB   . ILE A 1 202 ? -0.172  4.767   -20.941 1.00 0.00 ? 202 ILE A CB   1  
ATOM 3134   C CG1  . ILE A 1 202 ? 1.107   5.602   -21.043 1.00 0.00 ? 202 ILE A CG1  1  
ATOM 3135   C CG2  . ILE A 1 202 ? -1.307  5.489   -21.684 1.00 0.00 ? 202 ILE A CG2  1  
ATOM 3136   C CD1  . ILE A 1 202 ? 0.772   7.100   -20.937 1.00 0.00 ? 202 ILE A CD1  1  
ATOM 3137   H H    . ILE A 1 202 ? -2.274  5.858   -19.395 1.00 0.00 ? 202 ILE A H    1  
ATOM 3138   H HA   . ILE A 1 202 ? -0.367  3.554   -19.163 1.00 0.00 ? 202 ILE A HA   1  
ATOM 3139   H HB   . ILE A 1 202 ? -0.007  3.800   -21.394 1.00 0.00 ? 202 ILE A HB   1  
ATOM 3140   H HG12 . ILE A 1 202 ? 1.779   5.327   -20.242 1.00 0.00 ? 202 ILE A HG12 1  
ATOM 3141   H HG13 . ILE A 1 202 ? 1.585   5.409   -21.992 1.00 0.00 ? 202 ILE A HG13 1  
ATOM 3142   H HG21 . ILE A 1 202 ? -2.096  4.785   -21.906 1.00 0.00 ? 202 ILE A HG21 1  
ATOM 3143   H HG22 . ILE A 1 202 ? -0.927  5.907   -22.604 1.00 0.00 ? 202 ILE A HG22 1  
ATOM 3144   H HG23 . ILE A 1 202 ? -1.697  6.282   -21.062 1.00 0.00 ? 202 ILE A HG23 1  
ATOM 3145   H HD11 . ILE A 1 202 ? -0.236  7.218   -20.565 1.00 0.00 ? 202 ILE A HD11 1  
ATOM 3146   H HD12 . ILE A 1 202 ? 0.851   7.556   -21.913 1.00 0.00 ? 202 ILE A HD12 1  
ATOM 3147   H HD13 . ILE A 1 202 ? 1.464   7.577   -20.259 1.00 0.00 ? 202 ILE A HD13 1  
ATOM 3148   N N    . VAL A 1 203 ? 1.455   5.065   -18.122 1.00 0.00 ? 203 VAL A N    1  
ATOM 3149   C CA   . VAL A 1 203 ? 2.324   5.946   -17.272 1.00 0.00 ? 203 VAL A CA   1  
ATOM 3150   C C    . VAL A 1 203 ? 3.763   5.954   -17.803 1.00 0.00 ? 203 VAL A C    1  
ATOM 3151   O O    . VAL A 1 203 ? 4.588   6.731   -17.357 1.00 0.00 ? 203 VAL A O    1  
ATOM 3152   C CB   . VAL A 1 203 ? 2.328   5.402   -15.837 1.00 0.00 ? 203 VAL A CB   1  
ATOM 3153   C CG1  . VAL A 1 203 ? 0.926   5.532   -15.242 1.00 0.00 ? 203 VAL A CG1  1  
ATOM 3154   C CG2  . VAL A 1 203 ? 2.740   3.926   -15.855 1.00 0.00 ? 203 VAL A CG2  1  
ATOM 3155   H H    . VAL A 1 203 ? 1.737   4.148   -18.322 1.00 0.00 ? 203 VAL A H    1  
ATOM 3156   H HA   . VAL A 1 203 ? 1.931   6.951   -17.273 1.00 0.00 ? 203 VAL A HA   1  
ATOM 3157   H HB   . VAL A 1 203 ? 3.028   5.969   -15.239 1.00 0.00 ? 203 VAL A HB   1  
ATOM 3158   H HG11 . VAL A 1 203 ? 0.813   6.509   -14.796 1.00 0.00 ? 203 VAL A HG11 1  
ATOM 3159   H HG12 . VAL A 1 203 ? 0.784   4.774   -14.487 1.00 0.00 ? 203 VAL A HG12 1  
ATOM 3160   H HG13 . VAL A 1 203 ? 0.190   5.405   -16.023 1.00 0.00 ? 203 VAL A HG13 1  
ATOM 3161   H HG21 . VAL A 1 203 ? 2.826   3.564   -14.841 1.00 0.00 ? 203 VAL A HG21 1  
ATOM 3162   H HG22 . VAL A 1 203 ? 3.692   3.824   -16.355 1.00 0.00 ? 203 VAL A HG22 1  
ATOM 3163   H HG23 . VAL A 1 203 ? 1.993   3.350   -16.381 1.00 0.00 ? 203 VAL A HG23 1  
ATOM 3164   N N    . GLY A 1 204 ? 4.073   5.083   -18.741 1.00 0.00 ? 204 GLY A N    1  
ATOM 3165   C CA   . GLY A 1 204 ? 5.465   5.009   -19.295 1.00 0.00 ? 204 GLY A CA   1  
ATOM 3166   C C    . GLY A 1 204 ? 5.497   5.474   -20.753 1.00 0.00 ? 204 GLY A C    1  
ATOM 3167   O O    . GLY A 1 204 ? 6.370   5.093   -21.505 1.00 0.00 ? 204 GLY A O    1  
ATOM 3168   H H    . GLY A 1 204 ? 3.389   4.463   -19.069 1.00 0.00 ? 204 GLY A H    1  
ATOM 3169   H HA2  . GLY A 1 204 ? 6.115   5.640   -18.706 1.00 0.00 ? 204 GLY A HA2  1  
ATOM 3170   H HA3  . GLY A 1 204 ? 5.814   3.989   -19.240 1.00 0.00 ? 204 GLY A HA3  1  
ATOM 3171   N N    . THR A 1 205 ? 4.549   6.269   -21.171 1.00 0.00 ? 205 THR A N    1  
ATOM 3172   C CA   . THR A 1 205 ? 4.533   6.736   -22.589 1.00 0.00 ? 205 THR A CA   1  
ATOM 3173   C C    . THR A 1 205 ? 5.942   7.161   -23.017 1.00 0.00 ? 205 THR A C    1  
ATOM 3174   O O    . THR A 1 205 ? 6.405   6.832   -24.089 1.00 0.00 ? 205 THR A O    1  
ATOM 3175   C CB   . THR A 1 205 ? 3.583   7.929   -22.705 1.00 0.00 ? 205 THR A CB   1  
ATOM 3176   O OG1  . THR A 1 205 ? 2.683   7.706   -23.780 1.00 0.00 ? 205 THR A OG1  1  
ATOM 3177   C CG2  . THR A 1 205 ? 4.375   9.217   -22.959 1.00 0.00 ? 205 THR A CG2  1  
ATOM 3178   H H    . THR A 1 205 ? 3.842   6.553   -20.555 1.00 0.00 ? 205 THR A H    1  
ATOM 3179   H HA   . THR A 1 205 ? 4.187   5.937   -23.228 1.00 0.00 ? 205 THR A HA   1  
ATOM 3180   H HB   . THR A 1 205 ? 3.026   8.033   -21.787 1.00 0.00 ? 205 THR A HB   1  
ATOM 3181   H HG1  . THR A 1 205 ? 2.056   8.434   -23.799 1.00 0.00 ? 205 THR A HG1  1  
ATOM 3182   H HG21 . THR A 1 205 ? 3.699   10.060  -22.964 1.00 0.00 ? 205 THR A HG21 1  
ATOM 3183   H HG22 . THR A 1 205 ? 4.874   9.150   -23.915 1.00 0.00 ? 205 THR A HG22 1  
ATOM 3184   H HG23 . THR A 1 205 ? 5.109   9.349   -22.179 1.00 0.00 ? 205 THR A HG23 1  
ATOM 3185   N N    . GLY A 1 206 ? 6.631   7.882   -22.175 1.00 0.00 ? 206 GLY A N    1  
ATOM 3186   C CA   . GLY A 1 206 ? 8.021   8.323   -22.517 1.00 0.00 ? 206 GLY A CA   1  
ATOM 3187   C C    . GLY A 1 206 ? 8.020   9.725   -23.136 1.00 0.00 ? 206 GLY A C    1  
ATOM 3188   O O    . GLY A 1 206 ? 8.769   10.586  -22.719 1.00 0.00 ? 206 GLY A O    1  
ATOM 3189   H H    . GLY A 1 206 ? 6.241   8.128   -21.311 1.00 0.00 ? 206 GLY A H    1  
ATOM 3190   H HA2  . GLY A 1 206 ? 8.620   8.333   -21.618 1.00 0.00 ? 206 GLY A HA2  1  
ATOM 3191   H HA3  . GLY A 1 206 ? 8.451   7.626   -23.221 1.00 0.00 ? 206 GLY A HA3  1  
ATOM 3192   N N    . SER A 1 207 ? 7.212   9.971   -24.137 1.00 0.00 ? 207 SER A N    1  
ATOM 3193   C CA   . SER A 1 207 ? 7.223   11.332  -24.764 1.00 0.00 ? 207 SER A CA   1  
ATOM 3194   C C    . SER A 1 207 ? 5.939   11.587  -25.556 1.00 0.00 ? 207 SER A C    1  
ATOM 3195   O O    . SER A 1 207 ? 5.968   12.161  -26.624 1.00 0.00 ? 207 SER A O    1  
ATOM 3196   C CB   . SER A 1 207 ? 8.421   11.431  -25.703 1.00 0.00 ? 207 SER A CB   1  
ATOM 3197   O OG   . SER A 1 207 ? 8.344   10.393  -26.672 1.00 0.00 ? 207 SER A OG   1  
ATOM 3198   H H    . SER A 1 207 ? 6.620   9.270   -24.481 1.00 0.00 ? 207 SER A H    1  
ATOM 3199   H HA   . SER A 1 207 ? 7.318   12.079  -23.991 1.00 0.00 ? 207 SER A HA   1  
ATOM 3200   H HB2  . SER A 1 207 ? 8.411   12.384  -26.203 1.00 0.00 ? 207 SER A HB2  1  
ATOM 3201   H HB3  . SER A 1 207 ? 9.334   11.336  -25.129 1.00 0.00 ? 207 SER A HB3  1  
ATOM 3202   H HG   . SER A 1 207 ? 8.193   10.798  -27.529 1.00 0.00 ? 207 SER A HG   1  
ATOM 3203   N N    . VAL A 1 208 ? 4.813   11.176  -25.051 1.00 0.00 ? 208 VAL A N    1  
ATOM 3204   C CA   . VAL A 1 208 ? 3.546   11.423  -25.790 1.00 0.00 ? 208 VAL A CA   1  
ATOM 3205   C C    . VAL A 1 208 ? 3.124   12.892  -25.615 1.00 0.00 ? 208 VAL A C    1  
ATOM 3206   O O    . VAL A 1 208 ? 2.651   13.522  -26.536 1.00 0.00 ? 208 VAL A O    1  
ATOM 3207   C CB   . VAL A 1 208 ? 2.456   10.463  -25.270 1.00 0.00 ? 208 VAL A CB   1  
ATOM 3208   C CG1  . VAL A 1 208 ? 1.813   11.036  -24.009 1.00 0.00 ? 208 VAL A CG1  1  
ATOM 3209   C CG2  . VAL A 1 208 ? 1.369   10.306  -26.346 1.00 0.00 ? 208 VAL A CG2  1  
ATOM 3210   H H    . VAL A 1 208 ? 4.797   10.717  -24.185 1.00 0.00 ? 208 VAL A H    1  
ATOM 3211   H HA   . VAL A 1 208 ? 3.713   11.230  -26.841 1.00 0.00 ? 208 VAL A HA   1  
ATOM 3212   H HB   . VAL A 1 208 ? 2.894   9.500   -25.050 1.00 0.00 ? 208 VAL A HB   1  
ATOM 3213   H HG11 . VAL A 1 208 ? 1.482   10.227  -23.374 1.00 0.00 ? 208 VAL A HG11 1  
ATOM 3214   H HG12 . VAL A 1 208 ? 0.966   11.649  -24.283 1.00 0.00 ? 208 VAL A HG12 1  
ATOM 3215   H HG13 . VAL A 1 208 ? 2.535   11.638  -23.477 1.00 0.00 ? 208 VAL A HG13 1  
ATOM 3216   H HG21 . VAL A 1 208 ? 1.789   9.817   -27.213 1.00 0.00 ? 208 VAL A HG21 1  
ATOM 3217   H HG22 . VAL A 1 208 ? 0.997   11.280  -26.626 1.00 0.00 ? 208 VAL A HG22 1  
ATOM 3218   H HG23 . VAL A 1 208 ? 0.558   9.710   -25.953 1.00 0.00 ? 208 VAL A HG23 1  
ATOM 3219   N N    . THR A 1 209 ? 3.264   13.425  -24.430 1.00 0.00 ? 209 THR A N    1  
ATOM 3220   C CA   . THR A 1 209 ? 2.839   14.841  -24.194 1.00 0.00 ? 209 THR A CA   1  
ATOM 3221   C C    . THR A 1 209 ? 3.562   15.791  -25.155 1.00 0.00 ? 209 THR A C    1  
ATOM 3222   O O    . THR A 1 209 ? 3.037   16.819  -25.529 1.00 0.00 ? 209 THR A O    1  
ATOM 3223   C CB   . THR A 1 209 ? 3.172   15.245  -22.750 1.00 0.00 ? 209 THR A CB   1  
ATOM 3224   O OG1  . THR A 1 209 ? 3.956   16.432  -22.772 1.00 0.00 ? 209 THR A OG1  1  
ATOM 3225   C CG2  . THR A 1 209 ? 3.963   14.130  -22.044 1.00 0.00 ? 209 THR A CG2  1  
ATOM 3226   H H    . THR A 1 209 ? 3.628   12.892  -23.691 1.00 0.00 ? 209 THR A H    1  
ATOM 3227   H HA   . THR A 1 209 ? 1.773   14.922  -24.348 1.00 0.00 ? 209 THR A HA   1  
ATOM 3228   H HB   . THR A 1 209 ? 2.256   15.429  -22.208 1.00 0.00 ? 209 THR A HB   1  
ATOM 3229   H HG1  . THR A 1 209 ? 4.867   16.189  -22.591 1.00 0.00 ? 209 THR A HG1  1  
ATOM 3230   H HG21 . THR A 1 209 ? 4.822   13.866  -22.642 1.00 0.00 ? 209 THR A HG21 1  
ATOM 3231   H HG22 . THR A 1 209 ? 3.331   13.264  -21.920 1.00 0.00 ? 209 THR A HG22 1  
ATOM 3232   H HG23 . THR A 1 209 ? 4.290   14.479  -21.076 1.00 0.00 ? 209 THR A HG23 1  
ATOM 3233   N N    . SER A 1 210 ? 4.760   15.467  -25.555 1.00 0.00 ? 210 SER A N    1  
ATOM 3234   C CA   . SER A 1 210 ? 5.497   16.370  -26.481 1.00 0.00 ? 210 SER A CA   1  
ATOM 3235   C C    . SER A 1 210 ? 4.952   16.199  -27.896 1.00 0.00 ? 210 SER A C    1  
ATOM 3236   O O    . SER A 1 210 ? 5.225   16.989  -28.779 1.00 0.00 ? 210 SER A O    1  
ATOM 3237   C CB   . SER A 1 210 ? 6.984   16.025  -26.456 1.00 0.00 ? 210 SER A CB   1  
ATOM 3238   O OG   . SER A 1 210 ? 7.694   16.955  -27.262 1.00 0.00 ? 210 SER A OG   1  
ATOM 3239   H H    . SER A 1 210 ? 5.176   14.636  -25.242 1.00 0.00 ? 210 SER A H    1  
ATOM 3240   H HA   . SER A 1 210 ? 5.361   17.395  -26.166 1.00 0.00 ? 210 SER A HA   1  
ATOM 3241   H HB2  . SER A 1 210 ? 7.351   16.078  -25.446 1.00 0.00 ? 210 SER A HB2  1  
ATOM 3242   H HB3  . SER A 1 210 ? 7.125   15.021  -26.837 1.00 0.00 ? 210 SER A HB3  1  
ATOM 3243   H HG   . SER A 1 210 ? 7.627   17.819  -26.848 1.00 0.00 ? 210 SER A HG   1  
ATOM 3244   N N    . GLN A 1 211 ? 4.185   15.167  -28.110 1.00 0.00 ? 211 GLN A N    1  
ATOM 3245   C CA   . GLN A 1 211 ? 3.607   14.914  -29.461 1.00 0.00 ? 211 GLN A CA   1  
ATOM 3246   C C    . GLN A 1 211 ? 2.135   15.339  -29.480 1.00 0.00 ? 211 GLN A C    1  
ATOM 3247   O O    . GLN A 1 211 ? 1.519   15.406  -30.523 1.00 0.00 ? 211 GLN A O    1  
ATOM 3248   C CB   . GLN A 1 211 ? 3.698   13.412  -29.768 1.00 0.00 ? 211 GLN A CB   1  
ATOM 3249   C CG   . GLN A 1 211 ? 3.398   13.137  -31.269 1.00 0.00 ? 211 GLN A CG   1  
ATOM 3250   C CD   . GLN A 1 211 ? 4.444   13.826  -32.160 1.00 0.00 ? 211 GLN A CD   1  
ATOM 3251   O OE1  . GLN A 1 211 ? 5.629   13.619  -32.002 1.00 0.00 ? 211 GLN A OE1  1  
ATOM 3252   N NE2  . GLN A 1 211 ? 4.046   14.649  -33.091 1.00 0.00 ? 211 GLN A NE2  1  
ATOM 3253   H H    . GLN A 1 211 ? 3.988   14.549  -27.375 1.00 0.00 ? 211 GLN A H    1  
ATOM 3254   H HA   . GLN A 1 211 ? 4.157   15.470  -30.205 1.00 0.00 ? 211 GLN A HA   1  
ATOM 3255   H HB2  . GLN A 1 211 ? 4.693   13.062  -29.533 1.00 0.00 ? 211 GLN A HB2  1  
ATOM 3256   H HB3  . GLN A 1 211 ? 2.981   12.881  -29.160 1.00 0.00 ? 211 GLN A HB3  1  
ATOM 3257   H HG2  . GLN A 1 211 ? 3.424   12.072  -31.449 1.00 0.00 ? 211 GLN A HG2  1  
ATOM 3258   H HG3  . GLN A 1 211 ? 2.417   13.517  -31.512 1.00 0.00 ? 211 GLN A HG3  1  
ATOM 3259   H HE21 . GLN A 1 211 ? 3.089   14.821  -33.215 1.00 0.00 ? 211 GLN A HE21 1  
ATOM 3260   H HE22 . GLN A 1 211 ? 4.703   15.095  -33.665 1.00 0.00 ? 211 GLN A HE22 1  
ATOM 3261   N N    . VAL A 1 212 ? 1.559   15.588  -28.327 1.00 0.00 ? 212 VAL A N    1  
ATOM 3262   C CA   . VAL A 1 212 ? 0.105   15.973  -28.265 1.00 0.00 ? 212 VAL A CA   1  
ATOM 3263   C C    . VAL A 1 212 ? -0.064  17.442  -27.878 1.00 0.00 ? 212 VAL A C    1  
ATOM 3264   O O    . VAL A 1 212 ? 0.609   17.956  -27.006 1.00 0.00 ? 212 VAL A O    1  
ATOM 3265   C CB   . VAL A 1 212 ? -0.607  15.112  -27.208 1.00 0.00 ? 212 VAL A CB   1  
ATOM 3266   C CG1  . VAL A 1 212 ? -2.104  15.437  -27.169 1.00 0.00 ? 212 VAL A CG1  1  
ATOM 3267   C CG2  . VAL A 1 212 ? -0.429  13.647  -27.568 1.00 0.00 ? 212 VAL A CG2  1  
ATOM 3268   H H    . VAL A 1 212 ? 2.073   15.498  -27.498 1.00 0.00 ? 212 VAL A H    1  
ATOM 3269   H HA   . VAL A 1 212 ? -0.352  15.802  -29.228 1.00 0.00 ? 212 VAL A HA   1  
ATOM 3270   H HB   . VAL A 1 212 ? -0.172  15.301  -26.238 1.00 0.00 ? 212 VAL A HB   1  
ATOM 3271   H HG11 . VAL A 1 212 ? -2.571  14.885  -26.366 1.00 0.00 ? 212 VAL A HG11 1  
ATOM 3272   H HG12 . VAL A 1 212 ? -2.558  15.157  -28.108 1.00 0.00 ? 212 VAL A HG12 1  
ATOM 3273   H HG13 . VAL A 1 212 ? -2.239  16.496  -27.004 1.00 0.00 ? 212 VAL A HG13 1  
ATOM 3274   H HG21 . VAL A 1 212 ? 0.618   13.442  -27.737 1.00 0.00 ? 212 VAL A HG21 1  
ATOM 3275   H HG22 . VAL A 1 212 ? -0.989  13.425  -28.465 1.00 0.00 ? 212 VAL A HG22 1  
ATOM 3276   H HG23 . VAL A 1 212 ? -0.789  13.030  -26.758 1.00 0.00 ? 212 VAL A HG23 1  
ATOM 3277   N N    . LYS A 1 213 ? -1.026  18.095  -28.486 1.00 0.00 ? 213 LYS A N    1  
ATOM 3278   C CA   . LYS A 1 213 ? -1.344  19.513  -28.145 1.00 0.00 ? 213 LYS A CA   1  
ATOM 3279   C C    . LYS A 1 213 ? -2.706  19.478  -27.462 1.00 0.00 ? 213 LYS A C    1  
ATOM 3280   O O    . LYS A 1 213 ? -3.467  18.562  -27.669 1.00 0.00 ? 213 LYS A O    1  
ATOM 3281   C CB   . LYS A 1 213 ? -1.468  20.366  -29.416 1.00 0.00 ? 213 LYS A CB   1  
ATOM 3282   C CG   . LYS A 1 213 ? -0.133  21.055  -29.734 1.00 0.00 ? 213 LYS A CG   1  
ATOM 3283   C CD   . LYS A 1 213 ? 0.955   20.006  -30.040 1.00 0.00 ? 213 LYS A CD   1  
ATOM 3284   C CE   . LYS A 1 213 ? 2.292   20.688  -30.420 1.00 0.00 ? 213 LYS A CE   1  
ATOM 3285   N NZ   . LYS A 1 213 ? 3.316   19.635  -30.702 1.00 0.00 ? 213 LYS A NZ   1  
ATOM 3286   H H    . LYS A 1 213 ? -1.580  17.626  -29.144 1.00 0.00 ? 213 LYS A H    1  
ATOM 3287   H HA   . LYS A 1 213 ? -0.596  19.921  -27.480 1.00 0.00 ? 213 LYS A HA   1  
ATOM 3288   H HB2  . LYS A 1 213 ? -1.749  19.733  -30.244 1.00 0.00 ? 213 LYS A HB2  1  
ATOM 3289   H HB3  . LYS A 1 213 ? -2.230  21.118  -29.268 1.00 0.00 ? 213 LYS A HB3  1  
ATOM 3290   H HG2  . LYS A 1 213 ? -0.260  21.699  -30.593 1.00 0.00 ? 213 LYS A HG2  1  
ATOM 3291   H HG3  . LYS A 1 213 ? 0.174   21.649  -28.886 1.00 0.00 ? 213 LYS A HG3  1  
ATOM 3292   H HD2  . LYS A 1 213 ? 1.107   19.388  -29.167 1.00 0.00 ? 213 LYS A HD2  1  
ATOM 3293   H HD3  . LYS A 1 213 ? 0.628   19.384  -30.861 1.00 0.00 ? 213 LYS A HD3  1  
ATOM 3294   H HE2  . LYS A 1 213 ? 2.149   21.297  -31.300 1.00 0.00 ? 213 LYS A HE2  1  
ATOM 3295   H HE3  . LYS A 1 213 ? 2.628   21.307  -29.602 1.00 0.00 ? 213 LYS A HE3  1  
ATOM 3296   H HZ1  . LYS A 1 213 ? 4.168   20.077  -31.099 1.00 0.00 ? 213 LYS A HZ1  1  
ATOM 3297   H HZ2  . LYS A 1 213 ? 2.929   18.950  -31.384 1.00 0.00 ? 213 LYS A HZ2  1  
ATOM 3298   H HZ3  . LYS A 1 213 ? 3.561   19.144  -29.819 1.00 0.00 ? 213 LYS A HZ3  1  
ATOM 3299   N N    . ASN A 1 214 ? -3.046  20.434  -26.658 1.00 0.00 ? 214 ASN A N    1  
ATOM 3300   C CA   . ASN A 1 214 ? -4.387  20.368  -26.018 1.00 0.00 ? 214 ASN A CA   1  
ATOM 3301   C C    . ASN A 1 214 ? -5.454  20.383  -27.109 1.00 0.00 ? 214 ASN A C    1  
ATOM 3302   O O    . ASN A 1 214 ? -5.244  20.913  -28.180 1.00 0.00 ? 214 ASN A O    1  
ATOM 3303   C CB   . ASN A 1 214 ? -4.595  21.564  -25.082 1.00 0.00 ? 214 ASN A CB   1  
ATOM 3304   C CG   . ASN A 1 214 ? -4.484  22.879  -25.863 1.00 0.00 ? 214 ASN A CG   1  
ATOM 3305   O OD1  . ASN A 1 214 ? -4.603  22.897  -27.071 1.00 0.00 ? 214 ASN A OD1  1  
ATOM 3306   N ND2  . ASN A 1 214 ? -4.266  23.990  -25.211 1.00 0.00 ? 214 ASN A ND2  1  
ATOM 3307   H H    . ASN A 1 214 ? -2.439  21.183  -26.481 1.00 0.00 ? 214 ASN A H    1  
ATOM 3308   H HA   . ASN A 1 214 ? -4.467  19.451  -25.453 1.00 0.00 ? 214 ASN A HA   1  
ATOM 3309   H HB2  . ASN A 1 214 ? -5.574  21.497  -24.630 1.00 0.00 ? 214 ASN A HB2  1  
ATOM 3310   H HB3  . ASN A 1 214 ? -3.843  21.546  -24.307 1.00 0.00 ? 214 ASN A HB3  1  
ATOM 3311   H HD21 . ASN A 1 214 ? -4.176  23.975  -24.235 1.00 0.00 ? 214 ASN A HD21 1  
ATOM 3312   H HD22 . ASN A 1 214 ? -4.193  24.837  -25.697 1.00 0.00 ? 214 ASN A HD22 1  
ATOM 3313   N N    . ASP A 1 215 ? -6.593  19.794  -26.833 1.00 0.00 ? 215 ASP A N    1  
ATOM 3314   C CA   . ASP A 1 215 ? -7.733  19.747  -27.808 1.00 0.00 ? 215 ASP A CA   1  
ATOM 3315   C C    . ASP A 1 215 ? -7.458  18.727  -28.921 1.00 0.00 ? 215 ASP A C    1  
ATOM 3316   O O    . ASP A 1 215 ? -8.188  18.652  -29.890 1.00 0.00 ? 215 ASP A O    1  
ATOM 3317   C CB   . ASP A 1 215 ? -8.007  21.158  -28.420 1.00 0.00 ? 215 ASP A CB   1  
ATOM 3318   C CG   . ASP A 1 215 ? -9.439  21.246  -28.965 1.00 0.00 ? 215 ASP A CG   1  
ATOM 3319   O OD1  . ASP A 1 215 ? -10.174 20.284  -28.809 1.00 0.00 ? 215 ASP A OD1  1  
ATOM 3320   O OD2  . ASP A 1 215 ? -9.769  22.273  -29.531 1.00 0.00 ? 215 ASP A OD2  1  
ATOM 3321   H H    . ASP A 1 215 ? -6.708  19.377  -25.953 1.00 0.00 ? 215 ASP A H    1  
ATOM 3322   H HA   . ASP A 1 215 ? -8.619  19.431  -27.274 1.00 0.00 ? 215 ASP A HA   1  
ATOM 3323   H HB2  . ASP A 1 215 ? -7.872  21.909  -27.656 1.00 0.00 ? 215 ASP A HB2  1  
ATOM 3324   H HB3  . ASP A 1 215 ? -7.309  21.338  -29.223 1.00 0.00 ? 215 ASP A HB3  1  
ATOM 3325   N N    . ASP A 1 216 ? -6.441  17.929  -28.787 1.00 0.00 ? 216 ASP A N    1  
ATOM 3326   C CA   . ASP A 1 216 ? -6.169  16.908  -29.839 1.00 0.00 ? 216 ASP A CA   1  
ATOM 3327   C C    . ASP A 1 216 ? -7.119  15.725  -29.602 1.00 0.00 ? 216 ASP A C    1  
ATOM 3328   O O    . ASP A 1 216 ? -7.395  15.355  -28.479 1.00 0.00 ? 216 ASP A O    1  
ATOM 3329   C CB   . ASP A 1 216 ? -4.697  16.439  -29.750 1.00 0.00 ? 216 ASP A CB   1  
ATOM 3330   C CG   . ASP A 1 216 ? -3.759  17.453  -30.431 1.00 0.00 ? 216 ASP A CG   1  
ATOM 3331   O OD1  . ASP A 1 216 ? -4.263  18.392  -31.022 1.00 0.00 ? 216 ASP A OD1  1  
ATOM 3332   O OD2  . ASP A 1 216 ? -2.557  17.263  -30.352 1.00 0.00 ? 216 ASP A OD2  1  
ATOM 3333   H H    . ASP A 1 216 ? -5.870  17.984  -27.993 1.00 0.00 ? 216 ASP A H    1  
ATOM 3334   H HA   . ASP A 1 216 ? -6.359  17.334  -30.814 1.00 0.00 ? 216 ASP A HA   1  
ATOM 3335   H HB2  . ASP A 1 216 ? -4.419  16.340  -28.711 1.00 0.00 ? 216 ASP A HB2  1  
ATOM 3336   H HB3  . ASP A 1 216 ? -4.599  15.481  -30.238 1.00 0.00 ? 216 ASP A HB3  1  
ATOM 3337   N N    . TYR A 1 217 ? -7.600  15.115  -30.650 1.00 0.00 ? 217 TYR A N    1  
ATOM 3338   C CA   . TYR A 1 217 ? -8.506  13.942  -30.476 1.00 0.00 ? 217 TYR A CA   1  
ATOM 3339   C C    . TYR A 1 217 ? -7.645  12.682  -30.478 1.00 0.00 ? 217 TYR A C    1  
ATOM 3340   O O    . TYR A 1 217 ? -6.908  12.428  -31.410 1.00 0.00 ? 217 TYR A O    1  
ATOM 3341   C CB   . TYR A 1 217 ? -9.517  13.889  -31.629 1.00 0.00 ? 217 TYR A CB   1  
ATOM 3342   C CG   . TYR A 1 217 ? -10.550 12.823  -31.355 1.00 0.00 ? 217 TYR A CG   1  
ATOM 3343   C CD1  . TYR A 1 217 ? -11.635 13.101  -30.498 1.00 0.00 ? 217 TYR A CD1  1  
ATOM 3344   C CD2  . TYR A 1 217 ? -10.438 11.558  -31.958 1.00 0.00 ? 217 TYR A CD2  1  
ATOM 3345   C CE1  . TYR A 1 217 ? -12.608 12.111  -30.251 1.00 0.00 ? 217 TYR A CE1  1  
ATOM 3346   C CE2  . TYR A 1 217 ? -11.409 10.569  -31.710 1.00 0.00 ? 217 TYR A CE2  1  
ATOM 3347   C CZ   . TYR A 1 217 ? -12.495 10.843  -30.860 1.00 0.00 ? 217 TYR A CZ   1  
ATOM 3348   O OH   . TYR A 1 217 ? -13.447 9.875   -30.618 1.00 0.00 ? 217 TYR A OH   1  
ATOM 3349   H H    . TYR A 1 217 ? -7.353  15.416  -31.550 1.00 0.00 ? 217 TYR A H    1  
ATOM 3350   H HA   . TYR A 1 217 ? -9.029  14.024  -29.534 1.00 0.00 ? 217 TYR A HA   1  
ATOM 3351   H HB2  . TYR A 1 217 ? -10.005 14.848  -31.722 1.00 0.00 ? 217 TYR A HB2  1  
ATOM 3352   H HB3  . TYR A 1 217 ? -9.000  13.659  -32.549 1.00 0.00 ? 217 TYR A HB3  1  
ATOM 3353   H HD1  . TYR A 1 217 ? -11.722 14.072  -30.034 1.00 0.00 ? 217 TYR A HD1  1  
ATOM 3354   H HD2  . TYR A 1 217 ? -9.605  11.344  -32.612 1.00 0.00 ? 217 TYR A HD2  1  
ATOM 3355   H HE1  . TYR A 1 217 ? -13.439 12.323  -29.595 1.00 0.00 ? 217 TYR A HE1  1  
ATOM 3356   H HE2  . TYR A 1 217 ? -11.321 9.598   -32.177 1.00 0.00 ? 217 TYR A HE2  1  
ATOM 3357   H HH   . TYR A 1 217 ? -13.657 9.892   -29.682 1.00 0.00 ? 217 TYR A HH   1  
ATOM 3358   N N    . LEU A 1 218 ? -7.706  11.899  -29.428 1.00 0.00 ? 218 LEU A N    1  
ATOM 3359   C CA   . LEU A 1 218 ? -6.860  10.664  -29.354 1.00 0.00 ? 218 LEU A CA   1  
ATOM 3360   C C    . LEU A 1 218 ? -7.709  9.455   -28.983 1.00 0.00 ? 218 LEU A C    1  
ATOM 3361   O O    . LEU A 1 218 ? -8.650  9.561   -28.220 1.00 0.00 ? 218 LEU A O    1  
ATOM 3362   C CB   . LEU A 1 218 ? -5.820  10.830  -28.246 1.00 0.00 ? 218 LEU A CB   1  
ATOM 3363   C CG   . LEU A 1 218 ? -4.931  12.046  -28.508 1.00 0.00 ? 218 LEU A CG   1  
ATOM 3364   C CD1  . LEU A 1 218 ? -3.938  12.181  -27.354 1.00 0.00 ? 218 LEU A CD1  1  
ATOM 3365   C CD2  . LEU A 1 218 ? -4.173  11.886  -29.836 1.00 0.00 ? 218 LEU A CD2  1  
ATOM 3366   H H    . LEU A 1 218 ? -8.291  12.134  -28.678 1.00 0.00 ? 218 LEU A H    1  
ATOM 3367   H HA   . LEU A 1 218 ? -6.364  10.494  -30.296 1.00 0.00 ? 218 LEU A HA   1  
ATOM 3368   H HB2  . LEU A 1 218 ? -6.327  10.959  -27.301 1.00 0.00 ? 218 LEU A HB2  1  
ATOM 3369   H HB3  . LEU A 1 218 ? -5.204  9.944   -28.200 1.00 0.00 ? 218 LEU A HB3  1  
ATOM 3370   H HG   . LEU A 1 218 ? -5.548  12.933  -28.550 1.00 0.00 ? 218 LEU A HG   1  
ATOM 3371   H HD11 . LEU A 1 218 ? -3.289  13.026  -27.534 1.00 0.00 ? 218 LEU A HD11 1  
ATOM 3372   H HD12 . LEU A 1 218 ? -3.345  11.281  -27.281 1.00 0.00 ? 218 LEU A HD12 1  
ATOM 3373   H HD13 . LEU A 1 218 ? -4.478  12.334  -26.431 1.00 0.00 ? 218 LEU A HD13 1  
ATOM 3374   H HD21 . LEU A 1 218 ? -4.091  10.837  -30.080 1.00 0.00 ? 218 LEU A HD21 1  
ATOM 3375   H HD22 . LEU A 1 218 ? -3.184  12.311  -29.741 1.00 0.00 ? 218 LEU A HD22 1  
ATOM 3376   H HD23 . LEU A 1 218 ? -4.710  12.397  -30.622 1.00 0.00 ? 218 LEU A HD23 1  
ATOM 3377   N N    . ILE A 1 219 ? -7.349  8.293   -29.473 1.00 0.00 ? 219 ILE A N    1  
ATOM 3378   C CA   . ILE A 1 219 ? -8.094  7.053   -29.103 1.00 0.00 ? 219 ILE A CA   1  
ATOM 3379   C C    . ILE A 1 219 ? -7.092  6.160   -28.369 1.00 0.00 ? 219 ILE A C    1  
ATOM 3380   O O    . ILE A 1 219 ? -6.014  5.889   -28.861 1.00 0.00 ? 219 ILE A O    1  
ATOM 3381   C CB   . ILE A 1 219 ? -8.626  6.352   -30.351 1.00 0.00 ? 219 ILE A CB   1  
ATOM 3382   C CG1  . ILE A 1 219 ? -9.465  7.347   -31.168 1.00 0.00 ? 219 ILE A CG1  1  
ATOM 3383   C CG2  . ILE A 1 219 ? -9.515  5.176   -29.927 1.00 0.00 ? 219 ILE A CG2  1  
ATOM 3384   C CD1  . ILE A 1 219 ? -9.861  6.728   -32.516 1.00 0.00 ? 219 ILE A CD1  1  
ATOM 3385   H H    . ILE A 1 219 ? -6.561  8.233   -30.052 1.00 0.00 ? 219 ILE A H    1  
ATOM 3386   H HA   . ILE A 1 219 ? -8.911  7.304   -28.439 1.00 0.00 ? 219 ILE A HA   1  
ATOM 3387   H HB   . ILE A 1 219 ? -7.802  5.990   -30.948 1.00 0.00 ? 219 ILE A HB   1  
ATOM 3388   H HG12 . ILE A 1 219 ? -10.357 7.602   -30.614 1.00 0.00 ? 219 ILE A HG12 1  
ATOM 3389   H HG13 . ILE A 1 219 ? -8.887  8.242   -31.343 1.00 0.00 ? 219 ILE A HG13 1  
ATOM 3390   H HG21 . ILE A 1 219 ? -10.206 5.504   -29.164 1.00 0.00 ? 219 ILE A HG21 1  
ATOM 3391   H HG22 . ILE A 1 219 ? -8.898  4.381   -29.536 1.00 0.00 ? 219 ILE A HG22 1  
ATOM 3392   H HG23 . ILE A 1 219 ? -10.068 4.816   -30.782 1.00 0.00 ? 219 ILE A HG23 1  
ATOM 3393   H HD11 . ILE A 1 219 ? -9.867  7.494   -33.277 1.00 0.00 ? 219 ILE A HD11 1  
ATOM 3394   H HD12 . ILE A 1 219 ? -10.846 6.292   -32.436 1.00 0.00 ? 219 ILE A HD12 1  
ATOM 3395   H HD13 . ILE A 1 219 ? -9.149  5.961   -32.783 1.00 0.00 ? 219 ILE A HD13 1  
ATOM 3396   N N    . LEU A 1 220 ? -7.423  5.722   -27.184 1.00 0.00 ? 220 LEU A N    1  
ATOM 3397   C CA   . LEU A 1 220 ? -6.480  4.874   -26.395 1.00 0.00 ? 220 LEU A CA   1  
ATOM 3398   C C    . LEU A 1 220 ? -6.862  3.405   -26.555 1.00 0.00 ? 220 LEU A C    1  
ATOM 3399   O O    . LEU A 1 220 ? -7.934  2.984   -26.173 1.00 0.00 ? 220 LEU A O    1  
ATOM 3400   C CB   . LEU A 1 220 ? -6.590  5.319   -24.931 1.00 0.00 ? 220 LEU A CB   1  
ATOM 3401   C CG   . LEU A 1 220 ? -5.726  4.455   -24.010 1.00 0.00 ? 220 LEU A CG   1  
ATOM 3402   C CD1  . LEU A 1 220 ? -4.257  4.560   -24.419 1.00 0.00 ? 220 LEU A CD1  1  
ATOM 3403   C CD2  . LEU A 1 220 ? -5.889  4.957   -22.567 1.00 0.00 ? 220 LEU A CD2  1  
ATOM 3404   H H    . LEU A 1 220 ? -8.289  5.970   -26.799 1.00 0.00 ? 220 LEU A H    1  
ATOM 3405   H HA   . LEU A 1 220 ? -5.471  5.028   -26.747 1.00 0.00 ? 220 LEU A HA   1  
ATOM 3406   H HB2  . LEU A 1 220 ? -6.269  6.348   -24.850 1.00 0.00 ? 220 LEU A HB2  1  
ATOM 3407   H HB3  . LEU A 1 220 ? -7.622  5.247   -24.617 1.00 0.00 ? 220 LEU A HB3  1  
ATOM 3408   H HG   . LEU A 1 220 ? -6.047  3.426   -24.074 1.00 0.00 ? 220 LEU A HG   1  
ATOM 3409   H HD11 . LEU A 1 220 ? -4.035  5.577   -24.708 1.00 0.00 ? 220 LEU A HD11 1  
ATOM 3410   H HD12 . LEU A 1 220 ? -4.067  3.900   -25.253 1.00 0.00 ? 220 LEU A HD12 1  
ATOM 3411   H HD13 . LEU A 1 220 ? -3.630  4.277   -23.586 1.00 0.00 ? 220 LEU A HD13 1  
ATOM 3412   H HD21 . LEU A 1 220 ? -6.932  5.160   -22.373 1.00 0.00 ? 220 LEU A HD21 1  
ATOM 3413   H HD22 . LEU A 1 220 ? -5.315  5.862   -22.434 1.00 0.00 ? 220 LEU A HD22 1  
ATOM 3414   H HD23 . LEU A 1 220 ? -5.535  4.201   -21.881 1.00 0.00 ? 220 LEU A HD23 1  
ATOM 3415   N N    . ASP A 1 221 ? -5.982  2.611   -27.107 1.00 0.00 ? 221 ASP A N    1  
ATOM 3416   C CA   . ASP A 1 221 ? -6.286  1.164   -27.277 1.00 0.00 ? 221 ASP A CA   1  
ATOM 3417   C C    . ASP A 1 221 ? -6.151  0.475   -25.924 1.00 0.00 ? 221 ASP A C    1  
ATOM 3418   O O    . ASP A 1 221 ? -6.978  -0.321  -25.542 1.00 0.00 ? 221 ASP A O    1  
ATOM 3419   C CB   . ASP A 1 221 ? -5.308  0.527   -28.278 1.00 0.00 ? 221 ASP A CB   1  
ATOM 3420   C CG   . ASP A 1 221 ? -5.347  1.295   -29.597 1.00 0.00 ? 221 ASP A CG   1  
ATOM 3421   O OD1  . ASP A 1 221 ? -6.397  1.833   -29.905 1.00 0.00 ? 221 ASP A OD1  1  
ATOM 3422   O OD2  . ASP A 1 221 ? -4.328  1.345   -30.270 1.00 0.00 ? 221 ASP A OD2  1  
ATOM 3423   H H    . ASP A 1 221 ? -5.117  2.967   -27.398 1.00 0.00 ? 221 ASP A H    1  
ATOM 3424   H HA   . ASP A 1 221 ? -7.297  1.050   -27.639 1.00 0.00 ? 221 ASP A HA   1  
ATOM 3425   H HB2  . ASP A 1 221 ? -4.307  0.559   -27.872 1.00 0.00 ? 221 ASP A HB2  1  
ATOM 3426   H HB3  . ASP A 1 221 ? -5.592  -0.500  -28.454 1.00 0.00 ? 221 ASP A HB3  1  
ATOM 3427   N N    . ALA A 1 222 ? -5.104  0.771   -25.203 1.00 0.00 ? 222 ALA A N    1  
ATOM 3428   C CA   . ALA A 1 222 ? -4.907  0.126   -23.877 1.00 0.00 ? 222 ALA A CA   1  
ATOM 3429   C C    . ALA A 1 222 ? -5.078  -1.394  -24.037 1.00 0.00 ? 222 ALA A C    1  
ATOM 3430   O O    . ALA A 1 222 ? -5.203  -2.126  -23.077 1.00 0.00 ? 222 ALA A O    1  
ATOM 3431   C CB   . ALA A 1 222 ? -5.935  0.696   -22.880 1.00 0.00 ? 222 ALA A CB   1  
ATOM 3432   H H    . ALA A 1 222 ? -4.444  1.413   -25.538 1.00 0.00 ? 222 ALA A H    1  
ATOM 3433   H HA   . ALA A 1 222 ? -3.908  0.337   -23.523 1.00 0.00 ? 222 ALA A HA   1  
ATOM 3434   H HB1  . ALA A 1 222 ? -6.362  -0.111  -22.302 1.00 0.00 ? 222 ALA A HB1  1  
ATOM 3435   H HB2  . ALA A 1 222 ? -6.720  1.204   -23.423 1.00 0.00 ? 222 ALA A HB2  1  
ATOM 3436   H HB3  . ALA A 1 222 ? -5.446  1.395   -22.218 1.00 0.00 ? 222 ALA A HB3  1  
ATOM 3437   N N    . VAL A 1 223 ? -5.055  -1.860  -25.262 1.00 0.00 ? 223 VAL A N    1  
ATOM 3438   C CA   . VAL A 1 223 ? -5.181  -3.322  -25.544 1.00 0.00 ? 223 VAL A CA   1  
ATOM 3439   C C    . VAL A 1 223 ? -4.038  -3.700  -26.483 1.00 0.00 ? 223 VAL A C    1  
ATOM 3440   O O    . VAL A 1 223 ? -3.312  -4.647  -26.254 1.00 0.00 ? 223 VAL A O    1  
ATOM 3441   C CB   . VAL A 1 223 ? -6.528  -3.614  -26.212 1.00 0.00 ? 223 VAL A CB   1  
ATOM 3442   C CG1  . VAL A 1 223 ? -7.625  -3.657  -25.152 1.00 0.00 ? 223 VAL A CG1  1  
ATOM 3443   C CG2  . VAL A 1 223 ? -6.839  -2.509  -27.224 1.00 0.00 ? 223 VAL A CG2  1  
ATOM 3444   H H    . VAL A 1 223 ? -4.934  -1.237  -26.009 1.00 0.00 ? 223 VAL A H    1  
ATOM 3445   H HA   . VAL A 1 223 ? -5.097  -3.880  -24.622 1.00 0.00 ? 223 VAL A HA   1  
ATOM 3446   H HB   . VAL A 1 223 ? -6.479  -4.567  -26.719 1.00 0.00 ? 223 VAL A HB   1  
ATOM 3447   H HG11 . VAL A 1 223 ? -8.583  -3.486  -25.619 1.00 0.00 ? 223 VAL A HG11 1  
ATOM 3448   H HG12 . VAL A 1 223 ? -7.443  -2.890  -24.414 1.00 0.00 ? 223 VAL A HG12 1  
ATOM 3449   H HG13 . VAL A 1 223 ? -7.625  -4.625  -24.673 1.00 0.00 ? 223 VAL A HG13 1  
ATOM 3450   H HG21 . VAL A 1 223 ? -7.770  -2.029  -26.957 1.00 0.00 ? 223 VAL A HG21 1  
ATOM 3451   H HG22 . VAL A 1 223 ? -6.926  -2.938  -28.211 1.00 0.00 ? 223 VAL A HG22 1  
ATOM 3452   H HG23 . VAL A 1 223 ? -6.043  -1.779  -27.217 1.00 0.00 ? 223 VAL A HG23 1  
ATOM 3453   N N    . ASN A 1 224 ? -3.837  -2.917  -27.512 1.00 0.00 ? 224 ASN A N    1  
ATOM 3454   C CA   . ASN A 1 224 ? -2.698  -3.164  -28.443 1.00 0.00 ? 224 ASN A CA   1  
ATOM 3455   C C    . ASN A 1 224 ? -1.571  -2.236  -28.001 1.00 0.00 ? 224 ASN A C    1  
ATOM 3456   O O    . ASN A 1 224 ? -0.505  -2.196  -28.584 1.00 0.00 ? 224 ASN A O    1  
ATOM 3457   C CB   . ASN A 1 224 ? -3.104  -2.851  -29.889 1.00 0.00 ? 224 ASN A CB   1  
ATOM 3458   C CG   . ASN A 1 224 ? -3.409  -1.357  -30.028 1.00 0.00 ? 224 ASN A CG   1  
ATOM 3459   O OD1  . ASN A 1 224 ? -3.035  -0.567  -29.185 1.00 0.00 ? 224 ASN A OD1  1  
ATOM 3460   N ND2  . ASN A 1 224 ? -4.089  -0.933  -31.059 1.00 0.00 ? 224 ASN A ND2  1  
ATOM 3461   H H    . ASN A 1 224 ? -4.411  -2.134  -27.644 1.00 0.00 ? 224 ASN A H    1  
ATOM 3462   H HA   . ASN A 1 224 ? -2.376  -4.193  -28.362 1.00 0.00 ? 224 ASN A HA   1  
ATOM 3463   H HB2  . ASN A 1 224 ? -2.295  -3.117  -30.554 1.00 0.00 ? 224 ASN A HB2  1  
ATOM 3464   H HB3  . ASN A 1 224 ? -3.983  -3.421  -30.147 1.00 0.00 ? 224 ASN A HB3  1  
ATOM 3465   H HD21 . ASN A 1 224 ? -4.400  -1.569  -31.736 1.00 0.00 ? 224 ASN A HD21 1  
ATOM 3466   H HD22 . ASN A 1 224 ? -4.288  0.022   -31.156 1.00 0.00 ? 224 ASN A HD22 1  
ATOM 3467   N N    . ASN A 1 225 ? -1.822  -1.486  -26.960 1.00 0.00 ? 225 ASN A N    1  
ATOM 3468   C CA   . ASN A 1 225 ? -0.801  -0.544  -26.434 1.00 0.00 ? 225 ASN A CA   1  
ATOM 3469   C C    . ASN A 1 225 ? -0.431  0.469   -27.519 1.00 0.00 ? 225 ASN A C    1  
ATOM 3470   O O    . ASN A 1 225 ? 0.728   0.737   -27.757 1.00 0.00 ? 225 ASN A O    1  
ATOM 3471   C CB   . ASN A 1 225 ? 0.442   -1.328  -26.000 1.00 0.00 ? 225 ASN A CB   1  
ATOM 3472   C CG   . ASN A 1 225 ? 1.565   -1.128  -27.028 1.00 0.00 ? 225 ASN A CG   1  
ATOM 3473   O OD1  . ASN A 1 225 ? 1.512   -1.669  -28.117 1.00 0.00 ? 225 ASN A OD1  1  
ATOM 3474   N ND2  . ASN A 1 225 ? 2.586   -0.372  -26.720 1.00 0.00 ? 225 ASN A ND2  1  
ATOM 3475   H H    . ASN A 1 225 ? -2.694  -1.548  -26.520 1.00 0.00 ? 225 ASN A H    1  
ATOM 3476   H HA   . ASN A 1 225 ? -1.207  -0.020  -25.582 1.00 0.00 ? 225 ASN A HA   1  
ATOM 3477   H HB2  . ASN A 1 225 ? 0.771   -0.974  -25.033 1.00 0.00 ? 225 ASN A HB2  1  
ATOM 3478   H HB3  . ASN A 1 225 ? 0.200   -2.378  -25.935 1.00 0.00 ? 225 ASN A HB3  1  
ATOM 3479   H HD21 . ASN A 1 225 ? 2.628   0.061   -25.842 1.00 0.00 ? 225 ASN A HD21 1  
ATOM 3480   H HD22 . ASN A 1 225 ? 3.308   -0.237  -27.368 1.00 0.00 ? 225 ASN A HD22 1  
ATOM 3481   N N    . GLN A 1 226 ? -1.415  1.035   -28.178 1.00 0.00 ? 226 GLN A N    1  
ATOM 3482   C CA   . GLN A 1 226 ? -1.131  2.041   -29.257 1.00 0.00 ? 226 GLN A CA   1  
ATOM 3483   C C    . GLN A 1 226 ? -2.063  3.243   -29.103 1.00 0.00 ? 226 GLN A C    1  
ATOM 3484   O O    . GLN A 1 226 ? -3.146  3.137   -28.560 1.00 0.00 ? 226 GLN A O    1  
ATOM 3485   C CB   . GLN A 1 226 ? -1.390  1.412   -30.629 1.00 0.00 ? 226 GLN A CB   1  
ATOM 3486   C CG   . GLN A 1 226 ? -0.328  0.347   -30.933 1.00 0.00 ? 226 GLN A CG   1  
ATOM 3487   C CD   . GLN A 1 226 ? -0.726  -0.406  -32.204 1.00 0.00 ? 226 GLN A CD   1  
ATOM 3488   O OE1  . GLN A 1 226 ? -1.895  -0.534  -32.506 1.00 0.00 ? 226 GLN A OE1  1  
ATOM 3489   N NE2  . GLN A 1 226 ? 0.202   -0.927  -32.965 1.00 0.00 ? 226 GLN A NE2  1  
ATOM 3490   H H    . GLN A 1 226 ? -2.343  0.799   -27.965 1.00 0.00 ? 226 GLN A H    1  
ATOM 3491   H HA   . GLN A 1 226 ? -0.103  2.365   -29.194 1.00 0.00 ? 226 GLN A HA   1  
ATOM 3492   H HB2  . GLN A 1 226 ? -2.368  0.953   -30.633 1.00 0.00 ? 226 GLN A HB2  1  
ATOM 3493   H HB3  . GLN A 1 226 ? -1.351  2.179   -31.388 1.00 0.00 ? 226 GLN A HB3  1  
ATOM 3494   H HG2  . GLN A 1 226 ? 0.630   0.824   -31.078 1.00 0.00 ? 226 GLN A HG2  1  
ATOM 3495   H HG3  . GLN A 1 226 ? -0.266  -0.347  -30.108 1.00 0.00 ? 226 GLN A HG3  1  
ATOM 3496   H HE21 . GLN A 1 226 ? 1.146   -0.834  -32.719 1.00 0.00 ? 226 GLN A HE21 1  
ATOM 3497   H HE22 . GLN A 1 226 ? -0.047  -1.410  -33.779 1.00 0.00 ? 226 GLN A HE22 1  
ATOM 3498   N N    . VAL A 1 227 ? -1.655  4.381   -29.605 1.00 0.00 ? 227 VAL A N    1  
ATOM 3499   C CA   . VAL A 1 227 ? -2.507  5.612   -29.533 1.00 0.00 ? 227 VAL A CA   1  
ATOM 3500   C C    . VAL A 1 227 ? -2.705  6.145   -30.951 1.00 0.00 ? 227 VAL A C    1  
ATOM 3501   O O    . VAL A 1 227 ? -1.733  6.311   -31.688 1.00 0.00 ? 227 VAL A O    1  
ATOM 3502   C CB   . VAL A 1 227 ? -1.829  6.673   -28.666 1.00 0.00 ? 227 VAL A CB   1  
ATOM 3503   C CG1  . VAL A 1 227 ? -2.697  7.935   -28.633 1.00 0.00 ? 227 VAL A CG1  1  
ATOM 3504   C CG2  . VAL A 1 227 ? -1.656  6.136   -27.246 1.00 0.00 ? 227 VAL A CG2  1  
ATOM 3505   H H    . VAL A 1 227 ? -0.785  4.424   -30.053 1.00 0.00 ? 227 VAL A H    1  
ATOM 3506   H HA   . VAL A 1 227 ? -3.468  5.359   -29.109 1.00 0.00 ? 227 VAL A HA   1  
ATOM 3507   H HB   . VAL A 1 227 ? -0.861  6.913   -29.084 1.00 0.00 ? 227 VAL A HB   1  
ATOM 3508   H HG11 . VAL A 1 227 ? -3.714  7.665   -28.390 1.00 0.00 ? 227 VAL A HG11 1  
ATOM 3509   H HG12 . VAL A 1 227 ? -2.673  8.414   -29.600 1.00 0.00 ? 227 VAL A HG12 1  
ATOM 3510   H HG13 . VAL A 1 227 ? -2.317  8.614   -27.884 1.00 0.00 ? 227 VAL A HG13 1  
ATOM 3511   H HG21 . VAL A 1 227 ? -2.621  6.067   -26.766 1.00 0.00 ? 227 VAL A HG21 1  
ATOM 3512   H HG22 . VAL A 1 227 ? -1.022  6.805   -26.683 1.00 0.00 ? 227 VAL A HG22 1  
ATOM 3513   H HG23 . VAL A 1 227 ? -1.202  5.156   -27.283 1.00 0.00 ? 227 VAL A HG23 1  
ATOM 3514   N N    . TYR A 1 228 ? -3.927  6.416   -31.333 1.00 0.00 ? 228 TYR A N    1  
ATOM 3515   C CA   . TYR A 1 228 ? -4.190  6.949   -32.706 1.00 0.00 ? 228 TYR A CA   1  
ATOM 3516   C C    . TYR A 1 228 ? -4.451  8.457   -32.629 1.00 0.00 ? 228 TYR A C    1  
ATOM 3517   O O    . TYR A 1 228 ? -5.343  8.900   -31.903 1.00 0.00 ? 228 TYR A O    1  
ATOM 3518   C CB   . TYR A 1 228 ? -5.403  6.246   -33.319 1.00 0.00 ? 228 TYR A CB   1  
ATOM 3519   C CG   . TYR A 1 228 ? -5.086  4.784   -33.522 1.00 0.00 ? 228 TYR A CG   1  
ATOM 3520   C CD1  . TYR A 1 228 ? -4.262  4.384   -34.581 1.00 0.00 ? 228 TYR A CD1  1  
ATOM 3521   C CD2  . TYR A 1 228 ? -5.616  3.824   -32.647 1.00 0.00 ? 228 TYR A CD2  1  
ATOM 3522   C CE1  . TYR A 1 228 ? -3.969  3.029   -34.768 1.00 0.00 ? 228 TYR A CE1  1  
ATOM 3523   C CE2  . TYR A 1 228 ? -5.323  2.467   -32.835 1.00 0.00 ? 228 TYR A CE2  1  
ATOM 3524   C CZ   . TYR A 1 228 ? -4.499  2.070   -33.896 1.00 0.00 ? 228 TYR A CZ   1  
ATOM 3525   O OH   . TYR A 1 228 ? -4.209  0.733   -34.080 1.00 0.00 ? 228 TYR A OH   1  
ATOM 3526   H H    . TYR A 1 228 ? -4.673  6.275   -30.715 1.00 0.00 ? 228 TYR A H    1  
ATOM 3527   H HA   . TYR A 1 228 ? -3.324  6.771   -33.326 1.00 0.00 ? 228 TYR A HA   1  
ATOM 3528   H HB2  . TYR A 1 228 ? -6.249  6.343   -32.654 1.00 0.00 ? 228 TYR A HB2  1  
ATOM 3529   H HB3  . TYR A 1 228 ? -5.638  6.699   -34.271 1.00 0.00 ? 228 TYR A HB3  1  
ATOM 3530   H HD1  . TYR A 1 228 ? -3.853  5.123   -35.255 1.00 0.00 ? 228 TYR A HD1  1  
ATOM 3531   H HD2  . TYR A 1 228 ? -6.252  4.130   -31.829 1.00 0.00 ? 228 TYR A HD2  1  
ATOM 3532   H HE1  . TYR A 1 228 ? -3.334  2.722   -35.586 1.00 0.00 ? 228 TYR A HE1  1  
ATOM 3533   H HE2  . TYR A 1 228 ? -5.731  1.728   -32.162 1.00 0.00 ? 228 TYR A HE2  1  
ATOM 3534   H HH   . TYR A 1 228 ? -3.268  0.655   -34.252 1.00 0.00 ? 228 TYR A HH   1  
ATOM 3535   N N    . VAL A 1 229 ? -3.674  9.228   -33.343 1.00 0.00 ? 229 VAL A N    1  
ATOM 3536   C CA   . VAL A 1 229 ? -3.826  10.719  -33.317 1.00 0.00 ? 229 VAL A CA   1  
ATOM 3537   C C    . VAL A 1 229 ? -4.587  11.204  -34.563 1.00 0.00 ? 229 VAL A C    1  
ATOM 3538   O O    . VAL A 1 229 ? -4.073  11.096  -35.677 1.00 0.00 ? 229 VAL A O    1  
ATOM 3539   C CB   . VAL A 1 229 ? -2.449  11.383  -33.267 1.00 0.00 ? 229 VAL A CB   1  
ATOM 3540   C CG1  . VAL A 1 229 ? -2.613  12.903  -33.256 1.00 0.00 ? 229 VAL A CG1  1  
ATOM 3541   C CG2  . VAL A 1 229 ? -1.717  10.939  -31.997 1.00 0.00 ? 229 VAL A CG2  1  
ATOM 3542   H H    . VAL A 1 229 ? -2.968  8.826   -33.890 1.00 0.00 ? 229 VAL A H    1  
ATOM 3543   H HA   . VAL A 1 229 ? -4.384  10.999  -32.434 1.00 0.00 ? 229 VAL A HA   1  
ATOM 3544   H HB   . VAL A 1 229 ? -1.877  11.089  -34.136 1.00 0.00 ? 229 VAL A HB   1  
ATOM 3545   H HG11 . VAL A 1 229 ? -2.297  13.307  -34.207 1.00 0.00 ? 229 VAL A HG11 1  
ATOM 3546   H HG12 . VAL A 1 229 ? -2.009  13.326  -32.467 1.00 0.00 ? 229 VAL A HG12 1  
ATOM 3547   H HG13 . VAL A 1 229 ? -3.651  13.152  -33.087 1.00 0.00 ? 229 VAL A HG13 1  
ATOM 3548   H HG21 . VAL A 1 229 ? -0.764  10.507  -32.263 1.00 0.00 ? 229 VAL A HG21 1  
ATOM 3549   H HG22 . VAL A 1 229 ? -2.313  10.202  -31.477 1.00 0.00 ? 229 VAL A HG22 1  
ATOM 3550   H HG23 . VAL A 1 229 ? -1.559  11.792  -31.355 1.00 0.00 ? 229 VAL A HG23 1  
ATOM 3551   N N    . ASN A 1 230 ? -5.770  11.736  -34.386 1.00 0.00 ? 230 ASN A N    1  
ATOM 3552   C CA   . ASN A 1 230 ? -6.555  12.243  -35.556 1.00 0.00 ? 230 ASN A CA   1  
ATOM 3553   C C    . ASN A 1 230 ? -6.707  11.153  -36.621 1.00 0.00 ? 230 ASN A C    1  
ATOM 3554   O O    . ASN A 1 230 ? -6.602  11.423  -37.818 1.00 0.00 ? 230 ASN A O    1  
ATOM 3555   C CB   . ASN A 1 230 ? -5.852  13.459  -36.166 1.00 0.00 ? 230 ASN A CB   1  
ATOM 3556   C CG   . ASN A 1 230 ? -6.792  14.174  -37.133 1.00 0.00 ? 230 ASN A CG   1  
ATOM 3557   O OD1  . ASN A 1 230 ? -7.750  13.578  -37.621 1.00 0.00 ? 230 ASN A OD1  1  
ATOM 3558   N ND2  . ASN A 1 230 ? -6.573  15.423  -37.435 1.00 0.00 ? 230 ASN A ND2  1  
ATOM 3559   H H    . ASN A 1 230 ? -6.140  11.813  -33.482 1.00 0.00 ? 230 ASN A H    1  
ATOM 3560   H HA   . ASN A 1 230 ? -7.536  12.539  -35.217 1.00 0.00 ? 230 ASN A HA   1  
ATOM 3561   H HB2  . ASN A 1 230 ? -5.563  14.139  -35.377 1.00 0.00 ? 230 ASN A HB2  1  
ATOM 3562   H HB3  . ASN A 1 230 ? -4.971  13.133  -36.699 1.00 0.00 ? 230 ASN A HB3  1  
ATOM 3563   H HD21 . ASN A 1 230 ? -5.809  15.896  -37.042 1.00 0.00 ? 230 ASN A HD21 1  
ATOM 3564   H HD22 . ASN A 1 230 ? -7.172  15.889  -38.055 1.00 0.00 ? 230 ASN A HD22 1  
ATOM 3565   N N    . PRO A 1 231 ? -6.909  9.928   -36.210 1.00 0.00 ? 231 PRO A N    1  
ATOM 3566   C CA   . PRO A 1 231 ? -6.990  8.740   -37.134 1.00 0.00 ? 231 PRO A CA   1  
ATOM 3567   C C    . PRO A 1 231 ? -8.087  8.738   -38.188 1.00 0.00 ? 231 PRO A C    1  
ATOM 3568   O O    . PRO A 1 231 ? -8.994  9.545   -38.209 1.00 0.00 ? 231 PRO A O    1  
ATOM 3569   C CB   . PRO A 1 231 ? -7.278  7.571   -36.195 1.00 0.00 ? 231 PRO A CB   1  
ATOM 3570   C CG   . PRO A 1 231 ? -7.846  8.195   -34.965 1.00 0.00 ? 231 PRO A CG   1  
ATOM 3571   C CD   . PRO A 1 231 ? -7.111  9.512   -34.810 1.00 0.00 ? 231 PRO A CD   1  
ATOM 3572   H HA   . PRO A 1 231 ? -6.035  8.575   -37.600 1.00 0.00 ? 231 PRO A HA   1  
ATOM 3573   H HB2  . PRO A 1 231 ? -7.999  6.906   -36.636 1.00 0.00 ? 231 PRO A HB2  1  
ATOM 3574   H HB3  . PRO A 1 231 ? -6.377  7.043   -35.982 1.00 0.00 ? 231 PRO A HB3  1  
ATOM 3575   H HG2  . PRO A 1 231 ? -8.903  8.380   -35.104 1.00 0.00 ? 231 PRO A HG2  1  
ATOM 3576   H HG3  . PRO A 1 231 ? -7.691  7.570   -34.104 1.00 0.00 ? 231 PRO A HG3  1  
ATOM 3577   H HD2  . PRO A 1 231 ? -7.715  10.231  -34.270 1.00 0.00 ? 231 PRO A HD2  1  
ATOM 3578   H HD3  . PRO A 1 231 ? -6.170  9.349   -34.320 1.00 0.00 ? 231 PRO A HD3  1  
ATOM 3579   N N    . THR A 1 232 ? -8.000  7.729   -39.016 1.00 0.00 ? 232 THR A N    1  
ATOM 3580   C CA   . THR A 1 232 ? -9.011  7.488   -40.063 1.00 0.00 ? 232 THR A CA   1  
ATOM 3581   C C    . THR A 1 232 ? -10.239 6.911   -39.354 1.00 0.00 ? 232 THR A C    1  
ATOM 3582   O O    . THR A 1 232 ? -10.116 6.152   -38.413 1.00 0.00 ? 232 THR A O    1  
ATOM 3583   C CB   . THR A 1 232 ? -8.449  6.466   -41.058 1.00 0.00 ? 232 THR A CB   1  
ATOM 3584   O OG1  . THR A 1 232 ? -7.296  7.005   -41.689 1.00 0.00 ? 232 THR A OG1  1  
ATOM 3585   C CG2  . THR A 1 232 ? -9.502  6.131   -42.115 1.00 0.00 ? 232 THR A CG2  1  
ATOM 3586   H H    . THR A 1 232 ? -7.271  7.083   -38.903 1.00 0.00 ? 232 THR A H    1  
ATOM 3587   H HA   . THR A 1 232 ? -9.261  8.409   -40.566 1.00 0.00 ? 232 THR A HA   1  
ATOM 3588   H HB   . THR A 1 232 ? -8.180  5.561   -40.530 1.00 0.00 ? 232 THR A HB   1  
ATOM 3589   H HG1  . THR A 1 232 ? -6.623  7.126   -41.019 1.00 0.00 ? 232 THR A HG1  1  
ATOM 3590   H HG21 . THR A 1 232 ? -9.009  5.770   -43.009 1.00 0.00 ? 232 THR A HG21 1  
ATOM 3591   H HG22 . THR A 1 232 ? -10.073 7.014   -42.352 1.00 0.00 ? 232 THR A HG22 1  
ATOM 3592   H HG23 . THR A 1 232 ? -10.164 5.367   -41.734 1.00 0.00 ? 232 THR A HG23 1  
ATOM 3593   N N    . ASN A 1 233 ? -11.414 7.281   -39.758 1.00 0.00 ? 233 ASN A N    1  
ATOM 3594   C CA   . ASN A 1 233 ? -12.630 6.771   -39.060 1.00 0.00 ? 233 ASN A CA   1  
ATOM 3595   C C    . ASN A 1 233 ? -12.564 5.239   -38.893 1.00 0.00 ? 233 ASN A C    1  
ATOM 3596   O O    . ASN A 1 233 ? -13.170 4.685   -37.996 1.00 0.00 ? 233 ASN A O    1  
ATOM 3597   C CB   . ASN A 1 233 ? -13.878 7.158   -39.869 1.00 0.00 ? 233 ASN A CB   1  
ATOM 3598   C CG   . ASN A 1 233 ? -14.254 8.615   -39.578 1.00 0.00 ? 233 ASN A CG   1  
ATOM 3599   O OD1  . ASN A 1 233 ? -14.941 8.898   -38.617 1.00 0.00 ? 233 ASN A OD1  1  
ATOM 3600   N ND2  . ASN A 1 233 ? -13.824 9.557   -40.373 1.00 0.00 ? 233 ASN A ND2  1  
ATOM 3601   H H    . ASN A 1 233 ? -11.502 7.915   -40.500 1.00 0.00 ? 233 ASN A H    1  
ATOM 3602   H HA   . ASN A 1 233 ? -12.685 7.227   -38.082 1.00 0.00 ? 233 ASN A HA   1  
ATOM 3603   H HB2  . ASN A 1 233 ? -13.668 7.045   -40.924 1.00 0.00 ? 233 ASN A HB2  1  
ATOM 3604   H HB3  . ASN A 1 233 ? -14.701 6.515   -39.597 1.00 0.00 ? 233 ASN A HB3  1  
ATOM 3605   H HD21 . ASN A 1 233 ? -13.265 9.329   -41.146 1.00 0.00 ? 233 ASN A HD21 1  
ATOM 3606   H HD22 . ASN A 1 233 ? -14.055 10.493  -40.196 1.00 0.00 ? 233 ASN A HD22 1  
ATOM 3607   N N    . GLU A 1 234 ? -11.856 4.548   -39.749 1.00 0.00 ? 234 GLU A N    1  
ATOM 3608   C CA   . GLU A 1 234 ? -11.786 3.055   -39.628 1.00 0.00 ? 234 GLU A CA   1  
ATOM 3609   C C    . GLU A 1 234 ? -11.086 2.652   -38.315 1.00 0.00 ? 234 GLU A C    1  
ATOM 3610   O O    . GLU A 1 234 ? -11.482 1.719   -37.650 1.00 0.00 ? 234 GLU A O    1  
ATOM 3611   C CB   . GLU A 1 234 ? -11.033 2.478   -40.837 1.00 0.00 ? 234 GLU A CB   1  
ATOM 3612   C CG   . GLU A 1 234 ? -9.519  2.583   -40.626 1.00 0.00 ? 234 GLU A CG   1  
ATOM 3613   C CD   . GLU A 1 234 ? -8.803  2.362   -41.959 1.00 0.00 ? 234 GLU A CD   1  
ATOM 3614   O OE1  . GLU A 1 234 ? -8.620  3.333   -42.677 1.00 0.00 ? 234 GLU A OE1  1  
ATOM 3615   O OE2  . GLU A 1 234 ? -8.451  1.227   -42.241 1.00 0.00 ? 234 GLU A OE2  1  
ATOM 3616   H H    . GLU A 1 234 ? -11.385 5.003   -40.475 1.00 0.00 ? 234 GLU A H    1  
ATOM 3617   H HA   . GLU A 1 234 ? -12.792 2.659   -39.622 1.00 0.00 ? 234 GLU A HA   1  
ATOM 3618   H HB2  . GLU A 1 234 ? -11.305 1.441   -40.965 1.00 0.00 ? 234 GLU A HB2  1  
ATOM 3619   H HB3  . GLU A 1 234 ? -11.307 3.030   -41.724 1.00 0.00 ? 234 GLU A HB3  1  
ATOM 3620   H HG2  . GLU A 1 234 ? -9.275  3.560   -40.238 1.00 0.00 ? 234 GLU A HG2  1  
ATOM 3621   H HG3  . GLU A 1 234 ? -9.203  1.826   -39.922 1.00 0.00 ? 234 GLU A HG3  1  
ATOM 3622   N N    . VAL A 1 235 ? -10.058 3.341   -37.927 1.00 0.00 ? 235 VAL A N    1  
ATOM 3623   C CA   . VAL A 1 235 ? -9.378  2.984   -36.647 1.00 0.00 ? 235 VAL A CA   1  
ATOM 3624   C C    . VAL A 1 235 ? -10.335 3.288   -35.491 1.00 0.00 ? 235 VAL A C    1  
ATOM 3625   O O    . VAL A 1 235 ? -10.498 2.507   -34.574 1.00 0.00 ? 235 VAL A O    1  
ATOM 3626   C CB   . VAL A 1 235 ? -8.118  3.815   -36.491 1.00 0.00 ? 235 VAL A CB   1  
ATOM 3627   C CG1  . VAL A 1 235 ? -7.477  3.572   -35.108 1.00 0.00 ? 235 VAL A CG1  1  
ATOM 3628   C CG2  . VAL A 1 235 ? -7.130  3.449   -37.607 1.00 0.00 ? 235 VAL A CG2  1  
ATOM 3629   H H    . VAL A 1 235 ? -9.740  4.098   -38.461 1.00 0.00 ? 235 VAL A H    1  
ATOM 3630   H HA   . VAL A 1 235 ? -9.128  1.933   -36.647 1.00 0.00 ? 235 VAL A HA   1  
ATOM 3631   H HB   . VAL A 1 235 ? -8.385  4.848   -36.582 1.00 0.00 ? 235 VAL A HB   1  
ATOM 3632   H HG11 . VAL A 1 235 ? -7.472  4.499   -34.554 1.00 0.00 ? 235 VAL A HG11 1  
ATOM 3633   H HG12 . VAL A 1 235 ? -6.472  3.223   -35.233 1.00 0.00 ? 235 VAL A HG12 1  
ATOM 3634   H HG13 . VAL A 1 235 ? -8.031  2.833   -34.554 1.00 0.00 ? 235 VAL A HG13 1  
ATOM 3635   H HG21 . VAL A 1 235 ? -7.556  3.708   -38.566 1.00 0.00 ? 235 VAL A HG21 1  
ATOM 3636   H HG22 . VAL A 1 235 ? -6.929  2.389   -37.578 1.00 0.00 ? 235 VAL A HG22 1  
ATOM 3637   H HG23 . VAL A 1 235 ? -6.208  3.993   -37.462 1.00 0.00 ? 235 VAL A HG23 1  
ATOM 3638   N N    . ILE A 1 236 ? -11.012 4.394   -35.575 1.00 0.00 ? 236 ILE A N    1  
ATOM 3639   C CA   . ILE A 1 236 ? -11.998 4.745   -34.564 1.00 0.00 ? 236 ILE A CA   1  
ATOM 3640   C C    . ILE A 1 236 ? -13.004 3.612   -34.503 1.00 0.00 ? 236 ILE A C    1  
ATOM 3641   O O    . ILE A 1 236 ? -13.686 3.407   -33.509 1.00 0.00 ? 236 ILE A O    1  
ATOM 3642   C CB   . ILE A 1 236 ? -12.683 6.123   -34.813 1.00 0.00 ? 236 ILE A CB   1  
ATOM 3643   C CG1  . ILE A 1 236 ? -11.718 7.087   -35.496 1.00 0.00 ? 236 ILE A CG1  1  
ATOM 3644   C CG2  . ILE A 1 236 ? -13.146 6.761   -33.495 1.00 0.00 ? 236 ILE A CG2  1  
ATOM 3645   C CD1  . ILE A 1 236 ? -12.320 8.453   -35.824 1.00 0.00 ? 236 ILE A CD1  1  
ATOM 3646   H H    . ILE A 1 236 ? -10.916 4.960   -36.370 1.00 0.00 ? 236 ILE A H    1  
ATOM 3647   H HA   . ILE A 1 236 ? -11.489 4.786   -33.608 1.00 0.00 ? 236 ILE A HA   1  
ATOM 3648   H HB   . ILE A 1 236 ? -13.544 5.974   -35.450 1.00 0.00 ? 236 ILE A HB   1  
ATOM 3649   H HG12 . ILE A 1 236 ? -10.868 7.238   -34.849 1.00 0.00 ? 236 ILE A HG12 1  
ATOM 3650   H HG13 . ILE A 1 236 ? -11.372 6.631   -36.413 1.00 0.00 ? 236 ILE A HG13 1  
ATOM 3651   H HG21 . ILE A 1 236 ? -12.492 7.585   -33.245 1.00 0.00 ? 236 ILE A HG21 1  
ATOM 3652   H HG22 . ILE A 1 236 ? -13.114 6.024   -32.706 1.00 0.00 ? 236 ILE A HG22 1  
ATOM 3653   H HG23 . ILE A 1 236 ? -14.157 7.125   -33.607 1.00 0.00 ? 236 ILE A HG23 1  
ATOM 3654   H HD11 . ILE A 1 236 ? -11.776 8.899   -36.643 1.00 0.00 ? 236 ILE A HD11 1  
ATOM 3655   H HD12 . ILE A 1 236 ? -12.255 9.094   -34.957 1.00 0.00 ? 236 ILE A HD12 1  
ATOM 3656   H HD13 . ILE A 1 236 ? -13.356 8.331   -36.104 1.00 0.00 ? 236 ILE A HD13 1  
ATOM 3657   N N    . ASP A 1 237 ? -13.044 2.836   -35.567 1.00 0.00 ? 237 ASP A N    1  
ATOM 3658   C CA   . ASP A 1 237 ? -13.948 1.705   -35.617 1.00 0.00 ? 237 ASP A CA   1  
ATOM 3659   C C    . ASP A 1 237 ? -13.391 0.435   -34.979 1.00 0.00 ? 237 ASP A C    1  
ATOM 3660   O O    . ASP A 1 237 ? -14.002 -0.079  -34.053 1.00 0.00 ? 237 ASP A O    1  
ATOM 3661   C CB   . ASP A 1 237 ? -14.448 1.505   -37.046 1.00 0.00 ? 237 ASP A CB   1  
ATOM 3662   C CG   . ASP A 1 237 ? -15.154 2.749   -37.581 1.00 0.00 ? 237 ASP A CG   1  
ATOM 3663   O OD1  . ASP A 1 237 ? -15.933 3.360   -36.810 1.00 0.00 ? 237 ASP A OD1  1  
ATOM 3664   O OD2  . ASP A 1 237 ? -14.923 3.131   -38.753 1.00 0.00 ? 237 ASP A OD2  1  
ATOM 3665   H H    . ASP A 1 237 ? -12.447 3.016   -36.323 1.00 0.00 ? 237 ASP A H    1  
ATOM 3666   H HA   . ASP A 1 237 ? -14.811 1.982   -35.027 1.00 0.00 ? 237 ASP A HA   1  
ATOM 3667   H HB2  . ASP A 1 237 ? -13.607 1.277   -37.685 1.00 0.00 ? 237 ASP A HB2  1  
ATOM 3668   H HB3  . ASP A 1 237 ? -15.138 0.674   -37.064 1.00 0.00 ? 237 ASP A HB3  1  
ATOM 3669   N N    . LYS A 1 238 ? -12.226 -0.034  -35.447 1.00 0.00 ? 238 LYS A N    1  
ATOM 3670   C CA   . LYS A 1 238 ? -11.493 -1.178  -34.860 1.00 0.00 ? 238 LYS A CA   1  
ATOM 3671   C C    . LYS A 1 238 ? -11.474 -1.095  -33.342 1.00 0.00 ? 238 LYS A C    1  
ATOM 3672   O O    . LYS A 1 238 ? -11.829 -2.054  -32.653 1.00 0.00 ? 238 LYS A O    1  
ATOM 3673   C CB   . LYS A 1 238 ? -10.026 -1.172  -35.292 1.00 0.00 ? 238 LYS A CB   1  
ATOM 3674   C CG   . LYS A 1 238 ? -9.730  -1.442  -36.750 1.00 0.00 ? 238 LYS A CG   1  
ATOM 3675   C CD   . LYS A 1 238 ? -8.207  -1.384  -36.954 1.00 0.00 ? 238 LYS A CD   1  
ATOM 3676   C CE   . LYS A 1 238 ? -7.786  -1.646  -38.394 1.00 0.00 ? 238 LYS A CE   1  
ATOM 3677   N NZ   . LYS A 1 238 ? -6.294  -1.557  -38.477 1.00 0.00 ? 238 LYS A NZ   1  
ATOM 3678   H H    . LYS A 1 238 ? -11.794 0.460   -36.175 1.00 0.00 ? 238 LYS A H    1  
ATOM 3679   H HA   . LYS A 1 238 ? -11.952 -2.103  -35.169 1.00 0.00 ? 238 LYS A HA   1  
ATOM 3680   H HB2  . LYS A 1 238 ? -9.613  -0.206  -35.051 1.00 0.00 ? 238 LYS A HB2  1  
ATOM 3681   H HB3  . LYS A 1 238 ? -9.505  -1.911  -34.697 1.00 0.00 ? 238 LYS A HB3  1  
ATOM 3682   H HG2  . LYS A 1 238 ? -10.099 -2.421  -37.021 1.00 0.00 ? 238 LYS A HG2  1  
ATOM 3683   H HG3  . LYS A 1 238 ? -10.203 -0.690  -37.364 1.00 0.00 ? 238 LYS A HG3  1  
ATOM 3684   H HD2  . LYS A 1 238 ? -7.854  -0.406  -36.664 1.00 0.00 ? 238 LYS A HD2  1  
ATOM 3685   H HD3  . LYS A 1 238 ? -7.744  -2.123  -36.314 1.00 0.00 ? 238 LYS A HD3  1  
ATOM 3686   H HE2  . LYS A 1 238 ? -8.110  -2.632  -38.693 1.00 0.00 ? 238 LYS A HE2  1  
ATOM 3687   H HE3  . LYS A 1 238 ? -8.229  -0.905  -39.042 1.00 0.00 ? 238 LYS A HE3  1  
ATOM 3688   H HZ1  . LYS A 1 238 ? -6.004  -0.559  -38.456 1.00 0.00 ? 238 LYS A HZ1  1  
ATOM 3689   H HZ2  . LYS A 1 238 ? -5.971  -1.995  -39.364 1.00 0.00 ? 238 LYS A HZ2  1  
ATOM 3690   H HZ3  . LYS A 1 238 ? -5.871  -2.056  -37.669 1.00 0.00 ? 238 LYS A HZ3  1  
ATOM 3691   N N    . MET A 1 239 ? -11.036 0.065   -32.847 1.00 0.00 ? 239 MET A N    1  
ATOM 3692   C CA   . MET A 1 239 ? -10.997 0.369   -31.430 1.00 0.00 ? 239 MET A CA   1  
ATOM 3693   C C    . MET A 1 239 ? -12.357 0.206   -30.779 1.00 0.00 ? 239 MET A C    1  
ATOM 3694   O O    . MET A 1 239 ? -12.478 -0.440  -29.737 1.00 0.00 ? 239 MET A O    1  
ATOM 3695   C CB   . MET A 1 239 ? -10.472 1.790   -31.204 1.00 0.00 ? 239 MET A CB   1  
ATOM 3696   C CG   . MET A 1 239 ? -8.965  1.906   -31.249 1.00 0.00 ? 239 MET A CG   1  
ATOM 3697   S SD   . MET A 1 239 ? -8.184  0.886   -32.714 1.00 0.00 ? 239 MET A SD   1  
ATOM 3698   C CE   . MET A 1 239 ? -7.449  -0.620  -31.677 1.00 0.00 ? 239 MET A CE   1  
ATOM 3699   H H    . MET A 1 239 ? -10.763 0.764   -33.478 1.00 0.00 ? 239 MET A H    1  
ATOM 3700   H HA   . MET A 1 239 ? -10.313 -0.319  -30.957 1.00 0.00 ? 239 MET A HA   1  
ATOM 3701   H HB2  . MET A 1 239 ? -10.886 2.434   -31.964 1.00 0.00 ? 239 MET A HB2  1  
ATOM 3702   H HB3  . MET A 1 239 ? -10.819 2.133   -30.238 1.00 0.00 ? 239 MET A HB3  1  
ATOM 3703   H HG2  . MET A 1 239 ? -8.698  2.947   -31.365 1.00 0.00 ? 239 MET A HG2  1  
ATOM 3704   H HG3  . MET A 1 239 ? -8.559  1.542   -30.317 1.00 0.00 ? 239 MET A HG3  1  
ATOM 3705   H HE1  . MET A 1 239 ? -8.010  -0.730  -30.759 1.00 0.00 ? 239 MET A HE1  1  
ATOM 3706   H HE2  . MET A 1 239 ? -6.416  -0.427  -31.442 1.00 0.00 ? 239 MET A HE2  1  
ATOM 3707   H HE3  . MET A 1 239 ? -7.518  -1.527  -32.265 1.00 0.00 ? 239 MET A HE3  1  
ATOM 3708   N N    . ARG A 1 240 ? -13.380 0.769   -31.410 1.00 0.00 ? 240 ARG A N    1  
ATOM 3709   C CA   . ARG A 1 240 ? -14.710 0.689   -30.860 1.00 0.00 ? 240 ARG A CA   1  
ATOM 3710   C C    . ARG A 1 240 ? -15.103 -0.787  -30.678 1.00 0.00 ? 240 ARG A C    1  
ATOM 3711   O O    . ARG A 1 240 ? -15.769 -1.155  -29.706 1.00 0.00 ? 240 ARG A O    1  
ATOM 3712   C CB   . ARG A 1 240 ? -15.703 1.479   -31.720 1.00 0.00 ? 240 ARG A CB   1  
ATOM 3713   C CG   . ARG A 1 240 ? -17.125 1.546   -31.116 1.00 0.00 ? 240 ARG A CG   1  
ATOM 3714   C CD   . ARG A 1 240 ? -17.255 2.597   -29.980 1.00 0.00 ? 240 ARG A CD   1  
ATOM 3715   N NE   . ARG A 1 240 ? -18.613 2.703   -29.415 1.00 0.00 ? 240 ARG A NE   1  
ATOM 3716   C CZ   . ARG A 1 240 ? -18.972 3.531   -28.423 1.00 0.00 ? 240 ARG A CZ   1  
ATOM 3717   N NH1  . ARG A 1 240 ? -18.087 4.347   -27.873 1.00 0.00 ? 240 ARG A NH1  1  
ATOM 3718   N NH2  . ARG A 1 240 ? -20.223 3.556   -27.970 1.00 0.00 ? 240 ARG A NH2  1  
ATOM 3719   H H    . ARG A 1 240 ? -13.228 1.255   -32.247 1.00 0.00 ? 240 ARG A H    1  
ATOM 3720   H HA   . ARG A 1 240 ? -14.684 1.143   -29.878 1.00 0.00 ? 240 ARG A HA   1  
ATOM 3721   H HB2  . ARG A 1 240 ? -15.333 2.485   -31.840 1.00 0.00 ? 240 ARG A HB2  1  
ATOM 3722   H HB3  . ARG A 1 240 ? -15.761 1.014   -32.695 1.00 0.00 ? 240 ARG A HB3  1  
ATOM 3723   H HG2  . ARG A 1 240 ? -17.823 1.797   -31.900 1.00 0.00 ? 240 ARG A HG2  1  
ATOM 3724   H HG3  . ARG A 1 240 ? -17.381 0.573   -30.722 1.00 0.00 ? 240 ARG A HG3  1  
ATOM 3725   H HD2  . ARG A 1 240 ? -16.577 2.330   -29.185 1.00 0.00 ? 240 ARG A HD2  1  
ATOM 3726   H HD3  . ARG A 1 240 ? -16.960 3.562   -30.371 1.00 0.00 ? 240 ARG A HD3  1  
ATOM 3727   H HE   . ARG A 1 240 ? -19.306 2.122   -29.792 1.00 0.00 ? 240 ARG A HE   1  
ATOM 3728   H HH11 . ARG A 1 240 ? -17.141 4.350   -28.196 1.00 0.00 ? 240 ARG A HH11 1  
ATOM 3729   H HH12 . ARG A 1 240 ? -18.365 4.961   -27.134 1.00 0.00 ? 240 ARG A HH12 1  
ATOM 3730   H HH21 . ARG A 1 240 ? -20.911 2.952   -28.369 1.00 0.00 ? 240 ARG A HH21 1  
ATOM 3731   H HH22 . ARG A 1 240 ? -20.474 4.180   -27.229 1.00 0.00 ? 240 ARG A HH22 1  
ATOM 3732   N N    . ALA A 1 241 ? -14.629 -1.636  -31.580 1.00 0.00 ? 241 ALA A N    1  
ATOM 3733   C CA   . ALA A 1 241 ? -14.904 -3.076  -31.486 1.00 0.00 ? 241 ALA A CA   1  
ATOM 3734   C C    . ALA A 1 241 ? -14.024 -3.721  -30.431 1.00 0.00 ? 241 ALA A C    1  
ATOM 3735   O O    . ALA A 1 241 ? -14.421 -4.720  -29.828 1.00 0.00 ? 241 ALA A O    1  
ATOM 3736   C CB   . ALA A 1 241 ? -14.712 -3.771  -32.839 1.00 0.00 ? 241 ALA A CB   1  
ATOM 3737   H H    . ALA A 1 241 ? -14.063 -1.300  -32.307 1.00 0.00 ? 241 ALA A H    1  
ATOM 3738   H HA   . ALA A 1 241 ? -15.934 -3.200  -31.185 1.00 0.00 ? 241 ALA A HA   1  
ATOM 3739   H HB1  . ALA A 1 241 ? -15.125 -3.154  -33.623 1.00 0.00 ? 241 ALA A HB1  1  
ATOM 3740   H HB2  . ALA A 1 241 ? -15.218 -4.726  -32.828 1.00 0.00 ? 241 ALA A HB2  1  
ATOM 3741   H HB3  . ALA A 1 241 ? -13.657 -3.925  -33.018 1.00 0.00 ? 241 ALA A HB3  1  
ATOM 3742   N N    . VAL A 1 242 ? -12.839 -3.147  -30.222 1.00 0.00 ? 242 VAL A N    1  
ATOM 3743   C CA   . VAL A 1 242 ? -11.890 -3.654  -29.230 1.00 0.00 ? 242 VAL A CA   1  
ATOM 3744   C C    . VAL A 1 242 ? -12.491 -3.422  -27.850 1.00 0.00 ? 242 VAL A C    1  
ATOM 3745   O O    . VAL A 1 242 ? -12.428 -4.285  -26.959 1.00 0.00 ? 242 VAL A O    1  
ATOM 3746   C CB   . VAL A 1 242 ? -10.495 -2.991  -29.380 1.00 0.00 ? 242 VAL A CB   1  
ATOM 3747   C CG1  . VAL A 1 242 ? -9.581  -3.393  -28.257 1.00 0.00 ? 242 VAL A CG1  1  
ATOM 3748   C CG2  . VAL A 1 242 ? -9.867  -3.364  -30.723 1.00 0.00 ? 242 VAL A CG2  1  
ATOM 3749   H H    . VAL A 1 242 ? -12.598 -2.355  -30.745 1.00 0.00 ? 242 VAL A H    1  
ATOM 3750   H HA   . VAL A 1 242 ? -11.784 -4.721  -29.377 1.00 0.00 ? 242 VAL A HA   1  
ATOM 3751   H HB   . VAL A 1 242 ? -10.624 -1.918  -29.346 1.00 0.00 ? 242 VAL A HB   1  
ATOM 3752   H HG11 . VAL A 1 242 ? -9.423  -2.548  -27.602 1.00 0.00 ? 242 VAL A HG11 1  
ATOM 3753   H HG12 . VAL A 1 242 ? -8.634  -3.717  -28.663 1.00 0.00 ? 242 VAL A HG12 1  
ATOM 3754   H HG13 . VAL A 1 242 ? -10.030 -4.200  -27.699 1.00 0.00 ? 242 VAL A HG13 1  
ATOM 3755   H HG21 . VAL A 1 242 ? -9.904  -2.511  -31.386 1.00 0.00 ? 242 VAL A HG21 1  
ATOM 3756   H HG22 . VAL A 1 242 ? -10.416 -4.185  -31.161 1.00 0.00 ? 242 VAL A HG22 1  
ATOM 3757   H HG23 . VAL A 1 242 ? -8.839  -3.658  -30.570 1.00 0.00 ? 242 VAL A HG23 1  
ATOM 3758   N N    . GLN A 1 243 ? -13.115 -2.255  -27.730 1.00 0.00 ? 243 GLN A N    1  
ATOM 3759   C CA   . GLN A 1 243 ? -13.874 -1.825  -26.568 1.00 0.00 ? 243 GLN A CA   1  
ATOM 3760   C C    . GLN A 1 243 ? -15.083 -2.714  -26.289 1.00 0.00 ? 243 GLN A C    1  
ATOM 3761   O O    . GLN A 1 243 ? -15.424 -2.968  -25.131 1.00 0.00 ? 243 GLN A O    1  
ATOM 3762   C CB   . GLN A 1 243 ? -14.327 -0.418  -26.836 1.00 0.00 ? 243 GLN A CB   1  
ATOM 3763   C CG   . GLN A 1 243 ? -15.320 0.101   -25.892 1.00 0.00 ? 243 GLN A CG   1  
ATOM 3764   C CD   . GLN A 1 243 ? -15.330 1.604   -25.918 1.00 0.00 ? 243 GLN A CD   1  
ATOM 3765   O OE1  . GLN A 1 243 ? -14.671 2.239   -25.104 1.00 0.00 ? 243 GLN A OE1  1  
ATOM 3766   N NE2  . GLN A 1 243 ? -16.055 2.191   -26.883 1.00 0.00 ? 243 GLN A NE2  1  
ATOM 3767   H H    . GLN A 1 243 ? -13.127 -1.668  -28.516 1.00 0.00 ? 243 GLN A H    1  
ATOM 3768   H HA   . GLN A 1 243 ? -13.229 -1.823  -25.704 1.00 0.00 ? 243 GLN A HA   1  
ATOM 3769   H HB2  . GLN A 1 243 ? -13.466 0.229   -26.806 1.00 0.00 ? 243 GLN A HB2  1  
ATOM 3770   H HB3  . GLN A 1 243 ? -14.744 -0.381  -27.835 1.00 0.00 ? 243 GLN A HB3  1  
ATOM 3771   H HG2  . GLN A 1 243 ? -16.299 -0.268  -26.164 1.00 0.00 ? 243 GLN A HG2  1  
ATOM 3772   H HG3  . GLN A 1 243 ? -15.075 -0.236  -24.896 1.00 0.00 ? 243 GLN A HG3  1  
ATOM 3773   H HE21 . GLN A 1 243 ? -16.546 1.642   -27.530 1.00 0.00 ? 243 GLN A HE21 1  
ATOM 3774   H HE22 . GLN A 1 243 ? -16.093 3.169   -26.942 1.00 0.00 ? 243 GLN A HE22 1  
ATOM 3775   N N    . GLU A 1 244 ? -15.731 -3.180  -27.350 1.00 0.00 ? 244 GLU A N    1  
ATOM 3776   C CA   . GLU A 1 244 ? -16.777 -4.189  -27.202 1.00 0.00 ? 244 GLU A CA   1  
ATOM 3777   C C    . GLU A 1 244 ? -16.261 -5.463  -26.534 1.00 0.00 ? 244 GLU A C    1  
ATOM 3778   O O    . GLU A 1 244 ? -16.917 -6.005  -25.669 1.00 0.00 ? 244 GLU A O    1  
ATOM 3779   C CB   . GLU A 1 244 ? -17.409 -4.531  -28.563 1.00 0.00 ? 244 GLU A CB   1  
ATOM 3780   C CG   . GLU A 1 244 ? -18.610 -5.543  -28.507 1.00 0.00 ? 244 GLU A CG   1  
ATOM 3781   C CD   . GLU A 1 244 ? -19.296 -5.739  -29.876 1.00 0.00 ? 244 GLU A CD   1  
ATOM 3782   O OE1  . GLU A 1 244 ? -20.182 -4.900  -30.225 1.00 0.00 ? 244 GLU A OE1  1  
ATOM 3783   O OE2  . GLU A 1 244 ? -18.955 -6.727  -30.605 1.00 0.00 ? 244 GLU A OE2  1  
ATOM 3784   H H    . GLU A 1 244 ? -15.419 -2.942  -28.248 1.00 0.00 ? 244 GLU A H    1  
ATOM 3785   H HA   . GLU A 1 244 ? -17.550 -3.774  -26.572 1.00 0.00 ? 244 GLU A HA   1  
ATOM 3786   H HB2  . GLU A 1 244 ? -17.761 -3.616  -29.013 1.00 0.00 ? 244 GLU A HB2  1  
ATOM 3787   H HB3  . GLU A 1 244 ? -16.639 -4.947  -29.198 1.00 0.00 ? 244 GLU A HB3  1  
ATOM 3788   H HG2  . GLU A 1 244 ? -18.244 -6.499  -28.165 1.00 0.00 ? 244 GLU A HG2  1  
ATOM 3789   H HG3  . GLU A 1 244 ? -19.340 -5.177  -27.799 1.00 0.00 ? 244 GLU A HG3  1  
ATOM 3790   N N    . GLN A 1 245 ? -15.101 -5.946  -26.959 1.00 0.00 ? 245 GLN A N    1  
ATOM 3791   C CA   . GLN A 1 245 ? -14.548 -7.192  -26.426 1.00 0.00 ? 245 GLN A CA   1  
ATOM 3792   C C    . GLN A 1 245 ? -14.278 -7.005  -24.951 1.00 0.00 ? 245 GLN A C    1  
ATOM 3793   O O    . GLN A 1 245 ? -14.626 -7.853  -24.122 1.00 0.00 ? 245 GLN A O    1  
ATOM 3794   C CB   . GLN A 1 245 ? -13.229 -7.539  -27.114 1.00 0.00 ? 245 GLN A CB   1  
ATOM 3795   C CG   . GLN A 1 245 ? -13.348 -7.961  -28.571 1.00 0.00 ? 245 GLN A CG   1  
ATOM 3796   C CD   . GLN A 1 245 ? -11.978 -8.265  -29.173 1.00 0.00 ? 245 GLN A CD   1  
ATOM 3797   O OE1  . GLN A 1 245 ? -11.408 -9.336  -28.940 1.00 0.00 ? 245 GLN A OE1  1  
ATOM 3798   N NE2  . GLN A 1 245 ? -11.425 -7.300  -29.927 1.00 0.00 ? 245 GLN A NE2  1  
ATOM 3799   H H    . GLN A 1 245 ? -14.621 -5.477  -27.673 1.00 0.00 ? 245 GLN A H    1  
ATOM 3800   H HA   . GLN A 1 245 ? -15.255 -7.996  -26.569 1.00 0.00 ? 245 GLN A HA   1  
ATOM 3801   H HB2  . GLN A 1 245 ? -12.585 -6.675  -27.067 1.00 0.00 ? 245 GLN A HB2  1  
ATOM 3802   H HB3  . GLN A 1 245 ? -12.760 -8.341  -26.560 1.00 0.00 ? 245 GLN A HB3  1  
ATOM 3803   H HG2  . GLN A 1 245 ? -13.966 -8.844  -28.635 1.00 0.00 ? 245 GLN A HG2  1  
ATOM 3804   H HG3  . GLN A 1 245 ? -13.812 -7.163  -29.133 1.00 0.00 ? 245 GLN A HG3  1  
ATOM 3805   H HE21 . GLN A 1 245 ? -11.900 -6.455  -30.066 1.00 0.00 ? 245 GLN A HE21 1  
ATOM 3806   H HE22 . GLN A 1 245 ? -10.547 -7.443  -30.338 1.00 0.00 ? 245 GLN A HE22 1  
ATOM 3807   N N    . VAL A 1 246 ? -13.643 -5.872  -24.653 1.00 0.00 ? 246 VAL A N    1  
ATOM 3808   C CA   . VAL A 1 246 ? -13.348 -5.451  -23.304 1.00 0.00 ? 246 VAL A CA   1  
ATOM 3809   C C    . VAL A 1 246 ? -14.589 -5.516  -22.417 1.00 0.00 ? 246 VAL A C    1  
ATOM 3810   O O    . VAL A 1 246 ? -14.539 -6.081  -21.318 1.00 0.00 ? 246 VAL A O    1  
ATOM 3811   C CB   . VAL A 1 246 ? -12.719 -4.043  -23.332 1.00 0.00 ? 246 VAL A CB   1  
ATOM 3812   C CG1  . VAL A 1 246 ? -12.581 -3.415  -21.914 1.00 0.00 ? 246 VAL A CG1  1  
ATOM 3813   C CG2  . VAL A 1 246 ? -11.391 -4.117  -24.065 1.00 0.00 ? 246 VAL A CG2  1  
ATOM 3814   H H    . VAL A 1 246 ? -13.406 -5.267  -25.388 1.00 0.00 ? 246 VAL A H    1  
ATOM 3815   H HA   . VAL A 1 246 ? -12.616 -6.133  -22.897 1.00 0.00 ? 246 VAL A HA   1  
ATOM 3816   H HB   . VAL A 1 246 ? -13.380 -3.405  -23.905 1.00 0.00 ? 246 VAL A HB   1  
ATOM 3817   H HG11 . VAL A 1 246 ? -11.780 -3.904  -21.381 1.00 0.00 ? 246 VAL A HG11 1  
ATOM 3818   H HG12 . VAL A 1 246 ? -13.505 -3.543  -21.372 1.00 0.00 ? 246 VAL A HG12 1  
ATOM 3819   H HG13 . VAL A 1 246 ? -12.362 -2.361  -22.008 1.00 0.00 ? 246 VAL A HG13 1  
ATOM 3820   H HG21 . VAL A 1 246 ? -11.459 -4.845  -24.861 1.00 0.00 ? 246 VAL A HG21 1  
ATOM 3821   H HG22 . VAL A 1 246 ? -10.615 -4.411  -23.374 1.00 0.00 ? 246 VAL A HG22 1  
ATOM 3822   H HG23 . VAL A 1 246 ? -11.156 -3.149  -24.482 1.00 0.00 ? 246 VAL A HG23 1  
ATOM 3823   N N    . ALA A 1 247 ? -15.694 -4.960  -22.909 1.00 0.00 ? 247 ALA A N    1  
ATOM 3824   C CA   . ALA A 1 247 ? -16.968 -4.978  -22.192 1.00 0.00 ? 247 ALA A CA   1  
ATOM 3825   C C    . ALA A 1 247 ? -17.560 -6.393  -22.008 1.00 0.00 ? 247 ALA A C    1  
ATOM 3826   O O    . ALA A 1 247 ? -18.133 -6.690  -20.954 1.00 0.00 ? 247 ALA A O    1  
ATOM 3827   C CB   . ALA A 1 247 ? -17.959 -4.041  -22.865 1.00 0.00 ? 247 ALA A CB   1  
ATOM 3828   H H    . ALA A 1 247 ? -15.658 -4.546  -23.796 1.00 0.00 ? 247 ALA A H    1  
ATOM 3829   H HA   . ALA A 1 247 ? -16.779 -4.585  -21.203 1.00 0.00 ? 247 ALA A HA   1  
ATOM 3830   H HB1  . ALA A 1 247 ? -18.378 -4.526  -23.734 1.00 0.00 ? 247 ALA A HB1  1  
ATOM 3831   H HB2  . ALA A 1 247 ? -17.451 -3.137  -23.167 1.00 0.00 ? 247 ALA A HB2  1  
ATOM 3832   H HB3  . ALA A 1 247 ? -18.751 -3.796  -22.173 1.00 0.00 ? 247 ALA A HB3  1  
ATOM 3833   N N    . SER A 1 248 ? -17.407 -7.256  -23.013 1.00 0.00 ? 248 SER A N    1  
ATOM 3834   C CA   . SER A 1 248 ? -17.833 -8.642  -22.909 1.00 0.00 ? 248 SER A CA   1  
ATOM 3835   C C    . SER A 1 248 ? -16.985 -9.381  -21.910 1.00 0.00 ? 248 SER A C    1  
ATOM 3836   O O    . SER A 1 248 ? -17.497 -10.224 -21.154 1.00 0.00 ? 248 SER A O    1  
ATOM 3837   C CB   . SER A 1 248 ? -17.703 -9.365  -24.240 1.00 0.00 ? 248 SER A CB   1  
ATOM 3838   O OG   . SER A 1 248 ? -18.575 -8.831  -25.202 1.00 0.00 ? 248 SER A OG   1  
ATOM 3839   H H    . SER A 1 248 ? -16.934 -6.965  -23.820 1.00 0.00 ? 248 SER A H    1  
ATOM 3840   H HA   . SER A 1 248 ? -18.865 -8.674  -22.593 1.00 0.00 ? 248 SER A HA   1  
ATOM 3841   H HB2  . SER A 1 248 ? -16.693 -9.269  -24.600 1.00 0.00 ? 248 SER A HB2  1  
ATOM 3842   H HB3  . SER A 1 248 ? -17.922 -10.415 -24.091 1.00 0.00 ? 248 SER A HB3  1  
ATOM 3843   H HG   . SER A 1 248 ? -18.465 -7.877  -25.205 1.00 0.00 ? 248 SER A HG   1  
ATOM 3844   N N    . GLU A 1 249 ? -15.684 -9.100  -21.910 1.00 0.00 ? 249 GLU A N    1  
ATOM 3845   C CA   . GLU A 1 249 ? -14.798 -9.712  -20.930 1.00 0.00 ? 249 GLU A CA   1  
ATOM 3846   C C    . GLU A 1 249 ? -15.330 -9.452  -19.527 1.00 0.00 ? 249 GLU A C    1  
ATOM 3847   O O    . GLU A 1 249 ? -15.379 -10.375 -18.700 1.00 0.00 ? 249 GLU A O    1  
ATOM 3848   C CB   . GLU A 1 249 ? -13.376 -9.215  -21.081 1.00 0.00 ? 249 GLU A CB   1  
ATOM 3849   C CG   . GLU A 1 249 ? -12.700 -9.758  -22.337 1.00 0.00 ? 249 GLU A CG   1  
ATOM 3850   C CD   . GLU A 1 249 ? -11.351 -9.109  -22.612 1.00 0.00 ? 249 GLU A CD   1  
ATOM 3851   O OE1  . GLU A 1 249 ? -11.063 -8.050  -21.976 1.00 0.00 ? 249 GLU A OE1  1  
ATOM 3852   O OE2  . GLU A 1 249 ? -10.594 -9.670  -23.453 1.00 0.00 ? 249 GLU A OE2  1  
ATOM 3853   H H    . GLU A 1 249 ? -15.329 -8.441  -22.543 1.00 0.00 ? 249 GLU A H    1  
ATOM 3854   H HA   . GLU A 1 249 ? -14.805 -10.781 -21.097 1.00 0.00 ? 249 GLU A HA   1  
ATOM 3855   H HB2  . GLU A 1 249 ? -13.385 -8.137  -21.128 1.00 0.00 ? 249 GLU A HB2  1  
ATOM 3856   H HB3  . GLU A 1 249 ? -12.806 -9.522  -20.215 1.00 0.00 ? 249 GLU A HB3  1  
ATOM 3857   H HG2  . GLU A 1 249 ? -12.556 -10.821 -22.222 1.00 0.00 ? 249 GLU A HG2  1  
ATOM 3858   H HG3  . GLU A 1 249 ? -13.351 -9.584  -23.183 1.00 0.00 ? 249 GLU A HG3  1  
ATOM 3859   N N    . LYS A 1 250 ? -15.777 -8.220  -19.272 1.00 0.00 ? 250 LYS A N    1  
ATOM 3860   C CA   . LYS A 1 250 ? -16.295 -7.894  -17.947 1.00 0.00 ? 250 LYS A CA   1  
ATOM 3861   C C    . LYS A 1 250 ? -17.488 -8.769  -17.700 1.00 0.00 ? 250 LYS A C    1  
ATOM 3862   O O    . LYS A 1 250 ? -17.528 -9.511  -16.711 1.00 0.00 ? 250 LYS A O    1  
ATOM 3863   C CB   . LYS A 1 250 ? -16.690 -6.419  -17.793 1.00 0.00 ? 250 LYS A CB   1  
ATOM 3864   C CG   . LYS A 1 250 ? -15.548 -5.444  -17.858 1.00 0.00 ? 250 LYS A CG   1  
ATOM 3865   C CD   . LYS A 1 250 ? -16.011 -4.010  -17.710 1.00 0.00 ? 250 LYS A CD   1  
ATOM 3866   C CE   . LYS A 1 250 ? -14.812 -3.099  -17.789 1.00 0.00 ? 250 LYS A CE   1  
ATOM 3867   N NZ   . LYS A 1 250 ? -15.208 -1.695  -17.662 1.00 0.00 ? 250 LYS A NZ   1  
ATOM 3868   H H    . LYS A 1 250 ? -15.754 -7.535  -19.973 1.00 0.00 ? 250 LYS A H    1  
ATOM 3869   H HA   . LYS A 1 250 ? -15.536 -8.132  -17.214 1.00 0.00 ? 250 LYS A HA   1  
ATOM 3870   H HB2  . LYS A 1 250 ? -17.388 -6.171  -18.576 1.00 0.00 ? 250 LYS A HB2  1  
ATOM 3871   H HB3  . LYS A 1 250 ? -17.192 -6.301  -16.842 1.00 0.00 ? 250 LYS A HB3  1  
ATOM 3872   H HG2  . LYS A 1 250 ? -14.850 -5.669  -17.066 1.00 0.00 ? 250 LYS A HG2  1  
ATOM 3873   H HG3  . LYS A 1 250 ? -15.046 -5.555  -18.809 1.00 0.00 ? 250 LYS A HG3  1  
ATOM 3874   H HD2  . LYS A 1 250 ? -16.703 -3.769  -18.505 1.00 0.00 ? 250 LYS A HD2  1  
ATOM 3875   H HD3  . LYS A 1 250 ? -16.497 -3.883  -16.754 1.00 0.00 ? 250 LYS A HD3  1  
ATOM 3876   H HE2  . LYS A 1 250 ? -14.127 -3.345  -16.992 1.00 0.00 ? 250 LYS A HE2  1  
ATOM 3877   H HE3  . LYS A 1 250 ? -14.317 -3.246  -18.738 1.00 0.00 ? 250 LYS A HE3  1  
ATOM 3878   H HZ1  . LYS A 1 250 ? -16.041 -1.515  -18.255 1.00 0.00 ? 250 LYS A HZ1  1  
ATOM 3879   H HZ2  . LYS A 1 250 ? -14.422 -1.086  -17.970 1.00 0.00 ? 250 LYS A HZ2  1  
ATOM 3880   H HZ3  . LYS A 1 250 ? -15.441 -1.489  -16.671 1.00 0.00 ? 250 LYS A HZ3  1  
ATOM 3881   N N    . ALA A 1 251 ? -18.440 -8.692  -18.632 1.00 0.00 ? 251 ALA A N    1  
ATOM 3882   C CA   . ALA A 1 251 ? -19.687 -9.439  -18.536 1.00 0.00 ? 251 ALA A CA   1  
ATOM 3883   C C    . ALA A 1 251 ? -19.464 -10.915 -18.208 1.00 0.00 ? 251 ALA A C    1  
ATOM 3884   O O    . ALA A 1 251 ? -20.178 -11.470 -17.391 1.00 0.00 ? 251 ALA A O    1  
ATOM 3885   C CB   . ALA A 1 251 ? -20.492 -9.286  -19.788 1.00 0.00 ? 251 ALA A CB   1  
ATOM 3886   H H    . ALA A 1 251 ? -18.308 -8.091  -19.394 1.00 0.00 ? 251 ALA A H    1  
ATOM 3887   H HA   . ALA A 1 251 ? -20.258 -9.011  -17.724 1.00 0.00 ? 251 ALA A HA   1  
ATOM 3888   H HB1  . ALA A 1 251 ? -20.519 -8.245  -20.074 1.00 0.00 ? 251 ALA A HB1  1  
ATOM 3889   H HB2  . ALA A 1 251 ? -21.499 -9.638  -19.613 1.00 0.00 ? 251 ALA A HB2  1  
ATOM 3890   H HB3  . ALA A 1 251 ? -20.041 -9.865  -20.580 1.00 0.00 ? 251 ALA A HB3  1  
ATOM 3891   N N    . GLU A 1 252 ? -18.454 -11.534 -18.810 1.00 0.00 ? 252 GLU A N    1  
ATOM 3892   C CA   . GLU A 1 252 ? -18.173 -12.949 -18.538 1.00 0.00 ? 252 GLU A CA   1  
ATOM 3893   C C    . GLU A 1 252 ? -17.542 -13.162 -17.155 1.00 0.00 ? 252 GLU A C    1  
ATOM 3894   O O    . GLU A 1 252 ? -18.023 -13.993 -16.367 1.00 0.00 ? 252 GLU A O    1  
ATOM 3895   C CB   . GLU A 1 252 ? -17.253 -13.524 -19.614 1.00 0.00 ? 252 GLU A CB   1  
ATOM 3896   C CG   . GLU A 1 252 ? -17.130 -15.054 -19.553 1.00 0.00 ? 252 GLU A CG   1  
ATOM 3897   C CD   . GLU A 1 252 ? -18.430 -15.770 -19.892 1.00 0.00 ? 252 GLU A CD   1  
ATOM 3898   O OE1  . GLU A 1 252 ? -19.313 -15.136 -20.534 1.00 0.00 ? 252 GLU A OE1  1  
ATOM 3899   O OE2  . GLU A 1 252 ? -18.551 -16.967 -19.525 1.00 0.00 ? 252 GLU A OE2  1  
ATOM 3900   H H    . GLU A 1 252 ? -17.887 -11.038 -19.438 1.00 0.00 ? 252 GLU A H    1  
ATOM 3901   H HA   . GLU A 1 252 ? -19.107 -13.490 -18.570 1.00 0.00 ? 252 GLU A HA   1  
ATOM 3902   H HB2  . GLU A 1 252 ? -17.639 -13.248 -20.584 1.00 0.00 ? 252 GLU A HB2  1  
ATOM 3903   H HB3  . GLU A 1 252 ? -16.270 -13.089 -19.496 1.00 0.00 ? 252 GLU A HB3  1  
ATOM 3904   H HG2  . GLU A 1 252 ? -16.370 -15.370 -20.253 1.00 0.00 ? 252 GLU A HG2  1  
ATOM 3905   H HG3  . GLU A 1 252 ? -16.822 -15.338 -18.556 1.00 0.00 ? 252 GLU A HG3  1  
ATOM 3906   N N    . LEU A 1 253 ? -16.464 -12.423 -16.877 1.00 0.00 ? 253 LEU A N    1  
ATOM 3907   C CA   . LEU A 1 253 ? -15.819 -12.445 -15.566 1.00 0.00 ? 253 LEU A CA   1  
ATOM 3908   C C    . LEU A 1 253 ? -16.805 -12.158 -14.448 1.00 0.00 ? 253 LEU A C    1  
ATOM 3909   O O    . LEU A 1 253 ? -16.721 -12.762 -13.400 1.00 0.00 ? 253 LEU A O    1  
ATOM 3910   C CB   . LEU A 1 253 ? -14.689 -11.433 -15.507 1.00 0.00 ? 253 LEU A CB   1  
ATOM 3911   C CG   . LEU A 1 253 ? -13.460 -11.731 -16.350 1.00 0.00 ? 253 LEU A CG   1  
ATOM 3912   C CD1  . LEU A 1 253 ? -12.535 -10.503 -16.341 1.00 0.00 ? 253 LEU A CD1  1  
ATOM 3913   C CD2  . LEU A 1 253 ? -12.762 -13.022 -15.863 1.00 0.00 ? 253 LEU A CD2  1  
ATOM 3914   H H    . LEU A 1 253 ? -16.134 -11.796 -17.554 1.00 0.00 ? 253 LEU A H    1  
ATOM 3915   H HA   . LEU A 1 253 ? -15.402 -13.429 -15.409 1.00 0.00 ? 253 LEU A HA   1  
ATOM 3916   H HB2  . LEU A 1 253 ? -15.079 -10.479 -15.823 1.00 0.00 ? 253 LEU A HB2  1  
ATOM 3917   H HB3  . LEU A 1 253 ? -14.380 -11.341 -14.475 1.00 0.00 ? 253 LEU A HB3  1  
ATOM 3918   H HG   . LEU A 1 253 ? -13.790 -11.886 -17.371 1.00 0.00 ? 253 LEU A HG   1  
ATOM 3919   H HD11 . LEU A 1 253 ? -13.019 -9.684  -16.852 1.00 0.00 ? 253 LEU A HD11 1  
ATOM 3920   H HD12 . LEU A 1 253 ? -11.610 -10.745 -16.844 1.00 0.00 ? 253 LEU A HD12 1  
ATOM 3921   H HD13 . LEU A 1 253 ? -12.325 -10.218 -15.320 1.00 0.00 ? 253 LEU A HD13 1  
ATOM 3922   H HD21 . LEU A 1 253 ? -13.267 -13.882 -16.276 1.00 0.00 ? 253 LEU A HD21 1  
ATOM 3923   H HD22 . LEU A 1 253 ? -12.799 -13.066 -14.784 1.00 0.00 ? 253 LEU A HD22 1  
ATOM 3924   H HD23 . LEU A 1 253 ? -11.732 -13.018 -16.187 1.00 0.00 ? 253 LEU A HD23 1  
ATOM 3925   N N    . ALA A 1 254 ? -17.738 -11.250 -14.700 1.00 0.00 ? 254 ALA A N    1  
ATOM 3926   C CA   . ALA A 1 254 ? -18.804 -10.900 -13.765 1.00 0.00 ? 254 ALA A CA   1  
ATOM 3927   C C    . ALA A 1 254 ? -19.467 -12.090 -13.084 1.00 0.00 ? 254 ALA A C    1  
ATOM 3928   O O    . ALA A 1 254 ? -19.887 -12.015 -11.935 1.00 0.00 ? 254 ALA A O    1  
ATOM 3929   C CB   . ALA A 1 254 ? -19.868 -10.064 -14.485 1.00 0.00 ? 254 ALA A CB   1  
ATOM 3930   H H    . ALA A 1 254 ? -17.738 -10.821 -15.581 1.00 0.00 ? 254 ALA A H    1  
ATOM 3931   H HA   . ALA A 1 254 ? -18.374 -10.280 -12.995 1.00 0.00 ? 254 ALA A HA   1  
ATOM 3932   H HB1  . ALA A 1 254 ? -19.842 -9.050  -14.113 1.00 0.00 ? 254 ALA A HB1  1  
ATOM 3933   H HB2  . ALA A 1 254 ? -20.845 -10.490 -14.302 1.00 0.00 ? 254 ALA A HB2  1  
ATOM 3934   H HB3  . ALA A 1 254 ? -19.668 -10.064 -15.546 1.00 0.00 ? 254 ALA A HB3  1  
ATOM 3935   N N    . LYS A 1 255 ? -19.563 -13.193 -13.803 1.00 0.00 ? 255 LYS A N    1  
ATOM 3936   C CA   . LYS A 1 255 ? -20.274 -14.317 -13.088 1.00 0.00 ? 255 LYS A CA   1  
ATOM 3937   C C    . LYS A 1 255 ? -19.834 -15.769 -13.180 1.00 0.00 ? 255 LYS A C    1  
ATOM 3938   O O    . LYS A 1 255 ? -19.449 -16.294 -14.221 1.00 0.00 ? 255 LYS A O    1  
ATOM 3939   C CB   . LYS A 1 255 ? -21.799 -14.277 -13.308 1.00 0.00 ? 255 LYS A CB   1  
ATOM 3940   C CG   . LYS A 1 255 ? -22.528 -13.597 -12.123 1.00 0.00 ? 255 LYS A CG   1  
ATOM 3941   C CD   . LYS A 1 255 ? -22.474 -14.507 -10.866 1.00 0.00 ? 255 LYS A CD   1  
ATOM 3942   C CE   . LYS A 1 255 ? -23.245 -13.863 -9.714  1.00 0.00 ? 255 LYS A CE   1  
ATOM 3943   N NZ   . LYS A 1 255 ? -23.167 -14.748 -8.513  1.00 0.00 ? 255 LYS A NZ   1  
ATOM 3944   H H    . LYS A 1 255 ? -19.235 -13.264 -14.724 1.00 0.00 ? 255 LYS A H    1  
ATOM 3945   H HA   . LYS A 1 255 ? -20.138 -14.092 -12.060 1.00 0.00 ? 255 LYS A HA   1  
ATOM 3946   H HB2  . LYS A 1 255 ? -22.006 -13.718 -14.210 1.00 0.00 ? 255 LYS A HB2  1  
ATOM 3947   H HB3  . LYS A 1 255 ? -22.169 -15.284 -13.424 1.00 0.00 ? 255 LYS A HB3  1  
ATOM 3948   H HG2  . LYS A 1 255 ? -22.067 -12.651 -11.902 1.00 0.00 ? 255 LYS A HG2  1  
ATOM 3949   H HG3  . LYS A 1 255 ? -23.561 -13.434 -12.391 1.00 0.00 ? 255 LYS A HG3  1  
ATOM 3950   H HD2  . LYS A 1 255 ? -22.920 -15.462 -11.097 1.00 0.00 ? 255 LYS A HD2  1  
ATOM 3951   H HD3  . LYS A 1 255 ? -21.461 -14.661 -10.549 1.00 0.00 ? 255 LYS A HD3  1  
ATOM 3952   H HE2  . LYS A 1 255 ? -22.813 -12.901 -9.483  1.00 0.00 ? 255 LYS A HE2  1  
ATOM 3953   H HE3  . LYS A 1 255 ? -24.275 -13.735 -9.998  1.00 0.00 ? 255 LYS A HE3  1  
ATOM 3954   H HZ1  . LYS A 1 255 ? -22.242 -14.625 -8.052  1.00 0.00 ? 255 LYS A HZ1  1  
ATOM 3955   H HZ2  . LYS A 1 255 ? -23.279 -15.741 -8.803  1.00 0.00 ? 255 LYS A HZ2  1  
ATOM 3956   H HZ3  . LYS A 1 255 ? -23.920 -14.494 -7.843  1.00 0.00 ? 255 LYS A HZ3  1  
ATOM 3957   N N    . LEU A 1 256 ? -20.062 -16.391 -11.990 1.00 0.00 ? 256 LEU A N    1  
ATOM 3958   C CA   . LEU A 1 256 ? -19.892 -17.819 -11.692 1.00 0.00 ? 256 LEU A CA   1  
ATOM 3959   C C    . LEU A 1 256 ? -19.738 -18.000 -10.160 1.00 0.00 ? 256 LEU A C    1  
ATOM 3960   O O    . LEU A 1 256 ? -18.628 -17.883 -9.645  1.00 0.00 ? 256 LEU A O    1  
ATOM 3961   C CB   . LEU A 1 256 ? -18.680 -18.430 -12.406 1.00 0.00 ? 256 LEU A CB   1  
ATOM 3962   C CG   . LEU A 1 256 ? -18.582 -19.926 -12.071 1.00 0.00 ? 256 LEU A CG   1  
ATOM 3963   C CD1  . LEU A 1 256 ? -19.842 -20.653 -12.558 1.00 0.00 ? 256 LEU A CD1  1  
ATOM 3964   C CD2  . LEU A 1 256 ? -17.369 -20.519 -12.782 1.00 0.00 ? 256 LEU A CD2  1  
ATOM 3965   H H    . LEU A 1 256 ? -20.452 -15.845 -11.280 1.00 0.00 ? 256 LEU A H    1  
ATOM 3966   H HA   . LEU A 1 256 ? -20.788 -18.326 -12.010 1.00 0.00 ? 256 LEU A HA   1  
ATOM 3967   H HB2  . LEU A 1 256 ? -18.791 -18.317 -13.471 1.00 0.00 ? 256 LEU A HB2  1  
ATOM 3968   H HB3  . LEU A 1 256 ? -17.781 -17.932 -12.080 1.00 0.00 ? 256 LEU A HB3  1  
ATOM 3969   H HG   . LEU A 1 256 ? -18.475 -20.061 -11.005 1.00 0.00 ? 256 LEU A HG   1  
ATOM 3970   H HD11 . LEU A 1 256 ? -20.174 -20.212 -13.486 1.00 0.00 ? 256 LEU A HD11 1  
ATOM 3971   H HD12 . LEU A 1 256 ? -20.624 -20.566 -11.821 1.00 0.00 ? 256 LEU A HD12 1  
ATOM 3972   H HD13 . LEU A 1 256 ? -19.616 -21.697 -12.718 1.00 0.00 ? 256 LEU A HD13 1  
ATOM 3973   H HD21 . LEU A 1 256 ? -17.446 -20.328 -13.842 1.00 0.00 ? 256 LEU A HD21 1  
ATOM 3974   H HD22 . LEU A 1 256 ? -17.340 -21.585 -12.612 1.00 0.00 ? 256 LEU A HD22 1  
ATOM 3975   H HD23 . LEU A 1 256 ? -16.468 -20.066 -12.399 1.00 0.00 ? 256 LEU A HD23 1  
ATOM 3976   N N    . LYS A 1 257 ? -20.837 -18.268 -9.421  1.00 0.00 ? 257 LYS A N    1  
ATOM 3977   C CA   . LYS A 1 257 ? -20.721 -18.430 -7.952  1.00 0.00 ? 257 LYS A CA   1  
ATOM 3978   C C    . LYS A 1 257 ? -20.621 -19.892 -7.484  1.00 0.00 ? 257 LYS A C    1  
ATOM 3979   O O    . LYS A 1 257 ? -19.638 -20.282 -6.854  1.00 0.00 ? 257 LYS A O    1  
ATOM 3980   C CB   . LYS A 1 257 ? -21.935 -17.787 -7.250  1.00 0.00 ? 257 LYS A CB   1  
ATOM 3981   C CG   . LYS A 1 257 ? -21.802 -17.951 -5.722  1.00 0.00 ? 257 LYS A CG   1  
ATOM 3982   C CD   . LYS A 1 257 ? -22.983 -17.303 -5.000  1.00 0.00 ? 257 LYS A CD   1  
ATOM 3983   C CE   . LYS A 1 257 ? -22.805 -17.509 -3.492  1.00 0.00 ? 257 LYS A CE   1  
ATOM 3984   N NZ   . LYS A 1 257 ? -23.939 -16.883 -2.756  1.00 0.00 ? 257 LYS A NZ   1  
ATOM 3985   H H    . LYS A 1 257 ? -21.712 -18.345 -9.854  1.00 0.00 ? 257 LYS A H    1  
ATOM 3986   H HA   . LYS A 1 257 ? -19.835 -17.909 -7.623  1.00 0.00 ? 257 LYS A HA   1  
ATOM 3987   H HB2  . LYS A 1 257 ? -21.977 -16.736 -7.496  1.00 0.00 ? 257 LYS A HB2  1  
ATOM 3988   H HB3  . LYS A 1 257 ? -22.840 -18.272 -7.582  1.00 0.00 ? 257 LYS A HB3  1  
ATOM 3989   H HG2  . LYS A 1 257 ? -21.783 -18.993 -5.465  1.00 0.00 ? 257 LYS A HG2  1  
ATOM 3990   H HG3  . LYS A 1 257 ? -20.886 -17.485 -5.390  1.00 0.00 ? 257 LYS A HG3  1  
ATOM 3991   H HD2  . LYS A 1 257 ? -23.010 -16.246 -5.223  1.00 0.00 ? 257 LYS A HD2  1  
ATOM 3992   H HD3  . LYS A 1 257 ? -23.903 -17.767 -5.319  1.00 0.00 ? 257 LYS A HD3  1  
ATOM 3993   H HE2  . LYS A 1 257 ? -22.779 -18.566 -3.275  1.00 0.00 ? 257 LYS A HE2  1  
ATOM 3994   H HE3  . LYS A 1 257 ? -21.877 -17.056 -3.174  1.00 0.00 ? 257 LYS A HE3  1  
ATOM 3995   H HZ1  . LYS A 1 257 ? -23.567 -16.263 -2.009  1.00 0.00 ? 257 LYS A HZ1  1  
ATOM 3996   H HZ2  . LYS A 1 257 ? -24.526 -17.628 -2.327  1.00 0.00 ? 257 LYS A HZ2  1  
ATOM 3997   H HZ3  . LYS A 1 257 ? -24.515 -16.322 -3.414  1.00 0.00 ? 257 LYS A HZ3  1  
ATOM 3998   N N    . ASP A 1 258 ? -21.668 -20.676 -7.752  1.00 0.00 ? 258 ASP A N    1  
ATOM 3999   C CA   . ASP A 1 258 ? -21.726 -22.078 -7.309  1.00 0.00 ? 258 ASP A CA   1  
ATOM 4000   C C    . ASP A 1 258 ? -21.176 -22.164 -5.886  1.00 0.00 ? 258 ASP A C    1  
ATOM 4001   O O    . ASP A 1 258 ? -21.076 -21.156 -5.194  1.00 0.00 ? 258 ASP A O    1  
ATOM 4002   C CB   . ASP A 1 258 ? -20.849 -22.951 -8.196  1.00 0.00 ? 258 ASP A CB   1  
ATOM 4003   C CG   . ASP A 1 258 ? -21.092 -22.611 -9.651  1.00 0.00 ? 258 ASP A CG   1  
ATOM 4004   O OD1  . ASP A 1 258 ? -22.246 -22.667 -10.117 1.00 0.00 ? 258 ASP A OD1  1  
ATOM 4005   O OD2  . ASP A 1 258 ? -20.121 -22.168 -10.299 1.00 0.00 ? 258 ASP A OD2  1  
ATOM 4006   H H    . ASP A 1 258 ? -22.437 -20.295 -8.225  1.00 0.00 ? 258 ASP A H    1  
ATOM 4007   H HA   . ASP A 1 258 ? -22.745 -22.434 -7.335  1.00 0.00 ? 258 ASP A HA   1  
ATOM 4008   H HB2  . ASP A 1 258 ? -19.813 -22.773 -7.954  1.00 0.00 ? 258 ASP A HB2  1  
ATOM 4009   H HB3  . ASP A 1 258 ? -21.086 -23.990 -8.025  1.00 0.00 ? 258 ASP A HB3  1  
ATOM 4010   N N    . LEU A 1 259 ? -20.743 -23.350 -5.473  1.00 0.00 ? 259 LEU A N    1  
ATOM 4011   C CA   . LEU A 1 259 ? -20.125 -23.480 -4.160  1.00 0.00 ? 259 LEU A CA   1  
ATOM 4012   C C    . LEU A 1 259 ? -18.717 -22.873 -4.248  1.00 0.00 ? 259 LEU A C    1  
ATOM 4013   O O    . LEU A 1 259 ? -18.151 -22.825 -5.341  1.00 0.00 ? 259 LEU A O    1  
ATOM 4014   C CB   . LEU A 1 259 ? -20.053 -24.939 -3.708  1.00 0.00 ? 259 LEU A CB   1  
ATOM 4015   C CG   . LEU A 1 259 ? -21.462 -25.499 -3.471  1.00 0.00 ? 259 LEU A CG   1  
ATOM 4016   C CD1  . LEU A 1 259 ? -21.366 -26.999 -3.175  1.00 0.00 ? 259 LEU A CD1  1  
ATOM 4017   C CD2  . LEU A 1 259 ? -22.116 -24.800 -2.270  1.00 0.00 ? 259 LEU A CD2  1  
ATOM 4018   H H    . LEU A 1 259 ? -20.785 -24.123 -6.073  1.00 0.00 ? 259 LEU A H    1  
ATOM 4019   H HA   . LEU A 1 259 ? -20.716 -22.918 -3.461  1.00 0.00 ? 259 LEU A HA   1  
ATOM 4020   H HB2  . LEU A 1 259 ? -19.561 -25.521 -4.467  1.00 0.00 ? 259 LEU A HB2  1  
ATOM 4021   H HB3  . LEU A 1 259 ? -19.491 -24.993 -2.790  1.00 0.00 ? 259 LEU A HB3  1  
ATOM 4022   H HG   . LEU A 1 259 ? -22.064 -25.345 -4.354  1.00 0.00 ? 259 LEU A HG   1  
ATOM 4023   H HD11 . LEU A 1 259 ? -20.364 -27.238 -2.849  1.00 0.00 ? 259 LEU A HD11 1  
ATOM 4024   H HD12 . LEU A 1 259 ? -21.595 -27.558 -4.070  1.00 0.00 ? 259 LEU A HD12 1  
ATOM 4025   H HD13 . LEU A 1 259 ? -22.069 -27.261 -2.396  1.00 0.00 ? 259 LEU A HD13 1  
ATOM 4026   H HD21 . LEU A 1 259 ? -22.868 -24.110 -2.622  1.00 0.00 ? 259 LEU A HD21 1  
ATOM 4027   H HD22 . LEU A 1 259 ? -21.372 -24.263 -1.703  1.00 0.00 ? 259 LEU A HD22 1  
ATOM 4028   H HD23 . LEU A 1 259 ? -22.578 -25.540 -1.637  1.00 0.00 ? 259 LEU A HD23 1  
ATOM 4029   N N    . PRO A 1 260 ? -18.136 -22.384 -3.176  1.00 0.00 ? 260 PRO A N    1  
ATOM 4030   C CA   . PRO A 1 260 ? -16.769 -21.749 -3.247  1.00 0.00 ? 260 PRO A CA   1  
ATOM 4031   C C    . PRO A 1 260 ? -15.687 -22.642 -3.858  1.00 0.00 ? 260 PRO A C    1  
ATOM 4032   O O    . PRO A 1 260 ? -15.538 -23.785 -3.484  1.00 0.00 ? 260 PRO A O    1  
ATOM 4033   C CB   . PRO A 1 260 ? -16.431 -21.544 -1.773  1.00 0.00 ? 260 PRO A CB   1  
ATOM 4034   C CG   . PRO A 1 260 ? -17.744 -21.376 -1.099  1.00 0.00 ? 260 PRO A CG   1  
ATOM 4035   C CD   . PRO A 1 260 ? -18.678 -22.350 -1.799  1.00 0.00 ? 260 PRO A CD   1  
ATOM 4036   H HA   . PRO A 1 260 ? -16.811 -20.795 -3.743  1.00 0.00 ? 260 PRO A HA   1  
ATOM 4037   H HB2  . PRO A 1 260 ? -15.920 -22.416 -1.386  1.00 0.00 ? 260 PRO A HB2  1  
ATOM 4038   H HB3  . PRO A 1 260 ? -15.826 -20.672 -1.644  1.00 0.00 ? 260 PRO A HB3  1  
ATOM 4039   H HG2  . PRO A 1 260 ? -17.659 -21.618 -0.048  1.00 0.00 ? 260 PRO A HG2  1  
ATOM 4040   H HG3  . PRO A 1 260 ? -18.109 -20.371 -1.226  1.00 0.00 ? 260 PRO A HG3  1  
ATOM 4041   H HD2  . PRO A 1 260 ? -18.630 -23.327 -1.335  1.00 0.00 ? 260 PRO A HD2  1  
ATOM 4042   H HD3  . PRO A 1 260 ? -19.681 -21.965 -1.791  1.00 0.00 ? 260 PRO A HD3  1  
ATOM 4043   N N    . ALA A 1 261 ? -14.888 -22.042 -4.735  1.00 0.00 ? 261 ALA A N    1  
ATOM 4044   C CA   . ALA A 1 261 ? -13.742 -22.694 -5.397  1.00 0.00 ? 261 ALA A CA   1  
ATOM 4045   C C    . ALA A 1 261 ? -13.599 -24.212 -5.157  1.00 0.00 ? 261 ALA A C    1  
ATOM 4046   O O    . ALA A 1 261 ? -12.815 -24.630 -4.306  1.00 0.00 ? 261 ALA A O    1  
ATOM 4047   C CB   . ALA A 1 261 ? -12.462 -22.002 -4.940  1.00 0.00 ? 261 ALA A CB   1  
ATOM 4048   H H    . ALA A 1 261 ? -15.047 -21.094 -4.924  1.00 0.00 ? 261 ALA A H    1  
ATOM 4049   H HA   . ALA A 1 261 ? -13.837 -22.533 -6.458  1.00 0.00 ? 261 ALA A HA   1  
ATOM 4050   H HB1  . ALA A 1 261 ? -12.641 -20.942 -4.868  1.00 0.00 ? 261 ALA A HB1  1  
ATOM 4051   H HB2  . ALA A 1 261 ? -11.676 -22.188 -5.656  1.00 0.00 ? 261 ALA A HB2  1  
ATOM 4052   H HB3  . ALA A 1 261 ? -12.169 -22.385 -3.974  1.00 0.00 ? 261 ALA A HB3  1  
ATOM 4053   N N    . ILE A 1 262 ? -14.295 -25.032 -5.957  1.00 0.00 ? 262 ILE A N    1  
ATOM 4054   C CA   . ILE A 1 262 ? -14.170 -26.492 -5.875  1.00 0.00 ? 262 ILE A CA   1  
ATOM 4055   C C    . ILE A 1 262 ? -13.686 -27.038 -7.217  1.00 0.00 ? 262 ILE A C    1  
ATOM 4056   O O    . ILE A 1 262 ? -14.298 -26.795 -8.263  1.00 0.00 ? 262 ILE A O    1  
ATOM 4057   C CB   . ILE A 1 262 ? -15.518 -27.185 -5.535  1.00 0.00 ? 262 ILE A CB   1  
ATOM 4058   C CG1  . ILE A 1 262 ? -16.029 -26.703 -4.173  1.00 0.00 ? 262 ILE A CG1  1  
ATOM 4059   C CG2  . ILE A 1 262 ? -15.364 -28.690 -5.456  1.00 0.00 ? 262 ILE A CG2  1  
ATOM 4060   C CD1  . ILE A 1 262 ? -17.437 -27.195 -3.833  1.00 0.00 ? 262 ILE A CD1  1  
ATOM 4061   H H    . ILE A 1 262 ? -14.862 -24.665 -6.667  1.00 0.00 ? 262 ILE A H    1  
ATOM 4062   H HA   . ILE A 1 262 ? -13.446 -26.740 -5.113  1.00 0.00 ? 262 ILE A HA   1  
ATOM 4063   H HB   . ILE A 1 262 ? -16.245 -26.940 -6.294  1.00 0.00 ? 262 ILE A HB   1  
ATOM 4064   H HG12 . ILE A 1 262 ? -15.351 -27.049 -3.409  1.00 0.00 ? 262 ILE A HG12 1  
ATOM 4065   H HG13 . ILE A 1 262 ? -16.028 -25.622 -4.169  1.00 0.00 ? 262 ILE A HG13 1  
ATOM 4066   H HG21 . ILE A 1 262 ? -15.724 -29.039 -4.500  1.00 0.00 ? 262 ILE A HG21 1  
ATOM 4067   H HG22 . ILE A 1 262 ? -14.322 -28.951 -5.566  1.00 0.00 ? 262 ILE A HG22 1  
ATOM 4068   H HG23 . ILE A 1 262 ? -15.937 -29.152 -6.247  1.00 0.00 ? 262 ILE A HG23 1  
ATOM 4069   H HD11 . ILE A 1 262 ? -17.379 -28.190 -3.414  1.00 0.00 ? 262 ILE A HD11 1  
ATOM 4070   H HD12 . ILE A 1 262 ? -18.038 -27.217 -4.730  1.00 0.00 ? 262 ILE A HD12 1  
ATOM 4071   H HD13 . ILE A 1 262 ? -17.887 -26.528 -3.113  1.00 0.00 ? 262 ILE A HD13 1  
ATOM 4072   N N    . THR A 1 263 ? -12.588 -27.778 -7.183  1.00 0.00 ? 263 THR A N    1  
ATOM 4073   C CA   . THR A 1 263 ? -12.139 -28.509 -8.336  1.00 0.00 ? 263 THR A CA   1  
ATOM 4074   C C    . THR A 1 263 ? -13.219 -29.505 -8.803  1.00 0.00 ? 263 THR A C    1  
ATOM 4075   O O    . THR A 1 263 ? -14.126 -29.895 -8.019  1.00 0.00 ? 263 THR A O    1  
ATOM 4076   C CB   . THR A 1 263 ? -10.912 -29.301 -7.997  1.00 0.00 ? 263 THR A CB   1  
ATOM 4077   O OG1  . THR A 1 263 ? -11.236 -30.253 -6.970  1.00 0.00 ? 263 THR A OG1  1  
ATOM 4078   C CG2  . THR A 1 263 ? -9.802  -28.366 -7.534  1.00 0.00 ? 263 THR A CG2  1  
ATOM 4079   H H    . THR A 1 263 ? -12.148 -27.935 -6.321  1.00 0.00 ? 263 THR A H    1  
ATOM 4080   H HA   . THR A 1 263 ? -11.910 -27.821 -9.135  1.00 0.00 ? 263 THR A HA   1  
ATOM 4081   H HB   . THR A 1 263 ? -10.580 -29.832 -8.877  1.00 0.00 ? 263 THR A HB   1  
ATOM 4082   H HG1  . THR A 1 263 ? -11.865 -29.841 -6.372  1.00 0.00 ? 263 THR A HG1  1  
ATOM 4083   H HG21 . THR A 1 263 ? -8.851  -28.875 -7.600  1.00 0.00 ? 263 THR A HG21 1  
ATOM 4084   H HG22 . THR A 1 263 ? -9.981  -28.072 -6.510  1.00 0.00 ? 263 THR A HG22 1  
ATOM 4085   H HG23 . THR A 1 263 ? -9.784  -27.488 -8.163  1.00 0.00 ? 263 THR A HG23 1  
ATOM 4086   N N    . LEU A 1 264 ? -13.121 -29.887 -10.077 1.00 0.00 ? 264 LEU A N    1  
ATOM 4087   C CA   . LEU A 1 264 ? -13.943 -30.952 -10.664 1.00 0.00 ? 264 LEU A CA   1  
ATOM 4088   C C    . LEU A 1 264 ? -14.110 -32.150 -9.741  1.00 0.00 ? 264 LEU A C    1  
ATOM 4089   O O    . LEU A 1 264 ? -15.207 -32.640 -9.563  1.00 0.00 ? 264 LEU A O    1  
ATOM 4090   C CB   . LEU A 1 264 ? -13.354 -31.389 -12.017 1.00 0.00 ? 264 LEU A CB   1  
ATOM 4091   C CG   . LEU A 1 264 ? -13.573 -30.266 -13.054 1.00 0.00 ? 264 LEU A CG   1  
ATOM 4092   C CD1  . LEU A 1 264 ? -12.734 -30.424 -14.345 1.00 0.00 ? 264 LEU A CD1  1  
ATOM 4093   C CD2  . LEU A 1 264 ? -15.134 -30.040 -13.326 1.00 0.00 ? 264 LEU A CD2  1  
ATOM 4094   H H    . LEU A 1 264 ? -12.391 -29.516 -10.616 1.00 0.00 ? 264 LEU A H    1  
ATOM 4095   H HA   . LEU A 1 264 ? -14.925 -30.543 -10.851 1.00 0.00 ? 264 LEU A HA   1  
ATOM 4096   H HB2  . LEU A 1 264 ? -12.295 -31.578 -11.905 1.00 0.00 ? 264 LEU A HB2  1  
ATOM 4097   H HB3  . LEU A 1 264 ? -13.848 -32.288 -12.353 1.00 0.00 ? 264 LEU A HB3  1  
ATOM 4098   H HG   . LEU A 1 264 ? -13.212 -29.360 -12.583 1.00 0.00 ? 264 LEU A HG   1  
ATOM 4099   H HD11 . LEU A 1 264 ? -13.383 -30.690 -15.166 1.00 0.00 ? 264 LEU A HD11 1  
ATOM 4100   H HD12 . LEU A 1 264 ? -11.997 -31.201 -14.203 1.00 0.00 ? 264 LEU A HD12 1  
ATOM 4101   H HD13 . LEU A 1 264 ? -12.235 -29.491 -14.566 1.00 0.00 ? 264 LEU A HD13 1  
ATOM 4102   H HD21 . LEU A 1 264 ? -15.286 -29.796 -14.368 1.00 0.00 ? 264 LEU A HD21 1  
ATOM 4103   H HD22 . LEU A 1 264 ? -15.493 -29.228 -12.712 1.00 0.00 ? 264 LEU A HD22 1  
ATOM 4104   H HD23 . LEU A 1 264 ? -15.676 -30.943 -13.082 1.00 0.00 ? 264 LEU A HD23 1  
ATOM 4105   N N    . ASP A 1 265 ? -13.020 -32.588 -9.124  1.00 0.00 ? 265 ASP A N    1  
ATOM 4106   C CA   . ASP A 1 265 ? -13.035 -33.763 -8.256  1.00 0.00 ? 265 ASP A CA   1  
ATOM 4107   C C    . ASP A 1 265 ? -13.292 -33.470 -6.787  1.00 0.00 ? 265 ASP A C    1  
ATOM 4108   O O    . ASP A 1 265 ? -12.985 -34.292 -5.947  1.00 0.00 ? 265 ASP A O    1  
ATOM 4109   C CB   . ASP A 1 265 ? -11.728 -34.557 -8.402  1.00 0.00 ? 265 ASP A CB   1  
ATOM 4110   C CG   . ASP A 1 265 ? -10.533 -33.775 -7.936  1.00 0.00 ? 265 ASP A CG   1  
ATOM 4111   O OD1  . ASP A 1 265 ? -10.725 -32.636 -7.459  1.00 0.00 ? 265 ASP A OD1  1  
ATOM 4112   O OD2  . ASP A 1 265 ? -9.408  -34.295 -8.030  1.00 0.00 ? 265 ASP A OD2  1  
ATOM 4113   H H    . ASP A 1 265 ? -12.169 -32.130 -9.285  1.00 0.00 ? 265 ASP A H    1  
ATOM 4114   H HA   . ASP A 1 265 ? -13.834 -34.403 -8.599  1.00 0.00 ? 265 ASP A HA   1  
ATOM 4115   H HB2  . ASP A 1 265 ? -11.801 -35.462 -7.818  1.00 0.00 ? 265 ASP A HB2  1  
ATOM 4116   H HB3  . ASP A 1 265 ? -11.594 -34.822 -9.442  1.00 0.00 ? 265 ASP A HB3  1  
ATOM 4117   N N    . GLY A 1 266 ? -13.879 -32.330 -6.467  1.00 0.00 ? 266 GLY A N    1  
ATOM 4118   C CA   . GLY A 1 266 ? -14.377 -32.102 -5.089  1.00 0.00 ? 266 GLY A CA   1  
ATOM 4119   C C    . GLY A 1 266 ? -13.505 -31.439 -4.022  1.00 0.00 ? 266 GLY A C    1  
ATOM 4120   O O    . GLY A 1 266 ? -13.847 -31.471 -2.853  1.00 0.00 ? 266 GLY A O    1  
ATOM 4121   H H    . GLY A 1 266 ? -14.131 -31.704 -7.178  1.00 0.00 ? 266 GLY A H    1  
ATOM 4122   H HA2  . GLY A 1 266 ? -15.266 -31.501 -5.172  1.00 0.00 ? 266 GLY A HA2  1  
ATOM 4123   H HA3  . GLY A 1 266 ? -14.684 -33.068 -4.706  1.00 0.00 ? 266 GLY A HA3  1  
ATOM 4124   N N    . HIS A 1 267 ? -12.398 -30.831 -4.421  1.00 0.00 ? 267 HIS A N    1  
ATOM 4125   C CA   . HIS A 1 267 ? -11.476 -30.246 -3.456  1.00 0.00 ? 267 HIS A CA   1  
ATOM 4126   C C    . HIS A 1 267 ? -11.809 -28.782 -3.352  1.00 0.00 ? 267 HIS A C    1  
ATOM 4127   O O    . HIS A 1 267 ? -11.789 -28.075 -4.365  1.00 0.00 ? 267 HIS A O    1  
ATOM 4128   C CB   . HIS A 1 267 ? -10.010 -30.411 -3.895  1.00 0.00 ? 267 HIS A CB   1  
ATOM 4129   C CG   . HIS A 1 267 ? -9.014  -30.074 -2.828  1.00 0.00 ? 267 HIS A CG   1  
ATOM 4130   N ND1  . HIS A 1 267 ? -8.634  -28.778 -2.542  1.00 0.00 ? 267 HIS A ND1  1  
ATOM 4131   C CD2  . HIS A 1 267 ? -8.295  -30.864 -1.994  1.00 0.00 ? 267 HIS A CD2  1  
ATOM 4132   C CE1  . HIS A 1 267 ? -7.740  -28.785 -1.567  1.00 0.00 ? 267 HIS A CE1  1  
ATOM 4133   N NE2  . HIS A 1 267 ? -7.521  -30.036 -1.212  1.00 0.00 ? 267 HIS A NE2  1  
ATOM 4134   H H    . HIS A 1 267 ? -12.170 -30.821 -5.374  1.00 0.00 ? 267 HIS A H    1  
ATOM 4135   H HA   . HIS A 1 267 ? -11.619 -30.715 -2.493  1.00 0.00 ? 267 HIS A HA   1  
ATOM 4136   H HB2  . HIS A 1 267 ? -9.854  -31.435 -4.194  1.00 0.00 ? 267 HIS A HB2  1  
ATOM 4137   H HB3  . HIS A 1 267 ? -9.835  -29.773 -4.751  1.00 0.00 ? 267 HIS A HB3  1  
ATOM 4138   H HD1  . HIS A 1 267 ? -8.974  -27.977 -2.991  1.00 0.00 ? 267 HIS A HD1  1  
ATOM 4139   H HD2  . HIS A 1 267 ? -8.324  -31.943 -1.951  1.00 0.00 ? 267 HIS A HD2  1  
ATOM 4140   H HE1  . HIS A 1 267 ? -7.270  -27.914 -1.134  1.00 0.00 ? 267 HIS A HE1  1  
ATOM 4141   H HE2  . HIS A 1 267 ? -6.906  -30.330 -0.507  1.00 0.00 ? 267 HIS A HE2  1  
ATOM 4142   N N    . GLN A 1 268 ? -12.102 -28.333 -2.134  1.00 0.00 ? 268 GLN A N    1  
ATOM 4143   C CA   . GLN A 1 268 ? -12.453 -26.947 -1.893  1.00 0.00 ? 268 GLN A CA   1  
ATOM 4144   C C    . GLN A 1 268 ? -11.351 -26.118 -1.254  1.00 0.00 ? 268 GLN A C    1  
ATOM 4145   O O    . GLN A 1 268 ? -10.637 -26.595 -0.354  1.00 0.00 ? 268 GLN A O    1  
ATOM 4146   C CB   . GLN A 1 268 ? -13.665 -26.876 -0.993  1.00 0.00 ? 268 GLN A CB   1  
ATOM 4147   C CG   . GLN A 1 268 ? -14.223 -25.486 -0.899  1.00 0.00 ? 268 GLN A CG   1  
ATOM 4148   C CD   . GLN A 1 268 ? -15.452 -25.441 -0.054  1.00 0.00 ? 268 GLN A CD   1  
ATOM 4149   O OE1  . GLN A 1 268 ? -16.257 -26.366 -0.083  1.00 0.00 ? 268 GLN A OE1  1  
ATOM 4150   N NE2  . GLN A 1 268 ? -15.615 -24.358 0.729   1.00 0.00 ? 268 GLN A NE2  1  
ATOM 4151   H H    . GLN A 1 268 ? -12.088 -28.959 -1.380  1.00 0.00 ? 268 GLN A H    1  
ATOM 4152   H HA   . GLN A 1 268 ? -12.715 -26.495 -2.836  1.00 0.00 ? 268 GLN A HA   1  
ATOM 4153   H HB2  . GLN A 1 268 ? -14.428 -27.533 -1.382  1.00 0.00 ? 268 GLN A HB2  1  
ATOM 4154   H HB3  . GLN A 1 268 ? -13.386 -27.211 -0.004  1.00 0.00 ? 268 GLN A HB3  1  
ATOM 4155   H HG2  . GLN A 1 268 ? -13.477 -24.835 -0.469  1.00 0.00 ? 268 GLN A HG2  1  
ATOM 4156   H HG3  . GLN A 1 268 ? -14.465 -25.136 -1.893  1.00 0.00 ? 268 GLN A HG3  1  
ATOM 4157   H HE21 . GLN A 1 268 ? -14.942 -23.645 0.724   1.00 0.00 ? 268 GLN A HE21 1  
ATOM 4158   H HE22 . GLN A 1 268 ? -16.406 -24.283 1.302   1.00 0.00 ? 268 GLN A HE22 1  
ATOM 4159   N N    . VAL A 1 269 ? -11.240 -24.868 -1.700  1.00 0.00 ? 269 VAL A N    1  
ATOM 4160   C CA   . VAL A 1 269 ? -10.353 -23.891 -1.041  1.00 0.00 ? 269 VAL A CA   1  
ATOM 4161   C C    . VAL A 1 269 ? -11.109 -22.588 -0.802  1.00 0.00 ? 269 VAL A C    1  
ATOM 4162   O O    . VAL A 1 269 ? -12.112 -22.343 -1.430  1.00 0.00 ? 269 VAL A O    1  
ATOM 4163   C CB   . VAL A 1 269 ? -9.075  -23.606 -1.862  1.00 0.00 ? 269 VAL A CB   1  
ATOM 4164   C CG1  . VAL A 1 269 ? -8.282  -24.857 -2.025  1.00 0.00 ? 269 VAL A CG1  1  
ATOM 4165   C CG2  . VAL A 1 269 ? -9.420  -23.048 -3.211  1.00 0.00 ? 269 VAL A CG2  1  
ATOM 4166   H H    . VAL A 1 269 ? -11.854 -24.557 -2.397  1.00 0.00 ? 269 VAL A H    1  
ATOM 4167   H HA   . VAL A 1 269 ? -10.061 -24.294 -0.081  1.00 0.00 ? 269 VAL A HA   1  
ATOM 4168   H HB   . VAL A 1 269 ? -8.475  -22.884 -1.325  1.00 0.00 ? 269 VAL A HB   1  
ATOM 4169   H HG11 . VAL A 1 269 ? -7.285  -24.704 -1.639  1.00 0.00 ? 269 VAL A HG11 1  
ATOM 4170   H HG12 . VAL A 1 269 ? -8.228  -25.114 -3.073  1.00 0.00 ? 269 VAL A HG12 1  
ATOM 4171   H HG13 . VAL A 1 269 ? -8.759  -25.659 -1.480  1.00 0.00 ? 269 VAL A HG13 1  
ATOM 4172   H HG21 . VAL A 1 269 ? -9.749  -22.024 -3.104  1.00 0.00 ? 269 VAL A HG21 1  
ATOM 4173   H HG22 . VAL A 1 269 ? -10.212 -23.636 -3.652  1.00 0.00 ? 269 VAL A HG22 1  
ATOM 4174   H HG23 . VAL A 1 269 ? -8.548  -23.081 -3.848  1.00 0.00 ? 269 VAL A HG23 1  
ATOM 4175   N N    . GLU A 1 270 ? -10.646 -21.757 0.111   1.00 0.00 ? 270 GLU A N    1  
ATOM 4176   C CA   . GLU A 1 270 ? -11.229 -20.459 0.209   1.00 0.00 ? 270 GLU A CA   1  
ATOM 4177   C C    . GLU A 1 270 ? -10.532 -19.538 -0.776  1.00 0.00 ? 270 GLU A C    1  
ATOM 4178   O O    . GLU A 1 270 ? -9.361  -19.719 -1.112  1.00 0.00 ? 270 GLU A O    1  
ATOM 4179   C CB   . GLU A 1 270 ? -11.069 -19.915 1.615   1.00 0.00 ? 270 GLU A CB   1  
ATOM 4180   C CG   . GLU A 1 270 ? -11.703 -20.754 2.729   1.00 0.00 ? 270 GLU A CG   1  
ATOM 4181   C CD   . GLU A 1 270 ? -11.515 -20.111 4.094   1.00 0.00 ? 270 GLU A CD   1  
ATOM 4182   O OE1  . GLU A 1 270 ? -10.359 -19.713 4.415   1.00 0.00 ? 270 GLU A OE1  1  
ATOM 4183   O OE2  . GLU A 1 270 ? -12.518 -20.012 4.838   1.00 0.00 ? 270 GLU A OE2  1  
ATOM 4184   H H    . GLU A 1 270 ? -9.837  -21.977 0.618   1.00 0.00 ? 270 GLU A H    1  
ATOM 4185   H HA   . GLU A 1 270 ? -12.279 -20.517 -0.034  1.00 0.00 ? 270 GLU A HA   1  
ATOM 4186   H HB2  . GLU A 1 270 ? -10.014 -19.826 1.825   1.00 0.00 ? 270 GLU A HB2  1  
ATOM 4187   H HB3  . GLU A 1 270 ? -11.502 -18.925 1.643   1.00 0.00 ? 270 GLU A HB3  1  
ATOM 4188   H HG2  . GLU A 1 270 ? -12.760 -20.858 2.534   1.00 0.00 ? 270 GLU A HG2  1  
ATOM 4189   H HG3  . GLU A 1 270 ? -11.248 -21.734 2.734   1.00 0.00 ? 270 GLU A HG3  1  
ATOM 4190   N N    . VAL A 1 271 ? -11.248 -18.516 -1.197  1.00 0.00 ? 271 VAL A N    1  
ATOM 4191   C CA   . VAL A 1 271 ? -10.747 -17.568 -2.145  1.00 0.00 ? 271 VAL A CA   1  
ATOM 4192   C C    . VAL A 1 271 ? -11.317 -16.235 -1.692  1.00 0.00 ? 271 VAL A C    1  
ATOM 4193   O O    . VAL A 1 271 ? -12.535 -16.045 -1.681  1.00 0.00 ? 271 VAL A O    1  
ATOM 4194   C CB   . VAL A 1 271 ? -11.228 -17.926 -3.556  1.00 0.00 ? 271 VAL A CB   1  
ATOM 4195   C CG1  . VAL A 1 271 ? -10.822 -16.872 -4.530  1.00 0.00 ? 271 VAL A CG1  1  
ATOM 4196   C CG2  . VAL A 1 271 ? -10.649 -19.261 -3.997  1.00 0.00 ? 271 VAL A CG2  1  
ATOM 4197   H H    . VAL A 1 271 ? -12.163 -18.410 -0.861  1.00 0.00 ? 271 VAL A H    1  
ATOM 4198   H HA   . VAL A 1 271 ? -9.667  -17.542 -2.110  1.00 0.00 ? 271 VAL A HA   1  
ATOM 4199   H HB   . VAL A 1 271 ? -12.306 -17.997 -3.549  1.00 0.00 ? 271 VAL A HB   1  
ATOM 4200   H HG11 . VAL A 1 271 ? -11.096 -17.179 -5.528  1.00 0.00 ? 271 VAL A HG11 1  
ATOM 4201   H HG12 . VAL A 1 271 ? -9.753  -16.727 -4.478  1.00 0.00 ? 271 VAL A HG12 1  
ATOM 4202   H HG13 . VAL A 1 271 ? -11.323 -15.947 -4.290  1.00 0.00 ? 271 VAL A HG13 1  
ATOM 4203   H HG21 . VAL A 1 271 ? -11.074 -20.054 -3.398  1.00 0.00 ? 271 VAL A HG21 1  
ATOM 4204   H HG22 . VAL A 1 271 ? -9.576  -19.248 -3.867  1.00 0.00 ? 271 VAL A HG22 1  
ATOM 4205   H HG23 . VAL A 1 271 ? -10.885 -19.430 -5.037  1.00 0.00 ? 271 VAL A HG23 1  
ATOM 4206   N N    . CYS A 1 272 ? -10.442 -15.322 -1.301  1.00 0.00 ? 272 CYS A N    1  
ATOM 4207   C CA   . CYS A 1 272 ? -10.876 -14.136 -0.604  1.00 0.00 ? 272 CYS A CA   1  
ATOM 4208   C C    . CYS A 1 272 ? -10.183 -12.958 -1.151  1.00 0.00 ? 272 CYS A C    1  
ATOM 4209   O O    . CYS A 1 272 ? -9.226  -13.096 -1.954  1.00 0.00 ? 272 CYS A O    1  
ATOM 4210   C CB   . CYS A 1 272 ? -10.461 -14.188 0.843   1.00 0.00 ? 272 CYS A CB   1  
ATOM 4211   S SG   . CYS A 1 272 ? -11.376 -15.311 1.786   1.00 0.00 ? 272 CYS A SG   1  
ATOM 4212   H H    . CYS A 1 272 ? -9.486  -15.538 -1.322  1.00 0.00 ? 272 CYS A H    1  
ATOM 4213   H HA   . CYS A 1 272 ? -11.945 -14.019 -0.676  1.00 0.00 ? 272 CYS A HA   1  
ATOM 4214   H HB2  . CYS A 1 272 ? -9.422  -14.470 0.895   1.00 0.00 ? 272 CYS A HB2  1  
ATOM 4215   H HB3  . CYS A 1 272 ? -10.570 -13.198 1.267   1.00 0.00 ? 272 CYS A HB3  1  
ATOM 4216   H HG   . CYS A 1 272 ? -11.022 -15.307 2.679   1.00 0.00 ? 272 CYS A HG   1  
ATOM 4217   N N    . ALA A 1 273 ? -10.633 -11.793 -0.691  1.00 0.00 ? 273 ALA A N    1  
ATOM 4218   C CA   . ALA A 1 273 ? -10.032 -10.562 -1.121  1.00 0.00 ? 273 ALA A CA   1  
ATOM 4219   C C    . ALA A 1 273 ? -9.031  -10.064 -0.084  1.00 0.00 ? 273 ALA A C    1  
ATOM 4220   O O    . ALA A 1 273 ? -9.233  -10.212 1.126   1.00 0.00 ? 273 ALA A O    1  
ATOM 4221   C CB   . ALA A 1 273 ? -11.079 -9.539  -1.405  1.00 0.00 ? 273 ALA A CB   1  
ATOM 4222   H H    . ALA A 1 273 ? -11.368 -11.776 -0.043  1.00 0.00 ? 273 ALA A H    1  
ATOM 4223   H HA   . ALA A 1 273 ? -9.493  -10.757 -2.038  1.00 0.00 ? 273 ALA A HA   1  
ATOM 4224   H HB1  . ALA A 1 273 ? -11.435 -9.120  -0.476  1.00 0.00 ? 273 ALA A HB1  1  
ATOM 4225   H HB2  . ALA A 1 273 ? -11.902 -10.003 -1.930  1.00 0.00 ? 273 ALA A HB2  1  
ATOM 4226   H HB3  . ALA A 1 273 ? -10.659 -8.753  -2.015  1.00 0.00 ? 273 ALA A HB3  1  
ATOM 4227   N N    . ASN A 1 274 ? -7.923  -9.526  -0.563  1.00 0.00 ? 274 ASN A N    1  
ATOM 4228   C CA   . ASN A 1 274 ? -7.100  -8.693  0.262   1.00 0.00 ? 274 ASN A CA   1  
ATOM 4229   C C    . ASN A 1 274 ? -7.743  -7.352  0.201   1.00 0.00 ? 274 ASN A C    1  
ATOM 4230   O O    . ASN A 1 274 ? -8.174  -6.973  -0.872  1.00 0.00 ? 274 ASN A O    1  
ATOM 4231   C CB   . ASN A 1 274 ? -5.726  -8.600  -0.360  1.00 0.00 ? 274 ASN A CB   1  
ATOM 4232   C CG   . ASN A 1 274 ? -4.980  -9.908  -0.294  1.00 0.00 ? 274 ASN A CG   1  
ATOM 4233   O OD1  . ASN A 1 274 ? -5.320  -10.780 0.506   1.00 0.00 ? 274 ASN A OD1  1  
ATOM 4234   N ND2  . ASN A 1 274 ? -3.952  -10.048 -1.118  1.00 0.00 ? 274 ASN A ND2  1  
ATOM 4235   H H    . ASN A 1 274 ? -7.805  -9.483  -1.535  1.00 0.00 ? 274 ASN A H    1  
ATOM 4236   H HA   . ASN A 1 274 ? -7.049  -9.063  1.274   1.00 0.00 ? 274 ASN A HA   1  
ATOM 4237   H HB2  . ASN A 1 274 ? -5.828  -8.309  -1.394  1.00 0.00 ? 274 ASN A HB2  1  
ATOM 4238   H HB3  . ASN A 1 274 ? -5.156  -7.844  0.161   1.00 0.00 ? 274 ASN A HB3  1  
ATOM 4239   H HD21 . ASN A 1 274 ? -3.711  -9.320  -1.729  1.00 0.00 ? 274 ASN A HD21 1  
ATOM 4240   H HD22 . ASN A 1 274 ? -3.432  -10.878 -1.117  1.00 0.00 ? 274 ASN A HD22 1  
ATOM 4241   N N    . ILE A 1 275 ? -7.860  -6.642  1.321   1.00 0.00 ? 275 ILE A N    1  
ATOM 4242   C CA   . ILE A 1 275 ? -8.420  -5.274  1.290   1.00 0.00 ? 275 ILE A CA   1  
ATOM 4243   C C    . ILE A 1 275 ? -7.565  -4.270  2.050   1.00 0.00 ? 275 ILE A C    1  
ATOM 4244   O O    . ILE A 1 275 ? -6.688  -4.619  2.842   1.00 0.00 ? 275 ILE A O    1  
ATOM 4245   C CB   . ILE A 1 275 ? -9.892  -5.169  1.857   1.00 0.00 ? 275 ILE A CB   1  
ATOM 4246   C CG1  . ILE A 1 275 ? -9.938  -5.691  3.308   1.00 0.00 ? 275 ILE A CG1  1  
ATOM 4247   C CG2  . ILE A 1 275 ? -10.918 -5.868  0.949   1.00 0.00 ? 275 ILE A CG2  1  
ATOM 4248   C CD1  . ILE A 1 275 ? -11.305 -5.606  4.029   1.00 0.00 ? 275 ILE A CD1  1  
ATOM 4249   H H    . ILE A 1 275 ? -7.524  -7.009  2.165   1.00 0.00 ? 275 ILE A H    1  
ATOM 4250   H HA   . ILE A 1 275 ? -8.448  -4.961  0.257   1.00 0.00 ? 275 ILE A HA   1  
ATOM 4251   H HB   . ILE A 1 275 ? -10.150 -4.117  1.876   1.00 0.00 ? 275 ILE A HB   1  
ATOM 4252   H HG12 . ILE A 1 275 ? -9.634  -6.725  3.301   1.00 0.00 ? 275 ILE A HG12 1  
ATOM 4253   H HG13 . ILE A 1 275 ? -9.212  -5.133  3.885   1.00 0.00 ? 275 ILE A HG13 1  
ATOM 4254   H HG21 . ILE A 1 275 ? -10.531 -5.919  -0.059  1.00 0.00 ? 275 ILE A HG21 1  
ATOM 4255   H HG22 . ILE A 1 275 ? -11.842 -5.309  0.952   1.00 0.00 ? 275 ILE A HG22 1  
ATOM 4256   H HG23 . ILE A 1 275 ? -11.100 -6.868  1.316   1.00 0.00 ? 275 ILE A HG23 1  
ATOM 4257   H HD11 . ILE A 1 275 ? -11.596 -4.570  4.127   1.00 0.00 ? 275 ILE A HD11 1  
ATOM 4258   H HD12 . ILE A 1 275 ? -11.224 -6.051  5.010   1.00 0.00 ? 275 ILE A HD12 1  
ATOM 4259   H HD13 . ILE A 1 275 ? -12.049 -6.136  3.454   1.00 0.00 ? 275 ILE A HD13 1  
ATOM 4260   N N    . GLY A 1 276 ? -7.889  -2.998  1.833   1.00 0.00 ? 276 GLY A N    1  
ATOM 4261   C CA   . GLY A 1 276 ? -7.220  -1.905  2.487   1.00 0.00 ? 276 GLY A CA   1  
ATOM 4262   C C    . GLY A 1 276 ? -8.131  -1.041  3.329   1.00 0.00 ? 276 GLY A C    1  
ATOM 4263   O O    . GLY A 1 276 ? -7.634  -0.319  4.179   1.00 0.00 ? 276 GLY A O    1  
ATOM 4264   H H    . GLY A 1 276 ? -8.628  -2.799  1.221   1.00 0.00 ? 276 GLY A H    1  
ATOM 4265   H HA2  . GLY A 1 276 ? -6.446  -2.307  3.123   1.00 0.00 ? 276 GLY A HA2  1  
ATOM 4266   H HA3  . GLY A 1 276 ? -6.757  -1.285  1.732   1.00 0.00 ? 276 GLY A HA3  1  
ATOM 4267   N N    . THR A 1 277 ? -9.447  -1.126  3.113   1.00 0.00 ? 277 THR A N    1  
ATOM 4268   C CA   . THR A 1 277 ? -10.407 -0.072  3.489   1.00 0.00 ? 277 THR A CA   1  
ATOM 4269   C C    . THR A 1 277 ? -11.800 -0.629  3.274   1.00 0.00 ? 277 THR A C    1  
ATOM 4270   O O    . THR A 1 277 ? -12.004 -1.192  2.199   1.00 0.00 ? 277 THR A O    1  
ATOM 4271   C CB   . THR A 1 277 ? -10.326 1.067   2.418   1.00 0.00 ? 277 THR A CB   1  
ATOM 4272   O OG1  . THR A 1 277 ? -8.972  1.459   2.202   1.00 0.00 ? 277 THR A OG1  1  
ATOM 4273   C CG2  . THR A 1 277 ? -11.047 2.254   2.868   1.00 0.00 ? 277 THR A CG2  1  
ATOM 4274   H H    . THR A 1 277 ? -9.741  -1.761  2.426   1.00 0.00 ? 277 THR A H    1  
ATOM 4275   H HA   . THR A 1 277 ? -10.254 0.305   4.485   1.00 0.00 ? 277 THR A HA   1  
ATOM 4276   H HB   . THR A 1 277 ? -10.753 0.719   1.489   1.00 0.00 ? 277 THR A HB   1  
ATOM 4277   H HG1  . THR A 1 277 ? -8.914  1.858   1.331   1.00 0.00 ? 277 THR A HG1  1  
ATOM 4278   H HG21 . THR A 1 277 ? -12.110 2.068   2.827   1.00 0.00 ? 277 THR A HG21 1  
ATOM 4279   H HG22 . THR A 1 277 ? -10.801 3.089   2.228   1.00 0.00 ? 277 THR A HG22 1  
ATOM 4280   H HG23 . THR A 1 277 ? -10.765 2.483   3.885   1.00 0.00 ? 277 THR A HG23 1  
ATOM 4281   N N    . VAL A 1 278 ? -12.768 -0.451  4.198   1.00 0.00 ? 278 VAL A N    1  
ATOM 4282   C CA   . VAL A 1 278 ? -14.190 -0.806  3.901   1.00 0.00 ? 278 VAL A CA   1  
ATOM 4283   C C    . VAL A 1 278 ? -14.561 -0.676  2.427   1.00 0.00 ? 278 VAL A C    1  
ATOM 4284   O O    . VAL A 1 278 ? -15.332 -1.494  1.884   1.00 0.00 ? 278 VAL A O    1  
ATOM 4285   C CB   . VAL A 1 278 ? -15.244 0.141   4.558   1.00 0.00 ? 278 VAL A CB   1  
ATOM 4286   C CG1  . VAL A 1 278 ? -15.184 0.098   6.131   1.00 0.00 ? 278 VAL A CG1  1  
ATOM 4287   C CG2  . VAL A 1 278 ? -15.259 1.548   3.911   1.00 0.00 ? 278 VAL A CG2  1  
ATOM 4288   H H    . VAL A 1 278 ? -12.561 0.044   5.018   1.00 0.00 ? 278 VAL A H    1  
ATOM 4289   H HA   . VAL A 1 278 ? -14.381 -1.814  4.231   1.00 0.00 ? 278 VAL A HA   1  
ATOM 4290   H HB   . VAL A 1 278 ? -16.203 -0.310  4.313   1.00 0.00 ? 278 VAL A HB   1  
ATOM 4291   H HG11 . VAL A 1 278 ? -14.155 0.156   6.454   1.00 0.00 ? 278 VAL A HG11 1  
ATOM 4292   H HG12 . VAL A 1 278 ? -15.620 -0.825  6.483   1.00 0.00 ? 278 VAL A HG12 1  
ATOM 4293   H HG13 . VAL A 1 278 ? -15.737 0.934   6.535   1.00 0.00 ? 278 VAL A HG13 1  
ATOM 4294   H HG21 . VAL A 1 278 ? -14.246 1.851   3.684   1.00 0.00 ? 278 VAL A HG21 1  
ATOM 4295   H HG22 . VAL A 1 278 ? -15.701 2.256   4.596   1.00 0.00 ? 278 VAL A HG22 1  
ATOM 4296   H HG23 . VAL A 1 278 ? -15.838 1.520   3.000   1.00 0.00 ? 278 VAL A HG23 1  
ATOM 4297   N N    . ARG A 1 279 ? -14.040 0.378   1.790   1.00 0.00 ? 279 ARG A N    1  
ATOM 4298   C CA   . ARG A 1 279 ? -14.371 0.656   0.402   1.00 0.00 ? 279 ARG A CA   1  
ATOM 4299   C C    . ARG A 1 279 ? -13.990 -0.492  -0.543  1.00 0.00 ? 279 ARG A C    1  
ATOM 4300   O O    . ARG A 1 279 ? -14.502 -0.562  -1.663  1.00 0.00 ? 279 ARG A O    1  
ATOM 4301   C CB   . ARG A 1 279 ? -13.762 1.977   -0.071  1.00 0.00 ? 279 ARG A CB   1  
ATOM 4302   C CG   . ARG A 1 279 ? -14.380 3.271   0.551   1.00 0.00 ? 279 ARG A CG   1  
ATOM 4303   C CD   . ARG A 1 279 ? -13.858 4.519   -0.154  1.00 0.00 ? 279 ARG A CD   1  
ATOM 4304   N NE   . ARG A 1 279 ? -12.399 4.685   0.064   1.00 0.00 ? 279 ARG A NE   1  
ATOM 4305   C CZ   . ARG A 1 279 ? -11.823 5.317   1.101   1.00 0.00 ? 279 ARG A CZ   1  
ATOM 4306   N NH1  . ARG A 1 279 ? -12.539 5.899   2.045   1.00 0.00 ? 279 ARG A NH1  1  
ATOM 4307   N NH2  . ARG A 1 279 ? -10.513 5.393   1.180   1.00 0.00 ? 279 ARG A NH2  1  
ATOM 4308   H H    . ARG A 1 279 ? -13.462 0.999   2.281   1.00 0.00 ? 279 ARG A H    1  
ATOM 4309   H HA   . ARG A 1 279 ? -15.445 0.763   0.350   1.00 0.00 ? 279 ARG A HA   1  
ATOM 4310   H HB2  . ARG A 1 279 ? -12.709 1.965   0.163   1.00 0.00 ? 279 ARG A HB2  1  
ATOM 4311   H HB3  . ARG A 1 279 ? -13.868 2.030   -1.146  1.00 0.00 ? 279 ARG A HB3  1  
ATOM 4312   H HG2  . ARG A 1 279 ? -15.455 3.233   0.454   1.00 0.00 ? 279 ARG A HG2  1  
ATOM 4313   H HG3  . ARG A 1 279 ? -14.122 3.319   1.599   1.00 0.00 ? 279 ARG A HG3  1  
ATOM 4314   H HD2  . ARG A 1 279 ? -14.049 4.434   -1.213  1.00 0.00 ? 279 ARG A HD2  1  
ATOM 4315   H HD3  . ARG A 1 279 ? -14.377 5.385   0.230   1.00 0.00 ? 279 ARG A HD3  1  
ATOM 4316   H HE   . ARG A 1 279 ? -11.801 4.298   -0.608  1.00 0.00 ? 279 ARG A HE   1  
ATOM 4317   H HH11 . ARG A 1 279 ? -13.538 5.876   1.999   1.00 0.00 ? 279 ARG A HH11 1  
ATOM 4318   H HH12 . ARG A 1 279 ? -12.084 6.361   2.805   1.00 0.00 ? 279 ARG A HH12 1  
ATOM 4319   H HH21 . ARG A 1 279 ? -9.944  4.980   0.468   1.00 0.00 ? 279 ARG A HH21 1  
ATOM 4320   H HH22 . ARG A 1 279 ? -10.086 5.863   1.952   1.00 0.00 ? 279 ARG A HH22 1  
ATOM 4321   N N    . ASP A 1 280 ? -13.126 -1.392  -0.087  1.00 0.00 ? 280 ASP A N    1  
ATOM 4322   C CA   . ASP A 1 280 ? -12.665 -2.467  -0.907  1.00 0.00 ? 280 ASP A CA   1  
ATOM 4323   C C    . ASP A 1 280 ? -13.613 -3.655  -0.780  1.00 0.00 ? 280 ASP A C    1  
ATOM 4324   O O    . ASP A 1 280 ? -13.548 -4.601  -1.595  1.00 0.00 ? 280 ASP A O    1  
ATOM 4325   C CB   . ASP A 1 280 ? -11.258 -2.882  -0.507  1.00 0.00 ? 280 ASP A CB   1  
ATOM 4326   C CG   . ASP A 1 280 ? -10.183 -1.856  -0.916  1.00 0.00 ? 280 ASP A CG   1  
ATOM 4327   O OD1  . ASP A 1 280 ? -10.497 -0.940  -1.722  1.00 0.00 ? 280 ASP A OD1  1  
ATOM 4328   O OD2  . ASP A 1 280 ? -9.021  -1.972  -0.419  1.00 0.00 ? 280 ASP A OD2  1  
ATOM 4329   H H    . ASP A 1 280 ? -12.768 -1.295  0.820   1.00 0.00 ? 280 ASP A H    1  
ATOM 4330   H HA   . ASP A 1 280 ? -12.652 -2.140  -1.936  1.00 0.00 ? 280 ASP A HA   1  
ATOM 4331   H HB2  . ASP A 1 280 ? -11.225 -3.007  0.565   1.00 0.00 ? 280 ASP A HB2  1  
ATOM 4332   H HB3  . ASP A 1 280 ? -11.031 -3.830  -0.974  1.00 0.00 ? 280 ASP A HB3  1  
ATOM 4333   N N    . VAL A 1 281 ? -14.490 -3.615  0.224   1.00 0.00 ? 281 VAL A N    1  
ATOM 4334   C CA   . VAL A 1 281 ? -15.428 -4.690  0.470   1.00 0.00 ? 281 VAL A CA   1  
ATOM 4335   C C    . VAL A 1 281 ? -16.391 -4.781  -0.720  1.00 0.00 ? 281 VAL A C    1  
ATOM 4336   O O    . VAL A 1 281 ? -16.915 -5.849  -1.094  1.00 0.00 ? 281 VAL A O    1  
ATOM 4337   C CB   . VAL A 1 281 ? -16.235 -4.433  1.775   1.00 0.00 ? 281 VAL A CB   1  
ATOM 4338   C CG1  . VAL A 1 281 ? -17.349 -5.457  1.930   1.00 0.00 ? 281 VAL A CG1  1  
ATOM 4339   C CG2  . VAL A 1 281 ? -15.306 -4.444  3.006   1.00 0.00 ? 281 VAL A CG2  1  
ATOM 4340   H H    . VAL A 1 281 ? -14.488 -2.841  0.824   1.00 0.00 ? 281 VAL A H    1  
ATOM 4341   H HA   . VAL A 1 281 ? -14.887 -5.620  0.563   1.00 0.00 ? 281 VAL A HA   1  
ATOM 4342   H HB   . VAL A 1 281 ? -16.690 -3.454  1.698   1.00 0.00 ? 281 VAL A HB   1  
ATOM 4343   H HG11 . VAL A 1 281 ? -17.108 -6.340  1.357   1.00 0.00 ? 281 VAL A HG11 1  
ATOM 4344   H HG12 . VAL A 1 281 ? -18.277 -5.037  1.571   1.00 0.00 ? 281 VAL A HG12 1  
ATOM 4345   H HG13 . VAL A 1 281 ? -17.453 -5.722  2.972   1.00 0.00 ? 281 VAL A HG13 1  
ATOM 4346   H HG21 . VAL A 1 281 ? -14.958 -5.451  3.185   1.00 0.00 ? 281 VAL A HG21 1  
ATOM 4347   H HG22 . VAL A 1 281 ? -15.850 -4.094  3.871   1.00 0.00 ? 281 VAL A HG22 1  
ATOM 4348   H HG23 . VAL A 1 281 ? -14.461 -3.797  2.825   1.00 0.00 ? 281 VAL A HG23 1  
ATOM 4349   N N    . GLU A 1 282 ? -16.625 -3.629  -1.312  1.00 0.00 ? 282 GLU A N    1  
ATOM 4350   C CA   . GLU A 1 282 ? -17.521 -3.561  -2.417  1.00 0.00 ? 282 GLU A CA   1  
ATOM 4351   C C    . GLU A 1 282 ? -16.961 -4.420  -3.564  1.00 0.00 ? 282 GLU A C    1  
ATOM 4352   O O    . GLU A 1 282 ? -17.607 -5.399  -3.969  1.00 0.00 ? 282 GLU A O    1  
ATOM 4353   C CB   . GLU A 1 282 ? -17.698 -2.112  -2.791  1.00 0.00 ? 282 GLU A CB   1  
ATOM 4354   C CG   . GLU A 1 282 ? -18.620 -1.860  -3.949  1.00 0.00 ? 282 GLU A CG   1  
ATOM 4355   C CD   . GLU A 1 282 ? -18.752 -0.373  -4.220  1.00 0.00 ? 282 GLU A CD   1  
ATOM 4356   O OE1  . GLU A 1 282 ? -17.713 0.308   -4.459  1.00 0.00 ? 282 GLU A OE1  1  
ATOM 4357   O OE2  . GLU A 1 282 ? -19.903 0.108   -4.162  1.00 0.00 ? 282 GLU A OE2  1  
ATOM 4358   H H    . GLU A 1 282 ? -16.195 -2.813  -0.981  1.00 0.00 ? 282 GLU A H    1  
ATOM 4359   H HA   . GLU A 1 282 ? -18.477 -3.965  -2.115  1.00 0.00 ? 282 GLU A HA   1  
ATOM 4360   H HB2  . GLU A 1 282 ? -18.085 -1.585  -1.934  1.00 0.00 ? 282 GLU A HB2  1  
ATOM 4361   H HB3  . GLU A 1 282 ? -16.725 -1.703  -3.029  1.00 0.00 ? 282 GLU A HB3  1  
ATOM 4362   H HG2  . GLU A 1 282 ? -18.227 -2.348  -4.830  1.00 0.00 ? 282 GLU A HG2  1  
ATOM 4363   H HG3  . GLU A 1 282 ? -19.595 -2.268  -3.722  1.00 0.00 ? 282 GLU A HG3  1  
ATOM 4364   N N    . GLY A 1 283 ? -15.752 -4.093  -4.045  1.00 0.00 ? 283 GLY A N    1  
ATOM 4365   C CA   . GLY A 1 283 ? -15.053 -4.937  -5.031  1.00 0.00 ? 283 GLY A CA   1  
ATOM 4366   C C    . GLY A 1 283 ? -15.001 -6.409  -4.643  1.00 0.00 ? 283 GLY A C    1  
ATOM 4367   O O    . GLY A 1 283 ? -15.118 -7.278  -5.481  1.00 0.00 ? 283 GLY A O    1  
ATOM 4368   H H    . GLY A 1 283 ? -15.278 -3.329  -3.655  1.00 0.00 ? 283 GLY A H    1  
ATOM 4369   H HA2  . GLY A 1 283 ? -15.559 -4.849  -5.981  1.00 0.00 ? 283 GLY A HA2  1  
ATOM 4370   H HA3  . GLY A 1 283 ? -14.042 -4.572  -5.143  1.00 0.00 ? 283 GLY A HA3  1  
ATOM 4371   N N    . ALA A 1 284 ? -14.842 -6.702  -3.363  1.00 0.00 ? 284 ALA A N    1  
ATOM 4372   C CA   . ALA A 1 284 ? -14.751 -8.085  -2.932  1.00 0.00 ? 284 ALA A CA   1  
ATOM 4373   C C    . ALA A 1 284 ? -16.061 -8.835  -3.133  1.00 0.00 ? 284 ALA A C    1  
ATOM 4374   O O    . ALA A 1 284 ? -16.074 -10.000 -3.559  1.00 0.00 ? 284 ALA A O    1  
ATOM 4375   C CB   . ALA A 1 284 ? -14.340 -8.154  -1.503  1.00 0.00 ? 284 ALA A CB   1  
ATOM 4376   H H    . ALA A 1 284 ? -14.763 -5.981  -2.705  1.00 0.00 ? 284 ALA A H    1  
ATOM 4377   H HA   . ALA A 1 284 ? -13.991 -8.572  -3.525  1.00 0.00 ? 284 ALA A HA   1  
ATOM 4378   H HB1  . ALA A 1 284 ? -15.006 -7.550  -0.907  1.00 0.00 ? 284 ALA A HB1  1  
ATOM 4379   H HB2  . ALA A 1 284 ? -13.330 -7.784  -1.401  1.00 0.00 ? 284 ALA A HB2  1  
ATOM 4380   H HB3  . ALA A 1 284 ? -14.385 -9.178  -1.164  1.00 0.00 ? 284 ALA A HB3  1  
ATOM 4381   N N    . GLU A 1 285 ? -17.166 -8.162  -2.804  1.00 0.00 ? 285 GLU A N    1  
ATOM 4382   C CA   . GLU A 1 285 ? -18.477 -8.772  -2.918  1.00 0.00 ? 285 GLU A CA   1  
ATOM 4383   C C    . GLU A 1 285 ? -18.766 -8.881  -4.396  1.00 0.00 ? 285 GLU A C    1  
ATOM 4384   O O    . GLU A 1 285 ? -19.296 -9.890  -4.854  1.00 0.00 ? 285 GLU A O    1  
ATOM 4385   C CB   . GLU A 1 285 ? -19.539 -7.955  -2.176  1.00 0.00 ? 285 GLU A CB   1  
ATOM 4386   C CG   . GLU A 1 285 ? -19.388 -8.004  -0.636  1.00 0.00 ? 285 GLU A CG   1  
ATOM 4387   C CD   . GLU A 1 285 ? -20.349 -7.049  0.147   1.00 0.00 ? 285 GLU A CD   1  
ATOM 4388   O OE1  . GLU A 1 285 ? -21.004 -6.156  -0.483  1.00 0.00 ? 285 GLU A OE1  1  
ATOM 4389   O OE2  . GLU A 1 285 ? -20.433 -7.187  1.403   1.00 0.00 ? 285 GLU A OE2  1  
ATOM 4390   H H    . GLU A 1 285 ? -17.089 -7.248  -2.460  1.00 0.00 ? 285 GLU A H    1  
ATOM 4391   H HA   . GLU A 1 285 ? -18.435 -9.768  -2.497  1.00 0.00 ? 285 GLU A HA   1  
ATOM 4392   H HB2  . GLU A 1 285 ? -19.470 -6.926  -2.495  1.00 0.00 ? 285 GLU A HB2  1  
ATOM 4393   H HB3  . GLU A 1 285 ? -20.515 -8.335  -2.443  1.00 0.00 ? 285 GLU A HB3  1  
ATOM 4394   H HG2  . GLU A 1 285 ? -19.575 -9.014  -0.308  1.00 0.00 ? 285 GLU A HG2  1  
ATOM 4395   H HG3  . GLU A 1 285 ? -18.368 -7.747  -0.386  1.00 0.00 ? 285 GLU A HG3  1  
ATOM 4396   N N    . ARG A 1 286 ? -18.360 -7.851  -5.134  1.00 0.00 ? 286 ARG A N    1  
ATOM 4397   C CA   . ARG A 1 286 ? -18.579 -7.785  -6.570  1.00 0.00 ? 286 ARG A CA   1  
ATOM 4398   C C    . ARG A 1 286 ? -17.943 -8.976  -7.315  1.00 0.00 ? 286 ARG A C    1  
ATOM 4399   O O    . ARG A 1 286 ? -18.529 -9.503  -8.263  1.00 0.00 ? 286 ARG A O    1  
ATOM 4400   C CB   . ARG A 1 286 ? -18.054 -6.469  -7.125  1.00 0.00 ? 286 ARG A CB   1  
ATOM 4401   C CG   . ARG A 1 286 ? -18.322 -6.287  -8.610  1.00 0.00 ? 286 ARG A CG   1  
ATOM 4402   C CD   . ARG A 1 286 ? -17.805 -4.957  -9.134  1.00 0.00 ? 286 ARG A CD   1  
ATOM 4403   N NE   . ARG A 1 286 ? -18.530 -3.827  -8.537  1.00 0.00 ? 286 ARG A NE   1  
ATOM 4404   C CZ   . ARG A 1 286 ? -18.031 -3.002  -7.620  1.00 0.00 ? 286 ARG A CZ   1  
ATOM 4405   N NH1  . ARG A 1 286 ? -16.790 -3.159  -7.174  1.00 0.00 ? 286 ARG A NH1  1  
ATOM 4406   N NH2  . ARG A 1 286 ? -18.772 -2.018  -7.156  1.00 0.00 ? 286 ARG A NH2  1  
ATOM 4407   H H    . ARG A 1 286 ? -17.909 -7.102  -4.691  1.00 0.00 ? 286 ARG A H    1  
ATOM 4408   H HA   . ARG A 1 286 ? -19.645 -7.817  -6.744  1.00 0.00 ? 286 ARG A HA   1  
ATOM 4409   H HB2  . ARG A 1 286 ? -18.522 -5.657  -6.591  1.00 0.00 ? 286 ARG A HB2  1  
ATOM 4410   H HB3  . ARG A 1 286 ? -16.987 -6.425  -6.955  1.00 0.00 ? 286 ARG A HB3  1  
ATOM 4411   H HG2  . ARG A 1 286 ? -17.839 -7.086  -9.153  1.00 0.00 ? 286 ARG A HG2  1  
ATOM 4412   H HG3  . ARG A 1 286 ? -19.387 -6.342  -8.782  1.00 0.00 ? 286 ARG A HG3  1  
ATOM 4413   H HD2  . ARG A 1 286 ? -16.756 -4.867  -8.896  1.00 0.00 ? 286 ARG A HD2  1  
ATOM 4414   H HD3  . ARG A 1 286 ? -17.926 -4.931  -10.208 1.00 0.00 ? 286 ARG A HD3  1  
ATOM 4415   H HE   . ARG A 1 286 ? -19.450 -3.669  -8.837  1.00 0.00 ? 286 ARG A HE   1  
ATOM 4416   H HH11 . ARG A 1 286 ? -16.223 -3.902  -7.527  1.00 0.00 ? 286 ARG A HH11 1  
ATOM 4417   H HH12 . ARG A 1 286 ? -16.424 -2.534  -6.485  1.00 0.00 ? 286 ARG A HH12 1  
ATOM 4418   H HH21 . ARG A 1 286 ? -19.705 -1.894  -7.492  1.00 0.00 ? 286 ARG A HH21 1  
ATOM 4419   H HH22 . ARG A 1 286 ? -18.402 -1.395  -6.467  1.00 0.00 ? 286 ARG A HH22 1  
ATOM 4420   N N    . ASN A 1 287 ? -16.785 -9.412  -6.832  1.00 0.00 ? 287 ASN A N    1  
ATOM 4421   C CA   . ASN A 1 287 ? -15.962 -10.391 -7.486  1.00 0.00 ? 287 ASN A CA   1  
ATOM 4422   C C    . ASN A 1 287 ? -16.033 -11.757 -6.850  1.00 0.00 ? 287 ASN A C    1  
ATOM 4423   O O    . ASN A 1 287 ? -15.234 -12.648 -7.170  1.00 0.00 ? 287 ASN A O    1  
ATOM 4424   C CB   . ASN A 1 287 ? -14.533 -9.938  -7.436  1.00 0.00 ? 287 ASN A CB   1  
ATOM 4425   C CG   . ASN A 1 287 ? -14.282 -8.796  -8.334  1.00 0.00 ? 287 ASN A CG   1  
ATOM 4426   O OD1  . ASN A 1 287 ? -14.244 -8.952  -9.554  1.00 0.00 ? 287 ASN A OD1  1  
ATOM 4427   N ND2  . ASN A 1 287 ? -14.087 -7.624  -7.753  1.00 0.00 ? 287 ASN A ND2  1  
ATOM 4428   H H    . ASN A 1 287 ? -16.418 -8.959  -6.044  1.00 0.00 ? 287 ASN A H    1  
ATOM 4429   H HA   . ASN A 1 287 ? -16.259 -10.467 -8.519  1.00 0.00 ? 287 ASN A HA   1  
ATOM 4430   H HB2  . ASN A 1 287 ? -14.292 -9.646  -6.425  1.00 0.00 ? 287 ASN A HB2  1  
ATOM 4431   H HB3  . ASN A 1 287 ? -13.894 -10.761 -7.724  1.00 0.00 ? 287 ASN A HB3  1  
ATOM 4432   H HD21 . ASN A 1 287 ? -14.114 -7.550  -6.776  1.00 0.00 ? 287 ASN A HD21 1  
ATOM 4433   H HD22 . ASN A 1 287 ? -13.915 -6.829  -8.300  1.00 0.00 ? 287 ASN A HD22 1  
ATOM 4434   N N    . GLY A 1 288 ? -16.967 -11.913 -5.929  1.00 0.00 ? 288 GLY A N    1  
ATOM 4435   C CA   . GLY A 1 288 ? -17.333 -13.242 -5.471  1.00 0.00 ? 288 GLY A CA   1  
ATOM 4436   C C    . GLY A 1 288 ? -16.470 -13.776 -4.356  1.00 0.00 ? 288 GLY A C    1  
ATOM 4437   O O    . GLY A 1 288 ? -16.448 -14.979 -4.115  1.00 0.00 ? 288 GLY A O    1  
ATOM 4438   H H    . GLY A 1 288 ? -17.549 -11.156 -5.708  1.00 0.00 ? 288 GLY A H    1  
ATOM 4439   H HA2  . GLY A 1 288 ? -18.356 -13.216 -5.126  1.00 0.00 ? 288 GLY A HA2  1  
ATOM 4440   H HA3  . GLY A 1 288 ? -17.272 -13.921 -6.310  1.00 0.00 ? 288 GLY A HA3  1  
ATOM 4441   N N    . ALA A 1 289 ? -15.773 -12.873 -3.671  1.00 0.00 ? 289 ALA A N    1  
ATOM 4442   C CA   . ALA A 1 289 ? -14.932 -13.174 -2.517  1.00 0.00 ? 289 ALA A CA   1  
ATOM 4443   C C    . ALA A 1 289 ? -15.733 -13.918 -1.484  1.00 0.00 ? 289 ALA A C    1  
ATOM 4444   O O    . ALA A 1 289 ? -16.865 -13.559 -1.250  1.00 0.00 ? 289 ALA A O    1  
ATOM 4445   C CB   . ALA A 1 289 ? -14.408 -11.854 -1.917  1.00 0.00 ? 289 ALA A CB   1  
ATOM 4446   H H    . ALA A 1 289 ? -15.864 -11.933 -3.934  1.00 0.00 ? 289 ALA A H    1  
ATOM 4447   H HA   . ALA A 1 289 ? -14.095 -13.779 -2.829  1.00 0.00 ? 289 ALA A HA   1  
ATOM 4448   H HB1  . ALA A 1 289 ? -14.079 -11.202 -2.713  1.00 0.00 ? 289 ALA A HB1  1  
ATOM 4449   H HB2  . ALA A 1 289 ? -13.579 -12.063 -1.257  1.00 0.00 ? 289 ALA A HB2  1  
ATOM 4450   H HB3  . ALA A 1 289 ? -15.199 -11.373 -1.360  1.00 0.00 ? 289 ALA A HB3  1  
ATOM 4451   N N    . GLU A 1 290 ? -15.161 -14.945 -0.866  1.00 0.00 ? 290 GLU A N    1  
ATOM 4452   C CA   . GLU A 1 290 ? -15.866 -15.669 0.208   1.00 0.00 ? 290 GLU A CA   1  
ATOM 4453   C C    . GLU A 1 290 ? -15.511 -15.140 1.600   1.00 0.00 ? 290 GLU A C    1  
ATOM 4454   O O    . GLU A 1 290 ? -15.976 -15.677 2.600   1.00 0.00 ? 290 GLU A O    1  
ATOM 4455   C CB   . GLU A 1 290 ? -15.576 -17.162 0.170   1.00 0.00 ? 290 GLU A CB   1  
ATOM 4456   C CG   . GLU A 1 290 ? -15.912 -17.849 -1.139  1.00 0.00 ? 290 GLU A CG   1  
ATOM 4457   C CD   . GLU A 1 290 ? -14.683 -18.380 -1.833  1.00 0.00 ? 290 GLU A CD   1  
ATOM 4458   O OE1  . GLU A 1 290 ? -13.816 -18.960 -1.122  1.00 0.00 ? 290 GLU A OE1  1  
ATOM 4459   O OE2  . GLU A 1 290 ? -14.593 -18.234 -3.077  1.00 0.00 ? 290 GLU A OE2  1  
ATOM 4460   H H    . GLU A 1 290 ? -14.241 -15.194 -1.093  1.00 0.00 ? 290 GLU A H    1  
ATOM 4461   H HA   . GLU A 1 290 ? -16.927 -15.531 0.060   1.00 0.00 ? 290 GLU A HA   1  
ATOM 4462   H HB2  . GLU A 1 290 ? -14.526 -17.310 0.366   1.00 0.00 ? 290 GLU A HB2  1  
ATOM 4463   H HB3  . GLU A 1 290 ? -16.138 -17.636 0.963   1.00 0.00 ? 290 GLU A HB3  1  
ATOM 4464   H HG2  . GLU A 1 290 ? -16.584 -18.671 -0.942  1.00 0.00 ? 290 GLU A HG2  1  
ATOM 4465   H HG3  . GLU A 1 290 ? -16.406 -17.141 -1.789  1.00 0.00 ? 290 GLU A HG3  1  
ATOM 4466   N N    . GLY A 1 291 ? -14.702 -14.089 1.668   1.00 0.00 ? 291 GLY A N    1  
ATOM 4467   C CA   . GLY A 1 291 ? -14.324 -13.452 2.928   1.00 0.00 ? 291 GLY A CA   1  
ATOM 4468   C C    . GLY A 1 291 ? -13.089 -12.620 2.614   1.00 0.00 ? 291 GLY A C    1  
ATOM 4469   O O    . GLY A 1 291 ? -12.707 -12.490 1.444   1.00 0.00 ? 291 GLY A O    1  
ATOM 4470   H H    . GLY A 1 291 ? -14.370 -13.702 0.831   1.00 0.00 ? 291 GLY A H    1  
ATOM 4471   H HA2  . GLY A 1 291 ? -15.128 -12.819 3.280   1.00 0.00 ? 291 GLY A HA2  1  
ATOM 4472   H HA3  . GLY A 1 291 ? -14.081 -14.198 3.668   1.00 0.00 ? 291 GLY A HA3  1  
ATOM 4473   N N    . VAL A 1 292 ? -12.473 -12.054 3.639   1.00 0.00 ? 292 VAL A N    1  
ATOM 4474   C CA   . VAL A 1 292 ? -11.290 -11.238 3.475   1.00 0.00 ? 292 VAL A CA   1  
ATOM 4475   C C    . VAL A 1 292 ? -10.096 -11.971 4.078   1.00 0.00 ? 292 VAL A C    1  
ATOM 4476   O O    . VAL A 1 292 ? -10.140 -12.397 5.252   1.00 0.00 ? 292 VAL A O    1  
ATOM 4477   C CB   . VAL A 1 292 ? -11.445 -9.866  4.142   1.00 0.00 ? 292 VAL A CB   1  
ATOM 4478   C CG1  . VAL A 1 292 ? -10.125 -9.136  4.208   1.00 0.00 ? 292 VAL A CG1  1  
ATOM 4479   C CG2  . VAL A 1 292 ? -12.511 -9.019  3.412   1.00 0.00 ? 292 VAL A CG2  1  
ATOM 4480   H H    . VAL A 1 292 ? -12.831 -12.192 4.541   1.00 0.00 ? 292 VAL A H    1  
ATOM 4481   H HA   . VAL A 1 292 ? -11.112 -11.095 2.419   1.00 0.00 ? 292 VAL A HA   1  
ATOM 4482   H HB   . VAL A 1 292 ? -11.782 -10.029 5.157   1.00 0.00 ? 292 VAL A HB   1  
ATOM 4483   H HG11 . VAL A 1 292 ? -9.445  -9.680  4.847   1.00 0.00 ? 292 VAL A HG11 1  
ATOM 4484   H HG12 . VAL A 1 292 ? -10.281 -8.145  4.608   1.00 0.00 ? 292 VAL A HG12 1  
ATOM 4485   H HG13 . VAL A 1 292 ? -9.705  -9.062  3.215   1.00 0.00 ? 292 VAL A HG13 1  
ATOM 4486   H HG21 . VAL A 1 292 ? -13.342 -9.650  3.132   1.00 0.00 ? 292 VAL A HG21 1  
ATOM 4487   H HG22 . VAL A 1 292 ? -12.078 -8.581  2.526   1.00 0.00 ? 292 VAL A HG22 1  
ATOM 4488   H HG23 . VAL A 1 292 ? -12.859 -8.235  4.069   1.00 0.00 ? 292 VAL A HG23 1  
ATOM 4489   N N    . GLY A 1 293 ? -9.045  -12.130 3.269   1.00 0.00 ? 293 GLY A N    1  
ATOM 4490   C CA   . GLY A 1 293 ? -7.929  -12.961 3.654   1.00 0.00 ? 293 GLY A CA   1  
ATOM 4491   C C    . GLY A 1 293 ? -6.818  -12.109 4.213   1.00 0.00 ? 293 GLY A C    1  
ATOM 4492   O O    . GLY A 1 293 ? -5.912  -12.619 4.807   1.00 0.00 ? 293 GLY A O    1  
ATOM 4493   H H    . GLY A 1 293 ? -9.087  -11.779 2.355   1.00 0.00 ? 293 GLY A H    1  
ATOM 4494   H HA2  . GLY A 1 293 ? -8.253  -13.669 4.405   1.00 0.00 ? 293 GLY A HA2  1  
ATOM 4495   H HA3  . GLY A 1 293 ? -7.565  -13.496 2.790   1.00 0.00 ? 293 GLY A HA3  1  
ATOM 4496   N N    . LEU A 1 294 ? -6.885  -10.809 4.005   1.00 0.00 ? 294 LEU A N    1  
ATOM 4497   C CA   . LEU A 1 294 ? -5.861  -9.929  4.520   1.00 0.00 ? 294 LEU A CA   1  
ATOM 4498   C C    . LEU A 1 294 ? -6.377  -8.520  4.485   1.00 0.00 ? 294 LEU A C    1  
ATOM 4499   O O    . LEU A 1 294 ? -6.712  -8.010  3.404   1.00 0.00 ? 294 LEU A O    1  
ATOM 4500   C CB   . LEU A 1 294 ? -4.606  -9.950  3.651   1.00 0.00 ? 294 LEU A CB   1  
ATOM 4501   C CG   . LEU A 1 294 ? -3.566  -8.862  3.956   1.00 0.00 ? 294 LEU A CG   1  
ATOM 4502   C CD1  . LEU A 1 294 ? -2.857  -9.231  5.217   1.00 0.00 ? 294 LEU A CD1  1  
ATOM 4503   C CD2  . LEU A 1 294 ? -2.526  -8.707  2.837   1.00 0.00 ? 294 LEU A CD2  1  
ATOM 4504   H H    . LEU A 1 294 ? -7.639  -10.435 3.503   1.00 0.00 ? 294 LEU A H    1  
ATOM 4505   H HA   . LEU A 1 294 ? -5.608  -10.206 5.532   1.00 0.00 ? 294 LEU A HA   1  
ATOM 4506   H HB2  . LEU A 1 294 ? -4.128  -10.910 3.771   1.00 0.00 ? 294 LEU A HB2  1  
ATOM 4507   H HB3  . LEU A 1 294 ? -4.911  -9.852  2.618   1.00 0.00 ? 294 LEU A HB3  1  
ATOM 4508   H HG   . LEU A 1 294 ? -4.077  -7.920  4.103   1.00 0.00 ? 294 LEU A HG   1  
ATOM 4509   H HD11 . LEU A 1 294 ? -2.074  -9.941  4.996   1.00 0.00 ? 294 LEU A HD11 1  
ATOM 4510   H HD12 . LEU A 1 294 ? -3.560  -9.673  5.909   1.00 0.00 ? 294 LEU A HD12 1  
ATOM 4511   H HD13 . LEU A 1 294 ? -2.424  -8.346  5.659   1.00 0.00 ? 294 LEU A HD13 1  
ATOM 4512   H HD21 . LEU A 1 294 ? -1.943  -9.613  2.760   1.00 0.00 ? 294 LEU A HD21 1  
ATOM 4513   H HD22 . LEU A 1 294 ? -1.873  -7.877  3.065   1.00 0.00 ? 294 LEU A HD22 1  
ATOM 4514   H HD23 . LEU A 1 294 ? -3.029  -8.522  1.900   1.00 0.00 ? 294 LEU A HD23 1  
ATOM 4515   N N    . TYR A 1 295 ? -6.438  -7.908  5.660   1.00 0.00 ? 295 TYR A N    1  
ATOM 4516   C CA   . TYR A 1 295 ? -6.894  -6.569  5.820   1.00 0.00 ? 295 TYR A CA   1  
ATOM 4517   C C    . TYR A 1 295 ? -5.625  -5.881  6.236   1.00 0.00 ? 295 TYR A C    1  
ATOM 4518   O O    . TYR A 1 295 ? -5.207  -5.938  7.395   1.00 0.00 ? 295 TYR A O    1  
ATOM 4519   C CB   . TYR A 1 295 ? -8.019  -6.525  6.880   1.00 0.00 ? 295 TYR A CB   1  
ATOM 4520   C CG   . TYR A 1 295 ? -8.274  -5.170  7.480   1.00 0.00 ? 295 TYR A CG   1  
ATOM 4521   C CD1  . TYR A 1 295 ? -8.090  -4.015  6.719   1.00 0.00 ? 295 TYR A CD1  1  
ATOM 4522   C CD2  . TYR A 1 295 ? -8.715  -5.032  8.796   1.00 0.00 ? 295 TYR A CD2  1  
ATOM 4523   C CE1  . TYR A 1 295 ? -8.299  -2.778  7.240   1.00 0.00 ? 295 TYR A CE1  1  
ATOM 4524   C CE2  . TYR A 1 295 ? -8.939  -3.773  9.340   1.00 0.00 ? 295 TYR A CE2  1  
ATOM 4525   C CZ   . TYR A 1 295 ? -8.726  -2.650  8.541   1.00 0.00 ? 295 TYR A CZ   1  
ATOM 4526   O OH   . TYR A 1 295 ? -8.921  -1.363  9.004   1.00 0.00 ? 295 TYR A OH   1  
ATOM 4527   H H    . TYR A 1 295 ? -6.150  -8.400  6.457   1.00 0.00 ? 295 TYR A H    1  
ATOM 4528   H HA   . TYR A 1 295 ? -7.241  -6.177  4.873   1.00 0.00 ? 295 TYR A HA   1  
ATOM 4529   H HB2  . TYR A 1 295 ? -8.933  -6.865  6.421   1.00 0.00 ? 295 TYR A HB2  1  
ATOM 4530   H HB3  . TYR A 1 295 ? -7.762  -7.214  7.675   1.00 0.00 ? 295 TYR A HB3  1  
ATOM 4531   H HD1  . TYR A 1 295 ? -7.748  -4.106  5.698   1.00 0.00 ? 295 TYR A HD1  1  
ATOM 4532   H HD2  . TYR A 1 295 ? -8.876  -5.912  9.401   1.00 0.00 ? 295 TYR A HD2  1  
ATOM 4533   H HE1  . TYR A 1 295 ? -8.150  -1.899  6.629   1.00 0.00 ? 295 TYR A HE1  1  
ATOM 4534   H HE2  . TYR A 1 295 ? -9.273  -3.666  10.361  1.00 0.00 ? 295 TYR A HE2  1  
ATOM 4535   H HH   . TYR A 1 295 ? -8.146  -0.844  8.774   1.00 0.00 ? 295 TYR A HH   1  
ATOM 4536   N N    . ARG A 1 296 ? -4.965  -5.309  5.236   1.00 0.00 ? 296 ARG A N    1  
ATOM 4537   C CA   . ARG A 1 296 ? -3.743  -4.530  5.413   1.00 0.00 ? 296 ARG A CA   1  
ATOM 4538   C C    . ARG A 1 296 ? -4.115  -3.297  6.181   1.00 0.00 ? 296 ARG A C    1  
ATOM 4539   O O    . ARG A 1 296 ? -4.601  -2.363  5.594   1.00 0.00 ? 296 ARG A O    1  
ATOM 4540   C CB   . ARG A 1 296 ? -3.154  -4.105  4.044   1.00 0.00 ? 296 ARG A CB   1  
ATOM 4541   C CG   . ARG A 1 296 ? -2.500  -5.267  3.280   1.00 0.00 ? 296 ARG A CG   1  
ATOM 4542   C CD   . ARG A 1 296 ? -1.816  -4.825  1.961   1.00 0.00 ? 296 ARG A CD   1  
ATOM 4543   N NE   . ARG A 1 296 ? -1.160  -5.948  1.280   1.00 0.00 ? 296 ARG A NE   1  
ATOM 4544   C CZ   . ARG A 1 296 ? -1.776  -6.777  0.444   1.00 0.00 ? 296 ARG A CZ   1  
ATOM 4545   N NH1  . ARG A 1 296 ? -3.068  -6.608  0.155   1.00 0.00 ? 296 ARG A NH1  1  
ATOM 4546   N NH2  . ARG A 1 296 ? -1.111  -7.775  -0.135  1.00 0.00 ? 296 ARG A NH2  1  
ATOM 4547   H H    . ARG A 1 296 ? -5.342  -5.378  4.334   1.00 0.00 ? 296 ARG A H    1  
ATOM 4548   H HA   . ARG A 1 296 ? -3.014  -5.104  5.965   1.00 0.00 ? 296 ARG A HA   1  
ATOM 4549   H HB2  . ARG A 1 296 ? -3.947  -3.697  3.437   1.00 0.00 ? 296 ARG A HB2  1  
ATOM 4550   H HB3  . ARG A 1 296 ? -2.414  -3.335  4.210   1.00 0.00 ? 296 ARG A HB3  1  
ATOM 4551   H HG2  . ARG A 1 296 ? -1.759  -5.727  3.916   1.00 0.00 ? 296 ARG A HG2  1  
ATOM 4552   H HG3  . ARG A 1 296 ? -3.260  -6.000  3.049   1.00 0.00 ? 296 ARG A HG3  1  
ATOM 4553   H HD2  . ARG A 1 296 ? -2.560  -4.405  1.302   1.00 0.00 ? 296 ARG A HD2  1  
ATOM 4554   H HD3  . ARG A 1 296 ? -1.080  -4.066  2.186   1.00 0.00 ? 296 ARG A HD3  1  
ATOM 4555   H HE   . ARG A 1 296 ? -0.207  -6.097  1.455   1.00 0.00 ? 296 ARG A HE   1  
ATOM 4556   H HH11 . ARG A 1 296 ? -3.578  -5.855  0.570   1.00 0.00 ? 296 ARG A HH11 1  
ATOM 4557   H HH12 . ARG A 1 296 ? -3.526  -7.235  -0.475  1.00 0.00 ? 296 ARG A HH12 1  
ATOM 4558   H HH21 . ARG A 1 296 ? -0.140  -7.906  0.059   1.00 0.00 ? 296 ARG A HH21 1  
ATOM 4559   H HH22 . ARG A 1 296 ? -1.584  -8.393  -0.763  1.00 0.00 ? 296 ARG A HH22 1  
ATOM 4560   N N    . THR A 1 297 ? -3.924  -3.298  7.490   1.00 0.00 ? 297 THR A N    1  
ATOM 4561   C CA   . THR A 1 297 ? -4.377  -2.161  8.287   1.00 0.00 ? 297 THR A CA   1  
ATOM 4562   C C    . THR A 1 297 ? -3.561  -0.879  8.049   1.00 0.00 ? 297 THR A C    1  
ATOM 4563   O O    . THR A 1 297 ? -4.056  0.201   8.312   1.00 0.00 ? 297 THR A O    1  
ATOM 4564   C CB   . THR A 1 297 ? -4.463  -2.495  9.764   1.00 0.00 ? 297 THR A CB   1  
ATOM 4565   O OG1  . THR A 1 297 ? -3.180  -2.862  10.187  1.00 0.00 ? 297 THR A OG1  1  
ATOM 4566   C CG2  . THR A 1 297 ? -5.360  -3.702  9.991   1.00 0.00 ? 297 THR A CG2  1  
ATOM 4567   H H    . THR A 1 297 ? -3.549  -4.089  7.931   1.00 0.00 ? 297 THR A H    1  
ATOM 4568   H HA   . THR A 1 297 ? -5.384  -1.944  7.958   1.00 0.00 ? 297 THR A HA   1  
ATOM 4569   H HB   . THR A 1 297 ? -4.824  -1.650  10.327  1.00 0.00 ? 297 THR A HB   1  
ATOM 4570   H HG1  . THR A 1 297 ? -2.776  -2.099  10.606  1.00 0.00 ? 297 THR A HG1  1  
ATOM 4571   H HG21 . THR A 1 297 ? -6.395  -3.400  9.915   1.00 0.00 ? 297 THR A HG21 1  
ATOM 4572   H HG22 . THR A 1 297 ? -5.175  -4.109  10.973  1.00 0.00 ? 297 THR A HG22 1  
ATOM 4573   H HG23 . THR A 1 297 ? -5.149  -4.452  9.244   1.00 0.00 ? 297 THR A HG23 1  
ATOM 4574   N N    . GLU A 1 298 ? -2.332  -1.000  7.528   1.00 0.00 ? 298 GLU A N    1  
ATOM 4575   C CA   . GLU A 1 298 ? -1.508  0.165   7.160   1.00 0.00 ? 298 GLU A CA   1  
ATOM 4576   C C    . GLU A 1 298 ? -2.324  1.105   6.323   1.00 0.00 ? 298 GLU A C    1  
ATOM 4577   O O    . GLU A 1 298 ? -2.252  2.315   6.462   1.00 0.00 ? 298 GLU A O    1  
ATOM 4578   C CB   . GLU A 1 298 ? -0.312  -0.222  6.272   1.00 0.00 ? 298 GLU A CB   1  
ATOM 4579   C CG   . GLU A 1 298 ? 0.259   -1.567  6.517   1.00 0.00 ? 298 GLU A CG   1  
ATOM 4580   C CD   . GLU A 1 298 ? -0.531  -2.675  5.894   1.00 0.00 ? 298 GLU A CD   1  
ATOM 4581   O OE1  . GLU A 1 298 ? -1.452  -3.194  6.545   1.00 0.00 ? 298 GLU A OE1  1  
ATOM 4582   O OE2  . GLU A 1 298 ? -0.194  -3.047  4.764   1.00 0.00 ? 298 GLU A OE2  1  
ATOM 4583   H H    . GLU A 1 298 ? -1.997  -1.897  7.319   1.00 0.00 ? 298 GLU A H    1  
ATOM 4584   H HA   . GLU A 1 298 ? -1.156  0.667   8.047   1.00 0.00 ? 298 GLU A HA   1  
ATOM 4585   H HB2  . GLU A 1 298 ? -0.627  -0.179  5.243   1.00 0.00 ? 298 GLU A HB2  1  
ATOM 4586   H HB3  . GLU A 1 298 ? 0.466   0.516   6.416   1.00 0.00 ? 298 GLU A HB3  1  
ATOM 4587   H HG2  . GLU A 1 298 ? 1.262   -1.594  6.119   1.00 0.00 ? 298 GLU A HG2  1  
ATOM 4588   H HG3  . GLU A 1 298 ? 0.307   -1.731  7.585   1.00 0.00 ? 298 GLU A HG3  1  
ATOM 4589   N N    . PHE A 1 299 ? -3.070  0.515   5.407   1.00 0.00 ? 299 PHE A N    1  
ATOM 4590   C CA   . PHE A 1 299 ? -3.734  1.254   4.352   1.00 0.00 ? 299 PHE A CA   1  
ATOM 4591   C C    . PHE A 1 299 ? -4.773  2.160   5.003   1.00 0.00 ? 299 PHE A C    1  
ATOM 4592   O O    . PHE A 1 299 ? -4.974  3.315   4.576   1.00 0.00 ? 299 PHE A O    1  
ATOM 4593   C CB   . PHE A 1 299 ? -4.345  0.286   3.361   1.00 0.00 ? 299 PHE A CB   1  
ATOM 4594   C CG   . PHE A 1 299 ? -3.393  -0.145  2.274   1.00 0.00 ? 299 PHE A CG   1  
ATOM 4595   C CD1  . PHE A 1 299 ? -2.235  -0.874  2.582   1.00 0.00 ? 299 PHE A CD1  1  
ATOM 4596   C CD2  . PHE A 1 299 ? -3.656  0.169   0.929   1.00 0.00 ? 299 PHE A CD2  1  
ATOM 4597   C CE1  . PHE A 1 299 ? -1.336  -1.274  1.593   1.00 0.00 ? 299 PHE A CE1  1  
ATOM 4598   C CE2  . PHE A 1 299 ? -2.769  -0.231  -0.091  1.00 0.00 ? 299 PHE A CE2  1  
ATOM 4599   C CZ   . PHE A 1 299 ? -1.592  -0.956  0.258   1.00 0.00 ? 299 PHE A CZ   1  
ATOM 4600   H H    . PHE A 1 299 ? -3.042  -0.463  5.343   1.00 0.00 ? 299 PHE A H    1  
ATOM 4601   H HA   . PHE A 1 299 ? -3.004  1.869   3.844   1.00 0.00 ? 299 PHE A HA   1  
ATOM 4602   H HB2  . PHE A 1 299 ? -4.676  -0.592  3.895   1.00 0.00 ? 299 PHE A HB2  1  
ATOM 4603   H HB3  . PHE A 1 299 ? -5.205  0.757   2.905   1.00 0.00 ? 299 PHE A HB3  1  
ATOM 4604   H HD1  . PHE A 1 299 ? -2.026  -1.120  3.613   1.00 0.00 ? 299 PHE A HD1  1  
ATOM 4605   H HD2  . PHE A 1 299 ? -4.551  0.719   0.674   1.00 0.00 ? 299 PHE A HD2  1  
ATOM 4606   H HE1  . PHE A 1 299 ? -0.451  -1.834  1.858   1.00 0.00 ? 299 PHE A HE1  1  
ATOM 4607   H HE2  . PHE A 1 299 ? -2.973  0.018   -1.122  1.00 0.00 ? 299 PHE A HE2  1  
ATOM 4608   H HZ   . PHE A 1 299 ? -0.899  -1.263  -0.512  1.00 0.00 ? 299 PHE A HZ   1  
ATOM 4609   N N    . LEU A 1 300 ? -5.376  1.668   6.076   1.00 0.00 ? 300 LEU A N    1  
ATOM 4610   C CA   . LEU A 1 300 ? -6.279  2.490   6.819   1.00 0.00 ? 300 LEU A CA   1  
ATOM 4611   C C    . LEU A 1 300 ? -5.509  3.644   7.446   1.00 0.00 ? 300 LEU A C    1  
ATOM 4612   O O    . LEU A 1 300 ? -6.032  4.732   7.574   1.00 0.00 ? 300 LEU A O    1  
ATOM 4613   C CB   . LEU A 1 300 ? -6.997  1.638   7.864   1.00 0.00 ? 300 LEU A CB   1  
ATOM 4614   C CG   . LEU A 1 300 ? -8.234  2.022   8.701   1.00 0.00 ? 300 LEU A CG   1  
ATOM 4615   C CD1  . LEU A 1 300 ? -7.862  2.243   10.175  1.00 0.00 ? 300 LEU A CD1  1  
ATOM 4616   C CD2  . LEU A 1 300 ? -9.069  3.170   8.088   1.00 0.00 ? 300 LEU A CD2  1  
ATOM 4617   H H    . LEU A 1 300 ? -5.144  0.774   6.403   1.00 0.00 ? 300 LEU A H    1  
ATOM 4618   H HA   . LEU A 1 300 ? -7.014  2.896   6.139   1.00 0.00 ? 300 LEU A HA   1  
ATOM 4619   H HB2  . LEU A 1 300 ? -7.284  0.739   7.354   1.00 0.00 ? 300 LEU A HB2  1  
ATOM 4620   H HB3  . LEU A 1 300 ? -6.225  1.343   8.569   1.00 0.00 ? 300 LEU A HB3  1  
ATOM 4621   H HG   . LEU A 1 300 ? -8.869  1.142   8.696   1.00 0.00 ? 300 LEU A HG   1  
ATOM 4622   H HD11 . LEU A 1 300 ? -7.140  3.043   10.248  1.00 0.00 ? 300 LEU A HD11 1  
ATOM 4623   H HD12 . LEU A 1 300 ? -7.436  1.336   10.579  1.00 0.00 ? 300 LEU A HD12 1  
ATOM 4624   H HD13 . LEU A 1 300 ? -8.747  2.505   10.735  1.00 0.00 ? 300 LEU A HD13 1  
ATOM 4625   H HD21 . LEU A 1 300 ? -9.662  2.788   7.270   1.00 0.00 ? 300 LEU A HD21 1  
ATOM 4626   H HD22 . LEU A 1 300 ? -8.407  3.942   7.723   1.00 0.00 ? 300 LEU A HD22 1  
ATOM 4627   H HD23 . LEU A 1 300 ? -9.722  3.584   8.844   1.00 0.00 ? 300 LEU A HD23 1  
ATOM 4628   N N    . PHE A 1 301 ? -4.258  3.413   7.792   1.00 0.00 ? 301 PHE A N    1  
ATOM 4629   C CA   . PHE A 1 301 ? -3.425  4.414   8.444   1.00 0.00 ? 301 PHE A CA   1  
ATOM 4630   C C    . PHE A 1 301 ? -2.980  5.458   7.445   1.00 0.00 ? 301 PHE A C    1  
ATOM 4631   O O    . PHE A 1 301 ? -2.683  6.584   7.812   1.00 0.00 ? 301 PHE A O    1  
ATOM 4632   C CB   . PHE A 1 301 ? -2.190  3.732   9.030   1.00 0.00 ? 301 PHE A CB   1  
ATOM 4633   C CG   . PHE A 1 301 ? -2.405  3.131   10.383  1.00 0.00 ? 301 PHE A CG   1  
ATOM 4634   C CD1  . PHE A 1 301 ? -3.432  2.234   10.616  1.00 0.00 ? 301 PHE A CD1  1  
ATOM 4635   C CD2  . PHE A 1 301 ? -1.579  3.456   11.421  1.00 0.00 ? 301 PHE A CD2  1  
ATOM 4636   C CE1  . PHE A 1 301 ? -3.635  1.678   11.856  1.00 0.00 ? 301 PHE A CE1  1  
ATOM 4637   C CE2  . PHE A 1 301 ? -1.776  2.896   12.653  1.00 0.00 ? 301 PHE A CE2  1  
ATOM 4638   C CZ   . PHE A 1 301 ? -2.809  1.990   12.867  1.00 0.00 ? 301 PHE A CZ   1  
ATOM 4639   H H    . PHE A 1 301 ? -3.883  2.522   7.632   1.00 0.00 ? 301 PHE A H    1  
ATOM 4640   H HA   . PHE A 1 301 ? -3.981  4.886   9.239   1.00 0.00 ? 301 PHE A HA   1  
ATOM 4641   H HB2  . PHE A 1 301 ? -1.878  2.949   8.357   1.00 0.00 ? 301 PHE A HB2  1  
ATOM 4642   H HB3  . PHE A 1 301 ? -1.395  4.462   9.096   1.00 0.00 ? 301 PHE A HB3  1  
ATOM 4643   H HD1  . PHE A 1 301 ? -4.094  1.968   9.805   1.00 0.00 ? 301 PHE A HD1  1  
ATOM 4644   H HD2  . PHE A 1 301 ? -0.772  4.158   11.269  1.00 0.00 ? 301 PHE A HD2  1  
ATOM 4645   H HE1  . PHE A 1 301 ? -4.444  0.980   12.012  1.00 0.00 ? 301 PHE A HE1  1  
ATOM 4646   H HE2  . PHE A 1 301 ? -1.111  3.149   13.467  1.00 0.00 ? 301 PHE A HE2  1  
ATOM 4647   H HZ   . PHE A 1 301 ? -2.961  1.558   13.846  1.00 0.00 ? 301 PHE A HZ   1  
ATOM 4648   N N    . MET A 1 302 ? -2.914  5.074   6.178   1.00 0.00 ? 302 MET A N    1  
ATOM 4649   C CA   . MET A 1 302 ? -2.539  6.027   5.129   1.00 0.00 ? 302 MET A CA   1  
ATOM 4650   C C    . MET A 1 302 ? -3.796  6.629   4.516   1.00 0.00 ? 302 MET A C    1  
ATOM 4651   O O    . MET A 1 302 ? -3.727  7.374   3.526   1.00 0.00 ? 302 MET A O    1  
ATOM 4652   C CB   . MET A 1 302 ? -1.676  5.381   4.029   1.00 0.00 ? 302 MET A CB   1  
ATOM 4653   C CG   . MET A 1 302 ? -0.454  4.685   4.542   1.00 0.00 ? 302 MET A CG   1  
ATOM 4654   S SD   . MET A 1 302 ? 0.175   3.392   3.302   1.00 0.00 ? 302 MET A SD   1  
ATOM 4655   C CE   . MET A 1 302 ? 1.939   3.903   3.396   1.00 0.00 ? 302 MET A CE   1  
ATOM 4656   H H    . MET A 1 302 ? -3.148  4.154   5.937   1.00 0.00 ? 302 MET A H    1  
ATOM 4657   H HA   . MET A 1 302 ? -1.970  6.825   5.586   1.00 0.00 ? 302 MET A HA   1  
ATOM 4658   H HB2  . MET A 1 302 ? -2.278  4.662   3.498   1.00 0.00 ? 302 MET A HB2  1  
ATOM 4659   H HB3  . MET A 1 302 ? -1.373  6.152   3.334   1.00 0.00 ? 302 MET A HB3  1  
ATOM 4660   H HG2  . MET A 1 302 ? 0.322   5.416   4.716   1.00 0.00 ? 302 MET A HG2  1  
ATOM 4661   H HG3  . MET A 1 302 ? -0.692  4.193   5.473   1.00 0.00 ? 302 MET A HG3  1  
ATOM 4662   H HE1  . MET A 1 302 ? 2.517   3.334   2.680   1.00 0.00 ? 302 MET A HE1  1  
ATOM 4663   H HE2  . MET A 1 302 ? 2.317   3.718   4.388   1.00 0.00 ? 302 MET A HE2  1  
ATOM 4664   H HE3  . MET A 1 302 ? 2.019   4.960   3.174   1.00 0.00 ? 302 MET A HE3  1  
ATOM 4665   N N    . ASP A 1 303 ? -4.942  6.285   5.097   1.00 0.00 ? 303 ASP A N    1  
ATOM 4666   C CA   . ASP A 1 303 ? -6.194  6.870   4.687   1.00 0.00 ? 303 ASP A CA   1  
ATOM 4667   C C    . ASP A 1 303 ? -6.517  8.120   5.513   1.00 0.00 ? 303 ASP A C    1  
ATOM 4668   O O    . ASP A 1 303 ? -7.594  8.707   5.325   1.00 0.00 ? 303 ASP A O    1  
ATOM 4669   C CB   . ASP A 1 303 ? -7.311  5.852   4.828   1.00 0.00 ? 303 ASP A CB   1  
ATOM 4670   C CG   . ASP A 1 303 ? -8.619  6.388   4.339   1.00 0.00 ? 303 ASP A CG   1  
ATOM 4671   O OD1  . ASP A 1 303 ? -8.721  6.617   3.108   1.00 0.00 ? 303 ASP A OD1  1  
ATOM 4672   O OD2  . ASP A 1 303 ? -9.525  6.610   5.177   1.00 0.00 ? 303 ASP A OD2  1  
ATOM 4673   H H    . ASP A 1 303 ? -4.926  5.679   5.867   1.00 0.00 ? 303 ASP A H    1  
ATOM 4674   H HA   . ASP A 1 303 ? -6.118  7.154   3.648   1.00 0.00 ? 303 ASP A HA   1  
ATOM 4675   H HB2  . ASP A 1 303 ? -7.058  4.971   4.257   1.00 0.00 ? 303 ASP A HB2  1  
ATOM 4676   H HB3  . ASP A 1 303 ? -7.407  5.579   5.869   1.00 0.00 ? 303 ASP A HB3  1  
ATOM 4677   N N    . ARG A 1 304 ? -5.565  8.525   6.382   1.00 0.00 ? 304 ARG A N    1  
ATOM 4678   C CA   . ARG A 1 304 ? -5.713  9.582   7.406   1.00 0.00 ? 304 ARG A CA   1  
ATOM 4679   C C    . ARG A 1 304 ? -4.446  10.441  7.511   1.00 0.00 ? 304 ARG A C    1  
ATOM 4680   O O    . ARG A 1 304 ? -3.385  9.974   7.098   1.00 0.00 ? 304 ARG A O    1  
ATOM 4681   C CB   . ARG A 1 304 ? -5.904  8.915   8.764   1.00 0.00 ? 304 ARG A CB   1  
ATOM 4682   C CG   . ARG A 1 304 ? -7.106  8.001   8.833   1.00 0.00 ? 304 ARG A CG   1  
ATOM 4683   C CD   . ARG A 1 304 ? -7.680  8.049   10.215  1.00 0.00 ? 304 ARG A CD   1  
ATOM 4684   N NE   . ARG A 1 304 ? -8.785  7.112   10.385  1.00 0.00 ? 304 ARG A NE   1  
ATOM 4685   C CZ   . ARG A 1 304 ? -9.721  7.226   11.325  1.00 0.00 ? 304 ARG A CZ   1  
ATOM 4686   N NH1  . ARG A 1 304 ? -9.704  8.259   12.186  1.00 0.00 ? 304 ARG A NH1  1  
ATOM 4687   N NH2  . ARG A 1 304 ? -10.677 6.298   11.400  1.00 0.00 ? 304 ARG A NH2  1  
ATOM 4688   H H    . ARG A 1 304 ? -4.742  7.994   6.413   1.00 0.00 ? 304 ARG A H    1  
ATOM 4689   H HA   . ARG A 1 304 ? -6.567  10.201  7.183   1.00 0.00 ? 304 ARG A HA   1  
ATOM 4690   H HB2  . ARG A 1 304 ? -5.023  8.336   8.991   1.00 0.00 ? 304 ARG A HB2  1  
ATOM 4691   H HB3  . ARG A 1 304 ? -6.009  9.687   9.514   1.00 0.00 ? 304 ARG A HB3  1  
ATOM 4692   H HG2  . ARG A 1 304 ? -7.850  8.328   8.120   1.00 0.00 ? 304 ARG A HG2  1  
ATOM 4693   H HG3  . ARG A 1 304 ? -6.805  6.990   8.603   1.00 0.00 ? 304 ARG A HG3  1  
ATOM 4694   H HD2  . ARG A 1 304 ? -6.905  7.804   10.925  1.00 0.00 ? 304 ARG A HD2  1  
ATOM 4695   H HD3  . ARG A 1 304 ? -8.031  9.052   10.413  1.00 0.00 ? 304 ARG A HD3  1  
ATOM 4696   H HE   . ARG A 1 304 ? -8.838  6.349   9.773   1.00 0.00 ? 304 ARG A HE   1  
ATOM 4697   H HH11 . ARG A 1 304 ? -8.984  8.950   12.123  1.00 0.00 ? 304 ARG A HH11 1  
ATOM 4698   H HH12 . ARG A 1 304 ? -10.411 8.336   12.889  1.00 0.00 ? 304 ARG A HH12 1  
ATOM 4699   H HH21 . ARG A 1 304 ? -10.683 5.533   10.755  1.00 0.00 ? 304 ARG A HH21 1  
ATOM 4700   H HH22 . ARG A 1 304 ? -11.388 6.367   12.100  1.00 0.00 ? 304 ARG A HH22 1  
ATOM 4701   N N    . ASP A 1 305 ? -4.516  11.659  8.073   1.00 0.00 ? 305 ASP A N    1  
ATOM 4702   C CA   . ASP A 1 305 ? -3.270  12.430  8.305   1.00 0.00 ? 305 ASP A CA   1  
ATOM 4703   C C    . ASP A 1 305 ? -2.807  12.464  9.765   1.00 0.00 ? 305 ASP A C    1  
ATOM 4704   O O    . ASP A 1 305 ? -2.027  13.346  10.162  1.00 0.00 ? 305 ASP A O    1  
ATOM 4705   C CB   . ASP A 1 305 ? -3.274  13.851  7.684   1.00 0.00 ? 305 ASP A CB   1  
ATOM 4706   C CG   . ASP A 1 305 ? -1.899  14.602  7.868   1.00 0.00 ? 305 ASP A CG   1  
ATOM 4707   O OD1  . ASP A 1 305 ? -0.873  14.174  7.278   1.00 0.00 ? 305 ASP A OD1  1  
ATOM 4708   O OD2  . ASP A 1 305 ? -1.827  15.624  8.604   1.00 0.00 ? 305 ASP A OD2  1  
ATOM 4709   H H    . ASP A 1 305 ? -5.372  11.995  8.413   1.00 0.00 ? 305 ASP A H    1  
ATOM 4710   H HA   . ASP A 1 305 ? -2.500  11.881  7.778   1.00 0.00 ? 305 ASP A HA   1  
ATOM 4711   H HB2  . ASP A 1 305 ? -3.486  13.769  6.628   1.00 0.00 ? 305 ASP A HB2  1  
ATOM 4712   H HB3  . ASP A 1 305 ? -4.054  14.433  8.152   1.00 0.00 ? 305 ASP A HB3  1  
ATOM 4713   N N    . ALA A 1 306 ? -3.256  11.481  10.544  1.00 0.00 ? 306 ALA A N    1  
ATOM 4714   C CA   . ALA A 1 306 ? -2.827  11.313  11.932  1.00 0.00 ? 306 ALA A CA   1  
ATOM 4715   C C    . ALA A 1 306 ? -2.903  9.845   12.244  1.00 0.00 ? 306 ALA A C    1  
ATOM 4716   O O    . ALA A 1 306 ? -3.650  9.112   11.563  1.00 0.00 ? 306 ALA A O    1  
ATOM 4717   C CB   . ALA A 1 306 ? -3.749  12.079  12.858  1.00 0.00 ? 306 ALA A CB   1  
ATOM 4718   H H    . ALA A 1 306 ? -3.846  10.805  10.151  1.00 0.00 ? 306 ALA A H    1  
ATOM 4719   H HA   . ALA A 1 306 ? -1.812  11.663  12.049  1.00 0.00 ? 306 ALA A HA   1  
ATOM 4720   H HB1  . ALA A 1 306 ? -3.309  12.130  13.843  1.00 0.00 ? 306 ALA A HB1  1  
ATOM 4721   H HB2  . ALA A 1 306 ? -4.702  11.574  12.915  1.00 0.00 ? 306 ALA A HB2  1  
ATOM 4722   H HB3  . ALA A 1 306 ? -3.893  13.079  12.476  1.00 0.00 ? 306 ALA A HB3  1  
ATOM 4723   N N    . LEU A 1 307 ? -2.155  9.412   13.266  1.00 0.00 ? 307 LEU A N    1  
ATOM 4724   C CA   . LEU A 1 307 ? -2.221  8.017   13.723  1.00 0.00 ? 307 LEU A CA   1  
ATOM 4725   C C    . LEU A 1 307 ? -3.592  7.746   14.320  1.00 0.00 ? 307 LEU A C    1  
ATOM 4726   O O    . LEU A 1 307 ? -4.030  8.489   15.209  1.00 0.00 ? 307 LEU A O    1  
ATOM 4727   C CB   . LEU A 1 307 ? -1.155  7.722   14.766  1.00 0.00 ? 307 LEU A CB   1  
ATOM 4728   C CG   . LEU A 1 307 ? -0.960  6.280   15.240  1.00 0.00 ? 307 LEU A CG   1  
ATOM 4729   C CD1  . LEU A 1 307 ? 0.372   6.171   16.010  1.00 0.00 ? 307 LEU A CD1  1  
ATOM 4730   C CD2  . LEU A 1 307 ? -2.110  5.752   16.076  1.00 0.00 ? 307 LEU A CD2  1  
ATOM 4731   H H    . LEU A 1 307 ? -1.600  10.052  13.759  1.00 0.00 ? 307 LEU A H    1  
ATOM 4732   H HA   . LEU A 1 307 ? -2.074  7.364   12.875  1.00 0.00 ? 307 LEU A HA   1  
ATOM 4733   H HB2  . LEU A 1 307 ? -0.211  8.054   14.368  1.00 0.00 ? 307 LEU A HB2  1  
ATOM 4734   H HB3  . LEU A 1 307 ? -1.375  8.333   15.633  1.00 0.00 ? 307 LEU A HB3  1  
ATOM 4735   H HG   . LEU A 1 307 ? -0.871  5.659   14.355  1.00 0.00 ? 307 LEU A HG   1  
ATOM 4736   H HD11 . LEU A 1 307 ? 0.271   5.447   16.805  1.00 0.00 ? 307 LEU A HD11 1  
ATOM 4737   H HD12 . LEU A 1 307 ? 0.625   7.132   16.431  1.00 0.00 ? 307 LEU A HD12 1  
ATOM 4738   H HD13 . LEU A 1 307 ? 1.154   5.857   15.335  1.00 0.00 ? 307 LEU A HD13 1  
ATOM 4739   H HD21 . LEU A 1 307 ? -2.733  5.111   15.468  1.00 0.00 ? 307 LEU A HD21 1  
ATOM 4740   H HD22 . LEU A 1 307 ? -2.697  6.580   16.445  1.00 0.00 ? 307 LEU A HD22 1  
ATOM 4741   H HD23 . LEU A 1 307 ? -1.720  5.187   16.910  1.00 0.00 ? 307 LEU A HD23 1  
ATOM 4742   N N    . PRO A 1 308 ? -4.287  6.697   13.828  1.00 0.00 ? 308 PRO A N    1  
ATOM 4743   C CA   . PRO A 1 308 ? -5.652  6.444   14.326  1.00 0.00 ? 308 PRO A CA   1  
ATOM 4744   C C    . PRO A 1 308 ? -5.644  5.801   15.702  1.00 0.00 ? 308 PRO A C    1  
ATOM 4745   O O    . PRO A 1 308 ? -4.975  4.814   15.921  1.00 0.00 ? 308 PRO A O    1  
ATOM 4746   C CB   . PRO A 1 308 ? -6.292  5.537   13.258  1.00 0.00 ? 308 PRO A CB   1  
ATOM 4747   C CG   . PRO A 1 308 ? -5.169  4.864   12.548  1.00 0.00 ? 308 PRO A CG   1  
ATOM 4748   C CD   . PRO A 1 308 ? -3.873  5.718   12.810  1.00 0.00 ? 308 PRO A CD   1  
ATOM 4749   H HA   . PRO A 1 308 ? -6.197  7.373   14.368  1.00 0.00 ? 308 PRO A HA   1  
ATOM 4750   H HB2  . PRO A 1 308 ? -6.928  4.802   13.731  1.00 0.00 ? 308 PRO A HB2  1  
ATOM 4751   H HB3  . PRO A 1 308 ? -6.864  6.130   12.561  1.00 0.00 ? 308 PRO A HB3  1  
ATOM 4752   H HG2  . PRO A 1 308 ? -5.056  3.858   12.928  1.00 0.00 ? 308 PRO A HG2  1  
ATOM 4753   H HG3  . PRO A 1 308 ? -5.383  4.826   11.490  1.00 0.00 ? 308 PRO A HG3  1  
ATOM 4754   H HD2  . PRO A 1 308 ? -3.063  5.102   13.177  1.00 0.00 ? 308 PRO A HD2  1  
ATOM 4755   H HD3  . PRO A 1 308 ? -3.586  6.224   11.901  1.00 0.00 ? 308 PRO A HD3  1  
ATOM 4756   N N    . THR A 1 309 ? -6.380  6.394   16.617  1.00 0.00 ? 309 THR A N    1  
ATOM 4757   C CA   . THR A 1 309 ? -6.397  5.987   18.003  1.00 0.00 ? 309 THR A CA   1  
ATOM 4758   C C    . THR A 1 309 ? -7.066  4.663   18.146  1.00 0.00 ? 309 THR A C    1  
ATOM 4759   O O    . THR A 1 309 ? -7.613  4.142   17.206  1.00 0.00 ? 309 THR A O    1  
ATOM 4760   C CB   . THR A 1 309 ? -7.248  6.974   18.820  1.00 0.00 ? 309 THR A CB   1  
ATOM 4761   O OG1  . THR A 1 309 ? -8.621  6.920   18.360  1.00 0.00 ? 309 THR A OG1  1  
ATOM 4762   C CG2  . THR A 1 309 ? -6.685  8.354   18.665  1.00 0.00 ? 309 THR A CG2  1  
ATOM 4763   H H    . THR A 1 309 ? -6.881  7.197   16.362  1.00 0.00 ? 309 THR A H    1  
ATOM 4764   H HA   . THR A 1 309 ? -5.397  5.953   18.402  1.00 0.00 ? 309 THR A HA   1  
ATOM 4765   H HB   . THR A 1 309 ? -7.214  6.691   19.862  1.00 0.00 ? 309 THR A HB   1  
ATOM 4766   H HG1  . THR A 1 309 ? -9.190  7.160   19.094  1.00 0.00 ? 309 THR A HG1  1  
ATOM 4767   H HG21 . THR A 1 309 ? -6.577  8.584   17.615  1.00 0.00 ? 309 THR A HG21 1  
ATOM 4768   H HG22 . THR A 1 309 ? -5.719  8.405   19.146  1.00 0.00 ? 309 THR A HG22 1  
ATOM 4769   H HG23 . THR A 1 309 ? -7.352  9.069   19.122  1.00 0.00 ? 309 THR A HG23 1  
ATOM 4770   N N    . GLU A 1 310 ? -7.094  4.154   19.360  1.00 0.00 ? 310 GLU A N    1  
ATOM 4771   C CA   . GLU A 1 310 ? -7.823  2.937   19.582  1.00 0.00 ? 310 GLU A CA   1  
ATOM 4772   C C    . GLU A 1 310 ? -9.237  3.079   19.019  1.00 0.00 ? 310 GLU A C    1  
ATOM 4773   O O    . GLU A 1 310 ? -9.706  2.239   18.227  1.00 0.00 ? 310 GLU A O    1  
ATOM 4774   C CB   . GLU A 1 310 ? -7.844  2.592   21.058  1.00 0.00 ? 310 GLU A CB   1  
ATOM 4775   C CG   . GLU A 1 310 ? -8.602  1.340   21.327  1.00 0.00 ? 310 GLU A CG   1  
ATOM 4776   C CD   . GLU A 1 310 ? -8.624  0.952   22.777  1.00 0.00 ? 310 GLU A CD   1  
ATOM 4777   O OE1  . GLU A 1 310 ? -7.873  1.553   23.578  1.00 0.00 ? 310 GLU A OE1  1  
ATOM 4778   O OE2  . GLU A 1 310 ? -9.410  0.034   23.117  1.00 0.00 ? 310 GLU A OE2  1  
ATOM 4779   H H    . GLU A 1 310 ? -6.692  4.637   20.112  1.00 0.00 ? 310 GLU A H    1  
ATOM 4780   H HA   . GLU A 1 310 ? -7.324  2.140   19.050  1.00 0.00 ? 310 GLU A HA   1  
ATOM 4781   H HB2  . GLU A 1 310 ? -6.829  2.468   21.404  1.00 0.00 ? 310 GLU A HB2  1  
ATOM 4782   H HB3  . GLU A 1 310 ? -8.301  3.406   21.602  1.00 0.00 ? 310 GLU A HB3  1  
ATOM 4783   H HG2  . GLU A 1 310 ? -9.619  1.472   20.992  1.00 0.00 ? 310 GLU A HG2  1  
ATOM 4784   H HG3  . GLU A 1 310 ? -8.153  0.537   20.757  1.00 0.00 ? 310 GLU A HG3  1  
ATOM 4785   N N    . GLU A 1 311 ? -9.891  4.176   19.372  1.00 0.00 ? 311 GLU A N    1  
ATOM 4786   C CA   . GLU A 1 311 ? -11.297 4.380   19.039  1.00 0.00 ? 311 GLU A CA   1  
ATOM 4787   C C    . GLU A 1 311 ? -11.513 4.484   17.506  1.00 0.00 ? 311 GLU A C    1  
ATOM 4788   O O    . GLU A 1 311 ? -12.465 3.894   16.933  1.00 0.00 ? 311 GLU A O    1  
ATOM 4789   C CB   . GLU A 1 311 ? -11.819 5.617   19.806  1.00 0.00 ? 311 GLU A CB   1  
ATOM 4790   C CG   . GLU A 1 311 ? -13.294 5.990   19.613  1.00 0.00 ? 311 GLU A CG   1  
ATOM 4791   C CD   . GLU A 1 311 ? -14.275 4.926   20.125  1.00 0.00 ? 311 GLU A CD   1  
ATOM 4792   O OE1  . GLU A 1 311 ? -13.894 4.057   20.949  1.00 0.00 ? 311 GLU A OE1  1  
ATOM 4793   O OE2  . GLU A 1 311 ? -15.452 4.973   19.704  1.00 0.00 ? 311 GLU A OE2  1  
ATOM 4794   H H    . GLU A 1 311 ? -9.446  4.823   19.958  1.00 0.00 ? 311 GLU A H    1  
ATOM 4795   H HA   . GLU A 1 311 ? -11.846 3.517   19.389  1.00 0.00 ? 311 GLU A HA   1  
ATOM 4796   H HB2  . GLU A 1 311 ? -11.663 5.445   20.858  1.00 0.00 ? 311 GLU A HB2  1  
ATOM 4797   H HB3  . GLU A 1 311 ? -11.212 6.465   19.515  1.00 0.00 ? 311 GLU A HB3  1  
ATOM 4798   H HG2  . GLU A 1 311 ? -13.487 6.913   20.137  1.00 0.00 ? 311 GLU A HG2  1  
ATOM 4799   H HG3  . GLU A 1 311 ? -13.472 6.149   18.558  1.00 0.00 ? 311 GLU A HG3  1  
ATOM 4800   N N    . GLU A 1 312 ? -10.615 5.196   16.834  1.00 0.00 ? 312 GLU A N    1  
ATOM 4801   C CA   . GLU A 1 312 ? -10.780 5.361   15.387  1.00 0.00 ? 312 GLU A CA   1  
ATOM 4802   C C    . GLU A 1 312 ? -10.570 4.028   14.709  1.00 0.00 ? 312 GLU A C    1  
ATOM 4803   O O    . GLU A 1 312 ? -11.270 3.686   13.758  1.00 0.00 ? 312 GLU A O    1  
ATOM 4804   C CB   . GLU A 1 312 ? -9.874  6.475   14.854  1.00 0.00 ? 312 GLU A CB   1  
ATOM 4805   C CG   . GLU A 1 312 ? -10.355 7.873   15.336  1.00 0.00 ? 312 GLU A CG   1  
ATOM 4806   C CD   . GLU A 1 312 ? -9.392  9.014   15.005  1.00 0.00 ? 312 GLU A CD   1  
ATOM 4807   O OE1  . GLU A 1 312 ? -8.219  8.733   14.618  1.00 0.00 ? 312 GLU A OE1  1  
ATOM 4808   O OE2  . GLU A 1 312 ? -9.793  10.210  15.134  1.00 0.00 ? 312 GLU A OE2  1  
ATOM 4809   H H    . GLU A 1 312 ? -9.867  5.623   17.302  1.00 0.00 ? 312 GLU A H    1  
ATOM 4810   H HA   . GLU A 1 312 ? -11.807 5.654   15.210  1.00 0.00 ? 312 GLU A HA   1  
ATOM 4811   H HB2  . GLU A 1 312 ? -8.866  6.308   15.204  1.00 0.00 ? 312 GLU A HB2  1  
ATOM 4812   H HB3  . GLU A 1 312 ? -9.882  6.452   13.774  1.00 0.00 ? 312 GLU A HB3  1  
ATOM 4813   H HG2  . GLU A 1 312 ? -11.306 8.087   14.873  1.00 0.00 ? 312 GLU A HG2  1  
ATOM 4814   H HG3  . GLU A 1 312 ? -10.496 7.836   16.407  1.00 0.00 ? 312 GLU A HG3  1  
ATOM 4815   N N    . GLN A 1 313 ? -9.662  3.232   15.266  1.00 0.00 ? 313 GLN A N    1  
ATOM 4816   C CA   . GLN A 1 313 ? -9.346  1.950   14.677  1.00 0.00 ? 313 GLN A CA   1  
ATOM 4817   C C    . GLN A 1 313 ? -10.510 1.012   14.871  1.00 0.00 ? 313 GLN A C    1  
ATOM 4818   O O    . GLN A 1 313 ? -10.955 0.292   13.950  1.00 0.00 ? 313 GLN A O    1  
ATOM 4819   C CB   . GLN A 1 313 ? -8.099  1.364   15.312  1.00 0.00 ? 313 GLN A CB   1  
ATOM 4820   C CG   . GLN A 1 313 ? -6.795  2.100   14.941  1.00 0.00 ? 313 GLN A CG   1  
ATOM 4821   C CD   . GLN A 1 313 ? -5.552  1.428   15.531  1.00 0.00 ? 313 GLN A CD   1  
ATOM 4822   O OE1  . GLN A 1 313 ? -5.285  0.245   15.283  1.00 0.00 ? 313 GLN A OE1  1  
ATOM 4823   N NE2  . GLN A 1 313 ? -4.800  2.178   16.314  1.00 0.00 ? 313 GLN A NE2  1  
ATOM 4824   H H    . GLN A 1 313 ? -9.181  3.530   16.066  1.00 0.00 ? 313 GLN A H    1  
ATOM 4825   H HA   . GLN A 1 313 ? -9.173  2.082   13.619  1.00 0.00 ? 313 GLN A HA   1  
ATOM 4826   H HB2  . GLN A 1 313 ? -8.213  1.394   16.385  1.00 0.00 ? 313 GLN A HB2  1  
ATOM 4827   H HB3  . GLN A 1 313 ? -8.013  0.331   15.006  1.00 0.00 ? 313 GLN A HB3  1  
ATOM 4828   H HG2  . GLN A 1 313 ? -6.700  2.120   13.866  1.00 0.00 ? 313 GLN A HG2  1  
ATOM 4829   H HG3  . GLN A 1 313 ? -6.853  3.115   15.305  1.00 0.00 ? 313 GLN A HG3  1  
ATOM 4830   H HE21 . GLN A 1 313 ? -5.049  3.110   16.488  1.00 0.00 ? 313 GLN A HE21 1  
ATOM 4831   H HE22 . GLN A 1 313 ? -3.991  1.802   16.721  1.00 0.00 ? 313 GLN A HE22 1  
ATOM 4832   N N    . PHE A 1 314 ? -10.985 1.009   16.100  1.00 0.00 ? 314 PHE A N    1  
ATOM 4833   C CA   . PHE A 1 314 ? -12.106 0.197   16.450  1.00 0.00 ? 314 PHE A CA   1  
ATOM 4834   C C    . PHE A 1 314 ? -13.244 0.444   15.457  1.00 0.00 ? 314 PHE A C    1  
ATOM 4835   O O    . PHE A 1 314 ? -13.852 -0.517  14.964  1.00 0.00 ? 314 PHE A O    1  
ATOM 4836   C CB   . PHE A 1 314 ? -12.538 0.564   17.848  1.00 0.00 ? 314 PHE A CB   1  
ATOM 4837   C CG   . PHE A 1 314 ? -13.883 0.032   18.225  1.00 0.00 ? 314 PHE A CG   1  
ATOM 4838   C CD1  . PHE A 1 314 ? -14.080 -1.358  18.420  1.00 0.00 ? 314 PHE A CD1  1  
ATOM 4839   C CD2  . PHE A 1 314 ? -14.953 0.910   18.414  1.00 0.00 ? 314 PHE A CD2  1  
ATOM 4840   C CE1  . PHE A 1 314 ? -15.320 -1.870  18.797  1.00 0.00 ? 314 PHE A CE1  1  
ATOM 4841   C CE2  . PHE A 1 314 ? -16.178 0.423   18.765  1.00 0.00 ? 314 PHE A CE2  1  
ATOM 4842   C CZ   . PHE A 1 314 ? -16.367 -0.994  18.968  1.00 0.00 ? 314 PHE A CZ   1  
ATOM 4843   H H    . PHE A 1 314 ? -10.575 1.586   16.778  1.00 0.00 ? 314 PHE A H    1  
ATOM 4844   H HA   . PHE A 1 314 ? -11.822 -0.844  16.424  1.00 0.00 ? 314 PHE A HA   1  
ATOM 4845   H HB2  . PHE A 1 314 ? -11.811 0.178   18.545  1.00 0.00 ? 314 PHE A HB2  1  
ATOM 4846   H HB3  . PHE A 1 314 ? -12.554 1.643   17.931  1.00 0.00 ? 314 PHE A HB3  1  
ATOM 4847   H HD1  . PHE A 1 314 ? -13.251 -2.035  18.274  1.00 0.00 ? 314 PHE A HD1  1  
ATOM 4848   H HD2  . PHE A 1 314 ? -14.816 1.971   18.263  1.00 0.00 ? 314 PHE A HD2  1  
ATOM 4849   H HE1  . PHE A 1 314 ? -15.458 -2.931  18.943  1.00 0.00 ? 314 PHE A HE1  1  
ATOM 4850   H HE2  . PHE A 1 314 ? -17.008 1.101   18.902  1.00 0.00 ? 314 PHE A HE2  1  
ATOM 4851   H HZ   . PHE A 1 314 ? -17.336 -1.369  19.260  1.00 0.00 ? 314 PHE A HZ   1  
ATOM 4852   N N    . ALA A 1 315 ? -13.522 1.722   15.170  1.00 0.00 ? 315 ALA A N    1  
ATOM 4853   C CA   . ALA A 1 315 ? -14.677 2.093   14.368  1.00 0.00 ? 315 ALA A CA   1  
ATOM 4854   C C    . ALA A 1 315 ? -14.486 1.579   12.967  1.00 0.00 ? 315 ALA A C    1  
ATOM 4855   O O    . ALA A 1 315 ? -15.413 1.048   12.344  1.00 0.00 ? 315 ALA A O    1  
ATOM 4856   C CB   . ALA A 1 315 ? -14.878 3.619   14.360  1.00 0.00 ? 315 ALA A CB   1  
ATOM 4857   H H    . ALA A 1 315 ? -12.995 2.429   15.597  1.00 0.00 ? 315 ALA A H    1  
ATOM 4858   H HA   . ALA A 1 315 ? -15.556 1.629   14.791  1.00 0.00 ? 315 ALA A HA   1  
ATOM 4859   H HB1  . ALA A 1 315 ? -14.727 4.007   15.357  1.00 0.00 ? 315 ALA A HB1  1  
ATOM 4860   H HB2  . ALA A 1 315 ? -15.881 3.848   14.032  1.00 0.00 ? 315 ALA A HB2  1  
ATOM 4861   H HB3  . ALA A 1 315 ? -14.166 4.072   13.685  1.00 0.00 ? 315 ALA A HB3  1  
ATOM 4862   N N    . ALA A 1 316 ? -13.265 1.777   12.477  1.00 0.00 ? 316 ALA A N    1  
ATOM 4863   C CA   . ALA A 1 316 ? -12.860 1.394   11.154  1.00 0.00 ? 316 ALA A CA   1  
ATOM 4864   C C    . ALA A 1 316 ? -12.978 -0.105  11.024  1.00 0.00 ? 316 ALA A C    1  
ATOM 4865   O O    . ALA A 1 316 ? -13.537 -0.583  10.027  1.00 0.00 ? 316 ALA A O    1  
ATOM 4866   C CB   . ALA A 1 316 ? -11.460 1.838   10.909  1.00 0.00 ? 316 ALA A CB   1  
ATOM 4867   H H    . ALA A 1 316 ? -12.607 2.227   13.048  1.00 0.00 ? 316 ALA A H    1  
ATOM 4868   H HA   . ALA A 1 316 ? -13.513 1.865   10.433  1.00 0.00 ? 316 ALA A HA   1  
ATOM 4869   H HB1  . ALA A 1 316 ? -11.104 1.413   9.983   1.00 0.00 ? 316 ALA A HB1  1  
ATOM 4870   H HB2  . ALA A 1 316 ? -10.830 1.508   11.723  1.00 0.00 ? 316 ALA A HB2  1  
ATOM 4871   H HB3  . ALA A 1 316 ? -11.430 2.915   10.844  1.00 0.00 ? 316 ALA A HB3  1  
ATOM 4872   N N    . TYR A 1 317 ? -12.483 -0.838  12.025  1.00 0.00 ? 317 TYR A N    1  
ATOM 4873   C CA   . TYR A 1 317 ? -12.568 -2.302  12.039  1.00 0.00 ? 317 TYR A CA   1  
ATOM 4874   C C    . TYR A 1 317 ? -13.982 -2.786  12.106  1.00 0.00 ? 317 TYR A C    1  
ATOM 4875   O O    . TYR A 1 317 ? -14.339 -3.730  11.388  1.00 0.00 ? 317 TYR A O    1  
ATOM 4876   C CB   . TYR A 1 317 ? -11.713 -2.925  13.163  1.00 0.00 ? 317 TYR A CB   1  
ATOM 4877   C CG   . TYR A 1 317 ? -10.283 -2.412  13.179  1.00 0.00 ? 317 TYR A CG   1  
ATOM 4878   C CD1  . TYR A 1 317 ? -9.735  -1.807  12.042  1.00 0.00 ? 317 TYR A CD1  1  
ATOM 4879   C CD2  . TYR A 1 317 ? -9.475  -2.531  14.301  1.00 0.00 ? 317 TYR A CD2  1  
ATOM 4880   C CE1  . TYR A 1 317 ? -8.445  -1.326  12.005  1.00 0.00 ? 317 TYR A CE1  1  
ATOM 4881   C CE2  . TYR A 1 317 ? -8.131  -2.047  14.274  1.00 0.00 ? 317 TYR A CE2  1  
ATOM 4882   C CZ   . TYR A 1 317 ? -7.649  -1.447  13.110  1.00 0.00 ? 317 TYR A CZ   1  
ATOM 4883   O OH   . TYR A 1 317 ? -6.381  -0.947  13.010  1.00 0.00 ? 317 TYR A OH   1  
ATOM 4884   H H    . TYR A 1 317 ? -12.071 -0.381  12.788  1.00 0.00 ? 317 TYR A H    1  
ATOM 4885   H HA   . TYR A 1 317 ? -12.161 -2.649  11.100  1.00 0.00 ? 317 TYR A HA   1  
ATOM 4886   H HB2  . TYR A 1 317 ? -12.171 -2.698  14.113  1.00 0.00 ? 317 TYR A HB2  1  
ATOM 4887   H HB3  . TYR A 1 317 ? -11.700 -3.998  13.033  1.00 0.00 ? 317 TYR A HB3  1  
ATOM 4888   H HD1  . TYR A 1 317 ? -10.352 -1.704  11.161  1.00 0.00 ? 317 TYR A HD1  1  
ATOM 4889   H HD2  . TYR A 1 317 ? -9.863  -2.993  15.197  1.00 0.00 ? 317 TYR A HD2  1  
ATOM 4890   H HE1  . TYR A 1 317 ? -8.062  -0.861  11.108  1.00 0.00 ? 317 TYR A HE1  1  
ATOM 4891   H HE2  . TYR A 1 317 ? -7.499  -2.138  15.146  1.00 0.00 ? 317 TYR A HE2  1  
ATOM 4892   H HH   . TYR A 1 317 ? -6.400  -0.031  13.299  1.00 0.00 ? 317 TYR A HH   1  
ATOM 4893   N N    . LYS A 1 318 ? -14.794 -2.116  12.941  1.00 0.00 ? 318 LYS A N    1  
ATOM 4894   C CA   . LYS A 1 318 ? -16.219 -2.450  13.161  1.00 0.00 ? 318 LYS A CA   1  
ATOM 4895   C C    . LYS A 1 318 ? -16.905 -2.316  11.838  1.00 0.00 ? 318 LYS A C    1  
ATOM 4896   O O    . LYS A 1 318 ? -17.579 -3.263  11.388  1.00 0.00 ? 318 LYS A O    1  
ATOM 4897   C CB   . LYS A 1 318 ? -16.870 -1.537  14.214  1.00 0.00 ? 318 LYS A CB   1  
ATOM 4898   C CG   . LYS A 1 318 ? -18.404 -1.752  14.516  1.00 0.00 ? 318 LYS A CG   1  
ATOM 4899   C CD   . LYS A 1 318 ? -18.883 -0.758  15.613  1.00 0.00 ? 318 LYS A CD   1  
ATOM 4900   C CE   . LYS A 1 318 ? -20.429 -0.770  15.886  1.00 0.00 ? 318 LYS A CE   1  
ATOM 4901   N NZ   . LYS A 1 318 ? -20.921 -2.088  16.373  1.00 0.00 ? 318 LYS A NZ   1  
ATOM 4902   H H    . LYS A 1 318 ? -14.416 -1.365  13.445  1.00 0.00 ? 318 LYS A H    1  
ATOM 4903   H HA   . LYS A 1 318 ? -16.290 -3.479  13.488  1.00 0.00 ? 318 LYS A HA   1  
ATOM 4904   H HB2  . LYS A 1 318 ? -16.335 -1.668  15.141  1.00 0.00 ? 318 LYS A HB2  1  
ATOM 4905   H HB3  . LYS A 1 318 ? -16.730 -0.514  13.893  1.00 0.00 ? 318 LYS A HB3  1  
ATOM 4906   H HG2  . LYS A 1 318 ? -18.972 -1.588  13.613  1.00 0.00 ? 318 LYS A HG2  1  
ATOM 4907   H HG3  . LYS A 1 318 ? -18.562 -2.764  14.859  1.00 0.00 ? 318 LYS A HG3  1  
ATOM 4908   H HD2  . LYS A 1 318 ? -18.376 -0.997  16.534  1.00 0.00 ? 318 LYS A HD2  1  
ATOM 4909   H HD3  . LYS A 1 318 ? -18.593 0.241   15.316  1.00 0.00 ? 318 LYS A HD3  1  
ATOM 4910   H HE2  . LYS A 1 318 ? -20.657 -0.022  16.629  1.00 0.00 ? 318 LYS A HE2  1  
ATOM 4911   H HE3  . LYS A 1 318 ? -20.944 -0.516  14.969  1.00 0.00 ? 318 LYS A HE3  1  
ATOM 4912   H HZ1  . LYS A 1 318 ? -20.168 -2.562  16.910  1.00 0.00 ? 318 LYS A HZ1  1  
ATOM 4913   H HZ2  . LYS A 1 318 ? -21.192 -2.678  15.560  1.00 0.00 ? 318 LYS A HZ2  1  
ATOM 4914   H HZ3  . LYS A 1 318 ? -21.745 -1.945  16.989  1.00 0.00 ? 318 LYS A HZ3  1  
ATOM 4915   N N    . ALA A 1 319 ? -16.706 -1.178  11.186  1.00 0.00 ? 319 ALA A N    1  
ATOM 4916   C CA   . ALA A 1 319 ? -17.338 -0.987  9.882   1.00 0.00 ? 319 ALA A CA   1  
ATOM 4917   C C    . ALA A 1 319 ? -17.006 -2.159  8.960   1.00 0.00 ? 319 ALA A C    1  
ATOM 4918   O O    . ALA A 1 319 ? -17.909 -2.728  8.356   1.00 0.00 ? 319 ALA A O    1  
ATOM 4919   C CB   . ALA A 1 319 ? -16.981 0.368   9.233   1.00 0.00 ? 319 ALA A CB   1  
ATOM 4920   H H    . ALA A 1 319 ? -16.137 -0.478  11.570  1.00 0.00 ? 319 ALA A H    1  
ATOM 4921   H HA   . ALA A 1 319 ? -18.408 -1.001  10.042  1.00 0.00 ? 319 ALA A HA   1  
ATOM 4922   H HB1  . ALA A 1 319 ? -15.961 0.339   8.878   1.00 0.00 ? 319 ALA A HB1  1  
ATOM 4923   H HB2  . ALA A 1 319 ? -17.086 1.156   9.964   1.00 0.00 ? 319 ALA A HB2  1  
ATOM 4924   H HB3  . ALA A 1 319 ? -17.646 0.555   8.402   1.00 0.00 ? 319 ALA A HB3  1  
ATOM 4925   N N    . VAL A 1 320 ? -15.730 -2.543  8.888   1.00 0.00 ? 320 VAL A N    1  
ATOM 4926   C CA   . VAL A 1 320 ? -15.317 -3.561  7.942   1.00 0.00 ? 320 VAL A CA   1  
ATOM 4927   C C    . VAL A 1 320 ? -16.047 -4.833  8.335   1.00 0.00 ? 320 VAL A C    1  
ATOM 4928   O O    . VAL A 1 320 ? -16.745 -5.446  7.516   1.00 0.00 ? 320 VAL A O    1  
ATOM 4929   C CB   . VAL A 1 320 ? -13.773 -3.754  7.929   1.00 0.00 ? 320 VAL A CB   1  
ATOM 4930   C CG1  . VAL A 1 320 ? -13.351 -4.968  7.097   1.00 0.00 ? 320 VAL A CG1  1  
ATOM 4931   C CG2  . VAL A 1 320 ? -13.088 -2.551  7.385   1.00 0.00 ? 320 VAL A CG2  1  
ATOM 4932   H H    . VAL A 1 320 ? -15.053 -2.073  9.418   1.00 0.00 ? 320 VAL A H    1  
ATOM 4933   H HA   . VAL A 1 320 ? -15.644 -3.267  6.953   1.00 0.00 ? 320 VAL A HA   1  
ATOM 4934   H HB   . VAL A 1 320 ? -13.443 -3.910  8.947   1.00 0.00 ? 320 VAL A HB   1  
ATOM 4935   H HG11 . VAL A 1 320 ? -13.709 -4.852  6.085   1.00 0.00 ? 320 VAL A HG11 1  
ATOM 4936   H HG12 . VAL A 1 320 ? -13.773 -5.864  7.528   1.00 0.00 ? 320 VAL A HG12 1  
ATOM 4937   H HG13 . VAL A 1 320 ? -12.274 -5.044  7.092   1.00 0.00 ? 320 VAL A HG13 1  
ATOM 4938   H HG21 . VAL A 1 320 ? -12.019 -2.670  7.481   1.00 0.00 ? 320 VAL A HG21 1  
ATOM 4939   H HG22 . VAL A 1 320 ? -13.405 -1.677  7.936   1.00 0.00 ? 320 VAL A HG22 1  
ATOM 4940   H HG23 . VAL A 1 320 ? -13.343 -2.432  6.342   1.00 0.00 ? 320 VAL A HG23 1  
ATOM 4941   N N    . ALA A 1 321 ? -15.938 -5.194  9.608   1.00 0.00 ? 321 ALA A N    1  
ATOM 4942   C CA   . ALA A 1 321 ? -16.530 -6.418  10.113  1.00 0.00 ? 321 ALA A CA   1  
ATOM 4943   C C    . ALA A 1 321 ? -17.988 -6.498  9.733   1.00 0.00 ? 321 ALA A C    1  
ATOM 4944   O O    . ALA A 1 321 ? -18.551 -7.571  9.478   1.00 0.00 ? 321 ALA A O    1  
ATOM 4945   C CB   . ALA A 1 321 ? -16.385 -6.445  11.587  1.00 0.00 ? 321 ALA A CB   1  
ATOM 4946   H H    . ALA A 1 321 ? -15.407 -4.638  10.216  1.00 0.00 ? 321 ALA A H    1  
ATOM 4947   H HA   . ALA A 1 321 ? -16.007 -7.264  9.692   1.00 0.00 ? 321 ALA A HA   1  
ATOM 4948   H HB1  . ALA A 1 321 ? -15.414 -6.061  11.861  1.00 0.00 ? 321 ALA A HB1  1  
ATOM 4949   H HB2  . ALA A 1 321 ? -16.483 -7.462  11.940  1.00 0.00 ? 321 ALA A HB2  1  
ATOM 4950   H HB3  . ALA A 1 321 ? -17.152 -5.832  12.036  1.00 0.00 ? 321 ALA A HB3  1  
ATOM 4951   N N    . GLU A 1 322 ? -18.608 -5.337  9.678   1.00 0.00 ? 322 GLU A N    1  
ATOM 4952   C CA   . GLU A 1 322 ? -20.020 -5.282  9.417   1.00 0.00 ? 322 GLU A CA   1  
ATOM 4953   C C    . GLU A 1 322 ? -20.288 -5.209  7.931   1.00 0.00 ? 322 GLU A C    1  
ATOM 4954   O O    . GLU A 1 322 ? -21.217 -5.840  7.444   1.00 0.00 ? 322 GLU A O    1  
ATOM 4955   C CB   . GLU A 1 322 ? -20.674 -4.172  10.238  1.00 0.00 ? 322 GLU A CB   1  
ATOM 4956   C CG   . GLU A 1 322 ? -20.645 -4.492  11.729  1.00 0.00 ? 322 GLU A CG   1  
ATOM 4957   C CD   . GLU A 1 322 ? -21.183 -3.385  12.605  1.00 0.00 ? 322 GLU A CD   1  
ATOM 4958   O OE1  . GLU A 1 322 ? -21.421 -2.291  12.079  1.00 0.00 ? 322 GLU A OE1  1  
ATOM 4959   O OE2  . GLU A 1 322 ? -21.343 -3.596  13.828  1.00 0.00 ? 322 GLU A OE2  1  
ATOM 4960   H H    . GLU A 1 322 ? -18.117 -4.513  9.877   1.00 0.00 ? 322 GLU A H    1  
ATOM 4961   H HA   . GLU A 1 322 ? -20.437 -6.220  9.761   1.00 0.00 ? 322 GLU A HA   1  
ATOM 4962   H HB2  . GLU A 1 322 ? -20.144 -3.247  10.066  1.00 0.00 ? 322 GLU A HB2  1  
ATOM 4963   H HB3  . GLU A 1 322 ? -21.700 -4.056  9.921   1.00 0.00 ? 322 GLU A HB3  1  
ATOM 4964   H HG2  . GLU A 1 322 ? -21.235 -5.379  11.901  1.00 0.00 ? 322 GLU A HG2  1  
ATOM 4965   H HG3  . GLU A 1 322 ? -19.623 -4.698  12.016  1.00 0.00 ? 322 GLU A HG3  1  
ATOM 4966   N N    . ALA A 1 323 ? -19.444 -4.507  7.194   1.00 0.00 ? 323 ALA A N    1  
ATOM 4967   C CA   . ALA A 1 323 ? -19.597 -4.476  5.750   1.00 0.00 ? 323 ALA A CA   1  
ATOM 4968   C C    . ALA A 1 323 ? -19.289 -5.829  5.175   1.00 0.00 ? 323 ALA A C    1  
ATOM 4969   O O    . ALA A 1 323 ? -19.539 -6.078  4.017   1.00 0.00 ? 323 ALA A O    1  
ATOM 4970   C CB   . ALA A 1 323 ? -18.702 -3.463  5.142   1.00 0.00 ? 323 ALA A CB   1  
ATOM 4971   H H    . ALA A 1 323 ? -18.681 -4.059  7.615   1.00 0.00 ? 323 ALA A H    1  
ATOM 4972   H HA   . ALA A 1 323 ? -20.621 -4.223  5.515   1.00 0.00 ? 323 ALA A HA   1  
ATOM 4973   H HB1  . ALA A 1 323 ? -18.772 -3.519  4.066   1.00 0.00 ? 323 ALA A HB1  1  
ATOM 4974   H HB2  . ALA A 1 323 ? -17.683 -3.654  5.448   1.00 0.00 ? 323 ALA A HB2  1  
ATOM 4975   H HB3  . ALA A 1 323 ? -18.998 -2.478  5.469   1.00 0.00 ? 323 ALA A HB3  1  
ATOM 4976   N N    . CYS A 1 324 ? -18.754 -6.722  5.987   1.00 0.00 ? 324 CYS A N    1  
ATOM 4977   C CA   . CYS A 1 324 ? -18.508 -8.063  5.504   1.00 0.00 ? 324 CYS A CA   1  
ATOM 4978   C C    . CYS A 1 324 ? -19.573 -9.059  5.859   1.00 0.00 ? 324 CYS A C    1  
ATOM 4979   O O    . CYS A 1 324 ? -19.462 -10.217 5.459   1.00 0.00 ? 324 CYS A O    1  
ATOM 4980   C CB   . CYS A 1 324 ? -17.154 -8.558  5.965   1.00 0.00 ? 324 CYS A CB   1  
ATOM 4981   S SG   . CYS A 1 324 ? -15.917 -7.489  5.276   1.00 0.00 ? 324 CYS A SG   1  
ATOM 4982   H H    . CYS A 1 324 ? -18.573 -6.493  6.923   1.00 0.00 ? 324 CYS A H    1  
ATOM 4983   H HA   . CYS A 1 324 ? -18.472 -8.009  4.427   1.00 0.00 ? 324 CYS A HA   1  
ATOM 4984   H HB2  . CYS A 1 324 ? -17.102 -8.530  7.044   1.00 0.00 ? 324 CYS A HB2  1  
ATOM 4985   H HB3  . CYS A 1 324 ? -16.996 -9.568  5.618   1.00 0.00 ? 324 CYS A HB3  1  
ATOM 4986   H HG   . CYS A 1 324 ? -15.230 -7.367  5.935   1.00 0.00 ? 324 CYS A HG   1  
ATOM 4987   N N    . GLY A 1 325 ? -20.586 -8.632  6.609   1.00 0.00 ? 325 GLY A N    1  
ATOM 4988   C CA   . GLY A 1 325 ? -21.716 -9.499  6.921   1.00 0.00 ? 325 GLY A CA   1  
ATOM 4989   C C    . GLY A 1 325 ? -21.273 -10.727 7.677   1.00 0.00 ? 325 GLY A C    1  
ATOM 4990   O O    . GLY A 1 325 ? -20.606 -10.639 8.715   1.00 0.00 ? 325 GLY A O    1  
ATOM 4991   H H    . GLY A 1 325 ? -20.604 -7.697  6.902   1.00 0.00 ? 325 GLY A H    1  
ATOM 4992   H HA2  . GLY A 1 325 ? -22.427 -8.950  7.522   1.00 0.00 ? 325 GLY A HA2  1  
ATOM 4993   H HA3  . GLY A 1 325 ? -22.192 -9.804  6.001   1.00 0.00 ? 325 GLY A HA3  1  
ATOM 4994   N N    . SER A 1 326 ? -21.599 -11.884 7.126   1.00 0.00 ? 326 SER A N    1  
ATOM 4995   C CA   . SER A 1 326 ? -21.328 -13.136 7.802   1.00 0.00 ? 326 SER A CA   1  
ATOM 4996   C C    . SER A 1 326 ? -19.856 -13.465 7.677   1.00 0.00 ? 326 SER A C    1  
ATOM 4997   O O    . SER A 1 326 ? -19.337 -14.295 8.421   1.00 0.00 ? 326 SER A O    1  
ATOM 4998   C CB   . SER A 1 326 ? -22.157 -14.243 7.148   1.00 0.00 ? 326 SER A CB   1  
ATOM 4999   O OG   . SER A 1 326 ? -21.691 -14.512 5.809   1.00 0.00 ? 326 SER A OG   1  
ATOM 5000   H H    . SER A 1 326 ? -22.095 -11.891 6.281   1.00 0.00 ? 326 SER A H    1  
ATOM 5001   H HA   . SER A 1 326 ? -21.596 -13.054 8.844   1.00 0.00 ? 326 SER A HA   1  
ATOM 5002   H HB2  . SER A 1 326 ? -22.074 -15.144 7.733   1.00 0.00 ? 326 SER A HB2  1  
ATOM 5003   H HB3  . SER A 1 326 ? -23.195 -13.937 7.119   1.00 0.00 ? 326 SER A HB3  1  
ATOM 5004   H HG   . SER A 1 326 ? -21.099 -15.267 5.848   1.00 0.00 ? 326 SER A HG   1  
ATOM 5005   N N    . GLN A 1 327 ? -19.183 -12.820 6.725   1.00 0.00 ? 327 GLN A N    1  
ATOM 5006   C CA   . GLN A 1 327 ? -17.832 -13.233 6.329   1.00 0.00 ? 327 GLN A CA   1  
ATOM 5007   C C    . GLN A 1 327 ? -16.717 -12.867 7.310   1.00 0.00 ? 327 GLN A C    1  
ATOM 5008   O O    . GLN A 1 327 ? -16.790 -11.878 8.024   1.00 0.00 ? 327 GLN A O    1  
ATOM 5009   C CB   . GLN A 1 327 ? -17.490 -12.670 4.963   1.00 0.00 ? 327 GLN A CB   1  
ATOM 5010   C CG   . GLN A 1 327 ? -18.257 -13.257 3.807   1.00 0.00 ? 327 GLN A CG   1  
ATOM 5011   C CD   . GLN A 1 327 ? -17.969 -12.497 2.538   1.00 0.00 ? 327 GLN A CD   1  
ATOM 5012   O OE1  . GLN A 1 327 ? -16.975 -12.745 1.871   1.00 0.00 ? 327 GLN A OE1  1  
ATOM 5013   N NE2  . GLN A 1 327 ? -18.833 -11.538 2.203   1.00 0.00 ? 327 GLN A NE2  1  
ATOM 5014   H H    . GLN A 1 327 ? -19.661 -12.174 6.164   1.00 0.00 ? 327 GLN A H    1  
ATOM 5015   H HA   . GLN A 1 327 ? -17.839 -14.308 6.237   1.00 0.00 ? 327 GLN A HA   1  
ATOM 5016   H HB2  . GLN A 1 327 ? -17.674 -11.608 4.979   1.00 0.00 ? 327 GLN A HB2  1  
ATOM 5017   H HB3  . GLN A 1 327 ? -16.433 -12.826 4.791   1.00 0.00 ? 327 GLN A HB3  1  
ATOM 5018   H HG2  . GLN A 1 327 ? -17.968 -14.290 3.676   1.00 0.00 ? 327 GLN A HG2  1  
ATOM 5019   H HG3  . GLN A 1 327 ? -19.314 -13.207 4.020   1.00 0.00 ? 327 GLN A HG3  1  
ATOM 5020   H HE21 . GLN A 1 327 ? -19.609 -11.357 2.773   1.00 0.00 ? 327 GLN A HE21 1  
ATOM 5021   H HE22 . GLN A 1 327 ? -18.691 -11.014 1.387   1.00 0.00 ? 327 GLN A HE22 1  
ATOM 5022   N N    . ALA A 1 328 ? -15.679 -13.688 7.314   1.00 0.00 ? 328 ALA A N    1  
ATOM 5023   C CA   . ALA A 1 328 ? -14.520 -13.554 8.200   1.00 0.00 ? 328 ALA A CA   1  
ATOM 5024   C C    . ALA A 1 328 ? -13.512 -12.573 7.609   1.00 0.00 ? 328 ALA A C    1  
ATOM 5025   O O    . ALA A 1 328 ? -13.179 -12.662 6.443   1.00 0.00 ? 328 ALA A O    1  
ATOM 5026   C CB   . ALA A 1 328 ? -13.848 -14.942 8.402   1.00 0.00 ? 328 ALA A CB   1  
ATOM 5027   H H    . ALA A 1 328 ? -15.699 -14.453 6.701   1.00 0.00 ? 328 ALA A H    1  
ATOM 5028   H HA   . ALA A 1 328 ? -14.851 -13.184 9.159   1.00 0.00 ? 328 ALA A HA   1  
ATOM 5029   H HB1  . ALA A 1 328 ? -13.370 -14.973 9.370   1.00 0.00 ? 328 ALA A HB1  1  
ATOM 5030   H HB2  . ALA A 1 328 ? -13.108 -15.100 7.631   1.00 0.00 ? 328 ALA A HB2  1  
ATOM 5031   H HB3  . ALA A 1 328 ? -14.598 -15.717 8.345   1.00 0.00 ? 328 ALA A HB3  1  
ATOM 5032   N N    . VAL A 1 329 ? -12.996 -11.666 8.417   1.00 0.00 ? 329 VAL A N    1  
ATOM 5033   C CA   . VAL A 1 329 ? -11.912 -10.807 7.968   1.00 0.00 ? 329 VAL A CA   1  
ATOM 5034   C C    . VAL A 1 329 ? -10.610 -11.143 8.712   1.00 0.00 ? 329 VAL A C    1  
ATOM 5035   O O    . VAL A 1 329 ? -10.610 -11.316 9.914   1.00 0.00 ? 329 VAL A O    1  
ATOM 5036   C CB   . VAL A 1 329 ? -12.304 -9.333  8.091   1.00 0.00 ? 329 VAL A CB   1  
ATOM 5037   C CG1  . VAL A 1 329 ? -11.200 -8.448  7.705   1.00 0.00 ? 329 VAL A CG1  1  
ATOM 5038   C CG2  . VAL A 1 329 ? -13.469 -9.049  7.202   1.00 0.00 ? 329 VAL A CG2  1  
ATOM 5039   H H    . VAL A 1 329 ? -13.269 -11.646 9.358   1.00 0.00 ? 329 VAL A H    1  
ATOM 5040   H HA   . VAL A 1 329 ? -11.747 -11.018 6.920   1.00 0.00 ? 329 VAL A HA   1  
ATOM 5041   H HB   . VAL A 1 329 ? -12.584 -9.125  9.113   1.00 0.00 ? 329 VAL A HB   1  
ATOM 5042   H HG11 . VAL A 1 329 ? -10.291 -8.772  8.191   1.00 0.00 ? 329 VAL A HG11 1  
ATOM 5043   H HG12 . VAL A 1 329 ? -11.429 -7.435  8.007   1.00 0.00 ? 329 VAL A HG12 1  
ATOM 5044   H HG13 . VAL A 1 329 ? -11.066 -8.483  6.635   1.00 0.00 ? 329 VAL A HG13 1  
ATOM 5045   H HG21 . VAL A 1 329 ? -13.156 -8.405  6.392   1.00 0.00 ? 329 VAL A HG21 1  
ATOM 5046   H HG22 . VAL A 1 329 ? -14.245 -8.560  7.771   1.00 0.00 ? 329 VAL A HG22 1  
ATOM 5047   H HG23 . VAL A 1 329 ? -13.848 -9.975  6.797   1.00 0.00 ? 329 VAL A HG23 1  
ATOM 5048   N N    . ILE A 1 330 ? -9.517  -11.305 7.982   1.00 0.00 ? 330 ILE A N    1  
ATOM 5049   C CA   . ILE A 1 330 ? -8.233  -11.527 8.619   1.00 0.00 ? 330 ILE A CA   1  
ATOM 5050   C C    . ILE A 1 330 ? -7.543  -10.168 8.708   1.00 0.00 ? 330 ILE A C    1  
ATOM 5051   O O    . ILE A 1 330 ? -7.001  -9.657  7.733   1.00 0.00 ? 330 ILE A O    1  
ATOM 5052   C CB   . ILE A 1 330 ? -7.347  -12.605 7.933   1.00 0.00 ? 330 ILE A CB   1  
ATOM 5053   C CG1  . ILE A 1 330 ? -8.072  -13.951 7.828   1.00 0.00 ? 330 ILE A CG1  1  
ATOM 5054   C CG2  . ILE A 1 330 ? -6.134  -12.863 8.758   1.00 0.00 ? 330 ILE A CG2  1  
ATOM 5055   C CD1  . ILE A 1 330 ? -7.347  -14.994 6.929   1.00 0.00 ? 330 ILE A CD1  1  
ATOM 5056   H H    . ILE A 1 330 ? -9.565  -11.209 7.008   1.00 0.00 ? 330 ILE A H    1  
ATOM 5057   H HA   . ILE A 1 330 ? -8.431  -11.853 9.634   1.00 0.00 ? 330 ILE A HA   1  
ATOM 5058   H HB   . ILE A 1 330 ? -7.056  -12.269 6.949   1.00 0.00 ? 330 ILE A HB   1  
ATOM 5059   H HG12 . ILE A 1 330 ? -8.172  -14.366 8.819   1.00 0.00 ? 330 ILE A HG12 1  
ATOM 5060   H HG13 . ILE A 1 330 ? -9.061  -13.776 7.427   1.00 0.00 ? 330 ILE A HG13 1  
ATOM 5061   H HG21 . ILE A 1 330 ? -5.495  -13.569 8.248   1.00 0.00 ? 330 ILE A HG21 1  
ATOM 5062   H HG22 . ILE A 1 330 ? -6.430  -13.269 9.715   1.00 0.00 ? 330 ILE A HG22 1  
ATOM 5063   H HG23 . ILE A 1 330 ? -5.598  -11.938 8.909   1.00 0.00 ? 330 ILE A HG23 1  
ATOM 5064   H HD11 . ILE A 1 330 ? -6.851  -14.485 6.116   1.00 0.00 ? 330 ILE A HD11 1  
ATOM 5065   H HD12 . ILE A 1 330 ? -8.071  -15.690 6.530   1.00 0.00 ? 330 ILE A HD12 1  
ATOM 5066   H HD13 . ILE A 1 330 ? -6.618  -15.531 7.519   1.00 0.00 ? 330 ILE A HD13 1  
ATOM 5067   N N    . VAL A 1 331 ? -7.609  -9.586  9.902   1.00 0.00 ? 331 VAL A N    1  
ATOM 5068   C CA   . VAL A 1 331 ? -7.114  -8.259  10.153  1.00 0.00 ? 331 VAL A CA   1  
ATOM 5069   C C    . VAL A 1 331 ? -5.649  -8.419  10.471  1.00 0.00 ? 331 VAL A C    1  
ATOM 5070   O O    . VAL A 1 331 ? -5.299  -9.057  11.453  1.00 0.00 ? 331 VAL A O    1  
ATOM 5071   C CB   . VAL A 1 331 ? -7.806  -7.621  11.359  1.00 0.00 ? 331 VAL A CB   1  
ATOM 5072   C CG1  . VAL A 1 331 ? -7.376  -6.213  11.497  1.00 0.00 ? 331 VAL A CG1  1  
ATOM 5073   C CG2  . VAL A 1 331 ? -9.336  -7.660  11.221  1.00 0.00 ? 331 VAL A CG2  1  
ATOM 5074   H H    . VAL A 1 331 ? -8.079  -10.053 10.624  1.00 0.00 ? 331 VAL A H    1  
ATOM 5075   H HA   . VAL A 1 331 ? -7.241  -7.640  9.277   1.00 0.00 ? 331 VAL A HA   1  
ATOM 5076   H HB   . VAL A 1 331 ? -7.521  -8.161  12.250  1.00 0.00 ? 331 VAL A HB   1  
ATOM 5077   H HG11 . VAL A 1 331 ? -6.845  -5.910  10.608  1.00 0.00 ? 331 VAL A HG11 1  
ATOM 5078   H HG12 . VAL A 1 331 ? -6.726  -6.118  12.356  1.00 0.00 ? 331 VAL A HG12 1  
ATOM 5079   H HG13 . VAL A 1 331 ? -8.242  -5.582  11.630  1.00 0.00 ? 331 VAL A HG13 1  
ATOM 5080   H HG21 . VAL A 1 331 ? -9.599  -7.962  10.218  1.00 0.00 ? 331 VAL A HG21 1  
ATOM 5081   H HG22 . VAL A 1 331 ? -9.740  -6.678  11.419  1.00 0.00 ? 331 VAL A HG22 1  
ATOM 5082   H HG23 . VAL A 1 331 ? -9.743  -8.366  11.929  1.00 0.00 ? 331 VAL A HG23 1  
ATOM 5083   N N    . ARG A 1 332 ? -4.775  -7.884  9.617   1.00 0.00 ? 332 ARG A N    1  
ATOM 5084   C CA   . ARG A 1 332 ? -3.354  -7.972  9.925   1.00 0.00 ? 332 ARG A CA   1  
ATOM 5085   C C    . ARG A 1 332 ? -3.003  -6.733  10.698  1.00 0.00 ? 332 ARG A C    1  
ATOM 5086   O O    . ARG A 1 332 ? -3.409  -5.621  10.353  1.00 0.00 ? 332 ARG A O    1  
ATOM 5087   C CB   . ARG A 1 332 ? -2.493  -8.103  8.655   1.00 0.00 ? 332 ARG A CB   1  
ATOM 5088   C CG   . ARG A 1 332 ? -1.049  -8.502  8.906   1.00 0.00 ? 332 ARG A CG   1  
ATOM 5089   C CD   . ARG A 1 332 ? -0.294  -8.756  7.611   1.00 0.00 ? 332 ARG A CD   1  
ATOM 5090   N NE   . ARG A 1 332 ? -0.076  -7.509  6.886   1.00 0.00 ? 332 ARG A NE   1  
ATOM 5091   C CZ   . ARG A 1 332 ? 0.514   -7.407  5.695   1.00 0.00 ? 332 ARG A CZ   1  
ATOM 5092   N NH1  . ARG A 1 332 ? 0.945   -8.498  5.061   1.00 0.00 ? 332 ARG A NH1  1  
ATOM 5093   N NH2  . ARG A 1 332 ? 0.655   -6.201  5.137   1.00 0.00 ? 332 ARG A NH2  1  
ATOM 5094   H H    . ARG A 1 332 ? -5.084  -7.408  8.818   1.00 0.00 ? 332 ARG A H    1  
ATOM 5095   H HA   . ARG A 1 332 ? -3.188  -8.835  10.556  1.00 0.00 ? 332 ARG A HA   1  
ATOM 5096   H HB2  . ARG A 1 332 ? -2.940  -8.846  8.014   1.00 0.00 ? 332 ARG A HB2  1  
ATOM 5097   H HB3  . ARG A 1 332 ? -2.506  -7.153  8.136   1.00 0.00 ? 332 ARG A HB3  1  
ATOM 5098   H HG2  . ARG A 1 332 ? -0.556  -7.709  9.449   1.00 0.00 ? 332 ARG A HG2  1  
ATOM 5099   H HG3  . ARG A 1 332 ? -1.034  -9.400  9.506   1.00 0.00 ? 332 ARG A HG3  1  
ATOM 5100   H HD2  . ARG A 1 332 ? 0.661   -9.204  7.838   1.00 0.00 ? 332 ARG A HD2  1  
ATOM 5101   H HD3  . ARG A 1 332 ? -0.867  -9.434  6.994   1.00 0.00 ? 332 ARG A HD3  1  
ATOM 5102   H HE   . ARG A 1 332 ? -0.387  -6.681  7.308   1.00 0.00 ? 332 ARG A HE   1  
ATOM 5103   H HH11 . ARG A 1 332 ? 0.826   -9.399  5.479   1.00 0.00 ? 332 ARG A HH11 1  
ATOM 5104   H HH12 . ARG A 1 332 ? 1.387   -8.416  4.168   1.00 0.00 ? 332 ARG A HH12 1  
ATOM 5105   H HH21 . ARG A 1 332 ? 0.320   -5.387  5.613   1.00 0.00 ? 332 ARG A HH21 1  
ATOM 5106   H HH22 . ARG A 1 332 ? 1.096   -6.111  4.244   1.00 0.00 ? 332 ARG A HH22 1  
ATOM 5107   N N    . THR A 1 333 ? -2.257  -6.927  11.765  1.00 0.00 ? 333 THR A N    1  
ATOM 5108   C CA   . THR A 1 333 ? -1.725  -5.778  12.473  1.00 0.00 ? 333 THR A CA   1  
ATOM 5109   C C    . THR A 1 333 ? -0.742  -5.116  11.544  1.00 0.00 ? 333 THR A C    1  
ATOM 5110   O O    . THR A 1 333 ? -0.301  -5.703  10.527  1.00 0.00 ? 333 THR A O    1  
ATOM 5111   C CB   . THR A 1 333 ? -1.127  -6.165  13.791  1.00 0.00 ? 333 THR A CB   1  
ATOM 5112   O OG1  . THR A 1 333 ? -0.000  -7.008  13.562  1.00 0.00 ? 333 THR A OG1  1  
ATOM 5113   C CG2  . THR A 1 333 ? -2.178  -6.912  14.633  1.00 0.00 ? 333 THR A CG2  1  
ATOM 5114   H H    . THR A 1 333 ? -1.969  -7.832  12.007  1.00 0.00 ? 333 THR A H    1  
ATOM 5115   H HA   . THR A 1 333 ? -2.539  -5.086  12.650  1.00 0.00 ? 333 THR A HA   1  
ATOM 5116   H HB   . THR A 1 333 ? -0.814  -5.279  14.320  1.00 0.00 ? 333 THR A HB   1  
ATOM 5117   H HG1  . THR A 1 333 ? 0.593   -6.921  14.313  1.00 0.00 ? 333 THR A HG1  1  
ATOM 5118   H HG21 . THR A 1 333 ? -2.547  -7.762  14.078  1.00 0.00 ? 333 THR A HG21 1  
ATOM 5119   H HG22 . THR A 1 333 ? -2.997  -6.246  14.859  1.00 0.00 ? 333 THR A HG22 1  
ATOM 5120   H HG23 . THR A 1 333 ? -1.725  -7.252  15.553  1.00 0.00 ? 333 THR A HG23 1  
ATOM 5121   N N    . MET A 1 334 ? -0.449  -3.877  11.888  1.00 0.00 ? 334 MET A N    1  
ATOM 5122   C CA   . MET A 1 334 ? 0.089   -2.877  10.996  1.00 0.00 ? 334 MET A CA   1  
ATOM 5123   C C    . MET A 1 334 ? 1.484   -3.180  10.462  1.00 0.00 ? 334 MET A C    1  
ATOM 5124   O O    . MET A 1 334 ? 2.367   -3.664  11.182  1.00 0.00 ? 334 MET A O    1  
ATOM 5125   C CB   . MET A 1 334 ? 0.012   -1.558  11.732  1.00 0.00 ? 334 MET A CB   1  
ATOM 5126   C CG   . MET A 1 334 ? 1.286   -0.896  12.076  1.00 0.00 ? 334 MET A CG   1  
ATOM 5127   S SD   . MET A 1 334 ? 2.112   -1.967  13.491  1.00 0.00 ? 334 MET A SD   1  
ATOM 5128   C CE   . MET A 1 334 ? 3.555   -0.722  13.737  1.00 0.00 ? 334 MET A CE   1  
ATOM 5129   H H    . MET A 1 334 ? -0.881  -3.540  12.701  1.00 0.00 ? 334 MET A H    1  
ATOM 5130   H HA   . MET A 1 334 ? -0.573  -2.808  10.147  1.00 0.00 ? 334 MET A HA   1  
ATOM 5131   H HB2  . MET A 1 334 ? -0.554  -0.873  11.124  1.00 0.00 ? 334 MET A HB2  1  
ATOM 5132   H HB3  . MET A 1 334 ? -0.544  -1.724  12.647  1.00 0.00 ? 334 MET A HB3  1  
ATOM 5133   H HG2  . MET A 1 334 ? 1.929   -0.859  11.205  1.00 0.00 ? 334 MET A HG2  1  
ATOM 5134   H HG3  . MET A 1 334 ? 1.099   0.100   12.444  1.00 0.00 ? 334 MET A HG3  1  
ATOM 5135   H HE1  . MET A 1 334 ? 4.048   -0.926  14.678  1.00 0.00 ? 334 MET A HE1  1  
ATOM 5136   H HE2  . MET A 1 334 ? 3.167   0.283   13.750  1.00 0.00 ? 334 MET A HE2  1  
ATOM 5137   H HE3  . MET A 1 334 ? 4.259   -0.824  12.922  1.00 0.00 ? 334 MET A HE3  1  
ATOM 5138   N N    . ASP A 1 335 ? 1.669   -2.923  9.172   1.00 0.00 ? 335 ASP A N    1  
ATOM 5139   C CA   . ASP A 1 335 ? 2.936   -3.176  8.524   1.00 0.00 ? 335 ASP A CA   1  
ATOM 5140   C C    . ASP A 1 335 ? 3.418   -1.922  7.799   1.00 0.00 ? 335 ASP A C    1  
ATOM 5141   O O    . ASP A 1 335 ? 3.258   -1.749  6.594   1.00 0.00 ? 335 ASP A O    1  
ATOM 5142   C CB   . ASP A 1 335 ? 2.851   -4.361  7.572   1.00 0.00 ? 335 ASP A CB   1  
ATOM 5143   C CG   . ASP A 1 335 ? 4.171   -4.660  6.924   1.00 0.00 ? 335 ASP A CG   1  
ATOM 5144   O OD1  . ASP A 1 335 ? 5.136   -3.854  7.094   1.00 0.00 ? 335 ASP A OD1  1  
ATOM 5145   O OD2  . ASP A 1 335 ? 4.244   -5.692  6.226   1.00 0.00 ? 335 ASP A OD2  1  
ATOM 5146   H H    . ASP A 1 335 ? 0.925   -2.563  8.645   1.00 0.00 ? 335 ASP A H    1  
ATOM 5147   H HA   . ASP A 1 335 ? 3.659   -3.413  9.292   1.00 0.00 ? 335 ASP A HA   1  
ATOM 5148   H HB2  . ASP A 1 335 ? 2.528   -5.231  8.122   1.00 0.00 ? 335 ASP A HB2  1  
ATOM 5149   H HB3  . ASP A 1 335 ? 2.121   -4.142  6.805   1.00 0.00 ? 335 ASP A HB3  1  
ATOM 5150   N N    . ILE A 1 336 ? 4.034   -1.052  8.572   1.00 0.00 ? 336 ILE A N    1  
ATOM 5151   C CA   . ILE A 1 336 ? 4.680   0.107   8.062   1.00 0.00 ? 336 ILE A CA   1  
ATOM 5152   C C    . ILE A 1 336 ? 6.188   -0.149  7.987   1.00 0.00 ? 336 ILE A C    1  
ATOM 5153   O O    . ILE A 1 336 ? 6.724   -0.909  8.778   1.00 0.00 ? 336 ILE A O    1  
ATOM 5154   C CB   . ILE A 1 336 ? 4.238   1.318   8.931   1.00 0.00 ? 336 ILE A CB   1  
ATOM 5155   C CG1  . ILE A 1 336 ? 2.940   1.869   8.358   1.00 0.00 ? 336 ILE A CG1  1  
ATOM 5156   C CG2  . ILE A 1 336 ? 5.256   2.434   8.964   1.00 0.00 ? 336 ILE A CG2  1  
ATOM 5157   C CD1  . ILE A 1 336 ? 1.765   1.042   8.664   1.00 0.00 ? 336 ILE A CD1  1  
ATOM 5158   H H    . ILE A 1 336 ? 4.134   -1.262  9.524   1.00 0.00 ? 336 ILE A H    1  
ATOM 5159   H HA   . ILE A 1 336 ? 4.323   0.270   7.055   1.00 0.00 ? 336 ILE A HA   1  
ATOM 5160   H HB   . ILE A 1 336 ? 4.055   0.979   9.940   1.00 0.00 ? 336 ILE A HB   1  
ATOM 5161   H HG12 . ILE A 1 336 ? 2.776   2.856   8.760   1.00 0.00 ? 336 ILE A HG12 1  
ATOM 5162   H HG13 . ILE A 1 336 ? 3.044   1.949   7.284   1.00 0.00 ? 336 ILE A HG13 1  
ATOM 5163   H HG21 . ILE A 1 336 ? 4.968   3.162   9.708   1.00 0.00 ? 336 ILE A HG21 1  
ATOM 5164   H HG22 . ILE A 1 336 ? 5.301   2.907   7.994   1.00 0.00 ? 336 ILE A HG22 1  
ATOM 5165   H HG23 . ILE A 1 336 ? 6.226   2.029   9.213   1.00 0.00 ? 336 ILE A HG23 1  
ATOM 5166   H HD11 . ILE A 1 336 ? 1.722   0.856   9.726   1.00 0.00 ? 336 ILE A HD11 1  
ATOM 5167   H HD12 . ILE A 1 336 ? 1.841   0.101   8.136   1.00 0.00 ? 336 ILE A HD12 1  
ATOM 5168   H HD13 . ILE A 1 336 ? 0.869   1.558   8.354   1.00 0.00 ? 336 ILE A HD13 1  
ATOM 5169   N N    . GLY A 1 337 ? 6.845   0.395   6.971   1.00 0.00 ? 337 GLY A N    1  
ATOM 5170   C CA   . GLY A 1 337 ? 8.283   0.525   7.020   1.00 0.00 ? 337 GLY A CA   1  
ATOM 5171   C C    . GLY A 1 337 ? 9.183   -0.133  5.982   1.00 0.00 ? 337 GLY A C    1  
ATOM 5172   O O    . GLY A 1 337 ? 10.451  -0.211  6.167   1.00 0.00 ? 337 GLY A O    1  
ATOM 5173   H H    . GLY A 1 337 ? 6.346   0.927   6.317   1.00 0.00 ? 337 GLY A H    1  
ATOM 5174   H HA2  . GLY A 1 337 ? 8.503   1.578   6.989   1.00 0.00 ? 337 GLY A HA2  1  
ATOM 5175   H HA3  . GLY A 1 337 ? 8.594   0.166   7.994   1.00 0.00 ? 337 GLY A HA3  1  
ATOM 5176   N N    . GLY A 1 338 ? 8.607   -0.616  4.899   1.00 0.00 ? 338 GLY A N    1  
ATOM 5177   C CA   . GLY A 1 338 ? 9.497   -1.027  3.825   1.00 0.00 ? 338 GLY A CA   1  
ATOM 5178   C C    . GLY A 1 338 ? 9.238   0.057   2.827   1.00 0.00 ? 338 GLY A C    1  
ATOM 5179   O O    . GLY A 1 338 ? 9.514   1.220   3.067   1.00 0.00 ? 338 GLY A O    1  
ATOM 5180   H H    . GLY A 1 338 ? 7.638   -0.552  4.764   1.00 0.00 ? 338 GLY A H    1  
ATOM 5181   H HA2  . GLY A 1 338 ? 10.529  -1.026  4.156   1.00 0.00 ? 338 GLY A HA2  1  
ATOM 5182   H HA3  . GLY A 1 338 ? 9.211   -1.984  3.421   1.00 0.00 ? 338 GLY A HA3  1  
ATOM 5183   N N    . ASP A 1 339 ? 8.641   -0.304  1.712   1.00 0.00 ? 339 ASP A N    1  
ATOM 5184   C CA   . ASP A 1 339 ? 8.166   0.725   0.816   1.00 0.00 ? 339 ASP A CA   1  
ATOM 5185   C C    . ASP A 1 339 ? 6.882   1.383   1.335   1.00 0.00 ? 339 ASP A C    1  
ATOM 5186   O O    . ASP A 1 339 ? 6.322   2.213   0.648   1.00 0.00 ? 339 ASP A O    1  
ATOM 5187   C CB   . ASP A 1 339 ? 7.950   0.144   -0.565  1.00 0.00 ? 339 ASP A CB   1  
ATOM 5188   C CG   . ASP A 1 339 ? 6.818   -0.840  -0.598  1.00 0.00 ? 339 ASP A CG   1  
ATOM 5189   O OD1  . ASP A 1 339 ? 6.166   -1.023  0.458   1.00 0.00 ? 339 ASP A OD1  1  
ATOM 5190   O OD2  . ASP A 1 339 ? 6.569   -1.427  -1.683  1.00 0.00 ? 339 ASP A OD2  1  
ATOM 5191   H H    . ASP A 1 339 ? 8.389   -1.240  1.567   1.00 0.00 ? 339 ASP A H    1  
ATOM 5192   H HA   . ASP A 1 339 ? 8.929   1.487   0.745   1.00 0.00 ? 339 ASP A HA   1  
ATOM 5193   H HB2  . ASP A 1 339 ? 7.733   0.947   -1.253  1.00 0.00 ? 339 ASP A HB2  1  
ATOM 5194   H HB3  . ASP A 1 339 ? 8.857   -0.352  -0.881  1.00 0.00 ? 339 ASP A HB3  1  
ATOM 5195   N N    . LYS A 1 340 ? 6.384   1.005   2.512   1.00 0.00 ? 340 LYS A N    1  
ATOM 5196   C CA   . LYS A 1 340 ? 5.215   1.722   3.039   1.00 0.00 ? 340 LYS A CA   1  
ATOM 5197   C C    . LYS A 1 340 ? 5.430   2.514   4.327   1.00 0.00 ? 340 LYS A C    1  
ATOM 5198   O O    . LYS A 1 340 ? 5.137   2.089   5.449   1.00 0.00 ? 340 LYS A O    1  
ATOM 5199   C CB   . LYS A 1 340 ? 3.886   0.961   3.004   1.00 0.00 ? 340 LYS A CB   1  
ATOM 5200   C CG   . LYS A 1 340 ? 3.916   -0.479  3.233   1.00 0.00 ? 340 LYS A CG   1  
ATOM 5201   C CD   . LYS A 1 340 ? 2.518   -0.972  3.156   1.00 0.00 ? 340 LYS A CD   1  
ATOM 5202   C CE   . LYS A 1 340 ? 2.430   -2.490  3.218   1.00 0.00 ? 340 LYS A CE   1  
ATOM 5203   N NZ   . LYS A 1 340 ? 2.893   -3.136  4.446   1.00 0.00 ? 340 LYS A NZ   1  
ATOM 5204   H H    . LYS A 1 340 ? 6.830   0.314   3.046   1.00 0.00 ? 340 LYS A H    1  
ATOM 5205   H HA   . LYS A 1 340 ? 5.079   2.508   2.304   1.00 0.00 ? 340 LYS A HA   1  
ATOM 5206   H HB2  . LYS A 1 340 ? 3.241   1.389   3.752   1.00 0.00 ? 340 LYS A HB2  1  
ATOM 5207   H HB3  . LYS A 1 340 ? 3.432   1.144   2.038   1.00 0.00 ? 340 LYS A HB3  1  
ATOM 5208   H HG2  . LYS A 1 340 ? 4.520   -0.959  2.475   1.00 0.00 ? 340 LYS A HG2  1  
ATOM 5209   H HG3  . LYS A 1 340 ? 4.319   -0.688  4.212   1.00 0.00 ? 340 LYS A HG3  1  
ATOM 5210   H HD2  . LYS A 1 340 ? 1.956   -0.556  3.979   1.00 0.00 ? 340 LYS A HD2  1  
ATOM 5211   H HD3  . LYS A 1 340 ? 2.080   -0.634  2.228   1.00 0.00 ? 340 LYS A HD3  1  
ATOM 5212   H HE2  . LYS A 1 340 ? 1.400   -2.769  3.074   1.00 0.00 ? 340 LYS A HE2  1  
ATOM 5213   H HE3  . LYS A 1 340 ? 2.998   -2.888  2.386   1.00 0.00 ? 340 LYS A HE3  1  
ATOM 5214   H HZ1  . LYS A 1 340 ? 2.085   -3.563  4.940   1.00 0.00 ? 340 LYS A HZ1  1  
ATOM 5215   H HZ2  . LYS A 1 340 ? 3.341   -2.427  5.061   1.00 0.00 ? 340 LYS A HZ2  1  
ATOM 5216   H HZ3  . LYS A 1 340 ? 3.582   -3.877  4.210   1.00 0.00 ? 340 LYS A HZ3  1  
ATOM 5217   N N    . GLU A 1 341 ? 5.941   3.707   4.123   1.00 0.00 ? 341 GLU A N    1  
ATOM 5218   C CA   . GLU A 1 341 ? 6.056   4.594   5.203   1.00 0.00 ? 341 GLU A CA   1  
ATOM 5219   C C    . GLU A 1 341 ? 4.725   5.306   5.352   1.00 0.00 ? 341 GLU A C    1  
ATOM 5220   O O    . GLU A 1 341 ? 3.965   5.382   4.389   1.00 0.00 ? 341 GLU A O    1  
ATOM 5221   C CB   . GLU A 1 341 ? 7.247   5.509   4.957   1.00 0.00 ? 341 GLU A CB   1  
ATOM 5222   C CG   . GLU A 1 341 ? 8.557   4.664   5.007   1.00 0.00 ? 341 GLU A CG   1  
ATOM 5223   C CD   . GLU A 1 341 ? 9.822   5.459   4.721   1.00 0.00 ? 341 GLU A CD   1  
ATOM 5224   O OE1  . GLU A 1 341 ? 9.670   6.651   4.336   1.00 0.00 ? 341 GLU A OE1  1  
ATOM 5225   O OE2  . GLU A 1 341 ? 10.948  4.882   4.907   1.00 0.00 ? 341 GLU A OE2  1  
ATOM 5226   H H    . GLU A 1 341 ? 6.144   4.008   3.213   1.00 0.00 ? 341 GLU A H    1  
ATOM 5227   H HA   . GLU A 1 341 ? 6.240   4.020   6.101   1.00 0.00 ? 341 GLU A HA   1  
ATOM 5228   H HB2  . GLU A 1 341 ? 7.151   5.974   3.986   1.00 0.00 ? 341 GLU A HB2  1  
ATOM 5229   H HB3  . GLU A 1 341 ? 7.283   6.270   5.721   1.00 0.00 ? 341 GLU A HB3  1  
ATOM 5230   H HG2  . GLU A 1 341 ? 8.646   4.227   5.989   1.00 0.00 ? 341 GLU A HG2  1  
ATOM 5231   H HG3  . GLU A 1 341 ? 8.476   3.865   4.283   1.00 0.00 ? 341 GLU A HG3  1  
ATOM 5232   N N    . LEU A 1 342 ? 4.401   5.721   6.573   1.00 0.00 ? 342 LEU A N    1  
ATOM 5233   C CA   . LEU A 1 342 ? 3.469   6.821   6.705   1.00 0.00 ? 342 LEU A CA   1  
ATOM 5234   C C    . LEU A 1 342 ? 4.186   8.080   7.180   1.00 0.00 ? 342 LEU A C    1  
ATOM 5235   O O    . LEU A 1 342 ? 4.578   8.197   8.351   1.00 0.00 ? 342 LEU A O    1  
ATOM 5236   C CB   . LEU A 1 342 ? 2.158   6.504   7.478   1.00 0.00 ? 342 LEU A CB   1  
ATOM 5237   C CG   . LEU A 1 342 ? 2.202   5.304   8.385   1.00 0.00 ? 342 LEU A CG   1  
ATOM 5238   C CD1  . LEU A 1 342 ? 3.514   5.303   9.120   1.00 0.00 ? 342 LEU A CD1  1  
ATOM 5239   C CD2  . LEU A 1 342 ? 1.059   5.282   9.327   1.00 0.00 ? 342 LEU A CD2  1  
ATOM 5240   H H    . LEU A 1 342 ? 5.023   5.544   7.310   1.00 0.00 ? 342 LEU A H    1  
ATOM 5241   H HA   . LEU A 1 342 ? 3.163   7.045   5.688   1.00 0.00 ? 342 LEU A HA   1  
ATOM 5242   H HB2  . LEU A 1 342 ? 1.905   7.363   8.078   1.00 0.00 ? 342 LEU A HB2  1  
ATOM 5243   H HB3  . LEU A 1 342 ? 1.368   6.358   6.752   1.00 0.00 ? 342 LEU A HB3  1  
ATOM 5244   H HG   . LEU A 1 342 ? 2.162   4.414   7.768   1.00 0.00 ? 342 LEU A HG   1  
ATOM 5245   H HD11 . LEU A 1 342 ? 4.249   4.760   8.545   1.00 0.00 ? 342 LEU A HD11 1  
ATOM 5246   H HD12 . LEU A 1 342 ? 3.387   4.828   10.083  1.00 0.00 ? 342 LEU A HD12 1  
ATOM 5247   H HD13 . LEU A 1 342 ? 3.848   6.320   9.262   1.00 0.00 ? 342 LEU A HD13 1  
ATOM 5248   H HD21 . LEU A 1 342 ? 0.719   4.273   9.508   1.00 0.00 ? 342 LEU A HD21 1  
ATOM 5249   H HD22 . LEU A 1 342 ? 0.253   5.865   8.904   1.00 0.00 ? 342 LEU A HD22 1  
ATOM 5250   H HD23 . LEU A 1 342 ? 1.374   5.726   10.259  1.00 0.00 ? 342 LEU A HD23 1  
ATOM 5251   N N    . PRO A 1 343 ? 4.316   9.034   6.250   1.00 0.00 ? 343 PRO A N    1  
ATOM 5252   C CA   . PRO A 1 343 ? 4.981   10.321  6.418   1.00 0.00 ? 343 PRO A CA   1  
ATOM 5253   C C    . PRO A 1 343 ? 4.628   10.966  7.757   1.00 0.00 ? 343 PRO A C    1  
ATOM 5254   O O    . PRO A 1 343 ? 5.526   11.443  8.464   1.00 0.00 ? 343 PRO A O    1  
ATOM 5255   C CB   . PRO A 1 343 ? 4.429   11.136  5.239   1.00 0.00 ? 343 PRO A CB   1  
ATOM 5256   C CG   . PRO A 1 343 ? 4.213   10.091  4.159   1.00 0.00 ? 343 PRO A CG   1  
ATOM 5257   C CD   . PRO A 1 343 ? 3.695   8.905   4.908   1.00 0.00 ? 343 PRO A CD   1  
ATOM 5258   H HA   . PRO A 1 343 ? 6.048   10.214  6.317   1.00 0.00 ? 343 PRO A HA   1  
ATOM 5259   H HB2  . PRO A 1 343 ? 3.494   11.610  5.510   1.00 0.00 ? 343 PRO A HB2  1  
ATOM 5260   H HB3  . PRO A 1 343 ? 5.150   11.868  4.909   1.00 0.00 ? 343 PRO A HB3  1  
ATOM 5261   H HG2  . PRO A 1 343 ? 3.485   10.440  3.438   1.00 0.00 ? 343 PRO A HG2  1  
ATOM 5262   H HG3  . PRO A 1 343 ? 5.144   9.848   3.674   1.00 0.00 ? 343 PRO A HG3  1  
ATOM 5263   H HD2  . PRO A 1 343 ? 2.615   8.928   4.980   1.00 0.00 ? 343 PRO A HD2  1  
ATOM 5264   H HD3  . PRO A 1 343 ? 4.028   7.996   4.432   1.00 0.00 ? 343 PRO A HD3  1  
ATOM 5265   N N    . TYR A 1 344 ? 3.358   10.954  8.144   1.00 0.00 ? 344 TYR A N    1  
ATOM 5266   C CA   . TYR A 1 344 ? 3.010   11.558  9.444   1.00 0.00 ? 344 TYR A CA   1  
ATOM 5267   C C    . TYR A 1 344 ? 3.758   11.006  10.666  1.00 0.00 ? 344 TYR A C    1  
ATOM 5268   O O    . TYR A 1 344 ? 3.724   11.622  11.749  1.00 0.00 ? 344 TYR A O    1  
ATOM 5269   C CB   . TYR A 1 344 ? 1.489   11.630  9.708   1.00 0.00 ? 344 TYR A CB   1  
ATOM 5270   C CG   . TYR A 1 344 ? 0.679   10.333  9.770   1.00 0.00 ? 344 TYR A CG   1  
ATOM 5271   C CD1  . TYR A 1 344 ? 0.706   9.502   10.902  1.00 0.00 ? 344 TYR A CD1  1  
ATOM 5272   C CD2  . TYR A 1 344 ? -0.182  9.992   8.720   1.00 0.00 ? 344 TYR A CD2  1  
ATOM 5273   C CE1  . TYR A 1 344 ? -0.076  8.350   10.974  1.00 0.00 ? 344 TYR A CE1  1  
ATOM 5274   C CE2  . TYR A 1 344 ? -0.964  8.847   8.778   1.00 0.00 ? 344 TYR A CE2  1  
ATOM 5275   C CZ   . TYR A 1 344 ? -0.911  8.013   9.901   1.00 0.00 ? 344 TYR A CZ   1  
ATOM 5276   O OH   . TYR A 1 344 ? -1.717  6.868   9.931   1.00 0.00 ? 344 TYR A OH   1  
ATOM 5277   H H    . TYR A 1 344 ? 2.668   10.541  7.583   1.00 0.00 ? 344 TYR A H    1  
ATOM 5278   H HA   . TYR A 1 344 ? 3.336   12.587  9.363   1.00 0.00 ? 344 TYR A HA   1  
ATOM 5279   H HB2  . TYR A 1 344 ? 1.348   12.134  10.648  1.00 0.00 ? 344 TYR A HB2  1  
ATOM 5280   H HB3  . TYR A 1 344 ? 1.059   12.258  8.937   1.00 0.00 ? 344 TYR A HB3  1  
ATOM 5281   H HD1  . TYR A 1 344 ? 1.363   9.748   11.723  1.00 0.00 ? 344 TYR A HD1  1  
ATOM 5282   H HD2  . TYR A 1 344 ? -0.233  10.626  7.847   1.00 0.00 ? 344 TYR A HD2  1  
ATOM 5283   H HE1  . TYR A 1 344 ? -0.042  7.723   11.854  1.00 0.00 ? 344 TYR A HE1  1  
ATOM 5284   H HE2  . TYR A 1 344 ? -1.606  8.591   7.948   1.00 0.00 ? 344 TYR A HE2  1  
ATOM 5285   H HH   . TYR A 1 344 ? -1.683  6.505   10.820  1.00 0.00 ? 344 TYR A HH   1  
ATOM 5286   N N    . MET A 1 345 ? 4.431   9.864   10.506  1.00 0.00 ? 345 MET A N    1  
ATOM 5287   C CA   . MET A 1 345 ? 5.164   9.282   11.629  1.00 0.00 ? 345 MET A CA   1  
ATOM 5288   C C    . MET A 1 345 ? 6.550   9.864   11.729  1.00 0.00 ? 345 MET A C    1  
ATOM 5289   O O    . MET A 1 345 ? 7.200   9.731   12.769  1.00 0.00 ? 345 MET A O    1  
ATOM 5290   C CB   . MET A 1 345 ? 5.281   7.766   11.531  1.00 0.00 ? 345 MET A CB   1  
ATOM 5291   C CG   . MET A 1 345 ? 4.069   7.013   11.922  1.00 0.00 ? 345 MET A CG   1  
ATOM 5292   S SD   . MET A 1 345 ? 3.262   7.324   13.687  1.00 0.00 ? 345 MET A SD   1  
ATOM 5293   C CE   . MET A 1 345 ? 4.858   6.869   15.039  1.00 0.00 ? 345 MET A CE   1  
ATOM 5294   H H    . MET A 1 345 ? 4.433   9.415   9.635   1.00 0.00 ? 345 MET A H    1  
ATOM 5295   H HA   . MET A 1 345 ? 4.631   9.521   12.538  1.00 0.00 ? 345 MET A HA   1  
ATOM 5296   H HB2  . MET A 1 345 ? 5.518   7.509   10.512  1.00 0.00 ? 345 MET A HB2  1  
ATOM 5297   H HB3  . MET A 1 345 ? 6.103   7.450   12.159  1.00 0.00 ? 345 MET A HB3  1  
ATOM 5298   H HG2  . MET A 1 345 ? 3.308   7.224   11.189  1.00 0.00 ? 345 MET A HG2  1  
ATOM 5299   H HG3  . MET A 1 345 ? 4.307   5.961   11.849  1.00 0.00 ? 345 MET A HG3  1  
ATOM 5300   H HE1  . MET A 1 345 ? 5.802   6.929   14.512  1.00 0.00 ? 345 MET A HE1  1  
ATOM 5301   H HE2  . MET A 1 345 ? 4.732   5.875   15.427  1.00 0.00 ? 345 MET A HE2  1  
ATOM 5302   H HE3  . MET A 1 345 ? 4.843   7.576   15.860  1.00 0.00 ? 345 MET A HE3  1  
ATOM 5303   N N    . ASN A 1 346 ? 7.018   10.468  10.639  1.00 0.00 ? 346 ASN A N    1  
ATOM 5304   C CA   . ASN A 1 346 ? 8.344   11.073  10.613  1.00 0.00 ? 346 ASN A CA   1  
ATOM 5305   C C    . ASN A 1 346 ? 9.455   10.151  11.075  1.00 0.00 ? 346 ASN A C    1  
ATOM 5306   O O    . ASN A 1 346 ? 10.468  10.608  11.587  1.00 0.00 ? 346 ASN A O    1  
ATOM 5307   C CB   . ASN A 1 346 ? 8.365   12.373  11.427  1.00 0.00 ? 346 ASN A CB   1  
ATOM 5308   C CG   . ASN A 1 346 ? 7.379   13.415  10.878  1.00 0.00 ? 346 ASN A CG   1  
ATOM 5309   O OD1  . ASN A 1 346 ? 7.292   13.584  9.649   1.00 0.00 ? 346 ASN A OD1  1  
ATOM 5310   N ND2  . ASN A 1 346 ? 6.630   14.117  11.778  1.00 0.00 ? 346 ASN A ND2  1  
ATOM 5311   H H    . ASN A 1 346 ? 6.457   10.509  9.836   1.00 0.00 ? 346 ASN A H    1  
ATOM 5312   H HA   . ASN A 1 346 ? 8.554   11.337  9.587   1.00 0.00 ? 346 ASN A HA   1  
ATOM 5313   H HB2  . ASN A 1 346 ? 8.103   12.149  12.450  1.00 0.00 ? 346 ASN A HB2  1  
ATOM 5314   H HB3  . ASN A 1 346 ? 9.363   12.786  11.402  1.00 0.00 ? 346 ASN A HB3  1  
ATOM 5315   H HD21 . ASN A 1 346 ? 6.731   13.948  12.738  1.00 0.00 ? 346 ASN A HD21 1  
ATOM 5316   H HD22 . ASN A 1 346 ? 5.990   14.790  11.464  1.00 0.00 ? 346 ASN A HD22 1  
ATOM 5317   N N    . PHE A 1 347 ? 9.280   8.853   10.894  1.00 0.00 ? 347 PHE A N    1  
ATOM 5318   C CA   . PHE A 1 347 ? 10.324  7.930   11.258  1.00 0.00 ? 347 PHE A CA   1  
ATOM 5319   C C    . PHE A 1 347 ? 11.596  8.335   10.544  1.00 0.00 ? 347 PHE A C    1  
ATOM 5320   O O    . PHE A 1 347 ? 11.538  9.020   9.521   1.00 0.00 ? 347 PHE A O    1  
ATOM 5321   C CB   . PHE A 1 347 ? 9.912   6.491   10.929  1.00 0.00 ? 347 PHE A CB   1  
ATOM 5322   C CG   . PHE A 1 347 ? 9.008   5.878   11.977  1.00 0.00 ? 347 PHE A CG   1  
ATOM 5323   C CD1  . PHE A 1 347 ? 9.418   5.809   13.316  1.00 0.00 ? 347 PHE A CD1  1  
ATOM 5324   C CD2  . PHE A 1 347 ? 7.760   5.389   11.649  1.00 0.00 ? 347 PHE A CD2  1  
ATOM 5325   C CE1  . PHE A 1 347 ? 8.587   5.258   14.281  1.00 0.00 ? 347 PHE A CE1  1  
ATOM 5326   C CE2  . PHE A 1 347 ? 6.936   4.837   12.625  1.00 0.00 ? 347 PHE A CE2  1  
ATOM 5327   C CZ   . PHE A 1 347 ? 7.347   4.771   13.934  1.00 0.00 ? 347 PHE A CZ   1  
ATOM 5328   H H    . PHE A 1 347 ? 8.457   8.523   10.476  1.00 0.00 ? 347 PHE A H    1  
ATOM 5329   H HA   . PHE A 1 347 ? 10.491  8.006   12.323  1.00 0.00 ? 347 PHE A HA   1  
ATOM 5330   H HB2  . PHE A 1 347 ? 9.394   6.486   9.983   1.00 0.00 ? 347 PHE A HB2  1  
ATOM 5331   H HB3  . PHE A 1 347 ? 10.804  5.887   10.840  1.00 0.00 ? 347 PHE A HB3  1  
ATOM 5332   H HD1  . PHE A 1 347 ? 10.389  6.188   13.599  1.00 0.00 ? 347 PHE A HD1  1  
ATOM 5333   H HD2  . PHE A 1 347 ? 7.422   5.432   10.624  1.00 0.00 ? 347 PHE A HD2  1  
ATOM 5334   H HE1  . PHE A 1 347 ? 8.916   5.209   15.308  1.00 0.00 ? 347 PHE A HE1  1  
ATOM 5335   H HE2  . PHE A 1 347 ? 5.962   4.458   12.351  1.00 0.00 ? 347 PHE A HE2  1  
ATOM 5336   H HZ   . PHE A 1 347 ? 6.702   4.340   14.686  1.00 0.00 ? 347 PHE A HZ   1  
ATOM 5337   N N    . PRO A 1 348 ? 12.756  7.982   11.115  1.00 0.00 ? 348 PRO A N    1  
ATOM 5338   C CA   . PRO A 1 348 ? 14.012  8.293   10.433  1.00 0.00 ? 348 PRO A CA   1  
ATOM 5339   C C    . PRO A 1 348 ? 14.266  7.369   9.248   1.00 0.00 ? 348 PRO A C    1  
ATOM 5340   O O    . PRO A 1 348 ? 13.700  6.269   9.181   1.00 0.00 ? 348 PRO A O    1  
ATOM 5341   C CB   . PRO A 1 348 ? 15.060  8.077   11.509  1.00 0.00 ? 348 PRO A CB   1  
ATOM 5342   C CG   . PRO A 1 348 ? 14.445  7.080   12.480  1.00 0.00 ? 348 PRO A CG   1  
ATOM 5343   C CD   . PRO A 1 348 ? 12.940  7.320   12.423  1.00 0.00 ? 348 PRO A CD   1  
ATOM 5344   H HA   . PRO A 1 348 ? 14.026  9.323   10.118  1.00 0.00 ? 348 PRO A HA   1  
ATOM 5345   H HB2  . PRO A 1 348 ? 15.964  7.672   11.073  1.00 0.00 ? 348 PRO A HB2  1  
ATOM 5346   H HB3  . PRO A 1 348 ? 15.270  9.004   12.020  1.00 0.00 ? 348 PRO A HB3  1  
ATOM 5347   H HG2  . PRO A 1 348 ? 14.690  6.073   12.174  1.00 0.00 ? 348 PRO A HG2  1  
ATOM 5348   H HG3  . PRO A 1 348 ? 14.817  7.262   13.477  1.00 0.00 ? 348 PRO A HG3  1  
ATOM 5349   H HD2  . PRO A 1 348 ? 12.401  6.383   12.459  1.00 0.00 ? 348 PRO A HD2  1  
ATOM 5350   H HD3  . PRO A 1 348 ? 12.623  7.975   13.219  1.00 0.00 ? 348 PRO A HD3  1  
ATOM 5351   N N    . LYS A 1 349 ? 15.117  7.825   8.320   1.00 0.00 ? 349 LYS A N    1  
ATOM 5352   C CA   . LYS A 1 349 ? 15.478  7.045   7.149   1.00 0.00 ? 349 LYS A CA   1  
ATOM 5353   C C    . LYS A 1 349 ? 16.316  5.841   7.524   1.00 0.00 ? 349 LYS A C    1  
ATOM 5354   O O    . LYS A 1 349 ? 17.001  5.829   8.554   1.00 0.00 ? 349 LYS A O    1  
ATOM 5355   C CB   . LYS A 1 349 ? 16.203  7.911   6.117   1.00 0.00 ? 349 LYS A CB   1  
ATOM 5356   C CG   . LYS A 1 349 ? 15.371  9.141   5.670   1.00 0.00 ? 349 LYS A CG   1  
ATOM 5357   C CD   . LYS A 1 349 ? 14.056  8.750   4.851   1.00 0.00 ? 349 LYS A CD   1  
ATOM 5358   C CE   . LYS A 1 349 ? 13.288  9.983   4.270   1.00 0.00 ? 349 LYS A CE   1  
ATOM 5359   N NZ   . LYS A 1 349 ? 12.030  9.603   3.494   1.00 0.00 ? 349 LYS A NZ   1  
ATOM 5360   H H    . LYS A 1 349 ? 15.524  8.708   8.444   1.00 0.00 ? 349 LYS A H    1  
ATOM 5361   H HA   . LYS A 1 349 ? 14.565  6.685   6.698   1.00 0.00 ? 349 LYS A HA   1  
ATOM 5362   H HB2  . LYS A 1 349 ? 17.132  8.257   6.545   1.00 0.00 ? 349 LYS A HB2  1  
ATOM 5363   H HB3  . LYS A 1 349 ? 16.425  7.305   5.250   1.00 0.00 ? 349 LYS A HB3  1  
ATOM 5364   H HG2  . LYS A 1 349 ? 15.079  9.698   6.547   1.00 0.00 ? 349 LYS A HG2  1  
ATOM 5365   H HG3  . LYS A 1 349 ? 15.991  9.771   5.050   1.00 0.00 ? 349 LYS A HG3  1  
ATOM 5366   H HD2  . LYS A 1 349 ? 14.338  8.106   4.031   1.00 0.00 ? 349 LYS A HD2  1  
ATOM 5367   H HD3  . LYS A 1 349 ? 13.392  8.203   5.506   1.00 0.00 ? 349 LYS A HD3  1  
ATOM 5368   H HE2  . LYS A 1 349 ? 13.006  10.630  5.085   1.00 0.00 ? 349 LYS A HE2  1  
ATOM 5369   H HE3  . LYS A 1 349 ? 13.954  10.526  3.613   1.00 0.00 ? 349 LYS A HE3  1  
ATOM 5370   H HZ1  . LYS A 1 349 ? 11.190  9.839   4.059   1.00 0.00 ? 349 LYS A HZ1  1  
ATOM 5371   H HZ2  . LYS A 1 349 ? 12.040  8.581   3.298   1.00 0.00 ? 349 LYS A HZ2  1  
ATOM 5372   H HZ3  . LYS A 1 349 ? 12.003  10.129  2.598   1.00 0.00 ? 349 LYS A HZ3  1  
ATOM 5373   N N    . GLU A 1 350 ? 16.224  4.824   6.678   1.00 0.00 ? 350 GLU A N    1  
ATOM 5374   C CA   . GLU A 1 350 ? 17.026  3.601   6.793   1.00 0.00 ? 350 GLU A CA   1  
ATOM 5375   C C    . GLU A 1 350 ? 17.732  3.262   5.491   1.00 0.00 ? 350 GLU A C    1  
ATOM 5376   O O    . GLU A 1 350 ? 17.254  3.537   4.396   1.00 0.00 ? 350 GLU A O    1  
ATOM 5377   C CB   . GLU A 1 350 ? 16.152  2.423   7.172   1.00 0.00 ? 350 GLU A CB   1  
ATOM 5378   C CG   . GLU A 1 350 ? 15.456  2.634   8.471   1.00 0.00 ? 350 GLU A CG   1  
ATOM 5379   C CD   . GLU A 1 350 ? 14.623  1.465   8.872   1.00 0.00 ? 350 GLU A CD   1  
ATOM 5380   O OE1  . GLU A 1 350 ? 13.838  0.960   8.021   1.00 0.00 ? 350 GLU A OE1  1  
ATOM 5381   O OE2  . GLU A 1 350 ? 14.762  1.065   10.051  1.00 0.00 ? 350 GLU A OE2  1  
ATOM 5382   H H    . GLU A 1 350 ? 15.638  4.922   5.898   1.00 0.00 ? 350 GLU A H    1  
ATOM 5383   H HA   . GLU A 1 350 ? 17.767  3.742   7.565   1.00 0.00 ? 350 GLU A HA   1  
ATOM 5384   H HB2  . GLU A 1 350 ? 15.412  2.273   6.401   1.00 0.00 ? 350 GLU A HB2  1  
ATOM 5385   H HB3  . GLU A 1 350 ? 16.768  1.538   7.241   1.00 0.00 ? 350 GLU A HB3  1  
ATOM 5386   H HG2  . GLU A 1 350 ? 16.195  2.813   9.237   1.00 0.00 ? 350 GLU A HG2  1  
ATOM 5387   H HG3  . GLU A 1 350 ? 14.822  3.506   8.389   1.00 0.00 ? 350 GLU A HG3  1  
ATOM 5388   N N    . GLU A 1 351 ? 18.881  2.647   5.632   1.00 0.00 ? 351 GLU A N    1  
ATOM 5389   C CA   . GLU A 1 351 ? 19.645  2.250   4.498   1.00 0.00 ? 351 GLU A CA   1  
ATOM 5390   C C    . GLU A 1 351 ? 18.921  1.171   3.677   1.00 0.00 ? 351 GLU A C    1  
ATOM 5391   O O    . GLU A 1 351 ? 19.000  1.169   2.447   1.00 0.00 ? 351 GLU A O    1  
ATOM 5392   C CB   . GLU A 1 351 ? 21.063  1.847   4.947   1.00 0.00 ? 351 GLU A CB   1  
ATOM 5393   C CG   . GLU A 1 351 ? 21.893  3.050   5.440   1.00 0.00 ? 351 GLU A CG   1  
ATOM 5394   C CD   . GLU A 1 351 ? 22.078  4.139   4.313   1.00 0.00 ? 351 GLU A CD   1  
ATOM 5395   O OE1  . GLU A 1 351 ? 22.460  3.765   3.171   1.00 0.00 ? 351 GLU A OE1  1  
ATOM 5396   O OE2  . GLU A 1 351 ? 21.814  5.353   4.574   1.00 0.00 ? 351 GLU A OE2  1  
ATOM 5397   H H    . GLU A 1 351 ? 19.213  2.445   6.532   1.00 0.00 ? 351 GLU A H    1  
ATOM 5398   H HA   . GLU A 1 351 ? 19.744  3.118   3.862   1.00 0.00 ? 351 GLU A HA   1  
ATOM 5399   H HB2  . GLU A 1 351 ? 20.984  1.128   5.749   1.00 0.00 ? 351 GLU A HB2  1  
ATOM 5400   H HB3  . GLU A 1 351 ? 21.574  1.386   4.114   1.00 0.00 ? 351 GLU A HB3  1  
ATOM 5401   H HG2  . GLU A 1 351 ? 21.393  3.499   6.285   1.00 0.00 ? 351 GLU A HG2  1  
ATOM 5402   H HG3  . GLU A 1 351 ? 22.866  2.700   5.753   1.00 0.00 ? 351 GLU A HG3  1  
ATOM 5403   N N    . ASN A 1 352 ? 18.206  0.269   4.346   1.00 0.00 ? 352 ASN A N    1  
ATOM 5404   C CA   . ASN A 1 352 ? 17.399  -0.741  3.632   1.00 0.00 ? 352 ASN A CA   1  
ATOM 5405   C C    . ASN A 1 352 ? 16.054  -0.873  4.310   1.00 0.00 ? 352 ASN A C    1  
ATOM 5406   O O    . ASN A 1 352 ? 15.886  -1.715  5.196   1.00 0.00 ? 352 ASN A O    1  
ATOM 5407   C CB   . ASN A 1 352 ? 18.054  -2.148  3.542   1.00 0.00 ? 352 ASN A CB   1  
ATOM 5408   C CG   . ASN A 1 352 ? 19.330  -2.158  2.777   1.00 0.00 ? 352 ASN A CG   1  
ATOM 5409   O OD1  . ASN A 1 352 ? 19.360  -2.510  1.603   1.00 0.00 ? 352 ASN A OD1  1  
ATOM 5410   N ND2  . ASN A 1 352 ? 20.407  -1.772  3.431   1.00 0.00 ? 352 ASN A ND2  1  
ATOM 5411   H H    . ASN A 1 352 ? 18.163  0.317   5.324   1.00 0.00 ? 352 ASN A H    1  
ATOM 5412   H HA   . ASN A 1 352 ? 17.231  -0.380  2.626   1.00 0.00 ? 352 ASN A HA   1  
ATOM 5413   H HB2  . ASN A 1 352 ? 18.252  -2.502  4.541   1.00 0.00 ? 352 ASN A HB2  1  
ATOM 5414   H HB3  . ASN A 1 352 ? 17.354  -2.824  3.069   1.00 0.00 ? 352 ASN A HB3  1  
ATOM 5415   H HD21 . ASN A 1 352 ? 20.338  -1.499  4.370   1.00 0.00 ? 352 ASN A HD21 1  
ATOM 5416   H HD22 . ASN A 1 352 ? 21.276  -1.757  2.979   1.00 0.00 ? 352 ASN A HD22 1  
ATOM 5417   N N    . PRO A 1 353 ? 15.098  -0.025  3.907   1.00 0.00 ? 353 PRO A N    1  
ATOM 5418   C CA   . PRO A 1 353 ? 13.849  -0.078  4.643   1.00 0.00 ? 353 PRO A CA   1  
ATOM 5419   C C    . PRO A 1 353 ? 13.313  -1.489  4.681   1.00 0.00 ? 353 PRO A C    1  
ATOM 5420   O O    . PRO A 1 353 ? 12.844  -1.921  5.729   1.00 0.00 ? 353 PRO A O    1  
ATOM 5421   C CB   . PRO A 1 353 ? 12.908  0.896   3.897   1.00 0.00 ? 353 PRO A CB   1  
ATOM 5422   C CG   . PRO A 1 353 ? 13.771  1.780   3.089   1.00 0.00 ? 353 PRO A CG   1  
ATOM 5423   C CD   . PRO A 1 353 ? 15.118  1.022   2.867   1.00 0.00 ? 353 PRO A CD   1  
ATOM 5424   H HA   . PRO A 1 353 ? 14.003  0.280   5.648   1.00 0.00 ? 353 PRO A HA   1  
ATOM 5425   H HB2  . PRO A 1 353 ? 12.237  0.343   3.255   1.00 0.00 ? 353 PRO A HB2  1  
ATOM 5426   H HB3  . PRO A 1 353 ? 12.343  1.482   4.607   1.00 0.00 ? 353 PRO A HB3  1  
ATOM 5427   H HG2  . PRO A 1 353 ? 13.289  1.993   2.144   1.00 0.00 ? 353 PRO A HG2  1  
ATOM 5428   H HG3  . PRO A 1 353 ? 13.951  2.701   3.622   1.00 0.00 ? 353 PRO A HG3  1  
ATOM 5429   H HD2  . PRO A 1 353 ? 15.150  0.580   1.880   1.00 0.00 ? 353 PRO A HD2  1  
ATOM 5430   H HD3  . PRO A 1 353 ? 15.959  1.681   3.018   1.00 0.00 ? 353 PRO A HD3  1  
ATOM 5431   N N    . PHE A 1 354 ? 13.432  -2.223  3.582   1.00 0.00 ? 354 PHE A N    1  
ATOM 5432   C CA   . PHE A 1 354 ? 12.830  -3.563  3.524   1.00 0.00 ? 354 PHE A CA   1  
ATOM 5433   C C    . PHE A 1 354 ? 13.478  -4.610  4.402   1.00 0.00 ? 354 PHE A C    1  
ATOM 5434   O O    . PHE A 1 354 ? 12.889  -5.666  4.631   1.00 0.00 ? 354 PHE A O    1  
ATOM 5435   C CB   . PHE A 1 354 ? 12.772  -4.084  2.092   1.00 0.00 ? 354 PHE A CB   1  
ATOM 5436   C CG   . PHE A 1 354 ? 11.492  -3.800  1.413   1.00 0.00 ? 354 PHE A CG   1  
ATOM 5437   C CD1  . PHE A 1 354 ? 10.278  -4.320  1.929   1.00 0.00 ? 354 PHE A CD1  1  
ATOM 5438   C CD2  . PHE A 1 354 ? 11.467  -3.038  0.254   1.00 0.00 ? 354 PHE A CD2  1  
ATOM 5439   C CE1  . PHE A 1 354 ? 9.060   -4.066  1.287   1.00 0.00 ? 354 PHE A CE1  1  
ATOM 5440   C CE2  . PHE A 1 354 ? 10.235  -2.787  -0.404  1.00 0.00 ? 354 PHE A CE2  1  
ATOM 5441   C CZ   . PHE A 1 354 ? 9.056   -3.288  0.092   1.00 0.00 ? 354 PHE A CZ   1  
ATOM 5442   H H    . PHE A 1 354 ? 13.856  -1.843  2.784   1.00 0.00 ? 354 PHE A H    1  
ATOM 5443   H HA   . PHE A 1 354 ? 11.809  -3.461  3.860   1.00 0.00 ? 354 PHE A HA   1  
ATOM 5444   H HB2  . PHE A 1 354 ? 13.568  -3.627  1.525   1.00 0.00 ? 354 PHE A HB2  1  
ATOM 5445   H HB3  . PHE A 1 354 ? 12.931  -5.154  2.108   1.00 0.00 ? 354 PHE A HB3  1  
ATOM 5446   H HD1  . PHE A 1 354 ? 10.292  -4.908  2.835   1.00 0.00 ? 354 PHE A HD1  1  
ATOM 5447   H HD2  . PHE A 1 354 ? 12.386  -2.636  -0.148  1.00 0.00 ? 354 PHE A HD2  1  
ATOM 5448   H HE1  . PHE A 1 354 ? 8.138   -4.465  1.685   1.00 0.00 ? 354 PHE A HE1  1  
ATOM 5449   H HE2  . PHE A 1 354 ? 10.224  -2.193  -1.307  1.00 0.00 ? 354 PHE A HE2  1  
ATOM 5450   H HZ   . PHE A 1 354 ? 8.125   -3.089  -0.421  1.00 0.00 ? 354 PHE A HZ   1  
ATOM 5451   N N    . LEU A 1 355 ? 14.701  -4.328  4.846   1.00 0.00 ? 355 LEU A N    1  
ATOM 5452   C CA   . LEU A 1 355 ? 15.368  -5.088  5.886   1.00 0.00 ? 355 LEU A CA   1  
ATOM 5453   C C    . LEU A 1 355 ? 15.478  -4.299  7.185   1.00 0.00 ? 355 LEU A C    1  
ATOM 5454   O O    . LEU A 1 355 ? 16.399  -4.502  7.979   1.00 0.00 ? 355 LEU A O    1  
ATOM 5455   C CB   . LEU A 1 355 ? 16.778  -5.401  5.442   1.00 0.00 ? 355 LEU A CB   1  
ATOM 5456   C CG   . LEU A 1 355 ? 16.936  -6.085  4.106   1.00 0.00 ? 355 LEU A CG   1  
ATOM 5457   C CD1  . LEU A 1 355 ? 18.371  -5.855  3.626   1.00 0.00 ? 355 LEU A CD1  1  
ATOM 5458   C CD2  . LEU A 1 355 ? 16.526  -7.583  4.296   1.00 0.00 ? 355 LEU A CD2  1  
ATOM 5459   H H    . LEU A 1 355 ? 15.101  -3.475  4.576   1.00 0.00 ? 355 LEU A H    1  
ATOM 5460   H HA   . LEU A 1 355 ? 14.839  -6.011  6.062   1.00 0.00 ? 355 LEU A HA   1  
ATOM 5461   H HB2  . LEU A 1 355 ? 17.328  -4.475  5.402   1.00 0.00 ? 355 LEU A HB2  1  
ATOM 5462   H HB3  . LEU A 1 355 ? 17.233  -6.025  6.200   1.00 0.00 ? 355 LEU A HB3  1  
ATOM 5463   H HG   . LEU A 1 355 ? 16.259  -5.621  3.400   1.00 0.00 ? 355 LEU A HG   1  
ATOM 5464   H HD11 . LEU A 1 355 ? 18.514  -4.807  3.409   1.00 0.00 ? 355 LEU A HD11 1  
ATOM 5465   H HD12 . LEU A 1 355 ? 18.548  -6.435  2.732   1.00 0.00 ? 355 LEU A HD12 1  
ATOM 5466   H HD13 . LEU A 1 355 ? 19.062  -6.161  4.398   1.00 0.00 ? 355 LEU A HD13 1  
ATOM 5467   H HD21 . LEU A 1 355 ? 17.187  -8.048  5.014   1.00 0.00 ? 355 LEU A HD21 1  
ATOM 5468   H HD22 . LEU A 1 355 ? 16.601  -8.100  3.352   1.00 0.00 ? 355 LEU A HD22 1  
ATOM 5469   H HD23 . LEU A 1 355 ? 15.508  -7.634  4.655   1.00 0.00 ? 355 LEU A HD23 1  
ATOM 5470   N N    . GLY A 1 356 ? 14.537  -3.396  7.417   1.00 0.00 ? 356 GLY A N    1  
ATOM 5471   C CA   . GLY A 1 356 ? 14.667  -2.476  8.540   1.00 0.00 ? 356 GLY A CA   1  
ATOM 5472   C C    . GLY A 1 356 ? 13.593  -2.640  9.576   1.00 0.00 ? 356 GLY A C    1  
ATOM 5473   O O    . GLY A 1 356 ? 13.109  -3.739  9.823   1.00 0.00 ? 356 GLY A O    1  
ATOM 5474   H H    . GLY A 1 356 ? 13.817  -3.266  6.764   1.00 0.00 ? 356 GLY A H    1  
ATOM 5475   H HA2  . GLY A 1 356 ? 15.625  -2.638  9.010   1.00 0.00 ? 356 GLY A HA2  1  
ATOM 5476   H HA3  . GLY A 1 356 ? 14.634  -1.464  8.162   1.00 0.00 ? 356 GLY A HA3  1  
ATOM 5477   N N    . TRP A 1 357 ? 13.215  -1.503  10.145  1.00 0.00 ? 357 TRP A N    1  
ATOM 5478   C CA   . TRP A 1 357 ? 12.414  -1.410  11.335  1.00 0.00 ? 357 TRP A CA   1  
ATOM 5479   C C    . TRP A 1 357 ? 10.970  -1.340  10.908  1.00 0.00 ? 357 TRP A C    1  
ATOM 5480   O O    . TRP A 1 357 ? 10.320  -0.288  10.940  1.00 0.00 ? 357 TRP A O    1  
ATOM 5481   C CB   . TRP A 1 357 ? 12.816  -0.148  12.069  1.00 0.00 ? 357 TRP A CB   1  
ATOM 5482   C CG   . TRP A 1 357 ? 12.456  -0.052  13.557  1.00 0.00 ? 357 TRP A CG   1  
ATOM 5483   C CD1  . TRP A 1 357 ? 12.486  -1.049  14.482  1.00 0.00 ? 357 TRP A CD1  1  
ATOM 5484   C CD2  . TRP A 1 357 ? 12.127  1.143   14.275  1.00 0.00 ? 357 TRP A CD2  1  
ATOM 5485   N NE1  . TRP A 1 357 ? 12.167  -0.557  15.725  1.00 0.00 ? 357 TRP A NE1  1  
ATOM 5486   C CE2  . TRP A 1 357 ? 11.948  0.789   15.623  1.00 0.00 ? 357 TRP A CE2  1  
ATOM 5487   C CE3  . TRP A 1 357 ? 11.941  2.480   13.902  1.00 0.00 ? 357 TRP A CE3  1  
ATOM 5488   C CZ2  . TRP A 1 357 ? 11.581  1.733   16.607  1.00 0.00 ? 357 TRP A CZ2  1  
ATOM 5489   C CZ3  . TRP A 1 357 ? 11.584  3.399   14.871  1.00 0.00 ? 357 TRP A CZ3  1  
ATOM 5490   C CH2  . TRP A 1 357 ? 11.424  3.028   16.205  1.00 0.00 ? 357 TRP A CH2  1  
ATOM 5491   H H    . TRP A 1 357 ? 13.655  -0.682  9.838   1.00 0.00 ? 357 TRP A H    1  
ATOM 5492   H HA   . TRP A 1 357 ? 12.577  -2.272  11.964  1.00 0.00 ? 357 TRP A HA   1  
ATOM 5493   H HB2  . TRP A 1 357 ? 13.886  -0.044  11.986  1.00 0.00 ? 357 TRP A HB2  1  
ATOM 5494   H HB3  . TRP A 1 357 ? 12.361  0.690   11.557  1.00 0.00 ? 357 TRP A HB3  1  
ATOM 5495   H HD1  . TRP A 1 357 ? 12.708  -2.084  14.266  1.00 0.00 ? 357 TRP A HD1  1  
ATOM 5496   H HE1  . TRP A 1 357 ? 12.108  -1.068  16.560  1.00 0.00 ? 357 TRP A HE1  1  
ATOM 5497   H HE3  . TRP A 1 357 ? 12.062  2.785   12.873  1.00 0.00 ? 357 TRP A HE3  1  
ATOM 5498   H HZ2  . TRP A 1 357 ? 11.458  1.448   17.641  1.00 0.00 ? 357 TRP A HZ2  1  
ATOM 5499   H HZ3  . TRP A 1 357 ? 11.451  4.434   14.592  1.00 0.00 ? 357 TRP A HZ3  1  
ATOM 5500   H HH2  . TRP A 1 357 ? 11.144  3.777   16.932  1.00 0.00 ? 357 TRP A HH2  1  
ATOM 5501   N N    . ARG A 1 358 ? 10.472  -2.519  10.595  1.00 0.00 ? 358 ARG A N    1  
ATOM 5502   C CA   . ARG A 1 358 ? 9.253   -2.683  9.846   1.00 0.00 ? 358 ARG A CA   1  
ATOM 5503   C C    . ARG A 1 358 ? 8.173   -3.435  10.663  1.00 0.00 ? 358 ARG A C    1  
ATOM 5504   O O    . ARG A 1 358 ? 8.468   -4.398  11.394  1.00 0.00 ? 358 ARG A O    1  
ATOM 5505   C CB   . ARG A 1 358 ? 9.615   -3.415  8.566   1.00 0.00 ? 358 ARG A CB   1  
ATOM 5506   C CG   . ARG A 1 358 ? 8.511   -3.632  7.612   1.00 0.00 ? 358 ARG A CG   1  
ATOM 5507   C CD   . ARG A 1 358 ? 8.995   -4.490  6.410   1.00 0.00 ? 358 ARG A CD   1  
ATOM 5508   N NE   . ARG A 1 358 ? 7.894   -4.683  5.481   1.00 0.00 ? 358 ARG A NE   1  
ATOM 5509   C CZ   . ARG A 1 358 ? 7.899   -5.530  4.475   1.00 0.00 ? 358 ARG A CZ   1  
ATOM 5510   N NH1  . ARG A 1 358 ? 8.946   -6.282  4.256   1.00 0.00 ? 358 ARG A NH1  1  
ATOM 5511   N NH2  . ARG A 1 358 ? 6.842   -5.627  3.689   1.00 0.00 ? 358 ARG A NH2  1  
ATOM 5512   H H    . ARG A 1 358 ? 11.062  -3.297  10.675  1.00 0.00 ? 358 ARG A H    1  
ATOM 5513   H HA   . ARG A 1 358 ? 8.872   -1.707  9.586   1.00 0.00 ? 358 ARG A HA   1  
ATOM 5514   H HB2  . ARG A 1 358 ? 10.381  -2.851  8.061   1.00 0.00 ? 358 ARG A HB2  1  
ATOM 5515   H HB3  . ARG A 1 358 ? 10.031  -4.376  8.837   1.00 0.00 ? 358 ARG A HB3  1  
ATOM 5516   H HG2  . ARG A 1 358 ? 7.700   -4.141  8.114   1.00 0.00 ? 358 ARG A HG2  1  
ATOM 5517   H HG3  . ARG A 1 358 ? 8.162   -2.678  7.246   1.00 0.00 ? 358 ARG A HG3  1  
ATOM 5518   H HD2  . ARG A 1 358 ? 9.804   -3.982  5.907   1.00 0.00 ? 358 ARG A HD2  1  
ATOM 5519   H HD3  . ARG A 1 358 ? 9.340   -5.450  6.769   1.00 0.00 ? 358 ARG A HD3  1  
ATOM 5520   H HE   . ARG A 1 358 ? 7.088   -4.141  5.614   1.00 0.00 ? 358 ARG A HE   1  
ATOM 5521   H HH11 . ARG A 1 358 ? 9.744   -6.214  4.853   1.00 0.00 ? 358 ARG A HH11 1  
ATOM 5522   H HH12 . ARG A 1 358 ? 8.948   -6.926  3.490   1.00 0.00 ? 358 ARG A HH12 1  
ATOM 5523   H HH21 . ARG A 1 358 ? 6.039   -5.056  3.859   1.00 0.00 ? 358 ARG A HH21 1  
ATOM 5524   H HH22 . ARG A 1 358 ? 6.845   -6.271  2.923   1.00 0.00 ? 358 ARG A HH22 1  
ATOM 5525   N N    . ALA A 1 359 ? 6.926   -2.961  10.546  1.00 0.00 ? 359 ALA A N    1  
ATOM 5526   C CA   . ALA A 1 359 ? 5.754   -3.713  10.995  1.00 0.00 ? 359 ALA A CA   1  
ATOM 5527   C C    . ALA A 1 359 ? 5.856   -3.967  12.458  1.00 0.00 ? 359 ALA A C    1  
ATOM 5528   O O    . ALA A 1 359 ? 5.859   -3.063  13.246  1.00 0.00 ? 359 ALA A O    1  
ATOM 5529   C CB   . ALA A 1 359 ? 5.639   -5.073  10.236  1.00 0.00 ? 359 ALA A CB   1  
ATOM 5530   H H    . ALA A 1 359 ? 6.780   -2.183  9.969   1.00 0.00 ? 359 ALA A H    1  
ATOM 5531   H HA   . ALA A 1 359 ? 4.867   -3.130  10.800  1.00 0.00 ? 359 ALA A HA   1  
ATOM 5532   H HB1  . ALA A 1 359 ? 5.469   -4.885  9.185   1.00 0.00 ? 359 ALA A HB1  1  
ATOM 5533   H HB2  . ALA A 1 359 ? 4.814   -5.641  10.638  1.00 0.00 ? 359 ALA A HB2  1  
ATOM 5534   H HB3  . ALA A 1 359 ? 6.555   -5.632  10.360  1.00 0.00 ? 359 ALA A HB3  1  
ATOM 5535   N N    . ILE A 1 360 ? 5.996   -5.221  12.806  1.00 0.00 ? 360 ILE A N    1  
ATOM 5536   C CA   . ILE A 1 360 ? 5.962   -5.684  14.193  1.00 0.00 ? 360 ILE A CA   1  
ATOM 5537   C C    . ILE A 1 360 ? 7.157   -5.192  15.040  1.00 0.00 ? 360 ILE A C    1  
ATOM 5538   O O    . ILE A 1 360 ? 7.121   -5.116  16.294  1.00 0.00 ? 360 ILE A O    1  
ATOM 5539   C CB   . ILE A 1 360 ? 5.813   -7.188  14.143  1.00 0.00 ? 360 ILE A CB   1  
ATOM 5540   C CG1  . ILE A 1 360 ? 5.260   -7.621  15.435  1.00 0.00 ? 360 ILE A CG1  1  
ATOM 5541   C CG2  . ILE A 1 360 ? 6.993   -7.952  13.587  1.00 0.00 ? 360 ILE A CG2  1  
ATOM 5542   C CD1  . ILE A 1 360 ? 3.757   -7.720  15.329  1.00 0.00 ? 360 ILE A CD1  1  
ATOM 5543   H H    . ILE A 1 360 ? 6.027   -5.896  12.096  1.00 0.00 ? 360 ILE A H    1  
ATOM 5544   H HA   . ILE A 1 360 ? 5.065   -5.285  14.644  1.00 0.00 ? 360 ILE A HA   1  
ATOM 5545   H HB   . ILE A 1 360 ? 5.024   -7.359  13.420  1.00 0.00 ? 360 ILE A HB   1  
ATOM 5546   H HG12 . ILE A 1 360 ? 5.668   -8.588  15.695  1.00 0.00 ? 360 ILE A HG12 1  
ATOM 5547   H HG13 . ILE A 1 360 ? 5.518   -6.902  16.198  1.00 0.00 ? 360 ILE A HG13 1  
ATOM 5548   H HG21 . ILE A 1 360 ? 7.716   -8.121  14.372  1.00 0.00 ? 360 ILE A HG21 1  
ATOM 5549   H HG22 . ILE A 1 360 ? 7.451   -7.380  12.793  1.00 0.00 ? 360 ILE A HG22 1  
ATOM 5550   H HG23 . ILE A 1 360 ? 6.657   -8.902  13.198  1.00 0.00 ? 360 ILE A HG23 1  
ATOM 5551   H HD11 . ILE A 1 360 ? 3.368   -6.819  14.879  1.00 0.00 ? 360 ILE A HD11 1  
ATOM 5552   H HD12 . ILE A 1 360 ? 3.334   -7.841  16.317  1.00 0.00 ? 360 ILE A HD12 1  
ATOM 5553   H HD13 . ILE A 1 360 ? 3.494   -8.570  14.717  1.00 0.00 ? 360 ILE A HD13 1  
ATOM 5554   N N    . ARG A 1 361 ? 8.202   -4.830  14.324  1.00 0.00 ? 361 ARG A N    1  
ATOM 5555   C CA   . ARG A 1 361 ? 9.370   -4.373  14.961  1.00 0.00 ? 361 ARG A CA   1  
ATOM 5556   C C    . ARG A 1 361 ? 9.135   -3.025  15.559  1.00 0.00 ? 361 ARG A C    1  
ATOM 5557   O O    . ARG A 1 361 ? 9.821   -2.655  16.527  1.00 0.00 ? 361 ARG A O    1  
ATOM 5558   C CB   . ARG A 1 361 ? 10.493  -4.342  13.958  1.00 0.00 ? 361 ARG A CB   1  
ATOM 5559   C CG   . ARG A 1 361 ? 10.815  -5.747  13.551  1.00 0.00 ? 361 ARG A CG   1  
ATOM 5560   C CD   . ARG A 1 361 ? 11.806  -5.806  12.452  1.00 0.00 ? 361 ARG A CD   1  
ATOM 5561   N NE   . ARG A 1 361 ? 12.074  -7.203  12.113  1.00 0.00 ? 361 ARG A NE   1  
ATOM 5562   C CZ   . ARG A 1 361 ? 12.808  -7.534  11.062  1.00 0.00 ? 361 ARG A CZ   1  
ATOM 5563   N NH1  . ARG A 1 361 ? 13.322  -6.545  10.304  1.00 0.00 ? 361 ARG A NH1  1  
ATOM 5564   N NH2  . ARG A 1 361 ? 13.016  -8.818  10.743  1.00 0.00 ? 361 ARG A NH2  1  
ATOM 5565   H H    . ARG A 1 361 ? 8.169   -4.888  13.346  1.00 0.00 ? 361 ARG A H    1  
ATOM 5566   H HA   . ARG A 1 361 ? 9.631   -5.063  15.748  1.00 0.00 ? 361 ARG A HA   1  
ATOM 5567   H HB2  . ARG A 1 361 ? 10.189  -3.773  13.091  1.00 0.00 ? 361 ARG A HB2  1  
ATOM 5568   H HB3  . ARG A 1 361 ? 11.365  -3.887  14.403  1.00 0.00 ? 361 ARG A HB3  1  
ATOM 5569   H HG2  . ARG A 1 361 ? 11.211  -6.275  14.404  1.00 0.00 ? 361 ARG A HG2  1  
ATOM 5570   H HG3  . ARG A 1 361 ? 9.905   -6.234  13.231  1.00 0.00 ? 361 ARG A HG3  1  
ATOM 5571   H HD2  . ARG A 1 361 ? 11.414  -5.293  11.586  1.00 0.00 ? 361 ARG A HD2  1  
ATOM 5572   H HD3  . ARG A 1 361 ? 12.723  -5.330  12.769  1.00 0.00 ? 361 ARG A HD3  1  
ATOM 5573   H HE   . ARG A 1 361 ? 11.690  -7.912  12.669  1.00 0.00 ? 361 ARG A HE   1  
ATOM 5574   H HH11 . ARG A 1 361 ? 13.145  -5.589  10.541  1.00 0.00 ? 361 ARG A HH11 1  
ATOM 5575   H HH12 . ARG A 1 361 ? 13.880  -6.767  9.504   1.00 0.00 ? 361 ARG A HH12 1  
ATOM 5576   H HH21 . ARG A 1 361 ? 12.613  -9.544  11.301  1.00 0.00 ? 361 ARG A HH21 1  
ATOM 5577   H HH22 . ARG A 1 361 ? 13.573  -9.052  9.945   1.00 0.00 ? 361 ARG A HH22 1  
ATOM 5578   N N    . ILE A 1 362 ? 8.165   -2.298  14.995  1.00 0.00 ? 362 ILE A N    1  
ATOM 5579   C CA   . ILE A 1 362 ? 7.760   -0.986  15.509  1.00 0.00 ? 362 ILE A CA   1  
ATOM 5580   C C    . ILE A 1 362 ? 6.768   -1.155  16.662  1.00 0.00 ? 362 ILE A C    1  
ATOM 5581   O O    . ILE A 1 362 ? 6.929   -0.596  17.759  1.00 0.00 ? 362 ILE A O    1  
ATOM 5582   C CB   . ILE A 1 362 ? 7.059   -0.150  14.456  1.00 0.00 ? 362 ILE A CB   1  
ATOM 5583   C CG1  . ILE A 1 362 ? 8.003   0.258   13.332  1.00 0.00 ? 362 ILE A CG1  1  
ATOM 5584   C CG2  . ILE A 1 362 ? 6.416   1.055   15.094  1.00 0.00 ? 362 ILE A CG2  1  
ATOM 5585   C CD1  . ILE A 1 362 ? 7.290   0.889   12.087  1.00 0.00 ? 362 ILE A CD1  1  
ATOM 5586   H H    . ILE A 1 362 ? 7.673   -2.678  14.238  1.00 0.00 ? 362 ILE A H    1  
ATOM 5587   H HA   . ILE A 1 362 ? 8.632   -0.456  15.862  1.00 0.00 ? 362 ILE A HA   1  
ATOM 5588   H HB   . ILE A 1 362 ? 6.269   -0.755  14.031  1.00 0.00 ? 362 ILE A HB   1  
ATOM 5589   H HG12 . ILE A 1 362 ? 8.708   0.976   13.721  1.00 0.00 ? 362 ILE A HG12 1  
ATOM 5590   H HG13 . ILE A 1 362 ? 8.548   -0.617  13.009  1.00 0.00 ? 362 ILE A HG13 1  
ATOM 5591   H HG21 . ILE A 1 362 ? 7.040   1.413   15.899  1.00 0.00 ? 362 ILE A HG21 1  
ATOM 5592   H HG22 . ILE A 1 362 ? 5.446   0.781   15.484  1.00 0.00 ? 362 ILE A HG22 1  
ATOM 5593   H HG23 . ILE A 1 362 ? 6.301   1.834   14.355  1.00 0.00 ? 362 ILE A HG23 1  
ATOM 5594   H HD11 . ILE A 1 362 ? 7.991   1.507   11.545  1.00 0.00 ? 362 ILE A HD11 1  
ATOM 5595   H HD12 . ILE A 1 362 ? 6.458   1.493   12.416  1.00 0.00 ? 362 ILE A HD12 1  
ATOM 5596   H HD13 . ILE A 1 362 ? 6.929   0.101   11.442  1.00 0.00 ? 362 ILE A HD13 1  
ATOM 5597   N N    . ALA A 1 363 ? 5.742   -1.941  16.423  1.00 0.00 ? 363 ALA A N    1  
ATOM 5598   C CA   . ALA A 1 363 ? 4.710   -2.051  17.404  1.00 0.00 ? 363 ALA A CA   1  
ATOM 5599   C C    . ALA A 1 363 ? 5.293   -2.629  18.708  1.00 0.00 ? 363 ALA A C    1  
ATOM 5600   O O    . ALA A 1 363 ? 4.825   -2.314  19.806  1.00 0.00 ? 363 ALA A O    1  
ATOM 5601   C CB   . ALA A 1 363 ? 3.576   -2.848  16.853  1.00 0.00 ? 363 ALA A CB   1  
ATOM 5602   H H    . ALA A 1 363 ? 5.645   -2.377  15.551  1.00 0.00 ? 363 ALA A H    1  
ATOM 5603   H HA   . ALA A 1 363 ? 4.350   -1.053  17.618  1.00 0.00 ? 363 ALA A HA   1  
ATOM 5604   H HB1  . ALA A 1 363 ? 3.681   -2.931  15.781  1.00 0.00 ? 363 ALA A HB1  1  
ATOM 5605   H HB2  . ALA A 1 363 ? 2.643   -2.355  17.087  1.00 0.00 ? 363 ALA A HB2  1  
ATOM 5606   H HB3  . ALA A 1 363 ? 3.583   -3.835  17.292  1.00 0.00 ? 363 ALA A HB3  1  
ATOM 5607   N N    . MET A 1 364 ? 6.359   -3.413  18.591  1.00 0.00 ? 364 MET A N    1  
ATOM 5608   C CA   . MET A 1 364 ? 7.066   -3.918  19.778  1.00 0.00 ? 364 MET A CA   1  
ATOM 5609   C C    . MET A 1 364 ? 8.035   -2.914  20.377  1.00 0.00 ? 364 MET A C    1  
ATOM 5610   O O    . MET A 1 364 ? 8.441   -3.046  21.524  1.00 0.00 ? 364 MET A O    1  
ATOM 5611   C CB   . MET A 1 364 ? 7.776   -5.263  19.499  1.00 0.00 ? 364 MET A CB   1  
ATOM 5612   C CG   . MET A 1 364 ? 6.811   -6.412  19.252  1.00 0.00 ? 364 MET A CG   1  
ATOM 5613   S SD   . MET A 1 364 ? 7.703   -8.092  18.731  1.00 0.00 ? 364 MET A SD   1  
ATOM 5614   C CE   . MET A 1 364 ? 8.569   -8.527  20.544  1.00 0.00 ? 364 MET A CE   1  
ATOM 5615   H H    . MET A 1 364 ? 6.727   -3.592  17.701  1.00 0.00 ? 364 MET A H    1  
ATOM 5616   H HA   . MET A 1 364 ? 6.313   -4.110  20.529  1.00 0.00 ? 364 MET A HA   1  
ATOM 5617   H HB2  . MET A 1 364 ? 8.405   -5.149  18.629  1.00 0.00 ? 364 MET A HB2  1  
ATOM 5618   H HB3  . MET A 1 364 ? 8.401   -5.507  20.348  1.00 0.00 ? 364 MET A HB3  1  
ATOM 5619   H HG2  . MET A 1 364 ? 6.245   -6.587  20.156  1.00 0.00 ? 364 MET A HG2  1  
ATOM 5620   H HG3  . MET A 1 364 ? 6.128   -6.125  18.466  1.00 0.00 ? 364 MET A HG3  1  
ATOM 5621   H HE1  . MET A 1 364 ? 8.117   -9.423  20.952  1.00 0.00 ? 364 MET A HE1  1  
ATOM 5622   H HE2  . MET A 1 364 ? 8.412   -7.710  21.227  1.00 0.00 ? 364 MET A HE2  1  
ATOM 5623   H HE3  . MET A 1 364 ? 9.633   -8.678  20.407  1.00 0.00 ? 364 MET A HE3  1  
ATOM 5624   N N    . ASP A 1 365 ? 8.423   -1.906  19.627  1.00 0.00 ? 365 ASP A N    1  
ATOM 5625   C CA   . ASP A 1 365 ? 9.268   -0.897  20.242  1.00 0.00 ? 365 ASP A CA   1  
ATOM 5626   C C    . ASP A 1 365 ? 8.445   0.273   20.697  1.00 0.00 ? 365 ASP A C    1  
ATOM 5627   O O    . ASP A 1 365 ? 8.961   1.205   21.297  1.00 0.00 ? 365 ASP A O    1  
ATOM 5628   C CB   . ASP A 1 365 ? 10.412  -0.453  19.328  1.00 0.00 ? 365 ASP A CB   1  
ATOM 5629   C CG   . ASP A 1 365 ? 11.449  -1.524  19.161  1.00 0.00 ? 365 ASP A CG   1  
ATOM 5630   O OD1  . ASP A 1 365 ? 11.434  -2.502  19.941  1.00 0.00 ? 365 ASP A OD1  1  
ATOM 5631   O OD2  . ASP A 1 365 ? 12.283  -1.408  18.259  1.00 0.00 ? 365 ASP A OD2  1  
ATOM 5632   H H    . ASP A 1 365 ? 8.097   -1.803  18.709  1.00 0.00 ? 365 ASP A H    1  
ATOM 5633   H HA   . ASP A 1 365 ? 9.708   -1.342  21.124  1.00 0.00 ? 365 ASP A HA   1  
ATOM 5634   H HB2  . ASP A 1 365 ? 10.009  -0.203  18.359  1.00 0.00 ? 365 ASP A HB2  1  
ATOM 5635   H HB3  . ASP A 1 365 ? 10.877  0.427   19.752  1.00 0.00 ? 365 ASP A HB3  1  
ATOM 5636   N N    . ARG A 1 366 ? 7.154   0.233   20.415  1.00 0.00 ? 366 ARG A N    1  
ATOM 5637   C CA   . ARG A 1 366 ? 6.295   1.304   20.845  1.00 0.00 ? 366 ARG A CA   1  
ATOM 5638   C C    . ARG A 1 366 ? 4.973   0.696   21.144  1.00 0.00 ? 366 ARG A C    1  
ATOM 5639   O O    . ARG A 1 366 ? 4.075   0.767   20.304  1.00 0.00 ? 366 ARG A O    1  
ATOM 5640   C CB   . ARG A 1 366 ? 6.102   2.329   19.740  1.00 0.00 ? 366 ARG A CB   1  
ATOM 5641   C CG   . ARG A 1 366 ? 7.283   3.174   19.468  1.00 0.00 ? 366 ARG A CG   1  
ATOM 5642   C CD   . ARG A 1 366 ? 6.889   4.146   18.467  1.00 0.00 ? 366 ARG A CD   1  
ATOM 5643   N NE   . ARG A 1 366 ? 7.982   5.032   18.161  1.00 0.00 ? 366 ARG A NE   1  
ATOM 5644   C CZ   . ARG A 1 366 ? 7.836   6.152   17.463  1.00 0.00 ? 366 ARG A CZ   1  
ATOM 5645   N NH1  . ARG A 1 366 ? 6.623   6.513   17.021  1.00 0.00 ? 366 ARG A NH1  1  
ATOM 5646   N NH2  . ARG A 1 366 ? 8.899   6.913   17.209  1.00 0.00 ? 366 ARG A NH2  1  
ATOM 5647   H H    . ARG A 1 366 ? 6.780   -0.534  19.932  1.00 0.00 ? 366 ARG A H    1  
ATOM 5648   H HA   . ARG A 1 366 ? 6.698   1.778   21.727  1.00 0.00 ? 366 ARG A HA   1  
ATOM 5649   H HB2  . ARG A 1 366 ? 5.845   1.808   18.832  1.00 0.00 ? 366 ARG A HB2  1  
ATOM 5650   H HB3  . ARG A 1 366 ? 5.272   2.968   20.011  1.00 0.00 ? 366 ARG A HB3  1  
ATOM 5651   H HG2  . ARG A 1 366 ? 7.590   3.678   20.373  1.00 0.00 ? 366 ARG A HG2  1  
ATOM 5652   H HG3  . ARG A 1 366 ? 8.092   2.566   19.089  1.00 0.00 ? 366 ARG A HG3  1  
ATOM 5653   H HD2  . ARG A 1 366 ? 6.590   3.629   17.567  1.00 0.00 ? 366 ARG A HD2  1  
ATOM 5654   H HD3  . ARG A 1 366 ? 6.055   4.723   18.839  1.00 0.00 ? 366 ARG A HD3  1  
ATOM 5655   H HE   . ARG A 1 366 ? 8.877   4.795   18.479  1.00 0.00 ? 366 ARG A HE   1  
ATOM 5656   H HH11 . ARG A 1 366 ? 5.828   5.939   17.217  1.00 0.00 ? 366 ARG A HH11 1  
ATOM 5657   H HH12 . ARG A 1 366 ? 6.513   7.356   16.496  1.00 0.00 ? 366 ARG A HH12 1  
ATOM 5658   H HH21 . ARG A 1 366 ? 9.802   6.640   17.544  1.00 0.00 ? 366 ARG A HH21 1  
ATOM 5659   H HH22 . ARG A 1 366 ? 8.796   7.757   16.684  1.00 0.00 ? 366 ARG A HH22 1  
ATOM 5660   N N    . ARG A 1 367 ? 4.847   0.124   22.336  1.00 0.00 ? 367 ARG A N    1  
ATOM 5661   C CA   . ARG A 1 367 ? 3.662   -0.605  22.722  1.00 0.00 ? 367 ARG A CA   1  
ATOM 5662   C C    . ARG A 1 367 ? 2.336   0.142   22.531  1.00 0.00 ? 367 ARG A C    1  
ATOM 5663   O O    . ARG A 1 367 ? 1.345   -0.469  22.086  1.00 0.00 ? 367 ARG A O    1  
ATOM 5664   C CB   . ARG A 1 367 ? 3.804   -1.115  24.139  1.00 0.00 ? 367 ARG A CB   1  
ATOM 5665   C CG   . ARG A 1 367 ? 4.835   -2.229  24.238  1.00 0.00 ? 367 ARG A CG   1  
ATOM 5666   C CD   . ARG A 1 367 ? 4.951   -2.678  25.692  1.00 0.00 ? 367 ARG A CD   1  
ATOM 5667   N NE   . ARG A 1 367 ? 5.905   -3.769  25.872  1.00 0.00 ? 367 ARG A NE   1  
ATOM 5668   C CZ   . ARG A 1 367 ? 7.224   -3.611  25.987  1.00 0.00 ? 367 ARG A CZ   1  
ATOM 5669   N NH1  . ARG A 1 367 ? 7.772   -2.400  25.933  1.00 0.00 ? 367 ARG A NH1  1  
ATOM 5670   N NH2  . ARG A 1 367 ? 8.005   -4.670  26.142  1.00 0.00 ? 367 ARG A NH2  1  
ATOM 5671   H H    . ARG A 1 367 ? 5.614   0.132   22.946  1.00 0.00 ? 367 ARG A H    1  
ATOM 5672   H HA   . ARG A 1 367 ? 3.617   -1.476  22.085  1.00 0.00 ? 367 ARG A HA   1  
ATOM 5673   H HB2  . ARG A 1 367 ? 4.107   -0.299  24.777  1.00 0.00 ? 367 ARG A HB2  1  
ATOM 5674   H HB3  . ARG A 1 367 ? 2.848   -1.489  24.475  1.00 0.00 ? 367 ARG A HB3  1  
ATOM 5675   H HG2  . ARG A 1 367 ? 4.526   -3.063  23.625  1.00 0.00 ? 367 ARG A HG2  1  
ATOM 5676   H HG3  . ARG A 1 367 ? 5.793   -1.866  23.898  1.00 0.00 ? 367 ARG A HG3  1  
ATOM 5677   H HD2  . ARG A 1 367 ? 5.269   -1.840  26.292  1.00 0.00 ? 367 ARG A HD2  1  
ATOM 5678   H HD3  . ARG A 1 367 ? 3.977   -2.999  26.035  1.00 0.00 ? 367 ARG A HD3  1  
ATOM 5679   H HE   . ARG A 1 367 ? 5.551   -4.682  25.909  1.00 0.00 ? 367 ARG A HE   1  
ATOM 5680   H HH11 . ARG A 1 367 ? 7.193   -1.594  25.805  1.00 0.00 ? 367 ARG A HH11 1  
ATOM 5681   H HH12 . ARG A 1 367 ? 8.762   -2.294  26.021  1.00 0.00 ? 367 ARG A HH12 1  
ATOM 5682   H HH21 . ARG A 1 367 ? 7.606   -5.587  26.172  1.00 0.00 ? 367 ARG A HH21 1  
ATOM 5683   H HH22 . ARG A 1 367 ? 8.995   -4.553  26.228  1.00 0.00 ? 367 ARG A HH22 1  
ATOM 5684   N N    . GLU A 1 368 ? 2.296   1.441   22.823  1.00 0.00 ? 368 GLU A N    1  
ATOM 5685   C CA   . GLU A 1 368 ? 1.052   2.174   22.600  1.00 0.00 ? 368 GLU A CA   1  
ATOM 5686   C C    . GLU A 1 368 ? 0.418   1.793   21.206  1.00 0.00 ? 368 GLU A C    1  
ATOM 5687   O O    . GLU A 1 368 ? -0.805  1.750   21.049  1.00 0.00 ? 368 GLU A O    1  
ATOM 5688   C CB   . GLU A 1 368 ? 1.256   3.700   22.727  1.00 0.00 ? 368 GLU A CB   1  
ATOM 5689   C CG   . GLU A 1 368 ? 1.519   4.235   24.165  1.00 0.00 ? 368 GLU A CG   1  
ATOM 5690   C CD   . GLU A 1 368 ? 2.999   4.100   24.673  1.00 0.00 ? 368 GLU A CD   1  
ATOM 5691   O OE1  . GLU A 1 368 ? 3.888   3.616   23.896  1.00 0.00 ? 368 GLU A OE1  1  
ATOM 5692   O OE2  . GLU A 1 368 ? 3.267   4.518   25.846  1.00 0.00 ? 368 GLU A OE2  1  
ATOM 5693   H H    . GLU A 1 368 ? 3.095   1.903   23.151  1.00 0.00 ? 368 GLU A H    1  
ATOM 5694   H HA   . GLU A 1 368 ? 0.354   1.867   23.368  1.00 0.00 ? 368 GLU A HA   1  
ATOM 5695   H HB2  . GLU A 1 368 ? 2.095   3.980   22.111  1.00 0.00 ? 368 GLU A HB2  1  
ATOM 5696   H HB3  . GLU A 1 368 ? 0.374   4.190   22.335  1.00 0.00 ? 368 GLU A HB3  1  
ATOM 5697   H HG2  . GLU A 1 368 ? 1.249   5.280   24.192  1.00 0.00 ? 368 GLU A HG2  1  
ATOM 5698   H HG3  . GLU A 1 368 ? 0.872   3.701   24.847  1.00 0.00 ? 368 GLU A HG3  1  
ATOM 5699   N N    . ILE A 1 369 ? 1.258   1.498   20.213  1.00 0.00 ? 369 ILE A N    1  
ATOM 5700   C CA   . ILE A 1 369 ? 0.800   1.254   18.830  1.00 0.00 ? 369 ILE A CA   1  
ATOM 5701   C C    . ILE A 1 369 ? 0.192   -0.153  18.730  1.00 0.00 ? 369 ILE A C    1  
ATOM 5702   O O    . ILE A 1 369 ? -0.962  -0.341  18.308  1.00 0.00 ? 369 ILE A O    1  
ATOM 5703   C CB   . ILE A 1 369 ? 1.977   1.412   17.815  1.00 0.00 ? 369 ILE A CB   1  
ATOM 5704   C CG1  . ILE A 1 369 ? 2.451   2.856   17.766  1.00 0.00 ? 369 ILE A CG1  1  
ATOM 5705   C CG2  . ILE A 1 369 ? 1.576   0.983   16.426  1.00 0.00 ? 369 ILE A CG2  1  
ATOM 5706   C CD1  . ILE A 1 369 ? 3.739   3.051   16.983  1.00 0.00 ? 369 ILE A CD1  1  
ATOM 5707   H H    . ILE A 1 369 ? 2.222   1.528   20.389  1.00 0.00 ? 369 ILE A H    1  
ATOM 5708   H HA   . ILE A 1 369 ? 0.034   1.978   18.589  1.00 0.00 ? 369 ILE A HA   1  
ATOM 5709   H HB   . ILE A 1 369 ? 2.797   0.789   18.142  1.00 0.00 ? 369 ILE A HB   1  
ATOM 5710   H HG12 . ILE A 1 369 ? 1.679   3.456   17.310  1.00 0.00 ? 369 ILE A HG12 1  
ATOM 5711   H HG13 . ILE A 1 369 ? 2.603   3.202   18.779  1.00 0.00 ? 369 ILE A HG13 1  
ATOM 5712   H HG21 . ILE A 1 369 ? 0.671   1.497   16.138  1.00 0.00 ? 369 ILE A HG21 1  
ATOM 5713   H HG22 . ILE A 1 369 ? 1.404   -0.083  16.415  1.00 0.00 ? 369 ILE A HG22 1  
ATOM 5714   H HG23 . ILE A 1 369 ? 2.365   1.229   15.732  1.00 0.00 ? 369 ILE A HG23 1  
ATOM 5715   H HD11 . ILE A 1 369 ? 4.277   3.899   17.380  1.00 0.00 ? 369 ILE A HD11 1  
ATOM 5716   H HD12 . ILE A 1 369 ? 3.505   3.227   15.943  1.00 0.00 ? 369 ILE A HD12 1  
ATOM 5717   H HD13 . ILE A 1 369 ? 4.352   2.165   17.070  1.00 0.00 ? 369 ILE A HD13 1  
ATOM 5718   N N    . LEU A 1 370 ? 0.992   -1.134  19.120  1.00 0.00 ? 370 LEU A N    1  
ATOM 5719   C CA   . LEU A 1 370 ? 0.538   -2.459  19.240  1.00 0.00 ? 370 LEU A CA   1  
ATOM 5720   C C    . LEU A 1 370 ? -0.719  -2.543  20.129  1.00 0.00 ? 370 LEU A C    1  
ATOM 5721   O O    . LEU A 1 370 ? -1.687  -3.227  19.758  1.00 0.00 ? 370 LEU A O    1  
ATOM 5722   C CB   . LEU A 1 370 ? 1.655   -3.297  19.820  1.00 0.00 ? 370 LEU A CB   1  
ATOM 5723   C CG   . LEU A 1 370 ? 1.311   -4.767  19.948  1.00 0.00 ? 370 LEU A CG   1  
ATOM 5724   C CD1  . LEU A 1 370 ? 0.977   -5.330  18.569  1.00 0.00 ? 370 LEU A CD1  1  
ATOM 5725   C CD2  . LEU A 1 370 ? 2.417   -5.502  20.659  1.00 0.00 ? 370 LEU A CD2  1  
ATOM 5726   H H    . LEU A 1 370 ? 1.893   -0.912  19.436  1.00 0.00 ? 370 LEU A H    1  
ATOM 5727   H HA   . LEU A 1 370 ? 0.298   -2.837  18.259  1.00 0.00 ? 370 LEU A HA   1  
ATOM 5728   H HB2  . LEU A 1 370 ? 2.522   -3.203  19.185  1.00 0.00 ? 370 LEU A HB2  1  
ATOM 5729   H HB3  . LEU A 1 370 ? 1.902   -2.910  20.799  1.00 0.00 ? 370 LEU A HB3  1  
ATOM 5730   H HG   . LEU A 1 370 ? 0.414   -4.839  20.552  1.00 0.00 ? 370 LEU A HG   1  
ATOM 5731   H HD11 . LEU A 1 370 ? -0.080  -5.212  18.379  1.00 0.00 ? 370 LEU A HD11 1  
ATOM 5732   H HD12 . LEU A 1 370 ? 1.235   -6.378  18.537  1.00 0.00 ? 370 LEU A HD12 1  
ATOM 5733   H HD13 . LEU A 1 370 ? 1.540   -4.797  17.817  1.00 0.00 ? 370 LEU A HD13 1  
ATOM 5734   H HD21 . LEU A 1 370 ? 2.085   -6.500  20.908  1.00 0.00 ? 370 LEU A HD21 1  
ATOM 5735   H HD22 . LEU A 1 370 ? 2.678   -4.973  21.564  1.00 0.00 ? 370 LEU A HD22 1  
ATOM 5736   H HD23 . LEU A 1 370 ? 3.282   -5.563  20.015  1.00 0.00 ? 370 LEU A HD23 1  
ATOM 5737   N N    . ARG A 1 371 ? -0.719  -1.848  21.269  1.00 0.00 ? 371 ARG A N    1  
ATOM 5738   C CA   . ARG A 1 371 ? -1.806  -1.976  22.223  1.00 0.00 ? 371 ARG A CA   1  
ATOM 5739   C C    . ARG A 1 371 ? -3.146  -1.399  21.728  1.00 0.00 ? 371 ARG A C    1  
ATOM 5740   O O    . ARG A 1 371 ? -4.178  -2.087  21.766  1.00 0.00 ? 371 ARG A O    1  
ATOM 5741   C CB   . ARG A 1 371 ? -1.432  -1.333  23.537  1.00 0.00 ? 371 ARG A CB   1  
ATOM 5742   C CG   . ARG A 1 371 ? -2.579  -1.334  24.529  1.00 0.00 ? 371 ARG A CG   1  
ATOM 5743   C CD   . ARG A 1 371 ? -2.149  -0.770  25.868  1.00 0.00 ? 371 ARG A CD   1  
ATOM 5744   N NE   . ARG A 1 371 ? -3.258  -0.761  26.818  1.00 0.00 ? 371 ARG A NE   1  
ATOM 5745   C CZ   . ARG A 1 371 ? -4.107  0.261   26.984  1.00 0.00 ? 371 ARG A CZ   1  
ATOM 5746   N NH1  . ARG A 1 371 ? -4.019  1.395   26.270  1.00 0.00 ? 371 ARG A NH1  1  
ATOM 5747   N NH2  . ARG A 1 371 ? -5.055  0.147   27.892  1.00 0.00 ? 371 ARG A NH2  1  
ATOM 5748   H H    . ARG A 1 371 ? 0.067   -1.312  21.505  1.00 0.00 ? 371 ARG A H    1  
ATOM 5749   H HA   . ARG A 1 371 ? -1.954  -3.029  22.408  1.00 0.00 ? 371 ARG A HA   1  
ATOM 5750   H HB2  . ARG A 1 371 ? -0.600  -1.872  23.965  1.00 0.00 ? 371 ARG A HB2  1  
ATOM 5751   H HB3  . ARG A 1 371 ? -1.128  -0.312  23.352  1.00 0.00 ? 371 ARG A HB3  1  
ATOM 5752   H HG2  . ARG A 1 371 ? -3.387  -0.734  24.136  1.00 0.00 ? 371 ARG A HG2  1  
ATOM 5753   H HG3  . ARG A 1 371 ? -2.925  -2.348  24.667  1.00 0.00 ? 371 ARG A HG3  1  
ATOM 5754   H HD2  . ARG A 1 371 ? -1.349  -1.374  26.268  1.00 0.00 ? 371 ARG A HD2  1  
ATOM 5755   H HD3  . ARG A 1 371 ? -1.792  0.241   25.728  1.00 0.00 ? 371 ARG A HD3  1  
ATOM 5756   H HE   . ARG A 1 371 ? -3.385  -1.555  27.377  1.00 0.00 ? 371 ARG A HE   1  
ATOM 5757   H HH11 . ARG A 1 371 ? -3.299  1.499   25.583  1.00 0.00 ? 371 ARG A HH11 1  
ATOM 5758   H HH12 . ARG A 1 371 ? -4.673  2.135   26.424  1.00 0.00 ? 371 ARG A HH12 1  
ATOM 5759   H HH21 . ARG A 1 371 ? -5.128  -0.688  28.437  1.00 0.00 ? 371 ARG A HH21 1  
ATOM 5760   H HH22 . ARG A 1 371 ? -5.702  0.896   28.035  1.00 0.00 ? 371 ARG A HH22 1  
ATOM 5761   N N    . ASP A 1 372 ? -3.103  -0.143  21.264  1.00 0.00 ? 372 ASP A N    1  
ATOM 5762   C CA   . ASP A 1 372 ? -4.258  0.518   20.718  1.00 0.00 ? 372 ASP A CA   1  
ATOM 5763   C C    . ASP A 1 372 ? -4.819  -0.398  19.707  1.00 0.00 ? 372 ASP A C    1  
ATOM 5764   O O    . ASP A 1 372 ? -6.025  -0.674  19.727  1.00 0.00 ? 372 ASP A O    1  
ATOM 5765   C CB   . ASP A 1 372 ? -3.882  1.789   19.958  1.00 0.00 ? 372 ASP A CB   1  
ATOM 5766   C CG   . ASP A 1 372 ? -3.446  2.908   20.857  1.00 0.00 ? 372 ASP A CG   1  
ATOM 5767   O OD1  . ASP A 1 372 ? -3.678  2.769   22.088  1.00 0.00 ? 372 ASP A OD1  1  
ATOM 5768   O OD2  . ASP A 1 372 ? -2.828  3.885   20.336  1.00 0.00 ? 372 ASP A OD2  1  
ATOM 5769   H H    . ASP A 1 372 ? -2.245  0.331   21.264  1.00 0.00 ? 372 ASP A H    1  
ATOM 5770   H HA   . ASP A 1 372 ? -4.982  0.735   21.488  1.00 0.00 ? 372 ASP A HA   1  
ATOM 5771   H HB2  . ASP A 1 372 ? -3.076  1.561   19.278  1.00 0.00 ? 372 ASP A HB2  1  
ATOM 5772   H HB3  . ASP A 1 372 ? -4.738  2.114   19.383  1.00 0.00 ? 372 ASP A HB3  1  
ATOM 5773   N N    . GLN A 1 373 ? -3.956  -0.856  18.794  1.00 0.00 ? 373 GLN A N    1  
ATOM 5774   C CA   . GLN A 1 373 ? -4.457  -1.635  17.664  1.00 0.00 ? 373 GLN A CA   1  
ATOM 5775   C C    . GLN A 1 373 ? -5.067  -2.946  18.105  1.00 0.00 ? 373 GLN A C    1  
ATOM 5776   O O    . GLN A 1 373 ? -6.191  -3.225  17.786  1.00 0.00 ? 373 GLN A O    1  
ATOM 5777   C CB   . GLN A 1 373 ? -3.414  -1.876  16.567  1.00 0.00 ? 373 GLN A CB   1  
ATOM 5778   C CG   . GLN A 1 373 ? -4.003  -2.682  15.383  1.00 0.00 ? 373 GLN A CG   1  
ATOM 5779   C CD   . GLN A 1 373 ? -3.045  -2.845  14.224  1.00 0.00 ? 373 GLN A CD   1  
ATOM 5780   O OE1  . GLN A 1 373 ? -1.816  -2.878  14.394  1.00 0.00 ? 373 GLN A OE1  1  
ATOM 5781   N NE2  . GLN A 1 373 ? -3.601  -2.952  13.027  1.00 0.00 ? 373 GLN A NE2  1  
ATOM 5782   H H    . GLN A 1 373 ? -3.016  -0.580  18.823  1.00 0.00 ? 373 GLN A H    1  
ATOM 5783   H HA   . GLN A 1 373 ? -5.255  -1.055  17.220  1.00 0.00 ? 373 GLN A HA   1  
ATOM 5784   H HB2  . GLN A 1 373 ? -3.060  -0.923  16.203  1.00 0.00 ? 373 GLN A HB2  1  
ATOM 5785   H HB3  . GLN A 1 373 ? -2.583  -2.423  16.987  1.00 0.00 ? 373 GLN A HB3  1  
ATOM 5786   H HG2  . GLN A 1 373 ? -4.281  -3.662  15.737  1.00 0.00 ? 373 GLN A HG2  1  
ATOM 5787   H HG3  . GLN A 1 373 ? -4.893  -2.177  15.032  1.00 0.00 ? 373 GLN A HG3  1  
ATOM 5788   H HE21 . GLN A 1 373 ? -4.577  -2.922  12.936  1.00 0.00 ? 373 GLN A HE21 1  
ATOM 5789   H HE22 . GLN A 1 373 ? -3.037  -3.060  12.233  1.00 0.00 ? 373 GLN A HE22 1  
ATOM 5790   N N    . LEU A 1 374 ? -4.330  -3.762  18.847  1.00 0.00 ? 374 LEU A N    1  
ATOM 5791   C CA   . LEU A 1 374 ? -4.881  -5.050  19.243  1.00 0.00 ? 374 LEU A CA   1  
ATOM 5792   C C    . LEU A 1 374 ? -6.145  -4.902  20.063  1.00 0.00 ? 374 LEU A C    1  
ATOM 5793   O O    . LEU A 1 374 ? -7.129  -5.603  19.814  1.00 0.00 ? 374 LEU A O    1  
ATOM 5794   C CB   . LEU A 1 374 ? -3.859  -5.859  19.985  1.00 0.00 ? 374 LEU A CB   1  
ATOM 5795   C CG   . LEU A 1 374 ? -2.776  -6.393  19.060  1.00 0.00 ? 374 LEU A CG   1  
ATOM 5796   C CD1  . LEU A 1 374 ? -1.644  -7.000  19.938  1.00 0.00 ? 374 LEU A CD1  1  
ATOM 5797   C CD2  . LEU A 1 374 ? -3.372  -7.404  18.016  1.00 0.00 ? 374 LEU A CD2  1  
ATOM 5798   H H    . LEU A 1 374 ? -3.416  -3.515  19.098  1.00 0.00 ? 374 LEU A H    1  
ATOM 5799   H HA   . LEU A 1 374 ? -5.137  -5.588  18.341  1.00 0.00 ? 374 LEU A HA   1  
ATOM 5800   H HB2  . LEU A 1 374 ? -3.400  -5.237  20.739  1.00 0.00 ? 374 LEU A HB2  1  
ATOM 5801   H HB3  . LEU A 1 374 ? -4.353  -6.691  20.467  1.00 0.00 ? 374 LEU A HB3  1  
ATOM 5802   H HG   . LEU A 1 374 ? -2.358  -5.550  18.522  1.00 0.00 ? 374 LEU A HG   1  
ATOM 5803   H HD11 . LEU A 1 374 ? -2.004  -7.900  20.417  1.00 0.00 ? 374 LEU A HD11 1  
ATOM 5804   H HD12 . LEU A 1 374 ? -1.349  -6.284  20.691  1.00 0.00 ? 374 LEU A HD12 1  
ATOM 5805   H HD13 . LEU A 1 374 ? -0.794  -7.239  19.315  1.00 0.00 ? 374 LEU A HD13 1  
ATOM 5806   H HD21 . LEU A 1 374 ? -4.325  -7.771  18.372  1.00 0.00 ? 374 LEU A HD21 1  
ATOM 5807   H HD22 . LEU A 1 374 ? -2.693  -8.234  17.889  1.00 0.00 ? 374 LEU A HD22 1  
ATOM 5808   H HD23 . LEU A 1 374 ? -3.510  -6.904  17.068  1.00 0.00 ? 374 LEU A HD23 1  
ATOM 5809   N N    . ARG A 1 375 ? -6.112  -3.997  21.039  1.00 0.00 ? 375 ARG A N    1  
ATOM 5810   C CA   . ARG A 1 375 ? -7.315  -3.530  21.717  1.00 0.00 ? 375 ARG A CA   1  
ATOM 5811   C C    . ARG A 1 375 ? -8.500  -3.284  20.732  1.00 0.00 ? 375 ARG A C    1  
ATOM 5812   O O    . ARG A 1 375 ? -9.574  -3.932  20.849  1.00 0.00 ? 375 ARG A O    1  
ATOM 5813   C CB   . ARG A 1 375 ? -7.019  -2.250  22.532  1.00 0.00 ? 375 ARG A CB   1  
ATOM 5814   C CG   . ARG A 1 375 ? -6.273  -2.489  23.860  1.00 0.00 ? 375 ARG A CG   1  
ATOM 5815   C CD   . ARG A 1 375 ? -6.139  -1.156  24.649  1.00 0.00 ? 375 ARG A CD   1  
ATOM 5816   N NE   . ARG A 1 375 ? -7.446  -0.690  25.093  1.00 0.00 ? 375 ARG A NE   1  
ATOM 5817   C CZ   . ARG A 1 375 ? -8.060  -1.159  26.177  1.00 0.00 ? 375 ARG A CZ   1  
ATOM 5818   N NH1  . ARG A 1 375 ? -7.465  -2.070  26.926  1.00 0.00 ? 375 ARG A NH1  1  
ATOM 5819   N NH2  . ARG A 1 375 ? -9.256  -0.735  26.523  1.00 0.00 ? 375 ARG A NH2  1  
ATOM 5820   H H    . ARG A 1 375 ? -5.283  -3.491  21.172  1.00 0.00 ? 375 ARG A H    1  
ATOM 5821   H HA   . ARG A 1 375 ? -7.620  -4.300  22.411  1.00 0.00 ? 375 ARG A HA   1  
ATOM 5822   H HB2  . ARG A 1 375 ? -6.422  -1.589  21.924  1.00 0.00 ? 375 ARG A HB2  1  
ATOM 5823   H HB3  . ARG A 1 375 ? -7.958  -1.759  22.747  1.00 0.00 ? 375 ARG A HB3  1  
ATOM 5824   H HG2  . ARG A 1 375 ? -6.822  -3.204  24.455  1.00 0.00 ? 375 ARG A HG2  1  
ATOM 5825   H HG3  . ARG A 1 375 ? -5.287  -2.878  23.651  1.00 0.00 ? 375 ARG A HG3  1  
ATOM 5826   H HD2  . ARG A 1 375 ? -5.509  -1.314  25.510  1.00 0.00 ? 375 ARG A HD2  1  
ATOM 5827   H HD3  . ARG A 1 375 ? -5.688  -0.409  24.011  1.00 0.00 ? 375 ARG A HD3  1  
ATOM 5828   H HE   . ARG A 1 375 ? -7.901  -0.006  24.560  1.00 0.00 ? 375 ARG A HE   1  
ATOM 5829   H HH11 . ARG A 1 375 ? -6.556  -2.405  26.679  1.00 0.00 ? 375 ARG A HH11 1  
ATOM 5830   H HH12 . ARG A 1 375 ? -7.923  -2.425  27.741  1.00 0.00 ? 375 ARG A HH12 1  
ATOM 5831   H HH21 . ARG A 1 375 ? -9.722  -0.047  25.968  1.00 0.00 ? 375 ARG A HH21 1  
ATOM 5832   H HH22 . ARG A 1 375 ? -9.699  -1.101  27.341  1.00 0.00 ? 375 ARG A HH22 1  
ATOM 5833   N N    . ALA A 1 376 ? -8.287  -2.376  19.773  1.00 0.00 ? 376 ALA A N    1  
ATOM 5834   C CA   . ALA A 1 376 ? -9.284  -2.091  18.766  1.00 0.00 ? 376 ALA A CA   1  
ATOM 5835   C C    . ALA A 1 376 ? -9.759  -3.327  18.006  1.00 0.00 ? 376 ALA A C    1  
ATOM 5836   O O    . ALA A 1 376 ? -10.970 -3.501  17.821  1.00 0.00 ? 376 ALA A O    1  
ATOM 5837   C CB   . ALA A 1 376 ? -8.785  -1.058  17.821  1.00 0.00 ? 376 ALA A CB   1  
ATOM 5838   H H    . ALA A 1 376 ? -7.422  -1.918  19.732  1.00 0.00 ? 376 ALA A H    1  
ATOM 5839   H HA   . ALA A 1 376 ? -10.143 -1.676  19.273  1.00 0.00 ? 376 ALA A HA   1  
ATOM 5840   H HB1  . ALA A 1 376 ? -7.858  -1.392  17.379  1.00 0.00 ? 376 ALA A HB1  1  
ATOM 5841   H HB2  . ALA A 1 376 ? -8.618  -0.133  18.355  1.00 0.00 ? 376 ALA A HB2  1  
ATOM 5842   H HB3  . ALA A 1 376 ? -9.516  -0.898  17.043  1.00 0.00 ? 376 ALA A HB3  1  
ATOM 5843   N N    . ILE A 1 377 ? -8.847  -4.188  17.562  1.00 0.00 ? 377 ILE A N    1  
ATOM 5844   C CA   . ILE A 1 377 ? -9.262  -5.372  16.810  1.00 0.00 ? 377 ILE A CA   1  
ATOM 5845   C C    . ILE A 1 377 ? -10.156 -6.205  17.716  1.00 0.00 ? 377 ILE A C    1  
ATOM 5846   O O    . ILE A 1 377 ? -11.319 -6.471  17.373  1.00 0.00 ? 377 ILE A O    1  
ATOM 5847   C CB   . ILE A 1 377 ? -8.084  -6.268  16.273  1.00 0.00 ? 377 ILE A CB   1  
ATOM 5848   C CG1  . ILE A 1 377 ? -7.260  -5.539  15.195  1.00 0.00 ? 377 ILE A CG1  1  
ATOM 5849   C CG2  . ILE A 1 377 ? -8.617  -7.639  15.750  1.00 0.00 ? 377 ILE A CG2  1  
ATOM 5850   C CD1  . ILE A 1 377 ? -5.913  -6.237  14.831  1.00 0.00 ? 377 ILE A CD1  1  
ATOM 5851   H H    . ILE A 1 377 ? -7.895  -4.021  17.726  1.00 0.00 ? 377 ILE A H    1  
ATOM 5852   H HA   . ILE A 1 377 ? -9.854  -5.042  15.966  1.00 0.00 ? 377 ILE A HA   1  
ATOM 5853   H HB   . ILE A 1 377 ? -7.431  -6.477  17.113  1.00 0.00 ? 377 ILE A HB   1  
ATOM 5854   H HG12 . ILE A 1 377 ? -7.856  -5.466  14.299  1.00 0.00 ? 377 ILE A HG12 1  
ATOM 5855   H HG13 . ILE A 1 377 ? -7.046  -4.539  15.547  1.00 0.00 ? 377 ILE A HG13 1  
ATOM 5856   H HG21 . ILE A 1 377 ? -9.659  -7.543  15.483  1.00 0.00 ? 377 ILE A HG21 1  
ATOM 5857   H HG22 . ILE A 1 377 ? -8.512  -8.385  16.524  1.00 0.00 ? 377 ILE A HG22 1  
ATOM 5858   H HG23 . ILE A 1 377 ? -8.048  -7.939  14.882  1.00 0.00 ? 377 ILE A HG23 1  
ATOM 5859   H HD11 . ILE A 1 377 ? -5.345  -6.413  15.733  1.00 0.00 ? 377 ILE A HD11 1  
ATOM 5860   H HD12 . ILE A 1 377 ? -5.346  -5.602  14.167  1.00 0.00 ? 377 ILE A HD12 1  
ATOM 5861   H HD13 . ILE A 1 377 ? -6.117  -7.179  14.342  1.00 0.00 ? 377 ILE A HD13 1  
ATOM 5862   N N    . LEU A 1 378 ? -9.641  -6.568  18.883  1.00 0.00 ? 378 LEU A N    1  
ATOM 5863   C CA   . LEU A 1 378 ? -10.414 -7.396  19.781  1.00 0.00 ? 378 LEU A CA   1  
ATOM 5864   C C    . LEU A 1 378 ? -11.805 -6.826  19.962  1.00 0.00 ? 378 LEU A C    1  
ATOM 5865   O O    . LEU A 1 378 ? -12.817 -7.539  19.808  1.00 0.00 ? 378 LEU A O    1  
ATOM 5866   C CB   . LEU A 1 378 ? -9.712  -7.544  21.131  1.00 0.00 ? 378 LEU A CB   1  
ATOM 5867   C CG   . LEU A 1 378 ? -8.477  -8.412  20.987  1.00 0.00 ? 378 LEU A CG   1  
ATOM 5868   C CD1  . LEU A 1 378 ? -7.594  -8.322  22.230  1.00 0.00 ? 378 LEU A CD1  1  
ATOM 5869   C CD2  . LEU A 1 378 ? -8.865  -9.865  20.628  1.00 0.00 ? 378 LEU A CD2  1  
ATOM 5870   H H    . LEU A 1 378 ? -8.730  -6.300  19.123  1.00 0.00 ? 378 LEU A H    1  
ATOM 5871   H HA   . LEU A 1 378 ? -10.507 -8.377  19.339  1.00 0.00 ? 378 LEU A HA   1  
ATOM 5872   H HB2  . LEU A 1 378 ? -9.423  -6.568  21.493  1.00 0.00 ? 378 LEU A HB2  1  
ATOM 5873   H HB3  . LEU A 1 378 ? -10.389 -8.001  21.837  1.00 0.00 ? 378 LEU A HB3  1  
ATOM 5874   H HG   . LEU A 1 378 ? -7.901  -8.012  20.161  1.00 0.00 ? 378 LEU A HG   1  
ATOM 5875   H HD11 . LEU A 1 378 ? -8.143  -8.682  23.088  1.00 0.00 ? 378 LEU A HD11 1  
ATOM 5876   H HD12 . LEU A 1 378 ? -7.305  -7.294  22.394  1.00 0.00 ? 378 LEU A HD12 1  
ATOM 5877   H HD13 . LEU A 1 378 ? -6.710  -8.926  22.089  1.00 0.00 ? 378 LEU A HD13 1  
ATOM 5878   H HD21 . LEU A 1 378 ? -8.721  -10.024 19.569  1.00 0.00 ? 378 LEU A HD21 1  
ATOM 5879   H HD22 . LEU A 1 378 ? -9.902  -10.033 20.879  1.00 0.00 ? 378 LEU A HD22 1  
ATOM 5880   H HD23 . LEU A 1 378 ? -8.244  -10.551 21.185  1.00 0.00 ? 378 LEU A HD23 1  
ATOM 5881   N N    . ARG A 1 379 ? -11.874 -5.544  20.257  1.00 0.00 ? 379 ARG A N    1  
ATOM 5882   C CA   . ARG A 1 379 ? -13.148 -4.977  20.563  1.00 0.00 ? 379 ARG A CA   1  
ATOM 5883   C C    . ARG A 1 379 ? -14.035 -5.073  19.338  1.00 0.00 ? 379 ARG A C    1  
ATOM 5884   O O    . ARG A 1 379 ? -15.236 -5.328  19.461  1.00 0.00 ? 379 ARG A O    1  
ATOM 5885   C CB   . ARG A 1 379 ? -13.007 -3.519  20.961  1.00 0.00 ? 379 ARG A CB   1  
ATOM 5886   C CG   . ARG A 1 379 ? -12.370 -3.289  22.276  1.00 0.00 ? 379 ARG A CG   1  
ATOM 5887   C CD   . ARG A 1 379 ? -12.218 -1.813  22.477  1.00 0.00 ? 379 ARG A CD   1  
ATOM 5888   N NE   . ARG A 1 379 ? -13.539 -1.185  22.514  1.00 0.00 ? 379 ARG A NE   1  
ATOM 5889   C CZ   . ARG A 1 379 ? -13.765 0.116   22.540  1.00 0.00 ? 379 ARG A CZ   1  
ATOM 5890   N NH1  . ARG A 1 379 ? -12.764 0.972   22.521  1.00 0.00 ? 379 ARG A NH1  1  
ATOM 5891   N NH2  . ARG A 1 379 ? -15.008 0.540   22.567  1.00 0.00 ? 379 ARG A NH2  1  
ATOM 5892   H H    . ARG A 1 379 ? -11.057 -5.010  20.349  1.00 0.00 ? 379 ARG A H    1  
ATOM 5893   H HA   . ARG A 1 379 ? -13.599 -5.526  21.376  1.00 0.00 ? 379 ARG A HA   1  
ATOM 5894   H HB2  . ARG A 1 379 ? -12.417 -3.017  20.211  1.00 0.00 ? 379 ARG A HB2  1  
ATOM 5895   H HB3  . ARG A 1 379 ? -13.993 -3.074  20.970  1.00 0.00 ? 379 ARG A HB3  1  
ATOM 5896   H HG2  . ARG A 1 379 ? -12.992 -3.703  23.057  1.00 0.00 ? 379 ARG A HG2  1  
ATOM 5897   H HG3  . ARG A 1 379 ? -11.398 -3.758  22.296  1.00 0.00 ? 379 ARG A HG3  1  
ATOM 5898   H HD2  . ARG A 1 379 ? -11.705 -1.628  23.410  1.00 0.00 ? 379 ARG A HD2  1  
ATOM 5899   H HD3  . ARG A 1 379 ? -11.643 -1.396  21.663  1.00 0.00 ? 379 ARG A HD3  1  
ATOM 5900   H HE   . ARG A 1 379 ? -14.320 -1.778  22.518  1.00 0.00 ? 379 ARG A HE   1  
ATOM 5901   H HH11 . ARG A 1 379 ? -11.822 0.639   22.486  1.00 0.00 ? 379 ARG A HH11 1  
ATOM 5902   H HH12 . ARG A 1 379 ? -12.947 1.955   22.541  1.00 0.00 ? 379 ARG A HH12 1  
ATOM 5903   H HH21 . ARG A 1 379 ? -15.761 -0.118  22.568  1.00 0.00 ? 379 ARG A HH21 1  
ATOM 5904   H HH22 . ARG A 1 379 ? -15.201 1.521   22.587  1.00 0.00 ? 379 ARG A HH22 1  
ATOM 5905   N N    . ALA A 1 380 ? -13.458 -4.851  18.147  1.00 0.00 ? 380 ALA A N    1  
ATOM 5906   C CA   . ALA A 1 380 ? -14.245 -4.950  16.911  1.00 0.00 ? 380 ALA A CA   1  
ATOM 5907   C C    . ALA A 1 380 ? -14.761 -6.368  16.668  1.00 0.00 ? 380 ALA A C    1  
ATOM 5908   O O    . ALA A 1 380 ? -15.770 -6.537  15.999  1.00 0.00 ? 380 ALA A O    1  
ATOM 5909   C CB   . ALA A 1 380 ? -13.433 -4.496  15.747  1.00 0.00 ? 380 ALA A CB   1  
ATOM 5910   H H    . ALA A 1 380 ? -12.503 -4.638  18.101  1.00 0.00 ? 380 ALA A H    1  
ATOM 5911   H HA   . ALA A 1 380 ? -15.098 -4.294  17.004  1.00 0.00 ? 380 ALA A HA   1  
ATOM 5912   H HB1  . ALA A 1 380 ? -13.045 -3.507  15.942  1.00 0.00 ? 380 ALA A HB1  1  
ATOM 5913   H HB2  . ALA A 1 380 ? -14.054 -4.472  14.862  1.00 0.00 ? 380 ALA A HB2  1  
ATOM 5914   H HB3  . ALA A 1 380 ? -12.612 -5.180  15.592  1.00 0.00 ? 380 ALA A HB3  1  
ATOM 5915   N N    . SER A 1 381 ? -14.079 -7.379  17.227  1.00 0.00 ? 381 SER A N    1  
ATOM 5916   C CA   . SER A 1 381 ? -14.472 -8.760  17.042  1.00 0.00 ? 381 SER A CA   1  
ATOM 5917   C C    . SER A 1 381 ? -15.775 -9.061  17.749  1.00 0.00 ? 381 SER A C    1  
ATOM 5918   O O    . SER A 1 381 ? -16.302 -10.155 17.647  1.00 0.00 ? 381 SER A O    1  
ATOM 5919   C CB   . SER A 1 381 ? -13.369 -9.713  17.545  1.00 0.00 ? 381 SER A CB   1  
ATOM 5920   O OG   . SER A 1 381 ? -13.218 -9.690  18.969  1.00 0.00 ? 381 SER A OG   1  
ATOM 5921   H H    . SER A 1 381 ? -13.285 -7.178  17.765  1.00 0.00 ? 381 SER A H    1  
ATOM 5922   H HA   . SER A 1 381 ? -14.611 -8.934  15.986  1.00 0.00 ? 381 SER A HA   1  
ATOM 5923   H HB2  . SER A 1 381 ? -13.613 -10.718 17.247  1.00 0.00 ? 381 SER A HB2  1  
ATOM 5924   H HB3  . SER A 1 381 ? -12.432 -9.434  17.077  1.00 0.00 ? 381 SER A HB3  1  
ATOM 5925   H HG   . SER A 1 381 ? -12.280 -9.645  19.167  1.00 0.00 ? 381 SER A HG   1  
ATOM 5926   N N    . ALA A 1 382 ? -16.275 -8.109  18.523  1.00 0.00 ? 382 ALA A N    1  
ATOM 5927   C CA   . ALA A 1 382 ? -17.569 -8.297  19.147  1.00 0.00 ? 382 ALA A CA   1  
ATOM 5928   C C    . ALA A 1 382 ? -18.645 -8.067  18.121  1.00 0.00 ? 382 ALA A C    1  
ATOM 5929   O O    . ALA A 1 382 ? -19.824 -8.175  18.450  1.00 0.00 ? 382 ALA A O    1  
ATOM 5930   C CB   . ALA A 1 382 ? -17.758 -7.350  20.320  1.00 0.00 ? 382 ALA A CB   1  
ATOM 5931   H H    . ALA A 1 382 ? -15.804 -7.255  18.618  1.00 0.00 ? 382 ALA A H    1  
ATOM 5932   H HA   . ALA A 1 382 ? -17.639 -9.314  19.504  1.00 0.00 ? 382 ALA A HA   1  
ATOM 5933   H HB1  . ALA A 1 382 ? -18.706 -7.552  20.797  1.00 0.00 ? 382 ALA A HB1  1  
ATOM 5934   H HB2  . ALA A 1 382 ? -17.743 -6.330  19.965  1.00 0.00 ? 382 ALA A HB2  1  
ATOM 5935   H HB3  . ALA A 1 382 ? -16.959 -7.495  21.032  1.00 0.00 ? 382 ALA A HB3  1  
ATOM 5936   N N    . PHE A 1 383 ? -18.253 -7.766  16.882  1.00 0.00 ? 383 PHE A N    1  
ATOM 5937   C CA   . PHE A 1 383 ? -19.214 -7.302  15.886  1.00 0.00 ? 383 PHE A CA   1  
ATOM 5938   C C    . PHE A 1 383 ? -19.196 -8.025  14.571  1.00 0.00 ? 383 PHE A C    1  
ATOM 5939   O O    . PHE A 1 383 ? -19.935 -7.627  13.657  1.00 0.00 ? 383 PHE A O    1  
ATOM 5940   C CB   . PHE A 1 383 ? -19.066 -5.795  15.629  1.00 0.00 ? 383 PHE A CB   1  
ATOM 5941   C CG   . PHE A 1 383 ? -19.325 -4.992  16.817  1.00 0.00 ? 383 PHE A CG   1  
ATOM 5942   C CD1  . PHE A 1 383 ? -20.618 -4.632  17.142  1.00 0.00 ? 383 PHE A CD1  1  
ATOM 5943   C CD2  . PHE A 1 383 ? -18.298 -4.650  17.660  1.00 0.00 ? 383 PHE A CD2  1  
ATOM 5944   C CE1  . PHE A 1 383 ? -20.893 -3.897  18.332  1.00 0.00 ? 383 PHE A CE1  1  
ATOM 5945   C CE2  . PHE A 1 383 ? -18.543 -3.927  18.845  1.00 0.00 ? 383 PHE A CE2  1  
ATOM 5946   C CZ   . PHE A 1 383 ? -19.853 -3.549  19.187  1.00 0.00 ? 383 PHE A CZ   1  
ATOM 5947   H H    . PHE A 1 383 ? -17.295 -7.708  16.685  1.00 0.00 ? 383 PHE A H    1  
ATOM 5948   H HA   . PHE A 1 383 ? -20.196 -7.447  16.309  1.00 0.00 ? 383 PHE A HA   1  
ATOM 5949   H HB2  . PHE A 1 383 ? -18.061 -5.596  15.291  1.00 0.00 ? 383 PHE A HB2  1  
ATOM 5950   H HB3  . PHE A 1 383 ? -19.757 -5.507  14.849  1.00 0.00 ? 383 PHE A HB3  1  
ATOM 5951   H HD1  . PHE A 1 383 ? -21.428 -4.900  16.481  1.00 0.00 ? 383 PHE A HD1  1  
ATOM 5952   H HD2  . PHE A 1 383 ? -17.286 -4.931  17.407  1.00 0.00 ? 383 PHE A HD2  1  
ATOM 5953   H HE1  . PHE A 1 383 ? -21.909 -3.618  18.573  1.00 0.00 ? 383 PHE A HE1  1  
ATOM 5954   H HE2  . PHE A 1 383 ? -17.721 -3.667  19.496  1.00 0.00 ? 383 PHE A HE2  1  
ATOM 5955   H HZ   . PHE A 1 383 ? -20.048 -2.994  20.094  1.00 0.00 ? 383 PHE A HZ   1  
ATOM 5956   N N    . GLY A 1 384 ? -18.362 -9.057  14.453  1.00 0.00 ? 384 GLY A N    1  
ATOM 5957   C CA   . GLY A 1 384 ? -18.290 -9.814  13.226  1.00 0.00 ? 384 GLY A CA   1  
ATOM 5958   C C    . GLY A 1 384 ? -17.118 -10.725 13.331  1.00 0.00 ? 384 GLY A C    1  
ATOM 5959   O O    . GLY A 1 384 ? -16.259 -10.477 14.156  1.00 0.00 ? 384 GLY A O    1  
ATOM 5960   H H    . GLY A 1 384 ? -17.795 -9.310  15.211  1.00 0.00 ? 384 GLY A H    1  
ATOM 5961   H HA2  . GLY A 1 384 ? -19.197 -10.390 13.097  1.00 0.00 ? 384 GLY A HA2  1  
ATOM 5962   H HA3  . GLY A 1 384 ? -18.155 -9.147  12.389  1.00 0.00 ? 384 GLY A HA3  1  
ATOM 5963   N N    . LYS A 1 385 ? -17.062 -11.789 12.517  1.00 0.00 ? 385 LYS A N    1  
ATOM 5964   C CA   . LYS A 1 385 ? -15.921 -12.710 12.609  1.00 0.00 ? 385 LYS A CA   1  
ATOM 5965   C C    . LYS A 1 385 ? -14.616 -12.043 12.151  1.00 0.00 ? 385 LYS A C    1  
ATOM 5966   O O    . LYS A 1 385 ? -14.412 -11.763 10.974  1.00 0.00 ? 385 LYS A O    1  
ATOM 5967   C CB   . LYS A 1 385 ? -16.163 -14.012 11.838  1.00 0.00 ? 385 LYS A CB   1  
ATOM 5968   C CG   . LYS A 1 385 ? -15.059 -15.038 11.992  1.00 0.00 ? 385 LYS A CG   1  
ATOM 5969   C CD   . LYS A 1 385 ? -15.311 -15.843 13.222  1.00 0.00 ? 385 LYS A CD   1  
ATOM 5970   C CE   . LYS A 1 385 ? -14.175 -16.839 13.519  1.00 0.00 ? 385 LYS A CE   1  
ATOM 5971   N NZ   . LYS A 1 385 ? -14.001 -17.869 12.424  1.00 0.00 ? 385 LYS A NZ   1  
ATOM 5972   H H    . LYS A 1 385 ? -17.780 -11.955 11.871  1.00 0.00 ? 385 LYS A H    1  
ATOM 5973   H HA   . LYS A 1 385 ? -15.801 -12.966 13.653  1.00 0.00 ? 385 LYS A HA   1  
ATOM 5974   H HB2  . LYS A 1 385 ? -17.085 -14.451 12.186  1.00 0.00 ? 385 LYS A HB2  1  
ATOM 5975   H HB3  . LYS A 1 385 ? -16.272 -13.773 10.789  1.00 0.00 ? 385 LYS A HB3  1  
ATOM 5976   H HG2  . LYS A 1 385 ? -15.046 -15.688 11.128  1.00 0.00 ? 385 LYS A HG2  1  
ATOM 5977   H HG3  . LYS A 1 385 ? -14.107 -14.534 12.079  1.00 0.00 ? 385 LYS A HG3  1  
ATOM 5978   H HD2  . LYS A 1 385 ? -15.416 -15.173 14.062  1.00 0.00 ? 385 LYS A HD2  1  
ATOM 5979   H HD3  . LYS A 1 385 ? -16.232 -16.393 13.096  1.00 0.00 ? 385 LYS A HD3  1  
ATOM 5980   H HE2  . LYS A 1 385 ? -13.252 -16.292 13.630  1.00 0.00 ? 385 LYS A HE2  1  
ATOM 5981   H HE3  . LYS A 1 385 ? -14.393 -17.347 14.448  1.00 0.00 ? 385 LYS A HE3  1  
ATOM 5982   H HZ1  . LYS A 1 385 ? -14.557 -18.717 12.654  1.00 0.00 ? 385 LYS A HZ1  1  
ATOM 5983   H HZ2  . LYS A 1 385 ? -12.995 -18.124 12.345  1.00 0.00 ? 385 LYS A HZ2  1  
ATOM 5984   H HZ3  . LYS A 1 385 ? -14.331 -17.474 11.520  1.00 0.00 ? 385 LYS A HZ3  1  
ATOM 5985   N N    . LEU A 1 386 ? -13.717 -11.816 13.094  1.00 0.00 ? 386 LEU A N    1  
ATOM 5986   C CA   . LEU A 1 386 ? -12.396 -11.293 12.780  1.00 0.00 ? 386 LEU A CA   1  
ATOM 5987   C C    . LEU A 1 386 ? -11.349 -12.296 13.210  1.00 0.00 ? 386 LEU A C    1  
ATOM 5988   O O    . LEU A 1 386 ? -11.548 -13.037 14.171  1.00 0.00 ? 386 LEU A O    1  
ATOM 5989   C CB   . LEU A 1 386 ? -12.158 -9.986  13.537  1.00 0.00 ? 386 LEU A CB   1  
ATOM 5990   C CG   . LEU A 1 386 ? -13.113 -8.829  13.318  1.00 0.00 ? 386 LEU A CG   1  
ATOM 5991   C CD1  . LEU A 1 386 ? -12.602 -7.689  14.200  1.00 0.00 ? 386 LEU A CD1  1  
ATOM 5992   C CD2  . LEU A 1 386 ? -13.075 -8.457  11.842  1.00 0.00 ? 386 LEU A CD2  1  
ATOM 5993   H H    . LEU A 1 386 ? -13.919 -12.076 14.017  1.00 0.00 ? 386 LEU A H    1  
ATOM 5994   H HA   . LEU A 1 386 ? -12.317 -11.114 11.719  1.00 0.00 ? 386 LEU A HA   1  
ATOM 5995   H HB2  . LEU A 1 386 ? -12.172 -10.213 14.589  1.00 0.00 ? 386 LEU A HB2  1  
ATOM 5996   H HB3  . LEU A 1 386 ? -11.159 -9.648  13.290  1.00 0.00 ? 386 LEU A HB3  1  
ATOM 5997   H HG   . LEU A 1 386 ? -14.114 -9.111  13.615  1.00 0.00 ? 386 LEU A HG   1  
ATOM 5998   H HD11 . LEU A 1 386 ? -13.245 -6.829  14.086  1.00 0.00 ? 386 LEU A HD11 1  
ATOM 5999   H HD12 . LEU A 1 386 ? -11.596 -7.428  13.903  1.00 0.00 ? 386 LEU A HD12 1  
ATOM 6000   H HD13 . LEU A 1 386 ? -12.601 -8.005  15.233  1.00 0.00 ? 386 LEU A HD13 1  
ATOM 6001   H HD21 . LEU A 1 386 ? -12.048 -8.411  11.509  1.00 0.00 ? 386 LEU A HD21 1  
ATOM 6002   H HD22 . LEU A 1 386 ? -13.543 -7.494  11.701  1.00 0.00 ? 386 LEU A HD22 1  
ATOM 6003   H HD23 . LEU A 1 386 ? -13.605 -9.203  11.269  1.00 0.00 ? 386 LEU A HD23 1  
ATOM 6004   N N    . ARG A 1 387 ? -10.242 -12.332 12.471  1.00 0.00 ? 387 ARG A N    1  
ATOM 6005   C CA   . ARG A 1 387 ? -9.029  -12.984 12.928  1.00 0.00 ? 387 ARG A CA   1  
ATOM 6006   C C    . ARG A 1 387 ? -7.919  -11.937 13.045  1.00 0.00 ? 387 ARG A C    1  
ATOM 6007   O O    . ARG A 1 387 ? -7.986  -10.881 12.379  1.00 0.00 ? 387 ARG A O    1  
ATOM 6008   C CB   . ARG A 1 387 ? -8.631  -14.095 11.967  1.00 0.00 ? 387 ARG A CB   1  
ATOM 6009   C CG   . ARG A 1 387 ? -9.611  -15.186 11.937  1.00 0.00 ? 387 ARG A CG   1  
ATOM 6010   C CD   . ARG A 1 387 ? -9.200  -16.412 11.097  1.00 0.00 ? 387 ARG A CD   1  
ATOM 6011   N NE   . ARG A 1 387 ? -10.250 -17.438 11.168  1.00 0.00 ? 387 ARG A NE   1  
ATOM 6012   C CZ   . ARG A 1 387 ? -11.346 -17.460 10.401  1.00 0.00 ? 387 ARG A CZ   1  
ATOM 6013   N NH1  . ARG A 1 387 ? -11.538 -16.543 9.442   1.00 0.00 ? 387 ARG A NH1  1  
ATOM 6014   N NH2  . ARG A 1 387 ? -12.247 -18.427 10.573  1.00 0.00 ? 387 ARG A NH2  1  
ATOM 6015   H H    . ARG A 1 387 ? -10.178 -11.723 11.706  1.00 0.00 ? 387 ARG A H    1  
ATOM 6016   H HA   . ARG A 1 387 ? -9.210  -13.411 13.904  1.00 0.00 ? 387 ARG A HA   1  
ATOM 6017   H HB2  . ARG A 1 387 ? -8.541  -13.683 10.974  1.00 0.00 ? 387 ARG A HB2  1  
ATOM 6018   H HB3  . ARG A 1 387 ? -7.671  -14.490 12.269  1.00 0.00 ? 387 ARG A HB3  1  
ATOM 6019   H HG2  . ARG A 1 387 ? -9.785  -15.514 12.950  1.00 0.00 ? 387 ARG A HG2  1  
ATOM 6020   H HG3  . ARG A 1 387 ? -10.539 -14.796 11.542  1.00 0.00 ? 387 ARG A HG3  1  
ATOM 6021   H HD2  . ARG A 1 387 ? -9.062  -16.114 10.068  1.00 0.00 ? 387 ARG A HD2  1  
ATOM 6022   H HD3  . ARG A 1 387 ? -8.274  -16.815 11.481  1.00 0.00 ? 387 ARG A HD3  1  
ATOM 6023   H HE   . ARG A 1 387 ? -10.145 -18.152 11.832  1.00 0.00 ? 387 ARG A HE   1  
ATOM 6024   H HH11 . ARG A 1 387 ? -10.856 -15.827 9.292   1.00 0.00 ? 387 ARG A HH11 1  
ATOM 6025   H HH12 . ARG A 1 387 ? -12.363 -16.574 8.878   1.00 0.00 ? 387 ARG A HH12 1  
ATOM 6026   H HH21 . ARG A 1 387 ? -12.101 -19.129 11.271  1.00 0.00 ? 387 ARG A HH21 1  
ATOM 6027   H HH22 . ARG A 1 387 ? -13.069 -18.451 10.005  1.00 0.00 ? 387 ARG A HH22 1  
ATOM 6028   N N    . ILE A 1 388 ? -6.916  -12.224 13.877  1.00 0.00 ? 388 ILE A N    1  
ATOM 6029   C CA   . ILE A 1 388 ? -5.718  -11.377 14.024  1.00 0.00 ? 388 ILE A CA   1  
ATOM 6030   C C    . ILE A 1 388 ? -4.552  -12.082 13.382  1.00 0.00 ? 388 ILE A C    1  
ATOM 6031   O O    . ILE A 1 388 ? -4.320  -13.296 13.598  1.00 0.00 ? 388 ILE A O    1  
ATOM 6032   C CB   . ILE A 1 388 ? -5.326  -11.152 15.534  1.00 0.00 ? 388 ILE A CB   1  
ATOM 6033   C CG1  . ILE A 1 388 ? -6.417  -10.383 16.273  1.00 0.00 ? 388 ILE A CG1  1  
ATOM 6034   C CG2  . ILE A 1 388 ? -3.997  -10.395 15.690  1.00 0.00 ? 388 ILE A CG2  1  
ATOM 6035   C CD1  . ILE A 1 388 ? -6.228  -10.389 17.766  1.00 0.00 ? 388 ILE A CD1  1  
ATOM 6036   H H    . ILE A 1 388 ? -6.945  -13.075 14.362  1.00 0.00 ? 388 ILE A H    1  
ATOM 6037   H HA   . ILE A 1 388 ? -5.880  -10.423 13.546  1.00 0.00 ? 388 ILE A HA   1  
ATOM 6038   H HB   . ILE A 1 388 ? -5.216  -12.122 15.999  1.00 0.00 ? 388 ILE A HB   1  
ATOM 6039   H HG12 . ILE A 1 388 ? -6.415  -9.360  15.930  1.00 0.00 ? 388 ILE A HG12 1  
ATOM 6040   H HG13 . ILE A 1 388 ? -7.374  -10.827 16.038  1.00 0.00 ? 388 ILE A HG13 1  
ATOM 6041   H HG21 . ILE A 1 388 ? -3.840  -10.153 16.731  1.00 0.00 ? 388 ILE A HG21 1  
ATOM 6042   H HG22 . ILE A 1 388 ? -4.032  -9.484  15.111  1.00 0.00 ? 388 ILE A HG22 1  
ATOM 6043   H HG23 . ILE A 1 388 ? -3.185  -11.015 15.338  1.00 0.00 ? 388 ILE A HG23 1  
ATOM 6044   H HD11 . ILE A 1 388 ? -6.507  -11.354 18.161  1.00 0.00 ? 388 ILE A HD11 1  
ATOM 6045   H HD12 . ILE A 1 388 ? -6.849  -9.625  18.210  1.00 0.00 ? 388 ILE A HD12 1  
ATOM 6046   H HD13 . ILE A 1 388 ? -5.192  -10.190 17.999  1.00 0.00 ? 388 ILE A HD13 1  
ATOM 6047   N N    . MET A 1 389 ? -3.772  -11.330 12.629  1.00 0.00 ? 389 MET A N    1  
ATOM 6048   C CA   . MET A 1 389 ? -2.610  -11.926 12.020  1.00 0.00 ? 389 MET A CA   1  
ATOM 6049   C C    . MET A 1 389 ? -1.534  -10.908 12.123  1.00 0.00 ? 389 MET A C    1  
ATOM 6050   O O    . MET A 1 389 ? -1.831  -9.728  12.053  1.00 0.00 ? 389 MET A O    1  
ATOM 6051   C CB   . MET A 1 389 ? -2.915  -12.243 10.569  1.00 0.00 ? 389 MET A CB   1  
ATOM 6052   C CG   . MET A 1 389 ? -1.821  -12.899 9.854   1.00 0.00 ? 389 MET A CG   1  
ATOM 6053   S SD   . MET A 1 389 ? -2.385  -13.572 8.151   1.00 0.00 ? 389 MET A SD   1  
ATOM 6054   C CE   . MET A 1 389 ? -2.683  -11.871 7.267   1.00 0.00 ? 389 MET A CE   1  
ATOM 6055   H H    . MET A 1 389 ? -3.962  -10.376 12.512  1.00 0.00 ? 389 MET A H    1  
ATOM 6056   H HA   . MET A 1 389 ? -2.328  -12.824 12.549  1.00 0.00 ? 389 MET A HA   1  
ATOM 6057   H HB2  . MET A 1 389 ? -3.777  -12.889 10.532  1.00 0.00 ? 389 MET A HB2  1  
ATOM 6058   H HB3  . MET A 1 389 ? -3.160  -11.319 10.062  1.00 0.00 ? 389 MET A HB3  1  
ATOM 6059   H HG2  . MET A 1 389 ? -1.021  -12.186 9.706   1.00 0.00 ? 389 MET A HG2  1  
ATOM 6060   H HG3  . MET A 1 389 ? -1.454  -13.721 10.450  1.00 0.00 ? 389 MET A HG3  1  
ATOM 6061   H HE1  . MET A 1 389 ? -2.270  -11.075 7.873   1.00 0.00 ? 389 MET A HE1  1  
ATOM 6062   H HE2  . MET A 1 389 ? -3.740  -11.709 7.140   1.00 0.00 ? 389 MET A HE2  1  
ATOM 6063   H HE3  . MET A 1 389 ? -2.204  -11.882 6.297   1.00 0.00 ? 389 MET A HE3  1  
ATOM 6064   N N    . PHE A 1 390 ? -0.306  -11.383 12.291  1.00 0.00 ? 390 PHE A N    1  
ATOM 6065   C CA   . PHE A 1 390 ? 0.886   -10.550 12.451  1.00 0.00 ? 390 PHE A CA   1  
ATOM 6066   C C    . PHE A 1 390 ? 1.802   -10.628 11.249  1.00 0.00 ? 390 PHE A C    1  
ATOM 6067   O O    . PHE A 1 390 ? 2.027   -11.709 10.713  1.00 0.00 ? 390 PHE A O    1  
ATOM 6068   C CB   . PHE A 1 390 ? 1.694   -11.002 13.650  1.00 0.00 ? 390 PHE A CB   1  
ATOM 6069   C CG   . PHE A 1 390 ? 1.034   -10.739 14.938  1.00 0.00 ? 390 PHE A CG   1  
ATOM 6070   C CD1  . PHE A 1 390 ? 0.841   -9.441  15.368  1.00 0.00 ? 390 PHE A CD1  1  
ATOM 6071   C CD2  . PHE A 1 390 ? 0.618   -11.801 15.742  1.00 0.00 ? 390 PHE A CD2  1  
ATOM 6072   C CE1  . PHE A 1 390 ? 0.220   -9.177  16.598  1.00 0.00 ? 390 PHE A CE1  1  
ATOM 6073   C CE2  . PHE A 1 390 ? -0.019  -11.569 16.985  1.00 0.00 ? 390 PHE A CE2  1  
ATOM 6074   C CZ   . PHE A 1 390 ? -0.222  -10.246 17.420  1.00 0.00 ? 390 PHE A CZ   1  
ATOM 6075   H H    . PHE A 1 390 ? -0.194  -12.356 12.334  1.00 0.00 ? 390 PHE A H    1  
ATOM 6076   H HA   . PHE A 1 390 ? 0.585   -9.526  12.602  1.00 0.00 ? 390 PHE A HA   1  
ATOM 6077   H HB2  . PHE A 1 390 ? 1.871   -12.063 13.568  1.00 0.00 ? 390 PHE A HB2  1  
ATOM 6078   H HB3  . PHE A 1 390 ? 2.648   -10.492 13.634  1.00 0.00 ? 390 PHE A HB3  1  
ATOM 6079   H HD1  . PHE A 1 390 ? 1.174   -8.620  14.750  1.00 0.00 ? 390 PHE A HD1  1  
ATOM 6080   H HD2  . PHE A 1 390 ? 0.770   -12.816 15.403  1.00 0.00 ? 390 PHE A HD2  1  
ATOM 6081   H HE1  . PHE A 1 390 ? 0.071   -8.156  16.916  1.00 0.00 ? 390 PHE A HE1  1  
ATOM 6082   H HE2  . PHE A 1 390 ? -0.336  -12.399 17.599  1.00 0.00 ? 390 PHE A HE2  1  
ATOM 6083   H HZ   . PHE A 1 390 ? -0.706  -10.046 18.365  1.00 0.00 ? 390 PHE A HZ   1  
ATOM 6084   N N    . PRO A 1 391 ? 2.311   -9.474  10.808  1.00 0.00 ? 391 PRO A N    1  
ATOM 6085   C CA   . PRO A 1 391 ? 3.268   -9.339  9.707   1.00 0.00 ? 391 PRO A CA   1  
ATOM 6086   C C    . PRO A 1 391 ? 4.721   -9.490  10.136  1.00 0.00 ? 391 PRO A C    1  
ATOM 6087   O O    . PRO A 1 391 ? 5.023   -9.301  11.296  1.00 0.00 ? 391 PRO A O    1  
ATOM 6088   C CB   . PRO A 1 391 ? 3.034   -7.909  9.219   1.00 0.00 ? 391 PRO A CB   1  
ATOM 6089   C CG   . PRO A 1 391 ? 2.541   -7.161  10.461  1.00 0.00 ? 391 PRO A CG   1  
ATOM 6090   C CD   . PRO A 1 391 ? 1.870   -8.184  11.361  1.00 0.00 ? 391 PRO A CD   1  
ATOM 6091   H HA   . PRO A 1 391 ? 3.034   -10.027 8.914   1.00 0.00 ? 391 PRO A HA   1  
ATOM 6092   H HB2  . PRO A 1 391 ? 3.959   -7.480  8.855   1.00 0.00 ? 391 PRO A HB2  1  
ATOM 6093   H HB3  . PRO A 1 391 ? 2.277   -7.889  8.452   1.00 0.00 ? 391 PRO A HB3  1  
ATOM 6094   H HG2  . PRO A 1 391 ? 3.382   -6.723  10.980  1.00 0.00 ? 391 PRO A HG2  1  
ATOM 6095   H HG3  . PRO A 1 391 ? 1.849   -6.385  10.169  1.00 0.00 ? 391 PRO A HG3  1  
ATOM 6096   H HD2  . PRO A 1 391 ? 2.195   -8.075  12.387  1.00 0.00 ? 391 PRO A HD2  1  
ATOM 6097   H HD3  . PRO A 1 391 ? 0.798   -8.095  11.288  1.00 0.00 ? 391 PRO A HD3  1  
ATOM 6098   N N    . MET A 1 392 ? 5.621   -9.812  9.199   1.00 0.00 ? 392 MET A N    1  
ATOM 6099   C CA   . MET A 1 392 ? 7.079   -9.795  9.446   1.00 0.00 ? 392 MET A CA   1  
ATOM 6100   C C    . MET A 1 392 ? 7.600   -10.629 10.588  1.00 0.00 ? 392 MET A C    1  
ATOM 6101   O O    . MET A 1 392 ? 8.663   -10.340 11.114  1.00 0.00 ? 392 MET A O    1  
ATOM 6102   C CB   . MET A 1 392 ? 7.588   -8.384  9.651   1.00 0.00 ? 392 MET A CB   1  
ATOM 6103   C CG   . MET A 1 392 ? 7.332   -7.466  8.464   1.00 0.00 ? 392 MET A CG   1  
ATOM 6104   S SD   . MET A 1 392 ? 7.978   -8.176  6.801   1.00 0.00 ? 392 MET A SD   1  
ATOM 6105   C CE   . MET A 1 392 ? 9.790   -8.142  7.188   1.00 0.00 ? 392 MET A CE   1  
ATOM 6106   H H    . MET A 1 392 ? 5.308   -9.940  8.279   1.00 0.00 ? 392 MET A H    1  
ATOM 6107   H HA   . MET A 1 392 ? 7.550   -10.164 8.549   1.00 0.00 ? 392 MET A HA   1  
ATOM 6108   H HB2  . MET A 1 392 ? 7.103   -7.964  10.520  1.00 0.00 ? 392 MET A HB2  1  
ATOM 6109   H HB3  . MET A 1 392 ? 8.653   -8.425  9.837   1.00 0.00 ? 392 MET A HB3  1  
ATOM 6110   H HG2  . MET A 1 392 ? 6.269   -7.301  8.377   1.00 0.00 ? 392 MET A HG2  1  
ATOM 6111   H HG3  . MET A 1 392 ? 7.816   -6.519  8.648   1.00 0.00 ? 392 MET A HG3  1  
ATOM 6112   H HE1  . MET A 1 392 ? 10.327  -7.705  6.357   1.00 0.00 ? 392 MET A HE1  1  
ATOM 6113   H HE2  . MET A 1 392 ? 10.143  -9.147  7.351   1.00 0.00 ? 392 MET A HE2  1  
ATOM 6114   H HE3  . MET A 1 392 ? 9.956   -7.555  8.082   1.00 0.00 ? 392 MET A HE3  1  
ATOM 6115   N N    . ILE A 1 393 ? 6.876   -11.669 10.952  1.00 0.00 ? 393 ILE A N    1  
ATOM 6116   C CA   . ILE A 1 393 ? 7.317   -12.623 11.949  1.00 0.00 ? 393 ILE A CA   1  
ATOM 6117   C C    . ILE A 1 393 ? 8.577   -13.376 11.524  1.00 0.00 ? 393 ILE A C    1  
ATOM 6118   O O    . ILE A 1 393 ? 8.667   -13.909 10.395  1.00 0.00 ? 393 ILE A O    1  
ATOM 6119   C CB   . ILE A 1 393 ? 6.216   -13.643 12.220  1.00 0.00 ? 393 ILE A CB   1  
ATOM 6120   C CG1  . ILE A 1 393 ? 4.975   -12.939 12.791  1.00 0.00 ? 393 ILE A CG1  1  
ATOM 6121   C CG2  . ILE A 1 393 ? 6.749   -14.814 13.058  1.00 0.00 ? 393 ILE A CG2  1  
ATOM 6122   C CD1  . ILE A 1 393 ? 5.225   -12.153 14.021  1.00 0.00 ? 393 ILE A CD1  1  
ATOM 6123   H H    . ILE A 1 393 ? 6.042   -11.849 10.471  1.00 0.00 ? 393 ILE A H    1  
ATOM 6124   H HA   . ILE A 1 393 ? 7.523   -12.094 12.866  1.00 0.00 ? 393 ILE A HA   1  
ATOM 6125   H HB   . ILE A 1 393 ? 5.937   -14.058 11.258  1.00 0.00 ? 393 ILE A HB   1  
ATOM 6126   H HG12 . ILE A 1 393 ? 4.584   -12.272 12.040  1.00 0.00 ? 393 ILE A HG12 1  
ATOM 6127   H HG13 . ILE A 1 393 ? 4.225   -13.691 13.003  1.00 0.00 ? 393 ILE A HG13 1  
ATOM 6128   H HG21 . ILE A 1 393 ? 7.290   -15.497 12.420  1.00 0.00 ? 393 ILE A HG21 1  
ATOM 6129   H HG22 . ILE A 1 393 ? 5.921   -15.333 13.520  1.00 0.00 ? 393 ILE A HG22 1  
ATOM 6130   H HG23 . ILE A 1 393 ? 7.410   -14.437 13.825  1.00 0.00 ? 393 ILE A HG23 1  
ATOM 6131   H HD11 . ILE A 1 393 ? 5.989   -12.638 14.610  1.00 0.00 ? 393 ILE A HD11 1  
ATOM 6132   H HD12 . ILE A 1 393 ? 4.313   -12.087 14.597  1.00 0.00 ? 393 ILE A HD12 1  
ATOM 6133   H HD13 . ILE A 1 393 ? 5.555   -11.160 13.754  1.00 0.00 ? 393 ILE A HD13 1  
ATOM 6134   N N    . ILE A 1 394 ? 9.513   -13.488 12.463  1.00 0.00 ? 394 ILE A N    1  
ATOM 6135   C CA   . ILE A 1 394 ? 10.824  -14.044 12.167  1.00 0.00 ? 394 ILE A CA   1  
ATOM 6136   C C    . ILE A 1 394 ? 11.268  -15.143 13.113  1.00 0.00 ? 394 ILE A C    1  
ATOM 6137   O O    . ILE A 1 394 ? 12.159  -15.939 12.770  1.00 0.00 ? 394 ILE A O    1  
ATOM 6138   C CB   . ILE A 1 394 ? 11.801  -12.910 12.101  1.00 0.00 ? 394 ILE A CB   1  
ATOM 6139   C CG1  . ILE A 1 394 ? 12.288  -12.828 10.699  1.00 0.00 ? 394 ILE A CG1  1  
ATOM 6140   C CG2  . ILE A 1 394 ? 12.929  -12.977 13.095  1.00 0.00 ? 394 ILE A CG2  1  
ATOM 6141   C CD1  . ILE A 1 394 ? 11.333  -12.060 9.918   1.00 0.00 ? 394 ILE A CD1  1  
ATOM 6142   H H    . ILE A 1 394 ? 9.350   -13.097 13.347  1.00 0.00 ? 394 ILE A H    1  
ATOM 6143   H HA   . ILE A 1 394 ? 10.772  -14.477 11.179  1.00 0.00 ? 394 ILE A HA   1  
ATOM 6144   H HB   . ILE A 1 394 ? 11.253  -12.002 12.304  1.00 0.00 ? 394 ILE A HB   1  
ATOM 6145   H HG12 . ILE A 1 394 ? 13.251  -12.338 10.678  1.00 0.00 ? 394 ILE A HG12 1  
ATOM 6146   H HG13 . ILE A 1 394 ? 12.378  -13.822 10.287  1.00 0.00 ? 394 ILE A HG13 1  
ATOM 6147   H HG21 . ILE A 1 394 ? 13.564  -12.111 12.979  1.00 0.00 ? 394 ILE A HG21 1  
ATOM 6148   H HG22 . ILE A 1 394 ? 13.507  -13.874 12.923  1.00 0.00 ? 394 ILE A HG22 1  
ATOM 6149   H HG23 . ILE A 1 394 ? 12.526  -12.995 14.096  1.00 0.00 ? 394 ILE A HG23 1  
ATOM 6150   H HD11 . ILE A 1 394 ? 10.438  -12.644 9.767   1.00 0.00 ? 394 ILE A HD11 1  
ATOM 6151   H HD12 . ILE A 1 394 ? 11.769  -11.813 8.959   1.00 0.00 ? 394 ILE A HD12 1  
ATOM 6152   H HD13 . ILE A 1 394 ? 11.083  -11.152 10.445  1.00 0.00 ? 394 ILE A HD13 1  
ATOM 6153   N N    . SER A 1 395 ? 10.615  -15.224 14.275  1.00 0.00 ? 395 SER A N    1  
ATOM 6154   C CA   . SER A 1 395 ? 11.045  -16.136 15.318  1.00 0.00 ? 395 SER A CA   1  
ATOM 6155   C C    . SER A 1 395 ? 9.858   -16.626 16.136  1.00 0.00 ? 395 SER A C    1  
ATOM 6156   O O    . SER A 1 395 ? 8.826   -15.958 16.196  1.00 0.00 ? 395 SER A O    1  
ATOM 6157   C CB   . SER A 1 395 ? 12.021  -15.398 16.235  1.00 0.00 ? 395 SER A CB   1  
ATOM 6158   O OG   . SER A 1 395 ? 11.374  -14.340 16.967  1.00 0.00 ? 395 SER A OG   1  
ATOM 6159   H H    . SER A 1 395 ? 9.894   -14.588 14.464  1.00 0.00 ? 395 SER A H    1  
ATOM 6160   H HA   . SER A 1 395 ? 11.549  -16.980 14.873  1.00 0.00 ? 395 SER A HA   1  
ATOM 6161   H HB2  . SER A 1 395 ? 12.441  -16.096 16.939  1.00 0.00 ? 395 SER A HB2  1  
ATOM 6162   H HB3  . SER A 1 395 ? 12.822  -14.986 15.634  1.00 0.00 ? 395 SER A HB3  1  
ATOM 6163   H HG   . SER A 1 395 ? 11.965  -14.062 17.670  1.00 0.00 ? 395 SER A HG   1  
ATOM 6164   N N    . VAL A 1 396 ? 10.018  -17.748 16.830  1.00 0.00 ? 396 VAL A N    1  
ATOM 6165   C CA   . VAL A 1 396 ? 9.031   -18.144 17.799  1.00 0.00 ? 396 VAL A CA   1  
ATOM 6166   C C    . VAL A 1 396 ? 9.042   -17.124 18.936  1.00 0.00 ? 396 VAL A C    1  
ATOM 6167   O O    . VAL A 1 396 ? 7.992   -16.776 19.479  1.00 0.00 ? 396 VAL A O    1  
ATOM 6168   C CB   . VAL A 1 396 ? 9.294   -19.561 18.309  1.00 0.00 ? 396 VAL A CB   1  
ATOM 6169   C CG1  . VAL A 1 396 ? 8.380   -19.906 19.462  1.00 0.00 ? 396 VAL A CG1  1  
ATOM 6170   C CG2  . VAL A 1 396 ? 9.121   -20.574 17.168  1.00 0.00 ? 396 VAL A CG2  1  
ATOM 6171   H H    . VAL A 1 396 ? 10.877  -18.219 16.795  1.00 0.00 ? 396 VAL A H    1  
ATOM 6172   H HA   . VAL A 1 396 ? 8.058   -18.119 17.327  1.00 0.00 ? 396 VAL A HA   1  
ATOM 6173   H HB   . VAL A 1 396 ? 10.315  -19.611 18.660  1.00 0.00 ? 396 VAL A HB   1  
ATOM 6174   H HG11 . VAL A 1 396 ? 7.366   -19.632 19.213  1.00 0.00 ? 396 VAL A HG11 1  
ATOM 6175   H HG12 . VAL A 1 396 ? 8.693   -19.365 20.344  1.00 0.00 ? 396 VAL A HG12 1  
ATOM 6176   H HG13 . VAL A 1 396 ? 8.429   -20.967 19.655  1.00 0.00 ? 396 VAL A HG13 1  
ATOM 6177   H HG21 . VAL A 1 396 ? 9.978   -21.231 17.136  1.00 0.00 ? 396 VAL A HG21 1  
ATOM 6178   H HG22 . VAL A 1 396 ? 9.036   -20.048 16.228  1.00 0.00 ? 396 VAL A HG22 1  
ATOM 6179   H HG23 . VAL A 1 396 ? 8.227   -21.156 17.336  1.00 0.00 ? 396 VAL A HG23 1  
ATOM 6180   N N    . GLU A 1 397 ? 10.215  -16.613 19.290  1.00 0.00 ? 397 GLU A N    1  
ATOM 6181   C CA   . GLU A 1 397 ? 10.268  -15.538 20.301  1.00 0.00 ? 397 GLU A CA   1  
ATOM 6182   C C    . GLU A 1 397 ? 9.208   -14.441 20.074  1.00 0.00 ? 397 GLU A C    1  
ATOM 6183   O O    . GLU A 1 397 ? 8.358   -14.169 20.977  1.00 0.00 ? 397 GLU A O    1  
ATOM 6184   C CB   . GLU A 1 397 ? 11.650  -14.908 20.386  1.00 0.00 ? 397 GLU A CB   1  
ATOM 6185   C CG   . GLU A 1 397 ? 12.683  -15.785 21.086  1.00 0.00 ? 397 GLU A CG   1  
ATOM 6186   C CD   . GLU A 1 397 ? 13.334  -16.842 20.172  1.00 0.00 ? 397 GLU A CD   1  
ATOM 6187   O OE1  . GLU A 1 397 ? 12.859  -17.029 19.027  1.00 0.00 ? 397 GLU A OE1  1  
ATOM 6188   O OE2  . GLU A 1 397 ? 14.316  -17.495 20.626  1.00 0.00 ? 397 GLU A OE2  1  
ATOM 6189   H H    . GLU A 1 397 ? 11.032  -16.892 18.827  1.00 0.00 ? 397 GLU A H    1  
ATOM 6190   H HA   . GLU A 1 397 ? 10.059  -15.991 21.260  1.00 0.00 ? 397 GLU A HA   1  
ATOM 6191   H HB2  . GLU A 1 397 ? 11.998  -14.703 19.385  1.00 0.00 ? 397 GLU A HB2  1  
ATOM 6192   H HB3  . GLU A 1 397 ? 11.569  -13.972 20.921  1.00 0.00 ? 397 GLU A HB3  1  
ATOM 6193   H HG2  . GLU A 1 397 ? 13.462  -15.150 21.481  1.00 0.00 ? 397 GLU A HG2  1  
ATOM 6194   H HG3  . GLU A 1 397 ? 12.202  -16.290 21.911  1.00 0.00 ? 397 GLU A HG3  1  
ATOM 6195   N N    . GLU A 1 398 ? 9.237   -13.849 18.868  1.00 0.00 ? 398 GLU A N    1  
ATOM 6196   C CA   . GLU A 1 398 ? 8.289   -12.783 18.526  1.00 0.00 ? 398 GLU A CA   1  
ATOM 6197   C C    . GLU A 1 398 ? 6.828   -13.188 18.770  1.00 0.00 ? 398 GLU A C    1  
ATOM 6198   O O    . GLU A 1 398 ? 6.090   -12.480 19.426  1.00 0.00 ? 398 GLU A O    1  
ATOM 6199   C CB   . GLU A 1 398 ? 8.486   -12.288 17.089  1.00 0.00 ? 398 GLU A CB   1  
ATOM 6200   C CG   . GLU A 1 398 ? 9.726   -11.515 16.908  1.00 0.00 ? 398 GLU A CG   1  
ATOM 6201   C CD   . GLU A 1 398 ? 10.032  -11.172 15.470  1.00 0.00 ? 398 GLU A CD   1  
ATOM 6202   O OE1  . GLU A 1 398 ? 9.389   -11.751 14.571  1.00 0.00 ? 398 GLU A OE1  1  
ATOM 6203   O OE2  . GLU A 1 398 ? 10.931  -10.303 15.248  1.00 0.00 ? 398 GLU A OE2  1  
ATOM 6204   H H    . GLU A 1 398 ? 9.906   -14.130 18.209  1.00 0.00 ? 398 GLU A H    1  
ATOM 6205   H HA   . GLU A 1 398 ? 8.500   -11.951 19.184  1.00 0.00 ? 398 GLU A HA   1  
ATOM 6206   H HB2  . GLU A 1 398 ? 8.514   -13.140 16.429  1.00 0.00 ? 398 GLU A HB2  1  
ATOM 6207   H HB3  . GLU A 1 398 ? 7.642   -11.668 16.818  1.00 0.00 ? 398 GLU A HB3  1  
ATOM 6208   H HG2  . GLU A 1 398 ? 9.644   -10.596 17.469  1.00 0.00 ? 398 GLU A HG2  1  
ATOM 6209   H HG3  . GLU A 1 398 ? 10.550  -12.089 17.310  1.00 0.00 ? 398 GLU A HG3  1  
ATOM 6210   N N    . VAL A 1 399 ? 6.416   -14.325 18.232  1.00 0.00 ? 399 VAL A N    1  
ATOM 6211   C CA   . VAL A 1 399 ? 5.025   -14.786 18.422  1.00 0.00 ? 399 VAL A CA   1  
ATOM 6212   C C    . VAL A 1 399 ? 4.586   -14.919 19.888  1.00 0.00 ? 399 VAL A C    1  
ATOM 6213   O O    . VAL A 1 399 ? 3.509   -14.434 20.271  1.00 0.00 ? 399 VAL A O    1  
ATOM 6214   C CB   . VAL A 1 399 ? 4.789   -16.126 17.738  1.00 0.00 ? 399 VAL A CB   1  
ATOM 6215   C CG1  . VAL A 1 399 ? 3.453   -16.623 18.124  1.00 0.00 ? 399 VAL A CG1  1  
ATOM 6216   C CG2  . VAL A 1 399 ? 4.898   -15.970 16.211  1.00 0.00 ? 399 VAL A CG2  1  
ATOM 6217   H H    . VAL A 1 399 ? 7.039   -14.867 17.704  1.00 0.00 ? 399 VAL A H    1  
ATOM 6218   H HA   . VAL A 1 399 ? 4.376   -14.063 17.951  1.00 0.00 ? 399 VAL A HA   1  
ATOM 6219   H HB   . VAL A 1 399 ? 5.536   -16.829 18.077  1.00 0.00 ? 399 VAL A HB   1  
ATOM 6220   H HG11 . VAL A 1 399 ? 2.774   -15.789 18.229  1.00 0.00 ? 399 VAL A HG11 1  
ATOM 6221   H HG12 . VAL A 1 399 ? 3.523   -17.151 19.064  1.00 0.00 ? 399 VAL A HG12 1  
ATOM 6222   H HG13 . VAL A 1 399 ? 3.082   -17.291 17.362  1.00 0.00 ? 399 VAL A HG13 1  
ATOM 6223   H HG21 . VAL A 1 399 ? 4.498   -16.851 15.730  1.00 0.00 ? 399 VAL A HG21 1  
ATOM 6224   H HG22 . VAL A 1 399 ? 5.935   -15.848 15.934  1.00 0.00 ? 399 VAL A HG22 1  
ATOM 6225   H HG23 . VAL A 1 399 ? 4.337   -15.102 15.897  1.00 0.00 ? 399 VAL A HG23 1  
ATOM 6226   N N    . ARG A 1 400 ? 5.418   -15.547 20.712  1.00 0.00 ? 400 ARG A N    1  
ATOM 6227   C CA   . ARG A 1 400 ? 5.065   -15.678 22.098  1.00 0.00 ? 400 ARG A CA   1  
ATOM 6228   C C    . ARG A 1 400 ? 4.958   -14.322 22.776  1.00 0.00 ? 400 ARG A C    1  
ATOM 6229   O O    . ARG A 1 400 ? 4.145   -14.164 23.691  1.00 0.00 ? 400 ARG A O    1  
ATOM 6230   C CB   . ARG A 1 400 ? 6.070   -16.542 22.854  1.00 0.00 ? 400 ARG A CB   1  
ATOM 6231   C CG   . ARG A 1 400 ? 5.997   -17.955 22.463  1.00 0.00 ? 400 ARG A CG   1  
ATOM 6232   C CD   . ARG A 1 400 ? 6.986   -18.727 23.210  1.00 0.00 ? 400 ARG A CD   1  
ATOM 6233   N NE   . ARG A 1 400 ? 6.913   -20.134 22.835  1.00 0.00 ? 400 ARG A NE   1  
ATOM 6234   C CZ   . ARG A 1 400 ? 7.688   -21.089 23.363  1.00 0.00 ? 400 ARG A CZ   1  
ATOM 6235   N NH1  . ARG A 1 400 ? 8.627   -20.810 24.285  1.00 0.00 ? 400 ARG A NH1  1  
ATOM 6236   N NH2  . ARG A 1 400 ? 7.540   -22.334 22.931  1.00 0.00 ? 400 ARG A NH2  1  
ATOM 6237   H H    . ARG A 1 400 ? 6.269   -15.903 20.381  1.00 0.00 ? 400 ARG A H    1  
ATOM 6238   H HA   . ARG A 1 400 ? 4.100   -16.160 22.155  1.00 0.00 ? 400 ARG A HA   1  
ATOM 6239   H HB2  . ARG A 1 400 ? 7.065   -16.178 22.654  1.00 0.00 ? 400 ARG A HB2  1  
ATOM 6240   H HB3  . ARG A 1 400 ? 5.875   -16.457 23.914  1.00 0.00 ? 400 ARG A HB3  1  
ATOM 6241   H HG2  . ARG A 1 400 ? 5.010   -18.336 22.676  1.00 0.00 ? 400 ARG A HG2  1  
ATOM 6242   H HG3  . ARG A 1 400 ? 6.196   -18.045 21.405  1.00 0.00 ? 400 ARG A HG3  1  
ATOM 6243   H HD2  . ARG A 1 400 ? 7.974   -18.349 22.992  1.00 0.00 ? 400 ARG A HD2  1  
ATOM 6244   H HD3  . ARG A 1 400 ? 6.792   -18.628 24.268  1.00 0.00 ? 400 ARG A HD3  1  
ATOM 6245   H HE   . ARG A 1 400 ? 6.262   -20.396 22.152  1.00 0.00 ? 400 ARG A HE   1  
ATOM 6246   H HH11 . ARG A 1 400 ? 8.761   -19.869 24.593  1.00 0.00 ? 400 ARG A HH11 1  
ATOM 6247   H HH12 . ARG A 1 400 ? 9.192   -21.545 24.662  1.00 0.00 ? 400 ARG A HH12 1  
ATOM 6248   H HH21 . ARG A 1 400 ? 6.862   -22.541 22.227  1.00 0.00 ? 400 ARG A HH21 1  
ATOM 6249   H HH22 . ARG A 1 400 ? 8.107   -23.065 23.310  1.00 0.00 ? 400 ARG A HH22 1  
ATOM 6250   N N    . ALA A 1 401 ? 5.791   -13.360 22.377  1.00 0.00 ? 401 ALA A N    1  
ATOM 6251   C CA   . ALA A 1 401 ? 5.785   -12.103 23.074  1.00 0.00 ? 401 ALA A CA   1  
ATOM 6252   C C    . ALA A 1 401 ? 4.498   -11.339 22.743  1.00 0.00 ? 401 ALA A C    1  
ATOM 6253   O O    . ALA A 1 401 ? 3.970   -10.582 23.584  1.00 0.00 ? 401 ALA A O    1  
ATOM 6254   C CB   . ALA A 1 401 ? 7.007   -11.284 22.769  1.00 0.00 ? 401 ALA A CB   1  
ATOM 6255   H H    . ALA A 1 401 ? 6.447   -13.533 21.670  1.00 0.00 ? 401 ALA A H    1  
ATOM 6256   H HA   . ALA A 1 401 ? 5.778   -12.316 24.135  1.00 0.00 ? 401 ALA A HA   1  
ATOM 6257   H HB1  . ALA A 1 401 ? 6.729   -10.246 22.666  1.00 0.00 ? 401 ALA A HB1  1  
ATOM 6258   H HB2  . ALA A 1 401 ? 7.452   -11.631 21.847  1.00 0.00 ? 401 ALA A HB2  1  
ATOM 6259   H HB3  . ALA A 1 401 ? 7.720   -11.386 23.574  1.00 0.00 ? 401 ALA A HB3  1  
ATOM 6260   N N    . LEU A 1 402 ? 3.983   -11.587 21.547  1.00 0.00 ? 402 LEU A N    1  
ATOM 6261   C CA   . LEU A 1 402 ? 2.807   -10.899 21.044  1.00 0.00 ? 402 LEU A CA   1  
ATOM 6262   C C    . LEU A 1 402 ? 1.492   -11.544 21.540  1.00 0.00 ? 402 LEU A C    1  
ATOM 6263   O O    . LEU A 1 402 ? 0.503   -10.854 21.811  1.00 0.00 ? 402 LEU A O    1  
ATOM 6264   C CB   . LEU A 1 402 ? 2.833   -10.847 19.498  1.00 0.00 ? 402 LEU A CB   1  
ATOM 6265   C CG   . LEU A 1 402 ? 3.941   -10.188 18.655  1.00 0.00 ? 402 LEU A CG   1  
ATOM 6266   C CD1  . LEU A 1 402 ? 3.766   -10.546 17.216  1.00 0.00 ? 402 LEU A CD1  1  
ATOM 6267   C CD2  . LEU A 1 402 ? 4.041   -8.641  18.798  1.00 0.00 ? 402 LEU A CD2  1  
ATOM 6268   H H    . LEU A 1 402 ? 4.440   -12.226 20.961  1.00 0.00 ? 402 LEU A H    1  
ATOM 6269   H HA   . LEU A 1 402 ? 2.836   -9.883  21.410  1.00 0.00 ? 402 LEU A HA   1  
ATOM 6270   H HB2  . LEU A 1 402 ? 2.790   -11.866 19.163  1.00 0.00 ? 402 LEU A HB2  1  
ATOM 6271   H HB3  . LEU A 1 402 ? 1.893   -10.391 19.202  1.00 0.00 ? 402 LEU A HB3  1  
ATOM 6272   H HG   . LEU A 1 402 ? 4.883   -10.613 18.978  1.00 0.00 ? 402 LEU A HG   1  
ATOM 6273   H HD11 . LEU A 1 402 ? 3.639   -11.615 17.122  1.00 0.00 ? 402 LEU A HD11 1  
ATOM 6274   H HD12 . LEU A 1 402 ? 4.640   -10.238 16.660  1.00 0.00 ? 402 LEU A HD12 1  
ATOM 6275   H HD13 . LEU A 1 402 ? 2.893   -10.045 16.823  1.00 0.00 ? 402 LEU A HD13 1  
ATOM 6276   H HD21 . LEU A 1 402 ? 4.348   -8.391  19.804  1.00 0.00 ? 402 LEU A HD21 1  
ATOM 6277   H HD22 . LEU A 1 402 ? 3.077   -8.197  18.596  1.00 0.00 ? 402 LEU A HD22 1  
ATOM 6278   H HD23 . LEU A 1 402 ? 4.767   -8.260  18.094  1.00 0.00 ? 402 LEU A HD23 1  
ATOM 6279   N N    . ARG A 1 403 ? 1.478   -12.871 21.637  1.00 0.00 ? 403 ARG A N    1  
ATOM 6280   C CA   . ARG A 1 403 ? 0.353   -13.606 22.243  1.00 0.00 ? 403 ARG A CA   1  
ATOM 6281   C C    . ARG A 1 403 ? 0.167   -13.220 23.686  1.00 0.00 ? 403 ARG A C    1  
ATOM 6282   O O    . ARG A 1 403 ? -0.971  -13.059 24.184  1.00 0.00 ? 403 ARG A O    1  
ATOM 6283   C CB   . ARG A 1 403 ? 0.652   -15.082 22.223  1.00 0.00 ? 403 ARG A CB   1  
ATOM 6284   C CG   . ARG A 1 403 ? 0.559   -15.694 20.841  1.00 0.00 ? 403 ARG A CG   1  
ATOM 6285   C CD   . ARG A 1 403 ? -0.834  -16.143 20.611  1.00 0.00 ? 403 ARG A CD   1  
ATOM 6286   N NE   . ARG A 1 403 ? -1.177  -17.233 21.515  1.00 0.00 ? 403 ARG A NE   1  
ATOM 6287   C CZ   . ARG A 1 403 ? -2.388  -17.774 21.593  1.00 0.00 ? 403 ARG A CZ   1  
ATOM 6288   N NH1  . ARG A 1 403 ? -3.380  -17.294 20.840  1.00 0.00 ? 403 ARG A NH1  1  
ATOM 6289   N NH2  . ARG A 1 403 ? -2.599  -18.789 22.426  1.00 0.00 ? 403 ARG A NH2  1  
ATOM 6290   H H    . ARG A 1 403 ? 2.286   -13.368 21.392  1.00 0.00 ? 403 ARG A H    1  
ATOM 6291   H HA   . ARG A 1 403 ? -0.553  -13.415 21.690  1.00 0.00 ? 403 ARG A HA   1  
ATOM 6292   H HB2  . ARG A 1 403 ? 1.650   -15.238 22.602  1.00 0.00 ? 403 ARG A HB2  1  
ATOM 6293   H HB3  . ARG A 1 403 ? -0.048  -15.585 22.875  1.00 0.00 ? 403 ARG A HB3  1  
ATOM 6294   H HG2  . ARG A 1 403 ? 0.830   -14.956 20.100  1.00 0.00 ? 403 ARG A HG2  1  
ATOM 6295   H HG3  . ARG A 1 403 ? 1.228   -16.540 20.773  1.00 0.00 ? 403 ARG A HG3  1  
ATOM 6296   H HD2  . ARG A 1 403 ? -1.507  -15.317 20.780  1.00 0.00 ? 403 ARG A HD2  1  
ATOM 6297   H HD3  . ARG A 1 403 ? -0.935  -16.480 19.589  1.00 0.00 ? 403 ARG A HD3  1  
ATOM 6298   H HE   . ARG A 1 403 ? -0.471  -17.596 22.090  1.00 0.00 ? 403 ARG A HE   1  
ATOM 6299   H HH11 . ARG A 1 403 ? -3.210  -16.529 20.219  1.00 0.00 ? 403 ARG A HH11 1  
ATOM 6300   H HH12 . ARG A 1 403 ? -4.292  -17.700 20.896  1.00 0.00 ? 403 ARG A HH12 1  
ATOM 6301   H HH21 . ARG A 1 403 ? -1.850  -19.139 22.987  1.00 0.00 ? 403 ARG A HH21 1  
ATOM 6302   H HH22 . ARG A 1 403 ? -3.508  -19.202 22.490  1.00 0.00 ? 403 ARG A HH22 1  
ATOM 6303   N N    . LYS A 1 404 ? 1.304   -13.104 24.360  1.00 0.00 ? 404 LYS A N    1  
ATOM 6304   C CA   . LYS A 1 404 ? 1.336   -12.670 25.730  1.00 0.00 ? 404 LYS A CA   1  
ATOM 6305   C C    . LYS A 1 404 ? 0.741   -11.284 25.805  1.00 0.00 ? 404 LYS A C    1  
ATOM 6306   O O    . LYS A 1 404 ? -0.077  -10.989 26.662  1.00 0.00 ? 404 LYS A O    1  
ATOM 6307   C CB   . LYS A 1 404 ? 2.770   -12.616 26.201  1.00 0.00 ? 404 LYS A CB   1  
ATOM 6308   C CG   . LYS A 1 404 ? 3.348   -13.927 26.662  1.00 0.00 ? 404 LYS A CG   1  
ATOM 6309   C CD   . LYS A 1 404 ? 4.703   -13.581 27.268  1.00 0.00 ? 404 LYS A CD   1  
ATOM 6310   C CE   . LYS A 1 404 ? 4.554   -13.351 28.818  1.00 0.00 ? 404 LYS A CE   1  
ATOM 6311   N NZ   . LYS A 1 404 ? 5.836   -13.029 29.549  1.00 0.00 ? 404 LYS A NZ   1  
ATOM 6312   H H    . LYS A 1 404 ? 2.150   -13.271 23.895  1.00 0.00 ? 404 LYS A H    1  
ATOM 6313   H HA   . LYS A 1 404 ? 0.772   -13.351 26.349  1.00 0.00 ? 404 LYS A HA   1  
ATOM 6314   H HB2  . LYS A 1 404 ? 3.380   -12.249 25.390  1.00 0.00 ? 404 LYS A HB2  1  
ATOM 6315   H HB3  . LYS A 1 404 ? 2.831   -11.907 27.015  1.00 0.00 ? 404 LYS A HB3  1  
ATOM 6316   H HG2  . LYS A 1 404 ? 2.704   -14.378 27.406  1.00 0.00 ? 404 LYS A HG2  1  
ATOM 6317   H HG3  . LYS A 1 404 ? 3.480   -14.594 25.825  1.00 0.00 ? 404 LYS A HG3  1  
ATOM 6318   H HD2  . LYS A 1 404 ? 5.394   -14.394 27.089  1.00 0.00 ? 404 LYS A HD2  1  
ATOM 6319   H HD3  . LYS A 1 404 ? 5.083   -12.680 26.810  1.00 0.00 ? 404 LYS A HD3  1  
ATOM 6320   H HE2  . LYS A 1 404 ? 3.867   -12.534 28.975  1.00 0.00 ? 404 LYS A HE2  1  
ATOM 6321   H HE3  . LYS A 1 404 ? 4.122   -14.243 29.251  1.00 0.00 ? 404 LYS A HE3  1  
ATOM 6322   H HZ1  . LYS A 1 404 ? 5.842   -12.024 29.814  1.00 0.00 ? 404 LYS A HZ1  1  
ATOM 6323   H HZ2  . LYS A 1 404 ? 6.647   -13.230 28.930  1.00 0.00 ? 404 LYS A HZ2  1  
ATOM 6324   H HZ3  . LYS A 1 404 ? 5.901   -13.613 30.407  1.00 0.00 ? 404 LYS A HZ3  1  
ATOM 6325   N N    . GLU A 1 405 ? 1.151   -10.441 24.878  1.00 0.00 ? 405 GLU A N    1  
ATOM 6326   C CA   . GLU A 1 405 ? 0.543   -9.150  24.732  1.00 0.00 ? 405 GLU A CA   1  
ATOM 6327   C C    . GLU A 1 405 ? -0.990  -9.252  24.517  1.00 0.00 ? 405 GLU A C    1  
ATOM 6328   O O    . GLU A 1 405 ? -1.783  -8.677  25.292  1.00 0.00 ? 405 GLU A O    1  
ATOM 6329   C CB   . GLU A 1 405 ? 1.256   -8.368  23.644  1.00 0.00 ? 405 GLU A CB   1  
ATOM 6330   C CG   . GLU A 1 405 ? 1.883   -7.063  24.150  1.00 0.00 ? 405 GLU A CG   1  
ATOM 6331   C CD   . GLU A 1 405 ? 3.159   -7.260  24.988  1.00 0.00 ? 405 GLU A CD   1  
ATOM 6332   O OE1  . GLU A 1 405 ? 4.106   -7.885  24.499  1.00 0.00 ? 405 GLU A OE1  1  
ATOM 6333   O OE2  . GLU A 1 405 ? 3.226   -6.774  26.136  1.00 0.00 ? 405 GLU A OE2  1  
ATOM 6334   H H    . GLU A 1 405 ? 1.800   -10.743 24.209  1.00 0.00 ? 405 GLU A H    1  
ATOM 6335   H HA   . GLU A 1 405 ? 0.696   -8.621  25.663  1.00 0.00 ? 405 GLU A HA   1  
ATOM 6336   H HB2  . GLU A 1 405 ? 2.037   -8.986  23.228  1.00 0.00 ? 405 GLU A HB2  1  
ATOM 6337   H HB3  . GLU A 1 405 ? 0.545   -8.135  22.864  1.00 0.00 ? 405 GLU A HB3  1  
ATOM 6338   H HG2  . GLU A 1 405 ? 2.128   -6.447  23.298  1.00 0.00 ? 405 GLU A HG2  1  
ATOM 6339   H HG3  . GLU A 1 405 ? 1.151   -6.542  24.751  1.00 0.00 ? 405 GLU A HG3  1  
ATOM 6340   N N    . ILE A 1 406 ? -1.431  -10.012 23.521  1.00 0.00 ? 406 ILE A N    1  
ATOM 6341   C CA   . ILE A 1 406 ? -2.868  -10.190 23.353  1.00 0.00 ? 406 ILE A CA   1  
ATOM 6342   C C    . ILE A 1 406 ? -3.538  -10.530 24.709  1.00 0.00 ? 406 ILE A C    1  
ATOM 6343   O O    . ILE A 1 406 ? -4.467  -9.837  25.148  1.00 0.00 ? 406 ILE A O    1  
ATOM 6344   C CB   . ILE A 1 406 ? -3.172  -11.265 22.295  1.00 0.00 ? 406 ILE A CB   1  
ATOM 6345   C CG1  . ILE A 1 406 ? -2.700  -10.799 20.918  1.00 0.00 ? 406 ILE A CG1  1  
ATOM 6346   C CG2  . ILE A 1 406 ? -4.652  -11.596 22.227  1.00 0.00 ? 406 ILE A CG2  1  
ATOM 6347   C CD1  . ILE A 1 406 ? -2.706  -11.887 19.900  1.00 0.00 ? 406 ILE A CD1  1  
ATOM 6348   H H    . ILE A 1 406 ? -0.800  -10.491 22.944  1.00 0.00 ? 406 ILE A H    1  
ATOM 6349   H HA   . ILE A 1 406 ? -3.279  -9.252  23.007  1.00 0.00 ? 406 ILE A HA   1  
ATOM 6350   H HB   . ILE A 1 406 ? -2.632  -12.164 22.557  1.00 0.00 ? 406 ILE A HB   1  
ATOM 6351   H HG12 . ILE A 1 406 ? -3.349  -10.006 20.578  1.00 0.00 ? 406 ILE A HG12 1  
ATOM 6352   H HG13 . ILE A 1 406 ? -1.696  -10.409 21.010  1.00 0.00 ? 406 ILE A HG13 1  
ATOM 6353   H HG21 . ILE A 1 406 ? -4.847  -12.491 22.800  1.00 0.00 ? 406 ILE A HG21 1  
ATOM 6354   H HG22 . ILE A 1 406 ? -4.937  -11.759 21.198  1.00 0.00 ? 406 ILE A HG22 1  
ATOM 6355   H HG23 . ILE A 1 406 ? -5.224  -10.776 22.635  1.00 0.00 ? 406 ILE A HG23 1  
ATOM 6356   H HD11 . ILE A 1 406 ? -1.803  -11.834 19.310  1.00 0.00 ? 406 ILE A HD11 1  
ATOM 6357   H HD12 . ILE A 1 406 ? -3.566  -11.771 19.255  1.00 0.00 ? 406 ILE A HD12 1  
ATOM 6358   H HD13 . ILE A 1 406 ? -2.755  -12.844 20.397  1.00 0.00 ? 406 ILE A HD13 1  
ATOM 6359   N N    . GLU A 1 407 ? -3.056  -11.578 25.377  1.00 0.00 ? 407 GLU A N    1  
ATOM 6360   C CA   . GLU A 1 407 ? -3.632  -11.989 26.623  1.00 0.00 ? 407 GLU A CA   1  
ATOM 6361   C C    . GLU A 1 407 ? -3.765  -10.868 27.653  1.00 0.00 ? 407 GLU A C    1  
ATOM 6362   O O    . GLU A 1 407 ? -4.745  -10.810 28.392  1.00 0.00 ? 407 GLU A O    1  
ATOM 6363   C CB   . GLU A 1 407 ? -2.862  -13.191 27.161  1.00 0.00 ? 407 GLU A CB   1  
ATOM 6364   C CG   . GLU A 1 407 ? -3.099  -14.448 26.333  1.00 0.00 ? 407 GLU A CG   1  
ATOM 6365   C CD   . GLU A 1 407 ? -4.570  -14.892 26.336  1.00 0.00 ? 407 GLU A CD   1  
ATOM 6366   O OE1  . GLU A 1 407 ? -5.224  -14.988 27.435  1.00 0.00 ? 407 GLU A OE1  1  
ATOM 6367   O OE2  . GLU A 1 407 ? -5.089  -15.125 25.227  1.00 0.00 ? 407 GLU A OE2  1  
ATOM 6368   H H    . GLU A 1 407 ? -2.310  -12.089 24.999  1.00 0.00 ? 407 GLU A H    1  
ATOM 6369   H HA   . GLU A 1 407 ? -4.633  -12.331 26.406  1.00 0.00 ? 407 GLU A HA   1  
ATOM 6370   H HB2  . GLU A 1 407 ? -1.806  -12.962 27.154  1.00 0.00 ? 407 GLU A HB2  1  
ATOM 6371   H HB3  . GLU A 1 407 ? -3.172  -13.377 28.179  1.00 0.00 ? 407 GLU A HB3  1  
ATOM 6372   H HG2  . GLU A 1 407 ? -2.797  -14.257 25.315  1.00 0.00 ? 407 GLU A HG2  1  
ATOM 6373   H HG3  . GLU A 1 407 ? -2.491  -15.248 26.731  1.00 0.00 ? 407 GLU A HG3  1  
ATOM 6374   N N    . ILE A 1 408 ? -2.800  -9.956  27.681  1.00 0.00 ? 408 ILE A N    1  
ATOM 6375   C CA   . ILE A 1 408 ? -2.878  -8.806  28.574  1.00 0.00 ? 408 ILE A CA   1  
ATOM 6376   C C    . ILE A 1 408 ? -3.999  -7.849  28.141  1.00 0.00 ? 408 ILE A C    1  
ATOM 6377   O O    . ILE A 1 408 ? -4.858  -7.434  28.950  1.00 0.00 ? 408 ILE A O    1  
ATOM 6378   C CB   . ILE A 1 408 ? -1.552  -8.048  28.641  1.00 0.00 ? 408 ILE A CB   1  
ATOM 6379   C CG1  . ILE A 1 408 ? -0.455  -8.898  29.326  1.00 0.00 ? 408 ILE A CG1  1  
ATOM 6380   C CG2  . ILE A 1 408 ? -1.752  -6.712  29.349  1.00 0.00 ? 408 ILE A CG2  1  
ATOM 6381   C CD1  . ILE A 1 408 ? 1.006   -8.327  29.209  1.00 0.00 ? 408 ILE A CD1  1  
ATOM 6382   H H    . ILE A 1 408 ? -2.050  -10.029 27.055  1.00 0.00 ? 408 ILE A H    1  
ATOM 6383   H HA   . ILE A 1 408 ? -3.111  -9.168  29.566  1.00 0.00 ? 408 ILE A HA   1  
ATOM 6384   H HB   . ILE A 1 408 ? -1.238  -7.841  27.626  1.00 0.00 ? 408 ILE A HB   1  
ATOM 6385   H HG12 . ILE A 1 408 ? -0.699  -8.986  30.373  1.00 0.00 ? 408 ILE A HG12 1  
ATOM 6386   H HG13 . ILE A 1 408 ? -0.472  -9.887  28.889  1.00 0.00 ? 408 ILE A HG13 1  
ATOM 6387   H HG21 . ILE A 1 408 ? -0.796  -6.332  29.678  1.00 0.00 ? 408 ILE A HG21 1  
ATOM 6388   H HG22 . ILE A 1 408 ? -2.398  -6.850  30.203  1.00 0.00 ? 408 ILE A HG22 1  
ATOM 6389   H HG23 . ILE A 1 408 ? -2.203  -6.006  28.666  1.00 0.00 ? 408 ILE A HG23 1  
ATOM 6390   H HD11 . ILE A 1 408 ? 1.479   -8.725  28.324  1.00 0.00 ? 408 ILE A HD11 1  
ATOM 6391   H HD12 . ILE A 1 408 ? 1.576   -8.613  30.080  1.00 0.00 ? 408 ILE A HD12 1  
ATOM 6392   H HD13 . ILE A 1 408 ? 0.967   -7.248  29.144  1.00 0.00 ? 408 ILE A HD13 1  
ATOM 6393   N N    . TYR A 1 409 ? -3.992  -7.498  26.866  1.00 0.00 ? 409 TYR A N    1  
ATOM 6394   C CA   . TYR A 1 409 ? -5.020  -6.667  26.315  1.00 0.00 ? 409 TYR A CA   1  
ATOM 6395   C C    . TYR A 1 409 ? -6.380  -7.321  26.430  1.00 0.00 ? 409 TYR A C    1  
ATOM 6396   O O    . TYR A 1 409 ? -7.369  -6.624  26.534  1.00 0.00 ? 409 TYR A O    1  
ATOM 6397   C CB   . TYR A 1 409 ? -4.693  -6.344  24.862  1.00 0.00 ? 409 TYR A CB   1  
ATOM 6398   C CG   . TYR A 1 409 ? -3.292  -5.813  24.704  1.00 0.00 ? 409 TYR A CG   1  
ATOM 6399   C CD1  . TYR A 1 409 ? -2.816  -4.864  25.598  1.00 0.00 ? 409 TYR A CD1  1  
ATOM 6400   C CD2  . TYR A 1 409 ? -2.449  -6.246  23.671  1.00 0.00 ? 409 TYR A CD2  1  
ATOM 6401   C CE1  . TYR A 1 409 ? -1.560  -4.377  25.526  1.00 0.00 ? 409 TYR A CE1  1  
ATOM 6402   C CE2  . TYR A 1 409 ? -1.141  -5.748  23.578  1.00 0.00 ? 409 TYR A CE2  1  
ATOM 6403   C CZ   . TYR A 1 409 ? -0.713  -4.789  24.527  1.00 0.00 ? 409 TYR A CZ   1  
ATOM 6404   O OH   . TYR A 1 409 ? 0.550   -4.210  24.532  1.00 0.00 ? 409 TYR A OH   1  
ATOM 6405   H H    . TYR A 1 409 ? -3.295  -7.852  26.275  1.00 0.00 ? 409 TYR A H    1  
ATOM 6406   H HA   . TYR A 1 409 ? -5.041  -5.741  26.869  1.00 0.00 ? 409 TYR A HA   1  
ATOM 6407   H HB2  . TYR A 1 409 ? -4.795  -7.242  24.271  1.00 0.00 ? 409 TYR A HB2  1  
ATOM 6408   H HB3  . TYR A 1 409 ? -5.394  -5.605  24.501  1.00 0.00 ? 409 TYR A HB3  1  
ATOM 6409   H HD1  . TYR A 1 409 ? -3.463  -4.523  26.392  1.00 0.00 ? 409 TYR A HD1  1  
ATOM 6410   H HD2  . TYR A 1 409 ? -2.798  -6.983  22.964  1.00 0.00 ? 409 TYR A HD2  1  
ATOM 6411   H HE1  . TYR A 1 409 ? -1.225  -3.644  26.246  1.00 0.00 ? 409 TYR A HE1  1  
ATOM 6412   H HE2  . TYR A 1 409 ? -0.481  -6.073  22.786  1.00 0.00 ? 409 TYR A HE2  1  
ATOM 6413   H HH   . TYR A 1 409 ? 0.682   -3.794  25.386  1.00 0.00 ? 409 TYR A HH   1  
ATOM 6414   N N    . LYS A 1 410 ? -6.456  -8.645  26.407  1.00 0.00 ? 410 LYS A N    1  
ATOM 6415   C CA   . LYS A 1 410 ? -7.743  -9.317  26.519  1.00 0.00 ? 410 LYS A CA   1  
ATOM 6416   C C    . LYS A 1 410 ? -8.308  -9.067  27.893  1.00 0.00 ? 410 LYS A C    1  
ATOM 6417   O O    . LYS A 1 410 ? -9.495  -8.788  28.027  1.00 0.00 ? 410 LYS A O    1  
ATOM 6418   C CB   . LYS A 1 410 ? -7.609  -10.840 26.315  1.00 0.00 ? 410 LYS A CB   1  
ATOM 6419   C CG   . LYS A 1 410 ? -7.578  -11.318 24.864  1.00 0.00 ? 410 LYS A CG   1  
ATOM 6420   C CD   . LYS A 1 410 ? -7.500  -12.798 24.827  1.00 0.00 ? 410 LYS A CD   1  
ATOM 6421   C CE   . LYS A 1 410 ? -7.780  -13.358 23.462  1.00 0.00 ? 410 LYS A CE   1  
ATOM 6422   N NZ   . LYS A 1 410 ? -7.628  -14.826 23.521  1.00 0.00 ? 410 LYS A NZ   1  
ATOM 6423   H H    . LYS A 1 410 ? -5.638  -9.176  26.317  1.00 0.00 ? 410 LYS A H    1  
ATOM 6424   H HA   . LYS A 1 410 ? -8.419  -8.918  25.777  1.00 0.00 ? 410 LYS A HA   1  
ATOM 6425   H HB2  . LYS A 1 410 ? -6.697  -11.165 26.790  1.00 0.00 ? 410 LYS A HB2  1  
ATOM 6426   H HB3  . LYS A 1 410 ? -8.438  -11.320 26.817  1.00 0.00 ? 410 LYS A HB3  1  
ATOM 6427   H HG2  . LYS A 1 410 ? -8.476  -10.994 24.359  1.00 0.00 ? 410 LYS A HG2  1  
ATOM 6428   H HG3  . LYS A 1 410 ? -6.716  -10.900 24.366  1.00 0.00 ? 410 LYS A HG3  1  
ATOM 6429   H HD2  . LYS A 1 410 ? -6.509  -13.102 25.130  1.00 0.00 ? 410 LYS A HD2  1  
ATOM 6430   H HD3  . LYS A 1 410 ? -8.217  -13.202 25.527  1.00 0.00 ? 410 LYS A HD3  1  
ATOM 6431   H HE2  . LYS A 1 410 ? -8.789  -13.107 23.166  1.00 0.00 ? 410 LYS A HE2  1  
ATOM 6432   H HE3  . LYS A 1 410 ? -7.079  -12.950 22.749  1.00 0.00 ? 410 LYS A HE3  1  
ATOM 6433   H HZ1  . LYS A 1 410 ? -7.463  -15.119 24.505  1.00 0.00 ? 410 LYS A HZ1  1  
ATOM 6434   H HZ2  . LYS A 1 410 ? -6.821  -15.114 22.932  1.00 0.00 ? 410 LYS A HZ2  1  
ATOM 6435   H HZ3  . LYS A 1 410 ? -8.495  -15.279 23.170  1.00 0.00 ? 410 LYS A HZ3  1  
ATOM 6436   N N    . GLN A 1 411 ? -7.472  -9.183  28.921  1.00 0.00 ? 411 GLN A N    1  
ATOM 6437   C CA   . GLN A 1 411 ? -7.932  -9.033  30.296  1.00 0.00 ? 411 GLN A CA   1  
ATOM 6438   C C    . GLN A 1 411 ? -8.401  -7.633  30.552  1.00 0.00 ? 411 GLN A C    1  
ATOM 6439   O O    . GLN A 1 411 ? -9.427  -7.431  31.156  1.00 0.00 ? 411 GLN A O    1  
ATOM 6440   C CB   . GLN A 1 411 ? -6.808  -9.288  31.290  1.00 0.00 ? 411 GLN A CB   1  
ATOM 6441   C CG   . GLN A 1 411 ? -6.315  -10.724 31.402  1.00 0.00 ? 411 GLN A CG   1  
ATOM 6442   C CD   . GLN A 1 411 ? -7.347  -11.676 31.904  1.00 0.00 ? 411 GLN A CD   1  
ATOM 6443   O OE1  . GLN A 1 411 ? -8.070  -11.384 32.852  1.00 0.00 ? 411 GLN A OE1  1  
ATOM 6444   N NE2  . GLN A 1 411 ? -7.396  -12.860 31.293  1.00 0.00 ? 411 GLN A NE2  1  
ATOM 6445   H H    . GLN A 1 411 ? -6.537  -9.422  28.753  1.00 0.00 ? 411 GLN A H    1  
ATOM 6446   H HA   . GLN A 1 411 ? -8.736  -9.726  30.486  1.00 0.00 ? 411 GLN A HA   1  
ATOM 6447   H HB2  . GLN A 1 411 ? -5.968  -8.673  31.011  1.00 0.00 ? 411 GLN A HB2  1  
ATOM 6448   H HB3  . GLN A 1 411 ? -7.148  -8.966  32.266  1.00 0.00 ? 411 GLN A HB3  1  
ATOM 6449   H HG2  . GLN A 1 411 ? -5.991  -11.054 30.427  1.00 0.00 ? 411 GLN A HG2  1  
ATOM 6450   H HG3  . GLN A 1 411 ? -5.465  -10.744 32.071  1.00 0.00 ? 411 GLN A HG3  1  
ATOM 6451   H HE21 . GLN A 1 411 ? -6.776  -13.060 30.561  1.00 0.00 ? 411 GLN A HE21 1  
ATOM 6452   H HE22 . GLN A 1 411 ? -8.053  -13.531 31.576  1.00 0.00 ? 411 GLN A HE22 1  
ATOM 6453   N N    . GLU A 1 412 ? -7.618  -6.663  30.120  1.00 0.00 ? 412 GLU A N    1  
ATOM 6454   C CA   . GLU A 1 412 ? -7.997  -5.292  30.276  1.00 0.00 ? 412 GLU A CA   1  
ATOM 6455   C C    . GLU A 1 412 ? -9.402  -5.094  29.736  1.00 0.00 ? 412 GLU A C    1  
ATOM 6456   O O    . GLU A 1 412 ? -10.284 -4.644  30.465  1.00 0.00 ? 412 GLU A O    1  
ATOM 6457   C CB   . GLU A 1 412 ? -6.979  -4.402  29.598  1.00 0.00 ? 412 GLU A CB   1  
ATOM 6458   C CG   . GLU A 1 412 ? -5.656  -4.376  30.356  1.00 0.00 ? 412 GLU A CG   1  
ATOM 6459   C CD   . GLU A 1 412 ? -4.569  -3.630  29.638  1.00 0.00 ? 412 GLU A CD   1  
ATOM 6460   O OE1  . GLU A 1 412 ? -4.775  -3.313  28.432  1.00 0.00 ? 412 GLU A OE1  1  
ATOM 6461   O OE2  . GLU A 1 412 ? -3.516  -3.358  30.281  1.00 0.00 ? 412 GLU A OE2  1  
ATOM 6462   H H    . GLU A 1 412 ? -6.781  -6.885  29.660  1.00 0.00 ? 412 GLU A H    1  
ATOM 6463   H HA   . GLU A 1 412 ? -8.005  -5.060  31.332  1.00 0.00 ? 412 GLU A HA   1  
ATOM 6464   H HB2  . GLU A 1 412 ? -6.803  -4.767  28.597  1.00 0.00 ? 412 GLU A HB2  1  
ATOM 6465   H HB3  . GLU A 1 412 ? -7.372  -3.398  29.541  1.00 0.00 ? 412 GLU A HB3  1  
ATOM 6466   H HG2  . GLU A 1 412 ? -5.816  -3.908  31.315  1.00 0.00 ? 412 GLU A HG2  1  
ATOM 6467   H HG3  . GLU A 1 412 ? -5.332  -5.394  30.519  1.00 0.00 ? 412 GLU A HG3  1  
ATOM 6468   N N    . LEU A 1 413 ? -9.652  -5.509  28.504  1.00 0.00 ? 413 LEU A N    1  
ATOM 6469   C CA   . LEU A 1 413 ? -11.012 -5.440  27.974  1.00 0.00 ? 413 LEU A CA   1  
ATOM 6470   C C    . LEU A 1 413 ? -12.051 -6.085  28.896  1.00 0.00 ? 413 LEU A C    1  
ATOM 6471   O O    . LEU A 1 413 ? -13.017 -5.409  29.264  1.00 0.00 ? 413 LEU A O    1  
ATOM 6472   C CB   . LEU A 1 413 ? -11.096 -6.012  26.560  1.00 0.00 ? 413 LEU A CB   1  
ATOM 6473   C CG   . LEU A 1 413 ? -10.315 -5.231  25.506  1.00 0.00 ? 413 LEU A CG   1  
ATOM 6474   C CD1  . LEU A 1 413 ? -10.390 -5.978  24.183  1.00 0.00 ? 413 LEU A CD1  1  
ATOM 6475   C CD2  . LEU A 1 413 ? -10.783 -3.753  25.353  1.00 0.00 ? 413 LEU A CD2  1  
ATOM 6476   H H    . LEU A 1 413 ? -8.941  -5.927  27.975  1.00 0.00 ? 413 LEU A H    1  
ATOM 6477   H HA   . LEU A 1 413 ? -11.266 -4.391  27.906  1.00 0.00 ? 413 LEU A HA   1  
ATOM 6478   H HB2  . LEU A 1 413 ? -10.719 -7.022  26.578  1.00 0.00 ? 413 LEU A HB2  1  
ATOM 6479   H HB3  . LEU A 1 413 ? -12.137 -6.042  26.267  1.00 0.00 ? 413 LEU A HB3  1  
ATOM 6480   H HG   . LEU A 1 413 ? -9.276  -5.225  25.814  1.00 0.00 ? 413 LEU A HG   1  
ATOM 6481   H HD11 . LEU A 1 413 ? -9.768  -6.858  24.231  1.00 0.00 ? 413 LEU A HD11 1  
ATOM 6482   H HD12 . LEU A 1 413 ? -10.045 -5.335  23.387  1.00 0.00 ? 413 LEU A HD12 1  
ATOM 6483   H HD13 . LEU A 1 413 ? -11.413 -6.269  23.992  1.00 0.00 ? 413 LEU A HD13 1  
ATOM 6484   H HD21 . LEU A 1 413 ? -10.354 -3.156  26.146  1.00 0.00 ? 413 LEU A HD21 1  
ATOM 6485   H HD22 . LEU A 1 413 ? -11.860 -3.709  25.411  1.00 0.00 ? 413 LEU A HD22 1  
ATOM 6486   H HD23 . LEU A 1 413 ? -10.458 -3.370  24.397  1.00 0.00 ? 413 LEU A HD23 1  
ATOM 6487   N N    . ARG A 1 414 ? -11.847 -7.362  29.264  1.00 0.00 ? 414 ARG A N    1  
ATOM 6488   C CA   . ARG A 1 414 ? -12.659 -8.038  30.308  1.00 0.00 ? 414 ARG A CA   1  
ATOM 6489   C C    . ARG A 1 414 ? -12.923 -7.162  31.539  1.00 0.00 ? 414 ARG A C    1  
ATOM 6490   O O    . ARG A 1 414 ? -14.041 -7.084  32.036  1.00 0.00 ? 414 ARG A O    1  
ATOM 6491   C CB   . ARG A 1 414 ? -12.023 -9.359  30.726  1.00 0.00 ? 414 ARG A CB   1  
ATOM 6492   C CG   . ARG A 1 414 ? -12.611 -10.570 29.964  1.00 0.00 ? 414 ARG A CG   1  
ATOM 6493   C CD   . ARG A 1 414 ? -12.219 -11.943 30.518  1.00 0.00 ? 414 ARG A CD   1  
ATOM 6494   N NE   . ARG A 1 414 ? -10.811 -12.188 30.241  1.00 0.00 ? 414 ARG A NE   1  
ATOM 6495   C CZ   . ARG A 1 414 ? -10.322 -12.828 29.174  1.00 0.00 ? 414 ARG A CZ   1  
ATOM 6496   N NH1  . ARG A 1 414 ? -11.122 -13.368 28.232  1.00 0.00 ? 414 ARG A NH1  1  
ATOM 6497   N NH2  . ARG A 1 414 ? -8.996  -12.923 29.064  1.00 0.00 ? 414 ARG A NH2  1  
ATOM 6498   H H    . ARG A 1 414 ? -11.050 -7.821  28.926  1.00 0.00 ? 414 ARG A H    1  
ATOM 6499   H HA   . ARG A 1 414 ? -13.619 -8.267  29.867  1.00 0.00 ? 414 ARG A HA   1  
ATOM 6500   H HB2  . ARG A 1 414 ? -10.961 -9.311  30.535  1.00 0.00 ? 414 ARG A HB2  1  
ATOM 6501   H HB3  . ARG A 1 414 ? -12.181 -9.502  31.785  1.00 0.00 ? 414 ARG A HB3  1  
ATOM 6502   H HG2  . ARG A 1 414 ? -13.687 -10.495 29.986  1.00 0.00 ? 414 ARG A HG2  1  
ATOM 6503   H HG3  . ARG A 1 414 ? -12.289 -10.509 28.933  1.00 0.00 ? 414 ARG A HG3  1  
ATOM 6504   H HD2  . ARG A 1 414 ? -12.385 -11.963 31.585  1.00 0.00 ? 414 ARG A HD2  1  
ATOM 6505   H HD3  . ARG A 1 414 ? -12.820 -12.707 30.046  1.00 0.00 ? 414 ARG A HD3  1  
ATOM 6506   H HE   . ARG A 1 414 ? -10.163 -11.840 30.888  1.00 0.00 ? 414 ARG A HE   1  
ATOM 6507   H HH11 . ARG A 1 414 ? -12.116 -13.295 28.319  1.00 0.00 ? 414 ARG A HH11 1  
ATOM 6508   H HH12 . ARG A 1 414 ? -10.723 -13.840 27.447  1.00 0.00 ? 414 ARG A HH12 1  
ATOM 6509   H HH21 . ARG A 1 414 ? -8.407  -12.522 29.765  1.00 0.00 ? 414 ARG A HH21 1  
ATOM 6510   H HH22 . ARG A 1 414 ? -8.592  -13.394 28.280  1.00 0.00 ? 414 ARG A HH22 1  
ATOM 6511   N N    . ASP A 1 415 ? -11.909 -6.438  31.977  1.00 0.00 ? 415 ASP A N    1  
ATOM 6512   C CA   . ASP A 1 415 ? -11.999 -5.613  33.168  1.00 0.00 ? 415 ASP A CA   1  
ATOM 6513   C C    . ASP A 1 415 ? -12.710 -4.296  32.967  1.00 0.00 ? 415 ASP A C    1  
ATOM 6514   O O    . ASP A 1 415 ? -13.110 -3.658  33.935  1.00 0.00 ? 415 ASP A O    1  
ATOM 6515   C CB   . ASP A 1 415 ? -10.586 -5.289  33.661  1.00 0.00 ? 415 ASP A CB   1  
ATOM 6516   C CG   . ASP A 1 415 ? -9.873  -6.502  34.244  1.00 0.00 ? 415 ASP A CG   1  
ATOM 6517   O OD1  . ASP A 1 415 ? -10.510 -7.551  34.519  1.00 0.00 ? 415 ASP A OD1  1  
ATOM 6518   O OD2  . ASP A 1 415 ? -8.659  -6.390  34.433  1.00 0.00 ? 415 ASP A OD2  1  
ATOM 6519   H H    . ASP A 1 415 ? -11.052 -6.492  31.504  1.00 0.00 ? 415 ASP A H    1  
ATOM 6520   H HA   . ASP A 1 415 ? -12.503 -6.169  33.941  1.00 0.00 ? 415 ASP A HA   1  
ATOM 6521   H HB2  . ASP A 1 415 ? -10.006 -4.912  32.832  1.00 0.00 ? 415 ASP A HB2  1  
ATOM 6522   H HB3  . ASP A 1 415 ? -10.650 -4.522  34.420  1.00 0.00 ? 415 ASP A HB3  1  
ATOM 6523   N N    . GLU A 1 416 ? -12.787 -3.851  31.718  1.00 0.00 ? 416 GLU A N    1  
ATOM 6524   C CA   . GLU A 1 416 ? -13.440 -2.603  31.407  1.00 0.00 ? 416 GLU A CA   1  
ATOM 6525   C C    . GLU A 1 416 ? -14.873 -2.834  30.903  1.00 0.00 ? 416 GLU A C    1  
ATOM 6526   O O    . GLU A 1 416 ? -15.524 -1.881  30.461  1.00 0.00 ? 416 GLU A O    1  
ATOM 6527   C CB   . GLU A 1 416 ? -12.677 -1.863  30.337  1.00 0.00 ? 416 GLU A CB   1  
ATOM 6528   C CG   . GLU A 1 416 ? -11.307 -1.400  30.679  1.00 0.00 ? 416 GLU A CG   1  
ATOM 6529   C CD   . GLU A 1 416 ? -10.695 -0.679  29.497  1.00 0.00 ? 416 GLU A CD   1  
ATOM 6530   O OE1  . GLU A 1 416 ? -11.351 -0.644  28.425  1.00 0.00 ? 416 GLU A OE1  1  
ATOM 6531   O OE2  . GLU A 1 416 ? -9.573  -0.138  29.619  1.00 0.00 ? 416 GLU A OE2  1  
ATOM 6532   H H    . GLU A 1 416 ? -12.391 -4.379  30.994  1.00 0.00 ? 416 GLU A H    1  
ATOM 6533   H HA   . GLU A 1 416 ? -13.474 -1.992  32.296  1.00 0.00 ? 416 GLU A HA   1  
ATOM 6534   H HB2  . GLU A 1 416 ? -12.596 -2.509  29.479  1.00 0.00 ? 416 GLU A HB2  1  
ATOM 6535   H HB3  . GLU A 1 416 ? -13.266 -1.002  30.048  1.00 0.00 ? 416 GLU A HB3  1  
ATOM 6536   H HG2  . GLU A 1 416 ? -11.356 -0.728  31.525  1.00 0.00 ? 416 GLU A HG2  1  
ATOM 6537   H HG3  . GLU A 1 416 ? -10.694 -2.252  30.933  1.00 0.00 ? 416 GLU A HG3  1  
ATOM 6538   N N    . GLY A 1 417 ? -15.343 -4.088  30.960  1.00 0.00 ? 417 GLY A N    1  
ATOM 6539   C CA   . GLY A 1 417 ? -16.714 -4.457  30.574  1.00 0.00 ? 417 GLY A CA   1  
ATOM 6540   C C    . GLY A 1 417 ? -16.944 -4.256  29.081  1.00 0.00 ? 417 GLY A C    1  
ATOM 6541   O O    . GLY A 1 417 ? -17.971 -3.668  28.647  1.00 0.00 ? 417 GLY A O    1  
ATOM 6542   H H    . GLY A 1 417 ? -14.756 -4.788  31.315  1.00 0.00 ? 417 GLY A H    1  
ATOM 6543   H HA2  . GLY A 1 417 ? -16.883 -5.495  30.822  1.00 0.00 ? 417 GLY A HA2  1  
ATOM 6544   H HA3  . GLY A 1 417 ? -17.413 -3.844  31.123  1.00 0.00 ? 417 GLY A HA3  1  
ATOM 6545   N N    . LYS A 1 418 ? -15.963 -4.753  28.319  1.00 0.00 ? 418 LYS A N    1  
ATOM 6546   C CA   . LYS A 1 418 ? -15.889 -4.621  26.876  1.00 0.00 ? 418 LYS A CA   1  
ATOM 6547   C C    . LYS A 1 418 ? -15.766 -6.002  26.188  1.00 0.00 ? 418 LYS A C    1  
ATOM 6548   O O    . LYS A 1 418 ? -14.735 -6.699  26.317  1.00 0.00 ? 418 LYS A O    1  
ATOM 6549   C CB   . LYS A 1 418 ? -14.700 -3.750  26.515  1.00 0.00 ? 418 LYS A CB   1  
ATOM 6550   C CG   . LYS A 1 418 ? -14.834 -2.342  26.920  1.00 0.00 ? 418 LYS A CG   1  
ATOM 6551   C CD   . LYS A 1 418 ? -13.610 -1.518  26.526  1.00 0.00 ? 418 LYS A CD   1  
ATOM 6552   C CE   . LYS A 1 418 ? -13.832 -0.061  26.974  1.00 0.00 ? 418 LYS A CE   1  
ATOM 6553   N NZ   . LYS A 1 418 ? -12.716 0.812   26.656  1.00 0.00 ? 418 LYS A NZ   1  
ATOM 6554   H H    . LYS A 1 418 ? -15.212 -5.188  28.774  1.00 0.00 ? 418 LYS A H    1  
ATOM 6555   H HA   . LYS A 1 418 ? -16.789 -4.138  26.526  1.00 0.00 ? 418 LYS A HA   1  
ATOM 6556   H HB2  . LYS A 1 418 ? -13.821 -4.155  26.990  1.00 0.00 ? 418 LYS A HB2  1  
ATOM 6557   H HB3  . LYS A 1 418 ? -14.559 -3.793  25.443  1.00 0.00 ? 418 LYS A HB3  1  
ATOM 6558   H HG2  . LYS A 1 418 ? -15.709 -1.921  26.446  1.00 0.00 ? 418 LYS A HG2  1  
ATOM 6559   H HG3  . LYS A 1 418 ? -14.958 -2.295  27.992  1.00 0.00 ? 418 LYS A HG3  1  
ATOM 6560   H HD2  . LYS A 1 418 ? -12.731 -1.919  27.012  1.00 0.00 ? 418 LYS A HD2  1  
ATOM 6561   H HD3  . LYS A 1 418 ? -13.480 -1.549  25.455  1.00 0.00 ? 418 LYS A HD3  1  
ATOM 6562   H HE2  . LYS A 1 418 ? -14.713 0.322   26.487  1.00 0.00 ? 418 LYS A HE2  1  
ATOM 6563   H HE3  . LYS A 1 418 ? -13.997 -0.049  28.043  1.00 0.00 ? 418 LYS A HE3  1  
ATOM 6564   H HZ1  . LYS A 1 418 ? -11.823 0.324   26.867  1.00 0.00 ? 418 LYS A HZ1  1  
ATOM 6565   H HZ2  . LYS A 1 418 ? -12.782 1.679   27.228  1.00 0.00 ? 418 LYS A HZ2  1  
ATOM 6566   H HZ3  . LYS A 1 418 ? -12.743 1.057   25.647  1.00 0.00 ? 418 LYS A HZ3  1  
ATOM 6567   N N    . ALA A 1 419 ? -16.836 -6.392  25.492  1.00 0.00 ? 419 ALA A N    1  
ATOM 6568   C CA   . ALA A 1 419 ? -16.922 -7.666  24.789  1.00 0.00 ? 419 ALA A CA   1  
ATOM 6569   C C    . ALA A 1 419 ? -15.844 -7.757  23.731  1.00 0.00 ? 419 ALA A C    1  
ATOM 6570   O O    . ALA A 1 419 ? -15.474 -6.751  23.124  1.00 0.00 ? 419 ALA A O    1  
ATOM 6571   C CB   . ALA A 1 419 ? -18.314 -7.828  24.113  1.00 0.00 ? 419 ALA A CB   1  
ATOM 6572   H H    . ALA A 1 419 ? -17.612 -5.794  25.462  1.00 0.00 ? 419 ALA A H    1  
ATOM 6573   H HA   . ALA A 1 419 ? -16.786 -8.468  25.499  1.00 0.00 ? 419 ALA A HA   1  
ATOM 6574   H HB1  . ALA A 1 419 ? -19.091 -7.617  24.834  1.00 0.00 ? 419 ALA A HB1  1  
ATOM 6575   H HB2  . ALA A 1 419 ? -18.424 -8.840  23.752  1.00 0.00 ? 419 ALA A HB2  1  
ATOM 6576   H HB3  . ALA A 1 419 ? -18.394 -7.140  23.284  1.00 0.00 ? 419 ALA A HB3  1  
ATOM 6577   N N    . PHE A 1 420 ? -15.354 -8.978  23.545  1.00 0.00 ? 420 PHE A N    1  
ATOM 6578   C CA   . PHE A 1 420 ? -14.546 -9.347  22.433  1.00 0.00 ? 420 PHE A CA   1  
ATOM 6579   C C    . PHE A 1 420 ? -14.797 -10.831 22.247  1.00 0.00 ? 420 PHE A C    1  
ATOM 6580   O O    . PHE A 1 420 ? -15.161 -11.536 23.187  1.00 0.00 ? 420 PHE A O    1  
ATOM 6581   C CB   . PHE A 1 420 ? -13.068 -9.033  22.687  1.00 0.00 ? 420 PHE A CB   1  
ATOM 6582   C CG   . PHE A 1 420 ? -12.510 -9.666  23.935  1.00 0.00 ? 420 PHE A CG   1  
ATOM 6583   C CD1  . PHE A 1 420 ? -11.933 -10.945 23.898  1.00 0.00 ? 420 PHE A CD1  1  
ATOM 6584   C CD2  . PHE A 1 420 ? -12.501 -8.981  25.118  1.00 0.00 ? 420 PHE A CD2  1  
ATOM 6585   C CE1  . PHE A 1 420 ? -11.407 -11.537 25.051  1.00 0.00 ? 420 PHE A CE1  1  
ATOM 6586   C CE2  . PHE A 1 420 ? -11.959 -9.557  26.254  1.00 0.00 ? 420 PHE A CE2  1  
ATOM 6587   C CZ   . PHE A 1 420 ? -11.420 -10.830 26.224  1.00 0.00 ? 420 PHE A CZ   1  
ATOM 6588   H H    . PHE A 1 420 ? -15.716 -9.700  24.099  1.00 0.00 ? 420 PHE A H    1  
ATOM 6589   H HA   . PHE A 1 420 ? -14.885 -8.815  21.554  1.00 0.00 ? 420 PHE A HA   1  
ATOM 6590   H HB2  . PHE A 1 420 ? -12.493 -9.381  21.844  1.00 0.00 ? 420 PHE A HB2  1  
ATOM 6591   H HB3  . PHE A 1 420 ? -12.954 -7.960  22.759  1.00 0.00 ? 420 PHE A HB3  1  
ATOM 6592   H HD1  . PHE A 1 420 ? -11.932 -11.498 22.970  1.00 0.00 ? 420 PHE A HD1  1  
ATOM 6593   H HD2  . PHE A 1 420 ? -12.916 -7.985  25.167  1.00 0.00 ? 420 PHE A HD2  1  
ATOM 6594   H HE1  . PHE A 1 420 ? -10.966 -12.522 25.010  1.00 0.00 ? 420 PHE A HE1  1  
ATOM 6595   H HE2  . PHE A 1 420 ? -11.965 -9.005  27.183  1.00 0.00 ? 420 PHE A HE2  1  
ATOM 6596   H HZ   . PHE A 1 420 ? -11.019 -11.270 27.126  1.00 0.00 ? 420 PHE A HZ   1  
ATOM 6597   N N    . ASP A 1 421 ? -14.611 -11.299 21.020  1.00 0.00 ? 421 ASP A N    1  
ATOM 6598   C CA   . ASP A 1 421 ? -14.868 -12.675 20.655  1.00 0.00 ? 421 ASP A CA   1  
ATOM 6599   C C    . ASP A 1 421 ? -13.802 -13.448 21.388  1.00 0.00 ? 421 ASP A C    1  
ATOM 6600   O O    . ASP A 1 421 ? -12.636 -13.277 21.089  1.00 0.00 ? 421 ASP A O    1  
ATOM 6601   C CB   . ASP A 1 421 ? -14.731 -12.816 19.131  1.00 0.00 ? 421 ASP A CB   1  
ATOM 6602   C CG   . ASP A 1 421 ? -15.105 -14.195 18.629  1.00 0.00 ? 421 ASP A CG   1  
ATOM 6603   O OD1  . ASP A 1 421 ? -15.506 -15.047 19.441  1.00 0.00 ? 421 ASP A OD1  1  
ATOM 6604   O OD2  . ASP A 1 421 ? -14.984 -14.437 17.404  1.00 0.00 ? 421 ASP A OD2  1  
ATOM 6605   H H    . ASP A 1 421 ? -14.328 -10.675 20.320  1.00 0.00 ? 421 ASP A H    1  
ATOM 6606   H HA   . ASP A 1 421 ? -15.852 -12.978 20.983  1.00 0.00 ? 421 ASP A HA   1  
ATOM 6607   H HB2  . ASP A 1 421 ? -15.373 -12.090 18.656  1.00 0.00 ? 421 ASP A HB2  1  
ATOM 6608   H HB3  . ASP A 1 421 ? -13.707 -12.608 18.854  1.00 0.00 ? 421 ASP A HB3  1  
ATOM 6609   N N    . GLU A 1 422 ? -14.187 -14.250 22.380  1.00 0.00 ? 422 GLU A N    1  
ATOM 6610   C CA   . GLU A 1 422 ? -13.205 -15.075 23.111  1.00 0.00 ? 422 GLU A CA   1  
ATOM 6611   C C    . GLU A 1 422 ? -12.625 -16.174 22.223  1.00 0.00 ? 422 GLU A C    1  
ATOM 6612   O O    . GLU A 1 422 ? -11.636 -16.756 22.564  1.00 0.00 ? 422 GLU A O    1  
ATOM 6613   C CB   . GLU A 1 422 ? -13.793 -15.699 24.386  1.00 0.00 ? 422 GLU A CB   1  
ATOM 6614   C CG   . GLU A 1 422 ? -14.241 -14.696 25.506  1.00 0.00 ? 422 GLU A CG   1  
ATOM 6615   C CD   . GLU A 1 422 ? -13.098 -13.928 26.239  1.00 0.00 ? 422 GLU A CD   1  
ATOM 6616   O OE1  . GLU A 1 422 ? -11.911 -14.332 26.170  1.00 0.00 ? 422 GLU A OE1  1  
ATOM 6617   O OE2  . GLU A 1 422 ? -13.403 -12.909 26.911  1.00 0.00 ? 422 GLU A OE2  1  
ATOM 6618   H H    . GLU A 1 422 ? -15.138 -14.317 22.606  1.00 0.00 ? 422 GLU A H    1  
ATOM 6619   H HA   . GLU A 1 422 ? -12.390 -14.428 23.405  1.00 0.00 ? 422 GLU A HA   1  
ATOM 6620   H HB2  . GLU A 1 422 ? -14.652 -16.287 24.106  1.00 0.00 ? 422 GLU A HB2  1  
ATOM 6621   H HB3  . GLU A 1 422 ? -13.052 -16.366 24.804  1.00 0.00 ? 422 GLU A HB3  1  
ATOM 6622   H HG2  . GLU A 1 422 ? -14.897 -13.965 25.060  1.00 0.00 ? 422 GLU A HG2  1  
ATOM 6623   H HG3  . GLU A 1 422 ? -14.809 -15.249 26.243  1.00 0.00 ? 422 GLU A HG3  1  
ATOM 6624   N N    . SER A 1 423 ? -13.259 -16.451 21.091  1.00 0.00 ? 423 SER A N    1  
ATOM 6625   C CA   . SER A 1 423 ? -12.846 -17.493 20.148  1.00 0.00 ? 423 SER A CA   1  
ATOM 6626   C C    . SER A 1 423 ? -11.793 -17.020 19.176  1.00 0.00 ? 423 SER A C    1  
ATOM 6627   O O    . SER A 1 423 ? -11.475 -17.740 18.240  1.00 0.00 ? 423 SER A O    1  
ATOM 6628   C CB   . SER A 1 423 ? -14.033 -17.826 19.255  1.00 0.00 ? 423 SER A CB   1  
ATOM 6629   O OG   . SER A 1 423 ? -15.103 -18.297 20.036  1.00 0.00 ? 423 SER A OG   1  
ATOM 6630   H H    . SER A 1 423 ? -14.067 -15.937 20.881  1.00 0.00 ? 423 SER A H    1  
ATOM 6631   H HA   . SER A 1 423 ? -12.524 -18.379 20.667  1.00 0.00 ? 423 SER A HA   1  
ATOM 6632   H HB2  . SER A 1 423 ? -14.346 -16.941 18.728  1.00 0.00 ? 423 SER A HB2  1  
ATOM 6633   H HB3  . SER A 1 423 ? -13.738 -18.582 18.537  1.00 0.00 ? 423 SER A HB3  1  
ATOM 6634   H HG   . SER A 1 423 ? -15.214 -17.699 20.780  1.00 0.00 ? 423 SER A HG   1  
ATOM 6635   N N    . ILE A 1 424 ? -11.314 -15.786 19.346  1.00 0.00 ? 424 ILE A N    1  
ATOM 6636   C CA   . ILE A 1 424 ? -10.668 -15.098 18.243  1.00 0.00 ? 424 ILE A CA   1  
ATOM 6637   C C    . ILE A 1 424 ? -9.391  -15.798 17.886  1.00 0.00 ? 424 ILE A C    1  
ATOM 6638   O O    . ILE A 1 424 ? -8.588  -16.104 18.767  1.00 0.00 ? 424 ILE A O    1  
ATOM 6639   C CB   . ILE A 1 424 ? -10.413 -13.615 18.522  1.00 0.00 ? 424 ILE A CB   1  
ATOM 6640   C CG1  . ILE A 1 424 ? -10.141 -12.896 17.212  1.00 0.00 ? 424 ILE A CG1  1  
ATOM 6641   C CG2  . ILE A 1 424 ? -9.293  -13.449 19.554  1.00 0.00 ? 424 ILE A CG2  1  
ATOM 6642   C CD1  . ILE A 1 424 ? -9.989  -11.479 17.379  1.00 0.00 ? 424 ILE A CD1  1  
ATOM 6643   H H    . ILE A 1 424 ? -11.658 -15.250 20.091  1.00 0.00 ? 424 ILE A H    1  
ATOM 6644   H HA   . ILE A 1 424 ? -11.327 -15.166 17.388  1.00 0.00 ? 424 ILE A HA   1  
ATOM 6645   H HB   . ILE A 1 424 ? -11.317 -13.203 18.953  1.00 0.00 ? 424 ILE A HB   1  
ATOM 6646   H HG12 . ILE A 1 424 ? -9.236  -13.290 16.778  1.00 0.00 ? 424 ILE A HG12 1  
ATOM 6647   H HG13 . ILE A 1 424 ? -10.962 -13.088 16.534  1.00 0.00 ? 424 ILE A HG13 1  
ATOM 6648   H HG21 . ILE A 1 424 ? -8.349  -13.319 19.044  1.00 0.00 ? 424 ILE A HG21 1  
ATOM 6649   H HG22 . ILE A 1 424 ? -9.245  -14.329 20.179  1.00 0.00 ? 424 ILE A HG22 1  
ATOM 6650   H HG23 . ILE A 1 424 ? -9.493  -12.583 20.167  1.00 0.00 ? 424 ILE A HG23 1  
ATOM 6651   H HD11 . ILE A 1 424 ? -10.232 -10.978 16.454  1.00 0.00 ? 424 ILE A HD11 1  
ATOM 6652   H HD12 . ILE A 1 424 ? -8.966  -11.257 17.652  1.00 0.00 ? 424 ILE A HD12 1  
ATOM 6653   H HD13 . ILE A 1 424 ? -10.653 -11.133 18.156  1.00 0.00 ? 424 ILE A HD13 1  
ATOM 6654   N N    . GLU A 1 425 ? -9.231  -16.073 16.598  1.00 0.00 ? 425 GLU A N    1  
ATOM 6655   C CA   . GLU A 1 425 ? -8.088  -16.830 16.177  1.00 0.00 ? 425 GLU A CA   1  
ATOM 6656   C C    . GLU A 1 425 ? -6.971  -15.925 15.768  1.00 0.00 ? 425 GLU A C    1  
ATOM 6657   O O    . GLU A 1 425 ? -7.185  -14.824 15.232  1.00 0.00 ? 425 GLU A O    1  
ATOM 6658   C CB   . GLU A 1 425 ? -8.418  -17.775 15.055  1.00 0.00 ? 425 GLU A CB   1  
ATOM 6659   C CG   . GLU A 1 425 ? -9.472  -18.780 15.399  1.00 0.00 ? 425 GLU A CG   1  
ATOM 6660   C CD   . GLU A 1 425 ? -9.688  -19.662 14.233  1.00 0.00 ? 425 GLU A CD   1  
ATOM 6661   O OE1  . GLU A 1 425 ? -8.680  -20.299 13.837  1.00 0.00 ? 425 GLU A OE1  1  
ATOM 6662   O OE2  . GLU A 1 425 ? -10.824 -19.652 13.673  1.00 0.00 ? 425 GLU A OE2  1  
ATOM 6663   H H    . GLU A 1 425 ? -9.922  -15.821 15.950  1.00 0.00 ? 425 GLU A H    1  
ATOM 6664   H HA   . GLU A 1 425 ? -7.750  -17.417 17.019  1.00 0.00 ? 425 GLU A HA   1  
ATOM 6665   H HB2  . GLU A 1 425 ? -8.759  -17.199 14.209  1.00 0.00 ? 425 GLU A HB2  1  
ATOM 6666   H HB3  . GLU A 1 425 ? -7.515  -18.299 14.771  1.00 0.00 ? 425 GLU A HB3  1  
ATOM 6667   H HG2  . GLU A 1 425 ? -9.148  -19.370 16.245  1.00 0.00 ? 425 GLU A HG2  1  
ATOM 6668   H HG3  . GLU A 1 425 ? -10.392 -18.272 15.644  1.00 0.00 ? 425 GLU A HG3  1  
ATOM 6669   N N    . ILE A 1 426 ? -5.775  -16.425 16.048  1.00 0.00 ? 426 ILE A N    1  
ATOM 6670   C CA   . ILE A 1 426 ? -4.558  -15.696 15.883  1.00 0.00 ? 426 ILE A CA   1  
ATOM 6671   C C    . ILE A 1 426 ? -3.633  -16.484 14.960  1.00 0.00 ? 426 ILE A C    1  
ATOM 6672   O O    . ILE A 1 426 ? -3.475  -17.700 15.111  1.00 0.00 ? 426 ILE A O    1  
ATOM 6673   C CB   . ILE A 1 426 ? -3.950  -15.532 17.248  1.00 0.00 ? 426 ILE A CB   1  
ATOM 6674   C CG1  . ILE A 1 426 ? -4.951  -14.729 18.071  1.00 0.00 ? 426 ILE A CG1  1  
ATOM 6675   C CG2  . ILE A 1 426 ? -2.587  -14.855 17.170  1.00 0.00 ? 426 ILE A CG2  1  
ATOM 6676   C CD1  . ILE A 1 426 ? -4.667  -14.629 19.505  1.00 0.00 ? 426 ILE A CD1  1  
ATOM 6677   H H    . ILE A 1 426 ? -5.731  -17.305 16.476  1.00 0.00 ? 426 ILE A H    1  
ATOM 6678   H HA   . ILE A 1 426 ? -4.764  -14.726 15.457  1.00 0.00 ? 426 ILE A HA   1  
ATOM 6679   H HB   . ILE A 1 426 ? -3.831  -16.507 17.698  1.00 0.00 ? 426 ILE A HB   1  
ATOM 6680   H HG12 . ILE A 1 426 ? -4.991  -13.729 17.672  1.00 0.00 ? 426 ILE A HG12 1  
ATOM 6681   H HG13 . ILE A 1 426 ? -5.927  -15.179 17.942  1.00 0.00 ? 426 ILE A HG13 1  
ATOM 6682   H HG21 . ILE A 1 426 ? -2.550  -14.036 17.873  1.00 0.00 ? 426 ILE A HG21 1  
ATOM 6683   H HG22 . ILE A 1 426 ? -2.430  -14.477 16.170  1.00 0.00 ? 426 ILE A HG22 1  
ATOM 6684   H HG23 . ILE A 1 426 ? -1.815  -15.570 17.410  1.00 0.00 ? 426 ILE A HG23 1  
ATOM 6685   H HD11 . ILE A 1 426 ? -3.628  -14.860 19.684  1.00 0.00 ? 426 ILE A HD11 1  
ATOM 6686   H HD12 . ILE A 1 426 ? -5.291  -15.328 20.045  1.00 0.00 ? 426 ILE A HD12 1  
ATOM 6687   H HD13 . ILE A 1 426 ? -4.874  -13.625 19.844  1.00 0.00 ? 426 ILE A HD13 1  
ATOM 6688   N N    . GLY A 1 427 ? -3.036  -15.801 13.995  1.00 0.00 ? 427 GLY A N    1  
ATOM 6689   C CA   . GLY A 1 427 ? -2.100  -16.456 13.078  1.00 0.00 ? 427 GLY A CA   1  
ATOM 6690   C C    . GLY A 1 427 ? -0.945  -15.552 12.716  1.00 0.00 ? 427 GLY A C    1  
ATOM 6691   O O    . GLY A 1 427 ? -0.765  -14.484 13.302  1.00 0.00 ? 427 GLY A O    1  
ATOM 6692   H H    . GLY A 1 427 ? -3.204  -14.839 13.909  1.00 0.00 ? 427 GLY A H    1  
ATOM 6693   H HA2  . GLY A 1 427 ? -1.714  -17.349 13.548  1.00 0.00 ? 427 GLY A HA2  1  
ATOM 6694   H HA3  . GLY A 1 427 ? -2.626  -16.732 12.176  1.00 0.00 ? 427 GLY A HA3  1  
ATOM 6695   N N    . VAL A 1 428 ? -0.141  -15.953 11.755  1.00 0.00 ? 428 VAL A N    1  
ATOM 6696   C CA   . VAL A 1 428 ? 1.023   -15.157 11.447  1.00 0.00 ? 428 VAL A CA   1  
ATOM 6697   C C    . VAL A 1 428 ? 1.248   -15.166 9.972   1.00 0.00 ? 428 VAL A C    1  
ATOM 6698   O O    . VAL A 1 428 ? 0.888   -16.122 9.300   1.00 0.00 ? 428 VAL A O    1  
ATOM 6699   C CB   . VAL A 1 428 ? 2.297   -15.696 12.142  1.00 0.00 ? 428 VAL A CB   1  
ATOM 6700   C CG1  . VAL A 1 428 ? 2.239   -15.457 13.627  1.00 0.00 ? 428 VAL A CG1  1  
ATOM 6701   C CG2  . VAL A 1 428 ? 2.509   -17.172 11.823  1.00 0.00 ? 428 VAL A CG2  1  
ATOM 6702   H H    . VAL A 1 428 ? -0.296  -16.807 11.300  1.00 0.00 ? 428 VAL A H    1  
ATOM 6703   H HA   . VAL A 1 428 ? 0.851   -14.142 11.771  1.00 0.00 ? 428 VAL A HA   1  
ATOM 6704   H HB   . VAL A 1 428 ? 3.142   -15.142 11.753  1.00 0.00 ? 428 VAL A HB   1  
ATOM 6705   H HG11 . VAL A 1 428 ? 3.104   -15.901 14.097  1.00 0.00 ? 428 VAL A HG11 1  
ATOM 6706   H HG12 . VAL A 1 428 ? 1.342   -15.906 14.028  1.00 0.00 ? 428 VAL A HG12 1  
ATOM 6707   H HG13 . VAL A 1 428 ? 2.229   -14.395 13.821  1.00 0.00 ? 428 VAL A HG13 1  
ATOM 6708   H HG21 . VAL A 1 428 ? 1.558   -17.633 11.601  1.00 0.00 ? 428 VAL A HG21 1  
ATOM 6709   H HG22 . VAL A 1 428 ? 2.956   -17.663 12.675  1.00 0.00 ? 428 VAL A HG22 1  
ATOM 6710   H HG23 . VAL A 1 428 ? 3.162   -17.265 10.969  1.00 0.00 ? 428 VAL A HG23 1  
ATOM 6711   N N    . MET A 1 429 ? 1.803   -14.079 9.467   1.00 0.00 ? 429 MET A N    1  
ATOM 6712   C CA   . MET A 1 429 ? 2.231   -14.011 8.098   1.00 0.00 ? 429 MET A CA   1  
ATOM 6713   C C    . MET A 1 429 ? 3.436   -14.903 8.073   1.00 0.00 ? 429 MET A C    1  
ATOM 6714   O O    . MET A 1 429 ? 4.236   -14.846 8.999   1.00 0.00 ? 429 MET A O    1  
ATOM 6715   C CB   . MET A 1 429 ? 2.670   -12.591 7.790   1.00 0.00 ? 429 MET A CB   1  
ATOM 6716   C CG   . MET A 1 429 ? 1.521   -11.648 7.437   1.00 0.00 ? 429 MET A CG   1  
ATOM 6717   S SD   . MET A 1 429 ? 0.420   -12.429 6.066   1.00 0.00 ? 429 MET A SD   1  
ATOM 6718   C CE   . MET A 1 429 ? 1.827   -12.579 4.767   1.00 0.00 ? 429 MET A CE   1  
ATOM 6719   H H    . MET A 1 429 ? 2.031   -13.341 10.070  1.00 0.00 ? 429 MET A H    1  
ATOM 6720   H HA   . MET A 1 429 ? 1.464   -14.351 7.419   1.00 0.00 ? 429 MET A HA   1  
ATOM 6721   H HB2  . MET A 1 429 ? 3.183   -12.195 8.653   1.00 0.00 ? 429 MET A HB2  1  
ATOM 6722   H HB3  . MET A 1 429 ? 3.363   -12.619 6.961   1.00 0.00 ? 429 MET A HB3  1  
ATOM 6723   H HG2  . MET A 1 429 ? 0.923   -11.466 8.320   1.00 0.00 ? 429 MET A HG2  1  
ATOM 6724   H HG3  . MET A 1 429 ? 1.923   -10.713 7.078   1.00 0.00 ? 429 MET A HG3  1  
ATOM 6725   H HE1  . MET A 1 429 ? 2.546   -11.786 4.923   1.00 0.00 ? 429 MET A HE1  1  
ATOM 6726   H HE2  . MET A 1 429 ? 1.414   -12.494 3.775   1.00 0.00 ? 429 MET A HE2  1  
ATOM 6727   H HE3  . MET A 1 429 ? 2.311   -13.542 4.871   1.00 0.00 ? 429 MET A HE3  1  
ATOM 6728   N N    . VAL A 1 430 ? 3.544   -15.798 7.108   1.00 0.00 ? 430 VAL A N    1  
ATOM 6729   C CA   . VAL A 1 430 ? 4.831   -16.429 6.868   1.00 0.00 ? 430 VAL A CA   1  
ATOM 6730   C C    . VAL A 1 430 ? 5.377   -15.748 5.601   1.00 0.00 ? 430 VAL A C    1  
ATOM 6731   O O    . VAL A 1 430 ? 4.960   -16.088 4.491   1.00 0.00 ? 430 VAL A O    1  
ATOM 6732   C CB   . VAL A 1 430 ? 4.687   -17.938 6.658   1.00 0.00 ? 430 VAL A CB   1  
ATOM 6733   C CG1  . VAL A 1 430 ? 6.043   -18.628 6.543   1.00 0.00 ? 430 VAL A CG1  1  
ATOM 6734   C CG2  . VAL A 1 430 ? 3.867   -18.550 7.765   1.00 0.00 ? 430 VAL A CG2  1  
ATOM 6735   H H    . VAL A 1 430 ? 2.839   -15.865 6.430   1.00 0.00 ? 430 VAL A H    1  
ATOM 6736   H HA   . VAL A 1 430 ? 5.493   -16.231 7.701   1.00 0.00 ? 430 VAL A HA   1  
ATOM 6737   H HB   . VAL A 1 430 ? 4.160   -18.091 5.725   1.00 0.00 ? 430 VAL A HB   1  
ATOM 6738   H HG11 . VAL A 1 430 ? 6.829   -17.903 6.691   1.00 0.00 ? 430 VAL A HG11 1  
ATOM 6739   H HG12 . VAL A 1 430 ? 6.140   -19.070 5.562   1.00 0.00 ? 430 VAL A HG12 1  
ATOM 6740   H HG13 . VAL A 1 430 ? 6.119   -19.400 7.295   1.00 0.00 ? 430 VAL A HG13 1  
ATOM 6741   H HG21 . VAL A 1 430 ? 4.328   -18.332 8.717   1.00 0.00 ? 430 VAL A HG21 1  
ATOM 6742   H HG22 . VAL A 1 430 ? 3.815   -19.620 7.626   1.00 0.00 ? 430 VAL A HG22 1  
ATOM 6743   H HG23 . VAL A 1 430 ? 2.869   -18.135 7.745   1.00 0.00 ? 430 VAL A HG23 1  
ATOM 6744   N N    . GLU A 1 431 ? 6.242   -14.747 5.753   1.00 0.00 ? 431 GLU A N    1  
ATOM 6745   C CA   . GLU A 1 431 ? 6.675   -13.992 4.601   1.00 0.00 ? 431 GLU A CA   1  
ATOM 6746   C C    . GLU A 1 431 ? 8.148   -13.679 4.712   1.00 0.00 ? 431 GLU A C    1  
ATOM 6747   O O    . GLU A 1 431 ? 8.740   -12.939 3.942   1.00 0.00 ? 431 GLU A O    1  
ATOM 6748   C CB   . GLU A 1 431 ? 5.852   -12.736 4.476   1.00 0.00 ? 431 GLU A CB   1  
ATOM 6749   C CG   . GLU A 1 431 ? 6.155   -11.678 5.490   1.00 0.00 ? 431 GLU A CG   1  
ATOM 6750   C CD   . GLU A 1 431 ? 5.248   -10.499 5.284   1.00 0.00 ? 431 GLU A CD   1  
ATOM 6751   O OE1  . GLU A 1 431 ? 4.448   -10.546 4.304   1.00 0.00 ? 431 GLU A OE1  1  
ATOM 6752   O OE2  . GLU A 1 431 ? 5.298   -9.542  6.117   1.00 0.00 ? 431 GLU A OE2  1  
ATOM 6753   H H    . GLU A 1 431 ? 6.512   -14.466 6.652   1.00 0.00 ? 431 GLU A H    1  
ATOM 6754   H HA   . GLU A 1 431 ? 6.519   -14.595 3.718   1.00 0.00 ? 431 GLU A HA   1  
ATOM 6755   H HB2  . GLU A 1 431 ? 6.016   -12.318 3.496   1.00 0.00 ? 431 GLU A HB2  1  
ATOM 6756   H HB3  . GLU A 1 431 ? 4.808   -13.006 4.558   1.00 0.00 ? 431 GLU A HB3  1  
ATOM 6757   H HG2  . GLU A 1 431 ? 6.003   -12.079 6.482   1.00 0.00 ? 431 GLU A HG2  1  
ATOM 6758   H HG3  . GLU A 1 431 ? 7.182   -11.362 5.384   1.00 0.00 ? 431 GLU A HG3  1  
ATOM 6759   N N    . THR A 1 432 ? 8.733   -14.311 5.685   1.00 0.00 ? 432 THR A N    1  
ATOM 6760   C CA   . THR A 1 432 ? 10.141  -14.314 5.955   1.00 0.00 ? 432 THR A CA   1  
ATOM 6761   C C    . THR A 1 432 ? 10.644  -15.791 5.762   1.00 0.00 ? 432 THR A C    1  
ATOM 6762   O O    . THR A 1 432 ? 9.889   -16.778 6.079   1.00 0.00 ? 432 THR A O    1  
ATOM 6763   C CB   . THR A 1 432 ? 10.209  -13.850 7.402   1.00 0.00 ? 432 THR A CB   1  
ATOM 6764   O OG1  . THR A 1 432 ? 10.324  -12.420 7.445   1.00 0.00 ? 432 THR A OG1  1  
ATOM 6765   C CG2  . THR A 1 432 ? 11.231  -14.513 8.141   1.00 0.00 ? 432 THR A CG2  1  
ATOM 6766   H H    . THR A 1 432 ? 8.174   -14.903 6.231   1.00 0.00 ? 432 THR A H    1  
ATOM 6767   H HA   . THR A 1 432 ? 10.665  -13.631 5.305   1.00 0.00 ? 432 THR A HA   1  
ATOM 6768   H HB   . THR A 1 432 ? 9.257   -14.101 7.857   1.00 0.00 ? 432 THR A HB   1  
ATOM 6769   H HG1  . THR A 1 432 ? 11.125  -12.172 6.979   1.00 0.00 ? 432 THR A HG1  1  
ATOM 6770   H HG21 . THR A 1 432 ? 11.493  -15.436 7.647   1.00 0.00 ? 432 THR A HG21 1  
ATOM 6771   H HG22 . THR A 1 432 ? 10.871  -14.725 9.138   1.00 0.00 ? 432 THR A HG22 1  
ATOM 6772   H HG23 . THR A 1 432 ? 12.103  -13.881 8.198   1.00 0.00 ? 432 THR A HG23 1  
ATOM 6773   N N    . PRO A 1 433 ? 11.874  -15.962 5.218   1.00 0.00 ? 433 PRO A N    1  
ATOM 6774   C CA   . PRO A 1 433 ? 12.470  -17.274 5.092   1.00 0.00 ? 433 PRO A CA   1  
ATOM 6775   C C    . PRO A 1 433 ? 12.742  -17.849 6.469   1.00 0.00 ? 433 PRO A C    1  
ATOM 6776   O O    . PRO A 1 433 ? 12.727  -19.051 6.633   1.00 0.00 ? 433 PRO A O    1  
ATOM 6777   C CB   . PRO A 1 433 ? 13.797  -17.020 4.341   1.00 0.00 ? 433 PRO A CB   1  
ATOM 6778   C CG   . PRO A 1 433 ? 13.687  -15.680 3.763   1.00 0.00 ? 433 PRO A CG   1  
ATOM 6779   C CD   . PRO A 1 433 ? 12.775  -14.920 4.699   1.00 0.00 ? 433 PRO A CD   1  
ATOM 6780   H HA   . PRO A 1 433 ? 11.839  -17.931 4.516   1.00 0.00 ? 433 PRO A HA   1  
ATOM 6781   H HB2  . PRO A 1 433 ? 14.627  -17.061 5.031   1.00 0.00 ? 433 PRO A HB2  1  
ATOM 6782   H HB3  . PRO A 1 433 ? 13.926  -17.752 3.557   1.00 0.00 ? 433 PRO A HB3  1  
ATOM 6783   H HG2  . PRO A 1 433 ? 14.659  -15.205 3.724   1.00 0.00 ? 433 PRO A HG2  1  
ATOM 6784   H HG3  . PRO A 1 433 ? 13.242  -15.724 2.782   1.00 0.00 ? 433 PRO A HG3  1  
ATOM 6785   H HD2  . PRO A 1 433 ? 13.340  -14.462 5.500   1.00 0.00 ? 433 PRO A HD2  1  
ATOM 6786   H HD3  . PRO A 1 433 ? 12.215  -14.180 4.149   1.00 0.00 ? 433 PRO A HD3  1  
ATOM 6787   N N    . ALA A 1 434 ? 12.985  -17.015 7.463   1.00 0.00 ? 434 ALA A N    1  
ATOM 6788   C CA   . ALA A 1 434 ? 13.018  -17.478 8.837   1.00 0.00 ? 434 ALA A CA   1  
ATOM 6789   C C    . ALA A 1 434 ? 11.741  -18.187 9.177   1.00 0.00 ? 434 ALA A C    1  
ATOM 6790   O O    . ALA A 1 434 ? 11.740  -19.384 9.474   1.00 0.00 ? 434 ALA A O    1  
ATOM 6791   C CB   . ALA A 1 434 ? 13.232  -16.335 9.766   1.00 0.00 ? 434 ALA A CB   1  
ATOM 6792   H H    . ALA A 1 434 ? 12.986  -16.051 7.286   1.00 0.00 ? 434 ALA A H    1  
ATOM 6793   H HA   . ALA A 1 434 ? 13.838  -18.172 8.948   1.00 0.00 ? 434 ALA A HA   1  
ATOM 6794   H HB1  . ALA A 1 434 ? 12.319  -16.133 10.305  1.00 0.00 ? 434 ALA A HB1  1  
ATOM 6795   H HB2  . ALA A 1 434 ? 13.518  -15.460 9.200   1.00 0.00 ? 434 ALA A HB2  1  
ATOM 6796   H HB3  . ALA A 1 434 ? 14.015  -16.583 10.468  1.00 0.00 ? 434 ALA A HB3  1  
ATOM 6797   N N    . ALA A 1 435 ? 10.636  -17.465 9.089   1.00 0.00 ? 435 ALA A N    1  
ATOM 6798   C CA   . ALA A 1 435 ? 9.335   -18.057 9.446   1.00 0.00 ? 435 ALA A CA   1  
ATOM 6799   C C    . ALA A 1 435 ? 9.148   -19.354 8.688   1.00 0.00 ? 435 ALA A C    1  
ATOM 6800   O O    . ALA A 1 435 ? 8.731   -20.378 9.259   1.00 0.00 ? 435 ALA A O    1  
ATOM 6801   C CB   . ALA A 1 435 ? 8.176   -17.090 9.168   1.00 0.00 ? 435 ALA A CB   1  
ATOM 6802   H H    . ALA A 1 435 ? 10.687  -16.526 8.815   1.00 0.00 ? 435 ALA A H    1  
ATOM 6803   H HA   . ALA A 1 435 ? 9.346   -18.283 10.504  1.00 0.00 ? 435 ALA A HA   1  
ATOM 6804   H HB1  . ALA A 1 435 ? 7.241   -17.628 9.207   1.00 0.00 ? 435 ALA A HB1  1  
ATOM 6805   H HB2  . ALA A 1 435 ? 8.299   -16.653 8.188   1.00 0.00 ? 435 ALA A HB2  1  
ATOM 6806   H HB3  . ALA A 1 435 ? 8.173   -16.308 9.914   1.00 0.00 ? 435 ALA A HB3  1  
ATOM 6807   N N    . ALA A 1 436 ? 9.489   -19.320 7.405   1.00 0.00 ? 436 ALA A N    1  
ATOM 6808   C CA   . ALA A 1 436 ? 9.243   -20.486 6.575   1.00 0.00 ? 436 ALA A CA   1  
ATOM 6809   C C    . ALA A 1 436 ? 10.028  -21.647 7.143   1.00 0.00 ? 436 ALA A C    1  
ATOM 6810   O O    . ALA A 1 436 ? 9.489   -22.729 7.261   1.00 0.00 ? 436 ALA A O    1  
ATOM 6811   C CB   . ALA A 1 436 ? 9.604   -20.237 5.137   1.00 0.00 ? 436 ALA A CB   1  
ATOM 6812   H H    . ALA A 1 436 ? 9.835   -18.494 7.007   1.00 0.00 ? 436 ALA A H    1  
ATOM 6813   H HA   . ALA A 1 436 ? 8.190   -20.727 6.632   1.00 0.00 ? 436 ALA A HA   1  
ATOM 6814   H HB1  . ALA A 1 436 ? 10.596  -19.814 5.083   1.00 0.00 ? 436 ALA A HB1  1  
ATOM 6815   H HB2  . ALA A 1 436 ? 8.894   -19.548 4.702   1.00 0.00 ? 436 ALA A HB2  1  
ATOM 6816   H HB3  . ALA A 1 436 ? 9.581   -21.170 4.593   1.00 0.00 ? 436 ALA A HB3  1  
ATOM 6817   N N    . THR A 1 437 ? 11.273  -21.380 7.548   1.00 0.00 ? 437 THR A N    1  
ATOM 6818   C CA   . THR A 1 437 ? 12.183  -22.397 8.081   1.00 0.00 ? 437 THR A CA   1  
ATOM 6819   C C    . THR A 1 437 ? 11.758  -23.056 9.404   1.00 0.00 ? 437 THR A C    1  
ATOM 6820   O O    . THR A 1 437 ? 12.037  -24.266 9.646   1.00 0.00 ? 437 THR A O    1  
ATOM 6821   C CB   . THR A 1 437 ? 13.535  -21.806 8.264   1.00 0.00 ? 437 THR A CB   1  
ATOM 6822   O OG1  . THR A 1 437 ? 13.975  -21.357 6.984   1.00 0.00 ? 437 THR A OG1  1  
ATOM 6823   C CG2  . THR A 1 437 ? 14.530  -22.848 8.806   1.00 0.00 ? 437 THR A CG2  1  
ATOM 6824   H H    . THR A 1 437 ? 11.604  -20.462 7.457   1.00 0.00 ? 437 THR A H    1  
ATOM 6825   H HA   . THR A 1 437 ? 12.270  -23.177 7.341   1.00 0.00 ? 437 THR A HA   1  
ATOM 6826   H HB   . THR A 1 437 ? 13.479  -20.970 8.945   1.00 0.00 ? 437 THR A HB   1  
ATOM 6827   H HG1  . THR A 1 437 ? 14.730  -20.779 7.116   1.00 0.00 ? 437 THR A HG1  1  
ATOM 6828   H HG21 . THR A 1 437 ? 14.425  -23.769 8.252   1.00 0.00 ? 437 THR A HG21 1  
ATOM 6829   H HG22 . THR A 1 437 ? 14.326  -23.031 9.851   1.00 0.00 ? 437 THR A HG22 1  
ATOM 6830   H HG23 . THR A 1 437 ? 15.538  -22.474 8.696   1.00 0.00 ? 437 THR A HG23 1  
ATOM 6831   N N    . ILE A 1 438 ? 11.105  -22.262 10.246  1.00 0.00 ? 438 ILE A N    1  
ATOM 6832   C CA   . ILE A 1 438 ? 10.701  -22.700 11.555  1.00 0.00 ? 438 ILE A CA   1  
ATOM 6833   C C    . ILE A 1 438 ? 9.182   -22.825 11.550  1.00 0.00 ? 438 ILE A C    1  
ATOM 6834   O O    . ILE A 1 438 ? 8.515   -22.853 12.598  1.00 0.00 ? 438 ILE A O    1  
ATOM 6835   C CB   . ILE A 1 438 ? 11.206  -21.745 12.669  1.00 0.00 ? 438 ILE A CB   1  
ATOM 6836   C CG1  . ILE A 1 438 ? 10.648  -20.321 12.450  1.00 0.00 ? 438 ILE A CG1  1  
ATOM 6837   C CG2  . ILE A 1 438 ? 12.748  -21.744 12.743  1.00 0.00 ? 438 ILE A CG2  1  
ATOM 6838   C CD1  . ILE A 1 438 ? 10.866  -19.377 13.615  1.00 0.00 ? 438 ILE A CD1  1  
ATOM 6839   H H    . ILE A 1 438 ? 10.936  -21.333 9.985   1.00 0.00 ? 438 ILE A H    1  
ATOM 6840   H HA   . ILE A 1 438 ? 11.120  -23.682 11.727  1.00 0.00 ? 438 ILE A HA   1  
ATOM 6841   H HB   . ILE A 1 438 ? 10.832  -22.115 13.615  1.00 0.00 ? 438 ILE A HB   1  
ATOM 6842   H HG12 . ILE A 1 438 ? 11.121  -19.898 11.579  1.00 0.00 ? 438 ILE A HG12 1  
ATOM 6843   H HG13 . ILE A 1 438 ? 9.586   -20.397 12.259  1.00 0.00 ? 438 ILE A HG13 1  
ATOM 6844   H HG21 . ILE A 1 438 ? 13.076  -20.970 13.421  1.00 0.00 ? 438 ILE A HG21 1  
ATOM 6845   H HG22 . ILE A 1 438 ? 13.155  -21.556 11.760  1.00 0.00 ? 438 ILE A HG22 1  
ATOM 6846   H HG23 . ILE A 1 438 ? 13.093  -22.704 13.098  1.00 0.00 ? 438 ILE A HG23 1  
ATOM 6847   H HD11 . ILE A 1 438 ? 10.663  -19.894 14.541  1.00 0.00 ? 438 ILE A HD11 1  
ATOM 6848   H HD12 . ILE A 1 438 ? 10.201  -18.530 13.522  1.00 0.00 ? 438 ILE A HD12 1  
ATOM 6849   H HD13 . ILE A 1 438 ? 11.890  -19.033 13.613  1.00 0.00 ? 438 ILE A HD13 1  
ATOM 6850   N N    . ALA A 1 439 ? 8.634   -22.914 10.351  1.00 0.00 ? 439 ALA A N    1  
ATOM 6851   C CA   . ALA A 1 439 ? 7.214   -23.126 10.228  1.00 0.00 ? 439 ALA A CA   1  
ATOM 6852   C C    . ALA A 1 439 ? 6.710   -24.202 11.195  1.00 0.00 ? 439 ALA A C    1  
ATOM 6853   O O    . ALA A 1 439 ? 5.652   -24.025 11.763  1.00 0.00 ? 439 ALA A O    1  
ATOM 6854   C CB   . ALA A 1 439 ? 6.847   -23.452 8.799   1.00 0.00 ? 439 ALA A CB   1  
ATOM 6855   H H    . ALA A 1 439 ? 9.199   -22.897 9.550   1.00 0.00 ? 439 ALA A H    1  
ATOM 6856   H HA   . ALA A 1 439 ? 6.723   -22.199 10.489  1.00 0.00 ? 439 ALA A HA   1  
ATOM 6857   H HB1  . ALA A 1 439 ? 7.296   -22.726 8.137   1.00 0.00 ? 439 ALA A HB1  1  
ATOM 6858   H HB2  . ALA A 1 439 ? 5.773   -23.425 8.688   1.00 0.00 ? 439 ALA A HB2  1  
ATOM 6859   H HB3  . ALA A 1 439 ? 7.210   -24.438 8.550   1.00 0.00 ? 439 ALA A HB3  1  
ATOM 6860   N N    . ARG A 1 440 ? 7.445   -25.299 11.407  1.00 0.00 ? 440 ARG A N    1  
ATOM 6861   C CA   . ARG A 1 440 ? 6.889   -26.368 12.255  1.00 0.00 ? 440 ARG A CA   1  
ATOM 6862   C C    . ARG A 1 440 ? 6.703   -25.788 13.603  1.00 0.00 ? 440 ARG A C    1  
ATOM 6863   O O    . ARG A 1 440 ? 5.593   -25.764 14.094  1.00 0.00 ? 440 ARG A O    1  
ATOM 6864   C CB   . ARG A 1 440 ? 7.733   -27.631 12.348  1.00 0.00 ? 440 ARG A CB   1  
ATOM 6865   C CG   . ARG A 1 440 ? 7.715   -28.504 11.083  1.00 0.00 ? 440 ARG A CG   1  
ATOM 6866   C CD   . ARG A 1 440 ? 6.455   -29.458 10.914  1.00 0.00 ? 440 ARG A CD   1  
ATOM 6867   N NE   . ARG A 1 440 ? 6.451   -30.157 9.607   1.00 0.00 ? 440 ARG A NE   1  
ATOM 6868   C CZ   . ARG A 1 440 ? 7.100   -31.322 9.333   1.00 0.00 ? 440 ARG A CZ   1  
ATOM 6869   N NH1  . ARG A 1 440 ? 7.834   -31.946 10.265  1.00 0.00 ? 440 ARG A NH1  1  
ATOM 6870   N NH2  . ARG A 1 440 ? 7.024   -31.884 8.120   1.00 0.00 ? 440 ARG A NH2  1  
ATOM 6871   H H    . ARG A 1 440 ? 8.303   -25.421 10.949  1.00 0.00 ? 440 ARG A H    1  
ATOM 6872   H HA   . ARG A 1 440 ? 5.913   -26.631 11.865  1.00 0.00 ? 440 ARG A HA   1  
ATOM 6873   H HB2  . ARG A 1 440 ? 8.754   -27.346 12.549  1.00 0.00 ? 440 ARG A HB2  1  
ATOM 6874   H HB3  . ARG A 1 440 ? 7.373   -28.221 13.180  1.00 0.00 ? 440 ARG A HB3  1  
ATOM 6875   H HG2  . ARG A 1 440 ? 7.757   -27.852 10.225  1.00 0.00 ? 440 ARG A HG2  1  
ATOM 6876   H HG3  . ARG A 1 440 ? 8.608   -29.115 11.086  1.00 0.00 ? 440 ARG A HG3  1  
ATOM 6877   H HD2  . ARG A 1 440 ? 6.466   -30.195 11.701  1.00 0.00 ? 440 ARG A HD2  1  
ATOM 6878   H HD3  . ARG A 1 440 ? 5.555   -28.866 11.004  1.00 0.00 ? 440 ARG A HD3  1  
ATOM 6879   H HE   . ARG A 1 440 ? 5.933   -29.750 8.882   1.00 0.00 ? 440 ARG A HE   1  
ATOM 6880   H HH11 . ARG A 1 440 ? 7.912   -31.558 11.183  1.00 0.00 ? 440 ARG A HH11 1  
ATOM 6881   H HH12 . ARG A 1 440 ? 8.303   -32.800 10.043  1.00 0.00 ? 440 ARG A HH12 1  
ATOM 6882   H HH21 . ARG A 1 440 ? 6.484   -31.448 7.400   1.00 0.00 ? 440 ARG A HH21 1  
ATOM 6883   H HH22 . ARG A 1 440 ? 7.507   -32.740 7.934   1.00 0.00 ? 440 ARG A HH22 1  
ATOM 6884   N N    . HIS A 1 441 ? 7.775   -25.243 14.166  1.00 0.00 ? 441 HIS A N    1  
ATOM 6885   C CA   . HIS A 1 441 ? 7.702   -24.572 15.471  1.00 0.00 ? 441 HIS A CA   1  
ATOM 6886   C C    . HIS A 1 441 ? 6.623   -23.544 15.595  1.00 0.00 ? 441 HIS A C    1  
ATOM 6887   O O    . HIS A 1 441 ? 5.972   -23.491 16.636  1.00 0.00 ? 441 HIS A O    1  
ATOM 6888   C CB   . HIS A 1 441 ? 9.010   -23.914 15.831  1.00 0.00 ? 441 HIS A CB   1  
ATOM 6889   C CG   . HIS A 1 441 ? 10.154  -24.859 15.846  1.00 0.00 ? 441 HIS A CG   1  
ATOM 6890   N ND1  . HIS A 1 441 ? 10.173  -25.987 16.647  1.00 0.00 ? 441 HIS A ND1  1  
ATOM 6891   C CD2  . HIS A 1 441 ? 11.317  -24.854 15.160  1.00 0.00 ? 441 HIS A CD2  1  
ATOM 6892   C CE1  . HIS A 1 441 ? 11.309  -26.637 16.453  1.00 0.00 ? 441 HIS A CE1  1  
ATOM 6893   N NE2  . HIS A 1 441 ? 12.024  -25.969 15.560  1.00 0.00 ? 441 HIS A NE2  1  
ATOM 6894   H H    . HIS A 1 441 ? 8.625   -25.247 13.678  1.00 0.00 ? 441 HIS A H    1  
ATOM 6895   H HA   . HIS A 1 441 ? 7.512   -25.332 16.213  1.00 0.00 ? 441 HIS A HA   1  
ATOM 6896   H HB2  . HIS A 1 441 ? 9.216   -23.136 15.112  1.00 0.00 ? 441 HIS A HB2  1  
ATOM 6897   H HB3  . HIS A 1 441 ? 8.913   -23.464 16.809  1.00 0.00 ? 441 HIS A HB3  1  
ATOM 6898   H HD1  . HIS A 1 441 ? 9.459   -26.261 17.260  1.00 0.00 ? 441 HIS A HD1  1  
ATOM 6899   H HD2  . HIS A 1 441 ? 11.633  -24.118 14.436  1.00 0.00 ? 441 HIS A HD2  1  
ATOM 6900   H HE1  . HIS A 1 441 ? 11.602  -27.555 16.939  1.00 0.00 ? 441 HIS A HE1  1  
ATOM 6901   H HE2  . HIS A 1 441 ? 12.912  -26.225 15.237  1.00 0.00 ? 441 HIS A HE2  1  
ATOM 6902   N N    . LEU A 1 442 ? 6.426   -22.726 14.557  1.00 0.00 ? 442 LEU A N    1  
ATOM 6903   C CA   . LEU A 1 442 ? 5.447   -21.629 14.637  1.00 0.00 ? 442 LEU A CA   1  
ATOM 6904   C C    . LEU A 1 442 ? 4.029   -22.168 14.616  1.00 0.00 ? 442 LEU A C    1  
ATOM 6905   O O    . LEU A 1 442 ? 3.147   -21.634 15.301  1.00 0.00 ? 442 LEU A O    1  
ATOM 6906   C CB   . LEU A 1 442 ? 5.638   -20.608 13.528  1.00 0.00 ? 442 LEU A CB   1  
ATOM 6907   C CG   . LEU A 1 442 ? 6.837   -19.636 13.490  1.00 0.00 ? 442 LEU A CG   1  
ATOM 6908   C CD1  . LEU A 1 442 ? 6.980   -18.953 12.090  1.00 0.00 ? 442 LEU A CD1  1  
ATOM 6909   C CD2  . LEU A 1 442 ? 6.782   -18.590 14.564  1.00 0.00 ? 442 LEU A CD2  1  
ATOM 6910   H H    . LEU A 1 442 ? 6.983   -22.819 13.756  1.00 0.00 ? 442 LEU A H    1  
ATOM 6911   H HA   . LEU A 1 442 ? 5.594   -21.126 15.583  1.00 0.00 ? 442 LEU A HA   1  
ATOM 6912   H HB2  . LEU A 1 442 ? 5.670   -21.156 12.603  1.00 0.00 ? 442 LEU A HB2  1  
ATOM 6913   H HB3  . LEU A 1 442 ? 4.735   -20.009 13.504  1.00 0.00 ? 442 LEU A HB3  1  
ATOM 6914   H HG   . LEU A 1 442 ? 7.731   -20.229 13.647  1.00 0.00 ? 442 LEU A HG   1  
ATOM 6915   H HD11 . LEU A 1 442 ? 7.633   -18.096 12.173  1.00 0.00 ? 442 LEU A HD11 1  
ATOM 6916   H HD12 . LEU A 1 442 ? 6.009   -18.633 11.745  1.00 0.00 ? 442 LEU A HD12 1  
ATOM 6917   H HD13 . LEU A 1 442 ? 7.397   -19.660 11.387  1.00 0.00 ? 442 LEU A HD13 1  
ATOM 6918   H HD21 . LEU A 1 442 ? 6.046   -18.870 15.303  1.00 0.00 ? 442 LEU A HD21 1  
ATOM 6919   H HD22 . LEU A 1 442 ? 6.511   -17.640 14.127  1.00 0.00 ? 442 LEU A HD22 1  
ATOM 6920   H HD23 . LEU A 1 442 ? 7.751   -18.507 15.036  1.00 0.00 ? 442 LEU A HD23 1  
ATOM 6921   N N    . ALA A 1 443 ? 3.821   -23.233 13.844  1.00 0.00 ? 443 ALA A N    1  
ATOM 6922   C CA   . ALA A 1 443 ? 2.493   -23.866 13.692  1.00 0.00 ? 443 ALA A CA   1  
ATOM 6923   C C    . ALA A 1 443 ? 1.834   -24.348 15.004  1.00 0.00 ? 443 ALA A C    1  
ATOM 6924   O O    . ALA A 1 443 ? 0.596   -24.373 15.104  1.00 0.00 ? 443 ALA A O    1  
ATOM 6925   C CB   . ALA A 1 443 ? 2.547   -24.993 12.676  1.00 0.00 ? 443 ALA A CB   1  
ATOM 6926   H H    . ALA A 1 443 ? 4.577   -23.603 13.343  1.00 0.00 ? 443 ALA A H    1  
ATOM 6927   H HA   . ALA A 1 443 ? 1.839   -23.110 13.282  1.00 0.00 ? 443 ALA A HA   1  
ATOM 6928   H HB1  . ALA A 1 443 ? 2.924   -25.887 13.150  1.00 0.00 ? 443 ALA A HB1  1  
ATOM 6929   H HB2  . ALA A 1 443 ? 3.201   -24.714 11.862  1.00 0.00 ? 443 ALA A HB2  1  
ATOM 6930   H HB3  . ALA A 1 443 ? 1.555   -25.180 12.292  1.00 0.00 ? 443 ALA A HB3  1  
ATOM 6931   N N    . LYS A 1 444 ? 2.649   -24.716 16.004  1.00 0.00 ? 444 LYS A N    1  
ATOM 6932   C CA   . LYS A 1 444 ? 2.148   -25.045 17.355  1.00 0.00 ? 444 LYS A CA   1  
ATOM 6933   C C    . LYS A 1 444 ? 1.654   -23.820 18.025  1.00 0.00 ? 444 LYS A C    1  
ATOM 6934   O O    . LYS A 1 444 ? 0.917   -23.904 18.951  1.00 0.00 ? 444 LYS A O    1  
ATOM 6935   C CB   . LYS A 1 444 ? 3.241   -25.610 18.287  1.00 0.00 ? 444 LYS A CB   1  
ATOM 6936   C CG   . LYS A 1 444 ? 3.766   -26.977 17.926  1.00 0.00 ? 444 LYS A CG   1  
ATOM 6937   C CD   . LYS A 1 444 ? 4.838   -27.399 18.941  1.00 0.00 ? 444 LYS A CD   1  
ATOM 6938   C CE   . LYS A 1 444 ? 5.411   -28.787 18.633  1.00 0.00 ? 444 LYS A CE   1  
ATOM 6939   N NZ   . LYS A 1 444 ? 6.455   -29.143 19.649  1.00 0.00 ? 444 LYS A NZ   1  
ATOM 6940   H H    . LYS A 1 444 ? 3.617   -24.667 15.862  1.00 0.00 ? 444 LYS A H    1  
ATOM 6941   H HA   . LYS A 1 444 ? 1.345   -25.762 17.276  1.00 0.00 ? 444 LYS A HA   1  
ATOM 6942   H HB2  . LYS A 1 444 ? 4.073   -24.925 18.286  1.00 0.00 ? 444 LYS A HB2  1  
ATOM 6943   H HB3  . LYS A 1 444 ? 2.838   -25.649 19.291  1.00 0.00 ? 444 LYS A HB3  1  
ATOM 6944   H HG2  . LYS A 1 444 ? 2.953   -27.689 17.941  1.00 0.00 ? 444 LYS A HG2  1  
ATOM 6945   H HG3  . LYS A 1 444 ? 4.202   -26.947 16.939  1.00 0.00 ? 444 LYS A HG3  1  
ATOM 6946   H HD2  . LYS A 1 444 ? 5.642   -26.677 18.922  1.00 0.00 ? 444 LYS A HD2  1  
ATOM 6947   H HD3  . LYS A 1 444 ? 4.401   -27.409 19.929  1.00 0.00 ? 444 LYS A HD3  1  
ATOM 6948   H HE2  . LYS A 1 444 ? 4.616   -29.518 18.664  1.00 0.00 ? 444 LYS A HE2  1  
ATOM 6949   H HE3  . LYS A 1 444 ? 5.855   -28.782 17.649  1.00 0.00 ? 444 LYS A HE3  1  
ATOM 6950   H HZ1  . LYS A 1 444 ? 6.133   -28.852 20.594  1.00 0.00 ? 444 LYS A HZ1  1  
ATOM 6951   H HZ2  . LYS A 1 444 ? 7.344   -28.653 19.418  1.00 0.00 ? 444 LYS A HZ2  1  
ATOM 6952   H HZ3  . LYS A 1 444 ? 6.613   -30.171 19.640  1.00 0.00 ? 444 LYS A HZ3  1  
ATOM 6953   N N    . GLU A 1 445 ? 2.123   -22.673 17.600  1.00 0.00 ? 445 GLU A N    1  
ATOM 6954   C CA   . GLU A 1 445 ? 1.946   -21.467 18.397  1.00 0.00 ? 445 GLU A CA   1  
ATOM 6955   C C    . GLU A 1 445 ? 0.857   -20.554 17.850  1.00 0.00 ? 445 GLU A C    1  
ATOM 6956   O O    . GLU A 1 445 ? 0.451   -19.616 18.534  1.00 0.00 ? 445 GLU A O    1  
ATOM 6957   C CB   . GLU A 1 445 ? 3.288   -20.719 18.525  1.00 0.00 ? 445 GLU A CB   1  
ATOM 6958   C CG   . GLU A 1 445 ? 4.388   -21.571 19.195  1.00 0.00 ? 445 GLU A CG   1  
ATOM 6959   C CD   . GLU A 1 445 ? 4.084   -21.887 20.637  1.00 0.00 ? 445 GLU A CD   1  
ATOM 6960   O OE1  . GLU A 1 445 ? 3.268   -21.180 21.247  1.00 0.00 ? 445 GLU A OE1  1  
ATOM 6961   O OE2  . GLU A 1 445 ? 4.683   -22.823 21.186  1.00 0.00 ? 445 GLU A OE2  1  
ATOM 6962   H H    . GLU A 1 445 ? 2.771   -22.666 16.864  1.00 0.00 ? 445 GLU A H    1  
ATOM 6963   H HA   . GLU A 1 445 ? 1.647   -21.772 19.389  1.00 0.00 ? 445 GLU A HA   1  
ATOM 6964   H HB2  . GLU A 1 445 ? 3.624   -20.434 17.539  1.00 0.00 ? 445 GLU A HB2  1  
ATOM 6965   H HB3  . GLU A 1 445 ? 3.133   -19.824 19.111  1.00 0.00 ? 445 GLU A HB3  1  
ATOM 6966   H HG2  . GLU A 1 445 ? 4.490   -22.498 18.653  1.00 0.00 ? 445 GLU A HG2  1  
ATOM 6967   H HG3  . GLU A 1 445 ? 5.324   -21.033 19.143  1.00 0.00 ? 445 GLU A HG3  1  
ATOM 6968   N N    . VAL A 1 446 ? 0.356   -20.852 16.647  1.00 0.00 ? 446 VAL A N    1  
ATOM 6969   C CA   . VAL A 1 446 ? -0.658  -20.027 16.033  1.00 0.00 ? 446 VAL A CA   1  
ATOM 6970   C C    . VAL A 1 446 ? -1.768  -20.883 15.501  1.00 0.00 ? 446 VAL A C    1  
ATOM 6971   O O    . VAL A 1 446 ? -1.617  -22.094 15.412  1.00 0.00 ? 446 VAL A O    1  
ATOM 6972   C CB   . VAL A 1 446 ? -0.079  -19.251 14.881  1.00 0.00 ? 446 VAL A CB   1  
ATOM 6973   C CG1  . VAL A 1 446 ? 0.976   -18.279 15.385  1.00 0.00 ? 446 VAL A CG1  1  
ATOM 6974   C CG2  . VAL A 1 446 ? 0.495   -20.217 13.877  1.00 0.00 ? 446 VAL A CG2  1  
ATOM 6975   H H    . VAL A 1 446 ? 0.698   -21.633 16.164  1.00 0.00 ? 446 VAL A H    1  
ATOM 6976   H HA   . VAL A 1 446 ? -1.052  -19.337 16.763  1.00 0.00 ? 446 VAL A HA   1  
ATOM 6977   H HB   . VAL A 1 446 ? -0.872  -18.687 14.410  1.00 0.00 ? 446 VAL A HB   1  
ATOM 6978   H HG11 . VAL A 1 446 ? 1.705   -18.103 14.607  1.00 0.00 ? 446 VAL A HG11 1  
ATOM 6979   H HG12 . VAL A 1 446 ? 1.468   -18.697 16.251  1.00 0.00 ? 446 VAL A HG12 1  
ATOM 6980   H HG13 . VAL A 1 446 ? 0.505   -17.344 15.655  1.00 0.00 ? 446 VAL A HG13 1  
ATOM 6981   H HG21 . VAL A 1 446 ? 1.092   -20.957 14.389  1.00 0.00 ? 446 VAL A HG21 1  
ATOM 6982   H HG22 . VAL A 1 446 ? 1.114   -19.678 13.173  1.00 0.00 ? 446 VAL A HG22 1  
ATOM 6983   H HG23 . VAL A 1 446 ? -0.309  -20.707 13.348  1.00 0.00 ? 446 VAL A HG23 1  
ATOM 6984   N N    . ASP A 1 447 ? -2.890  -20.255 15.134  1.00 0.00 ? 447 ASP A N    1  
ATOM 6985   C CA   . ASP A 1 447 ? -4.029  -20.981 14.544  1.00 0.00 ? 447 ASP A CA   1  
ATOM 6986   C C    . ASP A 1 447 ? -3.947  -21.114 13.063  1.00 0.00 ? 447 ASP A C    1  
ATOM 6987   O O    . ASP A 1 447 ? -4.664  -21.908 12.468  1.00 0.00 ? 447 ASP A O    1  
ATOM 6988   C CB   . ASP A 1 447 ? -5.360  -20.310 14.880  1.00 0.00 ? 447 ASP A CB   1  
ATOM 6989   C CG   . ASP A 1 447 ? -5.726  -20.474 16.323  1.00 0.00 ? 447 ASP A CG   1  
ATOM 6990   O OD1  . ASP A 1 447 ? -5.088  -21.314 16.988  1.00 0.00 ? 447 ASP A OD1  1  
ATOM 6991   O OD2  . ASP A 1 447 ? -6.650  -19.772 16.789  1.00 0.00 ? 447 ASP A OD2  1  
ATOM 6992   H H    . ASP A 1 447 ? -2.942  -19.281 15.226  1.00 0.00 ? 447 ASP A H    1  
ATOM 6993   H HA   . ASP A 1 447 ? -4.046  -21.973 14.968  1.00 0.00 ? 447 ASP A HA   1  
ATOM 6994   H HB2  . ASP A 1 447 ? -5.288  -19.256 14.656  1.00 0.00 ? 447 ASP A HB2  1  
ATOM 6995   H HB3  . ASP A 1 447 ? -6.136  -20.745 14.267  1.00 0.00 ? 447 ASP A HB3  1  
ATOM 6996   N N    . PHE A 1 448 ? -3.111  -20.307 12.444  1.00 0.00 ? 448 PHE A N    1  
ATOM 6997   C CA   . PHE A 1 448 ? -3.062  -20.343 10.997  1.00 0.00 ? 448 PHE A CA   1  
ATOM 6998   C C    . PHE A 1 448 ? -1.892  -19.569 10.444  1.00 0.00 ? 448 PHE A C    1  
ATOM 6999   O O    . PHE A 1 448 ? -1.194  -18.897 11.182  1.00 0.00 ? 448 PHE A O    1  
ATOM 7000   C CB   . PHE A 1 448 ? -4.387  -19.841 10.403  1.00 0.00 ? 448 PHE A CB   1  
ATOM 7001   C CG   . PHE A 1 448 ? -4.685  -18.424 10.707  1.00 0.00 ? 448 PHE A CG   1  
ATOM 7002   C CD1  . PHE A 1 448 ? -4.200  -17.391 9.865   1.00 0.00 ? 448 PHE A CD1  1  
ATOM 7003   C CD2  . PHE A 1 448 ? -5.460  -18.099 11.789  1.00 0.00 ? 448 PHE A CD2  1  
ATOM 7004   C CE1  . PHE A 1 448 ? -4.480  -16.053 10.112  1.00 0.00 ? 448 PHE A CE1  1  
ATOM 7005   C CE2  . PHE A 1 448 ? -5.739  -16.748 12.070  1.00 0.00 ? 448 PHE A CE2  1  
ATOM 7006   C CZ   . PHE A 1 448 ? -5.266  -15.715 11.215  1.00 0.00 ? 448 PHE A CZ   1  
ATOM 7007   H H    . PHE A 1 448 ? -2.577  -19.657 12.947  1.00 0.00 ? 448 PHE A H    1  
ATOM 7008   H HA   . PHE A 1 448 ? -2.941  -21.374 10.700  1.00 0.00 ? 448 PHE A HA   1  
ATOM 7009   H HB2  . PHE A 1 448 ? -4.350  -19.957 9.332   1.00 0.00 ? 448 PHE A HB2  1  
ATOM 7010   H HB3  . PHE A 1 448 ? -5.189  -20.458 10.786  1.00 0.00 ? 448 PHE A HB3  1  
ATOM 7011   H HD1  . PHE A 1 448 ? -3.590  -17.652 9.012   1.00 0.00 ? 448 PHE A HD1  1  
ATOM 7012   H HD2  . PHE A 1 448 ? -5.826  -18.874 12.447  1.00 0.00 ? 448 PHE A HD2  1  
ATOM 7013   H HE1  . PHE A 1 448 ? -4.099  -15.284 9.455   1.00 0.00 ? 448 PHE A HE1  1  
ATOM 7014   H HE2  . PHE A 1 448 ? -6.348  -16.495 12.927  1.00 0.00 ? 448 PHE A HE2  1  
ATOM 7015   H HZ   . PHE A 1 448 ? -5.496  -14.681 11.426  1.00 0.00 ? 448 PHE A HZ   1  
ATOM 7016   N N    . PHE A 1 449 ? -1.710  -19.651 9.127   1.00 0.00 ? 449 PHE A N    1  
ATOM 7017   C CA   . PHE A 1 449 ? -0.612  -18.977 8.435   1.00 0.00 ? 449 PHE A CA   1  
ATOM 7018   C C    . PHE A 1 449 ? -1.207  -18.420 7.219   1.00 0.00 ? 449 PHE A C    1  
ATOM 7019   O O    . PHE A 1 449 ? -2.056  -19.063 6.621   1.00 0.00 ? 449 PHE A O    1  
ATOM 7020   C CB   . PHE A 1 449 ? 0.409   -19.997 7.895   1.00 0.00 ? 449 PHE A CB   1  
ATOM 7021   C CG   . PHE A 1 449 ? 1.255   -20.674 8.942   1.00 0.00 ? 449 PHE A CG   1  
ATOM 7022   C CD1  . PHE A 1 449 ? 2.082   -19.941 9.806   1.00 0.00 ? 449 PHE A CD1  1  
ATOM 7023   C CD2  . PHE A 1 449 ? 1.264   -22.075 9.023   1.00 0.00 ? 449 PHE A CD2  1  
ATOM 7024   C CE1  . PHE A 1 449 ? 2.906   -20.586 10.723  1.00 0.00 ? 449 PHE A CE1  1  
ATOM 7025   C CE2  . PHE A 1 449 ? 2.094   -22.743 9.949   1.00 0.00 ? 449 PHE A CE2  1  
ATOM 7026   C CZ   . PHE A 1 449 ? 2.909   -21.987 10.815  1.00 0.00 ? 449 PHE A CZ   1  
ATOM 7027   H H    . PHE A 1 449 ? -2.331  -20.196 8.601   1.00 0.00 ? 449 PHE A H    1  
ATOM 7028   H HA   . PHE A 1 449 ? -0.140  -18.223 9.043   1.00 0.00 ? 449 PHE A HA   1  
ATOM 7029   H HB2  . PHE A 1 449 ? -0.127  -20.760 7.355   1.00 0.00 ? 449 PHE A HB2  1  
ATOM 7030   H HB3  . PHE A 1 449 ? 1.062   -19.486 7.200   1.00 0.00 ? 449 PHE A HB3  1  
ATOM 7031   H HD1  . PHE A 1 449 ? 2.092   -18.862 9.748   1.00 0.00 ? 449 PHE A HD1  1  
ATOM 7032   H HD2  . PHE A 1 449 ? 0.632   -22.651 8.363   1.00 0.00 ? 449 PHE A HD2  1  
ATOM 7033   H HE1  . PHE A 1 449 ? 3.530   -20.004 11.386  1.00 0.00 ? 449 PHE A HE1  1  
ATOM 7034   H HE2  . PHE A 1 449 ? 2.093   -23.822 10.004  1.00 0.00 ? 449 PHE A HE2  1  
ATOM 7035   H HZ   . PHE A 1 449 ? 3.549   -22.483 11.530  1.00 0.00 ? 449 PHE A HZ   1  
ATOM 7036   N N    . SER A 1 450 ? -0.705  -17.265 6.803   1.00 0.00 ? 450 SER A N    1  
ATOM 7037   C CA   . SER A 1 450 ? -0.885  -16.797 5.468   1.00 0.00 ? 450 SER A CA   1  
ATOM 7038   C C    . SER A 1 450 ? 0.480   -16.478 4.908   1.00 0.00 ? 450 SER A C    1  
ATOM 7039   O O    . SER A 1 450 ? 1.232   -15.693 5.508   1.00 0.00 ? 450 SER A O    1  
ATOM 7040   C CB   . SER A 1 450 ? -1.717  -15.564 5.461   1.00 0.00 ? 450 SER A CB   1  
ATOM 7041   O OG   . SER A 1 450 ? -1.828  -15.142 4.118   1.00 0.00 ? 450 SER A OG   1  
ATOM 7042   H H    . SER A 1 450 ? 0.014   -16.862 7.334   1.00 0.00 ? 450 SER A H    1  
ATOM 7043   H HA   . SER A 1 450 ? -1.358  -17.562 4.871   1.00 0.00 ? 450 SER A HA   1  
ATOM 7044   H HB2  . SER A 1 450 ? -2.697  -15.778 5.858   1.00 0.00 ? 450 SER A HB2  1  
ATOM 7045   H HB3  . SER A 1 450 ? -1.241  -14.797 6.056   1.00 0.00 ? 450 SER A HB3  1  
ATOM 7046   H HG   . SER A 1 450 ? -1.025  -14.669 3.888   1.00 0.00 ? 450 SER A HG   1  
ATOM 7047   N N    . ILE A 1 451 ? 0.827   -17.068 3.765   1.00 0.00 ? 451 ILE A N    1  
ATOM 7048   C CA   . ILE A 1 451 ? 2.160   -16.851 3.198   1.00 0.00 ? 451 ILE A CA   1  
ATOM 7049   C C    . ILE A 1 451 ? 2.209   -15.559 2.393   1.00 0.00 ? 451 ILE A C    1  
ATOM 7050   O O    . ILE A 1 451 ? 1.447   -15.388 1.414   1.00 0.00 ? 451 ILE A O    1  
ATOM 7051   C CB   . ILE A 1 451 ? 2.590   -17.988 2.262   1.00 0.00 ? 451 ILE A CB   1  
ATOM 7052   C CG1  . ILE A 1 451 ? 2.369   -19.334 2.934   1.00 0.00 ? 451 ILE A CG1  1  
ATOM 7053   C CG2  . ILE A 1 451 ? 4.052   -17.798 1.832   1.00 0.00 ? 451 ILE A CG2  1  
ATOM 7054   C CD1  . ILE A 1 451 ? 2.613   -20.478 2.039   1.00 0.00 ? 451 ILE A CD1  1  
ATOM 7055   H H    . ILE A 1 451 ? 0.203   -17.681 3.324   1.00 0.00 ? 451 ILE A H    1  
ATOM 7056   H HA   . ILE A 1 451 ? 2.872   -16.783 4.006   1.00 0.00 ? 451 ILE A HA   1  
ATOM 7057   H HB   . ILE A 1 451 ? 1.973   -17.941 1.374   1.00 0.00 ? 451 ILE A HB   1  
ATOM 7058   H HG12 . ILE A 1 451 ? 3.033   -19.414 3.779   1.00 0.00 ? 451 ILE A HG12 1  
ATOM 7059   H HG13 . ILE A 1 451 ? 1.349   -19.378 3.291   1.00 0.00 ? 451 ILE A HG13 1  
ATOM 7060   H HG21 . ILE A 1 451 ? 4.695   -17.880 2.696   1.00 0.00 ? 451 ILE A HG21 1  
ATOM 7061   H HG22 . ILE A 1 451 ? 4.172   -16.823 1.384   1.00 0.00 ? 451 ILE A HG22 1  
ATOM 7062   H HG23 . ILE A 1 451 ? 4.317   -18.560 1.113   1.00 0.00 ? 451 ILE A HG23 1  
ATOM 7063   H HD11 . ILE A 1 451 ? 1.803   -20.560 1.329   1.00 0.00 ? 451 ILE A HD11 1  
ATOM 7064   H HD12 . ILE A 1 451 ? 2.673   -21.385 2.623   1.00 0.00 ? 451 ILE A HD12 1  
ATOM 7065   H HD13 . ILE A 1 451 ? 3.540   -20.328 1.507   1.00 0.00 ? 451 ILE A HD13 1  
ATOM 7066   N N    . GLY A 1 452 ? 3.097   -14.653 2.793   1.00 0.00 ? 452 GLY A N    1  
ATOM 7067   C CA   . GLY A 1 452 ? 3.275   -13.444 2.023   1.00 0.00 ? 452 GLY A CA   1  
ATOM 7068   C C    . GLY A 1 452 ? 4.392   -13.684 1.042   1.00 0.00 ? 452 GLY A C    1  
ATOM 7069   O O    . GLY A 1 452 ? 5.551   -13.547 1.373   1.00 0.00 ? 452 GLY A O    1  
ATOM 7070   H H    . GLY A 1 452 ? 3.673   -14.835 3.565   1.00 0.00 ? 452 GLY A H    1  
ATOM 7071   H HA2  . GLY A 1 452 ? 2.361   -13.211 1.493   1.00 0.00 ? 452 GLY A HA2  1  
ATOM 7072   H HA3  . GLY A 1 452 ? 3.540   -12.628 2.677   1.00 0.00 ? 452 GLY A HA3  1  
ATOM 7073   N N    . THR A 1 453 ? 4.059   -14.030 -0.187  1.00 0.00 ? 453 THR A N    1  
ATOM 7074   C CA   . THR A 1 453 ? 5.068   -14.336 -1.171  1.00 0.00 ? 453 THR A CA   1  
ATOM 7075   C C    . THR A 1 453 ? 5.775   -13.102 -1.728  1.00 0.00 ? 453 THR A C    1  
ATOM 7076   O O    . THR A 1 453 ? 6.861   -13.213 -2.318  1.00 0.00 ? 453 THR A O    1  
ATOM 7077   C CB   . THR A 1 453 ? 4.461   -15.128 -2.337  1.00 0.00 ? 453 THR A CB   1  
ATOM 7078   O OG1  . THR A 1 453 ? 3.428   -14.347 -2.929  1.00 0.00 ? 453 THR A OG1  1  
ATOM 7079   C CG2  . THR A 1 453 ? 3.903   -16.472 -1.843  1.00 0.00 ? 453 THR A CG2  1  
ATOM 7080   H H    . THR A 1 453 ? 3.112   -14.119 -0.423  1.00 0.00 ? 453 THR A H    1  
ATOM 7081   H HA   . THR A 1 453 ? 5.811   -14.962 -0.702  1.00 0.00 ? 453 THR A HA   1  
ATOM 7082   H HB   . THR A 1 453 ? 5.229   -15.314 -3.074  1.00 0.00 ? 453 THR A HB   1  
ATOM 7083   H HG1  . THR A 1 453 ? 3.559   -13.433 -2.665  1.00 0.00 ? 453 THR A HG1  1  
ATOM 7084   H HG21 . THR A 1 453 ? 4.665   -17.232 -1.933  1.00 0.00 ? 453 THR A HG21 1  
ATOM 7085   H HG22 . THR A 1 453 ? 3.047   -16.747 -2.440  1.00 0.00 ? 453 THR A HG22 1  
ATOM 7086   H HG23 . THR A 1 453 ? 3.607   -16.380 -0.809  1.00 0.00 ? 453 THR A HG23 1  
ATOM 7087   N N    . ASN A 1 454 ? 5.167   -11.930 -1.589  1.00 0.00 ? 454 ASN A N    1  
ATOM 7088   C CA   . ASN A 1 454 ? 5.839   -10.726 -2.069  1.00 0.00 ? 454 ASN A CA   1  
ATOM 7089   C C    . ASN A 1 454 ? 7.102   -10.538 -1.255  1.00 0.00 ? 454 ASN A C    1  
ATOM 7090   O O    . ASN A 1 454 ? 8.218   -10.409 -1.807  1.00 0.00 ? 454 ASN A O    1  
ATOM 7091   C CB   . ASN A 1 454 ? 4.958   -9.506  -1.932  1.00 0.00 ? 454 ASN A CB   1  
ATOM 7092   C CG   . ASN A 1 454 ? 3.815   -9.502  -2.904  1.00 0.00 ? 454 ASN A CG   1  
ATOM 7093   O OD1  . ASN A 1 454 ? 3.826   -10.203 -3.958  1.00 0.00 ? 454 ASN A OD1  1  
ATOM 7094   N ND2  . ASN A 1 454 ? 2.815   -8.710  -2.587  1.00 0.00 ? 454 ASN A ND2  1  
ATOM 7095   H H    . ASN A 1 454 ? 4.296   -11.870 -1.143  1.00 0.00 ? 454 ASN A H    1  
ATOM 7096   H HA   . ASN A 1 454 ? 6.105   -10.860 -3.108  1.00 0.00 ? 454 ASN A HA   1  
ATOM 7097   H HB2  . ASN A 1 454 ? 4.560   -9.475  -0.930  1.00 0.00 ? 454 ASN A HB2  1  
ATOM 7098   H HB3  . ASN A 1 454 ? 5.560   -8.623  -2.094  1.00 0.00 ? 454 ASN A HB3  1  
ATOM 7099   H HD21 . ASN A 1 454 ? 2.854   -8.176  -1.766  1.00 0.00 ? 454 ASN A HD21 1  
ATOM 7100   H HD22 . ASN A 1 454 ? 2.031   -8.652  -3.172  1.00 0.00 ? 454 ASN A HD22 1  
ATOM 7101   N N    . ASP A 1 455 ? 6.930   -10.566 0.060   1.00 0.00 ? 455 ASP A N    1  
ATOM 7102   C CA   . ASP A 1 455 ? 8.063   -10.501 0.919   1.00 0.00 ? 455 ASP A CA   1  
ATOM 7103   C C    . ASP A 1 455 ? 8.943   -11.738 0.874   1.00 0.00 ? 455 ASP A C    1  
ATOM 7104   O O    . ASP A 1 455 ? 10.147  -11.593 0.629   1.00 0.00 ? 455 ASP A O    1  
ATOM 7105   C CB   . ASP A 1 455 ? 7.650   -10.138 2.320   1.00 0.00 ? 455 ASP A CB   1  
ATOM 7106   C CG   . ASP A 1 455 ? 7.951   -8.690  2.613   1.00 0.00 ? 455 ASP A CG   1  
ATOM 7107   O OD1  . ASP A 1 455 ? 9.104   -8.301  2.409   1.00 0.00 ? 455 ASP A OD1  1  
ATOM 7108   O OD2  . ASP A 1 455 ? 7.056   -7.937  3.033   1.00 0.00 ? 455 ASP A OD2  1  
ATOM 7109   H H    . ASP A 1 455 ? 6.035   -10.701 0.436   1.00 0.00 ? 455 ASP A H    1  
ATOM 7110   H HA   . ASP A 1 455 ? 8.671   -9.684  0.557   1.00 0.00 ? 455 ASP A HA   1  
ATOM 7111   H HB2  . ASP A 1 455 ? 6.590   -10.309 2.432   1.00 0.00 ? 455 ASP A HB2  1  
ATOM 7112   H HB3  . ASP A 1 455 ? 8.187   -10.761 3.021   1.00 0.00 ? 455 ASP A HB3  1  
ATOM 7113   N N    . LEU A 1 456 ? 8.375   -12.930 1.082   1.00 0.00 ? 456 LEU A N    1  
ATOM 7114   C CA   . LEU A 1 456 ? 9.131   -14.166 1.005   1.00 0.00 ? 456 LEU A CA   1  
ATOM 7115   C C    . LEU A 1 456 ? 10.004  -14.250 -0.271  1.00 0.00 ? 456 LEU A C    1  
ATOM 7116   O O    . LEU A 1 456 ? 11.182  -14.613 -0.259  1.00 0.00 ? 456 LEU A O    1  
ATOM 7117   C CB   . LEU A 1 456 ? 8.163   -15.322 1.081   1.00 0.00 ? 456 LEU A CB   1  
ATOM 7118   C CG   . LEU A 1 456 ? 8.754   -16.633 1.611   1.00 0.00 ? 456 LEU A CG   1  
ATOM 7119   C CD1  . LEU A 1 456 ? 9.166   -16.583 3.128   1.00 0.00 ? 456 LEU A CD1  1  
ATOM 7120   C CD2  . LEU A 1 456 ? 7.777   -17.808 1.316   1.00 0.00 ? 456 LEU A CD2  1  
ATOM 7121   H H    . LEU A 1 456 ? 7.412   -12.973 1.257   1.00 0.00 ? 456 LEU A H    1  
ATOM 7122   H HA   . LEU A 1 456 ? 9.784   -14.217 1.864   1.00 0.00 ? 456 LEU A HA   1  
ATOM 7123   H HB2  . LEU A 1 456 ? 7.345   -15.038 1.725   1.00 0.00 ? 456 LEU A HB2  1  
ATOM 7124   H HB3  . LEU A 1 456 ? 7.769   -15.499 0.089   1.00 0.00 ? 456 LEU A HB3  1  
ATOM 7125   H HG   . LEU A 1 456 ? 9.659   -16.818 1.048   1.00 0.00 ? 456 LEU A HG   1  
ATOM 7126   H HD11 . LEU A 1 456 ? 9.260   -17.590 3.508   1.00 0.00 ? 456 LEU A HD11 1  
ATOM 7127   H HD12 . LEU A 1 456 ? 8.409   -16.056 3.690   1.00 0.00 ? 456 LEU A HD12 1  
ATOM 7128   H HD13 . LEU A 1 456 ? 10.110  -16.069 3.227   1.00 0.00 ? 456 LEU A HD13 1  
ATOM 7129   H HD21 . LEU A 1 456 ? 8.242   -18.741 1.600   1.00 0.00 ? 456 LEU A HD21 1  
ATOM 7130   H HD22 . LEU A 1 456 ? 7.545   -17.828 0.262   1.00 0.00 ? 456 LEU A HD22 1  
ATOM 7131   H HD23 . LEU A 1 456 ? 6.867   -17.671 1.882   1.00 0.00 ? 456 LEU A HD23 1  
ATOM 7132   N N    . THR A 1 457 ? 9.444   -13.877 -1.391  1.00 0.00 ? 457 THR A N    1  
ATOM 7133   C CA   . THR A 1 457 ? 10.218  -13.899 -2.581  1.00 0.00 ? 457 THR A CA   1  
ATOM 7134   C C    . THR A 1 457 ? 11.396  -12.961 -2.354  1.00 0.00 ? 457 THR A C    1  
ATOM 7135   O O    . THR A 1 457 ? 12.569  -13.365 -2.515  1.00 0.00 ? 457 THR A O    1  
ATOM 7136   C CB   . THR A 1 457 ? 9.345   -13.494 -3.759  1.00 0.00 ? 457 THR A CB   1  
ATOM 7137   O OG1  . THR A 1 457 ? 8.284   -14.456 -3.865  1.00 0.00 ? 457 THR A OG1  1  
ATOM 7138   C CG2  . THR A 1 457 ? 10.129  -13.467 -5.054  1.00 0.00 ? 457 THR A CG2  1  
ATOM 7139   H H    . THR A 1 457 ? 8.516   -13.562 -1.405  1.00 0.00 ? 457 THR A H    1  
ATOM 7140   H HA   . THR A 1 457 ? 10.591  -14.901 -2.741  1.00 0.00 ? 457 THR A HA   1  
ATOM 7141   H HB   . THR A 1 457 ? 8.923   -12.516 -3.572  1.00 0.00 ? 457 THR A HB   1  
ATOM 7142   H HG1  . THR A 1 457 ? 7.453   -13.979 -3.901  1.00 0.00 ? 457 THR A HG1  1  
ATOM 7143   H HG21 . THR A 1 457 ? 9.534   -13.001 -5.825  1.00 0.00 ? 457 THR A HG21 1  
ATOM 7144   H HG22 . THR A 1 457 ? 10.374  -14.477 -5.347  1.00 0.00 ? 457 THR A HG22 1  
ATOM 7145   H HG23 . THR A 1 457 ? 11.039  -12.902 -4.911  1.00 0.00 ? 457 THR A HG23 1  
ATOM 7146   N N    . GLN A 1 458 ? 11.067  -11.745 -1.921  1.00 0.00 ? 458 GLN A N    1  
ATOM 7147   C CA   . GLN A 1 458 ? 12.023  -10.682 -1.739  1.00 0.00 ? 458 GLN A CA   1  
ATOM 7148   C C    . GLN A 1 458 ? 13.195  -11.153 -0.936  1.00 0.00 ? 458 GLN A C    1  
ATOM 7149   O O    . GLN A 1 458 ? 14.331  -10.967 -1.388  1.00 0.00 ? 458 GLN A O    1  
ATOM 7150   C CB   . GLN A 1 458 ? 11.367  -9.490  -1.073  1.00 0.00 ? 458 GLN A CB   1  
ATOM 7151   C CG   . GLN A 1 458 ? 12.305  -8.358  -0.738  1.00 0.00 ? 458 GLN A CG   1  
ATOM 7152   C CD   . GLN A 1 458 ? 11.555  -7.169  -0.164  1.00 0.00 ? 458 GLN A CD   1  
ATOM 7153   O OE1  . GLN A 1 458 ? 10.857  -6.478  -0.893  1.00 0.00 ? 458 GLN A OE1  1  
ATOM 7154   N NE2  . GLN A 1 458 ? 11.653  -6.956  1.141   1.00 0.00 ? 458 GLN A NE2  1  
ATOM 7155   H H    . GLN A 1 458 ? 10.118  -11.544 -1.781  1.00 0.00 ? 458 GLN A H    1  
ATOM 7156   H HA   . GLN A 1 458 ? 12.378  -10.374 -2.711  1.00 0.00 ? 458 GLN A HA   1  
ATOM 7157   H HB2  . GLN A 1 458 ? 10.602  -9.110  -1.732  1.00 0.00 ? 458 GLN A HB2  1  
ATOM 7158   H HB3  . GLN A 1 458 ? 10.893  -9.828  -0.162  1.00 0.00 ? 458 GLN A HB3  1  
ATOM 7159   H HG2  . GLN A 1 458 ? 13.028  -8.702  -0.013  1.00 0.00 ? 458 GLN A HG2  1  
ATOM 7160   H HG3  . GLN A 1 458 ? 12.821  -8.051  -1.635  1.00 0.00 ? 458 GLN A HG3  1  
ATOM 7161   H HE21 . GLN A 1 458 ? 12.195  -7.555  1.696   1.00 0.00 ? 458 GLN A HE21 1  
ATOM 7162   H HE22 . GLN A 1 458 ? 11.185  -6.198  1.550   1.00 0.00 ? 458 GLN A HE22 1  
ATOM 7163   N N    . TYR A 1 459 ? 12.963  -11.775 0.222   1.00 0.00 ? 459 TYR A N    1  
ATOM 7164   C CA   . TYR A 1 459 ? 14.089  -12.147 1.092   1.00 0.00 ? 459 TYR A CA   1  
ATOM 7165   C C    . TYR A 1 459 ? 14.744  -13.426 0.708   1.00 0.00 ? 459 TYR A C    1  
ATOM 7166   O O    . TYR A 1 459 ? 15.926  -13.644 1.029   1.00 0.00 ? 459 TYR A O    1  
ATOM 7167   C CB   . TYR A 1 459 ? 13.683  -12.287 2.544   1.00 0.00 ? 459 TYR A CB   1  
ATOM 7168   C CG   . TYR A 1 459 ? 13.013  -11.067 3.005   1.00 0.00 ? 459 TYR A CG   1  
ATOM 7169   C CD1  . TYR A 1 459 ? 13.681  -9.870  2.987   1.00 0.00 ? 459 TYR A CD1  1  
ATOM 7170   C CD2  . TYR A 1 459 ? 11.678  -11.086 3.408   1.00 0.00 ? 459 TYR A CD2  1  
ATOM 7171   C CE1  . TYR A 1 459 ? 13.071  -8.742  3.370   1.00 0.00 ? 459 TYR A CE1  1  
ATOM 7172   C CE2  . TYR A 1 459 ? 11.067  -9.947  3.793   1.00 0.00 ? 459 TYR A CE2  1  
ATOM 7173   C CZ   . TYR A 1 459 ? 11.776  -8.776  3.780   1.00 0.00 ? 459 TYR A CZ   1  
ATOM 7174   O OH   . TYR A 1 459 ? 11.193  -7.587  4.152   1.00 0.00 ? 459 TYR A OH   1  
ATOM 7175   H H    . TYR A 1 459 ? 12.042  -11.913 0.527   1.00 0.00 ? 459 TYR A H    1  
ATOM 7176   H HA   . TYR A 1 459 ? 14.827  -11.363 1.032   1.00 0.00 ? 459 TYR A HA   1  
ATOM 7177   H HB2  . TYR A 1 459 ? 13.009  -13.124 2.648   1.00 0.00 ? 459 TYR A HB2  1  
ATOM 7178   H HB3  . TYR A 1 459 ? 14.563  -12.462 3.145   1.00 0.00 ? 459 TYR A HB3  1  
ATOM 7179   H HD1  . TYR A 1 459 ? 14.711  -9.838  2.662   1.00 0.00 ? 459 TYR A HD1  1  
ATOM 7180   H HD2  . TYR A 1 459 ? 11.136  -12.020 3.428   1.00 0.00 ? 459 TYR A HD2  1  
ATOM 7181   H HE1  . TYR A 1 459 ? 13.612  -7.808  3.368   1.00 0.00 ? 459 TYR A HE1  1  
ATOM 7182   H HE2  . TYR A 1 459 ? 10.033  -9.959  4.106   1.00 0.00 ? 459 TYR A HE2  1  
ATOM 7183   H HH   . TYR A 1 459 ? 11.761  -7.170  4.804   1.00 0.00 ? 459 TYR A HH   1  
ATOM 7184   N N    . THR A 1 460 ? 13.988  -14.308 0.084   1.00 0.00 ? 460 THR A N    1  
ATOM 7185   C CA   . THR A 1 460 ? 14.564  -15.567 -0.252  1.00 0.00 ? 460 THR A CA   1  
ATOM 7186   C C    . THR A 1 460 ? 15.525  -15.304 -1.415  1.00 0.00 ? 460 THR A C    1  
ATOM 7187   O O    . THR A 1 460 ? 16.632  -15.801 -1.437  1.00 0.00 ? 460 THR A O    1  
ATOM 7188   C CB   . THR A 1 460 ? 13.475  -16.536 -0.647  1.00 0.00 ? 460 THR A CB   1  
ATOM 7189   O OG1  . THR A 1 460 ? 12.598  -16.749 0.464   1.00 0.00 ? 460 THR A OG1  1  
ATOM 7190   C CG2  . THR A 1 460 ? 14.071  -17.841 -1.105  1.00 0.00 ? 460 THR A CG2  1  
ATOM 7191   H H    . THR A 1 460 ? 13.046  -14.117 -0.109  1.00 0.00 ? 460 THR A H    1  
ATOM 7192   H HA   . THR A 1 460 ? 15.113  -15.954 0.595   1.00 0.00 ? 460 THR A HA   1  
ATOM 7193   H HB   . THR A 1 460 ? 12.907  -16.108 -1.461  1.00 0.00 ? 460 THR A HB   1  
ATOM 7194   H HG1  . THR A 1 460 ? 12.272  -15.893 0.753   1.00 0.00 ? 460 THR A HG1  1  
ATOM 7195   H HG21 . THR A 1 460 ? 14.657  -17.676 -1.997  1.00 0.00 ? 460 THR A HG21 1  
ATOM 7196   H HG22 . THR A 1 460 ? 13.278  -18.543 -1.320  1.00 0.00 ? 460 THR A HG22 1  
ATOM 7197   H HG23 . THR A 1 460 ? 14.705  -18.240 -0.328  1.00 0.00 ? 460 THR A HG23 1  
ATOM 7198   N N    . LEU A 1 461 ? 15.099  -14.471 -2.357  1.00 0.00 ? 461 LEU A N    1  
ATOM 7199   C CA   . LEU A 1 461 ? 15.929  -14.144 -3.500  1.00 0.00 ? 461 LEU A CA   1  
ATOM 7200   C C    . LEU A 1 461 ? 16.748  -12.884 -3.263  1.00 0.00 ? 461 LEU A C    1  
ATOM 7201   O O    . LEU A 1 461 ? 17.543  -12.498 -4.111  1.00 0.00 ? 461 LEU A O    1  
ATOM 7202   C CB   . LEU A 1 461 ? 15.100  -14.007 -4.785  1.00 0.00 ? 461 LEU A CB   1  
ATOM 7203   C CG   . LEU A 1 461 ? 14.015  -15.049 -5.123  1.00 0.00 ? 461 LEU A CG   1  
ATOM 7204   C CD1  . LEU A 1 461 ? 13.405  -14.772 -6.455  1.00 0.00 ? 461 LEU A CD1  1  
ATOM 7205   C CD2  . LEU A 1 461 ? 14.559  -16.414 -5.157  1.00 0.00 ? 461 LEU A CD2  1  
ATOM 7206   H H    . LEU A 1 461 ? 14.210  -14.066 -2.276  1.00 0.00 ? 461 LEU A H    1  
ATOM 7207   H HA   . LEU A 1 461 ? 16.622  -14.961 -3.643  1.00 0.00 ? 461 LEU A HA   1  
ATOM 7208   H HB2  . LEU A 1 461 ? 14.609  -13.050 -4.749  1.00 0.00 ? 461 LEU A HB2  1  
ATOM 7209   H HB3  . LEU A 1 461 ? 15.800  -13.978 -5.612  1.00 0.00 ? 461 LEU A HB3  1  
ATOM 7210   H HG   . LEU A 1 461 ? 13.240  -14.998 -4.370  1.00 0.00 ? 461 LEU A HG   1  
ATOM 7211   H HD11 . LEU A 1 461 ? 13.433  -13.710 -6.650  1.00 0.00 ? 461 LEU A HD11 1  
ATOM 7212   H HD12 . LEU A 1 461 ? 12.379  -15.113 -6.460  1.00 0.00 ? 461 LEU A HD12 1  
ATOM 7213   H HD13 . LEU A 1 461 ? 13.961  -15.291 -7.221  1.00 0.00 ? 461 LEU A HD13 1  
ATOM 7214   H HD21 . LEU A 1 461 ? 13.753  -17.120 -5.282  1.00 0.00 ? 461 LEU A HD21 1  
ATOM 7215   H HD22 . LEU A 1 461 ? 15.078  -16.618 -4.231  1.00 0.00 ? 461 LEU A HD22 1  
ATOM 7216   H HD23 . LEU A 1 461 ? 15.247  -16.508 -5.984  1.00 0.00 ? 461 LEU A HD23 1  
ATOM 7217   N N    . ALA A 1 462 ? 16.588  -12.225 -2.131  1.00 0.00 ? 462 ALA A N    1  
ATOM 7218   C CA   . ALA A 1 462 ? 17.263  -10.910 -1.966  1.00 0.00 ? 462 ALA A CA   1  
ATOM 7219   C C    . ALA A 1 462 ? 17.082  -10.012 -3.162  1.00 0.00 ? 462 ALA A C    1  
ATOM 7220   O O    . ALA A 1 462 ? 18.045  -9.448  -3.684  1.00 0.00 ? 462 ALA A O    1  
ATOM 7221   C CB   . ALA A 1 462 ? 18.755  -11.068 -1.668  1.00 0.00 ? 462 ALA A CB   1  
ATOM 7222   H H    . ALA A 1 462 ? 15.952  -12.544 -1.457  1.00 0.00 ? 462 ALA A H    1  
ATOM 7223   H HA   . ALA A 1 462 ? 16.810  -10.417 -1.118  1.00 0.00 ? 462 ALA A HA   1  
ATOM 7224   H HB1  . ALA A 1 462 ? 19.223  -11.633 -2.461  1.00 0.00 ? 462 ALA A HB1  1  
ATOM 7225   H HB2  . ALA A 1 462 ? 18.882  -11.590 -0.731  1.00 0.00 ? 462 ALA A HB2  1  
ATOM 7226   H HB3  . ALA A 1 462 ? 19.214  -10.093 -1.601  1.00 0.00 ? 462 ALA A HB3  1  
ATOM 7227   N N    . VAL A 1 463 ? 15.854  -9.919  -3.631  1.00 0.00 ? 463 VAL A N    1  
ATOM 7228   C CA   . VAL A 1 463 ? 15.538  -8.940  -4.648  1.00 0.00 ? 463 VAL A CA   1  
ATOM 7229   C C    . VAL A 1 463 ? 14.405  -8.040  -4.197  1.00 0.00 ? 463 VAL A C    1  
ATOM 7230   O O    . VAL A 1 463 ? 13.332  -8.495  -3.755  1.00 0.00 ? 463 VAL A O    1  
ATOM 7231   C CB   . VAL A 1 463 ? 15.454  -9.534  -6.099  1.00 0.00 ? 463 VAL A CB   1  
ATOM 7232   C CG1  . VAL A 1 463 ? 16.448  -10.616 -6.289  1.00 0.00 ? 463 VAL A CG1  1  
ATOM 7233   C CG2  . VAL A 1 463 ? 14.080  -9.964  -6.480  1.00 0.00 ? 463 VAL A CG2  1  
ATOM 7234   H H    . VAL A 1 463 ? 15.131  -10.420 -3.200  1.00 0.00 ? 463 VAL A H    1  
ATOM 7235   H HA   . VAL A 1 463 ? 16.404  -8.284  -4.661  1.00 0.00 ? 463 VAL A HA   1  
ATOM 7236   H HB   . VAL A 1 463 ? 15.741  -8.734  -6.773  1.00 0.00 ? 463 VAL A HB   1  
ATOM 7237   H HG11 . VAL A 1 463 ? 16.155  -11.481 -5.713  1.00 0.00 ? 463 VAL A HG11 1  
ATOM 7238   H HG12 . VAL A 1 463 ? 17.420  -10.275 -5.959  1.00 0.00 ? 463 VAL A HG12 1  
ATOM 7239   H HG13 . VAL A 1 463 ? 16.496  -10.882 -7.335  1.00 0.00 ? 463 VAL A HG13 1  
ATOM 7240   H HG21 . VAL A 1 463 ? 13.822  -10.865 -5.944  1.00 0.00 ? 463 VAL A HG21 1  
ATOM 7241   H HG22 . VAL A 1 463 ? 14.045  -10.155 -7.543  1.00 0.00 ? 463 VAL A HG22 1  
ATOM 7242   H HG23 . VAL A 1 463 ? 13.376  -9.184  -6.231  1.00 0.00 ? 463 VAL A HG23 1  
ATOM 7243   N N    . ASP A 1 464 ? 14.716  -6.747  -4.250  1.00 0.00 ? 464 ASP A N    1  
ATOM 7244   C CA   . ASP A 1 464 ? 13.862  -5.703  -3.775  1.00 0.00 ? 464 ASP A CA   1  
ATOM 7245   C C    . ASP A 1 464 ? 12.654  -5.665  -4.700  1.00 0.00 ? 464 ASP A C    1  
ATOM 7246   O O    . ASP A 1 464 ? 12.776  -5.557  -5.917  1.00 0.00 ? 464 ASP A O    1  
ATOM 7247   C CB   . ASP A 1 464 ? 14.639  -4.396  -3.795  1.00 0.00 ? 464 ASP A CB   1  
ATOM 7248   C CG   . ASP A 1 464 ? 13.940  -3.256  -3.048  1.00 0.00 ? 464 ASP A CG   1  
ATOM 7249   O OD1  . ASP A 1 464 ? 12.744  -3.372  -2.642  1.00 0.00 ? 464 ASP A OD1  1  
ATOM 7250   O OD2  . ASP A 1 464 ? 14.616  -2.213  -2.858  1.00 0.00 ? 464 ASP A OD2  1  
ATOM 7251   H H    . ASP A 1 464 ? 15.611  -6.502  -4.565  1.00 0.00 ? 464 ASP A H    1  
ATOM 7252   H HA   . ASP A 1 464 ? 13.543  -5.924  -2.767  1.00 0.00 ? 464 ASP A HA   1  
ATOM 7253   H HB2  . ASP A 1 464 ? 15.605  -4.562  -3.342  1.00 0.00 ? 464 ASP A HB2  1  
ATOM 7254   H HB3  . ASP A 1 464 ? 14.787  -4.099  -4.824  1.00 0.00 ? 464 ASP A HB3  1  
ATOM 7255   N N    . ARG A 1 465 ? 11.480  -5.777  -4.089  1.00 0.00 ? 465 ARG A N    1  
ATOM 7256   C CA   . ARG A 1 465 ? 10.209  -5.719  -4.787  1.00 0.00 ? 465 ARG A CA   1  
ATOM 7257   C C    . ARG A 1 465 ? 10.052  -4.452  -5.579  1.00 0.00 ? 465 ARG A C    1  
ATOM 7258   O O    . ARG A 1 465 ? 9.277   -4.409  -6.521  1.00 0.00 ? 465 ARG A O    1  
ATOM 7259   C CB   . ARG A 1 465 ? 9.083   -5.815  -3.785  1.00 0.00 ? 465 ARG A CB   1  
ATOM 7260   C CG   . ARG A 1 465 ? 8.926   -7.197  -3.200  1.00 0.00 ? 465 ARG A CG   1  
ATOM 7261   C CD   . ARG A 1 465 ? 8.050   -7.107  -1.977  1.00 0.00 ? 465 ARG A CD   1  
ATOM 7262   N NE   . ARG A 1 465 ? 6.708   -6.554  -2.200  1.00 0.00 ? 465 ARG A NE   1  
ATOM 7263   C CZ   . ARG A 1 465 ? 5.907   -6.197  -1.203  1.00 0.00 ? 465 ARG A CZ   1  
ATOM 7264   N NH1  . ARG A 1 465 ? 6.327   -6.366  0.049   1.00 0.00 ? 465 ARG A NH1  1  
ATOM 7265   N NH2  . ARG A 1 465 ? 4.685   -5.727  -1.435  1.00 0.00 ? 465 ARG A NH2  1  
ATOM 7266   H H    . ARG A 1 465 ? 11.471  -5.874  -3.114  1.00 0.00 ? 465 ARG A H    1  
ATOM 7267   H HA   . ARG A 1 465 ? 10.142  -6.561  -5.459  1.00 0.00 ? 465 ARG A HA   1  
ATOM 7268   H HB2  . ARG A 1 465 ? 9.273   -5.120  -2.981  1.00 0.00 ? 465 ARG A HB2  1  
ATOM 7269   H HB3  . ARG A 1 465 ? 8.161   -5.534  -4.273  1.00 0.00 ? 465 ARG A HB3  1  
ATOM 7270   H HG2  . ARG A 1 465 ? 8.467   -7.849  -3.929  1.00 0.00 ? 465 ARG A HG2  1  
ATOM 7271   H HG3  . ARG A 1 465 ? 9.894   -7.585  -2.922  1.00 0.00 ? 465 ARG A HG3  1  
ATOM 7272   H HD2  . ARG A 1 465 ? 7.936   -8.097  -1.567  1.00 0.00 ? 465 ARG A HD2  1  
ATOM 7273   H HD3  . ARG A 1 465 ? 8.559   -6.495  -1.242  1.00 0.00 ? 465 ARG A HD3  1  
ATOM 7274   H HE   . ARG A 1 465 ? 6.387   -6.454  -3.121  1.00 0.00 ? 465 ARG A HE   1  
ATOM 7275   H HH11 . ARG A 1 465 ? 7.231   -6.754  0.225   1.00 0.00 ? 465 ARG A HH11 1  
ATOM 7276   H HH12 . ARG A 1 465 ? 5.737   -6.103  0.814   1.00 0.00 ? 465 ARG A HH12 1  
ATOM 7277   H HH21 . ARG A 1 465 ? 4.353   -5.636  -2.374  1.00 0.00 ? 465 ARG A HH21 1  
ATOM 7278   H HH22 . ARG A 1 465 ? 4.097   -5.464  -0.669  1.00 0.00 ? 465 ARG A HH22 1  
ATOM 7279   N N    . GLY A 1 466 ? 10.791  -3.415  -5.177  1.00 0.00 ? 466 GLY A N    1  
ATOM 7280   C CA   . GLY A 1 466 ? 10.718  -2.087  -5.787  1.00 0.00 ? 466 GLY A CA   1  
ATOM 7281   C C    . GLY A 1 466 ? 11.681  -1.907  -6.938  1.00 0.00 ? 466 GLY A C    1  
ATOM 7282   O O    . GLY A 1 466 ? 11.509  -0.995  -7.723  1.00 0.00 ? 466 GLY A O    1  
ATOM 7283   H H    . GLY A 1 466 ? 11.382  -3.539  -4.405  1.00 0.00 ? 466 GLY A H    1  
ATOM 7284   H HA2  . GLY A 1 466 ? 9.713   -1.927  -6.149  1.00 0.00 ? 466 GLY A HA2  1  
ATOM 7285   H HA3  . GLY A 1 466 ? 10.937  -1.346  -5.031  1.00 0.00 ? 466 GLY A HA3  1  
ATOM 7286   N N    . ASN A 1 467 ? 12.685  -2.770  -7.067  1.00 0.00 ? 467 ASN A N    1  
ATOM 7287   C CA   . ASN A 1 467 ? 13.850  -2.488  -7.927  1.00 0.00 ? 467 ASN A CA   1  
ATOM 7288   C C    . ASN A 1 467 ? 13.691  -3.056  -9.347  1.00 0.00 ? 467 ASN A C    1  
ATOM 7289   O O    . ASN A 1 467 ? 13.888  -4.261  -9.583  1.00 0.00 ? 467 ASN A O    1  
ATOM 7290   C CB   . ASN A 1 467 ? 15.078  -3.066  -7.238  1.00 0.00 ? 467 ASN A CB   1  
ATOM 7291   C CG   . ASN A 1 467 ? 16.367  -2.870  -8.006  1.00 0.00 ? 467 ASN A CG   1  
ATOM 7292   O OD1  . ASN A 1 467 ? 16.393  -2.362  -9.143  1.00 0.00 ? 467 ASN A OD1  1  
ATOM 7293   N ND2  . ASN A 1 467 ? 17.460  -3.337  -7.404  1.00 0.00 ? 467 ASN A ND2  1  
ATOM 7294   H H    . ASN A 1 467 ? 12.759  -3.496  -6.412  1.00 0.00 ? 467 ASN A H    1  
ATOM 7295   H HA   . ASN A 1 467 ? 13.973  -1.418  -7.998  1.00 0.00 ? 467 ASN A HA   1  
ATOM 7296   H HB2  . ASN A 1 467 ? 15.183  -2.596  -6.272  1.00 0.00 ? 467 ASN A HB2  1  
ATOM 7297   H HB3  . ASN A 1 467 ? 14.919  -4.126  -7.089  1.00 0.00 ? 467 ASN A HB3  1  
ATOM 7298   H HD21 . ASN A 1 467 ? 17.390  -3.769  -6.528  1.00 0.00 ? 467 ASN A HD21 1  
ATOM 7299   H HD22 . ASN A 1 467 ? 18.334  -3.248  -7.837  1.00 0.00 ? 467 ASN A HD22 1  
ATOM 7300   N N    . ASP A 1 468 ? 13.319  -2.193  -10.293 1.00 0.00 ? 468 ASP A N    1  
ATOM 7301   C CA   . ASP A 1 468 ? 13.077  -2.632  -11.675 1.00 0.00 ? 468 ASP A CA   1  
ATOM 7302   C C    . ASP A 1 468 ? 14.327  -3.141  -12.369 1.00 0.00 ? 468 ASP A C    1  
ATOM 7303   O O    . ASP A 1 468 ? 14.253  -4.068  -13.167 1.00 0.00 ? 468 ASP A O    1  
ATOM 7304   C CB   . ASP A 1 468 ? 12.407  -1.553  -12.528 1.00 0.00 ? 468 ASP A CB   1  
ATOM 7305   C CG   . ASP A 1 468 ? 13.240  -0.279  -12.636 1.00 0.00 ? 468 ASP A CG   1  
ATOM 7306   O OD1  . ASP A 1 468 ? 14.375  -0.229  -12.082 1.00 0.00 ? 468 ASP A OD1  1  
ATOM 7307   O OD2  . ASP A 1 468 ? 12.750  0.692   -13.273 1.00 0.00 ? 468 ASP A OD2  1  
ATOM 7308   H H    . ASP A 1 468 ? 13.166  -1.255  -10.054 1.00 0.00 ? 468 ASP A H    1  
ATOM 7309   H HA   . ASP A 1 468 ? 12.389  -3.464  -11.621 1.00 0.00 ? 468 ASP A HA   1  
ATOM 7310   H HB2  . ASP A 1 468 ? 12.245  -1.944  -13.521 1.00 0.00 ? 468 ASP A HB2  1  
ATOM 7311   H HB3  . ASP A 1 468 ? 11.449  -1.310  -12.091 1.00 0.00 ? 468 ASP A HB3  1  
ATOM 7312   N N    . MET A 1 469 ? 15.466  -2.554  -12.040 1.00 0.00 ? 469 MET A N    1  
ATOM 7313   C CA   . MET A 1 469 ? 16.717  -3.011  -12.602 1.00 0.00 ? 469 MET A CA   1  
ATOM 7314   C C    . MET A 1 469 ? 16.971  -4.514  -12.445 1.00 0.00 ? 469 MET A C    1  
ATOM 7315   O O    . MET A 1 469 ? 17.517  -5.138  -13.347 1.00 0.00 ? 469 MET A O    1  
ATOM 7316   C CB   . MET A 1 469 ? 17.887  -2.239  -12.022 1.00 0.00 ? 469 MET A CB   1  
ATOM 7317   C CG   . MET A 1 469 ? 19.156  -2.551  -12.775 1.00 0.00 ? 469 MET A CG   1  
ATOM 7318   S SD   . MET A 1 469 ? 20.625  -1.422  -12.236 1.00 0.00 ? 469 MET A SD   1  
ATOM 7319   C CE   . MET A 1 469 ? 19.903  0.371   -13.142 1.00 0.00 ? 469 MET A CE   1  
ATOM 7320   H H    . MET A 1 469 ? 15.466  -1.831  -11.379 1.00 0.00 ? 469 MET A H    1  
ATOM 7321   H HA   . MET A 1 469 ? 16.688  -2.799  -13.660 1.00 0.00 ? 469 MET A HA   1  
ATOM 7322   H HB2  . MET A 1 469 ? 17.684  -1.181  -12.091 1.00 0.00 ? 469 MET A HB2  1  
ATOM 7323   H HB3  . MET A 1 469 ? 18.013  -2.511  -10.985 1.00 0.00 ? 469 MET A HB3  1  
ATOM 7324   H HG2  . MET A 1 469 ? 19.424  -3.582  -12.596 1.00 0.00 ? 469 MET A HG2  1  
ATOM 7325   H HG3  . MET A 1 469 ? 18.979  -2.414  -13.831 1.00 0.00 ? 469 MET A HG3  1  
ATOM 7326   H HE1  . MET A 1 469 ? 18.919  0.191   -13.559 1.00 0.00 ? 469 MET A HE1  1  
ATOM 7327   H HE2  . MET A 1 469 ? 20.570  0.674   -13.929 1.00 0.00 ? 469 MET A HE2  1  
ATOM 7328   H HE3  . MET A 1 469 ? 19.853  1.155   -12.396 1.00 0.00 ? 469 MET A HE3  1  
ATOM 7329   N N    . ILE A 1 470 ? 16.585  -5.096  -11.315 1.00 0.00 ? 470 ILE A N    1  
ATOM 7330   C CA   . ILE A 1 470 ? 16.690  -6.536  -11.165 1.00 0.00 ? 470 ILE A CA   1  
ATOM 7331   C C    . ILE A 1 470 ? 15.362  -7.262  -11.164 1.00 0.00 ? 470 ILE A C    1  
ATOM 7332   O O    . ILE A 1 470 ? 15.288  -8.417  -10.754 1.00 0.00 ? 470 ILE A O    1  
ATOM 7333   C CB   . ILE A 1 470 ? 17.500  -6.953  -9.916  1.00 0.00 ? 470 ILE A CB   1  
ATOM 7334   C CG1  . ILE A 1 470 ? 16.872  -6.370  -8.662  1.00 0.00 ? 470 ILE A CG1  1  
ATOM 7335   C CG2  . ILE A 1 470 ? 18.955  -6.558  -10.102 1.00 0.00 ? 470 ILE A CG2  1  
ATOM 7336   C CD1  . ILE A 1 470 ? 17.495  -6.798  -7.381  1.00 0.00 ? 470 ILE A CD1  1  
ATOM 7337   H H    . ILE A 1 470 ? 16.153  -4.563  -10.615 1.00 0.00 ? 470 ILE A H    1  
ATOM 7338   H HA   . ILE A 1 470 ? 17.238  -6.895  -12.023 1.00 0.00 ? 470 ILE A HA   1  
ATOM 7339   H HB   . ILE A 1 470 ? 17.461  -8.034  -9.847  1.00 0.00 ? 470 ILE A HB   1  
ATOM 7340   H HG12 . ILE A 1 470 ? 16.933  -5.296  -8.721  1.00 0.00 ? 470 ILE A HG12 1  
ATOM 7341   H HG13 . ILE A 1 470 ? 15.826  -6.648  -8.649  1.00 0.00 ? 470 ILE A HG13 1  
ATOM 7342   H HG21 . ILE A 1 470 ? 19.010  -5.539  -10.454 1.00 0.00 ? 470 ILE A HG21 1  
ATOM 7343   H HG22 . ILE A 1 470 ? 19.416  -7.215  -10.826 1.00 0.00 ? 470 ILE A HG22 1  
ATOM 7344   H HG23 . ILE A 1 470 ? 19.474  -6.642  -9.159  1.00 0.00 ? 470 ILE A HG23 1  
ATOM 7345   H HD11 . ILE A 1 470 ? 17.760  -7.843  -7.440  1.00 0.00 ? 470 ILE A HD11 1  
ATOM 7346   H HD12 . ILE A 1 470 ? 16.793  -6.649  -6.572  1.00 0.00 ? 470 ILE A HD12 1  
ATOM 7347   H HD13 . ILE A 1 470 ? 18.383  -6.212  -7.199  1.00 0.00 ? 470 ILE A HD13 1  
ATOM 7348   N N    . SER A 1 471 ? 14.306  -6.625  -11.641 1.00 0.00 ? 471 SER A N    1  
ATOM 7349   C CA   . SER A 1 471 ? 13.022  -7.295  -11.534 1.00 0.00 ? 471 SER A CA   1  
ATOM 7350   C C    . SER A 1 471 ? 13.050  -8.702  -12.126 1.00 0.00 ? 471 SER A C    1  
ATOM 7351   O O    . SER A 1 471 ? 12.321  -9.565  -11.667 1.00 0.00 ? 471 SER A O    1  
ATOM 7352   C CB   . SER A 1 471 ? 11.905  -6.467  -12.163 1.00 0.00 ? 471 SER A CB   1  
ATOM 7353   O OG   . SER A 1 471 ? 12.199  -6.193  -13.495 1.00 0.00 ? 471 SER A OG   1  
ATOM 7354   H H    . SER A 1 471 ? 14.376  -5.710  -11.985 1.00 0.00 ? 471 SER A H    1  
ATOM 7355   H HA   . SER A 1 471 ? 12.799  -7.394  -10.481 1.00 0.00 ? 471 SER A HA   1  
ATOM 7356   H HB2  . SER A 1 471 ? 10.981  -7.016  -12.116 1.00 0.00 ? 471 SER A HB2  1  
ATOM 7357   H HB3  . SER A 1 471 ? 11.795  -5.542  -11.610 1.00 0.00 ? 471 SER A HB3  1  
ATOM 7358   H HG   . SER A 1 471 ? 12.454  -5.270  -13.558 1.00 0.00 ? 471 SER A HG   1  
ATOM 7359   N N    . HIS A 1 472 ? 13.897  -8.936  -13.136 1.00 0.00 ? 472 HIS A N    1  
ATOM 7360   C CA   . HIS A 1 472 ? 13.897  -10.206 -13.843 1.00 0.00 ? 472 HIS A CA   1  
ATOM 7361   C C    . HIS A 1 472 ? 14.264  -11.358 -12.915 1.00 0.00 ? 472 HIS A C    1  
ATOM 7362   O O    . HIS A 1 472 ? 14.004  -12.526 -13.234 1.00 0.00 ? 472 HIS A O    1  
ATOM 7363   C CB   . HIS A 1 472 ? 14.830  -10.155 -15.068 1.00 0.00 ? 472 HIS A CB   1  
ATOM 7364   C CG   . HIS A 1 472 ? 16.291  -10.072 -14.727 1.00 0.00 ? 472 HIS A CG   1  
ATOM 7365   N ND1  . HIS A 1 472 ? 16.902  -8.891  -14.339 1.00 0.00 ? 472 HIS A ND1  1  
ATOM 7366   C CD2  . HIS A 1 472 ? 17.257  -11.030 -14.698 1.00 0.00 ? 472 HIS A CD2  1  
ATOM 7367   C CE1  . HIS A 1 472 ? 18.182  -9.135  -14.082 1.00 0.00 ? 472 HIS A CE1  1  
ATOM 7368   N NE2  . HIS A 1 472 ? 18.424  -10.421 -14.301 1.00 0.00 ? 472 HIS A NE2  1  
ATOM 7369   H H    . HIS A 1 472 ? 14.467  -8.208  -13.461 1.00 0.00 ? 472 HIS A H    1  
ATOM 7370   H HA   . HIS A 1 472 ? 12.892  -10.381 -14.201 1.00 0.00 ? 472 HIS A HA   1  
ATOM 7371   H HB2  . HIS A 1 472 ? 14.670  -11.043 -15.658 1.00 0.00 ? 472 HIS A HB2  1  
ATOM 7372   H HB3  . HIS A 1 472 ? 14.562  -9.295  -15.666 1.00 0.00 ? 472 HIS A HB3  1  
ATOM 7373   H HD1  . HIS A 1 472 ? 16.462  -8.019  -14.266 1.00 0.00 ? 472 HIS A HD1  1  
ATOM 7374   H HD2  . HIS A 1 472 ? 17.130  -12.075 -14.941 1.00 0.00 ? 472 HIS A HD2  1  
ATOM 7375   H HE1  . HIS A 1 472 ? 18.906  -8.406  -13.750 1.00 0.00 ? 472 HIS A HE1  1  
ATOM 7376   H HE2  . HIS A 1 472 ? 19.292  -10.863 -14.196 1.00 0.00 ? 472 HIS A HE2  1  
ATOM 7377   N N    . LEU A 1 473 ? 14.888  -11.021 -11.784 1.00 0.00 ? 473 LEU A N    1  
ATOM 7378   C CA   . LEU A 1 473 ? 15.281  -11.985 -10.745 1.00 0.00 ? 473 LEU A CA   1  
ATOM 7379   C C    . LEU A 1 473 ? 14.209  -12.140 -9.672  1.00 0.00 ? 473 LEU A C    1  
ATOM 7380   O O    . LEU A 1 473 ? 14.360  -12.937 -8.753  1.00 0.00 ? 473 LEU A O    1  
ATOM 7381   C CB   . LEU A 1 473 ? 16.557  -11.546 -10.038 1.00 0.00 ? 473 LEU A CB   1  
ATOM 7382   C CG   . LEU A 1 473 ? 17.821  -11.450 -10.874 1.00 0.00 ? 473 LEU A CG   1  
ATOM 7383   C CD1  . LEU A 1 473 ? 18.990  -10.922 -10.047 1.00 0.00 ? 473 LEU A CD1  1  
ATOM 7384   C CD2  . LEU A 1 473 ? 18.127  -12.794 -11.495 1.00 0.00 ? 473 LEU A CD2  1  
ATOM 7385   H H    . LEU A 1 473 ? 15.069  -10.071 -11.623 1.00 0.00 ? 473 LEU A H    1  
ATOM 7386   H HA   . LEU A 1 473 ? 15.455  -12.945 -11.207 1.00 0.00 ? 473 LEU A HA   1  
ATOM 7387   H HB2  . LEU A 1 473 ? 16.379  -10.575 -9.607  1.00 0.00 ? 473 LEU A HB2  1  
ATOM 7388   H HB3  . LEU A 1 473 ? 16.738  -12.239 -9.226  1.00 0.00 ? 473 LEU A HB3  1  
ATOM 7389   H HG   . LEU A 1 473 ? 17.636  -10.743 -11.672 1.00 0.00 ? 473 LEU A HG   1  
ATOM 7390   H HD11 . LEU A 1 473 ? 19.765  -11.673 -9.999  1.00 0.00 ? 473 LEU A HD11 1  
ATOM 7391   H HD12 . LEU A 1 473 ? 18.649  -10.691 -9.048  1.00 0.00 ? 473 LEU A HD12 1  
ATOM 7392   H HD13 . LEU A 1 473 ? 19.382  -10.029 -10.509 1.00 0.00 ? 473 LEU A HD13 1  
ATOM 7393   H HD21 . LEU A 1 473 ? 19.171  -12.836 -11.768 1.00 0.00 ? 473 LEU A HD21 1  
ATOM 7394   H HD22 . LEU A 1 473 ? 17.519  -12.930 -12.378 1.00 0.00 ? 473 LEU A HD22 1  
ATOM 7395   H HD23 . LEU A 1 473 ? 17.910  -13.577 -10.784 1.00 0.00 ? 473 LEU A HD23 1  
ATOM 7396   N N    . TYR A 1 474 ? 13.139  -11.373 -9.753  1.00 0.00 ? 474 TYR A N    1  
ATOM 7397   C CA   . TYR A 1 474 ? 12.149  -11.478 -8.728  1.00 0.00 ? 474 TYR A CA   1  
ATOM 7398   C C    . TYR A 1 474 ? 11.227  -12.567 -9.178  1.00 0.00 ? 474 TYR A C    1  
ATOM 7399   O O    . TYR A 1 474 ? 10.364  -12.322 -10.012 1.00 0.00 ? 474 TYR A O    1  
ATOM 7400   C CB   . TYR A 1 474 ? 11.379  -10.188 -8.558  1.00 0.00 ? 474 TYR A CB   1  
ATOM 7401   C CG   . TYR A 1 474 ? 10.137  -10.343 -7.717  1.00 0.00 ? 474 TYR A CG   1  
ATOM 7402   C CD1  . TYR A 1 474 ? 10.209  -10.298 -6.334  1.00 0.00 ? 474 TYR A CD1  1  
ATOM 7403   C CD2  . TYR A 1 474 ? 8.898   -10.525 -8.294  1.00 0.00 ? 474 TYR A CD2  1  
ATOM 7404   C CE1  . TYR A 1 474 ? 9.091   -10.439 -5.562  1.00 0.00 ? 474 TYR A CE1  1  
ATOM 7405   C CE2  . TYR A 1 474 ? 7.762   -10.647 -7.520  1.00 0.00 ? 474 TYR A CE2  1  
ATOM 7406   C CZ   . TYR A 1 474 ? 7.861   -10.614 -6.148  1.00 0.00 ? 474 TYR A CZ   1  
ATOM 7407   O OH   . TYR A 1 474 ? 6.744   -10.775 -5.329  1.00 0.00 ? 474 TYR A OH   1  
ATOM 7408   H H    . TYR A 1 474 ? 13.040  -10.725 -10.481 1.00 0.00 ? 474 TYR A H    1  
ATOM 7409   H HA   . TYR A 1 474 ? 12.616  -11.756 -7.794  1.00 0.00 ? 474 TYR A HA   1  
ATOM 7410   H HB2  . TYR A 1 474 ? 12.022  -9.459  -8.090  1.00 0.00 ? 474 TYR A HB2  1  
ATOM 7411   H HB3  . TYR A 1 474 ? 11.096  -9.822  -9.536  1.00 0.00 ? 474 TYR A HB3  1  
ATOM 7412   H HD1  . TYR A 1 474 ? 11.168  -10.156 -5.857  1.00 0.00 ? 474 TYR A HD1  1  
ATOM 7413   H HD2  . TYR A 1 474 ? 8.813   -10.552 -9.370  1.00 0.00 ? 474 TYR A HD2  1  
ATOM 7414   H HE1  . TYR A 1 474 ? 9.173   -10.400 -4.485  1.00 0.00 ? 474 TYR A HE1  1  
ATOM 7415   H HE2  . TYR A 1 474 ? 6.799   -10.784 -7.989  1.00 0.00 ? 474 TYR A HE2  1  
ATOM 7416   H HH   . TYR A 1 474 ? 6.790   -10.117 -4.631  1.00 0.00 ? 474 TYR A HH   1  
ATOM 7417   N N    . GLN A 1 475 ? 11.406  -13.777 -8.646  1.00 0.00 ? 475 GLN A N    1  
ATOM 7418   C CA   . GLN A 1 475 ? 10.625  -14.910 -9.123  1.00 0.00 ? 475 GLN A CA   1  
ATOM 7419   C C    . GLN A 1 475 ? 10.017  -15.637 -8.027  1.00 0.00 ? 475 GLN A C    1  
ATOM 7420   O O    . GLN A 1 475 ? 10.664  -16.421 -7.409  1.00 0.00 ? 475 GLN A O    1  
ATOM 7421   C CB   . GLN A 1 475 ? 11.471  -15.891 -9.888  1.00 0.00 ? 475 GLN A CB   1  
ATOM 7422   C CG   . GLN A 1 475 ? 12.135  -15.249 -11.051 1.00 0.00 ? 475 GLN A CG   1  
ATOM 7423   C CD   . GLN A 1 475 ? 11.155  -14.635 -12.059 1.00 0.00 ? 475 GLN A CD   1  
ATOM 7424   O OE1  . GLN A 1 475 ? 10.194  -15.284 -12.577 1.00 0.00 ? 475 GLN A OE1  1  
ATOM 7425   N NE2  . GLN A 1 475 ? 11.391  -13.346 -12.333 1.00 0.00 ? 475 GLN A NE2  1  
ATOM 7426   H H    . GLN A 1 475 ? 12.119  -13.919 -7.989  1.00 0.00 ? 475 GLN A H    1  
ATOM 7427   H HA   . GLN A 1 475 ? 9.848   -14.548 -9.777  1.00 0.00 ? 475 GLN A HA   1  
ATOM 7428   H HB2  . GLN A 1 475 ? 12.226  -16.293 -9.230  1.00 0.00 ? 475 GLN A HB2  1  
ATOM 7429   H HB3  . GLN A 1 475 ? 10.844  -16.698 -10.239 1.00 0.00 ? 475 GLN A HB3  1  
ATOM 7430   H HG2  . GLN A 1 475 ? 12.786  -14.468 -10.688 1.00 0.00 ? 475 GLN A HG2  1  
ATOM 7431   H HG3  . GLN A 1 475 ? 12.735  -15.991 -11.558 1.00 0.00 ? 475 GLN A HG3  1  
ATOM 7432   H HE21 . GLN A 1 475 ? 12.138  -12.881 -11.900 1.00 0.00 ? 475 GLN A HE21 1  
ATOM 7433   H HE22 . GLN A 1 475 ? 10.818  -12.866 -12.966 1.00 0.00 ? 475 GLN A HE22 1  
ATOM 7434   N N    . PRO A 1 476 ? 8.739   -15.380 -7.760  1.00 0.00 ? 476 PRO A N    1  
ATOM 7435   C CA   . PRO A 1 476 ? 8.119   -16.176 -6.696  1.00 0.00 ? 476 PRO A CA   1  
ATOM 7436   C C    . PRO A 1 476 ? 7.918   -17.590 -7.228  1.00 0.00 ? 476 PRO A C    1  
ATOM 7437   O O    . PRO A 1 476 ? 7.572   -18.487 -6.481  1.00 0.00 ? 476 PRO A O    1  
ATOM 7438   C CB   . PRO A 1 476 ? 6.773   -15.486 -6.494  1.00 0.00 ? 476 PRO A CB   1  
ATOM 7439   C CG   . PRO A 1 476 ? 6.909   -14.141 -7.203  1.00 0.00 ? 476 PRO A CG   1  
ATOM 7440   C CD   . PRO A 1 476 ? 7.790   -14.415 -8.358  1.00 0.00 ? 476 PRO A CD   1  
ATOM 7441   H HA   . PRO A 1 476 ? 8.704   -16.163 -5.791  1.00 0.00 ? 476 PRO A HA   1  
ATOM 7442   H HB2  . PRO A 1 476 ? 5.981   -16.073 -6.940  1.00 0.00 ? 476 PRO A HB2  1  
ATOM 7443   H HB3  . PRO A 1 476 ? 6.583   -15.331 -5.444  1.00 0.00 ? 476 PRO A HB3  1  
ATOM 7444   H HG2  . PRO A 1 476 ? 5.940   -13.793 -7.535  1.00 0.00 ? 476 PRO A HG2  1  
ATOM 7445   H HG3  . PRO A 1 476 ? 7.365   -13.415 -6.546  1.00 0.00 ? 476 PRO A HG3  1  
ATOM 7446   H HD2  . PRO A 1 476 ? 7.244   -14.857 -9.183  1.00 0.00 ? 476 PRO A HD2  1  
ATOM 7447   H HD3  . PRO A 1 476 ? 8.308   -13.520 -8.664  1.00 0.00 ? 476 PRO A HD3  1  
ATOM 7448   N N    . MET A 1 477 ? 8.129   -17.784 -8.524  1.00 0.00 ? 477 MET A N    1  
ATOM 7449   C CA   . MET A 1 477 ? 7.994   -19.088 -9.083  1.00 0.00 ? 477 MET A CA   1  
ATOM 7450   C C    . MET A 1 477 ? 9.329   -19.693 -9.317  1.00 0.00 ? 477 MET A C    1  
ATOM 7451   O O    . MET A 1 477 ? 9.666   -20.121 -10.426 1.00 0.00 ? 477 MET A O    1  
ATOM 7452   C CB   . MET A 1 477 ? 7.147   -19.056 -10.317 1.00 0.00 ? 477 MET A CB   1  
ATOM 7453   C CG   . MET A 1 477 ? 5.759   -18.648 -9.945  1.00 0.00 ? 477 MET A CG   1  
ATOM 7454   S SD   . MET A 1 477 ? 4.582   -18.495 -11.425 1.00 0.00 ? 477 MET A SD   1  
ATOM 7455   C CE   . MET A 1 477 ? 4.477   -20.391 -11.751 1.00 0.00 ? 477 MET A CE   1  
ATOM 7456   H H    . MET A 1 477 ? 8.402   -17.034 -9.093  1.00 0.00 ? 477 MET A H    1  
ATOM 7457   H HA   . MET A 1 477 ? 7.485   -19.702 -8.353  1.00 0.00 ? 477 MET A HA   1  
ATOM 7458   H HB2  . MET A 1 477 ? 7.559   -18.344 -11.019 1.00 0.00 ? 477 MET A HB2  1  
ATOM 7459   H HB3  . MET A 1 477 ? 7.125   -20.038 -10.766 1.00 0.00 ? 477 MET A HB3  1  
ATOM 7460   H HG2  . MET A 1 477 ? 5.356   -19.380 -9.261  1.00 0.00 ? 477 MET A HG2  1  
ATOM 7461   H HG3  . MET A 1 477 ? 5.805   -17.694 -9.440  1.00 0.00 ? 477 MET A HG3  1  
ATOM 7462   H HE1  . MET A 1 477 ? 4.318   -20.908 -10.814 1.00 0.00 ? 477 MET A HE1  1  
ATOM 7463   H HE2  . MET A 1 477 ? 5.397   -20.733 -12.194 1.00 0.00 ? 477 MET A HE2  1  
ATOM 7464   H HE3  . MET A 1 477 ? 3.657   -20.594 -12.428 1.00 0.00 ? 477 MET A HE3  1  
ATOM 7465   N N    . SER A 1 478 ? 10.072  -19.731 -8.224  1.00 0.00 ? 478 SER A N    1  
ATOM 7466   C CA   . SER A 1 478 ? 11.349  -20.361 -8.192  1.00 0.00 ? 478 SER A CA   1  
ATOM 7467   C C    . SER A 1 478 ? 11.192  -21.649 -7.473  1.00 0.00 ? 478 SER A C    1  
ATOM 7468   O O    . SER A 1 478 ? 10.339  -21.781 -6.599  1.00 0.00 ? 478 SER A O    1  
ATOM 7469   C CB   . SER A 1 478 ? 12.297  -19.533 -7.389  1.00 0.00 ? 478 SER A CB   1  
ATOM 7470   O OG   . SER A 1 478 ? 12.425  -18.313 -8.025  1.00 0.00 ? 478 SER A OG   1  
ATOM 7471   H H    . SER A 1 478 ? 9.702   -19.374 -7.390  1.00 0.00 ? 478 SER A H    1  
ATOM 7472   H HA   . SER A 1 478 ? 11.731  -20.516 -9.188  1.00 0.00 ? 478 SER A HA   1  
ATOM 7473   H HB2  . SER A 1 478 ? 11.906  -19.385 -6.396  1.00 0.00 ? 478 SER A HB2  1  
ATOM 7474   H HB3  . SER A 1 478 ? 13.257  -20.029 -7.332  1.00 0.00 ? 478 SER A HB3  1  
ATOM 7475   H HG   . SER A 1 478 ? 13.143  -17.834 -7.605  1.00 0.00 ? 478 SER A HG   1  
ATOM 7476   N N    . PRO A 1 479 ? 12.023  -22.618 -7.825  1.00 0.00 ? 479 PRO A N    1  
ATOM 7477   C CA   . PRO A 1 479 ? 12.099  -23.827 -7.025  1.00 0.00 ? 479 PRO A CA   1  
ATOM 7478   C C    . PRO A 1 479 ? 12.392  -23.488 -5.569  1.00 0.00 ? 479 PRO A C    1  
ATOM 7479   O O    . PRO A 1 479 ? 12.016  -24.259 -4.669  1.00 0.00 ? 479 PRO A O    1  
ATOM 7480   C CB   . PRO A 1 479 ? 13.285  -24.590 -7.625  1.00 0.00 ? 479 PRO A CB   1  
ATOM 7481   C CG   . PRO A 1 479 ? 13.503  -24.053 -8.958  1.00 0.00 ? 479 PRO A CG   1  
ATOM 7482   C CD   . PRO A 1 479 ? 12.892  -22.634 -9.009  1.00 0.00 ? 479 PRO A CD   1  
ATOM 7483   H HA   . PRO A 1 479 ? 11.199  -24.411 -7.116  1.00 0.00 ? 479 PRO A HA   1  
ATOM 7484   H HB2  . PRO A 1 479 ? 14.166  -24.440 -7.018  1.00 0.00 ? 479 PRO A HB2  1  
ATOM 7485   H HB3  . PRO A 1 479 ? 13.053  -25.643 -7.686  1.00 0.00 ? 479 PRO A HB3  1  
ATOM 7486   H HG2  . PRO A 1 479 ? 14.564  -24.018 -9.161  1.00 0.00 ? 479 PRO A HG2  1  
ATOM 7487   H HG3  . PRO A 1 479 ? 13.018  -24.687 -9.685  1.00 0.00 ? 479 PRO A HG3  1  
ATOM 7488   H HD2  . PRO A 1 479 ? 13.656  -21.870 -8.939  1.00 0.00 ? 479 PRO A HD2  1  
ATOM 7489   H HD3  . PRO A 1 479 ? 12.306  -22.511 -9.905  1.00 0.00 ? 479 PRO A HD3  1  
ATOM 7490   N N    . SER A 1 480 ? 13.057  -22.357 -5.320  1.00 0.00 ? 480 SER A N    1  
ATOM 7491   C CA   . SER A 1 480 ? 13.336  -21.956 -3.943  1.00 0.00 ? 480 SER A CA   1  
ATOM 7492   C C    . SER A 1 480 ? 12.121  -21.413 -3.163  1.00 0.00 ? 480 SER A C    1  
ATOM 7493   O O    . SER A 1 480 ? 11.941  -21.678 -1.971  1.00 0.00 ? 480 SER A O    1  
ATOM 7494   C CB   . SER A 1 480 ? 14.479  -20.956 -3.905  1.00 0.00 ? 480 SER A CB   1  
ATOM 7495   O OG   . SER A 1 480 ? 14.182  -19.797 -4.657  1.00 0.00 ? 480 SER A OG   1  
ATOM 7496   H H    . SER A 1 480 ? 13.337  -21.781 -6.062  1.00 0.00 ? 480 SER A H    1  
ATOM 7497   H HA   . SER A 1 480 ? 13.673  -22.840 -3.422  1.00 0.00 ? 480 SER A HA   1  
ATOM 7498   H HB2  . SER A 1 480 ? 14.663  -20.666 -2.885  1.00 0.00 ? 480 SER A HB2  1  
ATOM 7499   H HB3  . SER A 1 480 ? 15.371  -21.429 -4.299  1.00 0.00 ? 480 SER A HB3  1  
ATOM 7500   H HG   . SER A 1 480 ? 14.952  -19.225 -4.639  1.00 0.00 ? 480 SER A HG   1  
ATOM 7501   N N    . VAL A 1 481 ? 11.286  -20.619 -3.805  1.00 0.00 ? 481 VAL A N    1  
ATOM 7502   C CA   . VAL A 1 481 ? 10.168  -20.081 -3.080  1.00 0.00 ? 481 VAL A CA   1  
ATOM 7503   C C    . VAL A 1 481 ? 9.088   -21.164 -2.951  1.00 0.00 ? 481 VAL A C    1  
ATOM 7504   O O    . VAL A 1 481 ? 8.452   -21.311 -1.892  1.00 0.00 ? 481 VAL A O    1  
ATOM 7505   C CB   . VAL A 1 481 ? 9.688   -18.755 -3.713  1.00 0.00 ? 481 VAL A CB   1  
ATOM 7506   C CG1  . VAL A 1 481 ? 8.435   -18.274 -3.064  1.00 0.00 ? 481 VAL A CG1  1  
ATOM 7507   C CG2  . VAL A 1 481 ? 10.757  -17.694 -3.549  1.00 0.00 ? 481 VAL A CG2  1  
ATOM 7508   H H    . VAL A 1 481 ? 11.436  -20.385 -4.745  1.00 0.00 ? 481 VAL A H    1  
ATOM 7509   H HA   . VAL A 1 481 ? 10.515  -19.859 -2.078  1.00 0.00 ? 481 VAL A HA   1  
ATOM 7510   H HB   . VAL A 1 481 ? 9.504   -18.912 -4.765  1.00 0.00 ? 481 VAL A HB   1  
ATOM 7511   H HG11 . VAL A 1 481 ? 8.373   -18.672 -2.062  1.00 0.00 ? 481 VAL A HG11 1  
ATOM 7512   H HG12 . VAL A 1 481 ? 7.583   -18.607 -3.638  1.00 0.00 ? 481 VAL A HG12 1  
ATOM 7513   H HG13 . VAL A 1 481 ? 8.443   -17.195 -3.022  1.00 0.00 ? 481 VAL A HG13 1  
ATOM 7514   H HG21 . VAL A 1 481 ? 10.524  -16.848 -4.178  1.00 0.00 ? 481 VAL A HG21 1  
ATOM 7515   H HG22 . VAL A 1 481 ? 11.715  -18.102 -3.834  1.00 0.00 ? 481 VAL A HG22 1  
ATOM 7516   H HG23 . VAL A 1 481 ? 10.793  -17.377 -2.517  1.00 0.00 ? 481 VAL A HG23 1  
ATOM 7517   N N    . LEU A 1 482 ? 8.910   -21.951 -4.009  1.00 0.00 ? 482 LEU A N    1  
ATOM 7518   C CA   . LEU A 1 482 ? 7.874   -22.995 -3.992  1.00 0.00 ? 482 LEU A CA   1  
ATOM 7519   C C    . LEU A 1 482 ? 8.152   -23.992 -2.903  1.00 0.00 ? 482 LEU A C    1  
ATOM 7520   O O    . LEU A 1 482 ? 7.303   -24.264 -2.079  1.00 0.00 ? 482 LEU A O    1  
ATOM 7521   C CB   . LEU A 1 482 ? 7.730   -23.692 -5.348  1.00 0.00 ? 482 LEU A CB   1  
ATOM 7522   C CG   . LEU A 1 482 ? 7.085   -22.730 -6.360  1.00 0.00 ? 482 LEU A CG   1  
ATOM 7523   C CD1  . LEU A 1 482 ? 7.126   -23.272 -7.775  1.00 0.00 ? 482 LEU A CD1  1  
ATOM 7524   C CD2  . LEU A 1 482 ? 5.681   -22.301 -5.944  1.00 0.00 ? 482 LEU A CD2  1  
ATOM 7525   H H    . LEU A 1 482 ? 9.456   -21.819 -4.812  1.00 0.00 ? 482 LEU A H    1  
ATOM 7526   H HA   . LEU A 1 482 ? 6.932   -22.516 -3.763  1.00 0.00 ? 482 LEU A HA   1  
ATOM 7527   H HB2  . LEU A 1 482 ? 8.706   -23.989 -5.704  1.00 0.00 ? 482 LEU A HB2  1  
ATOM 7528   H HB3  . LEU A 1 482 ? 7.106   -24.566 -5.239  1.00 0.00 ? 482 LEU A HB3  1  
ATOM 7529   H HG   . LEU A 1 482 ? 7.701   -21.838 -6.361  1.00 0.00 ? 482 LEU A HG   1  
ATOM 7530   H HD11 . LEU A 1 482 ? 7.621   -24.233 -7.778  1.00 0.00 ? 482 LEU A HD11 1  
ATOM 7531   H HD12 . LEU A 1 482 ? 7.669   -22.585 -8.409  1.00 0.00 ? 482 LEU A HD12 1  
ATOM 7532   H HD13 . LEU A 1 482 ? 6.119   -23.386 -8.147  1.00 0.00 ? 482 LEU A HD13 1  
ATOM 7533   H HD21 . LEU A 1 482 ? 5.250   -23.054 -5.302  1.00 0.00 ? 482 LEU A HD21 1  
ATOM 7534   H HD22 . LEU A 1 482 ? 5.065   -22.183 -6.825  1.00 0.00 ? 482 LEU A HD22 1  
ATOM 7535   H HD23 . LEU A 1 482 ? 5.734   -21.362 -5.413  1.00 0.00 ? 482 LEU A HD23 1  
ATOM 7536   N N    . ASN A 1 483 ? 9.372   -24.491 -2.860  1.00 0.00 ? 483 ASN A N    1  
ATOM 7537   C CA   . ASN A 1 483 ? 9.743   -25.370 -1.774  1.00 0.00 ? 483 ASN A CA   1  
ATOM 7538   C C    . ASN A 1 483 ? 9.424   -24.845 -0.370  1.00 0.00 ? 483 ASN A C    1  
ATOM 7539   O O    . ASN A 1 483 ? 8.807   -25.571 0.430   1.00 0.00 ? 483 ASN A O    1  
ATOM 7540   C CB   . ASN A 1 483 ? 11.162  -25.831 -1.941  1.00 0.00 ? 483 ASN A CB   1  
ATOM 7541   C CG   . ASN A 1 483 ? 11.218  -26.977 -2.847  1.00 0.00 ? 483 ASN A CG   1  
ATOM 7542   O OD1  . ASN A 1 483 ? 10.947  -28.129 -2.456  1.00 0.00 ? 483 ASN A OD1  1  
ATOM 7543   N ND2  . ASN A 1 483 ? 11.462  -26.688 -4.122  1.00 0.00 ? 483 ASN A ND2  1  
ATOM 7544   H H    . ASN A 1 483 ? 10.043  -24.209 -3.516  1.00 0.00 ? 483 ASN A H    1  
ATOM 7545   H HA   . ASN A 1 483 ? 9.129   -26.252 -1.895  1.00 0.00 ? 483 ASN A HA   1  
ATOM 7546   H HB2  . ASN A 1 483 ? 11.755  -25.025 -2.348  1.00 0.00 ? 483 ASN A HB2  1  
ATOM 7547   H HB3  . ASN A 1 483 ? 11.561  -26.116 -0.978  1.00 0.00 ? 483 ASN A HB3  1  
ATOM 7548   H HD21 . ASN A 1 483 ? 11.591  -25.756 -4.397  1.00 0.00 ? 483 ASN A HD21 1  
ATOM 7549   H HD22 . ASN A 1 483 ? 11.514  -27.407 -4.786  1.00 0.00 ? 483 ASN A HD22 1  
ATOM 7550   N N    . LEU A 1 484 ? 9.791   -23.592 -0.112  1.00 0.00 ? 484 LEU A N    1  
ATOM 7551   C CA   . LEU A 1 484 ? 9.469   -22.930 1.128   1.00 0.00 ? 484 LEU A CA   1  
ATOM 7552   C C    . LEU A 1 484 ? 7.994   -22.789 1.338   1.00 0.00 ? 484 LEU A C    1  
ATOM 7553   O O    . LEU A 1 484 ? 7.555   -22.963 2.460   1.00 0.00 ? 484 LEU A O    1  
ATOM 7554   C CB   . LEU A 1 484 ? 10.121  -21.551 1.229   1.00 0.00 ? 484 LEU A CB   1  
ATOM 7555   C CG   . LEU A 1 484 ? 11.646  -21.423 1.384   1.00 0.00 ? 484 LEU A CG   1  
ATOM 7556   C CD1  . LEU A 1 484 ? 12.049  -19.956 1.245   1.00 0.00 ? 484 LEU A CD1  1  
ATOM 7557   C CD2  . LEU A 1 484 ? 12.095  -21.979 2.731   1.00 0.00 ? 484 LEU A CD2  1  
ATOM 7558   H H    . LEU A 1 484 ? 10.239  -23.079 -0.817  1.00 0.00 ? 484 LEU A H    1  
ATOM 7559   H HA   . LEU A 1 484 ? 9.859   -23.534 1.933   1.00 0.00 ? 484 LEU A HA   1  
ATOM 7560   H HB2  . LEU A 1 484 ? 9.854   -21.006 0.340   1.00 0.00 ? 484 LEU A HB2  1  
ATOM 7561   H HB3  . LEU A 1 484 ? 9.659   -21.043 2.067   1.00 0.00 ? 484 LEU A HB3  1  
ATOM 7562   H HG   . LEU A 1 484 ? 12.121  -21.988 0.593   1.00 0.00 ? 484 LEU A HG   1  
ATOM 7563   H HD11 . LEU A 1 484 ? 11.451  -19.353 1.913   1.00 0.00 ? 484 LEU A HD11 1  
ATOM 7564   H HD12 . LEU A 1 484 ? 11.887  -19.633 0.227   1.00 0.00 ? 484 LEU A HD12 1  
ATOM 7565   H HD13 . LEU A 1 484 ? 13.094  -19.844 1.497   1.00 0.00 ? 484 LEU A HD13 1  
ATOM 7566   H HD21 . LEU A 1 484 ? 12.673  -21.230 3.254   1.00 0.00 ? 484 LEU A HD21 1  
ATOM 7567   H HD22 . LEU A 1 484 ? 12.703  -22.858 2.573   1.00 0.00 ? 484 LEU A HD22 1  
ATOM 7568   H HD23 . LEU A 1 484 ? 11.228  -22.241 3.319   1.00 0.00 ? 484 LEU A HD23 1  
ATOM 7569   N N    . ILE A 1 485 ? 7.225   -22.502 0.284   1.00 0.00 ? 485 ILE A N    1  
ATOM 7570   C CA   . ILE A 1 485 ? 5.740   -22.555 0.363   1.00 0.00 ? 485 ILE A CA   1  
ATOM 7571   C C    . ILE A 1 485 ? 5.209   -23.932 0.820   1.00 0.00 ? 485 ILE A C    1  
ATOM 7572   O O    . ILE A 1 485 ? 4.389   -24.026 1.760   1.00 0.00 ? 485 ILE A O    1  
ATOM 7573   C CB   . ILE A 1 485 ? 5.086   -22.159 -0.967  1.00 0.00 ? 485 ILE A CB   1  
ATOM 7574   C CG1  . ILE A 1 485 ? 5.379   -20.692 -1.278  1.00 0.00 ? 485 ILE A CG1  1  
ATOM 7575   C CG2  . ILE A 1 485 ? 3.559   -22.431 -0.972  1.00 0.00 ? 485 ILE A CG2  1  
ATOM 7576   C CD1  . ILE A 1 485 ? 5.056   -20.362 -2.659  1.00 0.00 ? 485 ILE A CD1  1  
ATOM 7577   H H    . ILE A 1 485 ? 7.648   -22.390 -0.593  1.00 0.00 ? 485 ILE A H    1  
ATOM 7578   H HA   . ILE A 1 485 ? 5.433   -21.831 1.105   1.00 0.00 ? 485 ILE A HA   1  
ATOM 7579   H HB   . ILE A 1 485 ? 5.530   -22.764 -1.745  1.00 0.00 ? 485 ILE A HB   1  
ATOM 7580   H HG12 . ILE A 1 485 ? 4.791   -20.068 -0.623  1.00 0.00 ? 485 ILE A HG12 1  
ATOM 7581   H HG13 . ILE A 1 485 ? 6.427   -20.498 -1.101  1.00 0.00 ? 485 ILE A HG13 1  
ATOM 7582   H HG21 . ILE A 1 485 ? 3.104   -21.946 -0.120  1.00 0.00 ? 485 ILE A HG21 1  
ATOM 7583   H HG22 . ILE A 1 485 ? 3.382   -23.494 -0.918  1.00 0.00 ? 485 ILE A HG22 1  
ATOM 7584   H HG23 . ILE A 1 485 ? 3.127   -22.039 -1.881  1.00 0.00 ? 485 ILE A HG23 1  
ATOM 7585   H HD11 . ILE A 1 485 ? 4.518   -19.427 -2.689  1.00 0.00 ? 485 ILE A HD11 1  
ATOM 7586   H HD12 . ILE A 1 485 ? 4.444   -21.147 -3.083  1.00 0.00 ? 485 ILE A HD12 1  
ATOM 7587   H HD13 . ILE A 1 485 ? 5.967   -20.268 -3.230  1.00 0.00 ? 485 ILE A HD13 1  
ATOM 7588   N N    . LYS A 1 486 ? 5.700   -24.984 0.181   1.00 0.00 ? 486 LYS A N    1  
ATOM 7589   C CA   . LYS A 1 486 ? 5.276   -26.326 0.495   1.00 0.00 ? 486 LYS A CA   1  
ATOM 7590   C C    . LYS A 1 486 ? 5.552   -26.627 1.940   1.00 0.00 ? 486 LYS A C    1  
ATOM 7591   O O    . LYS A 1 486 ? 4.809   -27.347 2.611   1.00 0.00 ? 486 LYS A O    1  
ATOM 7592   C CB   . LYS A 1 486 ? 6.030   -27.383 -0.353  1.00 0.00 ? 486 LYS A CB   1  
ATOM 7593   C CG   . LYS A 1 486 ? 5.336   -28.782 -0.285  1.00 0.00 ? 486 LYS A CG   1  
ATOM 7594   C CD   . LYS A 1 486 ? 6.381   -29.927 -0.037  1.00 0.00 ? 486 LYS A CD   1  
ATOM 7595   C CE   . LYS A 1 486 ? 5.798   -31.370 -0.314  1.00 0.00 ? 486 LYS A CE   1  
ATOM 7596   N NZ   . LYS A 1 486 ? 4.640   -31.740 0.615   1.00 0.00 ? 486 LYS A NZ   1  
ATOM 7597   H H    . LYS A 1 486 ? 6.358   -24.846 -0.532  1.00 0.00 ? 486 LYS A H    1  
ATOM 7598   H HA   . LYS A 1 486 ? 4.218   -26.418 0.308   1.00 0.00 ? 486 LYS A HA   1  
ATOM 7599   H HB2  . LYS A 1 486 ? 6.059   -27.054 -1.381  1.00 0.00 ? 486 LYS A HB2  1  
ATOM 7600   H HB3  . LYS A 1 486 ? 7.041   -27.474 0.016   1.00 0.00 ? 486 LYS A HB3  1  
ATOM 7601   H HG2  . LYS A 1 486 ? 4.615   -28.780 0.520   1.00 0.00 ? 486 LYS A HG2  1  
ATOM 7602   H HG3  . LYS A 1 486 ? 4.823   -28.968 -1.218  1.00 0.00 ? 486 LYS A HG3  1  
ATOM 7603   H HD2  . LYS A 1 486 ? 7.231   -29.768 -0.683  1.00 0.00 ? 486 LYS A HD2  1  
ATOM 7604   H HD3  . LYS A 1 486 ? 6.712   -29.876 0.990   1.00 0.00 ? 486 LYS A HD3  1  
ATOM 7605   H HE2  . LYS A 1 486 ? 5.448   -31.412 -1.334  1.00 0.00 ? 486 LYS A HE2  1  
ATOM 7606   H HE3  . LYS A 1 486 ? 6.593   -32.093 -0.192  1.00 0.00 ? 486 LYS A HE3  1  
ATOM 7607   H HZ1  . LYS A 1 486 ? 3.835   -32.075 0.049   1.00 0.00 ? 486 LYS A HZ1  1  
ATOM 7608   H HZ2  . LYS A 1 486 ? 4.355   -30.904 1.163   1.00 0.00 ? 486 LYS A HZ2  1  
ATOM 7609   H HZ3  . LYS A 1 486 ? 4.944   -32.493 1.264   1.00 0.00 ? 486 LYS A HZ3  1  
ATOM 7610   N N    . GLN A 1 487 ? 6.670   -26.115 2.392   1.00 0.00 ? 487 GLN A N    1  
ATOM 7611   C CA   . GLN A 1 487 ? 7.199   -26.551 3.644   1.00 0.00 ? 487 GLN A CA   1  
ATOM 7612   C C    . GLN A 1 487 ? 6.278   -25.930 4.707   1.00 0.00 ? 487 GLN A C    1  
ATOM 7613   O O    . GLN A 1 487 ? 5.972   -26.550 5.728   1.00 0.00 ? 487 GLN A O    1  
ATOM 7614   C CB   . GLN A 1 487 ? 8.671   -26.118 3.723   1.00 0.00 ? 487 GLN A CB   1  
ATOM 7615   C CG   . GLN A 1 487 ? 9.429   -26.589 4.927   1.00 0.00 ? 487 GLN A CG   1  
ATOM 7616   C CD   . GLN A 1 487 ? 10.862  -26.091 4.914   1.00 0.00 ? 487 GLN A CD   1  
ATOM 7617   O OE1  . GLN A 1 487 ? 11.118  -24.885 4.869   1.00 0.00 ? 487 GLN A OE1  1  
ATOM 7618   N NE2  . GLN A 1 487 ? 11.799  -27.011 4.941   1.00 0.00 ? 487 GLN A NE2  1  
ATOM 7619   H H    . GLN A 1 487 ? 7.235   -25.588 1.790   1.00 0.00 ? 487 GLN A H    1  
ATOM 7620   H HA   . GLN A 1 487 ? 7.133   -27.630 3.702   1.00 0.00 ? 487 GLN A HA   1  
ATOM 7621   H HB2  . GLN A 1 487 ? 9.179   -26.488 2.847   1.00 0.00 ? 487 GLN A HB2  1  
ATOM 7622   H HB3  . GLN A 1 487 ? 8.703   -25.037 3.697   1.00 0.00 ? 487 GLN A HB3  1  
ATOM 7623   H HG2  . GLN A 1 487 ? 8.938   -26.225 5.816   1.00 0.00 ? 487 GLN A HG2  1  
ATOM 7624   H HG3  . GLN A 1 487 ? 9.431   -27.669 4.942   1.00 0.00 ? 487 GLN A HG3  1  
ATOM 7625   H HE21 . GLN A 1 487 ? 11.554  -27.959 4.968   1.00 0.00 ? 487 GLN A HE21 1  
ATOM 7626   H HE22 . GLN A 1 487 ? 12.743  -26.748 4.934   1.00 0.00 ? 487 GLN A HE22 1  
ATOM 7627   N N    . VAL A 1 488 ? 5.783   -24.729 4.402   1.00 0.00 ? 488 VAL A N    1  
ATOM 7628   C CA   . VAL A 1 488 ? 4.898   -23.983 5.301   1.00 0.00 ? 488 VAL A CA   1  
ATOM 7629   C C    . VAL A 1 488 ? 3.516   -24.626 5.360   1.00 0.00 ? 488 VAL A C    1  
ATOM 7630   O O    . VAL A 1 488 ? 2.964   -24.828 6.467   1.00 0.00 ? 488 VAL A O    1  
ATOM 7631   C CB   . VAL A 1 488 ? 4.776   -22.491 4.882   1.00 0.00 ? 488 VAL A CB   1  
ATOM 7632   C CG1  . VAL A 1 488 ? 3.688   -21.774 5.672   1.00 0.00 ? 488 VAL A CG1  1  
ATOM 7633   C CG2  . VAL A 1 488 ? 6.069   -21.811 5.043   1.00 0.00 ? 488 VAL A CG2  1  
ATOM 7634   H H    . VAL A 1 488 ? 6.028   -24.325 3.543   1.00 0.00 ? 488 VAL A H    1  
ATOM 7635   H HA   . VAL A 1 488 ? 5.325   -24.019 6.293   1.00 0.00 ? 488 VAL A HA   1  
ATOM 7636   H HB   . VAL A 1 488 ? 4.500   -22.462 3.835   1.00 0.00 ? 488 VAL A HB   1  
ATOM 7637   H HG11 . VAL A 1 488 ? 3.771   -22.036 6.718   1.00 0.00 ? 488 VAL A HG11 1  
ATOM 7638   H HG12 . VAL A 1 488 ? 2.718   -22.072 5.302   1.00 0.00 ? 488 VAL A HG12 1  
ATOM 7639   H HG13 . VAL A 1 488 ? 3.805   -20.706 5.558   1.00 0.00 ? 488 VAL A HG13 1  
ATOM 7640   H HG21 . VAL A 1 488 ? 6.170   -21.046 4.288   1.00 0.00 ? 488 VAL A HG21 1  
ATOM 7641   H HG22 . VAL A 1 488 ? 6.869   -22.530 4.939   1.00 0.00 ? 488 VAL A HG22 1  
ATOM 7642   H HG23 . VAL A 1 488 ? 6.118   -21.356 6.020   1.00 0.00 ? 488 VAL A HG23 1  
ATOM 7643   N N    . ILE A 1 489 ? 2.961   -24.909 4.169   1.00 0.00 ? 489 ILE A N    1  
ATOM 7644   C CA   . ILE A 1 489 ? 1.657   -25.532 4.074   1.00 0.00 ? 489 ILE A CA   1  
ATOM 7645   C C    . ILE A 1 489 ? 1.687   -26.811 4.920   1.00 0.00 ? 489 ILE A C    1  
ATOM 7646   O O    . ILE A 1 489 ? 0.843   -26.993 5.830   1.00 0.00 ? 489 ILE A O    1  
ATOM 7647   C CB   . ILE A 1 489 ? 1.310   -25.871 2.657   1.00 0.00 ? 489 ILE A CB   1  
ATOM 7648   C CG1  . ILE A 1 489 ? 1.193   -24.600 1.813   1.00 0.00 ? 489 ILE A CG1  1  
ATOM 7649   C CG2  . ILE A 1 489 ? 0.015   -26.679 2.600   1.00 0.00 ? 489 ILE A CG2  1  
ATOM 7650   C CD1  . ILE A 1 489 ? 1.101   -24.858 0.301   1.00 0.00 ? 489 ILE A CD1  1  
ATOM 7651   H H    . ILE A 1 489 ? 3.452   -24.697 3.348   1.00 0.00 ? 489 ILE A H    1  
ATOM 7652   H HA   . ILE A 1 489 ? 0.912   -24.858 4.476   1.00 0.00 ? 489 ILE A HA   1  
ATOM 7653   H HB   . ILE A 1 489 ? 2.106   -26.480 2.251   1.00 0.00 ? 489 ILE A HB   1  
ATOM 7654   H HG12 . ILE A 1 489 ? 0.309   -24.064 2.121   1.00 0.00 ? 489 ILE A HG12 1  
ATOM 7655   H HG13 . ILE A 1 489 ? 2.056   -23.979 2.007   1.00 0.00 ? 489 ILE A HG13 1  
ATOM 7656   H HG21 . ILE A 1 489 ? -0.761  -26.153 3.137   1.00 0.00 ? 489 ILE A HG21 1  
ATOM 7657   H HG22 . ILE A 1 489 ? 0.175   -27.647 3.052   1.00 0.00 ? 489 ILE A HG22 1  
ATOM 7658   H HG23 . ILE A 1 489 ? -0.284  -26.807 1.570   1.00 0.00 ? 489 ILE A HG23 1  
ATOM 7659   H HD11 . ILE A 1 489 ? 1.040   -23.914 -0.222  1.00 0.00 ? 489 ILE A HD11 1  
ATOM 7660   H HD12 . ILE A 1 489 ? 0.220   -25.445 0.089   1.00 0.00 ? 489 ILE A HD12 1  
ATOM 7661   H HD13 . ILE A 1 489 ? 1.980   -25.395 -0.026  1.00 0.00 ? 489 ILE A HD13 1  
ATOM 7662   N N    . ASP A 1 490 ? 2.698   -27.642 4.663   1.00 0.00 ? 490 ASP A N    1  
ATOM 7663   C CA   . ASP A 1 490 ? 2.855   -28.889 5.358   1.00 0.00 ? 490 ASP A CA   1  
ATOM 7664   C C    . ASP A 1 490 ? 2.928   -28.671 6.858   1.00 0.00 ? 490 ASP A C    1  
ATOM 7665   O O    . ASP A 1 490 ? 2.212   -29.346 7.622   1.00 0.00 ? 490 ASP A O    1  
ATOM 7666   C CB   . ASP A 1 490 ? 4.056   -29.684 4.834   1.00 0.00 ? 490 ASP A CB   1  
ATOM 7667   C CG   . ASP A 1 490 ? 3.815   -30.255 3.452   1.00 0.00 ? 490 ASP A CG   1  
ATOM 7668   O OD1  . ASP A 1 490 ? 2.646   -30.257 3.001   1.00 0.00 ? 490 ASP A OD1  1  
ATOM 7669   O OD2  . ASP A 1 490 ? 4.800   -30.696 2.797   1.00 0.00 ? 490 ASP A OD2  1  
ATOM 7670   H H    . ASP A 1 490 ? 3.347   -27.400 3.970   1.00 0.00 ? 490 ASP A H    1  
ATOM 7671   H HA   . ASP A 1 490 ? 1.968   -29.476 5.164   1.00 0.00 ? 490 ASP A HA   1  
ATOM 7672   H HB2  . ASP A 1 490 ? 4.916   -29.033 4.795   1.00 0.00 ? 490 ASP A HB2  1  
ATOM 7673   H HB3  . ASP A 1 490 ? 4.263   -30.495 5.518   1.00 0.00 ? 490 ASP A HB3  1  
ATOM 7674   N N    . ALA A 1 491 ? 3.753   -27.727 7.295   1.00 0.00 ? 491 ALA A N    1  
ATOM 7675   C CA   . ALA A 1 491 ? 3.757   -27.381 8.721   1.00 0.00 ? 491 ALA A CA   1  
ATOM 7676   C C    . ALA A 1 491 ? 2.353   -27.207 9.230   1.00 0.00 ? 491 ALA A C    1  
ATOM 7677   O O    . ALA A 1 491 ? 1.993   -27.918 10.137  1.00 0.00 ? 491 ALA A O    1  
ATOM 7678   C CB   . ALA A 1 491 ? 4.587   -26.152 9.025   1.00 0.00 ? 491 ALA A CB   1  
ATOM 7679   H H    . ALA A 1 491 ? 4.284   -27.203 6.659   1.00 0.00 ? 491 ALA A H    1  
ATOM 7680   H HA   . ALA A 1 491 ? 4.194   -28.215 9.254   1.00 0.00 ? 491 ALA A HA   1  
ATOM 7681   H HB1  . ALA A 1 491 ? 5.635   -26.386 8.905   1.00 0.00 ? 491 ALA A HB1  1  
ATOM 7682   H HB2  . ALA A 1 491 ? 4.403   -25.836 10.041  1.00 0.00 ? 491 ALA A HB2  1  
ATOM 7683   H HB3  . ALA A 1 491 ? 4.316   -25.357 8.346   1.00 0.00 ? 491 ALA A HB3  1  
ATOM 7684   N N    . SER A 1 492 ? 1.563   -26.302 8.631   1.00 0.00 ? 492 SER A N    1  
ATOM 7685   C CA   . SER A 1 492 ? 0.141   -26.108 8.964   1.00 0.00 ? 492 SER A CA   1  
ATOM 7686   C C    . SER A 1 492 ? -0.557  -27.406 9.191   1.00 0.00 ? 492 SER A C    1  
ATOM 7687   O O    . SER A 1 492 ? -1.142  -27.633 10.264  1.00 0.00 ? 492 SER A O    1  
ATOM 7688   C CB   . SER A 1 492 ? -0.607  -25.506 7.784   1.00 0.00 ? 492 SER A CB   1  
ATOM 7689   O OG   . SER A 1 492 ? -1.390  -24.439 8.245   1.00 0.00 ? 492 SER A OG   1  
ATOM 7690   H H    . SER A 1 492 ? 1.935   -25.788 7.884   1.00 0.00 ? 492 SER A H    1  
ATOM 7691   H HA   . SER A 1 492 ? 0.037   -25.466 9.823   1.00 0.00 ? 492 SER A HA   1  
ATOM 7692   H HB2  . SER A 1 492 ? 0.097   -25.142 7.054   1.00 0.00 ? 492 SER A HB2  1  
ATOM 7693   H HB3  . SER A 1 492 ? -1.236  -26.261 7.332   1.00 0.00 ? 492 SER A HB3  1  
ATOM 7694   H HG   . SER A 1 492 ? -1.576  -24.587 9.175   1.00 0.00 ? 492 SER A HG   1  
ATOM 7695   N N    . HIS A 1 493 ? -0.487  -28.256 8.157   1.00 0.00 ? 493 HIS A N    1  
ATOM 7696   C CA   . HIS A 1 493 ? -1.340  -29.407 8.110   1.00 0.00 ? 493 HIS A CA   1  
ATOM 7697   C C    . HIS A 1 493 ? -0.879  -30.381 9.146   1.00 0.00 ? 493 HIS A C    1  
ATOM 7698   O O    . HIS A 1 493 ? -1.690  -31.091 9.727   1.00 0.00 ? 493 HIS A O    1  
ATOM 7699   C CB   . HIS A 1 493 ? -1.383  -30.049 6.735   1.00 0.00 ? 493 HIS A CB   1  
ATOM 7700   C CG   . HIS A 1 493 ? -1.722  -29.098 5.634   1.00 0.00 ? 493 HIS A CG   1  
ATOM 7701   N ND1  . HIS A 1 493 ? -2.232  -27.840 5.864   1.00 0.00 ? 493 HIS A ND1  1  
ATOM 7702   C CD2  . HIS A 1 493 ? -1.632  -29.224 4.289   1.00 0.00 ? 493 HIS A CD2  1  
ATOM 7703   C CE1  . HIS A 1 493 ? -2.440  -27.231 4.713   1.00 0.00 ? 493 HIS A CE1  1  
ATOM 7704   N NE2  . HIS A 1 493 ? -2.088  -28.048 3.741   1.00 0.00 ? 493 HIS A NE2  1  
ATOM 7705   H H    . HIS A 1 493 ? -0.001  -27.988 7.349   1.00 0.00 ? 493 HIS A H    1  
ATOM 7706   H HA   . HIS A 1 493 ? -2.342  -29.092 8.369   1.00 0.00 ? 493 HIS A HA   1  
ATOM 7707   H HB2  . HIS A 1 493 ? -0.417  -30.481 6.526   1.00 0.00 ? 493 HIS A HB2  1  
ATOM 7708   H HB3  . HIS A 1 493 ? -2.118  -30.843 6.750   1.00 0.00 ? 493 HIS A HB3  1  
ATOM 7709   H HD1  . HIS A 1 493 ? -2.412  -27.456 6.748   1.00 0.00 ? 493 HIS A HD1  1  
ATOM 7710   H HD2  . HIS A 1 493 ? -1.270  -30.086 3.748   1.00 0.00 ? 493 HIS A HD2  1  
ATOM 7711   H HE1  . HIS A 1 493 ? -2.833  -26.232 4.588   1.00 0.00 ? 493 HIS A HE1  1  
ATOM 7712   H HE2  . HIS A 1 493 ? -2.141  -27.850 2.782   1.00 0.00 ? 493 HIS A HE2  1  
ATOM 7713   N N    . ALA A 1 494 ? 0.422   -30.394 9.408   1.00 0.00 ? 494 ALA A N    1  
ATOM 7714   C CA   . ALA A 1 494 ? 0.916   -31.330 10.389  1.00 0.00 ? 494 ALA A CA   1  
ATOM 7715   C C    . ALA A 1 494 ? 0.327   -30.998 11.751  1.00 0.00 ? 494 ALA A C    1  
ATOM 7716   O O    . ALA A 1 494 ? 0.057   -31.920 12.506  1.00 0.00 ? 494 ALA A O    1  
ATOM 7717   C CB   . ALA A 1 494 ? 2.445   -31.410 10.421  1.00 0.00 ? 494 ALA A CB   1  
ATOM 7718   H H    . ALA A 1 494 ? 1.034   -29.790 8.938   1.00 0.00 ? 494 ALA A H    1  
ATOM 7719   H HA   . ALA A 1 494 ? 0.543   -32.308 10.111  1.00 0.00 ? 494 ALA A HA   1  
ATOM 7720   H HB1  . ALA A 1 494 ? 2.829   -31.358 9.413   1.00 0.00 ? 494 ALA A HB1  1  
ATOM 7721   H HB2  . ALA A 1 494 ? 2.747   -32.343 10.874  1.00 0.00 ? 494 ALA A HB2  1  
ATOM 7722   H HB3  . ALA A 1 494 ? 2.837   -30.586 10.999  1.00 0.00 ? 494 ALA A HB3  1  
ATOM 7723   N N    . GLU A 1 495 ? 0.078   -29.716 12.055  1.00 0.00 ? 495 GLU A N    1  
ATOM 7724   C CA   . GLU A 1 495 ? -0.573  -29.363 13.332  1.00 0.00 ? 495 GLU A CA   1  
ATOM 7725   C C    . GLU A 1 495 ? -2.069  -29.353 13.246  1.00 0.00 ? 495 GLU A C    1  
ATOM 7726   O O    . GLU A 1 495 ? -2.724  -29.003 14.216  1.00 0.00 ? 495 GLU A O    1  
ATOM 7727   C CB   . GLU A 1 495 ? -0.183  -27.978 13.828  1.00 0.00 ? 495 GLU A CB   1  
ATOM 7728   C CG   . GLU A 1 495 ? 1.222   -27.829 14.240  1.00 0.00 ? 495 GLU A CG   1  
ATOM 7729   C CD   . GLU A 1 495 ? 1.590   -28.787 15.312  1.00 0.00 ? 495 GLU A CD   1  
ATOM 7730   O OE1  . GLU A 1 495 ? 0.831   -28.874 16.309  1.00 0.00 ? 495 GLU A OE1  1  
ATOM 7731   O OE2  . GLU A 1 495 ? 2.656   -29.433 15.135  1.00 0.00 ? 495 GLU A OE2  1  
ATOM 7732   H H    . GLU A 1 495 ? 0.277   -29.014 11.401  1.00 0.00 ? 495 GLU A H    1  
ATOM 7733   H HA   . GLU A 1 495 ? -0.276  -30.083 14.078  1.00 0.00 ? 495 GLU A HA   1  
ATOM 7734   H HB2  . GLU A 1 495 ? -0.375  -27.269 13.040  1.00 0.00 ? 495 GLU A HB2  1  
ATOM 7735   H HB3  . GLU A 1 495 ? -0.819  -27.730 14.668  1.00 0.00 ? 495 GLU A HB3  1  
ATOM 7736   H HG2  . GLU A 1 495 ? 1.859   -28.000 13.384  1.00 0.00 ? 495 GLU A HG2  1  
ATOM 7737   H HG3  . GLU A 1 495 ? 1.378   -26.822 14.598  1.00 0.00 ? 495 GLU A HG3  1  
ATOM 7738   N N    . GLY A 1 496 ? -2.615  -29.670 12.082  1.00 0.00 ? 496 GLY A N    1  
ATOM 7739   C CA   . GLY A 1 496 ? -4.060  -29.589 11.878  1.00 0.00 ? 496 GLY A CA   1  
ATOM 7740   C C    . GLY A 1 496 ? -4.576  -28.171 11.736  1.00 0.00 ? 496 GLY A C    1  
ATOM 7741   O O    . GLY A 1 496 ? -5.738  -27.927 11.949  1.00 0.00 ? 496 GLY A O    1  
ATOM 7742   H H    . GLY A 1 496 ? -2.035  -29.898 11.326  1.00 0.00 ? 496 GLY A H    1  
ATOM 7743   H HA2  . GLY A 1 496 ? -4.313  -30.138 10.983  1.00 0.00 ? 496 GLY A HA2  1  
ATOM 7744   H HA3  . GLY A 1 496 ? -4.553  -30.055 12.719  1.00 0.00 ? 496 GLY A HA3  1  
ATOM 7745   N N    . LYS A 1 497 ? -3.698  -27.235 11.404  1.00 0.00 ? 497 LYS A N    1  
ATOM 7746   C CA   . LYS A 1 497 ? -4.084  -25.877 11.009  1.00 0.00 ? 497 LYS A CA   1  
ATOM 7747   C C    . LYS A 1 497 ? -4.006  -25.770 9.514   1.00 0.00 ? 497 LYS A C    1  
ATOM 7748   O O    . LYS A 1 497 ? -3.708  -26.738 8.837   1.00 0.00 ? 497 LYS A O    1  
ATOM 7749   C CB   . LYS A 1 497 ? -3.122  -24.844 11.595  1.00 0.00 ? 497 LYS A CB   1  
ATOM 7750   C CG   . LYS A 1 497 ? -3.439  -24.461 13.007  1.00 0.00 ? 497 LYS A CG   1  
ATOM 7751   C CD   . LYS A 1 497 ? -3.194  -25.550 14.026  1.00 0.00 ? 497 LYS A CD   1  
ATOM 7752   C CE   . LYS A 1 497 ? -3.467  -25.023 15.396  1.00 0.00 ? 497 LYS A CE   1  
ATOM 7753   N NZ   . LYS A 1 497 ? -3.204  -26.125 16.306  1.00 0.00 ? 497 LYS A NZ   1  
ATOM 7754   H H    . LYS A 1 497 ? -2.765  -27.505 11.273  1.00 0.00 ? 497 LYS A H    1  
ATOM 7755   H HA   . LYS A 1 497 ? -5.089  -25.668 11.341  1.00 0.00 ? 497 LYS A HA   1  
ATOM 7756   H HB2  . LYS A 1 497 ? -2.123  -25.248 11.567  1.00 0.00 ? 497 LYS A HB2  1  
ATOM 7757   H HB3  . LYS A 1 497 ? -3.151  -23.957 10.977  1.00 0.00 ? 497 LYS A HB3  1  
ATOM 7758   H HG2  . LYS A 1 497 ? -2.835  -23.608 13.273  1.00 0.00 ? 497 LYS A HG2  1  
ATOM 7759   H HG3  . LYS A 1 497 ? -4.479  -24.171 13.055  1.00 0.00 ? 497 LYS A HG3  1  
ATOM 7760   H HD2  . LYS A 1 497 ? -3.848  -26.385 13.824  1.00 0.00 ? 497 LYS A HD2  1  
ATOM 7761   H HD3  . LYS A 1 497 ? -2.166  -25.875 13.965  1.00 0.00 ? 497 LYS A HD3  1  
ATOM 7762   H HE2  . LYS A 1 497 ? -2.810  -24.193 15.613  1.00 0.00 ? 497 LYS A HE2  1  
ATOM 7763   H HE3  . LYS A 1 497 ? -4.498  -24.715 15.479  1.00 0.00 ? 497 LYS A HE3  1  
ATOM 7764   H HZ1  . LYS A 1 497 ? -2.822  -25.755 17.198  1.00 0.00 ? 497 LYS A HZ1  1  
ATOM 7765   H HZ2  . LYS A 1 497 ? -2.513  -26.773 15.873  1.00 0.00 ? 497 LYS A HZ2  1  
ATOM 7766   H HZ3  . LYS A 1 497 ? -4.088  -26.637 16.496  1.00 0.00 ? 497 LYS A HZ3  1  
ATOM 7767   N N    . TRP A 1 498 ? -4.175  -24.563 9.024   1.00 0.00 ? 498 TRP A N    1  
ATOM 7768   C CA   . TRP A 1 498 ? -4.275  -24.307 7.611   1.00 0.00 ? 498 TRP A CA   1  
ATOM 7769   C C    . TRP A 1 498 ? -3.420  -23.117 7.195   1.00 0.00 ? 498 TRP A C    1  
ATOM 7770   O O    . TRP A 1 498 ? -3.104  -22.239 7.978   1.00 0.00 ? 498 TRP A O    1  
ATOM 7771   C CB   . TRP A 1 498 ? -5.734  -24.032 7.223   1.00 0.00 ? 498 TRP A CB   1  
ATOM 7772   C CG   . TRP A 1 498 ? -6.412  -23.006 8.111   1.00 0.00 ? 498 TRP A CG   1  
ATOM 7773   C CD1  . TRP A 1 498 ? -7.181  -23.265 9.204   1.00 0.00 ? 498 TRP A CD1  1  
ATOM 7774   C CD2  . TRP A 1 498 ? -6.353  -21.577 7.996   1.00 0.00 ? 498 TRP A CD2  1  
ATOM 7775   N NE1  . TRP A 1 498 ? -7.616  -22.092 9.774   1.00 0.00 ? 498 TRP A NE1  1  
ATOM 7776   C CE2  . TRP A 1 498 ? -7.129  -21.040 9.055   1.00 0.00 ? 498 TRP A CE2  1  
ATOM 7777   C CE3  . TRP A 1 498 ? -5.708  -20.694 7.115   1.00 0.00 ? 498 TRP A CE3  1  
ATOM 7778   C CZ2  . TRP A 1 498 ? -7.291  -19.680 9.253   1.00 0.00 ? 498 TRP A CZ2  1  
ATOM 7779   C CZ3  . TRP A 1 498 ? -5.867  -19.311 7.313   1.00 0.00 ? 498 TRP A CZ3  1  
ATOM 7780   C CH2  . TRP A 1 498 ? -6.650  -18.827 8.378   1.00 0.00 ? 498 TRP A CH2  1  
ATOM 7781   H H    . TRP A 1 498 ? -4.335  -23.823 9.646   1.00 0.00 ? 498 TRP A H    1  
ATOM 7782   H HA   . TRP A 1 498 ? -3.938  -25.181 7.075   1.00 0.00 ? 498 TRP A HA   1  
ATOM 7783   H HB2  . TRP A 1 498 ? -5.760  -23.674 6.206   1.00 0.00 ? 498 TRP A HB2  1  
ATOM 7784   H HB3  . TRP A 1 498 ? -6.286  -24.960 7.276   1.00 0.00 ? 498 TRP A HB3  1  
ATOM 7785   H HD1  . TRP A 1 498 ? -7.419  -24.252 9.571   1.00 0.00 ? 498 TRP A HD1  1  
ATOM 7786   H HE1  . TRP A 1 498 ? -8.187  -22.003 10.566  1.00 0.00 ? 498 TRP A HE1  1  
ATOM 7787   H HE3  . TRP A 1 498 ? -5.107  -21.068 6.299   1.00 0.00 ? 498 TRP A HE3  1  
ATOM 7788   H HZ2  . TRP A 1 498 ? -7.891  -19.300 10.067  1.00 0.00 ? 498 TRP A HZ2  1  
ATOM 7789   H HZ3  . TRP A 1 498 ? -5.379  -18.615 6.647   1.00 0.00 ? 498 TRP A HZ3  1  
ATOM 7790   H HH2  . TRP A 1 498 ? -6.758  -17.760 8.510   1.00 0.00 ? 498 TRP A HH2  1  
ATOM 7791   N N    . THR A 1 499 ? -3.052  -23.090 5.934   1.00 0.00 ? 499 THR A N    1  
ATOM 7792   C CA   . THR A 1 499 ? -2.276  -22.013 5.445   1.00 0.00 ? 499 THR A CA   1  
ATOM 7793   C C    . THR A 1 499 ? -3.094  -21.392 4.374   1.00 0.00 ? 499 THR A C    1  
ATOM 7794   O O    . THR A 1 499 ? -3.665  -22.096 3.531   1.00 0.00 ? 499 THR A O    1  
ATOM 7795   C CB   . THR A 1 499 ? -0.990  -22.523 4.843   1.00 0.00 ? 499 THR A CB   1  
ATOM 7796   O OG1  . THR A 1 499 ? -0.244  -23.160 5.869   1.00 0.00 ? 499 THR A OG1  1  
ATOM 7797   C CG2  . THR A 1 499 ? -0.163  -21.378 4.279   1.00 0.00 ? 499 THR A CG2  1  
ATOM 7798   H H    . THR A 1 499 ? -3.329  -23.808 5.328   1.00 0.00 ? 499 THR A H    1  
ATOM 7799   H HA   . THR A 1 499 ? -2.071  -21.302 6.230   1.00 0.00 ? 499 THR A HA   1  
ATOM 7800   H HB   . THR A 1 499 ? -1.210  -23.230 4.058   1.00 0.00 ? 499 THR A HB   1  
ATOM 7801   H HG1  . THR A 1 499 ? 0.629   -22.763 5.891   1.00 0.00 ? 499 THR A HG1  1  
ATOM 7802   H HG21 . THR A 1 499 ? -0.049  -20.611 5.031   1.00 0.00 ? 499 THR A HG21 1  
ATOM 7803   H HG22 . THR A 1 499 ? -0.662  -20.964 3.416   1.00 0.00 ? 499 THR A HG22 1  
ATOM 7804   H HG23 . THR A 1 499 ? 0.811   -21.745 3.989   1.00 0.00 ? 499 THR A HG23 1  
ATOM 7805   N N    . GLY A 1 500 ? -3.158  -20.068 4.427   1.00 0.00 ? 500 GLY A N    1  
ATOM 7806   C CA   . GLY A 1 500 ? -3.654  -19.292 3.304   1.00 0.00 ? 500 GLY A CA   1  
ATOM 7807   C C    . GLY A 1 500 ? -2.504  -18.562 2.672   1.00 0.00 ? 500 GLY A C    1  
ATOM 7808   O O    . GLY A 1 500 ? -1.387  -18.703 3.111   1.00 0.00 ? 500 GLY A O    1  
ATOM 7809   H H    . GLY A 1 500 ? -2.682  -19.602 5.146   1.00 0.00 ? 500 GLY A H    1  
ATOM 7810   H HA2  . GLY A 1 500 ? -4.108  -19.954 2.580   1.00 0.00 ? 500 GLY A HA2  1  
ATOM 7811   H HA3  . GLY A 1 500 ? -4.384  -18.577 3.651   1.00 0.00 ? 500 GLY A HA3  1  
ATOM 7812   N N    . MET A 1 501 ? -2.798  -17.786 1.639   1.00 0.00 ? 501 MET A N    1  
ATOM 7813   C CA   . MET A 1 501 ? -1.815  -17.014 0.907   1.00 0.00 ? 501 MET A CA   1  
ATOM 7814   C C    . MET A 1 501 ? -2.393  -15.669 0.464   1.00 0.00 ? 501 MET A C    1  
ATOM 7815   O O    . MET A 1 501 ? -3.367  -15.633 -0.291  1.00 0.00 ? 501 MET A O    1  
ATOM 7816   C CB   . MET A 1 501 ? -1.391  -17.767 -0.328  1.00 0.00 ? 501 MET A CB   1  
ATOM 7817   C CG   . MET A 1 501 ? -0.255  -17.076 -1.038  1.00 0.00 ? 501 MET A CG   1  
ATOM 7818   S SD   . MET A 1 501 ? 0.499   -17.998 -2.590  1.00 0.00 ? 501 MET A SD   1  
ATOM 7819   C CE   . MET A 1 501 ? 1.409   -19.439 -1.717  1.00 0.00 ? 501 MET A CE   1  
ATOM 7820   H H    . MET A 1 501 ? -3.734  -17.734 1.352   1.00 0.00 ? 501 MET A H    1  
ATOM 7821   H HA   . MET A 1 501 ? -0.952  -16.846 1.532   1.00 0.00 ? 501 MET A HA   1  
ATOM 7822   H HB2  . MET A 1 501 ? -1.076  -18.760 -0.045  1.00 0.00 ? 501 MET A HB2  1  
ATOM 7823   H HB3  . MET A 1 501 ? -2.233  -17.843 -1.000  1.00 0.00 ? 501 MET A HB3  1  
ATOM 7824   H HG2  . MET A 1 501 ? -0.606  -16.110 -1.367  1.00 0.00 ? 501 MET A HG2  1  
ATOM 7825   H HG3  . MET A 1 501 ? 0.538   -16.918 -0.320  1.00 0.00 ? 501 MET A HG3  1  
ATOM 7826   H HE1  . MET A 1 501 ? 2.233   -19.769 -2.334  1.00 0.00 ? 501 MET A HE1  1  
ATOM 7827   H HE2  . MET A 1 501 ? 0.727   -20.259 -1.566  1.00 0.00 ? 501 MET A HE2  1  
ATOM 7828   H HE3  . MET A 1 501 ? 1.779   -19.101 -0.757  1.00 0.00 ? 501 MET A HE3  1  
ATOM 7829   N N    . CYS A 1 502 ? -1.803  -14.567 0.924   1.00 0.00 ? 502 CYS A N    1  
ATOM 7830   C CA   . CYS A 1 502 ? -2.240  -13.261 0.470   1.00 0.00 ? 502 CYS A CA   1  
ATOM 7831   C C    . CYS A 1 502 ? -1.237  -12.571 -0.419  1.00 0.00 ? 502 CYS A C    1  
ATOM 7832   O O    . CYS A 1 502 ? -1.533  -11.546 -1.013  1.00 0.00 ? 502 CYS A O    1  
ATOM 7833   C CB   . CYS A 1 502 ? -2.594  -12.351 1.648   1.00 0.00 ? 502 CYS A CB   1  
ATOM 7834   S SG   . CYS A 1 502 ? -1.283  -12.178 2.789   1.00 0.00 ? 502 CYS A SG   1  
ATOM 7835   H H    . CYS A 1 502 ? -1.030  -14.641 1.522   1.00 0.00 ? 502 CYS A H    1  
ATOM 7836   H HA   . CYS A 1 502 ? -3.141  -13.404 -0.108  1.00 0.00 ? 502 CYS A HA   1  
ATOM 7837   H HB2  . CYS A 1 502 ? -2.850  -11.375 1.270   1.00 0.00 ? 502 CYS A HB2  1  
ATOM 7838   H HB3  . CYS A 1 502 ? -3.456  -12.762 2.157   1.00 0.00 ? 502 CYS A HB3  1  
ATOM 7839   H HG   . CYS A 1 502 ? -0.653  -11.552 2.425   1.00 0.00 ? 502 CYS A HG   1  
ATOM 7840   N N    . GLY A 1 503 ? -0.046  -13.127 -0.522  1.00 0.00 ? 503 GLY A N    1  
ATOM 7841   C CA   . GLY A 1 503 ? 0.895   -12.673 -1.539  1.00 0.00 ? 503 GLY A CA   1  
ATOM 7842   C C    . GLY A 1 503 ? 0.258   -12.779 -2.913  1.00 0.00 ? 503 GLY A C    1  
ATOM 7843   O O    . GLY A 1 503 ? -0.772  -13.512 -3.122  1.00 0.00 ? 503 GLY A O    1  
ATOM 7844   H H    . GLY A 1 503 ? 0.143   -13.951 -0.027  1.00 0.00 ? 503 GLY A H    1  
ATOM 7845   H HA2  . GLY A 1 503 ? 1.165   -11.644 -1.344  1.00 0.00 ? 503 GLY A HA2  1  
ATOM 7846   H HA3  . GLY A 1 503 ? 1.781   -13.289 -1.510  1.00 0.00 ? 503 GLY A HA3  1  
ATOM 7847   N N    . GLU A 1 504 ? 0.857   -12.040 -3.858  1.00 0.00 ? 504 GLU A N    1  
ATOM 7848   C CA   . GLU A 1 504 ? 0.298   -11.947 -5.205  1.00 0.00 ? 504 GLU A CA   1  
ATOM 7849   C C    . GLU A 1 504 ? 0.308   -13.261 -5.998  1.00 0.00 ? 504 GLU A C    1  
ATOM 7850   O O    . GLU A 1 504 ? -0.465  -13.415 -6.979  1.00 0.00 ? 504 GLU A O    1  
ATOM 7851   C CB   . GLU A 1 504 ? 0.924   -10.812 -5.965  1.00 0.00 ? 504 GLU A CB   1  
ATOM 7852   C CG   . GLU A 1 504 ? 0.628   -9.486  -5.298  1.00 0.00 ? 504 GLU A CG   1  
ATOM 7853   C CD   . GLU A 1 504 ? -0.821  -9.102  -5.387  1.00 0.00 ? 504 GLU A CD   1  
ATOM 7854   O OE1  . GLU A 1 504 ? -1.526  -9.685  -6.235  1.00 0.00 ? 504 GLU A OE1  1  
ATOM 7855   O OE2  . GLU A 1 504 ? -1.257  -8.228  -4.611  1.00 0.00 ? 504 GLU A OE2  1  
ATOM 7856   H H    . GLU A 1 504 ? 1.638   -11.497 -3.622  1.00 0.00 ? 504 GLU A H    1  
ATOM 7857   H HA   . GLU A 1 504 ? -0.744  -11.688 -5.076  1.00 0.00 ? 504 GLU A HA   1  
ATOM 7858   H HB2  . GLU A 1 504 ? 1.993   -10.959 -6.004  1.00 0.00 ? 504 GLU A HB2  1  
ATOM 7859   H HB3  . GLU A 1 504 ? 0.531   -10.799 -6.971  1.00 0.00 ? 504 GLU A HB3  1  
ATOM 7860   H HG2  . GLU A 1 504 ? 0.905   -9.551  -4.257  1.00 0.00 ? 504 GLU A HG2  1  
ATOM 7861   H HG3  . GLU A 1 504 ? 1.224   -8.719  -5.770  1.00 0.00 ? 504 GLU A HG3  1  
ATOM 7862   N N    . LEU A 1 505 ? 1.125   -14.218 -5.563  1.00 0.00 ? 505 LEU A N    1  
ATOM 7863   C CA   . LEU A 1 505 ? 1.069   -15.538 -6.165  1.00 0.00 ? 505 LEU A CA   1  
ATOM 7864   C C    . LEU A 1 505 ? -0.313  -16.186 -6.137  1.00 0.00 ? 505 LEU A C    1  
ATOM 7865   O O    . LEU A 1 505 ? -0.690  -16.880 -7.089  1.00 0.00 ? 505 LEU A O    1  
ATOM 7866   C CB   . LEU A 1 505 ? 2.026   -16.480 -5.467  1.00 0.00 ? 505 LEU A CB   1  
ATOM 7867   C CG   . LEU A 1 505 ? 3.449   -16.524 -5.999  1.00 0.00 ? 505 LEU A CG   1  
ATOM 7868   C CD1  . LEU A 1 505 ? 4.191   -17.494 -5.136  1.00 0.00 ? 505 LEU A CD1  1  
ATOM 7869   C CD2  . LEU A 1 505 ? 3.540   -16.873 -7.489  1.00 0.00 ? 505 LEU A CD2  1  
ATOM 7870   H H    . LEU A 1 505 ? 1.682   -14.064 -4.772  1.00 0.00 ? 505 LEU A H    1  
ATOM 7871   H HA   . LEU A 1 505 ? 1.381   -15.453 -7.194  1.00 0.00 ? 505 LEU A HA   1  
ATOM 7872   H HB2  . LEU A 1 505 ? 2.073   -16.198 -4.428  1.00 0.00 ? 505 LEU A HB2  1  
ATOM 7873   H HB3  . LEU A 1 505 ? 1.610   -17.477 -5.522  1.00 0.00 ? 505 LEU A HB3  1  
ATOM 7874   H HG   . LEU A 1 505 ? 3.888   -15.545 -5.845  1.00 0.00 ? 505 LEU A HG   1  
ATOM 7875   H HD11 . LEU A 1 505 ? 4.588   -18.290 -5.748  1.00 0.00 ? 505 LEU A HD11 1  
ATOM 7876   H HD12 . LEU A 1 505 ? 3.518   -17.907 -4.399  1.00 0.00 ? 505 LEU A HD12 1  
ATOM 7877   H HD13 . LEU A 1 505 ? 5.003   -16.985 -4.638  1.00 0.00 ? 505 LEU A HD13 1  
ATOM 7878   H HD21 . LEU A 1 505 ? 4.343   -17.580 -7.645  1.00 0.00 ? 505 LEU A HD21 1  
ATOM 7879   H HD22 . LEU A 1 505 ? 3.736   -15.976 -8.058  1.00 0.00 ? 505 LEU A HD22 1  
ATOM 7880   H HD23 . LEU A 1 505 ? 2.607   -17.310 -7.815  1.00 0.00 ? 505 LEU A HD23 1  
ATOM 7881   N N    . ALA A 1 506 ? -1.028  -16.008 -5.024  1.00 0.00 ? 506 ALA A N    1  
ATOM 7882   C CA   . ALA A 1 506 ? -2.387  -16.530 -4.868  1.00 0.00 ? 506 ALA A CA   1  
ATOM 7883   C C    . ALA A 1 506 ? -3.212  -16.107 -6.047  1.00 0.00 ? 506 ALA A C    1  
ATOM 7884   O O    . ALA A 1 506 ? -3.943  -16.929 -6.611  1.00 0.00 ? 506 ALA A O    1  
ATOM 7885   C CB   . ALA A 1 506 ? -3.030  -16.022 -3.590  1.00 0.00 ? 506 ALA A CB   1  
ATOM 7886   H H    . ALA A 1 506 ? -0.639  -15.482 -4.294  1.00 0.00 ? 506 ALA A H    1  
ATOM 7887   H HA   . ALA A 1 506 ? -2.347  -17.609 -4.837  1.00 0.00 ? 506 ALA A HA   1  
ATOM 7888   H HB1  . ALA A 1 506 ? -2.297  -15.483 -3.008  1.00 0.00 ? 506 ALA A HB1  1  
ATOM 7889   H HB2  . ALA A 1 506 ? -3.401  -16.859 -3.017  1.00 0.00 ? 506 ALA A HB2  1  
ATOM 7890   H HB3  . ALA A 1 506 ? -3.849  -15.363 -3.836  1.00 0.00 ? 506 ALA A HB3  1  
ATOM 7891   N N    . GLY A 1 507 ? -3.061  -14.837 -6.449  1.00 0.00 ? 507 GLY A N    1  
ATOM 7892   C CA   . GLY A 1 507 ? -3.827  -14.287 -7.557  1.00 0.00 ? 507 GLY A CA   1  
ATOM 7893   C C    . GLY A 1 507 ? -3.221  -14.502 -8.927  1.00 0.00 ? 507 GLY A C    1  
ATOM 7894   O O    . GLY A 1 507 ? -3.792  -14.041 -9.915  1.00 0.00 ? 507 GLY A O    1  
ATOM 7895   H H    . GLY A 1 507 ? -2.435  -14.256 -5.968  1.00 0.00 ? 507 GLY A H    1  
ATOM 7896   H HA2  . GLY A 1 507 ? -4.807  -14.737 -7.548  1.00 0.00 ? 507 GLY A HA2  1  
ATOM 7897   H HA3  . GLY A 1 507 ? -3.940  -13.224 -7.395  1.00 0.00 ? 507 GLY A HA3  1  
ATOM 7898   N N    . ASP A 1 508 ? -2.079  -15.182 -9.000  1.00 0.00 ? 508 ASP A N    1  
ATOM 7899   C CA   . ASP A 1 508 ? -1.329  -15.347 -10.252 1.00 0.00 ? 508 ASP A CA   1  
ATOM 7900   C C    . ASP A 1 508 ? -1.792  -16.635 -10.986 1.00 0.00 ? 508 ASP A C    1  
ATOM 7901   O O    . ASP A 1 508 ? -1.581  -17.765 -10.470 1.00 0.00 ? 508 ASP A O    1  
ATOM 7902   C CB   . ASP A 1 508 ? 0.161   -15.415 -9.883  1.00 0.00 ? 508 ASP A CB   1  
ATOM 7903   C CG   . ASP A 1 508 ? 1.116   -15.529 -11.098 1.00 0.00 ? 508 ASP A CG   1  
ATOM 7904   O OD1  . ASP A 1 508 ? 0.628   -15.692 -12.248 1.00 0.00 ? 508 ASP A OD1  1  
ATOM 7905   O OD2  . ASP A 1 508 ? 2.376   -15.511 -10.876 1.00 0.00 ? 508 ASP A OD2  1  
ATOM 7906   H H    . ASP A 1 508 ? -1.680  -15.516 -8.169  1.00 0.00 ? 508 ASP A H    1  
ATOM 7907   H HA   . ASP A 1 508 ? -1.500  -14.491 -10.888 1.00 0.00 ? 508 ASP A HA   1  
ATOM 7908   H HB2  . ASP A 1 508 ? 0.418   -14.523 -9.332  1.00 0.00 ? 508 ASP A HB2  1  
ATOM 7909   H HB3  . ASP A 1 508 ? 0.315   -16.270 -9.241  1.00 0.00 ? 508 ASP A HB3  1  
ATOM 7910   N N    . GLU A 1 509 ? -2.416  -16.471 -12.168 1.00 0.00 ? 509 GLU A N    1  
ATOM 7911   C CA   . GLU A 1 509 ? -2.940  -17.603 -12.977 1.00 0.00 ? 509 GLU A CA   1  
ATOM 7912   C C    . GLU A 1 509 ? -1.970  -18.760 -13.145 1.00 0.00 ? 509 GLU A C    1  
ATOM 7913   O O    . GLU A 1 509 ? -2.372  -19.869 -13.483 1.00 0.00 ? 509 GLU A O    1  
ATOM 7914   C CB   . GLU A 1 509 ? -3.297  -17.160 -14.387 1.00 0.00 ? 509 GLU A CB   1  
ATOM 7915   C CG   . GLU A 1 509 ? -4.485  -16.241 -14.518 1.00 0.00 ? 509 GLU A CG   1  
ATOM 7916   C CD   . GLU A 1 509 ? -4.727  -15.849 -15.949 1.00 0.00 ? 509 GLU A CD   1  
ATOM 7917   O OE1  . GLU A 1 509 ? -4.705  -16.757 -16.846 1.00 0.00 ? 509 GLU A OE1  1  
ATOM 7918   O OE2  . GLU A 1 509 ? -4.937  -14.619 -16.172 1.00 0.00 ? 509 GLU A OE2  1  
ATOM 7919   H H    . GLU A 1 509 ? -2.546  -15.559 -12.504 1.00 0.00 ? 509 GLU A H    1  
ATOM 7920   H HA   . GLU A 1 509 ? -3.837  -17.973 -12.506 1.00 0.00 ? 509 GLU A HA   1  
ATOM 7921   H HB2  . GLU A 1 509 ? -2.443  -16.654 -14.806 1.00 0.00 ? 509 GLU A HB2  1  
ATOM 7922   H HB3  . GLU A 1 509 ? -3.483  -18.047 -14.977 1.00 0.00 ? 509 GLU A HB3  1  
ATOM 7923   H HG2  . GLU A 1 509 ? -5.362  -16.743 -14.137 1.00 0.00 ? 509 GLU A HG2  1  
ATOM 7924   H HG3  . GLU A 1 509 ? -4.307  -15.350 -13.933 1.00 0.00 ? 509 GLU A HG3  1  
ATOM 7925   N N    . ARG A 1 510 ? -0.690  -18.501 -12.939 1.00 0.00 ? 510 ARG A N    1  
ATOM 7926   C CA   . ARG A 1 510 ? 0.333   -19.463 -13.300 1.00 0.00 ? 510 ARG A CA   1  
ATOM 7927   C C    . ARG A 1 510 ? 0.730   -20.329 -12.132 1.00 0.00 ? 510 ARG A C    1  
ATOM 7928   O O    . ARG A 1 510 ? 1.429   -21.352 -12.296 1.00 0.00 ? 510 ARG A O    1  
ATOM 7929   C CB   . ARG A 1 510 ? 1.561   -18.718 -13.761 1.00 0.00 ? 510 ARG A CB   1  
ATOM 7930   C CG   . ARG A 1 510 ? 1.314   -17.884 -14.964 1.00 0.00 ? 510 ARG A CG   1  
ATOM 7931   C CD   . ARG A 1 510 ? 2.508   -17.026 -15.225 1.00 0.00 ? 510 ARG A CD   1  
ATOM 7932   N NE   . ARG A 1 510 ? 2.681   -16.091 -14.121 1.00 0.00 ? 510 ARG A NE   1  
ATOM 7933   C CZ   . ARG A 1 510 ? 3.697   -15.255 -14.013 1.00 0.00 ? 510 ARG A CZ   1  
ATOM 7934   N NH1  . ARG A 1 510 ? 4.659   -15.227 -14.945 1.00 0.00 ? 510 ARG A NH1  1  
ATOM 7935   N NH2  . ARG A 1 510 ? 3.750   -14.474 -12.962 1.00 0.00 ? 510 ARG A NH2  1  
ATOM 7936   H H    . ARG A 1 510 ? -0.422  -17.592 -12.689 1.00 0.00 ? 510 ARG A H    1  
ATOM 7937   H HA   . ARG A 1 510 ? -0.023  -20.084 -14.106 1.00 0.00 ? 510 ARG A HA   1  
ATOM 7938   H HB2  . ARG A 1 510 ? 1.900   -18.078 -12.962 1.00 0.00 ? 510 ARG A HB2  1  
ATOM 7939   H HB3  . ARG A 1 510 ? 2.338   -19.436 -13.985 1.00 0.00 ? 510 ARG A HB3  1  
ATOM 7940   H HG2  . ARG A 1 510 ? 1.135   -18.525 -15.816 1.00 0.00 ? 510 ARG A HG2  1  
ATOM 7941   H HG3  . ARG A 1 510 ? 0.451   -17.257 -14.797 1.00 0.00 ? 510 ARG A HG3  1  
ATOM 7942   H HD2  . ARG A 1 510 ? 3.386   -17.648 -15.311 1.00 0.00 ? 510 ARG A HD2  1  
ATOM 7943   H HD3  . ARG A 1 510 ? 2.364   -16.477 -16.144 1.00 0.00 ? 510 ARG A HD3  1  
ATOM 7944   H HE   . ARG A 1 510 ? 2.004   -16.086 -13.413 1.00 0.00 ? 510 ARG A HE   1  
ATOM 7945   H HH11 . ARG A 1 510 ? 4.611   -15.842 -15.733 1.00 0.00 ? 510 ARG A HH11 1  
ATOM 7946   H HH12 . ARG A 1 510 ? 5.426   -14.591 -14.855 1.00 0.00 ? 510 ARG A HH12 1  
ATOM 7947   H HH21 . ARG A 1 510 ? 3.033   -14.521 -12.267 1.00 0.00 ? 510 ARG A HH21 1  
ATOM 7948   H HH22 . ARG A 1 510 ? 4.509   -13.832 -12.854 1.00 0.00 ? 510 ARG A HH22 1  
ATOM 7949   N N    . ALA A 1 511 ? 0.323   -19.901 -10.942 1.00 0.00 ? 511 ALA A N    1  
ATOM 7950   C CA   . ALA A 1 511 ? 0.632   -20.655 -9.771  1.00 0.00 ? 511 ALA A CA   1  
ATOM 7951   C C    . ALA A 1 511 ? -0.575  -21.445 -9.285  1.00 0.00 ? 511 ALA A C    1  
ATOM 7952   O O    . ALA A 1 511 ? -0.434  -22.394 -8.499  1.00 0.00 ? 511 ALA A O    1  
ATOM 7953   C CB   . ALA A 1 511 ? 1.138   -19.746 -8.721  1.00 0.00 ? 511 ALA A CB   1  
ATOM 7954   H H    . ALA A 1 511 ? -0.198  -19.074 -10.870 1.00 0.00 ? 511 ALA A H    1  
ATOM 7955   H HA   . ALA A 1 511 ? 1.416   -21.356 -10.018 1.00 0.00 ? 511 ALA A HA   1  
ATOM 7956   H HB1  . ALA A 1 511 ? 0.326   -19.142 -8.345  1.00 0.00 ? 511 ALA A HB1  1  
ATOM 7957   H HB2  . ALA A 1 511 ? 1.902   -19.105 -9.138  1.00 0.00 ? 511 ALA A HB2  1  
ATOM 7958   H HB3  . ALA A 1 511 ? 1.556   -20.327 -7.913  1.00 0.00 ? 511 ALA A HB3  1  
ATOM 7959   N N    . THR A 1 512 ? -1.754  -21.071 -9.764  1.00 0.00 ? 512 THR A N    1  
ATOM 7960   C CA   . THR A 1 512 ? -2.973  -21.600 -9.218  1.00 0.00 ? 512 THR A CA   1  
ATOM 7961   C C    . THR A 1 512 ? -2.979  -23.121 -9.103  1.00 0.00 ? 512 THR A C    1  
ATOM 7962   O O    . THR A 1 512 ? -3.270  -23.632 -8.025  1.00 0.00 ? 512 THR A O    1  
ATOM 7963   C CB   . THR A 1 512 ? -4.153  -21.176 -10.046 1.00 0.00 ? 512 THR A CB   1  
ATOM 7964   O OG1  . THR A 1 512 ? -4.241  -19.747 -10.081 1.00 0.00 ? 512 THR A OG1  1  
ATOM 7965   C CG2  . THR A 1 512 ? -5.413  -21.749 -9.458  1.00 0.00 ? 512 THR A CG2  1  
ATOM 7966   H H    . THR A 1 512 ? -1.798  -20.323 -10.395 1.00 0.00 ? 512 THR A H    1  
ATOM 7967   H HA   . THR A 1 512 ? -3.101  -21.190 -8.228  1.00 0.00 ? 512 THR A HA   1  
ATOM 7968   H HB   . THR A 1 512 ? -4.034  -21.550 -11.052 1.00 0.00 ? 512 THR A HB   1  
ATOM 7969   H HG1  . THR A 1 512 ? -3.977  -19.412 -9.222  1.00 0.00 ? 512 THR A HG1  1  
ATOM 7970   H HG21 . THR A 1 512 ? -5.488  -22.795 -9.714  1.00 0.00 ? 512 THR A HG21 1  
ATOM 7971   H HG22 . THR A 1 512 ? -6.269  -21.219 -9.854  1.00 0.00 ? 512 THR A HG22 1  
ATOM 7972   H HG23 . THR A 1 512 ? -5.390  -21.643 -8.383  1.00 0.00 ? 512 THR A HG23 1  
ATOM 7973   N N    . LEU A 1 513 ? -2.646  -23.851 -10.184 1.00 0.00 ? 513 LEU A N    1  
ATOM 7974   C CA   . LEU A 1 513 ? -2.541  -25.330 -10.098 1.00 0.00 ? 513 LEU A CA   1  
ATOM 7975   C C    . LEU A 1 513 ? -1.506  -25.835 -9.093  1.00 0.00 ? 513 LEU A C    1  
ATOM 7976   O O    . LEU A 1 513 ? -1.741  -26.832 -8.407  1.00 0.00 ? 513 LEU A O    1  
ATOM 7977   C CB   . LEU A 1 513 ? -2.295  -25.999 -11.444 1.00 0.00 ? 513 LEU A CB   1  
ATOM 7978   C CG   . LEU A 1 513 ? -3.173  -25.599 -12.640 1.00 0.00 ? 513 LEU A CG   1  
ATOM 7979   C CD1  . LEU A 1 513 ? -2.517  -26.056 -13.949 1.00 0.00 ? 513 LEU A CD1  1  
ATOM 7980   C CD2  . LEU A 1 513 ? -4.554  -26.134 -12.531 1.00 0.00 ? 513 LEU A CD2  1  
ATOM 7981   H H    . LEU A 1 513 ? -2.408  -23.397 -11.019 1.00 0.00 ? 513 LEU A H    1  
ATOM 7982   H HA   . LEU A 1 513 ? -3.502  -25.681 -9.748  1.00 0.00 ? 513 LEU A HA   1  
ATOM 7983   H HB2  . LEU A 1 513 ? -1.273  -25.805 -11.721 1.00 0.00 ? 513 LEU A HB2  1  
ATOM 7984   H HB3  . LEU A 1 513 ? -2.395  -27.068 -11.297 1.00 0.00 ? 513 LEU A HB3  1  
ATOM 7985   H HG   . LEU A 1 513 ? -3.226  -24.516 -12.659 1.00 0.00 ? 513 LEU A HG   1  
ATOM 7986   H HD11 . LEU A 1 513 ? -2.049  -27.017 -13.800 1.00 0.00 ? 513 LEU A HD11 1  
ATOM 7987   H HD12 . LEU A 1 513 ? -1.771  -25.335 -14.249 1.00 0.00 ? 513 LEU A HD12 1  
ATOM 7988   H HD13 . LEU A 1 513 ? -3.270  -26.136 -14.720 1.00 0.00 ? 513 LEU A HD13 1  
ATOM 7989   H HD21 . LEU A 1 513 ? -4.892  -26.053 -11.509 1.00 0.00 ? 513 LEU A HD21 1  
ATOM 7990   H HD22 . LEU A 1 513 ? -4.563  -27.171 -12.833 1.00 0.00 ? 513 LEU A HD22 1  
ATOM 7991   H HD23 . LEU A 1 513 ? -5.213  -25.566 -13.172 1.00 0.00 ? 513 LEU A HD23 1  
ATOM 7992   N N    . LEU A 1 514 ? -0.391  -25.136 -8.972  1.00 0.00 ? 514 LEU A N    1  
ATOM 7993   C CA   . LEU A 1 514 ? 0.640   -25.530 -8.010  1.00 0.00 ? 514 LEU A CA   1  
ATOM 7994   C C    . LEU A 1 514 ? 0.211   -25.239 -6.591  1.00 0.00 ? 514 LEU A C    1  
ATOM 7995   O O    . LEU A 1 514 ? 0.271   -26.102 -5.729  1.00 0.00 ? 514 LEU A O    1  
ATOM 7996   C CB   . LEU A 1 514 ? 1.951   -24.782 -8.279  1.00 0.00 ? 514 LEU A CB   1  
ATOM 7997   C CG   . LEU A 1 514 ? 2.411   -24.838 -9.728  1.00 0.00 ? 514 LEU A CG   1  
ATOM 7998   C CD1  . LEU A 1 514 ? 3.694   -24.133 -9.872  1.00 0.00 ? 514 LEU A CD1  1  
ATOM 7999   C CD2  . LEU A 1 514 ? 2.538   -26.294 -10.130 1.00 0.00 ? 514 LEU A CD2  1  
ATOM 8000   H H    . LEU A 1 514 ? -0.262  -24.332 -9.518  1.00 0.00 ? 514 LEU A H    1  
ATOM 8001   H HA   . LEU A 1 514 ? 0.822   -26.589 -8.109  1.00 0.00 ? 514 LEU A HA   1  
ATOM 8002   H HB2  . LEU A 1 514 ? 1.819   -23.748 -8.004  1.00 0.00 ? 514 LEU A HB2  1  
ATOM 8003   H HB3  . LEU A 1 514 ? 2.722   -25.207 -7.652  1.00 0.00 ? 514 LEU A HB3  1  
ATOM 8004   H HG   . LEU A 1 514 ? 1.672   -24.360 -10.354 1.00 0.00 ? 514 LEU A HG   1  
ATOM 8005   H HD11 . LEU A 1 514 ? 3.614   -23.147 -9.441  1.00 0.00 ? 514 LEU A HD11 1  
ATOM 8006   H HD12 . LEU A 1 514 ? 3.943   -24.050 -10.921 1.00 0.00 ? 514 LEU A HD12 1  
ATOM 8007   H HD13 . LEU A 1 514 ? 4.468   -24.686 -9.361  1.00 0.00 ? 514 LEU A HD13 1  
ATOM 8008   H HD21 . LEU A 1 514 ? 3.017   -26.846 -9.335  1.00 0.00 ? 514 LEU A HD21 1  
ATOM 8009   H HD22 . LEU A 1 514 ? 3.132   -26.368 -11.029 1.00 0.00 ? 514 LEU A HD22 1  
ATOM 8010   H HD23 . LEU A 1 514 ? 1.556   -26.704 -10.312 1.00 0.00 ? 514 LEU A HD23 1  
ATOM 8011   N N    . LEU A 1 515 ? -0.221  -24.013 -6.348  1.00 0.00 ? 515 LEU A N    1  
ATOM 8012   C CA   . LEU A 1 515 ? -0.724  -23.654 -5.055  1.00 0.00 ? 515 LEU A CA   1  
ATOM 8013   C C    . LEU A 1 515 ? -1.763  -24.669 -4.647  1.00 0.00 ? 515 LEU A C    1  
ATOM 8014   O O    . LEU A 1 515 ? -1.714  -25.218 -3.547  1.00 0.00 ? 515 LEU A O    1  
ATOM 8015   C CB   . LEU A 1 515 ? -1.346  -22.278 -5.142  1.00 0.00 ? 515 LEU A CB   1  
ATOM 8016   C CG   . LEU A 1 515 ? -0.303  -21.250 -5.523  1.00 0.00 ? 515 LEU A CG   1  
ATOM 8017   C CD1  . LEU A 1 515 ? -0.934  -19.916 -5.663  1.00 0.00 ? 515 LEU A CD1  1  
ATOM 8018   C CD2  . LEU A 1 515 ? 0.722   -21.204 -4.427  1.00 0.00 ? 515 LEU A CD2  1  
ATOM 8019   H H    . LEU A 1 515 ? -0.246  -23.357 -7.075  1.00 0.00 ? 515 LEU A H    1  
ATOM 8020   H HA   . LEU A 1 515 ? 0.082   -23.644 -4.337  1.00 0.00 ? 515 LEU A HA   1  
ATOM 8021   H HB2  . LEU A 1 515 ? -2.128  -22.287 -5.887  1.00 0.00 ? 515 LEU A HB2  1  
ATOM 8022   H HB3  . LEU A 1 515 ? -1.770  -22.016 -4.184  1.00 0.00 ? 515 LEU A HB3  1  
ATOM 8023   H HG   . LEU A 1 515 ? 0.171   -21.532 -6.452  1.00 0.00 ? 515 LEU A HG   1  
ATOM 8024   H HD11 . LEU A 1 515 ? -1.502  -19.881 -6.580  1.00 0.00 ? 515 LEU A HD11 1  
ATOM 8025   H HD12 . LEU A 1 515 ? -0.166  -19.156 -5.684  1.00 0.00 ? 515 LEU A HD12 1  
ATOM 8026   H HD13 . LEU A 1 515 ? -1.593  -19.740 -4.826  1.00 0.00 ? 515 LEU A HD13 1  
ATOM 8027   H HD21 . LEU A 1 515 ? 1.101   -20.197 -4.330  1.00 0.00 ? 515 LEU A HD21 1  
ATOM 8028   H HD22 . LEU A 1 515 ? 1.536   -21.874 -4.666  1.00 0.00 ? 515 LEU A HD22 1  
ATOM 8029   H HD23 . LEU A 1 515 ? 0.268   -21.508 -3.496  1.00 0.00 ? 515 LEU A HD23 1  
ATOM 8030   N N    . LEU A 1 516 ? -2.695  -24.942 -5.549  1.00 0.00 ? 516 LEU A N    1  
ATOM 8031   C CA   . LEU A 1 516 ? -3.717  -25.957 -5.274  1.00 0.00 ? 516 LEU A CA   1  
ATOM 8032   C C    . LEU A 1 516 ? -3.131  -27.342 -4.966  1.00 0.00 ? 516 LEU A C    1  
ATOM 8033   O O    . LEU A 1 516 ? -3.451  -27.946 -3.955  1.00 0.00 ? 516 LEU A O    1  
ATOM 8034   C CB   . LEU A 1 516 ? -4.659  -26.027 -6.461  1.00 0.00 ? 516 LEU A CB   1  
ATOM 8035   C CG   . LEU A 1 516 ? -5.815  -27.008 -6.644  1.00 0.00 ? 516 LEU A CG   1  
ATOM 8036   C CD1  . LEU A 1 516 ? -6.930  -26.945 -5.587  1.00 0.00 ? 516 LEU A CD1  1  
ATOM 8037   C CD2  . LEU A 1 516 ? -6.378  -26.698 -8.044  1.00 0.00 ? 516 LEU A CD2  1  
ATOM 8038   H H    . LEU A 1 516 ? -2.678  -24.491 -6.419  1.00 0.00 ? 516 LEU A H    1  
ATOM 8039   H HA   . LEU A 1 516 ? -4.287  -25.636 -4.415  1.00 0.00 ? 516 LEU A HA   1  
ATOM 8040   H HB2  . LEU A 1 516 ? -5.107  -25.055 -6.538  1.00 0.00 ? 516 LEU A HB2  1  
ATOM 8041   H HB3  . LEU A 1 516 ? -4.019  -26.130 -7.333  1.00 0.00 ? 516 LEU A HB3  1  
ATOM 8042   H HG   . LEU A 1 516 ? -5.415  -28.009 -6.661  1.00 0.00 ? 516 LEU A HG   1  
ATOM 8043   H HD11 . LEU A 1 516 ? -7.774  -27.532 -5.919  1.00 0.00 ? 516 LEU A HD11 1  
ATOM 8044   H HD12 . LEU A 1 516 ? -7.237  -25.918 -5.447  1.00 0.00 ? 516 LEU A HD12 1  
ATOM 8045   H HD13 . LEU A 1 516 ? -6.562  -27.342 -4.652  1.00 0.00 ? 516 LEU A HD13 1  
ATOM 8046   H HD21 . LEU A 1 516 ? -5.621  -26.896 -8.789  1.00 0.00 ? 516 LEU A HD21 1  
ATOM 8047   H HD22 . LEU A 1 516 ? -6.669  -25.659 -8.094  1.00 0.00 ? 516 LEU A HD22 1  
ATOM 8048   H HD23 . LEU A 1 516 ? -7.240  -27.322 -8.231  1.00 0.00 ? 516 LEU A HD23 1  
ATOM 8049   N N    . GLY A 1 517 ? -2.244  -27.819 -5.840  1.00 0.00 ? 517 GLY A N    1  
ATOM 8050   C CA   . GLY A 1 517 ? -1.682  -29.157 -5.731  1.00 0.00 ? 517 GLY A CA   1  
ATOM 8051   C C    . GLY A 1 517 ? -0.877  -29.307 -4.460  1.00 0.00 ? 517 GLY A C    1  
ATOM 8052   O O    . GLY A 1 517 ? -0.781  -30.395 -3.880  1.00 0.00 ? 517 GLY A O    1  
ATOM 8053   H H    . GLY A 1 517 ? -2.012  -27.273 -6.620  1.00 0.00 ? 517 GLY A H    1  
ATOM 8054   H HA2  . GLY A 1 517 ? -2.486  -29.879 -5.730  1.00 0.00 ? 517 GLY A HA2  1  
ATOM 8055   H HA3  . GLY A 1 517 ? -1.040  -29.342 -6.579  1.00 0.00 ? 517 GLY A HA3  1  
ATOM 8056   N N    . MET A 1 518 ? -0.291  -28.198 -4.030  1.00 0.00 ? 518 MET A N    1  
ATOM 8057   C CA   . MET A 1 518 ? 0.542   -28.193 -2.855  1.00 0.00 ? 518 MET A CA   1  
ATOM 8058   C C    . MET A 1 518 ? -0.278  -28.129 -1.610  1.00 0.00 ? 518 MET A C    1  
ATOM 8059   O O    . MET A 1 518 ? 0.288   -28.149 -0.516  1.00 0.00 ? 518 MET A O    1  
ATOM 8060   C CB   . MET A 1 518 ? 1.461   -27.002 -2.884  1.00 0.00 ? 518 MET A CB   1  
ATOM 8061   C CG   . MET A 1 518 ? 2.447   -27.004 -4.050  1.00 0.00 ? 518 MET A CG   1  
ATOM 8062   S SD   . MET A 1 518 ? 3.120   -25.209 -4.106  1.00 0.00 ? 518 MET A SD   1  
ATOM 8063   C CE   . MET A 1 518 ? 4.315   -25.486 -2.778  1.00 0.00 ? 518 MET A CE   1  
ATOM 8064   H H    . MET A 1 518 ? -0.405  -27.368 -4.539  1.00 0.00 ? 518 MET A H    1  
ATOM 8065   H HA   . MET A 1 518 ? 1.139   -29.091 -2.840  1.00 0.00 ? 518 MET A HA   1  
ATOM 8066   H HB2  . MET A 1 518 ? 0.861   -26.107 -2.946  1.00 0.00 ? 518 MET A HB2  1  
ATOM 8067   H HB3  . MET A 1 518 ? 2.018   -26.977 -1.958  1.00 0.00 ? 518 MET A HB3  1  
ATOM 8068   H HG2  . MET A 1 518 ? 3.248   -27.710 -3.864  1.00 0.00 ? 518 MET A HG2  1  
ATOM 8069   H HG3  . MET A 1 518 ? 1.943   -27.234 -4.974  1.00 0.00 ? 518 MET A HG3  1  
ATOM 8070   H HE1  . MET A 1 518 ? 5.058   -24.700 -2.793  1.00 0.00 ? 518 MET A HE1  1  
ATOM 8071   H HE2  . MET A 1 518 ? 4.800   -26.439 -2.920  1.00 0.00 ? 518 MET A HE2  1  
ATOM 8072   H HE3  . MET A 1 518 ? 3.801   -25.485 -1.826  1.00 0.00 ? 518 MET A HE3  1  
ATOM 8073   N N    . GLY A 1 519 ? -1.607  -28.029 -1.770  1.00 0.00 ? 519 GLY A N    1  
ATOM 8074   C CA   . GLY A 1 519 ? -2.553  -28.112 -0.654  1.00 0.00 ? 519 GLY A CA   1  
ATOM 8075   C C    . GLY A 1 519 ? -2.896  -26.815 0.058   1.00 0.00 ? 519 GLY A C    1  
ATOM 8076   O O    . GLY A 1 519 ? -3.470  -26.830 1.149   1.00 0.00 ? 519 GLY A O    1  
ATOM 8077   H H    . GLY A 1 519 ? -1.965  -28.001 -2.682  1.00 0.00 ? 519 GLY A H    1  
ATOM 8078   H HA2  . GLY A 1 519 ? -3.472  -28.532 -1.029  1.00 0.00 ? 519 GLY A HA2  1  
ATOM 8079   H HA3  . GLY A 1 519 ? -2.145  -28.800 0.074   1.00 0.00 ? 519 GLY A HA3  1  
ATOM 8080   N N    . LEU A 1 520 ? -2.541  -25.680 -0.533  1.00 0.00 ? 520 LEU A N    1  
ATOM 8081   C CA   . LEU A 1 520 ? -2.884  -24.393 0.029   1.00 0.00 ? 520 LEU A CA   1  
ATOM 8082   C C    . LEU A 1 520 ? -4.380  -24.360 0.295   1.00 0.00 ? 520 LEU A C    1  
ATOM 8083   O O    . LEU A 1 520 ? -5.181  -24.800 -0.565  1.00 0.00 ? 520 LEU A O    1  
ATOM 8084   C CB   . LEU A 1 520 ? -2.498  -23.322 -0.965  1.00 0.00 ? 520 LEU A CB   1  
ATOM 8085   C CG   . LEU A 1 520 ? -2.900  -21.918 -0.614  1.00 0.00 ? 520 LEU A CG   1  
ATOM 8086   C CD1  . LEU A 1 520 ? -2.191  -21.493 0.645   1.00 0.00 ? 520 LEU A CD1  1  
ATOM 8087   C CD2  . LEU A 1 520 ? -2.528  -21.056 -1.764  1.00 0.00 ? 520 LEU A CD2  1  
ATOM 8088   H H    . LEU A 1 520 ? -2.076  -25.716 -1.395  1.00 0.00 ? 520 LEU A H    1  
ATOM 8089   H HA   . LEU A 1 520 ? -2.345  -24.242 0.952   1.00 0.00 ? 520 LEU A HA   1  
ATOM 8090   H HB2  . LEU A 1 520 ? -1.427  -23.340 -1.078  1.00 0.00 ? 520 LEU A HB2  1  
ATOM 8091   H HB3  . LEU A 1 520 ? -2.940  -23.577 -1.920  1.00 0.00 ? 520 LEU A HB3  1  
ATOM 8092   H HG   . LEU A 1 520 ? -3.968  -21.876 -0.459  1.00 0.00 ? 520 LEU A HG   1  
ATOM 8093   H HD11 . LEU A 1 520 ? -1.130  -21.671 0.540   1.00 0.00 ? 520 LEU A HD11 1  
ATOM 8094   H HD12 . LEU A 1 520 ? -2.570  -22.061 1.481   1.00 0.00 ? 520 LEU A HD12 1  
ATOM 8095   H HD13 . LEU A 1 520 ? -2.363  -20.440 0.817   1.00 0.00 ? 520 LEU A HD13 1  
ATOM 8096   H HD21 . LEU A 1 520 ? -1.500  -21.241 -2.036  1.00 0.00 ? 520 LEU A HD21 1  
ATOM 8097   H HD22 . LEU A 1 520 ? -2.645  -20.017 -1.488  1.00 0.00 ? 520 LEU A HD22 1  
ATOM 8098   H HD23 . LEU A 1 520 ? -3.168  -21.280 -2.604  1.00 0.00 ? 520 LEU A HD23 1  
ATOM 8099   N N    . ASP A 1 521 ? -4.760  -23.871 1.482   1.00 0.00 ? 521 ASP A N    1  
ATOM 8100   C CA   . ASP A 1 521 ? -6.148  -23.950 1.965   1.00 0.00 ? 521 ASP A CA   1  
ATOM 8101   C C    . ASP A 1 521 ? -6.914  -22.757 1.553   1.00 0.00 ? 521 ASP A C    1  
ATOM 8102   O O    . ASP A 1 521 ? -8.122  -22.820 1.349   1.00 0.00 ? 521 ASP A O    1  
ATOM 8103   C CB   . ASP A 1 521 ? -6.195  -24.027 3.479   1.00 0.00 ? 521 ASP A CB   1  
ATOM 8104   C CG   . ASP A 1 521 ? -5.505  -25.270 4.011   1.00 0.00 ? 521 ASP A CG   1  
ATOM 8105   O OD1  . ASP A 1 521 ? -5.796  -26.403 3.526   1.00 0.00 ? 521 ASP A OD1  1  
ATOM 8106   O OD2  . ASP A 1 521 ? -4.651  -25.096 4.918   1.00 0.00 ? 521 ASP A OD2  1  
ATOM 8107   H H    . ASP A 1 521 ? -4.067  -23.563 2.103   1.00 0.00 ? 521 ASP A H    1  
ATOM 8108   H HA   . ASP A 1 521 ? -6.616  -24.832 1.556   1.00 0.00 ? 521 ASP A HA   1  
ATOM 8109   H HB2  . ASP A 1 521 ? -5.709  -23.155 3.890   1.00 0.00 ? 521 ASP A HB2  1  
ATOM 8110   H HB3  . ASP A 1 521 ? -7.228  -24.035 3.797   1.00 0.00 ? 521 ASP A HB3  1  
ATOM 8111   N N    . GLU A 1 522 ? -6.205  -21.653 1.425   1.00 0.00 ? 522 GLU A N    1  
ATOM 8112   C CA   . GLU A 1 522 ? -6.858  -20.385 1.274   1.00 0.00 ? 522 GLU A CA   1  
ATOM 8113   C C    . GLU A 1 522 ? -6.090  -19.462 0.362   1.00 0.00 ? 522 GLU A C    1  
ATOM 8114   O O    . GLU A 1 522 ? -4.871  -19.314 0.513   1.00 0.00 ? 522 GLU A O    1  
ATOM 8115   C CB   . GLU A 1 522 ? -7.031  -19.769 2.661   1.00 0.00 ? 522 GLU A CB   1  
ATOM 8116   C CG   . GLU A 1 522 ? -7.463  -18.323 2.647   1.00 0.00 ? 522 GLU A CG   1  
ATOM 8117   C CD   . GLU A 1 522 ? -6.293  -17.335 2.508   1.00 0.00 ? 522 GLU A CD   1  
ATOM 8118   O OE1  . GLU A 1 522 ? -5.790  -17.087 1.388   1.00 0.00 ? 522 GLU A OE1  1  
ATOM 8119   O OE2  . GLU A 1 522 ? -5.877  -16.795 3.553   1.00 0.00 ? 522 GLU A OE2  1  
ATOM 8120   H H    . GLU A 1 522 ? -5.241  -21.678 1.601   1.00 0.00 ? 522 GLU A H    1  
ATOM 8121   H HA   . GLU A 1 522 ? -7.837  -20.549 0.853   1.00 0.00 ? 522 GLU A HA   1  
ATOM 8122   H HB2  . GLU A 1 522 ? -7.772  -20.339 3.200   1.00 0.00 ? 522 GLU A HB2  1  
ATOM 8123   H HB3  . GLU A 1 522 ? -6.090  -19.845 3.189   1.00 0.00 ? 522 GLU A HB3  1  
ATOM 8124   H HG2  . GLU A 1 522 ? -8.139  -18.173 1.819   1.00 0.00 ? 522 GLU A HG2  1  
ATOM 8125   H HG3  . GLU A 1 522 ? -7.990  -18.111 3.566   1.00 0.00 ? 522 GLU A HG3  1  
ATOM 8126   N N    . PHE A 1 523 ? -6.800  -18.810 -0.554  1.00 0.00 ? 523 PHE A N    1  
ATOM 8127   C CA   . PHE A 1 523 ? -6.155  -17.856 -1.443  1.00 0.00 ? 523 PHE A CA   1  
ATOM 8128   C C    . PHE A 1 523 ? -6.714  -16.494 -1.186  1.00 0.00 ? 523 PHE A C    1  
ATOM 8129   O O    . PHE A 1 523 ? -7.932  -16.318 -1.092  1.00 0.00 ? 523 PHE A O    1  
ATOM 8130   C CB   . PHE A 1 523 ? -6.454  -18.160 -2.913  1.00 0.00 ? 523 PHE A CB   1  
ATOM 8131   C CG   . PHE A 1 523 ? -5.899  -19.446 -3.410  1.00 0.00 ? 523 PHE A CG   1  
ATOM 8132   C CD1  . PHE A 1 523 ? -6.425  -20.678 -2.983  1.00 0.00 ? 523 PHE A CD1  1  
ATOM 8133   C CD2  . PHE A 1 523 ? -4.900  -19.435 -4.361  1.00 0.00 ? 523 PHE A CD2  1  
ATOM 8134   C CE1  . PHE A 1 523 ? -5.923  -21.868 -3.450  1.00 0.00 ? 523 PHE A CE1  1  
ATOM 8135   C CE2  . PHE A 1 523 ? -4.387  -20.641 -4.881  1.00 0.00 ? 523 PHE A CE2  1  
ATOM 8136   C CZ   . PHE A 1 523 ? -4.905  -21.860 -4.414  1.00 0.00 ? 523 PHE A CZ   1  
ATOM 8137   H H    . PHE A 1 523 ? -7.769  -18.946 -0.606  1.00 0.00 ? 523 PHE A H    1  
ATOM 8138   H HA   . PHE A 1 523 ? -5.089  -17.857 -1.280  1.00 0.00 ? 523 PHE A HA   1  
ATOM 8139   H HB2  . PHE A 1 523 ? -7.524  -18.183 -3.046  1.00 0.00 ? 523 PHE A HB2  1  
ATOM 8140   H HB3  . PHE A 1 523 ? -6.055  -17.353 -3.514  1.00 0.00 ? 523 PHE A HB3  1  
ATOM 8141   H HD1  . PHE A 1 523 ? -7.207  -20.689 -2.239  1.00 0.00 ? 523 PHE A HD1  1  
ATOM 8142   H HD2  . PHE A 1 523 ? -4.510  -18.492 -4.714  1.00 0.00 ? 523 PHE A HD2  1  
ATOM 8143   H HE1  . PHE A 1 523 ? -6.342  -22.803 -3.109  1.00 0.00 ? 523 PHE A HE1  1  
ATOM 8144   H HE2  . PHE A 1 523 ? -3.602  -20.628 -5.624  1.00 0.00 ? 523 PHE A HE2  1  
ATOM 8145   H HZ   . PHE A 1 523 ? -4.506  -22.793 -4.784  1.00 0.00 ? 523 PHE A HZ   1  
ATOM 8146   N N    . SER A 1 524 ? -5.863  -15.486 -1.110  1.00 0.00 ? 524 SER A N    1  
ATOM 8147   C CA   . SER A 1 524 ? -6.444  -14.162 -0.930  1.00 0.00 ? 524 SER A CA   1  
ATOM 8148   C C    . SER A 1 524 ? -5.772  -13.177 -1.835  1.00 0.00 ? 524 SER A C    1  
ATOM 8149   O O    . SER A 1 524 ? -4.577  -13.142 -1.907  1.00 0.00 ? 524 SER A O    1  
ATOM 8150   C CB   . SER A 1 524 ? -6.387  -13.737 0.529   1.00 0.00 ? 524 SER A CB   1  
ATOM 8151   O OG   . SER A 1 524 ? -7.155  -12.581 0.694   1.00 0.00 ? 524 SER A OG   1  
ATOM 8152   H H    . SER A 1 524 ? -4.898  -15.616 -1.218  1.00 0.00 ? 524 SER A H    1  
ATOM 8153   H HA   . SER A 1 524 ? -7.484  -14.218 -1.220  1.00 0.00 ? 524 SER A HA   1  
ATOM 8154   H HB2  . SER A 1 524 ? -6.785  -14.521 1.152   1.00 0.00 ? 524 SER A HB2  1  
ATOM 8155   H HB3  . SER A 1 524 ? -5.359  -13.544 0.808   1.00 0.00 ? 524 SER A HB3  1  
ATOM 8156   H HG   . SER A 1 524 ? -6.574  -11.879 0.998   1.00 0.00 ? 524 SER A HG   1  
ATOM 8157   N N    . MET A 1 525 ? -6.545  -12.366 -2.528  1.00 0.00 ? 525 MET A N    1  
ATOM 8158   C CA   . MET A 1 525 ? -5.967  -11.577 -3.579  1.00 0.00 ? 525 MET A CA   1  
ATOM 8159   C C    . MET A 1 525 ? -6.696  -10.291 -3.758  1.00 0.00 ? 525 MET A C    1  
ATOM 8160   O O    . MET A 1 525 ? -7.711  -10.055 -3.119  1.00 0.00 ? 525 MET A O    1  
ATOM 8161   C CB   . MET A 1 525 ? -6.135  -12.329 -4.853  1.00 0.00 ? 525 MET A CB   1  
ATOM 8162   C CG   . MET A 1 525 ? -7.508  -12.899 -4.982  1.00 0.00 ? 525 MET A CG   1  
ATOM 8163   S SD   . MET A 1 525 ? -7.531  -14.236 -6.374  1.00 0.00 ? 525 MET A SD   1  
ATOM 8164   C CE   . MET A 1 525 ? -6.730  -15.774 -5.478  1.00 0.00 ? 525 MET A CE   1  
ATOM 8165   H H    . MET A 1 525 ? -7.519  -12.423 -2.438  1.00 0.00 ? 525 MET A H    1  
ATOM 8166   H HA   . MET A 1 525 ? -4.920  -11.402 -3.395  1.00 0.00 ? 525 MET A HA   1  
ATOM 8167   H HB2  . MET A 1 525 ? -5.953  -11.662 -5.682  1.00 0.00 ? 525 MET A HB2  1  
ATOM 8168   H HB3  . MET A 1 525 ? -5.414  -13.134 -4.884  1.00 0.00 ? 525 MET A HB3  1  
ATOM 8169   H HG2  . MET A 1 525 ? -7.799  -13.349 -4.042  1.00 0.00 ? 525 MET A HG2  1  
ATOM 8170   H HG3  . MET A 1 525 ? -8.202  -12.113 -5.235  1.00 0.00 ? 525 MET A HG3  1  
ATOM 8171   H HE1  . MET A 1 525 ? -6.198  -16.375 -6.204  1.00 0.00 ? 525 MET A HE1  1  
ATOM 8172   H HE2  . MET A 1 525 ? -7.503  -16.370 -5.022  1.00 0.00 ? 525 MET A HE2  1  
ATOM 8173   H HE3  . MET A 1 525 ? -6.047  -15.429 -4.714  1.00 0.00 ? 525 MET A HE3  1  
ATOM 8174   N N    . SER A 1 526 ? -6.176  -9.463  -4.658  1.00 0.00 ? 526 SER A N    1  
ATOM 8175   C CA   . SER A 1 526 ? -6.977  -8.408  -5.194  1.00 0.00 ? 526 SER A CA   1  
ATOM 8176   C C    . SER A 1 526 ? -8.286  -9.054  -5.598  1.00 0.00 ? 526 SER A C    1  
ATOM 8177   O O    . SER A 1 526 ? -8.315  -10.139 -6.222  1.00 0.00 ? 526 SER A O    1  
ATOM 8178   C CB   . SER A 1 526 ? -6.323  -7.882  -6.436  1.00 0.00 ? 526 SER A CB   1  
ATOM 8179   O OG   . SER A 1 526 ? -5.019  -7.425  -6.179  1.00 0.00 ? 526 SER A OG   1  
ATOM 8180   H H    . SER A 1 526 ? -5.364  -9.732  -5.137  1.00 0.00 ? 526 SER A H    1  
ATOM 8181   H HA   . SER A 1 526 ? -7.131  -7.622  -4.471  1.00 0.00 ? 526 SER A HA   1  
ATOM 8182   H HB2  . SER A 1 526 ? -6.274  -8.668  -7.171  1.00 0.00 ? 526 SER A HB2  1  
ATOM 8183   H HB3  . SER A 1 526 ? -6.923  -7.071  -6.831  1.00 0.00 ? 526 SER A HB3  1  
ATOM 8184   H HG   . SER A 1 526 ? -5.084  -6.621  -5.659  1.00 0.00 ? 526 SER A HG   1  
ATOM 8185   N N    . ALA A 1 527 ? -9.382  -8.399  -5.242  1.00 0.00 ? 527 ALA A N    1  
ATOM 8186   C CA   . ALA A 1 527 ? -10.705 -8.876  -5.617  1.00 0.00 ? 527 ALA A CA   1  
ATOM 8187   C C    . ALA A 1 527 ? -10.775 -9.186  -7.128  1.00 0.00 ? 527 ALA A C    1  
ATOM 8188   O O    . ALA A 1 527 ? -11.290 -10.256 -7.535  1.00 0.00 ? 527 ALA A O    1  
ATOM 8189   C CB   . ALA A 1 527 ? -11.714 -7.845  -5.248  1.00 0.00 ? 527 ALA A CB   1  
ATOM 8190   H H    . ALA A 1 527 ? -9.298  -7.556  -4.750  1.00 0.00 ? 527 ALA A H    1  
ATOM 8191   H HA   . ALA A 1 527 ? -10.916 -9.782  -5.067  1.00 0.00 ? 527 ALA A HA   1  
ATOM 8192   H HB1  . ALA A 1 527 ? -11.401 -6.883  -5.626  1.00 0.00 ? 527 ALA A HB1  1  
ATOM 8193   H HB2  . ALA A 1 527 ? -11.803 -7.798  -4.172  1.00 0.00 ? 527 ALA A HB2  1  
ATOM 8194   H HB3  . ALA A 1 527 ? -12.670 -8.106  -5.677  1.00 0.00 ? 527 ALA A HB3  1  
ATOM 8195   N N    . ILE A 1 528 ? -10.250 -8.289  -7.962  1.00 0.00 ? 528 ILE A N    1  
ATOM 8196   C CA   . ILE A 1 528 ? -10.306 -8.497  -9.409  1.00 0.00 ? 528 ILE A CA   1  
ATOM 8197   C C    . ILE A 1 528 ? -9.748  -9.824  -9.882  1.00 0.00 ? 528 ILE A C    1  
ATOM 8198   O O    . ILE A 1 528 ? -10.073 -10.247 -10.954 1.00 0.00 ? 528 ILE A O    1  
ATOM 8199   C CB   . ILE A 1 528 ? -9.614  -7.389  -10.216 1.00 0.00 ? 528 ILE A CB   1  
ATOM 8200   C CG1  . ILE A 1 528 ? -8.149  -7.258  -9.757  1.00 0.00 ? 528 ILE A CG1  1  
ATOM 8201   C CG2  . ILE A 1 528 ? -10.455 -6.097  -10.130 1.00 0.00 ? 528 ILE A CG2  1  
ATOM 8202   C CD1  . ILE A 1 528 ? -7.301  -6.401  -10.588 1.00 0.00 ? 528 ILE A CD1  1  
ATOM 8203   H H    . ILE A 1 528 ? -9.842  -7.473  -7.604  1.00 0.00 ? 528 ILE A H    1  
ATOM 8204   H HA   . ILE A 1 528 ? -11.350 -8.479  -9.685  1.00 0.00 ? 528 ILE A HA   1  
ATOM 8205   H HB   . ILE A 1 528 ? -9.615  -7.701  -11.255 1.00 0.00 ? 528 ILE A HB   1  
ATOM 8206   H HG12 . ILE A 1 528 ? -8.142  -6.860  -8.756  1.00 0.00 ? 528 ILE A HG12 1  
ATOM 8207   H HG13 . ILE A 1 528 ? -7.717  -8.250  -9.728  1.00 0.00 ? 528 ILE A HG13 1  
ATOM 8208   H HG21 . ILE A 1 528 ? -9.980  -5.319  -10.708 1.00 0.00 ? 528 ILE A HG21 1  
ATOM 8209   H HG22 . ILE A 1 528 ? -10.529 -5.784  -9.099  1.00 0.00 ? 528 ILE A HG22 1  
ATOM 8210   H HG23 . ILE A 1 528 ? -11.444 -6.284  -10.521 1.00 0.00 ? 528 ILE A HG23 1  
ATOM 8211   H HD11 . ILE A 1 528 ? -6.327  -6.854  -10.696 1.00 0.00 ? 528 ILE A HD11 1  
ATOM 8212   H HD12 . ILE A 1 528 ? -7.198  -5.432  -10.117 1.00 0.00 ? 528 ILE A HD12 1  
ATOM 8213   H HD13 . ILE A 1 528 ? -7.751  -6.283  -11.562 1.00 0.00 ? 528 ILE A HD13 1  
ATOM 8214   N N    . SER A 1 529 ? -8.947  -10.498 -9.083  1.00 0.00 ? 529 SER A N    1  
ATOM 8215   C CA   . SER A 1 529 ? -8.379  -11.751 -9.529  1.00 0.00 ? 529 SER A CA   1  
ATOM 8216   C C    . SER A 1 529 ? -9.182  -12.927 -9.112  1.00 0.00 ? 529 SER A C    1  
ATOM 8217   O O    . SER A 1 529 ? -8.916  -14.051 -9.512  1.00 0.00 ? 529 SER A O    1  
ATOM 8218   C CB   . SER A 1 529 ? -6.984  -11.903 -9.001  1.00 0.00 ? 529 SER A CB   1  
ATOM 8219   O OG   . SER A 1 529 ? -6.187  -10.857 -9.539  1.00 0.00 ? 529 SER A OG   1  
ATOM 8220   H H    . SER A 1 529 ? -8.720  -10.142 -8.199  1.00 0.00 ? 529 SER A H    1  
ATOM 8221   H HA   . SER A 1 529 ? -8.329  -11.738 -10.606 1.00 0.00 ? 529 SER A HA   1  
ATOM 8222   H HB2  . SER A 1 529 ? -6.991  -11.833 -7.926  1.00 0.00 ? 529 SER A HB2  1  
ATOM 8223   H HB3  . SER A 1 529 ? -6.586  -12.864 -9.299  1.00 0.00 ? 529 SER A HB3  1  
ATOM 8224   H HG   . SER A 1 529 ? -5.774  -10.392 -8.807  1.00 0.00 ? 529 SER A HG   1  
ATOM 8225   N N    . ILE A 1 530 ? -10.185 -12.680 -8.295  1.00 0.00 ? 530 ILE A N    1  
ATOM 8226   C CA   . ILE A 1 530 ? -10.945 -13.776 -7.735  1.00 0.00 ? 530 ILE A CA   1  
ATOM 8227   C C    . ILE A 1 530 ? -11.581 -14.658 -8.821  1.00 0.00 ? 530 ILE A C    1  
ATOM 8228   O O    . ILE A 1 530 ? -11.386 -15.880 -8.788  1.00 0.00 ? 530 ILE A O    1  
ATOM 8229   C CB   . ILE A 1 530 ? -11.905 -13.304 -6.662  1.00 0.00 ? 530 ILE A CB   1  
ATOM 8230   C CG1  . ILE A 1 530 ? -11.077 -12.814 -5.500  1.00 0.00 ? 530 ILE A CG1  1  
ATOM 8231   C CG2  . ILE A 1 530 ? -12.852 -14.406 -6.251  1.00 0.00 ? 530 ILE A CG2  1  
ATOM 8232   C CD1  . ILE A 1 530 ? -11.856 -12.141 -4.394  1.00 0.00 ? 530 ILE A CD1  1  
ATOM 8233   H H    . ILE A 1 530 ? -10.361 -11.762 -8.001  1.00 0.00 ? 530 ILE A H    1  
ATOM 8234   H HA   . ILE A 1 530 ? -10.219 -14.408 -7.237  1.00 0.00 ? 530 ILE A HA   1  
ATOM 8235   H HB   . ILE A 1 530 ? -12.482 -12.477 -7.051  1.00 0.00 ? 530 ILE A HB   1  
ATOM 8236   H HG12 . ILE A 1 530 ? -10.556 -13.657 -5.076  1.00 0.00 ? 530 ILE A HG12 1  
ATOM 8237   H HG13 . ILE A 1 530 ? -10.342 -12.116 -5.878  1.00 0.00 ? 530 ILE A HG13 1  
ATOM 8238   H HG21 . ILE A 1 530 ? -13.182 -14.238 -5.237  1.00 0.00 ? 530 ILE A HG21 1  
ATOM 8239   H HG22 . ILE A 1 530 ? -12.345 -15.358 -6.312  1.00 0.00 ? 530 ILE A HG22 1  
ATOM 8240   H HG23 . ILE A 1 530 ? -13.707 -14.411 -6.912  1.00 0.00 ? 530 ILE A HG23 1  
ATOM 8241   H HD11 . ILE A 1 530 ? -12.400 -12.886 -3.833  1.00 0.00 ? 530 ILE A HD11 1  
ATOM 8242   H HD12 . ILE A 1 530 ? -12.550 -11.433 -4.823  1.00 0.00 ? 530 ILE A HD12 1  
ATOM 8243   H HD13 . ILE A 1 530 ? -11.174 -11.623 -3.737  1.00 0.00 ? 530 ILE A HD13 1  
ATOM 8244   N N    . PRO A 1 531 ? -12.306 -14.059 -9.793  1.00 0.00 ? 531 PRO A N    1  
ATOM 8245   C CA   . PRO A 1 531 ? -12.881 -14.924 -10.828 1.00 0.00 ? 531 PRO A CA   1  
ATOM 8246   C C    . PRO A 1 531 ? -11.874 -15.716 -11.687 1.00 0.00 ? 531 PRO A C    1  
ATOM 8247   O O    . PRO A 1 531 ? -12.144 -16.895 -11.961 1.00 0.00 ? 531 PRO A O    1  
ATOM 8248   C CB   . PRO A 1 531 ? -13.704 -13.965 -11.670 1.00 0.00 ? 531 PRO A CB   1  
ATOM 8249   C CG   . PRO A 1 531 ? -13.989 -12.809 -10.728 1.00 0.00 ? 531 PRO A CG   1  
ATOM 8250   C CD   . PRO A 1 531 ? -12.712 -12.658 -9.977  1.00 0.00 ? 531 PRO A CD   1  
ATOM 8251   H HA   . PRO A 1 531 ? -13.558 -15.620 -10.362 1.00 0.00 ? 531 PRO A HA   1  
ATOM 8252   H HB2  . PRO A 1 531 ? -13.134 -13.631 -12.528 1.00 0.00 ? 531 PRO A HB2  1  
ATOM 8253   H HB3  . PRO A 1 531 ? -14.628 -14.426 -11.980 1.00 0.00 ? 531 PRO A HB3  1  
ATOM 8254   H HG2  . PRO A 1 531 ? -14.217 -11.911 -11.287 1.00 0.00 ? 531 PRO A HG2  1  
ATOM 8255   H HG3  . PRO A 1 531 ? -14.792 -13.055 -10.052 1.00 0.00 ? 531 PRO A HG3  1  
ATOM 8256   H HD2  . PRO A 1 531 ? -11.984 -12.112 -10.563 1.00 0.00 ? 531 PRO A HD2  1  
ATOM 8257   H HD3  . PRO A 1 531 ? -12.878 -12.186 -9.022  1.00 0.00 ? 531 PRO A HD3  1  
ATOM 8258   N N    . ARG A 1 532 ? -10.721 -15.137 -12.072 1.00 0.00 ? 532 ARG A N    1  
ATOM 8259   C CA   . ARG A 1 532 ? -9.783  -15.895 -12.936 1.00 0.00 ? 532 ARG A CA   1  
ATOM 8260   C C    . ARG A 1 532 ? -9.338  -17.134 -12.217 1.00 0.00 ? 532 ARG A C    1  
ATOM 8261   O O    . ARG A 1 532 ? -9.298  -18.225 -12.781 1.00 0.00 ? 532 ARG A O    1  
ATOM 8262   C CB   . ARG A 1 532 ? -8.546  -15.098 -13.296 1.00 0.00 ? 532 ARG A CB   1  
ATOM 8263   C CG   . ARG A 1 532 ? -8.820  -13.954 -14.235 1.00 0.00 ? 532 ARG A CG   1  
ATOM 8264   C CD   . ARG A 1 532 ? -7.531  -13.162 -14.529 1.00 0.00 ? 532 ARG A CD   1  
ATOM 8265   N NE   . ARG A 1 532 ? -7.781  -12.038 -15.452 1.00 0.00 ? 532 ARG A NE   1  
ATOM 8266   C CZ   . ARG A 1 532 ? -6.850  -11.180 -15.880 1.00 0.00 ? 532 ARG A CZ   1  
ATOM 8267   N NH1  . ARG A 1 532 ? -5.576  -11.279 -15.459 1.00 0.00 ? 532 ARG A NH1  1  
ATOM 8268   N NH2  . ARG A 1 532 ? -7.205  -10.208 -16.728 1.00 0.00 ? 532 ARG A NH2  1  
ATOM 8269   H H    . ARG A 1 532 ? -10.518 -14.215 -11.810 1.00 0.00 ? 532 ARG A H    1  
ATOM 8270   H HA   . ARG A 1 532 ? -10.295 -16.181 -13.844 1.00 0.00 ? 532 ARG A HA   1  
ATOM 8271   H HB2  . ARG A 1 532 ? -8.114  -14.701 -12.390 1.00 0.00 ? 532 ARG A HB2  1  
ATOM 8272   H HB3  . ARG A 1 532 ? -7.830  -15.764 -13.757 1.00 0.00 ? 532 ARG A HB3  1  
ATOM 8273   H HG2  . ARG A 1 532 ? -9.218  -14.342 -15.161 1.00 0.00 ? 532 ARG A HG2  1  
ATOM 8274   H HG3  . ARG A 1 532 ? -9.546  -13.293 -13.787 1.00 0.00 ? 532 ARG A HG3  1  
ATOM 8275   H HD2  . ARG A 1 532 ? -7.137  -12.772 -13.603 1.00 0.00 ? 532 ARG A HD2  1  
ATOM 8276   H HD3  . ARG A 1 532 ? -6.801  -13.828 -14.968 1.00 0.00 ? 532 ARG A HD3  1  
ATOM 8277   H HE   . ARG A 1 532 ? -8.696  -11.914 -15.778 1.00 0.00 ? 532 ARG A HE   1  
ATOM 8278   H HH11 . ARG A 1 532 ? -5.315  -12.002 -14.819 1.00 0.00 ? 532 ARG A HH11 1  
ATOM 8279   H HH12 . ARG A 1 532 ? -4.889  -10.631 -15.787 1.00 0.00 ? 532 ARG A HH12 1  
ATOM 8280   H HH21 . ARG A 1 532 ? -8.155  -10.132 -17.032 1.00 0.00 ? 532 ARG A HH21 1  
ATOM 8281   H HH22 . ARG A 1 532 ? -6.521  -9.558  -17.058 1.00 0.00 ? 532 ARG A HH22 1  
ATOM 8282   N N    . ILE A 1 533 ? -9.019  -16.957 -10.953 1.00 0.00 ? 533 ILE A N    1  
ATOM 8283   C CA   . ILE A 1 533 ? -8.501  -18.029 -10.178 1.00 0.00 ? 533 ILE A CA   1  
ATOM 8284   C C    . ILE A 1 533 ? -9.596  -19.036 -9.841  1.00 0.00 ? 533 ILE A C    1  
ATOM 8285   O O    . ILE A 1 533 ? -9.385  -20.243 -9.940  1.00 0.00 ? 533 ILE A O    1  
ATOM 8286   C CB   . ILE A 1 533 ? -7.842  -17.481 -8.907  1.00 0.00 ? 533 ILE A CB   1  
ATOM 8287   C CG1  . ILE A 1 533 ? -6.694  -16.502 -9.276  1.00 0.00 ? 533 ILE A CG1  1  
ATOM 8288   C CG2  . ILE A 1 533 ? -7.463  -18.647 -7.935  1.00 0.00 ? 533 ILE A CG2  1  
ATOM 8289   C CD1  . ILE A 1 533 ? -5.413  -17.102 -9.810  1.00 0.00 ? 533 ILE A CD1  1  
ATOM 8290   H H    . ILE A 1 533 ? -9.085  -16.062 -10.558 1.00 0.00 ? 533 ILE A H    1  
ATOM 8291   H HA   . ILE A 1 533 ? -7.744  -18.533 -10.759 1.00 0.00 ? 533 ILE A HA   1  
ATOM 8292   H HB   . ILE A 1 533 ? -8.605  -16.902 -8.397  1.00 0.00 ? 533 ILE A HB   1  
ATOM 8293   H HG12 . ILE A 1 533 ? -7.067  -15.821 -10.023 1.00 0.00 ? 533 ILE A HG12 1  
ATOM 8294   H HG13 . ILE A 1 533 ? -6.457  -15.925 -8.391  1.00 0.00 ? 533 ILE A HG13 1  
ATOM 8295   H HG21 . ILE A 1 533 ? -7.423  -19.576 -8.486  1.00 0.00 ? 533 ILE A HG21 1  
ATOM 8296   H HG22 . ILE A 1 533 ? -8.206  -18.723 -7.156  1.00 0.00 ? 533 ILE A HG22 1  
ATOM 8297   H HG23 . ILE A 1 533 ? -6.497  -18.448 -7.493  1.00 0.00 ? 533 ILE A HG23 1  
ATOM 8298   H HD11 . ILE A 1 533 ? -5.623  -17.659 -10.712 1.00 0.00 ? 533 ILE A HD11 1  
ATOM 8299   H HD12 . ILE A 1 533 ? -4.990  -17.764 -9.069  1.00 0.00 ? 533 ILE A HD12 1  
ATOM 8300   H HD13 . ILE A 1 533 ? -4.710  -16.312 -10.031 1.00 0.00 ? 533 ILE A HD13 1  
ATOM 8301   N N    . LYS A 1 534 ? -10.763 -18.537 -9.451  1.00 0.00 ? 534 LYS A N    1  
ATOM 8302   C CA   . LYS A 1 534 ? -11.895 -19.394 -9.214  1.00 0.00 ? 534 LYS A CA   1  
ATOM 8303   C C    . LYS A 1 534 ? -12.052 -20.292 -10.473 1.00 0.00 ? 534 LYS A C    1  
ATOM 8304   O O    . LYS A 1 534 ? -12.104 -21.540 -10.385 1.00 0.00 ? 534 LYS A O    1  
ATOM 8305   C CB   . LYS A 1 534 ? -13.141 -18.556 -8.948  1.00 0.00 ? 534 LYS A CB   1  
ATOM 8306   C CG   . LYS A 1 534 ? -14.393 -19.375 -8.669  1.00 0.00 ? 534 LYS A CG   1  
ATOM 8307   C CD   . LYS A 1 534 ? -15.737 -18.576 -8.515  1.00 0.00 ? 534 LYS A CD   1  
ATOM 8308   C CE   . LYS A 1 534 ? -15.726 -17.796 -7.206  1.00 0.00 ? 534 LYS A CE   1  
ATOM 8309   N NZ   . LYS A 1 534 ? -16.959 -17.088 -6.839  1.00 0.00 ? 534 LYS A NZ   1  
ATOM 8310   H H    . LYS A 1 534 ? -10.876 -17.565 -9.395  1.00 0.00 ? 534 LYS A H    1  
ATOM 8311   H HA   . LYS A 1 534 ? -11.691 -20.020 -8.356  1.00 0.00 ? 534 LYS A HA   1  
ATOM 8312   H HB2  . LYS A 1 534 ? -12.953 -17.922 -8.096  1.00 0.00 ? 534 LYS A HB2  1  
ATOM 8313   H HB3  . LYS A 1 534 ? -13.322 -17.928 -9.809  1.00 0.00 ? 534 LYS A HB3  1  
ATOM 8314   H HG2  . LYS A 1 534 ? -14.519 -20.078 -9.478  1.00 0.00 ? 534 LYS A HG2  1  
ATOM 8315   H HG3  . LYS A 1 534 ? -14.226 -19.937 -7.761  1.00 0.00 ? 534 LYS A HG3  1  
ATOM 8316   H HD2  . LYS A 1 534 ? -15.843 -17.889 -9.341  1.00 0.00 ? 534 LYS A HD2  1  
ATOM 8317   H HD3  . LYS A 1 534 ? -16.567 -19.267 -8.514  1.00 0.00 ? 534 LYS A HD3  1  
ATOM 8318   H HE2  . LYS A 1 534 ? -15.498 -18.485 -6.410  1.00 0.00 ? 534 LYS A HE2  1  
ATOM 8319   H HE3  . LYS A 1 534 ? -14.919 -17.075 -7.259  1.00 0.00 ? 534 LYS A HE3  1  
ATOM 8320   H HZ1  . LYS A 1 534 ? -17.472 -16.814 -7.701  1.00 0.00 ? 534 LYS A HZ1  1  
ATOM 8321   H HZ2  . LYS A 1 534 ? -16.720 -16.236 -6.291  1.00 0.00 ? 534 LYS A HZ2  1  
ATOM 8322   H HZ3  . LYS A 1 534 ? -17.560 -17.712 -6.266  1.00 0.00 ? 534 LYS A HZ3  1  
ATOM 8323   N N    . LYS A 1 535 ? -12.053 -19.665 -11.656 1.00 0.00 ? 535 LYS A N    1  
ATOM 8324   C CA   . LYS A 1 535 ? -12.266 -20.389 -12.904 1.00 0.00 ? 535 LYS A CA   1  
ATOM 8325   C C    . LYS A 1 535 ? -11.286 -21.517 -13.075 1.00 0.00 ? 535 LYS A C    1  
ATOM 8326   O O    . LYS A 1 535 ? -11.683 -22.627 -13.443 1.00 0.00 ? 535 LYS A O    1  
ATOM 8327   C CB   . LYS A 1 535 ? -12.163 -19.463 -14.094 1.00 0.00 ? 535 LYS A CB   1  
ATOM 8328   C CG   . LYS A 1 535 ? -12.408 -20.163 -15.415 1.00 0.00 ? 535 LYS A CG   1  
ATOM 8329   C CD   . LYS A 1 535 ? -12.326 -19.164 -16.558 1.00 0.00 ? 535 LYS A CD   1  
ATOM 8330   C CE   . LYS A 1 535 ? -12.558 -19.829 -17.886 1.00 0.00 ? 535 LYS A CE   1  
ATOM 8331   N NZ   . LYS A 1 535 ? -12.470 -18.787 -18.937 1.00 0.00 ? 535 LYS A NZ   1  
ATOM 8332   H H    . LYS A 1 535 ? -11.957 -18.690 -11.680 1.00 0.00 ? 535 LYS A H    1  
ATOM 8333   H HA   . LYS A 1 535 ? -13.262 -20.805 -12.887 1.00 0.00 ? 535 LYS A HA   1  
ATOM 8334   H HB2  . LYS A 1 535 ? -12.889 -18.673 -13.983 1.00 0.00 ? 535 LYS A HB2  1  
ATOM 8335   H HB3  . LYS A 1 535 ? -11.174 -19.026 -14.108 1.00 0.00 ? 535 LYS A HB3  1  
ATOM 8336   H HG2  . LYS A 1 535 ? -11.663 -20.932 -15.556 1.00 0.00 ? 535 LYS A HG2  1  
ATOM 8337   H HG3  . LYS A 1 535 ? -13.390 -20.614 -15.404 1.00 0.00 ? 535 LYS A HG3  1  
ATOM 8338   H HD2  . LYS A 1 535 ? -13.073 -18.398 -16.412 1.00 0.00 ? 535 LYS A HD2  1  
ATOM 8339   H HD3  . LYS A 1 535 ? -11.347 -18.707 -16.556 1.00 0.00 ? 535 LYS A HD3  1  
ATOM 8340   H HE2  . LYS A 1 535 ? -11.803 -20.584 -18.054 1.00 0.00 ? 535 LYS A HE2  1  
ATOM 8341   H HE3  . LYS A 1 535 ? -13.539 -20.280 -17.904 1.00 0.00 ? 535 LYS A HE3  1  
ATOM 8342   H HZ1  . LYS A 1 535 ? -11.928 -17.977 -18.578 1.00 0.00 ? 535 LYS A HZ1  1  
ATOM 8343   H HZ2  . LYS A 1 535 ? -13.430 -18.476 -19.197 1.00 0.00 ? 535 LYS A HZ2  1  
ATOM 8344   H HZ3  . LYS A 1 535 ? -11.993 -19.176 -19.774 1.00 0.00 ? 535 LYS A HZ3  1  
ATOM 8345   N N    . ILE A 1 536 ? -10.007 -21.228 -12.809 1.00 0.00 ? 536 ILE A N    1  
ATOM 8346   C CA   . ILE A 1 536 ? -8.964  -22.230 -12.924 1.00 0.00 ? 536 ILE A CA   1  
ATOM 8347   C C    . ILE A 1 536 ? -9.221  -23.355 -11.941 1.00 0.00 ? 536 ILE A C    1  
ATOM 8348   O O    . ILE A 1 536 ? -9.005  -24.530 -12.248 1.00 0.00 ? 536 ILE A O    1  
ATOM 8349   C CB   . ILE A 1 536 ? -7.569  -21.639 -12.733 1.00 0.00 ? 536 ILE A CB   1  
ATOM 8350   C CG1  . ILE A 1 536 ? -7.219  -20.715 -13.899 1.00 0.00 ? 536 ILE A CG1  1  
ATOM 8351   C CG2  . ILE A 1 536 ? -6.514  -22.758 -12.639 1.00 0.00 ? 536 ILE A CG2  1  
ATOM 8352   C CD1  . ILE A 1 536 ? -5.951  -19.874 -13.654 1.00 0.00 ? 536 ILE A CD1  1  
ATOM 8353   H H    . ILE A 1 536 ? -9.770  -20.321 -12.523 1.00 0.00 ? 536 ILE A H    1  
ATOM 8354   H HA   . ILE A 1 536 ? -9.017  -22.646 -13.921 1.00 0.00 ? 536 ILE A HA   1  
ATOM 8355   H HB   . ILE A 1 536 ? -7.555  -21.069 -11.814 1.00 0.00 ? 536 ILE A HB   1  
ATOM 8356   H HG12 . ILE A 1 536 ? -7.068  -21.315 -14.784 1.00 0.00 ? 536 ILE A HG12 1  
ATOM 8357   H HG13 . ILE A 1 536 ? -8.051  -20.048 -14.073 1.00 0.00 ? 536 ILE A HG13 1  
ATOM 8358   H HG21 . ILE A 1 536 ? -5.525  -22.327 -12.695 1.00 0.00 ? 536 ILE A HG21 1  
ATOM 8359   H HG22 . ILE A 1 536 ? -6.651  -23.451 -13.456 1.00 0.00 ? 536 ILE A HG22 1  
ATOM 8360   H HG23 . ILE A 1 536 ? -6.627  -23.281 -11.700 1.00 0.00 ? 536 ILE A HG23 1  
ATOM 8361   H HD11 . ILE A 1 536 ? -5.170  -20.507 -13.261 1.00 0.00 ? 536 ILE A HD11 1  
ATOM 8362   H HD12 . ILE A 1 536 ? -6.171  -19.090 -12.944 1.00 0.00 ? 536 ILE A HD12 1  
ATOM 8363   H HD13 . ILE A 1 536 ? -5.625  -19.435 -14.586 1.00 0.00 ? 536 ILE A HD13 1  
ATOM 8364   N N    . ILE A 1 537 ? -9.732  -22.994 -10.777 1.00 0.00 ? 537 ILE A N    1  
ATOM 8365   C CA   . ILE A 1 537 ? -9.894  -23.963 -9.697  1.00 0.00 ? 537 ILE A CA   1  
ATOM 8366   C C    . ILE A 1 537 ? -11.033 -24.855 -10.043 1.00 0.00 ? 537 ILE A C    1  
ATOM 8367   O O    . ILE A 1 537 ? -10.917 -26.079 -9.966  1.00 0.00 ? 537 ILE A O    1  
ATOM 8368   C CB   . ILE A 1 537 ? -10.081 -23.298 -8.312  1.00 0.00 ? 537 ILE A CB   1  
ATOM 8369   C CG1  . ILE A 1 537 ? -8.756  -22.591 -7.915  1.00 0.00 ? 537 ILE A CG1  1  
ATOM 8370   C CG2  . ILE A 1 537 ? -10.502 -24.350 -7.299  1.00 0.00 ? 537 ILE A CG2  1  
ATOM 8371   C CD1  . ILE A 1 537 ? -8.789  -21.660 -6.730  1.00 0.00 ? 537 ILE A CD1  1  
ATOM 8372   H H    . ILE A 1 537 ? -9.917  -22.047 -10.606 1.00 0.00 ? 537 ILE A H    1  
ATOM 8373   H HA   . ILE A 1 537 ? -8.999  -24.570 -9.662  1.00 0.00 ? 537 ILE A HA   1  
ATOM 8374   H HB   . ILE A 1 537 ? -10.866 -22.558 -8.388  1.00 0.00 ? 537 ILE A HB   1  
ATOM 8375   H HG12 . ILE A 1 537 ? -8.026  -23.354 -7.703  1.00 0.00 ? 537 ILE A HG12 1  
ATOM 8376   H HG13 . ILE A 1 537 ? -8.411  -22.034 -8.777  1.00 0.00 ? 537 ILE A HG13 1  
ATOM 8377   H HG21 . ILE A 1 537 ? -9.936  -25.255 -7.464  1.00 0.00 ? 537 ILE A HG21 1  
ATOM 8378   H HG22 . ILE A 1 537 ? -11.556 -24.559 -7.414  1.00 0.00 ? 537 ILE A HG22 1  
ATOM 8379   H HG23 . ILE A 1 537 ? -10.314 -23.984 -6.300  1.00 0.00 ? 537 ILE A HG23 1  
ATOM 8380   H HD11 . ILE A 1 537 ? -7.781  -21.384 -6.460  1.00 0.00 ? 537 ILE A HD11 1  
ATOM 8381   H HD12 . ILE A 1 537 ? -9.264  -22.157 -5.896  1.00 0.00 ? 537 ILE A HD12 1  
ATOM 8382   H HD13 . ILE A 1 537 ? -9.348  -20.772 -6.986  1.00 0.00 ? 537 ILE A HD13 1  
ATOM 8383   N N    . ARG A 1 538 ? -12.109 -24.240 -10.506 1.00 0.00 ? 538 ARG A N    1  
ATOM 8384   C CA   . ARG A 1 538 ? -13.304 -24.987 -10.813 1.00 0.00 ? 538 ARG A CA   1  
ATOM 8385   C C    . ARG A 1 538 ? -13.137 -25.996 -11.965 1.00 0.00 ? 538 ARG A C    1  
ATOM 8386   O O    . ARG A 1 538 ? -13.949 -26.931 -12.094 1.00 0.00 ? 538 ARG A O    1  
ATOM 8387   C CB   . ARG A 1 538 ? -14.447 -24.034 -11.055 1.00 0.00 ? 538 ARG A CB   1  
ATOM 8388   C CG   . ARG A 1 538 ? -14.858 -23.293 -9.814  1.00 0.00 ? 538 ARG A CG   1  
ATOM 8389   C CD   . ARG A 1 538 ? -16.039 -22.404 -10.111 1.00 0.00 ? 538 ARG A CD   1  
ATOM 8390   N NE   . ARG A 1 538 ? -17.216 -23.187 -10.509 1.00 0.00 ? 538 ARG A NE   1  
ATOM 8391   C CZ   . ARG A 1 538 ? -17.988 -23.861 -9.652  1.00 0.00 ? 538 ARG A CZ   1  
ATOM 8392   N NH1  . ARG A 1 538 ? -17.724 -23.848 -8.344  1.00 0.00 ? 538 ARG A NH1  1  
ATOM 8393   N NH2  . ARG A 1 538 ? -19.032 -24.540 -10.097 1.00 0.00 ? 538 ARG A NH2  1  
ATOM 8394   H H    . ARG A 1 538 ? -12.109 -23.264 -10.597 1.00 0.00 ? 538 ARG A H    1  
ATOM 8395   H HA   . ARG A 1 538 ? -13.551 -25.559 -9.930  1.00 0.00 ? 538 ARG A HA   1  
ATOM 8396   H HB2  . ARG A 1 538 ? -14.150 -23.316 -11.804 1.00 0.00 ? 538 ARG A HB2  1  
ATOM 8397   H HB3  . ARG A 1 538 ? -15.294 -24.594 -11.427 1.00 0.00 ? 538 ARG A HB3  1  
ATOM 8398   H HG2  . ARG A 1 538 ? -15.127 -24.003 -9.046  1.00 0.00 ? 538 ARG A HG2  1  
ATOM 8399   H HG3  . ARG A 1 538 ? -14.034 -22.687 -9.469  1.00 0.00 ? 538 ARG A HG3  1  
ATOM 8400   H HD2  . ARG A 1 538 ? -16.281 -21.833 -9.228  1.00 0.00 ? 538 ARG A HD2  1  
ATOM 8401   H HD3  . ARG A 1 538 ? -15.777 -21.725 -10.909 1.00 0.00 ? 538 ARG A HD3  1  
ATOM 8402   H HE   . ARG A 1 538 ? -17.449 -23.216 -11.460 1.00 0.00 ? 538 ARG A HE   1  
ATOM 8403   H HH11 . ARG A 1 538 ? -16.942 -23.330 -7.997  1.00 0.00 ? 538 ARG A HH11 1  
ATOM 8404   H HH12 . ARG A 1 538 ? -18.307 -24.356 -7.711  1.00 0.00 ? 538 ARG A HH12 1  
ATOM 8405   H HH21 . ARG A 1 538 ? -19.244 -24.549 -11.075 1.00 0.00 ? 538 ARG A HH21 1  
ATOM 8406   H HH22 . ARG A 1 538 ? -19.610 -25.046 -9.456  1.00 0.00 ? 538 ARG A HH22 1  
ATOM 8407   N N    . ASN A 1 539 ? -12.064 -25.832 -12.746 1.00 0.00 ? 539 ASN A N    1  
ATOM 8408   C CA   . ASN A 1 539 ? -11.836 -26.596 -13.982 1.00 0.00 ? 539 ASN A CA   1  
ATOM 8409   C C    . ASN A 1 539 ? -10.610 -27.516 -13.908 1.00 0.00 ? 539 ASN A C    1  
ATOM 8410   O O    . ASN A 1 539 ? -10.183 -28.118 -14.892 1.00 0.00 ? 539 ASN A O    1  
ATOM 8411   C CB   . ASN A 1 539 ? -11.766 -25.643 -15.182 1.00 0.00 ? 539 ASN A CB   1  
ATOM 8412   C CG   . ASN A 1 539 ? -13.087 -24.863 -15.391 1.00 0.00 ? 539 ASN A CG   1  
ATOM 8413   O OD1  . ASN A 1 539 ? -14.192 -25.425 -15.259 1.00 0.00 ? 539 ASN A OD1  1  
ATOM 8414   N ND2  . ASN A 1 539 ? -12.976 -23.568 -15.688 1.00 0.00 ? 539 ASN A ND2  1  
ATOM 8415   H H    . ASN A 1 539 ? -11.454 -25.093 -12.542 1.00 0.00 ? 539 ASN A H    1  
ATOM 8416   H HA   . ASN A 1 539 ? -12.699 -27.230 -14.126 1.00 0.00 ? 539 ASN A HA   1  
ATOM 8417   H HB2  . ASN A 1 539 ? -10.966 -24.936 -15.021 1.00 0.00 ? 539 ASN A HB2  1  
ATOM 8418   H HB3  . ASN A 1 539 ? -11.553 -26.217 -16.072 1.00 0.00 ? 539 ASN A HB3  1  
ATOM 8419   H HD21 . ASN A 1 539 ? -12.090 -23.157 -15.763 1.00 0.00 ? 539 ASN A HD21 1  
ATOM 8420   H HD22 . ASN A 1 539 ? -13.781 -23.028 -15.831 1.00 0.00 ? 539 ASN A HD22 1  
ATOM 8421   N N    . THR A 1 540 ? -10.054 -27.634 -12.711 1.00 0.00 ? 540 THR A N    1  
ATOM 8422   C CA   . THR A 1 540 ? -8.923  -28.515 -12.495 1.00 0.00 ? 540 THR A CA   1  
ATOM 8423   C C    . THR A 1 540 ? -9.451  -29.743 -11.874 1.00 0.00 ? 540 THR A C    1  
ATOM 8424   O O    . THR A 1 540 ? -10.533 -29.755 -11.307 1.00 0.00 ? 540 THR A O    1  
ATOM 8425   C CB   . THR A 1 540 ? -7.929  -27.923 -11.497 1.00 0.00 ? 540 THR A CB   1  
ATOM 8426   O OG1  . THR A 1 540 ? -7.449  -26.674 -12.005 1.00 0.00 ? 540 THR A OG1  1  
ATOM 8427   C CG2  . THR A 1 540 ? -6.756  -28.827 -11.339 1.00 0.00 ? 540 THR A CG2  1  
ATOM 8428   H H    . THR A 1 540 ? -10.436 -27.146 -11.952 1.00 0.00 ? 540 THR A H    1  
ATOM 8429   H HA   . THR A 1 540 ? -8.430  -28.740 -13.428 1.00 0.00 ? 540 THR A HA   1  
ATOM 8430   H HB   . THR A 1 540 ? -8.408  -27.774 -10.542 1.00 0.00 ? 540 THR A HB   1  
ATOM 8431   H HG1  . THR A 1 540 ? -6.710  -26.396 -11.460 1.00 0.00 ? 540 THR A HG1  1  
ATOM 8432   H HG21 . THR A 1 540 ? -6.681  -29.474 -12.200 1.00 0.00 ? 540 THR A HG21 1  
ATOM 8433   H HG22 . THR A 1 540 ? -6.881  -29.426 -10.447 1.00 0.00 ? 540 THR A HG22 1  
ATOM 8434   H HG23 . THR A 1 540 ? -5.856  -28.238 -11.253 1.00 0.00 ? 540 THR A HG23 1  
ATOM 8435   N N    . ASN A 1 541 ? -8.674  -30.792 -12.006 1.00 0.00 ? 541 ASN A N    1  
ATOM 8436   C CA   . ASN A 1 541 ? -8.818  -31.916 -11.161 1.00 0.00 ? 541 ASN A CA   1  
ATOM 8437   C C    . ASN A 1 541 ? -7.734  -31.817 -10.064 1.00 0.00 ? 541 ASN A C    1  
ATOM 8438   O O    . ASN A 1 541 ? -6.527  -31.660 -10.342 1.00 0.00 ? 541 ASN A O    1  
ATOM 8439   C CB   . ASN A 1 541 ? -8.716  -33.192 -11.989 1.00 0.00 ? 541 ASN A CB   1  
ATOM 8440   C CG   . ASN A 1 541 ? -8.899  -34.410 -11.144 1.00 0.00 ? 541 ASN A CG   1  
ATOM 8441   O OD1  . ASN A 1 541 ? -8.030  -34.733 -10.319 1.00 0.00 ? 541 ASN A OD1  1  
ATOM 8442   N ND2  . ASN A 1 541 ? -10.053 -35.070 -11.279 1.00 0.00 ? 541 ASN A ND2  1  
ATOM 8443   H H    . ASN A 1 541 ? -7.833  -30.687 -12.497 1.00 0.00 ? 541 ASN A H    1  
ATOM 8444   H HA   . ASN A 1 541 ? -9.792  -31.877 -10.692 1.00 0.00 ? 541 ASN A HA   1  
ATOM 8445   H HB2  . ASN A 1 541 ? -9.478  -33.178 -12.754 1.00 0.00 ? 541 ASN A HB2  1  
ATOM 8446   H HB3  . ASN A 1 541 ? -7.744  -33.229 -12.461 1.00 0.00 ? 541 ASN A HB3  1  
ATOM 8447   H HD21 . ASN A 1 541 ? -10.731 -34.748 -11.910 1.00 0.00 ? 541 ASN A HD21 1  
ATOM 8448   H HD22 . ASN A 1 541 ? -10.222 -35.876 -10.747 1.00 0.00 ? 541 ASN A HD22 1  
ATOM 8449   N N    . PHE A 1 542 ? -8.155  -31.925 -8.813  1.00 0.00 ? 542 PHE A N    1  
ATOM 8450   C CA   . PHE A 1 542 ? -7.224  -31.743 -7.700  1.00 0.00 ? 542 PHE A CA   1  
ATOM 8451   C C    . PHE A 1 542 ? -6.112  -32.786 -7.670  1.00 0.00 ? 542 PHE A C    1  
ATOM 8452   O O    . PHE A 1 542 ? -4.948  -32.465 -7.409  1.00 0.00 ? 542 PHE A O    1  
ATOM 8453   C CB   . PHE A 1 542 ? -7.954  -31.702 -6.364  1.00 0.00 ? 542 PHE A CB   1  
ATOM 8454   C CG   . PHE A 1 542 ? -7.035  -31.735 -5.167  1.00 0.00 ? 542 PHE A CG   1  
ATOM 8455   C CD1  . PHE A 1 542 ? -6.291  -30.584 -4.788  1.00 0.00 ? 542 PHE A CD1  1  
ATOM 8456   C CD2  . PHE A 1 542 ? -6.922  -32.899 -4.387  1.00 0.00 ? 542 PHE A CD2  1  
ATOM 8457   C CE1  . PHE A 1 542 ? -5.435  -30.604 -3.659  1.00 0.00 ? 542 PHE A CE1  1  
ATOM 8458   C CE2  . PHE A 1 542 ? -6.065  -32.934 -3.257  1.00 0.00 ? 542 PHE A CE2  1  
ATOM 8459   C CZ   . PHE A 1 542 ? -5.320  -31.783 -2.896  1.00 0.00 ? 542 PHE A CZ   1  
ATOM 8460   H H    . PHE A 1 542 ? -9.109  -32.060 -8.631  1.00 0.00 ? 542 PHE A H    1  
ATOM 8461   H HA   . PHE A 1 542 ? -6.752  -30.780 -7.837  1.00 0.00 ? 542 PHE A HA   1  
ATOM 8462   H HB2  . PHE A 1 542 ? -8.540  -30.797 -6.319  1.00 0.00 ? 542 PHE A HB2  1  
ATOM 8463   H HB3  . PHE A 1 542 ? -8.624  -32.549 -6.313  1.00 0.00 ? 542 PHE A HB3  1  
ATOM 8464   H HD1  . PHE A 1 542 ? -6.370  -29.684 -5.379  1.00 0.00 ? 542 PHE A HD1  1  
ATOM 8465   H HD2  . PHE A 1 542 ? -7.487  -33.779 -4.656  1.00 0.00 ? 542 PHE A HD2  1  
ATOM 8466   H HE1  . PHE A 1 542 ? -4.877  -29.721 -3.384  1.00 0.00 ? 542 PHE A HE1  1  
ATOM 8467   H HE2  . PHE A 1 542 ? -5.978  -33.839 -2.674  1.00 0.00 ? 542 PHE A HE2  1  
ATOM 8468   H HZ   . PHE A 1 542 ? -4.670  -31.808 -2.034  1.00 0.00 ? 542 PHE A HZ   1  
ATOM 8469   N N    . GLU A 1 543 ? -6.459  -34.031 -7.942  1.00 0.00 ? 543 GLU A N    1  
ATOM 8470   C CA   . GLU A 1 543 ? -5.451  -35.075 -7.902  1.00 0.00 ? 543 GLU A CA   1  
ATOM 8471   C C    . GLU A 1 543 ? -4.335  -34.829 -8.898  1.00 0.00 ? 543 GLU A C    1  
ATOM 8472   O O    . GLU A 1 543 ? -3.151  -35.074 -8.611  1.00 0.00 ? 543 GLU A O    1  
ATOM 8473   C CB   . GLU A 1 543 ? -6.083  -36.450 -8.134  1.00 0.00 ? 543 GLU A CB   1  
ATOM 8474   C CG   . GLU A 1 543 ? -6.942  -36.892 -6.944  1.00 0.00 ? 543 GLU A CG   1  
ATOM 8475   C CD   . GLU A 1 543 ? -6.194  -36.979 -5.589  1.00 0.00 ? 543 GLU A CD   1  
ATOM 8476   O OE1  . GLU A 1 543 ? -5.095  -37.594 -5.481  1.00 0.00 ? 543 GLU A OE1  1  
ATOM 8477   O OE2  . GLU A 1 543 ? -6.730  -36.414 -4.617  1.00 0.00 ? 543 GLU A OE2  1  
ATOM 8478   H H    . GLU A 1 543 ? -7.391  -34.251 -8.150  1.00 0.00 ? 543 GLU A H    1  
ATOM 8479   H HA   . GLU A 1 543 ? -5.016  -35.075 -6.913  1.00 0.00 ? 543 GLU A HA   1  
ATOM 8480   H HB2  . GLU A 1 543 ? -6.703  -36.407 -9.017  1.00 0.00 ? 543 GLU A HB2  1  
ATOM 8481   H HB3  . GLU A 1 543 ? -5.298  -37.175 -8.291  1.00 0.00 ? 543 GLU A HB3  1  
ATOM 8482   H HG2  . GLU A 1 543 ? -7.755  -36.192 -6.833  1.00 0.00 ? 543 GLU A HG2  1  
ATOM 8483   H HG3  . GLU A 1 543 ? -7.358  -37.864 -7.170  1.00 0.00 ? 543 GLU A HG3  1  
ATOM 8484   N N    . ASP A 1 544 ? -4.727  -34.333 -10.069 1.00 0.00 ? 544 ASP A N    1  
ATOM 8485   C CA   . ASP A 1 544 ? -3.790  -34.062 -11.139 1.00 0.00 ? 544 ASP A CA   1  
ATOM 8486   C C    . ASP A 1 544 ? -2.805  -32.967 -10.749 1.00 0.00 ? 544 ASP A C    1  
ATOM 8487   O O    . ASP A 1 544 ? -1.610  -33.133 -10.921 1.00 0.00 ? 544 ASP A O    1  
ATOM 8488   C CB   . ASP A 1 544 ? -4.564  -33.748 -12.422 1.00 0.00 ? 544 ASP A CB   1  
ATOM 8489   C CG   . ASP A 1 544 ? -5.264  -34.993 -13.013 1.00 0.00 ? 544 ASP A CG   1  
ATOM 8490   O OD1  . ASP A 1 544 ? -4.966  -36.164 -12.606 1.00 0.00 ? 544 ASP A OD1  1  
ATOM 8491   O OD2  . ASP A 1 544 ? -6.117  -34.776 -13.896 1.00 0.00 ? 544 ASP A OD2  1  
ATOM 8492   H H    . ASP A 1 544 ? -5.680  -34.160 -10.217 1.00 0.00 ? 544 ASP A H    1  
ATOM 8493   H HA   . ASP A 1 544 ? -3.221  -34.965 -11.311 1.00 0.00 ? 544 ASP A HA   1  
ATOM 8494   H HB2  . ASP A 1 544 ? -5.311  -32.999 -12.205 1.00 0.00 ? 544 ASP A HB2  1  
ATOM 8495   H HB3  . ASP A 1 544 ? -3.877  -33.351 -13.155 1.00 0.00 ? 544 ASP A HB3  1  
ATOM 8496   N N    . ALA A 1 545 ? -3.333  -31.879 -10.191 1.00 0.00 ? 545 ALA A N    1  
ATOM 8497   C CA   . ALA A 1 545 ? -2.578  -30.809 -9.594  1.00 0.00 ? 545 ALA A CA   1  
ATOM 8498   C C    . ALA A 1 545 ? -1.575  -31.268 -8.562  1.00 0.00 ? 545 ALA A C    1  
ATOM 8499   O O    . ALA A 1 545 ? -0.428  -30.788 -8.602  1.00 0.00 ? 545 ALA A O    1  
ATOM 8500   C CB   . ALA A 1 545 ? -3.507  -29.823 -8.983  1.00 0.00 ? 545 ALA A CB   1  
ATOM 8501   H H    . ALA A 1 545 ? -4.306  -31.860 -10.077 1.00 0.00 ? 545 ALA A H    1  
ATOM 8502   H HA   . ALA A 1 545 ? -2.038  -30.306 -10.381 1.00 0.00 ? 545 ALA A HA   1  
ATOM 8503   H HB1  . ALA A 1 545 ? -4.173  -30.330 -8.300  1.00 0.00 ? 545 ALA A HB1  1  
ATOM 8504   H HB2  . ALA A 1 545 ? -4.084  -29.343 -9.760  1.00 0.00 ? 545 ALA A HB2  1  
ATOM 8505   H HB3  . ALA A 1 545 ? -2.940  -29.079 -8.444  1.00 0.00 ? 545 ALA A HB3  1  
ATOM 8506   N N    . LYS A 1 546 ? -1.968  -32.158 -7.634  1.00 0.00 ? 546 LYS A N    1  
ATOM 8507   C CA   . LYS A 1 546 ? -0.986  -32.697 -6.684  1.00 0.00 ? 546 LYS A CA   1  
ATOM 8508   C C    . LYS A 1 546 ? 0.198   -33.227 -7.478  1.00 0.00 ? 546 LYS A C    1  
ATOM 8509   O O    . LYS A 1 546 ? 1.327   -32.778 -7.315  1.00 0.00 ? 546 LYS A O    1  
ATOM 8510   C CB   . LYS A 1 546 ? -1.546  -33.809 -5.820  1.00 0.00 ? 546 LYS A CB   1  
ATOM 8511   C CG   . LYS A 1 546 ? -2.343  -33.343 -4.643  1.00 0.00 ? 546 LYS A CG   1  
ATOM 8512   C CD   . LYS A 1 546 ? -3.033  -34.483 -3.899  1.00 0.00 ? 546 LYS A CD   1  
ATOM 8513   C CE   . LYS A 1 546 ? -2.018  -35.369 -3.171  1.00 0.00 ? 546 LYS A CE   1  
ATOM 8514   N NZ   . LYS A 1 546 ? -2.708  -36.358 -2.274  1.00 0.00 ? 546 LYS A NZ   1  
ATOM 8515   H H    . LYS A 1 546 ? -2.888  -32.496 -7.635  1.00 0.00 ? 546 LYS A H    1  
ATOM 8516   H HA   . LYS A 1 546 ? -0.644  -31.893 -6.047  1.00 0.00 ? 546 LYS A HA   1  
ATOM 8517   H HB2  . LYS A 1 546 ? -2.181  -34.430 -6.432  1.00 0.00 ? 546 LYS A HB2  1  
ATOM 8518   H HB3  . LYS A 1 546 ? -0.721  -34.411 -5.464  1.00 0.00 ? 546 LYS A HB3  1  
ATOM 8519   H HG2  . LYS A 1 546 ? -1.684  -32.831 -3.958  1.00 0.00 ? 546 LYS A HG2  1  
ATOM 8520   H HG3  . LYS A 1 546 ? -3.093  -32.646 -4.987  1.00 0.00 ? 546 LYS A HG3  1  
ATOM 8521   H HD2  . LYS A 1 546 ? -3.721  -34.068 -3.177  1.00 0.00 ? 546 LYS A HD2  1  
ATOM 8522   H HD3  . LYS A 1 546 ? -3.585  -35.085 -4.607  1.00 0.00 ? 546 LYS A HD3  1  
ATOM 8523   H HE2  . LYS A 1 546 ? -1.429  -35.905 -3.900  1.00 0.00 ? 546 LYS A HE2  1  
ATOM 8524   H HE3  . LYS A 1 546 ? -1.365  -34.746 -2.578  1.00 0.00 ? 546 LYS A HE3  1  
ATOM 8525   H HZ1  . LYS A 1 546 ? -2.762  -35.974 -1.310  1.00 0.00 ? 546 LYS A HZ1  1  
ATOM 8526   H HZ2  . LYS A 1 546 ? -2.171  -37.249 -2.263  1.00 0.00 ? 546 LYS A HZ2  1  
ATOM 8527   H HZ3  . LYS A 1 546 ? -3.669  -36.536 -2.629  1.00 0.00 ? 546 LYS A HZ3  1  
ATOM 8528   N N    . VAL A 1 547 ? -0.064  -34.164 -8.368  1.00 0.00 ? 547 VAL A N    1  
ATOM 8529   C CA   . VAL A 1 547 ? 0.997   -34.721 -9.221  1.00 0.00 ? 547 VAL A CA   1  
ATOM 8530   C C    . VAL A 1 547 ? 1.806   -33.593 -9.877  1.00 0.00 ? 547 VAL A C    1  
ATOM 8531   O O    . VAL A 1 547 ? 3.041   -33.670 -9.957  1.00 0.00 ? 547 VAL A O    1  
ATOM 8532   C CB   . VAL A 1 547 ? 0.407   -35.699 -10.301 1.00 0.00 ? 547 VAL A CB   1  
ATOM 8533   C CG1  . VAL A 1 547 ? 1.436   -36.073 -11.295 1.00 0.00 ? 547 VAL A CG1  1  
ATOM 8534   C CG2  . VAL A 1 547 ? -0.225  -36.962 -9.631  1.00 0.00 ? 547 VAL A CG2  1  
ATOM 8535   H H    . VAL A 1 547 ? -0.986  -34.476 -8.482  1.00 0.00 ? 547 VAL A H    1  
ATOM 8536   H HA   . VAL A 1 547 ? 1.668   -35.286 -8.589  1.00 0.00 ? 547 VAL A HA   1  
ATOM 8537   H HB   . VAL A 1 547 ? -0.378  -35.172 -10.826 1.00 0.00 ? 547 VAL A HB   1  
ATOM 8538   H HG11 . VAL A 1 547 ? 2.342   -36.363 -10.785 1.00 0.00 ? 547 VAL A HG11 1  
ATOM 8539   H HG12 . VAL A 1 547 ? 1.639   -35.228 -11.938 1.00 0.00 ? 547 VAL A HG12 1  
ATOM 8540   H HG13 . VAL A 1 547 ? 1.079   -36.901 -11.889 1.00 0.00 ? 547 VAL A HG13 1  
ATOM 8541   H HG21 . VAL A 1 547 ? -1.175  -37.179 -10.097 1.00 0.00 ? 547 VAL A HG21 1  
ATOM 8542   H HG22 . VAL A 1 547 ? -0.375  -36.774 -8.578  1.00 0.00 ? 547 VAL A HG22 1  
ATOM 8543   H HG23 . VAL A 1 547 ? 0.440   -37.805 -9.754  1.00 0.00 ? 547 VAL A HG23 1  
ATOM 8544   N N    . LEU A 1 548 ? 1.110   -32.552 -10.351 1.00 0.00 ? 548 LEU A N    1  
ATOM 8545   C CA   . LEU A 1 548 ? 1.785   -31.460 -10.996 1.00 0.00 ? 548 LEU A CA   1  
ATOM 8546   C C    . LEU A 1 548 ? 2.712   -30.845 -9.981  1.00 0.00 ? 548 LEU A C    1  
ATOM 8547   O O    . LEU A 1 548 ? 3.892   -30.663 -10.264 1.00 0.00 ? 548 LEU A O    1  
ATOM 8548   C CB   . LEU A 1 548 ? 0.790   -30.407 -11.447 1.00 0.00 ? 548 LEU A CB   1  
ATOM 8549   C CG   . LEU A 1 548 ? 1.347   -29.140 -12.104 1.00 0.00 ? 548 LEU A CG   1  
ATOM 8550   C CD1  . LEU A 1 548 ? 2.036   -29.412 -13.416 1.00 0.00 ? 548 LEU A CD1  1  
ATOM 8551   C CD2  . LEU A 1 548 ? 0.179   -28.275 -12.359 1.00 0.00 ? 548 LEU A CD2  1  
ATOM 8552   H H    . LEU A 1 548 ? 0.134   -32.540 -10.268 1.00 0.00 ? 548 LEU A H    1  
ATOM 8553   H HA   . LEU A 1 548 ? 2.349   -31.821 -11.843 1.00 0.00 ? 548 LEU A HA   1  
ATOM 8554   H HB2  . LEU A 1 548 ? 0.118   -30.868 -12.152 1.00 0.00 ? 548 LEU A HB2  1  
ATOM 8555   H HB3  . LEU A 1 548 ? 0.209   -30.112 -10.583 1.00 0.00 ? 548 LEU A HB3  1  
ATOM 8556   H HG   . LEU A 1 548 ? 2.024   -28.641 -11.429 1.00 0.00 ? 548 LEU A HG   1  
ATOM 8557   H HD11 . LEU A 1 548 ? 2.872   -30.076 -13.253 1.00 0.00 ? 548 LEU A HD11 1  
ATOM 8558   H HD12 . LEU A 1 548 ? 2.391   -28.481 -13.835 1.00 0.00 ? 548 LEU A HD12 1  
ATOM 8559   H HD13 . LEU A 1 548 ? 1.339   -29.873 -14.100 1.00 0.00 ? 548 LEU A HD13 1  
ATOM 8560   H HD21 . LEU A 1 548 ? -0.274  -27.996 -11.419 1.00 0.00 ? 548 LEU A HD21 1  
ATOM 8561   H HD22 . LEU A 1 548 ? -0.540  -28.810 -12.962 1.00 0.00 ? 548 LEU A HD22 1  
ATOM 8562   H HD23 . LEU A 1 548 ? 0.497   -27.385 -12.881 1.00 0.00 ? 548 LEU A HD23 1  
ATOM 8563   N N    . ALA A 1 549 ? 2.172   -30.542 -8.788  1.00 0.00 ? 549 ALA A N    1  
ATOM 8564   C CA   . ALA A 1 549 ? 2.894   -29.813 -7.767  1.00 0.00 ? 549 ALA A CA   1  
ATOM 8565   C C    . ALA A 1 549 ? 4.127   -30.575 -7.400  1.00 0.00 ? 549 ALA A C    1  
ATOM 8566   O O    . ALA A 1 549 ? 5.266   -30.059 -7.371  1.00 0.00 ? 549 ALA A O    1  
ATOM 8567   C CB   . ALA A 1 549 ? 2.025   -29.630 -6.540  1.00 0.00 ? 549 ALA A CB   1  
ATOM 8568   H H    . ALA A 1 549 ? 1.222   -30.735 -8.642  1.00 0.00 ? 549 ALA A H    1  
ATOM 8569   H HA   . ALA A 1 549 ? 3.174   -28.844 -8.151  1.00 0.00 ? 549 ALA A HA   1  
ATOM 8570   H HB1  . ALA A 1 549 ? 1.442   -30.524 -6.375  1.00 0.00 ? 549 ALA A HB1  1  
ATOM 8571   H HB2  . ALA A 1 549 ? 1.362   -28.790 -6.691  1.00 0.00 ? 549 ALA A HB2  1  
ATOM 8572   H HB3  . ALA A 1 549 ? 2.651   -29.445 -5.680  1.00 0.00 ? 549 ALA A HB3  1  
ATOM 8573   N N    . GLU A 1 550 ? 3.916   -31.838 -7.144  1.00 0.00 ? 550 GLU A N    1  
ATOM 8574   C CA   . GLU A 1 550 ? 5.026   -32.608 -6.781  1.00 0.00 ? 550 GLU A CA   1  
ATOM 8575   C C    . GLU A 1 550 ? 6.151   -32.489 -7.847  1.00 0.00 ? 550 GLU A C    1  
ATOM 8576   O O    . GLU A 1 550 ? 7.307   -32.098 -7.522  1.00 0.00 ? 550 GLU A O    1  
ATOM 8577   C CB   . GLU A 1 550 ? 4.609   -34.007 -6.539  1.00 0.00 ? 550 GLU A CB   1  
ATOM 8578   C CG   . GLU A 1 550 ? 5.768   -34.793 -6.102  1.00 0.00 ? 550 GLU A CG   1  
ATOM 8579   C CD   . GLU A 1 550 ? 5.395   -36.198 -5.715  1.00 0.00 ? 550 GLU A CD   1  
ATOM 8580   O OE1  . GLU A 1 550 ? 4.164   -36.583 -5.789  1.00 0.00 ? 550 GLU A OE1  1  
ATOM 8581   O OE2  . GLU A 1 550 ? 6.366   -36.896 -5.340  1.00 0.00 ? 550 GLU A OE2  1  
ATOM 8582   H H    . GLU A 1 550 ? 3.018   -32.227 -7.195  1.00 0.00 ? 550 GLU A H    1  
ATOM 8583   H HA   . GLU A 1 550 ? 5.412   -32.210 -5.852  1.00 0.00 ? 550 GLU A HA   1  
ATOM 8584   H HB2  . GLU A 1 550 ? 3.849   -34.029 -5.772  1.00 0.00 ? 550 GLU A HB2  1  
ATOM 8585   H HB3  . GLU A 1 550 ? 4.213   -34.428 -7.451  1.00 0.00 ? 550 GLU A HB3  1  
ATOM 8586   H HG2  . GLU A 1 550 ? 6.487   -34.833 -6.907  1.00 0.00 ? 550 GLU A HG2  1  
ATOM 8587   H HG3  . GLU A 1 550 ? 6.221   -34.304 -5.252  1.00 0.00 ? 550 GLU A HG3  1  
ATOM 8588   N N    . GLN A 1 551 ? 5.818   -32.754 -9.105  1.00 0.00 ? 551 GLN A N    1  
ATOM 8589   C CA   . GLN A 1 551 ? 6.823   -32.650 -10.129 1.00 0.00 ? 551 GLN A CA   1  
ATOM 8590   C C    . GLN A 1 551 ? 7.545   -31.292 -10.006 1.00 0.00 ? 551 GLN A C    1  
ATOM 8591   O O    . GLN A 1 551 ? 8.799   -31.240 -9.914  1.00 0.00 ? 551 GLN A O    1  
ATOM 8592   C CB   . GLN A 1 551 ? 6.209   -32.813 -11.494 1.00 0.00 ? 551 GLN A CB   1  
ATOM 8593   C CG   . GLN A 1 551 ? 5.764   -34.214 -11.734 1.00 0.00 ? 551 GLN A CG   1  
ATOM 8594   C CD   . GLN A 1 551 ? 4.966   -34.346 -13.001 1.00 0.00 ? 551 GLN A CD   1  
ATOM 8595   O OE1  . GLN A 1 551 ? 4.287   -33.398 -13.413 1.00 0.00 ? 551 GLN A OE1  1  
ATOM 8596   N NE2  . GLN A 1 551 ? 5.033   -35.531 -13.638 1.00 0.00 ? 551 GLN A NE2  1  
ATOM 8597   H H    . GLN A 1 551 ? 4.900   -33.011 -9.333  1.00 0.00 ? 551 GLN A H    1  
ATOM 8598   H HA   . GLN A 1 551 ? 7.548   -33.438 -9.978  1.00 0.00 ? 551 GLN A HA   1  
ATOM 8599   H HB2  . GLN A 1 551 ? 5.357   -32.155 -11.578 1.00 0.00 ? 551 GLN A HB2  1  
ATOM 8600   H HB3  . GLN A 1 551 ? 6.939   -32.540 -12.243 1.00 0.00 ? 551 GLN A HB3  1  
ATOM 8601   H HG2  . GLN A 1 551 ? 6.633   -34.851 -11.800 1.00 0.00 ? 551 GLN A HG2  1  
ATOM 8602   H HG3  . GLN A 1 551 ? 5.156   -34.535 -10.900 1.00 0.00 ? 551 GLN A HG3  1  
ATOM 8603   H HE21 . GLN A 1 551 ? 5.583   -36.255 -13.271 1.00 0.00 ? 551 GLN A HE21 1  
ATOM 8604   H HE22 . GLN A 1 551 ? 4.532   -35.670 -14.469 1.00 0.00 ? 551 GLN A HE22 1  
ATOM 8605   N N    . ALA A 1 552 ? 6.755   -30.214 -9.952  1.00 0.00 ? 552 ALA A N    1  
ATOM 8606   C CA   . ALA A 1 552 ? 7.307   -28.883 -10.030 1.00 0.00 ? 552 ALA A CA   1  
ATOM 8607   C C    . ALA A 1 552 ? 8.326   -28.669 -8.929  1.00 0.00 ? 552 ALA A C    1  
ATOM 8608   O O    . ALA A 1 552 ? 9.375   -28.050 -9.147  1.00 0.00 ? 552 ALA A O    1  
ATOM 8609   C CB   . ALA A 1 552 ? 6.221   -27.865 -9.947  1.00 0.00 ? 552 ALA A CB   1  
ATOM 8610   H H    . ALA A 1 552 ? 5.783   -30.331 -9.990  1.00 0.00 ? 552 ALA A H    1  
ATOM 8611   H HA   . ALA A 1 552 ? 7.806   -28.776 -10.982 1.00 0.00 ? 552 ALA A HA   1  
ATOM 8612   H HB1  . ALA A 1 552 ? 5.275   -28.327 -10.186 1.00 0.00 ? 552 ALA A HB1  1  
ATOM 8613   H HB2  . ALA A 1 552 ? 6.420   -27.068 -10.649 1.00 0.00 ? 552 ALA A HB2  1  
ATOM 8614   H HB3  . ALA A 1 552 ? 6.181   -27.462 -8.946  1.00 0.00 ? 552 ALA A HB3  1  
ATOM 8615   N N    . LEU A 1 553 ? 8.020   -29.223 -7.752  1.00 0.00 ? 553 LEU A N    1  
ATOM 8616   C CA   . LEU A 1 553 ? 8.883   -29.068 -6.581  1.00 0.00 ? 553 LEU A CA   1  
ATOM 8617   C C    . LEU A 1 553 ? 10.233  -29.758 -6.702  1.00 0.00 ? 553 LEU A C    1  
ATOM 8618   O O    . LEU A 1 553 ? 11.149  -29.464 -5.899  1.00 0.00 ? 553 LEU A O    1  
ATOM 8619   C CB   . LEU A 1 553 ? 8.183   -29.479 -5.281  1.00 0.00 ? 553 LEU A CB   1  
ATOM 8620   C CG   . LEU A 1 553 ? 6.952   -28.625 -4.902  1.00 0.00 ? 553 LEU A CG   1  
ATOM 8621   C CD1  . LEU A 1 553 ? 6.302   -29.083 -3.550  1.00 0.00 ? 553 LEU A CD1  1  
ATOM 8622   C CD2  . LEU A 1 553 ? 7.232   -27.118 -4.921  1.00 0.00 ? 553 LEU A CD2  1  
ATOM 8623   H H    . LEU A 1 553 ? 7.182   -29.723 -7.664  1.00 0.00 ? 553 LEU A H    1  
ATOM 8624   H HA   . LEU A 1 553 ? 9.090   -28.010 -6.497  1.00 0.00 ? 553 LEU A HA   1  
ATOM 8625   H HB2  . LEU A 1 553 ? 7.864   -30.505 -5.377  1.00 0.00 ? 553 LEU A HB2  1  
ATOM 8626   H HB3  . LEU A 1 553 ? 8.902   -29.421 -4.476  1.00 0.00 ? 553 LEU A HB3  1  
ATOM 8627   H HG   . LEU A 1 553 ? 6.209   -28.820 -5.669  1.00 0.00 ? 553 LEU A HG   1  
ATOM 8628   H HD11 . LEU A 1 553 ? 5.311   -28.662 -3.467  1.00 0.00 ? 553 LEU A HD11 1  
ATOM 8629   H HD12 . LEU A 1 553 ? 6.909   -28.740 -2.726  1.00 0.00 ? 553 LEU A HD12 1  
ATOM 8630   H HD13 . LEU A 1 553 ? 6.240   -30.161 -3.528  1.00 0.00 ? 553 LEU A HD13 1  
ATOM 8631   H HD21 . LEU A 1 553 ? 6.479   -26.605 -4.340  1.00 0.00 ? 553 LEU A HD21 1  
ATOM 8632   H HD22 . LEU A 1 553 ? 7.207   -26.759 -5.940  1.00 0.00 ? 553 LEU A HD22 1  
ATOM 8633   H HD23 . LEU A 1 553 ? 8.206   -26.927 -4.496  1.00 0.00 ? 553 LEU A HD23 1  
ATOM 8634   N N    . ALA A 1 554 ? 10.395  -30.610 -7.706  1.00 0.00 ? 554 ALA A N    1  
ATOM 8635   C CA   . ALA A 1 554 ? 11.658  -31.292 -7.892  1.00 0.00 ? 554 ALA A CA   1  
ATOM 8636   C C    . ALA A 1 554 ? 12.538  -30.624 -8.944  1.00 0.00 ? 554 ALA A C    1  
ATOM 8637   O O    . ALA A 1 554 ? 13.713  -30.946 -9.032  1.00 0.00 ? 554 ALA A O    1  
ATOM 8638   C CB   . ALA A 1 554 ? 11.420  -32.790 -8.254  1.00 0.00 ? 554 ALA A CB   1  
ATOM 8639   H H    . ALA A 1 554 ? 9.658   -30.771 -8.332  1.00 0.00 ? 554 ALA A H    1  
ATOM 8640   H HA   . ALA A 1 554 ? 12.189  -31.264 -6.953  1.00 0.00 ? 554 ALA A HA   1  
ATOM 8641   H HB1  . ALA A 1 554 ? 10.776  -32.853 -9.119  1.00 0.00 ? 554 ALA A HB1  1  
ATOM 8642   H HB2  . ALA A 1 554 ? 10.953  -33.292 -7.420  1.00 0.00 ? 554 ALA A HB2  1  
ATOM 8643   H HB3  . ALA A 1 554 ? 12.367  -33.262 -8.473  1.00 0.00 ? 554 ALA A HB3  1  
ATOM 8644   N N    . GLN A 1 555 ? 11.976  -29.722 -9.744  1.00 0.00 ? 555 GLN A N    1  
ATOM 8645   C CA   . GLN A 1 555 ? 12.706  -29.024 -10.786 1.00 0.00 ? 555 GLN A CA   1  
ATOM 8646   C C    . GLN A 1 555 ? 13.779  -28.085 -10.200 1.00 0.00 ? 555 GLN A C    1  
ATOM 8647   O O    . GLN A 1 555 ? 13.528  -27.394 -9.230  1.00 0.00 ? 555 GLN A O    1  
ATOM 8648   C CB   . GLN A 1 555 ? 11.729  -28.247 -11.638 1.00 0.00 ? 555 GLN A CB   1  
ATOM 8649   C CG   . GLN A 1 555 ? 10.684  -29.090 -12.385 1.00 0.00 ? 555 GLN A CG   1  
ATOM 8650   C CD   . GLN A 1 555 ? 11.271  -30.354 -13.075 1.00 0.00 ? 555 GLN A CD   1  
ATOM 8651   O OE1  . GLN A 1 555 ? 10.738  -31.456 -12.936 1.00 0.00 ? 555 GLN A OE1  1  
ATOM 8652   N NE2  . GLN A 1 555 ? 12.363  -30.187 -13.801 1.00 0.00 ? 555 GLN A NE2  1  
ATOM 8653   H H    . GLN A 1 555 ? 11.024  -29.523 -9.627  1.00 0.00 ? 555 GLN A H    1  
ATOM 8654   H HA   . GLN A 1 555 ? 13.196  -29.756 -11.410 1.00 0.00 ? 555 GLN A HA   1  
ATOM 8655   H HB2  . GLN A 1 555 ? 11.205  -27.552 -11.002 1.00 0.00 ? 555 GLN A HB2  1  
ATOM 8656   H HB3  . GLN A 1 555 ? 12.294  -27.679 -12.365 1.00 0.00 ? 555 GLN A HB3  1  
ATOM 8657   H HG2  . GLN A 1 555 ? 9.929   -29.404 -11.681 1.00 0.00 ? 555 GLN A HG2  1  
ATOM 8658   H HG3  . GLN A 1 555 ? 10.216  -28.470 -13.136 1.00 0.00 ? 555 GLN A HG3  1  
ATOM 8659   H HE21 . GLN A 1 555 ? 12.764  -29.296 -13.884 1.00 0.00 ? 555 GLN A HE21 1  
ATOM 8660   H HE22 . GLN A 1 555 ? 12.770  -30.952 -14.256 1.00 0.00 ? 555 GLN A HE22 1  
ATOM 8661   N N    . PRO A 1 556 ? 15.010  -28.130 -10.721 1.00 0.00 ? 556 PRO A N    1  
ATOM 8662   C CA   . PRO A 1 556 ? 16.005  -27.169 -10.220 1.00 0.00 ? 556 PRO A CA   1  
ATOM 8663   C C    . PRO A 1 556 ? 15.938  -25.821 -10.962 1.00 0.00 ? 556 PRO A C    1  
ATOM 8664   O O    . PRO A 1 556 ? 16.746  -24.923 -10.717 1.00 0.00 ? 556 PRO A O    1  
ATOM 8665   C CB   . PRO A 1 556 ? 17.340  -27.878 -10.524 1.00 0.00 ? 556 PRO A CB   1  
ATOM 8666   C CG   . PRO A 1 556 ? 17.034  -28.623 -11.867 1.00 0.00 ? 556 PRO A CG   1  
ATOM 8667   C CD   . PRO A 1 556 ? 15.600  -29.079 -11.708 1.00 0.00 ? 556 PRO A CD   1  
ATOM 8668   H HA   . PRO A 1 556 ? 15.902  -27.028 -9.157  1.00 0.00 ? 556 PRO A HA   1  
ATOM 8669   H HB2  . PRO A 1 556 ? 18.136  -27.154 -10.651 1.00 0.00 ? 556 PRO A HB2  1  
ATOM 8670   H HB3  . PRO A 1 556 ? 17.583  -28.591 -9.753  1.00 0.00 ? 556 PRO A HB3  1  
ATOM 8671   H HG2  . PRO A 1 556 ? 17.125  -27.946 -12.707 1.00 0.00 ? 556 PRO A HG2  1  
ATOM 8672   H HG3  . PRO A 1 556 ? 17.680  -29.477 -11.989 1.00 0.00 ? 556 PRO A HG3  1  
ATOM 8673   H HD2  . PRO A 1 556 ? 15.079  -29.018 -12.654 1.00 0.00 ? 556 PRO A HD2  1  
ATOM 8674   H HD3  . PRO A 1 556 ? 15.568  -30.085 -11.320 1.00 0.00 ? 556 PRO A HD3  1  
ATOM 8675   N N    . THR A 1 557 ? 14.962  -25.661 -11.828 1.00 0.00 ? 557 THR A N    1  
ATOM 8676   C CA   . THR A 1 557 ? 14.945  -24.520 -12.713 1.00 0.00 ? 557 THR A CA   1  
ATOM 8677   C C    . THR A 1 557 ? 13.491  -24.066 -12.923 1.00 0.00 ? 557 THR A C    1  
ATOM 8678   O O    . THR A 1 557 ? 12.575  -24.882 -13.013 1.00 0.00 ? 557 THR A O    1  
ATOM 8679   C CB   . THR A 1 557 ? 15.766  -24.890 -14.013 1.00 0.00 ? 557 THR A CB   1  
ATOM 8680   O OG1  . THR A 1 557 ? 17.097  -25.260 -13.639 1.00 0.00 ? 557 THR A OG1  1  
ATOM 8681   C CG2  . THR A 1 557 ? 15.812  -23.816 -15.066 1.00 0.00 ? 557 THR A CG2  1  
ATOM 8682   H H    . THR A 1 557 ? 14.321  -26.389 -11.970 1.00 0.00 ? 557 THR A H    1  
ATOM 8683   H HA   . THR A 1 557 ? 15.465  -23.713 -12.213 1.00 0.00 ? 557 THR A HA   1  
ATOM 8684   H HB   . THR A 1 557 ? 15.299  -25.766 -14.448 1.00 0.00 ? 557 THR A HB   1  
ATOM 8685   H HG1  . THR A 1 557 ? 17.055  -25.689 -12.781 1.00 0.00 ? 557 THR A HG1  1  
ATOM 8686   H HG21 . THR A 1 557 ? 14.896  -23.245 -15.039 1.00 0.00 ? 557 THR A HG21 1  
ATOM 8687   H HG22 . THR A 1 557 ? 15.925  -24.271 -16.039 1.00 0.00 ? 557 THR A HG22 1  
ATOM 8688   H HG23 . THR A 1 557 ? 16.649  -23.161 -14.875 1.00 0.00 ? 557 THR A HG23 1  
ATOM 8689   N N    . THR A 1 558 ? 13.279  -22.759 -12.929 1.00 0.00 ? 558 THR A N    1  
ATOM 8690   C CA   . THR A 1 558 ? 11.968  -22.173 -13.167 1.00 0.00 ? 558 THR A CA   1  
ATOM 8691   C C    . THR A 1 558 ? 11.446  -22.625 -14.528 1.00 0.00 ? 558 THR A C    1  
ATOM 8692   O O    . THR A 1 558 ? 10.350  -23.155 -14.645 1.00 0.00 ? 558 THR A O    1  
ATOM 8693   C CB   . THR A 1 558 ? 12.044  -20.609 -13.095 1.00 0.00 ? 558 THR A CB   1  
ATOM 8694   O OG1  . THR A 1 558 ? 12.474  -20.205 -11.793 1.00 0.00 ? 558 THR A OG1  1  
ATOM 8695   C CG2  . THR A 1 558 ? 10.707  -19.963 -13.364 1.00 0.00 ? 558 THR A CG2  1  
ATOM 8696   H H    . THR A 1 558 ? 14.044  -22.160 -12.801 1.00 0.00 ? 558 THR A H    1  
ATOM 8697   H HA   . THR A 1 558 ? 11.289  -22.522 -12.403 1.00 0.00 ? 558 THR A HA   1  
ATOM 8698   H HB   . THR A 1 558 ? 12.759  -20.258 -13.826 1.00 0.00 ? 558 THR A HB   1  
ATOM 8699   H HG1  . THR A 1 558 ? 13.411  -20.398 -11.717 1.00 0.00 ? 558 THR A HG1  1  
ATOM 8700   H HG21 . THR A 1 558 ? 10.752  -18.917 -13.098 1.00 0.00 ? 558 THR A HG21 1  
ATOM 8701   H HG22 . THR A 1 558 ? 9.946   -20.452 -12.775 1.00 0.00 ? 558 THR A HG22 1  
ATOM 8702   H HG23 . THR A 1 558 ? 10.466  -20.056 -14.413 1.00 0.00 ? 558 THR A HG23 1  
ATOM 8703   N N    . ASP A 1 559 ? 12.250  -22.442 -15.556 1.00 0.00 ? 559 ASP A N    1  
ATOM 8704   C CA   . ASP A 1 559 ? 11.808  -22.828 -16.862 1.00 0.00 ? 559 ASP A CA   1  
ATOM 8705   C C    . ASP A 1 559 ? 11.231  -24.210 -16.871 1.00 0.00 ? 559 ASP A C    1  
ATOM 8706   O O    . ASP A 1 559 ? 10.144  -24.420 -17.404 1.00 0.00 ? 559 ASP A O    1  
ATOM 8707   C CB   . ASP A 1 559 ? 12.910  -22.678 -17.888 1.00 0.00 ? 559 ASP A CB   1  
ATOM 8708   C CG   . ASP A 1 559 ? 13.202  -21.229 -18.184 1.00 0.00 ? 559 ASP A CG   1  
ATOM 8709   O OD1  . ASP A 1 559 ? 12.379  -20.355 -17.778 1.00 0.00 ? 559 ASP A OD1  1  
ATOM 8710   O OD2  . ASP A 1 559 ? 14.245  -20.950 -18.820 1.00 0.00 ? 559 ASP A OD2  1  
ATOM 8711   H H    . ASP A 1 559 ? 13.133  -22.035 -15.430 1.00 0.00 ? 559 ASP A H    1  
ATOM 8712   H HA   . ASP A 1 559 ? 11.014  -22.150 -17.142 1.00 0.00 ? 559 ASP A HA   1  
ATOM 8713   H HB2  . ASP A 1 559 ? 13.807  -23.147 -17.512 1.00 0.00 ? 559 ASP A HB2  1  
ATOM 8714   H HB3  . ASP A 1 559 ? 12.610  -23.173 -18.801 1.00 0.00 ? 559 ASP A HB3  1  
ATOM 8715   N N    . GLU A 1 560 ? 11.933  -25.137 -16.237 1.00 0.00 ? 560 GLU A N    1  
ATOM 8716   C CA   . GLU A 1 560 ? 11.543  -26.540 -16.207 1.00 0.00 ? 560 GLU A CA   1  
ATOM 8717   C C    . GLU A 1 560 ? 10.215  -26.743 -15.499 1.00 0.00 ? 560 GLU A C    1  
ATOM 8718   O O    . GLU A 1 560 ? 9.417   -27.576 -15.898 1.00 0.00 ? 560 GLU A O    1  
ATOM 8719   C CB   . GLU A 1 560 ? 12.601  -27.358 -15.510 1.00 0.00 ? 560 GLU A CB   1  
ATOM 8720   C CG   . GLU A 1 560 ? 13.831  -27.487 -16.330 1.00 0.00 ? 560 GLU A CG   1  
ATOM 8721   C CD   . GLU A 1 560 ? 14.793  -28.422 -15.719 1.00 0.00 ? 560 GLU A CD   1  
ATOM 8722   O OE1  . GLU A 1 560 ? 15.478  -28.058 -14.741 1.00 0.00 ? 560 GLU A OE1  1  
ATOM 8723   O OE2  . GLU A 1 560 ? 14.877  -29.541 -16.219 1.00 0.00 ? 560 GLU A OE2  1  
ATOM 8724   H H    . GLU A 1 560 ? 12.773  -24.875 -15.805 1.00 0.00 ? 560 GLU A H    1  
ATOM 8725   H HA   . GLU A 1 560 ? 11.451  -26.894 -17.223 1.00 0.00 ? 560 GLU A HA   1  
ATOM 8726   H HB2  . GLU A 1 560 ? 12.854  -26.883 -14.574 1.00 0.00 ? 560 GLU A HB2  1  
ATOM 8727   H HB3  . GLU A 1 560 ? 12.206  -28.343 -15.307 1.00 0.00 ? 560 GLU A HB3  1  
ATOM 8728   H HG2  . GLU A 1 560 ? 13.563  -27.849 -17.311 1.00 0.00 ? 560 GLU A HG2  1  
ATOM 8729   H HG3  . GLU A 1 560 ? 14.294  -26.515 -16.427 1.00 0.00 ? 560 GLU A HG3  1  
ATOM 8730   N N    . LEU A 1 561 ? 9.989   -25.932 -14.480 1.00 0.00 ? 561 LEU A N    1  
ATOM 8731   C CA   . LEU A 1 561 ? 8.761   -25.943 -13.717 1.00 0.00 ? 561 LEU A CA   1  
ATOM 8732   C C    . LEU A 1 561 ? 7.607   -25.238 -14.517 1.00 0.00 ? 561 LEU A C    1  
ATOM 8733   O O    . LEU A 1 561 ? 6.454   -25.673 -14.497 1.00 0.00 ? 561 LEU A O    1  
ATOM 8734   C CB   . LEU A 1 561 ? 9.131   -25.354 -12.340 1.00 0.00 ? 561 LEU A CB   1  
ATOM 8735   C CG   . LEU A 1 561 ? 8.483   -24.586 -11.201 1.00 0.00 ? 561 LEU A CG   1  
ATOM 8736   C CD1  . LEU A 1 561 ? 9.415   -24.740 -10.063 1.00 0.00 ? 561 LEU A CD1  1  
ATOM 8737   C CD2  . LEU A 1 561 ? 8.351   -23.156 -11.536 1.00 0.00 ? 561 LEU A CD2  1  
ATOM 8738   H H    . LEU A 1 561 ? 10.674  -25.269 -14.251 1.00 0.00 ? 561 LEU A H    1  
ATOM 8739   H HA   . LEU A 1 561 ? 8.473   -26.975 -13.572 1.00 0.00 ? 561 LEU A HA   1  
ATOM 8740   H HB2  . LEU A 1 561 ? 9.503   -26.203 -11.819 1.00 0.00 ? 561 LEU A HB2  1  
ATOM 8741   H HB3  . LEU A 1 561 ? 10.032  -24.780 -12.576 1.00 0.00 ? 561 LEU A HB3  1  
ATOM 8742   H HG   . LEU A 1 561 ? 7.520   -25.016 -10.958 1.00 0.00 ? 561 LEU A HG   1  
ATOM 8743   H HD11 . LEU A 1 561 ? 9.237   -25.688 -9.578  1.00 0.00 ? 561 LEU A HD11 1  
ATOM 8744   H HD12 . LEU A 1 561 ? 9.256   -23.938 -9.357  1.00 0.00 ? 561 LEU A HD12 1  
ATOM 8745   H HD13 . LEU A 1 561 ? 10.433  -24.707 -10.423 1.00 0.00 ? 561 LEU A HD13 1  
ATOM 8746   H HD21 . LEU A 1 561 ? 8.470   -23.023 -12.601 1.00 0.00 ? 561 LEU A HD21 1  
ATOM 8747   H HD22 . LEU A 1 561 ? 9.112   -22.593 -11.014 1.00 0.00 ? 561 LEU A HD22 1  
ATOM 8748   H HD23 . LEU A 1 561 ? 7.374   -22.805 -11.238 1.00 0.00 ? 561 LEU A HD23 1  
ATOM 8749   N N    . MET A 1 562 ? 7.943   -24.200 -15.288 1.00 0.00 ? 562 MET A N    1  
ATOM 8750   C CA   . MET A 1 562 ? 6.963   -23.610 -16.185 1.00 0.00 ? 562 MET A CA   1  
ATOM 8751   C C    . MET A 1 562 ? 6.512   -24.610 -17.211 1.00 0.00 ? 562 MET A C    1  
ATOM 8752   O O    . MET A 1 562 ? 5.347   -24.654 -17.530 1.00 0.00 ? 562 MET A O    1  
ATOM 8753   C CB   . MET A 1 562 ? 7.497   -22.353 -16.844 1.00 0.00 ? 562 MET A CB   1  
ATOM 8754   C CG   . MET A 1 562 ? 7.682   -21.183 -15.868 1.00 0.00 ? 562 MET A CG   1  
ATOM 8755   S SD   . MET A 1 562 ? 5.939   -20.721 -15.021 1.00 0.00 ? 562 MET A SD   1  
ATOM 8756   C CE   . MET A 1 562 ? 5.117   -20.109 -16.750 1.00 0.00 ? 562 MET A CE   1  
ATOM 8757   H H    . MET A 1 562 ? 8.878   -23.911 -15.333 1.00 0.00 ? 562 MET A H    1  
ATOM 8758   H HA   . MET A 1 562 ? 6.101   -23.335 -15.594 1.00 0.00 ? 562 MET A HA   1  
ATOM 8759   H HB2  . MET A 1 562 ? 8.452   -22.578 -17.295 1.00 0.00 ? 562 MET A HB2  1  
ATOM 8760   H HB3  . MET A 1 562 ? 6.810   -22.052 -17.621 1.00 0.00 ? 562 MET A HB3  1  
ATOM 8761   H HG2  . MET A 1 562 ? 8.393   -21.464 -15.103 1.00 0.00 ? 562 MET A HG2  1  
ATOM 8762   H HG3  . MET A 1 562 ? 8.052   -20.323 -16.404 1.00 0.00 ? 562 MET A HG3  1  
ATOM 8763   H HE1  . MET A 1 562 ? 4.749   -20.968 -17.296 1.00 0.00 ? 562 MET A HE1  1  
ATOM 8764   H HE2  . MET A 1 562 ? 5.859   -19.603 -17.344 1.00 0.00 ? 562 MET A HE2  1  
ATOM 8765   H HE3  . MET A 1 562 ? 4.303   -19.428 -16.538 1.00 0.00 ? 562 MET A HE3  1  
ATOM 8766   N N    . THR A 1 563 ? 7.417   -25.457 -17.689 1.00 0.00 ? 563 THR A N    1  
ATOM 8767   C CA   . THR A 1 563 ? 7.064   -26.446 -18.693 1.00 0.00 ? 563 THR A CA   1  
ATOM 8768   C C    . THR A 1 563 ? 5.971   -27.383 -18.212 1.00 0.00 ? 563 THR A C    1  
ATOM 8769   O O    . THR A 1 563 ? 5.005   -27.586 -18.917 1.00 0.00 ? 563 THR A O    1  
ATOM 8770   C CB   . THR A 1 563 ? 8.277   -27.254 -19.102 1.00 0.00 ? 563 THR A CB   1  
ATOM 8771   O OG1  . THR A 1 563 ? 9.240   -26.376 -19.667 1.00 0.00 ? 563 THR A OG1  1  
ATOM 8772   C CG2  . THR A 1 563 ? 7.922   -28.320 -20.138 1.00 0.00 ? 563 THR A CG2  1  
ATOM 8773   H H    . THR A 1 563 ? 8.341   -25.408 -17.365 1.00 0.00 ? 563 THR A H    1  
ATOM 8774   H HA   . THR A 1 563 ? 6.700   -25.924 -19.565 1.00 0.00 ? 563 THR A HA   1  
ATOM 8775   H HB   . THR A 1 563 ? 8.698   -27.732 -18.231 1.00 0.00 ? 563 THR A HB   1  
ATOM 8776   H HG1  . THR A 1 563 ? 9.772   -26.020 -18.952 1.00 0.00 ? 563 THR A HG1  1  
ATOM 8777   H HG21 . THR A 1 563 ? 8.816   -28.628 -20.659 1.00 0.00 ? 563 THR A HG21 1  
ATOM 8778   H HG22 . THR A 1 563 ? 7.215   -27.913 -20.845 1.00 0.00 ? 563 THR A HG22 1  
ATOM 8779   H HG23 . THR A 1 563 ? 7.485   -29.174 -19.641 1.00 0.00 ? 563 THR A HG23 1  
ATOM 8780   N N    . LEU A 1 564 ? 6.115   -27.923 -17.005 1.00 0.00 ? 564 LEU A N    1  
ATOM 8781   C CA   . LEU A 1 564 ? 5.131   -28.803 -16.387 1.00 0.00 ? 564 LEU A CA   1  
ATOM 8782   C C    . LEU A 1 564 ? 3.782   -28.176 -16.382 1.00 0.00 ? 564 LEU A C    1  
ATOM 8783   O O    . LEU A 1 564 ? 2.827   -28.758 -16.932 1.00 0.00 ? 564 LEU A O    1  
ATOM 8784   C CB   . LEU A 1 564 ? 5.478   -29.121 -14.944 1.00 0.00 ? 564 LEU A CB   1  
ATOM 8785   C CG   . LEU A 1 564 ? 6.113   -30.432 -14.481 1.00 0.00 ? 564 LEU A CG   1  
ATOM 8786   C CD1  . LEU A 1 564 ? 5.752   -31.634 -15.313 1.00 0.00 ? 564 LEU A CD1  1  
ATOM 8787   C CD2  . LEU A 1 564 ? 7.543   -30.258 -14.515 1.00 0.00 ? 564 LEU A CD2  1  
ATOM 8788   H H    . LEU A 1 564 ? 6.915   -27.692 -16.489 1.00 0.00 ? 564 LEU A H    1  
ATOM 8789   H HA   . LEU A 1 564 ? 5.088   -29.726 -16.944 1.00 0.00 ? 564 LEU A HA   1  
ATOM 8790   H HB2  . LEU A 1 564 ? 6.145   -28.346 -14.616 1.00 0.00 ? 564 LEU A HB2  1  
ATOM 8791   H HB3  . LEU A 1 564 ? 4.559   -28.994 -14.380 1.00 0.00 ? 564 LEU A HB3  1  
ATOM 8792   H HG   . LEU A 1 564 ? 5.815   -30.618 -13.460 1.00 0.00 ? 564 LEU A HG   1  
ATOM 8793   H HD11 . LEU A 1 564 ? 4.692   -31.623 -15.521 1.00 0.00 ? 564 LEU A HD11 1  
ATOM 8794   H HD12 . LEU A 1 564 ? 6.005   -32.534 -14.772 1.00 0.00 ? 564 LEU A HD12 1  
ATOM 8795   H HD13 . LEU A 1 564 ? 6.301   -31.606 -16.243 1.00 0.00 ? 564 LEU A HD13 1  
ATOM 8796   H HD21 . LEU A 1 564 ? 8.025   -31.223 -14.469 1.00 0.00 ? 564 LEU A HD21 1  
ATOM 8797   H HD22 . LEU A 1 564 ? 7.853   -29.658 -13.671 1.00 0.00 ? 564 LEU A HD22 1  
ATOM 8798   H HD23 . LEU A 1 564 ? 7.824   -29.763 -15.432 1.00 0.00 ? 564 LEU A HD23 1  
ATOM 8799   N N    . VAL A 1 565 ? 3.698   -26.999 -15.761 1.00 0.00 ? 565 VAL A N    1  
ATOM 8800   C CA   . VAL A 1 565 ? 2.482   -26.176 -15.765 1.00 0.00 ? 565 VAL A CA   1  
ATOM 8801   C C    . VAL A 1 565 ? 1.852   -26.059 -17.159 1.00 0.00 ? 565 VAL A C    1  
ATOM 8802   O O    . VAL A 1 565 ? 0.658   -26.324 -17.326 1.00 0.00 ? 565 VAL A O    1  
ATOM 8803   C CB   . VAL A 1 565 ? 2.775   -24.765 -15.198 1.00 0.00 ? 565 VAL A CB   1  
ATOM 8804   C CG1  . VAL A 1 565 ? 1.591   -23.809 -15.404 1.00 0.00 ? 565 VAL A CG1  1  
ATOM 8805   C CG2  . VAL A 1 565 ? 3.211   -24.852 -13.705 1.00 0.00 ? 565 VAL A CG2  1  
ATOM 8806   H H    . VAL A 1 565 ? 4.509   -26.629 -15.354 1.00 0.00 ? 565 VAL A H    1  
ATOM 8807   H HA   . VAL A 1 565 ? 1.761   -26.649 -15.115 1.00 0.00 ? 565 VAL A HA   1  
ATOM 8808   H HB   . VAL A 1 565 ? 3.608   -24.363 -15.761 1.00 0.00 ? 565 VAL A HB   1  
ATOM 8809   H HG11 . VAL A 1 565 ? 1.738   -22.920 -14.808 1.00 0.00 ? 565 VAL A HG11 1  
ATOM 8810   H HG12 . VAL A 1 565 ? 0.677   -24.298 -15.102 1.00 0.00 ? 565 VAL A HG12 1  
ATOM 8811   H HG13 . VAL A 1 565 ? 1.526   -23.536 -16.447 1.00 0.00 ? 565 VAL A HG13 1  
ATOM 8812   H HG21 . VAL A 1 565 ? 3.746   -23.953 -13.434 1.00 0.00 ? 565 VAL A HG21 1  
ATOM 8813   H HG22 . VAL A 1 565 ? 3.853   -25.709 -13.566 1.00 0.00 ? 565 VAL A HG22 1  
ATOM 8814   H HG23 . VAL A 1 565 ? 2.335   -24.953 -13.080 1.00 0.00 ? 565 VAL A HG23 1  
ATOM 8815   N N    . ASN A 1 566 ? 2.649   -25.683 -18.158 1.00 0.00 ? 566 ASN A N    1  
ATOM 8816   C CA   . ASN A 1 566 ? 2.132   -25.587 -19.515 1.00 0.00 ? 566 ASN A CA   1  
ATOM 8817   C C    . ASN A 1 566 ? 1.613   -26.899 -20.125 1.00 0.00 ? 566 ASN A C    1  
ATOM 8818   O O    . ASN A 1 566 ? 0.512   -26.926 -20.686 1.00 0.00 ? 566 ASN A O    1  
ATOM 8819   C CB   . ASN A 1 566 ? 3.151   -24.929 -20.436 1.00 0.00 ? 566 ASN A CB   1  
ATOM 8820   C CG   . ASN A 1 566 ? 3.307   -23.439 -20.154 1.00 0.00 ? 566 ASN A CG   1  
ATOM 8821   O OD1  . ASN A 1 566 ? 2.447   -22.798 -19.562 1.00 0.00 ? 566 ASN A OD1  1  
ATOM 8822   N ND2  . ASN A 1 566 ? 4.428   -22.899 -20.558 1.00 0.00 ? 566 ASN A ND2  1  
ATOM 8823   H H    . ASN A 1 566 ? 3.595   -25.495 -17.982 1.00 0.00 ? 566 ASN A H    1  
ATOM 8824   H HA   . ASN A 1 566 ? 1.285   -24.918 -19.470 1.00 0.00 ? 566 ASN A HA   1  
ATOM 8825   H HB2  . ASN A 1 566 ? 4.108   -25.411 -20.302 1.00 0.00 ? 566 ASN A HB2  1  
ATOM 8826   H HB3  . ASN A 1 566 ? 2.833   -25.062 -21.461 1.00 0.00 ? 566 ASN A HB3  1  
ATOM 8827   H HD21 . ASN A 1 566 ? 5.101   -23.448 -21.010 1.00 0.00 ? 566 ASN A HD21 1  
ATOM 8828   H HD22 . ASN A 1 566 ? 4.594   -21.945 -20.408 1.00 0.00 ? 566 ASN A HD22 1  
ATOM 8829   N N    . LYS A 1 567 ? 2.380   -27.984 -20.034 1.00 0.00 ? 567 LYS A N    1  
ATOM 8830   C CA   . LYS A 1 567 ? 1.912   -29.244 -20.596 1.00 0.00 ? 567 LYS A CA   1  
ATOM 8831   C C    . LYS A 1 567 ? 0.618   -29.664 -19.920 1.00 0.00 ? 567 LYS A C    1  
ATOM 8832   O O    . LYS A 1 567 ? -0.229  -30.340 -20.513 1.00 0.00 ? 567 LYS A O    1  
ATOM 8833   C CB   . LYS A 1 567 ? 2.966   -30.345 -20.475 1.00 0.00 ? 567 LYS A CB   1  
ATOM 8834   C CG   . LYS A 1 567 ? 4.182   -30.126 -21.361 1.00 0.00 ? 567 LYS A CG   1  
ATOM 8835   C CD   . LYS A 1 567 ? 5.192   -31.288 -21.168 1.00 0.00 ? 567 LYS A CD   1  
ATOM 8836   C CE   . LYS A 1 567 ? 6.464   -31.132 -22.053 1.00 0.00 ? 567 LYS A CE   1  
ATOM 8837   N NZ   . LYS A 1 567 ? 7.448   -32.246 -21.866 1.00 0.00 ? 567 LYS A NZ   1  
ATOM 8838   H H    . LYS A 1 567 ? 3.251   -27.936 -19.588 1.00 0.00 ? 567 LYS A H    1  
ATOM 8839   H HA   . LYS A 1 567 ? 1.706   -29.086 -21.645 1.00 0.00 ? 567 LYS A HA   1  
ATOM 8840   H HB2  . LYS A 1 567 ? 3.296   -30.396 -19.449 1.00 0.00 ? 567 LYS A HB2  1  
ATOM 8841   H HB3  . LYS A 1 567 ? 2.508   -31.289 -20.737 1.00 0.00 ? 567 LYS A HB3  1  
ATOM 8842   H HG2  . LYS A 1 567 ? 3.869   -30.089 -22.395 1.00 0.00 ? 567 LYS A HG2  1  
ATOM 8843   H HG3  . LYS A 1 567 ? 4.657   -29.194 -21.095 1.00 0.00 ? 567 LYS A HG3  1  
ATOM 8844   H HD2  . LYS A 1 567 ? 5.492   -31.320 -20.131 1.00 0.00 ? 567 LYS A HD2  1  
ATOM 8845   H HD3  . LYS A 1 567 ? 4.703   -32.219 -21.418 1.00 0.00 ? 567 LYS A HD3  1  
ATOM 8846   H HE2  . LYS A 1 567 ? 6.165   -31.106 -23.088 1.00 0.00 ? 567 LYS A HE2  1  
ATOM 8847   H HE3  . LYS A 1 567 ? 6.942   -30.194 -21.807 1.00 0.00 ? 567 LYS A HE3  1  
ATOM 8848   H HZ1  . LYS A 1 567 ? 8.306   -32.049 -22.421 1.00 0.00 ? 567 LYS A HZ1  1  
ATOM 8849   H HZ2  . LYS A 1 567 ? 7.025   -33.140 -22.188 1.00 0.00 ? 567 LYS A HZ2  1  
ATOM 8850   H HZ3  . LYS A 1 567 ? 7.699   -32.323 -20.860 1.00 0.00 ? 567 LYS A HZ3  1  
ATOM 8851   N N    . PHE A 1 568 ? 0.478   -29.273 -18.665 1.00 0.00 ? 568 PHE A N    1  
ATOM 8852   C CA   . PHE A 1 568 ? -0.731  -29.533 -17.929 1.00 0.00 ? 568 PHE A CA   1  
ATOM 8853   C C    . PHE A 1 568 ? -1.903  -28.804 -18.608 1.00 0.00 ? 568 PHE A C    1  
ATOM 8854   O O    . PHE A 1 568 ? -2.854  -29.420 -19.070 1.00 0.00 ? 568 PHE A O    1  
ATOM 8855   C CB   . PHE A 1 568 ? -0.539  -29.041 -16.518 1.00 0.00 ? 568 PHE A CB   1  
ATOM 8856   C CG   . PHE A 1 568 ? -1.504  -29.610 -15.545 1.00 0.00 ? 568 PHE A CG   1  
ATOM 8857   C CD1  . PHE A 1 568 ? -2.726  -28.998 -15.318 1.00 0.00 ? 568 PHE A CD1  1  
ATOM 8858   C CD2  . PHE A 1 568 ? -1.186  -30.745 -14.820 1.00 0.00 ? 568 PHE A CD2  1  
ATOM 8859   C CE1  . PHE A 1 568 ? -3.631  -29.508 -14.386 1.00 0.00 ? 568 PHE A CE1  1  
ATOM 8860   C CE2  . PHE A 1 568 ? -2.089  -31.265 -13.875 1.00 0.00 ? 568 PHE A CE2  1  
ATOM 8861   C CZ   . PHE A 1 568 ? -3.319  -30.637 -13.657 1.00 0.00 ? 568 PHE A CZ   1  
ATOM 8862   H H    . PHE A 1 568 ? 1.191   -28.749 -18.244 1.00 0.00 ? 568 PHE A H    1  
ATOM 8863   H HA   . PHE A 1 568 ? -0.925  -30.595 -17.916 1.00 0.00 ? 568 PHE A HA   1  
ATOM 8864   H HB2  . PHE A 1 568 ? 0.458   -29.297 -16.197 1.00 0.00 ? 568 PHE A HB2  1  
ATOM 8865   H HB3  . PHE A 1 568 ? -0.634  -27.964 -16.515 1.00 0.00 ? 568 PHE A HB3  1  
ATOM 8866   H HD1  . PHE A 1 568 ? -2.987  -28.114 -15.880 1.00 0.00 ? 568 PHE A HD1  1  
ATOM 8867   H HD2  . PHE A 1 568 ? -0.237  -31.237 -14.983 1.00 0.00 ? 568 PHE A HD2  1  
ATOM 8868   H HE1  . PHE A 1 568 ? -4.577  -29.011 -14.229 1.00 0.00 ? 568 PHE A HE1  1  
ATOM 8869   H HE2  . PHE A 1 568 ? -1.830  -32.151 -13.315 1.00 0.00 ? 568 PHE A HE2  1  
ATOM 8870   H HZ   . PHE A 1 568 ? -4.016  -31.032 -12.932 1.00 0.00 ? 568 PHE A HZ   1  
ATOM 8871   N N    . ILE A 1 569 ? -1.795  -27.489 -18.702 1.00 0.00 ? 569 ILE A N    1  
ATOM 8872   C CA   . ILE A 1 569 ? -2.829  -26.660 -19.276 1.00 0.00 ? 569 ILE A CA   1  
ATOM 8873   C C    . ILE A 1 569 ? -3.244  -27.129 -20.670 1.00 0.00 ? 569 ILE A C    1  
ATOM 8874   O O    . ILE A 1 569 ? -4.430  -27.078 -21.027 1.00 0.00 ? 569 ILE A O    1  
ATOM 8875   C CB   . ILE A 1 569 ? -2.372  -25.195 -19.287 1.00 0.00 ? 569 ILE A CB   1  
ATOM 8876   C CG1  . ILE A 1 569 ? -2.295  -24.657 -17.842 1.00 0.00 ? 569 ILE A CG1  1  
ATOM 8877   C CG2  . ILE A 1 569 ? -3.258  -24.382 -20.180 1.00 0.00 ? 569 ILE A CG2  1  
ATOM 8878   C CD1  . ILE A 1 569 ? -1.590  -23.290 -17.706 1.00 0.00 ? 569 ILE A CD1  1  
ATOM 8879   H H    . ILE A 1 569 ? -0.992  -27.057 -18.343 1.00 0.00 ? 569 ILE A H    1  
ATOM 8880   H HA   . ILE A 1 569 ? -3.696  -26.728 -18.636 1.00 0.00 ? 569 ILE A HA   1  
ATOM 8881   H HB   . ILE A 1 569 ? -1.375  -25.168 -19.707 1.00 0.00 ? 569 ILE A HB   1  
ATOM 8882   H HG12 . ILE A 1 569 ? -3.300  -24.560 -17.459 1.00 0.00 ? 569 ILE A HG12 1  
ATOM 8883   H HG13 . ILE A 1 569 ? -1.768  -25.381 -17.236 1.00 0.00 ? 569 ILE A HG13 1  
ATOM 8884   H HG21 . ILE A 1 569 ? -2.981  -24.548 -21.210 1.00 0.00 ? 569 ILE A HG21 1  
ATOM 8885   H HG22 . ILE A 1 569 ? -3.147  -23.334 -19.940 1.00 0.00 ? 569 ILE A HG22 1  
ATOM 8886   H HG23 . ILE A 1 569 ? -4.287  -24.678 -20.033 1.00 0.00 ? 569 ILE A HG23 1  
ATOM 8887   H HD11 . ILE A 1 569 ? -0.637  -23.325 -18.215 1.00 0.00 ? 569 ILE A HD11 1  
ATOM 8888   H HD12 . ILE A 1 569 ? -1.432  -23.068 -16.662 1.00 0.00 ? 569 ILE A HD12 1  
ATOM 8889   H HD13 . ILE A 1 569 ? -2.207  -22.521 -18.148 1.00 0.00 ? 569 ILE A HD13 1  
ATOM 8890   N N    . GLU A 1 570 ? -2.265  -27.588 -21.440 1.00 0.00 ? 570 GLU A N    1  
ATOM 8891   C CA   . GLU A 1 570 ? -2.493  -28.198 -22.753 1.00 0.00 ? 570 GLU A CA   1  
ATOM 8892   C C    . GLU A 1 570 ? -3.372  -29.444 -22.665 1.00 0.00 ? 570 GLU A C    1  
ATOM 8893   O O    . GLU A 1 570 ? -4.409  -29.563 -23.338 1.00 0.00 ? 570 GLU A O    1  
ATOM 8894   C CB   . GLU A 1 570 ? -1.168  -28.665 -23.360 1.00 0.00 ? 570 GLU A CB   1  
ATOM 8895   C CG   . GLU A 1 570 ? -0.214  -27.614 -23.816 1.00 0.00 ? 570 GLU A CG   1  
ATOM 8896   C CD   . GLU A 1 570 ? 1.114   -28.250 -24.233 1.00 0.00 ? 570 GLU A CD   1  
ATOM 8897   O OE1  . GLU A 1 570 ? 1.334   -29.471 -23.943 1.00 0.00 ? 570 GLU A OE1  1  
ATOM 8898   O OE2  . GLU A 1 570 ? 1.928   -27.521 -24.868 1.00 0.00 ? 570 GLU A OE2  1  
ATOM 8899   H H    . GLU A 1 570 ? -1.355  -27.596 -21.077 1.00 0.00 ? 570 GLU A H    1  
ATOM 8900   H HA   . GLU A 1 570 ? -2.948  -27.478 -23.414 1.00 0.00 ? 570 GLU A HA   1  
ATOM 8901   H HB2  . GLU A 1 570 ? -0.660  -29.265 -22.624 1.00 0.00 ? 570 GLU A HB2  1  
ATOM 8902   H HB3  . GLU A 1 570 ? -1.400  -29.304 -24.203 1.00 0.00 ? 570 GLU A HB3  1  
ATOM 8903   H HG2  . GLU A 1 570 ? -0.640  -27.088 -24.659 1.00 0.00 ? 570 GLU A HG2  1  
ATOM 8904   H HG3  . GLU A 1 570 ? -0.037  -26.918 -23.011 1.00 0.00 ? 570 GLU A HG3  1  
ATOM 8905   N N    . GLU A 1 571 ? -2.924  -30.380 -21.843 1.00 0.00 ? 571 GLU A N    1  
ATOM 8906   C CA   . GLU A 1 571 ? -3.500  -31.690 -21.821 1.00 0.00 ? 571 GLU A CA   1  
ATOM 8907   C C    . GLU A 1 571 ? -4.774  -31.771 -20.981 1.00 0.00 ? 571 GLU A C    1  
ATOM 8908   O O    . GLU A 1 571 ? -5.606  -32.645 -21.219 1.00 0.00 ? 571 GLU A O    1  
ATOM 8909   C CB   . GLU A 1 571 ? -2.443  -32.684 -21.356 1.00 0.00 ? 571 GLU A CB   1  
ATOM 8910   C CG   . GLU A 1 571 ? -2.878  -34.145 -21.575 1.00 0.00 ? 571 GLU A CG   1  
ATOM 8911   C CD   . GLU A 1 571 ? -1.769  -35.187 -21.369 1.00 0.00 ? 571 GLU A CD   1  
ATOM 8912   O OE1  . GLU A 1 571 ? -0.671  -34.831 -20.858 1.00 0.00 ? 571 GLU A OE1  1  
ATOM 8913   O OE2  . GLU A 1 571 ? -2.012  -36.368 -21.744 1.00 0.00 ? 571 GLU A OE2  1  
ATOM 8914   H H    . GLU A 1 571 ? -2.088  -30.222 -21.356 1.00 0.00 ? 571 GLU A H    1  
ATOM 8915   H HA   . GLU A 1 571 ? -3.763  -31.948 -22.836 1.00 0.00 ? 571 GLU A HA   1  
ATOM 8916   H HB2  . GLU A 1 571 ? -1.530  -32.506 -21.904 1.00 0.00 ? 571 GLU A HB2  1  
ATOM 8917   H HB3  . GLU A 1 571 ? -2.255  -32.527 -20.304 1.00 0.00 ? 571 GLU A HB3  1  
ATOM 8918   H HG2  . GLU A 1 571 ? -3.681  -34.368 -20.889 1.00 0.00 ? 571 GLU A HG2  1  
ATOM 8919   H HG3  . GLU A 1 571 ? -3.257  -34.239 -22.583 1.00 0.00 ? 571 GLU A HG3  1  
ATOM 8920   N N    . LYS A 1 572 ? -4.953  -30.827 -20.053 1.00 0.00 ? 572 LYS A N    1  
ATOM 8921   C CA   . LYS A 1 572 ? -5.932  -30.985 -18.973 1.00 0.00 ? 572 LYS A CA   1  
ATOM 8922   C C    . LYS A 1 572 ? -7.168  -30.057 -18.976 1.00 0.00 ? 572 LYS A C    1  
ATOM 8923   O O    . LYS A 1 572 ? -8.091  -30.302 -18.195 1.00 0.00 ? 572 LYS A O    1  
ATOM 8924   C CB   . LYS A 1 572 ? -5.246  -30.962 -17.592 1.00 0.00 ? 572 LYS A CB   1  
ATOM 8925   C CG   . LYS A 1 572 ? -4.093  -31.961 -17.371 1.00 0.00 ? 572 LYS A CG   1  
ATOM 8926   C CD   . LYS A 1 572 ? -4.555  -33.403 -17.488 1.00 0.00 ? 572 LYS A CD   1  
ATOM 8927   C CE   . LYS A 1 572 ? -3.487  -34.385 -17.025 1.00 0.00 ? 572 LYS A CE   1  
ATOM 8928   N NZ   . LYS A 1 572 ? -2.237  -34.361 -17.845 1.00 0.00 ? 572 LYS A NZ   1  
ATOM 8929   H H    . LYS A 1 572 ? -4.269  -30.131 -19.960 1.00 0.00 ? 572 LYS A H    1  
ATOM 8930   H HA   . LYS A 1 572 ? -6.324  -31.985 -19.086 1.00 0.00 ? 572 LYS A HA   1  
ATOM 8931   H HB2  . LYS A 1 572 ? -4.855  -29.971 -17.430 1.00 0.00 ? 572 LYS A HB2  1  
ATOM 8932   H HB3  . LYS A 1 572 ? -6.004  -31.146 -16.842 1.00 0.00 ? 572 LYS A HB3  1  
ATOM 8933   H HG2  . LYS A 1 572 ? -3.325  -31.780 -18.108 1.00 0.00 ? 572 LYS A HG2  1  
ATOM 8934   H HG3  . LYS A 1 572 ? -3.676  -31.803 -16.386 1.00 0.00 ? 572 LYS A HG3  1  
ATOM 8935   H HD2  . LYS A 1 572 ? -5.440  -33.538 -16.885 1.00 0.00 ? 572 LYS A HD2  1  
ATOM 8936   H HD3  . LYS A 1 572 ? -4.800  -33.610 -18.520 1.00 0.00 ? 572 LYS A HD3  1  
ATOM 8937   H HE2  . LYS A 1 572 ? -3.227  -34.154 -16.005 1.00 0.00 ? 572 LYS A HE2  1  
ATOM 8938   H HE3  . LYS A 1 572 ? -3.904  -35.383 -17.055 1.00 0.00 ? 572 LYS A HE3  1  
ATOM 8939   H HZ1  . LYS A 1 572 ? -1.438  -34.060 -17.253 1.00 0.00 ? 572 LYS A HZ1  1  
ATOM 8940   H HZ2  . LYS A 1 572 ? -2.355  -33.693 -18.635 1.00 0.00 ? 572 LYS A HZ2  1  
ATOM 8941   H HZ3  . LYS A 1 572 ? -2.049  -35.312 -18.220 1.00 0.00 ? 572 LYS A HZ3  1  
ATOM 8942   N N    . THR A 1 573 ? -7.191  -29.001 -19.805 1.00 0.00 ? 573 THR A N    1  
ATOM 8943   C CA   . THR A 1 573 ? -8.457  -28.284 -20.119 1.00 0.00 ? 573 THR A CA   1  
ATOM 8944   C C    . THR A 1 573 ? -8.322  -27.334 -21.317 1.00 0.00 ? 573 THR A C    1  
ATOM 8945   O O    . THR A 1 573 ? -7.840  -26.202 -21.174 1.00 0.00 ? 573 THR A O    1  
ATOM 8946   C CB   . THR A 1 573 ? -9.020  -27.421 -18.937 1.00 0.00 ? 573 THR A CB   1  
ATOM 8947   O OG1  . THR A 1 573 ? -8.813  -28.072 -17.667 1.00 0.00 ? 573 THR A OG1  1  
ATOM 8948   C CG2  . THR A 1 573 ? -10.531 -27.081 -19.167 1.00 0.00 ? 573 THR A CG2  1  
ATOM 8949   H H    . THR A 1 573 ? -6.415  -28.847 -20.383 1.00 0.00 ? 573 THR A H    1  
ATOM 8950   H HA   . THR A 1 573 ? -9.201  -29.026 -20.368 1.00 0.00 ? 573 THR A HA   1  
ATOM 8951   H HB   . THR A 1 573 ? -8.471  -26.491 -18.921 1.00 0.00 ? 573 THR A HB   1  
ATOM 8952   H HG1  . THR A 1 573 ? -8.420  -27.434 -17.067 1.00 0.00 ? 573 THR A HG1  1  
ATOM 8953   H HG21 . THR A 1 573 ? -10.786 -26.184 -18.621 1.00 0.00 ? 573 THR A HG21 1  
ATOM 8954   H HG22 . THR A 1 573 ? -11.143 -27.900 -18.818 1.00 0.00 ? 573 THR A HG22 1  
ATOM 8955   H HG23 . THR A 1 573 ? -10.709 -26.924 -20.221 1.00 0.00 ? 573 THR A HG23 1  
ATOM 8956   N N    . MET B 1 1   ? 32.037  7.839   34.800  1.00 0.00 ? 1   MET B N    1  
ATOM 8957   C CA   . MET B 1 1   ? 31.450  6.572   34.272  1.00 0.00 ? 1   MET B CA   1  
ATOM 8958   C C    . MET B 1 1   ? 31.127  6.740   32.782  1.00 0.00 ? 1   MET B C    1  
ATOM 8959   O O    . MET B 1 1   ? 29.979  6.851   32.394  1.00 0.00 ? 1   MET B O    1  
ATOM 8960   C CB   . MET B 1 1   ? 30.164  6.248   35.055  1.00 0.00 ? 1   MET B CB   1  
ATOM 8961   C CG   . MET B 1 1   ? 30.466  6.154   36.570  1.00 0.00 ? 1   MET B CG   1  
ATOM 8962   S SD   . MET B 1 1   ? 31.711  4.873   36.877  1.00 0.00 ? 1   MET B SD   1  
ATOM 8963   C CE   . MET B 1 1   ? 30.711  3.436   36.405  1.00 0.00 ? 1   MET B CE   1  
ATOM 8964   H H1   . MET B 1 1   ? 32.036  8.560   34.051  1.00 0.00 ? 1   MET B H1   1  
ATOM 8965   H H2   . MET B 1 1   ? 33.013  7.664   35.113  1.00 0.00 ? 1   MET B H2   1  
ATOM 8966   H H3   . MET B 1 1   ? 31.469  8.177   35.603  1.00 0.00 ? 1   MET B H3   1  
ATOM 8967   H HA   . MET B 1 1   ? 32.160  5.768   34.398  1.00 0.00 ? 1   MET B HA   1  
ATOM 8968   H HB2  . MET B 1 1   ? 29.435  7.027   34.883  1.00 0.00 ? 1   MET B HB2  1  
ATOM 8969   H HB3  . MET B 1 1   ? 29.766  5.305   34.713  1.00 0.00 ? 1   MET B HB3  1  
ATOM 8970   H HG2  . MET B 1 1   ? 30.837  7.105   36.922  1.00 0.00 ? 1   MET B HG2  1  
ATOM 8971   H HG3  . MET B 1 1   ? 29.557  5.907   37.102  1.00 0.00 ? 1   MET B HG3  1  
ATOM 8972   H HE1  . MET B 1 1   ? 30.783  3.283   35.336  1.00 0.00 ? 1   MET B HE1  1  
ATOM 8973   H HE2  . MET B 1 1   ? 29.681  3.609   36.672  1.00 0.00 ? 1   MET B HE2  1  
ATOM 8974   H HE3  . MET B 1 1   ? 31.074  2.559   36.924  1.00 0.00 ? 1   MET B HE3  1  
ATOM 8975   N N    . ILE B 1 2   ? 32.138  6.748   31.946  1.00 0.00 ? 2   ILE B N    1  
ATOM 8976   C CA   . ILE B 1 2   ? 31.923  6.898   30.470  1.00 0.00 ? 2   ILE B CA   1  
ATOM 8977   C C    . ILE B 1 2   ? 32.197  5.557   29.788  1.00 0.00 ? 2   ILE B C    1  
ATOM 8978   O O    . ILE B 1 2   ? 33.217  4.939   30.019  1.00 0.00 ? 2   ILE B O    1  
ATOM 8979   C CB   . ILE B 1 2   ? 32.898  7.940   29.913  1.00 0.00 ? 2   ILE B CB   1  
ATOM 8980   C CG1  . ILE B 1 2   ? 32.757  9.263   30.685  1.00 0.00 ? 2   ILE B CG1  1  
ATOM 8981   C CG2  . ILE B 1 2   ? 32.583  8.170   28.435  1.00 0.00 ? 2   ILE B CG2  1  
ATOM 8982   C CD1  . ILE B 1 2   ? 33.898  9.413   31.733  1.00 0.00 ? 2   ILE B CD1  1  
ATOM 8983   H H    . ILE B 1 2   ? 33.050  6.649   32.293  1.00 0.00 ? 2   ILE B H    1  
ATOM 8984   H HA   . ILE B 1 2   ? 30.907  7.207   30.277  1.00 0.00 ? 2   ILE B HA   1  
ATOM 8985   H HB   . ILE B 1 2   ? 33.909  7.570   30.009  1.00 0.00 ? 2   ILE B HB   1  
ATOM 8986   H HG12 . ILE B 1 2   ? 32.803  10.088  29.989  1.00 0.00 ? 2   ILE B HG12 1  
ATOM 8987   H HG13 . ILE B 1 2   ? 31.805  9.279   31.194  1.00 0.00 ? 2   ILE B HG13 1  
ATOM 8988   H HG21 . ILE B 1 2   ? 31.524  8.353   28.317  1.00 0.00 ? 2   ILE B HG21 1  
ATOM 8989   H HG22 . ILE B 1 2   ? 32.862  7.295   27.867  1.00 0.00 ? 2   ILE B HG22 1  
ATOM 8990   H HG23 . ILE B 1 2   ? 33.139  9.024   28.077  1.00 0.00 ? 2   ILE B HG23 1  
ATOM 8991   H HD11 . ILE B 1 2   ? 33.815  10.373  32.222  1.00 0.00 ? 2   ILE B HD11 1  
ATOM 8992   H HD12 . ILE B 1 2   ? 34.855  9.344   31.236  1.00 0.00 ? 2   ILE B HD12 1  
ATOM 8993   H HD13 . ILE B 1 2   ? 33.818  8.625   32.468  1.00 0.00 ? 2   ILE B HD13 1  
ATOM 8994   N N    . SER B 1 3   ? 31.295  5.092   28.953  1.00 0.00 ? 3   SER B N    1  
ATOM 8995   C CA   . SER B 1 3   ? 31.502  3.777   28.258  1.00 0.00 ? 3   SER B CA   1  
ATOM 8996   C C    . SER B 1 3   ? 31.268  3.923   26.751  1.00 0.00 ? 3   SER B C    1  
ATOM 8997   O O    . SER B 1 3   ? 30.372  4.622   26.315  1.00 0.00 ? 3   SER B O    1  
ATOM 8998   C CB   . SER B 1 3   ? 30.510  2.757   28.816  1.00 0.00 ? 3   SER B CB   1  
ATOM 8999   O OG   . SER B 1 3   ? 30.683  1.513   28.148  1.00 0.00 ? 3   SER B OG   1  
ATOM 9000   H H    . SER B 1 3   ? 30.477  5.605   28.787  1.00 0.00 ? 3   SER B H    1  
ATOM 9001   H HA   . SER B 1 3   ? 32.509  3.430   28.435  1.00 0.00 ? 3   SER B HA   1  
ATOM 9002   H HB2  . SER B 1 3   ? 30.686  2.621   29.870  1.00 0.00 ? 3   SER B HB2  1  
ATOM 9003   H HB3  . SER B 1 3   ? 29.500  3.121   28.668  1.00 0.00 ? 3   SER B HB3  1  
ATOM 9004   H HG   . SER B 1 3   ? 31.041  0.884   28.779  1.00 0.00 ? 3   SER B HG   1  
ATOM 9005   N N    . GLY B 1 4   ? 32.064  3.249   25.950  1.00 0.00 ? 4   GLY B N    1  
ATOM 9006   C CA   . GLY B 1 4   ? 31.907  3.307   24.461  1.00 0.00 ? 4   GLY B CA   1  
ATOM 9007   C C    . GLY B 1 4   ? 31.716  1.879   23.940  1.00 0.00 ? 4   GLY B C    1  
ATOM 9008   O O    . GLY B 1 4   ? 31.323  0.996   24.675  1.00 0.00 ? 4   GLY B O    1  
ATOM 9009   H H    . GLY B 1 4   ? 32.767  2.687   26.336  1.00 0.00 ? 4   GLY B H    1  
ATOM 9010   H HA2  . GLY B 1 4   ? 31.044  3.908   24.209  1.00 0.00 ? 4   GLY B HA2  1  
ATOM 9011   H HA3  . GLY B 1 4   ? 32.793  3.736   24.017  1.00 0.00 ? 4   GLY B HA3  1  
ATOM 9012   N N    . ILE B 1 5   ? 31.963  1.639   22.675  1.00 0.00 ? 5   ILE B N    1  
ATOM 9013   C CA   . ILE B 1 5   ? 31.755  0.260   22.126  1.00 0.00 ? 5   ILE B CA   1  
ATOM 9014   C C    . ILE B 1 5   ? 33.067  -0.533  22.134  1.00 0.00 ? 5   ILE B C    1  
ATOM 9015   O O    . ILE B 1 5   ? 33.062  -1.730  21.925  1.00 0.00 ? 5   ILE B O    1  
ATOM 9016   C CB   . ILE B 1 5   ? 31.258  0.374   20.686  1.00 0.00 ? 5   ILE B CB   1  
ATOM 9017   C CG1  . ILE B 1 5   ? 30.386  -0.848  20.362  1.00 0.00 ? 5   ILE B CG1  1  
ATOM 9018   C CG2  . ILE B 1 5   ? 32.461  0.437   19.729  1.00 0.00 ? 5   ILE B CG2  1  
ATOM 9019   C CD1  . ILE B 1 5   ? 29.806  -0.749  18.938  1.00 0.00 ? 5   ILE B CD1  1  
ATOM 9020   H H    . ILE B 1 5   ? 32.261  2.364   22.086  1.00 0.00 ? 5   ILE B H    1  
ATOM 9021   H HA   . ILE B 1 5   ? 31.017  -0.257  22.719  1.00 0.00 ? 5   ILE B HA   1  
ATOM 9022   H HB   . ILE B 1 5   ? 30.671  1.274   20.581  1.00 0.00 ? 5   ILE B HB   1  
ATOM 9023   H HG12 . ILE B 1 5   ? 30.985  -1.743  20.439  1.00 0.00 ? 5   ILE B HG12 1  
ATOM 9024   H HG13 . ILE B 1 5   ? 29.573  -0.903  21.072  1.00 0.00 ? 5   ILE B HG13 1  
ATOM 9025   H HG21 . ILE B 1 5   ? 33.215  1.092   20.142  1.00 0.00 ? 5   ILE B HG21 1  
ATOM 9026   H HG22 . ILE B 1 5   ? 32.139  0.820   18.772  1.00 0.00 ? 5   ILE B HG22 1  
ATOM 9027   H HG23 . ILE B 1 5   ? 32.873  -0.553  19.602  1.00 0.00 ? 5   ILE B HG23 1  
ATOM 9028   H HD11 . ILE B 1 5   ? 30.082  -1.629  18.375  1.00 0.00 ? 5   ILE B HD11 1  
ATOM 9029   H HD12 . ILE B 1 5   ? 30.201  0.130   18.449  1.00 0.00 ? 5   ILE B HD12 1  
ATOM 9030   H HD13 . ILE B 1 5   ? 28.730  -0.678  18.992  1.00 0.00 ? 5   ILE B HD13 1  
ATOM 9031   N N    . LEU B 1 6   ? 34.183  0.109   22.364  1.00 0.00 ? 6   LEU B N    1  
ATOM 9032   C CA   . LEU B 1 6   ? 35.483  -0.631  22.373  1.00 0.00 ? 6   LEU B CA   1  
ATOM 9033   C C    . LEU B 1 6   ? 35.633  -1.423  21.069  1.00 0.00 ? 6   LEU B C    1  
ATOM 9034   O O    . LEU B 1 6   ? 35.027  -2.457  20.884  1.00 0.00 ? 6   LEU B O    1  
ATOM 9035   C CB   . LEU B 1 6   ? 35.522  -1.579  23.581  1.00 0.00 ? 6   LEU B CB   1  
ATOM 9036   C CG   . LEU B 1 6   ? 36.160  -0.894  24.804  1.00 0.00 ? 6   LEU B CG   1  
ATOM 9037   C CD1  . LEU B 1 6   ? 35.352  0.362   25.188  1.00 0.00 ? 6   LEU B CD1  1  
ATOM 9038   C CD2  . LEU B 1 6   ? 36.217  -1.894  25.999  1.00 0.00 ? 6   LEU B CD2  1  
ATOM 9039   H H    . LEU B 1 6   ? 34.168  1.075   22.526  1.00 0.00 ? 6   LEU B H    1  
ATOM 9040   H HA   . LEU B 1 6   ? 36.294  0.079   22.451  1.00 0.00 ? 6   LEU B HA   1  
ATOM 9041   H HB2  . LEU B 1 6   ? 34.514  -1.879  23.828  1.00 0.00 ? 6   LEU B HB2  1  
ATOM 9042   H HB3  . LEU B 1 6   ? 36.100  -2.455  23.324  1.00 0.00 ? 6   LEU B HB3  1  
ATOM 9043   H HG   . LEU B 1 6   ? 37.166  -0.594  24.547  1.00 0.00 ? 6   LEU B HG   1  
ATOM 9044   H HD11 . LEU B 1 6   ? 35.819  0.846   26.033  1.00 0.00 ? 6   LEU B HD11 1  
ATOM 9045   H HD12 . LEU B 1 6   ? 34.344  0.076   25.450  1.00 0.00 ? 6   LEU B HD12 1  
ATOM 9046   H HD13 . LEU B 1 6   ? 35.327  1.044   24.351  1.00 0.00 ? 6   LEU B HD13 1  
ATOM 9047   H HD21 . LEU B 1 6   ? 35.245  -1.949  26.469  1.00 0.00 ? 6   LEU B HD21 1  
ATOM 9048   H HD22 . LEU B 1 6   ? 36.946  -1.553  26.720  1.00 0.00 ? 6   LEU B HD22 1  
ATOM 9049   H HD23 . LEU B 1 6   ? 36.499  -2.872  25.637  1.00 0.00 ? 6   LEU B HD23 1  
ATOM 9050   N N    . ALA B 1 7   ? 36.448  -0.941  20.162  1.00 0.00 ? 7   ALA B N    1  
ATOM 9051   C CA   . ALA B 1 7   ? 36.647  -1.654  18.864  1.00 0.00 ? 7   ALA B CA   1  
ATOM 9052   C C    . ALA B 1 7   ? 37.885  -2.549  18.950  1.00 0.00 ? 7   ALA B C    1  
ATOM 9053   O O    . ALA B 1 7   ? 37.998  -3.531  18.245  1.00 0.00 ? 7   ALA B O    1  
ATOM 9054   C CB   . ALA B 1 7   ? 36.852  -0.623  17.759  1.00 0.00 ? 7   ALA B CB   1  
ATOM 9055   H H    . ALA B 1 7   ? 36.930  -0.106  20.336  1.00 0.00 ? 7   ALA B H    1  
ATOM 9056   H HA   . ALA B 1 7   ? 35.778  -2.255  18.642  1.00 0.00 ? 7   ALA B HA   1  
ATOM 9057   H HB1  . ALA B 1 7   ? 35.913  -0.133  17.545  1.00 0.00 ? 7   ALA B HB1  1  
ATOM 9058   H HB2  . ALA B 1 7   ? 37.211  -1.116  16.868  1.00 0.00 ? 7   ALA B HB2  1  
ATOM 9059   H HB3  . ALA B 1 7   ? 37.575  0.112   18.081  1.00 0.00 ? 7   ALA B HB3  1  
ATOM 9060   N N    . SER B 1 8   ? 38.818  -2.216  19.806  1.00 0.00 ? 8   SER B N    1  
ATOM 9061   C CA   . SER B 1 8   ? 40.051  -3.050  19.940  1.00 0.00 ? 8   SER B CA   1  
ATOM 9062   C C    . SER B 1 8   ? 40.454  -3.115  21.426  1.00 0.00 ? 8   SER B C    1  
ATOM 9063   O O    . SER B 1 8   ? 40.603  -2.088  22.061  1.00 0.00 ? 8   SER B O    1  
ATOM 9064   C CB   . SER B 1 8   ? 41.177  -2.401  19.132  1.00 0.00 ? 8   SER B CB   1  
ATOM 9065   O OG   . SER B 1 8   ? 41.040  -0.988  19.195  1.00 0.00 ? 8   SER B OG   1  
ATOM 9066   H H    . SER B 1 8   ? 38.707  -1.417  20.362  1.00 0.00 ? 8   SER B H    1  
ATOM 9067   H HA   . SER B 1 8   ? 39.860  -4.047  19.568  1.00 0.00 ? 8   SER B HA   1  
ATOM 9068   H HB2  . SER B 1 8   ? 42.131  -2.684  19.547  1.00 0.00 ? 8   SER B HB2  1  
ATOM 9069   H HB3  . SER B 1 8   ? 41.120  -2.734  18.104  1.00 0.00 ? 8   SER B HB3  1  
ATOM 9070   H HG   . SER B 1 8   ? 41.751  -0.645  19.742  1.00 0.00 ? 8   SER B HG   1  
ATOM 9071   N N    . PRO B 1 9   ? 40.630  -4.294  21.990  1.00 0.00 ? 9   PRO B N    1  
ATOM 9072   C CA   . PRO B 1 9   ? 41.022  -4.435  23.419  1.00 0.00 ? 9   PRO B CA   1  
ATOM 9073   C C    . PRO B 1 9   ? 42.530  -4.218  23.619  1.00 0.00 ? 9   PRO B C    1  
ATOM 9074   O O    . PRO B 1 9   ? 43.335  -4.610  22.801  1.00 0.00 ? 9   PRO B O    1  
ATOM 9075   C CB   . PRO B 1 9   ? 40.634  -5.879  23.744  1.00 0.00 ? 9   PRO B CB   1  
ATOM 9076   C CG   . PRO B 1 9   ? 40.834  -6.611  22.454  1.00 0.00 ? 9   PRO B CG   1  
ATOM 9077   C CD   . PRO B 1 9   ? 40.480  -5.617  21.346  1.00 0.00 ? 9   PRO B CD   1  
ATOM 9078   H HA   . PRO B 1 9   ? 40.455  -3.758  24.037  1.00 0.00 ? 9   PRO B HA   1  
ATOM 9079   H HB2  . PRO B 1 9   ? 41.281  -6.279  24.513  1.00 0.00 ? 9   PRO B HB2  1  
ATOM 9080   H HB3  . PRO B 1 9   ? 39.601  -5.936  24.046  1.00 0.00 ? 9   PRO B HB3  1  
ATOM 9081   H HG2  . PRO B 1 9   ? 41.865  -6.926  22.362  1.00 0.00 ? 9   PRO B HG2  1  
ATOM 9082   H HG3  . PRO B 1 9   ? 40.175  -7.463  22.402  1.00 0.00 ? 9   PRO B HG3  1  
ATOM 9083   H HD2  . PRO B 1 9   ? 41.163  -5.717  20.513  1.00 0.00 ? 9   PRO B HD2  1  
ATOM 9084   H HD3  . PRO B 1 9   ? 39.461  -5.760  21.023  1.00 0.00 ? 9   PRO B HD3  1  
ATOM 9085   N N    . GLY B 1 10  ? 42.909  -3.598  24.700  1.00 0.00 ? 10  GLY B N    1  
ATOM 9086   C CA   . GLY B 1 10  ? 44.360  -3.353  24.952  1.00 0.00 ? 10  GLY B CA   1  
ATOM 9087   C C    . GLY B 1 10  ? 44.492  -2.277  26.025  1.00 0.00 ? 10  GLY B C    1  
ATOM 9088   O O    . GLY B 1 10  ? 43.563  -2.008  26.748  1.00 0.00 ? 10  GLY B O    1  
ATOM 9089   H H    . GLY B 1 10  ? 42.241  -3.290  25.347  1.00 0.00 ? 10  GLY B H    1  
ATOM 9090   H HA2  . GLY B 1 10  ? 44.829  -4.266  25.290  1.00 0.00 ? 10  GLY B HA2  1  
ATOM 9091   H HA3  . GLY B 1 10  ? 44.835  -3.014  24.044  1.00 0.00 ? 10  GLY B HA3  1  
ATOM 9092   N N    . ILE B 1 11  ? 45.634  -1.644  26.130  1.00 0.00 ? 11  ILE B N    1  
ATOM 9093   C CA   . ILE B 1 11  ? 45.815  -0.557  27.149  1.00 0.00 ? 11  ILE B CA   1  
ATOM 9094   C C    . ILE B 1 11  ? 46.822  0.454   26.593  1.00 0.00 ? 11  ILE B C    1  
ATOM 9095   O O    . ILE B 1 11  ? 47.704  0.105   25.832  1.00 0.00 ? 11  ILE B O    1  
ATOM 9096   C CB   . ILE B 1 11  ? 46.334  -1.109  28.494  1.00 0.00 ? 11  ILE B CB   1  
ATOM 9097   C CG1  . ILE B 1 11  ? 47.421  -0.174  29.069  1.00 0.00 ? 11  ILE B CG1  1  
ATOM 9098   C CG2  . ILE B 1 11  ? 46.931  -2.516  28.268  1.00 0.00 ? 11  ILE B CG2  1  
ATOM 9099   C CD1  . ILE B 1 11  ? 46.811  1.198   29.454  1.00 0.00 ? 11  ILE B CD1  1  
ATOM 9100   H H    . ILE B 1 11  ? 46.371  -1.870  25.525  1.00 0.00 ? 11  ILE B H    1  
ATOM 9101   H HA   . ILE B 1 11  ? 44.867  -0.061  27.307  1.00 0.00 ? 11  ILE B HA   1  
ATOM 9102   H HB   . ILE B 1 11  ? 45.510  -1.179  29.192  1.00 0.00 ? 11  ILE B HB   1  
ATOM 9103   H HG12 . ILE B 1 11  ? 47.856  -0.630  29.946  1.00 0.00 ? 11  ILE B HG12 1  
ATOM 9104   H HG13 . ILE B 1 11  ? 48.191  -0.024  28.326  1.00 0.00 ? 11  ILE B HG13 1  
ATOM 9105   H HG21 . ILE B 1 11  ? 47.895  -2.426  27.791  1.00 0.00 ? 11  ILE B HG21 1  
ATOM 9106   H HG22 . ILE B 1 11  ? 46.270  -3.090  27.636  1.00 0.00 ? 11  ILE B HG22 1  
ATOM 9107   H HG23 . ILE B 1 11  ? 47.044  -3.016  29.219  1.00 0.00 ? 11  ILE B HG23 1  
ATOM 9108   H HD11 . ILE B 1 11  ? 45.799  1.260   29.081  1.00 0.00 ? 11  ILE B HD11 1  
ATOM 9109   H HD12 . ILE B 1 11  ? 47.402  1.991   29.020  1.00 0.00 ? 11  ILE B HD12 1  
ATOM 9110   H HD13 . ILE B 1 11  ? 46.806  1.300   30.529  1.00 0.00 ? 11  ILE B HD13 1  
ATOM 9111   N N    . ALA B 1 12  ? 46.714  1.709   26.960  1.00 0.00 ? 12  ALA B N    1  
ATOM 9112   C CA   . ALA B 1 12  ? 47.688  2.708   26.427  1.00 0.00 ? 12  ALA B CA   1  
ATOM 9113   C C    . ALA B 1 12  ? 47.800  3.924   27.356  1.00 0.00 ? 12  ALA B C    1  
ATOM 9114   O O    . ALA B 1 12  ? 46.884  4.258   28.084  1.00 0.00 ? 12  ALA B O    1  
ATOM 9115   C CB   . ALA B 1 12  ? 47.215  3.168   25.049  1.00 0.00 ? 12  ALA B CB   1  
ATOM 9116   H H    . ALA B 1 12  ? 46.004  1.988   27.576  1.00 0.00 ? 12  ALA B H    1  
ATOM 9117   H HA   . ALA B 1 12  ? 48.658  2.244   26.330  1.00 0.00 ? 12  ALA B HA   1  
ATOM 9118   H HB1  . ALA B 1 12  ? 47.783  2.658   24.284  1.00 0.00 ? 12  ALA B HB1  1  
ATOM 9119   H HB2  . ALA B 1 12  ? 47.362  4.234   24.954  1.00 0.00 ? 12  ALA B HB2  1  
ATOM 9120   H HB3  . ALA B 1 12  ? 46.166  2.937   24.933  1.00 0.00 ? 12  ALA B HB3  1  
ATOM 9121   N N    . PHE B 1 13  ? 48.922  4.598   27.310  1.00 0.00 ? 13  PHE B N    1  
ATOM 9122   C CA   . PHE B 1 13  ? 49.132  5.815   28.155  1.00 0.00 ? 13  PHE B CA   1  
ATOM 9123   C C    . PHE B 1 13  ? 49.731  6.916   27.269  1.00 0.00 ? 13  PHE B C    1  
ATOM 9124   O O    . PHE B 1 13  ? 50.737  6.699   26.620  1.00 0.00 ? 13  PHE B O    1  
ATOM 9125   C CB   . PHE B 1 13  ? 50.131  5.501   29.283  1.00 0.00 ? 13  PHE B CB   1  
ATOM 9126   C CG   . PHE B 1 13  ? 50.146  4.022   29.590  1.00 0.00 ? 13  PHE B CG   1  
ATOM 9127   C CD1  . PHE B 1 13  ? 50.963  3.155   28.841  1.00 0.00 ? 13  PHE B CD1  1  
ATOM 9128   C CD2  . PHE B 1 13  ? 49.349  3.511   30.635  1.00 0.00 ? 13  PHE B CD2  1  
ATOM 9129   C CE1  . PHE B 1 13  ? 50.988  1.778   29.141  1.00 0.00 ? 13  PHE B CE1  1  
ATOM 9130   C CE2  . PHE B 1 13  ? 49.373  2.137   30.931  1.00 0.00 ? 13  PHE B CE2  1  
ATOM 9131   C CZ   . PHE B 1 13  ? 50.193  1.269   30.182  1.00 0.00 ? 13  PHE B CZ   1  
ATOM 9132   H H    . PHE B 1 13  ? 49.632  4.309   26.699  1.00 0.00 ? 13  PHE B H    1  
ATOM 9133   H HA   . PHE B 1 13  ? 48.192  6.145   28.573  1.00 0.00 ? 13  PHE B HA   1  
ATOM 9134   H HB2  . PHE B 1 13  ? 51.120  5.809   28.977  1.00 0.00 ? 13  PHE B HB2  1  
ATOM 9135   H HB3  . PHE B 1 13  ? 49.847  6.047   30.171  1.00 0.00 ? 13  PHE B HB3  1  
ATOM 9136   H HD1  . PHE B 1 13  ? 51.574  3.545   28.039  1.00 0.00 ? 13  PHE B HD1  1  
ATOM 9137   H HD2  . PHE B 1 13  ? 48.722  4.176   31.209  1.00 0.00 ? 13  PHE B HD2  1  
ATOM 9138   H HE1  . PHE B 1 13  ? 51.615  1.112   28.566  1.00 0.00 ? 13  PHE B HE1  1  
ATOM 9139   H HE2  . PHE B 1 13  ? 48.762  1.747   31.731  1.00 0.00 ? 13  PHE B HE2  1  
ATOM 9140   H HZ   . PHE B 1 13  ? 50.213  0.213   30.411  1.00 0.00 ? 13  PHE B HZ   1  
ATOM 9141   N N    . GLY B 1 14  ? 49.156  8.094   27.222  1.00 0.00 ? 14  GLY B N    1  
ATOM 9142   C CA   . GLY B 1 14  ? 49.761  9.152   26.355  1.00 0.00 ? 14  GLY B CA   1  
ATOM 9143   C C    . GLY B 1 14  ? 48.949  10.457  26.436  1.00 0.00 ? 14  GLY B C    1  
ATOM 9144   O O    . GLY B 1 14  ? 47.946  10.542  27.117  1.00 0.00 ? 14  GLY B O    1  
ATOM 9145   H H    . GLY B 1 14  ? 48.347  8.278   27.745  1.00 0.00 ? 14  GLY B H    1  
ATOM 9146   H HA2  . GLY B 1 14  ? 50.773  9.341   26.680  1.00 0.00 ? 14  GLY B HA2  1  
ATOM 9147   H HA3  . GLY B 1 14  ? 49.774  8.808   25.331  1.00 0.00 ? 14  GLY B HA3  1  
ATOM 9148   N N    . LYS B 1 15  ? 49.398  11.465  25.738  1.00 0.00 ? 15  LYS B N    1  
ATOM 9149   C CA   . LYS B 1 15  ? 48.689  12.781  25.749  1.00 0.00 ? 15  LYS B CA   1  
ATOM 9150   C C    . LYS B 1 15  ? 47.491  12.711  24.807  1.00 0.00 ? 15  LYS B C    1  
ATOM 9151   O O    . LYS B 1 15  ? 47.410  11.850  23.953  1.00 0.00 ? 15  LYS B O    1  
ATOM 9152   C CB   . LYS B 1 15  ? 49.648  13.883  25.301  1.00 0.00 ? 15  LYS B CB   1  
ATOM 9153   C CG   . LYS B 1 15  ? 50.752  14.043  26.348  1.00 0.00 ? 15  LYS B CG   1  
ATOM 9154   C CD   . LYS B 1 15  ? 51.722  15.150  25.921  1.00 0.00 ? 15  LYS B CD   1  
ATOM 9155   C CE   . LYS B 1 15  ? 52.814  15.300  26.978  1.00 0.00 ? 15  LYS B CE   1  
ATOM 9156   N NZ   . LYS B 1 15  ? 53.765  16.371  26.567  1.00 0.00 ? 15  LYS B NZ   1  
ATOM 9157   H H    . LYS B 1 15  ? 50.212  11.359  25.203  1.00 0.00 ? 15  LYS B H    1  
ATOM 9158   H HA   . LYS B 1 15  ? 48.342  12.991  26.751  1.00 0.00 ? 15  LYS B HA   1  
ATOM 9159   H HB2  . LYS B 1 15  ? 50.086  13.616  24.350  1.00 0.00 ? 15  LYS B HB2  1  
ATOM 9160   H HB3  . LYS B 1 15  ? 49.109  14.814  25.203  1.00 0.00 ? 15  LYS B HB3  1  
ATOM 9161   H HG2  . LYS B 1 15  ? 50.309  14.301  27.299  1.00 0.00 ? 15  LYS B HG2  1  
ATOM 9162   H HG3  . LYS B 1 15  ? 51.292  13.113  26.444  1.00 0.00 ? 15  LYS B HG3  1  
ATOM 9163   H HD2  . LYS B 1 15  ? 52.169  14.891  24.972  1.00 0.00 ? 15  LYS B HD2  1  
ATOM 9164   H HD3  . LYS B 1 15  ? 51.185  16.082  25.824  1.00 0.00 ? 15  LYS B HD3  1  
ATOM 9165   H HE2  . LYS B 1 15  ? 52.365  15.563  27.924  1.00 0.00 ? 15  LYS B HE2  1  
ATOM 9166   H HE3  . LYS B 1 15  ? 53.347  14.365  27.079  1.00 0.00 ? 15  LYS B HE3  1  
ATOM 9167   H HZ1  . LYS B 1 15  ? 53.256  17.098  26.025  1.00 0.00 ? 15  LYS B HZ1  1  
ATOM 9168   H HZ2  . LYS B 1 15  ? 54.516  15.959  25.976  1.00 0.00 ? 15  LYS B HZ2  1  
ATOM 9169   H HZ3  . LYS B 1 15  ? 54.187  16.803  27.412  1.00 0.00 ? 15  LYS B HZ3  1  
ATOM 9170   N N    . ALA B 1 16  ? 46.532  13.593  24.978  1.00 0.00 ? 16  ALA B N    1  
ATOM 9171   C CA   . ALA B 1 16  ? 45.305  13.559  24.111  1.00 0.00 ? 16  ALA B CA   1  
ATOM 9172   C C    . ALA B 1 16  ? 45.338  14.679  23.062  1.00 0.00 ? 16  ALA B C    1  
ATOM 9173   O O    . ALA B 1 16  ? 45.528  15.838  23.374  1.00 0.00 ? 16  ALA B O    1  
ATOM 9174   C CB   . ALA B 1 16  ? 44.067  13.719  25.008  1.00 0.00 ? 16  ALA B CB   1  
ATOM 9175   H H    . ALA B 1 16  ? 46.606  14.261  25.691  1.00 0.00 ? 16  ALA B H    1  
ATOM 9176   H HA   . ALA B 1 16  ? 45.254  12.605  23.608  1.00 0.00 ? 16  ALA B HA   1  
ATOM 9177   H HB1  . ALA B 1 16  ? 43.786  14.761  25.051  1.00 0.00 ? 16  ALA B HB1  1  
ATOM 9178   H HB2  . ALA B 1 16  ? 44.294  13.366  26.003  1.00 0.00 ? 16  ALA B HB2  1  
ATOM 9179   H HB3  . ALA B 1 16  ? 43.250  13.142  24.599  1.00 0.00 ? 16  ALA B HB3  1  
ATOM 9180   N N    . LEU B 1 17  ? 45.123  14.328  21.817  1.00 0.00 ? 17  LEU B N    1  
ATOM 9181   C CA   . LEU B 1 17  ? 45.110  15.350  20.729  1.00 0.00 ? 17  LEU B CA   1  
ATOM 9182   C C    . LEU B 1 17  ? 43.644  15.657  20.392  1.00 0.00 ? 17  LEU B C    1  
ATOM 9183   O O    . LEU B 1 17  ? 42.840  14.757  20.268  1.00 0.00 ? 17  LEU B O    1  
ATOM 9184   C CB   . LEU B 1 17  ? 45.823  14.786  19.493  1.00 0.00 ? 17  LEU B CB   1  
ATOM 9185   C CG   . LEU B 1 17  ? 45.828  15.816  18.356  1.00 0.00 ? 17  LEU B CG   1  
ATOM 9186   C CD1  . LEU B 1 17  ? 46.586  17.079  18.789  1.00 0.00 ? 17  LEU B CD1  1  
ATOM 9187   C CD2  . LEU B 1 17  ? 46.526  15.206  17.137  1.00 0.00 ? 17  LEU B CD2  1  
ATOM 9188   H H    . LEU B 1 17  ? 44.953  13.387  21.602  1.00 0.00 ? 17  LEU B H    1  
ATOM 9189   H HA   . LEU B 1 17  ? 45.606  16.250  21.063  1.00 0.00 ? 17  LEU B HA   1  
ATOM 9190   H HB2  . LEU B 1 17  ? 46.841  14.536  19.752  1.00 0.00 ? 17  LEU B HB2  1  
ATOM 9191   H HB3  . LEU B 1 17  ? 45.310  13.895  19.162  1.00 0.00 ? 17  LEU B HB3  1  
ATOM 9192   H HG   . LEU B 1 17  ? 44.812  16.075  18.099  1.00 0.00 ? 17  LEU B HG   1  
ATOM 9193   H HD11 . LEU B 1 17  ? 45.903  17.761  19.274  1.00 0.00 ? 17  LEU B HD11 1  
ATOM 9194   H HD12 . LEU B 1 17  ? 47.016  17.557  17.920  1.00 0.00 ? 17  LEU B HD12 1  
ATOM 9195   H HD13 . LEU B 1 17  ? 47.373  16.809  19.477  1.00 0.00 ? 17  LEU B HD13 1  
ATOM 9196   H HD21 . LEU B 1 17  ? 45.973  14.341  16.800  1.00 0.00 ? 17  LEU B HD21 1  
ATOM 9197   H HD22 . LEU B 1 17  ? 47.529  14.909  17.407  1.00 0.00 ? 17  LEU B HD22 1  
ATOM 9198   H HD23 . LEU B 1 17  ? 46.568  15.937  16.342  1.00 0.00 ? 17  LEU B HD23 1  
ATOM 9199   N N    . LEU B 1 18  ? 43.289  16.913  20.251  1.00 0.00 ? 18  LEU B N    1  
ATOM 9200   C CA   . LEU B 1 18  ? 41.861  17.274  19.941  1.00 0.00 ? 18  LEU B CA   1  
ATOM 9201   C C    . LEU B 1 18  ? 41.767  17.967  18.575  1.00 0.00 ? 18  LEU B C    1  
ATOM 9202   O O    . LEU B 1 18  ? 42.389  18.981  18.332  1.00 0.00 ? 18  LEU B O    1  
ATOM 9203   C CB   . LEU B 1 18  ? 41.351  18.223  21.033  1.00 0.00 ? 18  LEU B CB   1  
ATOM 9204   C CG   . LEU B 1 18  ? 39.834  18.429  20.911  1.00 0.00 ? 18  LEU B CG   1  
ATOM 9205   C CD1  . LEU B 1 18  ? 39.097  17.086  21.071  1.00 0.00 ? 18  LEU B CD1  1  
ATOM 9206   C CD2  . LEU B 1 18  ? 39.364  19.412  22.004  1.00 0.00 ? 18  LEU B CD2  1  
ATOM 9207   H H    . LEU B 1 18  ? 43.956  17.622  20.362  1.00 0.00 ? 18  LEU B H    1  
ATOM 9208   H HA   . LEU B 1 18  ? 41.257  16.379  19.933  1.00 0.00 ? 18  LEU B HA   1  
ATOM 9209   H HB2  . LEU B 1 18  ? 41.576  17.802  22.003  1.00 0.00 ? 18  LEU B HB2  1  
ATOM 9210   H HB3  . LEU B 1 18  ? 41.848  19.177  20.937  1.00 0.00 ? 18  LEU B HB3  1  
ATOM 9211   H HG   . LEU B 1 18  ? 39.611  18.843  19.939  1.00 0.00 ? 18  LEU B HG   1  
ATOM 9212   H HD11 . LEU B 1 18  ? 38.938  16.644  20.098  1.00 0.00 ? 18  LEU B HD11 1  
ATOM 9213   H HD12 . LEU B 1 18  ? 38.144  17.253  21.551  1.00 0.00 ? 18  LEU B HD12 1  
ATOM 9214   H HD13 . LEU B 1 18  ? 39.693  16.418  21.676  1.00 0.00 ? 18  LEU B HD13 1  
ATOM 9215   H HD21 . LEU B 1 18  ? 38.857  18.865  22.786  1.00 0.00 ? 18  LEU B HD21 1  
ATOM 9216   H HD22 . LEU B 1 18  ? 38.686  20.133  21.572  1.00 0.00 ? 18  LEU B HD22 1  
ATOM 9217   H HD23 . LEU B 1 18  ? 40.219  19.925  22.420  1.00 0.00 ? 18  LEU B HD23 1  
ATOM 9218   N N    . LEU B 1 19  ? 40.983  17.411  17.684  1.00 0.00 ? 19  LEU B N    1  
ATOM 9219   C CA   . LEU B 1 19  ? 40.836  18.021  16.329  1.00 0.00 ? 19  LEU B CA   1  
ATOM 9220   C C    . LEU B 1 19  ? 39.716  19.073  16.338  1.00 0.00 ? 19  LEU B C    1  
ATOM 9221   O O    . LEU B 1 19  ? 38.546  18.746  16.326  1.00 0.00 ? 19  LEU B O    1  
ATOM 9222   C CB   . LEU B 1 19  ? 40.489  16.935  15.305  1.00 0.00 ? 19  LEU B CB   1  
ATOM 9223   C CG   . LEU B 1 19  ? 41.381  15.701  15.507  1.00 0.00 ? 19  LEU B CG   1  
ATOM 9224   C CD1  . LEU B 1 19  ? 41.098  14.689  14.392  1.00 0.00 ? 19  LEU B CD1  1  
ATOM 9225   C CD2  . LEU B 1 19  ? 42.860  16.109  15.468  1.00 0.00 ? 19  LEU B CD2  1  
ATOM 9226   H H    . LEU B 1 19  ? 40.493  16.592  17.908  1.00 0.00 ? 19  LEU B H    1  
ATOM 9227   H HA   . LEU B 1 19  ? 41.766  18.492  16.047  1.00 0.00 ? 19  LEU B HA   1  
ATOM 9228   H HB2  . LEU B 1 19  ? 39.454  16.651  15.425  1.00 0.00 ? 19  LEU B HB2  1  
ATOM 9229   H HB3  . LEU B 1 19  ? 40.640  17.325  14.309  1.00 0.00 ? 19  LEU B HB3  1  
ATOM 9230   H HG   . LEU B 1 19  ? 41.155  15.251  16.463  1.00 0.00 ? 19  LEU B HG   1  
ATOM 9231   H HD11 . LEU B 1 19  ? 41.451  13.714  14.694  1.00 0.00 ? 19  LEU B HD11 1  
ATOM 9232   H HD12 . LEU B 1 19  ? 41.609  14.994  13.491  1.00 0.00 ? 19  LEU B HD12 1  
ATOM 9233   H HD13 . LEU B 1 19  ? 40.035  14.646  14.206  1.00 0.00 ? 19  LEU B HD13 1  
ATOM 9234   H HD21 . LEU B 1 19  ? 43.186  16.376  16.462  1.00 0.00 ? 19  LEU B HD21 1  
ATOM 9235   H HD22 . LEU B 1 19  ? 42.983  16.956  14.808  1.00 0.00 ? 19  LEU B HD22 1  
ATOM 9236   H HD23 . LEU B 1 19  ? 43.452  15.282  15.105  1.00 0.00 ? 19  LEU B HD23 1  
ATOM 9237   N N    . LYS B 1 20  ? 40.045  20.221  16.698  1.00 0.00 ? 20  LYS B N    1  
ATOM 9238   C CA   . LYS B 1 20  ? 39.013  21.225  16.937  1.00 0.00 ? 20  LYS B CA   1  
ATOM 9239   C C    . LYS B 1 20  ? 39.541  22.324  16.184  1.00 0.00 ? 20  LYS B C    1  
ATOM 9240   O O    . LYS B 1 20  ? 39.599  23.424  16.660  1.00 0.00 ? 20  LYS B O    1  
ATOM 9241   C CB   . LYS B 1 20  ? 38.880  21.625  18.416  1.00 0.00 ? 20  LYS B CB   1  
ATOM 9242   C CG   . LYS B 1 20  ? 40.269  21.826  19.069  1.00 0.00 ? 20  LYS B CG   1  
ATOM 9243   C CD   . LYS B 1 20  ? 40.271  23.047  19.982  1.00 0.00 ? 20  LYS B CD   1  
ATOM 9244   C CE   . LYS B 1 20  ? 39.346  22.818  21.180  1.00 0.00 ? 20  LYS B CE   1  
ATOM 9245   N NZ   . LYS B 1 20  ? 39.112  24.120  21.865  1.00 0.00 ? 20  LYS B NZ   1  
ATOM 9246   H H    . LYS B 1 20  ? 40.973  20.404  16.950  1.00 0.00 ? 20  LYS B H    1  
ATOM 9247   H HA   . LYS B 1 20  ? 38.055  20.922  16.529  1.00 0.00 ? 20  LYS B HA   1  
ATOM 9248   H HB2  . LYS B 1 20  ? 38.313  22.545  18.473  1.00 0.00 ? 20  LYS B HB2  1  
ATOM 9249   H HB3  . LYS B 1 20  ? 38.344  20.851  18.944  1.00 0.00 ? 20  LYS B HB3  1  
ATOM 9250   H HG2  . LYS B 1 20  ? 40.510  20.971  19.666  1.00 0.00 ? 20  LYS B HG2  1  
ATOM 9251   H HG3  . LYS B 1 20  ? 41.021  21.951  18.310  1.00 0.00 ? 20  LYS B HG3  1  
ATOM 9252   H HD2  . LYS B 1 20  ? 41.269  23.213  20.336  1.00 0.00 ? 20  LYS B HD2  1  
ATOM 9253   H HD3  . LYS B 1 20  ? 39.938  23.908  19.433  1.00 0.00 ? 20  LYS B HD3  1  
ATOM 9254   H HE2  . LYS B 1 20  ? 38.406  22.415  20.838  1.00 0.00 ? 20  LYS B HE2  1  
ATOM 9255   H HE3  . LYS B 1 20  ? 39.802  22.128  21.875  1.00 0.00 ? 20  LYS B HE3  1  
ATOM 9256   H HZ1  . LYS B 1 20  ? 38.493  23.977  22.688  1.00 0.00 ? 20  LYS B HZ1  1  
ATOM 9257   H HZ2  . LYS B 1 20  ? 38.662  24.782  21.201  1.00 0.00 ? 20  LYS B HZ2  1  
ATOM 9258   H HZ3  . LYS B 1 20  ? 40.022  24.510  22.182  1.00 0.00 ? 20  LYS B HZ3  1  
ATOM 9259   N N    . GLU B 1 21  ? 39.976  21.977  14.997  1.00 0.00 ? 21  GLU B N    1  
ATOM 9260   C CA   . GLU B 1 21  ? 40.590  22.948  14.110  1.00 0.00 ? 21  GLU B CA   1  
ATOM 9261   C C    . GLU B 1 21  ? 39.821  24.239  14.399  1.00 0.00 ? 21  GLU B C    1  
ATOM 9262   O O    . GLU B 1 21  ? 38.867  24.623  13.750  1.00 0.00 ? 21  GLU B O    1  
ATOM 9263   C CB   . GLU B 1 21  ? 40.432  22.398  12.651  1.00 0.00 ? 21  GLU B CB   1  
ATOM 9264   C CG   . GLU B 1 21  ? 41.335  21.148  12.401  1.00 0.00 ? 21  GLU B CG   1  
ATOM 9265   C CD   . GLU B 1 21  ? 41.022  20.505  11.050  1.00 0.00 ? 21  GLU B CD   1  
ATOM 9266   O OE1  . GLU B 1 21  ? 40.005  20.844  10.472  1.00 0.00 ? 21  GLU B OE1  1  
ATOM 9267   O OE2  . GLU B 1 21  ? 41.816  19.688  10.615  1.00 0.00 ? 21  GLU B OE2  1  
ATOM 9268   H H    . GLU B 1 21  ? 39.918  21.040  14.718  1.00 0.00 ? 21  GLU B H    1  
ATOM 9269   H HA   . GLU B 1 21  ? 41.628  23.076  14.375  1.00 0.00 ? 21  GLU B HA   1  
ATOM 9270   H HB2  . GLU B 1 21  ? 39.399  22.126  12.501  1.00 0.00 ? 21  GLU B HB2  1  
ATOM 9271   H HB3  . GLU B 1 21  ? 40.690  23.171  11.943  1.00 0.00 ? 21  GLU B HB3  1  
ATOM 9272   H HG2  . GLU B 1 21  ? 42.372  21.451  12.401  1.00 0.00 ? 21  GLU B HG2  1  
ATOM 9273   H HG3  . GLU B 1 21  ? 41.189  20.415  13.179  1.00 0.00 ? 21  GLU B HG3  1  
ATOM 9274   N N    . ASP B 1 22  ? 40.243  25.058  15.321  1.00 0.00 ? 22  ASP B N    1  
ATOM 9275   C CA   . ASP B 1 22  ? 39.449  26.271  15.538  1.00 0.00 ? 22  ASP B CA   1  
ATOM 9276   C C    . ASP B 1 22  ? 39.293  27.126  14.270  1.00 0.00 ? 22  ASP B C    1  
ATOM 9277   O O    . ASP B 1 22  ? 40.193  27.243  13.439  1.00 0.00 ? 22  ASP B O    1  
ATOM 9278   C CB   . ASP B 1 22  ? 40.053  27.102  16.653  1.00 0.00 ? 22  ASP B CB   1  
ATOM 9279   C CG   . ASP B 1 22  ? 39.667  26.586  18.031  1.00 0.00 ? 22  ASP B CG   1  
ATOM 9280   O OD1  . ASP B 1 22  ? 38.565  26.888  18.452  1.00 0.00 ? 22  ASP B OD1  1  
ATOM 9281   O OD2  . ASP B 1 22  ? 40.508  25.997  18.687  1.00 0.00 ? 22  ASP B OD2  1  
ATOM 9282   H H    . ASP B 1 22  ? 41.051  24.872  15.844  1.00 0.00 ? 22  ASP B H    1  
ATOM 9283   H HA   . ASP B 1 22  ? 38.462  25.965  15.853  1.00 0.00 ? 22  ASP B HA   1  
ATOM 9284   H HB2  . ASP B 1 22  ? 41.109  27.060  16.562  1.00 0.00 ? 22  ASP B HB2  1  
ATOM 9285   H HB3  . ASP B 1 22  ? 39.722  28.122  16.555  1.00 0.00 ? 22  ASP B HB3  1  
ATOM 9286   N N    . GLU B 1 23  ? 38.084  27.684  14.156  1.00 0.00 ? 23  GLU B N    1  
ATOM 9287   C CA   . GLU B 1 23  ? 37.652  28.532  13.032  1.00 0.00 ? 23  GLU B CA   1  
ATOM 9288   C C    . GLU B 1 23  ? 38.435  29.842  12.917  1.00 0.00 ? 23  GLU B C    1  
ATOM 9289   O O    . GLU B 1 23  ? 39.141  30.242  13.842  1.00 0.00 ? 23  GLU B O    1  
ATOM 9290   C CB   . GLU B 1 23  ? 36.177  28.895  13.241  1.00 0.00 ? 23  GLU B CB   1  
ATOM 9291   C CG   . GLU B 1 23  ? 36.047  29.521  14.634  1.00 0.00 ? 23  GLU B CG   1  
ATOM 9292   C CD   . GLU B 1 23  ? 34.648  30.058  14.913  1.00 0.00 ? 23  GLU B CD   1  
ATOM 9293   O OE1  . GLU B 1 23  ? 33.903  30.299  13.977  1.00 0.00 ? 23  GLU B OE1  1  
ATOM 9294   O OE2  . GLU B 1 23  ? 34.416  30.367  16.069  1.00 0.00 ? 23  GLU B OE2  1  
ATOM 9295   H H    . GLU B 1 23  ? 37.433  27.503  14.865  1.00 0.00 ? 23  GLU B H    1  
ATOM 9296   H HA   . GLU B 1 23  ? 37.743  27.979  12.112  1.00 0.00 ? 23  GLU B HA   1  
ATOM 9297   H HB2  . GLU B 1 23  ? 35.864  29.603  12.487  1.00 0.00 ? 23  GLU B HB2  1  
ATOM 9298   H HB3  . GLU B 1 23  ? 35.568  28.005  13.187  1.00 0.00 ? 23  GLU B HB3  1  
ATOM 9299   H HG2  . GLU B 1 23  ? 36.280  28.774  15.375  1.00 0.00 ? 23  GLU B HG2  1  
ATOM 9300   H HG3  . GLU B 1 23  ? 36.751  30.333  14.730  1.00 0.00 ? 23  GLU B HG3  1  
ATOM 9301   N N    . ILE B 1 24  ? 38.252  30.530  11.780  1.00 0.00 ? 24  ILE B N    1  
ATOM 9302   C CA   . ILE B 1 24  ? 38.896  31.827  11.565  1.00 0.00 ? 24  ILE B CA   1  
ATOM 9303   C C    . ILE B 1 24  ? 37.875  32.961  11.712  1.00 0.00 ? 24  ILE B C    1  
ATOM 9304   O O    . ILE B 1 24  ? 37.050  33.199  10.830  1.00 0.00 ? 24  ILE B O    1  
ATOM 9305   C CB   . ILE B 1 24  ? 39.470  31.850  10.154  1.00 0.00 ? 24  ILE B CB   1  
ATOM 9306   C CG1  . ILE B 1 24  ? 40.531  30.751  10.021  1.00 0.00 ? 24  ILE B CG1  1  
ATOM 9307   C CG2  . ILE B 1 24  ? 40.057  33.221  9.853   1.00 0.00 ? 24  ILE B CG2  1  
ATOM 9308   C CD1  . ILE B 1 24  ? 40.936  30.595  8.555   1.00 0.00 ? 24  ILE B CD1  1  
ATOM 9309   H H    . ILE B 1 24  ? 37.646  30.175  11.097  1.00 0.00 ? 24  ILE B H    1  
ATOM 9310   H HA   . ILE B 1 24  ? 39.694  31.961  12.279  1.00 0.00 ? 24  ILE B HA   1  
ATOM 9311   H HB   . ILE B 1 24  ? 38.672  31.653  9.453   1.00 0.00 ? 24  ILE B HB   1  
ATOM 9312   H HG12 . ILE B 1 24  ? 41.399  31.018  10.607  1.00 0.00 ? 24  ILE B HG12 1  
ATOM 9313   H HG13 . ILE B 1 24  ? 40.129  29.817  10.383  1.00 0.00 ? 24  ILE B HG13 1  
ATOM 9314   H HG21 . ILE B 1 24  ? 40.603  33.175  8.925   1.00 0.00 ? 24  ILE B HG21 1  
ATOM 9315   H HG22 . ILE B 1 24  ? 40.710  33.516  10.659  1.00 0.00 ? 24  ILE B HG22 1  
ATOM 9316   H HG23 . ILE B 1 24  ? 39.259  33.942  9.760   1.00 0.00 ? 24  ILE B HG23 1  
ATOM 9317   H HD11 . ILE B 1 24  ? 42.010  30.664  8.468   1.00 0.00 ? 24  ILE B HD11 1  
ATOM 9318   H HD12 . ILE B 1 24  ? 40.476  31.376  7.968   1.00 0.00 ? 24  ILE B HD12 1  
ATOM 9319   H HD13 . ILE B 1 24  ? 40.607  29.632  8.192   1.00 0.00 ? 24  ILE B HD13 1  
ATOM 9320   N N    . VAL B 1 25  ? 37.936  33.615  12.866  1.00 0.00 ? 25  VAL B N    1  
ATOM 9321   C CA   . VAL B 1 25  ? 37.004  34.684  13.162  1.00 0.00 ? 25  VAL B CA   1  
ATOM 9322   C C    . VAL B 1 25  ? 37.746  35.989  12.944  1.00 0.00 ? 25  VAL B C    1  
ATOM 9323   O O    . VAL B 1 25  ? 38.647  36.336  13.697  1.00 0.00 ? 25  VAL B O    1  
ATOM 9324   C CB   . VAL B 1 25  ? 36.439  34.576  14.609  1.00 0.00 ? 25  VAL B CB   1  
ATOM 9325   C CG1  . VAL B 1 25  ? 35.467  35.725  14.909  1.00 0.00 ? 25  VAL B CG1  1  
ATOM 9326   C CG2  . VAL B 1 25  ? 35.754  33.237  14.817  1.00 0.00 ? 25  VAL B CG2  1  
ATOM 9327   H H    . VAL B 1 25  ? 38.591  33.342  13.543  1.00 0.00 ? 25  VAL B H    1  
ATOM 9328   H HA   . VAL B 1 25  ? 36.184  34.632  12.459  1.00 0.00 ? 25  VAL B HA   1  
ATOM 9329   H HB   . VAL B 1 25  ? 37.269  34.650  15.299  1.00 0.00 ? 25  VAL B HB   1  
ATOM 9330   H HG11 . VAL B 1 25  ? 35.125  35.649  15.932  1.00 0.00 ? 25  VAL B HG11 1  
ATOM 9331   H HG12 . VAL B 1 25  ? 34.620  35.664  14.241  1.00 0.00 ? 25  VAL B HG12 1  
ATOM 9332   H HG13 . VAL B 1 25  ? 35.971  36.669  14.767  1.00 0.00 ? 25  VAL B HG13 1  
ATOM 9333   H HG21 . VAL B 1 25  ? 35.986  32.581  13.991  1.00 0.00 ? 25  VAL B HG21 1  
ATOM 9334   H HG22 . VAL B 1 25  ? 34.685  33.383  14.871  1.00 0.00 ? 25  VAL B HG22 1  
ATOM 9335   H HG23 . VAL B 1 25  ? 36.104  32.792  15.738  1.00 0.00 ? 25  VAL B HG23 1  
ATOM 9336   N N    . ILE B 1 26  ? 37.371  36.695  11.887  1.00 0.00 ? 26  ILE B N    1  
ATOM 9337   C CA   . ILE B 1 26  ? 37.977  37.985  11.555  1.00 0.00 ? 26  ILE B CA   1  
ATOM 9338   C C    . ILE B 1 26  ? 37.398  39.133  12.403  1.00 0.00 ? 26  ILE B C    1  
ATOM 9339   O O    . ILE B 1 26  ? 36.199  39.434  12.328  1.00 0.00 ? 26  ILE B O    1  
ATOM 9340   C CB   . ILE B 1 26  ? 37.810  38.304  10.032  1.00 0.00 ? 26  ILE B CB   1  
ATOM 9341   C CG1  . ILE B 1 26  ? 38.313  37.154  9.165   1.00 0.00 ? 26  ILE B CG1  1  
ATOM 9342   C CG2  . ILE B 1 26  ? 38.544  39.559  9.641   1.00 0.00 ? 26  ILE B CG2  1  
ATOM 9343   C CD1  . ILE B 1 26  ? 37.214  36.266  8.660   1.00 0.00 ? 26  ILE B CD1  1  
ATOM 9344   H H    . ILE B 1 26  ? 36.654  36.347  11.317  1.00 0.00 ? 26  ILE B H    1  
ATOM 9345   H HA   . ILE B 1 26  ? 39.034  37.918  11.765  1.00 0.00 ? 26  ILE B HA   1  
ATOM 9346   H HB   . ILE B 1 26  ? 36.758  38.450  9.830   1.00 0.00 ? 26  ILE B HB   1  
ATOM 9347   H HG12 . ILE B 1 26  ? 38.840  37.564  8.318   1.00 0.00 ? 26  ILE B HG12 1  
ATOM 9348   H HG13 . ILE B 1 26  ? 39.004  36.560  9.747   1.00 0.00 ? 26  ILE B HG13 1  
ATOM 9349   H HG21 . ILE B 1 26  ? 38.216  40.377  10.265  1.00 0.00 ? 26  ILE B HG21 1  
ATOM 9350   H HG22 . ILE B 1 26  ? 38.338  39.789  8.605   1.00 0.00 ? 26  ILE B HG22 1  
ATOM 9351   H HG23 . ILE B 1 26  ? 39.606  39.410  9.773   1.00 0.00 ? 26  ILE B HG23 1  
ATOM 9352   H HD11 . ILE B 1 26  ? 36.726  35.787  9.495   1.00 0.00 ? 26  ILE B HD11 1  
ATOM 9353   H HD12 . ILE B 1 26  ? 37.632  35.513  8.007   1.00 0.00 ? 26  ILE B HD12 1  
ATOM 9354   H HD13 . ILE B 1 26  ? 36.494  36.857  8.115   1.00 0.00 ? 26  ILE B HD13 1  
ATOM 9355   N N    . ASP B 1 27  ? 38.251  39.769  13.207  1.00 0.00 ? 27  ASP B N    1  
ATOM 9356   C CA   . ASP B 1 27  ? 37.890  41.017  13.906  1.00 0.00 ? 27  ASP B CA   1  
ATOM 9357   C C    . ASP B 1 27  ? 37.613  42.148  12.903  1.00 0.00 ? 27  ASP B C    1  
ATOM 9358   O O    . ASP B 1 27  ? 38.509  42.578  12.157  1.00 0.00 ? 27  ASP B O    1  
ATOM 9359   C CB   . ASP B 1 27  ? 38.984  41.426  14.909  1.00 0.00 ? 27  ASP B CB   1  
ATOM 9360   C CG   . ASP B 1 27  ? 38.624  42.687  15.717  1.00 0.00 ? 27  ASP B CG   1  
ATOM 9361   O OD1  . ASP B 1 27  ? 37.600  43.360  15.432  1.00 0.00 ? 27  ASP B OD1  1  
ATOM 9362   O OD2  . ASP B 1 27  ? 39.382  42.999  16.661  1.00 0.00 ? 27  ASP B OD2  1  
ATOM 9363   H H    . ASP B 1 27  ? 39.186  39.478  13.221  1.00 0.00 ? 27  ASP B H    1  
ATOM 9364   H HA   . ASP B 1 27  ? 36.979  40.834  14.460  1.00 0.00 ? 27  ASP B HA   1  
ATOM 9365   H HB2  . ASP B 1 27  ? 39.147  40.610  15.597  1.00 0.00 ? 27  ASP B HB2  1  
ATOM 9366   H HB3  . ASP B 1 27  ? 39.900  41.609  14.365  1.00 0.00 ? 27  ASP B HB3  1  
ATOM 9367   N N    . ARG B 1 28  ? 36.371  42.626  12.905  1.00 0.00 ? 28  ARG B N    1  
ATOM 9368   C CA   . ARG B 1 28  ? 35.957  43.639  11.931  1.00 0.00 ? 28  ARG B CA   1  
ATOM 9369   C C    . ARG B 1 28  ? 35.813  45.093  12.411  1.00 0.00 ? 28  ARG B C    1  
ATOM 9370   O O    . ARG B 1 28  ? 35.506  45.979  11.603  1.00 0.00 ? 28  ARG B O    1  
ATOM 9371   C CB   . ARG B 1 28  ? 34.723  43.170  11.172  1.00 0.00 ? 28  ARG B CB   1  
ATOM 9372   C CG   . ARG B 1 28  ? 35.076  42.044  10.262  1.00 0.00 ? 28  ARG B CG   1  
ATOM 9373   C CD   . ARG B 1 28  ? 33.863  41.532  9.559   1.00 0.00 ? 28  ARG B CD   1  
ATOM 9374   N NE   . ARG B 1 28  ? 34.150  40.466  8.598   1.00 0.00 ? 28  ARG B NE   1  
ATOM 9375   C CZ   . ARG B 1 28  ? 34.299  39.175  8.898   1.00 0.00 ? 28  ARG B CZ   1  
ATOM 9376   N NH1  . ARG B 1 28  ? 34.242  38.747  10.157  1.00 0.00 ? 28  ARG B NH1  1  
ATOM 9377   N NH2  . ARG B 1 28  ? 34.526  38.307  7.930   1.00 0.00 ? 28  ARG B NH2  1  
ATOM 9378   H H    . ARG B 1 28  ? 35.709  42.251  13.522  1.00 0.00 ? 28  ARG B H    1  
ATOM 9379   H HA   . ARG B 1 28  ? 36.750  43.665  11.198  1.00 0.00 ? 28  ARG B HA   1  
ATOM 9380   H HB2  . ARG B 1 28  ? 33.975  42.839  11.877  1.00 0.00 ? 28  ARG B HB2  1  
ATOM 9381   H HB3  . ARG B 1 28  ? 34.328  43.990  10.591  1.00 0.00 ? 28  ARG B HB3  1  
ATOM 9382   H HG2  . ARG B 1 28  ? 35.791  42.390  9.530   1.00 0.00 ? 28  ARG B HG2  1  
ATOM 9383   H HG3  . ARG B 1 28  ? 35.516  41.245  10.840  1.00 0.00 ? 28  ARG B HG3  1  
ATOM 9384   H HD2  . ARG B 1 28  ? 33.172  41.151  10.294  1.00 0.00 ? 28  ARG B HD2  1  
ATOM 9385   H HD3  . ARG B 1 28  ? 33.393  42.355  9.039   1.00 0.00 ? 28  ARG B HD3  1  
ATOM 9386   H HE   . ARG B 1 28  ? 34.228  40.721  7.655   1.00 0.00 ? 28  ARG B HE   1  
ATOM 9387   H HH11 . ARG B 1 28  ? 34.084  39.398  10.900  1.00 0.00 ? 28  ARG B HH11 1  
ATOM 9388   H HH12 . ARG B 1 28  ? 34.356  37.775  10.361  1.00 0.00 ? 28  ARG B HH12 1  
ATOM 9389   H HH21 . ARG B 1 28  ? 34.585  38.620  6.982   1.00 0.00 ? 28  ARG B HH21 1  
ATOM 9390   H HH22 . ARG B 1 28  ? 34.639  37.337  8.145   1.00 0.00 ? 28  ARG B HH22 1  
ATOM 9391   N N    . LYS B 1 29  ? 36.052  45.339  13.699  1.00 0.00 ? 29  LYS B N    1  
ATOM 9392   C CA   . LYS B 1 29  ? 36.134  46.714  14.211  1.00 0.00 ? 29  LYS B CA   1  
ATOM 9393   C C    . LYS B 1 29  ? 37.357  47.383  13.574  1.00 0.00 ? 29  LYS B C    1  
ATOM 9394   O O    . LYS B 1 29  ? 38.466  46.848  13.654  1.00 0.00 ? 29  LYS B O    1  
ATOM 9395   C CB   . LYS B 1 29  ? 36.258  46.743  15.753  1.00 0.00 ? 29  LYS B CB   1  
ATOM 9396   C CG   . LYS B 1 29  ? 35.038  46.198  16.530  1.00 0.00 ? 29  LYS B CG   1  
ATOM 9397   C CD   . LYS B 1 29  ? 35.260  46.279  18.058  1.00 0.00 ? 29  LYS B CD   1  
ATOM 9398   C CE   . LYS B 1 29  ? 34.082  45.689  18.879  1.00 0.00 ? 29  LYS B CE   1  
ATOM 9399   N NZ   . LYS B 1 29  ? 32.769  46.395  18.687  1.00 0.00 ? 29  LYS B NZ   1  
ATOM 9400   H H    . LYS B 1 29  ? 36.305  44.597  14.287  1.00 0.00 ? 29  LYS B H    1  
ATOM 9401   H HA   . LYS B 1 29  ? 35.244  47.252  13.915  1.00 0.00 ? 29  LYS B HA   1  
ATOM 9402   H HB2  . LYS B 1 29  ? 37.119  46.159  16.035  1.00 0.00 ? 29  LYS B HB2  1  
ATOM 9403   H HB3  . LYS B 1 29  ? 36.430  47.766  16.058  1.00 0.00 ? 29  LYS B HB3  1  
ATOM 9404   H HG2  . LYS B 1 29  ? 34.165  46.778  16.270  1.00 0.00 ? 29  LYS B HG2  1  
ATOM 9405   H HG3  . LYS B 1 29  ? 34.873  45.168  16.251  1.00 0.00 ? 29  LYS B HG3  1  
ATOM 9406   H HD2  . LYS B 1 29  ? 36.159  45.735  18.306  1.00 0.00 ? 29  LYS B HD2  1  
ATOM 9407   H HD3  . LYS B 1 29  ? 35.394  47.315  18.334  1.00 0.00 ? 29  LYS B HD3  1  
ATOM 9408   H HE2  . LYS B 1 29  ? 33.952  44.656  18.598  1.00 0.00 ? 29  LYS B HE2  1  
ATOM 9409   H HE3  . LYS B 1 29  ? 34.347  45.725  19.927  1.00 0.00 ? 29  LYS B HE3  1  
ATOM 9410   H HZ1  . LYS B 1 29  ? 32.284  46.479  19.603  1.00 0.00 ? 29  LYS B HZ1  1  
ATOM 9411   H HZ2  . LYS B 1 29  ? 32.176  45.850  18.028  1.00 0.00 ? 29  LYS B HZ2  1  
ATOM 9412   H HZ3  . LYS B 1 29  ? 32.940  47.344  18.299  1.00 0.00 ? 29  LYS B HZ3  1  
ATOM 9413   N N    . LYS B 1 30  ? 37.141  48.524  12.917  1.00 0.00 ? 30  LYS B N    1  
ATOM 9414   C CA   . LYS B 1 30  ? 38.226  49.386  12.415  1.00 0.00 ? 30  LYS B CA   1  
ATOM 9415   C C    . LYS B 1 30  ? 39.173  49.774  13.550  1.00 0.00 ? 30  LYS B C    1  
ATOM 9416   O O    . LYS B 1 30  ? 38.757  49.828  14.701  1.00 0.00 ? 30  LYS B O    1  
ATOM 9417   C CB   . LYS B 1 30  ? 37.653  50.665  11.784  1.00 0.00 ? 30  LYS B CB   1  
ATOM 9418   C CG   . LYS B 1 30  ? 36.694  50.454  10.614  1.00 0.00 ? 30  LYS B CG   1  
ATOM 9419   C CD   . LYS B 1 30  ? 37.424  49.894  9.389   1.00 0.00 ? 30  LYS B CD   1  
ATOM 9420   C CE   . LYS B 1 30  ? 36.526  49.817  8.151   1.00 0.00 ? 30  LYS B CE   1  
ATOM 9421   N NZ   . LYS B 1 30  ? 37.271  49.265  6.970   1.00 0.00 ? 30  LYS B NZ   1  
ATOM 9422   H H    . LYS B 1 30  ? 36.224  48.865  12.873  1.00 0.00 ? 30  LYS B H    1  
ATOM 9423   H HA   . LYS B 1 30  ? 38.783  48.846  11.663  1.00 0.00 ? 30  LYS B HA   1  
ATOM 9424   H HB2  . LYS B 1 30  ? 37.127  51.212  12.550  1.00 0.00 ? 30  LYS B HB2  1  
ATOM 9425   H HB3  . LYS B 1 30  ? 38.481  51.272  11.445  1.00 0.00 ? 30  LYS B HB3  1  
ATOM 9426   H HG2  . LYS B 1 30  ? 35.921  49.762  10.912  1.00 0.00 ? 30  LYS B HG2  1  
ATOM 9427   H HG3  . LYS B 1 30  ? 36.241  51.400  10.355  1.00 0.00 ? 30  LYS B HG3  1  
ATOM 9428   H HD2  . LYS B 1 30  ? 38.268  50.529  9.167   1.00 0.00 ? 30  LYS B HD2  1  
ATOM 9429   H HD3  . LYS B 1 30  ? 37.786  48.903  9.623   1.00 0.00 ? 30  LYS B HD3  1  
ATOM 9430   H HE2  . LYS B 1 30  ? 35.683  49.178  8.365   1.00 0.00 ? 30  LYS B HE2  1  
ATOM 9431   H HE3  . LYS B 1 30  ? 36.168  50.808  7.913   1.00 0.00 ? 30  LYS B HE3  1  
ATOM 9432   H HZ1  . LYS B 1 30  ? 37.326  49.988  6.225   1.00 0.00 ? 30  LYS B HZ1  1  
ATOM 9433   H HZ2  . LYS B 1 30  ? 36.772  48.428  6.607   1.00 0.00 ? 30  LYS B HZ2  1  
ATOM 9434   H HZ3  . LYS B 1 30  ? 38.233  48.997  7.261   1.00 0.00 ? 30  LYS B HZ3  1  
ATOM 9435   N N    . ILE B 1 31  ? 40.439  50.043  13.237  1.00 0.00 ? 31  ILE B N    1  
ATOM 9436   C CA   . ILE B 1 31  ? 41.402  50.415  14.286  1.00 0.00 ? 31  ILE B CA   1  
ATOM 9437   C C    . ILE B 1 31  ? 41.769  51.913  14.341  1.00 0.00 ? 31  ILE B C    1  
ATOM 9438   O O    . ILE B 1 31  ? 41.369  52.700  13.484  1.00 0.00 ? 31  ILE B O    1  
ATOM 9439   C CB   . ILE B 1 31  ? 42.694  49.526  14.289  1.00 0.00 ? 31  ILE B CB   1  
ATOM 9440   C CG1  . ILE B 1 31  ? 42.881  48.803  12.949  1.00 0.00 ? 31  ILE B CG1  1  
ATOM 9441   C CG2  . ILE B 1 31  ? 42.700  48.564  15.493  1.00 0.00 ? 31  ILE B CG2  1  
ATOM 9442   C CD1  . ILE B 1 31  ? 44.017  49.360  12.083  1.00 0.00 ? 31  ILE B CD1  1  
ATOM 9443   H H    . ILE B 1 31  ? 40.733  49.988  12.304  1.00 0.00 ? 31  ILE B H    1  
ATOM 9444   H HA   . ILE B 1 31  ? 40.899  50.208  15.221  1.00 0.00 ? 31  ILE B HA   1  
ATOM 9445   H HB   . ILE B 1 31  ? 43.535  50.196  14.422  1.00 0.00 ? 31  ILE B HB   1  
ATOM 9446   H HG12 . ILE B 1 31  ? 43.085  47.762  13.146  1.00 0.00 ? 31  ILE B HG12 1  
ATOM 9447   H HG13 . ILE B 1 31  ? 41.956  48.871  12.393  1.00 0.00 ? 31  ILE B HG13 1  
ATOM 9448   H HG21 . ILE B 1 31  ? 43.650  48.050  15.538  1.00 0.00 ? 31  ILE B HG21 1  
ATOM 9449   H HG22 . ILE B 1 31  ? 41.905  47.841  15.380  1.00 0.00 ? 31  ILE B HG22 1  
ATOM 9450   H HG23 . ILE B 1 31  ? 42.550  49.125  16.404  1.00 0.00 ? 31  ILE B HG23 1  
ATOM 9451   H HD11 . ILE B 1 31  ? 43.832  49.117  11.047  1.00 0.00 ? 31  ILE B HD11 1  
ATOM 9452   H HD12 . ILE B 1 31  ? 44.954  48.922  12.395  1.00 0.00 ? 31  ILE B HD12 1  
ATOM 9453   H HD13 . ILE B 1 31  ? 44.065  50.433  12.199  1.00 0.00 ? 31  ILE B HD13 1  
ATOM 9454   N N    . SER B 1 32  ? 42.530  52.275  15.371  1.00 0.00 ? 32  SER B N    1  
ATOM 9455   C CA   . SER B 1 32  ? 42.899  53.656  15.646  1.00 0.00 ? 32  SER B CA   1  
ATOM 9456   C C    . SER B 1 32  ? 44.340  53.902  15.194  1.00 0.00 ? 32  SER B C    1  
ATOM 9457   O O    . SER B 1 32  ? 45.121  52.971  15.140  1.00 0.00 ? 32  SER B O    1  
ATOM 9458   C CB   . SER B 1 32  ? 42.761  53.917  17.151  1.00 0.00 ? 32  SER B CB   1  
ATOM 9459   O OG   . SER B 1 32  ? 43.174  55.225  17.513  1.00 0.00 ? 32  SER B OG   1  
ATOM 9460   H H    . SER B 1 32  ? 42.803  51.586  16.013  1.00 0.00 ? 32  SER B H    1  
ATOM 9461   H HA   . SER B 1 32  ? 42.237  54.318  15.107  1.00 0.00 ? 32  SER B HA   1  
ATOM 9462   H HB2  . SER B 1 32  ? 41.731  53.794  17.435  1.00 0.00 ? 32  SER B HB2  1  
ATOM 9463   H HB3  . SER B 1 32  ? 43.356  53.186  17.685  1.00 0.00 ? 32  SER B HB3  1  
ATOM 9464   H HG   . SER B 1 32  ? 43.841  55.145  18.200  1.00 0.00 ? 32  SER B HG   1  
ATOM 9465   N N    . ALA B 1 33  ? 44.705  55.129  14.941  1.00 0.00 ? 33  ALA B N    1  
ATOM 9466   C CA   . ALA B 1 33  ? 46.110  55.411  14.546  1.00 0.00 ? 33  ALA B CA   1  
ATOM 9467   C C    . ALA B 1 33  ? 47.044  54.828  15.610  1.00 0.00 ? 33  ALA B C    1  
ATOM 9468   O O    . ALA B 1 33  ? 48.062  54.243  15.301  1.00 0.00 ? 33  ALA B O    1  
ATOM 9469   C CB   . ALA B 1 33  ? 46.317  56.925  14.450  1.00 0.00 ? 33  ALA B CB   1  
ATOM 9470   H H    . ALA B 1 33  ? 44.065  55.863  15.041  1.00 0.00 ? 33  ALA B H    1  
ATOM 9471   H HA   . ALA B 1 33  ? 46.318  54.956  13.590  1.00 0.00 ? 33  ALA B HA   1  
ATOM 9472   H HB1  . ALA B 1 33  ? 47.015  57.143  13.655  1.00 0.00 ? 33  ALA B HB1  1  
ATOM 9473   H HB2  . ALA B 1 33  ? 46.710  57.293  15.386  1.00 0.00 ? 33  ALA B HB2  1  
ATOM 9474   H HB3  . ALA B 1 33  ? 45.373  57.404  14.242  1.00 0.00 ? 33  ALA B HB3  1  
ATOM 9475   N N    . ASP B 1 34  ? 46.703  54.967  16.863  1.00 0.00 ? 34  ASP B N    1  
ATOM 9476   C CA   . ASP B 1 34  ? 47.573  54.396  17.928  1.00 0.00 ? 34  ASP B CA   1  
ATOM 9477   C C    . ASP B 1 34  ? 47.585  52.867  17.801  1.00 0.00 ? 34  ASP B C    1  
ATOM 9478   O O    . ASP B 1 34  ? 48.627  52.244  17.841  1.00 0.00 ? 34  ASP B O    1  
ATOM 9479   C CB   . ASP B 1 34  ? 47.047  54.810  19.302  1.00 0.00 ? 34  ASP B CB   1  
ATOM 9480   C CG   . ASP B 1 34  ? 47.338  56.296  19.525  1.00 0.00 ? 34  ASP B CG   1  
ATOM 9481   O OD1  . ASP B 1 34  ? 48.097  56.855  18.749  1.00 0.00 ? 34  ASP B OD1  1  
ATOM 9482   O OD2  . ASP B 1 34  ? 46.798  56.849  20.468  1.00 0.00 ? 34  ASP B OD2  1  
ATOM 9483   H H    . ASP B 1 34  ? 45.875  55.431  17.099  1.00 0.00 ? 34  ASP B H    1  
ATOM 9484   H HA   . ASP B 1 34  ? 48.582  54.770  17.804  1.00 0.00 ? 34  ASP B HA   1  
ATOM 9485   H HB2  . ASP B 1 34  ? 45.981  54.638  19.346  1.00 0.00 ? 34  ASP B HB2  1  
ATOM 9486   H HB3  . ASP B 1 34  ? 47.540  54.229  20.067  1.00 0.00 ? 34  ASP B HB3  1  
ATOM 9487   N N    . GLN B 1 35  ? 46.439  52.257  17.612  1.00 0.00 ? 35  GLN B N    1  
ATOM 9488   C CA   . GLN B 1 35  ? 46.405  50.771  17.447  1.00 0.00 ? 35  GLN B CA   1  
ATOM 9489   C C    . GLN B 1 35  ? 47.137  50.443  16.149  1.00 0.00 ? 35  GLN B C    1  
ATOM 9490   O O    . GLN B 1 35  ? 48.070  49.717  16.163  1.00 0.00 ? 35  GLN B O    1  
ATOM 9491   C CB   . GLN B 1 35  ? 44.956  50.300  17.399  1.00 0.00 ? 35  GLN B CB   1  
ATOM 9492   C CG   . GLN B 1 35  ? 44.342  50.450  18.793  1.00 0.00 ? 35  GLN B CG   1  
ATOM 9493   C CD   . GLN B 1 35  ? 42.864  50.050  18.756  1.00 0.00 ? 35  GLN B CD   1  
ATOM 9494   O OE1  . GLN B 1 35  ? 42.069  50.679  18.087  1.00 0.00 ? 35  GLN B OE1  1  
ATOM 9495   N NE2  . GLN B 1 35  ? 42.464  49.022  19.452  1.00 0.00 ? 35  GLN B NE2  1  
ATOM 9496   H H    . GLN B 1 35  ? 45.612  52.776  17.555  1.00 0.00 ? 35  GLN B H    1  
ATOM 9497   H HA   . GLN B 1 35  ? 46.914  50.304  18.275  1.00 0.00 ? 35  GLN B HA   1  
ATOM 9498   H HB2  . GLN B 1 35  ? 44.408  50.912  16.697  1.00 0.00 ? 35  GLN B HB2  1  
ATOM 9499   H HB3  . GLN B 1 35  ? 44.919  49.267  17.093  1.00 0.00 ? 35  GLN B HB3  1  
ATOM 9500   H HG2  . GLN B 1 35  ? 44.871  49.816  19.489  1.00 0.00 ? 35  GLN B HG2  1  
ATOM 9501   H HG3  . GLN B 1 35  ? 44.424  51.479  19.111  1.00 0.00 ? 35  GLN B HG3  1  
ATOM 9502   H HE21 . GLN B 1 35  ? 43.108  48.514  19.989  1.00 0.00 ? 35  GLN B HE21 1  
ATOM 9503   H HE22 . GLN B 1 35  ? 41.520  48.759  19.441  1.00 0.00 ? 35  GLN B HE22 1  
ATOM 9504   N N    . VAL B 1 36  ? 46.638  50.977  15.056  1.00 0.00 ? 36  VAL B N    1  
ATOM 9505   C CA   . VAL B 1 36  ? 47.327  50.686  13.768  1.00 0.00 ? 36  VAL B CA   1  
ATOM 9506   C C    . VAL B 1 36  ? 48.705  50.097  14.074  1.00 0.00 ? 36  VAL B C    1  
ATOM 9507   O O    . VAL B 1 36  ? 49.069  49.046  13.580  1.00 0.00 ? 36  VAL B O    1  
ATOM 9508   C CB   . VAL B 1 36  ? 47.462  51.985  12.953  1.00 0.00 ? 36  VAL B CB   1  
ATOM 9509   C CG1  . VAL B 1 36  ? 48.561  51.834  11.896  1.00 0.00 ? 36  VAL B CG1  1  
ATOM 9510   C CG2  . VAL B 1 36  ? 46.133  52.281  12.250  1.00 0.00 ? 36  VAL B CG2  1  
ATOM 9511   H H    . VAL B 1 36  ? 45.814  51.414  15.357  1.00 0.00 ? 36  VAL B H    1  
ATOM 9512   H HA   . VAL B 1 36  ? 46.747  49.967  13.207  1.00 0.00 ? 36  VAL B HA   1  
ATOM 9513   H HB   . VAL B 1 36  ? 47.711  52.801  13.615  1.00 0.00 ? 36  VAL B HB   1  
ATOM 9514   H HG11 . VAL B 1 36  ? 48.463  52.619  11.161  1.00 0.00 ? 36  VAL B HG11 1  
ATOM 9515   H HG12 . VAL B 1 36  ? 48.464  50.873  11.412  1.00 0.00 ? 36  VAL B HG12 1  
ATOM 9516   H HG13 . VAL B 1 36  ? 49.528  51.903  12.370  1.00 0.00 ? 36  VAL B HG13 1  
ATOM 9517   H HG21 . VAL B 1 36  ? 45.325  52.213  12.964  1.00 0.00 ? 36  VAL B HG21 1  
ATOM 9518   H HG22 . VAL B 1 36  ? 45.975  51.563  11.459  1.00 0.00 ? 36  VAL B HG22 1  
ATOM 9519   H HG23 . VAL B 1 36  ? 46.161  53.276  11.832  1.00 0.00 ? 36  VAL B HG23 1  
ATOM 9520   N N    . ASP B 1 37  ? 49.477  50.763  14.877  1.00 0.00 ? 37  ASP B N    1  
ATOM 9521   C CA   . ASP B 1 37  ? 50.830  50.250  15.214  1.00 0.00 ? 37  ASP B CA   1  
ATOM 9522   C C    . ASP B 1 37  ? 50.721  48.882  15.888  1.00 0.00 ? 37  ASP B C    1  
ATOM 9523   O O    . ASP B 1 37  ? 51.522  48.001  15.650  1.00 0.00 ? 37  ASP B O    1  
ATOM 9524   C CB   . ASP B 1 37  ? 51.530  51.229  16.155  1.00 0.00 ? 37  ASP B CB   1  
ATOM 9525   C CG   . ASP B 1 37  ? 51.914  52.495  15.386  1.00 0.00 ? 37  ASP B CG   1  
ATOM 9526   O OD1  . ASP B 1 37  ? 51.860  52.464  14.168  1.00 0.00 ? 37  ASP B OD1  1  
ATOM 9527   O OD2  . ASP B 1 37  ? 52.259  53.475  16.026  1.00 0.00 ? 37  ASP B OD2  1  
ATOM 9528   H H    . ASP B 1 37  ? 49.167  51.609  15.261  1.00 0.00 ? 37  ASP B H    1  
ATOM 9529   H HA   . ASP B 1 37  ? 51.410  50.154  14.307  1.00 0.00 ? 37  ASP B HA   1  
ATOM 9530   H HB2  . ASP B 1 37  ? 50.864  51.487  16.966  1.00 0.00 ? 37  ASP B HB2  1  
ATOM 9531   H HB3  . ASP B 1 37  ? 52.422  50.770  16.555  1.00 0.00 ? 37  ASP B HB3  1  
ATOM 9532   N N    . GLN B 1 38  ? 49.761  48.698  16.750  1.00 0.00 ? 38  GLN B N    1  
ATOM 9533   C CA   . GLN B 1 38  ? 49.641  47.385  17.450  1.00 0.00 ? 38  GLN B CA   1  
ATOM 9534   C C    . GLN B 1 38  ? 49.224  46.285  16.471  1.00 0.00 ? 38  GLN B C    1  
ATOM 9535   O O    . GLN B 1 38  ? 49.699  45.172  16.549  1.00 0.00 ? 38  GLN B O    1  
ATOM 9536   C CB   . GLN B 1 38  ? 48.611  47.474  18.578  1.00 0.00 ? 38  GLN B CB   1  
ATOM 9537   C CG   . GLN B 1 38  ? 49.147  48.355  19.719  1.00 0.00 ? 38  GLN B CG   1  
ATOM 9538   C CD   . GLN B 1 38  ? 48.038  48.609  20.747  1.00 0.00 ? 38  GLN B CD   1  
ATOM 9539   O OE1  . GLN B 1 38  ? 46.871  48.630  20.410  1.00 0.00 ? 38  GLN B OE1  1  
ATOM 9540   N NE2  . GLN B 1 38  ? 48.360  48.790  21.996  1.00 0.00 ? 38  GLN B NE2  1  
ATOM 9541   H H    . GLN B 1 38  ? 49.134  49.423  16.951  1.00 0.00 ? 38  GLN B H    1  
ATOM 9542   H HA   . GLN B 1 38  ? 50.601  47.128  17.873  1.00 0.00 ? 38  GLN B HA   1  
ATOM 9543   H HB2  . GLN B 1 38  ? 47.697  47.902  18.194  1.00 0.00 ? 38  GLN B HB2  1  
ATOM 9544   H HB3  . GLN B 1 38  ? 48.410  46.483  18.957  1.00 0.00 ? 38  GLN B HB3  1  
ATOM 9545   H HG2  . GLN B 1 38  ? 49.975  47.855  20.201  1.00 0.00 ? 38  GLN B HG2  1  
ATOM 9546   H HG3  . GLN B 1 38  ? 49.483  49.299  19.317  1.00 0.00 ? 38  GLN B HG3  1  
ATOM 9547   H HE21 . GLN B 1 38  ? 49.302  48.763  22.268  1.00 0.00 ? 38  GLN B HE21 1  
ATOM 9548   H HE22 . GLN B 1 38  ? 47.662  48.954  22.664  1.00 0.00 ? 38  GLN B HE22 1  
ATOM 9549   N N    . GLU B 1 39  ? 48.330  46.569  15.566  1.00 0.00 ? 39  GLU B N    1  
ATOM 9550   C CA   . GLU B 1 39  ? 47.898  45.506  14.618  1.00 0.00 ? 39  GLU B CA   1  
ATOM 9551   C C    . GLU B 1 39  ? 49.064  45.096  13.725  1.00 0.00 ? 39  GLU B C    1  
ATOM 9552   O O    . GLU B 1 39  ? 49.260  43.929  13.450  1.00 0.00 ? 39  GLU B O    1  
ATOM 9553   C CB   . GLU B 1 39  ? 46.731  46.012  13.774  1.00 0.00 ? 39  GLU B CB   1  
ATOM 9554   C CG   . GLU B 1 39  ? 45.493  46.139  14.661  1.00 0.00 ? 39  GLU B CG   1  
ATOM 9555   C CD   . GLU B 1 39  ? 45.092  44.756  15.179  1.00 0.00 ? 39  GLU B CD   1  
ATOM 9556   O OE1  . GLU B 1 39  ? 45.017  43.839  14.374  1.00 0.00 ? 39  GLU B OE1  1  
ATOM 9557   O OE2  . GLU B 1 39  ? 44.871  44.630  16.371  1.00 0.00 ? 39  GLU B OE2  1  
ATOM 9558   H H    . GLU B 1 39  ? 47.938  47.467  15.518  1.00 0.00 ? 39  GLU B H    1  
ATOM 9559   H HA   . GLU B 1 39  ? 47.574  44.644  15.185  1.00 0.00 ? 39  GLU B HA   1  
ATOM 9560   H HB2  . GLU B 1 39  ? 46.979  46.977  13.357  1.00 0.00 ? 39  GLU B HB2  1  
ATOM 9561   H HB3  . GLU B 1 39  ? 46.530  45.312  12.977  1.00 0.00 ? 39  GLU B HB3  1  
ATOM 9562   H HG2  . GLU B 1 39  ? 45.714  46.788  15.496  1.00 0.00 ? 39  GLU B HG2  1  
ATOM 9563   H HG3  . GLU B 1 39  ? 44.679  46.555  14.086  1.00 0.00 ? 39  GLU B HG3  1  
ATOM 9564   N N    . VAL B 1 40  ? 49.859  46.030  13.278  1.00 0.00 ? 40  VAL B N    1  
ATOM 9565   C CA   . VAL B 1 40  ? 51.016  45.653  12.429  1.00 0.00 ? 40  VAL B CA   1  
ATOM 9566   C C    . VAL B 1 40  ? 51.927  44.719  13.228  1.00 0.00 ? 40  VAL B C    1  
ATOM 9567   O O    . VAL B 1 40  ? 52.352  43.689  12.747  1.00 0.00 ? 40  VAL B O    1  
ATOM 9568   C CB   . VAL B 1 40  ? 51.772  46.918  12.003  1.00 0.00 ? 40  VAL B CB   1  
ATOM 9569   C CG1  . VAL B 1 40  ? 53.099  46.541  11.320  1.00 0.00 ? 40  VAL B CG1  1  
ATOM 9570   C CG2  . VAL B 1 40  ? 50.894  47.713  11.028  1.00 0.00 ? 40  VAL B CG2  1  
ATOM 9571   H H    . VAL B 1 40  ? 49.703  46.968  13.515  1.00 0.00 ? 40  VAL B H    1  
ATOM 9572   H HA   . VAL B 1 40  ? 50.659  45.136  11.549  1.00 0.00 ? 40  VAL B HA   1  
ATOM 9573   H HB   . VAL B 1 40  ? 51.977  47.522  12.876  1.00 0.00 ? 40  VAL B HB   1  
ATOM 9574   H HG11 . VAL B 1 40  ? 53.518  47.415  10.844  1.00 0.00 ? 40  VAL B HG11 1  
ATOM 9575   H HG12 . VAL B 1 40  ? 52.918  45.778  10.578  1.00 0.00 ? 40  VAL B HG12 1  
ATOM 9576   H HG13 . VAL B 1 40  ? 53.790  46.167  12.060  1.00 0.00 ? 40  VAL B HG13 1  
ATOM 9577   H HG21 . VAL B 1 40  ? 51.308  48.701  10.895  1.00 0.00 ? 40  VAL B HG21 1  
ATOM 9578   H HG22 . VAL B 1 40  ? 49.893  47.792  11.426  1.00 0.00 ? 40  VAL B HG22 1  
ATOM 9579   H HG23 . VAL B 1 40  ? 50.863  47.204  10.075  1.00 0.00 ? 40  VAL B HG23 1  
ATOM 9580   N N    . GLU B 1 41  ? 52.218  45.069  14.452  1.00 0.00 ? 41  GLU B N    1  
ATOM 9581   C CA   . GLU B 1 41  ? 53.092  44.199  15.287  1.00 0.00 ? 41  GLU B CA   1  
ATOM 9582   C C    . GLU B 1 41  ? 52.437  42.820  15.445  1.00 0.00 ? 41  GLU B C    1  
ATOM 9583   O O    . GLU B 1 41  ? 53.097  41.801  15.358  1.00 0.00 ? 41  GLU B O    1  
ATOM 9584   C CB   . GLU B 1 41  ? 53.280  44.842  16.668  1.00 0.00 ? 41  GLU B CB   1  
ATOM 9585   C CG   . GLU B 1 41  ? 54.205  43.973  17.528  1.00 0.00 ? 41  GLU B CG   1  
ATOM 9586   C CD   . GLU B 1 41  ? 55.588  43.908  16.883  1.00 0.00 ? 41  GLU B CD   1  
ATOM 9587   O OE1  . GLU B 1 41  ? 55.894  44.784  16.091  1.00 0.00 ? 41  GLU B OE1  1  
ATOM 9588   O OE2  . GLU B 1 41  ? 56.322  42.983  17.191  1.00 0.00 ? 41  GLU B OE2  1  
ATOM 9589   H H    . GLU B 1 41  ? 51.857  45.902  14.823  1.00 0.00 ? 41  GLU B H    1  
ATOM 9590   H HA   . GLU B 1 41  ? 54.054  44.088  14.808  1.00 0.00 ? 41  GLU B HA   1  
ATOM 9591   H HB2  . GLU B 1 41  ? 53.717  45.823  16.549  1.00 0.00 ? 41  GLU B HB2  1  
ATOM 9592   H HB3  . GLU B 1 41  ? 52.321  44.933  17.156  1.00 0.00 ? 41  GLU B HB3  1  
ATOM 9593   H HG2  . GLU B 1 41  ? 54.287  44.403  18.515  1.00 0.00 ? 41  GLU B HG2  1  
ATOM 9594   H HG3  . GLU B 1 41  ? 53.797  42.976  17.601  1.00 0.00 ? 41  GLU B HG3  1  
ATOM 9595   N N    . ARG B 1 42  ? 51.144  42.773  15.652  1.00 0.00 ? 42  ARG B N    1  
ATOM 9596   C CA   . ARG B 1 42  ? 50.481  41.442  15.786  1.00 0.00 ? 42  ARG B CA   1  
ATOM 9597   C C    . ARG B 1 42  ? 50.708  40.663  14.497  1.00 0.00 ? 42  ARG B C    1  
ATOM 9598   O O    . ARG B 1 42  ? 51.052  39.497  14.512  1.00 0.00 ? 42  ARG B O    1  
ATOM 9599   C CB   . ARG B 1 42  ? 48.976  41.614  16.037  1.00 0.00 ? 42  ARG B CB   1  
ATOM 9600   C CG   . ARG B 1 42  ? 48.748  42.160  17.453  1.00 0.00 ? 42  ARG B CG   1  
ATOM 9601   C CD   . ARG B 1 42  ? 47.247  42.358  17.689  1.00 0.00 ? 42  ARG B CD   1  
ATOM 9602   N NE   . ARG B 1 42  ? 47.023  42.872  19.072  1.00 0.00 ? 42  ARG B NE   1  
ATOM 9603   C CZ   . ARG B 1 42  ? 45.808  43.108  19.498  1.00 0.00 ? 42  ARG B CZ   1  
ATOM 9604   N NH1  . ARG B 1 42  ? 44.789  42.913  18.704  1.00 0.00 ? 42  ARG B NH1  1  
ATOM 9605   N NH2  . ARG B 1 42  ? 45.612  43.534  20.715  1.00 0.00 ? 42  ARG B NH2  1  
ATOM 9606   H H    . ARG B 1 42  ? 50.618  43.598  15.704  1.00 0.00 ? 42  ARG B H    1  
ATOM 9607   H HA   . ARG B 1 42  ? 50.925  40.904  16.611  1.00 0.00 ? 42  ARG B HA   1  
ATOM 9608   H HB2  . ARG B 1 42  ? 48.568  42.306  15.314  1.00 0.00 ? 42  ARG B HB2  1  
ATOM 9609   H HB3  . ARG B 1 42  ? 48.484  40.658  15.939  1.00 0.00 ? 42  ARG B HB3  1  
ATOM 9610   H HG2  . ARG B 1 42  ? 49.138  41.458  18.176  1.00 0.00 ? 42  ARG B HG2  1  
ATOM 9611   H HG3  . ARG B 1 42  ? 49.254  43.107  17.560  1.00 0.00 ? 42  ARG B HG3  1  
ATOM 9612   H HD2  . ARG B 1 42  ? 46.861  43.071  16.974  1.00 0.00 ? 42  ARG B HD2  1  
ATOM 9613   H HD3  . ARG B 1 42  ? 46.736  41.414  17.568  1.00 0.00 ? 42  ARG B HD3  1  
ATOM 9614   H HE   . ARG B 1 42  ? 47.787  43.024  19.666  1.00 0.00 ? 42  ARG B HE   1  
ATOM 9615   H HH11 . ARG B 1 42  ? 44.938  42.583  17.771  1.00 0.00 ? 42  ARG B HH11 1  
ATOM 9616   H HH12 . ARG B 1 42  ? 43.860  43.092  19.028  1.00 0.00 ? 42  ARG B HH12 1  
ATOM 9617   H HH21 . ARG B 1 42  ? 46.391  43.681  21.324  1.00 0.00 ? 42  ARG B HH21 1  
ATOM 9618   H HH22 . ARG B 1 42  ? 44.684  43.714  21.038  1.00 0.00 ? 42  ARG B HH22 1  
ATOM 9619   N N    . PHE B 1 43  ? 50.547  41.313  13.376  1.00 0.00 ? 43  PHE B N    1  
ATOM 9620   C CA   . PHE B 1 43  ? 50.781  40.628  12.075  1.00 0.00 ? 43  PHE B CA   1  
ATOM 9621   C C    . PHE B 1 43  ? 52.237  40.164  12.019  1.00 0.00 ? 43  PHE B C    1  
ATOM 9622   O O    . PHE B 1 43  ? 52.524  39.019  11.730  1.00 0.00 ? 43  PHE B O    1  
ATOM 9623   C CB   . PHE B 1 43  ? 50.510  41.606  10.930  1.00 0.00 ? 43  PHE B CB   1  
ATOM 9624   C CG   . PHE B 1 43  ? 51.465  41.336  9.793   1.00 0.00 ? 43  PHE B CG   1  
ATOM 9625   C CD1  . PHE B 1 43  ? 51.222  40.273  8.906   1.00 0.00 ? 43  PHE B CD1  1  
ATOM 9626   C CD2  . PHE B 1 43  ? 52.592  42.158  9.618   1.00 0.00 ? 43  PHE B CD2  1  
ATOM 9627   C CE1  . PHE B 1 43  ? 52.109  40.029  7.846   1.00 0.00 ? 43  PHE B CE1  1  
ATOM 9628   C CE2  . PHE B 1 43  ? 53.482  41.913  8.552   1.00 0.00 ? 43  PHE B CE2  1  
ATOM 9629   C CZ   . PHE B 1 43  ? 53.240  40.849  7.668   1.00 0.00 ? 43  PHE B CZ   1  
ATOM 9630   H H    . PHE B 1 43  ? 50.291  42.258  13.391  1.00 0.00 ? 43  PHE B H    1  
ATOM 9631   H HA   . PHE B 1 43  ? 50.124  39.775  11.989  1.00 0.00 ? 43  PHE B HA   1  
ATOM 9632   H HB2  . PHE B 1 43  ? 49.494  41.482  10.584  1.00 0.00 ? 43  PHE B HB2  1  
ATOM 9633   H HB3  . PHE B 1 43  ? 50.649  42.619  11.282  1.00 0.00 ? 43  PHE B HB3  1  
ATOM 9634   H HD1  . PHE B 1 43  ? 50.355  39.643  9.042   1.00 0.00 ? 43  PHE B HD1  1  
ATOM 9635   H HD2  . PHE B 1 43  ? 52.776  42.975  10.299  1.00 0.00 ? 43  PHE B HD2  1  
ATOM 9636   H HE1  . PHE B 1 43  ? 51.923  39.212  7.164   1.00 0.00 ? 43  PHE B HE1  1  
ATOM 9637   H HE2  . PHE B 1 43  ? 54.350  42.542  8.416   1.00 0.00 ? 43  PHE B HE2  1  
ATOM 9638   H HZ   . PHE B 1 43  ? 53.922  40.660  6.851   1.00 0.00 ? 43  PHE B HZ   1  
ATOM 9639   N N    . LEU B 1 44  ? 53.158  41.040  12.313  1.00 0.00 ? 44  LEU B N    1  
ATOM 9640   C CA   . LEU B 1 44  ? 54.594  40.655  12.297  1.00 0.00 ? 44  LEU B CA   1  
ATOM 9641   C C    . LEU B 1 44  ? 54.820  39.545  13.334  1.00 0.00 ? 44  LEU B C    1  
ATOM 9642   O O    . LEU B 1 44  ? 55.494  38.569  13.072  1.00 0.00 ? 44  LEU B O    1  
ATOM 9643   C CB   . LEU B 1 44  ? 55.445  41.895  12.627  1.00 0.00 ? 44  LEU B CB   1  
ATOM 9644   C CG   . LEU B 1 44  ? 56.954  41.565  12.624  1.00 0.00 ? 44  LEU B CG   1  
ATOM 9645   C CD1  . LEU B 1 44  ? 57.757  42.701  11.949  1.00 0.00 ? 44  LEU B CD1  1  
ATOM 9646   C CD2  . LEU B 1 44  ? 57.432  41.393  14.076  1.00 0.00 ? 44  LEU B CD2  1  
ATOM 9647   H H    . LEU B 1 44  ? 52.900  41.953  12.558  1.00 0.00 ? 44  LEU B H    1  
ATOM 9648   H HA   . LEU B 1 44  ? 54.856  40.288  11.315  1.00 0.00 ? 44  LEU B HA   1  
ATOM 9649   H HB2  . LEU B 1 44  ? 55.251  42.662  11.891  1.00 0.00 ? 44  LEU B HB2  1  
ATOM 9650   H HB3  . LEU B 1 44  ? 55.166  42.264  13.603  1.00 0.00 ? 44  LEU B HB3  1  
ATOM 9651   H HG   . LEU B 1 44  ? 57.116  40.645  12.082  1.00 0.00 ? 44  LEU B HG   1  
ATOM 9652   H HD11 . LEU B 1 44  ? 57.503  42.748  10.900  1.00 0.00 ? 44  LEU B HD11 1  
ATOM 9653   H HD12 . LEU B 1 44  ? 58.815  42.506  12.055  1.00 0.00 ? 44  LEU B HD12 1  
ATOM 9654   H HD13 . LEU B 1 44  ? 57.516  43.642  12.422  1.00 0.00 ? 44  LEU B HD13 1  
ATOM 9655   H HD21 . LEU B 1 44  ? 57.283  42.317  14.615  1.00 0.00 ? 44  LEU B HD21 1  
ATOM 9656   H HD22 . LEU B 1 44  ? 58.482  41.139  14.081  1.00 0.00 ? 44  LEU B HD22 1  
ATOM 9657   H HD23 . LEU B 1 44  ? 56.868  40.604  14.550  1.00 0.00 ? 44  LEU B HD23 1  
ATOM 9658   N N    . SER B 1 45  ? 54.268  39.685  14.508  1.00 0.00 ? 45  SER B N    1  
ATOM 9659   C CA   . SER B 1 45  ? 54.460  38.626  15.547  1.00 0.00 ? 45  SER B CA   1  
ATOM 9660   C C    . SER B 1 45  ? 53.802  37.328  15.068  1.00 0.00 ? 45  SER B C    1  
ATOM 9661   O O    . SER B 1 45  ? 54.367  36.257  15.175  1.00 0.00 ? 45  SER B O    1  
ATOM 9662   C CB   . SER B 1 45  ? 53.819  39.068  16.856  1.00 0.00 ? 45  SER B CB   1  
ATOM 9663   O OG   . SER B 1 45  ? 54.505  40.205  17.363  1.00 0.00 ? 45  SER B OG   1  
ATOM 9664   H H    . SER B 1 45  ? 53.729  40.479  14.708  1.00 0.00 ? 45  SER B H    1  
ATOM 9665   H HA   . SER B 1 45  ? 55.517  38.459  15.699  1.00 0.00 ? 45  SER B HA   1  
ATOM 9666   H HB2  . SER B 1 45  ? 52.787  39.325  16.684  1.00 0.00 ? 45  SER B HB2  1  
ATOM 9667   H HB3  . SER B 1 45  ? 53.871  38.257  17.572  1.00 0.00 ? 45  SER B HB3  1  
ATOM 9668   H HG   . SER B 1 45  ? 55.157  39.900  17.999  1.00 0.00 ? 45  SER B HG   1  
ATOM 9669   N N    . GLY B 1 46  ? 52.616  37.416  14.521  1.00 0.00 ? 46  GLY B N    1  
ATOM 9670   C CA   . GLY B 1 46  ? 51.933  36.190  14.019  1.00 0.00 ? 46  GLY B CA   1  
ATOM 9671   C C    . GLY B 1 46  ? 52.684  35.678  12.789  1.00 0.00 ? 46  GLY B C    1  
ATOM 9672   O O    . GLY B 1 46  ? 52.892  34.491  12.615  1.00 0.00 ? 46  GLY B O    1  
ATOM 9673   H H    . GLY B 1 46  ? 52.182  38.290  14.431  1.00 0.00 ? 46  GLY B H    1  
ATOM 9674   H HA2  . GLY B 1 46  ? 51.936  35.433  14.791  1.00 0.00 ? 46  GLY B HA2  1  
ATOM 9675   H HA3  . GLY B 1 46  ? 50.916  36.427  13.745  1.00 0.00 ? 46  GLY B HA3  1  
ATOM 9676   N N    . ARG B 1 47  ? 53.115  36.578  11.952  1.00 0.00 ? 47  ARG B N    1  
ATOM 9677   C CA   . ARG B 1 47  ? 53.882  36.179  10.743  1.00 0.00 ? 47  ARG B CA   1  
ATOM 9678   C C    . ARG B 1 47  ? 55.202  35.571  11.199  1.00 0.00 ? 47  ARG B C    1  
ATOM 9679   O O    . ARG B 1 47  ? 55.748  34.685  10.570  1.00 0.00 ? 47  ARG B O    1  
ATOM 9680   C CB   . ARG B 1 47  ? 54.142  37.419  9.892   1.00 0.00 ? 47  ARG B CB   1  
ATOM 9681   C CG   . ARG B 1 47  ? 55.164  37.104  8.802   1.00 0.00 ? 47  ARG B CG   1  
ATOM 9682   C CD   . ARG B 1 47  ? 55.141  38.212  7.757   1.00 0.00 ? 47  ARG B CD   1  
ATOM 9683   N NE   . ARG B 1 47  ? 53.959  37.962  6.860   1.00 0.00 ? 47  ARG B NE   1  
ATOM 9684   C CZ   . ARG B 1 47  ? 53.881  38.416  5.650   1.00 0.00 ? 47  ARG B CZ   1  
ATOM 9685   N NH1  . ARG B 1 47  ? 54.843  39.145  5.148   1.00 0.00 ? 47  ARG B NH1  1  
ATOM 9686   N NH2  . ARG B 1 47  ? 52.834  38.147  4.927   1.00 0.00 ? 47  ARG B NH2  1  
ATOM 9687   H H    . ARG B 1 47  ? 52.949  37.528  12.131  1.00 0.00 ? 47  ARG B H    1  
ATOM 9688   H HA   . ARG B 1 47  ? 53.320  35.452  10.174  1.00 0.00 ? 47  ARG B HA   1  
ATOM 9689   H HB2  . ARG B 1 47  ? 53.217  37.738  9.434   1.00 0.00 ? 47  ARG B HB2  1  
ATOM 9690   H HB3  . ARG B 1 47  ? 54.523  38.210  10.520  1.00 0.00 ? 47  ARG B HB3  1  
ATOM 9691   H HG2  . ARG B 1 47  ? 56.149  37.040  9.241   1.00 0.00 ? 47  ARG B HG2  1  
ATOM 9692   H HG3  . ARG B 1 47  ? 54.914  36.163  8.334   1.00 0.00 ? 47  ARG B HG3  1  
ATOM 9693   H HD2  . ARG B 1 47  ? 55.041  39.172  8.242   1.00 0.00 ? 47  ARG B HD2  1  
ATOM 9694   H HD3  . ARG B 1 47  ? 56.050  38.187  7.176   1.00 0.00 ? 47  ARG B HD3  1  
ATOM 9695   H HE   . ARG B 1 47  ? 53.215  37.425  7.207   1.00 0.00 ? 47  ARG B HE   1  
ATOM 9696   H HH11 . ARG B 1 47  ? 55.650  39.357  5.701   1.00 0.00 ? 47  ARG B HH11 1  
ATOM 9697   H HH12 . ARG B 1 47  ? 54.773  39.491  4.212   1.00 0.00 ? 47  ARG B HH12 1  
ATOM 9698   H HH21 . ARG B 1 47  ? 52.093  37.593  5.306   1.00 0.00 ? 47  ARG B HH21 1  
ATOM 9699   H HH22 . ARG B 1 47  ? 52.769  38.496  3.992   1.00 0.00 ? 47  ARG B HH22 1  
ATOM 9700   N N    . ALA B 1 48  ? 55.720  36.046  12.299  1.00 0.00 ? 48  ALA B N    1  
ATOM 9701   C CA   . ALA B 1 48  ? 57.003  35.506  12.814  1.00 0.00 ? 48  ALA B CA   1  
ATOM 9702   C C    . ALA B 1 48  ? 56.840  34.009  13.086  1.00 0.00 ? 48  ALA B C    1  
ATOM 9703   O O    . ALA B 1 48  ? 57.711  33.219  12.783  1.00 0.00 ? 48  ALA B O    1  
ATOM 9704   C CB   . ALA B 1 48  ? 57.389  36.260  14.105  1.00 0.00 ? 48  ALA B CB   1  
ATOM 9705   H H    . ALA B 1 48  ? 55.260  36.761  12.787  1.00 0.00 ? 48  ALA B H    1  
ATOM 9706   H HA   . ALA B 1 48  ? 57.774  35.651  12.071  1.00 0.00 ? 48  ALA B HA   1  
ATOM 9707   H HB1  . ALA B 1 48  ? 56.727  35.963  14.906  1.00 0.00 ? 48  ALA B HB1  1  
ATOM 9708   H HB2  . ALA B 1 48  ? 57.302  37.323  13.941  1.00 0.00 ? 48  ALA B HB2  1  
ATOM 9709   H HB3  . ALA B 1 48  ? 58.408  36.019  14.371  1.00 0.00 ? 48  ALA B HB3  1  
ATOM 9710   N N    . LYS B 1 49  ? 55.732  33.602  13.637  1.00 0.00 ? 49  LYS B N    1  
ATOM 9711   C CA   . LYS B 1 49  ? 55.548  32.152  13.895  1.00 0.00 ? 49  LYS B CA   1  
ATOM 9712   C C    . LYS B 1 49  ? 55.530  31.430  12.552  1.00 0.00 ? 49  LYS B C    1  
ATOM 9713   O O    . LYS B 1 49  ? 56.467  30.733  12.217  1.00 0.00 ? 49  LYS B O    1  
ATOM 9714   C CB   . LYS B 1 49  ? 54.237  31.928  14.652  1.00 0.00 ? 49  LYS B CB   1  
ATOM 9715   C CG   . LYS B 1 49  ? 54.190  32.829  15.908  1.00 0.00 ? 49  LYS B CG   1  
ATOM 9716   C CD   . LYS B 1 49  ? 55.285  32.461  16.960  1.00 0.00 ? 49  LYS B CD   1  
ATOM 9717   C CE   . LYS B 1 49  ? 55.085  33.179  18.305  1.00 0.00 ? 49  LYS B CE   1  
ATOM 9718   N NZ   . LYS B 1 49  ? 53.788  32.762  18.914  1.00 0.00 ? 49  LYS B NZ   1  
ATOM 9719   H H    . LYS B 1 49  ? 55.026  34.243  13.868  1.00 0.00 ? 49  LYS B H    1  
ATOM 9720   H HA   . LYS B 1 49  ? 56.374  31.786  14.487  1.00 0.00 ? 49  LYS B HA   1  
ATOM 9721   H HB2  . LYS B 1 49  ? 53.405  32.167  14.006  1.00 0.00 ? 49  LYS B HB2  1  
ATOM 9722   H HB3  . LYS B 1 49  ? 54.170  30.894  14.954  1.00 0.00 ? 49  LYS B HB3  1  
ATOM 9723   H HG2  . LYS B 1 49  ? 54.331  33.856  15.604  1.00 0.00 ? 49  LYS B HG2  1  
ATOM 9724   H HG3  . LYS B 1 49  ? 53.217  32.733  16.368  1.00 0.00 ? 49  LYS B HG3  1  
ATOM 9725   H HD2  . LYS B 1 49  ? 55.261  31.396  17.130  1.00 0.00 ? 49  LYS B HD2  1  
ATOM 9726   H HD3  . LYS B 1 49  ? 56.254  32.727  16.560  1.00 0.00 ? 49  LYS B HD3  1  
ATOM 9727   H HE2  . LYS B 1 49  ? 55.893  32.920  18.973  1.00 0.00 ? 49  LYS B HE2  1  
ATOM 9728   H HE3  . LYS B 1 49  ? 55.080  34.247  18.145  1.00 0.00 ? 49  LYS B HE3  1  
ATOM 9729   H HZ1  . LYS B 1 49  ? 53.117  33.556  18.879  1.00 0.00 ? 49  LYS B HZ1  1  
ATOM 9730   H HZ2  . LYS B 1 49  ? 53.944  32.482  19.904  1.00 0.00 ? 49  LYS B HZ2  1  
ATOM 9731   H HZ3  . LYS B 1 49  ? 53.398  31.958  18.383  1.00 0.00 ? 49  LYS B HZ3  1  
ATOM 9732   N N    . ALA B 1 50  ? 54.470  31.561  11.787  1.00 0.00 ? 50  ALA B N    1  
ATOM 9733   C CA   . ALA B 1 50  ? 54.383  30.853  10.469  1.00 0.00 ? 50  ALA B CA   1  
ATOM 9734   C C    . ALA B 1 50  ? 55.736  30.848  9.753   1.00 0.00 ? 50  ALA B C    1  
ATOM 9735   O O    . ALA B 1 50  ? 56.068  29.903  9.068   1.00 0.00 ? 50  ALA B O    1  
ATOM 9736   C CB   . ALA B 1 50  ? 53.353  31.555  9.574   1.00 0.00 ? 50  ALA B CB   1  
ATOM 9737   H H    . ALA B 1 50  ? 53.720  32.113  12.090  1.00 0.00 ? 50  ALA B H    1  
ATOM 9738   H HA   . ALA B 1 50  ? 54.067  29.834  10.635  1.00 0.00 ? 50  ALA B HA   1  
ATOM 9739   H HB1  . ALA B 1 50  ? 52.393  31.563  10.068  1.00 0.00 ? 50  ALA B HB1  1  
ATOM 9740   H HB2  . ALA B 1 50  ? 53.271  31.026  8.636   1.00 0.00 ? 50  ALA B HB2  1  
ATOM 9741   H HB3  . ALA B 1 50  ? 53.670  32.571  9.388   1.00 0.00 ? 50  ALA B HB3  1  
ATOM 9742   N N    . SER B 1 51  ? 56.523  31.872  9.902   1.00 0.00 ? 51  SER B N    1  
ATOM 9743   C CA   . SER B 1 51  ? 57.834  31.863  9.212   1.00 0.00 ? 51  SER B CA   1  
ATOM 9744   C C    . SER B 1 51  ? 58.614  30.640  9.689   1.00 0.00 ? 51  SER B C    1  
ATOM 9745   O O    . SER B 1 51  ? 59.052  29.825  8.907   1.00 0.00 ? 51  SER B O    1  
ATOM 9746   C CB   . SER B 1 51  ? 58.610  33.134  9.559   1.00 0.00 ? 51  SER B CB   1  
ATOM 9747   O OG   . SER B 1 51  ? 59.875  33.106  8.909   1.00 0.00 ? 51  SER B OG   1  
ATOM 9748   H H    . SER B 1 51  ? 56.255  32.632  10.459  1.00 0.00 ? 51  SER B H    1  
ATOM 9749   H HA   . SER B 1 51  ? 57.684  31.806  8.143   1.00 0.00 ? 51  SER B HA   1  
ATOM 9750   H HB2  . SER B 1 51  ? 58.059  33.997  9.226   1.00 0.00 ? 51  SER B HB2  1  
ATOM 9751   H HB3  . SER B 1 51  ? 58.747  33.188  10.632  1.00 0.00 ? 51  SER B HB3  1  
ATOM 9752   H HG   . SER B 1 51  ? 60.537  32.856  9.558   1.00 0.00 ? 51  SER B HG   1  
ATOM 9753   N N    . ALA B 1 52  ? 58.799  30.521  10.968  1.00 0.00 ? 52  ALA B N    1  
ATOM 9754   C CA   . ALA B 1 52  ? 59.565  29.367  11.516  1.00 0.00 ? 52  ALA B CA   1  
ATOM 9755   C C    . ALA B 1 52  ? 58.783  28.051  11.360  1.00 0.00 ? 52  ALA B C    1  
ATOM 9756   O O    . ALA B 1 52  ? 59.358  27.022  11.052  1.00 0.00 ? 52  ALA B O    1  
ATOM 9757   C CB   . ALA B 1 52  ? 59.851  29.624  12.994  1.00 0.00 ? 52  ALA B CB   1  
ATOM 9758   H H    . ALA B 1 52  ? 58.442  31.202  11.576  1.00 0.00 ? 52  ALA B H    1  
ATOM 9759   H HA   . ALA B 1 52  ? 60.503  29.284  10.987  1.00 0.00 ? 52  ALA B HA   1  
ATOM 9760   H HB1  . ALA B 1 52  ? 60.613  30.383  13.087  1.00 0.00 ? 52  ALA B HB1  1  
ATOM 9761   H HB2  . ALA B 1 52  ? 60.193  28.711  13.459  1.00 0.00 ? 52  ALA B HB2  1  
ATOM 9762   H HB3  . ALA B 1 52  ? 58.947  29.959  13.482  1.00 0.00 ? 52  ALA B HB3  1  
ATOM 9763   N N    . GLN B 1 53  ? 57.494  28.056  11.578  1.00 0.00 ? 53  GLN B N    1  
ATOM 9764   C CA   . GLN B 1 53  ? 56.726  26.778  11.443  1.00 0.00 ? 53  GLN B CA   1  
ATOM 9765   C C    . GLN B 1 53  ? 56.708  26.322  9.983   1.00 0.00 ? 53  GLN B C    1  
ATOM 9766   O O    . GLN B 1 53  ? 56.853  25.152  9.688   1.00 0.00 ? 53  GLN B O    1  
ATOM 9767   C CB   . GLN B 1 53  ? 55.288  26.952  11.943  1.00 0.00 ? 53  GLN B CB   1  
ATOM 9768   C CG   . GLN B 1 53  ? 54.560  25.609  11.895  1.00 0.00 ? 53  GLN B CG   1  
ATOM 9769   C CD   . GLN B 1 53  ? 53.116  25.794  12.363  1.00 0.00 ? 53  GLN B CD   1  
ATOM 9770   O OE1  . GLN B 1 53  ? 52.714  26.885  12.719  1.00 0.00 ? 53  GLN B OE1  1  
ATOM 9771   N NE2  . GLN B 1 53  ? 52.319  24.760  12.399  1.00 0.00 ? 53  GLN B NE2  1  
ATOM 9772   H H    . GLN B 1 53  ? 57.038  28.884  11.836  1.00 0.00 ? 53  GLN B H    1  
ATOM 9773   H HA   . GLN B 1 53  ? 57.213  26.018  12.038  1.00 0.00 ? 53  GLN B HA   1  
ATOM 9774   H HB2  . GLN B 1 53  ? 55.303  27.317  12.960  1.00 0.00 ? 53  GLN B HB2  1  
ATOM 9775   H HB3  . GLN B 1 53  ? 54.772  27.661  11.314  1.00 0.00 ? 53  GLN B HB3  1  
ATOM 9776   H HG2  . GLN B 1 53  ? 54.566  25.232  10.881  1.00 0.00 ? 53  GLN B HG2  1  
ATOM 9777   H HG3  . GLN B 1 53  ? 55.059  24.905  12.544  1.00 0.00 ? 53  GLN B HG3  1  
ATOM 9778   H HE21 . GLN B 1 53  ? 52.647  23.878  12.127  1.00 0.00 ? 53  GLN B HE21 1  
ATOM 9779   H HE22 . GLN B 1 53  ? 51.391  24.866  12.697  1.00 0.00 ? 53  GLN B HE22 1  
ATOM 9780   N N    . LEU B 1 54  ? 56.551  27.230  9.055   1.00 0.00 ? 54  LEU B N    1  
ATOM 9781   C CA   . LEU B 1 54  ? 56.552  26.821  7.621   1.00 0.00 ? 54  LEU B CA   1  
ATOM 9782   C C    . LEU B 1 54  ? 57.908  26.211  7.284   1.00 0.00 ? 54  LEU B C    1  
ATOM 9783   O O    . LEU B 1 54  ? 58.001  25.227  6.580   1.00 0.00 ? 54  LEU B O    1  
ATOM 9784   C CB   . LEU B 1 54  ? 56.290  28.033  6.719   1.00 0.00 ? 54  LEU B CB   1  
ATOM 9785   C CG   . LEU B 1 54  ? 57.360  28.124  5.617   1.00 0.00 ? 54  LEU B CG   1  
ATOM 9786   C CD1  . LEU B 1 54  ? 58.668  28.636  6.226   1.00 0.00 ? 54  LEU B CD1  1  
ATOM 9787   C CD2  . LEU B 1 54  ? 57.600  26.735  4.981   1.00 0.00 ? 54  LEU B CD2  1  
ATOM 9788   H H    . LEU B 1 54  ? 56.449  28.173  9.299   1.00 0.00 ? 54  LEU B H    1  
ATOM 9789   H HA   . LEU B 1 54  ? 55.781  26.082  7.461   1.00 0.00 ? 54  LEU B HA   1  
ATOM 9790   H HB2  . LEU B 1 54  ? 55.315  27.934  6.264   1.00 0.00 ? 54  LEU B HB2  1  
ATOM 9791   H HB3  . LEU B 1 54  ? 56.316  28.933  7.315   1.00 0.00 ? 54  LEU B HB3  1  
ATOM 9792   H HG   . LEU B 1 54  ? 57.027  28.816  4.856   1.00 0.00 ? 54  LEU B HG   1  
ATOM 9793   H HD11 . LEU B 1 54  ? 58.735  29.706  6.089   1.00 0.00 ? 54  LEU B HD11 1  
ATOM 9794   H HD12 . LEU B 1 54  ? 59.505  28.159  5.737   1.00 0.00 ? 54  LEU B HD12 1  
ATOM 9795   H HD13 . LEU B 1 54  ? 58.689  28.406  7.281   1.00 0.00 ? 54  LEU B HD13 1  
ATOM 9796   H HD21 . LEU B 1 54  ? 58.615  26.420  5.176   1.00 0.00 ? 54  LEU B HD21 1  
ATOM 9797   H HD22 . LEU B 1 54  ? 57.441  26.794  3.915   1.00 0.00 ? 54  LEU B HD22 1  
ATOM 9798   H HD23 . LEU B 1 54  ? 56.912  26.019  5.407   1.00 0.00 ? 54  LEU B HD23 1  
ATOM 9799   N N    . GLU B 1 55  ? 58.960  26.789  7.792   1.00 0.00 ? 55  GLU B N    1  
ATOM 9800   C CA   . GLU B 1 55  ? 60.317  26.243  7.520   1.00 0.00 ? 55  GLU B CA   1  
ATOM 9801   C C    . GLU B 1 55  ? 60.422  24.813  8.058   1.00 0.00 ? 55  GLU B C    1  
ATOM 9802   O O    . GLU B 1 55  ? 61.035  23.956  7.458   1.00 0.00 ? 55  GLU B O    1  
ATOM 9803   C CB   . GLU B 1 55  ? 61.369  27.122  8.198   1.00 0.00 ? 55  GLU B CB   1  
ATOM 9804   C CG   . GLU B 1 55  ? 62.767  26.610  7.844   1.00 0.00 ? 55  GLU B CG   1  
ATOM 9805   C CD   . GLU B 1 55  ? 63.817  27.554  8.429   1.00 0.00 ? 55  GLU B CD   1  
ATOM 9806   O OE1  . GLU B 1 55  ? 63.845  27.699  9.640   1.00 0.00 ? 55  GLU B OE1  1  
ATOM 9807   O OE2  . GLU B 1 55  ? 64.581  28.109  7.656   1.00 0.00 ? 55  GLU B OE2  1  
ATOM 9808   H H    . GLU B 1 55  ? 58.857  27.579  8.362   1.00 0.00 ? 55  GLU B H    1  
ATOM 9809   H HA   . GLU B 1 55  ? 60.492  26.237  6.454   1.00 0.00 ? 55  GLU B HA   1  
ATOM 9810   H HB2  . GLU B 1 55  ? 61.261  28.142  7.856   1.00 0.00 ? 55  GLU B HB2  1  
ATOM 9811   H HB3  . GLU B 1 55  ? 61.235  27.085  9.269   1.00 0.00 ? 55  GLU B HB3  1  
ATOM 9812   H HG2  . GLU B 1 55  ? 62.902  25.620  8.255   1.00 0.00 ? 55  GLU B HG2  1  
ATOM 9813   H HG3  . GLU B 1 55  ? 62.877  26.574  6.770   1.00 0.00 ? 55  GLU B HG3  1  
ATOM 9814   N N    . THR B 1 56  ? 59.829  24.549  9.192   1.00 0.00 ? 56  THR B N    1  
ATOM 9815   C CA   . THR B 1 56  ? 59.904  23.177  9.765   1.00 0.00 ? 56  THR B CA   1  
ATOM 9816   C C    . THR B 1 56  ? 59.218  22.193  8.812   1.00 0.00 ? 56  THR B C    1  
ATOM 9817   O O    . THR B 1 56  ? 59.695  21.100  8.580   1.00 0.00 ? 56  THR B O    1  
ATOM 9818   C CB   . THR B 1 56  ? 59.195  23.164  11.129  1.00 0.00 ? 56  THR B CB   1  
ATOM 9819   O OG1  . THR B 1 56  ? 59.856  24.074  11.999  1.00 0.00 ? 56  THR B OG1  1  
ATOM 9820   C CG2  . THR B 1 56  ? 59.238  21.754  11.761  1.00 0.00 ? 56  THR B CG2  1  
ATOM 9821   H H    . THR B 1 56  ? 59.339  25.254  9.666   1.00 0.00 ? 56  THR B H    1  
ATOM 9822   H HA   . THR B 1 56  ? 60.939  22.895  9.894   1.00 0.00 ? 56  THR B HA   1  
ATOM 9823   H HB   . THR B 1 56  ? 58.167  23.468  11.003  1.00 0.00 ? 56  THR B HB   1  
ATOM 9824   H HG1  . THR B 1 56  ? 60.800  23.913  11.936  1.00 0.00 ? 56  THR B HG1  1  
ATOM 9825   H HG21 . THR B 1 56  ? 58.453  21.145  11.336  1.00 0.00 ? 56  THR B HG21 1  
ATOM 9826   H HG22 . THR B 1 56  ? 59.093  21.834  12.828  1.00 0.00 ? 56  THR B HG22 1  
ATOM 9827   H HG23 . THR B 1 56  ? 60.196  21.299  11.560  1.00 0.00 ? 56  THR B HG23 1  
ATOM 9828   N N    . ILE B 1 57  ? 58.099  22.573  8.255   1.00 0.00 ? 57  ILE B N    1  
ATOM 9829   C CA   . ILE B 1 57  ? 57.379  21.665  7.313   1.00 0.00 ? 57  ILE B CA   1  
ATOM 9830   C C    . ILE B 1 57  ? 58.263  21.389  6.093   1.00 0.00 ? 57  ILE B C    1  
ATOM 9831   O O    . ILE B 1 57  ? 58.299  20.290  5.574   1.00 0.00 ? 57  ILE B O    1  
ATOM 9832   C CB   . ILE B 1 57  ? 56.063  22.315  6.876   1.00 0.00 ? 57  ILE B CB   1  
ATOM 9833   C CG1  . ILE B 1 57  ? 56.300  23.103  5.582   1.00 0.00 ? 57  ILE B CG1  1  
ATOM 9834   C CG2  . ILE B 1 57  ? 55.581  23.274  7.969   1.00 0.00 ? 57  ILE B CG2  1  
ATOM 9835   C CD1  . ILE B 1 57  ? 55.081  23.996  5.242   1.00 0.00 ? 57  ILE B CD1  1  
ATOM 9836   H H    . ILE B 1 57  ? 57.730  23.459  8.456   1.00 0.00 ? 57  ILE B H    1  
ATOM 9837   H HA   . ILE B 1 57  ? 57.166  20.732  7.815   1.00 0.00 ? 57  ILE B HA   1  
ATOM 9838   H HB   . ILE B 1 57  ? 55.319  21.551  6.708   1.00 0.00 ? 57  ILE B HB   1  
ATOM 9839   H HG12 . ILE B 1 57  ? 57.175  23.726  5.702   1.00 0.00 ? 57  ILE B HG12 1  
ATOM 9840   H HG13 . ILE B 1 57  ? 56.468  22.409  4.771   1.00 0.00 ? 57  ILE B HG13 1  
ATOM 9841   H HG21 . ILE B 1 57  ? 55.617  22.776  8.927   1.00 0.00 ? 57  ILE B HG21 1  
ATOM 9842   H HG22 . ILE B 1 57  ? 54.566  23.578  7.760   1.00 0.00 ? 57  ILE B HG22 1  
ATOM 9843   H HG23 . ILE B 1 57  ? 56.220  24.146  7.991   1.00 0.00 ? 57  ILE B HG23 1  
ATOM 9844   H HD11 . ILE B 1 57  ? 55.337  24.660  4.429   1.00 0.00 ? 57  ILE B HD11 1  
ATOM 9845   H HD12 . ILE B 1 57  ? 54.808  24.579  6.109   1.00 0.00 ? 57  ILE B HD12 1  
ATOM 9846   H HD13 . ILE B 1 57  ? 54.248  23.373  4.952   1.00 0.00 ? 57  ILE B HD13 1  
ATOM 9847   N N    . LYS B 1 58  ? 58.965  22.384  5.629   1.00 0.00 ? 58  LYS B N    1  
ATOM 9848   C CA   . LYS B 1 58  ? 59.847  22.208  4.437   1.00 0.00 ? 58  LYS B CA   1  
ATOM 9849   C C    . LYS B 1 58  ? 60.851  21.083  4.697   1.00 0.00 ? 58  LYS B C    1  
ATOM 9850   O O    . LYS B 1 58  ? 61.023  20.188  3.895   1.00 0.00 ? 58  LYS B O    1  
ATOM 9851   C CB   . LYS B 1 58  ? 60.618  23.524  4.230   1.00 0.00 ? 58  LYS B CB   1  
ATOM 9852   C CG   . LYS B 1 58  ? 61.553  23.438  3.014   1.00 0.00 ? 58  LYS B CG   1  
ATOM 9853   C CD   . LYS B 1 58  ? 62.278  24.781  2.816   1.00 0.00 ? 58  LYS B CD   1  
ATOM 9854   C CE   . LYS B 1 58  ? 63.204  24.721  1.588   1.00 0.00 ? 58  LYS B CE   1  
ATOM 9855   N NZ   . LYS B 1 58  ? 64.262  23.698  1.821   1.00 0.00 ? 58  LYS B NZ   1  
ATOM 9856   H H    . LYS B 1 58  ? 58.909  23.260  6.064   1.00 0.00 ? 58  LYS B H    1  
ATOM 9857   H HA   . LYS B 1 58  ? 59.255  21.987  3.561   1.00 0.00 ? 58  LYS B HA   1  
ATOM 9858   H HB2  . LYS B 1 58  ? 59.912  24.327  4.077   1.00 0.00 ? 58  LYS B HB2  1  
ATOM 9859   H HB3  . LYS B 1 58  ? 61.204  23.732  5.113   1.00 0.00 ? 58  LYS B HB3  1  
ATOM 9860   H HG2  . LYS B 1 58  ? 62.281  22.656  3.176   1.00 0.00 ? 58  LYS B HG2  1  
ATOM 9861   H HG3  . LYS B 1 58  ? 60.974  23.212  2.131   1.00 0.00 ? 58  LYS B HG3  1  
ATOM 9862   H HD2  . LYS B 1 58  ? 61.546  25.563  2.672   1.00 0.00 ? 58  LYS B HD2  1  
ATOM 9863   H HD3  . LYS B 1 58  ? 62.866  25.001  3.695   1.00 0.00 ? 58  LYS B HD3  1  
ATOM 9864   H HE2  . LYS B 1 58  ? 62.628  24.452  0.715   1.00 0.00 ? 58  LYS B HE2  1  
ATOM 9865   H HE3  . LYS B 1 58  ? 63.663  25.686  1.435   1.00 0.00 ? 58  LYS B HE3  1  
ATOM 9866   H HZ1  . LYS B 1 58  ? 63.828  22.755  1.873   1.00 0.00 ? 58  LYS B HZ1  1  
ATOM 9867   H HZ2  . LYS B 1 58  ? 64.752  23.904  2.716   1.00 0.00 ? 58  LYS B HZ2  1  
ATOM 9868   H HZ3  . LYS B 1 58  ? 64.945  23.720  1.039   1.00 0.00 ? 58  LYS B HZ3  1  
ATOM 9869   N N    . THR B 1 59  ? 61.543  21.145  5.800   1.00 0.00 ? 59  THR B N    1  
ATOM 9870   C CA   . THR B 1 59  ? 62.570  20.109  6.102   1.00 0.00 ? 59  THR B CA   1  
ATOM 9871   C C    . THR B 1 59  ? 61.935  18.715  6.135   1.00 0.00 ? 59  THR B C    1  
ATOM 9872   O O    . THR B 1 59  ? 62.553  17.738  5.758   1.00 0.00 ? 59  THR B O    1  
ATOM 9873   C CB   . THR B 1 59  ? 63.209  20.426  7.462   1.00 0.00 ? 59  THR B CB   1  
ATOM 9874   O OG1  . THR B 1 59  ? 63.828  21.704  7.397   1.00 0.00 ? 59  THR B OG1  1  
ATOM 9875   C CG2  . THR B 1 59  ? 64.278  19.376  7.809   1.00 0.00 ? 59  THR B CG2  1  
ATOM 9876   H H    . THR B 1 59  ? 61.406  21.892  6.420   1.00 0.00 ? 59  THR B H    1  
ATOM 9877   H HA   . THR B 1 59  ? 63.334  20.133  5.338   1.00 0.00 ? 59  THR B HA   1  
ATOM 9878   H HB   . THR B 1 59  ? 62.449  20.430  8.229   1.00 0.00 ? 59  THR B HB   1  
ATOM 9879   H HG1  . THR B 1 59  ? 64.259  21.868  8.239   1.00 0.00 ? 59  THR B HG1  1  
ATOM 9880   H HG21 . THR B 1 59  ? 64.766  19.650  8.733   1.00 0.00 ? 59  THR B HG21 1  
ATOM 9881   H HG22 . THR B 1 59  ? 65.010  19.331  7.015   1.00 0.00 ? 59  THR B HG22 1  
ATOM 9882   H HG23 . THR B 1 59  ? 63.810  18.409  7.922   1.00 0.00 ? 59  THR B HG23 1  
ATOM 9883   N N    . LYS B 1 60  ? 60.713  18.605  6.570   1.00 0.00 ? 60  LYS B N    1  
ATOM 9884   C CA   . LYS B 1 60  ? 60.062  17.263  6.617   1.00 0.00 ? 60  LYS B CA   1  
ATOM 9885   C C    . LYS B 1 60  ? 59.791  16.784  5.196   1.00 0.00 ? 60  LYS B C    1  
ATOM 9886   O O    . LYS B 1 60  ? 59.915  15.617  4.884   1.00 0.00 ? 60  LYS B O    1  
ATOM 9887   C CB   . LYS B 1 60  ? 58.742  17.344  7.382   1.00 0.00 ? 60  LYS B CB   1  
ATOM 9888   C CG   . LYS B 1 60  ? 59.031  17.603  8.861   1.00 0.00 ? 60  LYS B CG   1  
ATOM 9889   C CD   . LYS B 1 60  ? 59.236  16.273  9.586   1.00 0.00 ? 60  LYS B CD   1  
ATOM 9890   C CE   . LYS B 1 60  ? 59.486  16.532  11.074  1.00 0.00 ? 60  LYS B CE   1  
ATOM 9891   N NZ   . LYS B 1 60  ? 58.289  17.179  11.676  1.00 0.00 ? 60  LYS B NZ   1  
ATOM 9892   H H    . LYS B 1 60  ? 60.222  19.401  6.866   1.00 0.00 ? 60  LYS B H    1  
ATOM 9893   H HA   . LYS B 1 60  ? 60.721  16.564  7.111   1.00 0.00 ? 60  LYS B HA   1  
ATOM 9894   H HB2  . LYS B 1 60  ? 58.143  18.151  6.984   1.00 0.00 ? 60  LYS B HB2  1  
ATOM 9895   H HB3  . LYS B 1 60  ? 58.208  16.412  7.279   1.00 0.00 ? 60  LYS B HB3  1  
ATOM 9896   H HG2  . LYS B 1 60  ? 59.923  18.205  8.953   1.00 0.00 ? 60  LYS B HG2  1  
ATOM 9897   H HG3  . LYS B 1 60  ? 58.196  18.127  9.304   1.00 0.00 ? 60  LYS B HG3  1  
ATOM 9898   H HD2  . LYS B 1 60  ? 58.353  15.660  9.470   1.00 0.00 ? 60  LYS B HD2  1  
ATOM 9899   H HD3  . LYS B 1 60  ? 60.088  15.761  9.164   1.00 0.00 ? 60  LYS B HD3  1  
ATOM 9900   H HE2  . LYS B 1 60  ? 59.678  15.594  11.575  1.00 0.00 ? 60  LYS B HE2  1  
ATOM 9901   H HE3  . LYS B 1 60  ? 60.342  17.181  11.188  1.00 0.00 ? 60  LYS B HE3  1  
ATOM 9902   H HZ1  . LYS B 1 60  ? 58.150  16.823  12.642  1.00 0.00 ? 60  LYS B HZ1  1  
ATOM 9903   H HZ2  . LYS B 1 60  ? 57.450  16.959  11.100  1.00 0.00 ? 60  LYS B HZ2  1  
ATOM 9904   H HZ3  . LYS B 1 60  ? 58.429  18.208  11.704  1.00 0.00 ? 60  LYS B HZ3  1  
ATOM 9905   N N    . ALA B 1 61  ? 59.421  17.683  4.334   1.00 0.00 ? 61  ALA B N    1  
ATOM 9906   C CA   . ALA B 1 61  ? 59.137  17.293  2.929   1.00 0.00 ? 61  ALA B CA   1  
ATOM 9907   C C    . ALA B 1 61  ? 60.425  16.799  2.266   1.00 0.00 ? 61  ALA B C    1  
ATOM 9908   O O    . ALA B 1 61  ? 60.432  15.808  1.562   1.00 0.00 ? 61  ALA B O    1  
ATOM 9909   C CB   . ALA B 1 61  ? 58.591  18.517  2.181   1.00 0.00 ? 61  ALA B CB   1  
ATOM 9910   H H    . ALA B 1 61  ? 59.329  18.619  4.610   1.00 0.00 ? 61  ALA B H    1  
ATOM 9911   H HA   . ALA B 1 61  ? 58.399  16.504  2.917   1.00 0.00 ? 61  ALA B HA   1  
ATOM 9912   H HB1  . ALA B 1 61  ? 57.724  18.228  1.603   1.00 0.00 ? 61  ALA B HB1  1  
ATOM 9913   H HB2  . ALA B 1 61  ? 59.352  18.904  1.519   1.00 0.00 ? 61  ALA B HB2  1  
ATOM 9914   H HB3  . ALA B 1 61  ? 58.312  19.280  2.893   1.00 0.00 ? 61  ALA B HB3  1  
ATOM 9915   N N    . GLY B 1 62  ? 61.511  17.491  2.474   1.00 0.00 ? 62  GLY B N    1  
ATOM 9916   C CA   . GLY B 1 62  ? 62.796  17.072  1.846   1.00 0.00 ? 62  GLY B CA   1  
ATOM 9917   C C    . GLY B 1 62  ? 63.183  15.672  2.312   1.00 0.00 ? 62  GLY B C    1  
ATOM 9918   O O    . GLY B 1 62  ? 63.478  14.807  1.511   1.00 0.00 ? 62  GLY B O    1  
ATOM 9919   H H    . GLY B 1 62  ? 61.480  18.292  3.036   1.00 0.00 ? 62  GLY B H    1  
ATOM 9920   H HA2  . GLY B 1 62  ? 62.685  17.074  0.771   1.00 0.00 ? 62  GLY B HA2  1  
ATOM 9921   H HA3  . GLY B 1 62  ? 63.573  17.767  2.126   1.00 0.00 ? 62  GLY B HA3  1  
ATOM 9922   N N    . GLU B 1 63  ? 63.197  15.434  3.586   1.00 0.00 ? 63  GLU B N    1  
ATOM 9923   C CA   . GLU B 1 63  ? 63.583  14.084  4.073   1.00 0.00 ? 63  GLU B CA   1  
ATOM 9924   C C    . GLU B 1 63  ? 62.487  13.079  3.718   1.00 0.00 ? 63  GLU B C    1  
ATOM 9925   O O    . GLU B 1 63  ? 62.762  11.979  3.283   1.00 0.00 ? 63  GLU B O    1  
ATOM 9926   C CB   . GLU B 1 63  ? 63.767  14.126  5.587   1.00 0.00 ? 63  GLU B CB   1  
ATOM 9927   C CG   . GLU B 1 63  ? 64.301  12.780  6.071   1.00 0.00 ? 63  GLU B CG   1  
ATOM 9928   C CD   . GLU B 1 63  ? 63.148  11.782  6.172   1.00 0.00 ? 63  GLU B CD   1  
ATOM 9929   O OE1  . GLU B 1 63  ? 62.035  12.218  6.424   1.00 0.00 ? 63  GLU B OE1  1  
ATOM 9930   O OE2  . GLU B 1 63  ? 63.394  10.601  5.996   1.00 0.00 ? 63  GLU B OE2  1  
ATOM 9931   H H    . GLU B 1 63  ? 62.962  16.141  4.223   1.00 0.00 ? 63  GLU B H    1  
ATOM 9932   H HA   . GLU B 1 63  ? 64.511  13.785  3.606   1.00 0.00 ? 63  GLU B HA   1  
ATOM 9933   H HB2  . GLU B 1 63  ? 64.469  14.906  5.843   1.00 0.00 ? 63  GLU B HB2  1  
ATOM 9934   H HB3  . GLU B 1 63  ? 62.818  14.326  6.060   1.00 0.00 ? 63  GLU B HB3  1  
ATOM 9935   H HG2  . GLU B 1 63  ? 65.038  12.412  5.371   1.00 0.00 ? 63  GLU B HG2  1  
ATOM 9936   H HG3  . GLU B 1 63  ? 64.755  12.901  7.044   1.00 0.00 ? 63  GLU B HG3  1  
ATOM 9937   N N    . THR B 1 64  ? 61.253  13.430  3.947   1.00 0.00 ? 64  THR B N    1  
ATOM 9938   C CA   . THR B 1 64  ? 60.127  12.489  3.673   1.00 0.00 ? 64  THR B CA   1  
ATOM 9939   C C    . THR B 1 64  ? 59.984  12.186  2.177   1.00 0.00 ? 64  THR B C    1  
ATOM 9940   O O    . THR B 1 64  ? 60.102  11.053  1.756   1.00 0.00 ? 64  THR B O    1  
ATOM 9941   C CB   . THR B 1 64  ? 58.837  13.146  4.177   1.00 0.00 ? 64  THR B CB   1  
ATOM 9942   O OG1  . THR B 1 64  ? 58.966  13.430  5.564   1.00 0.00 ? 64  THR B OG1  1  
ATOM 9943   C CG2  . THR B 1 64  ? 57.649  12.210  3.957   1.00 0.00 ? 64  THR B CG2  1  
ATOM 9944   H H    . THR B 1 64  ? 61.065  14.311  4.332   1.00 0.00 ? 64  THR B H    1  
ATOM 9945   H HA   . THR B 1 64  ? 60.288  11.570  4.213   1.00 0.00 ? 64  THR B HA   1  
ATOM 9946   H HB   . THR B 1 64  ? 58.668  14.065  3.637   1.00 0.00 ? 64  THR B HB   1  
ATOM 9947   H HG1  . THR B 1 64  ? 59.818  13.850  5.703   1.00 0.00 ? 64  THR B HG1  1  
ATOM 9948   H HG21 . THR B 1 64  ? 57.939  11.197  4.195   1.00 0.00 ? 64  THR B HG21 1  
ATOM 9949   H HG22 . THR B 1 64  ? 57.335  12.262  2.925   1.00 0.00 ? 64  THR B HG22 1  
ATOM 9950   H HG23 . THR B 1 64  ? 56.831  12.510  4.597   1.00 0.00 ? 64  THR B HG23 1  
ATOM 9951   N N    . PHE B 1 65  ? 59.684  13.177  1.371   1.00 0.00 ? 65  PHE B N    1  
ATOM 9952   C CA   . PHE B 1 65  ? 59.486  12.920  -0.095  1.00 0.00 ? 65  PHE B CA   1  
ATOM 9953   C C    . PHE B 1 65  ? 60.758  13.208  -0.899  1.00 0.00 ? 65  PHE B C    1  
ATOM 9954   O O    . PHE B 1 65  ? 61.173  12.394  -1.697  1.00 0.00 ? 65  PHE B O    1  
ATOM 9955   C CB   . PHE B 1 65  ? 58.336  13.798  -0.593  1.00 0.00 ? 65  PHE B CB   1  
ATOM 9956   C CG   . PHE B 1 65  ? 57.057  13.373  0.091   1.00 0.00 ? 65  PHE B CG   1  
ATOM 9957   C CD1  . PHE B 1 65  ? 56.328  12.275  -0.403  1.00 0.00 ? 65  PHE B CD1  1  
ATOM 9958   C CD2  . PHE B 1 65  ? 56.587  14.079  1.218   1.00 0.00 ? 65  PHE B CD2  1  
ATOM 9959   C CE1  . PHE B 1 65  ? 55.131  11.884  0.229   1.00 0.00 ? 65  PHE B CE1  1  
ATOM 9960   C CE2  . PHE B 1 65  ? 55.394  13.686  1.848   1.00 0.00 ? 65  PHE B CE2  1  
ATOM 9961   C CZ   . PHE B 1 65  ? 54.666  12.586  1.353   1.00 0.00 ? 65  PHE B CZ   1  
ATOM 9962   H H    . PHE B 1 65  ? 59.559  14.080  1.731   1.00 0.00 ? 65  PHE B H    1  
ATOM 9963   H HA   . PHE B 1 65  ? 59.215  11.883  -0.233  1.00 0.00 ? 65  PHE B HA   1  
ATOM 9964   H HB2  . PHE B 1 65  ? 58.546  14.833  -0.362  1.00 0.00 ? 65  PHE B HB2  1  
ATOM 9965   H HB3  . PHE B 1 65  ? 58.229  13.680  -1.662  1.00 0.00 ? 65  PHE B HB3  1  
ATOM 9966   H HD1  . PHE B 1 65  ? 56.684  11.734  -1.267  1.00 0.00 ? 65  PHE B HD1  1  
ATOM 9967   H HD2  . PHE B 1 65  ? 57.145  14.922  1.598   1.00 0.00 ? 65  PHE B HD2  1  
ATOM 9968   H HE1  . PHE B 1 65  ? 54.572  11.040  -0.149  1.00 0.00 ? 65  PHE B HE1  1  
ATOM 9969   H HE2  . PHE B 1 65  ? 55.035  14.228  2.712   1.00 0.00 ? 65  PHE B HE2  1  
ATOM 9970   H HZ   . PHE B 1 65  ? 53.749  12.284  1.837   1.00 0.00 ? 65  PHE B HZ   1  
ATOM 9971   N N    . GLY B 1 66  ? 61.395  14.340  -0.703  1.00 0.00 ? 66  GLY B N    1  
ATOM 9972   C CA   . GLY B 1 66  ? 62.649  14.631  -1.480  1.00 0.00 ? 66  GLY B CA   1  
ATOM 9973   C C    . GLY B 1 66  ? 62.730  16.113  -1.878  1.00 0.00 ? 66  GLY B C    1  
ATOM 9974   O O    . GLY B 1 66  ? 61.952  16.942  -1.400  1.00 0.00 ? 66  GLY B O    1  
ATOM 9975   H H    . GLY B 1 66  ? 61.058  14.989  -0.051  1.00 0.00 ? 66  GLY B H    1  
ATOM 9976   H HA2  . GLY B 1 66  ? 63.506  14.380  -0.873  1.00 0.00 ? 66  GLY B HA2  1  
ATOM 9977   H HA3  . GLY B 1 66  ? 62.659  14.025  -2.374  1.00 0.00 ? 66  GLY B HA3  1  
ATOM 9978   N N    . GLU B 1 67  ? 63.660  16.426  -2.746  1.00 0.00 ? 67  GLU B N    1  
ATOM 9979   C CA   . GLU B 1 67  ? 63.841  17.837  -3.206  1.00 0.00 ? 67  GLU B CA   1  
ATOM 9980   C C    . GLU B 1 67  ? 62.665  18.255  -4.091  1.00 0.00 ? 67  GLU B C    1  
ATOM 9981   O O    . GLU B 1 67  ? 62.360  19.442  -4.201  1.00 0.00 ? 67  GLU B O    1  
ATOM 9982   C CB   . GLU B 1 67  ? 65.151  17.958  -3.996  1.00 0.00 ? 67  GLU B CB   1  
ATOM 9983   C CG   . GLU B 1 67  ? 65.032  17.195  -5.328  1.00 0.00 ? 67  GLU B CG   1  
ATOM 9984   C CD   . GLU B 1 67  ? 64.742  15.722  -5.075  1.00 0.00 ? 67  GLU B CD   1  
ATOM 9985   O OE1  . GLU B 1 67  ? 63.578  15.387  -4.930  1.00 0.00 ? 67  GLU B OE1  1  
ATOM 9986   O OE2  . GLU B 1 67  ? 65.681  14.955  -5.038  1.00 0.00 ? 67  GLU B OE2  1  
ATOM 9987   H H    . GLU B 1 67  ? 64.249  15.725  -3.096  1.00 0.00 ? 67  GLU B H    1  
ATOM 9988   H HA   . GLU B 1 67  ? 63.885  18.487  -2.345  1.00 0.00 ? 67  GLU B HA   1  
ATOM 9989   H HB2  . GLU B 1 67  ? 65.355  19.000  -4.195  1.00 0.00 ? 67  GLU B HB2  1  
ATOM 9990   H HB3  . GLU B 1 67  ? 65.960  17.539  -3.416  1.00 0.00 ? 67  GLU B HB3  1  
ATOM 9991   H HG2  . GLU B 1 67  ? 64.229  17.621  -5.911  1.00 0.00 ? 67  GLU B HG2  1  
ATOM 9992   H HG3  . GLU B 1 67  ? 65.959  17.288  -5.875  1.00 0.00 ? 67  GLU B HG3  1  
ATOM 9993   N N    . GLU B 1 68  ? 62.011  17.307  -4.700  1.00 0.00 ? 68  GLU B N    1  
ATOM 9994   C CA   . GLU B 1 68  ? 60.851  17.622  -5.580  1.00 0.00 ? 68  GLU B CA   1  
ATOM 9995   C C    . GLU B 1 68  ? 59.754  18.313  -4.759  1.00 0.00 ? 68  GLU B C    1  
ATOM 9996   O O    . GLU B 1 68  ? 59.067  19.204  -5.253  1.00 0.00 ? 68  GLU B O    1  
ATOM 9997   C CB   . GLU B 1 68  ? 60.302  16.319  -6.172  1.00 0.00 ? 68  GLU B CB   1  
ATOM 9998   C CG   . GLU B 1 68  ? 59.366  16.636  -7.343  1.00 0.00 ? 68  GLU B CG   1  
ATOM 9999   C CD   . GLU B 1 68  ? 58.013  17.105  -6.825  1.00 0.00 ? 68  GLU B CD   1  
ATOM 10000  O OE1  . GLU B 1 68  ? 57.621  16.653  -5.760  1.00 0.00 ? 68  GLU B OE1  1  
ATOM 10001  O OE2  . GLU B 1 68  ? 57.393  17.902  -7.492  1.00 0.00 ? 68  GLU B OE2  1  
ATOM 10002  H H    . GLU B 1 68  ? 62.285  16.374  -4.576  1.00 0.00 ? 68  GLU B H    1  
ATOM 10003  H HA   . GLU B 1 68  ? 61.171  18.275  -6.378  1.00 0.00 ? 68  GLU B HA   1  
ATOM 10004  H HB2  . GLU B 1 68  ? 61.123  15.710  -6.522  1.00 0.00 ? 68  GLU B HB2  1  
ATOM 10005  H HB3  . GLU B 1 68  ? 59.754  15.782  -5.412  1.00 0.00 ? 68  GLU B HB3  1  
ATOM 10006  H HG2  . GLU B 1 68  ? 59.805  17.414  -7.951  1.00 0.00 ? 68  GLU B HG2  1  
ATOM 10007  H HG3  . GLU B 1 68  ? 59.229  15.749  -7.943  1.00 0.00 ? 68  GLU B HG3  1  
ATOM 10008  N N    . LYS B 1 69  ? 59.583  17.906  -3.529  1.00 0.00 ? 69  LYS B N    1  
ATOM 10009  C CA   . LYS B 1 69  ? 58.529  18.520  -2.660  1.00 0.00 ? 69  LYS B CA   1  
ATOM 10010  C C    . LYS B 1 69  ? 59.133  19.591  -1.755  1.00 0.00 ? 69  LYS B C    1  
ATOM 10011  O O    . LYS B 1 69  ? 58.407  20.449  -1.251  1.00 0.00 ? 69  LYS B O    1  
ATOM 10012  C CB   . LYS B 1 69  ? 57.855  17.428  -1.824  1.00 0.00 ? 69  LYS B CB   1  
ATOM 10013  C CG   . LYS B 1 69  ? 57.234  16.387  -2.766  1.00 0.00 ? 69  LYS B CG   1  
ATOM 10014  C CD   . LYS B 1 69  ? 55.987  16.974  -3.445  1.00 0.00 ? 69  LYS B CD   1  
ATOM 10015  C CE   . LYS B 1 69  ? 55.210  15.860  -4.148  1.00 0.00 ? 69  LYS B CE   1  
ATOM 10016  N NZ   . LYS B 1 69  ? 54.007  16.446  -4.806  1.00 0.00 ? 69  LYS B NZ   1  
ATOM 10017  H H    . LYS B 1 69  ? 60.147  17.188  -3.173  1.00 0.00 ? 69  LYS B H    1  
ATOM 10018  H HA   . LYS B 1 69  ? 57.785  18.982  -3.293  1.00 0.00 ? 69  LYS B HA   1  
ATOM 10019  H HB2  . LYS B 1 69  ? 58.591  16.953  -1.191  1.00 0.00 ? 69  LYS B HB2  1  
ATOM 10020  H HB3  . LYS B 1 69  ? 57.081  17.867  -1.213  1.00 0.00 ? 69  LYS B HB3  1  
ATOM 10021  H HG2  . LYS B 1 69  ? 57.956  16.110  -3.520  1.00 0.00 ? 69  LYS B HG2  1  
ATOM 10022  H HG3  . LYS B 1 69  ? 56.953  15.513  -2.198  1.00 0.00 ? 69  LYS B HG3  1  
ATOM 10023  H HD2  . LYS B 1 69  ? 55.356  17.437  -2.699  1.00 0.00 ? 69  LYS B HD2  1  
ATOM 10024  H HD3  . LYS B 1 69  ? 56.287  17.714  -4.171  1.00 0.00 ? 69  LYS B HD3  1  
ATOM 10025  H HE2  . LYS B 1 69  ? 55.839  15.395  -4.893  1.00 0.00 ? 69  LYS B HE2  1  
ATOM 10026  H HE3  . LYS B 1 69  ? 54.901  15.121  -3.423  1.00 0.00 ? 69  LYS B HE3  1  
ATOM 10027  H HZ1  . LYS B 1 69  ? 54.233  17.397  -5.158  1.00 0.00 ? 69  LYS B HZ1  1  
ATOM 10028  H HZ2  . LYS B 1 69  ? 53.230  16.506  -4.116  1.00 0.00 ? 69  LYS B HZ2  1  
ATOM 10029  H HZ3  . LYS B 1 69  ? 53.718  15.843  -5.602  1.00 0.00 ? 69  LYS B HZ3  1  
ATOM 10030  N N    . GLU B 1 70  ? 60.414  19.552  -1.532  1.00 0.00 ? 70  GLU B N    1  
ATOM 10031  C CA   . GLU B 1 70  ? 61.045  20.564  -0.637  1.00 0.00 ? 70  GLU B CA   1  
ATOM 10032  C C    . GLU B 1 70  ? 60.987  21.961  -1.268  1.00 0.00 ? 70  GLU B C    1  
ATOM 10033  O O    . GLU B 1 70  ? 60.718  22.945  -0.600  1.00 0.00 ? 70  GLU B O    1  
ATOM 10034  C CB   . GLU B 1 70  ? 62.512  20.197  -0.430  1.00 0.00 ? 70  GLU B CB   1  
ATOM 10035  C CG   . GLU B 1 70  ? 63.122  21.088  0.648   1.00 0.00 ? 70  GLU B CG   1  
ATOM 10036  C CD   . GLU B 1 70  ? 64.580  20.684  0.886   1.00 0.00 ? 70  GLU B CD   1  
ATOM 10037  O OE1  . GLU B 1 70  ? 65.359  20.769  -0.049  1.00 0.00 ? 70  GLU B OE1  1  
ATOM 10038  O OE2  . GLU B 1 70  ? 64.888  20.289  1.998   1.00 0.00 ? 70  GLU B OE2  1  
ATOM 10039  H H    . GLU B 1 70  ? 60.961  18.848  -1.941  1.00 0.00 ? 70  GLU B H    1  
ATOM 10040  H HA   . GLU B 1 70  ? 60.539  20.573  0.317   1.00 0.00 ? 70  GLU B HA   1  
ATOM 10041  H HB2  . GLU B 1 70  ? 62.584  19.163  -0.124  1.00 0.00 ? 70  GLU B HB2  1  
ATOM 10042  H HB3  . GLU B 1 70  ? 63.051  20.336  -1.355  1.00 0.00 ? 70  GLU B HB3  1  
ATOM 10043  H HG2  . GLU B 1 70  ? 63.080  22.120  0.327   1.00 0.00 ? 70  GLU B HG2  1  
ATOM 10044  H HG3  . GLU B 1 70  ? 62.564  20.974  1.566   1.00 0.00 ? 70  GLU B HG3  1  
ATOM 10045  N N    . ALA B 1 71  ? 61.275  22.058  -2.533  1.00 0.00 ? 71  ALA B N    1  
ATOM 10046  C CA   . ALA B 1 71  ? 61.286  23.398  -3.189  1.00 0.00 ? 71  ALA B CA   1  
ATOM 10047  C C    . ALA B 1 71  ? 59.876  23.983  -3.277  1.00 0.00 ? 71  ALA B C    1  
ATOM 10048  O O    . ALA B 1 71  ? 59.707  25.187  -3.287  1.00 0.00 ? 71  ALA B O    1  
ATOM 10049  C CB   . ALA B 1 71  ? 61.900  23.293  -4.585  1.00 0.00 ? 71  ALA B CB   1  
ATOM 10050  H H    . ALA B 1 71  ? 61.517  21.258  -3.046  1.00 0.00 ? 71  ALA B H    1  
ATOM 10051  H HA   . ALA B 1 71  ? 61.896  24.063  -2.594  1.00 0.00 ? 71  ALA B HA   1  
ATOM 10052  H HB1  . ALA B 1 71  ? 62.198  24.275  -4.922  1.00 0.00 ? 71  ALA B HB1  1  
ATOM 10053  H HB2  . ALA B 1 71  ? 61.170  22.884  -5.269  1.00 0.00 ? 71  ALA B HB2  1  
ATOM 10054  H HB3  . ALA B 1 71  ? 62.763  22.646  -4.551  1.00 0.00 ? 71  ALA B HB3  1  
ATOM 10055  N N    . ILE B 1 72  ? 58.850  23.174  -3.346  1.00 0.00 ? 72  ILE B N    1  
ATOM 10056  C CA   . ILE B 1 72  ? 57.488  23.780  -3.429  1.00 0.00 ? 72  ILE B CA   1  
ATOM 10057  C C    . ILE B 1 72  ? 57.267  24.646  -2.187  1.00 0.00 ? 72  ILE B C    1  
ATOM 10058  O O    . ILE B 1 72  ? 56.701  25.717  -2.270  1.00 0.00 ? 72  ILE B O    1  
ATOM 10059  C CB   . ILE B 1 72  ? 56.370  22.720  -3.544  1.00 0.00 ? 72  ILE B CB   1  
ATOM 10060  C CG1  . ILE B 1 72  ? 56.468  22.033  -4.921  1.00 0.00 ? 72  ILE B CG1  1  
ATOM 10061  C CG2  . ILE B 1 72  ? 54.985  23.415  -3.390  1.00 0.00 ? 72  ILE B CG2  1  
ATOM 10062  C CD1  . ILE B 1 72  ? 55.568  20.790  -4.994  1.00 0.00 ? 72  ILE B CD1  1  
ATOM 10063  H H    . ILE B 1 72  ? 58.971  22.201  -3.342  1.00 0.00 ? 72  ILE B H    1  
ATOM 10064  H HA   . ILE B 1 72  ? 57.453  24.420  -4.301  1.00 0.00 ? 72  ILE B HA   1  
ATOM 10065  H HB   . ILE B 1 72  ? 56.491  21.985  -2.760  1.00 0.00 ? 72  ILE B HB   1  
ATOM 10066  H HG12 . ILE B 1 72  ? 56.167  22.733  -5.687  1.00 0.00 ? 72  ILE B HG12 1  
ATOM 10067  H HG13 . ILE B 1 72  ? 57.493  21.739  -5.096  1.00 0.00 ? 72  ILE B HG13 1  
ATOM 10068  H HG21 . ILE B 1 72  ? 54.973  24.326  -3.970  1.00 0.00 ? 72  ILE B HG21 1  
ATOM 10069  H HG22 . ILE B 1 72  ? 54.812  23.648  -2.349  1.00 0.00 ? 72  ILE B HG22 1  
ATOM 10070  H HG23 . ILE B 1 72  ? 54.209  22.752  -3.744  1.00 0.00 ? 72  ILE B HG23 1  
ATOM 10071  H HD11 . ILE B 1 72  ? 55.710  20.189  -4.107  1.00 0.00 ? 72  ILE B HD11 1  
ATOM 10072  H HD12 . ILE B 1 72  ? 55.825  20.209  -5.867  1.00 0.00 ? 72  ILE B HD12 1  
ATOM 10073  H HD13 . ILE B 1 72  ? 54.534  21.098  -5.058  1.00 0.00 ? 72  ILE B HD13 1  
ATOM 10074  N N    . PHE B 1 73  ? 57.715  24.207  -1.045  1.00 0.00 ? 73  PHE B N    1  
ATOM 10075  C CA   . PHE B 1 73  ? 57.528  25.029  0.187   1.00 0.00 ? 73  PHE B CA   1  
ATOM 10076  C C    . PHE B 1 73  ? 58.334  26.319  0.067   1.00 0.00 ? 73  PHE B C    1  
ATOM 10077  O O    . PHE B 1 73  ? 57.889  27.378  0.476   1.00 0.00 ? 73  PHE B O    1  
ATOM 10078  C CB   . PHE B 1 73  ? 57.979  24.247  1.413   1.00 0.00 ? 73  PHE B CB   1  
ATOM 10079  C CG   . PHE B 1 73  ? 56.896  23.271  1.791   1.00 0.00 ? 73  PHE B CG   1  
ATOM 10080  C CD1  . PHE B 1 73  ? 55.617  23.742  2.135   1.00 0.00 ? 73  PHE B CD1  1  
ATOM 10081  C CD2  . PHE B 1 73  ? 57.156  21.891  1.766   1.00 0.00 ? 73  PHE B CD2  1  
ATOM 10082  C CE1  . PHE B 1 73  ? 54.596  22.836  2.462   1.00 0.00 ? 73  PHE B CE1  1  
ATOM 10083  C CE2  . PHE B 1 73  ? 56.136  20.979  2.087   1.00 0.00 ? 73  PHE B CE2  1  
ATOM 10084  C CZ   . PHE B 1 73  ? 54.855  21.455  2.434   1.00 0.00 ? 73  PHE B CZ   1  
ATOM 10085  H H    . PHE B 1 73  ? 58.178  23.344  -0.997  1.00 0.00 ? 73  PHE B H    1  
ATOM 10086  H HA   . PHE B 1 73  ? 56.480  25.277  0.289   1.00 0.00 ? 73  PHE B HA   1  
ATOM 10087  H HB2  . PHE B 1 73  ? 58.889  23.711  1.186   1.00 0.00 ? 73  PHE B HB2  1  
ATOM 10088  H HB3  . PHE B 1 73  ? 58.153  24.927  2.233   1.00 0.00 ? 73  PHE B HB3  1  
ATOM 10089  H HD1  . PHE B 1 73  ? 55.422  24.804  2.156   1.00 0.00 ? 73  PHE B HD1  1  
ATOM 10090  H HD2  . PHE B 1 73  ? 58.140  21.531  1.501   1.00 0.00 ? 73  PHE B HD2  1  
ATOM 10091  H HE1  . PHE B 1 73  ? 53.614  23.197  2.728   1.00 0.00 ? 73  PHE B HE1  1  
ATOM 10092  H HE2  . PHE B 1 73  ? 56.333  19.917  2.069   1.00 0.00 ? 73  PHE B HE2  1  
ATOM 10093  H HZ   . PHE B 1 73  ? 54.070  20.755  2.681   1.00 0.00 ? 73  PHE B HZ   1  
ATOM 10094  N N    . GLU B 1 74  ? 59.509  26.257  -0.485  1.00 0.00 ? 74  GLU B N    1  
ATOM 10095  C CA   . GLU B 1 74  ? 60.318  27.499  -0.612  1.00 0.00 ? 74  GLU B CA   1  
ATOM 10096  C C    . GLU B 1 74  ? 59.544  28.516  -1.453  1.00 0.00 ? 74  GLU B C    1  
ATOM 10097  O O    . GLU B 1 74  ? 59.526  29.693  -1.153  1.00 0.00 ? 74  GLU B O    1  
ATOM 10098  C CB   . GLU B 1 74  ? 61.656  27.179  -1.277  1.00 0.00 ? 74  GLU B CB   1  
ATOM 10099  C CG   . GLU B 1 74  ? 61.579  27.516  -2.769  1.00 0.00 ? 74  GLU B CG   1  
ATOM 10100  C CD   . GLU B 1 74  ? 61.695  29.028  -2.962  1.00 0.00 ? 74  GLU B CD   1  
ATOM 10101  O OE1  . GLU B 1 74  ? 62.351  29.660  -2.152  1.00 0.00 ? 74  GLU B OE1  1  
ATOM 10102  O OE2  . GLU B 1 74  ? 61.118  29.534  -3.912  1.00 0.00 ? 74  GLU B OE2  1  
ATOM 10103  H H    . GLU B 1 74  ? 59.858  25.402  -0.811  1.00 0.00 ? 74  GLU B H    1  
ATOM 10104  H HA   . GLU B 1 74  ? 60.495  27.911  0.371   1.00 0.00 ? 74  GLU B HA   1  
ATOM 10105  H HB2  . GLU B 1 74  ? 62.437  27.765  -0.814  1.00 0.00 ? 74  GLU B HB2  1  
ATOM 10106  H HB3  . GLU B 1 74  ? 61.875  26.128  -1.158  1.00 0.00 ? 74  GLU B HB3  1  
ATOM 10107  H HG2  . GLU B 1 74  ? 62.388  27.023  -3.290  1.00 0.00 ? 74  GLU B HG2  1  
ATOM 10108  H HG3  . GLU B 1 74  ? 60.635  27.175  -3.167  1.00 0.00 ? 74  GLU B HG3  1  
ATOM 10109  N N    . GLY B 1 75  ? 58.893  28.077  -2.493  1.00 0.00 ? 75  GLY B N    1  
ATOM 10110  C CA   . GLY B 1 75  ? 58.112  29.030  -3.325  1.00 0.00 ? 75  GLY B CA   1  
ATOM 10111  C C    . GLY B 1 75  ? 57.002  29.637  -2.466  1.00 0.00 ? 75  GLY B C    1  
ATOM 10112  O O    . GLY B 1 75  ? 56.805  30.837  -2.442  1.00 0.00 ? 75  GLY B O    1  
ATOM 10113  H H    . GLY B 1 75  ? 58.907  27.123  -2.717  1.00 0.00 ? 75  GLY B H    1  
ATOM 10114  H HA2  . GLY B 1 75  ? 58.764  29.814  -3.687  1.00 0.00 ? 75  GLY B HA2  1  
ATOM 10115  H HA3  . GLY B 1 75  ? 57.673  28.508  -4.161  1.00 0.00 ? 75  GLY B HA3  1  
ATOM 10116  N N    . HIS B 1 76  ? 56.281  28.812  -1.760  1.00 0.00 ? 76  HIS B N    1  
ATOM 10117  C CA   . HIS B 1 76  ? 55.188  29.331  -0.896  1.00 0.00 ? 76  HIS B CA   1  
ATOM 10118  C C    . HIS B 1 76  ? 55.780  30.272  0.148   1.00 0.00 ? 76  HIS B C    1  
ATOM 10119  O O    . HIS B 1 76  ? 55.273  31.351  0.384   1.00 0.00 ? 76  HIS B O    1  
ATOM 10120  C CB   . HIS B 1 76  ? 54.493  28.163  -0.192  1.00 0.00 ? 76  HIS B CB   1  
ATOM 10121  C CG   . HIS B 1 76  ? 53.514  27.503  -1.128  1.00 0.00 ? 76  HIS B CG   1  
ATOM 10122  N ND1  . HIS B 1 76  ? 53.325  27.950  -2.427  1.00 0.00 ? 76  HIS B ND1  1  
ATOM 10123  C CD2  . HIS B 1 76  ? 52.656  26.436  -0.973  1.00 0.00 ? 76  HIS B CD2  1  
ATOM 10124  C CE1  . HIS B 1 76  ? 52.388  27.170  -2.998  1.00 0.00 ? 76  HIS B CE1  1  
ATOM 10125  N NE2  . HIS B 1 76  ? 51.951  26.232  -2.154  1.00 0.00 ? 76  HIS B NE2  1  
ATOM 10126  H H    . HIS B 1 76  ? 56.462  27.849  -1.795  1.00 0.00 ? 76  HIS B H    1  
ATOM 10127  H HA   . HIS B 1 76  ? 54.471  29.867  -1.501  1.00 0.00 ? 76  HIS B HA   1  
ATOM 10128  H HB2  . HIS B 1 76  ? 55.234  27.441  0.118   1.00 0.00 ? 76  HIS B HB2  1  
ATOM 10129  H HB3  . HIS B 1 76  ? 53.966  28.531  0.677   1.00 0.00 ? 76  HIS B HB3  1  
ATOM 10130  H HD1  . HIS B 1 76  ? 53.791  28.700  -2.853  1.00 0.00 ? 76  HIS B HD1  1  
ATOM 10131  H HD2  . HIS B 1 76  ? 52.547  25.850  -0.073  1.00 0.00 ? 76  HIS B HD2  1  
ATOM 10132  H HE1  . HIS B 1 76  ? 52.035  27.288  -4.012  1.00 0.00 ? 76  HIS B HE1  1  
ATOM 10133  H HE2  . HIS B 1 76  ? 51.275  25.545  -2.330  1.00 0.00 ? 76  HIS B HE2  1  
ATOM 10134  N N    . ILE B 1 77  ? 56.859  29.877  0.769   1.00 0.00 ? 77  ILE B N    1  
ATOM 10135  C CA   . ILE B 1 77  ? 57.485  30.761  1.790   1.00 0.00 ? 77  ILE B CA   1  
ATOM 10136  C C    . ILE B 1 77  ? 58.036  32.013  1.098   1.00 0.00 ? 77  ILE B C    1  
ATOM 10137  O O    . ILE B 1 77  ? 57.834  33.121  1.555   1.00 0.00 ? 77  ILE B O    1  
ATOM 10138  C CB   . ILE B 1 77  ? 58.624  30.012  2.506   1.00 0.00 ? 77  ILE B CB   1  
ATOM 10139  C CG1  . ILE B 1 77  ? 58.211  28.542  2.717   1.00 0.00 ? 77  ILE B CG1  1  
ATOM 10140  C CG2  . ILE B 1 77  ? 58.894  30.673  3.865   1.00 0.00 ? 77  ILE B CG2  1  
ATOM 10141  C CD1  . ILE B 1 77  ? 56.668  28.386  2.649   1.00 0.00 ? 77  ILE B CD1  1  
ATOM 10142  H H    . ILE B 1 77  ? 57.258  29.007  0.560   1.00 0.00 ? 77  ILE B H    1  
ATOM 10143  H HA   . ILE B 1 77  ? 56.738  31.054  2.513   1.00 0.00 ? 77  ILE B HA   1  
ATOM 10144  H HB   . ILE B 1 77  ? 59.520  30.054  1.901   1.00 0.00 ? 77  ILE B HB   1  
ATOM 10145  H HG12 . ILE B 1 77  ? 58.664  27.933  1.949   1.00 0.00 ? 77  ILE B HG12 1  
ATOM 10146  H HG13 . ILE B 1 77  ? 58.558  28.211  3.684   1.00 0.00 ? 77  ILE B HG13 1  
ATOM 10147  H HG21 . ILE B 1 77  ? 57.981  30.693  4.443   1.00 0.00 ? 77  ILE B HG21 1  
ATOM 10148  H HG22 . ILE B 1 77  ? 59.243  31.683  3.710   1.00 0.00 ? 77  ILE B HG22 1  
ATOM 10149  H HG23 . ILE B 1 77  ? 59.645  30.109  4.397   1.00 0.00 ? 77  ILE B HG23 1  
ATOM 10150  H HD11 . ILE B 1 77  ? 56.201  29.200  3.184   1.00 0.00 ? 77  ILE B HD11 1  
ATOM 10151  H HD12 . ILE B 1 77  ? 56.381  27.448  3.099   1.00 0.00 ? 77  ILE B HD12 1  
ATOM 10152  H HD13 . ILE B 1 77  ? 56.350  28.402  1.617   1.00 0.00 ? 77  ILE B HD13 1  
ATOM 10153  N N    . MET B 1 78  ? 58.740  31.845  0.012   1.00 0.00 ? 78  MET B N    1  
ATOM 10154  C CA   . MET B 1 78  ? 59.312  33.024  -0.695  1.00 0.00 ? 78  MET B CA   1  
ATOM 10155  C C    . MET B 1 78  ? 58.188  33.959  -1.137  1.00 0.00 ? 78  MET B C    1  
ATOM 10156  O O    . MET B 1 78  ? 58.298  35.166  -1.046  1.00 0.00 ? 78  MET B O    1  
ATOM 10157  C CB   . MET B 1 78  ? 60.108  32.524  -1.908  1.00 0.00 ? 78  MET B CB   1  
ATOM 10158  C CG   . MET B 1 78  ? 60.753  33.704  -2.631  1.00 0.00 ? 78  MET B CG   1  
ATOM 10159  S SD   . MET B 1 78  ? 61.951  34.496  -1.524  1.00 0.00 ? 78  MET B SD   1  
ATOM 10160  C CE   . MET B 1 78  ? 62.144  36.055  -2.421  1.00 0.00 ? 78  MET B CE   1  
ATOM 10161  H H    . MET B 1 78  ? 58.901  30.942  -0.334  1.00 0.00 ? 78  MET B H    1  
ATOM 10162  H HA   . MET B 1 78  ? 59.975  33.553  -0.027  1.00 0.00 ? 78  MET B HA   1  
ATOM 10163  H HB2  . MET B 1 78  ? 60.878  31.844  -1.575  1.00 0.00 ? 78  MET B HB2  1  
ATOM 10164  H HB3  . MET B 1 78  ? 59.443  32.011  -2.586  1.00 0.00 ? 78  MET B HB3  1  
ATOM 10165  H HG2  . MET B 1 78  ? 61.259  33.351  -3.518  1.00 0.00 ? 78  MET B HG2  1  
ATOM 10166  H HG3  . MET B 1 78  ? 59.992  34.418  -2.909  1.00 0.00 ? 78  MET B HG3  1  
ATOM 10167  H HE1  . MET B 1 78  ? 62.627  36.780  -1.781  1.00 0.00 ? 78  MET B HE1  1  
ATOM 10168  H HE2  . MET B 1 78  ? 61.175  36.426  -2.714  1.00 0.00 ? 78  MET B HE2  1  
ATOM 10169  H HE3  . MET B 1 78  ? 62.746  35.888  -3.304  1.00 0.00 ? 78  MET B HE3  1  
ATOM 10170  N N    . LEU B 1 79  ? 57.100  33.415  -1.600  1.00 0.00 ? 79  LEU B N    1  
ATOM 10171  C CA   . LEU B 1 79  ? 55.968  34.276  -2.034  1.00 0.00 ? 79  LEU B CA   1  
ATOM 10172  C C    . LEU B 1 79  ? 55.396  35.008  -0.827  1.00 0.00 ? 79  LEU B C    1  
ATOM 10173  O O    . LEU B 1 79  ? 55.042  36.161  -0.903  1.00 0.00 ? 79  LEU B O    1  
ATOM 10174  C CB   . LEU B 1 79  ? 54.863  33.401  -2.643  1.00 0.00 ? 79  LEU B CB   1  
ATOM 10175  C CG   . LEU B 1 79  ? 54.088  34.187  -3.725  1.00 0.00 ? 79  LEU B CG   1  
ATOM 10176  C CD1  . LEU B 1 79  ? 53.507  35.493  -3.124  1.00 0.00 ? 79  LEU B CD1  1  
ATOM 10177  C CD2  . LEU B 1 79  ? 55.023  34.457  -4.953  1.00 0.00 ? 79  LEU B CD2  1  
ATOM 10178  H H    . LEU B 1 79  ? 57.024  32.439  -1.655  1.00 0.00 ? 79  LEU B H    1  
ATOM 10179  H HA   . LEU B 1 79  ? 56.310  34.990  -2.766  1.00 0.00 ? 79  LEU B HA   1  
ATOM 10180  H HB2  . LEU B 1 79  ? 55.307  32.523  -3.088  1.00 0.00 ? 79  LEU B HB2  1  
ATOM 10181  H HB3  . LEU B 1 79  ? 54.177  33.099  -1.866  1.00 0.00 ? 79  LEU B HB3  1  
ATOM 10182  H HG   . LEU B 1 79  ? 53.259  33.573  -4.053  1.00 0.00 ? 79  LEU B HG   1  
ATOM 10183  H HD11 . LEU B 1 79  ? 53.164  35.305  -2.117  1.00 0.00 ? 79  LEU B HD11 1  
ATOM 10184  H HD12 . LEU B 1 79  ? 52.679  35.831  -3.729  1.00 0.00 ? 79  LEU B HD12 1  
ATOM 10185  H HD13 . LEU B 1 79  ? 54.273  36.254  -3.107  1.00 0.00 ? 79  LEU B HD13 1  
ATOM 10186  H HD21 . LEU B 1 79  ? 55.220  35.517  -5.028  1.00 0.00 ? 79  LEU B HD21 1  
ATOM 10187  H HD22 . LEU B 1 79  ? 54.540  34.116  -5.856  1.00 0.00 ? 79  LEU B HD22 1  
ATOM 10188  H HD23 . LEU B 1 79  ? 55.954  33.925  -4.820  1.00 0.00 ? 79  LEU B HD23 1  
ATOM 10189  N N    . LEU B 1 80  ? 55.302  34.338  0.278   1.00 0.00 ? 80  LEU B N    1  
ATOM 10190  C CA   . LEU B 1 80  ? 54.738  34.977  1.489   1.00 0.00 ? 80  LEU B CA   1  
ATOM 10191  C C    . LEU B 1 80  ? 55.623  36.144  1.923   1.00 0.00 ? 80  LEU B C    1  
ATOM 10192  O O    . LEU B 1 80  ? 55.140  37.176  2.354   1.00 0.00 ? 80  LEU B O    1  
ATOM 10193  C CB   . LEU B 1 80  ? 54.643  33.937  2.613   1.00 0.00 ? 80  LEU B CB   1  
ATOM 10194  C CG   . LEU B 1 80  ? 54.346  34.627  3.954   1.00 0.00 ? 80  LEU B CG   1  
ATOM 10195  C CD1  . LEU B 1 80  ? 53.046  35.441  3.858   1.00 0.00 ? 80  LEU B CD1  1  
ATOM 10196  C CD2  . LEU B 1 80  ? 54.197  33.548  5.033   1.00 0.00 ? 80  LEU B CD2  1  
ATOM 10197  H H    . LEU B 1 80  ? 55.594  33.403  0.309   1.00 0.00 ? 80  LEU B H    1  
ATOM 10198  H HA   . LEU B 1 80  ? 53.749  35.348  1.265   1.00 0.00 ? 80  LEU B HA   1  
ATOM 10199  H HB2  . LEU B 1 80  ? 53.850  33.239  2.386   1.00 0.00 ? 80  LEU B HB2  1  
ATOM 10200  H HB3  . LEU B 1 80  ? 55.579  33.403  2.686   1.00 0.00 ? 80  LEU B HB3  1  
ATOM 10201  H HG   . LEU B 1 80  ? 55.164  35.284  4.210   1.00 0.00 ? 80  LEU B HG   1  
ATOM 10202  H HD11 . LEU B 1 80  ? 52.740  35.750  4.847   1.00 0.00 ? 80  LEU B HD11 1  
ATOM 10203  H HD12 . LEU B 1 80  ? 52.271  34.832  3.414   1.00 0.00 ? 80  LEU B HD12 1  
ATOM 10204  H HD13 . LEU B 1 80  ? 53.213  36.315  3.244   1.00 0.00 ? 80  LEU B HD13 1  
ATOM 10205  H HD21 . LEU B 1 80  ? 53.373  32.897  4.781   1.00 0.00 ? 80  LEU B HD21 1  
ATOM 10206  H HD22 . LEU B 1 80  ? 54.006  34.017  5.987   1.00 0.00 ? 80  LEU B HD22 1  
ATOM 10207  H HD23 . LEU B 1 80  ? 55.108  32.970  5.092   1.00 0.00 ? 80  LEU B HD23 1  
ATOM 10208  N N    . GLU B 1 81  ? 56.914  35.992  1.829   1.00 0.00 ? 81  GLU B N    1  
ATOM 10209  C CA   . GLU B 1 81  ? 57.834  37.088  2.253   1.00 0.00 ? 81  GLU B CA   1  
ATOM 10210  C C    . GLU B 1 81  ? 57.984  38.113  1.118   1.00 0.00 ? 81  GLU B C    1  
ATOM 10211  O O    . GLU B 1 81  ? 58.775  39.032  1.209   1.00 0.00 ? 81  GLU B O    1  
ATOM 10212  C CB   . GLU B 1 81  ? 59.208  36.497  2.583   1.00 0.00 ? 81  GLU B CB   1  
ATOM 10213  C CG   . GLU B 1 81  ? 59.076  35.473  3.716   1.00 0.00 ? 81  GLU B CG   1  
ATOM 10214  C CD   . GLU B 1 81  ? 58.647  36.184  4.997   1.00 0.00 ? 81  GLU B CD   1  
ATOM 10215  O OE1  . GLU B 1 81  ? 58.837  37.387  5.076   1.00 0.00 ? 81  GLU B OE1  1  
ATOM 10216  O OE2  . GLU B 1 81  ? 58.134  35.515  5.882   1.00 0.00 ? 81  GLU B OE2  1  
ATOM 10217  H H    . GLU B 1 81  ? 57.284  35.150  1.490   1.00 0.00 ? 81  GLU B H    1  
ATOM 10218  H HA   . GLU B 1 81  ? 57.433  37.576  3.128   1.00 0.00 ? 81  GLU B HA   1  
ATOM 10219  H HB2  . GLU B 1 81  ? 59.610  36.013  1.705   1.00 0.00 ? 81  GLU B HB2  1  
ATOM 10220  H HB3  . GLU B 1 81  ? 59.873  37.289  2.894   1.00 0.00 ? 81  GLU B HB3  1  
ATOM 10221  H HG2  . GLU B 1 81  ? 58.336  34.733  3.448   1.00 0.00 ? 81  GLU B HG2  1  
ATOM 10222  H HG3  . GLU B 1 81  ? 60.028  34.990  3.877   1.00 0.00 ? 81  GLU B HG3  1  
ATOM 10223  N N    . ASP B 1 82  ? 57.246  37.963  0.053   1.00 0.00 ? 82  ASP B N    1  
ATOM 10224  C CA   . ASP B 1 82  ? 57.370  38.940  -1.074  1.00 0.00 ? 82  ASP B CA   1  
ATOM 10225  C C    . ASP B 1 82  ? 57.252  40.368  -0.531  1.00 0.00 ? 82  ASP B C    1  
ATOM 10226  O O    . ASP B 1 82  ? 56.356  40.686  0.225   1.00 0.00 ? 82  ASP B O    1  
ATOM 10227  C CB   . ASP B 1 82  ? 56.262  38.686  -2.097  1.00 0.00 ? 82  ASP B CB   1  
ATOM 10228  C CG   . ASP B 1 82  ? 56.459  39.606  -3.302  1.00 0.00 ? 82  ASP B CG   1  
ATOM 10229  O OD1  . ASP B 1 82  ? 57.305  40.481  -3.226  1.00 0.00 ? 82  ASP B OD1  1  
ATOM 10230  O OD2  . ASP B 1 82  ? 55.760  39.417  -4.283  1.00 0.00 ? 82  ASP B OD2  1  
ATOM 10231  H H    . ASP B 1 82  ? 56.617  37.213  -0.010  1.00 0.00 ? 82  ASP B H    1  
ATOM 10232  H HA   . ASP B 1 82  ? 58.332  38.816  -1.550  1.00 0.00 ? 82  ASP B HA   1  
ATOM 10233  H HB2  . ASP B 1 82  ? 56.299  37.656  -2.419  1.00 0.00 ? 82  ASP B HB2  1  
ATOM 10234  H HB3  . ASP B 1 82  ? 55.303  38.888  -1.645  1.00 0.00 ? 82  ASP B HB3  1  
ATOM 10235  N N    . GLU B 1 83  ? 58.170  41.222  -0.895  1.00 0.00 ? 83  GLU B N    1  
ATOM 10236  C CA   . GLU B 1 83  ? 58.142  42.631  -0.391  1.00 0.00 ? 83  GLU B CA   1  
ATOM 10237  C C    . GLU B 1 83  ? 56.855  43.331  -0.823  1.00 0.00 ? 83  GLU B C    1  
ATOM 10238  O O    . GLU B 1 83  ? 56.459  44.322  -0.242  1.00 0.00 ? 83  GLU B O    1  
ATOM 10239  C CB   . GLU B 1 83  ? 59.345  43.395  -0.951  1.00 0.00 ? 83  GLU B CB   1  
ATOM 10240  C CG   . GLU B 1 83  ? 59.487  44.730  -0.223  1.00 0.00 ? 83  GLU B CG   1  
ATOM 10241  C CD   . GLU B 1 83  ? 59.897  44.476  1.231   1.00 0.00 ? 83  GLU B CD   1  
ATOM 10242  O OE1  . GLU B 1 83  ? 60.384  43.391  1.503   1.00 0.00 ? 83  GLU B OE1  1  
ATOM 10243  O OE2  . GLU B 1 83  ? 59.713  45.365  2.044   1.00 0.00 ? 83  GLU B OE2  1  
ATOM 10244  H H    . GLU B 1 83  ? 58.893  40.934  -1.490  1.00 0.00 ? 83  GLU B H    1  
ATOM 10245  H HA   . GLU B 1 83  ? 58.198  42.624  0.688   1.00 0.00 ? 83  GLU B HA   1  
ATOM 10246  H HB2  . GLU B 1 83  ? 60.241  42.808  -0.808  1.00 0.00 ? 83  GLU B HB2  1  
ATOM 10247  H HB3  . GLU B 1 83  ? 59.197  43.576  -2.005  1.00 0.00 ? 83  GLU B HB3  1  
ATOM 10248  H HG2  . GLU B 1 83  ? 60.243  45.329  -0.712  1.00 0.00 ? 83  GLU B HG2  1  
ATOM 10249  H HG3  . GLU B 1 83  ? 58.544  45.255  -0.242  1.00 0.00 ? 83  GLU B HG3  1  
ATOM 10250  N N    . GLU B 1 84  ? 56.184  42.828  -1.820  1.00 0.00 ? 84  GLU B N    1  
ATOM 10251  C CA   . GLU B 1 84  ? 54.913  43.472  -2.257  1.00 0.00 ? 84  GLU B CA   1  
ATOM 10252  C C    . GLU B 1 84  ? 53.824  43.222  -1.202  1.00 0.00 ? 84  GLU B C    1  
ATOM 10253  O O    . GLU B 1 84  ? 52.993  44.060  -0.937  1.00 0.00 ? 84  GLU B O    1  
ATOM 10254  C CB   . GLU B 1 84  ? 54.473  42.869  -3.596  1.00 0.00 ? 84  GLU B CB   1  
ATOM 10255  C CG   . GLU B 1 84  ? 55.504  43.209  -4.669  1.00 0.00 ? 84  GLU B CG   1  
ATOM 10256  C CD   . GLU B 1 84  ? 55.487  44.717  -4.939  1.00 0.00 ? 84  GLU B CD   1  
ATOM 10257  O OE1  . GLU B 1 84  ? 54.498  45.347  -4.612  1.00 0.00 ? 84  GLU B OE1  1  
ATOM 10258  O OE2  . GLU B 1 84  ? 56.469  45.214  -5.469  1.00 0.00 ? 84  GLU B OE2  1  
ATOM 10259  H H    . GLU B 1 84  ? 56.507  42.021  -2.272  1.00 0.00 ? 84  GLU B H    1  
ATOM 10260  H HA   . GLU B 1 84  ? 55.067  44.535  -2.373  1.00 0.00 ? 84  GLU B HA   1  
ATOM 10261  H HB2  . GLU B 1 84  ? 54.394  41.795  -3.498  1.00 0.00 ? 84  GLU B HB2  1  
ATOM 10262  H HB3  . GLU B 1 84  ? 53.514  43.278  -3.877  1.00 0.00 ? 84  GLU B HB3  1  
ATOM 10263  H HG2  . GLU B 1 84  ? 56.486  42.914  -4.330  1.00 0.00 ? 84  GLU B HG2  1  
ATOM 10264  H HG3  . GLU B 1 84  ? 55.263  42.680  -5.579  1.00 0.00 ? 84  GLU B HG3  1  
ATOM 10265  N N    . LEU B 1 85  ? 53.847  42.066  -0.600  1.00 0.00 ? 85  LEU B N    1  
ATOM 10266  C CA   . LEU B 1 85  ? 52.830  41.742  0.447   1.00 0.00 ? 85  LEU B CA   1  
ATOM 10267  C C    . LEU B 1 85  ? 53.082  42.576  1.697   1.00 0.00 ? 85  LEU B C    1  
ATOM 10268  O O    . LEU B 1 85  ? 52.165  43.052  2.338   1.00 0.00 ? 85  LEU B O    1  
ATOM 10269  C CB   . LEU B 1 85  ? 52.938  40.264  0.816   1.00 0.00 ? 85  LEU B CB   1  
ATOM 10270  C CG   . LEU B 1 85  ? 52.513  39.396  -0.375  1.00 0.00 ? 85  LEU B CG   1  
ATOM 10271  C CD1  . LEU B 1 85  ? 52.917  37.948  -0.103  1.00 0.00 ? 85  LEU B CD1  1  
ATOM 10272  C CD2  . LEU B 1 85  ? 50.991  39.457  -0.567  1.00 0.00 ? 85  LEU B CD2  1  
ATOM 10273  H H    . LEU B 1 85  ? 54.536  41.409  -0.830  1.00 0.00 ? 85  LEU B H    1  
ATOM 10274  H HA   . LEU B 1 85  ? 51.840  41.947  0.067   1.00 0.00 ? 85  LEU B HA   1  
ATOM 10275  H HB2  . LEU B 1 85  ? 53.961  40.035  1.080   1.00 0.00 ? 85  LEU B HB2  1  
ATOM 10276  H HB3  . LEU B 1 85  ? 52.294  40.056  1.657   1.00 0.00 ? 85  LEU B HB3  1  
ATOM 10277  H HG   . LEU B 1 85  ? 53.007  39.747  -1.270  1.00 0.00 ? 85  LEU B HG   1  
ATOM 10278  H HD11 . LEU B 1 85  ? 52.769  37.359  -0.996  1.00 0.00 ? 85  LEU B HD11 1  
ATOM 10279  H HD12 . LEU B 1 85  ? 52.311  37.549  0.696   1.00 0.00 ? 85  LEU B HD12 1  
ATOM 10280  H HD13 . LEU B 1 85  ? 53.958  37.913  0.182   1.00 0.00 ? 85  LEU B HD13 1  
ATOM 10281  H HD21 . LEU B 1 85  ? 50.507  39.480  0.398   1.00 0.00 ? 85  LEU B HD21 1  
ATOM 10282  H HD22 . LEU B 1 85  ? 50.662  38.586  -1.115  1.00 0.00 ? 85  LEU B HD22 1  
ATOM 10283  H HD23 . LEU B 1 85  ? 50.734  40.348  -1.121  1.00 0.00 ? 85  LEU B HD23 1  
ATOM 10284  N N    . GLU B 1 86  ? 54.318  42.749  2.055   1.00 0.00 ? 86  GLU B N    1  
ATOM 10285  C CA   . GLU B 1 86  ? 54.634  43.533  3.277   1.00 0.00 ? 86  GLU B CA   1  
ATOM 10286  C C    . GLU B 1 86  ? 54.102  44.959  3.115   1.00 0.00 ? 86  GLU B C    1  
ATOM 10287  O O    . GLU B 1 86  ? 53.461  45.493  3.999   1.00 0.00 ? 86  GLU B O    1  
ATOM 10288  C CB   . GLU B 1 86  ? 56.152  43.571  3.472   1.00 0.00 ? 86  GLU B CB   1  
ATOM 10289  C CG   . GLU B 1 86  ? 56.487  44.226  4.811   1.00 0.00 ? 86  GLU B CG   1  
ATOM 10290  C CD   . GLU B 1 86  ? 56.377  45.745  4.682   1.00 0.00 ? 86  GLU B CD   1  
ATOM 10291  O OE1  . GLU B 1 86  ? 56.606  46.241  3.592   1.00 0.00 ? 86  GLU B OE1  1  
ATOM 10292  O OE2  . GLU B 1 86  ? 56.070  46.383  5.675   1.00 0.00 ? 86  GLU B OE2  1  
ATOM 10293  H H    . GLU B 1 86  ? 55.042  42.350  1.529   1.00 0.00 ? 86  GLU B H    1  
ATOM 10294  H HA   . GLU B 1 86  ? 54.170  43.069  4.136   1.00 0.00 ? 86  GLU B HA   1  
ATOM 10295  H HB2  . GLU B 1 86  ? 56.540  42.563  3.458   1.00 0.00 ? 86  GLU B HB2  1  
ATOM 10296  H HB3  . GLU B 1 86  ? 56.602  44.141  2.672   1.00 0.00 ? 86  GLU B HB3  1  
ATOM 10297  H HG2  . GLU B 1 86  ? 55.795  43.877  5.564   1.00 0.00 ? 86  GLU B HG2  1  
ATOM 10298  H HG3  . GLU B 1 86  ? 57.494  43.963  5.098   1.00 0.00 ? 86  GLU B HG3  1  
ATOM 10299  N N    . GLN B 1 87  ? 54.379  45.581  2.008   1.00 0.00 ? 87  GLN B N    1  
ATOM 10300  C CA   . GLN B 1 87  ? 53.899  46.976  1.797   1.00 0.00 ? 87  GLN B CA   1  
ATOM 10301  C C    . GLN B 1 87  ? 52.374  47.009  1.614   1.00 0.00 ? 87  GLN B C    1  
ATOM 10302  O O    . GLN B 1 87  ? 51.701  47.888  2.115   1.00 0.00 ? 87  GLN B O    1  
ATOM 10303  C CB   . GLN B 1 87  ? 54.568  47.546  0.543   1.00 0.00 ? 87  GLN B CB   1  
ATOM 10304  C CG   . GLN B 1 87  ? 56.063  47.747  0.798   1.00 0.00 ? 87  GLN B CG   1  
ATOM 10305  C CD   . GLN B 1 87  ? 56.274  49.026  1.611   1.00 0.00 ? 87  GLN B CD   1  
ATOM 10306  O OE1  . GLN B 1 87  ? 55.325  49.689  1.983   1.00 0.00 ? 87  GLN B OE1  1  
ATOM 10307  N NE2  . GLN B 1 87  ? 57.487  49.407  1.905   1.00 0.00 ? 87  GLN B NE2  1  
ATOM 10308  H H    . GLN B 1 87  ? 54.910  45.136  1.315   1.00 0.00 ? 87  GLN B H    1  
ATOM 10309  H HA   . GLN B 1 87  ? 54.170  47.581  2.649   1.00 0.00 ? 87  GLN B HA   1  
ATOM 10310  H HB2  . GLN B 1 87  ? 54.433  46.859  -0.280  1.00 0.00 ? 87  GLN B HB2  1  
ATOM 10311  H HB3  . GLN B 1 87  ? 54.117  48.496  0.295   1.00 0.00 ? 87  GLN B HB3  1  
ATOM 10312  H HG2  . GLN B 1 87  ? 56.451  46.902  1.348   1.00 0.00 ? 87  GLN B HG2  1  
ATOM 10313  H HG3  . GLN B 1 87  ? 56.581  47.833  -0.146  1.00 0.00 ? 87  GLN B HG3  1  
ATOM 10314  H HE21 . GLN B 1 87  ? 58.253  48.875  1.604   1.00 0.00 ? 87  GLN B HE21 1  
ATOM 10315  H HE22 . GLN B 1 87  ? 57.631  50.225  2.426   1.00 0.00 ? 87  GLN B HE22 1  
ATOM 10316  N N    . GLU B 1 88  ? 51.824  46.071  0.885   1.00 0.00 ? 88  GLU B N    1  
ATOM 10317  C CA   . GLU B 1 88  ? 50.345  46.064  0.654   1.00 0.00 ? 88  GLU B CA   1  
ATOM 10318  C C    . GLU B 1 88  ? 49.569  45.711  1.930   1.00 0.00 ? 88  GLU B C    1  
ATOM 10319  O O    . GLU B 1 88  ? 48.540  46.292  2.213   1.00 0.00 ? 88  GLU B O    1  
ATOM 10320  C CB   . GLU B 1 88  ? 50.010  45.054  -0.446  1.00 0.00 ? 88  GLU B CB   1  
ATOM 10321  C CG   . GLU B 1 88  ? 50.583  45.552  -1.774  1.00 0.00 ? 88  GLU B CG   1  
ATOM 10322  C CD   . GLU B 1 88  ? 49.791  46.769  -2.249  1.00 0.00 ? 88  GLU B CD   1  
ATOM 10323  O OE1  . GLU B 1 88  ? 48.717  46.998  -1.721  1.00 0.00 ? 88  GLU B OE1  1  
ATOM 10324  O OE2  . GLU B 1 88  ? 50.278  47.458  -3.132  1.00 0.00 ? 88  GLU B OE2  1  
ATOM 10325  H H    . GLU B 1 88  ? 52.385  45.378  0.477   1.00 0.00 ? 88  GLU B H    1  
ATOM 10326  H HA   . GLU B 1 88  ? 50.042  47.047  0.325   1.00 0.00 ? 88  GLU B HA   1  
ATOM 10327  H HB2  . GLU B 1 88  ? 50.443  44.096  -0.200  1.00 0.00 ? 88  GLU B HB2  1  
ATOM 10328  H HB3  . GLU B 1 88  ? 48.938  44.956  -0.532  1.00 0.00 ? 88  GLU B HB3  1  
ATOM 10329  H HG2  . GLU B 1 88  ? 51.619  45.826  -1.638  1.00 0.00 ? 88  GLU B HG2  1  
ATOM 10330  H HG3  . GLU B 1 88  ? 50.512  44.768  -2.513  1.00 0.00 ? 88  GLU B HG3  1  
ATOM 10331  N N    . ILE B 1 89  ? 50.042  44.779  2.700   1.00 0.00 ? 89  ILE B N    1  
ATOM 10332  C CA   . ILE B 1 89  ? 49.311  44.416  3.948   1.00 0.00 ? 89  ILE B CA   1  
ATOM 10333  C C    . ILE B 1 89  ? 49.382  45.589  4.931   1.00 0.00 ? 89  ILE B C    1  
ATOM 10334  O O    . ILE B 1 89  ? 48.400  45.976  5.530   1.00 0.00 ? 89  ILE B O    1  
ATOM 10335  C CB   . ILE B 1 89  ? 49.944  43.163  4.570   1.00 0.00 ? 89  ILE B CB   1  
ATOM 10336  C CG1  . ILE B 1 89  ? 48.854  42.390  5.328   1.00 0.00 ? 89  ILE B CG1  1  
ATOM 10337  C CG2  . ILE B 1 89  ? 51.066  43.564  5.539   1.00 0.00 ? 89  ILE B CG2  1  
ATOM 10338  C CD1  . ILE B 1 89  ? 48.167  43.290  6.363   1.00 0.00 ? 89  ILE B CD1  1  
ATOM 10339  H H    . ILE B 1 89  ? 50.875  44.318  2.463   1.00 0.00 ? 89  ILE B H    1  
ATOM 10340  H HA   . ILE B 1 89  ? 48.277  44.213  3.708   1.00 0.00 ? 89  ILE B HA   1  
ATOM 10341  H HB   . ILE B 1 89  ? 50.350  42.539  3.788   1.00 0.00 ? 89  ILE B HB   1  
ATOM 10342  H HG12 . ILE B 1 89  ? 48.117  42.032  4.624   1.00 0.00 ? 89  ILE B HG12 1  
ATOM 10343  H HG13 . ILE B 1 89  ? 49.302  41.547  5.833   1.00 0.00 ? 89  ILE B HG13 1  
ATOM 10344  H HG21 . ILE B 1 89  ? 51.763  44.216  5.033   1.00 0.00 ? 89  ILE B HG21 1  
ATOM 10345  H HG22 . ILE B 1 89  ? 51.584  42.679  5.878   1.00 0.00 ? 89  ILE B HG22 1  
ATOM 10346  H HG23 . ILE B 1 89  ? 50.642  44.080  6.389   1.00 0.00 ? 89  ILE B HG23 1  
ATOM 10347  H HD11 . ILE B 1 89  ? 48.904  43.921  6.838   1.00 0.00 ? 89  ILE B HD11 1  
ATOM 10348  H HD12 . ILE B 1 89  ? 47.683  42.676  7.110   1.00 0.00 ? 89  ILE B HD12 1  
ATOM 10349  H HD13 . ILE B 1 89  ? 47.428  43.906  5.871   1.00 0.00 ? 89  ILE B HD13 1  
ATOM 10350  N N    . ILE B 1 90  ? 50.545  46.150  5.090   1.00 0.00 ? 90  ILE B N    1  
ATOM 10351  C CA   . ILE B 1 90  ? 50.724  47.294  6.023   1.00 0.00 ? 90  ILE B CA   1  
ATOM 10352  C C    . ILE B 1 90  ? 49.992  48.540  5.509   1.00 0.00 ? 90  ILE B C    1  
ATOM 10353  O O    . ILE B 1 90  ? 49.423  49.291  6.274   1.00 0.00 ? 90  ILE B O    1  
ATOM 10354  C CB   . ILE B 1 90  ? 52.230  47.573  6.162   1.00 0.00 ? 90  ILE B CB   1  
ATOM 10355  C CG1  . ILE B 1 90  ? 52.802  47.893  4.768   1.00 0.00 ? 90  ILE B CG1  1  
ATOM 10356  C CG2  . ILE B 1 90  ? 52.942  46.353  6.759   1.00 0.00 ? 90  ILE B CG2  1  
ATOM 10357  C CD1  . ILE B 1 90  ? 52.781  49.402  4.495   1.00 0.00 ? 90  ILE B CD1  1  
ATOM 10358  H H    . ILE B 1 90  ? 51.315  45.811  4.588   1.00 0.00 ? 90  ILE B H    1  
ATOM 10359  H HA   . ILE B 1 90  ? 50.326  47.026  6.991   1.00 0.00 ? 90  ILE B HA   1  
ATOM 10360  H HB   . ILE B 1 90  ? 52.376  48.423  6.812   1.00 0.00 ? 90  ILE B HB   1  
ATOM 10361  H HG12 . ILE B 1 90  ? 53.821  47.538  4.714   1.00 0.00 ? 90  ILE B HG12 1  
ATOM 10362  H HG13 . ILE B 1 90  ? 52.211  47.388  4.019   1.00 0.00 ? 90  ILE B HG13 1  
ATOM 10363  H HG21 . ILE B 1 90  ? 52.250  45.526  6.819   1.00 0.00 ? 90  ILE B HG21 1  
ATOM 10364  H HG22 . ILE B 1 90  ? 53.301  46.594  7.749   1.00 0.00 ? 90  ILE B HG22 1  
ATOM 10365  H HG23 . ILE B 1 90  ? 53.777  46.080  6.129   1.00 0.00 ? 90  ILE B HG23 1  
ATOM 10366  H HD11 . ILE B 1 90  ? 52.461  49.580  3.479   1.00 0.00 ? 90  ILE B HD11 1  
ATOM 10367  H HD12 . ILE B 1 90  ? 53.772  49.809  4.636   1.00 0.00 ? 90  ILE B HD12 1  
ATOM 10368  H HD13 . ILE B 1 90  ? 52.095  49.881  5.178   1.00 0.00 ? 90  ILE B HD13 1  
ATOM 10369  N N    . ALA B 1 91  ? 50.025  48.777  4.229   1.00 0.00 ? 91  ALA B N    1  
ATOM 10370  C CA   . ALA B 1 91  ? 49.351  49.991  3.683   1.00 0.00 ? 91  ALA B CA   1  
ATOM 10371  C C    . ALA B 1 91  ? 47.843  49.973  3.993   1.00 0.00 ? 91  ALA B C    1  
ATOM 10372  O O    . ALA B 1 91  ? 47.295  50.960  4.441   1.00 0.00 ? 91  ALA B O    1  
ATOM 10373  C CB   . ALA B 1 91  ? 49.562  50.049  2.172   1.00 0.00 ? 91  ALA B CB   1  
ATOM 10374  H H    . ALA B 1 91  ? 50.506  48.169  3.629   1.00 0.00 ? 91  ALA B H    1  
ATOM 10375  H HA   . ALA B 1 91  ? 49.792  50.868  4.133   1.00 0.00 ? 91  ALA B HA   1  
ATOM 10376  H HB1  . ALA B 1 91  ? 50.601  50.251  1.961   1.00 0.00 ? 91  ALA B HB1  1  
ATOM 10377  H HB2  . ALA B 1 91  ? 48.949  50.835  1.754   1.00 0.00 ? 91  ALA B HB2  1  
ATOM 10378  H HB3  . ALA B 1 91  ? 49.283  49.103  1.732   1.00 0.00 ? 91  ALA B HB3  1  
ATOM 10379  N N    . LEU B 1 92  ? 47.174  48.884  3.748   1.00 0.00 ? 92  LEU B N    1  
ATOM 10380  C CA   . LEU B 1 92  ? 45.705  48.838  4.024   1.00 0.00 ? 92  LEU B CA   1  
ATOM 10381  C C    . LEU B 1 92  ? 45.446  49.083  5.514   1.00 0.00 ? 92  LEU B C    1  
ATOM 10382  O O    . LEU B 1 92  ? 44.591  49.864  5.887   1.00 0.00 ? 92  LEU B O    1  
ATOM 10383  C CB   . LEU B 1 92  ? 45.164  47.456  3.626   1.00 0.00 ? 92  LEU B CB   1  
ATOM 10384  C CG   . LEU B 1 92  ? 45.380  47.212  2.118   1.00 0.00 ? 92  LEU B CG   1  
ATOM 10385  C CD1  . LEU B 1 92  ? 44.881  45.811  1.755   1.00 0.00 ? 92  LEU B CD1  1  
ATOM 10386  C CD2  . LEU B 1 92  ? 44.596  48.250  1.287   1.00 0.00 ? 92  LEU B CD2  1  
ATOM 10387  H H    . LEU B 1 92  ? 47.629  48.100  3.375   1.00 0.00 ? 92  LEU B H    1  
ATOM 10388  H HA   . LEU B 1 92  ? 45.206  49.600  3.442   1.00 0.00 ? 92  LEU B HA   1  
ATOM 10389  H HB2  . LEU B 1 92  ? 45.683  46.693  4.189   1.00 0.00 ? 92  LEU B HB2  1  
ATOM 10390  H HB3  . LEU B 1 92  ? 44.109  47.407  3.847   1.00 0.00 ? 92  LEU B HB3  1  
ATOM 10391  H HG   . LEU B 1 92  ? 46.434  47.287  1.890   1.00 0.00 ? 92  LEU B HG   1  
ATOM 10392  H HD11 . LEU B 1 92  ? 45.339  45.085  2.410   1.00 0.00 ? 92  LEU B HD11 1  
ATOM 10393  H HD12 . LEU B 1 92  ? 45.144  45.589  0.731   1.00 0.00 ? 92  LEU B HD12 1  
ATOM 10394  H HD13 . LEU B 1 92  ? 43.808  45.771  1.867   1.00 0.00 ? 92  LEU B HD13 1  
ATOM 10395  H HD21 . LEU B 1 92  ? 43.775  48.636  1.874   1.00 0.00 ? 92  LEU B HD21 1  
ATOM 10396  H HD22 . LEU B 1 92  ? 44.211  47.780  0.394   1.00 0.00 ? 92  LEU B HD22 1  
ATOM 10397  H HD23 . LEU B 1 92  ? 45.254  49.062  1.011   1.00 0.00 ? 92  LEU B HD23 1  
ATOM 10398  N N    . ILE B 1 93  ? 46.188  48.433  6.373   1.00 0.00 ? 93  ILE B N    1  
ATOM 10399  C CA   . ILE B 1 93  ? 45.989  48.650  7.834   1.00 0.00 ? 93  ILE B CA   1  
ATOM 10400  C C    . ILE B 1 93  ? 46.268  50.120  8.146   1.00 0.00 ? 93  ILE B C    1  
ATOM 10401  O O    . ILE B 1 93  ? 45.500  50.789  8.801   1.00 0.00 ? 93  ILE B O    1  
ATOM 10402  C CB   . ILE B 1 93  ? 46.971  47.776  8.625   1.00 0.00 ? 93  ILE B CB   1  
ATOM 10403  C CG1  . ILE B 1 93  ? 46.597  46.290  8.442   1.00 0.00 ? 93  ILE B CG1  1  
ATOM 10404  C CG2  . ILE B 1 93  ? 46.891  48.161  10.115  1.00 0.00 ? 93  ILE B CG2  1  
ATOM 10405  C CD1  . ILE B 1 93  ? 47.689  45.392  9.046   1.00 0.00 ? 93  ILE B CD1  1  
ATOM 10406  H H    . ILE B 1 93  ? 46.880  47.815  6.057   1.00 0.00 ? 93  ILE B H    1  
ATOM 10407  H HA   . ILE B 1 93  ? 44.973  48.402  8.108   1.00 0.00 ? 93  ILE B HA   1  
ATOM 10408  H HB   . ILE B 1 93  ? 47.976  47.946  8.263   1.00 0.00 ? 93  ILE B HB   1  
ATOM 10409  H HG12 . ILE B 1 93  ? 45.657  46.094  8.938   1.00 0.00 ? 93  ILE B HG12 1  
ATOM 10410  H HG13 . ILE B 1 93  ? 46.499  46.072  7.389   1.00 0.00 ? 93  ILE B HG13 1  
ATOM 10411  H HG21 . ILE B 1 93  ? 47.369  49.118  10.266  1.00 0.00 ? 93  ILE B HG21 1  
ATOM 10412  H HG22 . ILE B 1 93  ? 47.394  47.411  10.709  1.00 0.00 ? 93  ILE B HG22 1  
ATOM 10413  H HG23 . ILE B 1 93  ? 45.855  48.224  10.416  1.00 0.00 ? 93  ILE B HG23 1  
ATOM 10414  H HD11 . ILE B 1 93  ? 48.661  45.781  8.783   1.00 0.00 ? 93  ILE B HD11 1  
ATOM 10415  H HD12 . ILE B 1 93  ? 47.586  44.389  8.659   1.00 0.00 ? 93  ILE B HD12 1  
ATOM 10416  H HD13 . ILE B 1 93  ? 47.588  45.375  10.122  1.00 0.00 ? 93  ILE B HD13 1  
ATOM 10417  N N    . LYS B 1 94  ? 47.372  50.620  7.673   1.00 0.00 ? 94  LYS B N    1  
ATOM 10418  C CA   . LYS B 1 94  ? 47.716  52.050  7.938   1.00 0.00 ? 94  LYS B CA   1  
ATOM 10419  C C    . LYS B 1 94  ? 46.770  52.981  7.170   1.00 0.00 ? 94  LYS B C    1  
ATOM 10420  O O    . LYS B 1 94  ? 46.341  53.996  7.683   1.00 0.00 ? 94  LYS B O    1  
ATOM 10421  C CB   . LYS B 1 94  ? 49.161  52.358  7.502   1.00 0.00 ? 94  LYS B CB   1  
ATOM 10422  C CG   . LYS B 1 94  ? 50.166  51.639  8.420   1.00 0.00 ? 94  LYS B CG   1  
ATOM 10423  C CD   . LYS B 1 94  ? 51.630  51.950  7.980   1.00 0.00 ? 94  LYS B CD   1  
ATOM 10424  C CE   . LYS B 1 94  ? 52.626  51.235  8.905   1.00 0.00 ? 94  LYS B CE   1  
ATOM 10425  N NZ   . LYS B 1 94  ? 54.022  51.531  8.472   1.00 0.00 ? 94  LYS B NZ   1  
ATOM 10426  H H    . LYS B 1 94  ? 47.978  50.059  7.146   1.00 0.00 ? 94  LYS B H    1  
ATOM 10427  H HA   . LYS B 1 94  ? 47.619  52.244  8.996   1.00 0.00 ? 94  LYS B HA   1  
ATOM 10428  H HB2  . LYS B 1 94  ? 49.306  52.025  6.485   1.00 0.00 ? 94  LYS B HB2  1  
ATOM 10429  H HB3  . LYS B 1 94  ? 49.330  53.424  7.555   1.00 0.00 ? 94  LYS B HB3  1  
ATOM 10430  H HG2  . LYS B 1 94  ? 50.020  51.973  9.438   1.00 0.00 ? 94  LYS B HG2  1  
ATOM 10431  H HG3  . LYS B 1 94  ? 49.998  50.574  8.367   1.00 0.00 ? 94  LYS B HG3  1  
ATOM 10432  H HD2  . LYS B 1 94  ? 51.777  51.611  6.965   1.00 0.00 ? 94  LYS B HD2  1  
ATOM 10433  H HD3  . LYS B 1 94  ? 51.799  53.016  8.029   1.00 0.00 ? 94  LYS B HD3  1  
ATOM 10434  H HE2  . LYS B 1 94  ? 52.484  51.578  9.919   1.00 0.00 ? 94  LYS B HE2  1  
ATOM 10435  H HE3  . LYS B 1 94  ? 52.454  50.169  8.860   1.00 0.00 ? 94  LYS B HE3  1  
ATOM 10436  H HZ1  . LYS B 1 94  ? 54.056  52.469  8.027   1.00 0.00 ? 94  LYS B HZ1  1  
ATOM 10437  H HZ2  . LYS B 1 94  ? 54.333  50.810  7.789   1.00 0.00 ? 94  LYS B HZ2  1  
ATOM 10438  H HZ3  . LYS B 1 94  ? 54.652  51.520  9.299   1.00 0.00 ? 94  LYS B HZ3  1  
ATOM 10439  N N    . ASP B 1 95  ? 46.458  52.671  5.941   1.00 0.00 ? 95  ASP B N    1  
ATOM 10440  C CA   . ASP B 1 95  ? 45.569  53.577  5.151   1.00 0.00 ? 95  ASP B CA   1  
ATOM 10441  C C    . ASP B 1 95  ? 44.084  53.345  5.461   1.00 0.00 ? 95  ASP B C    1  
ATOM 10442  O O    . ASP B 1 95  ? 43.345  54.278  5.704   1.00 0.00 ? 95  ASP B O    1  
ATOM 10443  C CB   . ASP B 1 95  ? 45.807  53.348  3.659   1.00 0.00 ? 95  ASP B CB   1  
ATOM 10444  C CG   . ASP B 1 95  ? 44.982  54.359  2.862   1.00 0.00 ? 95  ASP B CG   1  
ATOM 10445  O OD1  . ASP B 1 95  ? 44.179  55.048  3.470   1.00 0.00 ? 95  ASP B OD1  1  
ATOM 10446  O OD2  . ASP B 1 95  ? 45.170  54.430  1.658   1.00 0.00 ? 95  ASP B OD2  1  
ATOM 10447  H H    . ASP B 1 95  ? 46.826  51.861  5.530   1.00 0.00 ? 95  ASP B H    1  
ATOM 10448  H HA   . ASP B 1 95  ? 45.818  54.600  5.387   1.00 0.00 ? 95  ASP B HA   1  
ATOM 10449  H HB2  . ASP B 1 95  ? 46.856  53.479  3.437   1.00 0.00 ? 95  ASP B HB2  1  
ATOM 10450  H HB3  . ASP B 1 95  ? 45.503  52.346  3.394   1.00 0.00 ? 95  ASP B HB3  1  
ATOM 10451  N N    . LYS B 1 96  ? 43.630  52.122  5.407   1.00 0.00 ? 96  LYS B N    1  
ATOM 10452  C CA   . LYS B 1 96  ? 42.172  51.863  5.655   1.00 0.00 ? 96  LYS B CA   1  
ATOM 10453  C C    . LYS B 1 96  ? 41.874  51.568  7.133   1.00 0.00 ? 96  LYS B C    1  
ATOM 10454  O O    . LYS B 1 96  ? 40.732  51.375  7.501   1.00 0.00 ? 96  LYS B O    1  
ATOM 10455  C CB   . LYS B 1 96  ? 41.693  50.699  4.773   1.00 0.00 ? 96  LYS B CB   1  
ATOM 10456  C CG   . LYS B 1 96  ? 41.837  51.074  3.266   1.00 0.00 ? 96  LYS B CG   1  
ATOM 10457  C CD   . LYS B 1 96  ? 41.158  50.016  2.370   1.00 0.00 ? 96  LYS B CD   1  
ATOM 10458  C CE   . LYS B 1 96  ? 41.316  50.397  0.893   1.00 0.00 ? 96  LYS B CE   1  
ATOM 10459  N NZ   . LYS B 1 96  ? 42.757  50.350  0.527   1.00 0.00 ? 96  LYS B NZ   1  
ATOM 10460  H H    . LYS B 1 96  ? 44.230  51.382  5.175   1.00 0.00 ? 96  LYS B H    1  
ATOM 10461  H HA   . LYS B 1 96  ? 41.622  52.749  5.372   1.00 0.00 ? 96  LYS B HA   1  
ATOM 10462  H HB2  . LYS B 1 96  ? 42.288  49.822  4.984   1.00 0.00 ? 96  LYS B HB2  1  
ATOM 10463  H HB3  . LYS B 1 96  ? 40.656  50.489  4.990   1.00 0.00 ? 96  LYS B HB3  1  
ATOM 10464  H HG2  . LYS B 1 96  ? 41.375  52.035  3.092   1.00 0.00 ? 96  LYS B HG2  1  
ATOM 10465  H HG3  . LYS B 1 96  ? 42.885  51.134  3.013   1.00 0.00 ? 96  LYS B HG3  1  
ATOM 10466  H HD2  . LYS B 1 96  ? 41.617  49.053  2.542   1.00 0.00 ? 96  LYS B HD2  1  
ATOM 10467  H HD3  . LYS B 1 96  ? 40.108  49.961  2.614   1.00 0.00 ? 96  LYS B HD3  1  
ATOM 10468  H HE2  . LYS B 1 96  ? 40.765  49.700  0.280   1.00 0.00 ? 96  LYS B HE2  1  
ATOM 10469  H HE3  . LYS B 1 96  ? 40.936  51.396  0.736   1.00 0.00 ? 96  LYS B HE3  1  
ATOM 10470  H HZ1  . LYS B 1 96  ? 42.999  51.187  -0.039  1.00 0.00 ? 96  LYS B HZ1  1  
ATOM 10471  H HZ2  . LYS B 1 96  ? 42.945  49.490  -0.028  1.00 0.00 ? 96  LYS B HZ2  1  
ATOM 10472  H HZ3  . LYS B 1 96  ? 43.335  50.340  1.390   1.00 0.00 ? 96  LYS B HZ3  1  
ATOM 10473  N N    . HIS B 1 97  ? 42.873  51.530  7.978   1.00 0.00 ? 97  HIS B N    1  
ATOM 10474  C CA   . HIS B 1 97  ? 42.623  51.254  9.430   1.00 0.00 ? 97  HIS B CA   1  
ATOM 10475  C C    . HIS B 1 97  ? 41.853  49.936  9.582   1.00 0.00 ? 97  HIS B C    1  
ATOM 10476  O O    . HIS B 1 97  ? 40.956  49.800  10.393  1.00 0.00 ? 97  HIS B O    1  
ATOM 10477  C CB   . HIS B 1 97  ? 41.846  52.425  10.039  1.00 0.00 ? 97  HIS B CB   1  
ATOM 10478  C CG   . HIS B 1 97  ? 42.673  53.679  9.942   1.00 0.00 ? 97  HIS B CG   1  
ATOM 10479  N ND1  . HIS B 1 97  ? 42.151  54.931  10.213  1.00 0.00 ? 97  HIS B ND1  1  
ATOM 10480  C CD2  . HIS B 1 97  ? 43.986  53.884  9.597   1.00 0.00 ? 97  HIS B CD2  1  
ATOM 10481  C CE1  . HIS B 1 97  ? 43.135  55.831  10.030  1.00 0.00 ? 97  HIS B CE1  1  
ATOM 10482  N NE2  . HIS B 1 97  ? 44.277  55.244  9.655   1.00 0.00 ? 97  HIS B NE2  1  
ATOM 10483  H H    . HIS B 1 97  ? 43.786  51.688  7.661   1.00 0.00 ? 97  HIS B H    1  
ATOM 10484  H HA   . HIS B 1 97  ? 43.574  51.161  9.936   1.00 0.00 ? 97  HIS B HA   1  
ATOM 10485  H HB2  . HIS B 1 97  ? 40.919  52.561  9.501   1.00 0.00 ? 97  HIS B HB2  1  
ATOM 10486  H HB3  . HIS B 1 97  ? 41.632  52.215  11.077  1.00 0.00 ? 97  HIS B HB3  1  
ATOM 10487  H HD1  . HIS B 1 97  ? 41.230  55.127  10.488  1.00 0.00 ? 97  HIS B HD1  1  
ATOM 10488  H HD2  . HIS B 1 97  ? 44.686  53.109  9.323   1.00 0.00 ? 97  HIS B HD2  1  
ATOM 10489  H HE1  . HIS B 1 97  ? 43.017  56.896  10.170  1.00 0.00 ? 97  HIS B HE1  1  
ATOM 10490  H HE2  . HIS B 1 97  ? 45.134  55.679  9.463   1.00 0.00 ? 97  HIS B HE2  1  
ATOM 10491  N N    . MET B 1 98  ? 42.202  48.974  8.773   1.00 0.00 ? 98  MET B N    1  
ATOM 10492  C CA   . MET B 1 98  ? 41.518  47.643  8.814   1.00 0.00 ? 98  MET B CA   1  
ATOM 10493  C C    . MET B 1 98  ? 42.294  46.693  9.734   1.00 0.00 ? 98  MET B C    1  
ATOM 10494  O O    . MET B 1 98  ? 43.392  46.992  10.156  1.00 0.00 ? 98  MET B O    1  
ATOM 10495  C CB   . MET B 1 98  ? 41.468  47.067  7.396   1.00 0.00 ? 98  MET B CB   1  
ATOM 10496  C CG   . MET B 1 98  ? 40.482  47.887  6.559   1.00 0.00 ? 98  MET B CG   1  
ATOM 10497  S SD   . MET B 1 98  ? 40.592  47.390  4.815   1.00 0.00 ? 98  MET B SD   1  
ATOM 10498  C CE   . MET B 1 98  ? 39.863  45.735  4.972   1.00 0.00 ? 98  MET B CE   1  
ATOM 10499  H H    . MET B 1 98  ? 42.918  49.128  8.123   1.00 0.00 ? 98  MET B H    1  
ATOM 10500  H HA   . MET B 1 98  ? 40.512  47.766  9.188   1.00 0.00 ? 98  MET B HA   1  
ATOM 10501  H HB2  . MET B 1 98  ? 42.453  47.117  6.951   1.00 0.00 ? 98  MET B HB2  1  
ATOM 10502  H HB3  . MET B 1 98  ? 41.140  46.040  7.434   1.00 0.00 ? 98  MET B HB3  1  
ATOM 10503  H HG2  . MET B 1 98  ? 39.478  47.717  6.918   1.00 0.00 ? 98  MET B HG2  1  
ATOM 10504  H HG3  . MET B 1 98  ? 40.721  48.937  6.648   1.00 0.00 ? 98  MET B HG3  1  
ATOM 10505  H HE1  . MET B 1 98  ? 40.614  45.044  5.329   1.00 0.00 ? 98  MET B HE1  1  
ATOM 10506  H HE2  . MET B 1 98  ? 39.503  45.406  4.010   1.00 0.00 ? 98  MET B HE2  1  
ATOM 10507  H HE3  . MET B 1 98  ? 39.038  45.771  5.670   1.00 0.00 ? 98  MET B HE3  1  
ATOM 10508  N N    . THR B 1 99  ? 41.734  45.553  10.048  1.00 0.00 ? 99  THR B N    1  
ATOM 10509  C CA   . THR B 1 99  ? 42.443  44.590  10.944  1.00 0.00 ? 99  THR B CA   1  
ATOM 10510  C C    . THR B 1 99  ? 43.471  43.785  10.134  1.00 0.00 ? 99  THR B C    1  
ATOM 10511  O O    . THR B 1 99  ? 43.388  43.695  8.926   1.00 0.00 ? 99  THR B O    1  
ATOM 10512  C CB   . THR B 1 99  ? 41.420  43.635  11.573  1.00 0.00 ? 99  THR B CB   1  
ATOM 10513  O OG1  . THR B 1 99  ? 40.748  42.916  10.554  1.00 0.00 ? 99  THR B OG1  1  
ATOM 10514  C CG2  . THR B 1 99  ? 40.397  44.436  12.392  1.00 0.00 ? 99  THR B CG2  1  
ATOM 10515  H H    . THR B 1 99  ? 40.846  45.332  9.697   1.00 0.00 ? 99  THR B H    1  
ATOM 10516  H HA   . THR B 1 99  ? 42.951  45.136  11.726  1.00 0.00 ? 99  THR B HA   1  
ATOM 10517  H HB   . THR B 1 99  ? 41.929  42.942  12.224  1.00 0.00 ? 99  THR B HB   1  
ATOM 10518  H HG1  . THR B 1 99  ? 39.849  43.248  10.499  1.00 0.00 ? 99  THR B HG1  1  
ATOM 10519  H HG21 . THR B 1 99  ? 40.841  45.370  12.708  1.00 0.00 ? 99  THR B HG21 1  
ATOM 10520  H HG22 . THR B 1 99  ? 40.105  43.865  13.261  1.00 0.00 ? 99  THR B HG22 1  
ATOM 10521  H HG23 . THR B 1 99  ? 39.528  44.638  11.785  1.00 0.00 ? 99  THR B HG23 1  
ATOM 10522  N N    . ALA B 1 100 ? 44.443  43.204  10.793  1.00 0.00 ? 100 ALA B N    1  
ATOM 10523  C CA   . ALA B 1 100 ? 45.478  42.417  10.064  1.00 0.00 ? 100 ALA B CA   1  
ATOM 10524  C C    . ALA B 1 100 ? 44.869  41.150  9.465   1.00 0.00 ? 100 ALA B C    1  
ATOM 10525  O O    . ALA B 1 100 ? 45.188  40.768  8.355   1.00 0.00 ? 100 ALA B O    1  
ATOM 10526  C CB   . ALA B 1 100 ? 46.585  42.017  11.037  1.00 0.00 ? 100 ALA B CB   1  
ATOM 10527  H H    . ALA B 1 100 ? 44.493  43.293  11.767  1.00 0.00 ? 100 ALA B H    1  
ATOM 10528  H HA   . ALA B 1 100 ? 45.899  43.021  9.275   1.00 0.00 ? 100 ALA B HA   1  
ATOM 10529  H HB1  . ALA B 1 100 ? 47.247  42.856  11.192  1.00 0.00 ? 100 ALA B HB1  1  
ATOM 10530  H HB2  . ALA B 1 100 ? 47.144  41.190  10.626  1.00 0.00 ? 100 ALA B HB2  1  
ATOM 10531  H HB3  . ALA B 1 100 ? 46.148  41.724  11.979  1.00 0.00 ? 100 ALA B HB3  1  
ATOM 10532  N N    . ASP B 1 101 ? 43.999  40.487  10.175  1.00 0.00 ? 101 ASP B N    1  
ATOM 10533  C CA   . ASP B 1 101 ? 43.393  39.249  9.612   1.00 0.00 ? 101 ASP B CA   1  
ATOM 10534  C C    . ASP B 1 101 ? 42.434  39.618  8.474   1.00 0.00 ? 101 ASP B C    1  
ATOM 10535  O O    . ASP B 1 101 ? 42.317  38.902  7.499   1.00 0.00 ? 101 ASP B O    1  
ATOM 10536  C CB   . ASP B 1 101 ? 42.653  38.475  10.709  1.00 0.00 ? 101 ASP B CB   1  
ATOM 10537  C CG   . ASP B 1 101 ? 42.097  39.437  11.756  1.00 0.00 ? 101 ASP B CG   1  
ATOM 10538  O OD1  . ASP B 1 101 ? 41.621  40.491  11.363  1.00 0.00 ? 101 ASP B OD1  1  
ATOM 10539  O OD2  . ASP B 1 101 ? 42.150  39.107  12.929  1.00 0.00 ? 101 ASP B OD2  1  
ATOM 10540  H H    . ASP B 1 101 ? 43.748  40.799  11.070  1.00 0.00 ? 101 ASP B H    1  
ATOM 10541  H HA   . ASP B 1 101 ? 44.182  38.627  9.214   1.00 0.00 ? 101 ASP B HA   1  
ATOM 10542  H HB2  . ASP B 1 101 ? 41.839  37.920  10.266  1.00 0.00 ? 101 ASP B HB2  1  
ATOM 10543  H HB3  . ASP B 1 101 ? 43.336  37.787  11.184  1.00 0.00 ? 101 ASP B HB3  1  
ATOM 10544  N N    . ALA B 1 102 ? 41.761  40.736  8.571   1.00 0.00 ? 102 ALA B N    1  
ATOM 10545  C CA   . ALA B 1 102 ? 40.835  41.135  7.471   1.00 0.00 ? 102 ALA B CA   1  
ATOM 10546  C C    . ALA B 1 102 ? 41.636  41.771  6.331   1.00 0.00 ? 102 ALA B C    1  
ATOM 10547  O O    . ALA B 1 102 ? 41.373  41.541  5.170   1.00 0.00 ? 102 ALA B O    1  
ATOM 10548  C CB   . ALA B 1 102 ? 39.805  42.144  7.986   1.00 0.00 ? 102 ALA B CB   1  
ATOM 10549  H H    . ALA B 1 102 ? 41.874  41.314  9.354   1.00 0.00 ? 102 ALA B H    1  
ATOM 10550  H HA   . ALA B 1 102 ? 40.323  40.259  7.101   1.00 0.00 ? 102 ALA B HA   1  
ATOM 10551  H HB1  . ALA B 1 102 ? 38.960  42.172  7.313   1.00 0.00 ? 102 ALA B HB1  1  
ATOM 10552  H HB2  . ALA B 1 102 ? 40.256  43.123  8.040   1.00 0.00 ? 102 ALA B HB2  1  
ATOM 10553  H HB3  . ALA B 1 102 ? 39.470  41.846  8.970   1.00 0.00 ? 102 ALA B HB3  1  
ATOM 10554  N N    . ALA B 1 103 ? 42.609  42.578  6.660   1.00 0.00 ? 103 ALA B N    1  
ATOM 10555  C CA   . ALA B 1 103 ? 43.423  43.236  5.597   1.00 0.00 ? 103 ALA B CA   1  
ATOM 10556  C C    . ALA B 1 103 ? 44.307  42.199  4.897   1.00 0.00 ? 103 ALA B C    1  
ATOM 10557  O O    . ALA B 1 103 ? 44.397  42.164  3.685   1.00 0.00 ? 103 ALA B O    1  
ATOM 10558  C CB   . ALA B 1 103 ? 44.303  44.322  6.225   1.00 0.00 ? 103 ALA B CB   1  
ATOM 10559  H H    . ALA B 1 103 ? 42.801  42.754  7.605   1.00 0.00 ? 103 ALA B H    1  
ATOM 10560  H HA   . ALA B 1 103 ? 42.763  43.688  4.872   1.00 0.00 ? 103 ALA B HA   1  
ATOM 10561  H HB1  . ALA B 1 103 ? 44.835  43.910  7.071   1.00 0.00 ? 103 ALA B HB1  1  
ATOM 10562  H HB2  . ALA B 1 103 ? 43.682  45.141  6.556   1.00 0.00 ? 103 ALA B HB2  1  
ATOM 10563  H HB3  . ALA B 1 103 ? 45.012  44.679  5.493   1.00 0.00 ? 103 ALA B HB3  1  
ATOM 10564  N N    . ALA B 1 104 ? 44.968  41.358  5.648   1.00 0.00 ? 104 ALA B N    1  
ATOM 10565  C CA   . ALA B 1 104 ? 45.849  40.328  5.022   1.00 0.00 ? 104 ALA B CA   1  
ATOM 10566  C C    . ALA B 1 104 ? 45.012  39.402  4.131   1.00 0.00 ? 104 ALA B C    1  
ATOM 10567  O O    . ALA B 1 104 ? 45.446  38.981  3.076   1.00 0.00 ? 104 ALA B O    1  
ATOM 10568  C CB   . ALA B 1 104 ? 46.538  39.512  6.122   1.00 0.00 ? 104 ALA B CB   1  
ATOM 10569  H H    . ALA B 1 104 ? 44.888  41.406  6.624   1.00 0.00 ? 104 ALA B H    1  
ATOM 10570  H HA   . ALA B 1 104 ? 46.599  40.820  4.420   1.00 0.00 ? 104 ALA B HA   1  
ATOM 10571  H HB1  . ALA B 1 104 ? 47.175  40.160  6.706   1.00 0.00 ? 104 ALA B HB1  1  
ATOM 10572  H HB2  . ALA B 1 104 ? 47.134  38.732  5.672   1.00 0.00 ? 104 ALA B HB2  1  
ATOM 10573  H HB3  . ALA B 1 104 ? 45.790  39.069  6.764   1.00 0.00 ? 104 ALA B HB3  1  
ATOM 10574  N N    . HIS B 1 105 ? 43.830  39.064  4.563   1.00 0.00 ? 105 HIS B N    1  
ATOM 10575  C CA   . HIS B 1 105 ? 42.977  38.145  3.755   1.00 0.00 ? 105 HIS B CA   1  
ATOM 10576  C C    . HIS B 1 105 ? 42.704  38.763  2.384   1.00 0.00 ? 105 HIS B C    1  
ATOM 10577  O O    . HIS B 1 105 ? 42.697  38.083  1.375   1.00 0.00 ? 105 HIS B O    1  
ATOM 10578  C CB   . HIS B 1 105 ? 41.639  37.937  4.467   1.00 0.00 ? 105 HIS B CB   1  
ATOM 10579  C CG   . HIS B 1 105 ? 40.920  36.777  3.836   1.00 0.00 ? 105 HIS B CG   1  
ATOM 10580  N ND1  . HIS B 1 105 ? 40.199  36.908  2.656   1.00 0.00 ? 105 HIS B ND1  1  
ATOM 10581  C CD2  . HIS B 1 105 ? 40.797  35.460  4.208   1.00 0.00 ? 105 HIS B CD2  1  
ATOM 10582  C CE1  . HIS B 1 105 ? 39.684  35.703  2.361   1.00 0.00 ? 105 HIS B CE1  1  
ATOM 10583  N NE2  . HIS B 1 105 ? 40.019  34.788  3.273   1.00 0.00 ? 105 HIS B NE2  1  
ATOM 10584  H H    . HIS B 1 105 ? 43.509  39.399  5.427   1.00 0.00 ? 105 HIS B H    1  
ATOM 10585  H HA   . HIS B 1 105 ? 43.476  37.195  3.635   1.00 0.00 ? 105 HIS B HA   1  
ATOM 10586  H HB2  . HIS B 1 105 ? 41.814  37.729  5.512   1.00 0.00 ? 105 HIS B HB2  1  
ATOM 10587  H HB3  . HIS B 1 105 ? 41.036  38.829  4.372   1.00 0.00 ? 105 HIS B HB3  1  
ATOM 10588  H HD1  . HIS B 1 105 ? 40.087  37.730  2.134   1.00 0.00 ? 105 HIS B HD1  1  
ATOM 10589  H HD2  . HIS B 1 105 ? 41.237  35.017  5.089   1.00 0.00 ? 105 HIS B HD2  1  
ATOM 10590  H HE1  . HIS B 1 105 ? 39.075  35.499  1.493   1.00 0.00 ? 105 HIS B HE1  1  
ATOM 10591  H HE2  . HIS B 1 105 ? 39.769  33.840  3.282   1.00 0.00 ? 105 HIS B HE2  1  
ATOM 10592  N N    . GLU B 1 106 ? 42.469  40.040  2.340   1.00 0.00 ? 106 GLU B N    1  
ATOM 10593  C CA   . GLU B 1 106 ? 42.174  40.704  1.039   1.00 0.00 ? 106 GLU B CA   1  
ATOM 10594  C C    . GLU B 1 106 ? 43.391  40.612  0.110   1.00 0.00 ? 106 GLU B C    1  
ATOM 10595  O O    . GLU B 1 106 ? 43.255  40.424  -1.085  1.00 0.00 ? 106 GLU B O    1  
ATOM 10596  C CB   . GLU B 1 106 ? 41.829  42.171  1.307   1.00 0.00 ? 106 GLU B CB   1  
ATOM 10597  C CG   . GLU B 1 106 ? 41.465  42.875  -0.001  1.00 0.00 ? 106 GLU B CG   1  
ATOM 10598  C CD   . GLU B 1 106 ? 41.072  44.324  0.294   1.00 0.00 ? 106 GLU B CD   1  
ATOM 10599  O OE1  . GLU B 1 106 ? 41.098  44.703  1.455   1.00 0.00 ? 106 GLU B OE1  1  
ATOM 10600  O OE2  . GLU B 1 106 ? 40.746  45.034  -0.644  1.00 0.00 ? 106 GLU B OE2  1  
ATOM 10601  H H    . GLU B 1 106 ? 42.471  40.565  3.167   1.00 0.00 ? 106 GLU B H    1  
ATOM 10602  H HA   . GLU B 1 106 ? 41.330  40.218  0.572   1.00 0.00 ? 106 GLU B HA   1  
ATOM 10603  H HB2  . GLU B 1 106 ? 40.992  42.222  1.987   1.00 0.00 ? 106 GLU B HB2  1  
ATOM 10604  H HB3  . GLU B 1 106 ? 42.682  42.662  1.751   1.00 0.00 ? 106 GLU B HB3  1  
ATOM 10605  H HG2  . GLU B 1 106 ? 42.316  42.859  -0.667  1.00 0.00 ? 106 GLU B HG2  1  
ATOM 10606  H HG3  . GLU B 1 106 ? 40.635  42.365  -0.465  1.00 0.00 ? 106 GLU B HG3  1  
ATOM 10607  N N    . VAL B 1 107 ? 44.567  40.782  0.639   1.00 0.00 ? 107 VAL B N    1  
ATOM 10608  C CA   . VAL B 1 107 ? 45.784  40.740  -0.222  1.00 0.00 ? 107 VAL B CA   1  
ATOM 10609  C C    . VAL B 1 107 ? 45.968  39.358  -0.856  1.00 0.00 ? 107 VAL B C    1  
ATOM 10610  O O    . VAL B 1 107 ? 46.077  39.235  -2.058  1.00 0.00 ? 107 VAL B O    1  
ATOM 10611  C CB   . VAL B 1 107 ? 47.006  41.089  0.631   1.00 0.00 ? 107 VAL B CB   1  
ATOM 10612  C CG1  . VAL B 1 107 ? 48.270  40.962  -0.222  1.00 0.00 ? 107 VAL B CG1  1  
ATOM 10613  C CG2  . VAL B 1 107 ? 46.873  42.528  1.135   1.00 0.00 ? 107 VAL B CG2  1  
ATOM 10614  H H    . VAL B 1 107 ? 44.651  40.961  1.599   1.00 0.00 ? 107 VAL B H    1  
ATOM 10615  H HA   . VAL B 1 107 ? 45.684  41.476  -1.007  1.00 0.00 ? 107 VAL B HA   1  
ATOM 10616  H HB   . VAL B 1 107 ? 47.066  40.413  1.471   1.00 0.00 ? 107 VAL B HB   1  
ATOM 10617  H HG11 . VAL B 1 107 ? 49.117  41.343  0.330   1.00 0.00 ? 107 VAL B HG11 1  
ATOM 10618  H HG12 . VAL B 1 107 ? 48.150  41.531  -1.132  1.00 0.00 ? 107 VAL B HG12 1  
ATOM 10619  H HG13 . VAL B 1 107 ? 48.436  39.923  -0.466  1.00 0.00 ? 107 VAL B HG13 1  
ATOM 10620  H HG21 . VAL B 1 107 ? 47.699  42.756  1.793   1.00 0.00 ? 107 VAL B HG21 1  
ATOM 10621  H HG22 . VAL B 1 107 ? 45.943  42.636  1.674   1.00 0.00 ? 107 VAL B HG22 1  
ATOM 10622  H HG23 . VAL B 1 107 ? 46.884  43.206  0.295   1.00 0.00 ? 107 VAL B HG23 1  
ATOM 10623  N N    . ILE B 1 108 ? 45.998  38.317  -0.073  1.00 0.00 ? 108 ILE B N    1  
ATOM 10624  C CA   . ILE B 1 108 ? 46.177  36.951  -0.653  1.00 0.00 ? 108 ILE B CA   1  
ATOM 10625  C C    . ILE B 1 108 ? 44.922  36.574  -1.445  1.00 0.00 ? 108 ILE B C    1  
ATOM 10626  O O    . ILE B 1 108 ? 45.001  36.008  -2.519  1.00 0.00 ? 108 ILE B O    1  
ATOM 10627  C CB   . ILE B 1 108 ? 46.382  35.934  0.474   1.00 0.00 ? 108 ILE B CB   1  
ATOM 10628  C CG1  . ILE B 1 108 ? 45.226  36.034  1.493   1.00 0.00 ? 108 ILE B CG1  1  
ATOM 10629  C CG2  . ILE B 1 108 ? 47.738  36.193  1.171   1.00 0.00 ? 108 ILE B CG2  1  
ATOM 10630  C CD1  . ILE B 1 108 ? 44.215  34.893  1.300   1.00 0.00 ? 108 ILE B CD1  1  
ATOM 10631  H H    . ILE B 1 108 ? 45.903  38.429  0.896   1.00 0.00 ? 108 ILE B H    1  
ATOM 10632  H HA   . ILE B 1 108 ? 47.036  36.945  -1.309  1.00 0.00 ? 108 ILE B HA   1  
ATOM 10633  H HB   . ILE B 1 108 ? 46.394  34.940  0.048   1.00 0.00 ? 108 ILE B HB   1  
ATOM 10634  H HG12 . ILE B 1 108 ? 45.631  35.984  2.492   1.00 0.00 ? 108 ILE B HG12 1  
ATOM 10635  H HG13 . ILE B 1 108 ? 44.721  36.980  1.362   1.00 0.00 ? 108 ILE B HG13 1  
ATOM 10636  H HG21 . ILE B 1 108 ? 47.862  37.254  1.335   1.00 0.00 ? 108 ILE B HG21 1  
ATOM 10637  H HG22 . ILE B 1 108 ? 48.540  35.830  0.545   1.00 0.00 ? 108 ILE B HG22 1  
ATOM 10638  H HG23 . ILE B 1 108 ? 47.760  35.676  2.120   1.00 0.00 ? 108 ILE B HG23 1  
ATOM 10639  H HD11 . ILE B 1 108 ? 43.408  35.230  0.666   1.00 0.00 ? 108 ILE B HD11 1  
ATOM 10640  H HD12 . ILE B 1 108 ? 43.818  34.598  2.261   1.00 0.00 ? 108 ILE B HD12 1  
ATOM 10641  H HD13 . ILE B 1 108 ? 44.707  34.049  0.840   1.00 0.00 ? 108 ILE B HD13 1  
ATOM 10642  N N    . GLU B 1 109 ? 43.771  36.897  -0.932  1.00 0.00 ? 109 GLU B N    1  
ATOM 10643  C CA   . GLU B 1 109 ? 42.512  36.581  -1.663  1.00 0.00 ? 109 GLU B CA   1  
ATOM 10644  C C    . GLU B 1 109 ? 42.484  37.391  -2.954  1.00 0.00 ? 109 GLU B C    1  
ATOM 10645  O O    . GLU B 1 109 ? 42.058  36.921  -3.992  1.00 0.00 ? 109 GLU B O    1  
ATOM 10646  C CB   . GLU B 1 109 ? 41.304  36.952  -0.799  1.00 0.00 ? 109 GLU B CB   1  
ATOM 10647  C CG   . GLU B 1 109 ? 40.010  36.568  -1.523  1.00 0.00 ? 109 GLU B CG   1  
ATOM 10648  C CD   . GLU B 1 109 ? 38.811  36.968  -0.660  1.00 0.00 ? 109 GLU B CD   1  
ATOM 10649  O OE1  . GLU B 1 109 ? 39.031  37.566  0.382   1.00 0.00 ? 109 GLU B OE1  1  
ATOM 10650  O OE2  . GLU B 1 109 ? 37.697  36.675  -1.055  1.00 0.00 ? 109 GLU B OE2  1  
ATOM 10651  H H    . GLU B 1 109 ? 43.733  37.363  -0.070  1.00 0.00 ? 109 GLU B H    1  
ATOM 10652  H HA   . GLU B 1 109 ? 42.482  35.526  -1.896  1.00 0.00 ? 109 GLU B HA   1  
ATOM 10653  H HB2  . GLU B 1 109 ? 41.361  36.423  0.142   1.00 0.00 ? 109 GLU B HB2  1  
ATOM 10654  H HB3  . GLU B 1 109 ? 41.308  38.015  -0.614  1.00 0.00 ? 109 GLU B HB3  1  
ATOM 10655  H HG2  . GLU B 1 109 ? 39.961  37.083  -2.472  1.00 0.00 ? 109 GLU B HG2  1  
ATOM 10656  H HG3  . GLU B 1 109 ? 39.991  35.501  -1.690  1.00 0.00 ? 109 GLU B HG3  1  
ATOM 10657  N N    . GLY B 1 110 ? 42.926  38.619  -2.889  1.00 0.00 ? 110 GLY B N    1  
ATOM 10658  C CA   . GLY B 1 110 ? 42.922  39.490  -4.098  1.00 0.00 ? 110 GLY B CA   1  
ATOM 10659  C C    . GLY B 1 110 ? 43.737  38.838  -5.217  1.00 0.00 ? 110 GLY B C    1  
ATOM 10660  O O    . GLY B 1 110 ? 43.281  38.732  -6.339  1.00 0.00 ? 110 GLY B O    1  
ATOM 10661  H H    . GLY B 1 110 ? 43.254  38.974  -2.036  1.00 0.00 ? 110 GLY B H    1  
ATOM 10662  H HA2  . GLY B 1 110 ? 41.903  39.634  -4.431  1.00 0.00 ? 110 GLY B HA2  1  
ATOM 10663  H HA3  . GLY B 1 110 ? 43.357  40.447  -3.852  1.00 0.00 ? 110 GLY B HA3  1  
ATOM 10664  N N    . GLN B 1 111 ? 44.936  38.389  -4.937  1.00 0.00 ? 111 GLN B N    1  
ATOM 10665  C CA   . GLN B 1 111 ? 45.739  37.752  -6.019  1.00 0.00 ? 111 GLN B CA   1  
ATOM 10666  C C    . GLN B 1 111 ? 45.076  36.437  -6.432  1.00 0.00 ? 111 GLN B C    1  
ATOM 10667  O O    . GLN B 1 111 ? 44.802  36.218  -7.592  1.00 0.00 ? 111 GLN B O    1  
ATOM 10668  C CB   . GLN B 1 111 ? 47.160  37.468  -5.533  1.00 0.00 ? 111 GLN B CB   1  
ATOM 10669  C CG   . GLN B 1 111 ? 47.995  36.871  -6.670  1.00 0.00 ? 111 GLN B CG   1  
ATOM 10670  C CD   . GLN B 1 111 ? 49.424  36.602  -6.181  1.00 0.00 ? 111 GLN B CD   1  
ATOM 10671  O OE1  . GLN B 1 111 ? 49.628  35.878  -5.227  1.00 0.00 ? 111 GLN B OE1  1  
ATOM 10672  N NE2  . GLN B 1 111 ? 50.425  37.175  -6.791  1.00 0.00 ? 111 GLN B NE2  1  
ATOM 10673  H H    . GLN B 1 111 ? 45.299  38.471  -4.030  1.00 0.00 ? 111 GLN B H    1  
ATOM 10674  H HA   . GLN B 1 111 ? 45.777  38.414  -6.872  1.00 0.00 ? 111 GLN B HA   1  
ATOM 10675  H HB2  . GLN B 1 111 ? 47.616  38.389  -5.199  1.00 0.00 ? 111 GLN B HB2  1  
ATOM 10676  H HB3  . GLN B 1 111 ? 47.125  36.768  -4.711  1.00 0.00 ? 111 GLN B HB3  1  
ATOM 10677  H HG2  . GLN B 1 111 ? 47.546  35.943  -6.996  1.00 0.00 ? 111 GLN B HG2  1  
ATOM 10678  H HG3  . GLN B 1 111 ? 48.025  37.565  -7.496  1.00 0.00 ? 111 GLN B HG3  1  
ATOM 10679  H HE21 . GLN B 1 111 ? 50.259  37.768  -7.552  1.00 0.00 ? 111 GLN B HE21 1  
ATOM 10680  H HE22 . GLN B 1 111 ? 51.343  37.011  -6.488  1.00 0.00 ? 111 GLN B HE22 1  
ATOM 10681  N N    . ALA B 1 112 ? 44.803  35.571  -5.496  1.00 0.00 ? 112 ALA B N    1  
ATOM 10682  C CA   . ALA B 1 112 ? 44.152  34.278  -5.850  1.00 0.00 ? 112 ALA B CA   1  
ATOM 10683  C C    . ALA B 1 112 ? 42.864  34.570  -6.621  1.00 0.00 ? 112 ALA B C    1  
ATOM 10684  O O    . ALA B 1 112 ? 42.535  33.899  -7.579  1.00 0.00 ? 112 ALA B O    1  
ATOM 10685  C CB   . ALA B 1 112 ? 43.822  33.500  -4.577  1.00 0.00 ? 112 ALA B CB   1  
ATOM 10686  H H    . ALA B 1 112 ? 45.023  35.770  -4.562  1.00 0.00 ? 112 ALA B H    1  
ATOM 10687  H HA   . ALA B 1 112 ? 44.820  33.696  -6.469  1.00 0.00 ? 112 ALA B HA   1  
ATOM 10688  H HB1  . ALA B 1 112 ? 42.818  33.740  -4.259  1.00 0.00 ? 112 ALA B HB1  1  
ATOM 10689  H HB2  . ALA B 1 112 ? 44.520  33.770  -3.799  1.00 0.00 ? 112 ALA B HB2  1  
ATOM 10690  H HB3  . ALA B 1 112 ? 43.894  32.441  -4.775  1.00 0.00 ? 112 ALA B HB3  1  
ATOM 10691  N N    . SER B 1 113 ? 42.130  35.563  -6.206  1.00 0.00 ? 113 SER B N    1  
ATOM 10692  C CA   . SER B 1 113 ? 40.863  35.891  -6.914  1.00 0.00 ? 113 SER B CA   1  
ATOM 10693  C C    . SER B 1 113 ? 41.182  36.223  -8.371  1.00 0.00 ? 113 SER B C    1  
ATOM 10694  O O    . SER B 1 113 ? 40.474  35.831  -9.275  1.00 0.00 ? 113 SER B O    1  
ATOM 10695  C CB   . SER B 1 113 ? 40.191  37.089  -6.243  1.00 0.00 ? 113 SER B CB   1  
ATOM 10696  O OG   . SER B 1 113 ? 39.782  36.724  -4.931  1.00 0.00 ? 113 SER B OG   1  
ATOM 10697  H H    . SER B 1 113 ? 42.410  36.091  -5.429  1.00 0.00 ? 113 SER B H    1  
ATOM 10698  H HA   . SER B 1 113 ? 40.201  35.038  -6.878  1.00 0.00 ? 113 SER B HA   1  
ATOM 10699  H HB2  . SER B 1 113 ? 40.889  37.908  -6.182  1.00 0.00 ? 113 SER B HB2  1  
ATOM 10700  H HB3  . SER B 1 113 ? 39.334  37.394  -6.828  1.00 0.00 ? 113 SER B HB3  1  
ATOM 10701  H HG   . SER B 1 113 ? 40.055  37.420  -4.330  1.00 0.00 ? 113 SER B HG   1  
ATOM 10702  N N    . ALA B 1 114 ? 42.248  36.936  -8.607  1.00 0.00 ? 114 ALA B N    1  
ATOM 10703  C CA   . ALA B 1 114 ? 42.612  37.273  -10.011 1.00 0.00 ? 114 ALA B CA   1  
ATOM 10704  C C    . ALA B 1 114 ? 42.932  35.983  -10.767 1.00 0.00 ? 114 ALA B C    1  
ATOM 10705  O O    . ALA B 1 114 ? 42.585  35.829  -11.920 1.00 0.00 ? 114 ALA B O    1  
ATOM 10706  C CB   . ALA B 1 114 ? 43.837  38.189  -10.032 1.00 0.00 ? 114 ALA B CB   1  
ATOM 10707  H H    . ALA B 1 114 ? 42.812  37.239  -7.864  1.00 0.00 ? 114 ALA B H    1  
ATOM 10708  H HA   . ALA B 1 114 ? 41.781  37.772  -10.488 1.00 0.00 ? 114 ALA B HA   1  
ATOM 10709  H HB1  . ALA B 1 114 ? 43.952  38.614  -11.018 1.00 0.00 ? 114 ALA B HB1  1  
ATOM 10710  H HB2  . ALA B 1 114 ? 44.719  37.617  -9.781  1.00 0.00 ? 114 ALA B HB2  1  
ATOM 10711  H HB3  . ALA B 1 114 ? 43.706  38.983  -9.311  1.00 0.00 ? 114 ALA B HB3  1  
ATOM 10712  N N    . LEU B 1 115 ? 43.604  35.062  -10.129 1.00 0.00 ? 115 LEU B N    1  
ATOM 10713  C CA   . LEU B 1 115 ? 43.958  33.793  -10.820 1.00 0.00 ? 115 LEU B CA   1  
ATOM 10714  C C    . LEU B 1 115 ? 42.679  33.030  -11.190 1.00 0.00 ? 115 LEU B C    1  
ATOM 10715  O O    . LEU B 1 115 ? 42.588  32.448  -12.252 1.00 0.00 ? 115 LEU B O    1  
ATOM 10716  C CB   . LEU B 1 115 ? 44.834  32.933  -9.904  1.00 0.00 ? 115 LEU B CB   1  
ATOM 10717  C CG   . LEU B 1 115 ? 46.323  33.196  -10.193 1.00 0.00 ? 115 LEU B CG   1  
ATOM 10718  C CD1  . LEU B 1 115 ? 46.683  32.623  -11.563 1.00 0.00 ? 115 LEU B CD1  1  
ATOM 10719  C CD2  . LEU B 1 115 ? 46.615  34.705  -10.171 1.00 0.00 ? 115 LEU B CD2  1  
ATOM 10720  H H    . LEU B 1 115 ? 43.884  35.211  -9.202  1.00 0.00 ? 115 LEU B H    1  
ATOM 10721  H HA   . LEU B 1 115 ? 44.505  34.023  -11.723 1.00 0.00 ? 115 LEU B HA   1  
ATOM 10722  H HB2  . LEU B 1 115 ? 44.620  33.176  -8.873  1.00 0.00 ? 115 LEU B HB2  1  
ATOM 10723  H HB3  . LEU B 1 115 ? 44.617  31.890  -10.078 1.00 0.00 ? 115 LEU B HB3  1  
ATOM 10724  H HG   . LEU B 1 115 ? 46.920  32.705  -9.437  1.00 0.00 ? 115 LEU B HG   1  
ATOM 10725  H HD11 . LEU B 1 115 ? 45.819  32.130  -11.986 1.00 0.00 ? 115 LEU B HD11 1  
ATOM 10726  H HD12 . LEU B 1 115 ? 47.487  31.910  -11.454 1.00 0.00 ? 115 LEU B HD12 1  
ATOM 10727  H HD13 . LEU B 1 115 ? 46.997  33.423  -12.217 1.00 0.00 ? 115 LEU B HD13 1  
ATOM 10728  H HD21 . LEU B 1 115 ? 46.501  35.109  -11.166 1.00 0.00 ? 115 LEU B HD21 1  
ATOM 10729  H HD22 . LEU B 1 115 ? 47.626  34.871  -9.829  1.00 0.00 ? 115 LEU B HD22 1  
ATOM 10730  H HD23 . LEU B 1 115 ? 45.924  35.196  -9.501  1.00 0.00 ? 115 LEU B HD23 1  
ATOM 10731  N N    . GLU B 1 116 ? 41.691  33.006  -10.333 1.00 0.00 ? 116 GLU B N    1  
ATOM 10732  C CA   . GLU B 1 116 ? 40.440  32.261  -10.667 1.00 0.00 ? 116 GLU B CA   1  
ATOM 10733  C C    . GLU B 1 116 ? 39.820  32.841  -11.935 1.00 0.00 ? 116 GLU B C    1  
ATOM 10734  O O    . GLU B 1 116 ? 39.254  32.131  -12.740 1.00 0.00 ? 116 GLU B O    1  
ATOM 10735  C CB   . GLU B 1 116 ? 39.445  32.384  -9.514  1.00 0.00 ? 116 GLU B CB   1  
ATOM 10736  C CG   . GLU B 1 116 ? 38.244  31.468  -9.759  1.00 0.00 ? 116 GLU B CG   1  
ATOM 10737  C CD   . GLU B 1 116 ? 37.302  32.128  -10.767 1.00 0.00 ? 116 GLU B CD   1  
ATOM 10738  O OE1  . GLU B 1 116 ? 37.268  33.346  -10.808 1.00 0.00 ? 116 GLU B OE1  1  
ATOM 10739  O OE2  . GLU B 1 116 ? 36.620  31.400  -11.472 1.00 0.00 ? 116 GLU B OE2  1  
ATOM 10740  H H    . GLU B 1 116 ? 41.774  33.469  -9.474  1.00 0.00 ? 116 GLU B H    1  
ATOM 10741  H HA   . GLU B 1 116 ? 40.675  31.219  -10.829 1.00 0.00 ? 116 GLU B HA   1  
ATOM 10742  H HB2  . GLU B 1 116 ? 39.930  32.101  -8.591  1.00 0.00 ? 116 GLU B HB2  1  
ATOM 10743  H HB3  . GLU B 1 116 ? 39.105  33.406  -9.441  1.00 0.00 ? 116 GLU B HB3  1  
ATOM 10744  H HG2  . GLU B 1 116 ? 38.588  30.521  -10.150 1.00 0.00 ? 116 GLU B HG2  1  
ATOM 10745  H HG3  . GLU B 1 116 ? 37.719  31.306  -8.829  1.00 0.00 ? 116 GLU B HG3  1  
ATOM 10746  N N    . GLU B 1 117 ? 39.920  34.128  -12.125 1.00 0.00 ? 117 GLU B N    1  
ATOM 10747  C CA   . GLU B 1 117 ? 39.332  34.731  -13.352 1.00 0.00 ? 117 GLU B CA   1  
ATOM 10748  C C    . GLU B 1 117 ? 39.914  34.023  -14.575 1.00 0.00 ? 117 GLU B C    1  
ATOM 10749  O O    . GLU B 1 117 ? 39.359  34.072  -15.653 1.00 0.00 ? 117 GLU B O    1  
ATOM 10750  C CB   . GLU B 1 117 ? 39.671  36.220  -13.413 1.00 0.00 ? 117 GLU B CB   1  
ATOM 10751  C CG   . GLU B 1 117 ? 39.038  36.941  -12.223 1.00 0.00 ? 117 GLU B CG   1  
ATOM 10752  C CD   . GLU B 1 117 ? 37.521  37.023  -12.419 1.00 0.00 ? 117 GLU B CD   1  
ATOM 10753  O OE1  . GLU B 1 117 ? 37.062  36.637  -13.482 1.00 0.00 ? 117 GLU B OE1  1  
ATOM 10754  O OE2  . GLU B 1 117 ? 36.850  37.473  -11.510 1.00 0.00 ? 117 GLU B OE2  1  
ATOM 10755  H H    . GLU B 1 117 ? 40.381  34.691  -11.468 1.00 0.00 ? 117 GLU B H    1  
ATOM 10756  H HA   . GLU B 1 117 ? 38.259  34.604  -13.337 1.00 0.00 ? 117 GLU B HA   1  
ATOM 10757  H HB2  . GLU B 1 117 ? 40.744  36.345  -13.383 1.00 0.00 ? 117 GLU B HB2  1  
ATOM 10758  H HB3  . GLU B 1 117 ? 39.286  36.639  -14.331 1.00 0.00 ? 117 GLU B HB3  1  
ATOM 10759  H HG2  . GLU B 1 117 ? 39.257  36.397  -11.316 1.00 0.00 ? 117 GLU B HG2  1  
ATOM 10760  H HG3  . GLU B 1 117 ? 39.444  37.940  -12.151 1.00 0.00 ? 117 GLU B HG3  1  
ATOM 10761  N N    . LEU B 1 118 ? 41.039  33.376  -14.421 1.00 0.00 ? 118 LEU B N    1  
ATOM 10762  C CA   . LEU B 1 118 ? 41.662  32.676  -15.578 1.00 0.00 ? 118 LEU B CA   1  
ATOM 10763  C C    . LEU B 1 118 ? 40.733  31.566  -16.065 1.00 0.00 ? 118 LEU B C    1  
ATOM 10764  O O    . LEU B 1 118 ? 40.018  30.960  -15.295 1.00 0.00 ? 118 LEU B O    1  
ATOM 10765  C CB   . LEU B 1 118 ? 42.981  32.043  -15.142 1.00 0.00 ? 118 LEU B CB   1  
ATOM 10766  C CG   . LEU B 1 118 ? 44.110  33.073  -15.247 1.00 0.00 ? 118 LEU B CG   1  
ATOM 10767  C CD1  . LEU B 1 118 ? 44.429  33.332  -16.720 1.00 0.00 ? 118 LEU B CD1  1  
ATOM 10768  C CD2  . LEU B 1 118 ? 43.694  34.391  -14.563 1.00 0.00 ? 118 LEU B CD2  1  
ATOM 10769  H H    . LEU B 1 118 ? 41.477  33.358  -13.545 1.00 0.00 ? 118 LEU B H    1  
ATOM 10770  H HA   . LEU B 1 118 ? 41.842  33.379  -16.378 1.00 0.00 ? 118 LEU B HA   1  
ATOM 10771  H HB2  . LEU B 1 118 ? 42.896  31.705  -14.119 1.00 0.00 ? 118 LEU B HB2  1  
ATOM 10772  H HB3  . LEU B 1 118 ? 43.204  31.202  -15.782 1.00 0.00 ? 118 LEU B HB3  1  
ATOM 10773  H HG   . LEU B 1 118 ? 44.991  32.680  -14.759 1.00 0.00 ? 118 LEU B HG   1  
ATOM 10774  H HD11 . LEU B 1 118 ? 44.211  34.362  -16.959 1.00 0.00 ? 118 LEU B HD11 1  
ATOM 10775  H HD12 . LEU B 1 118 ? 43.826  32.683  -17.338 1.00 0.00 ? 118 LEU B HD12 1  
ATOM 10776  H HD13 . LEU B 1 118 ? 45.475  33.133  -16.902 1.00 0.00 ? 118 LEU B HD13 1  
ATOM 10777  H HD21 . LEU B 1 118 ? 44.577  34.965  -14.322 1.00 0.00 ? 118 LEU B HD21 1  
ATOM 10778  H HD22 . LEU B 1 118 ? 43.151  34.170  -13.657 1.00 0.00 ? 118 LEU B HD22 1  
ATOM 10779  H HD23 . LEU B 1 118 ? 43.065  34.960  -15.231 1.00 0.00 ? 118 LEU B HD23 1  
ATOM 10780  N N    . ASP B 1 119 ? 40.739  31.297  -17.343 1.00 0.00 ? 119 ASP B N    1  
ATOM 10781  C CA   . ASP B 1 119 ? 39.856  30.226  -17.901 1.00 0.00 ? 119 ASP B CA   1  
ATOM 10782  C C    . ASP B 1 119 ? 40.659  28.928  -18.086 1.00 0.00 ? 119 ASP B C    1  
ATOM 10783  O O    . ASP B 1 119 ? 40.501  28.235  -19.073 1.00 0.00 ? 119 ASP B O    1  
ATOM 10784  C CB   . ASP B 1 119 ? 39.306  30.703  -19.255 1.00 0.00 ? 119 ASP B CB   1  
ATOM 10785  C CG   . ASP B 1 119 ? 38.246  29.724  -19.771 1.00 0.00 ? 119 ASP B CG   1  
ATOM 10786  O OD1  . ASP B 1 119 ? 37.220  29.595  -19.121 1.00 0.00 ? 119 ASP B OD1  1  
ATOM 10787  O OD2  . ASP B 1 119 ? 38.480  29.113  -20.802 1.00 0.00 ? 119 ASP B OD2  1  
ATOM 10788  H H    . ASP B 1 119 ? 41.326  31.804  -17.942 1.00 0.00 ? 119 ASP B H    1  
ATOM 10789  H HA   . ASP B 1 119 ? 39.035  30.047  -17.223 1.00 0.00 ? 119 ASP B HA   1  
ATOM 10790  H HB2  . ASP B 1 119 ? 38.861  31.681  -19.136 1.00 0.00 ? 119 ASP B HB2  1  
ATOM 10791  H HB3  . ASP B 1 119 ? 40.115  30.763  -19.969 1.00 0.00 ? 119 ASP B HB3  1  
ATOM 10792  N N    . ASP B 1 120 ? 41.518  28.598  -17.145 1.00 0.00 ? 120 ASP B N    1  
ATOM 10793  C CA   . ASP B 1 120 ? 42.339  27.346  -17.268 1.00 0.00 ? 120 ASP B CA   1  
ATOM 10794  C C    . ASP B 1 120 ? 42.277  26.539  -15.963 1.00 0.00 ? 120 ASP B C    1  
ATOM 10795  O O    . ASP B 1 120 ? 42.432  27.069  -14.880 1.00 0.00 ? 120 ASP B O    1  
ATOM 10796  C CB   . ASP B 1 120 ? 43.796  27.728  -17.564 1.00 0.00 ? 120 ASP B CB   1  
ATOM 10797  C CG   . ASP B 1 120 ? 44.590  26.474  -17.944 1.00 0.00 ? 120 ASP B CG   1  
ATOM 10798  O OD1  . ASP B 1 120 ? 44.081  25.387  -17.724 1.00 0.00 ? 120 ASP B OD1  1  
ATOM 10799  O OD2  . ASP B 1 120 ? 45.690  26.624  -18.446 1.00 0.00 ? 120 ASP B OD2  1  
ATOM 10800  H H    . ASP B 1 120 ? 41.626  29.176  -16.360 1.00 0.00 ? 120 ASP B H    1  
ATOM 10801  H HA   . ASP B 1 120 ? 41.955  26.746  -18.079 1.00 0.00 ? 120 ASP B HA   1  
ATOM 10802  H HB2  . ASP B 1 120 ? 43.824  28.434  -18.382 1.00 0.00 ? 120 ASP B HB2  1  
ATOM 10803  H HB3  . ASP B 1 120 ? 44.236  28.177  -16.686 1.00 0.00 ? 120 ASP B HB3  1  
ATOM 10804  N N    . GLU B 1 121 ? 42.065  25.254  -16.077 1.00 0.00 ? 121 GLU B N    1  
ATOM 10805  C CA   . GLU B 1 121 ? 42.001  24.367  -14.869 1.00 0.00 ? 121 GLU B CA   1  
ATOM 10806  C C    . GLU B 1 121 ? 43.386  24.224  -14.234 1.00 0.00 ? 121 GLU B C    1  
ATOM 10807  O O    . GLU B 1 121 ? 43.520  24.051  -13.042 1.00 0.00 ? 121 GLU B O    1  
ATOM 10808  C CB   . GLU B 1 121 ? 41.494  22.981  -15.281 1.00 0.00 ? 121 GLU B CB   1  
ATOM 10809  C CG   . GLU B 1 121 ? 42.486  22.328  -16.245 1.00 0.00 ? 121 GLU B CG   1  
ATOM 10810  C CD   . GLU B 1 121 ? 41.892  21.027  -16.781 1.00 0.00 ? 121 GLU B CD   1  
ATOM 10811  O OE1  . GLU B 1 121 ? 40.779  20.705  -16.400 1.00 0.00 ? 121 GLU B OE1  1  
ATOM 10812  O OE2  . GLU B 1 121 ? 42.559  20.372  -17.569 1.00 0.00 ? 121 GLU B OE2  1  
ATOM 10813  H H    . GLU B 1 121 ? 41.956  24.861  -16.968 1.00 0.00 ? 121 GLU B H    1  
ATOM 10814  H HA   . GLU B 1 121 ? 41.320  24.795  -14.148 1.00 0.00 ? 121 GLU B HA   1  
ATOM 10815  H HB2  . GLU B 1 121 ? 41.388  22.362  -14.401 1.00 0.00 ? 121 GLU B HB2  1  
ATOM 10816  H HB3  . GLU B 1 121 ? 40.535  23.080  -15.768 1.00 0.00 ? 121 GLU B HB3  1  
ATOM 10817  H HG2  . GLU B 1 121 ? 42.684  23.001  -17.067 1.00 0.00 ? 121 GLU B HG2  1  
ATOM 10818  H HG3  . GLU B 1 121 ? 43.407  22.114  -15.724 1.00 0.00 ? 121 GLU B HG3  1  
ATOM 10819  N N    . TYR B 1 122 ? 44.419  24.304  -15.030 1.00 0.00 ? 122 TYR B N    1  
ATOM 10820  C CA   . TYR B 1 122 ? 45.814  24.178  -14.505 1.00 0.00 ? 122 TYR B CA   1  
ATOM 10821  C C    . TYR B 1 122 ? 46.203  25.431  -13.705 1.00 0.00 ? 122 TYR B C    1  
ATOM 10822  O O    . TYR B 1 122 ? 46.840  25.349  -12.666 1.00 0.00 ? 122 TYR B O    1  
ATOM 10823  C CB   . TYR B 1 122 ? 46.748  23.992  -15.717 1.00 0.00 ? 122 TYR B CB   1  
ATOM 10824  C CG   . TYR B 1 122 ? 46.584  22.623  -16.349 1.00 0.00 ? 122 TYR B CG   1  
ATOM 10825  C CD1  . TYR B 1 122 ? 47.367  21.539  -15.895 1.00 0.00 ? 122 TYR B CD1  1  
ATOM 10826  C CD2  . TYR B 1 122 ? 45.662  22.430  -17.396 1.00 0.00 ? 122 TYR B CD2  1  
ATOM 10827  C CE1  . TYR B 1 122 ? 47.222  20.271  -16.484 1.00 0.00 ? 122 TYR B CE1  1  
ATOM 10828  C CE2  . TYR B 1 122 ? 45.522  21.160  -17.983 1.00 0.00 ? 122 TYR B CE2  1  
ATOM 10829  C CZ   . TYR B 1 122 ? 46.302  20.085  -17.528 1.00 0.00 ? 122 TYR B CZ   1  
ATOM 10830  O OH   . TYR B 1 122 ? 46.169  18.848  -18.104 1.00 0.00 ? 122 TYR B OH   1  
ATOM 10831  H H    . TYR B 1 122 ? 44.277  24.449  -15.989 1.00 0.00 ? 122 TYR B H    1  
ATOM 10832  H HA   . TYR B 1 122 ? 45.880  23.310  -13.867 1.00 0.00 ? 122 TYR B HA   1  
ATOM 10833  H HB2  . TYR B 1 122 ? 46.524  24.748  -16.455 1.00 0.00 ? 122 TYR B HB2  1  
ATOM 10834  H HB3  . TYR B 1 122 ? 47.772  24.111  -15.392 1.00 0.00 ? 122 TYR B HB3  1  
ATOM 10835  H HD1  . TYR B 1 122 ? 48.074  21.683  -15.092 1.00 0.00 ? 122 TYR B HD1  1  
ATOM 10836  H HD2  . TYR B 1 122 ? 45.062  23.257  -17.746 1.00 0.00 ? 122 TYR B HD2  1  
ATOM 10837  H HE1  . TYR B 1 122 ? 47.820  19.441  -16.136 1.00 0.00 ? 122 TYR B HE1  1  
ATOM 10838  H HE2  . TYR B 1 122 ? 44.815  21.011  -18.786 1.00 0.00 ? 122 TYR B HE2  1  
ATOM 10839  H HH   . TYR B 1 122 ? 46.985  18.364  -17.959 1.00 0.00 ? 122 TYR B HH   1  
ATOM 10840  N N    . LEU B 1 123 ? 45.824  26.586  -14.167 1.00 0.00 ? 123 LEU B N    1  
ATOM 10841  C CA   . LEU B 1 123 ? 46.171  27.829  -13.430 1.00 0.00 ? 123 LEU B CA   1  
ATOM 10842  C C    . LEU B 1 123 ? 45.291  27.922  -12.185 1.00 0.00 ? 123 LEU B C    1  
ATOM 10843  O O    . LEU B 1 123 ? 45.702  28.398  -11.149 1.00 0.00 ? 123 LEU B O    1  
ATOM 10844  C CB   . LEU B 1 123 ? 45.940  29.042  -14.342 1.00 0.00 ? 123 LEU B CB   1  
ATOM 10845  C CG   . LEU B 1 123 ? 47.106  29.156  -15.337 1.00 0.00 ? 123 LEU B CG   1  
ATOM 10846  C CD1  . LEU B 1 123 ? 47.351  27.801  -16.025 1.00 0.00 ? 123 LEU B CD1  1  
ATOM 10847  C CD2  . LEU B 1 123 ? 46.791  30.235  -16.393 1.00 0.00 ? 123 LEU B CD2  1  
ATOM 10848  H H    . LEU B 1 123 ? 45.307  26.637  -14.999 1.00 0.00 ? 123 LEU B H    1  
ATOM 10849  H HA   . LEU B 1 123 ? 47.210  27.792  -13.135 1.00 0.00 ? 123 LEU B HA   1  
ATOM 10850  H HB2  . LEU B 1 123 ? 45.013  28.916  -14.883 1.00 0.00 ? 123 LEU B HB2  1  
ATOM 10851  H HB3  . LEU B 1 123 ? 45.890  29.940  -13.744 1.00 0.00 ? 123 LEU B HB3  1  
ATOM 10852  H HG   . LEU B 1 123 ? 47.998  29.440  -14.797 1.00 0.00 ? 123 LEU B HG   1  
ATOM 10853  H HD11 . LEU B 1 123 ? 47.980  27.946  -16.891 1.00 0.00 ? 123 LEU B HD11 1  
ATOM 10854  H HD12 . LEU B 1 123 ? 46.406  27.377  -16.332 1.00 0.00 ? 123 LEU B HD12 1  
ATOM 10855  H HD13 . LEU B 1 123 ? 47.839  27.130  -15.334 1.00 0.00 ? 123 LEU B HD13 1  
ATOM 10856  H HD21 . LEU B 1 123 ? 46.876  31.213  -15.944 1.00 0.00 ? 123 LEU B HD21 1  
ATOM 10857  H HD22 . LEU B 1 123 ? 45.786  30.094  -16.763 1.00 0.00 ? 123 LEU B HD22 1  
ATOM 10858  H HD23 . LEU B 1 123 ? 47.491  30.152  -17.211 1.00 0.00 ? 123 LEU B HD23 1  
ATOM 10859  N N    . LYS B 1 124 ? 44.072  27.461  -12.290 1.00 0.00 ? 124 LYS B N    1  
ATOM 10860  C CA   . LYS B 1 124 ? 43.144  27.510  -11.126 1.00 0.00 ? 124 LYS B CA   1  
ATOM 10861  C C    . LYS B 1 124 ? 43.691  26.665  -9.965  1.00 0.00 ? 124 LYS B C    1  
ATOM 10862  O O    . LYS B 1 124 ? 43.632  27.069  -8.823  1.00 0.00 ? 124 LYS B O    1  
ATOM 10863  C CB   . LYS B 1 124 ? 41.775  26.983  -11.570 1.00 0.00 ? 124 LYS B CB   1  
ATOM 10864  C CG   . LYS B 1 124 ? 40.780  27.059  -10.411 1.00 0.00 ? 124 LYS B CG   1  
ATOM 10865  C CD   . LYS B 1 124 ? 40.587  25.657  -9.814  1.00 0.00 ? 124 LYS B CD   1  
ATOM 10866  C CE   . LYS B 1 124 ? 39.611  25.717  -8.623  1.00 0.00 ? 124 LYS B CE   1  
ATOM 10867  N NZ   . LYS B 1 124 ? 38.266  26.142  -9.109  1.00 0.00 ? 124 LYS B NZ   1  
ATOM 10868  H H    . LYS B 1 124 ? 43.768  27.081  -13.141 1.00 0.00 ? 124 LYS B H    1  
ATOM 10869  H HA   . LYS B 1 124 ? 43.039  28.534  -10.799 1.00 0.00 ? 124 LYS B HA   1  
ATOM 10870  H HB2  . LYS B 1 124 ? 41.412  27.581  -12.394 1.00 0.00 ? 124 LYS B HB2  1  
ATOM 10871  H HB3  . LYS B 1 124 ? 41.873  25.956  -11.889 1.00 0.00 ? 124 LYS B HB3  1  
ATOM 10872  H HG2  . LYS B 1 124 ? 41.162  27.727  -9.652  1.00 0.00 ? 124 LYS B HG2  1  
ATOM 10873  H HG3  . LYS B 1 124 ? 39.832  27.429  -10.773 1.00 0.00 ? 124 LYS B HG3  1  
ATOM 10874  H HD2  . LYS B 1 124 ? 40.188  24.998  -10.571 1.00 0.00 ? 124 LYS B HD2  1  
ATOM 10875  H HD3  . LYS B 1 124 ? 41.540  25.279  -9.475  1.00 0.00 ? 124 LYS B HD3  1  
ATOM 10876  H HE2  . LYS B 1 124 ? 39.538  24.741  -8.168  1.00 0.00 ? 124 LYS B HE2  1  
ATOM 10877  H HE3  . LYS B 1 124 ? 39.973  26.428  -7.895  1.00 0.00 ? 124 LYS B HE3  1  
ATOM 10878  H HZ1  . LYS B 1 124 ? 38.374  26.909  -9.803  1.00 0.00 ? 124 LYS B HZ1  1  
ATOM 10879  H HZ2  . LYS B 1 124 ? 37.698  26.478  -8.305  1.00 0.00 ? 124 LYS B HZ2  1  
ATOM 10880  H HZ3  . LYS B 1 124 ? 37.789  25.336  -9.560  1.00 0.00 ? 124 LYS B HZ3  1  
ATOM 10881  N N    . GLU B 1 125 ? 44.227  25.497  -10.233 1.00 0.00 ? 125 GLU B N    1  
ATOM 10882  C CA   . GLU B 1 125 ? 44.768  24.664  -9.111  1.00 0.00 ? 125 GLU B CA   1  
ATOM 10883  C C    . GLU B 1 125 ? 45.886  25.421  -8.396  1.00 0.00 ? 125 GLU B C    1  
ATOM 10884  O O    . GLU B 1 125 ? 45.940  25.461  -7.183  1.00 0.00 ? 125 GLU B O    1  
ATOM 10885  C CB   . GLU B 1 125 ? 45.326  23.338  -9.637  1.00 0.00 ? 125 GLU B CB   1  
ATOM 10886  C CG   . GLU B 1 125 ? 44.189  22.459  -10.164 1.00 0.00 ? 125 GLU B CG   1  
ATOM 10887  C CD   . GLU B 1 125 ? 43.329  22.000  -8.987  1.00 0.00 ? 125 GLU B CD   1  
ATOM 10888  O OE1  . GLU B 1 125 ? 43.805  22.072  -7.866  1.00 0.00 ? 125 GLU B OE1  1  
ATOM 10889  O OE2  . GLU B 1 125 ? 42.204  21.591  -9.224  1.00 0.00 ? 125 GLU B OE2  1  
ATOM 10890  H H    . GLU B 1 125 ? 44.276  25.175  -11.158 1.00 0.00 ? 125 GLU B H    1  
ATOM 10891  H HA   . GLU B 1 125 ? 43.973  24.461  -8.408  1.00 0.00 ? 125 GLU B HA   1  
ATOM 10892  H HB2  . GLU B 1 125 ? 46.026  23.536  -10.436 1.00 0.00 ? 125 GLU B HB2  1  
ATOM 10893  H HB3  . GLU B 1 125 ? 45.834  22.821  -8.836  1.00 0.00 ? 125 GLU B HB3  1  
ATOM 10894  H HG2  . GLU B 1 125 ? 43.584  23.028  -10.857 1.00 0.00 ? 125 GLU B HG2  1  
ATOM 10895  H HG3  . GLU B 1 125 ? 44.601  21.597  -10.666 1.00 0.00 ? 125 GLU B HG3  1  
ATOM 10896  N N    . ARG B 1 126 ? 46.780  26.031  -9.126  1.00 0.00 ? 126 ARG B N    1  
ATOM 10897  C CA   . ARG B 1 126 ? 47.874  26.782  -8.448  1.00 0.00 ? 126 ARG B CA   1  
ATOM 10898  C C    . ARG B 1 126 ? 47.247  27.874  -7.583  1.00 0.00 ? 126 ARG B C    1  
ATOM 10899  O O    . ARG B 1 126 ? 47.714  28.160  -6.497  1.00 0.00 ? 126 ARG B O    1  
ATOM 10900  C CB   . ARG B 1 126 ? 48.838  27.381  -9.493  1.00 0.00 ? 126 ARG B CB   1  
ATOM 10901  C CG   . ARG B 1 126 ? 49.995  28.100  -8.773  1.00 0.00 ? 126 ARG B CG   1  
ATOM 10902  C CD   . ARG B 1 126 ? 50.991  28.667  -9.791  1.00 0.00 ? 126 ARG B CD   1  
ATOM 10903  N NE   . ARG B 1 126 ? 52.109  29.348  -9.081  1.00 0.00 ? 126 ARG B NE   1  
ATOM 10904  C CZ   . ARG B 1 126 ? 51.964  30.573  -8.653  1.00 0.00 ? 126 ARG B CZ   1  
ATOM 10905  N NH1  . ARG B 1 126 ? 50.860  31.220  -8.894  1.00 0.00 ? 126 ARG B NH1  1  
ATOM 10906  N NH2  . ARG B 1 126 ? 52.923  31.156  -7.988  1.00 0.00 ? 126 ARG B NH2  1  
ATOM 10907  H H    . ARG B 1 126 ? 46.729  26.000  -10.104 1.00 0.00 ? 126 ARG B H    1  
ATOM 10908  H HA   . ARG B 1 126 ? 48.421  26.102  -7.810  1.00 0.00 ? 126 ARG B HA   1  
ATOM 10909  H HB2  . ARG B 1 126 ? 49.234  26.589  -10.113 1.00 0.00 ? 126 ARG B HB2  1  
ATOM 10910  H HB3  . ARG B 1 126 ? 48.306  28.089  -10.110 1.00 0.00 ? 126 ARG B HB3  1  
ATOM 10911  H HG2  . ARG B 1 126 ? 49.596  28.907  -8.176  1.00 0.00 ? 126 ARG B HG2  1  
ATOM 10912  H HG3  . ARG B 1 126 ? 50.505  27.399  -8.128  1.00 0.00 ? 126 ARG B HG3  1  
ATOM 10913  H HD2  . ARG B 1 126 ? 51.387  27.862  -10.393 1.00 0.00 ? 126 ARG B HD2  1  
ATOM 10914  H HD3  . ARG B 1 126 ? 50.486  29.377  -10.431 1.00 0.00 ? 126 ARG B HD3  1  
ATOM 10915  H HE   . ARG B 1 126 ? 52.948  28.869  -8.918  1.00 0.00 ? 126 ARG B HE   1  
ATOM 10916  H HH11 . ARG B 1 126 ? 50.124  30.779  -9.408  1.00 0.00 ? 126 ARG B HH11 1  
ATOM 10917  H HH12 . ARG B 1 126 ? 50.748  32.158  -8.566  1.00 0.00 ? 126 ARG B HH12 1  
ATOM 10918  H HH21 . ARG B 1 126 ? 53.774  30.664  -7.804  1.00 0.00 ? 126 ARG B HH21 1  
ATOM 10919  H HH22 . ARG B 1 126 ? 52.806  32.094  -7.662  1.00 0.00 ? 126 ARG B HH22 1  
ATOM 10920  N N    . ALA B 1 127 ? 46.180  28.462  -8.039  1.00 0.00 ? 127 ALA B N    1  
ATOM 10921  C CA   . ALA B 1 127 ? 45.508  29.504  -7.221  1.00 0.00 ? 127 ALA B CA   1  
ATOM 10922  C C    . ALA B 1 127 ? 45.045  28.856  -5.915  1.00 0.00 ? 127 ALA B C    1  
ATOM 10923  O O    . ALA B 1 127 ? 44.919  29.504  -4.896  1.00 0.00 ? 127 ALA B O    1  
ATOM 10924  C CB   . ALA B 1 127 ? 44.299  30.056  -7.981  1.00 0.00 ? 127 ALA B CB   1  
ATOM 10925  H H    . ALA B 1 127 ? 45.807  28.201  -8.907  1.00 0.00 ? 127 ALA B H    1  
ATOM 10926  H HA   . ALA B 1 127 ? 46.202  30.303  -7.006  1.00 0.00 ? 127 ALA B HA   1  
ATOM 10927  H HB1  . ALA B 1 127 ? 44.253  31.128  -7.854  1.00 0.00 ? 127 ALA B HB1  1  
ATOM 10928  H HB2  . ALA B 1 127 ? 43.395  29.608  -7.595  1.00 0.00 ? 127 ALA B HB2  1  
ATOM 10929  H HB3  . ALA B 1 127 ? 44.396  29.821  -9.031  1.00 0.00 ? 127 ALA B HB3  1  
ATOM 10930  N N    . ALA B 1 128 ? 44.816  27.565  -5.940  1.00 0.00 ? 128 ALA B N    1  
ATOM 10931  C CA   . ALA B 1 128 ? 44.386  26.856  -4.700  1.00 0.00 ? 128 ALA B CA   1  
ATOM 10932  C C    . ALA B 1 128 ? 45.569  26.805  -3.730  1.00 0.00 ? 128 ALA B C    1  
ATOM 10933  O O    . ALA B 1 128 ? 45.418  26.974  -2.536  1.00 0.00 ? 128 ALA B O    1  
ATOM 10934  C CB   . ALA B 1 128 ? 43.940  25.437  -5.050  1.00 0.00 ? 128 ALA B CB   1  
ATOM 10935  H H    . ALA B 1 128 ? 44.942  27.062  -6.772  1.00 0.00 ? 128 ALA B H    1  
ATOM 10936  H HA   . ALA B 1 128 ? 43.567  27.392  -4.242  1.00 0.00 ? 128 ALA B HA   1  
ATOM 10937  H HB1  . ALA B 1 128 ? 43.344  25.459  -5.951  1.00 0.00 ? 128 ALA B HB1  1  
ATOM 10938  H HB2  . ALA B 1 128 ? 43.352  25.033  -4.239  1.00 0.00 ? 128 ALA B HB2  1  
ATOM 10939  H HB3  . ALA B 1 128 ? 44.809  24.815  -5.209  1.00 0.00 ? 128 ALA B HB3  1  
ATOM 10940  N N    . ASP B 1 129 ? 46.750  26.572  -4.243  1.00 0.00 ? 129 ASP B N    1  
ATOM 10941  C CA   . ASP B 1 129 ? 47.951  26.508  -3.361  1.00 0.00 ? 129 ASP B CA   1  
ATOM 10942  C C    . ASP B 1 129 ? 48.213  27.889  -2.767  1.00 0.00 ? 129 ASP B C    1  
ATOM 10943  O O    . ASP B 1 129 ? 48.553  28.019  -1.603  1.00 0.00 ? 129 ASP B O    1  
ATOM 10944  C CB   . ASP B 1 129 ? 49.172  26.058  -4.180  1.00 0.00 ? 129 ASP B CB   1  
ATOM 10945  C CG   . ASP B 1 129 ? 49.007  24.584  -4.556  1.00 0.00 ? 129 ASP B CG   1  
ATOM 10946  O OD1  . ASP B 1 129 ? 48.149  23.936  -3.978  1.00 0.00 ? 129 ASP B OD1  1  
ATOM 10947  O OD2  . ASP B 1 129 ? 49.747  24.130  -5.413  1.00 0.00 ? 129 ASP B OD2  1  
ATOM 10948  H H    . ASP B 1 129 ? 46.845  26.439  -5.209  1.00 0.00 ? 129 ASP B H    1  
ATOM 10949  H HA   . ASP B 1 129 ? 47.774  25.802  -2.563  1.00 0.00 ? 129 ASP B HA   1  
ATOM 10950  H HB2  . ASP B 1 129 ? 49.246  26.657  -5.078  1.00 0.00 ? 129 ASP B HB2  1  
ATOM 10951  H HB3  . ASP B 1 129 ? 50.068  26.180  -3.590  1.00 0.00 ? 129 ASP B HB3  1  
ATOM 10952  N N    . VAL B 1 130 ? 48.048  28.921  -3.546  1.00 0.00 ? 130 VAL B N    1  
ATOM 10953  C CA   . VAL B 1 130 ? 48.283  30.297  -3.019  1.00 0.00 ? 130 VAL B CA   1  
ATOM 10954  C C    . VAL B 1 130 ? 47.196  30.625  -1.991  1.00 0.00 ? 130 VAL B C    1  
ATOM 10955  O O    . VAL B 1 130 ? 47.465  31.203  -0.955  1.00 0.00 ? 130 VAL B O    1  
ATOM 10956  C CB   . VAL B 1 130 ? 48.243  31.301  -4.181  1.00 0.00 ? 130 VAL B CB   1  
ATOM 10957  C CG1  . VAL B 1 130 ? 48.973  30.720  -5.391  1.00 0.00 ? 130 VAL B CG1  1  
ATOM 10958  C CG2  . VAL B 1 130 ? 46.783  31.575  -4.553  1.00 0.00 ? 130 VAL B CG2  1  
ATOM 10959  H H    . VAL B 1 130 ? 47.766  28.793  -4.475  1.00 0.00 ? 130 VAL B H    1  
ATOM 10960  H HA   . VAL B 1 130 ? 49.251  30.337  -2.541  1.00 0.00 ? 130 VAL B HA   1  
ATOM 10961  H HB   . VAL B 1 130 ? 48.720  32.223  -3.879  1.00 0.00 ? 130 VAL B HB   1  
ATOM 10962  H HG11 . VAL B 1 130 ? 49.594  31.483  -5.837  1.00 0.00 ? 130 VAL B HG11 1  
ATOM 10963  H HG12 . VAL B 1 130 ? 48.251  30.374  -6.116  1.00 0.00 ? 130 VAL B HG12 1  
ATOM 10964  H HG13 . VAL B 1 130 ? 49.591  29.891  -5.076  1.00 0.00 ? 130 VAL B HG13 1  
ATOM 10965  H HG21 . VAL B 1 130 ? 46.739  32.024  -5.534  1.00 0.00 ? 130 VAL B HG21 1  
ATOM 10966  H HG22 . VAL B 1 130 ? 46.347  32.247  -3.829  1.00 0.00 ? 130 VAL B HG22 1  
ATOM 10967  H HG23 . VAL B 1 130 ? 46.233  30.646  -4.557  1.00 0.00 ? 130 VAL B HG23 1  
ATOM 10968  N N    . ARG B 1 131 ? 45.983  30.238  -2.256  1.00 0.00 ? 131 ARG B N    1  
ATOM 10969  C CA   . ARG B 1 131 ? 44.870  30.498  -1.295  1.00 0.00 ? 131 ARG B CA   1  
ATOM 10970  C C    . ARG B 1 131 ? 45.182  29.813  0.039   1.00 0.00 ? 131 ARG B C    1  
ATOM 10971  O O    . ARG B 1 131 ? 44.923  30.338  1.104   1.00 0.00 ? 131 ARG B O    1  
ATOM 10972  C CB   . ARG B 1 131 ? 43.570  29.930  -1.851  1.00 0.00 ? 131 ARG B CB   1  
ATOM 10973  C CG   . ARG B 1 131 ? 42.405  30.316  -0.937  1.00 0.00 ? 131 ARG B CG   1  
ATOM 10974  C CD   . ARG B 1 131 ? 41.107  29.734  -1.489  1.00 0.00 ? 131 ARG B CD   1  
ATOM 10975  N NE   . ARG B 1 131 ? 40.847  30.321  -2.835  1.00 0.00 ? 131 ARG B NE   1  
ATOM 10976  C CZ   . ARG B 1 131 ? 40.277  31.491  -2.946  1.00 0.00 ? 131 ARG B CZ   1  
ATOM 10977  N NH1  . ARG B 1 131 ? 39.992  32.182  -1.877  1.00 0.00 ? 131 ARG B NH1  1  
ATOM 10978  N NH2  . ARG B 1 131 ? 40.007  31.979  -4.125  1.00 0.00 ? 131 ARG B NH2  1  
ATOM 10979  H H    . ARG B 1 131 ? 45.800  29.756  -3.090  1.00 0.00 ? 131 ARG B H    1  
ATOM 10980  H HA   . ARG B 1 131 ? 44.765  31.563  -1.141  1.00 0.00 ? 131 ARG B HA   1  
ATOM 10981  H HB2  . ARG B 1 131 ? 43.399  30.327  -2.842  1.00 0.00 ? 131 ARG B HB2  1  
ATOM 10982  H HB3  . ARG B 1 131 ? 43.641  28.853  -1.903  1.00 0.00 ? 131 ARG B HB3  1  
ATOM 10983  H HG2  . ARG B 1 131 ? 42.582  29.927  0.056   1.00 0.00 ? 131 ARG B HG2  1  
ATOM 10984  H HG3  . ARG B 1 131 ? 42.324  31.393  -0.893  1.00 0.00 ? 131 ARG B HG3  1  
ATOM 10985  H HD2  . ARG B 1 131 ? 41.199  28.661  -1.573  1.00 0.00 ? 131 ARG B HD2  1  
ATOM 10986  H HD3  . ARG B 1 131 ? 40.290  29.977  -0.826  1.00 0.00 ? 131 ARG B HD3  1  
ATOM 10987  H HE   . ARG B 1 131 ? 41.087  29.818  -3.641  1.00 0.00 ? 131 ARG B HE   1  
ATOM 10988  H HH11 . ARG B 1 131 ? 40.209  31.817  -0.972  1.00 0.00 ? 131 ARG B HH11 1  
ATOM 10989  H HH12 . ARG B 1 131 ? 39.556  33.078  -1.962  1.00 0.00 ? 131 ARG B HH12 1  
ATOM 10990  H HH21 . ARG B 1 131 ? 40.236  31.457  -4.947  1.00 0.00 ? 131 ARG B HH21 1  
ATOM 10991  H HH22 . ARG B 1 131 ? 39.571  32.874  -4.208  1.00 0.00 ? 131 ARG B HH22 1  
ATOM 10992  N N    . ASP B 1 132 ? 45.714  28.623  -0.022  1.00 0.00 ? 132 ASP B N    1  
ATOM 10993  C CA   . ASP B 1 132 ? 46.034  27.861  1.219   1.00 0.00 ? 132 ASP B CA   1  
ATOM 10994  C C    . ASP B 1 132 ? 47.028  28.640  2.079   1.00 0.00 ? 132 ASP B C    1  
ATOM 10995  O O    . ASP B 1 132 ? 46.939  28.653  3.289   1.00 0.00 ? 132 ASP B O    1  
ATOM 10996  C CB   . ASP B 1 132 ? 46.643  26.509  0.828   1.00 0.00 ? 132 ASP B CB   1  
ATOM 10997  C CG   . ASP B 1 132 ? 46.877  25.669  2.084   1.00 0.00 ? 132 ASP B CG   1  
ATOM 10998  O OD1  . ASP B 1 132 ? 46.723  26.202  3.167   1.00 0.00 ? 132 ASP B OD1  1  
ATOM 10999  O OD2  . ASP B 1 132 ? 47.209  24.502  1.939   1.00 0.00 ? 132 ASP B OD2  1  
ATOM 11000  H H    . ASP B 1 132 ? 45.892  28.219  -0.897  1.00 0.00 ? 132 ASP B H    1  
ATOM 11001  H HA   . ASP B 1 132 ? 45.128  27.695  1.782   1.00 0.00 ? 132 ASP B HA   1  
ATOM 11002  H HB2  . ASP B 1 132 ? 45.965  25.988  0.167   1.00 0.00 ? 132 ASP B HB2  1  
ATOM 11003  H HB3  . ASP B 1 132 ? 47.584  26.670  0.324   1.00 0.00 ? 132 ASP B HB3  1  
ATOM 11004  N N    . ILE B 1 133 ? 47.990  29.269  1.465   1.00 0.00 ? 133 ILE B N    1  
ATOM 11005  C CA   . ILE B 1 133 ? 49.001  30.024  2.258   1.00 0.00 ? 133 ILE B CA   1  
ATOM 11006  C C    . ILE B 1 133 ? 48.311  31.113  3.079   1.00 0.00 ? 133 ILE B C    1  
ATOM 11007  O O    . ILE B 1 133 ? 48.590  31.291  4.247   1.00 0.00 ? 133 ILE B O    1  
ATOM 11008  C CB   . ILE B 1 133 ? 50.019  30.664  1.304   1.00 0.00 ? 133 ILE B CB   1  
ATOM 11009  C CG1  . ILE B 1 133 ? 51.339  30.892  2.061   1.00 0.00 ? 133 ILE B CG1  1  
ATOM 11010  C CG2  . ILE B 1 133 ? 49.471  32.008  0.796   1.00 0.00 ? 133 ILE B CG2  1  
ATOM 11011  C CD1  . ILE B 1 133 ? 52.011  29.544  2.383   1.00 0.00 ? 133 ILE B CD1  1  
ATOM 11012  H H    . ILE B 1 133 ? 48.058  29.232  0.488   1.00 0.00 ? 133 ILE B H    1  
ATOM 11013  H HA   . ILE B 1 133 ? 49.514  29.345  2.923   1.00 0.00 ? 133 ILE B HA   1  
ATOM 11014  H HB   . ILE B 1 133 ? 50.191  30.005  0.466   1.00 0.00 ? 133 ILE B HB   1  
ATOM 11015  H HG12 . ILE B 1 133 ? 52.003  31.486  1.451   1.00 0.00 ? 133 ILE B HG12 1  
ATOM 11016  H HG13 . ILE B 1 133 ? 51.136  31.417  2.983   1.00 0.00 ? 133 ILE B HG13 1  
ATOM 11017  H HG21 . ILE B 1 133 ? 50.021  32.311  -0.084  1.00 0.00 ? 133 ILE B HG21 1  
ATOM 11018  H HG22 . ILE B 1 133 ? 49.584  32.757  1.566   1.00 0.00 ? 133 ILE B HG22 1  
ATOM 11019  H HG23 . ILE B 1 133 ? 48.426  31.900  0.547   1.00 0.00 ? 133 ILE B HG23 1  
ATOM 11020  H HD11 . ILE B 1 133 ? 51.682  29.201  3.352   1.00 0.00 ? 133 ILE B HD11 1  
ATOM 11021  H HD12 . ILE B 1 133 ? 53.083  29.670  2.390   1.00 0.00 ? 133 ILE B HD12 1  
ATOM 11022  H HD13 . ILE B 1 133 ? 51.739  28.818  1.631   1.00 0.00 ? 133 ILE B HD13 1  
ATOM 11023  N N    . GLY B 1 134 ? 47.410  31.847  2.485   1.00 0.00 ? 134 GLY B N    1  
ATOM 11024  C CA   . GLY B 1 134 ? 46.709  32.926  3.243   1.00 0.00 ? 134 GLY B CA   1  
ATOM 11025  C C    . GLY B 1 134 ? 45.732  32.321  4.254   1.00 0.00 ? 134 GLY B C    1  
ATOM 11026  O O    . GLY B 1 134 ? 45.514  32.864  5.321   1.00 0.00 ? 134 GLY B O    1  
ATOM 11027  H H    . GLY B 1 134 ? 47.195  31.691  1.542   1.00 0.00 ? 134 GLY B H    1  
ATOM 11028  H HA2  . GLY B 1 134 ? 47.440  33.526  3.766   1.00 0.00 ? 134 GLY B HA2  1  
ATOM 11029  H HA3  . GLY B 1 134 ? 46.163  33.551  2.552   1.00 0.00 ? 134 GLY B HA3  1  
ATOM 11030  N N    . LYS B 1 135 ? 45.127  31.217  3.918   1.00 0.00 ? 135 LYS B N    1  
ATOM 11031  C CA   . LYS B 1 135 ? 44.146  30.579  4.847   1.00 0.00 ? 135 LYS B CA   1  
ATOM 11032  C C    . LYS B 1 135 ? 44.846  30.231  6.170   1.00 0.00 ? 135 LYS B C    1  
ATOM 11033  O O    . LYS B 1 135 ? 44.354  30.520  7.248   1.00 0.00 ? 135 LYS B O    1  
ATOM 11034  C CB   . LYS B 1 135 ? 43.618  29.299  4.184   1.00 0.00 ? 135 LYS B CB   1  
ATOM 11035  C CG   . LYS B 1 135 ? 42.583  28.613  5.088   1.00 0.00 ? 135 LYS B CG   1  
ATOM 11036  C CD   . LYS B 1 135 ? 42.047  27.355  4.380   1.00 0.00 ? 135 LYS B CD   1  
ATOM 11037  C CE   . LYS B 1 135 ? 40.987  26.668  5.251   1.00 0.00 ? 135 LYS B CE   1  
ATOM 11038  N NZ   . LYS B 1 135 ? 41.616  26.212  6.524   1.00 0.00 ? 135 LYS B NZ   1  
ATOM 11039  H H    . LYS B 1 135 ? 45.306  30.809  3.046   1.00 0.00 ? 135 LYS B H    1  
ATOM 11040  H HA   . LYS B 1 135 ? 43.326  31.257  5.035   1.00 0.00 ? 135 LYS B HA   1  
ATOM 11041  H HB2  . LYS B 1 135 ? 43.157  29.551  3.239   1.00 0.00 ? 135 LYS B HB2  1  
ATOM 11042  H HB3  . LYS B 1 135 ? 44.441  28.622  4.009   1.00 0.00 ? 135 LYS B HB3  1  
ATOM 11043  H HG2  . LYS B 1 135 ? 43.048  28.334  6.023   1.00 0.00 ? 135 LYS B HG2  1  
ATOM 11044  H HG3  . LYS B 1 135 ? 41.765  29.291  5.280   1.00 0.00 ? 135 LYS B HG3  1  
ATOM 11045  H HD2  . LYS B 1 135 ? 41.606  27.637  3.435   1.00 0.00 ? 135 LYS B HD2  1  
ATOM 11046  H HD3  . LYS B 1 135 ? 42.863  26.669  4.203   1.00 0.00 ? 135 LYS B HD3  1  
ATOM 11047  H HE2  . LYS B 1 135 ? 40.194  27.367  5.470   1.00 0.00 ? 135 LYS B HE2  1  
ATOM 11048  H HE3  . LYS B 1 135 ? 40.583  25.816  4.722   1.00 0.00 ? 135 LYS B HE3  1  
ATOM 11049  H HZ1  . LYS B 1 135 ? 41.261  26.788  7.313   1.00 0.00 ? 135 LYS B HZ1  1  
ATOM 11050  H HZ2  . LYS B 1 135 ? 42.650  26.314  6.456   1.00 0.00 ? 135 LYS B HZ2  1  
ATOM 11051  H HZ3  . LYS B 1 135 ? 41.376  25.214  6.692   1.00 0.00 ? 135 LYS B HZ3  1  
ATOM 11052  N N    . ARG B 1 136 ? 45.992  29.615  6.098   1.00 0.00 ? 136 ARG B N    1  
ATOM 11053  C CA   . ARG B 1 136 ? 46.727  29.239  7.339   1.00 0.00 ? 136 ARG B CA   1  
ATOM 11054  C C    . ARG B 1 136 ? 47.262  30.493  8.028   1.00 0.00 ? 136 ARG B C    1  
ATOM 11055  O O    . ARG B 1 136 ? 47.390  30.545  9.237   1.00 0.00 ? 136 ARG B O    1  
ATOM 11056  C CB   . ARG B 1 136 ? 47.899  28.338  6.963   1.00 0.00 ? 136 ARG B CB   1  
ATOM 11057  C CG   . ARG B 1 136 ? 47.370  27.083  6.265   1.00 0.00 ? 136 ARG B CG   1  
ATOM 11058  C CD   . ARG B 1 136 ? 46.869  26.099  7.319   1.00 0.00 ? 136 ARG B CD   1  
ATOM 11059  N NE   . ARG B 1 136 ? 46.456  24.838  6.643   1.00 0.00 ? 136 ARG B NE   1  
ATOM 11060  C CZ   . ARG B 1 136 ? 45.258  24.723  6.149   1.00 0.00 ? 136 ARG B CZ   1  
ATOM 11061  N NH1  . ARG B 1 136 ? 44.442  25.742  6.178   1.00 0.00 ? 136 ARG B NH1  1  
ATOM 11062  N NH2  . ARG B 1 136 ? 44.877  23.600  5.611   1.00 0.00 ? 136 ARG B NH2  1  
ATOM 11063  H H    . ARG B 1 136 ? 46.372  29.394  5.222   1.00 0.00 ? 136 ARG B H    1  
ATOM 11064  H HA   . ARG B 1 136 ? 46.065  28.711  8.009   1.00 0.00 ? 136 ARG B HA   1  
ATOM 11065  H HB2  . ARG B 1 136 ? 48.563  28.870  6.296   1.00 0.00 ? 136 ARG B HB2  1  
ATOM 11066  H HB3  . ARG B 1 136 ? 48.436  28.053  7.855   1.00 0.00 ? 136 ARG B HB3  1  
ATOM 11067  H HG2  . ARG B 1 136 ? 46.558  27.352  5.604   1.00 0.00 ? 136 ARG B HG2  1  
ATOM 11068  H HG3  . ARG B 1 136 ? 48.163  26.624  5.694   1.00 0.00 ? 136 ARG B HG3  1  
ATOM 11069  H HD2  . ARG B 1 136 ? 47.660  25.890  8.024   1.00 0.00 ? 136 ARG B HD2  1  
ATOM 11070  H HD3  . ARG B 1 136 ? 46.023  26.524  7.838   1.00 0.00 ? 136 ARG B HD3  1  
ATOM 11071  H HE   . ARG B 1 136 ? 47.080  24.085  6.591   1.00 0.00 ? 136 ARG B HE   1  
ATOM 11072  H HH11 . ARG B 1 136 ? 44.739  26.608  6.579   1.00 0.00 ? 136 ARG B HH11 1  
ATOM 11073  H HH12 . ARG B 1 136 ? 43.521  25.657  5.799   1.00 0.00 ? 136 ARG B HH12 1  
ATOM 11074  H HH21 . ARG B 1 136 ? 45.506  22.823  5.576   1.00 0.00 ? 136 ARG B HH21 1  
ATOM 11075  H HH22 . ARG B 1 136 ? 43.956  23.514  5.232   1.00 0.00 ? 136 ARG B HH22 1  
ATOM 11076  N N    . LEU B 1 137 ? 47.584  31.500  7.273   1.00 0.00 ? 137 LEU B N    1  
ATOM 11077  C CA   . LEU B 1 137 ? 48.122  32.741  7.883   1.00 0.00 ? 137 LEU B CA   1  
ATOM 11078  C C    . LEU B 1 137 ? 47.102  33.278  8.884   1.00 0.00 ? 137 LEU B C    1  
ATOM 11079  O O    . LEU B 1 137 ? 47.442  33.690  9.972   1.00 0.00 ? 137 LEU B O    1  
ATOM 11080  C CB   . LEU B 1 137 ? 48.370  33.771  6.771   1.00 0.00 ? 137 LEU B CB   1  
ATOM 11081  C CG   . LEU B 1 137 ? 49.715  33.526  6.071   1.00 0.00 ? 137 LEU B CG   1  
ATOM 11082  C CD1  . LEU B 1 137 ? 49.841  34.445  4.838   1.00 0.00 ? 137 LEU B CD1  1  
ATOM 11083  C CD2  . LEU B 1 137 ? 50.877  33.787  7.073   1.00 0.00 ? 137 LEU B CD2  1  
ATOM 11084  H H    . LEU B 1 137 ? 47.480  31.438  6.301   1.00 0.00 ? 137 LEU B H    1  
ATOM 11085  H HA   . LEU B 1 137 ? 49.050  32.524  8.391   1.00 0.00 ? 137 LEU B HA   1  
ATOM 11086  H HB2  . LEU B 1 137 ? 47.576  33.703  6.042   1.00 0.00 ? 137 LEU B HB2  1  
ATOM 11087  H HB3  . LEU B 1 137 ? 48.371  34.762  7.201   1.00 0.00 ? 137 LEU B HB3  1  
ATOM 11088  H HG   . LEU B 1 137 ? 49.755  32.496  5.743   1.00 0.00 ? 137 LEU B HG   1  
ATOM 11089  H HD11 . LEU B 1 137 ? 48.908  34.965  4.680   1.00 0.00 ? 137 LEU B HD11 1  
ATOM 11090  H HD12 . LEU B 1 137 ? 50.074  33.849  3.967   1.00 0.00 ? 137 LEU B HD12 1  
ATOM 11091  H HD13 . LEU B 1 137 ? 50.630  35.163  5.004   1.00 0.00 ? 137 LEU B HD13 1  
ATOM 11092  H HD21 . LEU B 1 137 ? 50.495  34.308  7.939   1.00 0.00 ? 137 LEU B HD21 1  
ATOM 11093  H HD22 . LEU B 1 137 ? 51.636  34.390  6.597   1.00 0.00 ? 137 LEU B HD22 1  
ATOM 11094  H HD23 . LEU B 1 137 ? 51.307  32.845  7.379   1.00 0.00 ? 137 LEU B HD23 1  
ATOM 11095  N N    . LEU B 1 138 ? 45.851  33.253  8.535   1.00 0.00 ? 138 LEU B N    1  
ATOM 11096  C CA   . LEU B 1 138 ? 44.809  33.741  9.478   1.00 0.00 ? 138 LEU B CA   1  
ATOM 11097  C C    . LEU B 1 138 ? 44.840  32.894  10.747  1.00 0.00 ? 138 LEU B C    1  
ATOM 11098  O O    . LEU B 1 138 ? 44.710  33.399  11.843  1.00 0.00 ? 138 LEU B O    1  
ATOM 11099  C CB   . LEU B 1 138 ? 43.437  33.636  8.823   1.00 0.00 ? 138 LEU B CB   1  
ATOM 11100  C CG   . LEU B 1 138 ? 43.160  34.879  7.968   1.00 0.00 ? 138 LEU B CG   1  
ATOM 11101  C CD1  . LEU B 1 138 ? 42.755  36.036  8.885   1.00 0.00 ? 138 LEU B CD1  1  
ATOM 11102  C CD2  . LEU B 1 138 ? 44.425  35.268  7.185   1.00 0.00 ? 138 LEU B CD2  1  
ATOM 11103  H H    . LEU B 1 138 ? 45.592  32.899  7.659   1.00 0.00 ? 138 LEU B H    1  
ATOM 11104  H HA   . LEU B 1 138 ? 45.009  34.772  9.731   1.00 0.00 ? 138 LEU B HA   1  
ATOM 11105  H HB2  . LEU B 1 138 ? 43.407  32.757  8.196   1.00 0.00 ? 138 LEU B HB2  1  
ATOM 11106  H HB3  . LEU B 1 138 ? 42.680  33.555  9.589   1.00 0.00 ? 138 LEU B HB3  1  
ATOM 11107  H HG   . LEU B 1 138 ? 42.356  34.669  7.277   1.00 0.00 ? 138 LEU B HG   1  
ATOM 11108  H HD11 . LEU B 1 138 ? 42.237  36.789  8.308   1.00 0.00 ? 138 LEU B HD11 1  
ATOM 11109  H HD12 . LEU B 1 138 ? 43.638  36.469  9.331   1.00 0.00 ? 138 LEU B HD12 1  
ATOM 11110  H HD13 . LEU B 1 138 ? 42.102  35.667  9.663   1.00 0.00 ? 138 LEU B HD13 1  
ATOM 11111  H HD21 . LEU B 1 138 ? 44.150  35.874  6.335   1.00 0.00 ? 138 LEU B HD21 1  
ATOM 11112  H HD22 . LEU B 1 138 ? 44.926  34.375  6.844   1.00 0.00 ? 138 LEU B HD22 1  
ATOM 11113  H HD23 . LEU B 1 138 ? 45.088  35.829  7.828   1.00 0.00 ? 138 LEU B HD23 1  
ATOM 11114  N N    . ARG B 1 139 ? 45.025  31.608  10.610  1.00 0.00 ? 139 ARG B N    1  
ATOM 11115  C CA   . ARG B 1 139 ? 45.075  30.758  11.833  1.00 0.00 ? 139 ARG B CA   1  
ATOM 11116  C C    . ARG B 1 139 ? 46.343  31.111  12.621  1.00 0.00 ? 139 ARG B C    1  
ATOM 11117  O O    . ARG B 1 139 ? 46.340  31.172  13.836  1.00 0.00 ? 139 ARG B O    1  
ATOM 11118  C CB   . ARG B 1 139 ? 45.114  29.273  11.445  1.00 0.00 ? 139 ARG B CB   1  
ATOM 11119  C CG   . ARG B 1 139 ? 43.771  28.851  10.815  1.00 0.00 ? 139 ARG B CG   1  
ATOM 11120  C CD   . ARG B 1 139 ? 43.582  27.324  10.925  1.00 0.00 ? 139 ARG B CD   1  
ATOM 11121  N NE   . ARG B 1 139 ? 44.683  26.634  10.188  1.00 0.00 ? 139 ARG B NE   1  
ATOM 11122  C CZ   . ARG B 1 139 ? 44.739  25.327  10.164  1.00 0.00 ? 139 ARG B CZ   1  
ATOM 11123  N NH1  . ARG B 1 139 ? 43.776  24.619  10.690  1.00 0.00 ? 139 ARG B NH1  1  
ATOM 11124  N NH2  . ARG B 1 139 ? 45.747  24.727  9.593   1.00 0.00 ? 139 ARG B NH2  1  
ATOM 11125  H H    . ARG B 1 139 ? 45.138  31.211  9.721   1.00 0.00 ? 139 ARG B H    1  
ATOM 11126  H HA   . ARG B 1 139 ? 44.204  30.952  12.444  1.00 0.00 ? 139 ARG B HA   1  
ATOM 11127  H HB2  . ARG B 1 139 ? 45.911  29.111  10.733  1.00 0.00 ? 139 ARG B HB2  1  
ATOM 11128  H HB3  . ARG B 1 139 ? 45.297  28.677  12.327  1.00 0.00 ? 139 ARG B HB3  1  
ATOM 11129  H HG2  . ARG B 1 139 ? 42.964  29.350  11.330  1.00 0.00 ? 139 ARG B HG2  1  
ATOM 11130  H HG3  . ARG B 1 139 ? 43.761  29.136  9.773   1.00 0.00 ? 139 ARG B HG3  1  
ATOM 11131  H HD2  . ARG B 1 139 ? 43.606  27.032  11.965  1.00 0.00 ? 139 ARG B HD2  1  
ATOM 11132  H HD3  . ARG B 1 139 ? 42.631  27.046  10.495  1.00 0.00 ? 139 ARG B HD3  1  
ATOM 11133  H HE   . ARG B 1 139 ? 45.383  27.162  9.751   1.00 0.00 ? 139 ARG B HE   1  
ATOM 11134  H HH11 . ARG B 1 139 ? 42.993  25.076  11.113  1.00 0.00 ? 139 ARG B HH11 1  
ATOM 11135  H HH12 . ARG B 1 139 ? 43.821  23.620  10.670  1.00 0.00 ? 139 ARG B HH12 1  
ATOM 11136  H HH21 . ARG B 1 139 ? 46.478  25.266  9.173   1.00 0.00 ? 139 ARG B HH21 1  
ATOM 11137  H HH22 . ARG B 1 139 ? 45.789  23.728  9.574   1.00 0.00 ? 139 ARG B HH22 1  
ATOM 11138  N N    . ASN B 1 140 ? 47.429  31.332  11.930  1.00 0.00 ? 140 ASN B N    1  
ATOM 11139  C CA   . ASN B 1 140 ? 48.718  31.672  12.601  1.00 0.00 ? 140 ASN B CA   1  
ATOM 11140  C C    . ASN B 1 140 ? 48.607  32.984  13.385  1.00 0.00 ? 140 ASN B C    1  
ATOM 11141  O O    . ASN B 1 140 ? 49.159  33.111  14.462  1.00 0.00 ? 140 ASN B O    1  
ATOM 11142  C CB   . ASN B 1 140 ? 49.821  31.797  11.545  1.00 0.00 ? 140 ASN B CB   1  
ATOM 11143  C CG   . ASN B 1 140 ? 50.131  30.410  10.976  1.00 0.00 ? 140 ASN B CG   1  
ATOM 11144  O OD1  . ASN B 1 140 ? 49.970  30.176  9.796   1.00 0.00 ? 140 ASN B OD1  1  
ATOM 11145  N ND2  . ASN B 1 140 ? 50.580  29.475  11.769  1.00 0.00 ? 140 ASN B ND2  1  
ATOM 11146  H H    . ASN B 1 140 ? 47.398  31.268  10.952  1.00 0.00 ? 140 ASN B H    1  
ATOM 11147  H HA   . ASN B 1 140 ? 48.978  30.876  13.284  1.00 0.00 ? 140 ASN B HA   1  
ATOM 11148  H HB2  . ASN B 1 140 ? 49.487  32.448  10.750  1.00 0.00 ? 140 ASN B HB2  1  
ATOM 11149  H HB3  . ASN B 1 140 ? 50.711  32.206  11.999  1.00 0.00 ? 140 ASN B HB3  1  
ATOM 11150  H HD21 . ASN B 1 140 ? 50.716  29.664  12.721  1.00 0.00 ? 140 ASN B HD21 1  
ATOM 11151  H HD22 . ASN B 1 140 ? 50.781  28.585  11.412  1.00 0.00 ? 140 ASN B HD22 1  
ATOM 11152  N N    . ILE B 1 141 ? 47.906  33.965  12.885  1.00 0.00 ? 141 ILE B N    1  
ATOM 11153  C CA   . ILE B 1 141 ? 47.789  35.238  13.649  1.00 0.00 ? 141 ILE B CA   1  
ATOM 11154  C C    . ILE B 1 141 ? 46.896  34.981  14.859  1.00 0.00 ? 141 ILE B C    1  
ATOM 11155  O O    . ILE B 1 141 ? 47.179  35.408  15.959  1.00 0.00 ? 141 ILE B O    1  
ATOM 11156  C CB   . ILE B 1 141 ? 47.162  36.312  12.737  1.00 0.00 ? 141 ILE B CB   1  
ATOM 11157  C CG1  . ILE B 1 141 ? 48.152  36.637  11.605  1.00 0.00 ? 141 ILE B CG1  1  
ATOM 11158  C CG2  . ILE B 1 141 ? 46.824  37.597  13.539  1.00 0.00 ? 141 ILE B CG2  1  
ATOM 11159  C CD1  . ILE B 1 141 ? 47.461  37.490  10.539  1.00 0.00 ? 141 ILE B CD1  1  
ATOM 11160  H H    . ILE B 1 141 ? 47.458  33.863  12.020  1.00 0.00 ? 141 ILE B H    1  
ATOM 11161  H HA   . ILE B 1 141 ? 48.766  35.561  13.977  1.00 0.00 ? 141 ILE B HA   1  
ATOM 11162  H HB   . ILE B 1 141 ? 46.252  35.918  12.307  1.00 0.00 ? 141 ILE B HB   1  
ATOM 11163  H HG12 . ILE B 1 141 ? 48.994  37.180  12.010  1.00 0.00 ? 141 ILE B HG12 1  
ATOM 11164  H HG13 . ILE B 1 141 ? 48.500  35.718  11.158  1.00 0.00 ? 141 ILE B HG13 1  
ATOM 11165  H HG21 . ILE B 1 141 ? 45.917  37.439  14.106  1.00 0.00 ? 141 ILE B HG21 1  
ATOM 11166  H HG22 . ILE B 1 141 ? 46.681  38.421  12.856  1.00 0.00 ? 141 ILE B HG22 1  
ATOM 11167  H HG23 . ILE B 1 141 ? 47.636  37.825  14.214  1.00 0.00 ? 141 ILE B HG23 1  
ATOM 11168  H HD11 . ILE B 1 141 ? 46.788  36.871  9.963   1.00 0.00 ? 141 ILE B HD11 1  
ATOM 11169  H HD12 . ILE B 1 141 ? 48.205  37.919  9.883   1.00 0.00 ? 141 ILE B HD12 1  
ATOM 11170  H HD13 . ILE B 1 141 ? 46.903  38.281  11.017  1.00 0.00 ? 141 ILE B HD13 1  
ATOM 11171  N N    . LEU B 1 142 ? 45.819  34.276  14.661  1.00 0.00 ? 142 LEU B N    1  
ATOM 11172  C CA   . LEU B 1 142 ? 44.910  33.980  15.793  1.00 0.00 ? 142 LEU B CA   1  
ATOM 11173  C C    . LEU B 1 142 ? 45.584  32.973  16.732  1.00 0.00 ? 142 LEU B C    1  
ATOM 11174  O O    . LEU B 1 142 ? 45.378  32.987  17.928  1.00 0.00 ? 142 LEU B O    1  
ATOM 11175  C CB   . LEU B 1 142 ? 43.596  33.395  15.258  1.00 0.00 ? 142 LEU B CB   1  
ATOM 11176  C CG   . LEU B 1 142 ? 42.580  34.516  14.976  1.00 0.00 ? 142 LEU B CG   1  
ATOM 11177  C CD1  . LEU B 1 142 ? 43.144  35.448  13.900  1.00 0.00 ? 142 LEU B CD1  1  
ATOM 11178  C CD2  . LEU B 1 142 ? 41.248  33.920  14.494  1.00 0.00 ? 142 LEU B CD2  1  
ATOM 11179  H H    . LEU B 1 142 ? 45.612  33.938  13.765  1.00 0.00 ? 142 LEU B H    1  
ATOM 11180  H HA   . LEU B 1 142 ? 44.703  34.891  16.335  1.00 0.00 ? 142 LEU B HA   1  
ATOM 11181  H HB2  . LEU B 1 142 ? 43.793  32.854  14.344  1.00 0.00 ? 142 LEU B HB2  1  
ATOM 11182  H HB3  . LEU B 1 142 ? 43.184  32.718  15.992  1.00 0.00 ? 142 LEU B HB3  1  
ATOM 11183  H HG   . LEU B 1 142 ? 42.415  35.081  15.883  1.00 0.00 ? 142 LEU B HG   1  
ATOM 11184  H HD11 . LEU B 1 142 ? 43.333  34.884  12.999  1.00 0.00 ? 142 LEU B HD11 1  
ATOM 11185  H HD12 . LEU B 1 142 ? 44.067  35.885  14.251  1.00 0.00 ? 142 LEU B HD12 1  
ATOM 11186  H HD13 . LEU B 1 142 ? 42.429  36.231  13.693  1.00 0.00 ? 142 LEU B HD13 1  
ATOM 11187  H HD21 . LEU B 1 142 ? 41.428  32.962  14.031  1.00 0.00 ? 142 LEU B HD21 1  
ATOM 11188  H HD22 . LEU B 1 142 ? 40.794  34.588  13.777  1.00 0.00 ? 142 LEU B HD22 1  
ATOM 11189  H HD23 . LEU B 1 142 ? 40.584  33.793  15.337  1.00 0.00 ? 142 LEU B HD23 1  
ATOM 11190  N N    . GLY B 1 143 ? 46.378  32.085  16.191  1.00 0.00 ? 143 GLY B N    1  
ATOM 11191  C CA   . GLY B 1 143 ? 47.126  31.156  17.054  1.00 0.00 ? 143 GLY B CA   1  
ATOM 11192  C C    . GLY B 1 143 ? 46.489  29.826  17.265  1.00 0.00 ? 143 GLY B C    1  
ATOM 11193  O O    . GLY B 1 143 ? 46.916  29.049  18.119  1.00 0.00 ? 143 GLY B O    1  
ATOM 11194  H H    . GLY B 1 143 ? 46.524  32.080  15.223  1.00 0.00 ? 143 GLY B H    1  
ATOM 11195  H HA2  . GLY B 1 143 ? 48.097  30.992  16.613  1.00 0.00 ? 143 GLY B HA2  1  
ATOM 11196  H HA3  . GLY B 1 143 ? 47.271  31.625  18.018  1.00 0.00 ? 143 GLY B HA3  1  
ATOM 11197  N N    . LEU B 1 144 ? 45.487  29.550  16.505  1.00 0.00 ? 144 LEU B N    1  
ATOM 11198  C CA   . LEU B 1 144 ? 44.831  28.296  16.646  1.00 0.00 ? 144 LEU B CA   1  
ATOM 11199  C C    . LEU B 1 144 ? 45.800  27.207  16.207  1.00 0.00 ? 144 LEU B C    1  
ATOM 11200  O O    . LEU B 1 144 ? 46.574  27.394  15.267  1.00 0.00 ? 144 LEU B O    1  
ATOM 11201  C CB   . LEU B 1 144 ? 43.614  28.341  15.750  1.00 0.00 ? 144 LEU B CB   1  
ATOM 11202  C CG   . LEU B 1 144 ? 42.719  29.508  16.204  1.00 0.00 ? 144 LEU B CG   1  
ATOM 11203  C CD1  . LEU B 1 144 ? 41.525  29.639  15.269  1.00 0.00 ? 144 LEU B CD1  1  
ATOM 11204  C CD2  . LEU B 1 144 ? 42.220  29.305  17.646  1.00 0.00 ? 144 LEU B CD2  1  
ATOM 11205  H H    . LEU B 1 144 ? 45.182  30.197  15.835  1.00 0.00 ? 144 LEU B H    1  
ATOM 11206  H HA   . LEU B 1 144 ? 44.546  28.140  17.670  1.00 0.00 ? 144 LEU B HA   1  
ATOM 11207  H HB2  . LEU B 1 144 ? 43.929  28.500  14.728  1.00 0.00 ? 144 LEU B HB2  1  
ATOM 11208  H HB3  . LEU B 1 144 ? 43.085  27.415  15.820  1.00 0.00 ? 144 LEU B HB3  1  
ATOM 11209  H HG   . LEU B 1 144 ? 43.293  30.419  16.158  1.00 0.00 ? 144 LEU B HG   1  
ATOM 11210  H HD11 . LEU B 1 144 ? 41.259  28.671  14.896  1.00 0.00 ? 144 LEU B HD11 1  
ATOM 11211  H HD12 . LEU B 1 144 ? 41.790  30.281  14.441  1.00 0.00 ? 144 LEU B HD12 1  
ATOM 11212  H HD13 . LEU B 1 144 ? 40.692  30.069  15.803  1.00 0.00 ? 144 LEU B HD13 1  
ATOM 11213  H HD21 . LEU B 1 144 ? 42.347  28.279  17.948  1.00 0.00 ? 144 LEU B HD21 1  
ATOM 11214  H HD22 . LEU B 1 144 ? 41.174  29.564  17.702  1.00 0.00 ? 144 LEU B HD22 1  
ATOM 11215  H HD23 . LEU B 1 144 ? 42.781  29.945  18.311  1.00 0.00 ? 144 LEU B HD23 1  
ATOM 11216  N N    . LYS B 1 145 ? 45.785  26.088  16.915  1.00 0.00 ? 145 LYS B N    1  
ATOM 11217  C CA   . LYS B 1 145 ? 46.704  25.002  16.610  1.00 0.00 ? 145 LYS B CA   1  
ATOM 11218  C C    . LYS B 1 145 ? 46.595  24.592  15.154  1.00 0.00 ? 145 LYS B C    1  
ATOM 11219  O O    . LYS B 1 145 ? 45.552  24.754  14.520  1.00 0.00 ? 145 LYS B O    1  
ATOM 11220  C CB   . LYS B 1 145 ? 46.421  23.789  17.503  1.00 0.00 ? 145 LYS B CB   1  
ATOM 11221  C CG   . LYS B 1 145 ? 44.937  23.759  17.873  1.00 0.00 ? 145 LYS B CG   1  
ATOM 11222  C CD   . LYS B 1 145 ? 44.709  24.536  19.173  1.00 0.00 ? 145 LYS B CD   1  
ATOM 11223  C CE   . LYS B 1 145 ? 43.333  25.196  19.129  1.00 0.00 ? 145 LYS B CE   1  
ATOM 11224  N NZ   . LYS B 1 145 ? 43.058  25.860  20.435  1.00 0.00 ? 145 LYS B NZ   1  
ATOM 11225  H H    . LYS B 1 145 ? 45.170  26.003  17.672  1.00 0.00 ? 145 LYS B H    1  
ATOM 11226  H HA   . LYS B 1 145 ? 47.713  25.339  16.799  1.00 0.00 ? 145 LYS B HA   1  
ATOM 11227  H HB2  . LYS B 1 145 ? 46.676  22.885  16.967  1.00 0.00 ? 145 LYS B HB2  1  
ATOM 11228  H HB3  . LYS B 1 145 ? 47.018  23.851  18.401  1.00 0.00 ? 145 LYS B HB3  1  
ATOM 11229  H HG2  . LYS B 1 145 ? 44.355  24.202  17.078  1.00 0.00 ? 145 LYS B HG2  1  
ATOM 11230  H HG3  . LYS B 1 145 ? 44.626  22.735  18.013  1.00 0.00 ? 145 LYS B HG3  1  
ATOM 11231  H HD2  . LYS B 1 145 ? 44.756  23.856  20.011  1.00 0.00 ? 145 LYS B HD2  1  
ATOM 11232  H HD3  . LYS B 1 145 ? 45.466  25.298  19.285  1.00 0.00 ? 145 LYS B HD3  1  
ATOM 11233  H HE2  . LYS B 1 145 ? 43.317  25.935  18.341  1.00 0.00 ? 145 LYS B HE2  1  
ATOM 11234  H HE3  . LYS B 1 145 ? 42.582  24.451  18.934  1.00 0.00 ? 145 LYS B HE3  1  
ATOM 11235  H HZ1  . LYS B 1 145 ? 43.896  25.785  21.045  1.00 0.00 ? 145 LYS B HZ1  1  
ATOM 11236  H HZ2  . LYS B 1 145 ? 42.249  25.396  20.895  1.00 0.00 ? 145 LYS B HZ2  1  
ATOM 11237  H HZ3  . LYS B 1 145 ? 42.838  26.863  20.274  1.00 0.00 ? 145 LYS B HZ3  1  
ATOM 11238  N N    . ILE B 1 146 ? 47.683  24.042  14.641  1.00 0.00 ? 146 ILE B N    1  
ATOM 11239  C CA   . ILE B 1 146 ? 47.720  23.586  13.267  1.00 0.00 ? 146 ILE B CA   1  
ATOM 11240  C C    . ILE B 1 146 ? 47.710  22.076  13.308  1.00 0.00 ? 146 ILE B C    1  
ATOM 11241  O O    . ILE B 1 146 ? 48.601  21.476  13.911  1.00 0.00 ? 146 ILE B O    1  
ATOM 11242  C CB   . ILE B 1 146 ? 49.015  24.079  12.614  1.00 0.00 ? 146 ILE B CB   1  
ATOM 11243  C CG1  . ILE B 1 146 ? 49.179  25.582  12.886  1.00 0.00 ? 146 ILE B CG1  1  
ATOM 11244  C CG2  . ILE B 1 146 ? 48.951  23.839  11.106  1.00 0.00 ? 146 ILE B CG2  1  
ATOM 11245  C CD1  . ILE B 1 146 ? 49.948  25.814  14.199  1.00 0.00 ? 146 ILE B CD1  1  
ATOM 11246  H H    . ILE B 1 146 ? 48.475  23.929  15.206  1.00 0.00 ? 146 ILE B H    1  
ATOM 11247  H HA   . ILE B 1 146 ? 46.864  23.955  12.724  1.00 0.00 ? 146 ILE B HA   1  
ATOM 11248  H HB   . ILE B 1 146 ? 49.856  23.538  13.024  1.00 0.00 ? 146 ILE B HB   1  
ATOM 11249  H HG12 . ILE B 1 146 ? 49.723  26.034  12.070  1.00 0.00 ? 146 ILE B HG12 1  
ATOM 11250  H HG13 . ILE B 1 146 ? 48.204  26.038  12.961  1.00 0.00 ? 146 ILE B HG13 1  
ATOM 11251  H HG21 . ILE B 1 146 ? 48.134  24.405  10.685  1.00 0.00 ? 146 ILE B HG21 1  
ATOM 11252  H HG22 . ILE B 1 146 ? 48.797  22.787  10.915  1.00 0.00 ? 146 ILE B HG22 1  
ATOM 11253  H HG23 . ILE B 1 146 ? 49.880  24.154  10.652  1.00 0.00 ? 146 ILE B HG23 1  
ATOM 11254  H HD11 . ILE B 1 146 ? 49.879  24.942  14.830  1.00 0.00 ? 146 ILE B HD11 1  
ATOM 11255  H HD12 . ILE B 1 146 ? 49.525  26.661  14.717  1.00 0.00 ? 146 ILE B HD12 1  
ATOM 11256  H HD13 . ILE B 1 146 ? 50.983  26.014  13.980  1.00 0.00 ? 146 ILE B HD13 1  
ATOM 11257  N N    . ILE B 1 147 ? 46.672  21.459  12.745  1.00 0.00 ? 147 ILE B N    1  
ATOM 11258  C CA   . ILE B 1 147 ? 46.576  19.988  12.846  1.00 0.00 ? 147 ILE B CA   1  
ATOM 11259  C C    . ILE B 1 147 ? 46.471  19.241  11.524  1.00 0.00 ? 147 ILE B C    1  
ATOM 11260  O O    . ILE B 1 147 ? 45.686  18.337  11.429  1.00 0.00 ? 147 ILE B O    1  
ATOM 11261  C CB   . ILE B 1 147 ? 45.366  19.617  13.719  1.00 0.00 ? 147 ILE B CB   1  
ATOM 11262  C CG1  . ILE B 1 147 ? 45.476  20.321  15.086  1.00 0.00 ? 147 ILE B CG1  1  
ATOM 11263  C CG2  . ILE B 1 147 ? 45.341  18.092  13.944  1.00 0.00 ? 147 ILE B CG2  1  
ATOM 11264  C CD1  . ILE B 1 147 ? 44.174  20.137  15.874  1.00 0.00 ? 147 ILE B