data_2N8A
# 
_entry.id   2N8A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104547   RCSB  
2N8A         PDB   
25888        BMRB  
D_1000104547 WWPDB 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
25888 BMRB unspecified . 
25889 BMRB unspecified . 
25890 BMRB unspecified . 
25891 BMRB unspecified . 
25892 BMRB unspecified . 
25893 BMRB unspecified . 
25894 BMRB unspecified . 
25895 BMRB unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N8A 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Neuhaus, D.'    1 
'Eustermann, S.' 2 
'Yang, J.'       3 
'Wu, W.'         4 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis of Detection and Signaling of DNA Single-Strand Breaks by Human PARP-1.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            60 
_citation.page_first                742 
_citation.page_last                 754 
_citation.year                      2015 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26626479 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2015.10.032 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eustermann, S.'  1 
primary 'Wu, W.F.'        2 
primary 'Langelier, M.F.' 3 
primary 'Yang, J.C.'      4 
primary 'Easton, L.E.'    5 
primary 'Riccio, A.A.'    6 
primary 'Pascal, J.M.'    7 
primary 'Neuhaus, D.'     8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly [ADP-ribose] polymerase 1' 24106.572 1 2.4.2.30 ? 'residues 1-214' ? 
2 polymer     syn 'DNA (45-MER)'                   13871.856 1 ?        ? ?                ? 
3 non-polymer syn 'ZINC ION'                       65.409    2 ?        ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;PARP-1, ADP-ribosyltransferase diphtheria toxin-like 1, ARTD1, NAD(+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] synthase 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHP
GCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD
;
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHP
GCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD
;
A ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DT)(DG)(DG)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DA)(DG)(DA)(DA)(DG)(DC)(DC)(DA)
(DG)(DC)(DT)(DC)(DG)(DC)(DG)(DG)(DT)(DC)(DA)(DG)(DC)(DT)(DT)(DG)(DC)(DT)(DG)(DA)
(DC)(DC)(DG)(DC)(DG)
;
GCTGGCTTCGTAAGAAGCCAGCTCGCGGTCAGCTTGCTGACCGCG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLU n 
1 4   SER n 
1 5   SER n 
1 6   ASP n 
1 7   LYS n 
1 8   LEU n 
1 9   TYR n 
1 10  ARG n 
1 11  VAL n 
1 12  GLU n 
1 13  TYR n 
1 14  ALA n 
1 15  LYS n 
1 16  SER n 
1 17  GLY n 
1 18  ARG n 
1 19  ALA n 
1 20  SER n 
1 21  CYS n 
1 22  LYS n 
1 23  LYS n 
1 24  CYS n 
1 25  SER n 
1 26  GLU n 
1 27  SER n 
1 28  ILE n 
1 29  PRO n 
1 30  LYS n 
1 31  ASP n 
1 32  SER n 
1 33  LEU n 
1 34  ARG n 
1 35  MET n 
1 36  ALA n 
1 37  ILE n 
1 38  MET n 
1 39  VAL n 
1 40  GLN n 
1 41  SER n 
1 42  PRO n 
1 43  MET n 
1 44  PHE n 
1 45  ASP n 
1 46  GLY n 
1 47  LYS n 
1 48  VAL n 
1 49  PRO n 
1 50  HIS n 
1 51  TRP n 
1 52  TYR n 
1 53  HIS n 
1 54  PHE n 
1 55  SER n 
1 56  CYS n 
1 57  PHE n 
1 58  TRP n 
1 59  LYS n 
1 60  VAL n 
1 61  GLY n 
1 62  HIS n 
1 63  SER n 
1 64  ILE n 
1 65  ARG n 
1 66  HIS n 
1 67  PRO n 
1 68  ASP n 
1 69  VAL n 
1 70  GLU n 
1 71  VAL n 
1 72  ASP n 
1 73  GLY n 
1 74  PHE n 
1 75  SER n 
1 76  GLU n 
1 77  LEU n 
1 78  ARG n 
1 79  TRP n 
1 80  ASP n 
1 81  ASP n 
1 82  GLN n 
1 83  GLN n 
1 84  LYS n 
1 85  VAL n 
1 86  LYS n 
1 87  LYS n 
1 88  THR n 
1 89  ALA n 
1 90  GLU n 
1 91  ALA n 
1 92  GLY n 
1 93  GLY n 
1 94  VAL n 
1 95  THR n 
1 96  GLY n 
1 97  LYS n 
1 98  GLY n 
1 99  GLN n 
1 100 ASP n 
1 101 GLY n 
1 102 ILE n 
1 103 GLY n 
1 104 SER n 
1 105 LYS n 
1 106 ALA n 
1 107 GLU n 
1 108 LYS n 
1 109 THR n 
1 110 LEU n 
1 111 GLY n 
1 112 ASP n 
1 113 PHE n 
1 114 ALA n 
1 115 ALA n 
1 116 GLU n 
1 117 TYR n 
1 118 ALA n 
1 119 LYS n 
1 120 SER n 
1 121 ASN n 
1 122 ARG n 
1 123 SER n 
1 124 THR n 
1 125 CYS n 
1 126 LYS n 
1 127 GLY n 
1 128 CYS n 
1 129 MET n 
1 130 GLU n 
1 131 LYS n 
1 132 ILE n 
1 133 GLU n 
1 134 LYS n 
1 135 GLY n 
1 136 GLN n 
1 137 VAL n 
1 138 ARG n 
1 139 LEU n 
1 140 SER n 
1 141 LYS n 
1 142 LYS n 
1 143 MET n 
1 144 VAL n 
1 145 ASP n 
1 146 PRO n 
1 147 GLU n 
1 148 LYS n 
1 149 PRO n 
1 150 GLN n 
1 151 LEU n 
1 152 GLY n 
1 153 MET n 
1 154 ILE n 
1 155 ASP n 
1 156 ARG n 
1 157 TRP n 
1 158 TYR n 
1 159 HIS n 
1 160 PRO n 
1 161 GLY n 
1 162 CYS n 
1 163 PHE n 
1 164 VAL n 
1 165 LYS n 
1 166 ASN n 
1 167 ARG n 
1 168 GLU n 
1 169 GLU n 
1 170 LEU n 
1 171 GLY n 
1 172 PHE n 
1 173 ARG n 
1 174 PRO n 
1 175 GLU n 
1 176 TYR n 
1 177 SER n 
1 178 ALA n 
1 179 SER n 
1 180 GLN n 
1 181 LEU n 
1 182 LYS n 
1 183 GLY n 
1 184 PHE n 
1 185 SER n 
1 186 LEU n 
1 187 LEU n 
1 188 ALA n 
1 189 THR n 
1 190 GLU n 
1 191 ASP n 
1 192 LYS n 
1 193 GLU n 
1 194 ALA n 
1 195 LEU n 
1 196 LYS n 
1 197 LYS n 
1 198 GLN n 
1 199 LEU n 
1 200 PRO n 
1 201 GLY n 
1 202 VAL n 
1 203 LYS n 
1 204 SER n 
1 205 GLU n 
1 206 GLY n 
1 207 LYS n 
1 208 ARG n 
1 209 LYS n 
1 210 GLY n 
1 211 ASP n 
1 212 GLU n 
1 213 VAL n 
1 214 ASP n 
2 1   DG  n 
2 2   DC  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DC  n 
2 7   DT  n 
2 8   DT  n 
2 9   DC  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  DA  n 
2 14  DG  n 
2 15  DA  n 
2 16  DA  n 
2 17  DG  n 
2 18  DC  n 
2 19  DC  n 
2 20  DA  n 
2 21  DG  n 
2 22  DC  n 
2 23  DT  n 
2 24  DC  n 
2 25  DG  n 
2 26  DC  n 
2 27  DG  n 
2 28  DG  n 
2 29  DT  n 
2 30  DC  n 
2 31  DA  n 
2 32  DG  n 
2 33  DC  n 
2 34  DT  n 
2 35  DT  n 
2 36  DG  n 
2 37  DC  n 
2 38  DT  n 
2 39  DG  n 
2 40  DA  n 
2 41  DC  n 
2 42  DC  n 
2 43  DG  n 
2 44  DC  n 
2 45  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PARP1, ADPRT, PPOL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               Pet13 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PARP1_HUMAN P09874 1 
;MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWD
DQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHP
GCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD
;
1 ? 
2 PDB 2N8A        2N8A   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2N8A A 1 ? 214 ? P09874 1 ? 214 ? 1 214 
2 2 2N8A B 1 ? 45  ? 2N8A   1 ? 45  ? 1 45  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1  '2D 1H-15N TROSY'                                                      
1 2  1  '2D 1H-13C HMQC'                                                       
1 3  1  'TROSY-NHCACB (optimized for CB)'                                      
1 4  1  TROSY-HNCA                                                             
1 5  1  'TROSY-HN(CO)CA'                                                       
1 6  2  '2D 1H-15N TROSY'                                                      
1 7  2  '2D 1H-13C HMQC'                                                       
1 8  2  TROSY-HNCA                                                             
1 9  2  'TROSY-HN(CO)CA'                                                       
1 10 3  '2D 1H-15N TROSY'                                                      
1 11 4  '3D 1H-13C-1H NOESY-HMQC'                                              
1 12 5  'HMCM(CG)CBCA'                                                         
1 13 6  '2D 1H-1H NOESY'                                                       
1 14 6  '3D 13C-13C-1H HMQC-NOESY-HMQC'                                        
1 15 6  '3D 1H-13C-1H NOESY-HMQC'                                              
1 16 7  '2D 1H-13C HSQC aromatic'                                              
1 17 8  '2D 1H-1H NOESY filtered to accept 13C-1H in w2'                       
1 18 8  '2D 1H-1H NOESY filtered to accept 13C-1H in w2 (no decoupling in w1)' 
1 19 9  '2D 1H-1H NOESY filtered to accept 13C-1H in w2'                       
1 20 9  '2D 1H-1H NOESY filtered to accept 13C-1H in w2 (no decoupling in w1)' 
1 21 10 '2D 1H-1H NOESY filtered to accept 13C-1H in w2 (no decoupling in w1)' 
1 22 11 '2D 1H-1H NOESY filtered to accept 13C-1H in w2'                       
1 23 12 '2D 1H-13C HSQC aliphatic'                                             
1 24 12 '2D 1H-1H NOESY filtered to accept 13C-1H in w2'                       
1 25 13 '2D 1H-1H TOCSY'                                                       
1 26 13 '2D 1H-1H NOESY'                                                       
2 27 14 '2D 1H-1H TOCSY'                                                       
2 28 14 '2D 1H-1H NOESY'                                                       
1 29 15 '2D 1H-1H NOESY'                                                       
3 30 16 '2D 1H-15N TROSY'                                                      
3 31 17 '2D 1H-15N TROSY'                                                      
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 0.0004 7.2 ambient ? 310 K 
2 0.0004 7.2 ambient ? 300 K 
3 0.1    7.2 ambient ? 303 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;Sample 1: 0.2 mM [U-15N; U-13C; U-2H] PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O
;
1  '95% H2O/5% D2O' 
;Sample 2: 0.2 mM [U-15N; U-13C; U-70% 2H] PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O
;
2  '95% H2O/5% D2O' 
;Sample 3: 0.2 mM [U-98% 2H; U-98% 15N] PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O
;
3  '95% H2O/5% D2O' 
;Sample 4a: 0.2 MM PARP-1 1-214, Uniform [2H,15N,13C], back-labeled with [1H,13C] in the delta-methyl groups of Ile and all methyl groups of Leu and Val residues, using sodium [4-13C, 3,3-2H2] alpha-ketobutyrate and sodium [3- 2H, 4,4'-13C2] alpha-ketoisovalerate as precursors to maximize protonation of methyl groups, for use in NOE experiments; sodium [3-2H, 4,4'-13C2] alpha-ketoisovalerate was prepared from sodium [4,4'-13C2] alpha-ketoisovalerate by exchange with 2H2O at pH 12.5 and 45 C for 3 hrs. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O
;
4  '95% H2O/5% D2O' 
;Sample 4b: 0.2 MM PARP-1 1-214, Uniform [2H,15N,13C], back-labeled with [1H,13C] in the delta-methyl groups of Ile and all methyl groups of Leu and Val residues, using sodium [3,3-2H2,13C4] alpha-ketobutyrate and sodium [3- 2H,13C5] alpha-ketoisovalerate as precursors to produce linear chains of 13C in the sidechains of Val and Leu, for use in assignment experiments to link methyl signals to C-alpha signals. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
5  '100% D2O'       
;Sample 5: 0.2 MM PARP-1 1-214, Uniform [2H,15N,13C], back-labeled with [1H,13C] in the methyl groups of Met residues in addition to Ile, Leu and Val methyl groups as in sample 4a. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
6  '100% D2O'       
;Sample 6: 0.2 MM PARP-1 1-214, Uniform [2H,15N,13C]; back-labeled with [1H,13C] in the methyl groups of Ile, Leu and Val methyl groups as in sample 4a and [1H,13C,15N] Phe residues. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
7  '100% D2O'       
;Sample 7: 0.2 MM PARP-1 1-214, Sortase ligated, block-labelled sample. (N.B. residues 103 and 104 of WT sequence deleted, additional residues LPETGGG inserted between residues 102 and 105; this sample was not used for making any assignments of residues in this region, which is in the flexible linker between domains).  Labelling for residues 1-102 (and LPET of insertion):  uniform [1H,12C,15N]. Labelling for residues 105-214 (and GGG of insertion):  [2H,15N,13C] back-labeled with [1H,13C] Ile, Leu Val and Met methyl groups labeled as in sample 5. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
8  '100% D2O'       
;Sample 8: 0.2 MM PARP-1 1-214, 
Sortase ligated, block-labelled sample. (N.B. residues 103 and 104 of WT sequence deleted, additional residues LPETGGG inserted between residues 102 and 105; this sample was not used for making any assignments of residues in this region, which is in the flexible linker between domains).  Labelling for residues 1-102 (and LPET of insertion): uniform [1H,12C,15N]. Labelling for residues 105-214 (and GGG of insertion):  [2H,15N,13C] back labeled with [1H,13C] Met methyl groups as in sample 5 and [13C,15N,1H] Arg residues. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
9  '100% D2O'       
;Sample 9: 0.2 MM PARP-1 1-214, 
Sortase ligated, block-labelled sample. (N.B. residues 103 and 104 of WT sequence deleted, additional residues LPETGGG inserted between residues 102 and 105; this sample was not used for making any assignments of residues in this region, which is in the flexible linker between domains). Labelling for residues 1-102 (and LPET of insertion): [2H,15N,13C] back-labeled with Ile, Leu and Val methyl groups labeled as in sample 4a and [1H,13C,15N] Arg residues. Labelling for residues 105-214 (and GGG of insertion):  uniform [1H,12C,15N]. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O
;
10 '95% H2O/5% D2O' 
;Sample 10: 0.2 MM PARP-1 1-214, Sortase ligated, block-labelled sample. (N.B. residues 103 and 104 of WT sequence deleted, additional residues LPETGGG inserted between residues 102 and 105; this sample was not used for making any assignments of residues in this region, which is in the flexible linker between domains).  Labelling for residues 1-102 (and LPET of insertion): [2H,15N,13C] back-labeled with Ile, Leu and Val methyl groups labeled as in sample 4a and [1H,13C,15N] Phe residues. Labelling for residues 105-214 (and GGG of insertion):  uniform [1H,12C,15N]. 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
11 '100% D2O'       
;Sample 11: 0.2 mM see Sample details section PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O
;
12 '100% D2O'       
'Sample 12: 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O' 13 '100% D2O'       
'Sample 13: 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 95% H2O/5% D2O' 14 '95% H2O/5% D2O' 
'Sample 14: 0.2 mM [U-15N; U-13C; U-2H] PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 mM ZnSO4, 100% D2O' 
15 '100% D2O'       
;Sample 15: 0.2 mM [U-15N; U-13C; U-2H] PARP-1 1, 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 uM ZnSO4, 200 mM sodium chloride, 95% H2O/5% D2O
;
16 '95% H2O/5% D2O' 
;Sample 16: 0.2 mM [U-15N; U-13C; U-2H] PARP-1 1, 0.2 mM DNA (45-MER), 50 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 0.1 uM ZnSO4, 200 mM sodium chloride, 95% H2O/5% D2O
;
17 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker 'Avance I'   1 'Bruker Avance I'   
700 Bruker 'Avance II+' 2 'Bruker Avance II+' 
600 Bruker DMX          3 'Bruker DMX'        
500 Bruker DRX          4 'Bruker DRX'        
# 
_pdbx_nmr_refine.entry_id           2N8A 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE STRUCTURE WAS CALCULATED USING A COMBINED NMR/X-RAY PROTOCOL.  NMR EVIDENCE ESTABLISHED THE TOPOLOGY OF THE COMPLEX TO BE A MONOMERIC ASSEMBLY IN WHICH DOMAIN F1 (PROTEIN RESIDUES 6-91) IS BOUND TO THE DNA STEM WITH THE 5' TERMINUS AND DOMAIN F2 (PROTEIN RESIDUES 109-200) TO THE DNA STEM WITH THE 3' TERMINUS; NMR FURTHER SHOWED THAT THE INDIVIDUAL BINDING MODES OF F1 AND F2 TO THEIR RESPECTIVE STEMS WAS EQUIVALENT (THOUGH IN A DIFFERENT CONTEXT) TO THOSE SEEN IN CRYSTAL STRUCTURES PDB 3ODA AND 3ODC RESPECTIVELY.  TEMPLATE STRUCTURES WERE CREATED FROM 3ODA AND 3ODC (AND 1MSY AND 1RNG FOR THE DNA TETRALOOPS) AND USED TOGETHER WITH NON-CRYSTALLOGRAPHIC SYMMETRY TERMS IN XPLOR-NIH TO RETAIN THESE FEATURES IN THE CALCULATED STRUCTURES, WHILE THE RDC AND NOE DERIVED RESTRAINTS DEFINED THE OVERALL STRUCTURE.  FULL DETAILS OF THE APPROACH AND THE CALCULATION PROTOCOL APPEAR IN THE PRIMARY REFERENCE AND CORRESPONDING SUPPLEMENTARY MATERIAL FOR THIS ENTRY.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2N8A 
_pdbx_nmr_details.text       
'Sample numbers used here correspond to those used in the supplementary material for the primary citation' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'Total, Tensor and NOE xplor energies simultaneously below thresholds (6000, 1500 and 2 kcal.mol-1 respectively)' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            78 
_pdbx_nmr_ensemble.conformers_submitted_total_number             78 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N8A 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.177 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N8A 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH 2.28  1 
Goddard                                             'chemical shift assignment' SPARKY     3.115 2 
'Bruker Biospin'                                    processing                  TOPSPIN    2.1   3 
CCPN                                                'chemical shift assignment' Analysis   2.4.1 4 
CCPN                                                'data analysis'             Analysis   2.4.1 5 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis'             NMRPipe    ?     6 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ?     7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N8A 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N8A 
_struct.title                     
'1H, 13C and 15N chemical shift assignments and solution structure for PARP-1 F1F2 domains in complex with a DNA single-strand break' 
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase 1 (E.C.2.4.2.30)' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N8A 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The assembly is a hetero-dimer made of one chain of Poly [ADP-Ribose] 
Polymerase 1 and one chain of DNA (45-MER).
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 54  ? VAL A 60  ? PHE A 54  VAL A 60  1 ? 7  
HELX_P HELX_P2 2 HIS A 66  ? GLU A 70  ? HIS A 66  GLU A 70  1 ? 5  
HELX_P HELX_P3 3 GLY A 73  ? LEU A 77  ? GLY A 73  LEU A 77  5 ? 5  
HELX_P HELX_P4 4 ARG A 78  ? ALA A 91  ? ARG A 78  ALA A 91  1 ? 14 
HELX_P HELX_P5 5 HIS A 159 ? ASN A 166 ? HIS A 159 ASN A 166 1 ? 8  
HELX_P HELX_P6 6 SER A 177 ? LEU A 181 ? SER A 177 LEU A 181 5 ? 5  
HELX_P HELX_P7 7 GLY A 183 ? LEU A 187 ? GLY A 183 LEU A 187 5 ? 5  
HELX_P HELX_P8 8 ALA A 188 ? LEU A 199 ? ALA A 188 LEU A 199 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 53  ND1 ? ? ? 1_555 C ZN .  ZN ? ? A HIS 53  A ZN 1000 1_555 ? ? ? ? ? ? ?               2.009 ? 
metalc2  metalc ? ? A HIS 159 ND1 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 159 A ZN 1001 1_555 ? ? ? ? ? ? ?               2.012 ? 
metalc3  metalc ? ? A CYS 125 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 125 A ZN 1001 1_555 ? ? ? ? ? ? ?               2.283 ? 
metalc4  metalc ? ? A CYS 21  SG  ? ? ? 1_555 C ZN .  ZN ? ? A CYS 21  A ZN 1000 1_555 ? ? ? ? ? ? ?               2.284 ? 
metalc5  metalc ? ? A CYS 56  SG  ? ? ? 1_555 C ZN .  ZN ? ? A CYS 56  A ZN 1000 1_555 ? ? ? ? ? ? ?               2.309 ? 
metalc6  metalc ? ? A CYS 24  SG  ? ? ? 1_555 C ZN .  ZN ? ? A CYS 24  A ZN 1000 1_555 ? ? ? ? ? ? ?               2.310 ? 
metalc7  metalc ? ? A CYS 162 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 162 A ZN 1001 1_555 ? ? ? ? ? ? ?               2.313 ? 
metalc8  metalc ? ? A CYS 128 SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 128 A ZN 1001 1_555 ? ? ? ? ? ? ?               2.314 ? 
hydrog1  hydrog ? ? B DG  1   N1  ? ? ? 1_555 B DC 22 N3 ? ? B DG  1   B DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? B DG  1   N2  ? ? ? 1_555 B DC 22 O2 ? ? B DG  1   B DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? B DG  1   O6  ? ? ? 1_555 B DC 22 N4 ? ? B DG  1   B DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? B DC  2   N3  ? ? ? 1_555 B DG 21 N1 ? ? B DC  2   B DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? B DC  2   N4  ? ? ? 1_555 B DG 21 O6 ? ? B DC  2   B DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? B DC  2   O2  ? ? ? 1_555 B DG 21 N2 ? ? B DC  2   B DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? B DT  3   N3  ? ? ? 1_555 B DA 20 N1 ? ? B DT  3   B DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? B DT  3   O4  ? ? ? 1_555 B DA 20 N6 ? ? B DT  3   B DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? B DG  4   N1  ? ? ? 1_555 B DC 19 N3 ? ? B DG  4   B DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? B DG  4   N2  ? ? ? 1_555 B DC 19 O2 ? ? B DG  4   B DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? B DG  4   O6  ? ? ? 1_555 B DC 19 N4 ? ? B DG  4   B DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? B DG  5   N1  ? ? ? 1_555 B DC 18 N3 ? ? B DG  5   B DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? B DG  5   N2  ? ? ? 1_555 B DC 18 O2 ? ? B DG  5   B DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? B DG  5   O6  ? ? ? 1_555 B DC 18 N4 ? ? B DG  5   B DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? B DC  6   N3  ? ? ? 1_555 B DG 17 N1 ? ? B DC  6   B DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? B DC  6   N4  ? ? ? 1_555 B DG 17 O6 ? ? B DC  6   B DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? B DC  6   O2  ? ? ? 1_555 B DG 17 N2 ? ? B DC  6   B DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? B DT  7   N3  ? ? ? 1_555 B DA 16 N1 ? ? B DT  7   B DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? B DT  7   O4  ? ? ? 1_555 B DA 16 N6 ? ? B DT  7   B DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? B DT  8   N3  ? ? ? 1_555 B DA 15 N1 ? ? B DT  8   B DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? B DT  8   O4  ? ? ? 1_555 B DA 15 N6 ? ? B DT  8   B DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? B DC  9   N3  ? ? ? 1_555 B DG 14 N1 ? ? B DC  9   B DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? B DC  9   N4  ? ? ? 1_555 B DG 14 O6 ? ? B DC  9   B DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? B DC  9   O2  ? ? ? 1_555 B DG 14 N2 ? ? B DC  9   B DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? B DG  10  N2  ? ? ? 1_555 B DA 13 N7 ? ? B DG  10  B DA 13   1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog26 hydrog ? ? B DC  24  N3  ? ? ? 1_555 B DG 45 N1 ? ? B DC  24  B DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? B DC  24  N4  ? ? ? 1_555 B DG 45 O6 ? ? B DC  24  B DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? B DC  24  O2  ? ? ? 1_555 B DG 45 N2 ? ? B DC  24  B DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? B DG  25  N1  ? ? ? 1_555 B DC 44 N3 ? ? B DG  25  B DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? B DG  25  N2  ? ? ? 1_555 B DC 44 O2 ? ? B DG  25  B DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? B DG  25  O6  ? ? ? 1_555 B DC 44 N4 ? ? B DG  25  B DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? B DC  26  N3  ? ? ? 1_555 B DG 43 N1 ? ? B DC  26  B DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? B DC  26  N4  ? ? ? 1_555 B DG 43 O6 ? ? B DC  26  B DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? B DC  26  O2  ? ? ? 1_555 B DG 43 N2 ? ? B DC  26  B DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? B DG  27  N1  ? ? ? 1_555 B DC 42 N3 ? ? B DG  27  B DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? B DG  27  N2  ? ? ? 1_555 B DC 42 O2 ? ? B DG  27  B DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? B DG  27  O6  ? ? ? 1_555 B DC 42 N4 ? ? B DG  27  B DC 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? B DG  28  N1  ? ? ? 1_555 B DC 41 N3 ? ? B DG  28  B DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? B DG  28  N2  ? ? ? 1_555 B DC 41 O2 ? ? B DG  28  B DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? B DG  28  O6  ? ? ? 1_555 B DC 41 N4 ? ? B DG  28  B DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ? ? B DT  29  N3  ? ? ? 1_555 B DA 40 N1 ? ? B DT  29  B DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? B DT  29  O4  ? ? ? 1_555 B DA 40 N6 ? ? B DT  29  B DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ? ? B DC  30  N3  ? ? ? 1_555 B DG 39 N1 ? ? B DC  30  B DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ? ? B DC  30  N4  ? ? ? 1_555 B DG 39 O6 ? ? B DC  30  B DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45 hydrog ? ? B DC  30  O2  ? ? ? 1_555 B DG 39 N2 ? ? B DC  30  B DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? B DA  31  N1  ? ? ? 1_555 B DT 38 N3 ? ? B DA  31  B DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? B DA  31  N6  ? ? ? 1_555 B DT 38 O4 ? ? B DA  31  B DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ? ? B DG  32  N1  ? ? ? 1_555 B DC 37 N3 ? ? B DG  32  B DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? B DG  32  N2  ? ? ? 1_555 B DC 37 O2 ? ? B DG  32  B DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ? ? B DG  32  O6  ? ? ? 1_555 B DC 37 N4 ? ? B DG  32  B DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51 hydrog ? ? B DC  33  N3  ? ? ? 1_555 B DG 36 N1 ? ? B DC  33  B DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52 hydrog ? ? B DC  33  N4  ? ? ? 1_555 B DG 36 O6 ? ? B DC  33  B DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53 hydrog ? ? B DC  33  O2  ? ? ? 1_555 B DG 36 N2 ? ? B DC  33  B DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 47  ? HIS A 53  ? LYS A 47  HIS A 53  
A 2 LEU A 33  ? GLN A 40  ? LEU A 33  GLN A 40  
A 3 TYR A 9   ? TYR A 13  ? TYR A 9   TYR A 13  
A 4 VAL A 71  ? ASP A 72  ? VAL A 71  ASP A 72  
B 1 PHE A 113 ? TYR A 117 ? PHE A 113 TYR A 117 
B 2 VAL A 137 ? LYS A 141 ? VAL A 137 LYS A 141 
B 3 TRP A 157 ? TYR A 158 ? TRP A 157 TYR A 158 
C 1 MET A 143 ? VAL A 144 ? MET A 143 VAL A 144 
C 2 MET A 153 ? ILE A 154 ? MET A 153 ILE A 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 48  ? O VAL A 48  N VAL A 39  ? N VAL A 39  
A 2 3 O ARG A 34  ? O ARG A 34  N GLU A 12  ? N GLU A 12  
A 3 4 N TYR A 9   ? N TYR A 9   O ASP A 72  ? O ASP A 72  
B 1 2 N GLU A 116 ? N GLU A 116 O ARG A 138 ? O ARG A 138 
B 2 3 N LEU A 139 ? N LEU A 139 O TYR A 158 ? O TYR A 158 
C 1 2 N MET A 143 ? N MET A 143 O ILE A 154 ? O ILE A 154 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1000' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 21  ? CYS A 21  . ? 1_555 ? 
2 AC1 4 CYS A 24  ? CYS A 24  . ? 1_555 ? 
3 AC1 4 HIS A 53  ? HIS A 53  . ? 1_555 ? 
4 AC1 4 CYS A 56  ? CYS A 56  . ? 1_555 ? 
5 AC2 4 CYS A 125 ? CYS A 125 . ? 1_555 ? 
6 AC2 4 CYS A 128 ? CYS A 128 . ? 1_555 ? 
7 AC2 4 HIS A 159 ? HIS A 159 . ? 1_555 ? 
8 AC2 4 CYS A 162 ? CYS A 162 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2N8A 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N      . MET A 1 1   ? 2.880   -14.091 19.410  1.00 0.00  ? 1    MET A N      1  
ATOM   2      C  CA     . MET A 1 1   ? 2.083   -13.065 20.144  1.00 0.00  ? 1    MET A CA     1  
ATOM   3      C  C      . MET A 1 1   ? 0.611   -13.482 20.203  1.00 0.00  ? 1    MET A C      1  
ATOM   4      O  O      . MET A 1 1   ? -0.046  -13.618 19.189  1.00 0.00  ? 1    MET A O      1  
ATOM   5      C  CB     . MET A 1 1   ? 2.245   -11.781 19.330  1.00 0.00  ? 1    MET A CB     1  
ATOM   6      C  CG     . MET A 1 1   ? 1.623   -10.611 20.093  1.00 0.00  ? 1    MET A CG     1  
ATOM   7      S  SD     . MET A 1 1   ? 2.819   -9.964  21.287  1.00 0.00  ? 1    MET A SD     1  
ATOM   8      C  CE     . MET A 1 1   ? 1.679   -8.891  22.193  1.00 0.00  ? 1    MET A CE     1  
ATOM   9      H  H1     . MET A 1 1   ? 3.890   -13.853 19.468  1.00 0.00  ? 1    MET A H1     1  
ATOM   10     H  H2     . MET A 1 1   ? 2.584   -14.111 18.413  1.00 0.00  ? 1    MET A H2     1  
ATOM   11     H  H3     . MET A 1 1   ? 2.721   -15.025 19.838  1.00 0.00  ? 1    MET A H3     1  
ATOM   12     H  HA     . MET A 1 1   ? 2.475   -12.923 21.138  1.00 0.00  ? 1    MET A HA     1  
ATOM   13     H  HB2    . MET A 1 1   ? 3.296   -11.589 19.168  1.00 0.00  ? 1    MET A HB2    1  
ATOM   14     H  HB3    . MET A 1 1   ? 1.748   -11.893 18.378  1.00 0.00  ? 1    MET A HB3    1  
ATOM   15     H  HG2    . MET A 1 1   ? 1.351   -9.831  19.397  1.00 0.00  ? 1    MET A HG2    1  
ATOM   16     H  HG3    . MET A 1 1   ? 0.740   -10.950 20.616  1.00 0.00  ? 1    MET A HG3    1  
ATOM   17     H  HE1    . MET A 1 1   ? 2.049   -7.875  22.173  1.00 0.00  ? 1    MET A HE1    1  
ATOM   18     H  HE2    . MET A 1 1   ? 1.604   -9.224  23.215  1.00 0.00  ? 1    MET A HE2    1  
ATOM   19     H  HE3    . MET A 1 1   ? 0.702   -8.933  21.730  1.00 0.00  ? 1    MET A HE3    1  
ATOM   20     N  N      . ALA A 1 2   ? 0.089   -13.685 21.383  1.00 0.00  ? 2    ALA A N      1  
ATOM   21     C  CA     . ALA A 1 2   ? -1.341  -14.093 21.509  1.00 0.00  ? 2    ALA A CA     1  
ATOM   22     C  C      . ALA A 1 2   ? -2.257  -12.890 21.269  1.00 0.00  ? 2    ALA A C      1  
ATOM   23     O  O      . ALA A 1 2   ? -2.162  -11.882 21.941  1.00 0.00  ? 2    ALA A O      1  
ATOM   24     C  CB     . ALA A 1 2   ? -1.485  -14.599 22.945  1.00 0.00  ? 2    ALA A CB     1  
ATOM   25     H  H      . ALA A 1 2   ? 0.638   -13.569 22.187  1.00 0.00  ? 2    ALA A H      1  
ATOM   26     H  HA     . ALA A 1 2   ? -1.569  -14.886 20.815  1.00 0.00  ? 2    ALA A HA     1  
ATOM   27     H  HB1    . ALA A 1 2   ? -0.682  -14.202 23.549  1.00 0.00  ? 2    ALA A HB1    1  
ATOM   28     H  HB2    . ALA A 1 2   ? -1.441  -15.678 22.953  1.00 0.00  ? 2    ALA A HB2    1  
ATOM   29     H  HB3    . ALA A 1 2   ? -2.433  -14.274 23.348  1.00 0.00  ? 2    ALA A HB3    1  
ATOM   30     N  N      . GLU A 1 3   ? -3.145  -12.990 20.313  1.00 0.00  ? 3    GLU A N      1  
ATOM   31     C  CA     . GLU A 1 3   ? -4.074  -11.855 20.021  1.00 0.00  ? 3    GLU A CA     1  
ATOM   32     C  C      . GLU A 1 3   ? -3.283  -10.569 19.764  1.00 0.00  ? 3    GLU A C      1  
ATOM   33     O  O      . GLU A 1 3   ? -2.070  -10.548 19.841  1.00 0.00  ? 3    GLU A O      1  
ATOM   34     C  CB     . GLU A 1 3   ? -4.940  -11.711 21.275  1.00 0.00  ? 3    GLU A CB     1  
ATOM   35     C  CG     . GLU A 1 3   ? -6.345  -11.242 20.880  1.00 0.00  ? 3    GLU A CG     1  
ATOM   36     C  CD     . GLU A 1 3   ? -7.365  -12.331 21.220  1.00 0.00  ? 3    GLU A CD     1  
ATOM   37     O  OE1    . GLU A 1 3   ? -7.154  -13.462 20.812  1.00 0.00  ? 3    GLU A OE1    1  
ATOM   38     O  OE2    . GLU A 1 3   ? -8.339  -12.016 21.884  1.00 0.00  ? 3    GLU A OE2    1  
ATOM   39     H  H      . GLU A 1 3   ? -3.202  -13.814 19.785  1.00 0.00  ? 3    GLU A H      1  
ATOM   40     H  HA     . GLU A 1 3   ? -4.696  -12.089 19.171  1.00 0.00  ? 3    GLU A HA     1  
ATOM   41     H  HB2    . GLU A 1 3   ? -5.004  -12.664 21.779  1.00 0.00  ? 3    GLU A HB2    1  
ATOM   42     H  HB3    . GLU A 1 3   ? -4.494  -10.983 21.937  1.00 0.00  ? 3    GLU A HB3    1  
ATOM   43     H  HG2    . GLU A 1 3   ? -6.587  -10.340 21.422  1.00 0.00  ? 3    GLU A HG2    1  
ATOM   44     H  HG3    . GLU A 1 3   ? -6.375  -11.043 19.819  1.00 0.00  ? 3    GLU A HG3    1  
ATOM   45     N  N      . SER A 1 4   ? -3.963  -9.494  19.458  1.00 0.00  ? 4    SER A N      1  
ATOM   46     C  CA     . SER A 1 4   ? -3.259  -8.201  19.193  1.00 0.00  ? 4    SER A CA     1  
ATOM   47     C  C      . SER A 1 4   ? -2.166  -8.392  18.136  1.00 0.00  ? 4    SER A C      1  
ATOM   48     O  O      . SER A 1 4   ? -1.125  -7.767  18.187  1.00 0.00  ? 4    SER A O      1  
ATOM   49     C  CB     . SER A 1 4   ? -2.644  -7.799  20.534  1.00 0.00  ? 4    SER A CB     1  
ATOM   50     O  OG     . SER A 1 4   ? -3.625  -7.921  21.556  1.00 0.00  ? 4    SER A OG     1  
ATOM   51     H  H      . SER A 1 4   ? -4.941  -9.536  19.401  1.00 0.00  ? 4    SER A H      1  
ATOM   52     H  HA     . SER A 1 4   ? -3.963  -7.450  18.873  1.00 0.00  ? 4    SER A HA     1  
ATOM   53     H  HB2    . SER A 1 4   ? -1.813  -8.446  20.760  1.00 0.00  ? 4    SER A HB2    1  
ATOM   54     H  HB3    . SER A 1 4   ? -2.295  -6.776  20.476  1.00 0.00  ? 4    SER A HB3    1  
ATOM   55     H  HG     . SER A 1 4   ? -3.304  -8.556  22.201  1.00 0.00  ? 4    SER A HG     1  
ATOM   56     N  N      . SER A 1 5   ? -2.396  -9.252  17.180  1.00 0.00  ? 5    SER A N      1  
ATOM   57     C  CA     . SER A 1 5   ? -1.371  -9.484  16.120  1.00 0.00  ? 5    SER A CA     1  
ATOM   58     C  C      . SER A 1 5   ? -2.048  -9.730  14.767  1.00 0.00  ? 5    SER A C      1  
ATOM   59     O  O      . SER A 1 5   ? -1.453  -10.275 13.858  1.00 0.00  ? 5    SER A O      1  
ATOM   60     C  CB     . SER A 1 5   ? -0.611  -10.730 16.572  1.00 0.00  ? 5    SER A CB     1  
ATOM   61     O  OG     . SER A 1 5   ? -1.467  -11.861 16.480  1.00 0.00  ? 5    SER A OG     1  
ATOM   62     H  H      . SER A 1 5   ? -3.242  -9.746  17.159  1.00 0.00  ? 5    SER A H      1  
ATOM   63     H  HA     . SER A 1 5   ? -0.698  -8.645  16.057  1.00 0.00  ? 5    SER A HA     1  
ATOM   64     H  HB2    . SER A 1 5   ? 0.246   -10.881 15.937  1.00 0.00  ? 5    SER A HB2    1  
ATOM   65     H  HB3    . SER A 1 5   ? -0.281  -10.597 17.594  1.00 0.00  ? 5    SER A HB3    1  
ATOM   66     H  HG     . SER A 1 5   ? -1.357  -12.247 15.608  1.00 0.00  ? 5    SER A HG     1  
ATOM   67     N  N      . ASP A 1 6   ? -3.286  -9.335  14.627  1.00 54.80 ? 6    ASP A N      1  
ATOM   68     C  CA     . ASP A 1 6   ? -3.996  -9.549  13.333  1.00 64.03 ? 6    ASP A CA     1  
ATOM   69     C  C      . ASP A 1 6   ? -4.510  -8.217  12.772  1.00 53.30 ? 6    ASP A C      1  
ATOM   70     O  O      . ASP A 1 6   ? -4.968  -8.146  11.648  1.00 46.74 ? 6    ASP A O      1  
ATOM   71     C  CB     . ASP A 1 6   ? -5.167  -10.473 13.673  1.00 72.60 ? 6    ASP A CB     1  
ATOM   72     C  CG     . ASP A 1 6   ? -5.397  -11.451 12.520  1.00 85.58 ? 6    ASP A CG     1  
ATOM   73     O  OD1    . ASP A 1 6   ? -5.543  -10.991 11.399  1.00 78.13 ? 6    ASP A OD1    1  
ATOM   74     O  OD2    . ASP A 1 6   ? -5.424  -12.643 12.777  1.00 0.00  ? 6    ASP A OD2    1  
ATOM   75     H  H      . ASP A 1 6   ? -3.749  -8.900  15.372  1.00 0.00  ? 6    ASP A H      1  
ATOM   76     H  HA     . ASP A 1 6   ? -3.344  -10.030 12.622  1.00 0.00  ? 6    ASP A HA     1  
ATOM   77     H  HB2    . ASP A 1 6   ? -4.940  -11.024 14.574  1.00 0.00  ? 6    ASP A HB2    1  
ATOM   78     H  HB3    . ASP A 1 6   ? -6.058  -9.884  13.826  1.00 0.00  ? 6    ASP A HB3    1  
ATOM   79     N  N      . LYS A 1 7   ? -4.436  -7.160  13.542  1.00 51.81 ? 7    LYS A N      1  
ATOM   80     C  CA     . LYS A 1 7   ? -4.919  -5.836  13.043  1.00 31.86 ? 7    LYS A CA     1  
ATOM   81     C  C      . LYS A 1 7   ? -4.178  -5.463  11.757  1.00 39.85 ? 7    LYS A C      1  
ATOM   82     O  O      . LYS A 1 7   ? -3.064  -5.891  11.529  1.00 40.95 ? 7    LYS A O      1  
ATOM   83     C  CB     . LYS A 1 7   ? -4.590  -4.843  14.160  1.00 32.50 ? 7    LYS A CB     1  
ATOM   84     C  CG     . LYS A 1 7   ? -5.412  -5.182  15.406  1.00 35.73 ? 7    LYS A CG     1  
ATOM   85     C  CD     . LYS A 1 7   ? -6.899  -4.962  15.115  1.00 29.85 ? 7    LYS A CD     1  
ATOM   86     C  CE     . LYS A 1 7   ? -7.555  -6.299  14.761  1.00 29.89 ? 7    LYS A CE     1  
ATOM   87     N  NZ     . LYS A 1 7   ? -8.138  -6.792  16.039  1.00 29.51 ? 7    LYS A NZ     1  
ATOM   88     H  H      . LYS A 1 7   ? -4.062  -7.235  14.444  1.00 0.00  ? 7    LYS A H      1  
ATOM   89     H  HA     . LYS A 1 7   ? -5.984  -5.863  12.873  1.00 0.00  ? 7    LYS A HA     1  
ATOM   90     H  HB2    . LYS A 1 7   ? -3.537  -4.902  14.395  1.00 0.00  ? 7    LYS A HB2    1  
ATOM   91     H  HB3    . LYS A 1 7   ? -4.831  -3.843  13.834  1.00 0.00  ? 7    LYS A HB3    1  
ATOM   92     H  HG2    . LYS A 1 7   ? -5.245  -6.215  15.676  1.00 0.00  ? 7    LYS A HG2    1  
ATOM   93     H  HG3    . LYS A 1 7   ? -5.109  -4.544  16.221  1.00 0.00  ? 7    LYS A HG3    1  
ATOM   94     H  HD2    . LYS A 1 7   ? -7.378  -4.546  15.990  1.00 0.00  ? 7    LYS A HD2    1  
ATOM   95     H  HD3    . LYS A 1 7   ? -7.007  -4.279  14.286  1.00 0.00  ? 7    LYS A HD3    1  
ATOM   96     H  HE2    . LYS A 1 7   ? -8.330  -6.151  14.022  1.00 0.00  ? 7    LYS A HE2    1  
ATOM   97     H  HE3    . LYS A 1 7   ? -6.816  -6.997  14.398  1.00 0.00  ? 7    LYS A HE3    1  
ATOM   98     H  HZ1    . LYS A 1 7   ? -8.922  -6.172  16.325  1.00 0.00  ? 7    LYS A HZ1    1  
ATOM   99     H  HZ2    . LYS A 1 7   ? -7.405  -6.788  16.778  1.00 0.00  ? 7    LYS A HZ2    1  
ATOM   100    H  HZ3    . LYS A 1 7   ? -8.494  -7.760  15.908  1.00 0.00  ? 7    LYS A HZ3    1  
ATOM   101    N  N      . LEU A 1 8   ? -4.789  -4.680  10.910  1.00 34.86 ? 8    LEU A N      1  
ATOM   102    C  CA     . LEU A 1 8   ? -4.115  -4.298  9.636   1.00 26.44 ? 8    LEU A CA     1  
ATOM   103    C  C      . LEU A 1 8   ? -3.251  -3.045  9.823   1.00 31.60 ? 8    LEU A C      1  
ATOM   104    O  O      . LEU A 1 8   ? -2.386  -2.762  9.017   1.00 29.79 ? 8    LEU A O      1  
ATOM   105    C  CB     . LEU A 1 8   ? -5.253  -4.022  8.649   1.00 27.59 ? 8    LEU A CB     1  
ATOM   106    C  CG     . LEU A 1 8   ? -5.036  -4.838  7.372   1.00 38.31 ? 8    LEU A CG     1  
ATOM   107    C  CD1    . LEU A 1 8   ? -6.226  -4.642  6.432   1.00 41.64 ? 8    LEU A CD1    1  
ATOM   108    C  CD2    . LEU A 1 8   ? -3.755  -4.367  6.675   1.00 38.17 ? 8    LEU A CD2    1  
ATOM   109    H  H      . LEU A 1 8   ? -5.691  -4.352  11.107  1.00 0.00  ? 8    LEU A H      1  
ATOM   110    H  HA     . LEU A 1 8   ? -3.512  -5.115  9.275   1.00 0.00  ? 8    LEU A HA     1  
ATOM   111    H  HB2    . LEU A 1 8   ? -6.195  -4.301  9.099   1.00 0.00  ? 8    LEU A HB2    1  
ATOM   112    H  HB3    . LEU A 1 8   ? -5.271  -2.970  8.403   1.00 0.00  ? 8    LEU A HB3    1  
ATOM   113    H  HG     . LEU A 1 8   ? -4.946  -5.884  7.625   1.00 0.00  ? 8    LEU A HG     1  
ATOM   114    H  HD11   . LEU A 1 8   ? -5.906  -4.789  5.411   1.00 0.00  ? 8    LEU A HD11   1  
ATOM   115    H  HD12   . LEU A 1 8   ? -6.615  -3.642  6.546   1.00 0.00  ? 8    LEU A HD12   1  
ATOM   116    H  HD13   . LEU A 1 8   ? -6.997  -5.359  6.674   1.00 0.00  ? 8    LEU A HD13   1  
ATOM   117    H  HD21   . LEU A 1 8   ? -2.979  -4.217  7.411   1.00 0.00  ? 8    LEU A HD21   1  
ATOM   118    H  HD22   . LEU A 1 8   ? -3.947  -3.438  6.160   1.00 0.00  ? 8    LEU A HD22   1  
ATOM   119    H  HD23   . LEU A 1 8   ? -3.437  -5.115  5.963   1.00 0.00  ? 8    LEU A HD23   1  
ATOM   120    N  N      . TYR A 1 9   ? -3.478  -2.279  10.861  1.00 29.00 ? 9    TYR A N      1  
ATOM   121    C  CA     . TYR A 1 9   ? -2.659  -1.040  11.050  1.00 21.84 ? 9    TYR A CA     1  
ATOM   122    C  C      . TYR A 1 9   ? -2.037  -0.971  12.449  1.00 25.22 ? 9    TYR A C      1  
ATOM   123    O  O      . TYR A 1 9   ? -2.486  -1.612  13.382  1.00 24.44 ? 9    TYR A O      1  
ATOM   124    C  CB     . TYR A 1 9   ? -3.646  0.112   10.855  1.00 21.43 ? 9    TYR A CB     1  
ATOM   125    C  CG     . TYR A 1 9   ? -4.174  0.088   9.448   1.00 28.57 ? 9    TYR A CG     1  
ATOM   126    C  CD1    . TYR A 1 9   ? -3.366  0.529   8.390   1.00 27.44 ? 9    TYR A CD1    1  
ATOM   127    C  CD2    . TYR A 1 9   ? -5.476  -0.370  9.198   1.00 31.67 ? 9    TYR A CD2    1  
ATOM   128    C  CE1    . TYR A 1 9   ? -3.861  0.512   7.081   1.00 31.63 ? 9    TYR A CE1    1  
ATOM   129    C  CE2    . TYR A 1 9   ? -5.971  -0.387  7.887   1.00 29.62 ? 9    TYR A CE2    1  
ATOM   130    C  CZ     . TYR A 1 9   ? -5.162  0.054   6.830   1.00 34.34 ? 9    TYR A CZ     1  
ATOM   131    O  OH     . TYR A 1 9   ? -5.642  0.034   5.542   1.00 40.45 ? 9    TYR A OH     1  
ATOM   132    H  H      . TYR A 1 9   ? -4.191  -2.506  11.496  1.00 0.00  ? 9    TYR A H      1  
ATOM   133    H  HA     . TYR A 1 9   ? -1.888  -0.987  10.299  1.00 0.00  ? 9    TYR A HA     1  
ATOM   134    H  HB2    . TYR A 1 9   ? -4.469  0.005   11.547  1.00 0.00  ? 9    TYR A HB2    1  
ATOM   135    H  HB3    . TYR A 1 9   ? -3.145  1.051   11.033  1.00 0.00  ? 9    TYR A HB3    1  
ATOM   136    H  HD1    . TYR A 1 9   ? -2.362  0.882   8.584   1.00 0.00  ? 9    TYR A HD1    1  
ATOM   137    H  HD2    . TYR A 1 9   ? -6.097  -0.710  10.014  1.00 0.00  ? 9    TYR A HD2    1  
ATOM   138    H  HE1    . TYR A 1 9   ? -3.240  0.853   6.263   1.00 0.00  ? 9    TYR A HE1    1  
ATOM   139    H  HE2    . TYR A 1 9   ? -6.976  -0.739  7.692   1.00 0.00  ? 9    TYR A HE2    1  
ATOM   140    H  HH     . TYR A 1 9   ? -4.996  -0.416  4.996   1.00 0.00  ? 9    TYR A HH     1  
ATOM   141    N  N      . ARG A 1 10  ? -1.008  -0.175  12.588  1.00 20.35 ? 10   ARG A N      1  
ATOM   142    C  CA     . ARG A 1 10  ? -0.341  -0.025  13.907  1.00 18.98 ? 10   ARG A CA     1  
ATOM   143    C  C      . ARG A 1 10  ? 0.020   1.447   14.137  1.00 15.07 ? 10   ARG A C      1  
ATOM   144    O  O      . ARG A 1 10  ? 0.449   2.142   13.235  1.00 21.03 ? 10   ARG A O      1  
ATOM   145    C  CB     . ARG A 1 10  ? 0.926   -0.889  13.817  1.00 17.85 ? 10   ARG A CB     1  
ATOM   146    C  CG     . ARG A 1 10  ? 1.759   -0.730  15.096  1.00 23.08 ? 10   ARG A CG     1  
ATOM   147    C  CD     . ARG A 1 10  ? 1.508   -1.908  16.040  1.00 22.56 ? 10   ARG A CD     1  
ATOM   148    N  NE     . ARG A 1 10  ? 1.407   -1.293  17.396  1.00 46.91 ? 10   ARG A NE     1  
ATOM   149    C  CZ     . ARG A 1 10  ? 1.576   -2.019  18.474  1.00 43.06 ? 10   ARG A CZ     1  
ATOM   150    N  NH1    . ARG A 1 10  ? 1.834   -3.299  18.383  1.00 38.56 ? 10   ARG A NH1    1  
ATOM   151    N  NH2    . ARG A 1 10  ? 1.484   -1.459  19.651  1.00 16.57 ? 10   ARG A NH2    1  
ATOM   152    H  H      . ARG A 1 10  ? -0.681  0.334   11.816  1.00 0.00  ? 10   ARG A H      1  
ATOM   153    H  HA     . ARG A 1 10  ? -0.980  -0.386  14.697  1.00 0.00  ? 10   ARG A HA     1  
ATOM   154    H  HB2    . ARG A 1 10  ? 0.646   -1.926  13.695  1.00 0.00  ? 10   ARG A HB2    1  
ATOM   155    H  HB3    . ARG A 1 10  ? 1.515   -0.575  12.968  1.00 0.00  ? 10   ARG A HB3    1  
ATOM   156    H  HG2    . ARG A 1 10  ? 2.808   -0.697  14.839  1.00 0.00  ? 10   ARG A HG2    1  
ATOM   157    H  HG3    . ARG A 1 10  ? 1.484   0.188   15.592  1.00 0.00  ? 10   ARG A HG3    1  
ATOM   158    H  HD2    . ARG A 1 10  ? 0.585   -2.411  15.780  1.00 0.00  ? 10   ARG A HD2    1  
ATOM   159    H  HD3    . ARG A 1 10  ? 2.337   -2.599  16.008  1.00 0.00  ? 10   ARG A HD3    1  
ATOM   160    H  HE     . ARG A 1 10  ? 1.215   -0.336  17.482  1.00 0.00  ? 10   ARG A HE     1  
ATOM   161    H  HH11   . ARG A 1 10  ? 1.904   -3.735  17.487  1.00 0.00  ? 10   ARG A HH11   1  
ATOM   162    H  HH12   . ARG A 1 10  ? 1.961   -3.842  19.213  1.00 0.00  ? 10   ARG A HH12   1  
ATOM   163    H  HH21   . ARG A 1 10  ? 1.287   -0.481  19.726  1.00 0.00  ? 10   ARG A HH21   1  
ATOM   164    H  HH22   . ARG A 1 10  ? 1.612   -2.008  20.477  1.00 0.00  ? 10   ARG A HH22   1  
ATOM   165    N  N      . VAL A 1 11  ? -0.131  1.904   15.343  1.00 16.36 ? 11   VAL A N      1  
ATOM   166    C  CA     . VAL A 1 11  ? 0.220   3.312   15.665  1.00 15.61 ? 11   VAL A CA     1  
ATOM   167    C  C      . VAL A 1 11  ? 1.079   3.315   16.923  1.00 20.09 ? 11   VAL A C      1  
ATOM   168    O  O      . VAL A 1 11  ? 0.820   2.575   17.856  1.00 21.30 ? 11   VAL A O      1  
ATOM   169    C  CB     . VAL A 1 11  ? -1.113  4.026   15.906  1.00 14.54 ? 11   VAL A CB     1  
ATOM   170    C  CG1    . VAL A 1 11  ? -1.860  3.349   17.057  1.00 15.65 ? 11   VAL A CG1    1  
ATOM   171    C  CG2    . VAL A 1 11  ? -0.850  5.492   16.264  1.00 13.69 ? 11   VAL A CG2    1  
ATOM   172    H  H      . VAL A 1 11  ? -0.457  1.308   16.049  1.00 0.00  ? 11   VAL A H      1  
ATOM   173    H  HA     . VAL A 1 11  ? 0.748   3.770   14.843  1.00 0.00  ? 11   VAL A HA     1  
ATOM   174    H  HB     . VAL A 1 11  ? -1.714  3.976   15.010  1.00 0.00  ? 11   VAL A HB     1  
ATOM   175    H  HG11   . VAL A 1 11  ? -2.840  3.791   17.160  1.00 0.00  ? 11   VAL A HG11   1  
ATOM   176    H  HG12   . VAL A 1 11  ? -1.306  3.484   17.975  1.00 0.00  ? 11   VAL A HG12   1  
ATOM   177    H  HG13   . VAL A 1 11  ? -1.961  2.294   16.850  1.00 0.00  ? 11   VAL A HG13   1  
ATOM   178    H  HG21   . VAL A 1 11  ? -1.787  6.026   16.307  1.00 0.00  ? 11   VAL A HG21   1  
ATOM   179    H  HG22   . VAL A 1 11  ? -0.216  5.938   15.512  1.00 0.00  ? 11   VAL A HG22   1  
ATOM   180    H  HG23   . VAL A 1 11  ? -0.360  5.546   17.225  1.00 0.00  ? 11   VAL A HG23   1  
ATOM   181    N  N      . GLU A 1 12  ? 2.105   4.118   16.958  1.00 14.48 ? 12   GLU A N      1  
ATOM   182    C  CA     . GLU A 1 12  ? 2.977   4.135   18.166  1.00 13.47 ? 12   GLU A CA     1  
ATOM   183    C  C      . GLU A 1 12  ? 4.008   5.254   18.075  1.00 17.08 ? 12   GLU A C      1  
ATOM   184    O  O      . GLU A 1 12  ? 4.222   5.836   17.026  1.00 19.42 ? 12   GLU A O      1  
ATOM   185    C  CB     . GLU A 1 12  ? 3.682   2.775   18.156  1.00 15.15 ? 12   GLU A CB     1  
ATOM   186    C  CG     . GLU A 1 12  ? 4.471   2.618   16.850  1.00 18.26 ? 12   GLU A CG     1  
ATOM   187    C  CD     . GLU A 1 12  ? 5.370   1.384   16.933  1.00 22.80 ? 12   GLU A CD     1  
ATOM   188    O  OE1    . GLU A 1 12  ? 4.897   0.359   17.393  1.00 24.21 ? 12   GLU A OE1    1  
ATOM   189    O  OE2    . GLU A 1 12  ? 6.518   1.485   16.530  1.00 21.80 ? 12   GLU A OE2    1  
ATOM   190    H  H      . GLU A 1 12  ? 2.311   4.697   16.192  1.00 0.00  ? 12   GLU A H      1  
ATOM   191    H  HA     . GLU A 1 12  ? 2.384   4.236   19.061  1.00 0.00  ? 12   GLU A HA     1  
ATOM   192    H  HB2    . GLU A 1 12  ? 4.358   2.714   18.997  1.00 0.00  ? 12   GLU A HB2    1  
ATOM   193    H  HB3    . GLU A 1 12  ? 2.947   1.988   18.226  1.00 0.00  ? 12   GLU A HB3    1  
ATOM   194    H  HG2    . GLU A 1 12  ? 3.783   2.506   16.026  1.00 0.00  ? 12   GLU A HG2    1  
ATOM   195    H  HG3    . GLU A 1 12  ? 5.082   3.494   16.691  1.00 0.00  ? 12   GLU A HG3    1  
ATOM   196    N  N      . TYR A 1 13  ? 4.676   5.521   19.161  1.00 14.81 ? 13   TYR A N      1  
ATOM   197    C  CA     . TYR A 1 13  ? 5.727   6.556   19.140  1.00 16.02 ? 13   TYR A CA     1  
ATOM   198    C  C      . TYR A 1 13  ? 6.985   5.900   18.568  1.00 19.33 ? 13   TYR A C      1  
ATOM   199    O  O      . TYR A 1 13  ? 7.385   4.838   19.004  1.00 17.84 ? 13   TYR A O      1  
ATOM   200    C  CB     . TYR A 1 13  ? 5.903   6.982   20.600  1.00 17.04 ? 13   TYR A CB     1  
ATOM   201    C  CG     . TYR A 1 13  ? 4.645   7.667   21.076  1.00 17.46 ? 13   TYR A CG     1  
ATOM   202    C  CD1    . TYR A 1 13  ? 4.195   8.835   20.437  1.00 16.26 ? 13   TYR A CD1    1  
ATOM   203    C  CD2    . TYR A 1 13  ? 3.926   7.137   22.159  1.00 15.25 ? 13   TYR A CD2    1  
ATOM   204    C  CE1    . TYR A 1 13  ? 3.027   9.469   20.883  1.00 18.44 ? 13   TYR A CE1    1  
ATOM   205    C  CE2    . TYR A 1 13  ? 2.758   7.773   22.603  1.00 16.23 ? 13   TYR A CE2    1  
ATOM   206    C  CZ     . TYR A 1 13  ? 2.310   8.939   21.964  1.00 21.10 ? 13   TYR A CZ     1  
ATOM   207    O  OH     . TYR A 1 13  ? 1.161   9.562   22.394  1.00 23.72 ? 13   TYR A OH     1  
ATOM   208    H  H      . TYR A 1 13  ? 4.499   5.003   19.972  1.00 0.00  ? 13   TYR A H      1  
ATOM   209    H  HA     . TYR A 1 13  ? 5.423   7.395   18.532  1.00 0.00  ? 13   TYR A HA     1  
ATOM   210    H  HB2    . TYR A 1 13  ? 6.089   6.112   21.211  1.00 0.00  ? 13   TYR A HB2    1  
ATOM   211    H  HB3    . TYR A 1 13  ? 6.735   7.666   20.681  1.00 0.00  ? 13   TYR A HB3    1  
ATOM   212    H  HD1    . TYR A 1 13  ? 4.747   9.245   19.603  1.00 0.00  ? 13   TYR A HD1    1  
ATOM   213    H  HD2    . TYR A 1 13  ? 4.271   6.239   22.650  1.00 0.00  ? 13   TYR A HD2    1  
ATOM   214    H  HE1    . TYR A 1 13  ? 2.679   10.370  20.393  1.00 0.00  ? 13   TYR A HE1    1  
ATOM   215    H  HE2    . TYR A 1 13  ? 2.203   7.365   23.439  1.00 0.00  ? 13   TYR A HE2    1  
ATOM   216    H  HH     . TYR A 1 13  ? 0.648   9.797   21.619  1.00 0.00  ? 13   TYR A HH     1  
ATOM   217    N  N      . ALA A 1 14  ? 7.559   6.492   17.555  1.00 20.52 ? 14   ALA A N      1  
ATOM   218    C  CA     . ALA A 1 14  ? 8.760   5.894   16.867  1.00 17.91 ? 14   ALA A CA     1  
ATOM   219    C  C      . ALA A 1 14  ? 9.777   5.274   17.837  1.00 19.42 ? 14   ALA A C      1  
ATOM   220    O  O      . ALA A 1 14  ? 10.370  5.948   18.656  1.00 23.20 ? 14   ALA A O      1  
ATOM   221    C  CB     . ALA A 1 14  ? 9.394   7.061   16.117  1.00 18.67 ? 14   ALA A CB     1  
ATOM   222    H  H      . ALA A 1 14  ? 7.170   7.314   17.191  1.00 0.00  ? 14   ALA A H      1  
ATOM   223    H  HA     . ALA A 1 14  ? 8.440   5.153   16.155  1.00 0.00  ? 14   ALA A HA     1  
ATOM   224    H  HB1    . ALA A 1 14  ? 10.452  6.883   16.005  1.00 0.00  ? 14   ALA A HB1    1  
ATOM   225    H  HB2    . ALA A 1 14  ? 9.237   7.973   16.673  1.00 0.00  ? 14   ALA A HB2    1  
ATOM   226    H  HB3    . ALA A 1 14  ? 8.939   7.150   15.141  1.00 0.00  ? 14   ALA A HB3    1  
ATOM   227    N  N      . LYS A 1 15  ? 9.998   3.987   17.713  1.00 17.87 ? 15   LYS A N      1  
ATOM   228    C  CA     . LYS A 1 15  ? 10.998  3.299   18.587  1.00 13.86 ? 15   LYS A CA     1  
ATOM   229    C  C      . LYS A 1 15  ? 12.412  3.762   18.206  1.00 22.04 ? 15   LYS A C      1  
ATOM   230    O  O      . LYS A 1 15  ? 13.345  3.661   18.980  1.00 27.53 ? 15   LYS A O      1  
ATOM   231    C  CB     . LYS A 1 15  ? 10.821  1.808   18.298  1.00 14.26 ? 15   LYS A CB     1  
ATOM   232    C  CG     . LYS A 1 15  ? 9.459   1.344   18.823  1.00 21.40 ? 15   LYS A CG     1  
ATOM   233    C  CD     . LYS A 1 15  ? 9.409   -0.186  18.837  1.00 27.44 ? 15   LYS A CD     1  
ATOM   234    C  CE     . LYS A 1 15  ? 8.410   -0.656  19.900  1.00 36.58 ? 15   LYS A CE     1  
ATOM   235    N  NZ     . LYS A 1 15  ? 7.778   -1.879  19.329  1.00 57.35 ? 15   LYS A NZ     1  
ATOM   236    H  H      . LYS A 1 15  ? 9.521   3.479   17.024  1.00 0.00  ? 15   LYS A H      1  
ATOM   237    H  HA     . LYS A 1 15  ? 10.798  3.504   19.627  1.00 0.00  ? 15   LYS A HA     1  
ATOM   238    H  HB2    . LYS A 1 15  ? 10.873  1.641   17.232  1.00 0.00  ? 15   LYS A HB2    1  
ATOM   239    H  HB3    . LYS A 1 15  ? 11.603  1.250   18.789  1.00 0.00  ? 15   LYS A HB3    1  
ATOM   240    H  HG2    . LYS A 1 15  ? 9.314   1.720   19.826  1.00 0.00  ? 15   LYS A HG2    1  
ATOM   241    H  HG3    . LYS A 1 15  ? 8.678   1.722   18.181  1.00 0.00  ? 15   LYS A HG3    1  
ATOM   242    H  HD2    . LYS A 1 15  ? 9.099   -0.544  17.866  1.00 0.00  ? 15   LYS A HD2    1  
ATOM   243    H  HD3    . LYS A 1 15  ? 10.388  -0.576  19.070  1.00 0.00  ? 15   LYS A HD3    1  
ATOM   244    H  HE2    . LYS A 1 15  ? 8.927   -0.892  20.820  1.00 0.00  ? 15   LYS A HE2    1  
ATOM   245    H  HE3    . LYS A 1 15  ? 7.661   0.101   20.072  1.00 0.00  ? 15   LYS A HE3    1  
ATOM   246    H  HZ1    . LYS A 1 15  ? 8.514   -2.575  19.098  1.00 0.00  ? 15   LYS A HZ1    1  
ATOM   247    H  HZ2    . LYS A 1 15  ? 7.253   -1.628  18.466  1.00 0.00  ? 15   LYS A HZ2    1  
ATOM   248    H  HZ3    . LYS A 1 15  ? 7.123   -2.288  20.026  1.00 0.00  ? 15   LYS A HZ3    1  
ATOM   249    N  N      . SER A 1 16  ? 12.559  4.285   17.013  1.00 25.48 ? 16   SER A N      1  
ATOM   250    C  CA     . SER A 1 16  ? 13.878  4.793   16.551  1.00 21.30 ? 16   SER A CA     1  
ATOM   251    C  C      . SER A 1 16  ? 13.649  5.917   15.529  1.00 24.91 ? 16   SER A C      1  
ATOM   252    O  O      . SER A 1 16  ? 12.521  6.223   15.183  1.00 20.61 ? 16   SER A O      1  
ATOM   253    C  CB     . SER A 1 16  ? 14.553  3.595   15.887  1.00 23.39 ? 16   SER A CB     1  
ATOM   254    O  OG     . SER A 1 16  ? 14.288  3.616   14.489  1.00 25.58 ? 16   SER A OG     1  
ATOM   255    H  H      . SER A 1 16  ? 11.786  4.356   16.418  1.00 0.00  ? 16   SER A H      1  
ATOM   256    H  HA     . SER A 1 16  ? 14.466  5.139   17.385  1.00 0.00  ? 16   SER A HA     1  
ATOM   257    H  HB2    . SER A 1 16  ? 15.617  3.646   16.047  1.00 0.00  ? 16   SER A HB2    1  
ATOM   258    H  HB3    . SER A 1 16  ? 14.170  2.682   16.323  1.00 0.00  ? 16   SER A HB3    1  
ATOM   259    H  HG     . SER A 1 16  ? 14.334  2.715   14.165  1.00 0.00  ? 16   SER A HG     1  
ATOM   260    N  N      . GLY A 1 17  ? 14.703  6.529   15.044  1.00 24.25 ? 17   GLY A N      1  
ATOM   261    C  CA     . GLY A 1 17  ? 14.530  7.637   14.061  1.00 20.02 ? 17   GLY A CA     1  
ATOM   262    C  C      . GLY A 1 17  ? 15.086  7.187   12.706  1.00 23.96 ? 17   GLY A C      1  
ATOM   263    O  O      . GLY A 1 17  ? 15.403  7.996   11.855  1.00 19.85 ? 17   GLY A O      1  
ATOM   264    H  H      . GLY A 1 17  ? 15.592  6.293   15.384  1.00 0.00  ? 17   GLY A H      1  
ATOM   265    H  HA2    . GLY A 1 17  ? 13.480  7.873   13.965  1.00 0.00  ? 17   GLY A HA2    1  
ATOM   266    H  HA3    . GLY A 1 17  ? 15.066  8.514   14.395  1.00 0.00  ? 17   GLY A HA3    1  
ATOM   267    N  N      . ARG A 1 18  ? 15.223  5.894   12.506  1.00 20.35 ? 18   ARG A N      1  
ATOM   268    C  CA     . ARG A 1 18  ? 15.785  5.376   11.221  1.00 21.35 ? 18   ARG A CA     1  
ATOM   269    C  C      . ARG A 1 18  ? 14.691  5.001   10.210  1.00 22.05 ? 18   ARG A C      1  
ATOM   270    O  O      . ARG A 1 18  ? 14.963  4.854   9.031   1.00 21.05 ? 18   ARG A O      1  
ATOM   271    C  CB     . ARG A 1 18  ? 16.554  4.114   11.627  1.00 23.28 ? 18   ARG A CB     1  
ATOM   272    C  CG     . ARG A 1 18  ? 17.966  4.489   12.087  1.00 30.52 ? 18   ARG A CG     1  
ATOM   273    C  CD     . ARG A 1 18  ? 18.425  3.517   13.176  1.00 39.33 ? 18   ARG A CD     1  
ATOM   274    N  NE     . ARG A 1 18  ? 18.630  2.220   12.469  1.00 41.65 ? 18   ARG A NE     1  
ATOM   275    C  CZ     . ARG A 1 18  ? 18.686  1.097   13.140  1.00 47.92 ? 18   ARG A CZ     1  
ATOM   276    N  NH1    . ARG A 1 18  ? 18.572  1.093   14.445  1.00 48.84 ? 18   ARG A NH1    1  
ATOM   277    N  NH2    . ARG A 1 18  ? 18.861  -0.027  12.501  1.00 49.24 ? 18   ARG A NH2    1  
ATOM   278    H  H      . ARG A 1 18  ? 14.977  5.262   13.213  1.00 0.00  ? 18   ARG A H      1  
ATOM   279    H  HA     . ARG A 1 18  ? 16.468  6.091   10.794  1.00 0.00  ? 18   ARG A HA     1  
ATOM   280    H  HB2    . ARG A 1 18  ? 16.031  3.620   12.434  1.00 0.00  ? 18   ARG A HB2    1  
ATOM   281    H  HB3    . ARG A 1 18  ? 16.620  3.445   10.782  1.00 0.00  ? 18   ARG A HB3    1  
ATOM   282    H  HG2    . ARG A 1 18  ? 18.644  4.433   11.248  1.00 0.00  ? 18   ARG A HG2    1  
ATOM   283    H  HG3    . ARG A 1 18  ? 17.963  5.493   12.483  1.00 0.00  ? 18   ARG A HG3    1  
ATOM   284    H  HD2    . ARG A 1 18  ? 19.352  3.858   13.618  1.00 0.00  ? 18   ARG A HD2    1  
ATOM   285    H  HD3    . ARG A 1 18  ? 17.663  3.410   13.932  1.00 0.00  ? 18   ARG A HD3    1  
ATOM   286    H  HE     . ARG A 1 18  ? 18.723  2.207   11.494  1.00 0.00  ? 18   ARG A HE     1  
ATOM   287    H  HH11   . ARG A 1 18  ? 18.441  1.951   14.941  1.00 0.00  ? 18   ARG A HH11   1  
ATOM   288    H  HH12   . ARG A 1 18  ? 18.616  0.229   14.946  1.00 0.00  ? 18   ARG A HH12   1  
ATOM   289    H  HH21   . ARG A 1 18  ? 18.954  -0.027  11.506  1.00 0.00  ? 18   ARG A HH21   1  
ATOM   290    H  HH22   . ARG A 1 18  ? 18.899  -0.888  13.006  1.00 0.00  ? 18   ARG A HH22   1  
ATOM   291    N  N      . ALA A 1 19  ? 13.474  4.843   10.641  1.00 20.84 ? 19   ALA A N      1  
ATOM   292    C  CA     . ALA A 1 19  ? 12.380  4.493   9.658   1.00 18.95 ? 19   ALA A CA     1  
ATOM   293    C  C      . ALA A 1 19  ? 12.131  5.642   8.669   1.00 21.42 ? 19   ALA A C      1  
ATOM   294    O  O      . ALA A 1 19  ? 12.163  6.804   9.027   1.00 20.64 ? 19   ALA A O      1  
ATOM   295    C  CB     . ALA A 1 19  ? 11.135  4.243   10.507  1.00 18.52 ? 19   ALA A CB     1  
ATOM   296    H  H      . ALA A 1 19  ? 13.203  5.008   11.567  1.00 0.00  ? 19   ALA A H      1  
ATOM   297    H  HA     . ALA A 1 19  ? 12.644  3.595   9.126   1.00 0.00  ? 19   ALA A HA     1  
ATOM   298    H  HB1    . ALA A 1 19  ? 10.273  4.148   9.863   1.00 0.00  ? 19   ALA A HB1    1  
ATOM   299    H  HB2    . ALA A 1 19  ? 10.990  5.070   11.186  1.00 0.00  ? 19   ALA A HB2    1  
ATOM   300    H  HB3    . ALA A 1 19  ? 11.265  3.331   11.071  1.00 0.00  ? 19   ALA A HB3    1  
ATOM   301    N  N      . SER A 1 20  ? 11.886  5.313   7.427   1.00 22.34 ? 20   SER A N      1  
ATOM   302    C  CA     . SER A 1 20  ? 11.643  6.352   6.398   1.00 24.12 ? 20   SER A CA     1  
ATOM   303    C  C      . SER A 1 20  ? 10.177  6.313   5.987   1.00 21.61 ? 20   SER A C      1  
ATOM   304    O  O      . SER A 1 20  ? 9.612   5.260   5.754   1.00 22.04 ? 20   SER A O      1  
ATOM   305    C  CB     . SER A 1 20  ? 12.543  5.974   5.223   1.00 21.65 ? 20   SER A CB     1  
ATOM   306    O  OG     . SER A 1 20  ? 12.479  4.568   5.018   1.00 33.05 ? 20   SER A OG     1  
ATOM   307    H  H      . SER A 1 20  ? 11.880  4.373   7.178   1.00 0.00  ? 20   SER A H      1  
ATOM   308    H  HA     . SER A 1 20  ? 11.909  7.329   6.771   1.00 0.00  ? 20   SER A HA     1  
ATOM   309    H  HB2    . SER A 1 20  ? 12.206  6.478   4.332   1.00 0.00  ? 20   SER A HB2    1  
ATOM   310    H  HB3    . SER A 1 20  ? 13.560  6.271   5.439   1.00 0.00  ? 20   SER A HB3    1  
ATOM   311    H  HG     . SER A 1 20  ? 13.360  4.210   5.143   1.00 0.00  ? 20   SER A HG     1  
ATOM   312    N  N      . CYS A 1 21  ? 9.570   7.448   5.904   1.00 17.15 ? 21   CYS A N      1  
ATOM   313    C  CA     . CYS A 1 21  ? 8.129   7.517   5.511   1.00 15.04 ? 21   CYS A CA     1  
ATOM   314    C  C      . CYS A 1 21  ? 7.928   6.969   4.094   1.00 20.02 ? 21   CYS A C      1  
ATOM   315    O  O      . CYS A 1 21  ? 8.601   7.371   3.164   1.00 18.74 ? 21   CYS A O      1  
ATOM   316    C  CB     . CYS A 1 21  ? 7.809   9.004   5.566   1.00 15.75 ? 21   CYS A CB     1  
ATOM   317    S  SG     . CYS A 1 21  ? 6.080   9.290   5.137   1.00 17.32 ? 21   CYS A SG     1  
ATOM   318    H  H      . CYS A 1 21  ? 10.048  8.284   6.095   1.00 0.00  ? 21   CYS A H      1  
ATOM   319    H  HA     . CYS A 1 21  ? 7.516   6.983   6.217   1.00 0.00  ? 21   CYS A HA     1  
ATOM   320    H  HB2    . CYS A 1 21  ? 7.993   9.367   6.565   1.00 0.00  ? 21   CYS A HB2    1  
ATOM   321    H  HB3    . CYS A 1 21  ? 8.444   9.534   4.870   1.00 0.00  ? 21   CYS A HB3    1  
ATOM   322    N  N      . LYS A 1 22  ? 7.014   6.044   3.928   1.00 19.10 ? 22   LYS A N      1  
ATOM   323    C  CA     . LYS A 1 22  ? 6.776   5.449   2.575   1.00 14.89 ? 22   LYS A CA     1  
ATOM   324    C  C      . LYS A 1 22  ? 6.075   6.442   1.628   1.00 18.50 ? 22   LYS A C      1  
ATOM   325    O  O      . LYS A 1 22  ? 5.890   6.157   0.460   1.00 20.27 ? 22   LYS A O      1  
ATOM   326    C  CB     . LYS A 1 22  ? 5.886   4.239   2.837   1.00 18.82 ? 22   LYS A CB     1  
ATOM   327    C  CG     . LYS A 1 22  ? 6.737   2.969   2.828   1.00 15.21 ? 22   LYS A CG     1  
ATOM   328    C  CD     . LYS A 1 22  ? 7.194   2.667   1.400   1.00 19.41 ? 22   LYS A CD     1  
ATOM   329    C  CE     . LYS A 1 22  ? 7.916   1.319   1.372   1.00 19.64 ? 22   LYS A CE     1  
ATOM   330    N  NZ     . LYS A 1 22  ? 9.148   1.531   2.179   1.00 21.87 ? 22   LYS A NZ     1  
ATOM   331    H  H      . LYS A 1 22  ? 6.507   5.728   4.707   1.00 0.00  ? 22   LYS A H      1  
ATOM   332    H  HA     . LYS A 1 22  ? 7.710   5.124   2.143   1.00 0.00  ? 22   LYS A HA     1  
ATOM   333    H  HB2    . LYS A 1 22  ? 5.411   4.347   3.801   1.00 0.00  ? 22   LYS A HB2    1  
ATOM   334    H  HB3    . LYS A 1 22  ? 5.132   4.171   2.068   1.00 0.00  ? 22   LYS A HB3    1  
ATOM   335    H  HG2    . LYS A 1 22  ? 7.601   3.114   3.461   1.00 0.00  ? 22   LYS A HG2    1  
ATOM   336    H  HG3    . LYS A 1 22  ? 6.152   2.142   3.200   1.00 0.00  ? 22   LYS A HG3    1  
ATOM   337    H  HD2    . LYS A 1 22  ? 6.335   2.630   0.746   1.00 0.00  ? 22   LYS A HD2    1  
ATOM   338    H  HD3    . LYS A 1 22  ? 7.869   3.441   1.065   1.00 0.00  ? 22   LYS A HD3    1  
ATOM   339    H  HE2    . LYS A 1 22  ? 7.297   0.553   1.819   1.00 0.00  ? 22   LYS A HE2    1  
ATOM   340    H  HE3    . LYS A 1 22  ? 8.178   1.051   0.360   1.00 0.00  ? 22   LYS A HE3    1  
ATOM   341    H  HZ1    . LYS A 1 22  ? 8.895   1.620   3.183   1.00 0.00  ? 22   LYS A HZ1    1  
ATOM   342    H  HZ2    . LYS A 1 22  ? 9.626   2.399   1.862   1.00 0.00  ? 22   LYS A HZ2    1  
ATOM   343    H  HZ3    . LYS A 1 22  ? 9.782   0.723   2.055   1.00 0.00  ? 22   LYS A HZ3    1  
ATOM   344    N  N      . LYS A 1 23  ? 5.687   7.599   2.115   1.00 17.56 ? 23   LYS A N      1  
ATOM   345    C  CA     . LYS A 1 23  ? 5.005   8.608   1.240   1.00 19.86 ? 23   LYS A CA     1  
ATOM   346    C  C      . LYS A 1 23  ? 5.975   9.729   0.816   1.00 28.53 ? 23   LYS A C      1  
ATOM   347    O  O      . LYS A 1 23  ? 6.187   9.958   -0.361  1.00 29.86 ? 23   LYS A O      1  
ATOM   348    C  CB     . LYS A 1 23  ? 3.885   9.198   2.100   1.00 15.31 ? 23   LYS A CB     1  
ATOM   349    C  CG     . LYS A 1 23  ? 3.074   10.191  1.261   1.00 14.68 ? 23   LYS A CG     1  
ATOM   350    C  CD     . LYS A 1 23  ? 2.475   11.269  2.168   1.00 27.02 ? 23   LYS A CD     1  
ATOM   351    C  CE     . LYS A 1 23  ? 1.969   12.438  1.317   1.00 26.91 ? 23   LYS A CE     1  
ATOM   352    N  NZ     . LYS A 1 23  ? 3.191   13.209  0.953   1.00 24.85 ? 23   LYS A NZ     1  
ATOM   353    H  H      . LYS A 1 23  ? 5.845   7.802   3.049   1.00 0.00  ? 23   LYS A H      1  
ATOM   354    H  HA     . LYS A 1 23  ? 4.583   8.127   0.372   1.00 0.00  ? 23   LYS A HA     1  
ATOM   355    H  HB2    . LYS A 1 23  ? 3.238   8.405   2.450   1.00 0.00  ? 23   LYS A HB2    1  
ATOM   356    H  HB3    . LYS A 1 23  ? 4.314   9.714   2.946   1.00 0.00  ? 23   LYS A HB3    1  
ATOM   357    H  HG2    . LYS A 1 23  ? 3.721   10.655  0.530   1.00 0.00  ? 23   LYS A HG2    1  
ATOM   358    H  HG3    . LYS A 1 23  ? 2.279   9.668   0.753   1.00 0.00  ? 23   LYS A HG3    1  
ATOM   359    H  HD2    . LYS A 1 23  ? 1.653   10.849  2.729   1.00 0.00  ? 23   LYS A HD2    1  
ATOM   360    H  HD3    . LYS A 1 23  ? 3.231   11.626  2.851   1.00 0.00  ? 23   LYS A HD3    1  
ATOM   361    H  HE2    . LYS A 1 23  ? 1.474   12.070  0.428   1.00 0.00  ? 23   LYS A HE2    1  
ATOM   362    H  HE3    . LYS A 1 23  ? 1.299   13.059  1.891   1.00 0.00  ? 23   LYS A HE3    1  
ATOM   363    H  HZ1    . LYS A 1 23  ? 3.748   13.398  1.809   1.00 0.00  ? 23   LYS A HZ1    1  
ATOM   364    H  HZ2    . LYS A 1 23  ? 2.913   14.111  0.513   1.00 0.00  ? 23   LYS A HZ2    1  
ATOM   365    H  HZ3    . LYS A 1 23  ? 3.763   12.657  0.284   1.00 0.00  ? 23   LYS A HZ3    1  
ATOM   366    N  N      . CYS A 1 24  ? 6.537   10.444  1.764   1.00 27.41 ? 24   CYS A N      1  
ATOM   367    C  CA     . CYS A 1 24  ? 7.463   11.569  1.405   1.00 17.42 ? 24   CYS A CA     1  
ATOM   368    C  C      . CYS A 1 24  ? 8.957   11.171  1.493   1.00 20.96 ? 24   CYS A C      1  
ATOM   369    O  O      . CYS A 1 24  ? 9.820   11.946  1.132   1.00 27.34 ? 24   CYS A O      1  
ATOM   370    C  CB     . CYS A 1 24  ? 7.115   12.694  2.384   1.00 17.55 ? 24   CYS A CB     1  
ATOM   371    S  SG     . CYS A 1 24  ? 7.738   12.321  4.043   1.00 25.74 ? 24   CYS A SG     1  
ATOM   372    H  H      . CYS A 1 24  ? 6.329   10.258  2.701   1.00 0.00  ? 24   CYS A H      1  
ATOM   373    H  HA     . CYS A 1 24  ? 7.245   11.900  0.402   1.00 0.00  ? 24   CYS A HA     1  
ATOM   374    H  HB2    . CYS A 1 24  ? 7.558   13.615  2.037   1.00 0.00  ? 24   CYS A HB2    1  
ATOM   375    H  HB3    . CYS A 1 24  ? 6.042   12.808  2.424   1.00 0.00  ? 24   CYS A HB3    1  
ATOM   376    N  N      . SER A 1 25  ? 9.264   9.966   1.935   1.00 18.85 ? 25   SER A N      1  
ATOM   377    C  CA     . SER A 1 25  ? 10.695  9.475   2.019   1.00 23.24 ? 25   SER A CA     1  
ATOM   378    C  C      . SER A 1 25  ? 11.522  10.109  3.165   1.00 25.40 ? 25   SER A C      1  
ATOM   379    O  O      . SER A 1 25  ? 12.621  9.657   3.445   1.00 24.73 ? 25   SER A O      1  
ATOM   380    C  CB     . SER A 1 25  ? 11.321  9.800   0.665   1.00 22.84 ? 25   SER A CB     1  
ATOM   381    O  OG     . SER A 1 25  ? 12.010  11.041  0.744   1.00 20.16 ? 25   SER A OG     1  
ATOM   382    H  H      . SER A 1 25  ? 8.546   9.356   2.202   1.00 0.00  ? 25   SER A H      1  
ATOM   383    H  HA     . SER A 1 25  ? 10.690  8.404   2.146   1.00 0.00  ? 25   SER A HA     1  
ATOM   384    H  HB2    . SER A 1 25  ? 12.018  9.024   0.397   1.00 0.00  ? 25   SER A HB2    1  
ATOM   385    H  HB3    . SER A 1 25  ? 10.542  9.854   -0.083  1.00 0.00  ? 25   SER A HB3    1  
ATOM   386    H  HG     . SER A 1 25  ? 12.880  10.873  1.115   1.00 0.00  ? 25   SER A HG     1  
ATOM   387    N  N      . GLU A 1 26  ? 11.031  11.130  3.831   1.00 24.15 ? 26   GLU A N      1  
ATOM   388    C  CA     . GLU A 1 26  ? 11.828  11.738  4.944   1.00 25.41 ? 26   GLU A CA     1  
ATOM   389    C  C      . GLU A 1 26  ? 11.853  10.787  6.146   1.00 23.73 ? 26   GLU A C      1  
ATOM   390    O  O      . GLU A 1 26  ? 10.978  9.955   6.303   1.00 23.58 ? 26   GLU A O      1  
ATOM   391    C  CB     . GLU A 1 26  ? 11.114  13.042  5.292   1.00 23.95 ? 26   GLU A CB     1  
ATOM   392    C  CG     . GLU A 1 26  ? 11.407  14.088  4.212   1.00 26.20 ? 26   GLU A CG     1  
ATOM   393    C  CD     . GLU A 1 26  ? 12.900  14.427  4.215   1.00 43.32 ? 26   GLU A CD     1  
ATOM   394    O  OE1    . GLU A 1 26  ? 13.426  14.687  5.285   1.00 44.60 ? 26   GLU A OE1    1  
ATOM   395    O  OE2    . GLU A 1 26  ? 13.491  14.422  3.148   1.00 50.67 ? 26   GLU A OE2    1  
ATOM   396    H  H      . GLU A 1 26  ? 10.152  11.488  3.606   1.00 0.00  ? 26   GLU A H      1  
ATOM   397    H  HA     . GLU A 1 26  ? 12.835  11.946  4.611   1.00 0.00  ? 26   GLU A HA     1  
ATOM   398    H  HB2    . GLU A 1 26  ? 10.050  12.865  5.345   1.00 0.00  ? 26   GLU A HB2    1  
ATOM   399    H  HB3    . GLU A 1 26  ? 11.469  13.402  6.245   1.00 0.00  ? 26   GLU A HB3    1  
ATOM   400    H  HG2    . GLU A 1 26  ? 11.128  13.696  3.245   1.00 0.00  ? 26   GLU A HG2    1  
ATOM   401    H  HG3    . GLU A 1 26  ? 10.837  14.982  4.415   1.00 0.00  ? 26   GLU A HG3    1  
ATOM   402    N  N      . SER A 1 27  ? 12.862  10.889  6.979   1.00 21.94 ? 27   SER A N      1  
ATOM   403    C  CA     . SER A 1 27  ? 12.961  9.979   8.150   1.00 21.97 ? 27   SER A CA     1  
ATOM   404    C  C      . SER A 1 27  ? 11.903  10.307  9.201   1.00 20.79 ? 27   SER A C      1  
ATOM   405    O  O      . SER A 1 27  ? 11.518  11.448  9.381   1.00 21.38 ? 27   SER A O      1  
ATOM   406    C  CB     . SER A 1 27  ? 14.357  10.226  8.719   1.00 17.24 ? 27   SER A CB     1  
ATOM   407    O  OG     . SER A 1 27  ? 14.544  11.623  8.909   1.00 24.24 ? 27   SER A OG     1  
ATOM   408    H  H      . SER A 1 27  ? 13.554  11.566  6.813   1.00 0.00  ? 27   SER A H      1  
ATOM   409    H  HA     . SER A 1 27  ? 12.873  8.951   7.836   1.00 0.00  ? 27   SER A HA     1  
ATOM   410    H  HB2    . SER A 1 27  ? 14.457  9.723   9.667   1.00 0.00  ? 27   SER A HB2    1  
ATOM   411    H  HB3    . SER A 1 27  ? 15.098  9.843   8.031   1.00 0.00  ? 27   SER A HB3    1  
ATOM   412    H  HG     . SER A 1 27  ? 13.952  11.909  9.609   1.00 0.00  ? 27   SER A HG     1  
ATOM   413    N  N      . ILE A 1 28  ? 11.463  9.312   9.919   1.00 18.84 ? 28   ILE A N      1  
ATOM   414    C  CA     . ILE A 1 28  ? 10.465  9.546   10.998  1.00 21.99 ? 28   ILE A CA     1  
ATOM   415    C  C      . ILE A 1 28  ? 11.246  9.671   12.315  1.00 18.71 ? 28   ILE A C      1  
ATOM   416    O  O      . ILE A 1 28  ? 11.936  8.750   12.695  1.00 18.80 ? 28   ILE A O      1  
ATOM   417    C  CB     . ILE A 1 28  ? 9.572   8.301   10.968  1.00 17.83 ? 28   ILE A CB     1  
ATOM   418    C  CG1    . ILE A 1 28  ? 8.901   8.204   9.592   1.00 14.25 ? 28   ILE A CG1    1  
ATOM   419    C  CG2    . ILE A 1 28  ? 8.499   8.401   12.052  1.00 13.51 ? 28   ILE A CG2    1  
ATOM   420    C  CD1    . ILE A 1 28  ? 8.202   6.851   9.449   1.00 16.62 ? 28   ILE A CD1    1  
ATOM   421    H  H      . ILE A 1 28  ? 11.819  8.410   9.765   1.00 0.00  ? 28   ILE A H      1  
ATOM   422    H  HA     . ILE A 1 28  ? 9.888   10.435  10.799  1.00 0.00  ? 28   ILE A HA     1  
ATOM   423    H  HB     . ILE A 1 28  ? 10.175  7.421   11.137  1.00 0.00  ? 28   ILE A HB     1  
ATOM   424    H  HG12   . ILE A 1 28  ? 8.174   8.997   9.489   1.00 0.00  ? 28   ILE A HG12   1  
ATOM   425    H  HG13   . ILE A 1 28  ? 9.650   8.302   8.819   1.00 0.00  ? 28   ILE A HG13   1  
ATOM   426    H  HG21   . ILE A 1 28  ? 7.691   9.027   11.703  1.00 0.00  ? 28   ILE A HG21   1  
ATOM   427    H  HG22   . ILE A 1 28  ? 8.928   8.830   12.946  1.00 0.00  ? 28   ILE A HG22   1  
ATOM   428    H  HG23   . ILE A 1 28  ? 8.120   7.414   12.273  1.00 0.00  ? 28   ILE A HG23   1  
ATOM   429    H  HD11   . ILE A 1 28  ? 8.226   6.541   8.414   1.00 0.00  ? 28   ILE A HD11   1  
ATOM   430    H  HD12   . ILE A 1 28  ? 7.176   6.939   9.774   1.00 0.00  ? 28   ILE A HD12   1  
ATOM   431    H  HD13   . ILE A 1 28  ? 8.711   6.117   10.056  1.00 0.00  ? 28   ILE A HD13   1  
ATOM   432    N  N      . PRO A 1 29  ? 11.181  10.832  12.943  1.00 18.92 ? 29   PRO A N      1  
ATOM   433    C  CA     . PRO A 1 29  ? 11.975  11.064  14.182  1.00 20.83 ? 29   PRO A CA     1  
ATOM   434    C  C      . PRO A 1 29  ? 11.535  10.175  15.351  1.00 19.21 ? 29   PRO A C      1  
ATOM   435    O  O      . PRO A 1 29  ? 10.365  9.909   15.554  1.00 18.77 ? 29   PRO A O      1  
ATOM   436    C  CB     . PRO A 1 29  ? 11.753  12.544  14.477  1.00 21.91 ? 29   PRO A CB     1  
ATOM   437    C  CG     . PRO A 1 29  ? 10.466  12.883  13.798  1.00 20.62 ? 29   PRO A CG     1  
ATOM   438    C  CD     . PRO A 1 29  ? 10.376  12.002  12.580  1.00 17.84 ? 29   PRO A CD     1  
ATOM   439    H  HA     . PRO A 1 29  ? 13.021  10.901  13.976  1.00 0.00  ? 29   PRO A HA     1  
ATOM   440    H  HB2    . PRO A 1 29  ? 11.675  12.705  15.543  1.00 0.00  ? 29   PRO A HB2    1  
ATOM   441    H  HB3    . PRO A 1 29  ? 12.556  13.134  14.063  1.00 0.00  ? 29   PRO A HB3    1  
ATOM   442    H  HG2    . PRO A 1 29  ? 9.635   12.689  14.461  1.00 0.00  ? 29   PRO A HG2    1  
ATOM   443    H  HG3    . PRO A 1 29  ? 10.468  13.919  13.496  1.00 0.00  ? 29   PRO A HG3    1  
ATOM   444    H  HD2    . PRO A 1 29  ? 9.350   11.718  12.393  1.00 0.00  ? 29   PRO A HD2    1  
ATOM   445    H  HD3    . PRO A 1 29  ? 10.801  12.493  11.719  1.00 0.00  ? 29   PRO A HD3    1  
ATOM   446    N  N      . LYS A 1 30  ? 12.499  9.713   16.114  1.00 21.31 ? 30   LYS A N      1  
ATOM   447    C  CA     . LYS A 1 30  ? 12.210  8.826   17.287  1.00 24.75 ? 30   LYS A CA     1  
ATOM   448    C  C      . LYS A 1 30  ? 11.195  9.483   18.230  1.00 22.59 ? 30   LYS A C      1  
ATOM   449    O  O      . LYS A 1 30  ? 11.214  10.681  18.423  1.00 18.62 ? 30   LYS A O      1  
ATOM   450    C  CB     . LYS A 1 30  ? 13.561  8.670   17.989  1.00 16.88 ? 30   LYS A CB     1  
ATOM   451    C  CG     . LYS A 1 30  ? 13.422  7.711   19.173  1.00 29.63 ? 30   LYS A CG     1  
ATOM   452    C  CD     . LYS A 1 30  ? 14.812  7.378   19.725  1.00 26.13 ? 30   LYS A CD     1  
ATOM   453    C  CE     . LYS A 1 30  ? 14.673  6.650   21.066  1.00 30.85 ? 30   LYS A CE     1  
ATOM   454    N  NZ     . LYS A 1 30  ? 15.989  5.984   21.281  1.00 60.43 ? 30   LYS A NZ     1  
ATOM   455    H  H      . LYS A 1 30  ? 13.426  9.946   15.900  1.00 0.00  ? 30   LYS A H      1  
ATOM   456    H  HA     . LYS A 1 30  ? 11.854  7.863   16.957  1.00 0.00  ? 30   LYS A HA     1  
ATOM   457    H  HB2    . LYS A 1 30  ? 14.286  8.278   17.290  1.00 0.00  ? 30   LYS A HB2    1  
ATOM   458    H  HB3    . LYS A 1 30  ? 13.893  9.634   18.347  1.00 0.00  ? 30   LYS A HB3    1  
ATOM   459    H  HG2    . LYS A 1 30  ? 12.829  8.178   19.946  1.00 0.00  ? 30   LYS A HG2    1  
ATOM   460    H  HG3    . LYS A 1 30  ? 12.939  6.803   18.846  1.00 0.00  ? 30   LYS A HG3    1  
ATOM   461    H  HD2    . LYS A 1 30  ? 15.335  6.743   19.024  1.00 0.00  ? 30   LYS A HD2    1  
ATOM   462    H  HD3    . LYS A 1 30  ? 15.370  8.290   19.870  1.00 0.00  ? 30   LYS A HD3    1  
ATOM   463    H  HE2    . LYS A 1 30  ? 14.475  7.359   21.858  1.00 0.00  ? 30   LYS A HE2    1  
ATOM   464    H  HE3    . LYS A 1 30  ? 13.889  5.911   21.015  1.00 0.00  ? 30   LYS A HE3    1  
ATOM   465    H  HZ1    . LYS A 1 30  ? 16.021  5.577   22.237  1.00 0.00  ? 30   LYS A HZ1    1  
ATOM   466    H  HZ2    . LYS A 1 30  ? 16.753  6.683   21.174  1.00 0.00  ? 30   LYS A HZ2    1  
ATOM   467    H  HZ3    . LYS A 1 30  ? 16.113  5.225   20.581  1.00 0.00  ? 30   LYS A HZ3    1  
ATOM   468    N  N      . ASP A 1 31  ? 10.314  8.690   18.818  1.00 23.87 ? 31   ASP A N      1  
ATOM   469    C  CA     . ASP A 1 31  ? 9.268   9.211   19.776  1.00 24.13 ? 31   ASP A CA     1  
ATOM   470    C  C      . ASP A 1 31  ? 8.128   9.957   19.058  1.00 24.72 ? 31   ASP A C      1  
ATOM   471    O  O      . ASP A 1 31  ? 7.120   10.272  19.667  1.00 25.43 ? 31   ASP A O      1  
ATOM   472    C  CB     . ASP A 1 31  ? 9.984   10.156  20.745  1.00 20.67 ? 31   ASP A CB     1  
ATOM   473    C  CG     . ASP A 1 31  ? 11.215  9.464   21.334  1.00 30.42 ? 31   ASP A CG     1  
ATOM   474    O  OD1    . ASP A 1 31  ? 11.116  8.291   21.655  1.00 34.09 ? 31   ASP A OD1    1  
ATOM   475    O  OD2    . ASP A 1 31  ? 12.236  10.120  21.455  1.00 36.24 ? 31   ASP A OD2    1  
ATOM   476    H  H      . ASP A 1 31  ? 10.347  7.727   18.634  1.00 0.00  ? 31   ASP A H      1  
ATOM   477    H  HA     . ASP A 1 31  ? 8.855   8.384   20.333  1.00 0.00  ? 31   ASP A HA     1  
ATOM   478    H  HB2    . ASP A 1 31  ? 10.286  11.049  20.220  1.00 0.00  ? 31   ASP A HB2    1  
ATOM   479    H  HB3    . ASP A 1 31  ? 9.309   10.423  21.545  1.00 0.00  ? 31   ASP A HB3    1  
ATOM   480    N  N      . SER A 1 32  ? 8.259   10.237  17.782  1.00 16.38 ? 32   SER A N      1  
ATOM   481    C  CA     . SER A 1 32  ? 7.164   10.953  17.069  1.00 18.83 ? 32   SER A CA     1  
ATOM   482    C  C      . SER A 1 32  ? 6.021   9.983   16.791  1.00 19.83 ? 32   SER A C      1  
ATOM   483    O  O      . SER A 1 32  ? 6.226   8.784   16.711  1.00 18.96 ? 32   SER A O      1  
ATOM   484    C  CB     . SER A 1 32  ? 7.787   11.442  15.765  1.00 18.06 ? 32   SER A CB     1  
ATOM   485    O  OG     . SER A 1 32  ? 7.937   10.344  14.876  1.00 20.49 ? 32   SER A OG     1  
ATOM   486    H  H      . SER A 1 32  ? 9.063   9.975   17.295  1.00 0.00  ? 32   SER A H      1  
ATOM   487    H  HA     . SER A 1 32  ? 6.816   11.791  17.653  1.00 0.00  ? 32   SER A HA     1  
ATOM   488    H  HB2    . SER A 1 32  ? 7.147   12.181  15.313  1.00 0.00  ? 32   SER A HB2    1  
ATOM   489    H  HB3    . SER A 1 32  ? 8.752   11.883  15.975  1.00 0.00  ? 32   SER A HB3    1  
ATOM   490    H  HG     . SER A 1 32  ? 8.864   10.281  14.636  1.00 0.00  ? 32   SER A HG     1  
ATOM   491    N  N      . LEU A 1 33  ? 4.826   10.486  16.642  1.00 17.48 ? 33   LEU A N      1  
ATOM   492    C  CA     . LEU A 1 33  ? 3.672   9.590   16.367  1.00 16.64 ? 33   LEU A CA     1  
ATOM   493    C  C      . LEU A 1 33  ? 3.700   9.144   14.905  1.00 22.88 ? 33   LEU A C      1  
ATOM   494    O  O      . LEU A 1 33  ? 3.646   9.956   14.000  1.00 24.44 ? 33   LEU A O      1  
ATOM   495    C  CB     . LEU A 1 33  ? 2.429   10.434  16.651  1.00 13.16 ? 33   LEU A CB     1  
ATOM   496    C  CG     . LEU A 1 33  ? 1.179   9.572   16.465  1.00 18.91 ? 33   LEU A CG     1  
ATOM   497    C  CD1    . LEU A 1 33  ? 1.043   8.607   17.644  1.00 17.77 ? 33   LEU A CD1    1  
ATOM   498    C  CD2    . LEU A 1 33  ? -0.060  10.470  16.399  1.00 17.47 ? 33   LEU A CD2    1  
ATOM   499    H  H      . LEU A 1 33  ? 4.693   11.455  16.706  1.00 0.00  ? 33   LEU A H      1  
ATOM   500    H  HA     . LEU A 1 33  ? 3.695   8.734   17.023  1.00 0.00  ? 33   LEU A HA     1  
ATOM   501    H  HB2    . LEU A 1 33  ? 2.468   10.802  17.666  1.00 0.00  ? 33   LEU A HB2    1  
ATOM   502    H  HB3    . LEU A 1 33  ? 2.395   11.267  15.966  1.00 0.00  ? 33   LEU A HB3    1  
ATOM   503    H  HG     . LEU A 1 33  ? 1.265   9.008   15.548  1.00 0.00  ? 33   LEU A HG     1  
ATOM   504    H  HD11   . LEU A 1 33  ? -0.003  8.441   17.856  1.00 0.00  ? 33   LEU A HD11   1  
ATOM   505    H  HD12   . LEU A 1 33  ? 1.524   9.031   18.514  1.00 0.00  ? 33   LEU A HD12   1  
ATOM   506    H  HD13   . LEU A 1 33  ? 1.513   7.667   17.395  1.00 0.00  ? 33   LEU A HD13   1  
ATOM   507    H  HD21   . LEU A 1 33  ? -0.228  10.777  15.377  1.00 0.00  ? 33   LEU A HD21   1  
ATOM   508    H  HD22   . LEU A 1 33  ? 0.094   11.344  17.016  1.00 0.00  ? 33   LEU A HD22   1  
ATOM   509    H  HD23   . LEU A 1 33  ? -0.920  9.924   16.756  1.00 0.00  ? 33   LEU A HD23   1  
ATOM   510    N  N      . ARG A 1 34  ? 3.787   7.852   14.672  1.00 17.81 ? 34   ARG A N      1  
ATOM   511    C  CA     . ARG A 1 34  ? 3.826   7.340   13.280  1.00 14.68 ? 34   ARG A CA     1  
ATOM   512    C  C      . ARG A 1 34  ? 2.788   6.231   13.114  1.00 18.38 ? 34   ARG A C      1  
ATOM   513    O  O      . ARG A 1 34  ? 2.384   5.601   14.074  1.00 17.19 ? 34   ARG A O      1  
ATOM   514    C  CB     . ARG A 1 34  ? 5.247   6.795   13.073  1.00 12.94 ? 34   ARG A CB     1  
ATOM   515    C  CG     . ARG A 1 34  ? 5.594   5.779   14.169  1.00 14.70 ? 34   ARG A CG     1  
ATOM   516    C  CD     . ARG A 1 34  ? 6.269   4.553   13.545  1.00 16.52 ? 34   ARG A CD     1  
ATOM   517    N  NE     . ARG A 1 34  ? 7.696   4.627   13.983  1.00 16.01 ? 34   ARG A NE     1  
ATOM   518    C  CZ     . ARG A 1 34  ? 8.350   3.544   14.335  1.00 18.84 ? 34   ARG A CZ     1  
ATOM   519    N  NH1    . ARG A 1 34  ? 7.764   2.373   14.324  1.00 19.66 ? 34   ARG A NH1    1  
ATOM   520    N  NH2    . ARG A 1 34  ? 9.599   3.636   14.704  1.00 18.47 ? 34   ARG A NH2    1  
ATOM   521    H  H      . ARG A 1 34  ? 3.839   7.249   15.443  1.00 0.00  ? 34   ARG A H      1  
ATOM   522    H  HA     . ARG A 1 34  ? 3.634   8.140   12.581  1.00 0.00  ? 34   ARG A HA     1  
ATOM   523    H  HB2    . ARG A 1 34  ? 5.306   6.315   12.107  1.00 0.00  ? 34   ARG A HB2    1  
ATOM   524    H  HB3    . ARG A 1 34  ? 5.952   7.612   13.109  1.00 0.00  ? 34   ARG A HB3    1  
ATOM   525    H  HG2    . ARG A 1 34  ? 6.266   6.235   14.881  1.00 0.00  ? 34   ARG A HG2    1  
ATOM   526    H  HG3    . ARG A 1 34  ? 4.691   5.470   14.673  1.00 0.00  ? 34   ARG A HG3    1  
ATOM   527    H  HD2    . ARG A 1 34  ? 5.806   3.650   13.913  1.00 0.00  ? 34   ARG A HD2    1  
ATOM   528    H  HD3    . ARG A 1 34  ? 6.211   4.597   12.469  1.00 0.00  ? 34   ARG A HD3    1  
ATOM   529    H  HE     . ARG A 1 34  ? 8.152   5.494   14.006  1.00 0.00  ? 34   ARG A HE     1  
ATOM   530    H  HH11   . ARG A 1 34  ? 6.810   2.291   14.046  1.00 0.00  ? 34   ARG A HH11   1  
ATOM   531    H  HH12   . ARG A 1 34  ? 8.275   1.558   14.598  1.00 0.00  ? 34   ARG A HH12   1  
ATOM   532    H  HH21   . ARG A 1 34  ? 10.052  4.527   14.717  1.00 0.00  ? 34   ARG A HH21   1  
ATOM   533    H  HH22   . ARG A 1 34  ? 10.102  2.815   14.974  1.00 0.00  ? 34   ARG A HH22   1  
ATOM   534    N  N      . MET A 1 35  ? 2.355   5.996   11.905  1.00 17.10 ? 35   MET A N      1  
ATOM   535    C  CA     . MET A 1 35  ? 1.342   4.931   11.661  1.00 15.54 ? 35   MET A CA     1  
ATOM   536    C  C      . MET A 1 35  ? 1.814   4.024   10.527  1.00 18.06 ? 35   MET A C      1  
ATOM   537    O  O      . MET A 1 35  ? 2.572   4.441   9.666   1.00 12.57 ? 35   MET A O      1  
ATOM   538    C  CB     . MET A 1 35  ? 0.072   5.681   11.260  1.00 14.43 ? 35   MET A CB     1  
ATOM   539    C  CG     . MET A 1 35  ? -0.622  6.212   12.515  1.00 21.23 ? 35   MET A CG     1  
ATOM   540    S  SD     . MET A 1 35  ? -2.367  6.525   12.152  1.00 32.33 ? 35   MET A SD     1  
ATOM   541    C  CE     . MET A 1 35  ? -2.923  4.803   12.194  1.00 24.23 ? 35   MET A CE     1  
ATOM   542    H  H      . MET A 1 35  ? 2.703   6.524   11.153  1.00 0.00  ? 35   MET A H      1  
ATOM   543    H  HA     . MET A 1 35  ? 1.168   4.359   12.559  1.00 0.00  ? 35   MET A HA     1  
ATOM   544    H  HB2    . MET A 1 35  ? 0.332   6.508   10.614  1.00 0.00  ? 35   MET A HB2    1  
ATOM   545    H  HB3    . MET A 1 35  ? -0.593  5.011   10.738  1.00 0.00  ? 35   MET A HB3    1  
ATOM   546    H  HG2    . MET A 1 35  ? -0.544  5.480   13.306  1.00 0.00  ? 35   MET A HG2    1  
ATOM   547    H  HG3    . MET A 1 35  ? -0.148  7.131   12.827  1.00 0.00  ? 35   MET A HG3    1  
ATOM   548    H  HE1    . MET A 1 35  ? -2.063  4.147   12.209  1.00 0.00  ? 35   MET A HE1    1  
ATOM   549    H  HE2    . MET A 1 35  ? -3.517  4.593   11.318  1.00 0.00  ? 35   MET A HE2    1  
ATOM   550    H  HE3    . MET A 1 35  ? -3.522  4.640   13.079  1.00 0.00  ? 35   MET A HE3    1  
ATOM   551    N  N      . ALA A 1 36  ? 1.389   2.787   10.521  1.00 14.04 ? 36   ALA A N      1  
ATOM   552    C  CA     . ALA A 1 36  ? 1.846   1.874   9.445   1.00 14.62 ? 36   ALA A CA     1  
ATOM   553    C  C      . ALA A 1 36  ? 0.758   0.893   9.040   1.00 17.40 ? 36   ALA A C      1  
ATOM   554    O  O      . ALA A 1 36  ? -0.052  0.463   9.842   1.00 18.72 ? 36   ALA A O      1  
ATOM   555    C  CB     . ALA A 1 36  ? 3.015   1.099   10.048  1.00 12.78 ? 36   ALA A CB     1  
ATOM   556    H  H      . ALA A 1 36  ? 0.798   2.455   11.233  1.00 0.00  ? 36   ALA A H      1  
ATOM   557    H  HA     . ALA A 1 36  ? 2.186   2.438   8.591   1.00 0.00  ? 36   ALA A HA     1  
ATOM   558    H  HB1    . ALA A 1 36  ? 2.919   1.080   11.123  1.00 0.00  ? 36   ALA A HB1    1  
ATOM   559    H  HB2    . ALA A 1 36  ? 3.941   1.577   9.774   1.00 0.00  ? 36   ALA A HB2    1  
ATOM   560    H  HB3    . ALA A 1 36  ? 3.007   0.085   9.671   1.00 0.00  ? 36   ALA A HB3    1  
ATOM   561    N  N      . ILE A 1 37  ? 0.805   0.457   7.810   1.00 16.10 ? 37   ILE A N      1  
ATOM   562    C  CA     . ILE A 1 37  ? -0.153  -0.581  7.342   1.00 22.59 ? 37   ILE A CA     1  
ATOM   563    C  C      . ILE A 1 37  ? 0.564   -1.936  7.433   1.00 23.48 ? 37   ILE A C      1  
ATOM   564    O  O      . ILE A 1 37  ? 1.562   -2.167  6.781   1.00 19.72 ? 37   ILE A O      1  
ATOM   565    C  CB     . ILE A 1 37  ? -0.506  -0.218  5.890   1.00 16.82 ? 37   ILE A CB     1  
ATOM   566    C  CG1    . ILE A 1 37  ? -1.412  -1.303  5.303   1.00 27.02 ? 37   ILE A CG1    1  
ATOM   567    C  CG2    . ILE A 1 37  ? 0.762   -0.103  5.037   1.00 15.86 ? 37   ILE A CG2    1  
ATOM   568    C  CD1    . ILE A 1 37  ? -2.323  -0.687  4.239   1.00 33.55 ? 37   ILE A CD1    1  
ATOM   569    H  H      . ILE A 1 37  ? 1.517   0.767   7.215   1.00 0.00  ? 37   ILE A H      1  
ATOM   570    H  HA     . ILE A 1 37  ? -1.040  -0.580  7.958   1.00 0.00  ? 37   ILE A HA     1  
ATOM   571    H  HB     . ILE A 1 37  ? -1.028  0.728   5.878   1.00 0.00  ? 37   ILE A HB     1  
ATOM   572    H  HG12   . ILE A 1 37  ? -0.804  -2.075  4.855   1.00 0.00  ? 37   ILE A HG12   1  
ATOM   573    H  HG13   . ILE A 1 37  ? -2.017  -1.731  6.088   1.00 0.00  ? 37   ILE A HG13   1  
ATOM   574    H  HG21   . ILE A 1 37  ? 1.363   0.721   5.391   1.00 0.00  ? 37   ILE A HG21   1  
ATOM   575    H  HG22   . ILE A 1 37  ? 0.485   0.073   4.008   1.00 0.00  ? 37   ILE A HG22   1  
ATOM   576    H  HG23   . ILE A 1 37  ? 1.328   -1.018  5.103   1.00 0.00  ? 37   ILE A HG23   1  
ATOM   577    H  HD11   . ILE A 1 37  ? -2.499  0.352   4.473   1.00 0.00  ? 37   ILE A HD11   1  
ATOM   578    H  HD12   . ILE A 1 37  ? -3.265  -1.216  4.222   1.00 0.00  ? 37   ILE A HD12   1  
ATOM   579    H  HD13   . ILE A 1 37  ? -1.850  -0.764  3.272   1.00 0.00  ? 37   ILE A HD13   1  
ATOM   580    N  N      . MET A 1 38  ? 0.094   -2.811  8.277   1.00 23.23 ? 38   MET A N      1  
ATOM   581    C  CA     . MET A 1 38  ? 0.779   -4.130  8.458   1.00 22.50 ? 38   MET A CA     1  
ATOM   582    C  C      . MET A 1 38  ? 0.685   -5.004  7.206   1.00 27.87 ? 38   MET A C      1  
ATOM   583    O  O      . MET A 1 38  ? -0.317  -5.023  6.517   1.00 27.66 ? 38   MET A O      1  
ATOM   584    C  CB     . MET A 1 38  ? 0.043   -4.796  9.623   1.00 19.89 ? 38   MET A CB     1  
ATOM   585    C  CG     . MET A 1 38  ? 1.052   -5.515  10.521  1.00 23.67 ? 38   MET A CG     1  
ATOM   586    S  SD     . MET A 1 38  ? 1.537   -4.425  11.883  1.00 20.20 ? 38   MET A SD     1  
ATOM   587    C  CE     . MET A 1 38  ? 0.842   -5.418  13.227  1.00 28.61 ? 38   MET A CE     1  
ATOM   588    H  H      . MET A 1 38  ? -0.690  -2.589  8.823   1.00 0.00  ? 38   MET A H      1  
ATOM   589    H  HA     . MET A 1 38  ? 1.812   -3.977  8.726   1.00 0.00  ? 38   MET A HA     1  
ATOM   590    H  HB2    . MET A 1 38  ? -0.479  -4.043  10.195  1.00 0.00  ? 38   MET A HB2    1  
ATOM   591    H  HB3    . MET A 1 38  ? -0.667  -5.512  9.238   1.00 0.00  ? 38   MET A HB3    1  
ATOM   592    H  HG2    . MET A 1 38  ? 0.602   -6.412  10.921  1.00 0.00  ? 38   MET A HG2    1  
ATOM   593    H  HG3    . MET A 1 38  ? 1.925   -5.778  9.943   1.00 0.00  ? 38   MET A HG3    1  
ATOM   594    H  HE1    . MET A 1 38  ? 1.378   -5.209  14.142  1.00 0.00  ? 38   MET A HE1    1  
ATOM   595    H  HE2    . MET A 1 38  ? 0.936   -6.465  12.988  1.00 0.00  ? 38   MET A HE2    1  
ATOM   596    H  HE3    . MET A 1 38  ? -0.204  -5.172  13.351  1.00 0.00  ? 38   MET A HE3    1  
ATOM   597    N  N      . VAL A 1 39  ? 1.727   -5.744  6.925   1.00 25.82 ? 39   VAL A N      1  
ATOM   598    C  CA     . VAL A 1 39  ? 1.718   -6.644  5.737   1.00 26.62 ? 39   VAL A CA     1  
ATOM   599    C  C      . VAL A 1 39  ? 2.423   -7.962  6.084   1.00 31.41 ? 39   VAL A C      1  
ATOM   600    O  O      . VAL A 1 39  ? 3.419   -7.980  6.781   1.00 30.06 ? 39   VAL A O      1  
ATOM   601    C  CB     . VAL A 1 39  ? 2.471   -5.878  4.642   1.00 25.20 ? 39   VAL A CB     1  
ATOM   602    C  CG1    . VAL A 1 39  ? 1.871   -4.479  4.503   1.00 34.96 ? 39   VAL A CG1    1  
ATOM   603    C  CG2    . VAL A 1 39  ? 3.959   -5.758  4.996   1.00 21.52 ? 39   VAL A CG2    1  
ATOM   604    H  H      . VAL A 1 39  ? 2.513   -5.717  7.509   1.00 0.00  ? 39   VAL A H      1  
ATOM   605    H  HA     . VAL A 1 39  ? 0.704   -6.835  5.422   1.00 0.00  ? 39   VAL A HA     1  
ATOM   606    H  HB     . VAL A 1 39  ? 2.366   -6.404  3.705   1.00 0.00  ? 39   VAL A HB     1  
ATOM   607    H  HG11   . VAL A 1 39  ? 2.314   -3.822  5.237   1.00 0.00  ? 39   VAL A HG11   1  
ATOM   608    H  HG12   . VAL A 1 39  ? 0.804   -4.527  4.661   1.00 0.00  ? 39   VAL A HG12   1  
ATOM   609    H  HG13   . VAL A 1 39  ? 2.070   -4.099  3.512   1.00 0.00  ? 39   VAL A HG13   1  
ATOM   610    H  HG21   . VAL A 1 39  ? 4.550   -6.243  4.234   1.00 0.00  ? 39   VAL A HG21   1  
ATOM   611    H  HG22   . VAL A 1 39  ? 4.145   -6.228  5.948   1.00 0.00  ? 39   VAL A HG22   1  
ATOM   612    H  HG23   . VAL A 1 39  ? 4.234   -4.715  5.054   1.00 0.00  ? 39   VAL A HG23   1  
ATOM   613    N  N      . GLN A 1 40  ? 1.911   -9.065  5.612   1.00 37.04 ? 40   GLN A N      1  
ATOM   614    C  CA     . GLN A 1 40  ? 2.552   -10.377 5.923   1.00 34.73 ? 40   GLN A CA     1  
ATOM   615    C  C      . GLN A 1 40  ? 3.730   -10.622 4.976   1.00 33.18 ? 40   GLN A C      1  
ATOM   616    O  O      . GLN A 1 40  ? 3.623   -10.442 3.779   1.00 37.40 ? 40   GLN A O      1  
ATOM   617    C  CB     . GLN A 1 40  ? 1.456   -11.418 5.697   1.00 17.44 ? 40   GLN A CB     1  
ATOM   618    C  CG     . GLN A 1 40  ? 1.849   -12.730 6.380   1.00 40.93 ? 40   GLN A CG     1  
ATOM   619    C  CD     . GLN A 1 40  ? 0.809   -13.805 6.058   1.00 58.69 ? 40   GLN A CD     1  
ATOM   620    O  OE1    . GLN A 1 40  ? -0.302  -13.757 6.546   1.00 63.94 ? 40   GLN A OE1    1  
ATOM   621    N  NE2    . GLN A 1 40  ? 1.126   -14.781 5.251   1.00 54.01 ? 40   GLN A NE2    1  
ATOM   622    H  H      . GLN A 1 40  ? 1.104   -9.033  5.058   1.00 0.00  ? 40   GLN A H      1  
ATOM   623    H  HA     . GLN A 1 40  ? 2.881   -10.403 6.949   1.00 0.00  ? 40   GLN A HA     1  
ATOM   624    H  HB2    . GLN A 1 40  ? 0.526   -11.058 6.114   1.00 0.00  ? 40   GLN A HB2    1  
ATOM   625    H  HB3    . GLN A 1 40  ? 1.334   -11.589 4.638   1.00 0.00  ? 40   GLN A HB3    1  
ATOM   626    H  HG2    . GLN A 1 40  ? 2.818   -13.046 6.021   1.00 0.00  ? 40   GLN A HG2    1  
ATOM   627    H  HG3    . GLN A 1 40  ? 1.891   -12.581 7.448   1.00 0.00  ? 40   GLN A HG3    1  
ATOM   628    H  HE21   . GLN A 1 40  ? 2.023   -14.820 4.858   1.00 0.00  ? 40   GLN A HE21   1  
ATOM   629    H  HE22   . GLN A 1 40  ? 0.467   -15.475 5.039   1.00 0.00  ? 40   GLN A HE22   1  
ATOM   630    N  N      . SER A 1 41  ? 4.855   -11.028 5.503   1.00 36.90 ? 41   SER A N      1  
ATOM   631    C  CA     . SER A 1 41  ? 6.041   -11.281 4.631   1.00 42.69 ? 41   SER A CA     1  
ATOM   632    C  C      . SER A 1 41  ? 6.100   -12.761 4.222   1.00 45.47 ? 41   SER A C      1  
ATOM   633    O  O      . SER A 1 41  ? 5.963   -13.635 5.055   1.00 44.27 ? 41   SER A O      1  
ATOM   634    C  CB     . SER A 1 41  ? 7.248   -10.917 5.493   1.00 43.88 ? 41   SER A CB     1  
ATOM   635    O  OG     . SER A 1 41  ? 8.364   -10.656 4.652   1.00 48.72 ? 41   SER A OG     1  
ATOM   636    H  H      . SER A 1 41  ? 4.921   -11.165 6.471   1.00 0.00  ? 41   SER A H      1  
ATOM   637    H  HA     . SER A 1 41  ? 6.006   -10.647 3.761   1.00 0.00  ? 41   SER A HA     1  
ATOM   638    H  HB2    . SER A 1 41  ? 7.027   -10.036 6.072   1.00 0.00  ? 41   SER A HB2    1  
ATOM   639    H  HB3    . SER A 1 41  ? 7.472   -11.738 6.162   1.00 0.00  ? 41   SER A HB3    1  
ATOM   640    H  HG     . SER A 1 41  ? 8.777   -11.495 4.438   1.00 0.00  ? 41   SER A HG     1  
ATOM   641    N  N      . PRO A 1 42  ? 6.304   -12.997 2.947   1.00 52.87 ? 42   PRO A N      1  
ATOM   642    C  CA     . PRO A 1 42  ? 6.382   -14.386 2.438   1.00 51.98 ? 42   PRO A CA     1  
ATOM   643    C  C      . PRO A 1 42  ? 7.789   -14.968 2.638   1.00 54.26 ? 42   PRO A C      1  
ATOM   644    O  O      . PRO A 1 42  ? 8.039   -16.117 2.328   1.00 57.82 ? 42   PRO A O      1  
ATOM   645    C  CB     . PRO A 1 42  ? 6.076   -14.233 0.952   1.00 40.31 ? 42   PRO A CB     1  
ATOM   646    C  CG     . PRO A 1 42  ? 6.461   -12.827 0.602   1.00 34.32 ? 42   PRO A CG     1  
ATOM   647    C  CD     . PRO A 1 42  ? 6.473   -12.011 1.874   1.00 41.31 ? 42   PRO A CD     1  
ATOM   648    H  HA     . PRO A 1 42  ? 5.638   -15.008 2.906   1.00 0.00  ? 42   PRO A HA     1  
ATOM   649    H  HB2    . PRO A 1 42  ? 6.661   -14.938 0.378   1.00 0.00  ? 42   PRO A HB2    1  
ATOM   650    H  HB3    . PRO A 1 42  ? 5.023   -14.383 0.770   1.00 0.00  ? 42   PRO A HB3    1  
ATOM   651    H  HG2    . PRO A 1 42  ? 7.444   -12.819 0.152   1.00 0.00  ? 42   PRO A HG2    1  
ATOM   652    H  HG3    . PRO A 1 42  ? 5.740   -12.411 -0.086  1.00 0.00  ? 42   PRO A HG3    1  
ATOM   653    H  HD2    . PRO A 1 42  ? 7.416   -11.493 1.978   1.00 0.00  ? 42   PRO A HD2    1  
ATOM   654    H  HD3    . PRO A 1 42  ? 5.652   -11.311 1.881   1.00 0.00  ? 42   PRO A HD3    1  
ATOM   655    N  N      . MET A 1 43  ? 8.710   -14.188 3.143   1.00 54.47 ? 43   MET A N      1  
ATOM   656    C  CA     . MET A 1 43  ? 10.097  -14.704 3.348   1.00 54.93 ? 43   MET A CA     1  
ATOM   657    C  C      . MET A 1 43  ? 10.289  -15.193 4.788   1.00 52.89 ? 43   MET A C      1  
ATOM   658    O  O      . MET A 1 43  ? 11.238  -15.889 5.092   1.00 50.52 ? 43   MET A O      1  
ATOM   659    C  CB     . MET A 1 43  ? 11.007  -13.510 3.064   1.00 51.06 ? 43   MET A CB     1  
ATOM   660    C  CG     . MET A 1 43  ? 10.861  -13.093 1.599   1.00 69.08 ? 43   MET A CG     1  
ATOM   661    S  SD     . MET A 1 43  ? 12.030  -14.031 0.585   1.00 52.35 ? 43   MET A SD     1  
ATOM   662    C  CE     . MET A 1 43  ? 11.711  -13.176 -0.977  1.00 65.97 ? 43   MET A CE     1  
ATOM   663    H  H      . MET A 1 43  ? 8.494   -13.264 3.382   1.00 0.00  ? 43   MET A H      1  
ATOM   664    H  HA     . MET A 1 43  ? 10.308  -15.499 2.651   1.00 0.00  ? 43   MET A HA     1  
ATOM   665    H  HB2    . MET A 1 43  ? 10.728  -12.685 3.704   1.00 0.00  ? 43   MET A HB2    1  
ATOM   666    H  HB3    . MET A 1 43  ? 12.033  -13.784 3.257   1.00 0.00  ? 43   MET A HB3    1  
ATOM   667    H  HG2    . MET A 1 43  ? 9.853   -13.295 1.267   1.00 0.00  ? 43   MET A HG2    1  
ATOM   668    H  HG3    . MET A 1 43  ? 11.067  -12.037 1.503   1.00 0.00  ? 43   MET A HG3    1  
ATOM   669    H  HE1    . MET A 1 43  ? 12.002  -13.813 -1.801  1.00 0.00  ? 43   MET A HE1    1  
ATOM   670    H  HE2    . MET A 1 43  ? 12.284  -12.263 -1.013  1.00 0.00  ? 43   MET A HE2    1  
ATOM   671    H  HE3    . MET A 1 43  ? 10.658  -12.941 -1.050  1.00 0.00  ? 43   MET A HE3    1  
ATOM   672    N  N      . PHE A 1 44  ? 9.400   -14.835 5.677   1.00 45.91 ? 44   PHE A N      1  
ATOM   673    C  CA     . PHE A 1 44  ? 9.541   -15.282 7.094   1.00 45.62 ? 44   PHE A CA     1  
ATOM   674    C  C      . PHE A 1 44  ? 8.252   -15.005 7.873   1.00 52.47 ? 44   PHE A C      1  
ATOM   675    O  O      . PHE A 1 44  ? 7.532   -14.069 7.585   1.00 58.31 ? 44   PHE A O      1  
ATOM   676    C  CB     . PHE A 1 44  ? 10.697  -14.454 7.662   1.00 49.72 ? 44   PHE A CB     1  
ATOM   677    C  CG     . PHE A 1 44  ? 10.384  -12.981 7.536   1.00 51.73 ? 44   PHE A CG     1  
ATOM   678    C  CD1    . PHE A 1 44  ? 9.617   -12.337 8.523   1.00 46.78 ? 44   PHE A CD1    1  
ATOM   679    C  CD2    . PHE A 1 44  ? 10.862  -12.253 6.432   1.00 51.42 ? 44   PHE A CD2    1  
ATOM   680    C  CE1    . PHE A 1 44  ? 9.328   -10.965 8.406   1.00 40.68 ? 44   PHE A CE1    1  
ATOM   681    C  CE2    . PHE A 1 44  ? 10.573  -10.882 6.315   1.00 41.97 ? 44   PHE A CE2    1  
ATOM   682    C  CZ     . PHE A 1 44  ? 9.806   -10.238 7.302   1.00 43.62 ? 44   PHE A CZ     1  
ATOM   683    H  H      . PHE A 1 44  ? 8.642   -14.272 5.416   1.00 0.00  ? 44   PHE A H      1  
ATOM   684    H  HA     . PHE A 1 44  ? 9.786   -16.332 7.135   1.00 0.00  ? 44   PHE A HA     1  
ATOM   685    H  HB2    . PHE A 1 44  ? 10.839  -14.703 8.704   1.00 0.00  ? 44   PHE A HB2    1  
ATOM   686    H  HB3    . PHE A 1 44  ? 11.601  -14.677 7.114   1.00 0.00  ? 44   PHE A HB3    1  
ATOM   687    H  HD1    . PHE A 1 44  ? 9.249   -12.895 9.371   1.00 0.00  ? 44   PHE A HD1    1  
ATOM   688    H  HD2    . PHE A 1 44  ? 11.451  -12.748 5.674   1.00 0.00  ? 44   PHE A HD2    1  
ATOM   689    H  HE1    . PHE A 1 44  ? 8.739   -10.471 9.164   1.00 0.00  ? 44   PHE A HE1    1  
ATOM   690    H  HE2    . PHE A 1 44  ? 10.941  -10.324 5.467   1.00 0.00  ? 44   PHE A HE2    1  
ATOM   691    H  HZ     . PHE A 1 44  ? 9.586   -9.186  7.212   1.00 0.00  ? 44   PHE A HZ     1  
ATOM   692    N  N      . ASP A 1 45  ? 7.964   -15.807 8.863   1.00 54.42 ? 45   ASP A N      1  
ATOM   693    C  CA     . ASP A 1 45  ? 6.728   -15.583 9.668   1.00 58.10 ? 45   ASP A CA     1  
ATOM   694    C  C      . ASP A 1 45  ? 6.829   -14.247 10.407  1.00 66.11 ? 45   ASP A C      1  
ATOM   695    O  O      . ASP A 1 45  ? 7.753   -14.013 11.161  1.00 68.92 ? 45   ASP A O      1  
ATOM   696    C  CB     . ASP A 1 45  ? 6.681   -16.746 10.661  1.00 59.34 ? 45   ASP A CB     1  
ATOM   697    C  CG     . ASP A 1 45  ? 5.224   -17.080 10.989  1.00 76.02 ? 45   ASP A CG     1  
ATOM   698    O  OD1    . ASP A 1 45  ? 4.469   -17.318 10.061  1.00 66.91 ? 45   ASP A OD1    1  
ATOM   699    O  OD2    . ASP A 1 45  ? 4.889   -17.092 12.162  1.00 80.62 ? 45   ASP A OD2    1  
ATOM   700    H  H      . ASP A 1 45  ? 8.564   -16.551 9.081   1.00 0.00  ? 45   ASP A H      1  
ATOM   701    H  HA     . ASP A 1 45  ? 5.855   -15.601 9.034   1.00 0.00  ? 45   ASP A HA     1  
ATOM   702    H  HB2    . ASP A 1 45  ? 7.161   -17.610 10.226  1.00 0.00  ? 45   ASP A HB2    1  
ATOM   703    H  HB3    . ASP A 1 45  ? 7.196   -16.466 11.567  1.00 0.00  ? 45   ASP A HB3    1  
ATOM   704    N  N      . GLY A 1 46  ? 5.892   -13.368 10.188  1.00 66.60 ? 46   GLY A N      1  
ATOM   705    C  CA     . GLY A 1 46  ? 5.934   -12.041 10.865  1.00 62.39 ? 46   GLY A CA     1  
ATOM   706    C  C      . GLY A 1 46  ? 5.403   -10.979 9.903   1.00 57.06 ? 46   GLY A C      1  
ATOM   707    O  O      . GLY A 1 46  ? 5.421   -11.159 8.701   1.00 50.09 ? 46   GLY A O      1  
ATOM   708    H  H      . GLY A 1 46  ? 5.161   -13.577 9.569   1.00 0.00  ? 46   GLY A H      1  
ATOM   709    H  HA2    . GLY A 1 46  ? 5.318   -12.069 11.753  1.00 0.00  ? 46   GLY A HA2    1  
ATOM   710    H  HA3    . GLY A 1 46  ? 6.951   -11.803 11.136  1.00 0.00  ? 46   GLY A HA3    1  
ATOM   711    N  N      . LYS A 1 47  ? 4.921   -9.879  10.415  1.00 43.68 ? 47   LYS A N      1  
ATOM   712    C  CA     . LYS A 1 47  ? 4.379   -8.819  9.515   1.00 37.59 ? 47   LYS A CA     1  
ATOM   713    C  C      . LYS A 1 47  ? 5.345   -7.632  9.411   1.00 32.28 ? 47   LYS A C      1  
ATOM   714    O  O      . LYS A 1 47  ? 5.918   -7.194  10.389  1.00 39.08 ? 47   LYS A O      1  
ATOM   715    C  CB     . LYS A 1 47  ? 3.059   -8.385  10.161  1.00 33.15 ? 47   LYS A CB     1  
ATOM   716    C  CG     . LYS A 1 47  ? 3.319   -7.850  11.575  1.00 33.38 ? 47   LYS A CG     1  
ATOM   717    C  CD     . LYS A 1 47  ? 2.539   -8.686  12.592  1.00 50.59 ? 47   LYS A CD     1  
ATOM   718    C  CE     . LYS A 1 47  ? 3.176   -8.532  13.975  1.00 55.67 ? 47   LYS A CE     1  
ATOM   719    N  NZ     . LYS A 1 47  ? 2.668   -9.689  14.764  1.00 54.16 ? 47   LYS A NZ     1  
ATOM   720    H  H      . LYS A 1 47  ? 4.907   -9.755  11.387  1.00 0.00  ? 47   LYS A H      1  
ATOM   721    H  HA     . LYS A 1 47  ? 4.185   -9.227  8.535   1.00 0.00  ? 47   LYS A HA     1  
ATOM   722    H  HB2    . LYS A 1 47  ? 2.606   -7.610  9.561   1.00 0.00  ? 47   LYS A HB2    1  
ATOM   723    H  HB3    . LYS A 1 47  ? 2.392   -9.233  10.215  1.00 0.00  ? 47   LYS A HB3    1  
ATOM   724    H  HG2    . LYS A 1 47  ? 4.374   -7.908  11.796  1.00 0.00  ? 47   LYS A HG2    1  
ATOM   725    H  HG3    . LYS A 1 47  ? 2.995   -6.822  11.635  1.00 0.00  ? 47   LYS A HG3    1  
ATOM   726    H  HD2    . LYS A 1 47  ? 1.514   -8.346  12.627  1.00 0.00  ? 47   LYS A HD2    1  
ATOM   727    H  HD3    . LYS A 1 47  ? 2.565   -9.725  12.301  1.00 0.00  ? 47   LYS A HD3    1  
ATOM   728    H  HE2    . LYS A 1 47  ? 4.254   -8.570  13.897  1.00 0.00  ? 47   LYS A HE2    1  
ATOM   729    H  HE3    . LYS A 1 47  ? 2.862   -7.607  14.433  1.00 0.00  ? 47   LYS A HE3    1  
ATOM   730    H  HZ1    . LYS A 1 47  ? 3.067   -9.657  15.723  1.00 0.00  ? 47   LYS A HZ1    1  
ATOM   731    H  HZ2    . LYS A 1 47  ? 2.953   -10.576 14.299  1.00 0.00  ? 47   LYS A HZ2    1  
ATOM   732    H  HZ3    . LYS A 1 47  ? 1.631   -9.643  14.819  1.00 0.00  ? 47   LYS A HZ3    1  
ATOM   733    N  N      . VAL A 1 48  ? 5.511   -7.100  8.227   1.00 29.00 ? 48   VAL A N      1  
ATOM   734    C  CA     . VAL A 1 48  ? 6.419   -5.926  8.041   1.00 28.38 ? 48   VAL A CA     1  
ATOM   735    C  C      . VAL A 1 48  ? 5.577   -4.645  8.006   1.00 30.79 ? 48   VAL A C      1  
ATOM   736    O  O      . VAL A 1 48  ? 4.584   -4.589  7.310   1.00 32.45 ? 48   VAL A O      1  
ATOM   737    C  CB     . VAL A 1 48  ? 7.102   -6.157  6.691   1.00 31.12 ? 48   VAL A CB     1  
ATOM   738    C  CG1    . VAL A 1 48  ? 8.085   -5.018  6.413   1.00 29.70 ? 48   VAL A CG1    1  
ATOM   739    C  CG2    . VAL A 1 48  ? 7.861   -7.486  6.723   1.00 36.91 ? 48   VAL A CG2    1  
ATOM   740    H  H      . VAL A 1 48  ? 5.026   -7.465  7.458   1.00 0.00  ? 48   VAL A H      1  
ATOM   741    H  HA     . VAL A 1 48  ? 7.153   -5.885  8.829   1.00 0.00  ? 48   VAL A HA     1  
ATOM   742    H  HB     . VAL A 1 48  ? 6.355   -6.185  5.911   1.00 0.00  ? 48   VAL A HB     1  
ATOM   743    H  HG11   . VAL A 1 48  ? 7.773   -4.134  6.949   1.00 0.00  ? 48   VAL A HG11   1  
ATOM   744    H  HG12   . VAL A 1 48  ? 8.104   -4.809  5.354   1.00 0.00  ? 48   VAL A HG12   1  
ATOM   745    H  HG13   . VAL A 1 48  ? 9.073   -5.307  6.741   1.00 0.00  ? 48   VAL A HG13   1  
ATOM   746    H  HG21   . VAL A 1 48  ? 7.190   -8.276  7.025   1.00 0.00  ? 48   VAL A HG21   1  
ATOM   747    H  HG22   . VAL A 1 48  ? 8.677   -7.418  7.427   1.00 0.00  ? 48   VAL A HG22   1  
ATOM   748    H  HG23   . VAL A 1 48  ? 8.251   -7.701  5.739   1.00 0.00  ? 48   VAL A HG23   1  
ATOM   749    N  N      . PRO A 1 49  ? 5.966   -3.661  8.776   1.00 27.88 ? 49   PRO A N      1  
ATOM   750    C  CA     . PRO A 1 49  ? 5.191   -2.418  8.824   1.00 22.81 ? 49   PRO A CA     1  
ATOM   751    C  C      . PRO A 1 49  ? 5.684   -1.392  7.807   1.00 17.10 ? 49   PRO A C      1  
ATOM   752    O  O      . PRO A 1 49  ? 6.851   -1.044  7.781   1.00 26.81 ? 49   PRO A O      1  
ATOM   753    C  CB     . PRO A 1 49  ? 5.467   -1.907  10.232  1.00 22.13 ? 49   PRO A CB     1  
ATOM   754    C  CG     . PRO A 1 49  ? 6.800   -2.487  10.621  1.00 23.53 ? 49   PRO A CG     1  
ATOM   755    C  CD     . PRO A 1 49  ? 7.123   -3.613  9.667   1.00 22.30 ? 49   PRO A CD     1  
ATOM   756    H  HA     . PRO A 1 49  ? 4.139   -2.612  8.703   1.00 0.00  ? 49   PRO A HA     1  
ATOM   757    H  HB2    . PRO A 1 49  ? 5.509   -0.826  10.235  1.00 0.00  ? 49   PRO A HB2    1  
ATOM   758    H  HB3    . PRO A 1 49  ? 4.704   -2.255  10.911  1.00 0.00  ? 49   PRO A HB3    1  
ATOM   759    H  HG2    . PRO A 1 49  ? 7.562   -1.723  10.554  1.00 0.00  ? 49   PRO A HG2    1  
ATOM   760    H  HG3    . PRO A 1 49  ? 6.754   -2.870  11.629  1.00 0.00  ? 49   PRO A HG3    1  
ATOM   761    H  HD2    . PRO A 1 49  ? 8.025   -3.393  9.113   1.00 0.00  ? 49   PRO A HD2    1  
ATOM   762    H  HD3    . PRO A 1 49  ? 7.220   -4.545  10.201  1.00 0.00  ? 49   PRO A HD3    1  
ATOM   763    N  N      . HIS A 1 50  ? 4.789   -0.842  7.036   1.00 17.20 ? 50   HIS A N      1  
ATOM   764    C  CA     . HIS A 1 50  ? 5.183   0.247   6.103   1.00 19.81 ? 50   HIS A CA     1  
ATOM   765    C  C      . HIS A 1 50  ? 4.879   1.535   6.873   1.00 18.47 ? 50   HIS A C      1  
ATOM   766    O  O      . HIS A 1 50  ? 3.731   1.903   7.026   1.00 18.67 ? 50   HIS A O      1  
ATOM   767    C  CB     . HIS A 1 50  ? 4.288   0.104   4.869   1.00 16.01 ? 50   HIS A CB     1  
ATOM   768    C  CG     . HIS A 1 50  ? 4.530   -1.229  4.214   1.00 21.18 ? 50   HIS A CG     1  
ATOM   769    N  ND1    . HIS A 1 50  ? 5.795   -1.645  3.825   1.00 22.74 ? 50   HIS A ND1    1  
ATOM   770    C  CD2    . HIS A 1 50  ? 3.678   -2.248  3.866   1.00 22.09 ? 50   HIS A CD2    1  
ATOM   771    C  CE1    . HIS A 1 50  ? 5.668   -2.865  3.271   1.00 26.01 ? 50   HIS A CE1    1  
ATOM   772    N  NE2    . HIS A 1 50  ? 4.398   -3.279  3.271   1.00 23.91 ? 50   HIS A NE2    1  
ATOM   773    H  H      . HIS A 1 50  ? 3.844   -1.091  7.128   1.00 0.00  ? 50   HIS A H      1  
ATOM   774    H  HA     . HIS A 1 50  ? 6.229   0.179   5.843   1.00 0.00  ? 50   HIS A HA     1  
ATOM   775    H  HB2    . HIS A 1 50  ? 3.253   0.177   5.164   1.00 0.00  ? 50   HIS A HB2    1  
ATOM   776    H  HB3    . HIS A 1 50  ? 4.517   0.894   4.168   1.00 0.00  ? 50   HIS A HB3    1  
ATOM   777    H  HD1    . HIS A 1 50  ? 6.629   -1.142  3.932   1.00 0.00  ? 50   HIS A HD1    1  
ATOM   778    H  HD2    . HIS A 1 50  ? 2.611   -2.248  4.029   1.00 0.00  ? 50   HIS A HD2    1  
ATOM   779    H  HE1    . HIS A 1 50  ? 6.492   -3.440  2.874   1.00 0.00  ? 50   HIS A HE1    1  
ATOM   780    N  N      . TRP A 1 51  ? 5.886   2.161   7.448   1.00 14.75 ? 51   TRP A N      1  
ATOM   781    C  CA     . TRP A 1 51  ? 5.631   3.353   8.297   1.00 12.99 ? 51   TRP A CA     1  
ATOM   782    C  C      . TRP A 1 51  ? 5.481   4.659   7.517   1.00 13.82 ? 51   TRP A C      1  
ATOM   783    O  O      . TRP A 1 51  ? 5.990   4.839   6.424   1.00 14.73 ? 51   TRP A O      1  
ATOM   784    C  CB     . TRP A 1 51  ? 6.837   3.422   9.232   1.00 13.82 ? 51   TRP A CB     1  
ATOM   785    C  CG     . TRP A 1 51  ? 6.696   2.375   10.291  1.00 16.33 ? 51   TRP A CG     1  
ATOM   786    C  CD1    . TRP A 1 51  ? 7.535   1.329   10.468  1.00 13.99 ? 51   TRP A CD1    1  
ATOM   787    C  CD2    . TRP A 1 51  ? 5.674   2.255   11.319  1.00 15.07 ? 51   TRP A CD2    1  
ATOM   788    N  NE1    . TRP A 1 51  ? 7.086   0.571   11.532  1.00 15.84 ? 51   TRP A NE1    1  
ATOM   789    C  CE2    . TRP A 1 51  ? 5.944   1.099   12.089  1.00 18.14 ? 51   TRP A CE2    1  
ATOM   790    C  CE3    . TRP A 1 51  ? 4.546   3.028   11.652  1.00 17.08 ? 51   TRP A CE3    1  
ATOM   791    C  CZ2    . TRP A 1 51  ? 5.129   0.718   13.152  1.00 14.13 ? 51   TRP A CZ2    1  
ATOM   792    C  CZ3    . TRP A 1 51  ? 3.720   2.650   12.725  1.00 18.03 ? 51   TRP A CZ3    1  
ATOM   793    C  CH2    . TRP A 1 51  ? 4.012   1.494   13.474  1.00 17.28 ? 51   TRP A CH2    1  
ATOM   794    H  H      . TRP A 1 51  ? 6.782   1.769   7.341   1.00 0.00  ? 51   TRP A H      1  
ATOM   795    H  HA     . TRP A 1 51  ? 4.742   3.187   8.887   1.00 0.00  ? 51   TRP A HA     1  
ATOM   796    H  HB2    . TRP A 1 51  ? 7.741   3.246   8.669   1.00 0.00  ? 51   TRP A HB2    1  
ATOM   797    H  HB3    . TRP A 1 51  ? 6.880   4.397   9.692   1.00 0.00  ? 51   TRP A HB3    1  
ATOM   798    H  HD1    . TRP A 1 51  ? 8.411   1.118   9.873   1.00 0.00  ? 51   TRP A HD1    1  
ATOM   799    H  HE1    . TRP A 1 51  ? 7.514   -0.246  11.866  1.00 0.00  ? 51   TRP A HE1    1  
ATOM   800    H  HE3    . TRP A 1 51  ? 4.317   3.919   11.081  1.00 0.00  ? 51   TRP A HE3    1  
ATOM   801    H  HZ2    . TRP A 1 51  ? 5.360   -0.171  13.722  1.00 0.00  ? 51   TRP A HZ2    1  
ATOM   802    H  HZ3    . TRP A 1 51  ? 2.856   3.249   12.974  1.00 0.00  ? 51   TRP A HZ3    1  
ATOM   803    H  HH2    . TRP A 1 51  ? 3.374   1.206   14.296  1.00 0.00  ? 51   TRP A HH2    1  
ATOM   804    N  N      . TYR A 1 52  ? 4.775   5.568   8.125   1.00 14.59 ? 52   TYR A N      1  
ATOM   805    C  CA     . TYR A 1 52  ? 4.522   6.910   7.521   1.00 12.79 ? 52   TYR A CA     1  
ATOM   806    C  C      . TYR A 1 52  ? 4.407   7.940   8.648   1.00 14.74 ? 52   TYR A C      1  
ATOM   807    O  O      . TYR A 1 52  ? 3.928   7.621   9.724   1.00 15.94 ? 52   TYR A O      1  
ATOM   808    C  CB     . TYR A 1 52  ? 3.141   6.828   6.853   1.00 15.01 ? 52   TYR A CB     1  
ATOM   809    C  CG     . TYR A 1 52  ? 3.109   5.818   5.743   1.00 17.85 ? 52   TYR A CG     1  
ATOM   810    C  CD1    . TYR A 1 52  ? 2.887   4.464   6.033   1.00 14.07 ? 52   TYR A CD1    1  
ATOM   811    C  CD2    . TYR A 1 52  ? 3.255   6.240   4.414   1.00 19.44 ? 52   TYR A CD2    1  
ATOM   812    C  CE1    . TYR A 1 52  ? 2.818   3.530   4.992   1.00 16.41 ? 52   TYR A CE1    1  
ATOM   813    C  CE2    . TYR A 1 52  ? 3.181   5.308   3.373   1.00 16.81 ? 52   TYR A CE2    1  
ATOM   814    C  CZ     . TYR A 1 52  ? 2.963   3.953   3.663   1.00 17.11 ? 52   TYR A CZ     1  
ATOM   815    O  OH     . TYR A 1 52  ? 2.894   3.035   2.641   1.00 17.53 ? 52   TYR A OH     1  
ATOM   816    H  H      . TYR A 1 52  ? 4.370   5.377   8.999   1.00 0.00  ? 52   TYR A H      1  
ATOM   817    H  HA     . TYR A 1 52  ? 5.281   7.177   6.807   1.00 0.00  ? 52   TYR A HA     1  
ATOM   818    H  HB2    . TYR A 1 52  ? 2.407   6.549   7.594   1.00 0.00  ? 52   TYR A HB2    1  
ATOM   819    H  HB3    . TYR A 1 52  ? 2.883   7.799   6.454   1.00 0.00  ? 52   TYR A HB3    1  
ATOM   820    H  HD1    . TYR A 1 52  ? 2.775   4.141   7.059   1.00 0.00  ? 52   TYR A HD1    1  
ATOM   821    H  HD2    . TYR A 1 52  ? 3.426   7.285   4.193   1.00 0.00  ? 52   TYR A HD2    1  
ATOM   822    H  HE1    . TYR A 1 52  ? 2.647   2.485   5.212   1.00 0.00  ? 52   TYR A HE1    1  
ATOM   823    H  HE2    . TYR A 1 52  ? 3.291   5.632   2.347   1.00 0.00  ? 52   TYR A HE2    1  
ATOM   824    H  HH     . TYR A 1 52  ? 3.772   2.675   2.510   1.00 0.00  ? 52   TYR A HH     1  
ATOM   825    N  N      . HIS A 1 53  ? 4.746   9.185   8.401   1.00 13.44 ? 53   HIS A N      1  
ATOM   826    C  CA     . HIS A 1 53  ? 4.532   10.215  9.453   1.00 15.88 ? 53   HIS A CA     1  
ATOM   827    C  C      . HIS A 1 53  ? 3.019   10.276  9.654   1.00 21.42 ? 53   HIS A C      1  
ATOM   828    O  O      . HIS A 1 53  ? 2.281   9.915   8.753   1.00 20.21 ? 53   HIS A O      1  
ATOM   829    C  CB     . HIS A 1 53  ? 5.028   11.543  8.871   1.00 17.24 ? 53   HIS A CB     1  
ATOM   830    C  CG     . HIS A 1 53  ? 6.513   11.509  8.638   1.00 18.26 ? 53   HIS A CG     1  
ATOM   831    N  ND1    . HIS A 1 53  ? 7.059   11.532  7.364   1.00 17.99 ? 53   HIS A ND1    1  
ATOM   832    C  CD2    . HIS A 1 53  ? 7.577   11.501  9.509   1.00 23.33 ? 53   HIS A CD2    1  
ATOM   833    C  CE1    . HIS A 1 53  ? 8.400   11.543  7.502   1.00 24.41 ? 53   HIS A CE1    1  
ATOM   834    N  NE2    . HIS A 1 53  ? 8.768   11.526  8.788   1.00 23.92 ? 53   HIS A NE2    1  
ATOM   835    H  H      . HIS A 1 53  ? 5.057   9.444   7.517   1.00 0.00  ? 53   HIS A H      1  
ATOM   836    H  HA     . HIS A 1 53  ? 5.048   9.966   10.371  1.00 0.00  ? 53   HIS A HA     1  
ATOM   837    H  HB2    . HIS A 1 53  ? 4.528   11.729  7.938   1.00 0.00  ? 53   HIS A HB2    1  
ATOM   838    H  HB3    . HIS A 1 53  ? 4.798   12.340  9.564   1.00 0.00  ? 53   HIS A HB3    1  
ATOM   839    H  HD2    . HIS A 1 53  ? 7.498   11.481  10.591  1.00 0.00  ? 53   HIS A HD2    1  
ATOM   840    H  HE1    . HIS A 1 53  ? 9.090   11.563  6.671   1.00 0.00  ? 53   HIS A HE1    1  
ATOM   841    H  HE2    . HIS A 1 53  ? 9.681   11.531  9.148   1.00 0.00  ? 53   HIS A HE2    1  
ATOM   842    N  N      . PHE A 1 54  ? 2.544   10.678  10.799  1.00 18.07 ? 54   PHE A N      1  
ATOM   843    C  CA     . PHE A 1 54  ? 1.054   10.706  11.035  1.00 20.20 ? 54   PHE A CA     1  
ATOM   844    C  C      . PHE A 1 54  ? 0.271   11.317  9.854   1.00 21.07 ? 54   PHE A C      1  
ATOM   845    O  O      . PHE A 1 54  ? -0.673  10.728  9.361   1.00 25.87 ? 54   PHE A O      1  
ATOM   846    C  CB     . PHE A 1 54  ? 0.863   11.556  12.290  1.00 15.88 ? 54   PHE A CB     1  
ATOM   847    C  CG     . PHE A 1 54  ? -0.581  11.485  12.714  1.00 19.30 ? 54   PHE A CG     1  
ATOM   848    C  CD1    . PHE A 1 54  ? -1.168  10.239  12.975  1.00 21.48 ? 54   PHE A CD1    1  
ATOM   849    C  CD2    . PHE A 1 54  ? -1.337  12.660  12.843  1.00 22.09 ? 54   PHE A CD2    1  
ATOM   850    C  CE1    . PHE A 1 54  ? -2.512  10.164  13.367  1.00 26.90 ? 54   PHE A CE1    1  
ATOM   851    C  CE2    . PHE A 1 54  ? -2.682  12.588  13.236  1.00 22.26 ? 54   PHE A CE2    1  
ATOM   852    C  CZ     . PHE A 1 54  ? -3.269  11.339  13.498  1.00 24.85 ? 54   PHE A CZ     1  
ATOM   853    H  H      . PHE A 1 54  ? 3.160   10.935  11.519  1.00 0.00  ? 54   PHE A H      1  
ATOM   854    H  HA     . PHE A 1 54  ? 0.699   9.707   11.227  1.00 0.00  ? 54   PHE A HA     1  
ATOM   855    H  HB2    . PHE A 1 54  ? 1.491   11.176  13.083  1.00 0.00  ? 54   PHE A HB2    1  
ATOM   856    H  HB3    . PHE A 1 54  ? 1.127   12.581  12.079  1.00 0.00  ? 54   PHE A HB3    1  
ATOM   857    H  HD1    . PHE A 1 54  ? -0.584  9.335   12.873  1.00 0.00  ? 54   PHE A HD1    1  
ATOM   858    H  HD2    . PHE A 1 54  ? -0.883  13.621  12.641  1.00 0.00  ? 54   PHE A HD2    1  
ATOM   859    H  HE1    . PHE A 1 54  ? -2.964  9.202   13.568  1.00 0.00  ? 54   PHE A HE1    1  
ATOM   860    H  HE2    . PHE A 1 54  ? -3.267  13.494  13.337  1.00 0.00  ? 54   PHE A HE2    1  
ATOM   861    H  HZ     . PHE A 1 54  ? -4.305  11.282  13.800  1.00 0.00  ? 54   PHE A HZ     1  
ATOM   862    N  N      . SER A 1 55  ? 0.643   12.491  9.413   1.00 19.62 ? 55   SER A N      1  
ATOM   863    C  CA     . SER A 1 55  ? -0.091  13.151  8.282   1.00 24.28 ? 55   SER A CA     1  
ATOM   864    C  C      . SER A 1 55  ? 0.066   12.391  6.950   1.00 27.29 ? 55   SER A C      1  
ATOM   865    O  O      . SER A 1 55  ? -0.897  12.191  6.229   1.00 31.32 ? 55   SER A O      1  
ATOM   866    C  CB     . SER A 1 55  ? 0.541   14.536  8.170   1.00 28.94 ? 55   SER A CB     1  
ATOM   867    O  OG     . SER A 1 55  ? 1.849   14.409  7.629   1.00 42.24 ? 55   SER A OG     1  
ATOM   868    H  H      . SER A 1 55  ? 1.400   12.942  9.842   1.00 0.00  ? 55   SER A H      1  
ATOM   869    H  HA     . SER A 1 55  ? -1.136  13.254  8.529   1.00 0.00  ? 55   SER A HA     1  
ATOM   870    H  HB2    . SER A 1 55  ? -0.054  15.154  7.520   1.00 0.00  ? 55   SER A HB2    1  
ATOM   871    H  HB3    . SER A 1 55  ? 0.588   14.988  9.152   1.00 0.00  ? 55   SER A HB3    1  
ATOM   872    H  HG     . SER A 1 55  ? 2.473   14.737  8.281   1.00 0.00  ? 55   SER A HG     1  
ATOM   873    N  N      . CYS A 1 56  ? 1.267   11.992  6.606   1.00 24.51 ? 56   CYS A N      1  
ATOM   874    C  CA     . CYS A 1 56  ? 1.486   11.274  5.307   1.00 18.27 ? 56   CYS A CA     1  
ATOM   875    C  C      . CYS A 1 56  ? 0.604   10.017  5.191   1.00 23.54 ? 56   CYS A C      1  
ATOM   876    O  O      . CYS A 1 56  ? 0.130   9.675   4.122   1.00 21.88 ? 56   CYS A O      1  
ATOM   877    C  CB     . CYS A 1 56  ? 2.963   10.870  5.319   1.00 16.25 ? 56   CYS A CB     1  
ATOM   878    S  SG     . CYS A 1 56  ? 4.021   12.339  5.442   1.00 17.54 ? 56   CYS A SG     1  
ATOM   879    H  H      . CYS A 1 56  ? 2.026   12.181  7.197   1.00 0.00  ? 56   CYS A H      1  
ATOM   880    H  HA     . CYS A 1 56  ? 1.299   11.939  4.479   1.00 0.00  ? 56   CYS A HA     1  
ATOM   881    H  HB2    . CYS A 1 56  ? 3.150   10.224  6.164   1.00 0.00  ? 56   CYS A HB2    1  
ATOM   882    H  HB3    . CYS A 1 56  ? 3.193   10.340  4.407   1.00 0.00  ? 56   CYS A HB3    1  
ATOM   883    N  N      . PHE A 1 57  ? 0.406   9.319   6.275   1.00 19.45 ? 57   PHE A N      1  
ATOM   884    C  CA     . PHE A 1 57  ? -0.419  8.060   6.237   1.00 19.37 ? 57   PHE A CA     1  
ATOM   885    C  C      . PHE A 1 57  ? -1.794  8.272   5.565   1.00 21.13 ? 57   PHE A C      1  
ATOM   886    O  O      . PHE A 1 57  ? -2.303  7.386   4.903   1.00 24.24 ? 57   PHE A O      1  
ATOM   887    C  CB     . PHE A 1 57  ? -0.607  7.677   7.704   1.00 19.62 ? 57   PHE A CB     1  
ATOM   888    C  CG     . PHE A 1 57  ? -1.363  6.378   7.797   1.00 21.25 ? 57   PHE A CG     1  
ATOM   889    C  CD1    . PHE A 1 57  ? -0.667  5.162   7.761   1.00 15.87 ? 57   PHE A CD1    1  
ATOM   890    C  CD2    . PHE A 1 57  ? -2.760  6.387   7.929   1.00 19.91 ? 57   PHE A CD2    1  
ATOM   891    C  CE1    . PHE A 1 57  ? -1.367  3.951   7.856   1.00 14.54 ? 57   PHE A CE1    1  
ATOM   892    C  CE2    . PHE A 1 57  ? -3.462  5.177   8.027   1.00 17.33 ? 57   PHE A CE2    1  
ATOM   893    C  CZ     . PHE A 1 57  ? -2.765  3.958   7.990   1.00 17.80 ? 57   PHE A CZ     1  
ATOM   894    H  H      . PHE A 1 57  ? 0.818   9.610   7.117   1.00 0.00  ? 57   PHE A H      1  
ATOM   895    H  HA     . PHE A 1 57  ? 0.124   7.279   5.729   1.00 0.00  ? 57   PHE A HA     1  
ATOM   896    H  HB2    . PHE A 1 57  ? 0.358   7.565   8.175   1.00 0.00  ? 57   PHE A HB2    1  
ATOM   897    H  HB3    . PHE A 1 57  ? -1.166  8.452   8.209   1.00 0.00  ? 57   PHE A HB3    1  
ATOM   898    H  HD1    . PHE A 1 57  ? 0.409   5.159   7.657   1.00 0.00  ? 57   PHE A HD1    1  
ATOM   899    H  HD2    . PHE A 1 57  ? -3.295  7.326   7.955   1.00 0.00  ? 57   PHE A HD2    1  
ATOM   900    H  HE1    . PHE A 1 57  ? -0.829  3.012   7.828   1.00 0.00  ? 57   PHE A HE1    1  
ATOM   901    H  HE2    . PHE A 1 57  ? -4.540  5.183   8.129   1.00 0.00  ? 57   PHE A HE2    1  
ATOM   902    H  HZ     . PHE A 1 57  ? -3.305  3.025   8.066   1.00 0.00  ? 57   PHE A HZ     1  
ATOM   903    N  N      . TRP A 1 58  ? -2.419  9.425   5.765   1.00 24.66 ? 58   TRP A N      1  
ATOM   904    C  CA     . TRP A 1 58  ? -3.770  9.648   5.191   1.00 22.46 ? 58   TRP A CA     1  
ATOM   905    C  C      . TRP A 1 58  ? -3.701  10.192  3.759   1.00 25.18 ? 58   TRP A C      1  
ATOM   906    O  O      . TRP A 1 58  ? -4.676  10.150  3.028   1.00 26.94 ? 58   TRP A O      1  
ATOM   907    C  CB     . TRP A 1 58  ? -4.408  10.680  6.119   1.00 17.86 ? 58   TRP A CB     1  
ATOM   908    C  CG     . TRP A 1 58  ? -4.502  10.128  7.506   1.00 23.66 ? 58   TRP A CG     1  
ATOM   909    C  CD1    . TRP A 1 58  ? -3.607  10.350  8.496   1.00 24.53 ? 58   TRP A CD1    1  
ATOM   910    C  CD2    . TRP A 1 58  ? -5.533  9.274   8.074   1.00 18.42 ? 58   TRP A CD2    1  
ATOM   911    N  NE1    . TRP A 1 58  ? -4.023  9.685   9.632   1.00 26.19 ? 58   TRP A NE1    1  
ATOM   912    C  CE2    . TRP A 1 58  ? -5.203  9.009   9.425   1.00 23.99 ? 58   TRP A CE2    1  
ATOM   913    C  CE3    . TRP A 1 58  ? -6.712  8.710   7.554   1.00 25.59 ? 58   TRP A CE3    1  
ATOM   914    C  CZ2    . TRP A 1 58  ? -6.008  8.212   10.235  1.00 25.34 ? 58   TRP A CZ2    1  
ATOM   915    C  CZ3    . TRP A 1 58  ? -7.529  7.905   8.367   1.00 30.00 ? 58   TRP A CZ3    1  
ATOM   916    C  CH2    . TRP A 1 58  ? -7.176  7.657   9.707   1.00 32.08 ? 58   TRP A CH2    1  
ATOM   917    H  H      . TRP A 1 58  ? -1.968  10.058  6.357   1.00 0.00  ? 58   TRP A H      1  
ATOM   918    H  HA     . TRP A 1 58  ? -4.346  8.735   5.215   1.00 0.00  ? 58   TRP A HA     1  
ATOM   919    H  HB2    . TRP A 1 58  ? -3.801  11.573  6.131   1.00 0.00  ? 58   TRP A HB2    1  
ATOM   920    H  HB3    . TRP A 1 58  ? -5.396  10.922  5.759   1.00 0.00  ? 58   TRP A HB3    1  
ATOM   921    H  HD1    . TRP A 1 58  ? -2.713  10.949  8.412   1.00 0.00  ? 58   TRP A HD1    1  
ATOM   922    H  HE1    . TRP A 1 58  ? -3.551  9.683   10.492  1.00 0.00  ? 58   TRP A HE1    1  
ATOM   923    H  HE3    . TRP A 1 58  ? -6.989  8.897   6.525   1.00 0.00  ? 58   TRP A HE3    1  
ATOM   924    H  HZ2    . TRP A 1 58  ? -5.730  8.027   11.262  1.00 0.00  ? 58   TRP A HZ2    1  
ATOM   925    H  HZ3    . TRP A 1 58  ? -8.433  7.475   7.960   1.00 0.00  ? 58   TRP A HZ3    1  
ATOM   926    H  HH2    . TRP A 1 58  ? -7.807  7.038   10.328  1.00 0.00  ? 58   TRP A HH2    1  
ATOM   927    N  N      . LYS A 1 59  ? -2.576  10.718  3.357   1.00 23.59 ? 59   LYS A N      1  
ATOM   928    C  CA     . LYS A 1 59  ? -2.470  11.287  1.979   1.00 20.86 ? 59   LYS A CA     1  
ATOM   929    C  C      . LYS A 1 59  ? -2.176  10.208  0.925   1.00 21.54 ? 59   LYS A C      1  
ATOM   930    O  O      . LYS A 1 59  ? -2.051  10.513  -0.248  1.00 29.40 ? 59   LYS A O      1  
ATOM   931    C  CB     . LYS A 1 59  ? -1.314  12.281  2.058   1.00 22.71 ? 59   LYS A CB     1  
ATOM   932    C  CG     . LYS A 1 59  ? -1.680  13.405  3.027   1.00 22.99 ? 59   LYS A CG     1  
ATOM   933    C  CD     . LYS A 1 59  ? -0.529  14.410  3.102   1.00 27.65 ? 59   LYS A CD     1  
ATOM   934    C  CE     . LYS A 1 59  ? -0.888  15.524  4.088   1.00 34.62 ? 59   LYS A CE     1  
ATOM   935    N  NZ     . LYS A 1 59  ? 0.407   16.185  4.416   1.00 33.06 ? 59   LYS A NZ     1  
ATOM   936    H  H      . LYS A 1 59  ? -1.810  10.758  3.967   1.00 0.00  ? 59   LYS A H      1  
ATOM   937    H  HA     . LYS A 1 59  ? -3.377  11.812  1.727   1.00 0.00  ? 59   LYS A HA     1  
ATOM   938    H  HB2    . LYS A 1 59  ? -0.426  11.774  2.409   1.00 0.00  ? 59   LYS A HB2    1  
ATOM   939    H  HB3    . LYS A 1 59  ? -1.130  12.697  1.080   1.00 0.00  ? 59   LYS A HB3    1  
ATOM   940    H  HG2    . LYS A 1 59  ? -2.573  13.904  2.678   1.00 0.00  ? 59   LYS A HG2    1  
ATOM   941    H  HG3    . LYS A 1 59  ? -1.858  12.991  4.008   1.00 0.00  ? 59   LYS A HG3    1  
ATOM   942    H  HD2    . LYS A 1 59  ? 0.367   13.906  3.435   1.00 0.00  ? 59   LYS A HD2    1  
ATOM   943    H  HD3    . LYS A 1 59  ? -0.360  14.837  2.125   1.00 0.00  ? 59   LYS A HD3    1  
ATOM   944    H  HE2    . LYS A 1 59  ? -1.566  16.229  3.626   1.00 0.00  ? 59   LYS A HE2    1  
ATOM   945    H  HE3    . LYS A 1 59  ? -1.327  15.109  4.982   1.00 0.00  ? 59   LYS A HE3    1  
ATOM   946    H  HZ1    . LYS A 1 59  ? 0.261   16.875  5.179   1.00 0.00  ? 59   LYS A HZ1    1  
ATOM   947    H  HZ2    . LYS A 1 59  ? 0.771   16.673  3.571   1.00 0.00  ? 59   LYS A HZ2    1  
ATOM   948    H  HZ3    . LYS A 1 59  ? 1.094   15.469  4.726   1.00 0.00  ? 59   LYS A HZ3    1  
ATOM   949    N  N      . VAL A 1 60  ? -2.063  8.966   1.326   1.00 25.01 ? 60   VAL A N      1  
ATOM   950    C  CA     . VAL A 1 60  ? -1.769  7.883   0.337   1.00 16.41 ? 60   VAL A CA     1  
ATOM   951    C  C      . VAL A 1 60  ? -3.040  7.105   -0.032  1.00 26.16 ? 60   VAL A C      1  
ATOM   952    O  O      . VAL A 1 60  ? -3.094  6.448   -1.053  1.00 26.58 ? 60   VAL A O      1  
ATOM   953    C  CB     . VAL A 1 60  ? -0.763  6.967   1.040   1.00 21.20 ? 60   VAL A CB     1  
ATOM   954    C  CG1    . VAL A 1 60  ? -1.415  6.313   2.263   1.00 14.94 ? 60   VAL A CG1    1  
ATOM   955    C  CG2    . VAL A 1 60  ? -0.304  5.879   0.066   1.00 14.54 ? 60   VAL A CG2    1  
ATOM   956    H  H      . VAL A 1 60  ? -2.166  8.747   2.275   1.00 0.00  ? 60   VAL A H      1  
ATOM   957    H  HA     . VAL A 1 60  ? -1.320  8.302   -0.549  1.00 0.00  ? 60   VAL A HA     1  
ATOM   958    H  HB     . VAL A 1 60  ? 0.090   7.550   1.357   1.00 0.00  ? 60   VAL A HB     1  
ATOM   959    H  HG11   . VAL A 1 60  ? -1.695  5.298   2.023   1.00 0.00  ? 60   VAL A HG11   1  
ATOM   960    H  HG12   . VAL A 1 60  ? -2.294  6.871   2.546   1.00 0.00  ? 60   VAL A HG12   1  
ATOM   961    H  HG13   . VAL A 1 60  ? -0.713  6.308   3.084   1.00 0.00  ? 60   VAL A HG13   1  
ATOM   962    H  HG21   . VAL A 1 60  ? -0.057  6.328   -0.885  1.00 0.00  ? 60   VAL A HG21   1  
ATOM   963    H  HG22   . VAL A 1 60  ? -1.098  5.160   -0.070  1.00 0.00  ? 60   VAL A HG22   1  
ATOM   964    H  HG23   . VAL A 1 60  ? 0.567   5.382   0.467   1.00 0.00  ? 60   VAL A HG23   1  
ATOM   965    N  N      . GLY A 1 61  ? -4.057  7.168   0.784   1.00 21.21 ? 61   GLY A N      1  
ATOM   966    C  CA     . GLY A 1 61  ? -5.311  6.424   0.465   1.00 23.96 ? 61   GLY A CA     1  
ATOM   967    C  C      . GLY A 1 61  ? -5.714  5.540   1.651   1.00 31.77 ? 61   GLY A C      1  
ATOM   968    O  O      . GLY A 1 61  ? -6.806  5.007   1.688   1.00 33.85 ? 61   GLY A O      1  
ATOM   969    H  H      . GLY A 1 61  ? -3.998  7.701   1.605   1.00 0.00  ? 61   GLY A H      1  
ATOM   970    H  HA2    . GLY A 1 61  ? -6.102  7.130   0.257   1.00 0.00  ? 61   GLY A HA2    1  
ATOM   971    H  HA3    . GLY A 1 61  ? -5.147  5.802   -0.402  1.00 0.00  ? 61   GLY A HA3    1  
ATOM   972    N  N      . HIS A 1 62  ? -4.852  5.383   2.625   1.00 26.70 ? 62   HIS A N      1  
ATOM   973    C  CA     . HIS A 1 62  ? -5.210  4.537   3.804   1.00 31.48 ? 62   HIS A CA     1  
ATOM   974    C  C      . HIS A 1 62  ? -6.442  5.121   4.498   1.00 35.71 ? 62   HIS A C      1  
ATOM   975    O  O      . HIS A 1 62  ? -6.570  6.322   4.637   1.00 39.58 ? 62   HIS A O      1  
ATOM   976    C  CB     . HIS A 1 62  ? -3.992  4.596   4.729   1.00 24.97 ? 62   HIS A CB     1  
ATOM   977    C  CG     . HIS A 1 62  ? -2.856  3.821   4.119   1.00 24.92 ? 62   HIS A CG     1  
ATOM   978    N  ND1    . HIS A 1 62  ? -3.060  2.687   3.349   1.00 25.48 ? 62   HIS A ND1    1  
ATOM   979    C  CD2    . HIS A 1 62  ? -1.496  4.006   4.159   1.00 29.35 ? 62   HIS A CD2    1  
ATOM   980    C  CE1    . HIS A 1 62  ? -1.853  2.237   2.960   1.00 26.64 ? 62   HIS A CE1    1  
ATOM   981    N  NE2    . HIS A 1 62  ? -0.865  3.005   3.426   1.00 23.96 ? 62   HIS A NE2    1  
ATOM   982    H  H      . HIS A 1 62  ? -3.978  5.823   2.585   1.00 0.00  ? 62   HIS A H      1  
ATOM   983    H  HA     . HIS A 1 62  ? -5.395  3.520   3.498   1.00 0.00  ? 62   HIS A HA     1  
ATOM   984    H  HB2    . HIS A 1 62  ? -3.694  5.625   4.865   1.00 0.00  ? 62   HIS A HB2    1  
ATOM   985    H  HB3    . HIS A 1 62  ? -4.247  4.166   5.686   1.00 0.00  ? 62   HIS A HB3    1  
ATOM   986    H  HD1    . HIS A 1 62  ? -3.926  2.284   3.129   1.00 0.00  ? 62   HIS A HD1    1  
ATOM   987    H  HD2    . HIS A 1 62  ? -0.992  4.807   4.679   1.00 0.00  ? 62   HIS A HD2    1  
ATOM   988    H  HE1    . HIS A 1 62  ? -1.701  1.362   2.345   1.00 0.00  ? 62   HIS A HE1    1  
ATOM   989    N  N      . SER A 1 63  ? -7.360  4.291   4.919   1.00 41.17 ? 63   SER A N      1  
ATOM   990    C  CA     . SER A 1 63  ? -8.586  4.823   5.584   1.00 44.57 ? 63   SER A CA     1  
ATOM   991    C  C      . SER A 1 63  ? -8.948  3.999   6.822   1.00 45.48 ? 63   SER A C      1  
ATOM   992    O  O      . SER A 1 63  ? -8.771  2.797   6.859   1.00 52.79 ? 63   SER A O      1  
ATOM   993    C  CB     . SER A 1 63  ? -9.684  4.706   4.528   1.00 38.69 ? 63   SER A CB     1  
ATOM   994    O  OG     . SER A 1 63  ? -10.065 3.343   4.397   1.00 42.82 ? 63   SER A OG     1  
ATOM   995    H  H      . SER A 1 63  ? -7.249  3.326   4.789   1.00 0.00  ? 63   SER A H      1  
ATOM   996    H  HA     . SER A 1 63  ? -8.447  5.859   5.851   1.00 0.00  ? 63   SER A HA     1  
ATOM   997    H  HB2    . SER A 1 63  ? -10.540 5.286   4.830   1.00 0.00  ? 63   SER A HB2    1  
ATOM   998    H  HB3    . SER A 1 63  ? -9.314  5.080   3.583   1.00 0.00  ? 63   SER A HB3    1  
ATOM   999    H  HG     . SER A 1 63  ? -9.271  2.828   4.234   1.00 0.00  ? 63   SER A HG     1  
ATOM   1000   N  N      . ILE A 1 64  ? -9.464  4.647   7.834   1.00 36.94 ? 64   ILE A N      1  
ATOM   1001   C  CA     . ILE A 1 64  ? -9.856  3.923   9.078   1.00 42.22 ? 64   ILE A CA     1  
ATOM   1002   C  C      . ILE A 1 64  ? -11.129 4.549   9.662   1.00 46.52 ? 64   ILE A C      1  
ATOM   1003   O  O      . ILE A 1 64  ? -11.158 5.717   9.994   1.00 38.70 ? 64   ILE A O      1  
ATOM   1004   C  CB     . ILE A 1 64  ? -8.673  4.108   10.036  1.00 46.28 ? 64   ILE A CB     1  
ATOM   1005   C  CG1    . ILE A 1 64  ? -7.444  3.368   9.492   1.00 43.11 ? 64   ILE A CG1    1  
ATOM   1006   C  CG2    . ILE A 1 64  ? -9.032  3.551   11.418  1.00 52.58 ? 64   ILE A CG2    1  
ATOM   1007   C  CD1    . ILE A 1 64  ? -7.734  1.866   9.399   1.00 38.04 ? 64   ILE A CD1    1  
ATOM   1008   H  H      . ILE A 1 64  ? -9.601  5.615   7.772   1.00 0.00  ? 64   ILE A H      1  
ATOM   1009   H  HA     . ILE A 1 64  ? -10.009 2.875   8.873   1.00 0.00  ? 64   ILE A HA     1  
ATOM   1010   H  HB     . ILE A 1 64  ? -8.448  5.161   10.124  1.00 0.00  ? 64   ILE A HB     1  
ATOM   1011   H  HG12   . ILE A 1 64  ? -7.200  3.749   8.512   1.00 0.00  ? 64   ILE A HG12   1  
ATOM   1012   H  HG13   . ILE A 1 64  ? -6.608  3.529   10.156  1.00 0.00  ? 64   ILE A HG13   1  
ATOM   1013   H  HG21   . ILE A 1 64  ? -8.147  3.136   11.879  1.00 0.00  ? 64   ILE A HG21   1  
ATOM   1014   H  HG22   . ILE A 1 64  ? -9.779  2.779   11.312  1.00 0.00  ? 64   ILE A HG22   1  
ATOM   1015   H  HG23   . ILE A 1 64  ? -9.421  4.346   12.037  1.00 0.00  ? 64   ILE A HG23   1  
ATOM   1016   H  HD11   . ILE A 1 64  ? -7.051  1.329   10.041  1.00 0.00  ? 64   ILE A HD11   1  
ATOM   1017   H  HD12   . ILE A 1 64  ? -7.603  1.536   8.379   1.00 0.00  ? 64   ILE A HD12   1  
ATOM   1018   H  HD13   . ILE A 1 64  ? -8.749  1.672   9.713   1.00 0.00  ? 64   ILE A HD13   1  
ATOM   1019   N  N      . ARG A 1 65  ? -12.178 3.781   9.793   1.00 48.83 ? 65   ARG A N      1  
ATOM   1020   C  CA     . ARG A 1 65  ? -13.443 4.333   10.361  1.00 55.64 ? 65   ARG A CA     1  
ATOM   1021   C  C      . ARG A 1 65  ? -13.414 4.227   11.886  1.00 47.04 ? 65   ARG A C      1  
ATOM   1022   O  O      . ARG A 1 65  ? -13.782 5.144   12.593  1.00 37.84 ? 65   ARG A O      1  
ATOM   1023   C  CB     . ARG A 1 65  ? -14.556 3.459   9.780   1.00 56.74 ? 65   ARG A CB     1  
ATOM   1024   C  CG     . ARG A 1 65  ? -14.565 3.585   8.254   1.00 63.05 ? 65   ARG A CG     1  
ATOM   1025   C  CD     . ARG A 1 65  ? -13.876 2.366   7.632   1.00 69.43 ? 65   ARG A CD     1  
ATOM   1026   N  NE     . ARG A 1 65  ? -14.973 1.583   6.991   1.00 69.52 ? 65   ARG A NE     1  
ATOM   1027   C  CZ     . ARG A 1 65  ? -14.777 0.343   6.613   1.00 79.60 ? 65   ARG A CZ     1  
ATOM   1028   N  NH1    . ARG A 1 65  ? -13.615 -0.234  6.789   1.00 67.57 ? 65   ARG A NH1    1  
ATOM   1029   N  NH2    . ARG A 1 65  ? -15.750 -0.323  6.055   1.00 64.90 ? 65   ARG A NH2    1  
ATOM   1030   H  H      . ARG A 1 65  ? -12.133 2.840   9.521   1.00 0.00  ? 65   ARG A H      1  
ATOM   1031   H  HA     . ARG A 1 65  ? -13.579 5.359   10.055  1.00 0.00  ? 65   ARG A HA     1  
ATOM   1032   H  HB2    . ARG A 1 65  ? -14.385 2.429   10.057  1.00 0.00  ? 65   ARG A HB2    1  
ATOM   1033   H  HB3    . ARG A 1 65  ? -15.509 3.783   10.171  1.00 0.00  ? 65   ARG A HB3    1  
ATOM   1034   H  HG2    . ARG A 1 65  ? -15.586 3.641   7.905   1.00 0.00  ? 65   ARG A HG2    1  
ATOM   1035   H  HG3    . ARG A 1 65  ? -14.037 4.481   7.963   1.00 0.00  ? 65   ARG A HG3    1  
ATOM   1036   H  HD2    . ARG A 1 65  ? -13.154 2.682   6.891   1.00 0.00  ? 65   ARG A HD2    1  
ATOM   1037   H  HD3    . ARG A 1 65  ? -13.397 1.773   8.396   1.00 0.00  ? 65   ARG A HD3    1  
ATOM   1038   H  HE     . ARG A 1 65  ? -15.850 1.999   6.851   1.00 0.00  ? 65   ARG A HE     1  
ATOM   1039   H  HH11   . ARG A 1 65  ? -12.863 0.267   7.216   1.00 0.00  ? 65   ARG A HH11   1  
ATOM   1040   H  HH12   . ARG A 1 65  ? -13.480 -1.180  6.496   1.00 0.00  ? 65   ARG A HH12   1  
ATOM   1041   H  HH21   . ARG A 1 65  ? -16.639 0.112   5.917   1.00 0.00  ? 65   ARG A HH21   1  
ATOM   1042   H  HH22   . ARG A 1 65  ? -15.606 -1.269  5.764   1.00 0.00  ? 65   ARG A HH22   1  
ATOM   1043   N  N      . HIS A 1 66  ? -12.967 3.113   12.393  1.00 44.11 ? 66   HIS A N      1  
ATOM   1044   C  CA     . HIS A 1 66  ? -12.885 2.915   13.879  1.00 39.24 ? 66   HIS A CA     1  
ATOM   1045   C  C      . HIS A 1 66  ? -11.447 2.563   14.292  1.00 34.92 ? 66   HIS A C      1  
ATOM   1046   O  O      . HIS A 1 66  ? -11.057 1.411   14.257  1.00 38.19 ? 66   HIS A O      1  
ATOM   1047   C  CB     . HIS A 1 66  ? -13.825 1.745   14.165  1.00 43.17 ? 66   HIS A CB     1  
ATOM   1048   C  CG     . HIS A 1 66  ? -15.208 2.088   13.684  1.00 53.53 ? 66   HIS A CG     1  
ATOM   1049   N  ND1    . HIS A 1 66  ? -15.907 3.187   14.161  1.00 57.74 ? 66   HIS A ND1    1  
ATOM   1050   C  CD2    . HIS A 1 66  ? -16.034 1.488   12.768  1.00 50.38 ? 66   HIS A CD2    1  
ATOM   1051   C  CE1    . HIS A 1 66  ? -17.099 3.211   13.536  1.00 55.76 ? 66   HIS A CE1    1  
ATOM   1052   N  NE2    . HIS A 1 66  ? -17.228 2.197   12.676  1.00 57.84 ? 66   HIS A NE2    1  
ATOM   1053   H  H      . HIS A 1 66  ? -12.664 2.386   11.809  1.00 0.00  ? 66   HIS A H      1  
ATOM   1054   H  HA     . HIS A 1 66  ? -13.224 3.796   14.396  1.00 0.00  ? 66   HIS A HA     1  
ATOM   1055   H  HB2    . HIS A 1 66  ? -13.472 0.864   13.648  1.00 0.00  ? 66   HIS A HB2    1  
ATOM   1056   H  HB3    . HIS A 1 66  ? -13.850 1.555   15.227  1.00 0.00  ? 66   HIS A HB3    1  
ATOM   1057   H  HD1    . HIS A 1 66  ? -15.590 3.831   14.828  1.00 0.00  ? 66   HIS A HD1    1  
ATOM   1058   H  HD2    . HIS A 1 66  ? -15.793 0.599   12.203  1.00 0.00  ? 66   HIS A HD2    1  
ATOM   1059   H  HE1    . HIS A 1 66  ? -17.861 3.957   13.712  1.00 0.00  ? 66   HIS A HE1    1  
ATOM   1060   N  N      . PRO A 1 67  ? -10.694 3.573   14.672  1.00 42.90 ? 67   PRO A N      1  
ATOM   1061   C  CA     . PRO A 1 67  ? -9.275  3.357   15.083  1.00 40.77 ? 67   PRO A CA     1  
ATOM   1062   C  C      . PRO A 1 67  ? -9.144  2.404   16.293  1.00 37.61 ? 67   PRO A C      1  
ATOM   1063   O  O      . PRO A 1 67  ? -8.339  1.495   16.276  1.00 33.87 ? 67   PRO A O      1  
ATOM   1064   C  CB     . PRO A 1 67  ? -8.799  4.767   15.442  1.00 34.55 ? 67   PRO A CB     1  
ATOM   1065   C  CG     . PRO A 1 67  ? -10.056 5.509   15.753  1.00 39.24 ? 67   PRO A CG     1  
ATOM   1066   C  CD     . PRO A 1 67  ? -11.076 4.983   14.784  1.00 49.91 ? 67   PRO A CD     1  
ATOM   1067   H  HA     . PRO A 1 67  ? -8.697  2.987   14.251  1.00 0.00  ? 67   PRO A HA     1  
ATOM   1068   H  HB2    . PRO A 1 67  ? -8.152  4.735   16.309  1.00 0.00  ? 67   PRO A HB2    1  
ATOM   1069   H  HB3    . PRO A 1 67  ? -8.294  5.224   14.606  1.00 0.00  ? 67   PRO A HB3    1  
ATOM   1070   H  HG2    . PRO A 1 67  ? -10.365 5.307   16.770  1.00 0.00  ? 67   PRO A HG2    1  
ATOM   1071   H  HG3    . PRO A 1 67  ? -9.916  6.566   15.602  1.00 0.00  ? 67   PRO A HG3    1  
ATOM   1072   H  HD2    . PRO A 1 67  ? -12.074 5.085   15.188  1.00 0.00  ? 67   PRO A HD2    1  
ATOM   1073   H  HD3    . PRO A 1 67  ? -10.991 5.473   13.827  1.00 0.00  ? 67   PRO A HD3    1  
ATOM   1074   N  N      . ASP A 1 68  ? -9.920  2.609   17.345  1.00 37.92 ? 68   ASP A N      1  
ATOM   1075   C  CA     . ASP A 1 68  ? -9.839  1.716   18.537  1.00 32.31 ? 68   ASP A CA     1  
ATOM   1076   C  C      . ASP A 1 68  ? -9.832  0.208   18.188  1.00 35.25 ? 68   ASP A C      1  
ATOM   1077   O  O      . ASP A 1 68  ? -9.180  -0.579  18.855  1.00 38.80 ? 68   ASP A O      1  
ATOM   1078   C  CB     . ASP A 1 68  ? -11.085 2.056   19.352  1.00 47.41 ? 68   ASP A CB     1  
ATOM   1079   C  CG     . ASP A 1 68  ? -12.344 1.727   18.542  1.00 53.79 ? 68   ASP A CG     1  
ATOM   1080   O  OD1    . ASP A 1 68  ? -12.421 2.146   17.398  1.00 49.61 ? 68   ASP A OD1    1  
ATOM   1081   O  OD2    . ASP A 1 68  ? -13.212 1.059   19.081  1.00 51.97 ? 68   ASP A OD2    1  
ATOM   1082   H  H      . ASP A 1 68  ? -10.576 3.332   17.265  1.00 0.00  ? 68   ASP A H      1  
ATOM   1083   H  HA     . ASP A 1 68  ? -8.961  1.962   19.105  1.00 0.00  ? 68   ASP A HA     1  
ATOM   1084   H  HB2    . ASP A 1 68  ? -11.083 1.479   20.265  1.00 0.00  ? 68   ASP A HB2    1  
ATOM   1085   H  HB3    . ASP A 1 68  ? -11.079 3.109   19.590  1.00 0.00  ? 68   ASP A HB3    1  
ATOM   1086   N  N      . VAL A 1 69  ? -10.570 -0.202  17.189  1.00 33.89 ? 69   VAL A N      1  
ATOM   1087   C  CA     . VAL A 1 69  ? -10.619 -1.669  16.843  1.00 34.92 ? 69   VAL A CA     1  
ATOM   1088   C  C      . VAL A 1 69  ? -9.762  -2.038  15.613  1.00 32.22 ? 69   VAL A C      1  
ATOM   1089   O  O      . VAL A 1 69  ? -9.387  -3.188  15.448  1.00 38.20 ? 69   VAL A O      1  
ATOM   1090   C  CB     . VAL A 1 69  ? -12.093 -1.952  16.542  1.00 40.60 ? 69   VAL A CB     1  
ATOM   1091   C  CG1    . VAL A 1 69  ? -12.936 -1.655  17.780  1.00 41.77 ? 69   VAL A CG1    1  
ATOM   1092   C  CG2    . VAL A 1 69  ? -12.568 -1.068  15.383  1.00 34.27 ? 69   VAL A CG2    1  
ATOM   1093   H  H      . VAL A 1 69  ? -11.110 0.432   16.675  1.00 0.00  ? 69   VAL A H      1  
ATOM   1094   H  HA     . VAL A 1 69  ? -10.313 -2.257  17.693  1.00 0.00  ? 69   VAL A HA     1  
ATOM   1095   H  HB     . VAL A 1 69  ? -12.208 -2.992  16.271  1.00 0.00  ? 69   VAL A HB     1  
ATOM   1096   H  HG11   . VAL A 1 69  ? -13.396 -0.684  17.677  1.00 0.00  ? 69   VAL A HG11   1  
ATOM   1097   H  HG12   . VAL A 1 69  ? -12.305 -1.664  18.657  1.00 0.00  ? 69   VAL A HG12   1  
ATOM   1098   H  HG13   . VAL A 1 69  ? -13.703 -2.408  17.881  1.00 0.00  ? 69   VAL A HG13   1  
ATOM   1099   H  HG21   . VAL A 1 69  ? -11.797 -1.013  14.630  1.00 0.00  ? 69   VAL A HG21   1  
ATOM   1100   H  HG22   . VAL A 1 69  ? -12.782 -0.076  15.753  1.00 0.00  ? 69   VAL A HG22   1  
ATOM   1101   H  HG23   . VAL A 1 69  ? -13.463 -1.491  14.952  1.00 0.00  ? 69   VAL A HG23   1  
ATOM   1102   N  N      . GLU A 1 70  ? -9.483  -1.104  14.731  1.00 27.45 ? 70   GLU A N      1  
ATOM   1103   C  CA     . GLU A 1 70  ? -8.693  -1.450  13.499  1.00 27.31 ? 70   GLU A CA     1  
ATOM   1104   C  C      . GLU A 1 70  ? -7.197  -1.124  13.629  1.00 30.12 ? 70   GLU A C      1  
ATOM   1105   O  O      . GLU A 1 70  ? -6.399  -1.578  12.828  1.00 34.42 ? 70   GLU A O      1  
ATOM   1106   C  CB     . GLU A 1 70  ? -9.299  -0.585  12.395  1.00 26.74 ? 70   GLU A CB     1  
ATOM   1107   C  CG     . GLU A 1 70  ? -10.556 -1.252  11.835  1.00 27.57 ? 70   GLU A CG     1  
ATOM   1108   C  CD     . GLU A 1 70  ? -11.094 -0.416  10.671  1.00 38.38 ? 70   GLU A CD     1  
ATOM   1109   O  OE1    . GLU A 1 70  ? -10.625 -0.612  9.561   1.00 46.14 ? 70   GLU A OE1    1  
ATOM   1110   O  OE2    . GLU A 1 70  ? -11.961 0.408   10.909  1.00 37.29 ? 70   GLU A OE2    1  
ATOM   1111   H  H      . GLU A 1 70  ? -9.821  -0.191  14.859  1.00 0.00  ? 70   GLU A H      1  
ATOM   1112   H  HA     . GLU A 1 70  ? -8.827  -2.491  13.252  1.00 0.00  ? 70   GLU A HA     1  
ATOM   1113   H  HB2    . GLU A 1 70  ? -9.556  0.384   12.799  1.00 0.00  ? 70   GLU A HB2    1  
ATOM   1114   H  HB3    . GLU A 1 70  ? -8.578  -0.462  11.602  1.00 0.00  ? 70   GLU A HB3    1  
ATOM   1115   H  HG2    . GLU A 1 70  ? -10.313 -2.245  11.486  1.00 0.00  ? 70   GLU A HG2    1  
ATOM   1116   H  HG3    . GLU A 1 70  ? -11.307 -1.314  12.608  1.00 0.00  ? 70   GLU A HG3    1  
ATOM   1117   N  N      . VAL A 1 71  ? -6.808  -0.325  14.587  1.00 26.02 ? 71   VAL A N      1  
ATOM   1118   C  CA     . VAL A 1 71  ? -5.357  0.029   14.697  1.00 23.39 ? 71   VAL A CA     1  
ATOM   1119   C  C      . VAL A 1 71  ? -4.740  -0.484  16.004  1.00 23.58 ? 71   VAL A C      1  
ATOM   1120   O  O      . VAL A 1 71  ? -5.098  -0.060  17.087  1.00 26.27 ? 71   VAL A O      1  
ATOM   1121   C  CB     . VAL A 1 71  ? -5.318  1.555   14.643  1.00 19.60 ? 71   VAL A CB     1  
ATOM   1122   C  CG1    . VAL A 1 71  ? -3.866  2.032   14.668  1.00 16.73 ? 71   VAL A CG1    1  
ATOM   1123   C  CG2    . VAL A 1 71  ? -5.979  2.033   13.349  1.00 20.23 ? 71   VAL A CG2    1  
ATOM   1124   H  H      . VAL A 1 71  ? -7.462  0.056   15.213  1.00 0.00  ? 71   VAL A H      1  
ATOM   1125   H  HA     . VAL A 1 71  ? -4.816  -0.373  13.855  1.00 0.00  ? 71   VAL A HA     1  
ATOM   1126   H  HB     . VAL A 1 71  ? -5.847  1.961   15.493  1.00 0.00  ? 71   VAL A HB     1  
ATOM   1127   H  HG11   . VAL A 1 71  ? -3.564  2.207   15.688  1.00 0.00  ? 71   VAL A HG11   1  
ATOM   1128   H  HG12   . VAL A 1 71  ? -3.780  2.949   14.104  1.00 0.00  ? 71   VAL A HG12   1  
ATOM   1129   H  HG13   . VAL A 1 71  ? -3.231  1.278   14.227  1.00 0.00  ? 71   VAL A HG13   1  
ATOM   1130   H  HG21   . VAL A 1 71  ? -5.415  1.669   12.502  1.00 0.00  ? 71   VAL A HG21   1  
ATOM   1131   H  HG22   . VAL A 1 71  ? -5.998  3.112   13.333  1.00 0.00  ? 71   VAL A HG22   1  
ATOM   1132   H  HG23   . VAL A 1 71  ? -6.988  1.653   13.300  1.00 0.00  ? 71   VAL A HG23   1  
ATOM   1133   N  N      . ASP A 1 72  ? -3.791  -1.397  15.893  1.00 21.35 ? 72   ASP A N      1  
ATOM   1134   C  CA     . ASP A 1 72  ? -3.123  -1.943  17.103  1.00 22.04 ? 72   ASP A CA     1  
ATOM   1135   C  C      . ASP A 1 72  ? -2.283  -0.850  17.782  1.00 25.75 ? 72   ASP A C      1  
ATOM   1136   O  O      . ASP A 1 72  ? -1.658  -0.045  17.117  1.00 26.86 ? 72   ASP A O      1  
ATOM   1137   C  CB     . ASP A 1 72  ? -2.218  -3.047  16.563  1.00 26.18 ? 72   ASP A CB     1  
ATOM   1138   C  CG     . ASP A 1 72  ? -1.605  -3.827  17.724  1.00 38.25 ? 72   ASP A CG     1  
ATOM   1139   O  OD1    . ASP A 1 72  ? -2.290  -4.014  18.715  1.00 36.89 ? 72   ASP A OD1    1  
ATOM   1140   O  OD2    . ASP A 1 72  ? -0.459  -4.227  17.601  1.00 36.16 ? 72   ASP A OD2    1  
ATOM   1141   H  H      . ASP A 1 72  ? -3.547  -1.688  14.986  1.00 0.00  ? 72   ASP A H      1  
ATOM   1142   H  HA     . ASP A 1 72  ? -3.847  -2.354  17.790  1.00 0.00  ? 72   ASP A HA     1  
ATOM   1143   H  HB2    . ASP A 1 72  ? -2.797  -3.716  15.943  1.00 0.00  ? 72   ASP A HB2    1  
ATOM   1144   H  HB3    . ASP A 1 72  ? -1.429  -2.604  15.973  1.00 0.00  ? 72   ASP A HB3    1  
ATOM   1145   N  N      . GLY A 1 73  ? -2.252  -0.812  19.098  1.00 22.24 ? 73   GLY A N      1  
ATOM   1146   C  CA     . GLY A 1 73  ? -1.437  0.225   19.806  1.00 17.23 ? 73   GLY A CA     1  
ATOM   1147   C  C      . GLY A 1 73  ? -2.249  1.512   20.037  1.00 18.95 ? 73   GLY A C      1  
ATOM   1148   O  O      . GLY A 1 73  ? -1.798  2.420   20.715  1.00 27.56 ? 73   GLY A O      1  
ATOM   1149   H  H      . GLY A 1 73  ? -2.759  -1.475  19.614  1.00 0.00  ? 73   GLY A H      1  
ATOM   1150   H  HA2    . GLY A 1 73  ? -1.122  -0.168  20.762  1.00 0.00  ? 73   GLY A HA2    1  
ATOM   1151   H  HA3    . GLY A 1 73  ? -0.565  0.458   19.215  1.00 0.00  ? 73   GLY A HA3    1  
ATOM   1152   N  N      . PHE A 1 74  ? -3.421  1.607   19.476  1.00 17.74 ? 74   PHE A N      1  
ATOM   1153   C  CA     . PHE A 1 74  ? -4.246  2.856   19.653  1.00 21.03 ? 74   PHE A CA     1  
ATOM   1154   C  C      . PHE A 1 74  ? -4.516  3.141   21.132  1.00 22.41 ? 74   PHE A C      1  
ATOM   1155   O  O      . PHE A 1 74  ? -4.326  4.245   21.603  1.00 25.52 ? 74   PHE A O      1  
ATOM   1156   C  CB     . PHE A 1 74  ? -5.570  2.575   18.933  1.00 22.08 ? 74   PHE A CB     1  
ATOM   1157   C  CG     . PHE A 1 74  ? -6.483  3.773   19.051  1.00 24.18 ? 74   PHE A CG     1  
ATOM   1158   C  CD1    . PHE A 1 74  ? -6.318  4.866   18.189  1.00 27.19 ? 74   PHE A CD1    1  
ATOM   1159   C  CD2    . PHE A 1 74  ? -7.502  3.786   20.017  1.00 21.94 ? 74   PHE A CD2    1  
ATOM   1160   C  CE1    . PHE A 1 74  ? -7.171  5.975   18.291  1.00 25.71 ? 74   PHE A CE1    1  
ATOM   1161   C  CE2    . PHE A 1 74  ? -8.358  4.894   20.118  1.00 27.03 ? 74   PHE A CE2    1  
ATOM   1162   C  CZ     . PHE A 1 74  ? -8.192  5.989   19.255  1.00 27.42 ? 74   PHE A CZ     1  
ATOM   1163   H  H      . PHE A 1 74  ? -3.777  0.891   18.911  1.00 0.00  ? 74   PHE A H      1  
ATOM   1164   H  HA     . PHE A 1 74  ? -3.754  3.697   19.193  1.00 0.00  ? 74   PHE A HA     1  
ATOM   1165   H  HB2    . PHE A 1 74  ? -5.377  2.374   17.890  1.00 0.00  ? 74   PHE A HB2    1  
ATOM   1166   H  HB3    . PHE A 1 74  ? -6.048  1.716   19.381  1.00 0.00  ? 74   PHE A HB3    1  
ATOM   1167   H  HD1    . PHE A 1 74  ? -5.532  4.855   17.447  1.00 0.00  ? 74   PHE A HD1    1  
ATOM   1168   H  HD2    . PHE A 1 74  ? -7.629  2.944   20.682  1.00 0.00  ? 74   PHE A HD2    1  
ATOM   1169   H  HE1    . PHE A 1 74  ? -7.043  6.818   17.625  1.00 0.00  ? 74   PHE A HE1    1  
ATOM   1170   H  HE2    . PHE A 1 74  ? -9.144  4.905   20.863  1.00 0.00  ? 74   PHE A HE2    1  
ATOM   1171   H  HZ     . PHE A 1 74  ? -8.850  6.842   19.332  1.00 0.00  ? 74   PHE A HZ     1  
ATOM   1172   N  N      . SER A 1 75  ? -4.987  2.165   21.851  1.00 22.85 ? 75   SER A N      1  
ATOM   1173   C  CA     . SER A 1 75  ? -5.305  2.373   23.300  1.00 25.37 ? 75   SER A CA     1  
ATOM   1174   C  C      . SER A 1 75  ? -4.071  2.766   24.140  1.00 21.35 ? 75   SER A C      1  
ATOM   1175   O  O      . SER A 1 75  ? -4.221  3.322   25.209  1.00 30.44 ? 75   SER A O      1  
ATOM   1176   C  CB     . SER A 1 75  ? -5.852  1.027   23.782  1.00 24.40 ? 75   SER A CB     1  
ATOM   1177   O  OG     . SER A 1 75  ? -4.972  -0.013  23.377  1.00 35.52 ? 75   SER A OG     1  
ATOM   1178   H  H      . SER A 1 75  ? -5.134  1.285   21.444  1.00 0.00  ? 75   SER A H      1  
ATOM   1179   H  HA     . SER A 1 75  ? -6.072  3.122   23.398  1.00 0.00  ? 75   SER A HA     1  
ATOM   1180   H  HB2    . SER A 1 75  ? -5.925  1.031   24.857  1.00 0.00  ? 75   SER A HB2    1  
ATOM   1181   H  HB3    . SER A 1 75  ? -6.835  0.868   23.357  1.00 0.00  ? 75   SER A HB3    1  
ATOM   1182   H  HG     . SER A 1 75  ? -4.797  -0.567  24.142  1.00 0.00  ? 75   SER A HG     1  
ATOM   1183   N  N      . GLU A 1 76  ? -2.855  2.483   23.683  1.00 22.71 ? 76   GLU A N      1  
ATOM   1184   C  CA     . GLU A 1 76  ? -1.667  2.871   24.485  1.00 21.23 ? 76   GLU A CA     1  
ATOM   1185   C  C      . GLU A 1 76  ? -1.151  4.282   24.133  1.00 21.91 ? 76   GLU A C      1  
ATOM   1186   O  O      . GLU A 1 76  ? -0.214  4.764   24.741  1.00 26.42 ? 76   GLU A O      1  
ATOM   1187   C  CB     . GLU A 1 76  ? -0.622  1.815   24.154  1.00 13.99 ? 76   GLU A CB     1  
ATOM   1188   C  CG     . GLU A 1 76  ? -0.904  0.551   24.969  1.00 27.64 ? 76   GLU A CG     1  
ATOM   1189   C  CD     . GLU A 1 76  ? -1.773  -0.402  24.148  1.00 39.35 ? 76   GLU A CD     1  
ATOM   1190   O  OE1    . GLU A 1 76  ? -1.370  -0.740  23.048  1.00 44.01 ? 76   GLU A OE1    1  
ATOM   1191   O  OE2    . GLU A 1 76  ? -2.828  -0.778  24.634  1.00 37.68 ? 76   GLU A OE2    1  
ATOM   1192   H  H      . GLU A 1 76  ? -2.802  2.079   22.793  1.00 0.00  ? 76   GLU A H      1  
ATOM   1193   H  HA     . GLU A 1 76  ? -1.908  2.825   25.536  1.00 0.00  ? 76   GLU A HA     1  
ATOM   1194   H  HB2    . GLU A 1 76  ? -0.665  1.584   23.100  1.00 0.00  ? 76   GLU A HB2    1  
ATOM   1195   H  HB3    . GLU A 1 76  ? 0.359   2.190   24.403  1.00 0.00  ? 76   GLU A HB3    1  
ATOM   1196   H  HG2    . GLU A 1 76  ? 0.029   0.067   25.217  1.00 0.00  ? 76   GLU A HG2    1  
ATOM   1197   H  HG3    . GLU A 1 76  ? -1.424  0.817   25.878  1.00 0.00  ? 76   GLU A HG3    1  
ATOM   1198   N  N      . LEU A 1 77  ? -1.759  4.952   23.176  1.00 20.08 ? 77   LEU A N      1  
ATOM   1199   C  CA     . LEU A 1 77  ? -1.308  6.325   22.821  1.00 19.19 ? 77   LEU A CA     1  
ATOM   1200   C  C      . LEU A 1 77  ? -1.750  7.304   23.902  1.00 22.81 ? 77   LEU A C      1  
ATOM   1201   O  O      . LEU A 1 77  ? -2.701  7.049   24.619  1.00 23.38 ? 77   LEU A O      1  
ATOM   1202   C  CB     . LEU A 1 77  ? -2.042  6.671   21.525  1.00 21.85 ? 77   LEU A CB     1  
ATOM   1203   C  CG     . LEU A 1 77  ? -1.675  5.687   20.419  1.00 19.61 ? 77   LEU A CG     1  
ATOM   1204   C  CD1    . LEU A 1 77  ? -2.566  5.951   19.202  1.00 16.91 ? 77   LEU A CD1    1  
ATOM   1205   C  CD2    . LEU A 1 77  ? -0.209  5.883   20.030  1.00 14.85 ? 77   LEU A CD2    1  
ATOM   1206   H  H      . LEU A 1 77  ? -2.524  4.538   22.727  1.00 0.00  ? 77   LEU A H      1  
ATOM   1207   H  HA     . LEU A 1 77  ? -0.239  6.360   22.675  1.00 0.00  ? 77   LEU A HA     1  
ATOM   1208   H  HB2    . LEU A 1 77  ? -3.107  6.630   21.699  1.00 0.00  ? 77   LEU A HB2    1  
ATOM   1209   H  HB3    . LEU A 1 77  ? -1.771  7.671   21.218  1.00 0.00  ? 77   LEU A HB3    1  
ATOM   1210   H  HG     . LEU A 1 77  ? -1.829  4.677   20.769  1.00 0.00  ? 77   LEU A HG     1  
ATOM   1211   H  HD11   . LEU A 1 77  ? -2.186  5.406   18.352  1.00 0.00  ? 77   LEU A HD11   1  
ATOM   1212   H  HD12   . LEU A 1 77  ? -2.569  7.008   18.980  1.00 0.00  ? 77   LEU A HD12   1  
ATOM   1213   H  HD13   . LEU A 1 77  ? -3.574  5.627   19.416  1.00 0.00  ? 77   LEU A HD13   1  
ATOM   1214   H  HD21   . LEU A 1 77  ? 0.421   5.664   20.880  1.00 0.00  ? 77   LEU A HD21   1  
ATOM   1215   H  HD22   . LEU A 1 77  ? -0.052  6.906   19.721  1.00 0.00  ? 77   LEU A HD22   1  
ATOM   1216   H  HD23   . LEU A 1 77  ? 0.040   5.219   19.216  1.00 0.00  ? 77   LEU A HD23   1  
ATOM   1217   N  N      . ARG A 1 78  ? -1.109  8.440   23.997  1.00 25.50 ? 78   ARG A N      1  
ATOM   1218   C  CA     . ARG A 1 78  ? -1.549  9.450   24.999  1.00 16.88 ? 78   ARG A CA     1  
ATOM   1219   C  C      . ARG A 1 78  ? -2.958  9.920   24.613  1.00 24.75 ? 78   ARG A C      1  
ATOM   1220   O  O      . ARG A 1 78  ? -3.349  9.839   23.461  1.00 33.16 ? 78   ARG A O      1  
ATOM   1221   C  CB     . ARG A 1 78  ? -0.526  10.584  24.913  1.00 22.08 ? 78   ARG A CB     1  
ATOM   1222   C  CG     . ARG A 1 78  ? 0.789   10.124  25.552  1.00 23.66 ? 78   ARG A CG     1  
ATOM   1223   C  CD     . ARG A 1 78  ? 1.529   11.333  26.133  1.00 31.82 ? 78   ARG A CD     1  
ATOM   1224   N  NE     . ARG A 1 78  ? 2.976   10.990  26.020  1.00 46.69 ? 78   ARG A NE     1  
ATOM   1225   C  CZ     . ARG A 1 78  ? 3.566   10.985  24.851  1.00 45.08 ? 78   ARG A CZ     1  
ATOM   1226   N  NH1    . ARG A 1 78  ? 2.888   11.259  23.765  1.00 41.34 ? 78   ARG A NH1    1  
ATOM   1227   N  NH2    . ARG A 1 78  ? 4.837   10.700  24.769  1.00 41.10 ? 78   ARG A NH2    1  
ATOM   1228   H  H      . ARG A 1 78  ? -0.375  8.650   23.382  1.00 0.00  ? 78   ARG A H      1  
ATOM   1229   H  HA     . ARG A 1 78  ? -1.552  9.021   25.990  1.00 0.00  ? 78   ARG A HA     1  
ATOM   1230   H  HB2    . ARG A 1 78  ? -0.357  10.838  23.877  1.00 0.00  ? 78   ARG A HB2    1  
ATOM   1231   H  HB3    . ARG A 1 78  ? -0.899  11.448  25.442  1.00 0.00  ? 78   ARG A HB3    1  
ATOM   1232   H  HG2    . ARG A 1 78  ? 0.579   9.417   26.342  1.00 0.00  ? 78   ARG A HG2    1  
ATOM   1233   H  HG3    . ARG A 1 78  ? 1.409   9.652   24.803  1.00 0.00  ? 78   ARG A HG3    1  
ATOM   1234   H  HD2    . ARG A 1 78  ? 1.306   12.220  25.556  1.00 0.00  ? 78   ARG A HD2    1  
ATOM   1235   H  HD3    . ARG A 1 78  ? 1.263   11.478  27.168  1.00 0.00  ? 78   ARG A HD3    1  
ATOM   1236   H  HE     . ARG A 1 78  ? 3.491   10.774  26.827  1.00 0.00  ? 78   ARG A HE     1  
ATOM   1237   H  HH11   . ARG A 1 78  ? 1.913   11.474  23.822  1.00 0.00  ? 78   ARG A HH11   1  
ATOM   1238   H  HH12   . ARG A 1 78  ? 3.345   11.253  22.877  1.00 0.00  ? 78   ARG A HH12   1  
ATOM   1239   H  HH21   . ARG A 1 78  ? 5.357   10.487  25.596  1.00 0.00  ? 78   ARG A HH21   1  
ATOM   1240   H  HH22   . ARG A 1 78  ? 5.292   10.697  23.878  1.00 0.00  ? 78   ARG A HH22   1  
ATOM   1241   N  N      . TRP A 1 79  ? -3.735  10.357  25.568  1.00 26.73 ? 79   TRP A N      1  
ATOM   1242   C  CA     . TRP A 1 79  ? -5.147  10.780  25.275  1.00 24.29 ? 79   TRP A CA     1  
ATOM   1243   C  C      . TRP A 1 79  ? -5.247  11.717  24.060  1.00 26.70 ? 79   TRP A C      1  
ATOM   1244   O  O      . TRP A 1 79  ? -5.984  11.447  23.129  1.00 26.13 ? 79   TRP A O      1  
ATOM   1245   C  CB     . TRP A 1 79  ? -5.620  11.498  26.537  1.00 26.62 ? 79   TRP A CB     1  
ATOM   1246   C  CG     . TRP A 1 79  ? -7.106  11.666  26.480  1.00 27.81 ? 79   TRP A CG     1  
ATOM   1247   C  CD1    . TRP A 1 79  ? -7.753  12.850  26.378  1.00 32.00 ? 79   TRP A CD1    1  
ATOM   1248   C  CD2    . TRP A 1 79  ? -8.138  10.641  26.519  1.00 31.19 ? 79   TRP A CD2    1  
ATOM   1249   N  NE1    . TRP A 1 79  ? -9.114  12.614  26.344  1.00 37.20 ? 79   TRP A NE1    1  
ATOM   1250   C  CE2    . TRP A 1 79  ? -9.402  11.272  26.429  1.00 32.63 ? 79   TRP A CE2    1  
ATOM   1251   C  CE3    . TRP A 1 79  ? -8.099  9.239   26.620  1.00 33.68 ? 79   TRP A CE3    1  
ATOM   1252   C  CZ2    . TRP A 1 79  ? -10.589 10.543  26.437  1.00 44.57 ? 79   TRP A CZ2    1  
ATOM   1253   C  CZ3    . TRP A 1 79  ? -9.294  8.497   26.630  1.00 45.90 ? 79   TRP A CZ3    1  
ATOM   1254   C  CH2    . TRP A 1 79  ? -10.538 9.150   26.538  1.00 50.09 ? 79   TRP A CH2    1  
ATOM   1255   H  H      . TRP A 1 79  ? -3.402  10.373  26.491  1.00 0.00  ? 79   TRP A H      1  
ATOM   1256   H  HA     . TRP A 1 79  ? -5.761  9.909   25.111  1.00 0.00  ? 79   TRP A HA     1  
ATOM   1257   H  HB2    . TRP A 1 79  ? -5.355  10.910  27.404  1.00 0.00  ? 79   TRP A HB2    1  
ATOM   1258   H  HB3    . TRP A 1 79  ? -5.149  12.467  26.598  1.00 0.00  ? 79   TRP A HB3    1  
ATOM   1259   H  HD1    . TRP A 1 79  ? -7.284  13.821  26.328  1.00 0.00  ? 79   TRP A HD1    1  
ATOM   1260   H  HE1    . TRP A 1 79  ? -9.807  13.304  26.271  1.00 0.00  ? 79   TRP A HE1    1  
ATOM   1261   H  HE3    . TRP A 1 79  ? -7.147  8.731   26.693  1.00 0.00  ? 79   TRP A HE3    1  
ATOM   1262   H  HZ2    . TRP A 1 79  ? -11.540 11.051  26.364  1.00 0.00  ? 79   TRP A HZ2    1  
ATOM   1263   H  HZ3    . TRP A 1 79  ? -9.256  7.421   26.709  1.00 0.00  ? 79   TRP A HZ3    1  
ATOM   1264   H  HH2    . TRP A 1 79  ? -11.453 8.576   26.545  1.00 0.00  ? 79   TRP A HH2    1  
ATOM   1265   N  N      . ASP A 1 80  ? -4.539  12.818  24.068  1.00 20.85 ? 80   ASP A N      1  
ATOM   1266   C  CA     . ASP A 1 80  ? -4.621  13.777  22.918  1.00 23.23 ? 80   ASP A CA     1  
ATOM   1267   C  C      . ASP A 1 80  ? -4.330  13.078  21.580  1.00 26.89 ? 80   ASP A C      1  
ATOM   1268   O  O      . ASP A 1 80  ? -4.993  13.330  20.589  1.00 31.93 ? 80   ASP A O      1  
ATOM   1269   C  CB     . ASP A 1 80  ? -3.567  14.849  23.210  1.00 21.03 ? 80   ASP A CB     1  
ATOM   1270   C  CG     . ASP A 1 80  ? -2.181  14.207  23.300  1.00 39.98 ? 80   ASP A CG     1  
ATOM   1271   O  OD1    . ASP A 1 80  ? -1.960  13.451  24.231  1.00 43.13 ? 80   ASP A OD1    1  
ATOM   1272   O  OD2    . ASP A 1 80  ? -1.365  14.485  22.437  1.00 51.81 ? 80   ASP A OD2    1  
ATOM   1273   H  H      . ASP A 1 80  ? -3.967  13.019  24.838  1.00 0.00  ? 80   ASP A H      1  
ATOM   1274   H  HA     . ASP A 1 80  ? -5.598  14.232  22.889  1.00 0.00  ? 80   ASP A HA     1  
ATOM   1275   H  HB2    . ASP A 1 80  ? -3.573  15.582  22.416  1.00 0.00  ? 80   ASP A HB2    1  
ATOM   1276   H  HB3    . ASP A 1 80  ? -3.798  15.333  24.147  1.00 0.00  ? 80   ASP A HB3    1  
ATOM   1277   N  N      . ASP A 1 81  ? -3.352  12.207  21.540  1.00 26.67 ? 81   ASP A N      1  
ATOM   1278   C  CA     . ASP A 1 81  ? -3.036  11.503  20.260  1.00 21.47 ? 81   ASP A CA     1  
ATOM   1279   C  C      . ASP A 1 81  ? -4.181  10.551  19.901  1.00 27.28 ? 81   ASP A C      1  
ATOM   1280   O  O      . ASP A 1 81  ? -4.470  10.323  18.739  1.00 29.57 ? 81   ASP A O      1  
ATOM   1281   C  CB     . ASP A 1 81  ? -1.742  10.738  20.528  1.00 23.57 ? 81   ASP A CB     1  
ATOM   1282   C  CG     . ASP A 1 81  ? -0.548  11.682  20.355  1.00 26.63 ? 81   ASP A CG     1  
ATOM   1283   O  OD1    . ASP A 1 81  ? -0.585  12.492  19.443  1.00 35.67 ? 81   ASP A OD1    1  
ATOM   1284   O  OD2    . ASP A 1 81  ? 0.382   11.579  21.137  1.00 18.16 ? 81   ASP A OD2    1  
ATOM   1285   H  H      . ASP A 1 81  ? -2.831  12.018  22.348  1.00 0.00  ? 81   ASP A H      1  
ATOM   1286   H  HA     . ASP A 1 81  ? -2.884  12.221  19.468  1.00 0.00  ? 81   ASP A HA     1  
ATOM   1287   H  HB2    . ASP A 1 81  ? -1.754  10.353  21.537  1.00 0.00  ? 81   ASP A HB2    1  
ATOM   1288   H  HB3    . ASP A 1 81  ? -1.656  9.921   19.830  1.00 0.00  ? 81   ASP A HB3    1  
ATOM   1289   N  N      . GLN A 1 82  ? -4.849  10.017  20.893  1.00 24.99 ? 82   GLN A N      1  
ATOM   1290   C  CA     . GLN A 1 82  ? -5.999  9.106   20.619  1.00 21.39 ? 82   GLN A CA     1  
ATOM   1291   C  C      . GLN A 1 82  ? -7.133  9.922   19.992  1.00 24.45 ? 82   GLN A C      1  
ATOM   1292   O  O      . GLN A 1 82  ? -7.839  9.461   19.115  1.00 32.47 ? 82   GLN A O      1  
ATOM   1293   C  CB     . GLN A 1 82  ? -6.414  8.556   21.985  1.00 19.69 ? 82   GLN A CB     1  
ATOM   1294   C  CG     . GLN A 1 82  ? -5.885  7.130   22.149  1.00 22.38 ? 82   GLN A CG     1  
ATOM   1295   C  CD     . GLN A 1 82  ? -6.859  6.321   23.006  1.00 27.93 ? 82   GLN A CD     1  
ATOM   1296   O  OE1    . GLN A 1 82  ? -7.992  6.109   22.622  1.00 19.85 ? 82   GLN A OE1    1  
ATOM   1297   N  NE2    . GLN A 1 82  ? -6.465  5.858   24.160  1.00 24.87 ? 82   GLN A NE2    1  
ATOM   1298   H  H      . GLN A 1 82  ? -4.603  10.234  21.818  1.00 0.00  ? 82   GLN A H      1  
ATOM   1299   H  HA     . GLN A 1 82  ? -5.700  8.302   19.963  1.00 0.00  ? 82   GLN A HA     1  
ATOM   1300   H  HB2    . GLN A 1 82  ? -6.006  9.184   22.764  1.00 0.00  ? 82   GLN A HB2    1  
ATOM   1301   H  HB3    . GLN A 1 82  ? -7.491  8.548   22.057  1.00 0.00  ? 82   GLN A HB3    1  
ATOM   1302   H  HG2    . GLN A 1 82  ? -5.788  6.667   21.178  1.00 0.00  ? 82   GLN A HG2    1  
ATOM   1303   H  HG3    . GLN A 1 82  ? -4.920  7.157   22.634  1.00 0.00  ? 82   GLN A HG3    1  
ATOM   1304   H  HE21   . GLN A 1 82  ? -5.551  6.029   24.470  1.00 0.00  ? 82   GLN A HE21   1  
ATOM   1305   H  HE22   . GLN A 1 82  ? -7.082  5.338   24.716  1.00 0.00  ? 82   GLN A HE22   1  
ATOM   1306   N  N      . GLN A 1 83  ? -7.293  11.151  20.434  1.00 26.76 ? 83   GLN A N      1  
ATOM   1307   C  CA     . GLN A 1 83  ? -8.360  12.016  19.869  1.00 30.55 ? 83   GLN A CA     1  
ATOM   1308   C  C      . GLN A 1 83  ? -7.944  12.480  18.474  1.00 33.82 ? 83   GLN A C      1  
ATOM   1309   O  O      . GLN A 1 83  ? -8.737  12.503  17.549  1.00 36.61 ? 83   GLN A O      1  
ATOM   1310   C  CB     . GLN A 1 83  ? -8.455  13.211  20.819  1.00 36.04 ? 83   GLN A CB     1  
ATOM   1311   C  CG     . GLN A 1 83  ? -8.885  12.734  22.207  1.00 37.85 ? 83   GLN A CG     1  
ATOM   1312   C  CD     . GLN A 1 83  ? -10.317 12.198  22.143  1.00 49.20 ? 83   GLN A CD     1  
ATOM   1313   O  OE1    . GLN A 1 83  ? -10.540 11.075  21.738  1.00 39.57 ? 83   GLN A OE1    1  
ATOM   1314   N  NE2    . GLN A 1 83  ? -11.305 12.960  22.528  1.00 67.28 ? 83   GLN A NE2    1  
ATOM   1315   H  H      . GLN A 1 83  ? -6.698  11.473  21.144  1.00 0.00  ? 83   GLN A H      1  
ATOM   1316   H  HA     . GLN A 1 83  ? -9.302  11.491  19.833  1.00 0.00  ? 83   GLN A HA     1  
ATOM   1317   H  HB2    . GLN A 1 83  ? -7.491  13.694  20.886  1.00 0.00  ? 83   GLN A HB2    1  
ATOM   1318   H  HB3    . GLN A 1 83  ? -9.183  13.913  20.441  1.00 0.00  ? 83   GLN A HB3    1  
ATOM   1319   H  HG2    . GLN A 1 83  ? -8.221  11.950  22.540  1.00 0.00  ? 83   GLN A HG2    1  
ATOM   1320   H  HG3    . GLN A 1 83  ? -8.843  13.560  22.901  1.00 0.00  ? 83   GLN A HG3    1  
ATOM   1321   H  HE21   . GLN A 1 83  ? -11.126 13.867  22.854  1.00 0.00  ? 83   GLN A HE21   1  
ATOM   1322   H  HE22   . GLN A 1 83  ? -12.225 12.625  22.491  1.00 0.00  ? 83   GLN A HE22   1  
ATOM   1323   N  N      . LYS A 1 84  ? -6.698  12.836  18.318  1.00 23.41 ? 84   LYS A N      1  
ATOM   1324   C  CA     . LYS A 1 84  ? -6.200  13.287  16.976  1.00 22.31 ? 84   LYS A CA     1  
ATOM   1325   C  C      . LYS A 1 84  ? -6.416  12.182  15.939  1.00 25.36 ? 84   LYS A C      1  
ATOM   1326   O  O      . LYS A 1 84  ? -6.920  12.424  14.856  1.00 36.03 ? 84   LYS A O      1  
ATOM   1327   C  CB     . LYS A 1 84  ? -4.707  13.560  17.168  1.00 22.23 ? 84   LYS A CB     1  
ATOM   1328   C  CG     . LYS A 1 84  ? -4.181  14.372  15.982  1.00 24.28 ? 84   LYS A CG     1  
ATOM   1329   C  CD     . LYS A 1 84  ? -2.680  14.127  15.815  1.00 31.62 ? 84   LYS A CD     1  
ATOM   1330   C  CE     . LYS A 1 84  ? -1.913  14.888  16.899  1.00 39.44 ? 84   LYS A CE     1  
ATOM   1331   N  NZ     . LYS A 1 84  ? -0.477  14.735  16.533  1.00 57.57 ? 84   LYS A NZ     1  
ATOM   1332   H  H      . LYS A 1 84  ? -6.065  12.787  19.066  1.00 0.00  ? 84   LYS A H      1  
ATOM   1333   H  HA     . LYS A 1 84  ? -6.705  14.191  16.674  1.00 0.00  ? 84   LYS A HA     1  
ATOM   1334   H  HB2    . LYS A 1 84  ? -4.559  14.117  18.082  1.00 0.00  ? 84   LYS A HB2    1  
ATOM   1335   H  HB3    . LYS A 1 84  ? -4.173  12.623  17.225  1.00 0.00  ? 84   LYS A HB3    1  
ATOM   1336   H  HG2    . LYS A 1 84  ? -4.698  14.071  15.083  1.00 0.00  ? 84   LYS A HG2    1  
ATOM   1337   H  HG3    . LYS A 1 84  ? -4.354  15.423  16.161  1.00 0.00  ? 84   LYS A HG3    1  
ATOM   1338   H  HD2    . LYS A 1 84  ? -2.476  13.069  15.903  1.00 0.00  ? 84   LYS A HD2    1  
ATOM   1339   H  HD3    . LYS A 1 84  ? -2.365  14.474  14.843  1.00 0.00  ? 84   LYS A HD3    1  
ATOM   1340   H  HE2    . LYS A 1 84  ? -2.196  15.932  16.895  1.00 0.00  ? 84   LYS A HE2    1  
ATOM   1341   H  HE3    . LYS A 1 84  ? -2.097  14.450  17.868  1.00 0.00  ? 84   LYS A HE3    1  
ATOM   1342   H  HZ1    . LYS A 1 84  ? 0.118   15.119  17.295  1.00 0.00  ? 84   LYS A HZ1    1  
ATOM   1343   H  HZ2    . LYS A 1 84  ? -0.287  15.253  15.651  1.00 0.00  ? 84   LYS A HZ2    1  
ATOM   1344   H  HZ3    . LYS A 1 84  ? -0.258  13.728  16.400  1.00 0.00  ? 84   LYS A HZ3    1  
ATOM   1345   N  N      . VAL A 1 85  ? -6.056  10.969  16.272  1.00 22.84 ? 85   VAL A N      1  
ATOM   1346   C  CA     . VAL A 1 85  ? -6.259  9.842   15.318  1.00 24.64 ? 85   VAL A CA     1  
ATOM   1347   C  C      . VAL A 1 85  ? -7.763  9.620   15.113  1.00 26.98 ? 85   VAL A C      1  
ATOM   1348   O  O      . VAL A 1 85  ? -8.218  9.369   14.015  1.00 30.14 ? 85   VAL A O      1  
ATOM   1349   C  CB     . VAL A 1 85  ? -5.613  8.629   15.990  1.00 23.90 ? 85   VAL A CB     1  
ATOM   1350   C  CG1    . VAL A 1 85  ? -5.780  7.398   15.098  1.00 18.40 ? 85   VAL A CG1    1  
ATOM   1351   C  CG2    . VAL A 1 85  ? -4.121  8.898   16.205  1.00 16.10 ? 85   VAL A CG2    1  
ATOM   1352   H  H      . VAL A 1 85  ? -5.662  10.803  17.156  1.00 0.00  ? 85   VAL A H      1  
ATOM   1353   H  HA     . VAL A 1 85  ? -5.774  10.050  14.377  1.00 0.00  ? 85   VAL A HA     1  
ATOM   1354   H  HB     . VAL A 1 85  ? -6.090  8.450   16.943  1.00 0.00  ? 85   VAL A HB     1  
ATOM   1355   H  HG11   . VAL A 1 85  ? -4.898  7.274   14.487  1.00 0.00  ? 85   VAL A HG11   1  
ATOM   1356   H  HG12   . VAL A 1 85  ? -6.642  7.528   14.461  1.00 0.00  ? 85   VAL A HG12   1  
ATOM   1357   H  HG13   . VAL A 1 85  ? -5.917  6.523   15.715  1.00 0.00  ? 85   VAL A HG13   1  
ATOM   1358   H  HG21   . VAL A 1 85  ? -3.797  8.416   17.116  1.00 0.00  ? 85   VAL A HG21   1  
ATOM   1359   H  HG22   . VAL A 1 85  ? -3.953  9.962   16.282  1.00 0.00  ? 85   VAL A HG22   1  
ATOM   1360   H  HG23   . VAL A 1 85  ? -3.560  8.504   15.370  1.00 0.00  ? 85   VAL A HG23   1  
ATOM   1361   N  N      . LYS A 1 86  ? -8.533  9.707   16.173  1.00 28.36 ? 86   LYS A N      1  
ATOM   1362   C  CA     . LYS A 1 86  ? -10.003 9.484   16.054  1.00 35.07 ? 86   LYS A CA     1  
ATOM   1363   C  C      . LYS A 1 86  ? -10.634 10.546  15.151  1.00 42.55 ? 86   LYS A C      1  
ATOM   1364   O  O      . LYS A 1 86  ? -11.461 10.243  14.310  1.00 34.77 ? 86   LYS A O      1  
ATOM   1365   C  CB     . LYS A 1 86  ? -10.542 9.604   17.480  1.00 31.46 ? 86   LYS A CB     1  
ATOM   1366   C  CG     . LYS A 1 86  ? -12.021 9.214   17.497  1.00 48.63 ? 86   LYS A CG     1  
ATOM   1367   C  CD     . LYS A 1 86  ? -12.427 8.797   18.912  1.00 54.92 ? 86   LYS A CD     1  
ATOM   1368   C  CE     . LYS A 1 86  ? -11.873 7.403   19.213  1.00 53.73 ? 86   LYS A CE     1  
ATOM   1369   N  NZ     . LYS A 1 86  ? -12.533 6.994   20.484  1.00 64.34 ? 86   LYS A NZ     1  
ATOM   1370   H  H      . LYS A 1 86  ? -8.119  9.875   17.045  1.00 0.00  ? 86   LYS A H      1  
ATOM   1371   H  HA     . LYS A 1 86  ? -10.207 8.497   15.668  1.00 0.00  ? 86   LYS A HA     1  
ATOM   1372   H  HB2    . LYS A 1 86  ? -9.986  8.945   18.132  1.00 0.00  ? 86   LYS A HB2    1  
ATOM   1373   H  HB3    . LYS A 1 86  ? -10.436 10.623  17.820  1.00 0.00  ? 86   LYS A HB3    1  
ATOM   1374   H  HG2    . LYS A 1 86  ? -12.619 10.058  17.184  1.00 0.00  ? 86   LYS A HG2    1  
ATOM   1375   H  HG3    . LYS A 1 86  ? -12.183 8.388   16.821  1.00 0.00  ? 86   LYS A HG3    1  
ATOM   1376   H  HD2    . LYS A 1 86  ? -12.030 9.506   19.624  1.00 0.00  ? 86   LYS A HD2    1  
ATOM   1377   H  HD3    . LYS A 1 86  ? -13.504 8.777   18.986  1.00 0.00  ? 86   LYS A HD3    1  
ATOM   1378   H  HE2    . LYS A 1 86  ? -12.129 6.719   18.415  1.00 0.00  ? 86   LYS A HE2    1  
ATOM   1379   H  HE3    . LYS A 1 86  ? -10.804 7.444   19.348  1.00 0.00  ? 86   LYS A HE3    1  
ATOM   1380   H  HZ1    . LYS A 1 86  ? -13.565 7.007   20.359  1.00 0.00  ? 86   LYS A HZ1    1  
ATOM   1381   H  HZ2    . LYS A 1 86  ? -12.265 7.656   21.241  1.00 0.00  ? 86   LYS A HZ2    1  
ATOM   1382   H  HZ3    . LYS A 1 86  ? -12.229 6.033   20.739  1.00 0.00  ? 86   LYS A HZ3    1  
ATOM   1383   N  N      . LYS A 1 87  ? -10.260 11.790  15.326  1.00 37.77 ? 87   LYS A N      1  
ATOM   1384   C  CA     . LYS A 1 87  ? -10.853 12.868  14.489  1.00 37.13 ? 87   LYS A CA     1  
ATOM   1385   C  C      . LYS A 1 87  ? -10.310 12.794  13.061  1.00 38.41 ? 87   LYS A C      1  
ATOM   1386   O  O      . LYS A 1 87  ? -11.054 12.907  12.105  1.00 41.02 ? 87   LYS A O      1  
ATOM   1387   C  CB     . LYS A 1 87  ? -10.439 14.173  15.163  1.00 32.41 ? 87   LYS A CB     1  
ATOM   1388   C  CG     . LYS A 1 87  ? -11.425 14.492  16.289  1.00 62.80 ? 87   LYS A CG     1  
ATOM   1389   C  CD     . LYS A 1 87  ? -10.690 15.199  17.428  1.00 68.45 ? 87   LYS A CD     1  
ATOM   1390   C  CE     . LYS A 1 87  ? -11.324 14.808  18.764  1.00 63.12 ? 87   LYS A CE     1  
ATOM   1391   N  NZ     . LYS A 1 87  ? -11.164 16.008  19.631  1.00 67.24 ? 87   LYS A NZ     1  
ATOM   1392   H  H      . LYS A 1 87  ? -9.606  11.993  16.031  1.00 0.00  ? 87   LYS A H      1  
ATOM   1393   H  HA     . LYS A 1 87  ? -11.930 12.786  14.482  1.00 0.00  ? 87   LYS A HA     1  
ATOM   1394   H  HB2    . LYS A 1 87  ? -9.444  14.068  15.570  1.00 0.00  ? 87   LYS A HB2    1  
ATOM   1395   H  HB3    . LYS A 1 87  ? -10.452 14.972  14.438  1.00 0.00  ? 87   LYS A HB3    1  
ATOM   1396   H  HG2    . LYS A 1 87  ? -12.207 15.134  15.910  1.00 0.00  ? 87   LYS A HG2    1  
ATOM   1397   H  HG3    . LYS A 1 87  ? -11.859 13.575  16.658  1.00 0.00  ? 87   LYS A HG3    1  
ATOM   1398   H  HD2    . LYS A 1 87  ? -9.650  14.905  17.421  1.00 0.00  ? 87   LYS A HD2    1  
ATOM   1399   H  HD3    . LYS A 1 87  ? -10.763 16.268  17.295  1.00 0.00  ? 87   LYS A HD3    1  
ATOM   1400   H  HE2    . LYS A 1 87  ? -12.371 14.575  18.628  1.00 0.00  ? 87   LYS A HE2    1  
ATOM   1401   H  HE3    . LYS A 1 87  ? -10.803 13.968  19.196  1.00 0.00  ? 87   LYS A HE3    1  
ATOM   1402   H  HZ1    . LYS A 1 87  ? -11.547 16.842  19.143  1.00 0.00  ? 87   LYS A HZ1    1  
ATOM   1403   H  HZ2    . LYS A 1 87  ? -10.155 16.157  19.833  1.00 0.00  ? 87   LYS A HZ2    1  
ATOM   1404   H  HZ3    . LYS A 1 87  ? -11.680 15.864  20.522  1.00 0.00  ? 87   LYS A HZ3    1  
ATOM   1405   N  N      . THR A 1 88  ? -9.024  12.593  12.909  1.00 34.04 ? 88   THR A N      1  
ATOM   1406   C  CA     . THR A 1 88  ? -8.437  12.499  11.536  1.00 28.84 ? 88   THR A CA     1  
ATOM   1407   C  C      . THR A 1 88  ? -9.087  11.334  10.785  1.00 34.04 ? 88   THR A C      1  
ATOM   1408   O  O      . THR A 1 88  ? -9.345  11.411  9.598   1.00 41.39 ? 88   THR A O      1  
ATOM   1409   C  CB     . THR A 1 88  ? -6.943  12.252  11.746  1.00 30.77 ? 88   THR A CB     1  
ATOM   1410   O  OG1    . THR A 1 88  ? -6.396  13.302  12.533  1.00 25.21 ? 88   THR A OG1    1  
ATOM   1411   C  CG2    . THR A 1 88  ? -6.239  12.209  10.389  1.00 30.16 ? 88   THR A CG2    1  
ATOM   1412   H  H      . THR A 1 88  ? -8.448  12.495  13.698  1.00 0.00  ? 88   THR A H      1  
ATOM   1413   H  HA     . THR A 1 88  ? -8.589  13.423  10.999  1.00 0.00  ? 88   THR A HA     1  
ATOM   1414   H  HB     . THR A 1 88  ? -6.799  11.310  12.252  1.00 0.00  ? 88   THR A HB     1  
ATOM   1415   H  HG1    . THR A 1 88  ? -6.229  12.958  13.413  1.00 0.00  ? 88   THR A HG1    1  
ATOM   1416   H  HG21   . THR A 1 88  ? -5.174  12.111  10.537  1.00 0.00  ? 88   THR A HG21   1  
ATOM   1417   H  HG22   . THR A 1 88  ? -6.446  13.121  9.848   1.00 0.00  ? 88   THR A HG22   1  
ATOM   1418   H  HG23   . THR A 1 88  ? -6.603  11.364  9.822   1.00 0.00  ? 88   THR A HG23   1  
ATOM   1419   N  N      . ALA A 1 89  ? -9.371  10.263  11.482  1.00 29.13 ? 89   ALA A N      1  
ATOM   1420   C  CA     . ALA A 1 89  ? -10.017 9.092   10.822  1.00 33.74 ? 89   ALA A CA     1  
ATOM   1421   C  C      . ALA A 1 89  ? -11.404 9.506   10.328  1.00 45.58 ? 89   ALA A C      1  
ATOM   1422   O  O      . ALA A 1 89  ? -11.794 9.205   9.215   1.00 50.12 ? 89   ALA A O      1  
ATOM   1423   C  CB     . ALA A 1 89  ? -10.129 8.025   11.912  1.00 35.15 ? 89   ALA A CB     1  
ATOM   1424   H  H      . ALA A 1 89  ? -9.136  10.228  12.433  1.00 0.00  ? 89   ALA A H      1  
ATOM   1425   H  HA     . ALA A 1 89  ? -9.413  8.729   10.004  1.00 0.00  ? 89   ALA A HA     1  
ATOM   1426   H  HB1    . ALA A 1 89  ? -11.028 8.191   12.487  1.00 0.00  ? 89   ALA A HB1    1  
ATOM   1427   H  HB2    . ALA A 1 89  ? -9.269  8.083   12.562  1.00 0.00  ? 89   ALA A HB2    1  
ATOM   1428   H  HB3    . ALA A 1 89  ? -10.169 7.047   11.455  1.00 0.00  ? 89   ALA A HB3    1  
ATOM   1429   N  N      . GLU A 1 90  ? -12.151 10.200  11.147  1.00 47.40 ? 90   GLU A N      1  
ATOM   1430   C  CA     . GLU A 1 90  ? -13.514 10.641  10.728  1.00 49.84 ? 90   GLU A CA     1  
ATOM   1431   C  C      . GLU A 1 90  ? -13.417 11.594  9.533   1.00 56.71 ? 90   GLU A C      1  
ATOM   1432   O  O      . GLU A 1 90  ? -14.090 11.423  8.535   1.00 52.06 ? 90   GLU A O      1  
ATOM   1433   C  CB     . GLU A 1 90  ? -14.093 11.364  11.945  1.00 47.00 ? 90   GLU A CB     1  
ATOM   1434   C  CG     . GLU A 1 90  ? -14.207 10.384  13.115  1.00 57.68 ? 90   GLU A CG     1  
ATOM   1435   C  CD     . GLU A 1 90  ? -15.576 9.703   13.080  1.00 70.85 ? 90   GLU A CD     1  
ATOM   1436   O  OE1    . GLU A 1 90  ? -15.888 9.095   12.069  1.00 75.12 ? 90   GLU A OE1    1  
ATOM   1437   O  OE2    . GLU A 1 90  ? -16.291 9.802   14.064  1.00 62.59 ? 90   GLU A OE2    1  
ATOM   1438   H  H      . GLU A 1 90  ? -11.813 10.434  12.037  1.00 0.00  ? 90   GLU A H      1  
ATOM   1439   H  HA     . GLU A 1 90  ? -14.127 9.788   10.481  1.00 0.00  ? 90   GLU A HA     1  
ATOM   1440   H  HB2    . GLU A 1 90  ? -13.442 12.181  12.221  1.00 0.00  ? 90   GLU A HB2    1  
ATOM   1441   H  HB3    . GLU A 1 90  ? -15.072 11.749  11.704  1.00 0.00  ? 90   GLU A HB3    1  
ATOM   1442   H  HG2    . GLU A 1 90  ? -13.430 9.637   13.036  1.00 0.00  ? 90   GLU A HG2    1  
ATOM   1443   H  HG3    . GLU A 1 90  ? -14.098 10.920  14.046  1.00 0.00  ? 90   GLU A HG3    1  
ATOM   1444   N  N      . ALA A 1 91  ? -12.585 12.598  9.628   1.00 47.08 ? 91   ALA A N      1  
ATOM   1445   C  CA     . ALA A 1 91  ? -12.442 13.564  8.497   1.00 42.07 ? 91   ALA A CA     1  
ATOM   1446   C  C      . ALA A 1 91  ? -12.045 12.827  7.215   1.00 52.34 ? 91   ALA A C      1  
ATOM   1447   O  O      . ALA A 1 91  ? -11.012 12.190  7.150   1.00 0.00  ? 91   ALA A O      1  
ATOM   1448   C  CB     . ALA A 1 91  ? -11.331 14.521  8.930   1.00 35.58 ? 91   ALA A CB     1  
ATOM   1449   H  H      . ALA A 1 91  ? -12.054 12.716  10.443  1.00 0.00  ? 91   ALA A H      1  
ATOM   1450   H  HA     . ALA A 1 91  ? -13.361 14.109  8.349   1.00 0.00  ? 91   ALA A HA     1  
ATOM   1451   H  HB1    . ALA A 1 91  ? -10.706 14.038  9.666   1.00 0.00  ? 91   ALA A HB1    1  
ATOM   1452   H  HB2    . ALA A 1 91  ? -11.769 15.411  9.358   1.00 0.00  ? 91   ALA A HB2    1  
ATOM   1453   H  HB3    . ALA A 1 91  ? -10.733 14.791  8.072   1.00 0.00  ? 91   ALA A HB3    1  
ATOM   1454   N  N      . GLY A 1 92  ? -12.859 12.908  6.196   1.00 0.00  ? 92   GLY A N      1  
ATOM   1455   C  CA     . GLY A 1 92  ? -12.529 12.211  4.919   1.00 0.00  ? 92   GLY A CA     1  
ATOM   1456   C  C      . GLY A 1 92  ? -12.088 13.236  3.874   1.00 0.00  ? 92   GLY A C      1  
ATOM   1457   O  O      . GLY A 1 92  ? -12.515 13.199  2.737   1.00 0.00  ? 92   GLY A O      1  
ATOM   1458   H  H      . GLY A 1 92  ? -13.687 13.426  6.271   1.00 0.00  ? 92   GLY A H      1  
ATOM   1459   H  HA2    . GLY A 1 92  ? -11.730 11.504  5.092   1.00 0.00  ? 92   GLY A HA2    1  
ATOM   1460   H  HA3    . GLY A 1 92  ? -13.402 11.687  4.559   1.00 0.00  ? 92   GLY A HA3    1  
ATOM   1461   N  N      . GLY A 1 93  ? -11.236 14.153  4.251   1.00 0.00  ? 93   GLY A N      1  
ATOM   1462   C  CA     . GLY A 1 93  ? -10.766 15.183  3.279   1.00 0.00  ? 93   GLY A CA     1  
ATOM   1463   C  C      . GLY A 1 93  ? -11.957 16.014  2.799   1.00 0.00  ? 93   GLY A C      1  
ATOM   1464   O  O      . GLY A 1 93  ? -12.847 16.334  3.561   1.00 0.00  ? 93   GLY A O      1  
ATOM   1465   H  H      . GLY A 1 93  ? -10.905 14.163  5.173   1.00 0.00  ? 93   GLY A H      1  
ATOM   1466   H  HA2    . GLY A 1 93  ? -10.045 15.828  3.761   1.00 0.00  ? 93   GLY A HA2    1  
ATOM   1467   H  HA3    . GLY A 1 93  ? -10.307 14.696  2.433   1.00 0.00  ? 93   GLY A HA3    1  
ATOM   1468   N  N      . VAL A 1 94  ? -11.979 16.363  1.537   1.00 0.00  ? 94   VAL A N      1  
ATOM   1469   C  CA     . VAL A 1 94  ? -13.111 17.175  0.990   1.00 0.00  ? 94   VAL A CA     1  
ATOM   1470   C  C      . VAL A 1 94  ? -13.289 18.463  1.802   1.00 0.00  ? 94   VAL A C      1  
ATOM   1471   O  O      . VAL A 1 94  ? -13.817 18.452  2.897   1.00 0.00  ? 94   VAL A O      1  
ATOM   1472   C  CB     . VAL A 1 94  ? -14.349 16.281  1.114   1.00 0.00  ? 94   VAL A CB     1  
ATOM   1473   C  CG1    . VAL A 1 94  ? -15.572 17.021  0.567   1.00 0.00  ? 94   VAL A CG1    1  
ATOM   1474   C  CG2    . VAL A 1 94  ? -14.135 14.995  0.311   1.00 0.00  ? 94   VAL A CG2    1  
ATOM   1475   H  H      . VAL A 1 94  ? -11.247 16.089  0.945   1.00 0.00  ? 94   VAL A H      1  
ATOM   1476   H  HA     . VAL A 1 94  ? -12.933 17.410  -0.047  1.00 0.00  ? 94   VAL A HA     1  
ATOM   1477   H  HB     . VAL A 1 94  ? -14.515 16.036  2.153   1.00 0.00  ? 94   VAL A HB     1  
ATOM   1478   H  HG11   . VAL A 1 94  ? -16.285 16.305  0.185   1.00 0.00  ? 94   VAL A HG11   1  
ATOM   1479   H  HG12   . VAL A 1 94  ? -15.265 17.683  -0.229  1.00 0.00  ? 94   VAL A HG12   1  
ATOM   1480   H  HG13   . VAL A 1 94  ? -16.028 17.597  1.358   1.00 0.00  ? 94   VAL A HG13   1  
ATOM   1481   H  HG21   . VAL A 1 94  ? -14.619 14.172  0.815   1.00 0.00  ? 94   VAL A HG21   1  
ATOM   1482   H  HG22   . VAL A 1 94  ? -13.077 14.794  0.227   1.00 0.00  ? 94   VAL A HG22   1  
ATOM   1483   H  HG23   . VAL A 1 94  ? -14.558 15.112  -0.676  1.00 0.00  ? 94   VAL A HG23   1  
ATOM   1484   N  N      . THR A 1 95  ? -12.854 19.575  1.269   1.00 0.00  ? 95   THR A N      1  
ATOM   1485   C  CA     . THR A 1 95  ? -12.997 20.868  2.005   1.00 0.00  ? 95   THR A CA     1  
ATOM   1486   C  C      . THR A 1 95  ? -14.453 21.084  2.430   1.00 0.00  ? 95   THR A C      1  
ATOM   1487   O  O      . THR A 1 95  ? -15.269 21.561  1.665   1.00 0.00  ? 95   THR A O      1  
ATOM   1488   C  CB     . THR A 1 95  ? -12.567 21.943  1.005   1.00 0.00  ? 95   THR A CB     1  
ATOM   1489   O  OG1    . THR A 1 95  ? -11.376 21.528  0.350   1.00 0.00  ? 95   THR A OG1    1  
ATOM   1490   C  CG2    . THR A 1 95  ? -12.313 23.259  1.743   1.00 0.00  ? 95   THR A CG2    1  
ATOM   1491   H  H      . THR A 1 95  ? -12.434 19.560  0.384   1.00 0.00  ? 95   THR A H      1  
ATOM   1492   H  HA     . THR A 1 95  ? -12.347 20.885  2.866   1.00 0.00  ? 95   THR A HA     1  
ATOM   1493   H  HB     . THR A 1 95  ? -13.348 22.090  0.276   1.00 0.00  ? 95   THR A HB     1  
ATOM   1494   H  HG1    . THR A 1 95  ? -11.539 21.541  -0.596  1.00 0.00  ? 95   THR A HG1    1  
ATOM   1495   H  HG21   . THR A 1 95  ? -12.102 23.054  2.783   1.00 0.00  ? 95   THR A HG21   1  
ATOM   1496   H  HG22   . THR A 1 95  ? -13.188 23.887  1.671   1.00 0.00  ? 95   THR A HG22   1  
ATOM   1497   H  HG23   . THR A 1 95  ? -11.469 23.764  1.298   1.00 0.00  ? 95   THR A HG23   1  
ATOM   1498   N  N      . GLY A 1 96  ? -14.783 20.735  3.645   1.00 0.00  ? 96   GLY A N      1  
ATOM   1499   C  CA     . GLY A 1 96  ? -16.184 20.918  4.123   1.00 0.00  ? 96   GLY A CA     1  
ATOM   1500   C  C      . GLY A 1 96  ? -16.245 22.111  5.079   1.00 0.00  ? 96   GLY A C      1  
ATOM   1501   O  O      . GLY A 1 96  ? -15.461 23.034  4.984   1.00 0.00  ? 96   GLY A O      1  
ATOM   1502   H  H      . GLY A 1 96  ? -14.108 20.352  4.244   1.00 0.00  ? 96   GLY A H      1  
ATOM   1503   H  HA2    . GLY A 1 96  ? -16.832 21.098  3.277   1.00 0.00  ? 96   GLY A HA2    1  
ATOM   1504   H  HA3    . GLY A 1 96  ? -16.506 20.028  4.642   1.00 0.00  ? 96   GLY A HA3    1  
ATOM   1505   N  N      . LYS A 1 97  ? -17.172 22.098  6.000   1.00 0.00  ? 97   LYS A N      1  
ATOM   1506   C  CA     . LYS A 1 97  ? -17.286 23.233  6.963   1.00 0.00  ? 97   LYS A CA     1  
ATOM   1507   C  C      . LYS A 1 97  ? -18.245 22.868  8.100   1.00 0.00  ? 97   LYS A C      1  
ATOM   1508   O  O      . LYS A 1 97  ? -18.581 21.716  8.296   1.00 0.00  ? 97   LYS A O      1  
ATOM   1509   C  CB     . LYS A 1 97  ? -17.844 24.399  6.141   1.00 0.00  ? 97   LYS A CB     1  
ATOM   1510   C  CG     . LYS A 1 97  ? -16.932 25.621  6.290   1.00 0.00  ? 97   LYS A CG     1  
ATOM   1511   C  CD     . LYS A 1 97  ? -16.680 26.244  4.915   1.00 0.00  ? 97   LYS A CD     1  
ATOM   1512   C  CE     . LYS A 1 97  ? -15.869 27.532  5.078   1.00 0.00  ? 97   LYS A CE     1  
ATOM   1513   N  NZ     . LYS A 1 97  ? -16.869 28.572  5.447   1.00 0.00  ? 97   LYS A NZ     1  
ATOM   1514   H  H      . LYS A 1 97  ? -17.794 21.343  6.058   1.00 0.00  ? 97   LYS A H      1  
ATOM   1515   H  HA     . LYS A 1 97  ? -16.315 23.490  7.358   1.00 0.00  ? 97   LYS A HA     1  
ATOM   1516   H  HB2    . LYS A 1 97  ? -17.895 24.112  5.100   1.00 0.00  ? 97   LYS A HB2    1  
ATOM   1517   H  HB3    . LYS A 1 97  ? -18.834 24.647  6.494   1.00 0.00  ? 97   LYS A HB3    1  
ATOM   1518   H  HG2    . LYS A 1 97  ? -17.408 26.348  6.933   1.00 0.00  ? 97   LYS A HG2    1  
ATOM   1519   H  HG3    . LYS A 1 97  ? -15.990 25.320  6.723   1.00 0.00  ? 97   LYS A HG3    1  
ATOM   1520   H  HD2    . LYS A 1 97  ? -16.130 25.547  4.300   1.00 0.00  ? 97   LYS A HD2    1  
ATOM   1521   H  HD3    . LYS A 1 97  ? -17.624 26.473  4.444   1.00 0.00  ? 97   LYS A HD3    1  
ATOM   1522   H  HE2    . LYS A 1 97  ? -15.136 27.415  5.865   1.00 0.00  ? 97   LYS A HE2    1  
ATOM   1523   H  HE3    . LYS A 1 97  ? -15.388 27.794  4.149   1.00 0.00  ? 97   LYS A HE3    1  
ATOM   1524   H  HZ1    . LYS A 1 97  ? -16.416 29.507  5.442   1.00 0.00  ? 97   LYS A HZ1    1  
ATOM   1525   H  HZ2    . LYS A 1 97  ? -17.243 28.372  6.397   1.00 0.00  ? 97   LYS A HZ2    1  
ATOM   1526   H  HZ3    . LYS A 1 97  ? -17.648 28.563  4.759   1.00 0.00  ? 97   LYS A HZ3    1  
ATOM   1527   N  N      . GLY A 1 98  ? -18.688 23.843  8.849   1.00 0.00  ? 98   GLY A N      1  
ATOM   1528   C  CA     . GLY A 1 98  ? -19.625 23.558  9.973   1.00 0.00  ? 98   GLY A CA     1  
ATOM   1529   C  C      . GLY A 1 98  ? -20.340 24.847  10.381  1.00 0.00  ? 98   GLY A C      1  
ATOM   1530   O  O      . GLY A 1 98  ? -19.993 25.925  9.939   1.00 0.00  ? 98   GLY A O      1  
ATOM   1531   H  H      . GLY A 1 98  ? -18.403 24.763  8.671   1.00 0.00  ? 98   GLY A H      1  
ATOM   1532   H  HA2    . GLY A 1 98  ? -20.354 22.825  9.656   1.00 0.00  ? 98   GLY A HA2    1  
ATOM   1533   H  HA3    . GLY A 1 98  ? -19.071 23.175  10.816  1.00 0.00  ? 98   GLY A HA3    1  
ATOM   1534   N  N      . GLN A 1 99  ? -21.335 24.745  11.221  1.00 0.00  ? 99   GLN A N      1  
ATOM   1535   C  CA     . GLN A 1 99  ? -22.073 25.965  11.659  1.00 0.00  ? 99   GLN A CA     1  
ATOM   1536   C  C      . GLN A 1 99  ? -22.902 25.662  12.910  1.00 0.00  ? 99   GLN A C      1  
ATOM   1537   O  O      . GLN A 1 99  ? -22.862 26.389  13.883  1.00 0.00  ? 99   GLN A O      1  
ATOM   1538   C  CB     . GLN A 1 99  ? -22.985 26.319  10.484  1.00 0.00  ? 99   GLN A CB     1  
ATOM   1539   C  CG     . GLN A 1 99  ? -23.386 27.793  10.573  1.00 0.00  ? 99   GLN A CG     1  
ATOM   1540   C  CD     . GLN A 1 99  ? -24.401 28.114  9.474   1.00 0.00  ? 99   GLN A CD     1  
ATOM   1541   O  OE1    . GLN A 1 99  ? -25.591 27.961  9.667   1.00 0.00  ? 99   GLN A OE1    1  
ATOM   1542   N  NE2    . GLN A 1 99  ? -23.980 28.556  8.321   1.00 0.00  ? 99   GLN A NE2    1  
ATOM   1543   H  H      . GLN A 1 99  ? -21.597 23.865  11.564  1.00 0.00  ? 99   GLN A H      1  
ATOM   1544   H  HA     . GLN A 1 99  ? -21.385 26.774  11.848  1.00 0.00  ? 99   GLN A HA     1  
ATOM   1545   H  HB2    . GLN A 1 99  ? -22.461 26.143  9.556   1.00 0.00  ? 99   GLN A HB2    1  
ATOM   1546   H  HB3    . GLN A 1 99  ? -23.872 25.704  10.518  1.00 0.00  ? 99   GLN A HB3    1  
ATOM   1547   H  HG2    . GLN A 1 99  ? -23.826 27.988  11.540  1.00 0.00  ? 99   GLN A HG2    1  
ATOM   1548   H  HG3    . GLN A 1 99  ? -22.511 28.412  10.443  1.00 0.00  ? 99   GLN A HG3    1  
ATOM   1549   H  HE21   . GLN A 1 99  ? -23.020 28.679  8.164   1.00 0.00  ? 99   GLN A HE21   1  
ATOM   1550   H  HE22   . GLN A 1 99  ? -24.623 28.764  7.611   1.00 0.00  ? 99   GLN A HE22   1  
ATOM   1551   N  N      . ASP A 1 100 ? -23.651 24.592  12.890  1.00 0.00  ? 100  ASP A N      1  
ATOM   1552   C  CA     . ASP A 1 100 ? -24.483 24.239  14.077  1.00 0.00  ? 100  ASP A CA     1  
ATOM   1553   C  C      . ASP A 1 100 ? -24.633 22.719  14.184  1.00 0.00  ? 100  ASP A C      1  
ATOM   1554   O  O      . ASP A 1 100 ? -25.101 22.067  13.270  1.00 0.00  ? 100  ASP A O      1  
ATOM   1555   C  CB     . ASP A 1 100 ? -25.840 24.894  13.817  1.00 0.00  ? 100  ASP A CB     1  
ATOM   1556   C  CG     . ASP A 1 100 ? -25.679 26.415  13.800  1.00 0.00  ? 100  ASP A CG     1  
ATOM   1557   O  OD1    . ASP A 1 100 ? -25.180 26.949  14.777  1.00 0.00  ? 100  ASP A OD1    1  
ATOM   1558   O  OD2    . ASP A 1 100 ? -26.056 27.020  12.810  1.00 0.00  ? 100  ASP A OD2    1  
ATOM   1559   H  H      . ASP A 1 100 ? -23.667 24.021  12.094  1.00 0.00  ? 100  ASP A H      1  
ATOM   1560   H  HA     . ASP A 1 100 ? -24.046 24.640  14.977  1.00 0.00  ? 100  ASP A HA     1  
ATOM   1561   H  HB2    . ASP A 1 100 ? -26.224 24.561  12.864  1.00 0.00  ? 100  ASP A HB2    1  
ATOM   1562   H  HB3    . ASP A 1 100 ? -26.530 24.616  14.600  1.00 0.00  ? 100  ASP A HB3    1  
ATOM   1563   N  N      . GLY A 1 101 ? -24.240 22.151  15.292  1.00 0.00  ? 101  GLY A N      1  
ATOM   1564   C  CA     . GLY A 1 101 ? -24.358 20.674  15.460  1.00 0.00  ? 101  GLY A CA     1  
ATOM   1565   C  C      . GLY A 1 101 ? -24.316 20.323  16.948  1.00 0.00  ? 101  GLY A C      1  
ATOM   1566   O  O      . GLY A 1 101 ? -24.133 21.178  17.792  1.00 0.00  ? 101  GLY A O      1  
ATOM   1567   H  H      . GLY A 1 101 ? -23.866 22.697  16.015  1.00 0.00  ? 101  GLY A H      1  
ATOM   1568   H  HA2    . GLY A 1 101 ? -25.294 20.339  15.035  1.00 0.00  ? 101  GLY A HA2    1  
ATOM   1569   H  HA3    . GLY A 1 101 ? -23.538 20.187  14.955  1.00 0.00  ? 101  GLY A HA3    1  
ATOM   1570   N  N      . ILE A 1 102 ? -24.484 19.069  17.275  1.00 0.00  ? 102  ILE A N      1  
ATOM   1571   C  CA     . ILE A 1 102 ? -24.454 18.659  18.710  1.00 0.00  ? 102  ILE A CA     1  
ATOM   1572   C  C      . ILE A 1 102 ? -23.236 17.771  18.979  1.00 0.00  ? 102  ILE A C      1  
ATOM   1573   O  O      . ILE A 1 102 ? -22.407 18.075  19.815  1.00 0.00  ? 102  ILE A O      1  
ATOM   1574   C  CB     . ILE A 1 102 ? -25.751 17.876  18.926  1.00 0.00  ? 102  ILE A CB     1  
ATOM   1575   C  CG1    . ILE A 1 102 ? -26.950 18.784  18.642  1.00 0.00  ? 102  ILE A CG1    1  
ATOM   1576   C  CG2    . ILE A 1 102 ? -25.819 17.384  20.373  1.00 0.00  ? 102  ILE A CG2    1  
ATOM   1577   C  CD1    . ILE A 1 102 ? -28.081 17.960  18.025  1.00 0.00  ? 102  ILE A CD1    1  
ATOM   1578   H  H      . ILE A 1 102 ? -24.630 18.397  16.577  1.00 0.00  ? 102  ILE A H      1  
ATOM   1579   H  HA     . ILE A 1 102 ? -24.437 19.528  19.349  1.00 0.00  ? 102  ILE A HA     1  
ATOM   1580   H  HB     . ILE A 1 102 ? -25.773 17.027  18.257  1.00 0.00  ? 102  ILE A HB     1  
ATOM   1581   H  HG12   . ILE A 1 102 ? -27.290 19.229  19.566  1.00 0.00  ? 102  ILE A HG12   1  
ATOM   1582   H  HG13   . ILE A 1 102 ? -26.658 19.563  17.954  1.00 0.00  ? 102  ILE A HG13   1  
ATOM   1583   H  HG21   . ILE A 1 102 ? -25.259 18.054  21.008  1.00 0.00  ? 102  ILE A HG21   1  
ATOM   1584   H  HG22   . ILE A 1 102 ? -25.397 16.392  20.437  1.00 0.00  ? 102  ILE A HG22   1  
ATOM   1585   H  HG23   . ILE A 1 102 ? -26.849 17.359  20.697  1.00 0.00  ? 102  ILE A HG23   1  
ATOM   1586   H  HD11   . ILE A 1 102 ? -27.661 17.163  17.429  1.00 0.00  ? 102  ILE A HD11   1  
ATOM   1587   H  HD12   . ILE A 1 102 ? -28.690 18.595  17.399  1.00 0.00  ? 102  ILE A HD12   1  
ATOM   1588   H  HD13   . ILE A 1 102 ? -28.690 17.538  18.811  1.00 0.00  ? 102  ILE A HD13   1  
ATOM   1589   N  N      . GLY A 1 103 ? -23.123 16.675  18.277  1.00 0.00  ? 103  GLY A N      1  
ATOM   1590   C  CA     . GLY A 1 103 ? -21.961 15.766  18.490  1.00 0.00  ? 103  GLY A CA     1  
ATOM   1591   C  C      . GLY A 1 103 ? -20.721 16.350  17.811  1.00 0.00  ? 103  GLY A C      1  
ATOM   1592   O  O      . GLY A 1 103 ? -20.636 17.539  17.572  1.00 0.00  ? 103  GLY A O      1  
ATOM   1593   H  H      . GLY A 1 103 ? -23.803 16.451  17.608  1.00 0.00  ? 103  GLY A H      1  
ATOM   1594   H  HA2    . GLY A 1 103 ? -21.777 15.661  19.550  1.00 0.00  ? 103  GLY A HA2    1  
ATOM   1595   H  HA3    . GLY A 1 103 ? -22.177 14.798  18.064  1.00 0.00  ? 103  GLY A HA3    1  
ATOM   1596   N  N      . SER A 1 104 ? -19.760 15.523  17.498  1.00 0.00  ? 104  SER A N      1  
ATOM   1597   C  CA     . SER A 1 104 ? -18.524 16.029  16.833  1.00 0.00  ? 104  SER A CA     1  
ATOM   1598   C  C      . SER A 1 104 ? -18.403 15.438  15.426  1.00 0.00  ? 104  SER A C      1  
ATOM   1599   O  O      . SER A 1 104 ? -18.530 14.245  15.230  1.00 0.00  ? 104  SER A O      1  
ATOM   1600   C  CB     . SER A 1 104 ? -17.374 15.548  17.717  1.00 0.00  ? 104  SER A CB     1  
ATOM   1601   O  OG     . SER A 1 104 ? -17.513 14.153  17.951  1.00 0.00  ? 104  SER A OG     1  
ATOM   1602   H  H      . SER A 1 104 ? -19.851 14.568  17.700  1.00 0.00  ? 104  SER A H      1  
ATOM   1603   H  HA     . SER A 1 104 ? -18.532 17.106  16.792  1.00 0.00  ? 104  SER A HA     1  
ATOM   1604   H  HB2    . SER A 1 104 ? -16.435 15.733  17.223  1.00 0.00  ? 104  SER A HB2    1  
ATOM   1605   H  HB3    . SER A 1 104 ? -17.395 16.085  18.657  1.00 0.00  ? 104  SER A HB3    1  
ATOM   1606   H  HG     . SER A 1 104 ? -16.689 13.831  18.326  1.00 0.00  ? 104  SER A HG     1  
ATOM   1607   N  N      . LYS A 1 105 ? -18.157 16.266  14.443  1.00 0.00  ? 105  LYS A N      1  
ATOM   1608   C  CA     . LYS A 1 105 ? -18.026 15.760  13.042  1.00 0.00  ? 105  LYS A CA     1  
ATOM   1609   C  C      . LYS A 1 105 ? -19.252 14.926  12.659  1.00 0.00  ? 105  LYS A C      1  
ATOM   1610   O  O      . LYS A 1 105 ? -20.183 14.784  13.428  1.00 0.00  ? 105  LYS A O      1  
ATOM   1611   C  CB     . LYS A 1 105 ? -16.765 14.892  13.045  1.00 0.00  ? 105  LYS A CB     1  
ATOM   1612   C  CG     . LYS A 1 105 ? -15.988 15.113  11.746  1.00 0.00  ? 105  LYS A CG     1  
ATOM   1613   C  CD     . LYS A 1 105 ? -14.905 16.171  11.972  1.00 0.00  ? 105  LYS A CD     1  
ATOM   1614   C  CE     . LYS A 1 105 ? -15.468 17.557  11.649  1.00 0.00  ? 105  LYS A CE     1  
ATOM   1615   N  NZ     . LYS A 1 105 ? -15.734 18.182  12.975  1.00 0.00  ? 105  LYS A NZ     1  
ATOM   1616   H  H      . LYS A 1 105 ? -18.058 17.224  14.626  1.00 0.00  ? 105  LYS A H      1  
ATOM   1617   H  HA     . LYS A 1 105 ? -17.903 16.583  12.356  1.00 0.00  ? 105  LYS A HA     1  
ATOM   1618   H  HB2    . LYS A 1 105 ? -16.145 15.162  13.888  1.00 0.00  ? 105  LYS A HB2    1  
ATOM   1619   H  HB3    . LYS A 1 105 ? -17.045 13.852  13.123  1.00 0.00  ? 105  LYS A HB3    1  
ATOM   1620   H  HG2    . LYS A 1 105 ? -15.527 14.184  11.441  1.00 0.00  ? 105  LYS A HG2    1  
ATOM   1621   H  HG3    . LYS A 1 105 ? -16.663 15.451  10.975  1.00 0.00  ? 105  LYS A HG3    1  
ATOM   1622   H  HD2    . LYS A 1 105 ? -14.585 16.142  13.003  1.00 0.00  ? 105  LYS A HD2    1  
ATOM   1623   H  HD3    . LYS A 1 105 ? -14.063 15.967  11.328  1.00 0.00  ? 105  LYS A HD3    1  
ATOM   1624   H  HE2    . LYS A 1 105 ? -14.741 18.137  11.096  1.00 0.00  ? 105  LYS A HE2    1  
ATOM   1625   H  HE3    . LYS A 1 105 ? -16.387 17.471  11.090  1.00 0.00  ? 105  LYS A HE3    1  
ATOM   1626   H  HZ1    . LYS A 1 105 ? -16.386 17.581  13.517  1.00 0.00  ? 105  LYS A HZ1    1  
ATOM   1627   H  HZ2    . LYS A 1 105 ? -16.162 19.121  12.835  1.00 0.00  ? 105  LYS A HZ2    1  
ATOM   1628   H  HZ3    . LYS A 1 105 ? -14.841 18.281  13.497  1.00 0.00  ? 105  LYS A HZ3    1  
ATOM   1629   N  N      . ALA A 1 106 ? -19.258 14.373  11.475  1.00 0.00  ? 106  ALA A N      1  
ATOM   1630   C  CA     . ALA A 1 106 ? -20.422 13.547  11.040  1.00 0.00  ? 106  ALA A CA     1  
ATOM   1631   C  C      . ALA A 1 106 ? -20.026 12.656  9.860   1.00 0.00  ? 106  ALA A C      1  
ATOM   1632   O  O      . ALA A 1 106 ? -19.250 13.046  9.010   1.00 0.00  ? 106  ALA A O      1  
ATOM   1633   C  CB     . ALA A 1 106 ? -21.488 14.558  10.616  1.00 0.00  ? 106  ALA A CB     1  
ATOM   1634   H  H      . ALA A 1 106 ? -18.496 14.501  10.872  1.00 0.00  ? 106  ALA A H      1  
ATOM   1635   H  HA     . ALA A 1 106 ? -20.786 12.949  11.860  1.00 0.00  ? 106  ALA A HA     1  
ATOM   1636   H  HB1    . ALA A 1 106 ? -21.452 14.691  9.545   1.00 0.00  ? 106  ALA A HB1    1  
ATOM   1637   H  HB2    . ALA A 1 106 ? -21.303 15.503  11.104  1.00 0.00  ? 106  ALA A HB2    1  
ATOM   1638   H  HB3    . ALA A 1 106 ? -22.464 14.192  10.900  1.00 0.00  ? 106  ALA A HB3    1  
ATOM   1639   N  N      . GLU A 1 107 ? -20.554 11.463  9.803   1.00 0.00  ? 107  GLU A N      1  
ATOM   1640   C  CA     . GLU A 1 107 ? -20.209 10.545  8.678   1.00 0.00  ? 107  GLU A CA     1  
ATOM   1641   C  C      . GLU A 1 107 ? -21.461 10.214  7.861   1.00 0.00  ? 107  GLU A C      1  
ATOM   1642   O  O      . GLU A 1 107 ? -22.502 9.899   8.404   1.00 0.00  ? 107  GLU A O      1  
ATOM   1643   C  CB     . GLU A 1 107 ? -19.659 9.285   9.349   1.00 0.00  ? 107  GLU A CB     1  
ATOM   1644   C  CG     . GLU A 1 107 ? -18.325 9.608   10.025  1.00 0.00  ? 107  GLU A CG     1  
ATOM   1645   C  CD     . GLU A 1 107 ? -17.177 9.301   9.062   1.00 0.00  ? 107  GLU A CD     1  
ATOM   1646   O  OE1    . GLU A 1 107 ? -16.807 8.143   8.963   1.00 0.00  ? 107  GLU A OE1    1  
ATOM   1647   O  OE2    . GLU A 1 107 ? -16.688 10.229  8.440   1.00 0.00  ? 107  GLU A OE2    1  
ATOM   1648   H  H      . GLU A 1 107 ? -21.177 11.170  10.500  1.00 0.00  ? 107  GLU A H      1  
ATOM   1649   H  HA     . GLU A 1 107 ? -19.453 10.987  8.049   1.00 0.00  ? 107  GLU A HA     1  
ATOM   1650   H  HB2    . GLU A 1 107 ? -20.364 8.936   10.090  1.00 0.00  ? 107  GLU A HB2    1  
ATOM   1651   H  HB3    . GLU A 1 107 ? -19.507 8.518   8.605   1.00 0.00  ? 107  GLU A HB3    1  
ATOM   1652   H  HG2    . GLU A 1 107 ? -18.302 10.654  10.294  1.00 0.00  ? 107  GLU A HG2    1  
ATOM   1653   H  HG3    . GLU A 1 107 ? -18.217 9.005   10.915  1.00 0.00  ? 107  GLU A HG3    1  
ATOM   1654   N  N      . LYS A 1 108 ? -21.367 10.283  6.560   1.00 0.00  ? 108  LYS A N      1  
ATOM   1655   C  CA     . LYS A 1 108 ? -22.550 9.972   5.706   1.00 0.00  ? 108  LYS A CA     1  
ATOM   1656   C  C      . LYS A 1 108 ? -22.099 9.302   4.405   1.00 0.00  ? 108  LYS A C      1  
ATOM   1657   O  O      . LYS A 1 108 ? -22.724 9.447   3.373   1.00 0.00  ? 108  LYS A O      1  
ATOM   1658   C  CB     . LYS A 1 108 ? -23.199 11.328  5.416   1.00 0.00  ? 108  LYS A CB     1  
ATOM   1659   C  CG     . LYS A 1 108 ? -24.538 11.424  6.152   1.00 0.00  ? 108  LYS A CG     1  
ATOM   1660   C  CD     . LYS A 1 108 ? -25.236 12.737  5.782   1.00 0.00  ? 108  LYS A CD     1  
ATOM   1661   C  CE     . LYS A 1 108 ? -26.602 12.437  5.158   1.00 0.00  ? 108  LYS A CE     1  
ATOM   1662   N  NZ     . LYS A 1 108 ? -26.756 13.442  4.070   1.00 0.00  ? 108  LYS A NZ     1  
ATOM   1663   H  H      . LYS A 1 108 ? -20.517 10.538  6.145   1.00 0.00  ? 108  LYS A H      1  
ATOM   1664   H  HA     . LYS A 1 108 ? -23.241 9.337   6.237   1.00 0.00  ? 108  LYS A HA     1  
ATOM   1665   H  HB2    . LYS A 1 108 ? -22.545 12.119  5.752   1.00 0.00  ? 108  LYS A HB2    1  
ATOM   1666   H  HB3    . LYS A 1 108 ? -23.368 11.427  4.354   1.00 0.00  ? 108  LYS A HB3    1  
ATOM   1667   H  HG2    . LYS A 1 108 ? -25.164 10.589  5.870   1.00 0.00  ? 108  LYS A HG2    1  
ATOM   1668   H  HG3    . LYS A 1 108 ? -24.365 11.399  7.217   1.00 0.00  ? 108  LYS A HG3    1  
ATOM   1669   H  HD2    . LYS A 1 108 ? -25.371 13.335  6.672   1.00 0.00  ? 108  LYS A HD2    1  
ATOM   1670   H  HD3    . LYS A 1 108 ? -24.631 13.281  5.072   1.00 0.00  ? 108  LYS A HD3    1  
ATOM   1671   H  HE2    . LYS A 1 108 ? -26.616 11.434  4.753   1.00 0.00  ? 108  LYS A HE2    1  
ATOM   1672   H  HE3    . LYS A 1 108 ? -27.385 12.560  5.890   1.00 0.00  ? 108  LYS A HE3    1  
ATOM   1673   H  HZ1    . LYS A 1 108 ? -25.917 13.422  3.457   1.00 0.00  ? 108  LYS A HZ1    1  
ATOM   1674   H  HZ2    . LYS A 1 108 ? -26.860 14.390  4.487   1.00 0.00  ? 108  LYS A HZ2    1  
ATOM   1675   H  HZ3    . LYS A 1 108 ? -27.600 13.216  3.506   1.00 0.00  ? 108  LYS A HZ3    1  
ATOM   1676   N  N      . THR A 1 109 ? -21.018 8.569   4.448   1.00 60.27 ? 109  THR A N      1  
ATOM   1677   C  CA     . THR A 1 109 ? -20.526 7.889   3.215   1.00 53.76 ? 109  THR A CA     1  
ATOM   1678   C  C      . THR A 1 109 ? -19.682 6.665   3.585   1.00 52.62 ? 109  THR A C      1  
ATOM   1679   O  O      . THR A 1 109 ? -18.738 6.757   4.346   1.00 50.52 ? 109  THR A O      1  
ATOM   1680   C  CB     . THR A 1 109 ? -19.668 8.935   2.502   1.00 50.95 ? 109  THR A CB     1  
ATOM   1681   O  OG1    . THR A 1 109 ? -20.376 10.166  2.445   1.00 55.74 ? 109  THR A OG1    1  
ATOM   1682   C  CG2    . THR A 1 109 ? -19.353 8.459   1.083   1.00 43.46 ? 109  THR A CG2    1  
ATOM   1683   H  H      . THR A 1 109 ? -20.530 8.466   5.292   1.00 0.00  ? 109  THR A H      1  
ATOM   1684   H  HA     . THR A 1 109 ? -21.354 7.601   2.587   1.00 0.00  ? 109  THR A HA     1  
ATOM   1685   H  HB     . THR A 1 109 ? -18.745 9.074   3.043   1.00 0.00  ? 109  THR A HB     1  
ATOM   1686   H  HG1    . THR A 1 109 ? -20.172 10.662  3.241   1.00 0.00  ? 109  THR A HG1    1  
ATOM   1687   H  HG21   . THR A 1 109 ? -18.407 7.938   1.080   1.00 0.00  ? 109  THR A HG21   1  
ATOM   1688   H  HG22   . THR A 1 109 ? -19.297 9.311   0.422   1.00 0.00  ? 109  THR A HG22   1  
ATOM   1689   H  HG23   . THR A 1 109 ? -20.132 7.792   0.746   1.00 0.00  ? 109  THR A HG23   1  
ATOM   1690   N  N      . LEU A 1 110 ? -20.015 5.521   3.050   1.00 44.37 ? 110  LEU A N      1  
ATOM   1691   C  CA     . LEU A 1 110 ? -19.232 4.289   3.367   1.00 44.68 ? 110  LEU A CA     1  
ATOM   1692   C  C      . LEU A 1 110 ? -17.814 4.411   2.806   1.00 52.00 ? 110  LEU A C      1  
ATOM   1693   O  O      . LEU A 1 110 ? -17.595 5.018   1.775   1.00 52.30 ? 110  LEU A O      1  
ATOM   1694   C  CB     . LEU A 1 110 ? -19.985 3.149   2.679   1.00 46.27 ? 110  LEU A CB     1  
ATOM   1695   C  CG     . LEU A 1 110 ? -20.867 2.428   3.701   1.00 45.42 ? 110  LEU A CG     1  
ATOM   1696   C  CD1    . LEU A 1 110 ? -21.857 1.520   2.970   1.00 43.31 ? 110  LEU A CD1    1  
ATOM   1697   C  CD2    . LEU A 1 110 ? -19.987 1.583   4.625   1.00 46.72 ? 110  LEU A CD2    1  
ATOM   1698   H  H      . LEU A 1 110 ? -20.779 5.471   2.437   1.00 0.00  ? 110  LEU A H      1  
ATOM   1699   H  HA     . LEU A 1 110 ? -19.204 4.124   4.433   1.00 0.00  ? 110  LEU A HA     1  
ATOM   1700   H  HB2    . LEU A 1 110 ? -20.603 3.551   1.889   1.00 0.00  ? 110  LEU A HB2    1  
ATOM   1701   H  HB3    . LEU A 1 110 ? -19.276 2.450   2.262   1.00 0.00  ? 110  LEU A HB3    1  
ATOM   1702   H  HG     . LEU A 1 110 ? -21.410 3.157   4.284   1.00 0.00  ? 110  LEU A HG     1  
ATOM   1703   H  HD11   . LEU A 1 110 ? -22.144 0.705   3.618   1.00 0.00  ? 110  LEU A HD11   1  
ATOM   1704   H  HD12   . LEU A 1 110 ? -21.393 1.125   2.078   1.00 0.00  ? 110  LEU A HD12   1  
ATOM   1705   H  HD13   . LEU A 1 110 ? -22.734 2.089   2.698   1.00 0.00  ? 110  LEU A HD13   1  
ATOM   1706   H  HD21   . LEU A 1 110 ? -19.876 0.593   4.209   1.00 0.00  ? 110  LEU A HD21   1  
ATOM   1707   H  HD22   . LEU A 1 110 ? -20.450 1.515   5.599   1.00 0.00  ? 110  LEU A HD22   1  
ATOM   1708   H  HD23   . LEU A 1 110 ? -19.016 2.045   4.719   1.00 0.00  ? 110  LEU A HD23   1  
ATOM   1709   N  N      . GLY A 1 111 ? -16.848 3.844   3.477   1.00 43.43 ? 111  GLY A N      1  
ATOM   1710   C  CA     . GLY A 1 111 ? -15.443 3.934   2.984   1.00 38.75 ? 111  GLY A CA     1  
ATOM   1711   C  C      . GLY A 1 111 ? -15.049 2.637   2.265   1.00 40.16 ? 111  GLY A C      1  
ATOM   1712   O  O      . GLY A 1 111 ? -13.994 2.552   1.668   1.00 43.00 ? 111  GLY A O      1  
ATOM   1713   H  H      . GLY A 1 111 ? -17.045 3.363   4.308   1.00 0.00  ? 111  GLY A H      1  
ATOM   1714   H  HA2    . GLY A 1 111 ? -15.359 4.764   2.298   1.00 0.00  ? 111  GLY A HA2    1  
ATOM   1715   H  HA3    . GLY A 1 111 ? -14.779 4.091   3.820   1.00 0.00  ? 111  GLY A HA3    1  
ATOM   1716   N  N      . ASP A 1 112 ? -15.878 1.624   2.318   1.00 39.52 ? 112  ASP A N      1  
ATOM   1717   C  CA     . ASP A 1 112 ? -15.528 0.340   1.638   1.00 33.80 ? 112  ASP A CA     1  
ATOM   1718   C  C      . ASP A 1 112 ? -16.517 0.024   0.504   1.00 35.98 ? 112  ASP A C      1  
ATOM   1719   O  O      . ASP A 1 112 ? -16.513 -1.061  -0.043  1.00 38.37 ? 112  ASP A O      1  
ATOM   1720   C  CB     . ASP A 1 112 ? -15.619 -0.722  2.735   1.00 41.74 ? 112  ASP A CB     1  
ATOM   1721   C  CG     . ASP A 1 112 ? -14.323 -0.727  3.548   1.00 43.78 ? 112  ASP A CG     1  
ATOM   1722   O  OD1    . ASP A 1 112 ? -13.911 0.338   3.976   1.00 36.84 ? 112  ASP A OD1    1  
ATOM   1723   O  OD2    . ASP A 1 112 ? -13.765 -1.797  3.729   1.00 46.62 ? 112  ASP A OD2    1  
ATOM   1724   H  H      . ASP A 1 112 ? -16.723 1.705   2.807   1.00 0.00  ? 112  ASP A H      1  
ATOM   1725   H  HA     . ASP A 1 112 ? -14.522 0.384   1.256   1.00 0.00  ? 112  ASP A HA     1  
ATOM   1726   H  HB2    . ASP A 1 112 ? -16.452 -0.497  3.385   1.00 0.00  ? 112  ASP A HB2    1  
ATOM   1727   H  HB3    . ASP A 1 112 ? -15.764 -1.692  2.285   1.00 0.00  ? 112  ASP A HB3    1  
ATOM   1728   N  N      . PHE A 1 113 ? -17.355 0.960   0.140   1.00 38.62 ? 113  PHE A N      1  
ATOM   1729   C  CA     . PHE A 1 113 ? -18.333 0.709   -0.966  1.00 39.56 ? 113  PHE A CA     1  
ATOM   1730   C  C      . PHE A 1 113 ? -18.319 1.890   -1.946  1.00 39.08 ? 113  PHE A C      1  
ATOM   1731   O  O      . PHE A 1 113 ? -18.352 3.036   -1.540  1.00 41.89 ? 113  PHE A O      1  
ATOM   1732   C  CB     . PHE A 1 113 ? -19.694 0.598   -0.277  1.00 37.99 ? 113  PHE A CB     1  
ATOM   1733   C  CG     . PHE A 1 113 ? -19.708 -0.619  0.617   1.00 33.82 ? 113  PHE A CG     1  
ATOM   1734   C  CD1    . PHE A 1 113 ? -20.090 -1.868  0.097   1.00 30.84 ? 113  PHE A CD1    1  
ATOM   1735   C  CD2    . PHE A 1 113 ? -19.338 -0.503  1.969   1.00 34.82 ? 113  PHE A CD2    1  
ATOM   1736   C  CE1    . PHE A 1 113 ? -20.103 -3.002  0.929   1.00 31.72 ? 113  PHE A CE1    1  
ATOM   1737   C  CE2    . PHE A 1 113 ? -19.351 -1.636  2.801   1.00 31.20 ? 113  PHE A CE2    1  
ATOM   1738   C  CZ     . PHE A 1 113 ? -19.734 -2.886  2.281   1.00 34.31 ? 113  PHE A CZ     1  
ATOM   1739   H  H      . PHE A 1 113 ? -17.340 1.832   0.588   1.00 0.00  ? 113  PHE A H      1  
ATOM   1740   H  HA     . PHE A 1 113 ? -18.099 -0.211  -1.477  1.00 0.00  ? 113  PHE A HA     1  
ATOM   1741   H  HB2    . PHE A 1 113 ? -19.870 1.483   0.317   1.00 0.00  ? 113  PHE A HB2    1  
ATOM   1742   H  HB3    . PHE A 1 113 ? -20.469 0.505   -1.022  1.00 0.00  ? 113  PHE A HB3    1  
ATOM   1743   H  HD1    . PHE A 1 113 ? -20.374 -1.957  -0.941  1.00 0.00  ? 113  PHE A HD1    1  
ATOM   1744   H  HD2    . PHE A 1 113 ? -19.045 0.457   2.368   1.00 0.00  ? 113  PHE A HD2    1  
ATOM   1745   H  HE1    . PHE A 1 113 ? -20.396 -3.961  0.530   1.00 0.00  ? 113  PHE A HE1    1  
ATOM   1746   H  HE2    . PHE A 1 113 ? -19.068 -1.547  3.839   1.00 0.00  ? 113  PHE A HE2    1  
ATOM   1747   H  HZ     . PHE A 1 113 ? -19.743 -3.756  2.920   1.00 0.00  ? 113  PHE A HZ     1  
ATOM   1748   N  N      . ALA A 1 114 ? -18.245 1.630   -3.231  1.00 37.45 ? 114  ALA A N      1  
ATOM   1749   C  CA     . ALA A 1 114 ? -18.200 2.761   -4.206  1.00 35.35 ? 114  ALA A CA     1  
ATOM   1750   C  C      . ALA A 1 114 ? -19.031 2.496   -5.462  1.00 38.09 ? 114  ALA A C      1  
ATOM   1751   O  O      . ALA A 1 114 ? -19.318 1.370   -5.828  1.00 37.61 ? 114  ALA A O      1  
ATOM   1752   C  CB     . ALA A 1 114 ? -16.723 2.886   -4.579  1.00 36.74 ? 114  ALA A CB     1  
ATOM   1753   H  H      . ALA A 1 114 ? -18.195 0.699   -3.540  1.00 0.00  ? 114  ALA A H      1  
ATOM   1754   H  HA     . ALA A 1 114 ? -18.526 3.673   -3.732  1.00 0.00  ? 114  ALA A HA     1  
ATOM   1755   H  HB1    . ALA A 1 114 ? -16.519 2.277   -5.448  1.00 0.00  ? 114  ALA A HB1    1  
ATOM   1756   H  HB2    . ALA A 1 114 ? -16.115 2.550   -3.753  1.00 0.00  ? 114  ALA A HB2    1  
ATOM   1757   H  HB3    . ALA A 1 114 ? -16.494 3.918   -4.800  1.00 0.00  ? 114  ALA A HB3    1  
ATOM   1758   N  N      . ALA A 1 115 ? -19.390 3.555   -6.127  1.00 37.57 ? 115  ALA A N      1  
ATOM   1759   C  CA     . ALA A 1 115 ? -20.187 3.452   -7.384  1.00 34.00 ? 115  ALA A CA     1  
ATOM   1760   C  C      . ALA A 1 115 ? -19.612 4.441   -8.403  1.00 37.69 ? 115  ALA A C      1  
ATOM   1761   O  O      . ALA A 1 115 ? -19.380 5.595   -8.090  1.00 42.69 ? 115  ALA A O      1  
ATOM   1762   C  CB     . ALA A 1 115 ? -21.613 3.845   -6.995  1.00 32.44 ? 115  ALA A CB     1  
ATOM   1763   H  H      . ALA A 1 115 ? -19.138 4.448   -5.810  1.00 0.00  ? 115  ALA A H      1  
ATOM   1764   H  HA     . ALA A 1 115 ? -20.164 2.445   -7.769  1.00 0.00  ? 115  ALA A HA     1  
ATOM   1765   H  HB1    . ALA A 1 115 ? -21.666 4.914   -6.859  1.00 0.00  ? 115  ALA A HB1    1  
ATOM   1766   H  HB2    . ALA A 1 115 ? -21.883 3.351   -6.073  1.00 0.00  ? 115  ALA A HB2    1  
ATOM   1767   H  HB3    . ALA A 1 115 ? -22.296 3.546   -7.777  1.00 0.00  ? 115  ALA A HB3    1  
ATOM   1768   N  N      . GLU A 1 116 ? -19.369 4.005   -9.609  1.00 33.15 ? 116  GLU A N      1  
ATOM   1769   C  CA     . GLU A 1 116 ? -18.805 4.931   -10.632 1.00 36.74 ? 116  GLU A CA     1  
ATOM   1770   C  C      . GLU A 1 116 ? -19.004 4.353   -12.029 1.00 39.74 ? 116  GLU A C      1  
ATOM   1771   O  O      . GLU A 1 116 ? -19.275 3.177   -12.186 1.00 37.52 ? 116  GLU A O      1  
ATOM   1772   C  CB     . GLU A 1 116 ? -17.314 5.008   -10.297 1.00 36.59 ? 116  GLU A CB     1  
ATOM   1773   C  CG     . GLU A 1 116 ? -16.700 3.602   -10.358 1.00 37.24 ? 116  GLU A CG     1  
ATOM   1774   C  CD     . GLU A 1 116 ? -15.177 3.708   -10.427 1.00 40.69 ? 116  GLU A CD     1  
ATOM   1775   O  OE1    . GLU A 1 116 ? -14.591 4.172   -9.463  1.00 44.48 ? 116  GLU A OE1    1  
ATOM   1776   O  OE2    . GLU A 1 116 ? -14.622 3.320   -11.442 1.00 38.07 ? 116  GLU A OE2    1  
ATOM   1777   H  H      . GLU A 1 116 ? -19.569 3.074   -9.845  1.00 0.00  ? 116  GLU A H      1  
ATOM   1778   H  HA     . GLU A 1 116 ? -19.254 5.909   -10.557 1.00 0.00  ? 116  GLU A HA     1  
ATOM   1779   H  HB2    . GLU A 1 116 ? -16.817 5.649   -11.010 1.00 0.00  ? 116  GLU A HB2    1  
ATOM   1780   H  HB3    . GLU A 1 116 ? -17.189 5.408   -9.303  1.00 0.00  ? 116  GLU A HB3    1  
ATOM   1781   H  HG2    . GLU A 1 116 ? -16.983 3.047   -9.476  1.00 0.00  ? 116  GLU A HG2    1  
ATOM   1782   H  HG3    . GLU A 1 116 ? -17.062 3.089   -11.237 1.00 0.00  ? 116  GLU A HG3    1  
ATOM   1783   N  N      . TYR A 1 117 ? -18.834 5.155   -13.043 1.00 36.42 ? 117  TYR A N      1  
ATOM   1784   C  CA     . TYR A 1 117 ? -18.966 4.625   -14.419 1.00 35.12 ? 117  TYR A CA     1  
ATOM   1785   C  C      . TYR A 1 117 ? -17.652 3.921   -14.766 1.00 32.35 ? 117  TYR A C      1  
ATOM   1786   O  O      . TYR A 1 117 ? -16.584 4.414   -14.453 1.00 38.47 ? 117  TYR A O      1  
ATOM   1787   C  CB     . TYR A 1 117 ? -19.203 5.850   -15.310 1.00 36.64 ? 117  TYR A CB     1  
ATOM   1788   C  CG     . TYR A 1 117 ? -20.554 6.447   -15.003 1.00 35.51 ? 117  TYR A CG     1  
ATOM   1789   C  CD1    . TYR A 1 117 ? -21.725 5.740   -15.322 1.00 39.08 ? 117  TYR A CD1    1  
ATOM   1790   C  CD2    . TYR A 1 117 ? -20.640 7.716   -14.408 1.00 37.06 ? 117  TYR A CD2    1  
ATOM   1791   C  CE1    . TYR A 1 117 ? -22.980 6.302   -15.043 1.00 38.20 ? 117  TYR A CE1    1  
ATOM   1792   C  CE2    . TYR A 1 117 ? -21.895 8.277   -14.131 1.00 37.73 ? 117  TYR A CE2    1  
ATOM   1793   C  CZ     . TYR A 1 117 ? -23.063 7.570   -14.449 1.00 41.02 ? 117  TYR A CZ     1  
ATOM   1794   O  OH     . TYR A 1 117 ? -24.295 8.119   -14.172 1.00 45.70 ? 117  TYR A OH     1  
ATOM   1795   H  H      . TYR A 1 117 ? -18.561 6.086   -12.893 1.00 0.00  ? 117  TYR A H      1  
ATOM   1796   H  HA     . TYR A 1 117 ? -19.796 3.939   -14.484 1.00 0.00  ? 117  TYR A HA     1  
ATOM   1797   H  HB2    . TYR A 1 117 ? -18.437 6.587   -15.124 1.00 0.00  ? 117  TYR A HB2    1  
ATOM   1798   H  HB3    . TYR A 1 117 ? -19.172 5.553   -16.348 1.00 0.00  ? 117  TYR A HB3    1  
ATOM   1799   H  HD1    . TYR A 1 117 ? -21.662 4.763   -15.779 1.00 0.00  ? 117  TYR A HD1    1  
ATOM   1800   H  HD2    . TYR A 1 117 ? -19.740 8.261   -14.163 1.00 0.00  ? 117  TYR A HD2    1  
ATOM   1801   H  HE1    . TYR A 1 117 ? -23.883 5.760   -15.290 1.00 0.00  ? 117  TYR A HE1    1  
ATOM   1802   H  HE2    . TYR A 1 117 ? -21.962 9.255   -13.674 1.00 0.00  ? 117  TYR A HE2    1  
ATOM   1803   H  HH     . TYR A 1 117 ? -24.473 7.986   -13.239 1.00 0.00  ? 117  TYR A HH     1  
ATOM   1804   N  N      . ALA A 1 118 ? -17.716 2.760   -15.372 1.00 31.35 ? 118  ALA A N      1  
ATOM   1805   C  CA     . ALA A 1 118 ? -16.462 2.007   -15.701 1.00 35.96 ? 118  ALA A CA     1  
ATOM   1806   C  C      . ALA A 1 118 ? -15.443 2.896   -16.432 1.00 43.19 ? 118  ALA A C      1  
ATOM   1807   O  O      . ALA A 1 118 ? -15.656 3.311   -17.554 1.00 48.02 ? 118  ALA A O      1  
ATOM   1808   C  CB     . ALA A 1 118 ? -16.915 0.857   -16.597 1.00 35.11 ? 118  ALA A CB     1  
ATOM   1809   H  H      . ALA A 1 118 ? -18.591 2.371   -15.585 1.00 0.00  ? 118  ALA A H      1  
ATOM   1810   H  HA     . ALA A 1 118 ? -16.023 1.612   -14.801 1.00 0.00  ? 118  ALA A HA     1  
ATOM   1811   H  HB1    . ALA A 1 118 ? -17.585 1.233   -17.355 1.00 0.00  ? 118  ALA A HB1    1  
ATOM   1812   H  HB2    . ALA A 1 118 ? -17.426 0.117   -15.999 1.00 0.00  ? 118  ALA A HB2    1  
ATOM   1813   H  HB3    . ALA A 1 118 ? -16.053 0.408   -17.067 1.00 0.00  ? 118  ALA A HB3    1  
ATOM   1814   N  N      . LYS A 1 119 ? -14.318 3.172   -15.788 1.00 44.04 ? 119  LYS A N      1  
ATOM   1815   C  CA     . LYS A 1 119 ? -13.272 3.998   -16.431 1.00 44.06 ? 119  LYS A CA     1  
ATOM   1816   C  C      . LYS A 1 119 ? -12.704 3.283   -17.665 1.00 45.49 ? 119  LYS A C      1  
ATOM   1817   O  O      . LYS A 1 119 ? -12.096 3.897   -18.522 1.00 46.54 ? 119  LYS A O      1  
ATOM   1818   C  CB     . LYS A 1 119 ? -12.197 4.163   -15.360 1.00 40.16 ? 119  LYS A CB     1  
ATOM   1819   C  CG     . LYS A 1 119 ? -12.589 5.303   -14.418 1.00 35.98 ? 119  LYS A CG     1  
ATOM   1820   C  CD     . LYS A 1 119 ? -11.674 5.293   -13.190 1.00 39.76 ? 119  LYS A CD     1  
ATOM   1821   C  CE     . LYS A 1 119 ? -12.141 6.362   -12.196 1.00 47.92 ? 119  LYS A CE     1  
ATOM   1822   N  NZ     . LYS A 1 119 ? -11.523 5.981   -10.895 1.00 55.65 ? 119  LYS A NZ     1  
ATOM   1823   H  H      . LYS A 1 119 ? -14.208 2.765   -14.904 1.00 0.00  ? 119  LYS A H      1  
ATOM   1824   H  HA     . LYS A 1 119 ? -13.674 4.960   -16.706 1.00 0.00  ? 119  LYS A HA     1  
ATOM   1825   H  HB2    . LYS A 1 119 ? -12.105 3.244   -14.798 1.00 0.00  ? 119  LYS A HB2    1  
ATOM   1826   H  HB3    . LYS A 1 119 ? -11.253 4.394   -15.830 1.00 0.00  ? 119  LYS A HB3    1  
ATOM   1827   H  HG2    . LYS A 1 119 ? -12.489 6.247   -14.935 1.00 0.00  ? 119  LYS A HG2    1  
ATOM   1828   H  HG3    . LYS A 1 119 ? -13.613 5.173   -14.102 1.00 0.00  ? 119  LYS A HG3    1  
ATOM   1829   H  HD2    . LYS A 1 119 ? -11.712 4.321   -12.720 1.00 0.00  ? 119  LYS A HD2    1  
ATOM   1830   H  HD3    . LYS A 1 119 ? -10.660 5.507   -13.494 1.00 0.00  ? 119  LYS A HD3    1  
ATOM   1831   H  HE2    . LYS A 1 119 ? -11.796 7.338   -12.507 1.00 0.00  ? 119  LYS A HE2    1  
ATOM   1832   H  HE3    . LYS A 1 119 ? -13.217 6.352   -12.111 1.00 0.00  ? 119  LYS A HE3    1  
ATOM   1833   H  HZ1    . LYS A 1 119 ? -11.774 4.998   -10.665 1.00 0.00  ? 119  LYS A HZ1    1  
ATOM   1834   H  HZ2    . LYS A 1 119 ? -11.874 6.613   -10.147 1.00 0.00  ? 119  LYS A HZ2    1  
ATOM   1835   H  HZ3    . LYS A 1 119 ? -10.489 6.065   -10.963 1.00 0.00  ? 119  LYS A HZ3    1  
ATOM   1836   N  N      . SER A 1 120 ? -12.904 1.990   -17.762 1.00 40.36 ? 120  SER A N      1  
ATOM   1837   C  CA     . SER A 1 120 ? -12.390 1.230   -18.938 1.00 39.99 ? 120  SER A CA     1  
ATOM   1838   C  C      . SER A 1 120 ? -13.261 -0.010  -19.172 1.00 46.50 ? 120  SER A C      1  
ATOM   1839   O  O      . SER A 1 120 ? -14.325 -0.142  -18.594 1.00 49.28 ? 120  SER A O      1  
ATOM   1840   C  CB     . SER A 1 120 ? -10.962 0.836   -18.566 1.00 45.15 ? 120  SER A CB     1  
ATOM   1841   O  OG     . SER A 1 120 ? -10.992 -0.295  -17.704 1.00 47.94 ? 120  SER A OG     1  
ATOM   1842   H  H      . SER A 1 120 ? -13.398 1.518   -17.060 1.00 0.00  ? 120  SER A H      1  
ATOM   1843   H  HA     . SER A 1 120 ? -12.384 1.857   -19.816 1.00 0.00  ? 120  SER A HA     1  
ATOM   1844   H  HB2    . SER A 1 120 ? -10.413 0.587   -19.459 1.00 0.00  ? 120  SER A HB2    1  
ATOM   1845   H  HB3    . SER A 1 120 ? -10.478 1.667   -18.070 1.00 0.00  ? 120  SER A HB3    1  
ATOM   1846   H  HG     . SER A 1 120 ? -10.258 -0.218  -17.090 1.00 0.00  ? 120  SER A HG     1  
ATOM   1847   N  N      . ASN A 1 121 ? -12.825 -0.912  -20.020 1.00 47.10 ? 121  ASN A N      1  
ATOM   1848   C  CA     . ASN A 1 121 ? -13.642 -2.134  -20.292 1.00 48.56 ? 121  ASN A CA     1  
ATOM   1849   C  C      . ASN A 1 121 ? -12.870 -3.415  -19.942 1.00 55.46 ? 121  ASN A C      1  
ATOM   1850   O  O      . ASN A 1 121 ? -13.263 -4.502  -20.330 1.00 55.35 ? 121  ASN A O      1  
ATOM   1851   C  CB     . ASN A 1 121 ? -13.941 -2.084  -21.793 1.00 52.31 ? 121  ASN A CB     1  
ATOM   1852   C  CG     . ASN A 1 121 ? -12.630 -2.095  -22.584 1.00 57.84 ? 121  ASN A CG     1  
ATOM   1853   O  OD1    . ASN A 1 121 ? -11.865 -1.152  -22.529 1.00 54.16 ? 121  ASN A OD1    1  
ATOM   1854   N  ND2    . ASN A 1 121 ? -12.337 -3.130  -23.322 1.00 58.78 ? 121  ASN A ND2    1  
ATOM   1855   H  H      . ASN A 1 121 ? -11.968 -0.780  -20.479 1.00 0.00  ? 121  ASN A H      1  
ATOM   1856   H  HA     . ASN A 1 121 ? -14.565 -2.095  -19.738 1.00 0.00  ? 121  ASN A HA     1  
ATOM   1857   H  HB2    . ASN A 1 121 ? -14.536 -2.943  -22.068 1.00 0.00  ? 121  ASN A HB2    1  
ATOM   1858   H  HB3    . ASN A 1 121 ? -14.488 -1.180  -22.019 1.00 0.00  ? 121  ASN A HB3    1  
ATOM   1859   H  HD21   . ASN A 1 121 ? -12.954 -3.891  -23.366 1.00 0.00  ? 121  ASN A HD21   1  
ATOM   1860   H  HD22   . ASN A 1 121 ? -11.502 -3.147  -23.835 1.00 0.00  ? 121  ASN A HD22   1  
ATOM   1861   N  N      . ARG A 1 122 ? -11.786 -3.306  -19.207 1.00 55.33 ? 122  ARG A N      1  
ATOM   1862   C  CA     . ARG A 1 122 ? -11.015 -4.532  -18.839 1.00 54.48 ? 122  ARG A CA     1  
ATOM   1863   C  C      . ARG A 1 122 ? -11.351 -4.986  -17.408 1.00 50.96 ? 122  ARG A C      1  
ATOM   1864   O  O      . ARG A 1 122 ? -10.810 -5.965  -16.927 1.00 54.74 ? 122  ARG A O      1  
ATOM   1865   C  CB     . ARG A 1 122 ? -9.530  -4.158  -18.974 1.00 55.11 ? 122  ARG A CB     1  
ATOM   1866   C  CG     . ARG A 1 122 ? -9.201  -2.934  -18.115 1.00 60.75 ? 122  ARG A CG     1  
ATOM   1867   C  CD     . ARG A 1 122 ? -8.682  -1.804  -19.007 1.00 65.04 ? 122  ARG A CD     1  
ATOM   1868   N  NE     . ARG A 1 122 ? -7.540  -1.210  -18.253 1.00 71.01 ? 122  ARG A NE     1  
ATOM   1869   C  CZ     . ARG A 1 122 ? -6.795  -0.283  -18.801 1.00 65.69 ? 122  ARG A CZ     1  
ATOM   1870   N  NH1    . ARG A 1 122 ? -7.040  0.132   -20.018 1.00 56.82 ? 122  ARG A NH1    1  
ATOM   1871   N  NH2    . ARG A 1 122 ? -5.801  0.232   -18.129 1.00 58.41 ? 122  ARG A NH2    1  
ATOM   1872   H  H      . ARG A 1 122 ? -11.489 -2.425  -18.899 1.00 0.00  ? 122  ARG A H      1  
ATOM   1873   H  HA     . ARG A 1 122 ? -11.246 -5.326  -19.533 1.00 0.00  ? 122  ARG A HA     1  
ATOM   1874   H  HB2    . ARG A 1 122 ? -8.923  -4.991  -18.652 1.00 0.00  ? 122  ARG A HB2    1  
ATOM   1875   H  HB3    . ARG A 1 122 ? -9.311  -3.938  -20.009 1.00 0.00  ? 122  ARG A HB3    1  
ATOM   1876   H  HG2    . ARG A 1 122 ? -10.087 -2.605  -17.595 1.00 0.00  ? 122  ARG A HG2    1  
ATOM   1877   H  HG3    . ARG A 1 122 ? -8.439  -3.197  -17.397 1.00 0.00  ? 122  ARG A HG3    1  
ATOM   1878   H  HD2    . ARG A 1 122 ? -8.345  -2.199  -19.956 1.00 0.00  ? 122  ARG A HD2    1  
ATOM   1879   H  HD3    . ARG A 1 122 ? -9.449  -1.063  -19.159 1.00 0.00  ? 122  ARG A HD3    1  
ATOM   1880   H  HE     . ARG A 1 122 ? -7.345  -1.514  -17.341 1.00 0.00  ? 122  ARG A HE     1  
ATOM   1881   H  HH11   . ARG A 1 122 ? -7.800  -0.257  -20.538 1.00 0.00  ? 122  ARG A HH11   1  
ATOM   1882   H  HH12   . ARG A 1 122 ? -6.465  0.840   -20.428 1.00 0.00  ? 122  ARG A HH12   1  
ATOM   1883   H  HH21   . ARG A 1 122 ? -5.610  -0.082  -17.198 1.00 0.00  ? 122  ARG A HH21   1  
ATOM   1884   H  HH22   . ARG A 1 122 ? -5.229  0.939   -18.545 1.00 0.00  ? 122  ARG A HH22   1  
ATOM   1885   N  N      . SER A 1 123 ? -12.259 -4.311  -16.733 1.00 47.25 ? 123  SER A N      1  
ATOM   1886   C  CA     . SER A 1 123 ? -12.635 -4.752  -15.359 1.00 47.80 ? 123  SER A CA     1  
ATOM   1887   C  C      . SER A 1 123 ? -13.571 -5.952  -15.488 1.00 43.86 ? 123  SER A C      1  
ATOM   1888   O  O      . SER A 1 123 ? -13.990 -6.287  -16.582 1.00 47.35 ? 123  SER A O      1  
ATOM   1889   C  CB     . SER A 1 123 ? -13.363 -3.563  -14.734 1.00 44.04 ? 123  SER A CB     1  
ATOM   1890   O  OG     . SER A 1 123 ? -14.518 -3.262  -15.505 1.00 47.12 ? 123  SER A OG     1  
ATOM   1891   H  H      . SER A 1 123 ? -12.707 -3.539  -17.138 1.00 0.00  ? 123  SER A H      1  
ATOM   1892   H  HA     . SER A 1 123 ? -11.758 -5.005  -14.783 1.00 0.00  ? 123  SER A HA     1  
ATOM   1893   H  HB2    . SER A 1 123 ? -13.661 -3.809  -13.728 1.00 0.00  ? 123  SER A HB2    1  
ATOM   1894   H  HB3    . SER A 1 123 ? -12.699 -2.709  -14.711 1.00 0.00  ? 123  SER A HB3    1  
ATOM   1895   H  HG     . SER A 1 123 ? -15.204 -2.960  -14.904 1.00 0.00  ? 123  SER A HG     1  
ATOM   1896   N  N      . THR A 1 124 ? -13.896 -6.612  -14.411 1.00 44.35 ? 124  THR A N      1  
ATOM   1897   C  CA     . THR A 1 124 ? -14.788 -7.803  -14.526 1.00 42.43 ? 124  THR A CA     1  
ATOM   1898   C  C      . THR A 1 124 ? -15.700 -7.916  -13.305 1.00 46.41 ? 124  THR A C      1  
ATOM   1899   O  O      . THR A 1 124 ? -15.247 -7.898  -12.176 1.00 45.95 ? 124  THR A O      1  
ATOM   1900   C  CB     . THR A 1 124 ? -13.844 -9.005  -14.603 1.00 45.58 ? 124  THR A CB     1  
ATOM   1901   O  OG1    . THR A 1 124 ? -12.807 -8.737  -15.537 1.00 56.73 ? 124  THR A OG1    1  
ATOM   1902   C  CG2    . THR A 1 124 ? -14.629 -10.241 -15.047 1.00 47.70 ? 124  THR A CG2    1  
ATOM   1903   H  H      . THR A 1 124 ? -13.534 -6.357  -13.535 1.00 0.00  ? 124  THR A H      1  
ATOM   1904   H  HA     . THR A 1 124 ? -15.376 -7.744  -15.428 1.00 0.00  ? 124  THR A HA     1  
ATOM   1905   H  HB     . THR A 1 124 ? -13.415 -9.189  -13.630 1.00 0.00  ? 124  THR A HB     1  
ATOM   1906   H  HG1    . THR A 1 124 ? -13.212 -8.437  -16.354 1.00 0.00  ? 124  THR A HG1    1  
ATOM   1907   H  HG21   . THR A 1 124 ? -15.239 -9.992  -15.903 1.00 0.00  ? 124  THR A HG21   1  
ATOM   1908   H  HG22   . THR A 1 124 ? -15.262 -10.574 -14.238 1.00 0.00  ? 124  THR A HG22   1  
ATOM   1909   H  HG23   . THR A 1 124 ? -13.940 -11.029 -15.313 1.00 0.00  ? 124  THR A HG23   1  
ATOM   1910   N  N      . CYS A 1 125 ? -16.988 -8.071  -13.532 1.00 44.31 ? 125  CYS A N      1  
ATOM   1911   C  CA     . CYS A 1 125 ? -17.915 -8.243  -12.395 1.00 42.17 ? 125  CYS A CA     1  
ATOM   1912   C  C      . CYS A 1 125 ? -17.544 -9.525  -11.636 1.00 43.68 ? 125  CYS A C      1  
ATOM   1913   O  O      . CYS A 1 125 ? -17.517 -10.603 -12.199 1.00 47.65 ? 125  CYS A O      1  
ATOM   1914   C  CB     . CYS A 1 125 ? -19.285 -8.359  -13.042 1.00 42.46 ? 125  CYS A CB     1  
ATOM   1915   S  SG     . CYS A 1 125 ? -20.501 -8.916  -11.823 1.00 48.65 ? 125  CYS A SG     1  
ATOM   1916   H  H      . CYS A 1 125 ? -17.279 -8.146  -14.466 1.00 0.00  ? 125  CYS A H      1  
ATOM   1917   H  HA     . CYS A 1 125 ? -17.874 -7.386  -11.742 1.00 0.00  ? 125  CYS A HA     1  
ATOM   1918   H  HB2    . CYS A 1 125 ? -19.579 -7.394  -13.428 1.00 0.00  ? 125  CYS A HB2    1  
ATOM   1919   H  HB3    . CYS A 1 125 ? -19.237 -9.071  -13.853 1.00 0.00  ? 125  CYS A HB3    1  
ATOM   1920   N  N      . LYS A 1 126 ? -17.245 -9.407  -10.361 1.00 44.47 ? 126  LYS A N      1  
ATOM   1921   C  CA     . LYS A 1 126 ? -16.861 -10.610 -9.558  1.00 41.38 ? 126  LYS A CA     1  
ATOM   1922   C  C      . LYS A 1 126 ? -18.082 -11.435 -9.096  1.00 44.22 ? 126  LYS A C      1  
ATOM   1923   O  O      . LYS A 1 126 ? -17.991 -12.214 -8.168  1.00 49.96 ? 126  LYS A O      1  
ATOM   1924   C  CB     . LYS A 1 126 ? -16.102 -10.047 -8.362  1.00 37.65 ? 126  LYS A CB     1  
ATOM   1925   C  CG     . LYS A 1 126 ? -14.626 -9.879  -8.734  1.00 43.92 ? 126  LYS A CG     1  
ATOM   1926   C  CD     . LYS A 1 126 ? -13.994 -11.255 -8.961  1.00 47.90 ? 126  LYS A CD     1  
ATOM   1927   C  CE     . LYS A 1 126 ? -12.478 -11.164 -8.762  1.00 52.12 ? 126  LYS A CE     1  
ATOM   1928   N  NZ     . LYS A 1 126 ? -11.896 -12.057 -9.804  1.00 58.19 ? 126  LYS A NZ     1  
ATOM   1929   H  H      . LYS A 1 126 ? -17.291 -8.517  -9.950  1.00 0.00  ? 126  LYS A H      1  
ATOM   1930   H  HA     . LYS A 1 126 ? -16.202 -11.239 -10.137 1.00 0.00  ? 126  LYS A HA     1  
ATOM   1931   H  HB2    . LYS A 1 126 ? -16.519 -9.088  -8.091  1.00 0.00  ? 126  LYS A HB2    1  
ATOM   1932   H  HB3    . LYS A 1 126 ? -16.187 -10.727 -7.529  1.00 0.00  ? 126  LYS A HB3    1  
ATOM   1933   H  HG2    . LYS A 1 126 ? -14.549 -9.293  -9.639  1.00 0.00  ? 126  LYS A HG2    1  
ATOM   1934   H  HG3    . LYS A 1 126 ? -14.109 -9.375  -7.932  1.00 0.00  ? 126  LYS A HG3    1  
ATOM   1935   H  HD2    . LYS A 1 126 ? -14.409 -11.961 -8.256  1.00 0.00  ? 126  LYS A HD2    1  
ATOM   1936   H  HD3    . LYS A 1 126 ? -14.203 -11.587 -9.967  1.00 0.00  ? 126  LYS A HD3    1  
ATOM   1937   H  HE2    . LYS A 1 126 ? -12.141 -10.146 -8.904  1.00 0.00  ? 126  LYS A HE2    1  
ATOM   1938   H  HE3    . LYS A 1 126 ? -12.205 -11.518 -7.779  1.00 0.00  ? 126  LYS A HE3    1  
ATOM   1939   H  HZ1    . LYS A 1 126 ? -12.293 -11.812 -10.732 1.00 0.00  ? 126  LYS A HZ1    1  
ATOM   1940   H  HZ2    . LYS A 1 126 ? -12.123 -13.047 -9.578  1.00 0.00  ? 126  LYS A HZ2    1  
ATOM   1941   H  HZ3    . LYS A 1 126 ? -10.863 -11.935 -9.828  1.00 0.00  ? 126  LYS A HZ3    1  
ATOM   1942   N  N      . GLY A 1 127 ? -19.218 -11.277 -9.744  1.00 43.53 ? 127  GLY A N      1  
ATOM   1943   C  CA     . GLY A 1 127 ? -20.433 -12.034 -9.350  1.00 41.57 ? 127  GLY A CA     1  
ATOM   1944   C  C      . GLY A 1 127 ? -20.765 -12.995 -10.490 1.00 46.45 ? 127  GLY A C      1  
ATOM   1945   O  O      . GLY A 1 127 ? -21.058 -14.155 -10.274 1.00 46.31 ? 127  GLY A O      1  
ATOM   1946   H  H      . GLY A 1 127 ? -19.249 -10.613 -10.440 1.00 0.00  ? 127  GLY A H      1  
ATOM   1947   H  HA2    . GLY A 1 127 ? -20.239 -12.591 -8.442  1.00 0.00  ? 127  GLY A HA2    1  
ATOM   1948   H  HA3    . GLY A 1 127 ? -21.260 -11.358 -9.192  1.00 0.00  ? 127  GLY A HA3    1  
ATOM   1949   N  N      . CYS A 1 128 ? -20.684 -12.521 -11.711 1.00 48.54 ? 128  CYS A N      1  
ATOM   1950   C  CA     . CYS A 1 128 ? -20.952 -13.405 -12.885 1.00 46.61 ? 128  CYS A CA     1  
ATOM   1951   C  C      . CYS A 1 128 ? -19.673 -13.561 -13.751 1.00 51.31 ? 128  CYS A C      1  
ATOM   1952   O  O      . CYS A 1 128 ? -19.682 -14.223 -14.767 1.00 55.23 ? 128  CYS A O      1  
ATOM   1953   C  CB     . CYS A 1 128 ? -22.108 -12.743 -13.649 1.00 46.98 ? 128  CYS A CB     1  
ATOM   1954   S  SG     . CYS A 1 128 ? -21.589 -11.158 -14.358 1.00 48.35 ? 128  CYS A SG     1  
ATOM   1955   H  H      . CYS A 1 128 ? -20.421 -11.589 -11.854 1.00 0.00  ? 128  CYS A H      1  
ATOM   1956   H  HA     . CYS A 1 128 ? -21.264 -14.380 -12.538 1.00 0.00  ? 128  CYS A HA     1  
ATOM   1957   H  HB2    . CYS A 1 128 ? -22.430 -13.399 -14.443 1.00 0.00  ? 128  CYS A HB2    1  
ATOM   1958   H  HB3    . CYS A 1 128 ? -22.932 -12.577 -12.969 1.00 0.00  ? 128  CYS A HB3    1  
ATOM   1959   N  N      . MET A 1 129 ? -18.559 -12.955 -13.332 1.00 50.88 ? 129  MET A N      1  
ATOM   1960   C  CA     . MET A 1 129 ? -17.285 -13.047 -14.108 1.00 49.35 ? 129  MET A CA     1  
ATOM   1961   C  C      . MET A 1 129 ? -17.399 -12.498 -15.543 1.00 47.29 ? 129  MET A C      1  
ATOM   1962   O  O      . MET A 1 129 ? -16.508 -12.696 -16.351 1.00 47.32 ? 129  MET A O      1  
ATOM   1963   C  CB     . MET A 1 129 ? -16.941 -14.536 -14.131 1.00 48.23 ? 129  MET A CB     1  
ATOM   1964   C  CG     . MET A 1 129 ? -16.910 -15.076 -12.699 1.00 47.27 ? 129  MET A CG     1  
ATOM   1965   S  SD     . MET A 1 129 ? -15.511 -14.349 -11.806 1.00 67.85 ? 129  MET A SD     1  
ATOM   1966   C  CE     . MET A 1 129 ? -14.198 -15.322 -12.585 1.00 51.47 ? 129  MET A CE     1  
ATOM   1967   H  H      . MET A 1 129 ? -18.634 -12.383 -12.546 1.00 0.00  ? 129  MET A H      1  
ATOM   1968   H  HA     . MET A 1 129 ? -16.514 -12.512 -13.584 1.00 0.00  ? 129  MET A HA     1  
ATOM   1969   H  HB2    . MET A 1 129 ? -17.684 -15.071 -14.704 1.00 0.00  ? 129  MET A HB2    1  
ATOM   1970   H  HB3    . MET A 1 129 ? -15.972 -14.671 -14.585 1.00 0.00  ? 129  MET A HB3    1  
ATOM   1971   H  HG2    . MET A 1 129 ? -17.830 -14.815 -12.196 1.00 0.00  ? 129  MET A HG2    1  
ATOM   1972   H  HG3    . MET A 1 129 ? -16.805 -16.150 -12.721 1.00 0.00  ? 129  MET A HG3    1  
ATOM   1973   H  HE1    . MET A 1 129 ? -13.906 -14.852 -13.514 1.00 0.00  ? 129  MET A HE1    1  
ATOM   1974   H  HE2    . MET A 1 129 ? -14.555 -16.319 -12.786 1.00 0.00  ? 129  MET A HE2    1  
ATOM   1975   H  HE3    . MET A 1 129 ? -13.347 -15.374 -11.920 1.00 0.00  ? 129  MET A HE3    1  
ATOM   1976   N  N      . GLU A 1 130 ? -18.452 -11.788 -15.859 1.00 44.62 ? 130  GLU A N      1  
ATOM   1977   C  CA     . GLU A 1 130 ? -18.576 -11.208 -17.228 1.00 49.65 ? 130  GLU A CA     1  
ATOM   1978   C  C      . GLU A 1 130 ? -17.908 -9.833  -17.233 1.00 50.15 ? 130  GLU A C      1  
ATOM   1979   O  O      . GLU A 1 130 ? -17.931 -9.126  -16.241 1.00 50.94 ? 130  GLU A O      1  
ATOM   1980   C  CB     . GLU A 1 130 ? -20.079 -11.096 -17.489 1.00 48.89 ? 130  GLU A CB     1  
ATOM   1981   C  CG     . GLU A 1 130 ? -20.695 -12.498 -17.501 1.00 48.74 ? 130  GLU A CG     1  
ATOM   1982   C  CD     . GLU A 1 130 ? -22.120 -12.428 -18.052 1.00 53.37 ? 130  GLU A CD     1  
ATOM   1983   O  OE1    . GLU A 1 130 ? -22.325 -11.718 -19.022 1.00 48.29 ? 130  GLU A OE1    1  
ATOM   1984   O  OE2    . GLU A 1 130 ? -22.983 -13.089 -17.496 1.00 57.70 ? 130  GLU A OE2    1  
ATOM   1985   H  H      . GLU A 1 130 ? -19.143 -11.609 -15.194 1.00 0.00  ? 130  GLU A H      1  
ATOM   1986   H  HA     . GLU A 1 130 ? -18.116 -11.856 -17.958 1.00 0.00  ? 130  GLU A HA     1  
ATOM   1987   H  HB2    . GLU A 1 130 ? -20.536 -10.505 -16.710 1.00 0.00  ? 130  GLU A HB2    1  
ATOM   1988   H  HB3    . GLU A 1 130 ? -20.244 -10.624 -18.445 1.00 0.00  ? 130  GLU A HB3    1  
ATOM   1989   H  HG2    . GLU A 1 130 ? -20.098 -13.148 -18.126 1.00 0.00  ? 130  GLU A HG2    1  
ATOM   1990   H  HG3    . GLU A 1 130 ? -20.719 -12.890 -16.495 1.00 0.00  ? 130  GLU A HG3    1  
ATOM   1991   N  N      . LYS A 1 131 ? -17.281 -9.464  -18.319 1.00 54.84 ? 131  LYS A N      1  
ATOM   1992   C  CA     . LYS A 1 131 ? -16.573 -8.151  -18.361 1.00 51.76 ? 131  LYS A CA     1  
ATOM   1993   C  C      . LYS A 1 131 ? -17.555 -6.980  -18.276 1.00 51.84 ? 131  LYS A C      1  
ATOM   1994   O  O      . LYS A 1 131 ? -18.633 -7.016  -18.837 1.00 55.05 ? 131  LYS A O      1  
ATOM   1995   C  CB     . LYS A 1 131 ? -15.847 -8.137  -19.704 1.00 54.22 ? 131  LYS A CB     1  
ATOM   1996   C  CG     . LYS A 1 131 ? -14.428 -7.603  -19.507 1.00 60.53 ? 131  LYS A CG     1  
ATOM   1997   C  CD     . LYS A 1 131 ? -13.533 -8.723  -18.972 1.00 59.53 ? 131  LYS A CD     1  
ATOM   1998   C  CE     . LYS A 1 131 ? -12.151 -8.159  -18.638 1.00 65.23 ? 131  LYS A CE     1  
ATOM   1999   N  NZ     . LYS A 1 131 ? -11.418 -8.151  -19.934 1.00 68.69 ? 131  LYS A NZ     1  
ATOM   2000   H  H      . LYS A 1 131 ? -17.251 -10.066 -19.095 1.00 0.00  ? 131  LYS A H      1  
ATOM   2001   H  HA     . LYS A 1 131 ? -15.854 -8.091  -17.559 1.00 0.00  ? 131  LYS A HA     1  
ATOM   2002   H  HB2    . LYS A 1 131 ? -15.804 -9.142  -20.100 1.00 0.00  ? 131  LYS A HB2    1  
ATOM   2003   H  HB3    . LYS A 1 131 ? -16.378 -7.499  -20.394 1.00 0.00  ? 131  LYS A HB3    1  
ATOM   2004   H  HG2    . LYS A 1 131 ? -14.043 -7.252  -20.453 1.00 0.00  ? 131  LYS A HG2    1  
ATOM   2005   H  HG3    . LYS A 1 131 ? -14.445 -6.789  -18.799 1.00 0.00  ? 131  LYS A HG3    1  
ATOM   2006   H  HD2    . LYS A 1 131 ? -13.977 -9.143  -18.081 1.00 0.00  ? 131  LYS A HD2    1  
ATOM   2007   H  HD3    . LYS A 1 131 ? -13.434 -9.493  -19.723 1.00 0.00  ? 131  LYS A HD3    1  
ATOM   2008   H  HE2    . LYS A 1 131 ? -12.240 -7.155  -18.247 1.00 0.00  ? 131  LYS A HE2    1  
ATOM   2009   H  HE3    . LYS A 1 131 ? -11.644 -8.797  -17.931 1.00 0.00  ? 131  LYS A HE3    1  
ATOM   2010   H  HZ1    . LYS A 1 131 ? -11.821 -7.423  -20.557 1.00 0.00  ? 131  LYS A HZ1    1  
ATOM   2011   H  HZ2    . LYS A 1 131 ? -11.507 -9.084  -20.387 1.00 0.00  ? 131  LYS A HZ2    1  
ATOM   2012   H  HZ3    . LYS A 1 131 ? -10.414 -7.943  -19.765 1.00 0.00  ? 131  LYS A HZ3    1  
ATOM   2013   N  N      . ILE A 1 132 ? -17.150 -5.914  -17.611 1.00 48.15 ? 132  ILE A N      1  
ATOM   2014   C  CA     . ILE A 1 132 ? -18.003 -4.708  -17.541 1.00 45.47 ? 132  ILE A CA     1  
ATOM   2015   C  C      . ILE A 1 132 ? -17.576 -3.763  -18.668 1.00 49.65 ? 132  ILE A C      1  
ATOM   2016   O  O      . ILE A 1 132 ? -16.399 -3.531  -18.867 1.00 54.03 ? 132  ILE A O      1  
ATOM   2017   C  CB     . ILE A 1 132 ? -17.714 -4.108  -16.167 1.00 41.64 ? 132  ILE A CB     1  
ATOM   2018   C  CG1    . ILE A 1 132 ? -18.149 -5.097  -15.082 1.00 44.04 ? 132  ILE A CG1    1  
ATOM   2019   C  CG2    . ILE A 1 132 ? -18.491 -2.800  -16.005 1.00 40.40 ? 132  ILE A CG2    1  
ATOM   2020   C  CD1    . ILE A 1 132 ? -17.603 -4.644  -13.726 1.00 40.50 ? 132  ILE A CD1    1  
ATOM   2021   H  H      . ILE A 1 132 ? -16.237 -5.924  -17.256 1.00 0.00  ? 132  ILE A H      1  
ATOM   2022   H  HA     . ILE A 1 132 ? -19.046 -4.972  -17.634 1.00 0.00  ? 132  ILE A HA     1  
ATOM   2023   H  HB     . ILE A 1 132 ? -16.656 -3.913  -16.076 1.00 0.00  ? 132  ILE A HB     1  
ATOM   2024   H  HG12   . ILE A 1 132 ? -19.228 -5.135  -15.042 1.00 0.00  ? 132  ILE A HG12   1  
ATOM   2025   H  HG13   . ILE A 1 132 ? -17.763 -6.078  -15.313 1.00 0.00  ? 132  ILE A HG13   1  
ATOM   2026   H  HG21   . ILE A 1 132 ? -18.281 -2.375  -15.035 1.00 0.00  ? 132  ILE A HG21   1  
ATOM   2027   H  HG22   . ILE A 1 132 ? -19.549 -2.997  -16.091 1.00 0.00  ? 132  ILE A HG22   1  
ATOM   2028   H  HG23   . ILE A 1 132 ? -18.190 -2.106  -16.776 1.00 0.00  ? 132  ILE A HG23   1  
ATOM   2029   H  HD11   . ILE A 1 132 ? -17.691 -5.451  -13.014 1.00 0.00  ? 132  ILE A HD11   1  
ATOM   2030   H  HD12   . ILE A 1 132 ? -18.168 -3.793  -13.376 1.00 0.00  ? 132  ILE A HD12   1  
ATOM   2031   H  HD13   . ILE A 1 132 ? -16.564 -4.368  -13.830 1.00 0.00  ? 132  ILE A HD13   1  
ATOM   2032   N  N      . GLU A 1 133 ? -18.510 -3.243  -19.427 1.00 46.35 ? 133  GLU A N      1  
ATOM   2033   C  CA     . GLU A 1 133 ? -18.128 -2.340  -20.557 1.00 49.59 ? 133  GLU A CA     1  
ATOM   2034   C  C      . GLU A 1 133 ? -17.810 -0.932  -20.054 1.00 46.85 ? 133  GLU A C      1  
ATOM   2035   O  O      . GLU A 1 133 ? -18.454 -0.417  -19.157 1.00 45.38 ? 133  GLU A O      1  
ATOM   2036   C  CB     . GLU A 1 133 ? -19.336 -2.344  -21.484 1.00 51.52 ? 133  GLU A CB     1  
ATOM   2037   C  CG     . GLU A 1 133 ? -19.309 -3.609  -22.346 1.00 51.58 ? 133  GLU A CG     1  
ATOM   2038   C  CD     . GLU A 1 133 ? -18.151 -3.528  -23.343 1.00 61.90 ? 133  GLU A CD     1  
ATOM   2039   O  OE1    . GLU A 1 133 ? -17.926 -2.453  -23.874 1.00 59.50 ? 133  GLU A OE1    1  
ATOM   2040   O  OE2    . GLU A 1 133 ? -17.509 -4.543  -23.560 1.00 64.14 ? 133  GLU A OE2    1  
ATOM   2041   H  H      . GLU A 1 133 ? -19.454 -3.450  -19.252 1.00 0.00  ? 133  GLU A H      1  
ATOM   2042   H  HA     . GLU A 1 133 ? -17.271 -2.744  -21.074 1.00 0.00  ? 133  GLU A HA     1  
ATOM   2043   H  HB2    . GLU A 1 133 ? -20.241 -2.328  -20.894 1.00 0.00  ? 133  GLU A HB2    1  
ATOM   2044   H  HB3    . GLU A 1 133 ? -19.303 -1.475  -22.121 1.00 0.00  ? 133  GLU A HB3    1  
ATOM   2045   H  HG2    . GLU A 1 133 ? -19.177 -4.474  -21.712 1.00 0.00  ? 133  GLU A HG2    1  
ATOM   2046   H  HG3    . GLU A 1 133 ? -20.240 -3.696  -22.885 1.00 0.00  ? 133  GLU A HG3    1  
ATOM   2047   N  N      . LYS A 1 134 ? -16.832 -0.298  -20.654 1.00 45.12 ? 134  LYS A N      1  
ATOM   2048   C  CA     . LYS A 1 134 ? -16.497 1.119   -20.266 1.00 39.75 ? 134  LYS A CA     1  
ATOM   2049   C  C      . LYS A 1 134 ? -17.744 2.022   -20.310 1.00 37.30 ? 134  LYS A C      1  
ATOM   2050   O  O      . LYS A 1 134 ? -18.523 1.970   -21.244 1.00 40.40 ? 134  LYS A O      1  
ATOM   2051   C  CB     . LYS A 1 134 ? -15.475 1.584   -21.308 1.00 42.85 ? 134  LYS A CB     1  
ATOM   2052   C  CG     . LYS A 1 134 ? -15.018 3.007   -20.980 1.00 47.59 ? 134  LYS A CG     1  
ATOM   2053   C  CD     . LYS A 1 134 ? -13.954 3.451   -21.988 1.00 45.02 ? 134  LYS A CD     1  
ATOM   2054   C  CE     . LYS A 1 134 ? -13.705 4.955   -21.842 1.00 48.52 ? 134  LYS A CE     1  
ATOM   2055   N  NZ     . LYS A 1 134 ? -12.579 5.255   -22.771 1.00 60.73 ? 134  LYS A NZ     1  
ATOM   2056   H  H      . LYS A 1 134 ? -16.414 -0.672  -21.454 1.00 0.00  ? 134  LYS A H      1  
ATOM   2057   H  HA     . LYS A 1 134 ? -16.058 1.130   -19.286 1.00 0.00  ? 134  LYS A HA     1  
ATOM   2058   H  HB2    . LYS A 1 134 ? -14.624 0.919   -21.296 1.00 0.00  ? 134  LYS A HB2    1  
ATOM   2059   H  HB3    . LYS A 1 134 ? -15.928 1.572   -22.289 1.00 0.00  ? 134  LYS A HB3    1  
ATOM   2060   H  HG2    . LYS A 1 134 ? -15.864 3.677   -21.030 1.00 0.00  ? 134  LYS A HG2    1  
ATOM   2061   H  HG3    . LYS A 1 134 ? -14.599 3.030   -19.985 1.00 0.00  ? 134  LYS A HG3    1  
ATOM   2062   H  HD2    . LYS A 1 134 ? -13.035 2.913   -21.802 1.00 0.00  ? 134  LYS A HD2    1  
ATOM   2063   H  HD3    . LYS A 1 134 ? -14.298 3.241   -22.990 1.00 0.00  ? 134  LYS A HD3    1  
ATOM   2064   H  HE2    . LYS A 1 134 ? -14.589 5.510   -22.126 1.00 0.00  ? 134  LYS A HE2    1  
ATOM   2065   H  HE3    . LYS A 1 134 ? -13.421 5.193   -20.828 1.00 0.00  ? 134  LYS A HE3    1  
ATOM   2066   H  HZ1    . LYS A 1 134 ? -12.411 6.281   -22.793 1.00 0.00  ? 134  LYS A HZ1    1  
ATOM   2067   H  HZ2    . LYS A 1 134 ? -12.821 4.923   -23.727 1.00 0.00  ? 134  LYS A HZ2    1  
ATOM   2068   H  HZ3    . LYS A 1 134 ? -11.719 4.773   -22.442 1.00 0.00  ? 134  LYS A HZ3    1  
ATOM   2069   N  N      . GLY A 1 135 ? -17.939 2.849   -19.305 1.00 40.63 ? 135  GLY A N      1  
ATOM   2070   C  CA     . GLY A 1 135 ? -19.128 3.750   -19.293 1.00 33.58 ? 135  GLY A CA     1  
ATOM   2071   C  C      . GLY A 1 135 ? -20.257 3.118   -18.464 1.00 35.53 ? 135  GLY A C      1  
ATOM   2072   O  O      . GLY A 1 135 ? -21.063 3.811   -17.874 1.00 38.59 ? 135  GLY A O      1  
ATOM   2073   H  H      . GLY A 1 135 ? -17.287 2.878   -18.575 1.00 0.00  ? 135  GLY A H      1  
ATOM   2074   H  HA2    . GLY A 1 135 ? -18.853 4.700   -18.859 1.00 0.00  ? 135  GLY A HA2    1  
ATOM   2075   H  HA3    . GLY A 1 135 ? -19.472 3.905   -20.305 1.00 0.00  ? 135  GLY A HA3    1  
ATOM   2076   N  N      . GLN A 1 136 ? -20.322 1.802   -18.423 1.00 37.63 ? 136  GLN A N      1  
ATOM   2077   C  CA     . GLN A 1 136 ? -21.402 1.127   -17.650 1.00 40.73 ? 136  GLN A CA     1  
ATOM   2078   C  C      . GLN A 1 136 ? -21.256 1.395   -16.149 1.00 38.85 ? 136  GLN A C      1  
ATOM   2079   O  O      . GLN A 1 136 ? -20.164 1.389   -15.610 1.00 41.28 ? 136  GLN A O      1  
ATOM   2080   C  CB     . GLN A 1 136 ? -21.219 -0.363  -17.932 1.00 41.74 ? 136  GLN A CB     1  
ATOM   2081   C  CG     . GLN A 1 136 ? -21.667 -0.681  -19.359 1.00 40.64 ? 136  GLN A CG     1  
ATOM   2082   C  CD     . GLN A 1 136 ? -22.228 -2.105  -19.408 1.00 41.59 ? 136  GLN A CD     1  
ATOM   2083   O  OE1    . GLN A 1 136 ? -21.532 -3.054  -19.107 1.00 40.64 ? 136  GLN A OE1    1  
ATOM   2084   N  NE2    . GLN A 1 136 ? -23.466 -2.297  -19.777 1.00 45.59 ? 136  GLN A NE2    1  
ATOM   2085   H  H      . GLN A 1 136 ? -19.662 1.286   -18.931 1.00 0.00  ? 136  GLN A H      1  
ATOM   2086   H  HA     . GLN A 1 136 ? -22.372 1.449   -17.997 1.00 0.00  ? 136  GLN A HA     1  
ATOM   2087   H  HB2    . GLN A 1 136 ? -20.178 -0.624  -17.814 1.00 0.00  ? 136  GLN A HB2    1  
ATOM   2088   H  HB3    . GLN A 1 136 ? -21.814 -0.934  -17.235 1.00 0.00  ? 136  GLN A HB3    1  
ATOM   2089   H  HG2    . GLN A 1 136 ? -22.431 0.021   -19.664 1.00 0.00  ? 136  GLN A HG2    1  
ATOM   2090   H  HG3    . GLN A 1 136 ? -20.822 -0.607  -20.026 1.00 0.00  ? 136  GLN A HG3    1  
ATOM   2091   H  HE21   . GLN A 1 136 ? -24.030 -1.534  -20.020 1.00 0.00  ? 136  GLN A HE21   1  
ATOM   2092   H  HE22   . GLN A 1 136 ? -23.831 -3.206  -19.809 1.00 0.00  ? 136  GLN A HE22   1  
ATOM   2093   N  N      . VAL A 1 137 ? -22.358 1.606   -15.475 1.00 39.86 ? 137  VAL A N      1  
ATOM   2094   C  CA     . VAL A 1 137 ? -22.306 1.849   -14.010 1.00 37.99 ? 137  VAL A CA     1  
ATOM   2095   C  C      . VAL A 1 137 ? -21.877 0.567   -13.299 1.00 39.63 ? 137  VAL A C      1  
ATOM   2096   O  O      . VAL A 1 137 ? -22.382 -0.506  -13.583 1.00 41.36 ? 137  VAL A O      1  
ATOM   2097   C  CB     . VAL A 1 137 ? -23.737 2.217   -13.610 1.00 35.63 ? 137  VAL A CB     1  
ATOM   2098   C  CG1    . VAL A 1 137 ? -23.802 2.430   -12.097 1.00 38.53 ? 137  VAL A CG1    1  
ATOM   2099   C  CG2    . VAL A 1 137 ? -24.158 3.506   -14.320 1.00 36.67 ? 137  VAL A CG2    1  
ATOM   2100   H  H      . VAL A 1 137 ? -23.222 1.586   -15.937 1.00 0.00  ? 137  VAL A H      1  
ATOM   2101   H  HA     . VAL A 1 137 ? -21.633 2.660   -13.779 1.00 0.00  ? 137  VAL A HA     1  
ATOM   2102   H  HB     . VAL A 1 137 ? -24.407 1.415   -13.888 1.00 0.00  ? 137  VAL A HB     1  
ATOM   2103   H  HG11   . VAL A 1 137 ? -23.458 1.538   -11.594 1.00 0.00  ? 137  VAL A HG11   1  
ATOM   2104   H  HG12   . VAL A 1 137 ? -24.820 2.640   -11.805 1.00 0.00  ? 137  VAL A HG12   1  
ATOM   2105   H  HG13   . VAL A 1 137 ? -23.170 3.263   -11.824 1.00 0.00  ? 137  VAL A HG13   1  
ATOM   2106   H  HG21   . VAL A 1 137 ? -23.944 4.353   -13.686 1.00 0.00  ? 137  VAL A HG21   1  
ATOM   2107   H  HG22   . VAL A 1 137 ? -25.217 3.471   -14.529 1.00 0.00  ? 137  VAL A HG22   1  
ATOM   2108   H  HG23   . VAL A 1 137 ? -23.612 3.602   -15.247 1.00 0.00  ? 137  VAL A HG23   1  
ATOM   2109   N  N      . ARG A 1 138 ? -20.967 0.671   -12.380 1.00 37.09 ? 138  ARG A N      1  
ATOM   2110   C  CA     . ARG A 1 138 ? -20.506 -0.542  -11.643 1.00 34.38 ? 138  ARG A CA     1  
ATOM   2111   C  C      . ARG A 1 138 ? -20.377 -0.224  -10.156 1.00 35.36 ? 138  ARG A C      1  
ATOM   2112   O  O      . ARG A 1 138 ? -20.140 0.906   -9.773  1.00 36.41 ? 138  ARG A O      1  
ATOM   2113   C  CB     . ARG A 1 138 ? -19.143 -0.917  -12.248 1.00 32.50 ? 138  ARG A CB     1  
ATOM   2114   C  CG     . ARG A 1 138 ? -18.236 0.317   -12.336 1.00 35.31 ? 138  ARG A CG     1  
ATOM   2115   C  CD     . ARG A 1 138 ? -16.823 -0.047  -11.875 1.00 31.34 ? 138  ARG A CD     1  
ATOM   2116   N  NE     . ARG A 1 138 ? -15.974 0.075   -13.096 1.00 34.13 ? 138  ARG A NE     1  
ATOM   2117   C  CZ     . ARG A 1 138 ? -14.721 0.456   -13.006 1.00 41.40 ? 138  ARG A CZ     1  
ATOM   2118   N  NH1    . ARG A 1 138 ? -14.169 0.673   -11.838 1.00 36.69 ? 138  ARG A NH1    1  
ATOM   2119   N  NH2    . ARG A 1 138 ? -14.013 0.606   -14.093 1.00 37.39 ? 138  ARG A NH2    1  
ATOM   2120   H  H      . ARG A 1 138 ? -20.575 1.545   -12.165 1.00 0.00  ? 138  ARG A H      1  
ATOM   2121   H  HA     . ARG A 1 138 ? -21.205 -1.352  -11.789 1.00 0.00  ? 138  ARG A HA     1  
ATOM   2122   H  HB2    . ARG A 1 138 ? -18.672 -1.665  -11.627 1.00 0.00  ? 138  ARG A HB2    1  
ATOM   2123   H  HB3    . ARG A 1 138 ? -19.293 -1.319  -13.239 1.00 0.00  ? 138  ARG A HB3    1  
ATOM   2124   H  HG2    . ARG A 1 138 ? -18.200 0.663   -13.358 1.00 0.00  ? 138  ARG A HG2    1  
ATOM   2125   H  HG3    . ARG A 1 138 ? -18.626 1.099   -11.704 1.00 0.00  ? 138  ARG A HG3    1  
ATOM   2126   H  HD2    . ARG A 1 138 ? -16.493 0.645   -11.114 1.00 0.00  ? 138  ARG A HD2    1  
ATOM   2127   H  HD3    . ARG A 1 138 ? -16.793 -1.060  -11.503 1.00 0.00  ? 138  ARG A HD3    1  
ATOM   2128   H  HE     . ARG A 1 138 ? -16.361 -0.113  -13.976 1.00 0.00  ? 138  ARG A HE     1  
ATOM   2129   H  HH11   . ARG A 1 138 ? -14.698 0.549   -11.000 1.00 0.00  ? 138  ARG A HH11   1  
ATOM   2130   H  HH12   . ARG A 1 138 ? -13.213 0.963   -11.785 1.00 0.00  ? 138  ARG A HH12   1  
ATOM   2131   H  HH21   . ARG A 1 138 ? -14.425 0.432   -14.987 1.00 0.00  ? 138  ARG A HH21   1  
ATOM   2132   H  HH22   . ARG A 1 138 ? -13.059 0.898   -14.030 1.00 0.00  ? 138  ARG A HH22   1  
ATOM   2133   N  N      . LEU A 1 139 ? -20.533 -1.214  -9.324  1.00 35.01 ? 139  LEU A N      1  
ATOM   2134   C  CA     . LEU A 1 139 ? -20.419 -0.995  -7.850  1.00 38.09 ? 139  LEU A CA     1  
ATOM   2135   C  C      . LEU A 1 139 ? -19.261 -1.824  -7.314  1.00 34.86 ? 139  LEU A C      1  
ATOM   2136   O  O      . LEU A 1 139 ? -18.813 -2.748  -7.971  1.00 38.61 ? 139  LEU A O      1  
ATOM   2137   C  CB     . LEU A 1 139 ? -21.741 -1.499  -7.268  1.00 34.52 ? 139  LEU A CB     1  
ATOM   2138   C  CG     . LEU A 1 139 ? -22.821 -0.431  -7.442  1.00 35.09 ? 139  LEU A CG     1  
ATOM   2139   C  CD1    . LEU A 1 139 ? -24.174 -0.993  -6.998  1.00 35.39 ? 139  LEU A CD1    1  
ATOM   2140   C  CD2    . LEU A 1 139 ? -22.470 0.788   -6.587  1.00 34.66 ? 139  LEU A CD2    1  
ATOM   2141   H  H      . LEU A 1 139 ? -20.707 -2.121  -9.663  1.00 0.00  ? 139  LEU A H      1  
ATOM   2142   H  HA     . LEU A 1 139 ? -20.282 0.051   -7.625  1.00 0.00  ? 139  LEU A HA     1  
ATOM   2143   H  HB2    . LEU A 1 139 ? -22.040 -2.401  -7.783  1.00 0.00  ? 139  LEU A HB2    1  
ATOM   2144   H  HB3    . LEU A 1 139 ? -21.614 -1.712  -6.217  1.00 0.00  ? 139  LEU A HB3    1  
ATOM   2145   H  HG     . LEU A 1 139 ? -22.875 -0.141  -8.480  1.00 0.00  ? 139  LEU A HG     1  
ATOM   2146   H  HD11   . LEU A 1 139 ? -24.209 -2.053  -7.201  1.00 0.00  ? 139  LEU A HD11   1  
ATOM   2147   H  HD12   . LEU A 1 139 ? -24.964 -0.496  -7.540  1.00 0.00  ? 139  LEU A HD12   1  
ATOM   2148   H  HD13   . LEU A 1 139 ? -24.304 -0.825  -5.939  1.00 0.00  ? 139  LEU A HD13   1  
ATOM   2149   H  HD21   . LEU A 1 139 ? -22.127 0.461   -5.615  1.00 0.00  ? 139  LEU A HD21   1  
ATOM   2150   H  HD22   . LEU A 1 139 ? -23.344 1.409   -6.469  1.00 0.00  ? 139  LEU A HD22   1  
ATOM   2151   H  HD23   . LEU A 1 139 ? -21.688 1.354   -7.071  1.00 0.00  ? 139  LEU A HD23   1  
ATOM   2152   N  N      . SER A 1 140 ? -18.757 -1.514  -6.136  1.00 32.60 ? 140  SER A N      1  
ATOM   2153   C  CA     . SER A 1 140 ? -17.623 -2.319  -5.634  1.00 34.84 ? 140  SER A CA     1  
ATOM   2154   C  C      . SER A 1 140 ? -17.533 -2.364  -4.113  1.00 36.67 ? 140  SER A C      1  
ATOM   2155   O  O      . SER A 1 140 ? -17.808 -1.406  -3.414  1.00 36.81 ? 140  SER A O      1  
ATOM   2156   C  CB     . SER A 1 140 ? -16.381 -1.637  -6.193  1.00 33.31 ? 140  SER A CB     1  
ATOM   2157   O  OG     . SER A 1 140 ? -16.597 -0.233  -6.248  1.00 33.56 ? 140  SER A OG     1  
ATOM   2158   H  H      . SER A 1 140 ? -19.130 -0.758  -5.634  1.00 0.00  ? 140  SER A H      1  
ATOM   2159   H  HA     . SER A 1 140 ? -17.684 -3.320  -6.028  1.00 0.00  ? 140  SER A HA     1  
ATOM   2160   H  HB2    . SER A 1 140 ? -15.541 -1.840  -5.551  1.00 0.00  ? 140  SER A HB2    1  
ATOM   2161   H  HB3    . SER A 1 140 ? -16.178 -2.021  -7.180  1.00 0.00  ? 140  SER A HB3    1  
ATOM   2162   H  HG     . SER A 1 140 ? -16.403 0.130   -5.381  1.00 0.00  ? 140  SER A HG     1  
ATOM   2163   N  N      . LYS A 1 141 ? -17.092 -3.488  -3.615  1.00 32.92 ? 141  LYS A N      1  
ATOM   2164   C  CA     . LYS A 1 141 ? -16.903 -3.659  -2.153  1.00 33.23 ? 141  LYS A CA     1  
ATOM   2165   C  C      . LYS A 1 141 ? -15.399 -3.697  -1.872  1.00 34.29 ? 141  LYS A C      1  
ATOM   2166   O  O      . LYS A 1 141 ? -14.743 -4.699  -2.080  1.00 37.89 ? 141  LYS A O      1  
ATOM   2167   C  CB     . LYS A 1 141 ? -17.557 -5.000  -1.815  1.00 32.65 ? 141  LYS A CB     1  
ATOM   2168   C  CG     . LYS A 1 141 ? -17.955 -5.021  -0.335  1.00 32.87 ? 141  LYS A CG     1  
ATOM   2169   C  CD     . LYS A 1 141 ? -17.157 -6.103  0.397   1.00 31.53 ? 141  LYS A CD     1  
ATOM   2170   C  CE     . LYS A 1 141 ? -15.888 -5.488  0.991   1.00 35.56 ? 141  LYS A CE     1  
ATOM   2171   N  NZ     . LYS A 1 141 ? -15.732 -6.139  2.321   1.00 32.31 ? 141  LYS A NZ     1  
ATOM   2172   H  H      . LYS A 1 141 ? -16.850 -4.220  -4.220  1.00 0.00  ? 141  LYS A H      1  
ATOM   2173   H  HA     . LYS A 1 141 ? -17.377 -2.857  -1.609  1.00 0.00  ? 141  LYS A HA     1  
ATOM   2174   H  HB2    . LYS A 1 141 ? -18.438 -5.134  -2.426  1.00 0.00  ? 141  LYS A HB2    1  
ATOM   2175   H  HB3    . LYS A 1 141 ? -16.859 -5.800  -2.011  1.00 0.00  ? 141  LYS A HB3    1  
ATOM   2176   H  HG2    . LYS A 1 141 ? -17.748 -4.058  0.109   1.00 0.00  ? 141  LYS A HG2    1  
ATOM   2177   H  HG3    . LYS A 1 141 ? -19.010 -5.236  -0.250  1.00 0.00  ? 141  LYS A HG3    1  
ATOM   2178   H  HD2    . LYS A 1 141 ? -17.761 -6.521  1.190   1.00 0.00  ? 141  LYS A HD2    1  
ATOM   2179   H  HD3    . LYS A 1 141 ? -16.886 -6.883  -0.298  1.00 0.00  ? 141  LYS A HD3    1  
ATOM   2180   H  HE2    . LYS A 1 141 ? -15.037 -5.705  0.360   1.00 0.00  ? 141  LYS A HE2    1  
ATOM   2181   H  HE3    . LYS A 1 141 ? -16.007 -4.423  1.112   1.00 0.00  ? 141  LYS A HE3    1  
ATOM   2182   H  HZ1    . LYS A 1 141 ? -16.618 -6.051  2.857   1.00 0.00  ? 141  LYS A HZ1    1  
ATOM   2183   H  HZ2    . LYS A 1 141 ? -14.961 -5.676  2.845   1.00 0.00  ? 141  LYS A HZ2    1  
ATOM   2184   H  HZ3    . LYS A 1 141 ? -15.507 -7.146  2.191   1.00 0.00  ? 141  LYS A HZ3    1  
ATOM   2185   N  N      . LYS A 1 142 ? -14.847 -2.602  -1.427  1.00 31.61 ? 142  LYS A N      1  
ATOM   2186   C  CA     . LYS A 1 142 ? -13.377 -2.546  -1.159  1.00 33.67 ? 142  LYS A CA     1  
ATOM   2187   C  C      . LYS A 1 142 ? -12.925 -3.697  -0.256  1.00 36.23 ? 142  LYS A C      1  
ATOM   2188   O  O      . LYS A 1 142 ? -13.574 -4.038  0.713   1.00 43.09 ? 142  LYS A O      1  
ATOM   2189   C  CB     . LYS A 1 142 ? -13.154 -1.207  -0.457  1.00 34.08 ? 142  LYS A CB     1  
ATOM   2190   C  CG     . LYS A 1 142 ? -13.561 -0.063  -1.390  1.00 35.52 ? 142  LYS A CG     1  
ATOM   2191   C  CD     . LYS A 1 142 ? -12.318 0.506   -2.076  1.00 36.89 ? 142  LYS A CD     1  
ATOM   2192   C  CE     . LYS A 1 142 ? -12.619 1.914   -2.596  1.00 45.22 ? 142  LYS A CE     1  
ATOM   2193   N  NZ     . LYS A 1 142 ? -12.044 2.832   -1.574  1.00 48.99 ? 142  LYS A NZ     1  
ATOM   2194   H  H      . LYS A 1 142 ? -15.397 -1.803  -1.289  1.00 0.00  ? 142  LYS A H      1  
ATOM   2195   H  HA     . LYS A 1 142 ? -12.828 -2.563  -2.087  1.00 0.00  ? 142  LYS A HA     1  
ATOM   2196   H  HB2    . LYS A 1 142 ? -13.752 -1.170  0.442   1.00 0.00  ? 142  LYS A HB2    1  
ATOM   2197   H  HB3    . LYS A 1 142 ? -12.111 -1.104  -0.199  1.00 0.00  ? 142  LYS A HB3    1  
ATOM   2198   H  HG2    . LYS A 1 142 ? -14.247 -0.435  -2.138  1.00 0.00  ? 142  LYS A HG2    1  
ATOM   2199   H  HG3    . LYS A 1 142 ? -14.041 0.716   -0.816  1.00 0.00  ? 142  LYS A HG3    1  
ATOM   2200   H  HD2    . LYS A 1 142 ? -11.504 0.550   -1.366  1.00 0.00  ? 142  LYS A HD2    1  
ATOM   2201   H  HD3    . LYS A 1 142 ? -12.040 -0.129  -2.903  1.00 0.00  ? 142  LYS A HD3    1  
ATOM   2202   H  HE2    . LYS A 1 142 ? -12.143 2.068   -3.555  1.00 0.00  ? 142  LYS A HE2    1  
ATOM   2203   H  HE3    . LYS A 1 142 ? -13.684 2.067   -2.674  1.00 0.00  ? 142  LYS A HE3    1  
ATOM   2204   H  HZ1    . LYS A 1 142 ? -12.107 3.812   -1.914  1.00 0.00  ? 142  LYS A HZ1    1  
ATOM   2205   H  HZ2    . LYS A 1 142 ? -11.047 2.585   -1.409  1.00 0.00  ? 142  LYS A HZ2    1  
ATOM   2206   H  HZ3    . LYS A 1 142 ? -12.577 2.741   -0.686  1.00 0.00  ? 142  LYS A HZ3    1  
ATOM   2207   N  N      . MET A 1 143 ? -11.802 -4.285  -0.570  1.00 36.23 ? 143  MET A N      1  
ATOM   2208   C  CA     . MET A 1 143 ? -11.274 -5.407  0.257   1.00 40.14 ? 143  MET A CA     1  
ATOM   2209   C  C      . MET A 1 143 ? -9.751  -5.464  0.117   1.00 40.65 ? 143  MET A C      1  
ATOM   2210   O  O      . MET A 1 143 ? -9.205  -5.131  -0.915  1.00 46.33 ? 143  MET A O      1  
ATOM   2211   C  CB     . MET A 1 143 ? -11.917 -6.667  -0.323  1.00 39.76 ? 143  MET A CB     1  
ATOM   2212   C  CG     . MET A 1 143 ? -11.784 -7.816  0.679   1.00 49.10 ? 143  MET A CG     1  
ATOM   2213   S  SD     . MET A 1 143 ? -13.074 -9.045  0.363   1.00 53.45 ? 143  MET A SD     1  
ATOM   2214   C  CE     . MET A 1 143 ? -12.317 -9.800  -1.097  1.00 51.62 ? 143  MET A CE     1  
ATOM   2215   H  H      . MET A 1 143 ? -11.298 -3.980  -1.353  1.00 0.00  ? 143  MET A H      1  
ATOM   2216   H  HA     . MET A 1 143 ? -11.557 -5.284  1.290   1.00 0.00  ? 143  MET A HA     1  
ATOM   2217   H  HB2    . MET A 1 143 ? -12.963 -6.479  -0.519  1.00 0.00  ? 143  MET A HB2    1  
ATOM   2218   H  HB3    . MET A 1 143 ? -11.420 -6.935  -1.243  1.00 0.00  ? 143  MET A HB3    1  
ATOM   2219   H  HG2    . MET A 1 143 ? -10.813 -8.277  0.570   1.00 0.00  ? 143  MET A HG2    1  
ATOM   2220   H  HG3    . MET A 1 143 ? -11.890 -7.433  1.683   1.00 0.00  ? 143  MET A HG3    1  
ATOM   2221   H  HE1    . MET A 1 143 ? -12.459 -9.152  -1.950  1.00 0.00  ? 143  MET A HE1    1  
ATOM   2222   H  HE2    . MET A 1 143 ? -12.780 -10.754 -1.292  1.00 0.00  ? 143  MET A HE2    1  
ATOM   2223   H  HE3    . MET A 1 143 ? -11.260 -9.945  -0.919  1.00 0.00  ? 143  MET A HE3    1  
ATOM   2224   N  N      . VAL A 1 144 ? -9.059  -5.872  1.145   1.00 36.98 ? 144  VAL A N      1  
ATOM   2225   C  CA     . VAL A 1 144 ? -7.572  -5.935  1.060   1.00 39.13 ? 144  VAL A CA     1  
ATOM   2226   C  C      . VAL A 1 144 ? -7.110  -7.362  0.759   1.00 44.66 ? 144  VAL A C      1  
ATOM   2227   O  O      . VAL A 1 144 ? -7.687  -8.325  1.226   1.00 41.82 ? 144  VAL A O      1  
ATOM   2228   C  CB     . VAL A 1 144 ? -7.077  -5.489  2.437   1.00 35.25 ? 144  VAL A CB     1  
ATOM   2229   C  CG1    . VAL A 1 144 ? -5.547  -5.496  2.459   1.00 43.19 ? 144  VAL A CG1    1  
ATOM   2230   C  CG2    . VAL A 1 144 ? -7.580  -4.072  2.727   1.00 34.54 ? 144  VAL A CG2    1  
ATOM   2231   H  H      . VAL A 1 144 ? -9.516  -6.130  1.973   1.00 0.00  ? 144  VAL A H      1  
ATOM   2232   H  HA     . VAL A 1 144 ? -7.211  -5.256  0.303   1.00 0.00  ? 144  VAL A HA     1  
ATOM   2233   H  HB     . VAL A 1 144 ? -7.450  -6.167  3.191   1.00 0.00  ? 144  VAL A HB     1  
ATOM   2234   H  HG11   . VAL A 1 144 ? -5.194  -4.781  3.189   1.00 0.00  ? 144  VAL A HG11   1  
ATOM   2235   H  HG12   . VAL A 1 144 ? -5.171  -5.228  1.483   1.00 0.00  ? 144  VAL A HG12   1  
ATOM   2236   H  HG13   . VAL A 1 144 ? -5.195  -6.482  2.723   1.00 0.00  ? 144  VAL A HG13   1  
ATOM   2237   H  HG21   . VAL A 1 144 ? -8.634  -4.106  2.961   1.00 0.00  ? 144  VAL A HG21   1  
ATOM   2238   H  HG22   . VAL A 1 144 ? -7.424  -3.450  1.858   1.00 0.00  ? 144  VAL A HG22   1  
ATOM   2239   H  HG23   . VAL A 1 144 ? -7.038  -3.662  3.566   1.00 0.00  ? 144  VAL A HG23   1  
ATOM   2240   N  N      . ASP A 1 145 ? -6.061  -7.500  -0.005  1.00 44.34 ? 145  ASP A N      1  
ATOM   2241   C  CA     . ASP A 1 145 ? -5.541  -8.857  -0.327  1.00 46.92 ? 145  ASP A CA     1  
ATOM   2242   C  C      . ASP A 1 145 ? -4.279  -9.124  0.501   1.00 51.42 ? 145  ASP A C      1  
ATOM   2243   O  O      . ASP A 1 145 ? -3.361  -8.328  0.491   1.00 58.55 ? 145  ASP A O      1  
ATOM   2244   C  CB     . ASP A 1 145 ? -5.208  -8.813  -1.819  1.00 46.52 ? 145  ASP A CB     1  
ATOM   2245   C  CG     . ASP A 1 145 ? -5.076  -10.239 -2.356  1.00 55.13 ? 145  ASP A CG     1  
ATOM   2246   O  OD1    . ASP A 1 145 ? -4.105  -10.892 -2.013  1.00 53.77 ? 145  ASP A OD1    1  
ATOM   2247   O  OD2    . ASP A 1 145 ? -5.949  -10.654 -3.100  1.00 61.11 ? 145  ASP A OD2    1  
ATOM   2248   H  H      . ASP A 1 145 ? -5.607  -6.707  -0.358  1.00 0.00  ? 145  ASP A H      1  
ATOM   2249   H  HA     . ASP A 1 145 ? -6.293  -9.606  -0.135  1.00 0.00  ? 145  ASP A HA     1  
ATOM   2250   H  HB2    . ASP A 1 145 ? -5.998  -8.299  -2.348  1.00 0.00  ? 145  ASP A HB2    1  
ATOM   2251   H  HB3    . ASP A 1 145 ? -4.276  -8.288  -1.965  1.00 0.00  ? 145  ASP A HB3    1  
ATOM   2252   N  N      . PRO A 1 146 ? -4.266  -10.232 1.199   1.00 47.05 ? 146  PRO A N      1  
ATOM   2253   C  CA     . PRO A 1 146 ? -3.092  -10.577 2.039   1.00 48.39 ? 146  PRO A CA     1  
ATOM   2254   C  C      . PRO A 1 146 ? -1.876  -10.863 1.155   1.00 54.08 ? 146  PRO A C      1  
ATOM   2255   O  O      . PRO A 1 146 ? -0.745  -10.797 1.598   1.00 51.88 ? 146  PRO A O      1  
ATOM   2256   C  CB     . PRO A 1 146 ? -3.543  -11.828 2.792   1.00 41.67 ? 146  PRO A CB     1  
ATOM   2257   C  CG     . PRO A 1 146 ? -4.615  -12.419 1.935   1.00 44.11 ? 146  PRO A CG     1  
ATOM   2258   C  CD     . PRO A 1 146 ? -5.312  -11.262 1.271   1.00 46.93 ? 146  PRO A CD     1  
ATOM   2259   H  HA     . PRO A 1 146 ? -2.877  -9.783  2.736   1.00 0.00  ? 146  PRO A HA     1  
ATOM   2260   H  HB2    . PRO A 1 146 ? -2.718  -12.519 2.900   1.00 0.00  ? 146  PRO A HB2    1  
ATOM   2261   H  HB3    . PRO A 1 146 ? -3.945  -11.563 3.757   1.00 0.00  ? 146  PRO A HB3    1  
ATOM   2262   H  HG2    . PRO A 1 146 ? -4.176  -13.070 1.191   1.00 0.00  ? 146  PRO A HG2    1  
ATOM   2263   H  HG3    . PRO A 1 146 ? -5.317  -12.967 2.543   1.00 0.00  ? 146  PRO A HG3    1  
ATOM   2264   H  HD2    . PRO A 1 146 ? -5.648  -11.539 0.281   1.00 0.00  ? 146  PRO A HD2    1  
ATOM   2265   H  HD3    . PRO A 1 146 ? -6.136  -10.915 1.874   1.00 0.00  ? 146  PRO A HD3    1  
ATOM   2266   N  N      . GLU A 1 147 ? -2.100  -11.169 -0.096  1.00 55.07 ? 147  GLU A N      1  
ATOM   2267   C  CA     . GLU A 1 147 ? -0.960  -11.447 -1.018  1.00 56.92 ? 147  GLU A CA     1  
ATOM   2268   C  C      . GLU A 1 147 ? -0.391  -10.128 -1.550  1.00 58.35 ? 147  GLU A C      1  
ATOM   2269   O  O      . GLU A 1 147 ? 0.772   -10.033 -1.890  1.00 61.95 ? 147  GLU A O      1  
ATOM   2270   C  CB     . GLU A 1 147 ? -1.560  -12.273 -2.156  1.00 54.16 ? 147  GLU A CB     1  
ATOM   2271   C  CG     . GLU A 1 147 ? -0.534  -13.301 -2.637  1.00 61.94 ? 147  GLU A CG     1  
ATOM   2272   C  CD     . GLU A 1 147 ? -1.261  -14.535 -3.173  1.00 73.53 ? 147  GLU A CD     1  
ATOM   2273   O  OE1    . GLU A 1 147 ? -1.847  -15.247 -2.374  1.00 69.13 ? 147  GLU A OE1    1  
ATOM   2274   O  OE2    . GLU A 1 147 ? -1.220  -14.748 -4.374  1.00 77.53 ? 147  GLU A OE2    1  
ATOM   2275   H  H      . GLU A 1 147 ? -3.019  -11.208 -0.433  1.00 0.00  ? 147  GLU A H      1  
ATOM   2276   H  HA     . GLU A 1 147 ? -0.194  -12.014 -0.512  1.00 0.00  ? 147  GLU A HA     1  
ATOM   2277   H  HB2    . GLU A 1 147 ? -2.445  -12.783 -1.803  1.00 0.00  ? 147  GLU A HB2    1  
ATOM   2278   H  HB3    . GLU A 1 147 ? -1.824  -11.620 -2.975  1.00 0.00  ? 147  GLU A HB3    1  
ATOM   2279   H  HG2    . GLU A 1 147 ? 0.069   -12.867 -3.422  1.00 0.00  ? 147  GLU A HG2    1  
ATOM   2280   H  HG3    . GLU A 1 147 ? 0.100   -13.589 -1.813  1.00 0.00  ? 147  GLU A HG3    1  
ATOM   2281   N  N      . LYS A 1 148 ? -1.205  -9.108  -1.613  1.00 58.30 ? 148  LYS A N      1  
ATOM   2282   C  CA     . LYS A 1 148 ? -0.725  -7.785  -2.108  1.00 56.84 ? 148  LYS A CA     1  
ATOM   2283   C  C      . LYS A 1 148 ? -1.073  -6.705  -1.078  1.00 53.22 ? 148  LYS A C      1  
ATOM   2284   O  O      . LYS A 1 148 ? -1.988  -5.930  -1.276  1.00 51.19 ? 148  LYS A O      1  
ATOM   2285   C  CB     . LYS A 1 148 ? -1.481  -7.549  -3.417  1.00 54.81 ? 148  LYS A CB     1  
ATOM   2286   C  CG     . LYS A 1 148 ? -0.535  -7.765  -4.601  1.00 58.53 ? 148  LYS A CG     1  
ATOM   2287   C  CD     . LYS A 1 148 ? -0.442  -9.260  -4.915  1.00 65.18 ? 148  LYS A CD     1  
ATOM   2288   C  CE     . LYS A 1 148 ? 0.965   -9.590  -5.419  1.00 71.28 ? 148  LYS A CE     1  
ATOM   2289   N  NZ     . LYS A 1 148 ? 1.231   -10.973 -4.935  1.00 67.48 ? 148  LYS A NZ     1  
ATOM   2290   H  H      . LYS A 1 148 ? -2.136  -9.210  -1.325  1.00 0.00  ? 148  LYS A H      1  
ATOM   2291   H  HA     . LYS A 1 148 ? 0.338   -7.810  -2.288  1.00 0.00  ? 148  LYS A HA     1  
ATOM   2292   H  HB2    . LYS A 1 148 ? -2.307  -8.241  -3.485  1.00 0.00  ? 148  LYS A HB2    1  
ATOM   2293   H  HB3    . LYS A 1 148 ? -1.855  -6.537  -3.439  1.00 0.00  ? 148  LYS A HB3    1  
ATOM   2294   H  HG2    . LYS A 1 148 ? -0.914  -7.237  -5.464  1.00 0.00  ? 148  LYS A HG2    1  
ATOM   2295   H  HG3    . LYS A 1 148 ? 0.446   -7.390  -4.352  1.00 0.00  ? 148  LYS A HG3    1  
ATOM   2296   H  HD2    . LYS A 1 148 ? -0.648  -9.829  -4.020  1.00 0.00  ? 148  LYS A HD2    1  
ATOM   2297   H  HD3    . LYS A 1 148 ? -1.164  -9.513  -5.677  1.00 0.00  ? 148  LYS A HD3    1  
ATOM   2298   H  HE2    . LYS A 1 148 ? 0.994   -9.554  -6.500  1.00 0.00  ? 148  LYS A HE2    1  
ATOM   2299   H  HE3    . LYS A 1 148 ? 1.685   -8.906  -4.999  1.00 0.00  ? 148  LYS A HE3    1  
ATOM   2300   H  HZ1    . LYS A 1 148 ? 0.635   -11.645 -5.458  1.00 0.00  ? 148  LYS A HZ1    1  
ATOM   2301   H  HZ2    . LYS A 1 148 ? 1.013   -11.032 -3.919  1.00 0.00  ? 148  LYS A HZ2    1  
ATOM   2302   H  HZ3    . LYS A 1 148 ? 2.232   -11.208 -5.090  1.00 0.00  ? 148  LYS A HZ3    1  
ATOM   2303   N  N      . PRO A 1 149 ? -0.341  -6.707  0.006   1.00 58.89 ? 149  PRO A N      1  
ATOM   2304   C  CA     . PRO A 1 149 ? -0.591  -5.730  1.098   1.00 59.99 ? 149  PRO A CA     1  
ATOM   2305   C  C      . PRO A 1 149 ? -0.218  -4.303  0.675   1.00 56.51 ? 149  PRO A C      1  
ATOM   2306   O  O      . PRO A 1 149 ? -0.819  -3.344  1.119   1.00 54.80 ? 149  PRO A O      1  
ATOM   2307   C  CB     . PRO A 1 149 ? 0.308   -6.221  2.227   1.00 57.56 ? 149  PRO A CB     1  
ATOM   2308   C  CG     . PRO A 1 149 ? 1.391   -6.995  1.549   1.00 61.96 ? 149  PRO A CG     1  
ATOM   2309   C  CD     . PRO A 1 149 ? 0.780   -7.604  0.317   1.00 60.91 ? 149  PRO A CD     1  
ATOM   2310   H  HA     . PRO A 1 149 ? -1.622  -5.772  1.410   1.00 0.00  ? 149  PRO A HA     1  
ATOM   2311   H  HB2    . PRO A 1 149 ? 0.720   -5.381  2.761   1.00 0.00  ? 149  PRO A HB2    1  
ATOM   2312   H  HB3    . PRO A 1 149 ? -0.244  -6.862  2.896   1.00 0.00  ? 149  PRO A HB3    1  
ATOM   2313   H  HG2    . PRO A 1 149 ? 2.202   -6.334  1.276   1.00 0.00  ? 149  PRO A HG2    1  
ATOM   2314   H  HG3    . PRO A 1 149 ? 1.751   -7.776  2.200   1.00 0.00  ? 149  PRO A HG3    1  
ATOM   2315   H  HD2    . PRO A 1 149 ? 1.497   -7.618  -0.493  1.00 0.00  ? 149  PRO A HD2    1  
ATOM   2316   H  HD3    . PRO A 1 149 ? 0.416   -8.598  0.523   1.00 0.00  ? 149  PRO A HD3    1  
ATOM   2317   N  N      . GLN A 1 150 ? 0.761   -4.150  -0.173  1.00 54.30 ? 150  GLN A N      1  
ATOM   2318   C  CA     . GLN A 1 150 ? 1.160   -2.777  -0.615  1.00 57.16 ? 150  GLN A CA     1  
ATOM   2319   C  C      . GLN A 1 150 ? -0.015  -2.067  -1.304  1.00 59.15 ? 150  GLN A C      1  
ATOM   2320   O  O      . GLN A 1 150 ? -0.074  -0.853  -1.351  1.00 53.18 ? 150  GLN A O      1  
ATOM   2321   C  CB     . GLN A 1 150 ? 2.308   -2.995  -1.603  1.00 53.00 ? 150  GLN A CB     1  
ATOM   2322   C  CG     . GLN A 1 150 ? 1.853   -3.932  -2.724  1.00 55.35 ? 150  GLN A CG     1  
ATOM   2323   C  CD     . GLN A 1 150 ? 2.775   -3.767  -3.930  1.00 65.02 ? 150  GLN A CD     1  
ATOM   2324   O  OE1    . GLN A 1 150 ? 2.823   -2.711  -4.530  1.00 64.40 ? 150  GLN A OE1    1  
ATOM   2325   N  NE2    . GLN A 1 150 ? 3.513   -4.772  -4.313  1.00 55.83 ? 150  GLN A NE2    1  
ATOM   2326   H  H      . GLN A 1 150 ? 1.235   -4.934  -0.521  1.00 0.00  ? 150  GLN A H      1  
ATOM   2327   H  HA     . GLN A 1 150 ? 1.507   -2.198  0.227   1.00 0.00  ? 150  GLN A HA     1  
ATOM   2328   H  HB2    . GLN A 1 150 ? 2.604   -2.045  -2.025  1.00 0.00  ? 150  GLN A HB2    1  
ATOM   2329   H  HB3    . GLN A 1 150 ? 3.148   -3.436  -1.087  1.00 0.00  ? 150  GLN A HB3    1  
ATOM   2330   H  HG2    . GLN A 1 150 ? 1.893   -4.955  -2.377  1.00 0.00  ? 150  GLN A HG2    1  
ATOM   2331   H  HG3    . GLN A 1 150 ? 0.842   -3.688  -3.010  1.00 0.00  ? 150  GLN A HG3    1  
ATOM   2332   H  HE21   . GLN A 1 150 ? 3.473   -5.623  -3.828  1.00 0.00  ? 150  GLN A HE21   1  
ATOM   2333   H  HE22   . GLN A 1 150 ? 4.108   -4.676  -5.086  1.00 0.00  ? 150  GLN A HE22   1  
ATOM   2334   N  N      . LEU A 1 151 ? -0.948  -2.813  -1.838  1.00 56.65 ? 151  LEU A N      1  
ATOM   2335   C  CA     . LEU A 1 151 ? -2.118  -2.181  -2.525  1.00 54.82 ? 151  LEU A CA     1  
ATOM   2336   C  C      . LEU A 1 151 ? -3.069  -1.567  -1.496  1.00 55.75 ? 151  LEU A C      1  
ATOM   2337   O  O      . LEU A 1 151 ? -3.436  -0.412  -1.584  1.00 54.90 ? 151  LEU A O      1  
ATOM   2338   C  CB     . LEU A 1 151 ? -2.828  -3.325  -3.259  1.00 49.16 ? 151  LEU A CB     1  
ATOM   2339   C  CG     . LEU A 1 151 ? -1.944  -3.874  -4.382  1.00 52.18 ? 151  LEU A CG     1  
ATOM   2340   C  CD1    . LEU A 1 151 ? -2.714  -4.956  -5.149  1.00 49.51 ? 151  LEU A CD1    1  
ATOM   2341   C  CD2    . LEU A 1 151 ? -1.569  -2.746  -5.346  1.00 49.31 ? 151  LEU A CD2    1  
ATOM   2342   H  H      . LEU A 1 151 ? -0.880  -3.789  -1.789  1.00 0.00  ? 151  LEU A H      1  
ATOM   2343   H  HA     . LEU A 1 151 ? -1.788  -1.436  -3.230  1.00 0.00  ? 151  LEU A HA     1  
ATOM   2344   H  HB2    . LEU A 1 151 ? -3.046  -4.117  -2.558  1.00 0.00  ? 151  LEU A HB2    1  
ATOM   2345   H  HB3    . LEU A 1 151 ? -3.752  -2.957  -3.681  1.00 0.00  ? 151  LEU A HB3    1  
ATOM   2346   H  HG     . LEU A 1 151 ? -1.047  -4.302  -3.958  1.00 0.00  ? 151  LEU A HG     1  
ATOM   2347   H  HD11   . LEU A 1 151 ? -3.397  -4.490  -5.845  1.00 0.00  ? 151  LEU A HD11   1  
ATOM   2348   H  HD12   . LEU A 1 151 ? -3.272  -5.563  -4.452  1.00 0.00  ? 151  LEU A HD12   1  
ATOM   2349   H  HD13   . LEU A 1 151 ? -2.018  -5.578  -5.691  1.00 0.00  ? 151  LEU A HD13   1  
ATOM   2350   H  HD21   . LEU A 1 151 ? -1.098  -3.165  -6.221  1.00 0.00  ? 151  LEU A HD21   1  
ATOM   2351   H  HD22   . LEU A 1 151 ? -0.884  -2.068  -4.859  1.00 0.00  ? 151  LEU A HD22   1  
ATOM   2352   H  HD23   . LEU A 1 151 ? -2.460  -2.210  -5.637  1.00 0.00  ? 151  LEU A HD23   1  
ATOM   2353   N  N      . GLY A 1 152 ? -3.478  -2.343  -0.529  1.00 50.85 ? 152  GLY A N      1  
ATOM   2354   C  CA     . GLY A 1 152 ? -4.417  -1.823  0.502   1.00 45.84 ? 152  GLY A CA     1  
ATOM   2355   C  C      . GLY A 1 152 ? -5.852  -2.149  0.084   1.00 42.33 ? 152  GLY A C      1  
ATOM   2356   O  O      . GLY A 1 152 ? -6.121  -3.184  -0.494  1.00 44.12 ? 152  GLY A O      1  
ATOM   2357   H  H      . GLY A 1 152 ? -3.174  -3.274  -0.488  1.00 0.00  ? 152  GLY A H      1  
ATOM   2358   H  HA2    . GLY A 1 152 ? -4.201  -2.289  1.454   1.00 0.00  ? 152  GLY A HA2    1  
ATOM   2359   H  HA3    . GLY A 1 152 ? -4.304  -0.754  0.588   1.00 0.00  ? 152  GLY A HA3    1  
ATOM   2360   N  N      . MET A 1 153 ? -6.774  -1.272  0.371   1.00 46.44 ? 153  MET A N      1  
ATOM   2361   C  CA     . MET A 1 153 ? -8.197  -1.525  -0.009  1.00 42.93 ? 153  MET A CA     1  
ATOM   2362   C  C      . MET A 1 153 ? -8.362  -1.480  -1.533  1.00 43.25 ? 153  MET A C      1  
ATOM   2363   O  O      . MET A 1 153 ? -8.309  -0.429  -2.141  1.00 38.94 ? 153  MET A O      1  
ATOM   2364   C  CB     . MET A 1 153 ? -8.993  -0.394  0.652   1.00 38.58 ? 153  MET A CB     1  
ATOM   2365   C  CG     . MET A 1 153 ? -8.440  0.966   0.205   1.00 44.64 ? 153  MET A CG     1  
ATOM   2366   S  SD     . MET A 1 153 ? -7.884  1.907   1.649   1.00 45.93 ? 153  MET A SD     1  
ATOM   2367   C  CE     . MET A 1 153 ? -6.199  2.238   1.074   1.00 41.58 ? 153  MET A CE     1  
ATOM   2368   H  H      . MET A 1 153 ? -6.531  -0.445  0.837   1.00 0.00  ? 153  MET A H      1  
ATOM   2369   H  HA     . MET A 1 153 ? -8.524  -2.477  0.376   1.00 0.00  ? 153  MET A HA     1  
ATOM   2370   H  HB2    . MET A 1 153 ? -10.032 -0.473  0.364   1.00 0.00  ? 153  MET A HB2    1  
ATOM   2371   H  HB3    . MET A 1 153 ? -8.912  -0.480  1.725   1.00 0.00  ? 153  MET A HB3    1  
ATOM   2372   H  HG2    . MET A 1 153 ? -7.607  0.815   -0.466  1.00 0.00  ? 153  MET A HG2    1  
ATOM   2373   H  HG3    . MET A 1 153 ? -9.216  1.518   -0.306  1.00 0.00  ? 153  MET A HG3    1  
ATOM   2374   H  HE1    . MET A 1 153 ? -5.883  1.443   0.412   1.00 0.00  ? 153  MET A HE1    1  
ATOM   2375   H  HE2    . MET A 1 153 ? -5.531  2.285   1.919   1.00 0.00  ? 153  MET A HE2    1  
ATOM   2376   H  HE3    . MET A 1 153 ? -6.178  3.182   0.548   1.00 0.00  ? 153  MET A HE3    1  
ATOM   2377   N  N      . ILE A 1 154 ? -8.566  -2.612  -2.152  1.00 38.82 ? 154  ILE A N      1  
ATOM   2378   C  CA     . ILE A 1 154 ? -8.739  -2.634  -3.634  1.00 38.02 ? 154  ILE A CA     1  
ATOM   2379   C  C      . ILE A 1 154 ? -10.219 -2.822  -3.979  1.00 37.98 ? 154  ILE A C      1  
ATOM   2380   O  O      . ILE A 1 154 ? -10.941 -3.511  -3.284  1.00 41.70 ? 154  ILE A O      1  
ATOM   2381   C  CB     . ILE A 1 154 ? -7.894  -3.820  -4.116  1.00 44.96 ? 154  ILE A CB     1  
ATOM   2382   C  CG1    . ILE A 1 154 ? -7.984  -3.930  -5.640  1.00 49.09 ? 154  ILE A CG1    1  
ATOM   2383   C  CG2    . ILE A 1 154 ? -8.396  -5.121  -3.483  1.00 44.19 ? 154  ILE A CG2    1  
ATOM   2384   C  CD1    . ILE A 1 154 ? -6.787  -4.729  -6.162  1.00 46.71 ? 154  ILE A CD1    1  
ATOM   2385   H  H      . ILE A 1 154 ? -8.609  -3.448  -1.642  1.00 0.00  ? 154  ILE A H      1  
ATOM   2386   H  HA     . ILE A 1 154 ? -8.368  -1.718  -4.067  1.00 0.00  ? 154  ILE A HA     1  
ATOM   2387   H  HB     . ILE A 1 154 ? -6.865  -3.660  -3.829  1.00 0.00  ? 154  ILE A HB     1  
ATOM   2388   H  HG12   . ILE A 1 154 ? -8.901  -4.432  -5.911  1.00 0.00  ? 154  ILE A HG12   1  
ATOM   2389   H  HG13   . ILE A 1 154 ? -7.972  -2.941  -6.074  1.00 0.00  ? 154  ILE A HG13   1  
ATOM   2390   H  HG21   . ILE A 1 154 ? -8.366  -5.913  -4.216  1.00 0.00  ? 154  ILE A HG21   1  
ATOM   2391   H  HG22   . ILE A 1 154 ? -9.409  -4.990  -3.137  1.00 0.00  ? 154  ILE A HG22   1  
ATOM   2392   H  HG23   . ILE A 1 154 ? -7.763  -5.381  -2.647  1.00 0.00  ? 154  ILE A HG23   1  
ATOM   2393   H  HD11   . ILE A 1 154 ? -6.044  -4.050  -6.554  1.00 0.00  ? 154  ILE A HD11   1  
ATOM   2394   H  HD12   . ILE A 1 154 ? -7.114  -5.394  -6.946  1.00 0.00  ? 154  ILE A HD12   1  
ATOM   2395   H  HD13   . ILE A 1 154 ? -6.359  -5.306  -5.357  1.00 0.00  ? 154  ILE A HD13   1  
ATOM   2396   N  N      . ASP A 1 155 ? -10.686 -2.208  -5.035  1.00 38.26 ? 155  ASP A N      1  
ATOM   2397   C  CA     . ASP A 1 155 ? -12.124 -2.358  -5.390  1.00 31.66 ? 155  ASP A CA     1  
ATOM   2398   C  C      . ASP A 1 155 ? -12.440 -3.714  -6.033  1.00 36.59 ? 155  ASP A C      1  
ATOM   2399   O  O      . ASP A 1 155 ? -11.824 -4.125  -6.998  1.00 36.40 ? 155  ASP A O      1  
ATOM   2400   C  CB     . ASP A 1 155 ? -12.393 -1.245  -6.405  1.00 33.84 ? 155  ASP A CB     1  
ATOM   2401   C  CG     . ASP A 1 155 ? -12.250 0.122   -5.733  1.00 37.07 ? 155  ASP A CG     1  
ATOM   2402   O  OD1    . ASP A 1 155 ? -13.044 0.415   -4.854  1.00 35.73 ? 155  ASP A OD1    1  
ATOM   2403   O  OD2    . ASP A 1 155 ? -11.352 0.855   -6.114  1.00 37.99 ? 155  ASP A OD2    1  
ATOM   2404   H  H      . ASP A 1 155 ? -10.101 -1.644  -5.587  1.00 0.00  ? 155  ASP A H      1  
ATOM   2405   H  HA     . ASP A 1 155 ? -12.741 -2.206  -4.520  1.00 0.00  ? 155  ASP A HA     1  
ATOM   2406   H  HB2    . ASP A 1 155 ? -11.683 -1.321  -7.217  1.00 0.00  ? 155  ASP A HB2    1  
ATOM   2407   H  HB3    . ASP A 1 155 ? -13.394 -1.349  -6.794  1.00 0.00  ? 155  ASP A HB3    1  
ATOM   2408   N  N      . ARG A 1 156 ? -13.470 -4.352  -5.549  1.00 36.82 ? 156  ARG A N      1  
ATOM   2409   C  CA     . ARG A 1 156 ? -13.952 -5.623  -6.154  1.00 36.08 ? 156  ARG A CA     1  
ATOM   2410   C  C      . ARG A 1 156 ? -15.205 -5.198  -6.918  1.00 37.49 ? 156  ARG A C      1  
ATOM   2411   O  O      . ARG A 1 156 ? -16.193 -4.842  -6.313  1.00 39.29 ? 156  ARG A O      1  
ATOM   2412   C  CB     . ARG A 1 156 ? -14.273 -6.540  -4.963  1.00 38.75 ? 156  ARG A CB     1  
ATOM   2413   C  CG     . ARG A 1 156 ? -14.486 -7.978  -5.450  1.00 46.12 ? 156  ARG A CG     1  
ATOM   2414   C  CD     . ARG A 1 156 ? -13.650 -8.947  -4.610  1.00 47.82 ? 156  ARG A CD     1  
ATOM   2415   N  NE     . ARG A 1 156 ? -13.812 -10.267 -5.285  1.00 59.93 ? 156  ARG A NE     1  
ATOM   2416   C  CZ     . ARG A 1 156 ? -12.952 -11.233 -5.078  1.00 63.34 ? 156  ARG A CZ     1  
ATOM   2417   N  NH1    . ARG A 1 156 ? -11.942 -11.063 -4.265  1.00 57.22 ? 156  ARG A NH1    1  
ATOM   2418   N  NH2    . ARG A 1 156 ? -13.108 -12.378 -5.686  1.00 62.27 ? 156  ARG A NH2    1  
ATOM   2419   H  H      . ARG A 1 156 ? -13.989 -3.942  -4.826  1.00 0.00  ? 156  ARG A H      1  
ATOM   2420   H  HA     . ARG A 1 156 ? -13.212 -6.056  -6.808  1.00 0.00  ? 156  ARG A HA     1  
ATOM   2421   H  HB2    . ARG A 1 156 ? -13.449 -6.516  -4.262  1.00 0.00  ? 156  ARG A HB2    1  
ATOM   2422   H  HB3    . ARG A 1 156 ? -15.169 -6.193  -4.473  1.00 0.00  ? 156  ARG A HB3    1  
ATOM   2423   H  HG2    . ARG A 1 156 ? -15.530 -8.236  -5.357  1.00 0.00  ? 156  ARG A HG2    1  
ATOM   2424   H  HG3    . ARG A 1 156 ? -14.188 -8.055  -6.484  1.00 0.00  ? 156  ARG A HG3    1  
ATOM   2425   H  HD2    . ARG A 1 156 ? -12.611 -8.644  -4.611  1.00 0.00  ? 156  ARG A HD2    1  
ATOM   2426   H  HD3    . ARG A 1 156 ? -14.027 -8.998  -3.601  1.00 0.00  ? 156  ARG A HD3    1  
ATOM   2427   H  HE     . ARG A 1 156 ? -14.568 -10.412 -5.892  1.00 0.00  ? 156  ARG A HE     1  
ATOM   2428   H  HH11   . ARG A 1 156 ? -11.818 -10.192 -3.794  1.00 0.00  ? 156  ARG A HH11   1  
ATOM   2429   H  HH12   . ARG A 1 156 ? -11.291 -11.807 -4.116  1.00 0.00  ? 156  ARG A HH12   1  
ATOM   2430   H  HH21   . ARG A 1 156 ? -13.880 -12.514 -6.307  1.00 0.00  ? 156  ARG A HH21   1  
ATOM   2431   H  HH22   . ARG A 1 156 ? -12.454 -13.119 -5.533  1.00 0.00  ? 156  ARG A HH22   1  
ATOM   2432   N  N      . TRP A 1 157 ? -15.138 -5.113  -8.223  1.00 38.11 ? 157  TRP A N      1  
ATOM   2433   C  CA     . TRP A 1 157 ? -16.306 -4.578  -8.990  1.00 37.45 ? 157  TRP A CA     1  
ATOM   2434   C  C      . TRP A 1 157 ? -17.404 -5.595  -9.282  1.00 40.27 ? 157  TRP A C      1  
ATOM   2435   O  O      . TRP A 1 157 ? -17.209 -6.797  -9.265  1.00 41.73 ? 157  TRP A O      1  
ATOM   2436   C  CB     . TRP A 1 157 ? -15.707 -4.041  -10.288 1.00 34.90 ? 157  TRP A CB     1  
ATOM   2437   C  CG     . TRP A 1 157 ? -14.656 -3.026  -9.957  1.00 36.27 ? 157  TRP A CG     1  
ATOM   2438   C  CD1    . TRP A 1 157 ? -13.325 -3.236  -10.042 1.00 31.97 ? 157  TRP A CD1    1  
ATOM   2439   C  CD2    . TRP A 1 157 ? -14.823 -1.659  -9.482  1.00 34.77 ? 157  TRP A CD2    1  
ATOM   2440   N  NE1    . TRP A 1 157 ? -12.663 -2.088  -9.651  1.00 30.69 ? 157  TRP A NE1    1  
ATOM   2441   C  CE2    . TRP A 1 157 ? -13.540 -1.089  -9.297  1.00 32.19 ? 157  TRP A CE2    1  
ATOM   2442   C  CE3    . TRP A 1 157 ? -15.949 -0.864  -9.196  1.00 34.83 ? 157  TRP A CE3    1  
ATOM   2443   C  CZ2    . TRP A 1 157 ? -13.374 0.217   -8.846  1.00 31.62 ? 157  TRP A CZ2    1  
ATOM   2444   C  CZ3    . TRP A 1 157 ? -15.788 0.456   -8.740  1.00 34.07 ? 157  TRP A CZ3    1  
ATOM   2445   C  CH2    . TRP A 1 157 ? -14.500 0.995   -8.565  1.00 33.14 ? 157  TRP A CH2    1  
ATOM   2446   H  H      . TRP A 1 157 ? -14.305 -5.355  -8.686  1.00 0.00  ? 157  TRP A H      1  
ATOM   2447   H  HA     . TRP A 1 157 ? -16.731 -3.753  -8.443  1.00 0.00  ? 157  TRP A HA     1  
ATOM   2448   H  HB2    . TRP A 1 157 ? -15.265 -4.851  -10.848 1.00 0.00  ? 157  TRP A HB2    1  
ATOM   2449   H  HB3    . TRP A 1 157 ? -16.484 -3.575  -10.877 1.00 0.00  ? 157  TRP A HB3    1  
ATOM   2450   H  HD1    . TRP A 1 157 ? -12.855 -4.151  -10.362 1.00 0.00  ? 157  TRP A HD1    1  
ATOM   2451   H  HE1    . TRP A 1 157 ? -11.689 -1.977  -9.622  1.00 0.00  ? 157  TRP A HE1    1  
ATOM   2452   H  HE3    . TRP A 1 157 ? -16.943 -1.272  -9.329  1.00 0.00  ? 157  TRP A HE3    1  
ATOM   2453   H  HZ2    . TRP A 1 157 ? -12.382 0.623   -8.714  1.00 0.00  ? 157  TRP A HZ2    1  
ATOM   2454   H  HZ3    . TRP A 1 157 ? -16.658 1.060   -8.523  1.00 0.00  ? 157  TRP A HZ3    1  
ATOM   2455   H  HH2    . TRP A 1 157 ? -14.380 2.009   -8.215  1.00 0.00  ? 157  TRP A HH2    1  
ATOM   2456   N  N      . TYR A 1 158 ? -18.570 -5.069  -9.551  1.00 40.16 ? 158  TYR A N      1  
ATOM   2457   C  CA     . TYR A 1 158 ? -19.756 -5.909  -9.852  1.00 38.93 ? 158  TYR A CA     1  
ATOM   2458   C  C      . TYR A 1 158 ? -20.774 -5.084  -10.636 1.00 40.47 ? 158  TYR A C      1  
ATOM   2459   O  O      . TYR A 1 158 ? -20.818 -3.873  -10.516 1.00 39.12 ? 158  TYR A O      1  
ATOM   2460   C  CB     . TYR A 1 158 ? -20.392 -6.217  -8.490  1.00 38.66 ? 158  TYR A CB     1  
ATOM   2461   C  CG     . TYR A 1 158 ? -19.536 -7.131  -7.666  1.00 40.25 ? 158  TYR A CG     1  
ATOM   2462   C  CD1    . TYR A 1 158 ? -19.698 -8.518  -7.770  1.00 37.43 ? 158  TYR A CD1    1  
ATOM   2463   C  CD2    . TYR A 1 158 ? -18.607 -6.593  -6.764  1.00 37.55 ? 158  TYR A CD2    1  
ATOM   2464   C  CE1    . TYR A 1 158 ? -18.925 -9.370  -6.975  1.00 38.45 ? 158  TYR A CE1    1  
ATOM   2465   C  CE2    . TYR A 1 158 ? -17.836 -7.444  -5.966  1.00 38.65 ? 158  TYR A CE2    1  
ATOM   2466   C  CZ     . TYR A 1 158 ? -17.995 -8.834  -6.072  1.00 42.94 ? 158  TYR A CZ     1  
ATOM   2467   O  OH     . TYR A 1 158 ? -17.239 -9.674  -5.287  1.00 43.40 ? 158  TYR A OH     1  
ATOM   2468   H  H      . TYR A 1 158 ? -18.671 -4.090  -9.547  1.00 0.00  ? 158  TYR A H      1  
ATOM   2469   H  HA     . TYR A 1 158 ? -19.487 -6.817  -10.366 1.00 0.00  ? 158  TYR A HA     1  
ATOM   2470   H  HB2    . TYR A 1 158 ? -20.532 -5.293  -7.948  1.00 0.00  ? 158  TYR A HB2    1  
ATOM   2471   H  HB3    . TYR A 1 158 ? -21.356 -6.680  -8.646  1.00 0.00  ? 158  TYR A HB3    1  
ATOM   2472   H  HD1    . TYR A 1 158 ? -20.415 -8.930  -8.467  1.00 0.00  ? 158  TYR A HD1    1  
ATOM   2473   H  HD2    . TYR A 1 158 ? -18.485 -5.521  -6.687  1.00 0.00  ? 158  TYR A HD2    1  
ATOM   2474   H  HE1    . TYR A 1 158 ? -19.047 -10.441 -7.053  1.00 0.00  ? 158  TYR A HE1    1  
ATOM   2475   H  HE2    . TYR A 1 158 ? -17.119 -7.031  -5.268  1.00 0.00  ? 158  TYR A HE2    1  
ATOM   2476   H  HH     . TYR A 1 158 ? -17.092 -10.483 -5.779  1.00 0.00  ? 158  TYR A HH     1  
ATOM   2477   N  N      . HIS A 1 159 ? -21.664 -5.730  -11.336 1.00 41.59 ? 159  HIS A N      1  
ATOM   2478   C  CA     . HIS A 1 159 ? -22.756 -4.978  -12.001 1.00 35.86 ? 159  HIS A CA     1  
ATOM   2479   C  C      . HIS A 1 159 ? -23.706 -4.614  -10.859 1.00 36.55 ? 159  HIS A C      1  
ATOM   2480   O  O      . HIS A 1 159 ? -23.768 -5.354  -9.895  1.00 38.38 ? 159  HIS A O      1  
ATOM   2481   C  CB     . HIS A 1 159 ? -23.437 -5.970  -12.951 1.00 39.03 ? 159  HIS A CB     1  
ATOM   2482   C  CG     . HIS A 1 159 ? -22.541 -6.309  -14.113 1.00 41.27 ? 159  HIS A CG     1  
ATOM   2483   N  ND1    . HIS A 1 159 ? -22.057 -7.595  -14.325 1.00 40.43 ? 159  HIS A ND1    1  
ATOM   2484   C  CD2    . HIS A 1 159 ? -22.075 -5.551  -15.159 1.00 32.47 ? 159  HIS A CD2    1  
ATOM   2485   C  CE1    . HIS A 1 159 ? -21.340 -7.569  -15.465 1.00 39.34 ? 159  HIS A CE1    1  
ATOM   2486   N  NE2    . HIS A 1 159 ? -21.321 -6.349  -16.015 1.00 37.14 ? 159  HIS A NE2    1  
ATOM   2487   H  H      . HIS A 1 159 ? -21.669 -6.702  -11.339 1.00 0.00  ? 159  HIS A H      1  
ATOM   2488   H  HA     . HIS A 1 159 ? -22.389 -4.104  -12.522 1.00 0.00  ? 159  HIS A HA     1  
ATOM   2489   H  HB2    . HIS A 1 159 ? -23.673 -6.871  -12.412 1.00 0.00  ? 159  HIS A HB2    1  
ATOM   2490   H  HB3    . HIS A 1 159 ? -24.350 -5.530  -13.326 1.00 0.00  ? 159  HIS A HB3    1  
ATOM   2491   H  HD2    . HIS A 1 159 ? -22.267 -4.491  -15.294 1.00 0.00  ? 159  HIS A HD2    1  
ATOM   2492   H  HE1    . HIS A 1 159 ? -20.851 -8.435  -15.887 1.00 0.00  ? 159  HIS A HE1    1  
ATOM   2493   H  HE2    . HIS A 1 159 ? -20.874 -6.074  -16.844 1.00 0.00  ? 159  HIS A HE2    1  
ATOM   2494   N  N      . PRO A 1 160 ? -24.414 -3.519  -10.947 1.00 37.28 ? 160  PRO A N      1  
ATOM   2495   C  CA     . PRO A 1 160 ? -25.327 -3.138  -9.833  1.00 34.29 ? 160  PRO A CA     1  
ATOM   2496   C  C      . PRO A 1 160 ? -26.294 -4.289  -9.502  1.00 36.50 ? 160  PRO A C      1  
ATOM   2497   O  O      . PRO A 1 160 ? -26.505 -4.614  -8.347  1.00 37.39 ? 160  PRO A O      1  
ATOM   2498   C  CB     . PRO A 1 160 ? -26.026 -1.884  -10.370 1.00 35.05 ? 160  PRO A CB     1  
ATOM   2499   C  CG     . PRO A 1 160 ? -25.867 -1.985  -11.851 1.00 33.55 ? 160  PRO A CG     1  
ATOM   2500   C  CD     . PRO A 1 160 ? -24.491 -2.568  -12.054 1.00 33.56 ? 160  PRO A CD     1  
ATOM   2501   H  HA     . PRO A 1 160 ? -24.750 -2.882  -8.957  1.00 0.00  ? 160  PRO A HA     1  
ATOM   2502   H  HB2    . PRO A 1 160 ? -27.072 -1.891  -10.096 1.00 0.00  ? 160  PRO A HB2    1  
ATOM   2503   H  HB3    . PRO A 1 160 ? -25.541 -0.993  -10.003 1.00 0.00  ? 160  PRO A HB3    1  
ATOM   2504   H  HG2    . PRO A 1 160 ? -26.623 -2.639  -12.265 1.00 0.00  ? 160  PRO A HG2    1  
ATOM   2505   H  HG3    . PRO A 1 160 ? -25.922 -1.008  -12.304 1.00 0.00  ? 160  PRO A HG3    1  
ATOM   2506   H  HD2    . PRO A 1 160 ? -24.424 -3.072  -13.009 1.00 0.00  ? 160  PRO A HD2    1  
ATOM   2507   H  HD3    . PRO A 1 160 ? -23.730 -1.810  -11.957 1.00 0.00  ? 160  PRO A HD3    1  
ATOM   2508   N  N      . GLY A 1 161 ? -26.852 -4.929  -10.498 1.00 36.49 ? 161  GLY A N      1  
ATOM   2509   C  CA     . GLY A 1 161 ? -27.774 -6.075  -10.227 1.00 35.51 ? 161  GLY A CA     1  
ATOM   2510   C  C      . GLY A 1 161 ? -26.994 -7.197  -9.526  1.00 37.90 ? 161  GLY A C      1  
ATOM   2511   O  O      . GLY A 1 161 ? -27.393 -7.685  -8.484  1.00 40.53 ? 161  GLY A O      1  
ATOM   2512   H  H      . GLY A 1 161 ? -26.665 -4.671  -11.426 1.00 0.00  ? 161  GLY A H      1  
ATOM   2513   H  HA2    . GLY A 1 161 ? -28.586 -5.745  -9.594  1.00 0.00  ? 161  GLY A HA2    1  
ATOM   2514   H  HA3    . GLY A 1 161 ? -28.172 -6.446  -11.160 1.00 0.00  ? 161  GLY A HA3    1  
ATOM   2515   N  N      . CYS A 1 162 ? -25.876 -7.603  -10.084 1.00 39.98 ? 162  CYS A N      1  
ATOM   2516   C  CA     . CYS A 1 162 ? -25.064 -8.686  -9.440  1.00 40.24 ? 162  CYS A CA     1  
ATOM   2517   C  C      . CYS A 1 162 ? -24.688 -8.288  -7.998  1.00 39.36 ? 162  CYS A C      1  
ATOM   2518   O  O      . CYS A 1 162 ? -24.723 -9.099  -7.091  1.00 39.63 ? 162  CYS A O      1  
ATOM   2519   C  CB     . CYS A 1 162 ? -23.797 -8.813  -10.297 1.00 40.16 ? 162  CYS A CB     1  
ATOM   2520   S  SG     . CYS A 1 162 ? -24.213 -9.388  -11.966 1.00 45.50 ? 162  CYS A SG     1  
ATOM   2521   H  H      . CYS A 1 162 ? -25.564 -7.189  -10.918 1.00 0.00  ? 162  CYS A H      1  
ATOM   2522   H  HA     . CYS A 1 162 ? -25.608 -9.617  -9.447  1.00 0.00  ? 162  CYS A HA     1  
ATOM   2523   H  HB2    . CYS A 1 162 ? -23.312 -7.851  -10.362 1.00 0.00  ? 162  CYS A HB2    1  
ATOM   2524   H  HB3    . CYS A 1 162 ? -23.124 -9.520  -9.833  1.00 0.00  ? 162  CYS A HB3    1  
ATOM   2525   N  N      . PHE A 1 163 ? -24.331 -7.036  -7.789  1.00 36.66 ? 163  PHE A N      1  
ATOM   2526   C  CA     . PHE A 1 163 ? -23.955 -6.569  -6.419  1.00 36.06 ? 163  PHE A CA     1  
ATOM   2527   C  C      . PHE A 1 163 ? -25.144 -6.730  -5.469  1.00 38.77 ? 163  PHE A C      1  
ATOM   2528   O  O      . PHE A 1 163 ? -25.002 -7.196  -4.355  1.00 38.96 ? 163  PHE A O      1  
ATOM   2529   C  CB     . PHE A 1 163 ? -23.590 -5.092  -6.587  1.00 35.09 ? 163  PHE A CB     1  
ATOM   2530   C  CG     . PHE A 1 163 ? -23.070 -4.546  -5.281  1.00 34.98 ? 163  PHE A CG     1  
ATOM   2531   C  CD1    . PHE A 1 163 ? -23.968 -4.128  -4.287  1.00 37.79 ? 163  PHE A CD1    1  
ATOM   2532   C  CD2    . PHE A 1 163 ? -21.687 -4.448  -5.065  1.00 35.00 ? 163  PHE A CD2    1  
ATOM   2533   C  CE1    . PHE A 1 163 ? -23.483 -3.612  -3.076  1.00 36.87 ? 163  PHE A CE1    1  
ATOM   2534   C  CE2    . PHE A 1 163 ? -21.200 -3.934  -3.854  1.00 33.70 ? 163  PHE A CE2    1  
ATOM   2535   C  CZ     . PHE A 1 163 ? -22.099 -3.515  -2.860  1.00 37.86 ? 163  PHE A CZ     1  
ATOM   2536   H  H      . PHE A 1 163 ? -24.325 -6.423  -8.555  1.00 0.00  ? 163  PHE A H      1  
ATOM   2537   H  HA     . PHE A 1 163 ? -23.104 -7.123  -6.053  1.00 0.00  ? 163  PHE A HA     1  
ATOM   2538   H  HB2    . PHE A 1 163 ? -22.828 -4.993  -7.345  1.00 0.00  ? 163  PHE A HB2    1  
ATOM   2539   H  HB3    . PHE A 1 163 ? -24.467 -4.535  -6.883  1.00 0.00  ? 163  PHE A HB3    1  
ATOM   2540   H  HD1    . PHE A 1 163 ? -25.033 -4.204  -4.454  1.00 0.00  ? 163  PHE A HD1    1  
ATOM   2541   H  HD2    . PHE A 1 163 ? -20.996 -4.771  -5.831  1.00 0.00  ? 163  PHE A HD2    1  
ATOM   2542   H  HE1    . PHE A 1 163 ? -24.176 -3.289  -2.309  1.00 0.00  ? 163  PHE A HE1    1  
ATOM   2543   H  HE2    . PHE A 1 163 ? -20.133 -3.860  -3.687  1.00 0.00  ? 163  PHE A HE2    1  
ATOM   2544   H  HZ     . PHE A 1 163 ? -21.725 -3.118  -1.926  1.00 0.00  ? 163  PHE A HZ     1  
ATOM   2545   N  N      . VAL A 1 164 ? -26.318 -6.334  -5.905  1.00 38.52 ? 164  VAL A N      1  
ATOM   2546   C  CA     . VAL A 1 164 ? -27.510 -6.436  -5.025  1.00 37.41 ? 164  VAL A CA     1  
ATOM   2547   C  C      . VAL A 1 164 ? -27.784 -7.905  -4.684  1.00 39.01 ? 164  VAL A C      1  
ATOM   2548   O  O      . VAL A 1 164 ? -28.150 -8.226  -3.573  1.00 35.35 ? 164  VAL A O      1  
ATOM   2549   C  CB     . VAL A 1 164 ? -28.655 -5.836  -5.841  1.00 33.41 ? 164  VAL A CB     1  
ATOM   2550   C  CG1    . VAL A 1 164 ? -29.957 -5.916  -5.041  1.00 29.14 ? 164  VAL A CG1    1  
ATOM   2551   C  CG2    . VAL A 1 164 ? -28.339 -4.371  -6.145  1.00 37.85 ? 164  VAL A CG2    1  
ATOM   2552   H  H      . VAL A 1 164 ? -26.358 -5.909  -6.786  1.00 0.00  ? 164  VAL A H      1  
ATOM   2553   H  HA     . VAL A 1 164 ? -27.368 -5.863  -4.120  1.00 0.00  ? 164  VAL A HA     1  
ATOM   2554   H  HB     . VAL A 1 164 ? -28.764 -6.384  -6.766  1.00 0.00  ? 164  VAL A HB     1  
ATOM   2555   H  HG11   . VAL A 1 164 ? -29.824 -5.425  -4.089  1.00 0.00  ? 164  VAL A HG11   1  
ATOM   2556   H  HG12   . VAL A 1 164 ? -30.218 -6.952  -4.878  1.00 0.00  ? 164  VAL A HG12   1  
ATOM   2557   H  HG13   . VAL A 1 164 ? -30.748 -5.428  -5.591  1.00 0.00  ? 164  VAL A HG13   1  
ATOM   2558   H  HG21   . VAL A 1 164 ? -27.270 -4.223  -6.132  1.00 0.00  ? 164  VAL A HG21   1  
ATOM   2559   H  HG22   . VAL A 1 164 ? -28.798 -3.742  -5.396  1.00 0.00  ? 164  VAL A HG22   1  
ATOM   2560   H  HG23   . VAL A 1 164 ? -28.727 -4.113  -7.119  1.00 0.00  ? 164  VAL A HG23   1  
ATOM   2561   N  N      . LYS A 1 165 ? -27.611 -8.801  -5.625  1.00 37.09 ? 165  LYS A N      1  
ATOM   2562   C  CA     . LYS A 1 165 ? -27.874 -10.249 -5.332  1.00 40.62 ? 165  LYS A CA     1  
ATOM   2563   C  C      . LYS A 1 165 ? -26.992 -10.751 -4.177  1.00 43.07 ? 165  LYS A C      1  
ATOM   2564   O  O      . LYS A 1 165 ? -27.401 -11.580 -3.383  1.00 42.59 ? 165  LYS A O      1  
ATOM   2565   C  CB     . LYS A 1 165 ? -27.522 -10.986 -6.623  1.00 42.78 ? 165  LYS A CB     1  
ATOM   2566   C  CG     . LYS A 1 165 ? -28.480 -12.164 -6.817  1.00 48.35 ? 165  LYS A CG     1  
ATOM   2567   C  CD     . LYS A 1 165 ? -28.503 -12.569 -8.294  1.00 58.08 ? 165  LYS A CD     1  
ATOM   2568   C  CE     . LYS A 1 165 ? -27.207 -13.305 -8.647  1.00 64.74 ? 165  LYS A CE     1  
ATOM   2569   N  NZ     . LYS A 1 165 ? -27.115 -13.234 -10.133 1.00 65.53 ? 165  LYS A NZ     1  
ATOM   2570   H  H      . LYS A 1 165 ? -27.313 -8.522  -6.519  1.00 0.00  ? 165  LYS A H      1  
ATOM   2571   H  HA     . LYS A 1 165 ? -28.916 -10.400 -5.099  1.00 0.00  ? 165  LYS A HA     1  
ATOM   2572   H  HB2    . LYS A 1 165 ? -27.608 -10.307 -7.458  1.00 0.00  ? 165  LYS A HB2    1  
ATOM   2573   H  HB3    . LYS A 1 165 ? -26.509 -11.355 -6.561  1.00 0.00  ? 165  LYS A HB3    1  
ATOM   2574   H  HG2    . LYS A 1 165 ? -28.149 -13.000 -6.218  1.00 0.00  ? 165  LYS A HG2    1  
ATOM   2575   H  HG3    . LYS A 1 165 ? -29.474 -11.873 -6.511  1.00 0.00  ? 165  LYS A HG3    1  
ATOM   2576   H  HD2    . LYS A 1 165 ? -29.347 -13.220 -8.474  1.00 0.00  ? 165  LYS A HD2    1  
ATOM   2577   H  HD3    . LYS A 1 165 ? -28.593 -11.687 -8.909  1.00 0.00  ? 165  LYS A HD3    1  
ATOM   2578   H  HE2    . LYS A 1 165 ? -26.360 -12.812 -8.191  1.00 0.00  ? 165  LYS A HE2    1  
ATOM   2579   H  HE3    . LYS A 1 165 ? -27.260 -14.335 -8.330  1.00 0.00  ? 165  LYS A HE3    1  
ATOM   2580   H  HZ1    . LYS A 1 165 ? -27.127 -12.239 -10.435 1.00 0.00  ? 165  LYS A HZ1    1  
ATOM   2581   H  HZ2    . LYS A 1 165 ? -27.925 -13.735 -10.555 1.00 0.00  ? 165  LYS A HZ2    1  
ATOM   2582   H  HZ3    . LYS A 1 165 ? -26.230 -13.679 -10.448 1.00 0.00  ? 165  LYS A HZ3    1  
ATOM   2583   N  N      . ASN A 1 166 ? -25.792 -10.257 -4.083  1.00 38.21 ? 166  ASN A N      1  
ATOM   2584   C  CA     . ASN A 1 166 ? -24.862 -10.689 -2.980  1.00 40.49 ? 166  ASN A CA     1  
ATOM   2585   C  C      . ASN A 1 166 ? -24.709 -9.599  -1.903  1.00 40.40 ? 166  ASN A C      1  
ATOM   2586   O  O      . ASN A 1 166 ? -23.686 -9.512  -1.245  1.00 38.20 ? 166  ASN A O      1  
ATOM   2587   C  CB     . ASN A 1 166 ? -23.523 -10.906 -3.687  1.00 42.92 ? 166  ASN A CB     1  
ATOM   2588   C  CG     . ASN A 1 166 ? -23.651 -12.058 -4.684  1.00 48.43 ? 166  ASN A CG     1  
ATOM   2589   O  OD1    . ASN A 1 166 ? -23.598 -13.210 -4.304  1.00 50.79 ? 166  ASN A OD1    1  
ATOM   2590   N  ND2    . ASN A 1 166 ? -23.820 -11.797 -5.953  1.00 42.15 ? 166  ASN A ND2    1  
ATOM   2591   H  H      . ASN A 1 166 ? -25.475 -9.578  -4.712  1.00 0.00  ? 166  ASN A H      1  
ATOM   2592   H  HA     . ASN A 1 166 ? -25.199 -11.612 -2.539  1.00 0.00  ? 166  ASN A HA     1  
ATOM   2593   H  HB2    . ASN A 1 166 ? -23.247 -10.002 -4.213  1.00 0.00  ? 166  ASN A HB2    1  
ATOM   2594   H  HB3    . ASN A 1 166 ? -22.764 -11.144 -2.958  1.00 0.00  ? 166  ASN A HB3    1  
ATOM   2595   H  HD21   . ASN A 1 166 ? -23.865 -10.868 -6.262  1.00 0.00  ? 166  ASN A HD21   1  
ATOM   2596   H  HD22   . ASN A 1 166 ? -23.901 -12.532 -6.597  1.00 0.00  ? 166  ASN A HD22   1  
ATOM   2597   N  N      . ARG A 1 167 ? -25.709 -8.757  -1.721  1.00 37.94 ? 167  ARG A N      1  
ATOM   2598   C  CA     . ARG A 1 167 ? -25.590 -7.662  -0.702  1.00 39.05 ? 167  ARG A CA     1  
ATOM   2599   C  C      . ARG A 1 167 ? -25.213 -8.208  0.680   1.00 39.34 ? 167  ARG A C      1  
ATOM   2600   O  O      . ARG A 1 167 ? -24.456 -7.597  1.413   1.00 38.35 ? 167  ARG A O      1  
ATOM   2601   C  CB     . ARG A 1 167 ? -26.968 -6.978  -0.642  1.00 39.99 ? 167  ARG A CB     1  
ATOM   2602   C  CG     . ARG A 1 167 ? -28.099 -8.016  -0.575  1.00 42.58 ? 167  ARG A CG     1  
ATOM   2603   C  CD     . ARG A 1 167 ? -29.035 -7.698  0.598   1.00 35.34 ? 167  ARG A CD     1  
ATOM   2604   N  NE     . ARG A 1 167 ? -28.172 -7.723  1.817   1.00 41.05 ? 167  ARG A NE     1  
ATOM   2605   C  CZ     . ARG A 1 167 ? -28.694 -7.915  3.006   1.00 51.93 ? 167  ARG A CZ     1  
ATOM   2606   N  NH1    . ARG A 1 167 ? -29.984 -8.067  3.155   1.00 43.20 ? 167  ARG A NH1    1  
ATOM   2607   N  NH2    . ARG A 1 167 ? -27.916 -7.947  4.054   1.00 41.96 ? 167  ARG A NH2    1  
ATOM   2608   H  H      . ARG A 1 167 ? -26.507 -8.839  -2.287  1.00 0.00  ? 167  ARG A H      1  
ATOM   2609   H  HA     . ARG A 1 167 ? -24.851 -6.943  -1.023  1.00 0.00  ? 167  ARG A HA     1  
ATOM   2610   H  HB2    . ARG A 1 167 ? -27.011 -6.352  0.237   1.00 0.00  ? 167  ARG A HB2    1  
ATOM   2611   H  HB3    . ARG A 1 167 ? -27.100 -6.365  -1.520  1.00 0.00  ? 167  ARG A HB3    1  
ATOM   2612   H  HG2    . ARG A 1 167 ? -28.665 -7.985  -1.495  1.00 0.00  ? 167  ARG A HG2    1  
ATOM   2613   H  HG3    . ARG A 1 167 ? -27.683 -9.003  -0.445  1.00 0.00  ? 167  ARG A HG3    1  
ATOM   2614   H  HD2    . ARG A 1 167 ? -29.478 -6.720  0.467   1.00 0.00  ? 167  ARG A HD2    1  
ATOM   2615   H  HD3    . ARG A 1 167 ? -29.805 -8.451  0.674   1.00 0.00  ? 167  ARG A HD3    1  
ATOM   2616   H  HE     . ARG A 1 167 ? -27.207 -7.597  1.731   1.00 0.00  ? 167  ARG A HE     1  
ATOM   2617   H  HH11   . ARG A 1 167 ? -30.590 -8.037  2.362   1.00 0.00  ? 167  ARG A HH11   1  
ATOM   2618   H  HH12   . ARG A 1 167 ? -30.365 -8.215  4.068   1.00 0.00  ? 167  ARG A HH12   1  
ATOM   2619   H  HH21   . ARG A 1 167 ? -26.928 -7.826  3.949   1.00 0.00  ? 167  ARG A HH21   1  
ATOM   2620   H  HH22   . ARG A 1 167 ? -28.307 -8.092  4.963   1.00 0.00  ? 167  ARG A HH22   1  
ATOM   2621   N  N      . GLU A 1 168 ? -25.743 -9.329  1.043   1.00 40.65 ? 168  GLU A N      1  
ATOM   2622   C  CA     . GLU A 1 168 ? -25.437 -9.907  2.396   1.00 42.51 ? 168  GLU A CA     1  
ATOM   2623   C  C      . GLU A 1 168 ? -23.966 -10.308 2.523   1.00 40.26 ? 168  GLU A C      1  
ATOM   2624   O  O      . GLU A 1 168 ? -23.268 -9.869  3.424   1.00 40.66 ? 168  GLU A O      1  
ATOM   2625   C  CB     . GLU A 1 168 ? -26.332 -11.143 2.507   1.00 45.78 ? 168  GLU A CB     1  
ATOM   2626   C  CG     . GLU A 1 168 ? -26.427 -11.582 3.969   1.00 50.57 ? 168  GLU A CG     1  
ATOM   2627   C  CD     . GLU A 1 168 ? -27.706 -12.397 4.173   1.00 52.78 ? 168  GLU A CD     1  
ATOM   2628   O  OE1    . GLU A 1 168 ? -27.962 -13.274 3.363   1.00 57.98 ? 168  GLU A OE1    1  
ATOM   2629   O  OE2    . GLU A 1 168 ? -28.410 -12.130 5.133   1.00 52.91 ? 168  GLU A OE2    1  
ATOM   2630   H  H      . GLU A 1 168 ? -26.347 -9.820  0.454   1.00 0.00  ? 168  GLU A H      1  
ATOM   2631   H  HA     . GLU A 1 168 ? -25.699 -9.203  3.166   1.00 0.00  ? 168  GLU A HA     1  
ATOM   2632   H  HB2    . GLU A 1 168 ? -27.319 -10.905 2.137   1.00 0.00  ? 168  GLU A HB2    1  
ATOM   2633   H  HB3    . GLU A 1 168 ? -25.912 -11.946 1.920   1.00 0.00  ? 168  GLU A HB3    1  
ATOM   2634   H  HG2    . GLU A 1 168 ? -25.569 -12.188 4.221   1.00 0.00  ? 168  GLU A HG2    1  
ATOM   2635   H  HG3    . GLU A 1 168 ? -26.453 -10.711 4.607   1.00 0.00  ? 168  GLU A HG3    1  
ATOM   2636   N  N      . GLU A 1 169 ? -23.503 -11.154 1.648   1.00 39.56 ? 169  GLU A N      1  
ATOM   2637   C  CA     . GLU A 1 169 ? -22.084 -11.615 1.730   1.00 36.41 ? 169  GLU A CA     1  
ATOM   2638   C  C      . GLU A 1 169 ? -21.116 -10.453 1.512   1.00 35.30 ? 169  GLU A C      1  
ATOM   2639   O  O      . GLU A 1 169 ? -20.007 -10.463 2.017   1.00 35.66 ? 169  GLU A O      1  
ATOM   2640   C  CB     . GLU A 1 169 ? -21.933 -12.655 0.624   1.00 39.10 ? 169  GLU A CB     1  
ATOM   2641   C  CG     . GLU A 1 169 ? -20.615 -13.411 0.815   1.00 41.60 ? 169  GLU A CG     1  
ATOM   2642   C  CD     . GLU A 1 169 ? -20.853 -14.655 1.675   1.00 42.42 ? 169  GLU A CD     1  
ATOM   2643   O  OE1    . GLU A 1 169 ? -21.142 -15.697 1.108   1.00 45.68 ? 169  GLU A OE1    1  
ATOM   2644   O  OE2    . GLU A 1 169 ? -20.738 -14.547 2.885   1.00 36.23 ? 169  GLU A OE2    1  
ATOM   2645   H  H      . GLU A 1 169 ? -24.094 -11.498 0.947   1.00 0.00  ? 169  GLU A H      1  
ATOM   2646   H  HA     . GLU A 1 169 ? -21.900 -12.074 2.687   1.00 0.00  ? 169  GLU A HA     1  
ATOM   2647   H  HB2    . GLU A 1 169 ? -22.760 -13.348 0.669   1.00 0.00  ? 169  GLU A HB2    1  
ATOM   2648   H  HB3    . GLU A 1 169 ? -21.926 -12.160 -0.335  1.00 0.00  ? 169  GLU A HB3    1  
ATOM   2649   H  HG2    . GLU A 1 169 ? -20.230 -13.709 -0.150  1.00 0.00  ? 169  GLU A HG2    1  
ATOM   2650   H  HG3    . GLU A 1 169 ? -19.899 -12.770 1.306   1.00 0.00  ? 169  GLU A HG3    1  
ATOM   2651   N  N      . LEU A 1 170 ? -21.521 -9.451  0.775   1.00 40.94 ? 170  LEU A N      1  
ATOM   2652   C  CA     . LEU A 1 170 ? -20.614 -8.288  0.535   1.00 32.36 ? 170  LEU A CA     1  
ATOM   2653   C  C      . LEU A 1 170 ? -20.627 -7.316  1.730   1.00 35.34 ? 170  LEU A C      1  
ATOM   2654   O  O      . LEU A 1 170 ? -19.927 -6.318  1.732   1.00 36.62 ? 170  LEU A O      1  
ATOM   2655   C  CB     . LEU A 1 170 ? -21.155 -7.627  -0.731  1.00 31.48 ? 170  LEU A CB     1  
ATOM   2656   C  CG     . LEU A 1 170 ? -20.757 -8.476  -1.941  1.00 36.31 ? 170  LEU A CG     1  
ATOM   2657   C  CD1    . LEU A 1 170 ? -21.478 -7.970  -3.191  1.00 32.37 ? 170  LEU A CD1    1  
ATOM   2658   C  CD2    . LEU A 1 170 ? -19.245 -8.378  -2.151  1.00 36.50 ? 170  LEU A CD2    1  
ATOM   2659   H  H      . LEU A 1 170 ? -22.419 -9.463  0.381   1.00 0.00  ? 170  LEU A H      1  
ATOM   2660   H  HA     . LEU A 1 170 ? -19.609 -8.638  0.357   1.00 0.00  ? 170  LEU A HA     1  
ATOM   2661   H  HB2    . LEU A 1 170 ? -22.232 -7.559  -0.672  1.00 0.00  ? 170  LEU A HB2    1  
ATOM   2662   H  HB3    . LEU A 1 170 ? -20.733 -6.639  -0.832  1.00 0.00  ? 170  LEU A HB3    1  
ATOM   2663   H  HG     . LEU A 1 170 ? -21.030 -9.507  -1.762  1.00 0.00  ? 170  LEU A HG     1  
ATOM   2664   H  HD11   . LEU A 1 170 ? -21.494 -6.891  -3.187  1.00 0.00  ? 170  LEU A HD11   1  
ATOM   2665   H  HD12   . LEU A 1 170 ? -22.491 -8.345  -3.199  1.00 0.00  ? 170  LEU A HD12   1  
ATOM   2666   H  HD13   . LEU A 1 170 ? -20.959 -8.319  -4.072  1.00 0.00  ? 170  LEU A HD13   1  
ATOM   2667   H  HD21   . LEU A 1 170 ? -18.994 -8.734  -3.139  1.00 0.00  ? 170  LEU A HD21   1  
ATOM   2668   H  HD22   . LEU A 1 170 ? -18.739 -8.980  -1.411  1.00 0.00  ? 170  LEU A HD22   1  
ATOM   2669   H  HD23   . LEU A 1 170 ? -18.935 -7.348  -2.050  1.00 0.00  ? 170  LEU A HD23   1  
ATOM   2670   N  N      . GLY A 1 171 ? -21.386 -7.613  2.761   1.00 35.81 ? 171  GLY A N      1  
ATOM   2671   C  CA     . GLY A 1 171 ? -21.403 -6.725  3.964   1.00 36.27 ? 171  GLY A CA     1  
ATOM   2672   C  C      . GLY A 1 171 ? -22.201 -5.442  3.703   1.00 40.04 ? 171  GLY A C      1  
ATOM   2673   O  O      . GLY A 1 171 ? -22.010 -4.449  4.380   1.00 41.86 ? 171  GLY A O      1  
ATOM   2674   H  H      . GLY A 1 171 ? -21.923 -8.433  2.755   1.00 0.00  ? 171  GLY A H      1  
ATOM   2675   H  HA2    . GLY A 1 171 ? -21.852 -7.257  4.790   1.00 0.00  ? 171  GLY A HA2    1  
ATOM   2676   H  HA3    . GLY A 1 171 ? -20.388 -6.462  4.222   1.00 0.00  ? 171  GLY A HA3    1  
ATOM   2677   N  N      . PHE A 1 172 ? -23.099 -5.449  2.750   1.00 40.28 ? 172  PHE A N      1  
ATOM   2678   C  CA     . PHE A 1 172 ? -23.910 -4.218  2.486   1.00 39.66 ? 172  PHE A CA     1  
ATOM   2679   C  C      . PHE A 1 172 ? -25.204 -4.300  3.297   1.00 43.81 ? 172  PHE A C      1  
ATOM   2680   O  O      . PHE A 1 172 ? -26.247 -4.667  2.794   1.00 45.55 ? 172  PHE A O      1  
ATOM   2681   C  CB     . PHE A 1 172 ? -24.204 -4.220  0.983   1.00 37.86 ? 172  PHE A CB     1  
ATOM   2682   C  CG     . PHE A 1 172 ? -24.584 -2.829  0.546   1.00 39.33 ? 172  PHE A CG     1  
ATOM   2683   C  CD1    . PHE A 1 172 ? -25.927 -2.424  0.585   1.00 44.07 ? 172  PHE A CD1    1  
ATOM   2684   C  CD2    . PHE A 1 172 ? -23.595 -1.942  0.097   1.00 40.82 ? 172  PHE A CD2    1  
ATOM   2685   C  CE1    . PHE A 1 172 ? -26.282 -1.132  0.172   1.00 43.51 ? 172  PHE A CE1    1  
ATOM   2686   C  CE2    . PHE A 1 172 ? -23.948 -0.649  -0.315  1.00 37.60 ? 172  PHE A CE2    1  
ATOM   2687   C  CZ     . PHE A 1 172 ? -25.292 -0.243  -0.278  1.00 43.33 ? 172  PHE A CZ     1  
ATOM   2688   H  H      . PHE A 1 172 ? -23.252 -6.264  2.225   1.00 0.00  ? 172  PHE A H      1  
ATOM   2689   H  HA     . PHE A 1 172 ? -23.352 -3.335  2.756   1.00 0.00  ? 172  PHE A HA     1  
ATOM   2690   H  HB2    . PHE A 1 172 ? -23.324 -4.537  0.443   1.00 0.00  ? 172  PHE A HB2    1  
ATOM   2691   H  HB3    . PHE A 1 172 ? -25.020 -4.896  0.774   1.00 0.00  ? 172  PHE A HB3    1  
ATOM   2692   H  HD1    . PHE A 1 172 ? -26.688 -3.109  0.933   1.00 0.00  ? 172  PHE A HD1    1  
ATOM   2693   H  HD2    . PHE A 1 172 ? -22.561 -2.255  0.069   1.00 0.00  ? 172  PHE A HD2    1  
ATOM   2694   H  HE1    . PHE A 1 172 ? -27.318 -0.819  0.202   1.00 0.00  ? 172  PHE A HE1    1  
ATOM   2695   H  HE2    . PHE A 1 172 ? -23.185 0.036   -0.662  1.00 0.00  ? 172  PHE A HE2    1  
ATOM   2696   H  HZ     . PHE A 1 172 ? -25.565 0.753   -0.595  1.00 0.00  ? 172  PHE A HZ     1  
ATOM   2697   N  N      . ARG A 1 173 ? -25.120 -3.985  4.567   1.00 46.94 ? 173  ARG A N      1  
ATOM   2698   C  CA     . ARG A 1 173 ? -26.319 -4.066  5.476   1.00 50.53 ? 173  ARG A CA     1  
ATOM   2699   C  C      . ARG A 1 173 ? -27.574 -3.432  4.846   1.00 50.08 ? 173  ARG A C      1  
ATOM   2700   O  O      . ARG A 1 173 ? -27.471 -2.631  3.937   1.00 48.26 ? 173  ARG A O      1  
ATOM   2701   C  CB     . ARG A 1 173 ? -25.902 -3.310  6.736   1.00 54.02 ? 173  ARG A CB     1  
ATOM   2702   C  CG     . ARG A 1 173 ? -24.803 -4.093  7.462   1.00 52.18 ? 173  ARG A CG     1  
ATOM   2703   C  CD     . ARG A 1 173 ? -25.431 -5.224  8.284   1.00 55.52 ? 173  ARG A CD     1  
ATOM   2704   N  NE     . ARG A 1 173 ? -26.285 -4.537  9.297   1.00 67.99 ? 173  ARG A NE     1  
ATOM   2705   C  CZ     . ARG A 1 173 ? -25.743 -3.966  10.346  1.00 68.62 ? 173  ARG A CZ     1  
ATOM   2706   N  NH1    . ARG A 1 173 ? -24.446 -3.994  10.524  1.00 68.72 ? 173  ARG A NH1    1  
ATOM   2707   N  NH2    . ARG A 1 173 ? -26.504 -3.367  11.222  1.00 69.41 ? 173  ARG A NH2    1  
ATOM   2708   H  H      . ARG A 1 173 ? -24.251 -3.715  4.935   1.00 0.00  ? 173  ARG A H      1  
ATOM   2709   H  HA     . ARG A 1 173 ? -26.517 -5.096  5.727   1.00 0.00  ? 173  ARG A HA     1  
ATOM   2710   H  HB2    . ARG A 1 173 ? -25.530 -2.334  6.462   1.00 0.00  ? 173  ARG A HB2    1  
ATOM   2711   H  HB3    . ARG A 1 173 ? -26.755 -3.201  7.388   1.00 0.00  ? 173  ARG A HB3    1  
ATOM   2712   H  HG2    . ARG A 1 173 ? -24.121 -4.513  6.736   1.00 0.00  ? 173  ARG A HG2    1  
ATOM   2713   H  HG3    . ARG A 1 173 ? -24.264 -3.429  8.120   1.00 0.00  ? 173  ARG A HG3    1  
ATOM   2714   H  HD2    . ARG A 1 173 ? -26.032 -5.861  7.651   1.00 0.00  ? 173  ARG A HD2    1  
ATOM   2715   H  HD3    . ARG A 1 173 ? -24.664 -5.800  8.778   1.00 0.00  ? 173  ARG A HD3    1  
ATOM   2716   H  HE     . ARG A 1 173 ? -27.257 -4.512  9.178   1.00 0.00  ? 173  ARG A HE     1  
ATOM   2717   H  HH11   . ARG A 1 173 ? -23.857 -4.453  9.859   1.00 0.00  ? 173  ARG A HH11   1  
ATOM   2718   H  HH12   . ARG A 1 173 ? -24.043 -3.557  11.327  1.00 0.00  ? 173  ARG A HH12   1  
ATOM   2719   H  HH21   . ARG A 1 173 ? -27.495 -3.345  11.092  1.00 0.00  ? 173  ARG A HH21   1  
ATOM   2720   H  HH22   . ARG A 1 173 ? -26.096 -2.930  12.023  1.00 0.00  ? 173  ARG A HH22   1  
ATOM   2721   N  N      . PRO A 1 174 ? -28.733 -3.838  5.343   1.00 53.54 ? 174  PRO A N      1  
ATOM   2722   C  CA     . PRO A 1 174 ? -30.020 -3.324  4.803   1.00 51.08 ? 174  PRO A CA     1  
ATOM   2723   C  C      . PRO A 1 174 ? -30.285 -1.870  5.225   1.00 50.21 ? 174  PRO A C      1  
ATOM   2724   O  O      . PRO A 1 174 ? -31.132 -1.206  4.654   1.00 56.63 ? 174  PRO A O      1  
ATOM   2725   C  CB     . PRO A 1 174 ? -31.061 -4.266  5.395   1.00 52.06 ? 174  PRO A CB     1  
ATOM   2726   C  CG     . PRO A 1 174 ? -30.434 -4.816  6.637   1.00 48.54 ? 174  PRO A CG     1  
ATOM   2727   C  CD     . PRO A 1 174 ? -28.940 -4.795  6.436   1.00 50.81 ? 174  PRO A CD     1  
ATOM   2728   H  HA     . PRO A 1 174 ? -30.030 -3.406  3.729   1.00 0.00  ? 174  PRO A HA     1  
ATOM   2729   H  HB2    . PRO A 1 174 ? -31.962 -3.720  5.635   1.00 0.00  ? 174  PRO A HB2    1  
ATOM   2730   H  HB3    . PRO A 1 174 ? -31.277 -5.066  4.704   1.00 0.00  ? 174  PRO A HB3    1  
ATOM   2731   H  HG2    . PRO A 1 174 ? -30.702 -4.204  7.485   1.00 0.00  ? 174  PRO A HG2    1  
ATOM   2732   H  HG3    . PRO A 1 174 ? -30.763 -5.831  6.794   1.00 0.00  ? 174  PRO A HG3    1  
ATOM   2733   H  HD2    . PRO A 1 174 ? -28.444 -4.458  7.336   1.00 0.00  ? 174  PRO A HD2    1  
ATOM   2734   H  HD3    . PRO A 1 174 ? -28.582 -5.771  6.147   1.00 0.00  ? 174  PRO A HD3    1  
ATOM   2735   N  N      . GLU A 1 175 ? -29.567 -1.361  6.199   1.00 48.34 ? 175  GLU A N      1  
ATOM   2736   C  CA     . GLU A 1 175 ? -29.785 0.060   6.620   1.00 48.29 ? 175  GLU A CA     1  
ATOM   2737   C  C      . GLU A 1 175 ? -29.057 1.014   5.657   1.00 50.93 ? 175  GLU A C      1  
ATOM   2738   O  O      . GLU A 1 175 ? -29.327 2.200   5.620   1.00 52.91 ? 175  GLU A O      1  
ATOM   2739   C  CB     . GLU A 1 175 ? -29.184 0.163   8.020   1.00 44.65 ? 175  GLU A CB     1  
ATOM   2740   C  CG     . GLU A 1 175 ? -30.071 -0.579  9.021   1.00 51.95 ? 175  GLU A CG     1  
ATOM   2741   C  CD     . GLU A 1 175 ? -29.549 -2.005  9.202   1.00 58.34 ? 175  GLU A CD     1  
ATOM   2742   O  OE1    . GLU A 1 175 ? -28.342 -2.168  9.272   1.00 53.48 ? 175  GLU A OE1    1  
ATOM   2743   O  OE2    . GLU A 1 175 ? -30.364 -2.910  9.267   1.00 58.67 ? 175  GLU A OE2    1  
ATOM   2744   H  H      . GLU A 1 175 ? -28.879 -1.906  6.642   1.00 0.00  ? 175  GLU A H      1  
ATOM   2745   H  HA     . GLU A 1 175 ? -30.839 0.287   6.651   1.00 0.00  ? 175  GLU A HA     1  
ATOM   2746   H  HB2    . GLU A 1 175 ? -28.197 -0.275  8.019   1.00 0.00  ? 175  GLU A HB2    1  
ATOM   2747   H  HB3    . GLU A 1 175 ? -29.116 1.202   8.305   1.00 0.00  ? 175  GLU A HB3    1  
ATOM   2748   H  HG2    . GLU A 1 175 ? -30.050 -0.064  9.970   1.00 0.00  ? 175  GLU A HG2    1  
ATOM   2749   H  HG3    . GLU A 1 175 ? -31.085 -0.613  8.651   1.00 0.00  ? 175  GLU A HG3    1  
ATOM   2750   N  N      . TYR A 1 176 ? -28.136 0.497   4.879   1.00 46.61 ? 176  TYR A N      1  
ATOM   2751   C  CA     . TYR A 1 176 ? -27.386 1.356   3.923   1.00 46.24 ? 176  TYR A CA     1  
ATOM   2752   C  C      . TYR A 1 176 ? -28.235 1.654   2.683   1.00 46.12 ? 176  TYR A C      1  
ATOM   2753   O  O      . TYR A 1 176 ? -28.999 0.828   2.221   1.00 46.97 ? 176  TYR A O      1  
ATOM   2754   C  CB     . TYR A 1 176 ? -26.152 0.534   3.537   1.00 48.41 ? 176  TYR A CB     1  
ATOM   2755   C  CG     . TYR A 1 176 ? -25.100 0.655   4.607   1.00 47.61 ? 176  TYR A CG     1  
ATOM   2756   C  CD1    . TYR A 1 176 ? -24.720 1.920   5.078   1.00 48.89 ? 176  TYR A CD1    1  
ATOM   2757   C  CD2    . TYR A 1 176 ? -24.492 -0.500  5.120   1.00 48.49 ? 176  TYR A CD2    1  
ATOM   2758   C  CE1    . TYR A 1 176 ? -23.732 2.030   6.064   1.00 49.64 ? 176  TYR A CE1    1  
ATOM   2759   C  CE2    . TYR A 1 176 ? -23.504 -0.390  6.107   1.00 46.81 ? 176  TYR A CE2    1  
ATOM   2760   C  CZ     . TYR A 1 176 ? -23.124 0.875   6.577   1.00 49.77 ? 176  TYR A CZ     1  
ATOM   2761   O  OH     . TYR A 1 176 ? -22.155 0.982   7.547   1.00 55.28 ? 176  TYR A OH     1  
ATOM   2762   H  H      . TYR A 1 176 ? -27.934 -0.461  4.929   1.00 0.00  ? 176  TYR A H      1  
ATOM   2763   H  HA     . TYR A 1 176 ? -27.084 2.273   4.400   1.00 0.00  ? 176  TYR A HA     1  
ATOM   2764   H  HB2    . TYR A 1 176 ? -26.429 -0.504  3.428   1.00 0.00  ? 176  TYR A HB2    1  
ATOM   2765   H  HB3    . TYR A 1 176 ? -25.753 0.899   2.603   1.00 0.00  ? 176  TYR A HB3    1  
ATOM   2766   H  HD1    . TYR A 1 176 ? -25.190 2.809   4.683   1.00 0.00  ? 176  TYR A HD1    1  
ATOM   2767   H  HD2    . TYR A 1 176 ? -24.786 -1.476  4.758   1.00 0.00  ? 176  TYR A HD2    1  
ATOM   2768   H  HE1    . TYR A 1 176 ? -23.438 3.006   6.428   1.00 0.00  ? 176  TYR A HE1    1  
ATOM   2769   H  HE2    . TYR A 1 176 ? -23.032 -1.279  6.504   1.00 0.00  ? 176  TYR A HE2    1  
ATOM   2770   H  HH     . TYR A 1 176 ? -22.459 0.503   8.320   1.00 0.00  ? 176  TYR A HH     1  
ATOM   2771   N  N      . SER A 1 177 ? -28.085 2.833   2.146   1.00 42.97 ? 177  SER A N      1  
ATOM   2772   C  CA     . SER A 1 177 ? -28.849 3.222   0.931   1.00 45.09 ? 177  SER A CA     1  
ATOM   2773   C  C      . SER A 1 177 ? -27.867 3.573   -0.189  1.00 46.15 ? 177  SER A C      1  
ATOM   2774   O  O      . SER A 1 177 ? -26.688 3.762   0.048   1.00 50.58 ? 177  SER A O      1  
ATOM   2775   C  CB     . SER A 1 177 ? -29.659 4.449   1.346   1.00 50.61 ? 177  SER A CB     1  
ATOM   2776   O  OG     . SER A 1 177 ? -28.785 5.561   1.494   1.00 52.63 ? 177  SER A OG     1  
ATOM   2777   H  H      . SER A 1 177 ? -27.451 3.467   2.542   1.00 0.00  ? 177  SER A H      1  
ATOM   2778   H  HA     . SER A 1 177 ? -29.508 2.425   0.624   1.00 0.00  ? 177  SER A HA     1  
ATOM   2779   H  HB2    . SER A 1 177 ? -30.392 4.672   0.589   1.00 0.00  ? 177  SER A HB2    1  
ATOM   2780   H  HB3    . SER A 1 177 ? -30.162 4.246   2.282   1.00 0.00  ? 177  SER A HB3    1  
ATOM   2781   H  HG     . SER A 1 177 ? -28.315 5.460   2.324   1.00 0.00  ? 177  SER A HG     1  
ATOM   2782   N  N      . ALA A 1 178 ? -28.339 3.646   -1.403  1.00 43.60 ? 178  ALA A N      1  
ATOM   2783   C  CA     . ALA A 1 178 ? -27.429 3.967   -2.552  1.00 41.74 ? 178  ALA A CA     1  
ATOM   2784   C  C      . ALA A 1 178 ? -26.691 5.298   -2.335  1.00 44.01 ? 178  ALA A C      1  
ATOM   2785   O  O      . ALA A 1 178 ? -25.573 5.479   -2.783  1.00 44.88 ? 178  ALA A O      1  
ATOM   2786   C  CB     . ALA A 1 178 ? -28.357 4.075   -3.760  1.00 46.11 ? 178  ALA A CB     1  
ATOM   2787   H  H      . ALA A 1 178 ? -29.293 3.476   -1.563  1.00 0.00  ? 178  ALA A H      1  
ATOM   2788   H  HA     . ALA A 1 178 ? -26.723 3.168   -2.706  1.00 0.00  ? 178  ALA A HA     1  
ATOM   2789   H  HB1    . ALA A 1 178 ? -29.018 4.920   -3.629  1.00 0.00  ? 178  ALA A HB1    1  
ATOM   2790   H  HB2    . ALA A 1 178 ? -28.940 3.171   -3.847  1.00 0.00  ? 178  ALA A HB2    1  
ATOM   2791   H  HB3    . ALA A 1 178 ? -27.769 4.214   -4.654  1.00 0.00  ? 178  ALA A HB3    1  
ATOM   2792   N  N      . SER A 1 179 ? -27.318 6.231   -1.674  1.00 45.30 ? 179  SER A N      1  
ATOM   2793   C  CA     . SER A 1 179 ? -26.677 7.570   -1.445  1.00 46.30 ? 179  SER A CA     1  
ATOM   2794   C  C      . SER A 1 179 ? -25.393 7.472   -0.600  1.00 47.45 ? 179  SER A C      1  
ATOM   2795   O  O      . SER A 1 179 ? -24.625 8.417   -0.528  1.00 49.37 ? 179  SER A O      1  
ATOM   2796   C  CB     . SER A 1 179 ? -27.734 8.381   -0.696  1.00 46.00 ? 179  SER A CB     1  
ATOM   2797   O  OG     . SER A 1 179 ? -27.841 7.895   0.636   1.00 44.77 ? 179  SER A OG     1  
ATOM   2798   H  H      . SER A 1 179 ? -28.225 6.059   -1.343  1.00 0.00  ? 179  SER A H      1  
ATOM   2799   H  HA     . SER A 1 179 ? -26.464 8.044   -2.388  1.00 0.00  ? 179  SER A HA     1  
ATOM   2800   H  HB2    . SER A 1 179 ? -27.445 9.418   -0.673  1.00 0.00  ? 179  SER A HB2    1  
ATOM   2801   H  HB3    . SER A 1 179 ? -28.685 8.285   -1.203  1.00 0.00  ? 179  SER A HB3    1  
ATOM   2802   H  HG     . SER A 1 179 ? -28.131 6.981   0.596   1.00 0.00  ? 179  SER A HG     1  
ATOM   2803   N  N      . GLN A 1 180 ? -25.158 6.359   0.049   1.00 46.18 ? 180  GLN A N      1  
ATOM   2804   C  CA     . GLN A 1 180 ? -23.930 6.235   0.901   1.00 48.26 ? 180  GLN A CA     1  
ATOM   2805   C  C      . GLN A 1 180 ? -22.726 5.680   0.118   1.00 46.01 ? 180  GLN A C      1  
ATOM   2806   O  O      . GLN A 1 180 ? -21.626 5.624   0.637   1.00 48.40 ? 180  GLN A O      1  
ATOM   2807   C  CB     . GLN A 1 180 ? -24.323 5.263   2.013   1.00 48.28 ? 180  GLN A CB     1  
ATOM   2808   C  CG     . GLN A 1 180 ? -24.831 6.049   3.224   1.00 51.25 ? 180  GLN A CG     1  
ATOM   2809   C  CD     . GLN A 1 180 ? -25.778 5.168   4.041   1.00 53.56 ? 180  GLN A CD     1  
ATOM   2810   O  OE1    . GLN A 1 180 ? -26.698 4.584   3.505   1.00 48.11 ? 180  GLN A OE1    1  
ATOM   2811   N  NE2    . GLN A 1 180 ? -25.590 5.047   5.327   1.00 61.14 ? 180  GLN A NE2    1  
ATOM   2812   H  H      . GLN A 1 180 ? -25.794 5.616   -0.009  1.00 0.00  ? 180  GLN A H      1  
ATOM   2813   H  HA     . GLN A 1 180 ? -23.681 7.191   1.332   1.00 0.00  ? 180  GLN A HA     1  
ATOM   2814   H  HB2    . GLN A 1 180 ? -25.101 4.605   1.656   1.00 0.00  ? 180  GLN A HB2    1  
ATOM   2815   H  HB3    . GLN A 1 180 ? -23.461 4.680   2.302   1.00 0.00  ? 180  GLN A HB3    1  
ATOM   2816   H  HG2    . GLN A 1 180 ? -23.993 6.345   3.837   1.00 0.00  ? 180  GLN A HG2    1  
ATOM   2817   H  HG3    . GLN A 1 180 ? -25.361 6.927   2.888   1.00 0.00  ? 180  GLN A HG3    1  
ATOM   2818   H  HE21   . GLN A 1 180 ? -24.848 5.517   5.761   1.00 0.00  ? 180  GLN A HE21   1  
ATOM   2819   H  HE22   . GLN A 1 180 ? -26.192 4.484   5.859   1.00 0.00  ? 180  GLN A HE22   1  
ATOM   2820   N  N      . LEU A 1 181 ? -22.916 5.266   -1.108  1.00 43.34 ? 181  LEU A N      1  
ATOM   2821   C  CA     . LEU A 1 181 ? -21.772 4.711   -1.897  1.00 40.87 ? 181  LEU A CA     1  
ATOM   2822   C  C      . LEU A 1 181 ? -20.755 5.806   -2.236  1.00 41.65 ? 181  LEU A C      1  
ATOM   2823   O  O      . LEU A 1 181 ? -21.115 6.889   -2.666  1.00 43.49 ? 181  LEU A O      1  
ATOM   2824   C  CB     . LEU A 1 181 ? -22.405 4.169   -3.177  1.00 40.18 ? 181  LEU A CB     1  
ATOM   2825   C  CG     . LEU A 1 181 ? -23.171 2.884   -2.863  1.00 41.15 ? 181  LEU A CG     1  
ATOM   2826   C  CD1    . LEU A 1 181 ? -24.273 2.678   -3.902  1.00 39.95 ? 181  LEU A CD1    1  
ATOM   2827   C  CD2    . LEU A 1 181 ? -22.208 1.695   -2.901  1.00 37.39 ? 181  LEU A CD2    1  
ATOM   2828   H  H      . LEU A 1 181 ? -23.810 5.313   -1.509  1.00 0.00  ? 181  LEU A H      1  
ATOM   2829   H  HA     . LEU A 1 181 ? -21.295 3.908   -1.356  1.00 0.00  ? 181  LEU A HA     1  
ATOM   2830   H  HB2    . LEU A 1 181 ? -23.084 4.906   -3.580  1.00 0.00  ? 181  LEU A HB2    1  
ATOM   2831   H  HB3    . LEU A 1 181 ? -21.631 3.959   -3.900  1.00 0.00  ? 181  LEU A HB3    1  
ATOM   2832   H  HG     . LEU A 1 181 ? -23.613 2.960   -1.880  1.00 0.00  ? 181  LEU A HG     1  
ATOM   2833   H  HD11   . LEU A 1 181 ? -24.868 3.576   -3.980  1.00 0.00  ? 181  LEU A HD11   1  
ATOM   2834   H  HD12   . LEU A 1 181 ? -24.903 1.854   -3.601  1.00 0.00  ? 181  LEU A HD12   1  
ATOM   2835   H  HD13   . LEU A 1 181 ? -23.828 2.458   -4.861  1.00 0.00  ? 181  LEU A HD13   1  
ATOM   2836   H  HD21   . LEU A 1 181 ? -21.924 1.495   -3.924  1.00 0.00  ? 181  LEU A HD21   1  
ATOM   2837   H  HD22   . LEU A 1 181 ? -22.694 0.825   -2.485  1.00 0.00  ? 181  LEU A HD22   1  
ATOM   2838   H  HD23   . LEU A 1 181 ? -21.327 1.927   -2.322  1.00 0.00  ? 181  LEU A HD23   1  
ATOM   2839   N  N      . LYS A 1 182 ? -19.489 5.522   -2.062  1.00 42.66 ? 182  LYS A N      1  
ATOM   2840   C  CA     . LYS A 1 182 ? -18.440 6.535   -2.393  1.00 45.85 ? 182  LYS A CA     1  
ATOM   2841   C  C      . LYS A 1 182 ? -18.466 6.828   -3.900  1.00 44.68 ? 182  LYS A C      1  
ATOM   2842   O  O      . LYS A 1 182 ? -18.261 5.943   -4.711  1.00 43.04 ? 182  LYS A O      1  
ATOM   2843   C  CB     . LYS A 1 182 ? -17.119 5.871   -2.000  1.00 42.83 ? 182  LYS A CB     1  
ATOM   2844   C  CG     . LYS A 1 182 ? -15.957 6.827   -2.277  1.00 44.71 ? 182  LYS A CG     1  
ATOM   2845   C  CD     . LYS A 1 182 ? -14.699 6.319   -1.570  1.00 58.68 ? 182  LYS A CD     1  
ATOM   2846   C  CE     . LYS A 1 182 ? -13.502 7.192   -1.959  1.00 65.16 ? 182  LYS A CE     1  
ATOM   2847   N  NZ     . LYS A 1 182 ? -12.883 6.499   -3.123  1.00 60.88 ? 182  LYS A NZ     1  
ATOM   2848   H  H      . LYS A 1 182 ? -19.230 4.637   -1.726  1.00 0.00  ? 182  LYS A H      1  
ATOM   2849   H  HA     . LYS A 1 182 ? -18.588 7.439   -1.823  1.00 0.00  ? 182  LYS A HA     1  
ATOM   2850   H  HB2    . LYS A 1 182 ? -17.140 5.622   -0.949  1.00 0.00  ? 182  LYS A HB2    1  
ATOM   2851   H  HB3    . LYS A 1 182 ? -16.985 4.969   -2.580  1.00 0.00  ? 182  LYS A HB3    1  
ATOM   2852   H  HG2    . LYS A 1 182 ? -15.778 6.876   -3.342  1.00 0.00  ? 182  LYS A HG2    1  
ATOM   2853   H  HG3    . LYS A 1 182 ? -16.204 7.811   -1.907  1.00 0.00  ? 182  LYS A HG3    1  
ATOM   2854   H  HD2    . LYS A 1 182 ? -14.845 6.364   -0.500  1.00 0.00  ? 182  LYS A HD2    1  
ATOM   2855   H  HD3    . LYS A 1 182 ? -14.507 5.298   -1.865  1.00 0.00  ? 182  LYS A HD3    1  
ATOM   2856   H  HE2    . LYS A 1 182 ? -13.836 8.182   -2.240  1.00 0.00  ? 182  LYS A HE2    1  
ATOM   2857   H  HE3    . LYS A 1 182 ? -12.797 7.248   -1.144  1.00 0.00  ? 182  LYS A HE3    1  
ATOM   2858   H  HZ1    . LYS A 1 182 ? -13.538 6.523   -3.929  1.00 0.00  ? 182  LYS A HZ1    1  
ATOM   2859   H  HZ2    . LYS A 1 182 ? -12.679 5.511   -2.869  1.00 0.00  ? 182  LYS A HZ2    1  
ATOM   2860   H  HZ3    . LYS A 1 182 ? -11.999 6.980   -3.383  1.00 0.00  ? 182  LYS A HZ3    1  
ATOM   2861   N  N      . GLY A 1 183 ? -18.726 8.057   -4.282  1.00 41.16 ? 183  GLY A N      1  
ATOM   2862   C  CA     . GLY A 1 183 ? -18.768 8.404   -5.741  1.00 48.70 ? 183  GLY A CA     1  
ATOM   2863   C  C      . GLY A 1 183 ? -20.221 8.608   -6.213  1.00 51.68 ? 183  GLY A C      1  
ATOM   2864   O  O      . GLY A 1 183 ? -20.466 9.048   -7.322  1.00 51.64 ? 183  GLY A O      1  
ATOM   2865   H  H      . GLY A 1 183 ? -18.894 8.752   -3.611  1.00 0.00  ? 183  GLY A H      1  
ATOM   2866   H  HA2    . GLY A 1 183 ? -18.210 9.314   -5.905  1.00 0.00  ? 183  GLY A HA2    1  
ATOM   2867   H  HA3    . GLY A 1 183 ? -18.319 7.604   -6.310  1.00 0.00  ? 183  GLY A HA3    1  
ATOM   2868   N  N      . PHE A 1 184 ? -21.185 8.281   -5.385  1.00 47.93 ? 184  PHE A N      1  
ATOM   2869   C  CA     . PHE A 1 184 ? -22.627 8.434   -5.786  1.00 49.95 ? 184  PHE A CA     1  
ATOM   2870   C  C      . PHE A 1 184 ? -22.919 9.830   -6.344  1.00 53.69 ? 184  PHE A C      1  
ATOM   2871   O  O      . PHE A 1 184 ? -23.491 9.982   -7.407  1.00 52.36 ? 184  PHE A O      1  
ATOM   2872   C  CB     . PHE A 1 184 ? -23.414 8.226   -4.491  1.00 49.22 ? 184  PHE A CB     1  
ATOM   2873   C  CG     . PHE A 1 184 ? -24.885 8.124   -4.799  1.00 49.36 ? 184  PHE A CG     1  
ATOM   2874   C  CD1    . PHE A 1 184 ? -25.402 6.943   -5.347  1.00 49.16 ? 184  PHE A CD1    1  
ATOM   2875   C  CD2    . PHE A 1 184 ? -25.738 9.206   -4.525  1.00 49.53 ? 184  PHE A CD2    1  
ATOM   2876   C  CE1    . PHE A 1 184 ? -26.773 6.840   -5.625  1.00 44.63 ? 184  PHE A CE1    1  
ATOM   2877   C  CE2    . PHE A 1 184 ? -27.109 9.104   -4.800  1.00 50.18 ? 184  PHE A CE2    1  
ATOM   2878   C  CZ     . PHE A 1 184 ? -27.627 7.920   -5.350  1.00 47.46 ? 184  PHE A CZ     1  
ATOM   2879   H  H      . PHE A 1 184 ? -20.963 7.920   -4.503  1.00 0.00  ? 184  PHE A H      1  
ATOM   2880   H  HA     . PHE A 1 184 ? -22.898 7.677   -6.502  1.00 0.00  ? 184  PHE A HA     1  
ATOM   2881   H  HB2    . PHE A 1 184 ? -23.085 7.318   -4.009  1.00 0.00  ? 184  PHE A HB2    1  
ATOM   2882   H  HB3    . PHE A 1 184 ? -23.246 9.065   -3.830  1.00 0.00  ? 184  PHE A HB3    1  
ATOM   2883   H  HD1    . PHE A 1 184 ? -24.744 6.113   -5.559  1.00 0.00  ? 184  PHE A HD1    1  
ATOM   2884   H  HD2    . PHE A 1 184 ? -25.337 10.118  -4.103  1.00 0.00  ? 184  PHE A HD2    1  
ATOM   2885   H  HE1    . PHE A 1 184 ? -27.172 5.928   -6.049  1.00 0.00  ? 184  PHE A HE1    1  
ATOM   2886   H  HE2    . PHE A 1 184 ? -27.768 9.938   -4.589  1.00 0.00  ? 184  PHE A HE2    1  
ATOM   2887   H  HZ     . PHE A 1 184 ? -28.684 7.841   -5.563  1.00 0.00  ? 184  PHE A HZ     1  
ATOM   2888   N  N      . SER A 1 185 ? -22.563 10.837  -5.610  1.00 53.34 ? 185  SER A N      1  
ATOM   2889   C  CA     . SER A 1 185 ? -22.840 12.249  -6.035  1.00 55.93 ? 185  SER A CA     1  
ATOM   2890   C  C      . SER A 1 185 ? -22.385 12.564  -7.475  1.00 55.28 ? 185  SER A C      1  
ATOM   2891   O  O      . SER A 1 185 ? -22.902 13.480  -8.091  1.00 58.63 ? 185  SER A O      1  
ATOM   2892   C  CB     . SER A 1 185 ? -22.054 13.106  -5.045  1.00 53.89 ? 185  SER A CB     1  
ATOM   2893   O  OG     . SER A 1 185 ? -20.661 12.907  -5.253  1.00 53.62 ? 185  SER A OG     1  
ATOM   2894   H  H      . SER A 1 185 ? -22.133 10.666  -4.745  1.00 0.00  ? 185  SER A H      1  
ATOM   2895   H  HA     . SER A 1 185 ? -23.890 12.463  -5.929  1.00 0.00  ? 185  SER A HA     1  
ATOM   2896   H  HB2    . SER A 1 185 ? -22.291 14.145  -5.199  1.00 0.00  ? 185  SER A HB2    1  
ATOM   2897   H  HB3    . SER A 1 185 ? -22.322 12.824  -4.035  1.00 0.00  ? 185  SER A HB3    1  
ATOM   2898   H  HG     . SER A 1 185 ? -20.493 11.962  -5.261  1.00 0.00  ? 185  SER A HG     1  
ATOM   2899   N  N      . LEU A 1 186 ? -21.417 11.854  -8.011  1.00 50.26 ? 186  LEU A N      1  
ATOM   2900   C  CA     . LEU A 1 186 ? -20.930 12.174  -9.403  1.00 49.68 ? 186  LEU A CA     1  
ATOM   2901   C  C      . LEU A 1 186 ? -21.740 11.457  -10.500 1.00 49.71 ? 186  LEU A C      1  
ATOM   2902   O  O      . LEU A 1 186 ? -21.394 11.520  -11.669 1.00 51.56 ? 186  LEU A O      1  
ATOM   2903   C  CB     . LEU A 1 186 ? -19.483 11.689  -9.430  1.00 51.10 ? 186  LEU A CB     1  
ATOM   2904   C  CG     . LEU A 1 186 ? -18.652 12.479  -8.419  1.00 52.54 ? 186  LEU A CG     1  
ATOM   2905   C  CD1    . LEU A 1 186 ? -17.289 11.807  -8.246  1.00 43.83 ? 186  LEU A CD1    1  
ATOM   2906   C  CD2    . LEU A 1 186 ? -18.453 13.906  -8.932  1.00 39.08 ? 186  LEU A CD2    1  
ATOM   2907   H  H      . LEU A 1 186 ? -20.994 11.136  -7.495  1.00 0.00  ? 186  LEU A H      1  
ATOM   2908   H  HA     . LEU A 1 186 ? -20.953 13.240  -9.566  1.00 0.00  ? 186  LEU A HA     1  
ATOM   2909   H  HB2    . LEU A 1 186 ? -19.452 10.638  -9.180  1.00 0.00  ? 186  LEU A HB2    1  
ATOM   2910   H  HB3    . LEU A 1 186 ? -19.075 11.835  -10.419 1.00 0.00  ? 186  LEU A HB3    1  
ATOM   2911   H  HG     . LEU A 1 186 ? -19.166 12.503  -7.468  1.00 0.00  ? 186  LEU A HG     1  
ATOM   2912   H  HD11   . LEU A 1 186 ? -16.965 11.403  -9.194  1.00 0.00  ? 186  LEU A HD11   1  
ATOM   2913   H  HD12   . LEU A 1 186 ? -17.369 11.008  -7.524  1.00 0.00  ? 186  LEU A HD12   1  
ATOM   2914   H  HD13   . LEU A 1 186 ? -16.570 12.535  -7.901  1.00 0.00  ? 186  LEU A HD13   1  
ATOM   2915   H  HD21   . LEU A 1 186 ? -17.631 14.366  -8.406  1.00 0.00  ? 186  LEU A HD21   1  
ATOM   2916   H  HD22   . LEU A 1 186 ? -19.354 14.478  -8.765  1.00 0.00  ? 186  LEU A HD22   1  
ATOM   2917   H  HD23   . LEU A 1 186 ? -18.235 13.880  -9.990  1.00 0.00  ? 186  LEU A HD23   1  
ATOM   2918   N  N      . LEU A 1 187 ? -22.798 10.780  -10.144 1.00 49.68 ? 187  LEU A N      1  
ATOM   2919   C  CA     . LEU A 1 187 ? -23.603 10.061  -11.170 1.00 50.19 ? 187  LEU A CA     1  
ATOM   2920   C  C      . LEU A 1 187 ? -24.757 10.934  -11.666 1.00 52.94 ? 187  LEU A C      1  
ATOM   2921   O  O      . LEU A 1 187 ? -25.316 11.727  -10.930 1.00 54.11 ? 187  LEU A O      1  
ATOM   2922   C  CB     . LEU A 1 187 ? -24.147 8.833   -10.443 1.00 53.46 ? 187  LEU A CB     1  
ATOM   2923   C  CG     . LEU A 1 187 ? -22.981 7.948   -10.002 1.00 44.36 ? 187  LEU A CG     1  
ATOM   2924   C  CD1    . LEU A 1 187 ? -23.490 6.867   -9.046  1.00 39.36 ? 187  LEU A CD1    1  
ATOM   2925   C  CD2    . LEU A 1 187 ? -22.357 7.287   -11.231 1.00 38.22 ? 187  LEU A CD2    1  
ATOM   2926   H  H      . LEU A 1 187 ? -23.054 10.734  -9.201  1.00 0.00  ? 187  LEU A H      1  
ATOM   2927   H  HA     . LEU A 1 187 ? -22.980 9.753   -11.995 1.00 0.00  ? 187  LEU A HA     1  
ATOM   2928   H  HB2    . LEU A 1 187 ? -24.709 9.150   -9.576  1.00 0.00  ? 187  LEU A HB2    1  
ATOM   2929   H  HB3    . LEU A 1 187 ? -24.789 8.276   -11.107 1.00 0.00  ? 187  LEU A HB3    1  
ATOM   2930   H  HG     . LEU A 1 187 ? -22.240 8.552   -9.500  1.00 0.00  ? 187  LEU A HG     1  
ATOM   2931   H  HD11   . LEU A 1 187 ? -24.161 6.206   -9.574  1.00 0.00  ? 187  LEU A HD11   1  
ATOM   2932   H  HD12   . LEU A 1 187 ? -24.015 7.332   -8.224  1.00 0.00  ? 187  LEU A HD12   1  
ATOM   2933   H  HD13   . LEU A 1 187 ? -22.653 6.301   -8.665  1.00 0.00  ? 187  LEU A HD13   1  
ATOM   2934   H  HD21   . LEU A 1 187 ? -23.124 7.106   -11.970 1.00 0.00  ? 187  LEU A HD21   1  
ATOM   2935   H  HD22   . LEU A 1 187 ? -21.905 6.349   -10.945 1.00 0.00  ? 187  LEU A HD22   1  
ATOM   2936   H  HD23   . LEU A 1 187 ? -21.604 7.939   -11.647 1.00 0.00  ? 187  LEU A HD23   1  
ATOM   2937   N  N      . ALA A 1 188 ? -25.127 10.773  -12.914 1.00 51.35 ? 188  ALA A N      1  
ATOM   2938   C  CA     . ALA A 1 188 ? -26.260 11.565  -13.470 1.00 50.16 ? 188  ALA A CA     1  
ATOM   2939   C  C      . ALA A 1 188 ? -27.530 11.249  -12.674 1.00 51.12 ? 188  ALA A C      1  
ATOM   2940   O  O      . ALA A 1 188 ? -27.676 10.159  -12.153 1.00 54.95 ? 188  ALA A O      1  
ATOM   2941   C  CB     . ALA A 1 188 ? -26.403 11.090  -14.916 1.00 48.65 ? 188  ALA A CB     1  
ATOM   2942   H  H      . ALA A 1 188 ? -24.661 10.109  -13.465 1.00 0.00  ? 188  ALA A H      1  
ATOM   2943   H  HA     . ALA A 1 188 ? -26.041 12.621  -13.440 1.00 0.00  ? 188  ALA A HA     1  
ATOM   2944   H  HB1    . ALA A 1 188 ? -26.923 11.840  -15.493 1.00 0.00  ? 188  ALA A HB1    1  
ATOM   2945   H  HB2    . ALA A 1 188 ? -26.965 10.167  -14.936 1.00 0.00  ? 188  ALA A HB2    1  
ATOM   2946   H  HB3    . ALA A 1 188 ? -25.424 10.923  -15.339 1.00 0.00  ? 188  ALA A HB3    1  
ATOM   2947   N  N      . THR A 1 189 ? -28.440 12.191  -12.567 1.00 53.35 ? 189  THR A N      1  
ATOM   2948   C  CA     . THR A 1 189 ? -29.706 11.951  -11.785 1.00 58.31 ? 189  THR A CA     1  
ATOM   2949   C  C      . THR A 1 189 ? -30.352 10.603  -12.145 1.00 53.52 ? 189  THR A C      1  
ATOM   2950   O  O      . THR A 1 189 ? -30.732 9.839   -11.275 1.00 54.49 ? 189  THR A O      1  
ATOM   2951   C  CB     . THR A 1 189 ? -30.632 13.102  -12.174 1.00 61.24 ? 189  THR A CB     1  
ATOM   2952   O  OG1    . THR A 1 189 ? -29.960 14.336  -11.961 1.00 63.22 ? 189  THR A OG1    1  
ATOM   2953   C  CG2    . THR A 1 189 ? -31.899 13.053  -11.318 1.00 53.24 ? 189  THR A CG2    1  
ATOM   2954   H  H      . THR A 1 189 ? -28.288 13.061  -12.992 1.00 0.00  ? 189  THR A H      1  
ATOM   2955   H  HA     . THR A 1 189 ? -29.503 11.992  -10.728 1.00 0.00  ? 189  THR A HA     1  
ATOM   2956   H  HB     . THR A 1 189 ? -30.901 13.011  -13.214 1.00 0.00  ? 189  THR A HB     1  
ATOM   2957   H  HG1    . THR A 1 189 ? -29.617 14.336  -11.064 1.00 0.00  ? 189  THR A HG1    1  
ATOM   2958   H  HG21   . THR A 1 189 ? -31.630 13.077  -10.273 1.00 0.00  ? 189  THR A HG21   1  
ATOM   2959   H  HG22   . THR A 1 189 ? -32.441 12.142  -11.529 1.00 0.00  ? 189  THR A HG22   1  
ATOM   2960   H  HG23   . THR A 1 189 ? -32.522 13.904  -11.549 1.00 0.00  ? 189  THR A HG23   1  
ATOM   2961   N  N      . GLU A 1 190 ? -30.471 10.309  -13.411 1.00 54.58 ? 190  GLU A N      1  
ATOM   2962   C  CA     . GLU A 1 190 ? -31.092 9.008   -13.845 1.00 55.79 ? 190  GLU A CA     1  
ATOM   2963   C  C      . GLU A 1 190 ? -30.367 7.818   -13.202 1.00 55.46 ? 190  GLU A C      1  
ATOM   2964   O  O      . GLU A 1 190 ? -30.980 6.925   -12.646 1.00 50.71 ? 190  GLU A O      1  
ATOM   2965   C  CB     . GLU A 1 190 ? -30.911 8.980   -15.365 1.00 55.89 ? 190  GLU A CB     1  
ATOM   2966   C  CG     . GLU A 1 190 ? -31.595 7.739   -15.940 1.00 60.99 ? 190  GLU A CG     1  
ATOM   2967   C  CD     . GLU A 1 190 ? -31.119 7.509   -17.377 1.00 71.84 ? 190  GLU A CD     1  
ATOM   2968   O  OE1    . GLU A 1 190 ? -31.087 8.469   -18.131 1.00 70.78 ? 190  GLU A OE1    1  
ATOM   2969   O  OE2    . GLU A 1 190 ? -30.796 6.378   -17.699 1.00 75.36 ? 190  GLU A OE2    1  
ATOM   2970   H  H      . GLU A 1 190 ? -30.162 10.937  -14.099 1.00 0.00  ? 190  GLU A H      1  
ATOM   2971   H  HA     . GLU A 1 190 ? -32.142 8.989   -13.600 1.00 0.00  ? 190  GLU A HA     1  
ATOM   2972   H  HB2    . GLU A 1 190 ? -31.352 9.868   -15.796 1.00 0.00  ? 190  GLU A HB2    1  
ATOM   2973   H  HB3    . GLU A 1 190 ? -29.858 8.951   -15.602 1.00 0.00  ? 190  GLU A HB3    1  
ATOM   2974   H  HG2    . GLU A 1 190 ? -31.345 6.879   -15.336 1.00 0.00  ? 190  GLU A HG2    1  
ATOM   2975   H  HG3    . GLU A 1 190 ? -32.664 7.884   -15.937 1.00 0.00  ? 190  GLU A HG3    1  
ATOM   2976   N  N      . ASP A 1 191 ? -29.067 7.805   -13.280 1.00 50.50 ? 191  ASP A N      1  
ATOM   2977   C  CA     . ASP A 1 191 ? -28.286 6.682   -12.677 1.00 50.21 ? 191  ASP A CA     1  
ATOM   2978   C  C      . ASP A 1 191 ? -28.479 6.644   -11.154 1.00 52.24 ? 191  ASP A C      1  
ATOM   2979   O  O      . ASP A 1 191 ? -28.575 5.584   -10.559 1.00 48.44 ? 191  ASP A O      1  
ATOM   2980   C  CB     . ASP A 1 191 ? -26.828 6.988   -13.022 1.00 46.56 ? 191  ASP A CB     1  
ATOM   2981   C  CG     . ASP A 1 191 ? -26.536 6.522   -14.448 1.00 51.39 ? 191  ASP A CG     1  
ATOM   2982   O  OD1    . ASP A 1 191 ? -26.444 5.322   -14.651 1.00 50.19 ? 191  ASP A OD1    1  
ATOM   2983   O  OD2    . ASP A 1 191 ? -26.411 7.372   -15.314 1.00 46.23 ? 191  ASP A OD2    1  
ATOM   2984   H  H      . ASP A 1 191 ? -28.600 8.536   -13.740 1.00 0.00  ? 191  ASP A H      1  
ATOM   2985   H  HA     . ASP A 1 191 ? -28.578 5.742   -13.118 1.00 0.00  ? 191  ASP A HA     1  
ATOM   2986   H  HB2    . ASP A 1 191 ? -26.657 8.052   -12.947 1.00 0.00  ? 191  ASP A HB2    1  
ATOM   2987   H  HB3    . ASP A 1 191 ? -26.179 6.468   -12.334 1.00 0.00  ? 191  ASP A HB3    1  
ATOM   2988   N  N      . LYS A 1 192 ? -28.533 7.795   -10.515 1.00 51.98 ? 192  LYS A N      1  
ATOM   2989   C  CA     . LYS A 1 192 ? -28.712 7.822   -9.033  1.00 47.84 ? 192  LYS A CA     1  
ATOM   2990   C  C      . LYS A 1 192 ? -30.078 7.250   -8.645  1.00 52.77 ? 192  LYS A C      1  
ATOM   2991   O  O      . LYS A 1 192 ? -30.207 6.535   -7.666  1.00 52.10 ? 192  LYS A O      1  
ATOM   2992   C  CB     . LYS A 1 192 ? -28.626 9.298   -8.647  1.00 45.07 ? 192  LYS A CB     1  
ATOM   2993   C  CG     . LYS A 1 192 ? -27.170 9.766   -8.714  1.00 48.10 ? 192  LYS A CG     1  
ATOM   2994   C  CD     . LYS A 1 192 ? -26.991 11.005  -7.833  1.00 50.66 ? 192  LYS A CD     1  
ATOM   2995   C  CE     . LYS A 1 192 ? -27.731 12.192  -8.457  1.00 48.85 ? 192  LYS A CE     1  
ATOM   2996   N  NZ     . LYS A 1 192 ? -27.158 13.397  -7.794  1.00 52.46 ? 192  LYS A NZ     1  
ATOM   2997   H  H      . LYS A 1 192 ? -28.450 8.626   -11.030 1.00 0.00  ? 192  LYS A H      1  
ATOM   2998   H  HA     . LYS A 1 192 ? -27.922 7.268   -8.550  1.00 0.00  ? 192  LYS A HA     1  
ATOM   2999   H  HB2    . LYS A 1 192 ? -29.225 9.882   -9.330  1.00 0.00  ? 192  LYS A HB2    1  
ATOM   3000   H  HB3    . LYS A 1 192 ? -28.997 9.426   -7.642  1.00 0.00  ? 192  LYS A HB3    1  
ATOM   3001   H  HG2    . LYS A 1 192 ? -26.521 8.976   -8.362  1.00 0.00  ? 192  LYS A HG2    1  
ATOM   3002   H  HG3    . LYS A 1 192 ? -26.918 10.012  -9.734  1.00 0.00  ? 192  LYS A HG3    1  
ATOM   3003   H  HD2    . LYS A 1 192 ? -27.392 10.808  -6.849  1.00 0.00  ? 192  LYS A HD2    1  
ATOM   3004   H  HD3    . LYS A 1 192 ? -25.940 11.241  -7.753  1.00 0.00  ? 192  LYS A HD3    1  
ATOM   3005   H  HE2    . LYS A 1 192 ? -27.553 12.225  -9.523  1.00 0.00  ? 192  LYS A HE2    1  
ATOM   3006   H  HE3    . LYS A 1 192 ? -28.788 12.126  -8.252  1.00 0.00  ? 192  LYS A HE3    1  
ATOM   3007   H  HZ1    . LYS A 1 192 ? -27.348 13.355  -6.773  1.00 0.00  ? 192  LYS A HZ1    1  
ATOM   3008   H  HZ2    . LYS A 1 192 ? -27.594 14.253  -8.194  1.00 0.00  ? 192  LYS A HZ2    1  
ATOM   3009   H  HZ3    . LYS A 1 192 ? -26.130 13.425  -7.952  1.00 0.00  ? 192  LYS A HZ3    1  
ATOM   3010   N  N      . GLU A 1 193 ? -31.094 7.563   -9.401  1.00 55.35 ? 193  GLU A N      1  
ATOM   3011   C  CA     . GLU A 1 193 ? -32.458 7.040   -9.079  1.00 53.45 ? 193  GLU A CA     1  
ATOM   3012   C  C      . GLU A 1 193 ? -32.488 5.513   -9.206  1.00 51.79 ? 193  GLU A C      1  
ATOM   3013   O  O      . GLU A 1 193 ? -33.019 4.821   -8.354  1.00 50.91 ? 193  GLU A O      1  
ATOM   3014   C  CB     . GLU A 1 193 ? -33.385 7.682   -10.111 1.00 55.20 ? 193  GLU A CB     1  
ATOM   3015   C  CG     . GLU A 1 193 ? -34.818 7.693   -9.575  1.00 61.06 ? 193  GLU A CG     1  
ATOM   3016   C  CD     . GLU A 1 193 ? -35.032 8.938   -8.712  1.00 61.93 ? 193  GLU A CD     1  
ATOM   3017   O  OE1    . GLU A 1 193 ? -34.516 9.983   -9.076  1.00 61.45 ? 193  GLU A OE1    1  
ATOM   3018   O  OE2    . GLU A 1 193 ? -35.707 8.826   -7.702  1.00 61.21 ? 193  GLU A OE2    1  
ATOM   3019   H  H      . GLU A 1 193 ? -30.959 8.144   -10.181 1.00 0.00  ? 193  GLU A H      1  
ATOM   3020   H  HA     . GLU A 1 193 ? -32.750 7.341   -8.085  1.00 0.00  ? 193  GLU A HA     1  
ATOM   3021   H  HB2    . GLU A 1 193 ? -33.063 8.695   -10.302 1.00 0.00  ? 193  GLU A HB2    1  
ATOM   3022   H  HB3    . GLU A 1 193 ? -33.350 7.113   -11.028 1.00 0.00  ? 193  GLU A HB3    1  
ATOM   3023   H  HG2    . GLU A 1 193 ? -35.511 7.706   -10.404 1.00 0.00  ? 193  GLU A HG2    1  
ATOM   3024   H  HG3    . GLU A 1 193 ? -34.987 6.810   -8.978  1.00 0.00  ? 193  GLU A HG3    1  
ATOM   3025   N  N      . ALA A 1 194 ? -31.918 4.985   -10.262 1.00 46.17 ? 194  ALA A N      1  
ATOM   3026   C  CA     . ALA A 1 194 ? -31.908 3.499   -10.455 1.00 45.61 ? 194  ALA A CA     1  
ATOM   3027   C  C      . ALA A 1 194 ? -31.269 2.808   -9.245  1.00 51.75 ? 194  ALA A C      1  
ATOM   3028   O  O      . ALA A 1 194 ? -31.734 1.780   -8.790  1.00 54.43 ? 194  ALA A O      1  
ATOM   3029   C  CB     . ALA A 1 194 ? -31.074 3.269   -11.712 1.00 45.08 ? 194  ALA A CB     1  
ATOM   3030   H  H      . ALA A 1 194 ? -31.497 5.570   -10.926 1.00 0.00  ? 194  ALA A H      1  
ATOM   3031   H  HA     . ALA A 1 194 ? -32.912 3.135   -10.607 1.00 0.00  ? 194  ALA A HA     1  
ATOM   3032   H  HB1    . ALA A 1 194 ? -31.436 3.907   -12.505 1.00 0.00  ? 194  ALA A HB1    1  
ATOM   3033   H  HB2    . ALA A 1 194 ? -31.158 2.235   -12.014 1.00 0.00  ? 194  ALA A HB2    1  
ATOM   3034   H  HB3    . ALA A 1 194 ? -30.041 3.502   -11.505 1.00 0.00  ? 194  ALA A HB3    1  
ATOM   3035   N  N      . LEU A 1 195 ? -30.207 3.372   -8.726  1.00 49.32 ? 195  LEU A N      1  
ATOM   3036   C  CA     . LEU A 1 195 ? -29.526 2.752   -7.555  1.00 46.46 ? 195  LEU A CA     1  
ATOM   3037   C  C      . LEU A 1 195 ? -30.410 2.874   -6.309  1.00 50.56 ? 195  LEU A C      1  
ATOM   3038   O  O      . LEU A 1 195 ? -30.713 1.889   -5.660  1.00 52.14 ? 195  LEU A O      1  
ATOM   3039   C  CB     . LEU A 1 195 ? -28.235 3.551   -7.381  1.00 47.30 ? 195  LEU A CB     1  
ATOM   3040   C  CG     . LEU A 1 195 ? -27.254 3.174   -8.491  1.00 41.33 ? 195  LEU A CG     1  
ATOM   3041   C  CD1    . LEU A 1 195 ? -26.096 4.172   -8.515  1.00 37.99 ? 195  LEU A CD1    1  
ATOM   3042   C  CD2    . LEU A 1 195 ? -26.708 1.769   -8.230  1.00 39.79 ? 195  LEU A CD2    1  
ATOM   3043   H  H      . LEU A 1 195 ? -29.848 4.180   -9.150  1.00 0.00  ? 195  LEU A H      1  
ATOM   3044   H  HA     . LEU A 1 195 ? -29.293 1.716   -7.753  1.00 0.00  ? 195  LEU A HA     1  
ATOM   3045   H  HB2    . LEU A 1 195 ? -28.456 4.607   -7.435  1.00 0.00  ? 195  LEU A HB2    1  
ATOM   3046   H  HB3    . LEU A 1 195 ? -27.797 3.321   -6.422  1.00 0.00  ? 195  LEU A HB3    1  
ATOM   3047   H  HG     . LEU A 1 195 ? -27.765 3.193   -9.443  1.00 0.00  ? 195  LEU A HG     1  
ATOM   3048   H  HD11   . LEU A 1 195 ? -25.291 3.805   -7.896  1.00 0.00  ? 195  LEU A HD11   1  
ATOM   3049   H  HD12   . LEU A 1 195 ? -26.434 5.126   -8.139  1.00 0.00  ? 195  LEU A HD12   1  
ATOM   3050   H  HD13   . LEU A 1 195 ? -25.744 4.290   -9.530  1.00 0.00  ? 195  LEU A HD13   1  
ATOM   3051   H  HD21   . LEU A 1 195 ? -27.490 1.042   -8.396  1.00 0.00  ? 195  LEU A HD21   1  
ATOM   3052   H  HD22   . LEU A 1 195 ? -26.364 1.700   -7.209  1.00 0.00  ? 195  LEU A HD22   1  
ATOM   3053   H  HD23   . LEU A 1 195 ? -25.885 1.572   -8.902  1.00 0.00  ? 195  LEU A HD23   1  
ATOM   3054   N  N      . LYS A 1 196 ? -30.846 4.077   -5.979  1.00 50.38 ? 196  LYS A N      1  
ATOM   3055   C  CA     . LYS A 1 196 ? -31.734 4.255   -4.788  1.00 46.79 ? 196  LYS A CA     1  
ATOM   3056   C  C      . LYS A 1 196 ? -32.922 3.285   -4.864  1.00 50.43 ? 196  LYS A C      1  
ATOM   3057   O  O      . LYS A 1 196 ? -33.458 2.846   -3.861  1.00 53.20 ? 196  LYS A O      1  
ATOM   3058   C  CB     . LYS A 1 196 ? -32.219 5.703   -4.873  1.00 49.24 ? 196  LYS A CB     1  
ATOM   3059   C  CG     . LYS A 1 196 ? -31.194 6.633   -4.216  1.00 51.25 ? 196  LYS A CG     1  
ATOM   3060   C  CD     . LYS A 1 196 ? -31.617 8.089   -4.425  1.00 52.27 ? 196  LYS A CD     1  
ATOM   3061   C  CE     . LYS A 1 196 ? -30.765 9.003   -3.540  1.00 64.52 ? 196  LYS A CE     1  
ATOM   3062   N  NZ     . LYS A 1 196 ? -31.319 10.371  -3.749  1.00 64.60 ? 196  LYS A NZ     1  
ATOM   3063   H  H      . LYS A 1 196 ? -30.606 4.832   -6.558  1.00 0.00  ? 196  LYS A H      1  
ATOM   3064   H  HA     . LYS A 1 196 ? -31.176 4.100   -3.879  1.00 0.00  ? 196  LYS A HA     1  
ATOM   3065   H  HB2    . LYS A 1 196 ? -32.343 5.980   -5.910  1.00 0.00  ? 196  LYS A HB2    1  
ATOM   3066   H  HB3    . LYS A 1 196 ? -33.165 5.795   -4.362  1.00 0.00  ? 196  LYS A HB3    1  
ATOM   3067   H  HG2    . LYS A 1 196 ? -31.142 6.420   -3.158  1.00 0.00  ? 196  LYS A HG2    1  
ATOM   3068   H  HG3    . LYS A 1 196 ? -30.224 6.474   -4.664  1.00 0.00  ? 196  LYS A HG3    1  
ATOM   3069   H  HD2    . LYS A 1 196 ? -31.477 8.359   -5.463  1.00 0.00  ? 196  LYS A HD2    1  
ATOM   3070   H  HD3    . LYS A 1 196 ? -32.658 8.204   -4.161  1.00 0.00  ? 196  LYS A HD3    1  
ATOM   3071   H  HE2    . LYS A 1 196 ? -30.858 8.712   -2.503  1.00 0.00  ? 196  LYS A HE2    1  
ATOM   3072   H  HE3    . LYS A 1 196 ? -29.732 8.972   -3.851  1.00 0.00  ? 196  LYS A HE3    1  
ATOM   3073   H  HZ1    . LYS A 1 196 ? -30.845 11.039  -3.107  1.00 0.00  ? 196  LYS A HZ1    1  
ATOM   3074   H  HZ2    . LYS A 1 196 ? -32.341 10.365  -3.550  1.00 0.00  ? 196  LYS A HZ2    1  
ATOM   3075   H  HZ3    . LYS A 1 196 ? -31.157 10.666  -4.732  1.00 0.00  ? 196  LYS A HZ3    1  
ATOM   3076   N  N      . LYS A 1 197 ? -33.320 2.954   -6.056  1.00 51.52 ? 197  LYS A N      1  
ATOM   3077   C  CA     . LYS A 1 197 ? -34.470 2.014   -6.254  1.00 53.19 ? 197  LYS A CA     1  
ATOM   3078   C  C      . LYS A 1 197 ? -34.113 0.601   -5.761  1.00 49.70 ? 197  LYS A C      1  
ATOM   3079   O  O      . LYS A 1 197 ? -34.904 -0.057  -5.110  1.00 49.11 ? 197  LYS A O      1  
ATOM   3080   C  CB     . LYS A 1 197 ? -34.691 2.001   -7.770  1.00 58.77 ? 197  LYS A CB     1  
ATOM   3081   C  CG     . LYS A 1 197 ? -36.175 1.803   -8.076  1.00 59.14 ? 197  LYS A CG     1  
ATOM   3082   C  CD     . LYS A 1 197 ? -36.862 3.166   -8.179  1.00 69.57 ? 197  LYS A CD     1  
ATOM   3083   C  CE     . LYS A 1 197 ? -38.204 3.011   -8.898  1.00 78.01 ? 197  LYS A CE     1  
ATOM   3084   N  NZ     . LYS A 1 197 ? -39.054 2.230   -7.958  1.00 68.68 ? 197  LYS A NZ     1  
ATOM   3085   H  H      . LYS A 1 197 ? -32.880 3.333   -6.846  1.00 0.00  ? 197  LYS A H      1  
ATOM   3086   H  HA     . LYS A 1 197 ? -35.354 2.380   -5.757  1.00 0.00  ? 197  LYS A HA     1  
ATOM   3087   H  HB2    . LYS A 1 197 ? -34.359 2.940   -8.189  1.00 0.00  ? 197  LYS A HB2    1  
ATOM   3088   H  HB3    . LYS A 1 197 ? -34.124 1.192   -8.208  1.00 0.00  ? 197  LYS A HB3    1  
ATOM   3089   H  HG2    . LYS A 1 197 ? -36.280 1.274   -9.013  1.00 0.00  ? 197  LYS A HG2    1  
ATOM   3090   H  HG3    . LYS A 1 197 ? -36.633 1.229   -7.285  1.00 0.00  ? 197  LYS A HG3    1  
ATOM   3091   H  HD2    . LYS A 1 197 ? -37.027 3.561   -7.187  1.00 0.00  ? 197  LYS A HD2    1  
ATOM   3092   H  HD3    . LYS A 1 197 ? -36.233 3.845   -8.736  1.00 0.00  ? 197  LYS A HD3    1  
ATOM   3093   H  HE2    . LYS A 1 197 ? -38.642 3.982   -9.088  1.00 0.00  ? 197  LYS A HE2    1  
ATOM   3094   H  HE3    . LYS A 1 197 ? -38.076 2.467   -9.821  1.00 0.00  ? 197  LYS A HE3    1  
ATOM   3095   H  HZ1    . LYS A 1 197 ? -40.003 2.111   -8.365  1.00 0.00  ? 197  LYS A HZ1    1  
ATOM   3096   H  HZ2    . LYS A 1 197 ? -39.126 2.739   -7.052  1.00 0.00  ? 197  LYS A HZ2    1  
ATOM   3097   H  HZ3    . LYS A 1 197 ? -38.627 1.296   -7.798  1.00 0.00  ? 197  LYS A HZ3    1  
ATOM   3098   N  N      . GLN A 1 198 ? -32.935 0.122   -6.091  1.00 49.57 ? 198  GLN A N      1  
ATOM   3099   C  CA     . GLN A 1 198 ? -32.541 -1.261  -5.667  1.00 48.13 ? 198  GLN A CA     1  
ATOM   3100   C  C      . GLN A 1 198 ? -31.945 -1.260  -4.254  1.00 52.04 ? 198  GLN A C      1  
ATOM   3101   O  O      . GLN A 1 198 ? -32.062 -2.230  -3.527  1.00 46.08 ? 198  GLN A O      1  
ATOM   3102   C  CB     . GLN A 1 198 ? -31.516 -1.732  -6.702  1.00 46.76 ? 198  GLN A CB     1  
ATOM   3103   C  CG     . GLN A 1 198 ? -30.307 -0.796  -6.715  1.00 49.05 ? 198  GLN A CG     1  
ATOM   3104   C  CD     . GLN A 1 198 ? -29.112 -1.527  -7.328  1.00 49.38 ? 198  GLN A CD     1  
ATOM   3105   O  OE1    . GLN A 1 198 ? -28.033 -1.525  -6.770  1.00 46.53 ? 198  GLN A OE1    1  
ATOM   3106   N  NE2    . GLN A 1 198 ? -29.259 -2.159  -8.460  1.00 50.07 ? 198  GLN A NE2    1  
ATOM   3107   H  H      . GLN A 1 198 ? -32.331 0.664   -6.639  1.00 0.00  ? 198  GLN A H      1  
ATOM   3108   H  HA     . GLN A 1 198 ? -33.403 -1.910  -5.697  1.00 0.00  ? 198  GLN A HA     1  
ATOM   3109   H  HB2    . GLN A 1 198 ? -31.191 -2.732  -6.454  1.00 0.00  ? 198  GLN A HB2    1  
ATOM   3110   H  HB3    . GLN A 1 198 ? -31.973 -1.737  -7.681  1.00 0.00  ? 198  GLN A HB3    1  
ATOM   3111   H  HG2    . GLN A 1 198 ? -30.536 0.081   -7.304  1.00 0.00  ? 198  GLN A HG2    1  
ATOM   3112   H  HG3    . GLN A 1 198 ? -30.067 -0.501  -5.706  1.00 0.00  ? 198  GLN A HG3    1  
ATOM   3113   H  HE21   . GLN A 1 198 ? -30.129 -2.162  -8.911  1.00 0.00  ? 198  GLN A HE21   1  
ATOM   3114   H  HE22   . GLN A 1 198 ? -28.499 -2.633  -8.859  1.00 0.00  ? 198  GLN A HE22   1  
ATOM   3115   N  N      . LEU A 1 199 ? -31.335 -0.178  -3.853  1.00 48.92 ? 199  LEU A N      1  
ATOM   3116   C  CA     . LEU A 1 199 ? -30.767 -0.102  -2.474  1.00 47.12 ? 199  LEU A CA     1  
ATOM   3117   C  C      . LEU A 1 199 ? -31.439 1.074   -1.754  1.00 50.23 ? 199  LEU A C      1  
ATOM   3118   O  O      . LEU A 1 199 ? -30.882 2.149   -1.666  1.00 50.04 ? 199  LEU A O      1  
ATOM   3119   C  CB     . LEU A 1 199 ? -29.268 0.145   -2.660  1.00 43.00 ? 199  LEU A CB     1  
ATOM   3120   C  CG     . LEU A 1 199 ? -28.602 -1.126  -3.196  1.00 43.42 ? 199  LEU A CG     1  
ATOM   3121   C  CD1    . LEU A 1 199 ? -27.150 -0.824  -3.574  1.00 42.18 ? 199  LEU A CD1    1  
ATOM   3122   C  CD2    . LEU A 1 199 ? -28.627 -2.210  -2.117  1.00 34.79 ? 199  LEU A CD2    1  
ATOM   3123   H  H      . LEU A 1 199 ? -31.271 0.597   -4.454  1.00 0.00  ? 199  LEU A H      1  
ATOM   3124   H  HA     . LEU A 1 199 ? -30.935 -1.026  -1.941  1.00 0.00  ? 199  LEU A HA     1  
ATOM   3125   H  HB2    . LEU A 1 199 ? -29.120 0.955   -3.360  1.00 0.00  ? 199  LEU A HB2    1  
ATOM   3126   H  HB3    . LEU A 1 199 ? -28.827 0.405   -1.709  1.00 0.00  ? 199  LEU A HB3    1  
ATOM   3127   H  HG     . LEU A 1 199 ? -29.136 -1.472  -4.070  1.00 0.00  ? 199  LEU A HG     1  
ATOM   3128   H  HD11   . LEU A 1 199 ? -27.113 -0.431  -4.580  1.00 0.00  ? 199  LEU A HD11   1  
ATOM   3129   H  HD12   . LEU A 1 199 ? -26.568 -1.732  -3.521  1.00 0.00  ? 199  LEU A HD12   1  
ATOM   3130   H  HD13   . LEU A 1 199 ? -26.744 -0.095  -2.888  1.00 0.00  ? 199  LEU A HD13   1  
ATOM   3131   H  HD21   . LEU A 1 199 ? -29.582 -2.715  -2.135  1.00 0.00  ? 199  LEU A HD21   1  
ATOM   3132   H  HD22   . LEU A 1 199 ? -28.478 -1.757  -1.148  1.00 0.00  ? 199  LEU A HD22   1  
ATOM   3133   H  HD23   . LEU A 1 199 ? -27.839 -2.924  -2.306  1.00 0.00  ? 199  LEU A HD23   1  
ATOM   3134   N  N      . PRO A 1 200 ? -32.655 0.848   -1.307  1.00 52.86 ? 200  PRO A N      1  
ATOM   3135   C  CA     . PRO A 1 200 ? -33.438 1.923   -0.634  1.00 53.87 ? 200  PRO A CA     1  
ATOM   3136   C  C      . PRO A 1 200 ? -32.903 2.214   0.770   1.00 54.76 ? 200  PRO A C      1  
ATOM   3137   O  O      . PRO A 1 200 ? -32.818 3.353   1.185   1.00 54.47 ? 200  PRO A O      1  
ATOM   3138   C  CB     . PRO A 1 200 ? -34.848 1.343   -0.562  1.00 52.58 ? 200  PRO A CB     1  
ATOM   3139   C  CG     . PRO A 1 200 ? -34.663 -0.140  -0.599  1.00 50.31 ? 200  PRO A CG     1  
ATOM   3140   C  CD     . PRO A 1 200 ? -33.406 -0.412  -1.385  1.00 52.27 ? 200  PRO A CD     1  
ATOM   3141   H  HA     . PRO A 1 200 ? -33.442 2.819   -1.232  1.00 0.00  ? 200  PRO A HA     1  
ATOM   3142   H  HB2    . PRO A 1 200 ? -35.329 1.642   0.359   1.00 0.00  ? 200  PRO A HB2    1  
ATOM   3143   H  HB3    . PRO A 1 200 ? -35.430 1.663   -1.413  1.00 0.00  ? 200  PRO A HB3    1  
ATOM   3144   H  HG2    . PRO A 1 200 ? -34.562 -0.523  0.407   1.00 0.00  ? 200  PRO A HG2    1  
ATOM   3145   H  HG3    . PRO A 1 200 ? -35.504 -0.605  -1.089  1.00 0.00  ? 200  PRO A HG3    1  
ATOM   3146   H  HD2    . PRO A 1 200 ? -32.846 -1.219  -0.933  1.00 0.00  ? 200  PRO A HD2    1  
ATOM   3147   H  HD3    . PRO A 1 200 ? -33.642 -0.641  -2.412  1.00 0.00  ? 200  PRO A HD3    1  
ATOM   3148   N  N      . GLY A 1 201 ? -32.549 1.197   1.506   1.00 51.33 ? 201  GLY A N      1  
ATOM   3149   C  CA     . GLY A 1 201 ? -32.029 1.422   2.885   1.00 53.17 ? 201  GLY A CA     1  
ATOM   3150   C  C      . GLY A 1 201 ? -33.201 1.691   3.830   1.00 60.86 ? 201  GLY A C      1  
ATOM   3151   O  O      . GLY A 1 201 ? -34.080 0.867   3.993   1.00 0.00  ? 201  GLY A O      1  
ATOM   3152   H  H      . GLY A 1 201 ? -32.630 0.286   1.155   1.00 0.00  ? 201  GLY A H      1  
ATOM   3153   H  HA2    . GLY A 1 201 ? -31.491 0.544   3.215   1.00 0.00  ? 201  GLY A HA2    1  
ATOM   3154   H  HA3    . GLY A 1 201 ? -31.366 2.274   2.887   1.00 0.00  ? 201  GLY A HA3    1  
ATOM   3155   N  N      . VAL A 1 202 ? -33.220 2.838   4.455   1.00 0.00  ? 202  VAL A N      1  
ATOM   3156   C  CA     . VAL A 1 202 ? -34.336 3.161   5.393   1.00 0.00  ? 202  VAL A CA     1  
ATOM   3157   C  C      . VAL A 1 202 ? -35.491 3.822   4.634   1.00 0.00  ? 202  VAL A C      1  
ATOM   3158   O  O      . VAL A 1 202 ? -36.555 3.252   4.488   1.00 0.00  ? 202  VAL A O      1  
ATOM   3159   C  CB     . VAL A 1 202 ? -33.732 4.131   6.412   1.00 0.00  ? 202  VAL A CB     1  
ATOM   3160   C  CG1    . VAL A 1 202 ? -34.790 4.512   7.450   1.00 0.00  ? 202  VAL A CG1    1  
ATOM   3161   C  CG2    . VAL A 1 202 ? -32.548 3.462   7.116   1.00 0.00  ? 202  VAL A CG2    1  
ATOM   3162   H  H      . VAL A 1 202 ? -32.500 3.487   4.309   1.00 0.00  ? 202  VAL A H      1  
ATOM   3163   H  HA     . VAL A 1 202 ? -34.676 2.268   5.893   1.00 0.00  ? 202  VAL A HA     1  
ATOM   3164   H  HB     . VAL A 1 202 ? -33.392 5.022   5.902   1.00 0.00  ? 202  VAL A HB     1  
ATOM   3165   H  HG11   . VAL A 1 202 ? -35.774 4.394   7.023   1.00 0.00  ? 202  VAL A HG11   1  
ATOM   3166   H  HG12   . VAL A 1 202 ? -34.648 5.540   7.749   1.00 0.00  ? 202  VAL A HG12   1  
ATOM   3167   H  HG13   . VAL A 1 202 ? -34.694 3.870   8.314   1.00 0.00  ? 202  VAL A HG13   1  
ATOM   3168   H  HG21   . VAL A 1 202 ? -31.999 4.201   7.680   1.00 0.00  ? 202  VAL A HG21   1  
ATOM   3169   H  HG22   . VAL A 1 202 ? -31.897 3.014   6.380   1.00 0.00  ? 202  VAL A HG22   1  
ATOM   3170   H  HG23   . VAL A 1 202 ? -32.914 2.697   7.786   1.00 0.00  ? 202  VAL A HG23   1  
ATOM   3171   N  N      . LYS A 1 203 ? -35.289 5.019   4.152   1.00 0.00  ? 203  LYS A N      1  
ATOM   3172   C  CA     . LYS A 1 203 ? -36.376 5.717   3.405   1.00 0.00  ? 203  LYS A CA     1  
ATOM   3173   C  C      . LYS A 1 203 ? -35.782 6.780   2.476   1.00 0.00  ? 203  LYS A C      1  
ATOM   3174   O  O      . LYS A 1 203 ? -34.628 7.144   2.592   1.00 0.00  ? 203  LYS A O      1  
ATOM   3175   C  CB     . LYS A 1 203 ? -37.241 6.372   4.483   1.00 0.00  ? 203  LYS A CB     1  
ATOM   3176   C  CG     . LYS A 1 203 ? -38.690 6.465   3.993   1.00 0.00  ? 203  LYS A CG     1  
ATOM   3177   C  CD     . LYS A 1 203 ? -39.539 5.393   4.684   1.00 0.00  ? 203  LYS A CD     1  
ATOM   3178   C  CE     . LYS A 1 203 ? -40.422 6.045   5.751   1.00 0.00  ? 203  LYS A CE     1  
ATOM   3179   N  NZ     . LYS A 1 203 ? -41.581 6.603   5.001   1.00 0.00  ? 203  LYS A NZ     1  
ATOM   3180   H  H      . LYS A 1 203 ? -34.424 5.461   4.282   1.00 0.00  ? 203  LYS A H      1  
ATOM   3181   H  HA     . LYS A 1 203 ? -36.962 5.008   2.842   1.00 0.00  ? 203  LYS A HA     1  
ATOM   3182   H  HB2    . LYS A 1 203 ? -37.202 5.778   5.385   1.00 0.00  ? 203  LYS A HB2    1  
ATOM   3183   H  HB3    . LYS A 1 203 ? -36.869 7.364   4.689   1.00 0.00  ? 203  LYS A HB3    1  
ATOM   3184   H  HG2    . LYS A 1 203 ? -39.084 7.444   4.226   1.00 0.00  ? 203  LYS A HG2    1  
ATOM   3185   H  HG3    . LYS A 1 203 ? -38.720 6.311   2.925   1.00 0.00  ? 203  LYS A HG3    1  
ATOM   3186   H  HD2    . LYS A 1 203 ? -40.162 4.902   3.951   1.00 0.00  ? 203  LYS A HD2    1  
ATOM   3187   H  HD3    . LYS A 1 203 ? -38.891 4.665   5.151   1.00 0.00  ? 203  LYS A HD3    1  
ATOM   3188   H  HE2    . LYS A 1 203 ? -40.754 5.305   6.466   1.00 0.00  ? 203  LYS A HE2    1  
ATOM   3189   H  HE3    . LYS A 1 203 ? -39.887 6.839   6.249   1.00 0.00  ? 203  LYS A HE3    1  
ATOM   3190   H  HZ1    . LYS A 1 203 ? -42.311 6.914   5.672   1.00 0.00  ? 203  LYS A HZ1    1  
ATOM   3191   H  HZ2    . LYS A 1 203 ? -41.973 5.871   4.375   1.00 0.00  ? 203  LYS A HZ2    1  
ATOM   3192   H  HZ3    . LYS A 1 203 ? -41.268 7.415   4.432   1.00 0.00  ? 203  LYS A HZ3    1  
ATOM   3193   N  N      . SER A 1 204 ? -36.564 7.281   1.557   1.00 0.00  ? 204  SER A N      1  
ATOM   3194   C  CA     . SER A 1 204 ? -36.048 8.321   0.620   1.00 0.00  ? 204  SER A CA     1  
ATOM   3195   C  C      . SER A 1 204 ? -36.406 9.718   1.135   1.00 0.00  ? 204  SER A C      1  
ATOM   3196   O  O      . SER A 1 204 ? -35.681 10.671  0.926   1.00 0.00  ? 204  SER A O      1  
ATOM   3197   C  CB     . SER A 1 204 ? -36.752 8.043   -0.707  1.00 0.00  ? 204  SER A CB     1  
ATOM   3198   O  OG     . SER A 1 204 ? -38.143 7.866   -0.472  1.00 0.00  ? 204  SER A OG     1  
ATOM   3199   H  H      . SER A 1 204 ? -37.491 6.973   1.483   1.00 0.00  ? 204  SER A H      1  
ATOM   3200   H  HA     . SER A 1 204 ? -34.981 8.225   0.500   1.00 0.00  ? 204  SER A HA     1  
ATOM   3201   H  HB2    . SER A 1 204 ? -36.608 8.875   -1.375  1.00 0.00  ? 204  SER A HB2    1  
ATOM   3202   H  HB3    . SER A 1 204 ? -36.335 7.149   -1.153  1.00 0.00  ? 204  SER A HB3    1  
ATOM   3203   H  HG     . SER A 1 204 ? -38.573 7.743   -1.321  1.00 0.00  ? 204  SER A HG     1  
ATOM   3204   N  N      . GLU A 1 205 ? -37.520 9.845   1.805   1.00 0.00  ? 205  GLU A N      1  
ATOM   3205   C  CA     . GLU A 1 205 ? -37.928 11.179  2.334   1.00 0.00  ? 205  GLU A CA     1  
ATOM   3206   C  C      . GLU A 1 205 ? -37.244 11.447  3.678   1.00 0.00  ? 205  GLU A C      1  
ATOM   3207   O  O      . GLU A 1 205 ? -36.288 10.789  4.040   1.00 0.00  ? 205  GLU A O      1  
ATOM   3208   C  CB     . GLU A 1 205 ? -39.444 11.087  2.513   1.00 0.00  ? 205  GLU A CB     1  
ATOM   3209   C  CG     . GLU A 1 205 ? -40.090 12.409  2.095   1.00 0.00  ? 205  GLU A CG     1  
ATOM   3210   C  CD     . GLU A 1 205 ? -41.462 12.135  1.476   1.00 0.00  ? 205  GLU A CD     1  
ATOM   3211   O  OE1    . GLU A 1 205 ? -42.282 11.530  2.147   1.00 0.00  ? 205  GLU A OE1    1  
ATOM   3212   O  OE2    . GLU A 1 205 ? -41.669 12.533  0.342   1.00 0.00  ? 205  GLU A OE2    1  
ATOM   3213   H  H      . GLU A 1 205 ? -38.089 9.062   1.961   1.00 0.00  ? 205  GLU A H      1  
ATOM   3214   H  HA     . GLU A 1 205 ? -37.686 11.955  1.626   1.00 0.00  ? 205  GLU A HA     1  
ATOM   3215   H  HB2    . GLU A 1 205 ? -39.831 10.286  1.898   1.00 0.00  ? 205  GLU A HB2    1  
ATOM   3216   H  HB3    . GLU A 1 205 ? -39.674 10.888  3.549   1.00 0.00  ? 205  GLU A HB3    1  
ATOM   3217   H  HG2    . GLU A 1 205 ? -40.206 13.043  2.962   1.00 0.00  ? 205  GLU A HG2    1  
ATOM   3218   H  HG3    . GLU A 1 205 ? -39.462 12.903  1.369   1.00 0.00  ? 205  GLU A HG3    1  
ATOM   3219   N  N      . GLY A 1 206 ? -37.727 12.408  4.418   1.00 0.00  ? 206  GLY A N      1  
ATOM   3220   C  CA     . GLY A 1 206 ? -37.108 12.720  5.738   1.00 0.00  ? 206  GLY A CA     1  
ATOM   3221   C  C      . GLY A 1 206 ? -38.089 13.533  6.583   1.00 0.00  ? 206  GLY A C      1  
ATOM   3222   O  O      . GLY A 1 206 ? -38.275 14.715  6.370   1.00 0.00  ? 206  GLY A O      1  
ATOM   3223   H  H      . GLY A 1 206 ? -38.499 12.926  4.106   1.00 0.00  ? 206  GLY A H      1  
ATOM   3224   H  HA2    . GLY A 1 206 ? -36.867 11.799  6.249   1.00 0.00  ? 206  GLY A HA2    1  
ATOM   3225   H  HA3    . GLY A 1 206 ? -36.207 13.295  5.586   1.00 0.00  ? 206  GLY A HA3    1  
ATOM   3226   N  N      . LYS A 1 207 ? -38.720 12.908  7.542   1.00 0.00  ? 207  LYS A N      1  
ATOM   3227   C  CA     . LYS A 1 207 ? -39.691 13.642  8.403   1.00 0.00  ? 207  LYS A CA     1  
ATOM   3228   C  C      . LYS A 1 207 ? -39.008 14.111  9.691   1.00 0.00  ? 207  LYS A C      1  
ATOM   3229   O  O      . LYS A 1 207 ? -38.859 15.294  9.929   1.00 0.00  ? 207  LYS A O      1  
ATOM   3230   C  CB     . LYS A 1 207 ? -40.790 12.625  8.717   1.00 0.00  ? 207  LYS A CB     1  
ATOM   3231   C  CG     . LYS A 1 207 ? -42.148 13.332  8.754   1.00 0.00  ? 207  LYS A CG     1  
ATOM   3232   C  CD     . LYS A 1 207 ? -42.904 13.065  7.450   1.00 0.00  ? 207  LYS A CD     1  
ATOM   3233   C  CE     . LYS A 1 207 ? -42.746 14.262  6.509   1.00 0.00  ? 207  LYS A CE     1  
ATOM   3234   N  NZ     . LYS A 1 207 ? -43.599 15.333  7.098   1.00 0.00  ? 207  LYS A NZ     1  
ATOM   3235   H  H      . LYS A 1 207 ? -38.554 11.954  7.695   1.00 0.00  ? 207  LYS A H      1  
ATOM   3236   H  HA     . LYS A 1 207 ? -40.108 14.482  7.869   1.00 0.00  ? 207  LYS A HA     1  
ATOM   3237   H  HB2    . LYS A 1 207 ? -40.800 11.860  7.954   1.00 0.00  ? 207  LYS A HB2    1  
ATOM   3238   H  HB3    . LYS A 1 207 ? -40.597 12.172  9.678   1.00 0.00  ? 207  LYS A HB3    1  
ATOM   3239   H  HG2    . LYS A 1 207 ? -42.725 12.956  9.588   1.00 0.00  ? 207  LYS A HG2    1  
ATOM   3240   H  HG3    . LYS A 1 207 ? -41.999 14.394  8.871   1.00 0.00  ? 207  LYS A HG3    1  
ATOM   3241   H  HD2    . LYS A 1 207 ? -42.504 12.179  6.976   1.00 0.00  ? 207  LYS A HD2    1  
ATOM   3242   H  HD3    . LYS A 1 207 ? -43.951 12.915  7.665   1.00 0.00  ? 207  LYS A HD3    1  
ATOM   3243   H  HE2    . LYS A 1 207 ? -41.712 14.578  6.475   1.00 0.00  ? 207  LYS A HE2    1  
ATOM   3244   H  HE3    . LYS A 1 207 ? -43.097 14.013  5.520   1.00 0.00  ? 207  LYS A HE3    1  
ATOM   3245   H  HZ1    . LYS A 1 207 ? -44.517 14.933  7.376   1.00 0.00  ? 207  LYS A HZ1    1  
ATOM   3246   H  HZ2    . LYS A 1 207 ? -43.747 16.084  6.393   1.00 0.00  ? 207  LYS A HZ2    1  
ATOM   3247   H  HZ3    . LYS A 1 207 ? -43.129 15.730  7.935   1.00 0.00  ? 207  LYS A HZ3    1  
ATOM   3248   N  N      . ARG A 1 208 ? -38.594 13.192  10.522  1.00 0.00  ? 208  ARG A N      1  
ATOM   3249   C  CA     . ARG A 1 208 ? -37.920 13.582  11.797  1.00 0.00  ? 208  ARG A CA     1  
ATOM   3250   C  C      . ARG A 1 208 ? -37.342 12.344  12.489  1.00 0.00  ? 208  ARG A C      1  
ATOM   3251   O  O      . ARG A 1 208 ? -37.664 11.223  12.146  1.00 0.00  ? 208  ARG A O      1  
ATOM   3252   C  CB     . ARG A 1 208 ? -39.019 14.215  12.655  1.00 0.00  ? 208  ARG A CB     1  
ATOM   3253   C  CG     . ARG A 1 208 ? -40.159 13.212  12.865  1.00 0.00  ? 208  ARG A CG     1  
ATOM   3254   C  CD     . ARG A 1 208 ? -41.505 13.912  12.655  1.00 0.00  ? 208  ARG A CD     1  
ATOM   3255   N  NE     . ARG A 1 208 ? -42.400 13.359  13.713  1.00 0.00  ? 208  ARG A NE     1  
ATOM   3256   C  CZ     . ARG A 1 208 ? -43.637 13.778  13.828  1.00 0.00  ? 208  ARG A CZ     1  
ATOM   3257   N  NH1    . ARG A 1 208 ? -44.112 14.689  13.016  1.00 0.00  ? 208  ARG A NH1    1  
ATOM   3258   N  NH2    . ARG A 1 208 ? -44.403 13.282  14.760  1.00 0.00  ? 208  ARG A NH2    1  
ATOM   3259   H  H      . ARG A 1 208 ? -38.725 12.245  10.309  1.00 0.00  ? 208  ARG A H      1  
ATOM   3260   H  HA     . ARG A 1 208 ? -37.141 14.303  11.605  1.00 0.00  ? 208  ARG A HA     1  
ATOM   3261   H  HB2    . ARG A 1 208 ? -38.607 14.497  13.613  1.00 0.00  ? 208  ARG A HB2    1  
ATOM   3262   H  HB3    . ARG A 1 208 ? -39.402 15.093  12.156  1.00 0.00  ? 208  ARG A HB3    1  
ATOM   3263   H  HG2    . ARG A 1 208 ? -40.061 12.401  12.157  1.00 0.00  ? 208  ARG A HG2    1  
ATOM   3264   H  HG3    . ARG A 1 208 ? -40.113 12.820  13.870  1.00 0.00  ? 208  ARG A HG3    1  
ATOM   3265   H  HD2    . ARG A 1 208 ? -41.393 14.981  12.775  1.00 0.00  ? 208  ARG A HD2    1  
ATOM   3266   H  HD3    . ARG A 1 208 ? -41.901 13.682  11.678  1.00 0.00  ? 208  ARG A HD3    1  
ATOM   3267   H  HE     . ARG A 1 208 ? -42.060 12.676  14.329  1.00 0.00  ? 208  ARG A HE     1  
ATOM   3268   H  HH11   . ARG A 1 208 ? -43.533 15.075  12.299  1.00 0.00  ? 208  ARG A HH11   1  
ATOM   3269   H  HH12   . ARG A 1 208 ? -45.057 15.000  13.115  1.00 0.00  ? 208  ARG A HH12   1  
ATOM   3270   H  HH21   . ARG A 1 208 ? -44.046 12.586  15.383  1.00 0.00  ? 208  ARG A HH21   1  
ATOM   3271   H  HH22   . ARG A 1 208 ? -45.347 13.598  14.852  1.00 0.00  ? 208  ARG A HH22   1  
ATOM   3272   N  N      . LYS A 1 209 ? -36.492 12.539  13.461  1.00 0.00  ? 209  LYS A N      1  
ATOM   3273   C  CA     . LYS A 1 209 ? -35.893 11.375  14.177  1.00 0.00  ? 209  LYS A CA     1  
ATOM   3274   C  C      . LYS A 1 209 ? -35.477 11.782  15.594  1.00 0.00  ? 209  LYS A C      1  
ATOM   3275   O  O      . LYS A 1 209 ? -34.377 11.506  16.031  1.00 0.00  ? 209  LYS A O      1  
ATOM   3276   C  CB     . LYS A 1 209 ? -34.668 10.988  13.348  1.00 0.00  ? 209  LYS A CB     1  
ATOM   3277   C  CG     . LYS A 1 209 ? -35.019 9.813   12.433  1.00 0.00  ? 209  LYS A CG     1  
ATOM   3278   C  CD     . LYS A 1 209 ? -33.742 9.256   11.802  1.00 0.00  ? 209  LYS A CD     1  
ATOM   3279   C  CE     . LYS A 1 209 ? -34.088 8.534   10.498  1.00 0.00  ? 209  LYS A CE     1  
ATOM   3280   N  NZ     . LYS A 1 209 ? -32.780 8.068   9.958   1.00 0.00  ? 209  LYS A NZ     1  
ATOM   3281   H  H      . LYS A 1 209 ? -36.247 13.452  13.721  1.00 0.00  ? 209  LYS A H      1  
ATOM   3282   H  HA     . LYS A 1 209 ? -36.591 10.553  14.211  1.00 0.00  ? 209  LYS A HA     1  
ATOM   3283   H  HB2    . LYS A 1 209 ? -34.358 11.832  12.748  1.00 0.00  ? 209  LYS A HB2    1  
ATOM   3284   H  HB3    . LYS A 1 209 ? -33.863 10.700  14.007  1.00 0.00  ? 209  LYS A HB3    1  
ATOM   3285   H  HG2    . LYS A 1 209 ? -35.504 9.039   13.012  1.00 0.00  ? 209  LYS A HG2    1  
ATOM   3286   H  HG3    . LYS A 1 209 ? -35.686 10.150  11.653  1.00 0.00  ? 209  LYS A HG3    1  
ATOM   3287   H  HD2    . LYS A 1 209 ? -33.059 10.068  11.595  1.00 0.00  ? 209  LYS A HD2    1  
ATOM   3288   H  HD3    . LYS A 1 209 ? -33.277 8.560   12.484  1.00 0.00  ? 209  LYS A HD3    1  
ATOM   3289   H  HE2    . LYS A 1 209 ? -34.738 7.692   10.697  1.00 0.00  ? 209  LYS A HE2    1  
ATOM   3290   H  HE3    . LYS A 1 209 ? -34.554 9.215   9.803   1.00 0.00  ? 209  LYS A HE3    1  
ATOM   3291   H  HZ1    . LYS A 1 209 ? -32.379 7.349   10.593  1.00 0.00  ? 209  LYS A HZ1    1  
ATOM   3292   H  HZ2    . LYS A 1 209 ? -32.127 8.875   9.889   1.00 0.00  ? 209  LYS A HZ2    1  
ATOM   3293   H  HZ3    . LYS A 1 209 ? -32.922 7.654   9.015   1.00 0.00  ? 209  LYS A HZ3    1  
ATOM   3294   N  N      . GLY A 1 210 ? -36.350 12.436  16.314  1.00 0.00  ? 210  GLY A N      1  
ATOM   3295   C  CA     . GLY A 1 210 ? -36.008 12.860  17.702  1.00 0.00  ? 210  GLY A CA     1  
ATOM   3296   C  C      . GLY A 1 210 ? -36.733 14.165  18.033  1.00 0.00  ? 210  GLY A C      1  
ATOM   3297   O  O      . GLY A 1 210 ? -37.328 14.306  19.084  1.00 0.00  ? 210  GLY A O      1  
ATOM   3298   H  H      . GLY A 1 210 ? -37.232 12.647  15.941  1.00 0.00  ? 210  GLY A H      1  
ATOM   3299   H  HA2    . GLY A 1 210 ? -36.312 12.091  18.398  1.00 0.00  ? 210  GLY A HA2    1  
ATOM   3300   H  HA3    . GLY A 1 210 ? -34.942 13.015  17.779  1.00 0.00  ? 210  GLY A HA3    1  
ATOM   3301   N  N      . ASP A 1 211 ? -36.688 15.121  17.144  1.00 0.00  ? 211  ASP A N      1  
ATOM   3302   C  CA     . ASP A 1 211 ? -37.375 16.420  17.405  1.00 0.00  ? 211  ASP A CA     1  
ATOM   3303   C  C      . ASP A 1 211 ? -38.592 16.571  16.487  1.00 0.00  ? 211  ASP A C      1  
ATOM   3304   O  O      . ASP A 1 211 ? -38.897 15.698  15.698  1.00 0.00  ? 211  ASP A O      1  
ATOM   3305   C  CB     . ASP A 1 211 ? -36.330 17.496  17.096  1.00 0.00  ? 211  ASP A CB     1  
ATOM   3306   C  CG     . ASP A 1 211 ? -35.847 17.350  15.651  1.00 0.00  ? 211  ASP A CG     1  
ATOM   3307   O  OD1    . ASP A 1 211 ? -36.670 17.462  14.757  1.00 0.00  ? 211  ASP A OD1    1  
ATOM   3308   O  OD2    . ASP A 1 211 ? -34.662 17.129  15.463  1.00 0.00  ? 211  ASP A OD2    1  
ATOM   3309   H  H      . ASP A 1 211 ? -36.203 14.984  16.304  1.00 0.00  ? 211  ASP A H      1  
ATOM   3310   H  HA     . ASP A 1 211 ? -37.675 16.485  18.439  1.00 0.00  ? 211  ASP A HA     1  
ATOM   3311   H  HB2    . ASP A 1 211 ? -36.770 18.473  17.232  1.00 0.00  ? 211  ASP A HB2    1  
ATOM   3312   H  HB3    . ASP A 1 211 ? -35.491 17.384  17.766  1.00 0.00  ? 211  ASP A HB3    1  
ATOM   3313   N  N      . GLU A 1 212 ? -39.287 17.672  16.585  1.00 0.00  ? 212  GLU A N      1  
ATOM   3314   C  CA     . GLU A 1 212 ? -40.484 17.882  15.720  1.00 0.00  ? 212  GLU A CA     1  
ATOM   3315   C  C      . GLU A 1 212 ? -40.396 19.236  15.012  1.00 0.00  ? 212  GLU A C      1  
ATOM   3316   O  O      . GLU A 1 212 ? -40.707 20.265  15.580  1.00 0.00  ? 212  GLU A O      1  
ATOM   3317   C  CB     . GLU A 1 212 ? -41.674 17.855  16.679  1.00 0.00  ? 212  GLU A CB     1  
ATOM   3318   C  CG     . GLU A 1 212 ? -42.964 17.634  15.886  1.00 0.00  ? 212  GLU A CG     1  
ATOM   3319   C  CD     . GLU A 1 212 ? -44.018 16.997  16.793  1.00 0.00  ? 212  GLU A CD     1  
ATOM   3320   O  OE1    . GLU A 1 212 ? -44.526 17.691  17.658  1.00 0.00  ? 212  GLU A OE1    1  
ATOM   3321   O  OE2    . GLU A 1 212 ? -44.300 15.824  16.606  1.00 0.00  ? 212  GLU A OE2    1  
ATOM   3322   H  H      . GLU A 1 212 ? -39.022 18.362  17.228  1.00 0.00  ? 212  GLU A H      1  
ATOM   3323   H  HA     . GLU A 1 212 ? -40.573 17.084  15.000  1.00 0.00  ? 212  GLU A HA     1  
ATOM   3324   H  HB2    . GLU A 1 212 ? -41.545 17.051  17.390  1.00 0.00  ? 212  GLU A HB2    1  
ATOM   3325   H  HB3    . GLU A 1 212 ? -41.734 18.796  17.205  1.00 0.00  ? 212  GLU A HB3    1  
ATOM   3326   H  HG2    . GLU A 1 212 ? -43.328 18.583  15.521  1.00 0.00  ? 212  GLU A HG2    1  
ATOM   3327   H  HG3    . GLU A 1 212 ? -42.765 16.978  15.052  1.00 0.00  ? 212  GLU A HG3    1  
ATOM   3328   N  N      . VAL A 1 213 ? -39.975 19.243  13.775  1.00 0.00  ? 213  VAL A N      1  
ATOM   3329   C  CA     . VAL A 1 213 ? -39.866 20.530  13.028  1.00 0.00  ? 213  VAL A CA     1  
ATOM   3330   C  C      . VAL A 1 213 ? -39.962 20.274  11.519  1.00 0.00  ? 213  VAL A C      1  
ATOM   3331   O  O      . VAL A 1 213 ? -39.151 20.746  10.746  1.00 0.00  ? 213  VAL A O      1  
ATOM   3332   C  CB     . VAL A 1 213 ? -38.491 21.091  13.403  1.00 0.00  ? 213  VAL A CB     1  
ATOM   3333   C  CG1    . VAL A 1 213 ? -37.397 20.103  12.989  1.00 0.00  ? 213  VAL A CG1    1  
ATOM   3334   C  CG2    . VAL A 1 213 ? -38.269 22.426  12.688  1.00 0.00  ? 213  VAL A CG2    1  
ATOM   3335   H  H      . VAL A 1 213 ? -39.731 18.401  13.337  1.00 0.00  ? 213  VAL A H      1  
ATOM   3336   H  HA     . VAL A 1 213 ? -40.640 21.213  13.342  1.00 0.00  ? 213  VAL A HA     1  
ATOM   3337   H  HB     . VAL A 1 213 ? -38.448 21.243  14.472  1.00 0.00  ? 213  VAL A HB     1  
ATOM   3338   H  HG11   . VAL A 1 213 ? -37.447 19.226  13.618  1.00 0.00  ? 213  VAL A HG11   1  
ATOM   3339   H  HG12   . VAL A 1 213 ? -36.430 20.570  13.100  1.00 0.00  ? 213  VAL A HG12   1  
ATOM   3340   H  HG13   . VAL A 1 213 ? -37.542 19.815  11.959  1.00 0.00  ? 213  VAL A HG13   1  
ATOM   3341   H  HG21   . VAL A 1 213 ? -37.786 22.250  11.739  1.00 0.00  ? 213  VAL A HG21   1  
ATOM   3342   H  HG22   . VAL A 1 213 ? -37.644 23.061  13.298  1.00 0.00  ? 213  VAL A HG22   1  
ATOM   3343   H  HG23   . VAL A 1 213 ? -39.221 22.909  12.524  1.00 0.00  ? 213  VAL A HG23   1  
ATOM   3344   N  N      . ASP A 1 214 ? -40.951 19.528  11.096  1.00 0.00  ? 214  ASP A N      1  
ATOM   3345   C  CA     . ASP A 1 214 ? -41.110 19.235  9.638   1.00 0.00  ? 214  ASP A CA     1  
ATOM   3346   C  C      . ASP A 1 214 ? -39.801 18.691  9.055   1.00 0.00  ? 214  ASP A C      1  
ATOM   3347   O  O      . ASP A 1 214 ? -38.928 18.344  9.833   1.00 0.00  ? 214  ASP A O      1  
ATOM   3348   C  CB     . ASP A 1 214 ? -41.467 20.577  8.993   1.00 0.00  ? 214  ASP A CB     1  
ATOM   3349   C  CG     . ASP A 1 214 ? -42.986 20.687  8.850   1.00 0.00  ? 214  ASP A CG     1  
ATOM   3350   O  OD1    . ASP A 1 214 ? -43.620 21.125  9.795   1.00 0.00  ? 214  ASP A OD1    1  
ATOM   3351   O  OD2    . ASP A 1 214 ? -43.489 20.330  7.797   1.00 0.00  ? 214  ASP A OD2    1  
ATOM   3352   O  OXT    . ASP A 1 214 ? -39.696 18.630  7.841   1.00 0.00  ? 214  ASP A OXT    1  
ATOM   3353   H  H      . ASP A 1 214 ? -41.592 19.160  11.739  1.00 0.00  ? 214  ASP A H      1  
ATOM   3354   H  HA     . ASP A 1 214 ? -41.910 18.529  9.483   1.00 0.00  ? 214  ASP A HA     1  
ATOM   3355   H  HB2    . ASP A 1 214 ? -41.104 21.383  9.615   1.00 0.00  ? 214  ASP A HB2    1  
ATOM   3356   H  HB3    . ASP A 1 214 ? -41.010 20.640  8.017   1.00 0.00  ? 214  ASP A HB3    1  
ATOM   3357   O  OP3    . DG  B 2 1   ? 12.969  -17.378 9.866   1.00 0.00  ? 1    DG  B OP3    1  
ATOM   3358   P  P      . DG  B 2 1   ? 14.107  -16.923 10.883  1.00 0.00  ? 1    DG  B P      1  
ATOM   3359   O  OP1    . DG  B 2 1   ? 14.547  -18.113 11.654  1.00 0.00  ? 1    DG  B OP1    1  
ATOM   3360   O  OP2    . DG  B 2 1   ? 13.632  -15.715 11.606  1.00 0.00  ? 1    DG  B OP2    1  
ATOM   3361   O  "O5'"  . DG  B 2 1   ? 15.294  -16.492 9.912   1.00 0.00  ? 1    DG  B "O5'"  1  
ATOM   3362   C  "C5'"  . DG  B 2 1   ? 15.599  -17.256 8.740   1.00 0.00  ? 1    DG  B "C5'"  1  
ATOM   3363   C  "C4'"  . DG  B 2 1   ? 15.668  -16.366 7.521   1.00 0.00  ? 1    DG  B "C4'"  1  
ATOM   3364   O  "O4'"  . DG  B 2 1   ? 14.423  -15.647 7.407   1.00 0.00  ? 1    DG  B "O4'"  1  
ATOM   3365   C  "C3'"  . DG  B 2 1   ? 16.764  -15.304 7.569   1.00 0.00  ? 1    DG  B "C3'"  1  
ATOM   3366   O  "O3'"  . DG  B 2 1   ? 17.909  -15.765 6.848   1.00 0.00  ? 1    DG  B "O3'"  1  
ATOM   3367   C  "C2'"  . DG  B 2 1   ? 16.152  -14.099 6.873   1.00 0.00  ? 1    DG  B "C2'"  1  
ATOM   3368   C  "C1'"  . DG  B 2 1   ? 14.643  -14.323 6.953   1.00 0.00  ? 1    DG  B "C1'"  1  
ATOM   3369   N  N9     . DG  B 2 1   ? 13.948  -13.424 7.868   1.00 0.00  ? 1    DG  B N9     1  
ATOM   3370   C  C8     . DG  B 2 1   ? 13.376  -13.752 9.072   1.00 0.00  ? 1    DG  B C8     1  
ATOM   3371   N  N7     . DG  B 2 1   ? 12.818  -12.736 9.671   1.00 0.00  ? 1    DG  B N7     1  
ATOM   3372   C  C5     . DG  B 2 1   ? 13.037  -11.671 8.809   1.00 0.00  ? 1    DG  B C5     1  
ATOM   3373   C  C6     . DG  B 2 1   ? 12.662  -10.307 8.920   1.00 0.00  ? 1    DG  B C6     1  
ATOM   3374   O  O6     . DG  B 2 1   ? 12.040  -9.751  9.833   1.00 0.00  ? 1    DG  B O6     1  
ATOM   3375   N  N1     . DG  B 2 1   ? 13.085  -9.568  7.819   1.00 0.00  ? 1    DG  B N1     1  
ATOM   3376   C  C2     . DG  B 2 1   ? 13.780  -10.076 6.747   1.00 0.00  ? 1    DG  B C2     1  
ATOM   3377   N  N2     . DG  B 2 1   ? 14.099  -9.205  5.781   1.00 0.00  ? 1    DG  B N2     1  
ATOM   3378   N  N3     . DG  B 2 1   ? 14.136  -11.345 6.632   1.00 0.00  ? 1    DG  B N3     1  
ATOM   3379   C  C4     . DG  B 2 1   ? 13.734  -12.080 7.692   1.00 0.00  ? 1    DG  B C4     1  
ATOM   3380   H  "H5'"  . DG  B 2 1   ? 14.827  -18.010 8.586   1.00 0.00  ? 1    DG  B "H5'"  1  
ATOM   3381   H  "H5''" . DG  B 2 1   ? 16.560  -17.754 8.870   1.00 0.00  ? 1    DG  B "H5''" 1  
ATOM   3382   H  "H4'"  . DG  B 2 1   ? 15.881  -17.001 6.659   1.00 0.00  ? 1    DG  B "H4'"  1  
ATOM   3383   H  "H3'"  . DG  B 2 1   ? 17.053  -15.081 8.595   1.00 0.00  ? 1    DG  B "H3'"  1  
ATOM   3384   H  "H2'"  . DG  B 2 1   ? 16.453  -13.174 7.366   1.00 0.00  ? 1    DG  B "H2'"  1  
ATOM   3385   H  "H2''" . DG  B 2 1   ? 16.494  -14.032 5.841   1.00 0.00  ? 1    DG  B "H2''" 1  
ATOM   3386   H  "H1'"  . DG  B 2 1   ? 14.185  -14.229 5.968   1.00 0.00  ? 1    DG  B "H1'"  1  
ATOM   3387   H  H8     . DG  B 2 1   ? 13.387  -14.751 9.482   1.00 0.00  ? 1    DG  B H8     1  
ATOM   3388   H  H1     . DG  B 2 1   ? 12.864  -8.583  7.808   1.00 0.00  ? 1    DG  B H1     1  
ATOM   3389   H  H21    . DG  B 2 1   ? 14.610  -9.518  4.968   1.00 0.00  ? 1    DG  B H21    1  
ATOM   3390   H  H22    . DG  B 2 1   ? 13.829  -8.235  5.866   1.00 0.00  ? 1    DG  B H22    1  
ATOM   3391   H  "HO5'" . DG  B 2 1   ? 12.340  -17.909 10.360  1.00 0.00  ? 1    DG  B "HO5'" 1  
ATOM   3392   P  P      . DC  B 2 2   ? 19.362  -15.171 7.193   1.00 0.00  ? 2    DC  B P      1  
ATOM   3393   O  OP1    . DC  B 2 2   ? 20.359  -15.986 6.452   1.00 0.00  ? 2    DC  B OP1    1  
ATOM   3394   O  OP2    . DC  B 2 2   ? 19.471  -15.040 8.667   1.00 0.00  ? 2    DC  B OP2    1  
ATOM   3395   O  "O5'"  . DC  B 2 2   ? 19.343  -13.711 6.557   1.00 0.00  ? 2    DC  B "O5'"  1  
ATOM   3396   C  "C5'"  . DC  B 2 2   ? 19.477  -13.523 5.148   1.00 0.00  ? 2    DC  B "C5'"  1  
ATOM   3397   C  "C4'"  . DC  B 2 2   ? 19.692  -12.060 4.836   1.00 0.00  ? 2    DC  B "C4'"  1  
ATOM   3398   O  "O4'"  . DC  B 2 2   ? 18.633  -11.288 5.452   1.00 0.00  ? 2    DC  B "O4'"  1  
ATOM   3399   C  "C3'"  . DC  B 2 2   ? 20.998  -11.474 5.371   1.00 0.00  ? 2    DC  B "C3'"  1  
ATOM   3400   O  "O3'"  . DC  B 2 2   ? 21.493  -10.468 4.483   1.00 0.00  ? 2    DC  B "O3'"  1  
ATOM   3401   C  "C2'"  . DC  B 2 2   ? 20.582  -10.863 6.696   1.00 0.00  ? 2    DC  B "C2'"  1  
ATOM   3402   C  "C1'"  . DC  B 2 2   ? 19.178  -10.373 6.391   1.00 0.00  ? 2    DC  B "C1'"  1  
ATOM   3403   N  N1     . DC  B 2 2   ? 18.282  -10.330 7.555   1.00 0.00  ? 2    DC  B N1     1  
ATOM   3404   C  C2     . DC  B 2 2   ? 17.655  -9.124  7.875   1.00 0.00  ? 2    DC  B C2     1  
ATOM   3405   O  O2     . DC  B 2 2   ? 17.869  -8.131  7.165   1.00 0.00  ? 2    DC  B O2     1  
ATOM   3406   N  N3     . DC  B 2 2   ? 16.833  -9.070  8.948   1.00 0.00  ? 2    DC  B N3     1  
ATOM   3407   C  C4     . DC  B 2 2   ? 16.629  -10.163 9.687   1.00 0.00  ? 2    DC  B C4     1  
ATOM   3408   N  N4     . DC  B 2 2   ? 15.814  -10.062 10.739  1.00 0.00  ? 2    DC  B N4     1  
ATOM   3409   C  C5     . DC  B 2 2   ? 17.252  -11.409 9.381   1.00 0.00  ? 2    DC  B C5     1  
ATOM   3410   C  C6     . DC  B 2 2   ? 18.064  -11.445 8.315   1.00 0.00  ? 2    DC  B C6     1  
ATOM   3411   H  "H5'"  . DC  B 2 2   ? 18.573  -13.865 4.644   1.00 0.00  ? 2    DC  B "H5'"  1  
ATOM   3412   H  "H5''" . DC  B 2 2   ? 20.329  -14.095 4.781   1.00 0.00  ? 2    DC  B "H5''" 1  
ATOM   3413   H  "H4'"  . DC  B 2 2   ? 19.724  -11.956 3.750   1.00 0.00  ? 2    DC  B "H4'"  1  
ATOM   3414   H  "H3'"  . DC  B 2 2   ? 21.755  -12.248 5.497   1.00 0.00  ? 2    DC  B "H3'"  1  
ATOM   3415   H  "H2'"  . DC  B 2 2   ? 20.596  -11.602 7.496   1.00 0.00  ? 2    DC  B "H2'"  1  
ATOM   3416   H  "H2''" . DC  B 2 2   ? 21.248  -10.051 6.986   1.00 0.00  ? 2    DC  B "H2''" 1  
ATOM   3417   H  "H1'"  . DC  B 2 2   ? 19.199  -9.386  5.930   1.00 0.00  ? 2    DC  B "H1'"  1  
ATOM   3418   H  H41    . DC  B 2 2   ? 15.637  -10.868 11.321  1.00 0.00  ? 2    DC  B H41    1  
ATOM   3419   H  H42    . DC  B 2 2   ? 15.375  -9.178  10.951  1.00 0.00  ? 2    DC  B H42    1  
ATOM   3420   H  H5     . DC  B 2 2   ? 17.076  -12.295 9.989   1.00 0.00  ? 2    DC  B H5     1  
ATOM   3421   H  H6     . DC  B 2 2   ? 18.557  -12.381 8.052   1.00 0.00  ? 2    DC  B H6     1  
ATOM   3422   P  P      . DT  B 2 3   ? 22.934  -9.810  4.751   1.00 0.00  ? 3    DT  B P      1  
ATOM   3423   O  OP1    . DT  B 2 3   ? 23.523  -9.473  3.431   1.00 0.00  ? 3    DT  B OP1    1  
ATOM   3424   O  OP2    . DT  B 2 3   ? 23.682  -10.691 5.684   1.00 0.00  ? 3    DT  B OP2    1  
ATOM   3425   O  "O5'"  . DT  B 2 3   ? 22.603  -8.449  5.508   1.00 0.00  ? 3    DT  B "O5'"  1  
ATOM   3426   C  "C5'"  . DT  B 2 3   ? 21.336  -7.809  5.351   1.00 0.00  ? 3    DT  B "C5'"  1  
ATOM   3427   C  "C4'"  . DT  B 2 3   ? 21.509  -6.308  5.344   1.00 0.00  ? 3    DT  B "C4'"  1  
ATOM   3428   O  "O4'"  . DT  B 2 3   ? 20.680  -5.730  6.374   1.00 0.00  ? 3    DT  B "O4'"  1  
ATOM   3429   C  "C3'"  . DT  B 2 3   ? 22.915  -5.820  5.668   1.00 0.00  ? 3    DT  B "C3'"  1  
ATOM   3430   O  "O3'"  . DT  B 2 3   ? 23.111  -4.501  5.147   1.00 0.00  ? 3    DT  B "O3'"  1  
ATOM   3431   C  "C2'"  . DT  B 2 3   ? 22.916  -5.815  7.186   1.00 0.00  ? 3    DT  B "C2'"  1  
ATOM   3432   C  "C1'"  . DT  B 2 3   ? 21.468  -5.465  7.531   1.00 0.00  ? 3    DT  B "C1'"  1  
ATOM   3433   N  N1     . DT  B 2 3   ? 20.899  -6.244  8.643   1.00 0.00  ? 3    DT  B N1     1  
ATOM   3434   C  C2     . DT  B 2 3   ? 20.079  -5.586  9.530   1.00 0.00  ? 3    DT  B C2     1  
ATOM   3435   O  O2     . DT  B 2 3   ? 19.819  -4.399  9.440   1.00 0.00  ? 3    DT  B O2     1  
ATOM   3436   N  N3     . DT  B 2 3   ? 19.574  -6.373  10.532  1.00 0.00  ? 3    DT  B N3     1  
ATOM   3437   C  C4     . DT  B 2 3   ? 19.805  -7.718  10.732  1.00 0.00  ? 3    DT  B C4     1  
ATOM   3438   O  O4     . DT  B 2 3   ? 19.277  -8.295  11.678  1.00 0.00  ? 3    DT  B O4     1  
ATOM   3439   C  C5     . DT  B 2 3   ? 20.678  -8.344  9.766   1.00 0.00  ? 3    DT  B C5     1  
ATOM   3440   C  C7     . DT  B 2 3   ? 20.987  -9.800  9.911   1.00 0.00  ? 3    DT  B C7     1  
ATOM   3441   C  C6     . DT  B 2 3   ? 21.179  -7.588  8.778   1.00 0.00  ? 3    DT  B C6     1  
ATOM   3442   H  "H5'"  . DT  B 2 3   ? 20.680  -8.088  6.175   1.00 0.00  ? 3    DT  B "H5'"  1  
ATOM   3443   H  "H5''" . DT  B 2 3   ? 20.881  -8.121  4.411   1.00 0.00  ? 3    DT  B "H5''" 1  
ATOM   3444   H  "H4'"  . DT  B 2 3   ? 21.269  -5.948  4.343   1.00 0.00  ? 3    DT  B "H4'"  1  
ATOM   3445   H  "H3'"  . DT  B 2 3   ? 23.670  -6.491  5.259   1.00 0.00  ? 3    DT  B "H3'"  1  
ATOM   3446   H  "H2'"  . DT  B 2 3   ? 23.209  -6.788  7.581   1.00 0.00  ? 3    DT  B "H2'"  1  
ATOM   3447   H  "H2''" . DT  B 2 3   ? 23.621  -5.081  7.577   1.00 0.00  ? 3    DT  B "H2''" 1  
ATOM   3448   H  "H1'"  . DT  B 2 3   ? 21.370  -4.404  7.768   1.00 0.00  ? 3    DT  B "H1'"  1  
ATOM   3449   H  H3     . DT  B 2 3   ? 18.965  -5.916  11.193  1.00 0.00  ? 3    DT  B H3     1  
ATOM   3450   H  H71    . DT  B 2 3   ? 20.208  -10.387 9.426   1.00 0.00  ? 3    DT  B H71    1  
ATOM   3451   H  H72    . DT  B 2 3   ? 21.948  -10.016 9.445   1.00 0.00  ? 3    DT  B H72    1  
ATOM   3452   H  H73    . DT  B 2 3   ? 21.030  -10.059 10.969  1.00 0.00  ? 3    DT  B H73    1  
ATOM   3453   H  H6     . DT  B 2 3   ? 21.839  -8.058  8.049   1.00 0.00  ? 3    DT  B H6     1  
ATOM   3454   P  P      . DG  B 2 4   ? 24.502  -3.739  5.405   1.00 0.00  ? 4    DG  B P      1  
ATOM   3455   O  OP1    . DG  B 2 4   ? 24.769  -2.887  4.219   1.00 0.00  ? 4    DG  B OP1    1  
ATOM   3456   O  OP2    . DG  B 2 4   ? 25.511  -4.742  5.830   1.00 0.00  ? 4    DG  B OP2    1  
ATOM   3457   O  "O5'"  . DG  B 2 4   ? 24.200  -2.783  6.644   1.00 0.00  ? 4    DG  B "O5'"  1  
ATOM   3458   C  "C5'"  . DG  B 2 4   ? 22.990  -2.028  6.714   1.00 0.00  ? 4    DG  B "C5'"  1  
ATOM   3459   C  "C4'"  . DG  B 2 4   ? 22.899  -1.311  8.040   1.00 0.00  ? 4    DG  B "C4'"  1  
ATOM   3460   O  "O4'"  . DG  B 2 4   ? 22.185  -2.148  8.986   1.00 0.00  ? 4    DG  B "O4'"  1  
ATOM   3461   C  "C3'"  . DG  B 2 4   ? 24.234  -1.011  8.720   1.00 0.00  ? 4    DG  B "C3'"  1  
ATOM   3462   O  "O3'"  . DG  B 2 4   ? 24.099  0.139   9.560   1.00 0.00  ? 4    DG  B "O3'"  1  
ATOM   3463   C  "C2'"  . DG  B 2 4   ? 24.432  -2.244  9.577   1.00 0.00  ? 4    DG  B "C2'"  1  
ATOM   3464   C  "C1'"  . DG  B 2 4   ? 23.026  -2.391  10.104  1.00 0.00  ? 4    DG  B "C1'"  1  
ATOM   3465   N  N9     . DG  B 2 4   ? 22.679  -3.692  10.662  1.00 0.00  ? 4    DG  B N9     1  
ATOM   3466   C  C8     . DG  B 2 4   ? 23.106  -4.928  10.246  1.00 0.00  ? 4    DG  B C8     1  
ATOM   3467   N  N7     . DG  B 2 4   ? 22.607  -5.908  10.949  1.00 0.00  ? 4    DG  B N7     1  
ATOM   3468   C  C5     . DG  B 2 4   ? 21.803  -5.278  11.888  1.00 0.00  ? 4    DG  B C5     1  
ATOM   3469   C  C6     . DG  B 2 4   ? 21.001  -5.819  12.925  1.00 0.00  ? 4    DG  B C6     1  
ATOM   3470   O  O6     . DG  B 2 4   ? 20.837  -7.005  13.234  1.00 0.00  ? 4    DG  B O6     1  
ATOM   3471   N  N1     . DG  B 2 4   ? 20.347  -4.819  13.641  1.00 0.00  ? 4    DG  B N1     1  
ATOM   3472   C  C2     . DG  B 2 4   ? 20.456  -3.472  13.395  1.00 0.00  ? 4    DG  B C2     1  
ATOM   3473   N  N2     . DG  B 2 4   ? 19.754  -2.663  14.201  1.00 0.00  ? 4    DG  B N2     1  
ATOM   3474   N  N3     . DG  B 2 4   ? 21.199  -2.957  12.433  1.00 0.00  ? 4    DG  B N3     1  
ATOM   3475   C  C4     . DG  B 2 4   ? 21.839  -3.910  11.723  1.00 0.00  ? 4    DG  B C4     1  
ATOM   3476   H  "H5'"  . DG  B 2 4   ? 22.135  -2.696  6.611   1.00 0.00  ? 4    DG  B "H5'"  1  
ATOM   3477   H  "H5''" . DG  B 2 4   ? 22.968  -1.293  5.910   1.00 0.00  ? 4    DG  B "H5''" 1  
ATOM   3478   H  "H4'"  . DG  B 2 4   ? 22.412  -0.351  7.864   1.00 0.00  ? 4    DG  B "H4'"  1  
ATOM   3479   H  "H3'"  . DG  B 2 4   ? 25.038  -0.858  7.999   1.00 0.00  ? 4    DG  B "H3'"  1  
ATOM   3480   H  "H2'"  . DG  B 2 4   ? 24.750  -3.103  8.989   1.00 0.00  ? 4    DG  B "H2'"  1  
ATOM   3481   H  "H2''" . DG  B 2 4   ? 25.168  -2.079  10.365  1.00 0.00  ? 4    DG  B "H2''" 1  
ATOM   3482   H  "H1'"  . DG  B 2 4   ? 22.815  -1.625  10.851  1.00 0.00  ? 4    DG  B "H1'"  1  
ATOM   3483   H  H8     . DG  B 2 4   ? 23.789  -5.074  9.424   1.00 0.00  ? 4    DG  B H8     1  
ATOM   3484   H  H1     . DG  B 2 4   ? 19.743  -5.099  14.399  1.00 0.00  ? 4    DG  B H1     1  
ATOM   3485   H  H21    . DG  B 2 4   ? 19.792  -1.662  14.076  1.00 0.00  ? 4    DG  B H21    1  
ATOM   3486   H  H22    . DG  B 2 4   ? 19.177  -3.057  14.929  1.00 0.00  ? 4    DG  B H22    1  
ATOM   3487   P  P      . DG  B 2 5   ? 25.122  1.367   9.420   1.00 0.00  ? 5    DG  B P      1  
ATOM   3488   O  OP1    . DG  B 2 5   ? 24.834  2.040   8.127   1.00 0.00  ? 5    DG  B OP1    1  
ATOM   3489   O  OP2    . DG  B 2 5   ? 26.495  0.878   9.703   1.00 0.00  ? 5    DG  B OP2    1  
ATOM   3490   O  "O5'"  . DG  B 2 5   ? 24.681  2.341   10.601  1.00 0.00  ? 5    DG  B "O5'"  1  
ATOM   3491   C  "C5'"  . DG  B 2 5   ? 23.303  2.485   10.952  1.00 0.00  ? 5    DG  B "C5'"  1  
ATOM   3492   C  "C4'"  . DG  B 2 5   ? 23.133  2.448   12.453  1.00 0.00  ? 5    DG  B "C4'"  1  
ATOM   3493   O  "O4'"  . DG  B 2 5   ? 22.936  1.074   12.874  1.00 0.00  ? 5    DG  B "O4'"  1  
ATOM   3494   C  "C3'"  . DG  B 2 5   ? 24.328  2.953   13.261  1.00 0.00  ? 5    DG  B "C3'"  1  
ATOM   3495   O  "O3'"  . DG  B 2 5   ? 23.871  3.585   14.464  1.00 0.00  ? 5    DG  B "O3'"  1  
ATOM   3496   C  "C2'"  . DG  B 2 5   ? 25.082  1.674   13.575  1.00 0.00  ? 5    DG  B "C2'"  1  
ATOM   3497   C  "C1'"  . DG  B 2 5   ? 23.934  0.719   13.819  1.00 0.00  ? 5    DG  B "C1'"  1  
ATOM   3498   N  N9     . DG  B 2 5   ? 24.247  -0.694  13.637  1.00 0.00  ? 5    DG  B N9     1  
ATOM   3499   C  C8     . DG  B 2 5   ? 25.078  -1.248  12.695  1.00 0.00  ? 5    DG  B C8     1  
ATOM   3500   N  N7     . DG  B 2 5   ? 25.159  -2.548  12.780  1.00 0.00  ? 5    DG  B N7     1  
ATOM   3501   C  C5     . DG  B 2 5   ? 24.330  -2.874  13.845  1.00 0.00  ? 5    DG  B C5     1  
ATOM   3502   C  C6     . DG  B 2 5   ? 24.013  -4.136  14.413  1.00 0.00  ? 5    DG  B C6     1  
ATOM   3503   O  O6     . DG  B 2 5   ? 24.417  -5.256  14.077  1.00 0.00  ? 5    DG  B O6     1  
ATOM   3504   N  N1     . DG  B 2 5   ? 23.128  -4.009  15.480  1.00 0.00  ? 5    DG  B N1     1  
ATOM   3505   C  C2     . DG  B 2 5   ? 22.614  -2.822  15.943  1.00 0.00  ? 5    DG  B C2     1  
ATOM   3506   N  N2     . DG  B 2 5   ? 21.774  -2.905  16.985  1.00 0.00  ? 5    DG  B N2     1  
ATOM   3507   N  N3     . DG  B 2 5   ? 22.902  -1.640  15.422  1.00 0.00  ? 5    DG  B N3     1  
ATOM   3508   C  C4     . DG  B 2 5   ? 23.759  -1.739  14.384  1.00 0.00  ? 5    DG  B C4     1  
ATOM   3509   H  "H5'"  . DG  B 2 5   ? 22.724  1.675   10.509  1.00 0.00  ? 5    DG  B "H5'"  1  
ATOM   3510   H  "H5''" . DG  B 2 5   ? 22.928  3.437   10.576  1.00 0.00  ? 5    DG  B "H5''" 1  
ATOM   3511   H  "H4'"  . DG  B 2 5   ? 22.292  3.096   12.702  1.00 0.00  ? 5    DG  B "H4'"  1  
ATOM   3512   H  "H3'"  . DG  B 2 5   ? 24.929  3.657   12.686  1.00 0.00  ? 5    DG  B "H3'"  1  
ATOM   3513   H  "H2'"  . DG  B 2 5   ? 25.709  1.364   12.741  1.00 0.00  ? 5    DG  B "H2'"  1  
ATOM   3514   H  "H2''" . DG  B 2 5   ? 25.723  1.789   14.449  1.00 0.00  ? 5    DG  B "H2''" 1  
ATOM   3515   H  "H1'"  . DG  B 2 5   ? 23.517  0.859   14.817  1.00 0.00  ? 5    DG  B "H1'"  1  
ATOM   3516   H  H8     . DG  B 2 5   ? 25.611  -0.667  11.958  1.00 0.00  ? 5    DG  B H8     1  
ATOM   3517   H  H1     . DG  B 2 5   ? 22.841  -4.855  15.952  1.00 0.00  ? 5    DG  B H1     1  
ATOM   3518   H  H21    . DG  B 2 5   ? 21.363  -2.067  17.371  1.00 0.00  ? 5    DG  B H21    1  
ATOM   3519   H  H22    . DG  B 2 5   ? 21.550  -3.806  17.382  1.00 0.00  ? 5    DG  B H22    1  
ATOM   3520   P  P      . DC  B 2 6   ? 24.881  4.487   15.328  1.00 0.00  ? 6    DC  B P      1  
ATOM   3521   O  OP1    . DC  B 2 6   ? 24.277  5.839   15.442  1.00 0.00  ? 6    DC  B OP1    1  
ATOM   3522   O  OP2    . DC  B 2 6   ? 26.243  4.339   14.757  1.00 0.00  ? 6    DC  B OP2    1  
ATOM   3523   O  "O5'"  . DC  B 2 6   ? 24.869  3.811   16.772  1.00 0.00  ? 6    DC  B "O5'"  1  
ATOM   3524   C  "C5'"  . DC  B 2 6   ? 23.640  3.536   17.447  1.00 0.00  ? 6    DC  B "C5'"  1  
ATOM   3525   C  "C4'"  . DC  B 2 6   ? 23.858  2.508   18.534  1.00 0.00  ? 6    DC  B "C4'"  1  
ATOM   3526   O  "O4'"  . DC  B 2 6   ? 23.990  1.195   17.928  1.00 0.00  ? 6    DC  B "O4'"  1  
ATOM   3527   C  "C3'"  . DC  B 2 6   ? 25.129  2.697   19.369  1.00 0.00  ? 6    DC  B "C3'"  1  
ATOM   3528   O  "O3'"  . DC  B 2 6   ? 24.897  2.304   20.726  1.00 0.00  ? 6    DC  B "O3'"  1  
ATOM   3529   C  "C2'"  . DC  B 2 6   ? 26.097  1.725   18.725  1.00 0.00  ? 6    DC  B "C2'"  1  
ATOM   3530   C  "C1'"  . DC  B 2 6   ? 25.155  0.582   18.451  1.00 0.00  ? 6    DC  B "C1'"  1  
ATOM   3531   N  N1     . DC  B 2 6   ? 25.626  -0.427  17.490  1.00 0.00  ? 6    DC  B N1     1  
ATOM   3532   C  C2     . DC  B 2 6   ? 25.295  -1.761  17.721  1.00 0.00  ? 6    DC  B C2     1  
ATOM   3533   O  O2     . DC  B 2 6   ? 24.605  -2.043  18.712  1.00 0.00  ? 6    DC  B O2     1  
ATOM   3534   N  N3     . DC  B 2 6   ? 25.732  -2.711  16.865  1.00 0.00  ? 6    DC  B N3     1  
ATOM   3535   C  C4     . DC  B 2 6   ? 26.472  -2.367  15.811  1.00 0.00  ? 6    DC  B C4     1  
ATOM   3536   N  N4     . DC  B 2 6   ? 26.888  -3.342  15.000  1.00 0.00  ? 6    DC  B N4     1  
ATOM   3537   C  C5     . DC  B 2 6   ? 26.821  -1.009  15.543  1.00 0.00  ? 6    DC  B C5     1  
ATOM   3538   C  C6     . DC  B 2 6   ? 26.378  -0.079  16.402  1.00 0.00  ? 6    DC  B C6     1  
ATOM   3539   H  "H5'"  . DC  B 2 6   ? 22.909  3.152   16.735  1.00 0.00  ? 6    DC  B "H5'"  1  
ATOM   3540   H  "H5''" . DC  B 2 6   ? 23.255  4.452   17.895  1.00 0.00  ? 6    DC  B "H5''" 1  
ATOM   3541   H  "H4'"  . DC  B 2 6   ? 23.016  2.578   19.224  1.00 0.00  ? 6    DC  B "H4'"  1  
ATOM   3542   H  "H3'"  . DC  B 2 6   ? 25.484  3.727   19.338  1.00 0.00  ? 6    DC  B "H3'"  1  
ATOM   3543   H  "H2'"  . DC  B 2 6   ? 26.537  2.132   17.816  1.00 0.00  ? 6    DC  B "H2'"  1  
ATOM   3544   H  "H2''" . DC  B 2 6   ? 26.908  1.452   19.401  1.00 0.00  ? 6    DC  B "H2''" 1  
ATOM   3545   H  "H1'"  . DC  B 2 6   ? 24.879  0.078   19.377  1.00 0.00  ? 6    DC  B "H1'"  1  
ATOM   3546   H  H41    . DC  B 2 6   ? 27.452  -3.128  14.191  1.00 0.00  ? 6    DC  B H41    1  
ATOM   3547   H  H42    . DC  B 2 6   ? 26.628  -4.298  15.201  1.00 0.00  ? 6    DC  B H42    1  
ATOM   3548   H  H5     . DC  B 2 6   ? 27.424  -0.740  14.677  1.00 0.00  ? 6    DC  B H5     1  
ATOM   3549   H  H6     . DC  B 2 6   ? 26.619  0.969   16.227  1.00 0.00  ? 6    DC  B H6     1  
ATOM   3550   P  P      . DT  B 2 7   ? 24.621  3.417   21.849  1.00 0.00  ? 7    DT  B P      1  
ATOM   3551   O  OP1    . DT  B 2 7   ? 23.561  4.332   21.353  1.00 0.00  ? 7    DT  B OP1    1  
ATOM   3552   O  OP2    . DT  B 2 7   ? 25.936  3.970   22.259  1.00 0.00  ? 7    DT  B OP2    1  
ATOM   3553   O  "O5'"  . DT  B 2 7   ? 24.033  2.578   23.070  1.00 0.00  ? 7    DT  B "O5'"  1  
ATOM   3554   C  "C5'"  . DT  B 2 7   ? 22.921  1.701   22.888  1.00 0.00  ? 7    DT  B "C5'"  1  
ATOM   3555   C  "C4'"  . DT  B 2 7   ? 23.196  0.364   23.535  1.00 0.00  ? 7    DT  B "C4'"  1  
ATOM   3556   O  "O4'"  . DT  B 2 7   ? 24.083  -0.396  22.679  1.00 0.00  ? 7    DT  B "O4'"  1  
ATOM   3557   C  "C3'"  . DT  B 2 7   ? 23.881  0.430   24.904  1.00 0.00  ? 7    DT  B "C3'"  1  
ATOM   3558   O  "O3'"  . DT  B 2 7   ? 23.260  -0.491  25.806  1.00 0.00  ? 7    DT  B "O3'"  1  
ATOM   3559   C  "C2'"  . DT  B 2 7   ? 25.313  0.011   24.615  1.00 0.00  ? 7    DT  B "C2'"  1  
ATOM   3560   C  "C1'"  . DT  B 2 7   ? 25.130  -0.943  23.456  1.00 0.00  ? 7    DT  B "C1'"  1  
ATOM   3561   N  N1     . DT  B 2 7   ? 26.308  -1.099  22.588  1.00 0.00  ? 7    DT  B N1     1  
ATOM   3562   C  C2     . DT  B 2 7   ? 26.662  -2.372  22.206  1.00 0.00  ? 7    DT  B C2     1  
ATOM   3563   O  O2     . DT  B 2 7   ? 26.054  -3.367  22.563  1.00 0.00  ? 7    DT  B O2     1  
ATOM   3564   N  N3     . DT  B 2 7   ? 27.762  -2.439  21.391  1.00 0.00  ? 7    DT  B N3     1  
ATOM   3565   C  C4     . DT  B 2 7   ? 28.524  -1.384  20.932  1.00 0.00  ? 7    DT  B C4     1  
ATOM   3566   O  O4     . DT  B 2 7   ? 29.485  -1.597  20.199  1.00 0.00  ? 7    DT  B O4     1  
ATOM   3567   C  C5     . DT  B 2 7   ? 28.099  -0.076  21.377  1.00 0.00  ? 7    DT  B C5     1  
ATOM   3568   C  C7     . DT  B 2 7   ? 28.886  1.123   20.953  1.00 0.00  ? 7    DT  B C7     1  
ATOM   3569   C  C6     . DT  B 2 7   ? 27.023  0.005   22.174  1.00 0.00  ? 7    DT  B C6     1  
ATOM   3570   H  "H5'"  . DT  B 2 7   ? 22.743  1.551   21.823  1.00 0.00  ? 7    DT  B "H5'"  1  
ATOM   3571   H  "H5''" . DT  B 2 7   ? 22.032  2.139   23.340  1.00 0.00  ? 7    DT  B "H5''" 1  
ATOM   3572   H  "H4'"  . DT  B 2 7   ? 22.234  -0.126  23.694  1.00 0.00  ? 7    DT  B "H4'"  1  
ATOM   3573   H  "H3'"  . DT  B 2 7   ? 23.827  1.434   25.324  1.00 0.00  ? 7    DT  B "H3'"  1  
ATOM   3574   H  "H2'"  . DT  B 2 7   ? 25.933  0.869   24.352  1.00 0.00  ? 7    DT  B "H2'"  1  
ATOM   3575   H  "H2''" . DT  B 2 7   ? 25.769  -0.471  25.480  1.00 0.00  ? 7    DT  B "H2''" 1  
ATOM   3576   H  "H1'"  . DT  B 2 7   ? 24.816  -1.929  23.802  1.00 0.00  ? 7    DT  B "H1'"  1  
ATOM   3577   H  H3     . DT  B 2 7   ? 28.046  -3.362  21.098  1.00 0.00  ? 7    DT  B H3     1  
ATOM   3578   H  H71    . DT  B 2 7   ? 28.313  2.026   21.160  1.00 0.00  ? 7    DT  B H71    1  
ATOM   3579   H  H72    . DT  B 2 7   ? 29.825  1.154   21.506  1.00 0.00  ? 7    DT  B H72    1  
ATOM   3580   H  H73    . DT  B 2 7   ? 29.095  1.062   19.885  1.00 0.00  ? 7    DT  B H73    1  
ATOM   3581   H  H6     . DT  B 2 7   ? 26.701  0.990   22.513  1.00 0.00  ? 7    DT  B H6     1  
ATOM   3582   P  P      . DT  B 2 8   ? 23.784  -0.603  27.321  1.00 0.00  ? 8    DT  B P      1  
ATOM   3583   O  OP1    . DT  B 2 8   ? 22.611  -0.924  28.173  1.00 0.00  ? 8    DT  B OP1    1  
ATOM   3584   O  OP2    . DT  B 2 8   ? 24.603  0.599   27.624  1.00 0.00  ? 8    DT  B OP2    1  
ATOM   3585   O  "O5'"  . DT  B 2 8   ? 24.743  -1.874  27.305  1.00 0.00  ? 8    DT  B "O5'"  1  
ATOM   3586   C  "C5'"  . DT  B 2 8   ? 24.207  -3.194  27.220  1.00 0.00  ? 8    DT  B "C5'"  1  
ATOM   3587   C  "C4'"  . DT  B 2 8   ? 25.319  -4.214  27.283  1.00 0.00  ? 8    DT  B "C4'"  1  
ATOM   3588   O  "O4'"  . DT  B 2 8   ? 26.180  -4.034  26.135  1.00 0.00  ? 8    DT  B "O4'"  1  
ATOM   3589   C  "C3'"  . DT  B 2 8   ? 26.222  -4.108  28.519  1.00 0.00  ? 8    DT  B "C3'"  1  
ATOM   3590   O  "O3'"  . DT  B 2 8   ? 26.250  -5.356  29.216  1.00 0.00  ? 8    DT  B "O3'"  1  
ATOM   3591   C  "C2'"  . DT  B 2 8   ? 27.600  -3.783  27.962  1.00 0.00  ? 8    DT  B "C2'"  1  
ATOM   3592   C  "C1'"  . DT  B 2 8   ? 27.512  -4.270  26.532  1.00 0.00  ? 8    DT  B "C1'"  1  
ATOM   3593   N  N1     . DT  B 2 8   ? 28.401  -3.568  25.592  1.00 0.00  ? 8    DT  B N1     1  
ATOM   3594   C  C2     . DT  B 2 8   ? 29.247  -4.326  24.816  1.00 0.00  ? 8    DT  B C2     1  
ATOM   3595   O  O2     . DT  B 2 8   ? 29.286  -5.543  24.868  1.00 0.00  ? 8    DT  B O2     1  
ATOM   3596   N  N3     . DT  B 2 8   ? 30.050  -3.602  23.974  1.00 0.00  ? 8    DT  B N3     1  
ATOM   3597   C  C4     . DT  B 2 8   ? 30.089  -2.230  23.833  1.00 0.00  ? 8    DT  B C4     1  
ATOM   3598   O  O4     . DT  B 2 8   ? 30.869  -1.719  23.034  1.00 0.00  ? 8    DT  B O4     1  
ATOM   3599   C  C5     . DT  B 2 8   ? 29.173  -1.497  24.677  1.00 0.00  ? 8    DT  B C5     1  
ATOM   3600   C  C7     . DT  B 2 8   ? 29.157  -0.004  24.601  1.00 0.00  ? 8    DT  B C7     1  
ATOM   3601   C  C6     . DT  B 2 8   ? 28.380  -2.191  25.506  1.00 0.00  ? 8    DT  B C6     1  
ATOM   3602   H  "H5'"  . DT  B 2 8   ? 23.667  -3.311  26.280  1.00 0.00  ? 8    DT  B "H5'"  1  
ATOM   3603   H  "H5''" . DT  B 2 8   ? 23.519  -3.364  28.049  1.00 0.00  ? 8    DT  B "H5''" 1  
ATOM   3604   H  "H4'"  . DT  B 2 8   ? 24.856  -5.202  27.321  1.00 0.00  ? 8    DT  B "H4'"  1  
ATOM   3605   H  "H3'"  . DT  B 2 8   ? 25.866  -3.332  29.196  1.00 0.00  ? 8    DT  B "H3'"  1  
ATOM   3606   H  "H2'"  . DT  B 2 8   ? 27.807  -2.713  28.022  1.00 0.00  ? 8    DT  B "H2'"  1  
ATOM   3607   H  "H2''" . DT  B 2 8   ? 28.382  -4.296  28.522  1.00 0.00  ? 8    DT  B "H2''" 1  
ATOM   3608   H  "H1'"  . DT  B 2 8   ? 27.704  -5.343  26.464  1.00 0.00  ? 8    DT  B "H1'"  1  
ATOM   3609   H  H3     . DT  B 2 8   ? 30.685  -4.133  23.397  1.00 0.00  ? 8    DT  B H3     1  
ATOM   3610   H  H71    . DT  B 2 8   ? 28.154  0.361   24.819  1.00 0.00  ? 8    DT  B H71    1  
ATOM   3611   H  H72    . DT  B 2 8   ? 29.858  0.404   25.329  1.00 0.00  ? 8    DT  B H72    1  
ATOM   3612   H  H73    . DT  B 2 8   ? 29.449  0.312   23.600  1.00 0.00  ? 8    DT  B H73    1  
ATOM   3613   H  H6     . DT  B 2 8   ? 27.686  -1.642  26.142  1.00 0.00  ? 8    DT  B H6     1  
ATOM   3614   P  P      . DC  B 2 9   ? 27.133  -5.502  30.550  1.00 0.00  ? 9    DC  B P      1  
ATOM   3615   O  OP1    . DC  B 2 9   ? 26.493  -6.510  31.431  1.00 0.00  ? 9    DC  B OP1    1  
ATOM   3616   O  OP2    . DC  B 2 9   ? 27.386  -4.132  31.065  1.00 0.00  ? 9    DC  B OP2    1  
ATOM   3617   O  "O5'"  . DC  B 2 9   ? 28.517  -6.094  30.032  1.00 0.00  ? 9    DC  B "O5'"  1  
ATOM   3618   C  "C5'"  . DC  B 2 9   ? 28.674  -7.492  29.793  1.00 0.00  ? 9    DC  B "C5'"  1  
ATOM   3619   C  "C4'"  . DC  B 2 9   ? 30.089  -7.784  29.352  1.00 0.00  ? 9    DC  B "C4'"  1  
ATOM   3620   O  "O4'"  . DC  B 2 9   ? 30.361  -7.043  28.144  1.00 0.00  ? 9    DC  B "O4'"  1  
ATOM   3621   C  "C3'"  . DC  B 2 9   ? 31.170  -7.360  30.353  1.00 0.00  ? 9    DC  B "C3'"  1  
ATOM   3622   O  "O3'"  . DC  B 2 9   ? 31.790  -8.504  30.940  1.00 0.00  ? 9    DC  B "O3'"  1  
ATOM   3623   C  "C2'"  . DC  B 2 9   ? 32.194  -6.597  29.525  1.00 0.00  ? 9    DC  B "C2'"  1  
ATOM   3624   C  "C1'"  . DC  B 2 9   ? 31.749  -6.815  28.089  1.00 0.00  ? 9    DC  B "C1'"  1  
ATOM   3625   N  N1     . DC  B 2 9   ? 31.997  -5.663  27.214  1.00 0.00  ? 9    DC  B N1     1  
ATOM   3626   C  C2     . DC  B 2 9   ? 32.875  -5.815  26.142  1.00 0.00  ? 9    DC  B C2     1  
ATOM   3627   O  O2     . DC  B 2 9   ? 33.375  -6.930  25.932  1.00 0.00  ? 9    DC  B O2     1  
ATOM   3628   N  N3     . DC  B 2 9   ? 33.156  -4.748  25.361  1.00 0.00  ? 9    DC  B N3     1  
ATOM   3629   C  C4     . DC  B 2 9   ? 32.591  -3.566  25.620  1.00 0.00  ? 9    DC  B C4     1  
ATOM   3630   N  N4     . DC  B 2 9   ? 32.922  -2.534  24.844  1.00 0.00  ? 9    DC  B N4     1  
ATOM   3631   C  C5     . DC  B 2 9   ? 31.669  -3.389  26.692  1.00 0.00  ? 9    DC  B C5     1  
ATOM   3632   C  C6     . DC  B 2 9   ? 31.400  -4.456  27.454  1.00 0.00  ? 9    DC  B C6     1  
ATOM   3633   H  "H5'"  . DC  B 2 9   ? 27.983  -7.811  29.012  1.00 0.00  ? 9    DC  B "H5'"  1  
ATOM   3634   H  "H5''" . DC  B 2 9   ? 28.461  -8.046  30.707  1.00 0.00  ? 9    DC  B "H5''" 1  
ATOM   3635   H  "H4'"  . DC  B 2 9   ? 30.181  -8.865  29.227  1.00 0.00  ? 9    DC  B "H4'"  1  
ATOM   3636   H  "H3'"  . DC  B 2 9   ? 30.748  -6.742  31.144  1.00 0.00  ? 9    DC  B "H3'"  1  
ATOM   3637   H  "H2'"  . DC  B 2 9   ? 32.204  -5.539  29.797  1.00 0.00  ? 9    DC  B "H2'"  1  
ATOM   3638   H  "H2''" . DC  B 2 9   ? 33.199  -6.980  29.700  1.00 0.00  ? 9    DC  B "H2''" 1  
ATOM   3639   H  "H1'"  . DC  B 2 9   ? 32.225  -7.697  27.654  1.00 0.00  ? 9    DC  B "H1'"  1  
ATOM   3640   H  H41    . DC  B 2 9   ? 32.517  -1.625  25.019  1.00 0.00  ? 9    DC  B H41    1  
ATOM   3641   H  H42    . DC  B 2 9   ? 33.576  -2.661  24.085  1.00 0.00  ? 9    DC  B H42    1  
ATOM   3642   H  H5     . DC  B 2 9   ? 31.202  -2.423  26.884  1.00 0.00  ? 9    DC  B H5     1  
ATOM   3643   H  H6     . DC  B 2 9   ? 30.690  -4.359  28.276  1.00 0.00  ? 9    DC  B H6     1  
ATOM   3644   P  P      . DG  B 2 10  ? 32.967  -8.304  32.016  1.00 0.00  ? 10   DG  B P      1  
ATOM   3645   O  OP1    . DG  B 2 10  ? 33.176  -9.599  32.711  1.00 0.00  ? 10   DG  B OP1    1  
ATOM   3646   O  OP2    . DG  B 2 10  ? 32.630  -7.093  32.806  1.00 0.00  ? 10   DG  B OP2    1  
ATOM   3647   O  "O5'"  . DG  B 2 10  ? 34.258  -7.976  31.140  1.00 0.00  ? 10   DG  B "O5'"  1  
ATOM   3648   C  "C5'"  . DG  B 2 10  ? 34.895  -8.986  30.356  1.00 0.00  ? 10   DG  B "C5'"  1  
ATOM   3649   C  "C4'"  . DG  B 2 10  ? 36.158  -8.447  29.724  1.00 0.00  ? 10   DG  B "C4'"  1  
ATOM   3650   O  "O4'"  . DG  B 2 10  ? 35.823  -7.629  28.581  1.00 0.00  ? 10   DG  B "O4'"  1  
ATOM   3651   C  "C3'"  . DG  B 2 10  ? 37.004  -7.533  30.602  1.00 0.00  ? 10   DG  B "C3'"  1  
ATOM   3652   O  "O3'"  . DG  B 2 10  ? 37.885  -8.298  31.430  1.00 0.00  ? 10   DG  B "O3'"  1  
ATOM   3653   C  "C2'"  . DG  B 2 10  ? 37.791  -6.734  29.579  1.00 0.00  ? 10   DG  B "C2'"  1  
ATOM   3654   C  "C1'"  . DG  B 2 10  ? 36.822  -6.627  28.401  1.00 0.00  ? 10   DG  B "C1'"  1  
ATOM   3655   N  N9     . DG  B 2 10  ? 36.149  -5.336  28.297  1.00 0.00  ? 10   DG  B N9     1  
ATOM   3656   C  C8     . DG  B 2 10  ? 34.956  -4.976  28.872  1.00 0.00  ? 10   DG  B C8     1  
ATOM   3657   N  N7     . DG  B 2 10  ? 34.600  -3.751  28.599  1.00 0.00  ? 10   DG  B N7     1  
ATOM   3658   C  C5     . DG  B 2 10  ? 35.624  -3.269  27.797  1.00 0.00  ? 10   DG  B C5     1  
ATOM   3659   C  C6     . DG  B 2 10  ? 35.797  -1.997  27.193  1.00 0.00  ? 10   DG  B C6     1  
ATOM   3660   O  O6     . DG  B 2 10  ? 35.053  -1.010  27.248  1.00 0.00  ? 10   DG  B O6     1  
ATOM   3661   N  N1     . DG  B 2 10  ? 36.979  -1.933  26.461  1.00 0.00  ? 10   DG  B N1     1  
ATOM   3662   C  C2     . DG  B 2 10  ? 37.882  -2.960  26.330  1.00 0.00  ? 10   DG  B C2     1  
ATOM   3663   N  N2     . DG  B 2 10  ? 38.966  -2.701  25.585  1.00 0.00  ? 10   DG  B N2     1  
ATOM   3664   N  N3     . DG  B 2 10  ? 37.732  -4.152  26.887  1.00 0.00  ? 10   DG  B N3     1  
ATOM   3665   C  C4     . DG  B 2 10  ? 36.590  -4.235  27.601  1.00 0.00  ? 10   DG  B C4     1  
ATOM   3666   H  "H5'"  . DG  B 2 10  ? 34.218  -9.320  29.571  1.00 0.00  ? 10   DG  B "H5'"  1  
ATOM   3667   H  "H5''" . DG  B 2 10  ? 35.150  -9.836  30.991  1.00 0.00  ? 10   DG  B "H5''" 1  
ATOM   3668   H  "H4'"  . DG  B 2 10  ? 36.786  -9.301  29.467  1.00 0.00  ? 10   DG  B "H4'"  1  
ATOM   3669   H  "H3'"  . DG  B 2 10  ? 36.380  -6.895  31.228  1.00 0.00  ? 10   DG  B "H3'"  1  
ATOM   3670   H  "H2'"  . DG  B 2 10  ? 38.069  -5.756  29.972  1.00 0.00  ? 10   DG  B "H2'"  1  
ATOM   3671   H  "H2''" . DG  B 2 10  ? 38.713  -7.246  29.304  1.00 0.00  ? 10   DG  B "H2''" 1  
ATOM   3672   H  "H1'"  . DG  B 2 10  ? 37.332  -6.828  27.457  1.00 0.00  ? 10   DG  B "H1'"  1  
ATOM   3673   H  H8     . DG  B 2 10  ? 34.373  -5.639  29.491  1.00 0.00  ? 10   DG  B H8     1  
ATOM   3674   H  H1     . DG  B 2 10  ? 37.190  -1.064  25.990  1.00 0.00  ? 10   DG  B H1     1  
ATOM   3675   H  H21    . DG  B 2 10  ? 39.670  -3.412  25.448  1.00 0.00  ? 10   DG  B H21    1  
ATOM   3676   H  H22    . DG  B 2 10  ? 39.080  -1.791  25.162  1.00 0.00  ? 10   DG  B H22    1  
ATOM   3677   P  P      . DT  B 2 11  ? 38.271  -7.759  32.895  1.00 0.00  ? 11   DT  B P      1  
ATOM   3678   O  OP1    . DT  B 2 11  ? 39.007  -8.832  33.610  1.00 0.00  ? 11   DT  B OP1    1  
ATOM   3679   O  OP2    . DT  B 2 11  ? 37.038  -7.190  33.495  1.00 0.00  ? 11   DT  B OP2    1  
ATOM   3680   O  "O5'"  . DT  B 2 11  ? 39.281  -6.560  32.614  1.00 0.00  ? 11   DT  B "O5'"  1  
ATOM   3681   C  "C5'"  . DT  B 2 11  ? 39.458  -5.513  33.568  1.00 0.00  ? 11   DT  B "C5'"  1  
ATOM   3682   C  "C4'"  . DT  B 2 11  ? 40.893  -5.041  33.565  1.00 0.00  ? 11   DT  B "C4'"  1  
ATOM   3683   O  "O4'"  . DT  B 2 11  ? 41.758  -6.141  33.925  1.00 0.00  ? 11   DT  B "O4'"  1  
ATOM   3684   C  "C3'"  . DT  B 2 11  ? 41.411  -4.559  32.215  1.00 0.00  ? 11   DT  B "C3'"  1  
ATOM   3685   O  "O3'"  . DT  B 2 11  ? 41.151  -3.162  32.052  1.00 0.00  ? 11   DT  B "O3'"  1  
ATOM   3686   C  "C2'"  . DT  B 2 11  ? 42.903  -4.822  32.311  1.00 0.00  ? 11   DT  B "C2'"  1  
ATOM   3687   C  "C1'"  . DT  B 2 11  ? 42.985  -6.055  33.208  1.00 0.00  ? 11   DT  B "C1'"  1  
ATOM   3688   N  N1     . DT  B 2 11  ? 43.174  -7.322  32.477  1.00 0.00  ? 11   DT  B N1     1  
ATOM   3689   C  C2     . DT  B 2 11  ? 44.420  -7.583  31.955  1.00 0.00  ? 11   DT  B C2     1  
ATOM   3690   O  O2     . DT  B 2 11  ? 45.363  -6.818  32.070  1.00 0.00  ? 11   DT  B O2     1  
ATOM   3691   N  N3     . DT  B 2 11  ? 44.523  -8.778  31.291  1.00 0.00  ? 11   DT  B N3     1  
ATOM   3692   C  C4     . DT  B 2 11  ? 43.526  -9.713  31.101  1.00 0.00  ? 11   DT  B C4     1  
ATOM   3693   O  O4     . DT  B 2 11  ? 43.767  -10.746 30.481  1.00 0.00  ? 11   DT  B O4     1  
ATOM   3694   C  C5     . DT  B 2 11  ? 42.243  -9.374  31.674  1.00 0.00  ? 11   DT  B C5     1  
ATOM   3695   C  C7     . DT  B 2 11  ? 41.106  -10.333 31.517  1.00 0.00  ? 11   DT  B C7     1  
ATOM   3696   C  C6     . DT  B 2 11  ? 42.127  -8.209  32.328  1.00 0.00  ? 11   DT  B C6     1  
ATOM   3697   H  "H5'"  . DT  B 2 11  ? 39.205  -5.879  34.563  1.00 0.00  ? 11   DT  B "H5'"  1  
ATOM   3698   H  "H5''" . DT  B 2 11  ? 38.806  -4.676  33.319  1.00 0.00  ? 11   DT  B "H5''" 1  
ATOM   3699   H  "H4'"  . DT  B 2 11  ? 40.965  -4.195  34.250  1.00 0.00  ? 11   DT  B "H4'"  1  
ATOM   3700   H  "H3'"  . DT  B 2 11  ? 40.950  -5.111  31.396  1.00 0.00  ? 11   DT  B "H3'"  1  
ATOM   3701   H  "H2'"  . DT  B 2 11  ? 43.333  -5.002  31.325  1.00 0.00  ? 11   DT  B "H2'"  1  
ATOM   3702   H  "H2''" . DT  B 2 11  ? 43.426  -3.969  32.742  1.00 0.00  ? 11   DT  B "H2''" 1  
ATOM   3703   H  "H1'"  . DT  B 2 11  ? 43.792  -5.954  33.935  1.00 0.00  ? 11   DT  B "H1'"  1  
ATOM   3704   H  H3     . DT  B 2 11  ? 45.426  -8.996  30.897  1.00 0.00  ? 11   DT  B H3     1  
ATOM   3705   H  H71    . DT  B 2 11  ? 40.449  -10.263 32.384  1.00 0.00  ? 11   DT  B H71    1  
ATOM   3706   H  H72    . DT  B 2 11  ? 40.545  -10.087 30.616  1.00 0.00  ? 11   DT  B H72    1  
ATOM   3707   H  H73    . DT  B 2 11  ? 41.494  -11.348 31.437  1.00 0.00  ? 11   DT  B H73    1  
ATOM   3708   H  H6     . DT  B 2 11  ? 41.161  -7.951  32.761  1.00 0.00  ? 11   DT  B H6     1  
ATOM   3709   P  P      . DA  B 2 12  ? 40.127  -2.671  30.916  1.00 0.00  ? 12   DA  B P      1  
ATOM   3710   O  OP1    . DA  B 2 12  ? 39.671  -1.306  31.284  1.00 0.00  ? 12   DA  B OP1    1  
ATOM   3711   O  OP2    . DA  B 2 12  ? 39.126  -3.745  30.698  1.00 0.00  ? 12   DA  B OP2    1  
ATOM   3712   O  "O5'"  . DA  B 2 12  ? 41.030  -2.557  29.608  1.00 0.00  ? 12   DA  B "O5'"  1  
ATOM   3713   C  "C5'"  . DA  B 2 12  ? 41.946  -1.476  29.441  1.00 0.00  ? 12   DA  B "C5'"  1  
ATOM   3714   C  "C4'"  . DA  B 2 12  ? 43.139  -1.925  28.631  1.00 0.00  ? 12   DA  B "C4'"  1  
ATOM   3715   O  "O4'"  . DA  B 2 12  ? 43.580  -3.213  29.122  1.00 0.00  ? 12   DA  B "O4'"  1  
ATOM   3716   C  "C3'"  . DA  B 2 12  ? 42.868  -2.124  27.141  1.00 0.00  ? 12   DA  B "C3'"  1  
ATOM   3717   O  "O3'"  . DA  B 2 12  ? 43.212  -0.944  26.407  1.00 0.00  ? 12   DA  B "O3'"  1  
ATOM   3718   C  "C2'"  . DA  B 2 12  ? 43.792  -3.269  26.774  1.00 0.00  ? 12   DA  B "C2'"  1  
ATOM   3719   C  "C1'"  . DA  B 2 12  ? 43.792  -4.109  28.040  1.00 0.00  ? 12   DA  B "C1'"  1  
ATOM   3720   N  N9     . DA  B 2 12  ? 42.744  -5.128  28.089  1.00 0.00  ? 12   DA  B N9     1  
ATOM   3721   C  C8     . DA  B 2 12  ? 41.400  -4.944  28.303  1.00 0.00  ? 12   DA  B C8     1  
ATOM   3722   N  N7     . DA  B 2 12  ? 40.706  -6.056  28.292  1.00 0.00  ? 12   DA  B N7     1  
ATOM   3723   C  C5     . DA  B 2 12  ? 41.656  -7.039  28.055  1.00 0.00  ? 12   DA  B C5     1  
ATOM   3724   C  C6     . DA  B 2 12  ? 41.562  -8.437  27.928  1.00 0.00  ? 12   DA  B C6     1  
ATOM   3725   N  N6     . DA  B 2 12  ? 40.416  -9.114  28.029  1.00 0.00  ? 12   DA  B N6     1  
ATOM   3726   N  N1     . DA  B 2 12  ? 42.701  -9.125  27.693  1.00 0.00  ? 12   DA  B N1     1  
ATOM   3727   C  C2     . DA  B 2 12  ? 43.851  -8.446  27.593  1.00 0.00  ? 12   DA  B C2     1  
ATOM   3728   N  N3     . DA  B 2 12  ? 44.067  -7.136  27.693  1.00 0.00  ? 12   DA  B N3     1  
ATOM   3729   C  C4     . DA  B 2 12  ? 42.916  -6.482  27.927  1.00 0.00  ? 12   DA  B C4     1  
ATOM   3730   H  "H5'"  . DA  B 2 12  ? 42.287  -1.130  30.417  1.00 0.00  ? 12   DA  B "H5'"  1  
ATOM   3731   H  "H5''" . DA  B 2 12  ? 41.452  -0.653  28.924  1.00 0.00  ? 12   DA  B "H5''" 1  
ATOM   3732   H  "H4'"  . DA  B 2 12  ? 43.904  -1.149  28.710  1.00 0.00  ? 12   DA  B "H4'"  1  
ATOM   3733   H  "H3'"  . DA  B 2 12  ? 41.821  -2.368  26.960  1.00 0.00  ? 12   DA  B "H3'"  1  
ATOM   3734   H  "H2'"  . DA  B 2 12  ? 43.416  -3.820  25.912  1.00 0.00  ? 12   DA  B "H2'"  1  
ATOM   3735   H  "H2''" . DA  B 2 12  ? 44.789  -2.907  26.520  1.00 0.00  ? 12   DA  B "H2''" 1  
ATOM   3736   H  "H1'"  . DA  B 2 12  ? 44.758  -4.596  28.188  1.00 0.00  ? 12   DA  B "H1'"  1  
ATOM   3737   H  H8     . DA  B 2 12  ? 40.956  -3.973  28.464  1.00 0.00  ? 12   DA  B H8     1  
ATOM   3738   H  H61    . DA  B 2 12  ? 40.412  -10.119 27.928  1.00 0.00  ? 12   DA  B H61    1  
ATOM   3739   H  H62    . DA  B 2 12  ? 39.552  -8.621  28.205  1.00 0.00  ? 12   DA  B H62    1  
ATOM   3740   H  H2     . DA  B 2 12  ? 44.736  -9.052  27.403  1.00 0.00  ? 12   DA  B H2     1  
ATOM   3741   P  P      . DA  B 2 13  ? 42.332  -0.514  25.131  1.00 0.00  ? 13   DA  B P      1  
ATOM   3742   O  OP1    . DA  B 2 13  ? 42.820  0.816   24.683  1.00 0.00  ? 13   DA  B OP1    1  
ATOM   3743   O  OP2    . DA  B 2 13  ? 40.898  -0.692  25.471  1.00 0.00  ? 13   DA  B OP2    1  
ATOM   3744   O  "O5'"  . DA  B 2 13  ? 42.718  -1.584  24.016  1.00 0.00  ? 13   DA  B "O5'"  1  
ATOM   3745   C  "C5'"  . DA  B 2 13  ? 43.938  -1.475  23.284  1.00 0.00  ? 13   DA  B "C5'"  1  
ATOM   3746   C  "C4'"  . DA  B 2 13  ? 44.115  -2.677  22.387  1.00 0.00  ? 13   DA  B "C4'"  1  
ATOM   3747   O  "O4'"  . DA  B 2 13  ? 44.210  -3.863  23.210  1.00 0.00  ? 13   DA  B "O4'"  1  
ATOM   3748   C  "C3'"  . DA  B 2 13  ? 42.959  -2.944  21.427  1.00 0.00  ? 13   DA  B "C3'"  1  
ATOM   3749   O  "O3'"  . DA  B 2 13  ? 43.188  -2.298  20.169  1.00 0.00  ? 13   DA  B "O3'"  1  
ATOM   3750   C  "C2'"  . DA  B 2 13  ? 42.992  -4.452  21.269  1.00 0.00  ? 13   DA  B "C2'"  1  
ATOM   3751   C  "C1'"  . DA  B 2 13  ? 43.464  -4.928  22.635  1.00 0.00  ? 13   DA  B "C1'"  1  
ATOM   3752   N  N9     . DA  B 2 13  ? 42.381  -5.272  23.555  1.00 0.00  ? 13   DA  B N9     1  
ATOM   3753   C  C8     . DA  B 2 13  ? 41.512  -4.421  24.191  1.00 0.00  ? 13   DA  B C8     1  
ATOM   3754   N  N7     . DA  B 2 13  ? 40.639  -5.032  24.955  1.00 0.00  ? 13   DA  B N7     1  
ATOM   3755   C  C5     . DA  B 2 13  ? 40.954  -6.375  24.812  1.00 0.00  ? 13   DA  B C5     1  
ATOM   3756   C  C6     . DA  B 2 13  ? 40.397  -7.543  25.363  1.00 0.00  ? 13   DA  B C6     1  
ATOM   3757   N  N6     . DA  B 2 13  ? 39.363  -7.542  26.207  1.00 0.00  ? 13   DA  B N6     1  
ATOM   3758   N  N1     . DA  B 2 13  ? 40.948  -8.727  25.015  1.00 0.00  ? 13   DA  B N1     1  
ATOM   3759   C  C2     . DA  B 2 13  ? 41.987  -8.727  24.169  1.00 0.00  ? 13   DA  B C2     1  
ATOM   3760   N  N3     . DA  B 2 13  ? 42.597  -7.698  23.586  1.00 0.00  ? 13   DA  B N3     1  
ATOM   3761   C  C4     . DA  B 2 13  ? 42.026  -6.537  23.952  1.00 0.00  ? 13   DA  B C4     1  
ATOM   3762   H  "H5'"  . DA  B 2 13  ? 44.777  -1.421  23.977  1.00 0.00  ? 13   DA  B "H5'"  1  
ATOM   3763   H  "H5''" . DA  B 2 13  ? 43.920  -0.571  22.673  1.00 0.00  ? 13   DA  B "H5''" 1  
ATOM   3764   H  "H4'"  . DA  B 2 13  ? 45.001  -2.506  21.773  1.00 0.00  ? 13   DA  B "H4'"  1  
ATOM   3765   H  "H3'"  . DA  B 2 13  ? 42.013  -2.597  21.843  1.00 0.00  ? 13   DA  B "H3'"  1  
ATOM   3766   H  "H2'"  . DA  B 2 13  ? 42.005  -4.842  21.016  1.00 0.00  ? 13   DA  B "H2'"  1  
ATOM   3767   H  "H2''" . DA  B 2 13  ? 43.674  -4.750  20.473  1.00 0.00  ? 13   DA  B "H2''" 1  
ATOM   3768   H  "H1'"  . DA  B 2 13  ? 44.126  -5.790  22.541  1.00 0.00  ? 13   DA  B "H1'"  1  
ATOM   3769   H  H8     . DA  B 2 13  ? 41.544  -3.348  24.072  1.00 0.00  ? 13   DA  B H8     1  
ATOM   3770   H  H61    . DA  B 2 13  ? 39.006  -8.413  26.572  1.00 0.00  ? 13   DA  B H61    1  
ATOM   3771   H  H62    . DA  B 2 13  ? 38.936  -6.669  26.481  1.00 0.00  ? 13   DA  B H62    1  
ATOM   3772   H  H2     . DA  B 2 13  ? 42.389  -9.709  23.923  1.00 0.00  ? 13   DA  B H2     1  
ATOM   3773   P  P      . DG  B 2 14  ? 42.314  -2.718  18.886  1.00 0.00  ? 14   DG  B P      1  
ATOM   3774   O  OP1    . DG  B 2 14  ? 43.174  -2.623  17.680  1.00 0.00  ? 14   DG  B OP1    1  
ATOM   3775   O  OP2    . DG  B 2 14  ? 41.043  -1.950  18.943  1.00 0.00  ? 14   DG  B OP2    1  
ATOM   3776   O  "O5'"  . DG  B 2 14  ? 41.972  -4.252  19.143  1.00 0.00  ? 14   DG  B "O5'"  1  
ATOM   3777   C  "C5'"  . DG  B 2 14  ? 41.692  -5.136  18.062  1.00 0.00  ? 14   DG  B "C5'"  1  
ATOM   3778   C  "C4'"  . DG  B 2 14  ? 40.723  -6.205  18.508  1.00 0.00  ? 14   DG  B "C4'"  1  
ATOM   3779   O  "O4'"  . DG  B 2 14  ? 40.039  -5.742  19.699  1.00 0.00  ? 14   DG  B "O4'"  1  
ATOM   3780   C  "C3'"  . DG  B 2 14  ? 39.630  -6.541  17.491  1.00 0.00  ? 14   DG  B "C3'"  1  
ATOM   3781   O  "O3'"  . DG  B 2 14  ? 39.392  -7.950  17.453  1.00 0.00  ? 14   DG  B "O3'"  1  
ATOM   3782   C  "C2'"  . DG  B 2 14  ? 38.411  -5.811  18.024  1.00 0.00  ? 14   DG  B "C2'"  1  
ATOM   3783   C  "C1'"  . DG  B 2 14  ? 38.640  -5.854  19.519  1.00 0.00  ? 14   DG  B "C1'"  1  
ATOM   3784   N  N9     . DG  B 2 14  ? 37.997  -4.773  20.260  1.00 0.00  ? 14   DG  B N9     1  
ATOM   3785   C  C8     . DG  B 2 14  ? 38.094  -3.426  20.014  1.00 0.00  ? 14   DG  B C8     1  
ATOM   3786   N  N7     . DG  B 2 14  ? 37.382  -2.699  20.830  1.00 0.00  ? 14   DG  B N7     1  
ATOM   3787   C  C5     . DG  B 2 14  ? 36.782  -3.623  21.674  1.00 0.00  ? 14   DG  B C5     1  
ATOM   3788   C  C6     . DG  B 2 14  ? 35.892  -3.431  22.764  1.00 0.00  ? 14   DG  B C6     1  
ATOM   3789   O  O6     . DG  B 2 14  ? 35.438  -2.371  23.211  1.00 0.00  ? 14   DG  B O6     1  
ATOM   3790   N  N1     . DG  B 2 14  ? 35.530  -4.641  23.349  1.00 0.00  ? 14   DG  B N1     1  
ATOM   3791   C  C2     . DG  B 2 14  ? 35.967  -5.877  22.940  1.00 0.00  ? 14   DG  B C2     1  
ATOM   3792   N  N2     . DG  B 2 14  ? 35.513  -6.925  23.642  1.00 0.00  ? 14   DG  B N2     1  
ATOM   3793   N  N3     . DG  B 2 14  ? 36.792  -6.071  21.922  1.00 0.00  ? 14   DG  B N3     1  
ATOM   3794   C  C4     . DG  B 2 14  ? 37.156  -4.908  21.340  1.00 0.00  ? 14   DG  B C4     1  
ATOM   3795   H  "H5'"  . DG  B 2 14  ? 42.614  -5.610  17.727  1.00 0.00  ? 14   DG  B "H5'"  1  
ATOM   3796   H  "H5''" . DG  B 2 14  ? 41.255  -4.578  17.235  1.00 0.00  ? 14   DG  B "H5''" 1  
ATOM   3797   H  "H4'"  . DG  B 2 14  ? 41.294  -7.121  18.668  1.00 0.00  ? 14   DG  B "H4'"  1  
ATOM   3798   H  "H3'"  . DG  B 2 14  ? 39.905  -6.198  16.494  1.00 0.00  ? 14   DG  B "H3'"  1  
ATOM   3799   H  "H2'"  . DG  B 2 14  ? 38.361  -4.791  17.643  1.00 0.00  ? 14   DG  B "H2'"  1  
ATOM   3800   H  "H2''" . DG  B 2 14  ? 37.488  -6.314  17.733  1.00 0.00  ? 14   DG  B "H2''" 1  
ATOM   3801   H  "H1'"  . DG  B 2 14  ? 38.319  -6.808  19.941  1.00 0.00  ? 14   DG  B "H1'"  1  
ATOM   3802   H  H8     . DG  B 2 14  ? 38.705  -3.009  19.226  1.00 0.00  ? 14   DG  B H8     1  
ATOM   3803   H  H1     . DG  B 2 14  ? 34.896  -4.606  24.134  1.00 0.00  ? 14   DG  B H1     1  
ATOM   3804   H  H21    . DG  B 2 14  ? 35.796  -7.863  23.399  1.00 0.00  ? 14   DG  B H21    1  
ATOM   3805   H  H22    . DG  B 2 14  ? 34.884  -6.772  24.417  1.00 0.00  ? 14   DG  B H22    1  
ATOM   3806   P  P      . DA  B 2 15  ? 38.259  -8.540  16.475  1.00 0.00  ? 15   DA  B P      1  
ATOM   3807   O  OP1    . DA  B 2 15  ? 38.536  -9.988  16.298  1.00 0.00  ? 15   DA  B OP1    1  
ATOM   3808   O  OP2    . DA  B 2 15  ? 38.164  -7.660  15.282  1.00 0.00  ? 15   DA  B OP2    1  
ATOM   3809   O  "O5'"  . DA  B 2 15  ? 36.911  -8.389  17.311  1.00 0.00  ? 15   DA  B "O5'"  1  
ATOM   3810   C  "C5'"  . DA  B 2 15  ? 36.864  -8.724  18.698  1.00 0.00  ? 15   DA  B "C5'"  1  
ATOM   3811   C  "C4'"  . DA  B 2 15  ? 35.900  -9.865  18.928  1.00 0.00  ? 15   DA  B "C4'"  1  
ATOM   3812   O  "O4'"  . DA  B 2 15  ? 34.921  -9.475  19.910  1.00 0.00  ? 15   DA  B "O4'"  1  
ATOM   3813   C  "C3'"  . DA  B 2 15  ? 35.058  -10.247 17.719  1.00 0.00  ? 15   DA  B "C3'"  1  
ATOM   3814   O  "O3'"  . DA  B 2 15  ? 34.483  -11.547 17.912  1.00 0.00  ? 15   DA  B "O3'"  1  
ATOM   3815   C  "C2'"  . DA  B 2 15  ? 33.997  -9.165  17.738  1.00 0.00  ? 15   DA  B "C2'"  1  
ATOM   3816   C  "C1'"  . DA  B 2 15  ? 33.786  -8.936  19.236  1.00 0.00  ? 15   DA  B "C1'"  1  
ATOM   3817   N  N9     . DA  B 2 15  ? 33.678  -7.533  19.623  1.00 0.00  ? 15   DA  B N9     1  
ATOM   3818   C  C8     . DA  B 2 15  ? 34.282  -6.441  19.053  1.00 0.00  ? 15   DA  B C8     1  
ATOM   3819   N  N7     . DA  B 2 15  ? 33.991  -5.308  19.645  1.00 0.00  ? 15   DA  B N7     1  
ATOM   3820   C  C5     . DA  B 2 15  ? 33.137  -5.682  20.673  1.00 0.00  ? 15   DA  B C5     1  
ATOM   3821   C  C6     . DA  B 2 15  ? 32.474  -4.945  21.667  1.00 0.00  ? 15   DA  B C6     1  
ATOM   3822   N  N6     . DA  B 2 15  ? 32.569  -3.621  21.794  1.00 0.00  ? 15   DA  B N6     1  
ATOM   3823   N  N1     . DA  B 2 15  ? 31.698  -5.625  22.541  1.00 0.00  ? 15   DA  B N1     1  
ATOM   3824   C  C2     . DA  B 2 15  ? 31.600  -6.955  22.412  1.00 0.00  ? 15   DA  B C2     1  
ATOM   3825   N  N3     . DA  B 2 15  ? 32.170  -7.756  21.517  1.00 0.00  ? 15   DA  B N3     1  
ATOM   3826   C  C4     . DA  B 2 15  ? 32.935  -7.049  20.668  1.00 0.00  ? 15   DA  B C4     1  
ATOM   3827   H  "H5'"  . DA  B 2 15  ? 36.533  -7.857  19.272  1.00 0.00  ? 15   DA  B "H5'"  1  
ATOM   3828   H  "H5''" . DA  B 2 15  ? 37.856  -9.019  19.039  1.00 0.00  ? 15   DA  B "H5''" 1  
ATOM   3829   H  "H4'"  . DA  B 2 15  ? 36.476  -10.745 19.213  1.00 0.00  ? 15   DA  B "H4'"  1  
ATOM   3830   H  "H3'"  . DA  B 2 15  ? 35.648  -10.235 16.802  1.00 0.00  ? 15   DA  B "H3'"  1  
ATOM   3831   H  "H2'"  . DA  B 2 15  ? 34.345  -8.265  17.231  1.00 0.00  ? 15   DA  B "H2'"  1  
ATOM   3832   H  "H2''" . DA  B 2 15  ? 33.085  -9.490  17.237  1.00 0.00  ? 15   DA  B "H2''" 1  
ATOM   3833   H  "H1'"  . DA  B 2 15  ? 32.899  -9.463  19.590  1.00 0.00  ? 15   DA  B "H1'"  1  
ATOM   3834   H  H8     . DA  B 2 15  ? 34.942  -6.509  18.200  1.00 0.00  ? 15   DA  B H8     1  
ATOM   3835   H  H61    . DA  B 2 15  ? 32.059  -3.154  22.530  1.00 0.00  ? 15   DA  B H61    1  
ATOM   3836   H  H62    . DA  B 2 15  ? 33.141  -3.089  21.155  1.00 0.00  ? 15   DA  B H62    1  
ATOM   3837   H  H2     . DA  B 2 15  ? 30.964  -7.451  23.144  1.00 0.00  ? 15   DA  B H2     1  
ATOM   3838   P  P      . DA  B 2 16  ? 33.247  -12.021 17.000  1.00 0.00  ? 16   DA  B P      1  
ATOM   3839   O  OP1    . DA  B 2 16  ? 33.412  -13.471 16.725  1.00 0.00  ? 16   DA  B OP1    1  
ATOM   3840   O  OP2    . DA  B 2 16  ? 33.147  -11.068 15.866  1.00 0.00  ? 16   DA  B OP2    1  
ATOM   3841   O  "O5'"  . DA  B 2 16  ? 31.966  -11.825 17.933  1.00 0.00  ? 16   DA  B "O5'"  1  
ATOM   3842   C  "C5'"  . DA  B 2 16  ? 31.814  -12.567 19.147  1.00 0.00  ? 16   DA  B "C5'"  1  
ATOM   3843   C  "C4'"  . DA  B 2 16  ? 30.538  -12.166 19.853  1.00 0.00  ? 16   DA  B "C4'"  1  
ATOM   3844   O  "O4'"  . DA  B 2 16  ? 30.567  -10.739 20.086  1.00 0.00  ? 16   DA  B "O4'"  1  
ATOM   3845   C  "C3'"  . DA  B 2 16  ? 29.238  -12.452 19.092  1.00 0.00  ? 16   DA  B "C3'"  1  
ATOM   3846   O  "O3'"  . DA  B 2 16  ? 28.321  -13.141 19.947  1.00 0.00  ? 16   DA  B "O3'"  1  
ATOM   3847   C  "C2'"  . DA  B 2 16  ? 28.697  -11.077 18.728  1.00 0.00  ? 16   DA  B "C2'"  1  
ATOM   3848   C  "C1'"  . DA  B 2 16  ? 29.302  -10.183 19.791  1.00 0.00  ? 16   DA  B "C1'"  1  
ATOM   3849   N  N9     . DA  B 2 16  ? 29.512  -8.795  19.380  1.00 0.00  ? 16   DA  B N9     1  
ATOM   3850   C  C8     . DA  B 2 16  ? 30.375  -8.330  18.418  1.00 0.00  ? 16   DA  B C8     1  
ATOM   3851   N  N7     . DA  B 2 16  ? 30.357  -7.027  18.278  1.00 0.00  ? 16   DA  B N7     1  
ATOM   3852   C  C5     . DA  B 2 16  ? 29.417  -6.605  19.207  1.00 0.00  ? 16   DA  B C5     1  
ATOM   3853   C  C6     . DA  B 2 16  ? 28.938  -5.330  19.555  1.00 0.00  ? 16   DA  B C6     1  
ATOM   3854   N  N6     . DA  B 2 16  ? 29.360  -4.199  18.985  1.00 0.00  ? 16   DA  B N6     1  
ATOM   3855   N  N1     . DA  B 2 16  ? 27.999  -5.254  20.523  1.00 0.00  ? 16   DA  B N1     1  
ATOM   3856   C  C2     . DA  B 2 16  ? 27.576  -6.389  21.097  1.00 0.00  ? 16   DA  B C2     1  
ATOM   3857   N  N3     . DA  B 2 16  ? 27.951  -7.644  20.857  1.00 0.00  ? 16   DA  B N3     1  
ATOM   3858   C  C4     . DA  B 2 16  ? 28.885  -7.684  19.891  1.00 0.00  ? 16   DA  B C4     1  
ATOM   3859   H  "H5'"  . DA  B 2 16  ? 32.662  -12.369 19.804  1.00 0.00  ? 16   DA  B "H5'"  1  
ATOM   3860   H  "H5''" . DA  B 2 16  ? 31.778  -13.634 18.924  1.00 0.00  ? 16   DA  B "H5''" 1  
ATOM   3861   H  "H4'"  . DA  B 2 16  ? 30.485  -12.744 20.777  1.00 0.00  ? 16   DA  B "H4'"  1  
ATOM   3862   H  "H3'"  . DA  B 2 16  ? 29.425  -13.061 18.209  1.00 0.00  ? 16   DA  B "H3'"  1  
ATOM   3863   H  "H2'"  . DA  B 2 16  ? 29.003  -10.787 17.721  1.00 0.00  ? 16   DA  B "H2'"  1  
ATOM   3864   H  "H2''" . DA  B 2 16  ? 27.608  -11.062 18.753  1.00 0.00  ? 16   DA  B "H2''" 1  
ATOM   3865   H  "H1'"  . DA  B 2 16  ? 28.703  -10.193 20.704  1.00 0.00  ? 16   DA  B "H1'"  1  
ATOM   3866   H  H8     . DA  B 2 16  ? 31.011  -8.978  17.832  1.00 0.00  ? 16   DA  B H8     1  
ATOM   3867   H  H61    . DA  B 2 16  ? 28.981  -3.311  19.283  1.00 0.00  ? 16   DA  B H61    1  
ATOM   3868   H  H62    . DA  B 2 16  ? 30.062  -4.230  18.260  1.00 0.00  ? 16   DA  B H62    1  
ATOM   3869   H  H2     . DA  B 2 16  ? 26.819  -6.267  21.871  1.00 0.00  ? 16   DA  B H2     1  
ATOM   3870   P  P      . DG  B 2 17  ? 26.855  -13.521 19.408  1.00 0.00  ? 17   DG  B P      1  
ATOM   3871   O  OP1    . DG  B 2 17  ? 26.759  -15.003 19.400  1.00 0.00  ? 17   DG  B OP1    1  
ATOM   3872   O  OP2    . DG  B 2 17  ? 26.594  -12.764 18.158  1.00 0.00  ? 17   DG  B OP2    1  
ATOM   3873   O  "O5'"  . DG  B 2 17  ? 25.883  -12.965 20.541  1.00 0.00  ? 17   DG  B "O5'"  1  
ATOM   3874   C  "C5'"  . DG  B 2 17  ? 26.303  -11.908 21.404  1.00 0.00  ? 17   DG  B "C5'"  1  
ATOM   3875   C  "C4'"  . DG  B 2 17  ? 25.108  -11.266 22.067  1.00 0.00  ? 17   DG  B "C4'"  1  
ATOM   3876   O  "O4'"  . DG  B 2 17  ? 25.048  -9.873  21.687  1.00 0.00  ? 17   DG  B "O4'"  1  
ATOM   3877   C  "C3'"  . DG  B 2 17  ? 23.757  -11.840 21.659  1.00 0.00  ? 17   DG  B "C3'"  1  
ATOM   3878   O  "O3'"  . DG  B 2 17  ? 22.795  -11.615 22.692  1.00 0.00  ? 17   DG  B "O3'"  1  
ATOM   3879   C  "C2'"  . DG  B 2 17  ? 23.420  -11.041 20.415  1.00 0.00  ? 17   DG  B "C2'"  1  
ATOM   3880   C  "C1'"  . DG  B 2 17  ? 24.026  -9.674  20.717  1.00 0.00  ? 17   DG  B "C1'"  1  
ATOM   3881   N  N9     . DG  B 2 17  ? 24.633  -9.022  19.563  1.00 0.00  ? 17   DG  B N9     1  
ATOM   3882   C  C8     . DG  B 2 17  ? 25.280  -9.624  18.512  1.00 0.00  ? 17   DG  B C8     1  
ATOM   3883   N  N7     . DG  B 2 17  ? 25.728  -8.776  17.628  1.00 0.00  ? 17   DG  B N7     1  
ATOM   3884   C  C5     . DG  B 2 17  ? 25.352  -7.536  18.126  1.00 0.00  ? 17   DG  B C5     1  
ATOM   3885   C  C6     . DG  B 2 17  ? 25.560  -6.234  17.603  1.00 0.00  ? 17   DG  B C6     1  
ATOM   3886   O  O6     . DG  B 2 17  ? 26.138  -5.906  16.561  1.00 0.00  ? 17   DG  B O6     1  
ATOM   3887   N  N1     . DG  B 2 17  ? 25.012  -5.257  18.430  1.00 0.00  ? 17   DG  B N1     1  
ATOM   3888   C  C2     . DG  B 2 17  ? 24.350  -5.501  19.609  1.00 0.00  ? 17   DG  B C2     1  
ATOM   3889   N  N2     . DG  B 2 17  ? 23.895  -4.427  20.268  1.00 0.00  ? 17   DG  B N2     1  
ATOM   3890   N  N3     . DG  B 2 17  ? 24.150  -6.709  20.106  1.00 0.00  ? 17   DG  B N3     1  
ATOM   3891   C  C4     . DG  B 2 17  ? 24.674  -7.672  19.319  1.00 0.00  ? 17   DG  B C4     1  
ATOM   3892   H  "H5'"  . DG  B 2 17  ? 26.837  -11.155 20.826  1.00 0.00  ? 17   DG  B "H5'"  1  
ATOM   3893   H  "H5''" . DG  B 2 17  ? 26.967  -12.304 22.173  1.00 0.00  ? 17   DG  B "H5''" 1  
ATOM   3894   H  "H4'"  . DG  B 2 17  ? 25.203  -11.415 23.144  1.00 0.00  ? 17   DG  B "H4'"  1  
ATOM   3895   H  "H3'"  . DG  B 2 17  ? 23.827  -12.908 21.455  1.00 0.00  ? 17   DG  B "H3'"  1  
ATOM   3896   H  "H2'"  . DG  B 2 17  ? 23.855  -11.495 19.524  1.00 0.00  ? 17   DG  B "H2'"  1  
ATOM   3897   H  "H2''" . DG  B 2 17  ? 22.342  -10.987 20.259  1.00 0.00  ? 17   DG  B "H2''" 1  
ATOM   3898   H  "H1'"  . DG  B 2 17  ? 23.281  -9.001  21.145  1.00 0.00  ? 17   DG  B "H1'"  1  
ATOM   3899   H  H8     . DG  B 2 17  ? 25.406  -10.694 18.426  1.00 0.00  ? 17   DG  B H8     1  
ATOM   3900   H  H1     . DG  B 2 17  ? 25.109  -4.297  18.141  1.00 0.00  ? 17   DG  B H1     1  
ATOM   3901   H  H21    . DG  B 2 17  ? 23.401  -4.546  21.141  1.00 0.00  ? 17   DG  B H21    1  
ATOM   3902   H  H22    . DG  B 2 17  ? 24.044  -3.501  19.893  1.00 0.00  ? 17   DG  B H22    1  
ATOM   3903   P  P      . DC  B 2 18  ? 21.230  -11.777 22.373  1.00 0.00  ? 18   DC  B P      1  
ATOM   3904   O  OP1    . DC  B 2 18  ? 20.525  -12.045 23.652  1.00 0.00  ? 18   DC  B OP1    1  
ATOM   3905   O  OP2    . DC  B 2 18  ? 21.100  -12.739 21.248  1.00 0.00  ? 18   DC  B OP2    1  
ATOM   3906   O  "O5'"  . DC  B 2 18  ? 20.791  -10.338 21.849  1.00 0.00  ? 18   DC  B "O5'"  1  
ATOM   3907   C  "C5'"  . DC  B 2 18  ? 20.919  -9.186  22.682  1.00 0.00  ? 18   DC  B "C5'"  1  
ATOM   3908   C  "C4'"  . DC  B 2 18  ? 20.269  -7.991  22.026  1.00 0.00  ? 18   DC  B "C4'"  1  
ATOM   3909   O  "O4'"  . DC  B 2 18  ? 21.134  -7.500  20.970  1.00 0.00  ? 18   DC  B "O4'"  1  
ATOM   3910   C  "C3'"  . DC  B 2 18  ? 18.921  -8.271  21.358  1.00 0.00  ? 18   DC  B "C3'"  1  
ATOM   3911   O  "O3'"  . DC  B 2 18  ? 18.041  -7.161  21.559  1.00 0.00  ? 18   DC  B "O3'"  1  
ATOM   3912   C  "C2'"  . DC  B 2 18  ? 19.284  -8.399  19.890  1.00 0.00  ? 18   DC  B "C2'"  1  
ATOM   3913   C  "C1'"  . DC  B 2 18  ? 20.376  -7.362  19.782  1.00 0.00  ? 18   DC  B "C1'"  1  
ATOM   3914   N  N1     . DC  B 2 18  ? 21.282  -7.517  18.636  1.00 0.00  ? 18   DC  B N1     1  
ATOM   3915   C  C2     . DC  B 2 18  ? 21.626  -6.381  17.902  1.00 0.00  ? 18   DC  B C2     1  
ATOM   3916   O  O2     . DC  B 2 18  ? 21.162  -5.284  18.245  1.00 0.00  ? 18   DC  B O2     1  
ATOM   3917   N  N3     . DC  B 2 18  ? 22.453  -6.504  16.840  1.00 0.00  ? 18   DC  B N3     1  
ATOM   3918   C  C4     . DC  B 2 18  ? 22.932  -7.704  16.505  1.00 0.00  ? 18   DC  B C4     1  
ATOM   3919   N  N4     . DC  B 2 18  ? 23.744  -7.777  15.449  1.00 0.00  ? 18   DC  B N4     1  
ATOM   3920   C  C5     . DC  B 2 18  ? 22.600  -8.882  17.238  1.00 0.00  ? 18   DC  B C5     1  
ATOM   3921   C  C6     . DC  B 2 18  ? 21.778  -8.742  18.288  1.00 0.00  ? 18   DC  B C6     1  
ATOM   3922   H  "H5'"  . DC  B 2 18  ? 21.974  -8.970  22.849  1.00 0.00  ? 18   DC  B "H5'"  1  
ATOM   3923   H  "H5''" . DC  B 2 18  ? 20.436  -9.372  23.641  1.00 0.00  ? 18   DC  B "H5''" 1  
ATOM   3924   H  "H4'"  . DC  B 2 18  ? 20.082  -7.251  22.806  1.00 0.00  ? 18   DC  B "H4'"  1  
ATOM   3925   H  "H3'"  . DC  B 2 18  ? 18.460  -9.176  21.752  1.00 0.00  ? 18   DC  B "H3'"  1  
ATOM   3926   H  "H2'"  . DC  B 2 18  ? 19.637  -9.401  19.649  1.00 0.00  ? 18   DC  B "H2'"  1  
ATOM   3927   H  "H2''" . DC  B 2 18  ? 18.434  -8.180  19.244  1.00 0.00  ? 18   DC  B "H2''" 1  
ATOM   3928   H  "H1'"  . DC  B 2 18  ? 19.958  -6.356  19.765  1.00 0.00  ? 18   DC  B "H1'"  1  
ATOM   3929   H  H41    . DC  B 2 18  ? 24.128  -8.666  15.163  1.00 0.00  ? 18   DC  B H41    1  
ATOM   3930   H  H42    . DC  B 2 18  ? 23.972  -6.936  14.937  1.00 0.00  ? 18   DC  B H42    1  
ATOM   3931   H  H5     . DC  B 2 18  ? 22.999  -9.855  16.955  1.00 0.00  ? 18   DC  B H5     1  
ATOM   3932   H  H6     . DC  B 2 18  ? 21.502  -9.621  18.871  1.00 0.00  ? 18   DC  B H6     1  
ATOM   3933   P  P      . DC  B 2 19  ? 16.472  -7.415  21.782  1.00 0.00  ? 19   DC  B P      1  
ATOM   3934   O  OP1    . DC  B 2 19  ? 16.289  -7.860  23.187  1.00 0.00  ? 19   DC  B OP1    1  
ATOM   3935   O  OP2    . DC  B 2 19  ? 15.968  -8.262  20.672  1.00 0.00  ? 19   DC  B OP2    1  
ATOM   3936   O  "O5'"  . DC  B 2 19  ? 15.837  -5.962  21.636  1.00 0.00  ? 19   DC  B "O5'"  1  
ATOM   3937   C  "C5'"  . DC  B 2 19  ? 16.469  -4.825  22.225  1.00 0.00  ? 19   DC  B "C5'"  1  
ATOM   3938   C  "C4'"  . DC  B 2 19  ? 16.442  -3.657  21.268  1.00 0.00  ? 19   DC  B "C4'"  1  
ATOM   3939   O  "O4'"  . DC  B 2 19  ? 17.333  -3.935  20.160  1.00 0.00  ? 19   DC  B "O4'"  1  
ATOM   3940   C  "C3'"  . DC  B 2 19  ? 15.076  -3.363  20.646  1.00 0.00  ? 19   DC  B "C3'"  1  
ATOM   3941   O  "O3'"  . DC  B 2 19  ? 14.876  -1.950  20.560  1.00 0.00  ? 19   DC  B "O3'"  1  
ATOM   3942   C  "C2'"  . DC  B 2 19  ? 15.176  -3.983  19.262  1.00 0.00  ? 19   DC  B "C2'"  1  
ATOM   3943   C  "C1'"  . DC  B 2 19  ? 16.640  -3.777  18.935  1.00 0.00  ? 19   DC  B "C1'"  1  
ATOM   3944   N  N1     . DC  B 2 19  ? 17.204  -4.735  17.974  1.00 0.00  ? 19   DC  B N1     1  
ATOM   3945   C  C2     . DC  B 2 19  ? 17.943  -4.246  16.894  1.00 0.00  ? 19   DC  B C2     1  
ATOM   3946   O  O2     . DC  B 2 19  ? 18.085  -3.021  16.772  1.00 0.00  ? 19   DC  B O2     1  
ATOM   3947   N  N3     . DC  B 2 19  ? 18.482  -5.119  16.014  1.00 0.00  ? 19   DC  B N3     1  
ATOM   3948   C  C4     . DC  B 2 19  ? 18.307  -6.432  16.184  1.00 0.00  ? 19   DC  B C4     1  
ATOM   3949   N  N4     . DC  B 2 19  ? 18.862  -7.257  15.295  1.00 0.00  ? 19   DC  B N4     1  
ATOM   3950   C  C5     . DC  B 2 19  ? 17.554  -6.958  17.275  1.00 0.00  ? 19   DC  B C5     1  
ATOM   3951   C  C6     . DC  B 2 19  ? 17.020  -6.080  18.134  1.00 0.00  ? 19   DC  B C6     1  
ATOM   3952   H  "H5'"  . DC  B 2 19  ? 17.504  -5.065  22.466  1.00 0.00  ? 19   DC  B "H5'"  1  
ATOM   3953   H  "H5''" . DC  B 2 19  ? 15.944  -4.549  23.140  1.00 0.00  ? 19   DC  B "H5''" 1  
ATOM   3954   H  "H4'"  . DC  B 2 19  ? 16.725  -2.766  21.831  1.00 0.00  ? 19   DC  B "H4'"  1  
ATOM   3955   H  "H3'"  . DC  B 2 19  ? 14.272  -3.805  21.234  1.00 0.00  ? 19   DC  B "H3'"  1  
ATOM   3956   H  "H2'"  . DC  B 2 19  ? 14.899  -5.037  19.278  1.00 0.00  ? 19   DC  B "H2'"  1  
ATOM   3957   H  "H2''" . DC  B 2 19  ? 14.518  -3.481  18.552  1.00 0.00  ? 19   DC  B "H2''" 1  
ATOM   3958   H  "H1'"  . DC  B 2 19  ? 16.823  -2.766  18.569  1.00 0.00  ? 19   DC  B "H1'"  1  
ATOM   3959   H  H41    . DC  B 2 19  ? 18.750  -8.256  15.395  1.00 0.00  ? 19   DC  B H41    1  
ATOM   3960   H  H42    . DC  B 2 19  ? 19.389  -6.881  14.520  1.00 0.00  ? 19   DC  B H42    1  
ATOM   3961   H  H5     . DC  B 2 19  ? 17.424  -8.031  17.408  1.00 0.00  ? 19   DC  B H5     1  
ATOM   3962   H  H6     . DC  B 2 19  ? 16.424  -6.445  18.969  1.00 0.00  ? 19   DC  B H6     1  
ATOM   3963   P  P      . DA  B 2 20  ? 13.422  -1.368  20.206  1.00 0.00  ? 20   DA  B P      1  
ATOM   3964   O  OP1    . DA  B 2 20  ? 13.230  -0.145  21.026  1.00 0.00  ? 20   DA  B OP1    1  
ATOM   3965   O  OP2    . DA  B 2 20  ? 12.435  -2.474  20.294  1.00 0.00  ? 20   DA  B OP2    1  
ATOM   3966   O  "O5'"  . DA  B 2 20  ? 13.550  -0.926  18.681  1.00 0.00  ? 20   DA  B "O5'"  1  
ATOM   3967   C  "C5'"  . DA  B 2 20  ? 14.609  -0.072  18.254  1.00 0.00  ? 20   DA  B "C5'"  1  
ATOM   3968   C  "C4'"  . DA  B 2 20  ? 14.802  -0.187  16.760  1.00 0.00  ? 20   DA  B "C4'"  1  
ATOM   3969   O  "O4'"  . DA  B 2 20  ? 15.454  -1.440  16.464  1.00 0.00  ? 20   DA  B "O4'"  1  
ATOM   3970   C  "C3'"  . DA  B 2 20  ? 13.510  -0.183  15.934  1.00 0.00  ? 20   DA  B "C3'"  1  
ATOM   3971   O  "O3'"  . DA  B 2 20  ? 13.452  0.999   15.131  1.00 0.00  ? 20   DA  B "O3'"  1  
ATOM   3972   C  "C2'"  . DA  B 2 20  ? 13.611  -1.421  15.050  1.00 0.00  ? 20   DA  B "C2'"  1  
ATOM   3973   C  "C1'"  . DA  B 2 20  ? 15.072  -1.812  15.162  1.00 0.00  ? 20   DA  B "C1'"  1  
ATOM   3974   N  N9     . DA  B 2 20  ? 15.353  -3.238  14.996  1.00 0.00  ? 20   DA  B N9     1  
ATOM   3975   C  C8     . DA  B 2 20  ? 14.838  -4.296  15.705  1.00 0.00  ? 20   DA  B C8     1  
ATOM   3976   N  N7     . DA  B 2 20  ? 15.289  -5.463  15.315  1.00 0.00  ? 20   DA  B N7     1  
ATOM   3977   C  C5     . DA  B 2 20  ? 16.160  -5.154  14.279  1.00 0.00  ? 20   DA  B C5     1  
ATOM   3978   C  C6     . DA  B 2 20  ? 16.963  -5.954  13.445  1.00 0.00  ? 20   DA  B C6     1  
ATOM   3979   N  N6     . DA  B 2 20  ? 17.018  -7.285  13.524  1.00 0.00  ? 20   DA  B N6     1  
ATOM   3980   N  N1     . DA  B 2 20  ? 17.716  -5.331  12.513  1.00 0.00  ? 20   DA  B N1     1  
ATOM   3981   C  C2     . DA  B 2 20  ? 17.661  -3.995  12.430  1.00 0.00  ? 20   DA  B C2     1  
ATOM   3982   N  N3     . DA  B 2 20  ? 16.946  -3.136  13.155  1.00 0.00  ? 20   DA  B N3     1  
ATOM   3983   C  C4     . DA  B 2 20  ? 16.209  -3.787  14.073  1.00 0.00  ? 20   DA  B C4     1  
ATOM   3984   H  "H5'"  . DA  B 2 20  ? 15.533  -0.355  18.757  1.00 0.00  ? 20   DA  B "H5'"  1  
ATOM   3985   H  "H5''" . DA  B 2 20  ? 14.368  0.962   18.505  1.00 0.00  ? 20   DA  B "H5''" 1  
ATOM   3986   H  "H4'"  . DA  B 2 20  ? 15.380  0.682   16.439  1.00 0.00  ? 20   DA  B "H4'"  1  
ATOM   3987   H  "H3'"  . DA  B 2 20  ? 12.633  -0.217  16.579  1.00 0.00  ? 20   DA  B "H3'"  1  
ATOM   3988   H  "H2'"  . DA  B 2 20  ? 12.945  -2.210  15.403  1.00 0.00  ? 20   DA  B "H2'"  1  
ATOM   3989   H  "H2''" . DA  B 2 20  ? 13.326  -1.195  14.022  1.00 0.00  ? 20   DA  B "H2''" 1  
ATOM   3990   H  "H1'"  . DA  B 2 20  ? 15.686  -1.248  14.456  1.00 0.00  ? 20   DA  B "H1'"  1  
ATOM   3991   H  H8     . DA  B 2 20  ? 14.129  -4.176  16.512  1.00 0.00  ? 20   DA  B H8     1  
ATOM   3992   H  H61    . DA  B 2 20  ? 17.619  -7.802  12.898  1.00 0.00  ? 20   DA  B H61    1  
ATOM   3993   H  H62    . DA  B 2 20  ? 16.464  -7.776  14.211  1.00 0.00  ? 20   DA  B H62    1  
ATOM   3994   H  H2     . DA  B 2 20  ? 18.290  -3.547  11.662  1.00 0.00  ? 20   DA  B H2     1  
ATOM   3995   P  P      . DG  B 2 21  ? 12.231  1.210   14.108  1.00 0.00  ? 21   DG  B P      1  
ATOM   3996   O  OP1    . DG  B 2 21  ? 12.018  2.674   13.972  1.00 0.00  ? 21   DG  B OP1    1  
ATOM   3997   O  OP2    . DG  B 2 21  ? 11.104  0.340   14.531  1.00 0.00  ? 21   DG  B OP2    1  
ATOM   3998   O  "O5'"  . DG  B 2 21  ? 12.793  0.669   12.720  1.00 0.00  ? 21   DG  B "O5'"  1  
ATOM   3999   C  "C5'"  . DG  B 2 21  ? 13.772  1.408   11.990  1.00 0.00  ? 21   DG  B "C5'"  1  
ATOM   4000   C  "C4'"  . DG  B 2 21  ? 14.095  0.702   10.694  1.00 0.00  ? 21   DG  B "C4'"  1  
ATOM   4001   O  "O4'"  . DG  B 2 21  ? 14.569  -0.627  10.998  1.00 0.00  ? 21   DG  B "O4'"  1  
ATOM   4002   C  "C3'"  . DG  B 2 21  ? 12.902  0.526   9.748   1.00 0.00  ? 21   DG  B "C3'"  1  
ATOM   4003   O  "O3'"  . DG  B 2 21  ? 13.124  1.252   8.536   1.00 0.00  ? 21   DG  B "O3'"  1  
ATOM   4004   C  "C2'"  . DG  B 2 21  ? 12.842  -0.969  9.462   1.00 0.00  ? 21   DG  B "C2'"  1  
ATOM   4005   C  "C1'"  . DG  B 2 21  ? 14.182  -1.490  9.954   1.00 0.00  ? 21   DG  B "C1'"  1  
ATOM   4006   N  N9     . DG  B 2 21  ? 14.145  -2.848  10.486  1.00 0.00  ? 21   DG  B N9     1  
ATOM   4007   C  C8     . DG  B 2 21  ? 13.464  -3.285  11.596  1.00 0.00  ? 21   DG  B C8     1  
ATOM   4008   N  N7     . DG  B 2 21  ? 13.618  -4.559  11.827  1.00 0.00  ? 21   DG  B N7     1  
ATOM   4009   C  C5     . DG  B 2 21  ? 14.455  -4.992  10.808  1.00 0.00  ? 21   DG  B C5     1  
ATOM   4010   C  C6     . DG  B 2 21  ? 14.976  -6.283  10.532  1.00 0.00  ? 21   DG  B C6     1  
ATOM   4011   O  O6     . DG  B 2 21  ? 14.796  -7.336  11.156  1.00 0.00  ? 21   DG  B O6     1  
ATOM   4012   N  N1     . DG  B 2 21  ? 15.783  -6.279  9.398   1.00 0.00  ? 21   DG  B N1     1  
ATOM   4013   C  C2     . DG  B 2 21  ? 16.055  -5.174  8.628   1.00 0.00  ? 21   DG  B C2     1  
ATOM   4014   N  N2     . DG  B 2 21  ? 16.858  -5.372  7.574   1.00 0.00  ? 21   DG  B N2     1  
ATOM   4015   N  N3     . DG  B 2 21  ? 15.576  -3.965  8.874   1.00 0.00  ? 21   DG  B N3     1  
ATOM   4016   C  C4     . DG  B 2 21  ? 14.789  -3.947  9.971   1.00 0.00  ? 21   DG  B C4     1  
ATOM   4017   H  "H5'"  . DG  B 2 21  ? 14.681  1.499   12.585  1.00 0.00  ? 21   DG  B "H5'"  1  
ATOM   4018   H  "H5''" . DG  B 2 21  ? 13.388  2.404   11.769  1.00 0.00  ? 21   DG  B "H5''" 1  
ATOM   4019   H  "H4'"  . DG  B 2 21  ? 14.830  1.310   10.164  1.00 0.00  ? 21   DG  B "H4'"  1  
ATOM   4020   H  "H3'"  . DG  B 2 21  ? 11.984  0.884   10.210  1.00 0.00  ? 21   DG  B "H3'"  1  
ATOM   4021   H  "H2'"  . DG  B 2 21  ? 12.004  -1.432  9.986   1.00 0.00  ? 21   DG  B "H2'"  1  
ATOM   4022   H  "H2''" . DG  B 2 21  ? 12.699  -1.159  8.399   1.00 0.00  ? 21   DG  B "H2''" 1  
ATOM   4023   H  "H1'"  . DG  B 2 21  ? 14.940  -1.438  9.170   1.00 0.00  ? 21   DG  B "H1'"  1  
ATOM   4024   H  H8     . DG  B 2 21  ? 12.860  -2.637  12.216  1.00 0.00  ? 21   DG  B H8     1  
ATOM   4025   H  H1     . DG  B 2 21  ? 16.201  -7.155  9.122   1.00 0.00  ? 21   DG  B H1     1  
ATOM   4026   H  H21    . DG  B 2 21  ? 17.096  -4.599  6.969   1.00 0.00  ? 21   DG  B H21    1  
ATOM   4027   H  H22    . DG  B 2 21  ? 17.223  -6.294  7.383   1.00 0.00  ? 21   DG  B H22    1  
ATOM   4028   P  P      . DC  B 2 22  ? 11.996  1.252   7.392   1.00 0.00  ? 22   DC  B P      1  
ATOM   4029   O  OP1    . DC  B 2 22  ? 12.298  2.348   6.437   1.00 0.00  ? 22   DC  B OP1    1  
ATOM   4030   O  OP2    . DC  B 2 22  ? 10.675  1.211   8.069   1.00 0.00  ? 22   DC  B OP2    1  
ATOM   4031   O  "O5'"  . DC  B 2 22  ? 12.214  -0.135  6.640   1.00 0.00  ? 22   DC  B "O5'"  1  
ATOM   4032   C  "C5'"  . DC  B 2 22  ? 13.446  -0.419  5.979   1.00 0.00  ? 22   DC  B "C5'"  1  
ATOM   4033   C  "C4'"  . DC  B 2 22  ? 13.405  -1.798  5.364   1.00 0.00  ? 22   DC  B "C4'"  1  
ATOM   4034   O  "O4'"  . DC  B 2 22  ? 13.425  -2.783  6.419   1.00 0.00  ? 22   DC  B "O4'"  1  
ATOM   4035   C  "C3'"  . DC  B 2 22  ? 12.153  -2.095  4.530   1.00 0.00  ? 22   DC  B "C3'"  1  
ATOM   4036   O  "O3'"  . DC  B 2 22  ? 12.522  -2.367  3.176   1.00 0.00  ? 22   DC  B "O3'"  1  
ATOM   4037   C  "C2'"  . DC  B 2 22  ? 11.541  -3.332  5.171   1.00 0.00  ? 22   DC  B "C2'"  1  
ATOM   4038   C  "C1'"  . DC  B 2 22  ? 12.684  -3.900  5.987   1.00 0.00  ? 22   DC  B "C1'"  1  
ATOM   4039   N  N1     . DC  B 2 22  ? 12.275  -4.663  7.173   1.00 0.00  ? 22   DC  B N1     1  
ATOM   4040   C  C2     . DC  B 2 22  ? 12.607  -6.017  7.246   1.00 0.00  ? 22   DC  B C2     1  
ATOM   4041   O  O2     . DC  B 2 22  ? 13.239  -6.528  6.310   1.00 0.00  ? 22   DC  B O2     1  
ATOM   4042   N  N3     . DC  B 2 22  ? 12.231  -6.732  8.330   1.00 0.00  ? 22   DC  B N3     1  
ATOM   4043   C  C4     . DC  B 2 22  ? 11.551  -6.142  9.315   1.00 0.00  ? 22   DC  B C4     1  
ATOM   4044   N  N4     . DC  B 2 22  ? 11.198  -6.888  10.363  1.00 0.00  ? 22   DC  B N4     1  
ATOM   4045   C  C5     . DC  B 2 22  ? 11.201  -4.761  9.269   1.00 0.00  ? 22   DC  B C5     1  
ATOM   4046   C  C6     . DC  B 2 22  ? 11.581  -4.066  8.189   1.00 0.00  ? 22   DC  B C6     1  
ATOM   4047   H  "H5'"  . DC  B 2 22  ? 14.265  -0.372  6.697   1.00 0.00  ? 22   DC  B "H5'"  1  
ATOM   4048   H  "H5''" . DC  B 2 22  ? 13.617  0.317   5.194   1.00 0.00  ? 22   DC  B "H5''" 1  
ATOM   4049   H  "H4'"  . DC  B 2 22  ? 14.257  -1.878  4.686   1.00 0.00  ? 22   DC  B "H4'"  1  
ATOM   4050   H  "H3'"  . DC  B 2 22  ? 11.466  -1.251  4.545   1.00 0.00  ? 22   DC  B "H3'"  1  
ATOM   4051   H  "H2'"  . DC  B 2 22  ? 10.683  -3.068  5.791   1.00 0.00  ? 22   DC  B "H2'"  1  
ATOM   4052   H  "H2''" . DC  B 2 22  ? 11.189  -4.035  4.415   1.00 0.00  ? 22   DC  B "H2''" 1  
ATOM   4053   H  "H1'"  . DC  B 2 22  ? 13.337  -4.525  5.374   1.00 0.00  ? 22   DC  B "H1'"  1  
ATOM   4054   H  H41    . DC  B 2 22  ? 10.682  -6.474  11.126  1.00 0.00  ? 22   DC  B H41    1  
ATOM   4055   H  H42    . DC  B 2 22  ? 11.449  -7.866  10.393  1.00 0.00  ? 22   DC  B H42    1  
ATOM   4056   H  H5     . DC  B 2 22  ? 10.648  -4.289  10.081  1.00 0.00  ? 22   DC  B H5     1  
ATOM   4057   H  H6     . DC  B 2 22  ? 11.332  -3.006  8.121   1.00 0.00  ? 22   DC  B H6     1  
ATOM   4058   P  P      . DT  B 2 23  ? 12.178  -1.298  2.024   1.00 0.00  ? 23   DT  B P      1  
ATOM   4059   O  OP1    . DT  B 2 23  ? 13.363  -1.213  1.132   1.00 0.00  ? 23   DT  B OP1    1  
ATOM   4060   O  OP2    . DT  B 2 23  ? 11.662  -0.068  2.675   1.00 0.00  ? 23   DT  B OP2    1  
ATOM   4061   O  "O5'"  . DT  B 2 23  ? 10.990  -1.973  1.203   1.00 0.00  ? 23   DT  B "O5'"  1  
ATOM   4062   C  "C5'"  . DT  B 2 23  ? 10.033  -1.173  0.502   1.00 0.00  ? 23   DT  B "C5'"  1  
ATOM   4063   C  "C4'"  . DT  B 2 23  ? 9.762   -1.757  -0.865  1.00 0.00  ? 23   DT  B "C4'"  1  
ATOM   4064   O  "O4'"  . DT  B 2 23  ? 10.230  -3.128  -0.890  1.00 0.00  ? 23   DT  B "O4'"  1  
ATOM   4065   C  "C3'"  . DT  B 2 23  ? 8.286   -1.818  -1.261  1.00 0.00  ? 23   DT  B "C3'"  1  
ATOM   4066   O  "O3'"  . DT  B 2 23  ? 8.134   -1.649  -2.677  1.00 0.00  ? 23   DT  B "O3'"  1  
ATOM   4067   C  "C2'"  . DT  B 2 23  ? 7.877   -3.218  -0.843  1.00 0.00  ? 23   DT  B "C2'"  1  
ATOM   4068   C  "C1'"  . DT  B 2 23  ? 9.142   -4.015  -1.110  1.00 0.00  ? 23   DT  B "C1'"  1  
ATOM   4069   N  N1     . DT  B 2 23  ? 9.326   -5.183  -0.230  1.00 0.00  ? 23   DT  B N1     1  
ATOM   4070   C  C2     . DT  B 2 23  ? 9.586   -6.402  -0.816  1.00 0.00  ? 23   DT  B C2     1  
ATOM   4071   O  O2     . DT  B 2 23  ? 9.671   -6.556  -2.023  1.00 0.00  ? 23   DT  B O2     1  
ATOM   4072   N  N3     . DT  B 2 23  ? 9.745   -7.439  0.069   1.00 0.00  ? 23   DT  B N3     1  
ATOM   4073   C  C4     . DT  B 2 23  ? 9.671   -7.377  1.447   1.00 0.00  ? 23   DT  B C4     1  
ATOM   4074   O  O4     . DT  B 2 23  ? 9.836   -8.395  2.114   1.00 0.00  ? 23   DT  B O4     1  
ATOM   4075   C  C5     . DT  B 2 23  ? 9.394   -6.067  1.994   1.00 0.00  ? 23   DT  B C5     1  
ATOM   4076   C  C7     . DT  B 2 23  ? 9.296   -5.908  3.478   1.00 0.00  ? 23   DT  B C7     1  
ATOM   4077   C  C6     . DT  B 2 23  ? 9.237   -5.043  1.141   1.00 0.00  ? 23   DT  B C6     1  
ATOM   4078   H  "H5'"  . DT  B 2 23  ? 10.417  -0.160  0.387   1.00 0.00  ? 23   DT  B "H5'"  1  
ATOM   4079   H  "H5''" . DT  B 2 23  ? 9.101   -1.139  1.067   1.00 0.00  ? 23   DT  B "H5''" 1  
ATOM   4080   H  "H4'"  . DT  B 2 23  ? 10.258  -1.121  -1.600  1.00 0.00  ? 23   DT  B "H4'"  1  
ATOM   4081   H  "H3'"  . DT  B 2 23  ? 7.708   -1.053  -0.744  1.00 0.00  ? 23   DT  B "H3'"  1  
ATOM   4082   H  "H2'"  . DT  B 2 23  ? 7.583   -3.248  0.206   1.00 0.00  ? 23   DT  B "H2'"  1  
ATOM   4083   H  "H2''" . DT  B 2 23  ? 7.032   -3.576  -1.431  1.00 0.00  ? 23   DT  B "H2''" 1  
ATOM   4084   H  "H1'"  . DT  B 2 23  ? 9.184   -4.350  -2.147  1.00 0.00  ? 23   DT  B "H1'"  1  
ATOM   4085   H  H3     . DT  B 2 23  ? 9.937   -8.346  -0.331  1.00 0.00  ? 23   DT  B H3     1  
ATOM   4086   H  H71    . DT  B 2 23  ? 8.348   -6.320  3.826   1.00 0.00  ? 23   DT  B H71    1  
ATOM   4087   H  H72    . DT  B 2 23  ? 10.119  -6.439  3.956   1.00 0.00  ? 23   DT  B H72    1  
ATOM   4088   H  H73    . DT  B 2 23  ? 9.348   -4.850  3.735   1.00 0.00  ? 23   DT  B H73    1  
ATOM   4089   H  H6     . DT  B 2 23  ? 9.028   -4.055  1.550   1.00 0.00  ? 23   DT  B H6     1  
ATOM   4090   P  P      . DC  B 2 24  ? 6.673   -1.380  -3.296  1.00 0.00  ? 24   DC  B P      1  
ATOM   4091   O  OP1    . DC  B 2 24  ? 6.245   -0.015  -2.898  1.00 0.00  ? 24   DC  B OP1    1  
ATOM   4092   O  OP2    . DC  B 2 24  ? 5.821   -2.545  -2.950  1.00 0.00  ? 24   DC  B OP2    1  
ATOM   4093   O  "O5'"  . DC  B 2 24  ? 6.906   -1.389  -4.873  1.00 0.00  ? 24   DC  B "O5'"  1  
ATOM   4094   C  "C5'"  . DC  B 2 24  ? 5.808   -1.528  -5.779  1.00 0.00  ? 24   DC  B "C5'"  1  
ATOM   4095   C  "C4'"  . DC  B 2 24  ? 5.735   -2.946  -6.294  1.00 0.00  ? 24   DC  B "C4'"  1  
ATOM   4096   O  "O4'"  . DC  B 2 24  ? 4.359   -3.386  -6.244  1.00 0.00  ? 24   DC  B "O4'"  1  
ATOM   4097   C  "C3'"  . DC  B 2 24  ? 6.159   -3.123  -7.748  1.00 0.00  ? 24   DC  B "C3'"  1  
ATOM   4098   O  "O3'"  . DC  B 2 24  ? 6.631   -4.452  -7.982  1.00 0.00  ? 24   DC  B "O3'"  1  
ATOM   4099   C  "C2'"  . DC  B 2 24  ? 4.869   -2.877  -8.507  1.00 0.00  ? 24   DC  B "C2'"  1  
ATOM   4100   C  "C1'"  . DC  B 2 24  ? 3.803   -3.406  -7.555  1.00 0.00  ? 24   DC  B "C1'"  1  
ATOM   4101   N  N1     . DC  B 2 24  ? 2.577   -2.597  -7.541  1.00 0.00  ? 24   DC  B N1     1  
ATOM   4102   C  C2     . DC  B 2 24  ? 1.366   -3.204  -7.882  1.00 0.00  ? 24   DC  B C2     1  
ATOM   4103   O  O2     . DC  B 2 24  ? 1.361   -4.408  -8.175  1.00 0.00  ? 24   DC  B O2     1  
ATOM   4104   N  N3     . DC  B 2 24  ? 0.234   -2.463  -7.882  1.00 0.00  ? 24   DC  B N3     1  
ATOM   4105   C  C4     . DC  B 2 24  ? 0.282   -1.170  -7.552  1.00 0.00  ? 24   DC  B C4     1  
ATOM   4106   N  N4     . DC  B 2 24  ? -0.862  -0.484  -7.549  1.00 0.00  ? 24   DC  B N4     1  
ATOM   4107   C  C5     . DC  B 2 24  ? 1.504   -0.525  -7.201  1.00 0.00  ? 24   DC  B C5     1  
ATOM   4108   C  C6     . DC  B 2 24  ? 2.616   -1.271  -7.207  1.00 0.00  ? 24   DC  B C6     1  
ATOM   4109   H  "H5'"  . DC  B 2 24  ? 5.940   -0.849  -6.622  1.00 0.00  ? 24   DC  B "H5'"  1  
ATOM   4110   H  "H5''" . DC  B 2 24  ? 4.877   -1.285  -5.267  1.00 0.00  ? 24   DC  B "H5''" 1  
ATOM   4111   H  "H4'"  . DC  B 2 24  ? 6.407   -3.557  -5.689  1.00 0.00  ? 24   DC  B "H4'"  1  
ATOM   4112   H  "H3'"  . DC  B 2 24  ? 6.936   -2.411  -8.022  1.00 0.00  ? 24   DC  B "H3'"  1  
ATOM   4113   H  "H2'"  . DC  B 2 24  ? 4.737   -1.817  -8.724  1.00 0.00  ? 24   DC  B "H2'"  1  
ATOM   4114   H  "H2''" . DC  B 2 24  ? 4.866   -3.406  -9.460  1.00 0.00  ? 24   DC  B "H2''" 1  
ATOM   4115   H  "H1'"  . DC  B 2 24  ? 3.538   -4.436  -7.796  1.00 0.00  ? 24   DC  B "H1'"  1  
ATOM   4116   H  H41    . DC  B 2 24  ? -0.864  0.494   -7.298  1.00 0.00  ? 24   DC  B H41    1  
ATOM   4117   H  H42    . DC  B 2 24  ? -1.727  -0.943  -7.799  1.00 0.00  ? 24   DC  B H42    1  
ATOM   4118   H  H5     . DC  B 2 24  ? 1.532   0.532   -6.937  1.00 0.00  ? 24   DC  B H5     1  
ATOM   4119   H  H6     . DC  B 2 24  ? 3.568   -0.812  -6.941  1.00 0.00  ? 24   DC  B H6     1  
ATOM   4120   P  P      . DG  B 2 25  ? 7.182   -4.856  -9.437  1.00 0.00  ? 25   DG  B P      1  
ATOM   4121   O  OP1    . DG  B 2 25  ? 8.289   -5.826  -9.240  1.00 0.00  ? 25   DG  B OP1    1  
ATOM   4122   O  OP2    . DG  B 2 25  ? 7.429   -3.606  -10.201 1.00 0.00  ? 25   DG  B OP2    1  
ATOM   4123   O  "O5'"  . DG  B 2 25  ? 5.963   -5.625  -10.115 1.00 0.00  ? 25   DG  B "O5'"  1  
ATOM   4124   C  "C5'"  . DG  B 2 25  ? 5.719   -7.002  -9.833  1.00 0.00  ? 25   DG  B "C5'"  1  
ATOM   4125   C  "C4'"  . DG  B 2 25  ? 4.927   -7.633  -10.954 1.00 0.00  ? 25   DG  B "C4'"  1  
ATOM   4126   O  "O4'"  . DG  B 2 25  ? 3.613   -7.028  -11.004 1.00 0.00  ? 25   DG  B "O4'"  1  
ATOM   4127   C  "C3'"  . DG  B 2 25  ? 5.524   -7.450  -12.347 1.00 0.00  ? 25   DG  B "C3'"  1  
ATOM   4128   O  "O3'"  . DG  B 2 25  ? 5.272   -8.611  -13.143 1.00 0.00  ? 25   DG  B "O3'"  1  
ATOM   4129   C  "C2'"  . DG  B 2 25  ? 4.785   -6.242  -12.894 1.00 0.00  ? 25   DG  B "C2'"  1  
ATOM   4130   C  "C1'"  . DG  B 2 25  ? 3.417   -6.363  -12.243 1.00 0.00  ? 25   DG  B "C1'"  1  
ATOM   4131   N  N9     . DG  B 2 25  ? 2.769   -5.086  -11.962 1.00 0.00  ? 25   DG  B N9     1  
ATOM   4132   C  C8     . DG  B 2 25  ? 3.377   -3.918  -11.570 1.00 0.00  ? 25   DG  B C8     1  
ATOM   4133   N  N7     . DG  B 2 25  ? 2.537   -2.938  -11.382 1.00 0.00  ? 25   DG  B N7     1  
ATOM   4134   C  C5     . DG  B 2 25  ? 1.297   -3.491  -11.670 1.00 0.00  ? 25   DG  B C5     1  
ATOM   4135   C  C6     . DG  B 2 25  ? 0.003   -2.910  -11.643 1.00 0.00  ? 25   DG  B C6     1  
ATOM   4136   O  O6     . DG  B 2 25  ? -0.315  -1.752  -11.350 1.00 0.00  ? 25   DG  B O6     1  
ATOM   4137   N  N1     . DG  B 2 25  ? -0.979  -3.827  -12.006 1.00 0.00  ? 25   DG  B N1     1  
ATOM   4138   C  C2     . DG  B 2 25  ? -0.746  -5.136  -12.354 1.00 0.00  ? 25   DG  B C2     1  
ATOM   4139   N  N2     . DG  B 2 25  ? -1.824  -5.863  -12.676 1.00 0.00  ? 25   DG  B N2     1  
ATOM   4140   N  N3     . DG  B 2 25  ? 0.456   -5.690  -12.384 1.00 0.00  ? 25   DG  B N3     1  
ATOM   4141   C  C4     . DG  B 2 25  ? 1.424   -4.816  -12.033 1.00 0.00  ? 25   DG  B C4     1  
ATOM   4142   H  "H5'"  . DG  B 2 25  ? 5.157   -7.092  -8.904  1.00 0.00  ? 25   DG  B "H5'"  1  
ATOM   4143   H  "H5''" . DG  B 2 25  ? 6.669   -7.528  -9.729  1.00 0.00  ? 25   DG  B "H5''" 1  
ATOM   4144   H  "H4'"  . DG  B 2 25  ? 4.896   -8.708  -10.768 1.00 0.00  ? 25   DG  B "H4'"  1  
ATOM   4145   H  "H3'"  . DG  B 2 25  ? 6.599   -7.278  -12.294 1.00 0.00  ? 25   DG  B "H3'"  1  
ATOM   4146   H  "H2'"  . DG  B 2 25  ? 5.290   -5.314  -12.622 1.00 0.00  ? 25   DG  B "H2'"  1  
ATOM   4147   H  "H2''" . DG  B 2 25  ? 4.726   -6.273  -13.982 1.00 0.00  ? 25   DG  B "H2''" 1  
ATOM   4148   H  "H1'"  . DG  B 2 25  ? 2.744   -6.970  -12.851 1.00 0.00  ? 25   DG  B "H1'"  1  
ATOM   4149   H  H8     . DG  B 2 25  ? 4.443   -3.821  -11.429 1.00 0.00  ? 25   DG  B H8     1  
ATOM   4150   H  H1     . DG  B 2 25  ? -1.936  -3.506  -12.014 1.00 0.00  ? 25   DG  B H1     1  
ATOM   4151   H  H21    . DG  B 2 25  ? -1.719  -6.832  -12.941 1.00 0.00  ? 25   DG  B H21    1  
ATOM   4152   H  H22    . DG  B 2 25  ? -2.743  -5.444  -12.650 1.00 0.00  ? 25   DG  B H22    1  
ATOM   4153   P  P      . DC  B 2 26  ? 5.445   -8.536  -14.739 1.00 0.00  ? 26   DC  B P      1  
ATOM   4154   O  OP1    . DC  B 2 26  ? 5.748   -9.911  -15.213 1.00 0.00  ? 26   DC  B OP1    1  
ATOM   4155   O  OP2    . DC  B 2 26  ? 6.377   -7.427  -15.060 1.00 0.00  ? 26   DC  B OP2    1  
ATOM   4156   O  "O5'"  . DC  B 2 26  ? 3.994   -8.138  -15.260 1.00 0.00  ? 26   DC  B "O5'"  1  
ATOM   4157   C  "C5'"  . DC  B 2 26  ? 2.870   -8.980  -15.007 1.00 0.00  ? 26   DC  B "C5'"  1  
ATOM   4158   C  "C4'"  . DC  B 2 26  ? 1.660   -8.474  -15.755 1.00 0.00  ? 26   DC  B "C4'"  1  
ATOM   4159   O  "O4'"  . DC  B 2 26  ? 1.184   -7.258  -15.126 1.00 0.00  ? 26   DC  B "O4'"  1  
ATOM   4160   C  "C3'"  . DC  B 2 26  ? 1.912   -8.118  -17.223 1.00 0.00  ? 26   DC  B "C3'"  1  
ATOM   4161   O  "O3'"  . DC  B 2 26  ? 0.852   -8.639  -18.024 1.00 0.00  ? 26   DC  B "O3'"  1  
ATOM   4162   C  "C2'"  . DC  B 2 26  ? 1.897   -6.599  -17.236 1.00 0.00  ? 26   DC  B "C2'"  1  
ATOM   4163   C  "C1'"  . DC  B 2 26  ? 0.914   -6.299  -16.129 1.00 0.00  ? 26   DC  B "C1'"  1  
ATOM   4164   N  N1     . DC  B 2 26  ? 1.026   -4.962  -15.526 1.00 0.00  ? 26   DC  B N1     1  
ATOM   4165   C  C2     . DC  B 2 26  ? -0.106  -4.145  -15.506 1.00 0.00  ? 26   DC  B C2     1  
ATOM   4166   O  O2     . DC  B 2 26  ? -1.159  -4.569  -16.002 1.00 0.00  ? 26   DC  B O2     1  
ATOM   4167   N  N3     . DC  B 2 26  ? -0.026  -2.916  -14.948 1.00 0.00  ? 26   DC  B N3     1  
ATOM   4168   C  C4     . DC  B 2 26  ? 1.128   -2.495  -14.424 1.00 0.00  ? 26   DC  B C4     1  
ATOM   4169   N  N4     . DC  B 2 26  ? 1.157   -1.278  -13.877 1.00 0.00  ? 26   DC  B N4     1  
ATOM   4170   C  C5     . DC  B 2 26  ? 2.302   -3.306  -14.434 1.00 0.00  ? 26   DC  B C5     1  
ATOM   4171   C  C6     . DC  B 2 26  ? 2.206   -4.522  -14.992 1.00 0.00  ? 26   DC  B C6     1  
ATOM   4172   H  "H5'"  . DC  B 2 26  ? 2.651   -8.990  -13.940 1.00 0.00  ? 26   DC  B "H5'"  1  
ATOM   4173   H  "H5''" . DC  B 2 26  ? 3.093   -9.995  -15.335 1.00 0.00  ? 26   DC  B "H5''" 1  
ATOM   4174   H  "H4'"  . DC  B 2 26  ? 0.919   -9.275  -15.755 1.00 0.00  ? 26   DC  B "H4'"  1  
ATOM   4175   H  "H3'"  . DC  B 2 26  ? 2.861   -8.523  -17.573 1.00 0.00  ? 26   DC  B "H3'"  1  
ATOM   4176   H  "H2'"  . DC  B 2 26  ? 2.887   -6.188  -17.036 1.00 0.00  ? 26   DC  B "H2'"  1  
ATOM   4177   H  "H2''" . DC  B 2 26  ? 1.568   -6.211  -18.200 1.00 0.00  ? 26   DC  B "H2''" 1  
ATOM   4178   H  "H1'"  . DC  B 2 26  ? -0.113  -6.444  -16.467 1.00 0.00  ? 26   DC  B "H1'"  1  
ATOM   4179   H  H41    . DC  B 2 26  ? 2.010   -0.926  -13.469 1.00 0.00  ? 26   DC  B H41    1  
ATOM   4180   H  H42    . DC  B 2 26  ? 0.322   -0.709  -13.874 1.00 0.00  ? 26   DC  B H42    1  
ATOM   4181   H  H5     . DC  B 2 26  ? 3.238   -2.952  -14.005 1.00 0.00  ? 26   DC  B H5     1  
ATOM   4182   H  H6     . DC  B 2 26  ? 3.084   -5.167  -15.021 1.00 0.00  ? 26   DC  B H6     1  
ATOM   4183   P  P      . DG  B 2 27  ? 1.110   -8.983  -19.570 1.00 0.00  ? 27   DG  B P      1  
ATOM   4184   O  OP1    . DG  B 2 27  ? 1.637   -10.369 -19.654 1.00 0.00  ? 27   DG  B OP1    1  
ATOM   4185   O  OP2    . DG  B 2 27  ? 1.887   -7.865  -20.162 1.00 0.00  ? 27   DG  B OP2    1  
ATOM   4186   O  "O5'"  . DG  B 2 27  ? -0.355  -8.958  -20.190 1.00 0.00  ? 27   DG  B "O5'"  1  
ATOM   4187   C  "C5'"  . DG  B 2 27  ? -1.491  -8.733  -19.354 1.00 0.00  ? 27   DG  B "C5'"  1  
ATOM   4188   C  "C4'"  . DG  B 2 27  ? -2.162  -7.432  -19.723 1.00 0.00  ? 27   DG  B "C4'"  1  
ATOM   4189   O  "O4'"  . DG  B 2 27  ? -1.443  -6.329  -19.133 1.00 0.00  ? 27   DG  B "O4'"  1  
ATOM   4190   C  "C3'"  . DG  B 2 27  ? -2.205  -7.135  -21.225 1.00 0.00  ? 27   DG  B "C3'"  1  
ATOM   4191   O  "O3'"  . DG  B 2 27  ? -3.537  -7.321  -21.711 1.00 0.00  ? 27   DG  B "O3'"  1  
ATOM   4192   C  "C2'"  . DG  B 2 27  ? -1.787  -5.673  -21.344 1.00 0.00  ? 27   DG  B "C2'"  1  
ATOM   4193   C  "C1'"  . DG  B 2 27  ? -1.739  -5.187  -19.903 1.00 0.00  ? 27   DG  B "C1'"  1  
ATOM   4194   N  N9     . DG  B 2 27  ? -0.731  -4.169  -19.616 1.00 0.00  ? 27   DG  B N9     1  
ATOM   4195   C  C8     . DG  B 2 27  ? 0.635   -4.295  -19.690 1.00 0.00  ? 27   DG  B C8     1  
ATOM   4196   N  N7     . DG  B 2 27  ? 1.272   -3.200  -19.371 1.00 0.00  ? 27   DG  B N7     1  
ATOM   4197   C  C5     . DG  B 2 27  ? 0.265   -2.295  -19.064 1.00 0.00  ? 27   DG  B C5     1  
ATOM   4198   C  C6     . DG  B 2 27  ? 0.339   -0.937  -18.646 1.00 0.00  ? 27   DG  B C6     1  
ATOM   4199   O  O6     . DG  B 2 27  ? 1.345   -0.241  -18.460 1.00 0.00  ? 27   DG  B O6     1  
ATOM   4200   N  N1     . DG  B 2 27  ? -0.926  -0.394  -18.442 1.00 0.00  ? 27   DG  B N1     1  
ATOM   4201   C  C2     . DG  B 2 27  ? -2.111  -1.066  -18.620 1.00 0.00  ? 27   DG  B C2     1  
ATOM   4202   N  N2     . DG  B 2 27  ? -3.229  -0.371  -18.374 1.00 0.00  ? 27   DG  B N2     1  
ATOM   4203   N  N3     . DG  B 2 27  ? -2.194  -2.329  -19.009 1.00 0.00  ? 27   DG  B N3     1  
ATOM   4204   C  C4     . DG  B 2 27  ? -0.978  -2.878  -19.211 1.00 0.00  ? 27   DG  B C4     1  
ATOM   4205   H  "H5'"  . DG  B 2 27  ? -1.175  -8.688  -18.311 1.00 0.00  ? 27   DG  B "H5'"  1  
ATOM   4206   H  "H5''" . DG  B 2 27  ? -2.203  -9.550  -19.476 1.00 0.00  ? 27   DG  B "H5''" 1  
ATOM   4207   H  "H4'"  . DG  B 2 27  ? -3.200  -7.495  -19.390 1.00 0.00  ? 27   DG  B "H4'"  1  
ATOM   4208   H  "H3'"  . DG  B 2 27  ? -1.533  -7.795  -21.773 1.00 0.00  ? 27   DG  B "H3'"  1  
ATOM   4209   H  "H2'"  . DG  B 2 27  ? -0.819  -5.584  -21.841 1.00 0.00  ? 27   DG  B "H2'"  1  
ATOM   4210   H  "H2''" . DG  B 2 27  ? -2.505  -5.109  -21.939 1.00 0.00  ? 27   DG  B "H2''" 1  
ATOM   4211   H  "H1'"  . DG  B 2 27  ? -2.714  -4.812  -19.586 1.00 0.00  ? 27   DG  B "H1'"  1  
ATOM   4212   H  H8     . DG  B 2 27  ? 1.134   -5.208  -19.982 1.00 0.00  ? 27   DG  B H8     1  
ATOM   4213   H  H1     . DG  B 2 27  ? -0.979  0.569   -18.140 1.00 0.00  ? 27   DG  B H1     1  
ATOM   4214   H  H21    . DG  B 2 27  ? -4.128  -0.816  -18.487 1.00 0.00  ? 27   DG  B H21    1  
ATOM   4215   H  H22    . DG  B 2 27  ? -3.174  0.593   -18.077 1.00 0.00  ? 27   DG  B H22    1  
ATOM   4216   P  P      . DG  B 2 28  ? -3.834  -7.208  -23.285 1.00 0.00  ? 28   DG  B P      1  
ATOM   4217   O  OP1    . DG  B 2 28  ? -5.087  -7.951  -23.578 1.00 0.00  ? 28   DG  B OP1    1  
ATOM   4218   O  OP2    . DG  B 2 28  ? -2.584  -7.567  -24.001 1.00 0.00  ? 28   DG  B OP2    1  
ATOM   4219   O  "O5'"  . DG  B 2 28  ? -4.104  -5.655  -23.514 1.00 0.00  ? 28   DG  B "O5'"  1  
ATOM   4220   C  "C5'"  . DG  B 2 28  ? -5.278  -5.028  -22.996 1.00 0.00  ? 28   DG  B "C5'"  1  
ATOM   4221   C  "C4'"  . DG  B 2 28  ? -5.304  -3.570  -23.391 1.00 0.00  ? 28   DG  B "C4'"  1  
ATOM   4222   O  "O4'"  . DG  B 2 28  ? -4.218  -2.882  -22.717 1.00 0.00  ? 28   DG  B "O4'"  1  
ATOM   4223   C  "C3'"  . DG  B 2 28  ? -5.086  -3.304  -24.883 1.00 0.00  ? 28   DG  B "C3'"  1  
ATOM   4224   O  "O3'"  . DG  B 2 28  ? -5.789  -2.128  -25.305 1.00 0.00  ? 28   DG  B "O3'"  1  
ATOM   4225   C  "C2'"  . DG  B 2 28  ? -3.595  -3.043  -24.952 1.00 0.00  ? 28   DG  B "C2'"  1  
ATOM   4226   C  "C1'"  . DG  B 2 28  ? -3.415  -2.234  -23.690 1.00 0.00  ? 28   DG  B "C1'"  1  
ATOM   4227   N  N9     . DG  B 2 28  ? -2.051  -2.148  -23.180 1.00 0.00  ? 28   DG  B N9     1  
ATOM   4228   C  C8     . DG  B 2 28  ? -1.087  -3.126  -23.186 1.00 0.00  ? 28   DG  B C8     1  
ATOM   4229   N  N7     . DG  B 2 28  ? 0.044   -2.737  -22.663 1.00 0.00  ? 28   DG  B N7     1  
ATOM   4230   C  C5     . DG  B 2 28  ? -0.189  -1.420  -22.288 1.00 0.00  ? 28   DG  B C5     1  
ATOM   4231   C  C6     . DG  B 2 28  ? 0.667   -0.472  -21.667 1.00 0.00  ? 28   DG  B C6     1  
ATOM   4232   O  O6     . DG  B 2 28  ? 1.844   -0.611  -21.313 1.00 0.00  ? 28   DG  B O6     1  
ATOM   4233   N  N1     . DG  B 2 28  ? 0.022   0.746   -21.467 1.00 0.00  ? 28   DG  B N1     1  
ATOM   4234   C  C2     . DG  B 2 28  ? -1.278  1.018   -21.817 1.00 0.00  ? 28   DG  B C2     1  
ATOM   4235   N  N2     . DG  B 2 28  ? -1.722  2.253   -21.544 1.00 0.00  ? 28   DG  B N2     1  
ATOM   4236   N  N3     . DG  B 2 28  ? -2.084  0.144   -22.394 1.00 0.00  ? 28   DG  B N3     1  
ATOM   4237   C  C4     . DG  B 2 28  ? -1.479  -1.045  -22.598 1.00 0.00  ? 28   DG  B C4     1  
ATOM   4238   H  "H5'"  . DG  B 2 28  ? -5.284  -5.104  -21.908 1.00 0.00  ? 28   DG  B "H5'"  1  
ATOM   4239   H  "H5''" . DG  B 2 28  ? -6.164  -5.523  -23.394 1.00 0.00  ? 28   DG  B "H5''" 1  
ATOM   4240   H  "H4'"  . DG  B 2 28  ? -6.290  -3.174  -23.137 1.00 0.00  ? 28   DG  B "H4'"  1  
ATOM   4241   H  "H3'"  . DG  B 2 28  ? -5.390  -4.155  -25.492 1.00 0.00  ? 28   DG  B "H3'"  1  
ATOM   4242   H  "H2'"  . DG  B 2 28  ? -3.021  -3.969  -24.940 1.00 0.00  ? 28   DG  B "H2'"  1  
ATOM   4243   H  "H2''" . DG  B 2 28  ? -3.322  -2.489  -25.851 1.00 0.00  ? 28   DG  B "H2''" 1  
ATOM   4244   H  "H1'"  . DG  B 2 28  ? -3.802  -1.223  -23.822 1.00 0.00  ? 28   DG  B "H1'"  1  
ATOM   4245   H  H8     . DG  B 2 28  ? -1.247  -4.115  -23.587 1.00 0.00  ? 28   DG  B H8     1  
ATOM   4246   H  H1     . DG  B 2 28  ? 0.547   1.489   -21.030 1.00 0.00  ? 28   DG  B H1     1  
ATOM   4247   H  H21    . DG  B 2 28  ? -2.670  2.512   -21.779 1.00 0.00  ? 28   DG  B H21    1  
ATOM   4248   H  H22    . DG  B 2 28  ? -1.112  2.925   -21.103 1.00 0.00  ? 28   DG  B H22    1  
ATOM   4249   P  P      . DT  B 2 29  ? -7.314  -2.234  -25.799 1.00 0.00  ? 29   DT  B P      1  
ATOM   4250   O  OP1    . DT  B 2 29  ? -7.901  -3.458  -25.195 1.00 0.00  ? 29   DT  B OP1    1  
ATOM   4251   O  OP2    . DT  B 2 29  ? -7.335  -2.061  -27.274 1.00 0.00  ? 29   DT  B OP2    1  
ATOM   4252   O  "O5'"  . DT  B 2 29  ? -8.008  -0.960  -25.141 1.00 0.00  ? 29   DT  B "O5'"  1  
ATOM   4253   C  "C5'"  . DT  B 2 29  ? -7.349  -0.217  -24.115 1.00 0.00  ? 29   DT  B "C5'"  1  
ATOM   4254   C  "C4'"  . DT  B 2 29  ? -7.875  1.199   -24.066 1.00 0.00  ? 29   DT  B "C4'"  1  
ATOM   4255   O  "O4'"  . DT  B 2 29  ? -6.765  2.113   -24.124 1.00 0.00  ? 29   DT  B "O4'"  1  
ATOM   4256   C  "C3'"  . DT  B 2 29  ? -8.755  1.626   -25.234 1.00 0.00  ? 29   DT  B "C3'"  1  
ATOM   4257   O  "O3'"  . DT  B 2 29  ? -9.537  2.768   -24.855 1.00 0.00  ? 29   DT  B "O3'"  1  
ATOM   4258   C  "C2'"  . DT  B 2 29  ? -7.730  1.977   -26.300 1.00 0.00  ? 29   DT  B "C2'"  1  
ATOM   4259   C  "C1'"  . DT  B 2 29  ? -6.504  2.422   -25.488 1.00 0.00  ? 29   DT  B "C1'"  1  
ATOM   4260   N  N1     . DT  B 2 29  ? -5.235  1.762   -25.852 1.00 0.00  ? 29   DT  B N1     1  
ATOM   4261   C  C2     . DT  B 2 29  ? -4.083  2.310   -25.341 1.00 0.00  ? 29   DT  B C2     1  
ATOM   4262   O  O2     . DT  B 2 29  ? -4.079  3.295   -24.622 1.00 0.00  ? 29   DT  B O2     1  
ATOM   4263   N  N3     . DT  B 2 29  ? -2.931  1.661   -25.700 1.00 0.00  ? 29   DT  B N3     1  
ATOM   4264   C  C4     . DT  B 2 29  ? -2.819  0.547   -26.505 1.00 0.00  ? 29   DT  B C4     1  
ATOM   4265   O  O4     . DT  B 2 29  ? -1.711  0.075   -26.743 1.00 0.00  ? 29   DT  B O4     1  
ATOM   4266   C  C5     . DT  B 2 29  ? -4.065  0.024   -27.012 1.00 0.00  ? 29   DT  B C5     1  
ATOM   4267   C  C7     . DT  B 2 29  ? -4.030  -1.158  -27.926 1.00 0.00  ? 29   DT  B C7     1  
ATOM   4268   C  C6     . DT  B 2 29  ? -5.203  0.644   -26.665 1.00 0.00  ? 29   DT  B C6     1  
ATOM   4269   H  "H5'"  . DT  B 2 29  ? -6.276  -0.192  -24.313 1.00 0.00  ? 29   DT  B "H5'"  1  
ATOM   4270   H  "H5''" . DT  B 2 29  ? -7.521  -0.695  -23.151 1.00 0.00  ? 29   DT  B "H5''" 1  
ATOM   4271   H  "H4'"  . DT  B 2 29  ? -8.472  1.305   -23.160 1.00 0.00  ? 29   DT  B "H4'"  1  
ATOM   4272   H  "H3'"  . DT  B 2 29  ? -9.417  0.820   -25.550 1.00 0.00  ? 29   DT  B "H3'"  1  
ATOM   4273   H  "H2'"  . DT  B 2 29  ? -7.516  1.116   -26.932 1.00 0.00  ? 29   DT  B "H2'"  1  
ATOM   4274   H  "H2''" . DT  B 2 29  ? -8.096  2.769   -26.953 1.00 0.00  ? 29   DT  B "H2''" 1  
ATOM   4275   H  "H1'"  . DT  B 2 29  ? -6.362  3.502   -25.564 1.00 0.00  ? 29   DT  B "H1'"  1  
ATOM   4276   H  H3     . DT  B 2 29  ? -2.072  2.038   -25.333 1.00 0.00  ? 29   DT  B H3     1  
ATOM   4277   H  H71    . DT  B 2 29  ? -4.736  -1.911  -27.574 1.00 0.00  ? 29   DT  B H71    1  
ATOM   4278   H  H72    . DT  B 2 29  ? -3.025  -1.579  -27.936 1.00 0.00  ? 29   DT  B H72    1  
ATOM   4279   H  H73    . DT  B 2 29  ? -4.304  -0.847  -28.934 1.00 0.00  ? 29   DT  B H73    1  
ATOM   4280   H  H6     . DT  B 2 29  ? -6.144  0.245   -27.040 1.00 0.00  ? 29   DT  B H6     1  
ATOM   4281   P  P      . DC  B 2 30  ? -9.890  3.904   -25.940 1.00 0.00  ? 30   DC  B P      1  
ATOM   4282   O  OP1    . DC  B 2 30  ? -10.802 4.884   -25.296 1.00 0.00  ? 30   DC  B OP1    1  
ATOM   4283   O  OP2    . DC  B 2 30  ? -10.314 3.216   -27.186 1.00 0.00  ? 30   DC  B OP2    1  
ATOM   4284   O  "O5'"  . DC  B 2 30  ? -8.498  4.629   -26.218 1.00 0.00  ? 30   DC  B "O5'"  1  
ATOM   4285   C  "C5'"  . DC  B 2 30  ? -8.131  5.811   -25.504 1.00 0.00  ? 30   DC  B "C5'"  1  
ATOM   4286   C  "C4'"  . DC  B 2 30  ? -6.954  6.486   -26.170 1.00 0.00  ? 30   DC  B "C4'"  1  
ATOM   4287   O  "O4'"  . DC  B 2 30  ? -5.923  5.501   -26.421 1.00 0.00  ? 30   DC  B "O4'"  1  
ATOM   4288   C  "C3'"  . DC  B 2 30  ? -7.258  7.139   -27.525 1.00 0.00  ? 30   DC  B "C3'"  1  
ATOM   4289   O  "O3'"  . DC  B 2 30  ? -6.830  8.505   -27.516 1.00 0.00  ? 30   DC  B "O3'"  1  
ATOM   4290   C  "C2'"  . DC  B 2 30  ? -6.438  6.334   -28.523 1.00 0.00  ? 30   DC  B "C2'"  1  
ATOM   4291   C  "C1'"  . DC  B 2 30  ? -5.319  5.798   -27.660 1.00 0.00  ? 30   DC  B "C1'"  1  
ATOM   4292   N  N1     . DC  B 2 30  ? -4.671  4.575   -28.158 1.00 0.00  ? 30   DC  B N1     1  
ATOM   4293   C  C2     . DC  B 2 30  ? -3.280  4.555   -28.264 1.00 0.00  ? 30   DC  B C2     1  
ATOM   4294   O  O2     . DC  B 2 30  ? -2.641  5.566   -27.942 1.00 0.00  ? 30   DC  B O2     1  
ATOM   4295   N  N3     . DC  B 2 30  ? -2.667  3.436   -28.715 1.00 0.00  ? 30   DC  B N3     1  
ATOM   4296   C  C4     . DC  B 2 30  ? -3.393  2.368   -29.052 1.00 0.00  ? 30   DC  B C4     1  
ATOM   4297   N  N4     . DC  B 2 30  ? -2.744  1.285   -29.484 1.00 0.00  ? 30   DC  B N4     1  
ATOM   4298   C  C5     . DC  B 2 30  ? -4.816  2.362   -28.959 1.00 0.00  ? 30   DC  B C5     1  
ATOM   4299   C  C6     . DC  B 2 30  ? -5.408  3.479   -28.511 1.00 0.00  ? 30   DC  B C6     1  
ATOM   4300   H  "H5'"  . DC  B 2 30  ? -7.860  5.550   -24.481 1.00 0.00  ? 30   DC  B "H5'"  1  
ATOM   4301   H  "H5''" . DC  B 2 30  ? -8.973  6.502   -25.483 1.00 0.00  ? 30   DC  B "H5''" 1  
ATOM   4302   H  "H4'"  . DC  B 2 30  ? -6.624  7.289   -25.508 1.00 0.00  ? 30   DC  B "H4'"  1  
ATOM   4303   H  "H3'"  . DC  B 2 30  ? -8.323  7.100   -27.749 1.00 0.00  ? 30   DC  B "H3'"  1  
ATOM   4304   H  "H2'"  . DC  B 2 30  ? -7.032  5.538   -28.972 1.00 0.00  ? 30   DC  B "H2'"  1  
ATOM   4305   H  "H2''" . DC  B 2 30  ? -6.068  6.963   -29.332 1.00 0.00  ? 30   DC  B "H2''" 1  
ATOM   4306   H  "H1'"  . DC  B 2 30  ? -4.554  6.557   -27.491 1.00 0.00  ? 30   DC  B "H1'"  1  
ATOM   4307   H  H41    . DC  B 2 30  ? -3.259  0.456   -29.745 1.00 0.00  ? 30   DC  B H41    1  
ATOM   4308   H  H42    . DC  B 2 30  ? -1.736  1.299   -29.558 1.00 0.00  ? 30   DC  B H42    1  
ATOM   4309   H  H5     . DC  B 2 30  ? -5.398  1.485   -29.239 1.00 0.00  ? 30   DC  B H5     1  
ATOM   4310   H  H6     . DC  B 2 30  ? -6.495  3.511   -28.429 1.00 0.00  ? 30   DC  B H6     1  
ATOM   4311   P  P      . DA  B 2 31  ? -7.219  9.470   -28.741 1.00 0.00  ? 31   DA  B P      1  
ATOM   4312   O  OP1    . DA  B 2 31  ? -6.979  10.875  -28.323 1.00 0.00  ? 31   DA  B OP1    1  
ATOM   4313   O  OP2    . DA  B 2 31  ? -8.565  9.066   -29.219 1.00 0.00  ? 31   DA  B OP2    1  
ATOM   4314   O  "O5'"  . DA  B 2 31  ? -6.159  9.104   -29.873 1.00 0.00  ? 31   DA  B "O5'"  1  
ATOM   4315   C  "C5'"  . DA  B 2 31  ? -5.069  9.978   -30.164 1.00 0.00  ? 31   DA  B "C5'"  1  
ATOM   4316   C  "C4'"  . DA  B 2 31  ? -3.848  9.568   -29.376 1.00 0.00  ? 31   DA  B "C4'"  1  
ATOM   4317   O  "O4'"  . DA  B 2 31  ? -3.683  8.133   -29.485 1.00 0.00  ? 31   DA  B "O4'"  1  
ATOM   4318   C  "C3'"  . DA  B 2 31  ? -2.533  10.187  -29.860 1.00 0.00  ? 31   DA  B "C3'"  1  
ATOM   4319   O  "O3'"  . DA  B 2 31  ? -1.733  10.589  -28.744 1.00 0.00  ? 31   DA  B "O3'"  1  
ATOM   4320   C  "C2'"  . DA  B 2 31  ? -1.859  9.058   -30.620 1.00 0.00  ? 31   DA  B "C2'"  1  
ATOM   4321   C  "C1'"  . DA  B 2 31  ? -2.362  7.830   -29.890 1.00 0.00  ? 31   DA  B "C1'"  1  
ATOM   4322   N  N9     . DA  B 2 31  ? -2.406  6.614   -30.702 1.00 0.00  ? 31   DA  B N9     1  
ATOM   4323   C  C8     . DA  B 2 31  ? -3.514  5.932   -31.140 1.00 0.00  ? 31   DA  B C8     1  
ATOM   4324   N  N7     . DA  B 2 31  ? -3.232  4.870   -31.854 1.00 0.00  ? 31   DA  B N7     1  
ATOM   4325   C  C5     . DA  B 2 31  ? -1.845  4.850   -31.888 1.00 0.00  ? 31   DA  B C5     1  
ATOM   4326   C  C6     . DA  B 2 31  ? -0.925  3.972   -32.488 1.00 0.00  ? 31   DA  B C6     1  
ATOM   4327   N  N6     . DA  B 2 31  ? -1.279  2.899   -33.199 1.00 0.00  ? 31   DA  B N6     1  
ATOM   4328   N  N1     . DA  B 2 31  ? 0.391   4.237   -32.331 1.00 0.00  ? 31   DA  B N1     1  
ATOM   4329   C  C2     . DA  B 2 31  ? 0.748   5.314   -31.618 1.00 0.00  ? 31   DA  B C2     1  
ATOM   4330   N  N3     . DA  B 2 31  ? -0.023  6.212   -31.007 1.00 0.00  ? 31   DA  B N3     1  
ATOM   4331   C  C4     . DA  B 2 31  ? -1.323  5.919   -31.182 1.00 0.00  ? 31   DA  B C4     1  
ATOM   4332   H  "H5'"  . DA  B 2 31  ? -5.339  11.000  -29.897 1.00 0.00  ? 31   DA  B "H5'"  1  
ATOM   4333   H  "H5''" . DA  B 2 31  ? -4.839  9.935   -31.228 1.00 0.00  ? 31   DA  B "H5''" 1  
ATOM   4334   H  "H4'"  . DA  B 2 31  ? -3.992  9.907   -28.348 1.00 0.00  ? 31   DA  B "H4'"  1  
ATOM   4335   H  "H3'"  . DA  B 2 31  ? -2.718  11.051  -30.496 1.00 0.00  ? 31   DA  B "H3'"  1  
ATOM   4336   H  "H2'"  . DA  B 2 31  ? -2.147  9.061   -31.672 1.00 0.00  ? 31   DA  B "H2'"  1  
ATOM   4337   H  "H2''" . DA  B 2 31  ? -0.773  9.147   -30.578 1.00 0.00  ? 31   DA  B "H2''" 1  
ATOM   4338   H  "H1'"  . DA  B 2 31  ? -1.770  7.633   -28.995 1.00 0.00  ? 31   DA  B "H1'"  1  
ATOM   4339   H  H8     . DA  B 2 31  ? -4.524  6.242   -30.917 1.00 0.00  ? 31   DA  B H8     1  
ATOM   4340   H  H61    . DA  B 2 31  ? -0.570  2.307   -33.606 1.00 0.00  ? 31   DA  B H61    1  
ATOM   4341   H  H62    . DA  B 2 31  ? -2.257  2.680   -33.330 1.00 0.00  ? 31   DA  B H62    1  
ATOM   4342   H  H2     . DA  B 2 31  ? 1.820   5.478   -31.524 1.00 0.00  ? 31   DA  B H2     1  
ATOM   4343   P  P      . DG  B 2 32  ? -0.374  11.409  -28.994 1.00 0.00  ? 32   DG  B P      1  
ATOM   4344   O  OP1    . DG  B 2 32  ? 0.415   11.354  -27.737 1.00 0.00  ? 32   DG  B OP1    1  
ATOM   4345   O  OP2    . DG  B 2 32  ? -0.725  12.726  -29.582 1.00 0.00  ? 32   DG  B OP2    1  
ATOM   4346   O  "O5'"  . DG  B 2 32  ? 0.393   10.556  -30.099 1.00 0.00  ? 32   DG  B "O5'"  1  
ATOM   4347   C  "C5'"  . DG  B 2 32  ? 0.774   11.142  -31.344 1.00 0.00  ? 32   DG  B "C5'"  1  
ATOM   4348   C  "C4'"  . DG  B 2 32  ? 2.087   10.560  -31.812 1.00 0.00  ? 32   DG  B "C4'"  1  
ATOM   4349   O  "O4'"  . DG  B 2 32  ? 1.866   9.194   -32.240 1.00 0.00  ? 32   DG  B "O4'"  1  
ATOM   4350   C  "C3'"  . DG  B 2 32  ? 2.722   11.278  -33.005 1.00 0.00  ? 32   DG  B "C3'"  1  
ATOM   4351   O  "O3'"  . DG  B 2 32  ? 4.143   11.327  -32.854 1.00 0.00  ? 32   DG  B "O3'"  1  
ATOM   4352   C  "C2'"  . DG  B 2 32  ? 2.341   10.404  -34.186 1.00 0.00  ? 32   DG  B "C2'"  1  
ATOM   4353   C  "C1'"  . DG  B 2 32  ? 2.343   9.023   -33.563 1.00 0.00  ? 32   DG  B "C1'"  1  
ATOM   4354   N  N9     . DG  B 2 32  ? 1.485   8.049   -34.230 1.00 0.00  ? 32   DG  B N9     1  
ATOM   4355   C  C8     . DG  B 2 32  ? 0.138   8.158   -34.473 1.00 0.00  ? 32   DG  B C8     1  
ATOM   4356   N  N7     . DG  B 2 32  ? -0.360  7.123   -35.092 1.00 0.00  ? 32   DG  B N7     1  
ATOM   4357   C  C5     . DG  B 2 32  ? 0.726   6.277   -35.269 1.00 0.00  ? 32   DG  B C5     1  
ATOM   4358   C  C6     . DG  B 2 32  ? 0.806   4.998   -35.881 1.00 0.00  ? 32   DG  B C6     1  
ATOM   4359   O  O6     . DG  B 2 32  ? -0.097  4.337   -36.406 1.00 0.00  ? 32   DG  B O6     1  
ATOM   4360   N  N1     . DG  B 2 32  ? 2.103   4.493   -35.844 1.00 0.00  ? 32   DG  B N1     1  
ATOM   4361   C  C2     . DG  B 2 32  ? 3.184   5.134   -35.289 1.00 0.00  ? 32   DG  B C2     1  
ATOM   4362   N  N2     . DG  B 2 32  ? 4.354   4.483   -35.351 1.00 0.00  ? 32   DG  B N2     1  
ATOM   4363   N  N3     . DG  B 2 32  ? 3.123   6.325   -34.716 1.00 0.00  ? 32   DG  B N3     1  
ATOM   4364   C  C4     . DG  B 2 32  ? 1.872   6.834   -34.742 1.00 0.00  ? 32   DG  B C4     1  
ATOM   4365   H  "H5'"  . DG  B 2 32  ? 0.883   12.219  -31.224 1.00 0.00  ? 32   DG  B "H5'"  1  
ATOM   4366   H  "H5''" . DG  B 2 32  ? 0.007   10.942  -32.093 1.00 0.00  ? 32   DG  B "H5''" 1  
ATOM   4367   H  "H4'"  . DG  B 2 32  ? 2.795   10.642  -30.985 1.00 0.00  ? 32   DG  B "H4'"  1  
ATOM   4368   H  "H3'"  . DG  B 2 32  ? 2.336   12.292  -33.106 1.00 0.00  ? 32   DG  B "H3'"  1  
ATOM   4369   H  "H2'"  . DG  B 2 32  ? 1.364   10.677  -34.584 1.00 0.00  ? 32   DG  B "H2'"  1  
ATOM   4370   H  "H2''" . DG  B 2 32  ? 3.064   10.493  -34.997 1.00 0.00  ? 32   DG  B "H2''" 1  
ATOM   4371   H  "H1'"  . DG  B 2 32  ? 3.355   8.618   -33.508 1.00 0.00  ? 32   DG  B "H1'"  1  
ATOM   4372   H  H8     . DG  B 2 32  ? -0.451  9.015   -34.180 1.00 0.00  ? 32   DG  B H8     1  
ATOM   4373   H  H1     . DG  B 2 32  ? 2.260   3.586   -36.257 1.00 0.00  ? 32   DG  B H1     1  
ATOM   4374   H  H21    . DG  B 2 32  ? 5.186   4.901   -34.960 1.00 0.00  ? 32   DG  B H21    1  
ATOM   4375   H  H22    . DG  B 2 32  ? 4.404   3.574   -35.789 1.00 0.00  ? 32   DG  B H22    1  
ATOM   4376   P  P      . DC  B 2 33  ? 4.998   12.391  -33.701 1.00 0.00  ? 33   DC  B P      1  
ATOM   4377   O  OP1    . DC  B 2 33  ? 4.810   13.733  -33.094 1.00 0.00  ? 33   DC  B OP1    1  
ATOM   4378   O  OP2    . DC  B 2 33  ? 4.674   12.183  -35.136 1.00 0.00  ? 33   DC  B OP2    1  
ATOM   4379   O  "O5'"  . DC  B 2 33  ? 6.509   11.943  -33.471 1.00 0.00  ? 33   DC  B "O5'"  1  
ATOM   4380   C  "C5'"  . DC  B 2 33  ? 7.436   11.913  -34.555 1.00 0.00  ? 33   DC  B "C5'"  1  
ATOM   4381   C  "C4'"  . DC  B 2 33  ? 7.797   10.486  -34.892 1.00 0.00  ? 33   DC  B "C4'"  1  
ATOM   4382   O  "O4'"  . DC  B 2 33  ? 6.613   9.800   -35.369 1.00 0.00  ? 33   DC  B "O4'"  1  
ATOM   4383   C  "C3'"  . DC  B 2 33  ? 8.850   10.337  -35.995 1.00 0.00  ? 33   DC  B "C3'"  1  
ATOM   4384   O  "O3'"  . DC  B 2 33  ? 9.850   9.393   -35.599 1.00 0.00  ? 33   DC  B "O3'"  1  
ATOM   4385   C  "C2'"  . DC  B 2 33  ? 8.065   9.809   -37.184 1.00 0.00  ? 33   DC  B "C2'"  1  
ATOM   4386   C  "C1'"  . DC  B 2 33  ? 6.952   9.039   -36.510 1.00 0.00  ? 33   DC  B "C1'"  1  
ATOM   4387   N  N1     . DC  B 2 33  ? 5.740   8.861   -37.322 1.00 0.00  ? 33   DC  B N1     1  
ATOM   4388   C  C2     . DC  B 2 33  ? 5.493   7.608   -37.889 1.00 0.00  ? 33   DC  B C2     1  
ATOM   4389   O  O2     . DC  B 2 33  ? 6.298   6.688   -37.680 1.00 0.00  ? 33   DC  B O2     1  
ATOM   4390   N  N3     . DC  B 2 33  ? 4.388   7.432   -38.648 1.00 0.00  ? 33   DC  B N3     1  
ATOM   4391   C  C4     . DC  B 2 33  ? 3.546   8.448   -38.847 1.00 0.00  ? 33   DC  B C4     1  
ATOM   4392   N  N4     . DC  B 2 33  ? 2.473   8.229   -39.609 1.00 0.00  ? 33   DC  B N4     1  
ATOM   4393   C  C5     . DC  B 2 33  ? 3.769   9.736   -38.275 1.00 0.00  ? 33   DC  B C5     1  
ATOM   4394   C  C6     . DC  B 2 33  ? 4.869   9.895   -37.526 1.00 0.00  ? 33   DC  B C6     1  
ATOM   4395   H  "H5'"  . DC  B 2 33  ? 8.341   12.454  -34.278 1.00 0.00  ? 33   DC  B "H5'"  1  
ATOM   4396   H  "H5''" . DC  B 2 33  ? 6.991   12.385  -35.430 1.00 0.00  ? 33   DC  B "H5''" 1  
ATOM   4397   H  "H4'"  . DC  B 2 33  ? 8.221   10.034  -33.993 1.00 0.00  ? 33   DC  B "H4'"  1  
ATOM   4398   H  "H3'"  . DC  B 2 33  ? 9.327   11.292  -36.213 1.00 0.00  ? 33   DC  B "H3'"  1  
ATOM   4399   H  "H2'"  . DC  B 2 33  ? 7.689   10.623  -37.804 1.00 0.00  ? 33   DC  B "H2'"  1  
ATOM   4400   H  "H2''" . DC  B 2 33  ? 8.683   9.173   -37.818 1.00 0.00  ? 33   DC  B "H2''" 1  
ATOM   4401   H  "H1'"  . DC  B 2 33  ? 7.298   8.060   -36.174 1.00 0.00  ? 33   DC  B "H1'"  1  
ATOM   4402   H  H41    . DC  B 2 33  ? 1.815   8.974   -39.784 1.00 0.00  ? 33   DC  B H41    1  
ATOM   4403   H  H42    . DC  B 2 33  ? 2.322   7.315   -40.011 1.00 0.00  ? 33   DC  B H42    1  
ATOM   4404   H  H5     . DC  B 2 33  ? 3.072   10.557  -38.441 1.00 0.00  ? 33   DC  B H5     1  
ATOM   4405   H  H6     . DC  B 2 33  ? 5.070   10.866  -37.072 1.00 0.00  ? 33   DC  B H6     1  
ATOM   4406   P  P      . DT  B 2 34  ? 11.272  9.378   -36.347 1.00 0.00  ? 34   DT  B P      1  
ATOM   4407   O  OP1    . DT  B 2 34  ? 12.190  8.501   -35.577 1.00 0.00  ? 34   DT  B OP1    1  
ATOM   4408   O  OP2    . DT  B 2 34  ? 11.656  10.787  -36.614 1.00 0.00  ? 34   DT  B OP2    1  
ATOM   4409   O  "O5'"  . DT  B 2 34  ? 10.970  8.673   -37.743 1.00 0.00  ? 34   DT  B "O5'"  1  
ATOM   4410   C  "C5'"  . DT  B 2 34  ? 11.985  7.937   -38.423 1.00 0.00  ? 34   DT  B "C5'"  1  
ATOM   4411   C  "C4'"  . DT  B 2 34  ? 11.546  6.506   -38.626 1.00 0.00  ? 34   DT  B "C4'"  1  
ATOM   4412   O  "O4'"  . DT  B 2 34  ? 11.201  5.937   -37.339 1.00 0.00  ? 34   DT  B "O4'"  1  
ATOM   4413   C  "C3'"  . DT  B 2 34  ? 10.310  6.331   -39.515 1.00 0.00  ? 34   DT  B "C3'"  1  
ATOM   4414   O  "O3'"  . DT  B 2 34  ? 10.517  5.264   -40.446 1.00 0.00  ? 34   DT  B "O3'"  1  
ATOM   4415   C  "C2'"  . DT  B 2 34  ? 9.205   5.974   -38.536 1.00 0.00  ? 34   DT  B "C2'"  1  
ATOM   4416   C  "C1'"  . DT  B 2 34  ? 9.970   5.250   -37.451 1.00 0.00  ? 34   DT  B "C1'"  1  
ATOM   4417   N  N1     . DT  B 2 34  ? 9.321   5.247   -36.127 1.00 0.00  ? 34   DT  B N1     1  
ATOM   4418   C  C2     . DT  B 2 34  ? 8.345   4.305   -35.897 1.00 0.00  ? 34   DT  B C2     1  
ATOM   4419   O  O2     . DT  B 2 34  ? 7.999   3.488   -36.734 1.00 0.00  ? 34   DT  B O2     1  
ATOM   4420   N  N3     . DT  B 2 34  ? 7.785   4.354   -34.647 1.00 0.00  ? 34   DT  B N3     1  
ATOM   4421   C  C4     . DT  B 2 34  ? 8.097   5.232   -33.628 1.00 0.00  ? 34   DT  B C4     1  
ATOM   4422   O  O4     . DT  B 2 34  ? 7.508   5.155   -32.554 1.00 0.00  ? 34   DT  B O4     1  
ATOM   4423   C  C5     . DT  B 2 34  ? 9.130   6.194   -33.938 1.00 0.00  ? 34   DT  B C5     1  
ATOM   4424   C  C7     . DT  B 2 34  ? 9.536   7.180   -32.888 1.00 0.00  ? 34   DT  B C7     1  
ATOM   4425   C  C6     . DT  B 2 34  ? 9.688   6.159   -35.157 1.00 0.00  ? 34   DT  B C6     1  
ATOM   4426   H  "H5'"  . DT  B 2 34  ? 12.902  7.949   -37.834 1.00 0.00  ? 34   DT  B "H5'"  1  
ATOM   4427   H  "H5''" . DT  B 2 34  ? 12.179  8.393   -39.395 1.00 0.00  ? 34   DT  B "H5''" 1  
ATOM   4428   H  "H4'"  . DT  B 2 34  ? 12.364  5.980   -39.122 1.00 0.00  ? 34   DT  B "H4'"  1  
ATOM   4429   H  "H3'"  . DT  B 2 34  ? 10.089  7.246   -40.064 1.00 0.00  ? 34   DT  B "H3'"  1  
ATOM   4430   H  "H2'"  . DT  B 2 34  ? 8.701   6.866   -38.163 1.00 0.00  ? 34   DT  B "H2'"  1  
ATOM   4431   H  "H2''" . DT  B 2 34  ? 8.450   5.341   -39.003 1.00 0.00  ? 34   DT  B "H2''" 1  
ATOM   4432   H  "H1'"  . DT  B 2 34  ? 10.183  4.220   -37.740 1.00 0.00  ? 34   DT  B "H1'"  1  
ATOM   4433   H  H3     . DT  B 2 34  ? 7.066   3.673   -34.451 1.00 0.00  ? 34   DT  B H3     1  
ATOM   4434   H  H71    . DT  B 2 34  ? 9.431   6.726   -31.903 1.00 0.00  ? 34   DT  B H71    1  
ATOM   4435   H  H72    . DT  B 2 34  ? 10.574  7.472   -33.045 1.00 0.00  ? 34   DT  B H72    1  
ATOM   4436   H  H73    . DT  B 2 34  ? 8.898   8.062   -32.951 1.00 0.00  ? 34   DT  B H73    1  
ATOM   4437   H  H6     . DT  B 2 34  ? 10.466  6.884   -35.394 1.00 0.00  ? 34   DT  B H6     1  
ATOM   4438   P  P      . DT  B 2 35  ? 11.265  5.556   -41.838 1.00 0.00  ? 35   DT  B P      1  
ATOM   4439   O  OP1    . DT  B 2 35  ? 12.690  5.165   -41.691 1.00 0.00  ? 35   DT  B OP1    1  
ATOM   4440   O  OP2    . DT  B 2 35  ? 10.922  6.943   -42.243 1.00 0.00  ? 35   DT  B OP2    1  
ATOM   4441   O  "O5'"  . DT  B 2 35  ? 10.574  4.555   -42.867 1.00 0.00  ? 35   DT  B "O5'"  1  
ATOM   4442   C  "C5'"  . DT  B 2 35  ? 10.336  3.191   -42.520 1.00 0.00  ? 35   DT  B "C5'"  1  
ATOM   4443   C  "C4'"  . DT  B 2 35  ? 8.852   2.910   -42.510 1.00 0.00  ? 35   DT  B "C4'"  1  
ATOM   4444   O  "O4'"  . DT  B 2 35  ? 8.142   4.162   -42.515 1.00 0.00  ? 35   DT  B "O4'"  1  
ATOM   4445   C  "C3'"  . DT  B 2 35  ? 8.331   2.146   -43.729 1.00 0.00  ? 35   DT  B "C3'"  1  
ATOM   4446   O  "O3'"  . DT  B 2 35  ? 8.146   0.766   -43.403 1.00 0.00  ? 35   DT  B "O3'"  1  
ATOM   4447   C  "C2'"  . DT  B 2 35  ? 6.990   2.796   -44.050 1.00 0.00  ? 35   DT  B "C2'"  1  
ATOM   4448   C  "C1'"  . DT  B 2 35  ? 6.850   3.926   -43.031 1.00 0.00  ? 35   DT  B "C1'"  1  
ATOM   4449   N  N1     . DT  B 2 35  ? 6.343   5.194   -43.588 1.00 0.00  ? 35   DT  B N1     1  
ATOM   4450   C  C2     . DT  B 2 35  ? 5.263   5.140   -44.440 1.00 0.00  ? 35   DT  B C2     1  
ATOM   4451   O  O2     . DT  B 2 35  ? 4.714   4.097   -44.755 1.00 0.00  ? 35   DT  B O2     1  
ATOM   4452   N  N3     . DT  B 2 35  ? 4.848   6.358   -44.914 1.00 0.00  ? 35   DT  B N3     1  
ATOM   4453   C  C4     . DT  B 2 35  ? 5.392   7.593   -44.627 1.00 0.00  ? 35   DT  B C4     1  
ATOM   4454   O  O4     . DT  B 2 35  ? 4.909   8.605   -45.127 1.00 0.00  ? 35   DT  B O4     1  
ATOM   4455   C  C5     . DT  B 2 35  ? 6.523   7.575   -43.726 1.00 0.00  ? 35   DT  B C5     1  
ATOM   4456   C  C7     . DT  B 2 35  ? 7.174   8.871   -43.359 1.00 0.00  ? 35   DT  B C7     1  
ATOM   4457   C  C6     . DT  B 2 35  ? 6.941   6.392   -43.254 1.00 0.00  ? 35   DT  B C6     1  
ATOM   4458   H  "H5'"  . DT  B 2 35  ? 10.745  2.987   -41.532 1.00 0.00  ? 35   DT  B "H5'"  1  
ATOM   4459   H  "H5''" . DT  B 2 35  ? 10.817  2.539   -43.249 1.00 0.00  ? 35   DT  B "H5''" 1  
ATOM   4460   H  "H4'"  . DT  B 2 35  ? 8.636   2.295   -41.634 1.00 0.00  ? 35   DT  B "H4'"  1  
ATOM   4461   H  "H3'"  . DT  B 2 35  ? 9.026   2.223   -44.564 1.00 0.00  ? 35   DT  B "H3'"  1  
ATOM   4462   H  "H2'"  . DT  B 2 35  ? 6.977   3.167   -45.076 1.00 0.00  ? 35   DT  B "H2'"  1  
ATOM   4463   H  "H2''" . DT  B 2 35  ? 6.178   2.075   -43.963 1.00 0.00  ? 35   DT  B "H2''" 1  
ATOM   4464   H  "H1'"  . DT  B 2 35  ? 6.205   3.629   -42.203 1.00 0.00  ? 35   DT  B "H1'"  1  
ATOM   4465   H  H3     . DT  B 2 35  ? 4.057   6.348   -45.542 1.00 0.00  ? 35   DT  B H3     1  
ATOM   4466   H  H71    . DT  B 2 35  ? 7.089   9.569   -44.191 1.00 0.00  ? 35   DT  B H71    1  
ATOM   4467   H  H72    . DT  B 2 35  ? 6.682   9.290   -42.481 1.00 0.00  ? 35   DT  B H72    1  
ATOM   4468   H  H73    . DT  B 2 35  ? 8.227   8.698   -43.136 1.00 0.00  ? 35   DT  B H73    1  
ATOM   4469   H  H6     . DT  B 2 35  ? 7.793   6.375   -42.575 1.00 0.00  ? 35   DT  B H6     1  
ATOM   4470   P  P      . DG  B 2 36  ? 8.156   -0.335  -44.573 1.00 0.00  ? 36   DG  B P      1  
ATOM   4471   O  OP1    . DG  B 2 36  ? 8.946   -1.505  -44.112 1.00 0.00  ? 36   DG  B OP1    1  
ATOM   4472   O  OP2    . DG  B 2 36  ? 8.539   0.360   -45.827 1.00 0.00  ? 36   DG  B OP2    1  
ATOM   4473   O  "O5'"  . DG  B 2 36  ? 6.631   -0.780  -44.699 1.00 0.00  ? 36   DG  B "O5'"  1  
ATOM   4474   C  "C5'"  . DG  B 2 36  ? 6.121   -1.873  -43.936 1.00 0.00  ? 36   DG  B "C5'"  1  
ATOM   4475   C  "C4'"  . DG  B 2 36  ? 6.272   -1.592  -42.459 1.00 0.00  ? 36   DG  B "C4'"  1  
ATOM   4476   O  "O4'"  . DG  B 2 36  ? 5.921   -0.209  -42.209 1.00 0.00  ? 36   DG  B "O4'"  1  
ATOM   4477   C  "C3'"  . DG  B 2 36  ? 5.374   -2.428  -41.542 1.00 0.00  ? 36   DG  B "C3'"  1  
ATOM   4478   O  "O3'"  . DG  B 2 36  ? 6.114   -2.879  -40.403 1.00 0.00  ? 36   DG  B "O3'"  1  
ATOM   4479   C  "C2'"  . DG  B 2 36  ? 4.291   -1.453  -41.112 1.00 0.00  ? 36   DG  B "C2'"  1  
ATOM   4480   C  "C1'"  . DG  B 2 36  ? 5.050   -0.147  -41.098 1.00 0.00  ? 36   DG  B "C1'"  1  
ATOM   4481   N  N9     . DG  B 2 36  ? 4.227   1.050   -41.230 1.00 0.00  ? 36   DG  B N9     1  
ATOM   4482   C  C8     . DG  B 2 36  ? 3.094   1.205   -41.990 1.00 0.00  ? 36   DG  B C8     1  
ATOM   4483   N  N7     . DG  B 2 36  ? 2.573   2.398   -41.901 1.00 0.00  ? 36   DG  B N7     1  
ATOM   4484   C  C5     . DG  B 2 36  ? 3.416   3.073   -41.028 1.00 0.00  ? 36   DG  B C5     1  
ATOM   4485   C  C6     . DG  B 2 36  ? 3.365   4.407   -40.544 1.00 0.00  ? 36   DG  B C6     1  
ATOM   4486   O  O6     . DG  B 2 36  ? 2.536   5.288   -40.800 1.00 0.00  ? 36   DG  B O6     1  
ATOM   4487   N  N1     . DG  B 2 36  ? 4.419   4.677   -39.675 1.00 0.00  ? 36   DG  B N1     1  
ATOM   4488   C  C2     . DG  B 2 36  ? 5.397   3.781   -39.319 1.00 0.00  ? 36   DG  B C2     1  
ATOM   4489   N  N2     . DG  B 2 36  ? 6.332   4.227   -38.468 1.00 0.00  ? 36   DG  B N2     1  
ATOM   4490   N  N3     . DG  B 2 36  ? 5.456   2.537   -39.763 1.00 0.00  ? 36   DG  B N3     1  
ATOM   4491   C  C4     . DG  B 2 36  ? 4.442   2.253   -40.607 1.00 0.00  ? 36   DG  B C4     1  
ATOM   4492   H  "H5'"  . DG  B 2 36  ? 6.671   -2.781  -44.184 1.00 0.00  ? 36   DG  B "H5'"  1  
ATOM   4493   H  "H5''" . DG  B 2 36  ? 5.066   -2.020  -44.166 1.00 0.00  ? 36   DG  B "H5''" 1  
ATOM   4494   H  "H4'"  . DG  B 2 36  ? 7.302   -1.828  -42.185 1.00 0.00  ? 36   DG  B "H4'"  1  
ATOM   4495   H  "H3'"  . DG  B 2 36  ? 4.963   -3.289  -42.068 1.00 0.00  ? 36   DG  B "H3'"  1  
ATOM   4496   H  "H2'"  . DG  B 2 36  ? 3.460   -1.442  -41.817 1.00 0.00  ? 36   DG  B "H2'"  1  
ATOM   4497   H  "H2''" . DG  B 2 36  ? 3.889   -1.710  -40.132 1.00 0.00  ? 36   DG  B "H2''" 1  
ATOM   4498   H  "H1'"  . DG  B 2 36  ? 5.659   -0.057  -40.197 1.00 0.00  ? 36   DG  B "H1'"  1  
ATOM   4499   H  H8     . DG  B 2 36  ? 2.674   0.417   -42.598 1.00 0.00  ? 36   DG  B H8     1  
ATOM   4500   H  H1     . DG  B 2 36  ? 4.468   5.603   -39.276 1.00 0.00  ? 36   DG  B H1     1  
ATOM   4501   H  H21    . DG  B 2 36  ? 7.075   3.610   -38.173 1.00 0.00  ? 36   DG  B H21    1  
ATOM   4502   H  H22    . DG  B 2 36  ? 6.295   5.175   -38.122 1.00 0.00  ? 36   DG  B H22    1  
ATOM   4503   P  P      . DC  B 2 37  ? 6.244   -4.453  -40.109 1.00 0.00  ? 37   DC  B P      1  
ATOM   4504   O  OP1    . DC  B 2 37  ? 7.427   -4.946  -40.858 1.00 0.00  ? 37   DC  B OP1    1  
ATOM   4505   O  OP2    . DC  B 2 37  ? 4.918   -5.083  -40.335 1.00 0.00  ? 37   DC  B OP2    1  
ATOM   4506   O  "O5'"  . DC  B 2 37  ? 6.579   -4.529  -38.553 1.00 0.00  ? 37   DC  B "O5'"  1  
ATOM   4507   C  "C5'"  . DC  B 2 37  ? 5.639   -4.079  -37.578 1.00 0.00  ? 37   DC  B "C5'"  1  
ATOM   4508   C  "C4'"  . DC  B 2 37  ? 5.959   -2.663  -37.159 1.00 0.00  ? 37   DC  B "C4'"  1  
ATOM   4509   O  "O4'"  . DC  B 2 37  ? 5.107   -1.749  -37.874 1.00 0.00  ? 37   DC  B "O4'"  1  
ATOM   4510   C  "C3'"  . DC  B 2 37  ? 5.707   -2.349  -35.689 1.00 0.00  ? 37   DC  B "C3'"  1  
ATOM   4511   O  "O3'"  . DC  B 2 37  ? 6.877   -2.623  -34.914 1.00 0.00  ? 37   DC  B "O3'"  1  
ATOM   4512   C  "C2'"  . DC  B 2 37  ? 5.407   -0.857  -35.689 1.00 0.00  ? 37   DC  B "C2'"  1  
ATOM   4513   C  "C1'"  . DC  B 2 37  ? 5.016   -0.541  -37.137 1.00 0.00  ? 37   DC  B "C1'"  1  
ATOM   4514   N  N1     . DC  B 2 37  ? 3.650   -0.018  -37.290 1.00 0.00  ? 37   DC  B N1     1  
ATOM   4515   C  C2     . DC  B 2 37  ? 3.398   1.310   -36.936 1.00 0.00  ? 37   DC  B C2     1  
ATOM   4516   O  O2     . DC  B 2 37  ? 4.332   2.004   -36.508 1.00 0.00  ? 37   DC  B O2     1  
ATOM   4517   N  N3     . DC  B 2 37  ? 2.146   1.803   -37.070 1.00 0.00  ? 37   DC  B N3     1  
ATOM   4518   C  C4     . DC  B 2 37  ? 1.168   1.022   -37.534 1.00 0.00  ? 37   DC  B C4     1  
ATOM   4519   N  N4     . DC  B 2 37  ? -0.053  1.550   -37.645 1.00 0.00  ? 37   DC  B N4     1  
ATOM   4520   C  C5     . DC  B 2 37  ? 1.397   -0.336  -37.903 1.00 0.00  ? 37   DC  B C5     1  
ATOM   4521   C  C6     . DC  B 2 37  ? 2.642   -0.809  -37.767 1.00 0.00  ? 37   DC  B C6     1  
ATOM   4522   H  "H5'"  . DC  B 2 37  ? 5.680   -4.727  -36.703 1.00 0.00  ? 37   DC  B "H5'"  1  
ATOM   4523   H  "H5''" . DC  B 2 37  ? 4.633   -4.109  -37.997 1.00 0.00  ? 37   DC  B "H5''" 1  
ATOM   4524   H  "H4'"  . DC  B 2 37  ? 7.022   -2.495  -37.341 1.00 0.00  ? 37   DC  B "H4'"  1  
ATOM   4525   H  "H3'"  . DC  B 2 37  ? 4.873   -2.932  -35.299 1.00 0.00  ? 37   DC  B "H3'"  1  
ATOM   4526   H  "H2'"  . DC  B 2 37  ? 4.604   -0.624  -34.987 1.00 0.00  ? 37   DC  B "H2'"  1  
ATOM   4527   H  "H2''" . DC  B 2 37  ? 6.280   -0.286  -35.374 1.00 0.00  ? 37   DC  B "H2''" 1  
ATOM   4528   H  "H1'"  . DC  B 2 37  ? 5.710   0.175   -37.580 1.00 0.00  ? 37   DC  B "H1'"  1  
ATOM   4529   H  H41    . DC  B 2 37  ? -0.819  0.990   -37.992 1.00 0.00  ? 37   DC  B H41    1  
ATOM   4530   H  H42    . DC  B 2 37  ? -0.209  2.514   -37.386 1.00 0.00  ? 37   DC  B H42    1  
ATOM   4531   H  H5     . DC  B 2 37  ? 0.592   -0.963  -38.285 1.00 0.00  ? 37   DC  B H5     1  
ATOM   4532   H  H6     . DC  B 2 37  ? 2.854   -1.842  -38.043 1.00 0.00  ? 37   DC  B H6     1  
ATOM   4533   P  P      . DT  B 2 38  ? 6.740   -2.894  -33.336 1.00 0.00  ? 38   DT  B P      1  
ATOM   4534   O  OP1    . DT  B 2 38  ? 7.738   -3.923  -32.947 1.00 0.00  ? 38   DT  B OP1    1  
ATOM   4535   O  OP2    . DT  B 2 38  ? 5.301   -3.124  -33.055 1.00 0.00  ? 38   DT  B OP2    1  
ATOM   4536   O  "O5'"  . DT  B 2 38  ? 7.158   -1.509  -32.668 1.00 0.00  ? 38   DT  B "O5'"  1  
ATOM   4537   C  "C5'"  . DT  B 2 38  ? 8.271   -0.762  -33.160 1.00 0.00  ? 38   DT  B "C5'"  1  
ATOM   4538   C  "C4'"  . DT  B 2 38  ? 8.280   0.620   -32.551 1.00 0.00  ? 38   DT  B "C4'"  1  
ATOM   4539   O  "O4'"  . DT  B 2 38  ? 7.086   1.327   -32.970 1.00 0.00  ? 38   DT  B "O4'"  1  
ATOM   4540   C  "C3'"  . DT  B 2 38  ? 8.255   0.653   -31.023 1.00 0.00  ? 38   DT  B "C3'"  1  
ATOM   4541   O  "O3'"  . DT  B 2 38  ? 8.956   1.805   -30.542 1.00 0.00  ? 38   DT  B "O3'"  1  
ATOM   4542   C  "C2'"  . DT  B 2 38  ? 6.774   0.761   -30.717 1.00 0.00  ? 38   DT  B "C2'"  1  
ATOM   4543   C  "C1'"  . DT  B 2 38  ? 6.308   1.672   -31.835 1.00 0.00  ? 38   DT  B "C1'"  1  
ATOM   4544   N  N1     . DT  B 2 38  ? 4.888   1.534   -32.199 1.00 0.00  ? 38   DT  B N1     1  
ATOM   4545   C  C2     . DT  B 2 38  ? 4.094   2.654   -32.113 1.00 0.00  ? 38   DT  B C2     1  
ATOM   4546   O  O2     . DT  B 2 38  ? 4.514   3.740   -31.749 1.00 0.00  ? 38   DT  B O2     1  
ATOM   4547   N  N3     . DT  B 2 38  ? 2.787   2.456   -32.470 1.00 0.00  ? 38   DT  B N3     1  
ATOM   4548   C  C4     . DT  B 2 38  ? 2.208   1.277   -32.892 1.00 0.00  ? 38   DT  B C4     1  
ATOM   4549   O  O4     . DT  B 2 38  ? 1.013   1.249   -33.175 1.00 0.00  ? 38   DT  B O4     1  
ATOM   4550   C  C5     . DT  B 2 38  ? 3.099   0.140   -32.957 1.00 0.00  ? 38   DT  B C5     1  
ATOM   4551   C  C7     . DT  B 2 38  ? 2.555   -1.182  -33.397 1.00 0.00  ? 38   DT  B C7     1  
ATOM   4552   C  C6     . DT  B 2 38  ? 4.382   0.319   -32.612 1.00 0.00  ? 38   DT  B C6     1  
ATOM   4553   H  "H5'"  . DT  B 2 38  ? 8.202   -0.672  -34.244 1.00 0.00  ? 38   DT  B "H5'"  1  
ATOM   4554   H  "H5''" . DT  B 2 38  ? 9.198   -1.271  -32.901 1.00 0.00  ? 38   DT  B "H5''" 1  
ATOM   4555   H  "H4'"  . DT  B 2 38  ? 9.203   1.114   -32.861 1.00 0.00  ? 38   DT  B "H4'"  1  
ATOM   4556   H  "H3'"  . DT  B 2 38  ? 8.699   -0.247  -30.600 1.00 0.00  ? 38   DT  B "H3'"  1  
ATOM   4557   H  "H2'"  . DT  B 2 38  ? 6.287   -0.214  -30.746 1.00 0.00  ? 38   DT  B "H2'"  1  
ATOM   4558   H  "H2''" . DT  B 2 38  ? 6.599   1.189   -29.730 1.00 0.00  ? 38   DT  B "H2''" 1  
ATOM   4559   H  "H1'"  . DT  B 2 38  ? 6.506   2.717   -31.595 1.00 0.00  ? 38   DT  B "H1'"  1  
ATOM   4560   H  H3     . DT  B 2 38  ? 2.186   3.265   -32.422 1.00 0.00  ? 38   DT  B H3     1  
ATOM   4561   H  H71    . DT  B 2 38  ? 2.399   -1.171  -34.476 1.00 0.00  ? 38   DT  B H71    1  
ATOM   4562   H  H72    . DT  B 2 38  ? 3.262   -1.970  -33.140 1.00 0.00  ? 38   DT  B H72    1  
ATOM   4563   H  H73    . DT  B 2 38  ? 1.605   -1.370  -32.896 1.00 0.00  ? 38   DT  B H73    1  
ATOM   4564   H  H6     . DT  B 2 38  ? 5.058   -0.534  -32.661 1.00 0.00  ? 38   DT  B H6     1  
ATOM   4565   P  P      . DG  B 2 39  ? 9.482   1.842   -29.024 1.00 0.00  ? 39   DG  B P      1  
ATOM   4566   O  OP1    . DG  B 2 39  ? 10.840  2.443   -29.049 1.00 0.00  ? 39   DG  B OP1    1  
ATOM   4567   O  OP2    . DG  B 2 39  ? 9.286   0.497   -28.426 1.00 0.00  ? 39   DG  B OP2    1  
ATOM   4568   O  "O5'"  . DG  B 2 39  ? 8.500   2.864   -28.296 1.00 0.00  ? 39   DG  B "O5'"  1  
ATOM   4569   C  "C5'"  . DG  B 2 39  ? 8.502   4.251   -28.634 1.00 0.00  ? 39   DG  B "C5'"  1  
ATOM   4570   C  "C4'"  . DG  B 2 39  ? 7.459   4.988   -27.826 1.00 0.00  ? 39   DG  B "C4'"  1  
ATOM   4571   O  "O4'"  . DG  B 2 39  ? 6.153   4.646   -28.340 1.00 0.00  ? 39   DG  B "O4'"  1  
ATOM   4572   C  "C3'"  . DG  B 2 39  ? 7.438   4.650   -26.331 1.00 0.00  ? 39   DG  B "C3'"  1  
ATOM   4573   O  "O3'"  . DG  B 2 39  ? 7.601   5.843   -25.559 1.00 0.00  ? 39   DG  B "O3'"  1  
ATOM   4574   C  "C2'"  . DG  B 2 39  ? 6.063   4.044   -26.085 1.00 0.00  ? 39   DG  B "C2'"  1  
ATOM   4575   C  "C1'"  . DG  B 2 39  ? 5.246   4.532   -27.266 1.00 0.00  ? 39   DG  B "C1'"  1  
ATOM   4576   N  N9     . DG  B 2 39  ? 4.176   3.632   -27.683 1.00 0.00  ? 39   DG  B N9     1  
ATOM   4577   C  C8     . DG  B 2 39  ? 4.303   2.318   -28.065 1.00 0.00  ? 39   DG  B C8     1  
ATOM   4578   N  N7     . DG  B 2 39  ? 3.168   1.765   -28.395 1.00 0.00  ? 39   DG  B N7     1  
ATOM   4579   C  C5     . DG  B 2 39  ? 2.232   2.775   -28.218 1.00 0.00  ? 39   DG  B C5     1  
ATOM   4580   C  C6     . DG  B 2 39  ? 0.828   2.771   -28.420 1.00 0.00  ? 39   DG  B C6     1  
ATOM   4581   O  O6     . DG  B 2 39  ? 0.108   1.843   -28.808 1.00 0.00  ? 39   DG  B O6     1  
ATOM   4582   N  N1     . DG  B 2 39  ? 0.264   4.007   -28.121 1.00 0.00  ? 39   DG  B N1     1  
ATOM   4583   C  C2     . DG  B 2 39  ? 0.960   5.107   -27.682 1.00 0.00  ? 39   DG  B C2     1  
ATOM   4584   N  N2     . DG  B 2 39  ? 0.235   6.209   -27.445 1.00 0.00  ? 39   DG  B N2     1  
ATOM   4585   N  N3     . DG  B 2 39  ? 2.270   5.125   -27.490 1.00 0.00  ? 39   DG  B N3     1  
ATOM   4586   C  C4     . DG  B 2 39  ? 2.838   3.933   -27.776 1.00 0.00  ? 39   DG  B C4     1  
ATOM   4587   H  "H5'"  . DG  B 2 39  ? 8.280   4.369   -29.695 1.00 0.00  ? 39   DG  B "H5'"  1  
ATOM   4588   H  "H5''" . DG  B 2 39  ? 9.483   4.678   -28.425 1.00 0.00  ? 39   DG  B "H5''" 1  
ATOM   4589   H  "H4'"  . DG  B 2 39  ? 7.682   6.053   -27.900 1.00 0.00  ? 39   DG  B "H4'"  1  
ATOM   4590   H  "H3'"  . DG  B 2 39  ? 8.237   3.954   -26.077 1.00 0.00  ? 39   DG  B "H3'"  1  
ATOM   4591   H  "H2'"  . DG  B 2 39  ? 6.117   2.955   -26.043 1.00 0.00  ? 39   DG  B "H2'"  1  
ATOM   4592   H  "H2''" . DG  B 2 39  ? 5.650   4.383   -25.135 1.00 0.00  ? 39   DG  B "H2''" 1  
ATOM   4593   H  "H1'"  . DG  B 2 39  ? 4.821   5.520   -27.073 1.00 0.00  ? 39   DG  B "H1'"  1  
ATOM   4594   H  H8     . DG  B 2 39  ? 5.248   1.796   -28.092 1.00 0.00  ? 39   DG  B H8     1  
ATOM   4595   H  H1     . DG  B 2 39  ? -0.733  4.102   -28.238 1.00 0.00  ? 39   DG  B H1     1  
ATOM   4596   H  H21    . DG  B 2 39  ? 0.686   7.052   -27.119 1.00 0.00  ? 39   DG  B H21    1  
ATOM   4597   H  H22    . DG  B 2 39  ? -0.765  6.197   -27.593 1.00 0.00  ? 39   DG  B H22    1  
ATOM   4598   P  P      . DA  B 2 40  ? 8.036   5.740   -24.016 1.00 0.00  ? 40   DA  B P      1  
ATOM   4599   O  OP1    . DA  B 2 40  ? 8.821   6.957   -23.686 1.00 0.00  ? 40   DA  B OP1    1  
ATOM   4600   O  OP2    . DA  B 2 40  ? 8.630   4.399   -23.788 1.00 0.00  ? 40   DA  B OP2    1  
ATOM   4601   O  "O5'"  . DA  B 2 40  ? 6.656   5.810   -23.222 1.00 0.00  ? 40   DA  B "O5'"  1  
ATOM   4602   C  "C5'"  . DA  B 2 40  ? 5.822   6.966   -23.295 1.00 0.00  ? 40   DA  B "C5'"  1  
ATOM   4603   C  "C4'"  . DA  B 2 40  ? 4.621   6.797   -22.395 1.00 0.00  ? 40   DA  B "C4'"  1  
ATOM   4604   O  "O4'"  . DA  B 2 40  ? 3.650   5.953   -23.065 1.00 0.00  ? 40   DA  B "O4'"  1  
ATOM   4605   C  "C3'"  . DA  B 2 40  ? 4.905   6.094   -21.070 1.00 0.00  ? 40   DA  B "C3'"  1  
ATOM   4606   O  "O3'"  . DA  B 2 40  ? 3.955   6.488   -20.074 1.00 0.00  ? 40   DA  B "O3'"  1  
ATOM   4607   C  "C2'"  . DA  B 2 40  ? 4.688   4.640   -21.435 1.00 0.00  ? 40   DA  B "C2'"  1  
ATOM   4608   C  "C1'"  . DA  B 2 40  ? 3.456   4.770   -22.301 1.00 0.00  ? 40   DA  B "C1'"  1  
ATOM   4609   N  N9     . DA  B 2 40  ? 3.213   3.665   -23.226 1.00 0.00  ? 40   DA  B N9     1  
ATOM   4610   C  C8     . DA  B 2 40  ? 4.105   2.771   -23.762 1.00 0.00  ? 40   DA  B C8     1  
ATOM   4611   N  N7     . DA  B 2 40  ? 3.553   1.888   -24.560 1.00 0.00  ? 40   DA  B N7     1  
ATOM   4612   C  C5     . DA  B 2 40  ? 2.207   2.226   -24.547 1.00 0.00  ? 40   DA  B C5     1  
ATOM   4613   C  C6     . DA  B 2 40  ? 1.083   1.675   -25.191 1.00 0.00  ? 40   DA  B C6     1  
ATOM   4614   N  N6     . DA  B 2 40  ? 1.137   0.621   -26.007 1.00 0.00  ? 40   DA  B N6     1  
ATOM   4615   N  N1     . DA  B 2 40  ? -0.117  2.254   -24.962 1.00 0.00  ? 40   DA  B N1     1  
ATOM   4616   C  C2     . DA  B 2 40  ? -0.174  3.313   -24.142 1.00 0.00  ? 40   DA  B C2     1  
ATOM   4617   N  N3     . DA  B 2 40  ? 0.808   3.918   -23.482 1.00 0.00  ? 40   DA  B N3     1  
ATOM   4618   C  C4     . DA  B 2 40  ? 1.986   3.319   -23.731 1.00 0.00  ? 40   DA  B C4     1  
ATOM   4619   H  "H5'"  . DA  B 2 40  ? 5.482   7.110   -24.320 1.00 0.00  ? 40   DA  B "H5'"  1  
ATOM   4620   H  "H5''" . DA  B 2 40  ? 6.385   7.844   -22.978 1.00 0.00  ? 40   DA  B "H5''" 1  
ATOM   4621   H  "H4'"  . DA  B 2 40  ? 4.239   7.791   -22.155 1.00 0.00  ? 40   DA  B "H4'"  1  
ATOM   4622   H  "H3'"  . DA  B 2 40  ? 5.918   6.292   -20.716 1.00 0.00  ? 40   DA  B "H3'"  1  
ATOM   4623   H  "H2'"  . DA  B 2 40  ? 5.538   4.229   -21.979 1.00 0.00  ? 40   DA  B "H2'"  1  
ATOM   4624   H  "H2''" . DA  B 2 40  ? 4.521   4.021   -20.553 1.00 0.00  ? 40   DA  B "H2''" 1  
ATOM   4625   H  "H1'"  . DA  B 2 40  ? 2.566   4.912   -21.687 1.00 0.00  ? 40   DA  B "H1'"  1  
ATOM   4626   H  H8     . DA  B 2 40  ? 5.163   2.791   -23.546 1.00 0.00  ? 40   DA  B H8     1  
ATOM   4627   H  H61    . DA  B 2 40  ? 0.291   0.278   -26.437 1.00 0.00  ? 40   DA  B H61    1  
ATOM   4628   H  H62    . DA  B 2 40  ? 2.020   0.169   -26.195 1.00 0.00  ? 40   DA  B H62    1  
ATOM   4629   H  H2     . DA  B 2 40  ? -1.166  3.737   -23.993 1.00 0.00  ? 40   DA  B H2     1  
ATOM   4630   P  P      . DC  B 2 41  ? 4.296   7.695   -19.071 1.00 0.00  ? 41   DC  B P      1  
ATOM   4631   O  OP1    . DC  B 2 41  ? 4.939   8.772   -19.866 1.00 0.00  ? 41   DC  B OP1    1  
ATOM   4632   O  OP2    . DC  B 2 41  ? 5.004   7.128   -17.895 1.00 0.00  ? 41   DC  B OP2    1  
ATOM   4633   O  "O5'"  . DC  B 2 41  ? 2.862   8.202   -18.592 1.00 0.00  ? 41   DC  B "O5'"  1  
ATOM   4634   C  "C5'"  . DC  B 2 41  ? 2.165   9.223   -19.306 1.00 0.00  ? 41   DC  B "C5'"  1  
ATOM   4635   C  "C4'"  . DC  B 2 41  ? 0.682   8.930   -19.325 1.00 0.00  ? 41   DC  B "C4'"  1  
ATOM   4636   O  "O4'"  . DC  B 2 41  ? 0.465   7.647   -19.959 1.00 0.00  ? 41   DC  B "O4'"  1  
ATOM   4637   C  "C3'"  . DC  B 2 41  ? 0.023   8.813   -17.952 1.00 0.00  ? 41   DC  B "C3'"  1  
ATOM   4638   O  "O3'"  . DC  B 2 41  ? -1.363  9.166   -18.030 1.00 0.00  ? 41   DC  B "O3'"  1  
ATOM   4639   C  "C2'"  . DC  B 2 41  ? 0.179   7.339   -17.635 1.00 0.00  ? 41   DC  B "C2'"  1  
ATOM   4640   C  "C1'"  . DC  B 2 41  ? -0.004  6.702   -19.004 1.00 0.00  ? 41   DC  B "C1'"  1  
ATOM   4641   N  N1     . DC  B 2 41  ? 0.745   5.454   -19.204 1.00 0.00  ? 41   DC  B N1     1  
ATOM   4642   C  C2     . DC  B 2 41  ? 0.156   4.431   -19.948 1.00 0.00  ? 41   DC  B C2     1  
ATOM   4643   O  O2     . DC  B 2 41  ? -0.984  4.602   -20.406 1.00 0.00  ? 41   DC  B O2     1  
ATOM   4644   N  N3     . DC  B 2 41  ? 0.841   3.282   -20.149 1.00 0.00  ? 41   DC  B N3     1  
ATOM   4645   C  C4     . DC  B 2 41  ? 2.065   3.138   -19.637 1.00 0.00  ? 41   DC  B C4     1  
ATOM   4646   N  N4     . DC  B 2 41  ? 2.705   1.990   -19.865 1.00 0.00  ? 41   DC  B N4     1  
ATOM   4647   C  C5     . DC  B 2 41  ? 2.689   4.164   -18.870 1.00 0.00  ? 41   DC  B C5     1  
ATOM   4648   C  C6     . DC  B 2 41  ? 1.997   5.295   -18.678 1.00 0.00  ? 41   DC  B C6     1  
ATOM   4649   H  "H5'"  . DC  B 2 41  ? 2.532   9.270   -20.331 1.00 0.00  ? 41   DC  B "H5'"  1  
ATOM   4650   H  "H5''" . DC  B 2 41  ? 2.332   10.186  -18.823 1.00 0.00  ? 41   DC  B "H5''" 1  
ATOM   4651   H  "H4'"  . DC  B 2 41  ? 0.188   9.753   -19.843 1.00 0.00  ? 41   DC  B "H4'"  1  
ATOM   4652   H  "H3'"  . DC  B 2 41  ? 0.519   9.447   -17.218 1.00 0.00  ? 41   DC  B "H3'"  1  
ATOM   4653   H  "H2'"  . DC  B 2 41  ? 1.159   7.127   -17.208 1.00 0.00  ? 41   DC  B "H2'"  1  
ATOM   4654   H  "H2''" . DC  B 2 41  ? -0.571  7.005   -16.918 1.00 0.00  ? 41   DC  B "H2''" 1  
ATOM   4655   H  "H1'"  . DC  B 2 41  ? -1.059  6.512   -19.209 1.00 0.00  ? 41   DC  B "H1'"  1  
ATOM   4656   H  H41    . DC  B 2 41  ? 3.633   1.843   -19.494 1.00 0.00  ? 41   DC  B H41    1  
ATOM   4657   H  H42    . DC  B 2 41  ? 2.258   1.269   -20.412 1.00 0.00  ? 41   DC  B H42    1  
ATOM   4658   H  H5     . DC  B 2 41  ? 3.689   4.035   -18.457 1.00 0.00  ? 41   DC  B H5     1  
ATOM   4659   H  H6     . DC  B 2 41  ? 2.441   6.099   -18.092 1.00 0.00  ? 41   DC  B H6     1  
ATOM   4660   P  P      . DC  B 2 42  ? -2.195  9.433   -16.681 1.00 0.00  ? 42   DC  B P      1  
ATOM   4661   O  OP1    . DC  B 2 42  ? -2.496  10.885  -16.604 1.00 0.00  ? 42   DC  B OP1    1  
ATOM   4662   O  OP2    . DC  B 2 42  ? -1.461  8.776   -15.570 1.00 0.00  ? 42   DC  B OP2    1  
ATOM   4663   O  "O5'"  . DC  B 2 42  ? -3.570  8.657   -16.903 1.00 0.00  ? 42   DC  B "O5'"  1  
ATOM   4664   C  "C5'"  . DC  B 2 42  ? -3.648  7.518   -17.763 1.00 0.00  ? 42   DC  B "C5'"  1  
ATOM   4665   C  "C4'"  . DC  B 2 42  ? -4.415  6.405   -17.087 1.00 0.00  ? 42   DC  B "C4'"  1  
ATOM   4666   O  "O4'"  . DC  B 2 42  ? -3.704  5.159   -17.291 1.00 0.00  ? 42   DC  B "O4'"  1  
ATOM   4667   C  "C3'"  . DC  B 2 42  ? -4.528  6.522   -15.570 1.00 0.00  ? 42   DC  B "C3'"  1  
ATOM   4668   O  "O3'"  . DC  B 2 42  ? -5.572  5.684   -15.057 1.00 0.00  ? 42   DC  B "O3'"  1  
ATOM   4669   C  "C2'"  . DC  B 2 42  ? -3.201  5.938   -15.139 1.00 0.00  ? 42   DC  B "C2'"  1  
ATOM   4670   C  "C1'"  . DC  B 2 42  ? -3.172  4.722   -16.044 1.00 0.00  ? 42   DC  B "C1'"  1  
ATOM   4671   N  N1     . DC  B 2 42  ? -1.852  4.130   -16.301 1.00 0.00  ? 42   DC  B N1     1  
ATOM   4672   C  C2     . DC  B 2 42  ? -1.791  2.972   -17.075 1.00 0.00  ? 42   DC  B C2     1  
ATOM   4673   O  O2     . DC  B 2 42  ? -2.843  2.498   -17.527 1.00 0.00  ? 42   DC  B O2     1  
ATOM   4674   N  N3     . DC  B 2 42  ? -0.591  2.399   -17.314 1.00 0.00  ? 42   DC  B N3     1  
ATOM   4675   C  C4     . DC  B 2 42  ? 0.518   2.940   -16.809 1.00 0.00  ? 42   DC  B C4     1  
ATOM   4676   N  N4     . DC  B 2 42  ? 1.676   2.333   -17.064 1.00 0.00  ? 42   DC  B N4     1  
ATOM   4677   C  C5     . DC  B 2 42  ? 0.488   4.127   -16.019 1.00 0.00  ? 42   DC  B C5     1  
ATOM   4678   C  C6     . DC  B 2 42  ? -0.710  4.685   -15.794 1.00 0.00  ? 42   DC  B C6     1  
ATOM   4679   H  "H5'"  . DC  B 2 42  ? -2.643  7.168   -18.000 1.00 0.00  ? 42   DC  B "H5'"  1  
ATOM   4680   H  "H5''" . DC  B 2 42  ? -4.158  7.792   -18.686 1.00 0.00  ? 42   DC  B "H5''" 1  
ATOM   4681   H  "H4'"  . DC  B 2 42  ? -5.427  6.398   -17.489 1.00 0.00  ? 42   DC  B "H4'"  1  
ATOM   4682   H  "H3'"  . DC  B 2 42  ? -4.671  7.552   -15.245 1.00 0.00  ? 42   DC  B "H3'"  1  
ATOM   4683   H  "H2'"  . DC  B 2 42  ? -2.375  6.620   -15.328 1.00 0.00  ? 42   DC  B "H2'"  1  
ATOM   4684   H  "H2''" . DC  B 2 42  ? -3.195  5.681   -14.079 1.00 0.00  ? 42   DC  B "H2''" 1  
ATOM   4685   H  "H1'"  . DC  B 2 42  ? -3.830  3.944   -15.658 1.00 0.00  ? 42   DC  B "H1'"  1  
ATOM   4686   H  H41    . DC  B 2 42  ? 2.539   2.707   -16.699 1.00 0.00  ? 42   DC  B H41    1  
ATOM   4687   H  H42    . DC  B 2 42  ? 1.677   1.497   -17.632 1.00 0.00  ? 42   DC  B H42    1  
ATOM   4688   H  H5     . DC  B 2 42  ? 1.401   4.561   -15.614 1.00 0.00  ? 42   DC  B H5     1  
ATOM   4689   H  H6     . DC  B 2 42  ? -0.771  5.598   -15.203 1.00 0.00  ? 42   DC  B H6     1  
ATOM   4690   P  P      . DG  B 2 43  ? -7.099  6.178   -15.085 1.00 0.00  ? 43   DG  B P      1  
ATOM   4691   O  OP1    . DG  B 2 43  ? -7.286  7.063   -16.264 1.00 0.00  ? 43   DG  B OP1    1  
ATOM   4692   O  OP2    . DG  B 2 43  ? -7.430  6.683   -13.729 1.00 0.00  ? 43   DG  B OP2    1  
ATOM   4693   O  "O5'"  . DG  B 2 43  ? -7.918  4.831   -15.326 1.00 0.00  ? 43   DG  B "O5'"  1  
ATOM   4694   C  "C5'"  . DG  B 2 43  ? -7.965  4.218   -16.615 1.00 0.00  ? 43   DG  B "C5'"  1  
ATOM   4695   C  "C4'"  . DG  B 2 43  ? -8.030  2.713   -16.482 1.00 0.00  ? 43   DG  B "C4'"  1  
ATOM   4696   O  "O4'"  . DG  B 2 43  ? -6.687  2.199   -16.307 1.00 0.00  ? 43   DG  B "O4'"  1  
ATOM   4697   C  "C3'"  . DG  B 2 43  ? -8.841  2.187   -15.293 1.00 0.00  ? 43   DG  B "C3'"  1  
ATOM   4698   O  "O3'"  . DG  B 2 43  ? -9.614  1.049   -15.692 1.00 0.00  ? 43   DG  B "O3'"  1  
ATOM   4699   C  "C2'"  . DG  B 2 43  ? -7.782  1.782   -14.283 1.00 0.00  ? 43   DG  B "C2'"  1  
ATOM   4700   C  "C1'"  . DG  B 2 43  ? -6.641  1.344   -15.179 1.00 0.00  ? 43   DG  B "C1'"  1  
ATOM   4701   N  N9     . DG  B 2 43  ? -5.314  1.460   -14.582 1.00 0.00  ? 43   DG  B N9     1  
ATOM   4702   C  C8     . DG  B 2 43  ? -4.823  2.516   -13.854 1.00 0.00  ? 43   DG  B C8     1  
ATOM   4703   N  N7     . DG  B 2 43  ? -3.594  2.339   -13.455 1.00 0.00  ? 43   DG  B N7     1  
ATOM   4704   C  C5     . DG  B 2 43  ? -3.251  1.087   -13.947 1.00 0.00  ? 43   DG  B C5     1  
ATOM   4705   C  C6     . DG  B 2 43  ? -2.041  0.354   -13.835 1.00 0.00  ? 43   DG  B C6     1  
ATOM   4706   O  O6     . DG  B 2 43  ? -0.995  0.677   -13.260 1.00 0.00  ? 43   DG  B O6     1  
ATOM   4707   N  N1     . DG  B 2 43  ? -2.125  -0.875  -14.483 1.00 0.00  ? 43   DG  B N1     1  
ATOM   4708   C  C2     . DG  B 2 43  ? -3.230  -1.340  -15.154 1.00 0.00  ? 43   DG  B C2     1  
ATOM   4709   N  N2     . DG  B 2 43  ? -3.115  -2.553  -15.713 1.00 0.00  ? 43   DG  B N2     1  
ATOM   4710   N  N3     . DG  B 2 43  ? -4.363  -0.666  -15.267 1.00 0.00  ? 43   DG  B N3     1  
ATOM   4711   C  C4     . DG  B 2 43  ? -4.304  0.530   -14.644 1.00 0.00  ? 43   DG  B C4     1  
ATOM   4712   H  "H5'"  . DG  B 2 43  ? -7.073  4.486   -17.181 1.00 0.00  ? 43   DG  B "H5'"  1  
ATOM   4713   H  "H5''" . DG  B 2 43  ? -8.846  4.566   -17.152 1.00 0.00  ? 43   DG  B "H5''" 1  
ATOM   4714   H  "H4'"  . DG  B 2 43  ? -8.517  2.330   -17.381 1.00 0.00  ? 43   DG  B "H4'"  1  
ATOM   4715   H  "H3'"  . DG  B 2 43  ? -9.508  2.954   -14.900 1.00 0.00  ? 43   DG  B "H3'"  1  
ATOM   4716   H  "H2'"  . DG  B 2 43  ? -7.506  2.617   -13.640 1.00 0.00  ? 43   DG  B "H2'"  1  
ATOM   4717   H  "H2''" . DG  B 2 43  ? -8.134  0.975   -13.640 1.00 0.00  ? 43   DG  B "H2''" 1  
ATOM   4718   H  "H1'"  . DG  B 2 43  ? -6.782  0.318   -15.524 1.00 0.00  ? 43   DG  B "H1'"  1  
ATOM   4719   H  H8     . DG  B 2 43  ? -5.397  3.404   -13.634 1.00 0.00  ? 43   DG  B H8     1  
ATOM   4720   H  H1     . DG  B 2 43  ? -1.310  -1.471  -14.458 1.00 0.00  ? 43   DG  B H1     1  
ATOM   4721   H  H21    . DG  B 2 43  ? -3.893  -2.950  -16.220 1.00 0.00  ? 43   DG  B H21    1  
ATOM   4722   H  H22    . DG  B 2 43  ? -2.252  -3.069  -15.627 1.00 0.00  ? 43   DG  B H22    1  
ATOM   4723   P  P      . DC  B 2 44  ? -10.551 0.303   -14.620 1.00 0.00  ? 44   DC  B P      1  
ATOM   4724   O  OP1    . DC  B 2 44  ? -11.761 -0.157  -15.349 1.00 0.00  ? 44   DC  B OP1    1  
ATOM   4725   O  OP2    . DC  B 2 44  ? -10.700 1.178   -13.429 1.00 0.00  ? 44   DC  B OP2    1  
ATOM   4726   O  "O5'"  . DC  B 2 44  ? -9.714  -0.987  -14.203 1.00 0.00  ? 44   DC  B "O5'"  1  
ATOM   4727   C  "C5'"  . DC  B 2 44  ? -9.559  -2.078  -15.109 1.00 0.00  ? 44   DC  B "C5'"  1  
ATOM   4728   C  "C4'"  . DC  B 2 44  ? -8.711  -3.162  -14.486 1.00 0.00  ? 44   DC  B "C4'"  1  
ATOM   4729   O  "O4'"  . DC  B 2 44  ? -7.381  -2.645  -14.267 1.00 0.00  ? 44   DC  B "O4'"  1  
ATOM   4730   C  "C3'"  . DC  B 2 44  ? -9.201  -3.670  -13.125 1.00 0.00  ? 44   DC  B "C3'"  1  
ATOM   4731   O  "O3'"  . DC  B 2 44  ? -9.517  -5.061  -13.206 1.00 0.00  ? 44   DC  B "O3'"  1  
ATOM   4732   C  "C2'"  . DC  B 2 44  ? -8.028  -3.451  -12.179 1.00 0.00  ? 44   DC  B "C2'"  1  
ATOM   4733   C  "C1'"  . DC  B 2 44  ? -6.851  -3.261  -13.117 1.00 0.00  ? 44   DC  B "C1'"  1  
ATOM   4734   N  N1     . DC  B 2 44  ? -5.774  -2.405  -12.600 1.00 0.00  ? 44   DC  B N1     1  
ATOM   4735   C  C2     . DC  B 2 44  ? -4.510  -2.965  -12.402 1.00 0.00  ? 44   DC  B C2     1  
ATOM   4736   O  O2     . DC  B 2 44  ? -4.340  -4.165  -12.663 1.00 0.00  ? 44   DC  B O2     1  
ATOM   4737   N  N3     . DC  B 2 44  ? -3.508  -2.186  -11.935 1.00 0.00  ? 44   DC  B N3     1  
ATOM   4738   C  C4     . DC  B 2 44  ? -3.734  -0.898  -11.666 1.00 0.00  ? 44   DC  B C4     1  
ATOM   4739   N  N4     . DC  B 2 44  ? -2.714  -0.168  -11.211 1.00 0.00  ? 44   DC  B N4     1  
ATOM   4740   C  C5     . DC  B 2 44  ? -5.015  -0.301  -11.854 1.00 0.00  ? 44   DC  B C5     1  
ATOM   4741   C  C6     . DC  B 2 44  ? -5.997  -1.085  -12.318 1.00 0.00  ? 44   DC  B C6     1  
ATOM   4742   H  "H5'"  . DC  B 2 44  ? -9.077  -1.728  -16.021 1.00 0.00  ? 44   DC  B "H5'"  1  
ATOM   4743   H  "H5''" . DC  B 2 44  ? -10.538 -2.489  -15.358 1.00 0.00  ? 44   DC  B "H5''" 1  
ATOM   4744   H  "H4'"  . DC  B 2 44  ? -8.731  -4.020  -15.162 1.00 0.00  ? 44   DC  B "H4'"  1  
ATOM   4745   H  "H3'"  . DC  B 2 44  ? -10.087 -3.125  -12.802 1.00 0.00  ? 44   DC  B "H3'"  1  
ATOM   4746   H  "H2'"  . DC  B 2 44  ? -8.193  -2.579  -11.545 1.00 0.00  ? 44   DC  B "H2'"  1  
ATOM   4747   H  "H2''" . DC  B 2 44  ? -7.889  -4.308  -11.520 1.00 0.00  ? 44   DC  B "H2''" 1  
ATOM   4748   H  "H1'"  . DC  B 2 44  ? -6.424  -4.222  -13.413 1.00 0.00  ? 44   DC  B "H1'"  1  
ATOM   4749   H  H41    . DC  B 2 44  ? -2.850  0.810   -11.000 1.00 0.00  ? 44   DC  B H41    1  
ATOM   4750   H  H42    . DC  B 2 44  ? -1.808  -0.593  -11.076 1.00 0.00  ? 44   DC  B H42    1  
ATOM   4751   H  H5     . DC  B 2 44  ? -5.188  0.751   -11.629 1.00 0.00  ? 44   DC  B H5     1  
ATOM   4752   H  H6     . DC  B 2 44  ? -6.990  -0.662  -12.472 1.00 0.00  ? 44   DC  B H6     1  
ATOM   4753   P  P      . DG  B 2 45  ? -10.539 -5.705  -12.149 1.00 0.00  ? 45   DG  B P      1  
ATOM   4754   O  OP1    . DG  B 2 45  ? -11.436 -6.626  -12.892 1.00 0.00  ? 45   DG  B OP1    1  
ATOM   4755   O  OP2    . DG  B 2 45  ? -11.121 -4.597  -11.353 1.00 0.00  ? 45   DG  B OP2    1  
ATOM   4756   O  "O5'"  . DG  B 2 45  ? -9.609  -6.576  -11.194 1.00 0.00  ? 45   DG  B "O5'"  1  
ATOM   4757   C  "C5'"  . DG  B 2 45  ? -8.803  -7.628  -11.721 1.00 0.00  ? 45   DG  B "C5'"  1  
ATOM   4758   C  "C4'"  . DG  B 2 45  ? -7.616  -7.876  -10.820 1.00 0.00  ? 45   DG  B "C4'"  1  
ATOM   4759   O  "O4'"  . DG  B 2 45  ? -6.841  -6.661  -10.721 1.00 0.00  ? 45   DG  B "O4'"  1  
ATOM   4760   C  "C3'"  . DG  B 2 45  ? -7.973  -8.273  -9.383  1.00 0.00  ? 45   DG  B "C3'"  1  
ATOM   4761   O  "O3'"  . DG  B 2 45  ? -7.455  -9.572  -9.094  1.00 0.00  ? 45   DG  B "O3'"  1  
ATOM   4762   C  "C2'"  . DG  B 2 45  ? -7.295  -7.226  -8.509  1.00 0.00  ? 45   DG  B "C2'"  1  
ATOM   4763   C  "C1'"  . DG  B 2 45  ? -6.266  -6.609  -9.436  1.00 0.00  ? 45   DG  B "C1'"  1  
ATOM   4764   N  N9     . DG  B 2 45  ? -5.936  -5.218  -9.144  1.00 0.00  ? 45   DG  B N9     1  
ATOM   4765   C  C8     . DG  B 2 45  ? -6.808  -4.161  -9.045  1.00 0.00  ? 45   DG  B C8     1  
ATOM   4766   N  N7     . DG  B 2 45  ? -6.219  -3.031  -8.767  1.00 0.00  ? 45   DG  B N7     1  
ATOM   4767   C  C5     . DG  B 2 45  ? -4.874  -3.359  -8.679  1.00 0.00  ? 45   DG  B C5     1  
ATOM   4768   C  C6     . DG  B 2 45  ? -3.744  -2.545  -8.401  1.00 0.00  ? 45   DG  B C6     1  
ATOM   4769   O  O6     . DG  B 2 45  ? -3.707  -1.331  -8.169  1.00 0.00  ? 45   DG  B O6     1  
ATOM   4770   N  N1     . DG  B 2 45  ? -2.565  -3.285  -8.410  1.00 0.00  ? 45   DG  B N1     1  
ATOM   4771   C  C2     . DG  B 2 45  ? -2.482  -4.635  -8.654  1.00 0.00  ? 45   DG  B C2     1  
ATOM   4772   N  N2     . DG  B 2 45  ? -1.252  -5.167  -8.619  1.00 0.00  ? 45   DG  B N2     1  
ATOM   4773   N  N3     . DG  B 2 45  ? -3.526  -5.405  -8.913  1.00 0.00  ? 45   DG  B N3     1  
ATOM   4774   C  C4     . DG  B 2 45  ? -4.682  -4.706  -8.910  1.00 0.00  ? 45   DG  B C4     1  
ATOM   4775   H  "H5'"  . DG  B 2 45  ? -8.446  -7.355  -12.714 1.00 0.00  ? 45   DG  B "H5'"  1  
ATOM   4776   H  "H5''" . DG  B 2 45  ? -9.394  -8.541  -11.792 1.00 0.00  ? 45   DG  B "H5''" 1  
ATOM   4777   H  "H4'"  . DG  B 2 45  ? -7.053  -8.710  -11.242 1.00 0.00  ? 45   DG  B "H4'"  1  
ATOM   4778   H  "H3'"  . DG  B 2 45  ? -9.053  -8.282  -9.238  1.00 0.00  ? 45   DG  B "H3'"  1  
ATOM   4779   H  "HO3'" . DG  B 2 45  ? -7.641  -10.130 -9.852  1.00 0.00  ? 45   DG  B "HO3'" 1  
ATOM   4780   H  "H2'"  . DG  B 2 45  ? -8.015  -6.492  -8.146  1.00 0.00  ? 45   DG  B "H2'"  1  
ATOM   4781   H  "H2''" . DG  B 2 45  ? -6.833  -7.684  -7.635  1.00 0.00  ? 45   DG  B "H2''" 1  
ATOM   4782   H  "H1'"  . DG  B 2 45  ? -5.345  -7.195  -9.451  1.00 0.00  ? 45   DG  B "H1'"  1  
ATOM   4783   H  H8     . DG  B 2 45  ? -7.875  -4.257  -9.184  1.00 0.00  ? 45   DG  B H8     1  
ATOM   4784   H  H1     . DG  B 2 45  ? -1.704  -2.791  -8.223  1.00 0.00  ? 45   DG  B H1     1  
ATOM   4785   H  H21    . DG  B 2 45  ? -1.126  -6.154  -8.791  1.00 0.00  ? 45   DG  B H21    1  
ATOM   4786   H  H22    . DG  B 2 45  ? -0.453  -4.582  -8.422  1.00 0.00  ? 45   DG  B H22    1  
HETATM 4787   ZN ZN     . ZN  C 3 .   ? 6.182   11.533  5.557   1.00 18.88 ? 1000 ZN  A ZN     1  
HETATM 4788   ZN ZN     . ZN  D 3 .   ? -22.273 -9.263  -13.220 1.00 45.67 ? 1001 ZN  A ZN     1  
ATOM   4789   N  N      . MET A 1 1   ? 11.232  -15.007 19.136  1.00 0.00  ? 1    MET A N      2  
ATOM   4790   C  CA     . MET A 1 1   ? 10.690  -14.423 20.397  1.00 0.00  ? 1    MET A CA     2  
ATOM   4791   C  C      . MET A 1 1   ? 10.020  -13.076 20.110  1.00 0.00  ? 1    MET A C      2  
ATOM   4792   O  O      . MET A 1 1   ? 10.241  -12.103 20.804  1.00 0.00  ? 1    MET A O      2  
ATOM   4793   C  CB     . MET A 1 1   ? 11.908  -14.235 21.302  1.00 0.00  ? 1    MET A CB     2  
ATOM   4794   C  CG     . MET A 1 1   ? 12.210  -15.545 22.031  1.00 0.00  ? 1    MET A CG     2  
ATOM   4795   S  SD     . MET A 1 1   ? 13.035  -15.185 23.601  1.00 0.00  ? 1    MET A SD     2  
ATOM   4796   C  CE     . MET A 1 1   ? 11.674  -15.676 24.690  1.00 0.00  ? 1    MET A CE     2  
ATOM   4797   H  H1     . MET A 1 1   ? 11.798  -14.293 18.638  1.00 0.00  ? 1    MET A H1     2  
ATOM   4798   H  H2     . MET A 1 1   ? 10.444  -15.313 18.529  1.00 0.00  ? 1    MET A H2     2  
ATOM   4799   H  H3     . MET A 1 1   ? 11.832  -15.825 19.363  1.00 0.00  ? 1    MET A H3     2  
ATOM   4800   H  HA     . MET A 1 1   ? 9.990   -15.102 20.857  1.00 0.00  ? 1    MET A HA     2  
ATOM   4801   H  HB2    . MET A 1 1   ? 12.761  -13.950 20.702  1.00 0.00  ? 1    MET A HB2    2  
ATOM   4802   H  HB3    . MET A 1 1   ? 11.702  -13.461 22.026  1.00 0.00  ? 1    MET A HB3    2  
ATOM   4803   H  HG2    . MET A 1 1   ? 11.287  -16.072 22.222  1.00 0.00  ? 1    MET A HG2    2  
ATOM   4804   H  HG3    . MET A 1 1   ? 12.854  -16.158 21.418  1.00 0.00  ? 1    MET A HG3    2  
ATOM   4805   H  HE1    . MET A 1 1   ? 11.789  -16.717 24.960  1.00 0.00  ? 1    MET A HE1    2  
ATOM   4806   H  HE2    . MET A 1 1   ? 10.736  -15.541 24.177  1.00 0.00  ? 1    MET A HE2    2  
ATOM   4807   H  HE3    . MET A 1 1   ? 11.688  -15.063 25.580  1.00 0.00  ? 1    MET A HE3    2  
ATOM   4808   N  N      . ALA A 1 2   ? 9.204   -13.014 19.093  1.00 0.00  ? 2    ALA A N      2  
ATOM   4809   C  CA     . ALA A 1 2   ? 8.518   -11.732 18.758  1.00 0.00  ? 2    ALA A CA     2  
ATOM   4810   C  C      . ALA A 1 2   ? 7.001   -11.894 18.886  1.00 0.00  ? 2    ALA A C      2  
ATOM   4811   O  O      . ALA A 1 2   ? 6.488   -12.995 18.939  1.00 0.00  ? 2    ALA A O      2  
ATOM   4812   C  CB     . ALA A 1 2   ? 8.907   -11.441 17.309  1.00 0.00  ? 2    ALA A CB     2  
ATOM   4813   H  H      . ALA A 1 2   ? 9.041   -13.812 18.547  1.00 0.00  ? 2    ALA A H      2  
ATOM   4814   H  HA     . ALA A 1 2   ? 8.869   -10.939 19.400  1.00 0.00  ? 2    ALA A HA     2  
ATOM   4815   H  HB1    . ALA A 1 2   ? 9.865   -11.891 17.095  1.00 0.00  ? 2    ALA A HB1    2  
ATOM   4816   H  HB2    . ALA A 1 2   ? 8.969   -10.373 17.161  1.00 0.00  ? 2    ALA A HB2    2  
ATOM   4817   H  HB3    . ALA A 1 2   ? 8.160   -11.853 16.647  1.00 0.00  ? 2    ALA A HB3    2  
ATOM   4818   N  N      . GLU A 1 3   ? 6.282   -10.804 18.936  1.00 0.00  ? 3    GLU A N      2  
ATOM   4819   C  CA     . GLU A 1 3   ? 4.797   -10.893 19.060  1.00 0.00  ? 3    GLU A CA     2  
ATOM   4820   C  C      . GLU A 1 3   ? 4.125   -10.029 17.990  1.00 0.00  ? 3    GLU A C      2  
ATOM   4821   O  O      . GLU A 1 3   ? 4.384   -8.846  17.881  1.00 0.00  ? 3    GLU A O      2  
ATOM   4822   C  CB     . GLU A 1 3   ? 4.484   -10.357 20.457  1.00 0.00  ? 3    GLU A CB     2  
ATOM   4823   C  CG     . GLU A 1 3   ? 3.175   -10.970 20.958  1.00 0.00  ? 3    GLU A CG     2  
ATOM   4824   C  CD     . GLU A 1 3   ? 3.453   -12.351 21.555  1.00 0.00  ? 3    GLU A CD     2  
ATOM   4825   O  OE1    . GLU A 1 3   ? 3.821   -13.238 20.801  1.00 0.00  ? 3    GLU A OE1    2  
ATOM   4826   O  OE2    . GLU A 1 3   ? 3.294   -12.499 22.756  1.00 0.00  ? 3    GLU A OE2    2  
ATOM   4827   H  H      . GLU A 1 3   ? 6.717   -9.928  18.891  1.00 0.00  ? 3    GLU A H      2  
ATOM   4828   H  HA     . GLU A 1 3   ? 4.472   -11.918 18.976  1.00 0.00  ? 3    GLU A HA     2  
ATOM   4829   H  HB2    . GLU A 1 3   ? 5.287   -10.619 21.131  1.00 0.00  ? 3    GLU A HB2    2  
ATOM   4830   H  HB3    . GLU A 1 3   ? 4.384   -9.283  20.417  1.00 0.00  ? 3    GLU A HB3    2  
ATOM   4831   H  HG2    . GLU A 1 3   ? 2.745   -10.330 21.715  1.00 0.00  ? 3    GLU A HG2    2  
ATOM   4832   H  HG3    . GLU A 1 3   ? 2.485   -11.069 20.134  1.00 0.00  ? 3    GLU A HG3    2  
ATOM   4833   N  N      . SER A 1 4   ? 3.263   -10.611 17.200  1.00 0.00  ? 4    SER A N      2  
ATOM   4834   C  CA     . SER A 1 4   ? 2.572   -9.824  16.137  1.00 0.00  ? 4    SER A CA     2  
ATOM   4835   C  C      . SER A 1 4   ? 1.054   -9.896  16.326  1.00 0.00  ? 4    SER A C      2  
ATOM   4836   O  O      . SER A 1 4   ? 0.567   -10.411 17.314  1.00 0.00  ? 4    SER A O      2  
ATOM   4837   C  CB     . SER A 1 4   ? 2.981   -10.491 14.823  1.00 0.00  ? 4    SER A CB     2  
ATOM   4838   O  OG     . SER A 1 4   ? 3.185   -9.491  13.833  1.00 0.00  ? 4    SER A OG     2  
ATOM   4839   H  H      . SER A 1 4   ? 3.068   -11.565 17.306  1.00 0.00  ? 4    SER A H      2  
ATOM   4840   H  HA     . SER A 1 4   ? 2.905   -8.798  16.149  1.00 0.00  ? 4    SER A HA     2  
ATOM   4841   H  HB2    . SER A 1 4   ? 3.896   -11.040 14.966  1.00 0.00  ? 4    SER A HB2    2  
ATOM   4842   H  HB3    . SER A 1 4   ? 2.200   -11.171 14.508  1.00 0.00  ? 4    SER A HB3    2  
ATOM   4843   H  HG     . SER A 1 4   ? 4.111   -9.238  13.854  1.00 0.00  ? 4    SER A HG     2  
ATOM   4844   N  N      . SER A 1 5   ? 0.305   -9.385  15.386  1.00 0.00  ? 5    SER A N      2  
ATOM   4845   C  CA     . SER A 1 5   ? -1.182  -9.424  15.509  1.00 0.00  ? 5    SER A CA     2  
ATOM   4846   C  C      . SER A 1 5   ? -1.820  -9.655  14.137  1.00 0.00  ? 5    SER A C      2  
ATOM   4847   O  O      . SER A 1 5   ? -1.166  -10.068 13.200  1.00 0.00  ? 5    SER A O      2  
ATOM   4848   C  CB     . SER A 1 5   ? -1.568  -8.051  16.056  1.00 0.00  ? 5    SER A CB     2  
ATOM   4849   O  OG     . SER A 1 5   ? -0.783  -7.765  17.206  1.00 0.00  ? 5    SER A OG     2  
ATOM   4850   H  H      . SER A 1 5   ? 0.720   -8.975  14.598  1.00 0.00  ? 5    SER A H      2  
ATOM   4851   H  HA     . SER A 1 5   ? -1.483  -10.194 16.201  1.00 0.00  ? 5    SER A HA     2  
ATOM   4852   H  HB2    . SER A 1 5   ? -1.387  -7.298  15.307  1.00 0.00  ? 5    SER A HB2    2  
ATOM   4853   H  HB3    . SER A 1 5   ? -2.619  -8.051  16.315  1.00 0.00  ? 5    SER A HB3    2  
ATOM   4854   H  HG     . SER A 1 5   ? -1.361  -7.385  17.873  1.00 0.00  ? 5    SER A HG     2  
ATOM   4855   N  N      . ASP A 1 6   ? -3.094  -9.392  14.014  1.00 54.80 ? 6    ASP A N      2  
ATOM   4856   C  CA     . ASP A 1 6   ? -3.777  -9.596  12.704  1.00 64.03 ? 6    ASP A CA     2  
ATOM   4857   C  C      . ASP A 1 6   ? -4.300  -8.262  12.154  1.00 53.30 ? 6    ASP A C      2  
ATOM   4858   O  O      . ASP A 1 6   ? -4.753  -8.184  11.029  1.00 46.74 ? 6    ASP A O      2  
ATOM   4859   C  CB     . ASP A 1 6   ? -4.940  -10.542 13.008  1.00 72.60 ? 6    ASP A CB     2  
ATOM   4860   C  CG     . ASP A 1 6   ? -5.314  -11.314 11.742  1.00 85.58 ? 6    ASP A CG     2  
ATOM   4861   O  OD1    . ASP A 1 6   ? -5.286  -10.718 10.678  1.00 0.00  ? 6    ASP A OD1    2  
ATOM   4862   O  OD2    . ASP A 1 6   ? -5.622  -12.489 11.858  1.00 78.13 ? 6    ASP A OD2    2  
ATOM   4863   H  H      . ASP A 1 6   ? -3.601  -9.060  14.783  1.00 0.00  ? 6    ASP A H      2  
ATOM   4864   H  HA     . ASP A 1 6   ? -3.106  -10.056 11.997  1.00 0.00  ? 6    ASP A HA     2  
ATOM   4865   H  HB2    . ASP A 1 6   ? -4.645  -11.237 13.781  1.00 0.00  ? 6    ASP A HB2    2  
ATOM   4866   H  HB3    . ASP A 1 6   ? -5.792  -9.970  13.342  1.00 0.00  ? 6    ASP A HB3    2  
ATOM   4867   N  N      . LYS A 1 7   ? -4.238  -7.212  12.934  1.00 51.81 ? 7    LYS A N      2  
ATOM   4868   C  CA     . LYS A 1 7   ? -4.730  -5.888  12.448  1.00 31.86 ? 7    LYS A CA     2  
ATOM   4869   C  C      . LYS A 1 7   ? -3.992  -5.496  11.166  1.00 39.85 ? 7    LYS A C      2  
ATOM   4870   O  O      . LYS A 1 7   ? -2.883  -5.930  10.923  1.00 40.95 ? 7    LYS A O      2  
ATOM   4871   C  CB     . LYS A 1 7   ? -4.411  -4.904  13.574  1.00 32.50 ? 7    LYS A CB     2  
ATOM   4872   C  CG     . LYS A 1 7   ? -5.174  -5.309  14.837  1.00 35.73 ? 7    LYS A CG     2  
ATOM   4873   C  CD     . LYS A 1 7   ? -6.500  -4.546  14.899  1.00 29.85 ? 7    LYS A CD     2  
ATOM   4874   C  CE     . LYS A 1 7   ? -6.955  -4.432  16.356  1.00 29.89 ? 7    LYS A CE     2  
ATOM   4875   N  NZ     . LYS A 1 7   ? -7.702  -5.693  16.625  1.00 29.51 ? 7    LYS A NZ     2  
ATOM   4876   H  H      . LYS A 1 7   ? -3.867  -7.294  13.838  1.00 0.00  ? 7    LYS A H      2  
ATOM   4877   H  HA     . LYS A 1 7   ? -5.794  -5.921  12.276  1.00 0.00  ? 7    LYS A HA     2  
ATOM   4878   H  HB2    . LYS A 1 7   ? -3.349  -4.919  13.774  1.00 0.00  ? 7    LYS A HB2    2  
ATOM   4879   H  HB3    . LYS A 1 7   ? -4.709  -3.909  13.279  1.00 0.00  ? 7    LYS A HB3    2  
ATOM   4880   H  HG2    . LYS A 1 7   ? -5.369  -6.371  14.815  1.00 0.00  ? 7    LYS A HG2    2  
ATOM   4881   H  HG3    . LYS A 1 7   ? -4.583  -5.069  15.708  1.00 0.00  ? 7    LYS A HG3    2  
ATOM   4882   H  HD2    . LYS A 1 7   ? -6.365  -3.558  14.484  1.00 0.00  ? 7    LYS A HD2    2  
ATOM   4883   H  HD3    . LYS A 1 7   ? -7.248  -5.078  14.331  1.00 0.00  ? 7    LYS A HD3    2  
ATOM   4884   H  HE2    . LYS A 1 7   ? -6.099  -4.351  17.011  1.00 0.00  ? 7    LYS A HE2    2  
ATOM   4885   H  HE3    . LYS A 1 7   ? -7.608  -3.582  16.481  1.00 0.00  ? 7    LYS A HE3    2  
ATOM   4886   H  HZ1    . LYS A 1 7   ? -8.529  -5.746  15.999  1.00 0.00  ? 7    LYS A HZ1    2  
ATOM   4887   H  HZ2    . LYS A 1 7   ? -8.014  -5.704  17.618  1.00 0.00  ? 7    LYS A HZ2    2  
ATOM   4888   H  HZ3    . LYS A 1 7   ? -7.081  -6.508  16.447  1.00 0.00  ? 7    LYS A HZ3    2  
ATOM   4889   N  N      . LEU A 1 8   ? -4.601  -4.690  10.340  1.00 34.86 ? 8    LEU A N      2  
ATOM   4890   C  CA     . LEU A 1 8   ? -3.934  -4.284  9.070   1.00 26.44 ? 8    LEU A CA     2  
ATOM   4891   C  C      . LEU A 1 8   ? -3.072  -3.033  9.276   1.00 31.60 ? 8    LEU A C      2  
ATOM   4892   O  O      . LEU A 1 8   ? -2.206  -2.735  8.478   1.00 29.79 ? 8    LEU A O      2  
ATOM   4893   C  CB     . LEU A 1 8   ? -5.080  -3.985  8.102   1.00 27.59 ? 8    LEU A CB     2  
ATOM   4894   C  CG     . LEU A 1 8   ? -4.687  -4.426  6.691   1.00 38.31 ? 8    LEU A CG     2  
ATOM   4895   C  CD1    . LEU A 1 8   ? -4.826  -5.944  6.573   1.00 41.64 ? 8    LEU A CD1    2  
ATOM   4896   C  CD2    . LEU A 1 8   ? -5.607  -3.749  5.673   1.00 38.17 ? 8    LEU A CD2    2  
ATOM   4897   H  H      . LEU A 1 8   ? -5.498  -4.359  10.551  1.00 0.00  ? 8    LEU A H      2  
ATOM   4898   H  HA     . LEU A 1 8   ? -3.335  -5.093  8.685   1.00 0.00  ? 8    LEU A HA     2  
ATOM   4899   H  HB2    . LEU A 1 8   ? -5.964  -4.524  8.415   1.00 0.00  ? 8    LEU A HB2    2  
ATOM   4900   H  HB3    . LEU A 1 8   ? -5.286  -2.926  8.103   1.00 0.00  ? 8    LEU A HB3    2  
ATOM   4901   H  HG     . LEU A 1 8   ? -3.662  -4.142  6.499   1.00 0.00  ? 8    LEU A HG     2  
ATOM   4902   H  HD11   . LEU A 1 8   ? -3.953  -6.420  6.992   1.00 0.00  ? 8    LEU A HD11   2  
ATOM   4903   H  HD12   . LEU A 1 8   ? -4.919  -6.216  5.531   1.00 0.00  ? 8    LEU A HD12   2  
ATOM   4904   H  HD13   . LEU A 1 8   ? -5.706  -6.269  7.109   1.00 0.00  ? 8    LEU A HD13   2  
ATOM   4905   H  HD21   . LEU A 1 8   ? -5.330  -4.059  4.676   1.00 0.00  ? 8    LEU A HD21   2  
ATOM   4906   H  HD22   . LEU A 1 8   ? -5.509  -2.676  5.756   1.00 0.00  ? 8    LEU A HD22   2  
ATOM   4907   H  HD23   . LEU A 1 8   ? -6.630  -4.034  5.867   1.00 0.00  ? 8    LEU A HD23   2  
ATOM   4908   N  N      . TYR A 1 9   ? -3.310  -2.284  10.323  1.00 29.00 ? 9    TYR A N      2  
ATOM   4909   C  CA     . TYR A 1 9   ? -2.501  -1.044  10.540  1.00 21.84 ? 9    TYR A CA     2  
ATOM   4910   C  C      . TYR A 1 9   ? -1.899  -0.992  11.950  1.00 25.22 ? 9    TYR A C      2  
ATOM   4911   O  O      . TYR A 1 9   ? -2.356  -1.650  12.867  1.00 24.44 ? 9    TYR A O      2  
ATOM   4912   C  CB     . TYR A 1 9   ? -3.493  0.105   10.348  1.00 21.43 ? 9    TYR A CB     2  
ATOM   4913   C  CG     . TYR A 1 9   ? -4.000  0.096   8.938   1.00 28.57 ? 9    TYR A CG     2  
ATOM   4914   C  CD1    . TYR A 1 9   ? -3.177  0.562   7.896   1.00 27.44 ? 9    TYR A CD1    2  
ATOM   4915   C  CD2    . TYR A 1 9   ? -5.303  -0.369  8.665   1.00 31.67 ? 9    TYR A CD2    2  
ATOM   4916   C  CE1    . TYR A 1 9   ? -3.656  0.562   6.577   1.00 31.63 ? 9    TYR A CE1    2  
ATOM   4917   C  CE2    . TYR A 1 9   ? -5.783  -0.368  7.345   1.00 29.62 ? 9    TYR A CE2    2  
ATOM   4918   C  CZ     . TYR A 1 9   ? -4.956  0.099   6.304   1.00 34.34 ? 9    TYR A CZ     2  
ATOM   4919   O  OH     . TYR A 1 9   ? -5.415  0.093   5.008   1.00 40.45 ? 9    TYR A OH     2  
ATOM   4920   H  H      . TYR A 1 9   ? -4.029  -2.526  10.946  1.00 0.00  ? 9    TYR A H      2  
ATOM   4921   H  HA     . TYR A 1 9   ? -1.719  -0.977  9.803   1.00 0.00  ? 9    TYR A HA     2  
ATOM   4922   H  HB2    . TYR A 1 9   ? -4.326  -0.016  11.024  1.00 0.00  ? 9    TYR A HB2    2  
ATOM   4923   H  HB3    . TYR A 1 9   ? -3.002  1.046   10.544  1.00 0.00  ? 9    TYR A HB3    2  
ATOM   4924   H  HD1    . TYR A 1 9   ? -2.174  0.918   8.108   1.00 0.00  ? 9    TYR A HD1    2  
ATOM   4925   H  HD2    . TYR A 1 9   ? -5.933  -0.728  9.470   1.00 0.00  ? 9    TYR A HD2    2  
ATOM   4926   H  HE1    . TYR A 1 9   ? -3.025  0.923   5.769   1.00 0.00  ? 9    TYR A HE1    2  
ATOM   4927   H  HE2    . TYR A 1 9   ? -6.791  -0.724  7.131   1.00 0.00  ? 9    TYR A HE2    2  
ATOM   4928   H  HH     . TYR A 1 9   ? -4.758  -0.345  4.470   1.00 0.00  ? 9    TYR A HH     2  
ATOM   4929   N  N      . ARG A 1 10  ? -0.878  -0.191  12.115  1.00 20.35 ? 10   ARG A N      2  
ATOM   4930   C  CA     . ARG A 1 10  ? -0.231  -0.057  13.445  1.00 18.98 ? 10   ARG A CA     2  
ATOM   4931   C  C      . ARG A 1 10  ? 0.118   1.414   13.702  1.00 15.07 ? 10   ARG A C      2  
ATOM   4932   O  O      . ARG A 1 10  ? 0.555   2.126   12.817  1.00 21.03 ? 10   ARG A O      2  
ATOM   4933   C  CB     . ARG A 1 10  ? 1.039   -0.918  13.361  1.00 17.85 ? 10   ARG A CB     2  
ATOM   4934   C  CG     . ARG A 1 10  ? 1.852   -0.768  14.652  1.00 23.08 ? 10   ARG A CG     2  
ATOM   4935   C  CD     . ARG A 1 10  ? 1.599   -1.958  15.575  1.00 22.56 ? 10   ARG A CD     2  
ATOM   4936   N  NE     . ARG A 1 10  ? 1.477   -1.358  16.935  1.00 46.91 ? 10   ARG A NE     2  
ATOM   4937   C  CZ     . ARG A 1 10  ? 1.638   -2.100  18.002  1.00 43.06 ? 10   ARG A CZ     2  
ATOM   4938   N  NH1    . ARG A 1 10  ? 1.905   -3.377  17.886  1.00 38.56 ? 10   ARG A NH1    2  
ATOM   4939   N  NH2    . ARG A 1 10  ? 1.529   -1.564  19.188  1.00 16.57 ? 10   ARG A NH2    2  
ATOM   4940   H  H      . ARG A 1 10  ? -0.543  0.332   11.355  1.00 0.00  ? 10   ARG A H      2  
ATOM   4941   H  HA     . ARG A 1 10  ? -0.882  -0.433  14.218  1.00 0.00  ? 10   ARG A HA     2  
ATOM   4942   H  HB2    . ARG A 1 10  ? 0.765   -1.956  13.222  1.00 0.00  ? 10   ARG A HB2    2  
ATOM   4943   H  HB3    . ARG A 1 10  ? 1.639   -0.592  12.525  1.00 0.00  ? 10   ARG A HB3    2  
ATOM   4944   H  HG2    . ARG A 1 10  ? 2.904   -0.724  14.413  1.00 0.00  ? 10   ARG A HG2    2  
ATOM   4945   H  HG3    . ARG A 1 10  ? 1.560   0.140   15.156  1.00 0.00  ? 10   ARG A HG3    2  
ATOM   4946   H  HD2    . ARG A 1 10  ? 0.686   -2.466  15.297  1.00 0.00  ? 10   ARG A HD2    2  
ATOM   4947   H  HD3    . ARG A 1 10  ? 2.436   -2.639  15.546  1.00 0.00  ? 10   ARG A HD3    2  
ATOM   4948   H  HE     . ARG A 1 10  ? 1.277   -0.403  17.032  1.00 0.00  ? 10   ARG A HE     2  
ATOM   4949   H  HH11   . ARG A 1 10  ? 1.989   -3.793  16.979  1.00 0.00  ? 10   ARG A HH11   2  
ATOM   4950   H  HH12   . ARG A 1 10  ? 2.028   -3.937  18.704  1.00 0.00  ? 10   ARG A HH12   2  
ATOM   4951   H  HH21   . ARG A 1 10  ? 1.323   -0.588  19.281  1.00 0.00  ? 10   ARG A HH21   2  
ATOM   4952   H  HH22   . ARG A 1 10  ? 1.651   -2.128  20.004  1.00 0.00  ? 10   ARG A HH22   2  
ATOM   4953   N  N      . VAL A 1 11  ? -0.051  1.852   14.912  1.00 16.36 ? 11   VAL A N      2  
ATOM   4954   C  CA     . VAL A 1 11  ? 0.287   3.258   15.260  1.00 15.61 ? 11   VAL A CA     2  
ATOM   4955   C  C      . VAL A 1 11  ? 1.128   3.248   16.530  1.00 20.09 ? 11   VAL A C      2  
ATOM   4956   O  O      . VAL A 1 11  ? 0.861   2.492   17.448  1.00 21.30 ? 11   VAL A O      2  
ATOM   4957   C  CB     . VAL A 1 11  ? -1.054  3.960   15.494  1.00 14.54 ? 11   VAL A CB     2  
ATOM   4958   C  CG1    . VAL A 1 11  ? -1.808  3.258   16.624  1.00 15.65 ? 11   VAL A CG1    2  
ATOM   4959   C  CG2    . VAL A 1 11  ? -0.811  5.424   15.877  1.00 13.69 ? 11   VAL A CG2    2  
ATOM   4960   H  H      . VAL A 1 11  ? -0.383  1.244   15.605  1.00 0.00  ? 11   VAL A H      2  
ATOM   4961   H  HA     . VAL A 1 11  ? 0.823   3.733   14.453  1.00 0.00  ? 11   VAL A HA     2  
ATOM   4962   H  HB     . VAL A 1 11  ? -1.645  3.918   14.589  1.00 0.00  ? 11   VAL A HB     2  
ATOM   4963   H  HG11   . VAL A 1 11  ? -2.793  3.689   16.723  1.00 0.00  ? 11   VAL A HG11   2  
ATOM   4964   H  HG12   . VAL A 1 11  ? -1.266  3.384   17.551  1.00 0.00  ? 11   VAL A HG12   2  
ATOM   4965   H  HG13   . VAL A 1 11  ? -1.895  2.207   16.398  1.00 0.00  ? 11   VAL A HG13   2  
ATOM   4966   H  HG21   . VAL A 1 11  ? -1.755  5.948   15.915  1.00 0.00  ? 11   VAL A HG21   2  
ATOM   4967   H  HG22   . VAL A 1 11  ? -0.171  5.889   15.142  1.00 0.00  ? 11   VAL A HG22   2  
ATOM   4968   H  HG23   . VAL A 1 11  ? -0.336  5.470   16.846  1.00 0.00  ? 11   VAL A HG23   2  
ATOM   4969   N  N      . GLU A 1 12  ? 2.148   4.057   16.591  1.00 14.48 ? 12   GLU A N      2  
ATOM   4970   C  CA     . GLU A 1 12  ? 3.003   4.064   17.812  1.00 13.47 ? 12   GLU A CA     2  
ATOM   4971   C  C      . GLU A 1 12  ? 4.027   5.188   17.750  1.00 17.08 ? 12   GLU A C      2  
ATOM   4972   O  O      . GLU A 1 12  ? 4.251   5.788   16.713  1.00 19.42 ? 12   GLU A O      2  
ATOM   4973   C  CB     . GLU A 1 12  ? 3.714   2.708   17.797  1.00 15.15 ? 12   GLU A CB     2  
ATOM   4974   C  CG     . GLU A 1 12  ? 4.520   2.574   16.501  1.00 18.26 ? 12   GLU A CG     2  
ATOM   4975   C  CD     . GLU A 1 12  ? 5.424   1.347   16.577  1.00 22.80 ? 12   GLU A CD     2  
ATOM   4976   O  OE1    . GLU A 1 12  ? 4.953   0.312   17.012  1.00 24.21 ? 12   GLU A OE1    2  
ATOM   4977   O  OE2    . GLU A 1 12  ? 6.578   1.464   16.188  1.00 21.80 ? 12   GLU A OE2    2  
ATOM   4978   H  H      . GLU A 1 12  ? 2.359   4.649   15.836  1.00 0.00  ? 12   GLU A H      2  
ATOM   4979   H  HA     . GLU A 1 12  ? 2.396   4.152   18.700  1.00 0.00  ? 12   GLU A HA     2  
ATOM   4980   H  HB2    . GLU A 1 12  ? 4.377   2.637   18.647  1.00 0.00  ? 12   GLU A HB2    2  
ATOM   4981   H  HB3    . GLU A 1 12  ? 2.980   1.917   17.845  1.00 0.00  ? 12   GLU A HB3    2  
ATOM   4982   H  HG2    . GLU A 1 12  ? 3.843   2.468   15.668  1.00 0.00  ? 12   GLU A HG2    2  
ATOM   4983   H  HG3    . GLU A 1 12  ? 5.127   3.456   16.360  1.00 0.00  ? 12   GLU A HG3    2  
ATOM   4984   N  N      . TYR A 1 13  ? 4.678   5.444   18.849  1.00 14.81 ? 13   TYR A N      2  
ATOM   4985   C  CA     . TYR A 1 13  ? 5.723   6.485   18.859  1.00 16.02 ? 13   TYR A CA     2  
ATOM   4986   C  C      . TYR A 1 13  ? 6.993   5.846   18.293  1.00 19.33 ? 13   TYR A C      2  
ATOM   4987   O  O      . TYR A 1 13  ? 7.394   4.782   18.719  1.00 17.84 ? 13   TYR A O      2  
ATOM   4988   C  CB     . TYR A 1 13  ? 5.881   6.889   20.327  1.00 17.04 ? 13   TYR A CB     2  
ATOM   4989   C  CG     . TYR A 1 13  ? 4.620   7.555   20.792  1.00 17.46 ? 13   TYR A CG     2  
ATOM   4990   C  CD1    . TYR A 1 13  ? 4.170   8.734   20.161  1.00 16.26 ? 13   TYR A CD1    2  
ATOM   4991   C  CD2    . TYR A 1 13  ? 3.889   6.999   21.861  1.00 15.25 ? 13   TYR A CD2    2  
ATOM   4992   C  CE1    . TYR A 1 13  ? 2.990   9.354   20.601  1.00 18.44 ? 13   TYR A CE1    2  
ATOM   4993   C  CE2    . TYR A 1 13  ? 2.709   7.621   22.302  1.00 16.23 ? 13   TYR A CE2    2  
ATOM   4994   C  CZ     . TYR A 1 13  ? 2.262   8.798   21.670  1.00 21.10 ? 13   TYR A CZ     2  
ATOM   4995   O  OH     . TYR A 1 13  ? 1.102   9.405   22.085  1.00 23.72 ? 13   TYR A OH     2  
ATOM   4996   H  H      . TYR A 1 13  ? 4.495   4.911   19.649  1.00 0.00  ? 13   TYR A H      2  
ATOM   4997   H  HA     . TYR A 1 13  ? 5.425   7.333   18.260  1.00 0.00  ? 13   TYR A HA     2  
ATOM   4998   H  HB2    . TYR A 1 13  ? 6.064   6.009   20.927  1.00 0.00  ? 13   TYR A HB2    2  
ATOM   4999   H  HB3    . TYR A 1 13  ? 6.708   7.576   20.429  1.00 0.00  ? 13   TYR A HB3    2  
ATOM   5000   H  HD1    . TYR A 1 13  ? 4.732   9.161   19.337  1.00 0.00  ? 13   TYR A HD1    2  
ATOM   5001   H  HD2    . TYR A 1 13  ? 4.234   6.092   22.344  1.00 0.00  ? 13   TYR A HD2    2  
ATOM   5002   H  HE1    . TYR A 1 13  ? 2.640   10.265  20.121  1.00 0.00  ? 13   TYR A HE1    2  
ATOM   5003   H  HE2    . TYR A 1 13  ? 2.144   7.195   23.131  1.00 0.00  ? 13   TYR A HE2    2  
ATOM   5004   H  HH     . TYR A 1 13  ? 0.604   9.646   21.303  1.00 0.00  ? 13   TYR A HH     2  
ATOM   5005   N  N      . ALA A 1 14  ? 7.577   6.458   17.298  1.00 20.52 ? 14   ALA A N      2  
ATOM   5006   C  CA     . ALA A 1 14  ? 8.790   5.878   16.618  1.00 17.91 ? 14   ALA A CA     2  
ATOM   5007   C  C      . ALA A 1 14  ? 9.798   5.250   17.591  1.00 19.42 ? 14   ALA A C      2  
ATOM   5008   O  O      . ALA A 1 14  ? 10.375  5.916   18.427  1.00 23.20 ? 14   ALA A O      2  
ATOM   5009   C  CB     . ALA A 1 14  ? 9.423   7.063   15.900  1.00 18.67 ? 14   ALA A CB     2  
ATOM   5010   H  H      . ALA A 1 14  ? 7.186   7.283   16.939  1.00 0.00  ? 14   ALA A H      2  
ATOM   5011   H  HA     . ALA A 1 14  ? 8.487   5.147   15.888  1.00 0.00  ? 14   ALA A HA     2  
ATOM   5012   H  HB1    . ALA A 1 14  ? 10.484  6.898   15.799  1.00 0.00  ? 14   ALA A HB1    2  
ATOM   5013   H  HB2    . ALA A 1 14  ? 9.250   7.962   16.475  1.00 0.00  ? 14   ALA A HB2    2  
ATOM   5014   H  HB3    . ALA A 1 14  ? 8.980   7.170   14.921  1.00 0.00  ? 14   ALA A HB3    2  
ATOM   5015   N  N      . LYS A 1 15  ? 10.031  3.966   17.450  1.00 17.87 ? 15   LYS A N      2  
ATOM   5016   C  CA     . LYS A 1 15  ? 11.024  3.273   18.328  1.00 13.86 ? 15   LYS A CA     2  
ATOM   5017   C  C      . LYS A 1 15  ? 12.438  3.751   17.972  1.00 22.04 ? 15   LYS A C      2  
ATOM   5018   O  O      . LYS A 1 15  ? 13.362  3.645   18.757  1.00 27.53 ? 15   LYS A O      2  
ATOM   5019   C  CB     . LYS A 1 15  ? 10.859  1.788   18.016  1.00 14.26 ? 15   LYS A CB     2  
ATOM   5020   C  CG     . LYS A 1 15  ? 9.493   1.311   18.515  1.00 21.40 ? 15   LYS A CG     2  
ATOM   5021   C  CD     . LYS A 1 15  ? 9.455   -0.219  18.505  1.00 27.44 ? 15   LYS A CD     2  
ATOM   5022   C  CE     . LYS A 1 15  ? 8.447   -0.718  19.546  1.00 36.58 ? 15   LYS A CE     2  
ATOM   5023   N  NZ     . LYS A 1 15  ? 7.832   -1.937  18.946  1.00 57.35 ? 15   LYS A NZ     2  
ATOM   5024   H  H      . LYS A 1 15  ? 9.567   3.467   16.747  1.00 0.00  ? 15   LYS A H      2  
ATOM   5025   H  HA     . LYS A 1 15  ? 10.809  3.465   19.368  1.00 0.00  ? 15   LYS A HA     2  
ATOM   5026   H  HB2    . LYS A 1 15  ? 10.928  1.637   16.951  1.00 0.00  ? 15   LYS A HB2    2  
ATOM   5027   H  HB3    . LYS A 1 15  ? 11.636  1.227   18.512  1.00 0.00  ? 15   LYS A HB3    2  
ATOM   5028   H  HG2    . LYS A 1 15  ? 9.329   1.671   19.520  1.00 0.00  ? 15   LYS A HG2    2  
ATOM   5029   H  HG3    . LYS A 1 15  ? 8.720   1.692   17.865  1.00 0.00  ? 15   LYS A HG3    2  
ATOM   5030   H  HD2    . LYS A 1 15  ? 9.164   -0.565  17.524  1.00 0.00  ? 15   LYS A HD2    2  
ATOM   5031   H  HD3    . LYS A 1 15  ? 10.435  -0.603  18.745  1.00 0.00  ? 15   LYS A HD3    2  
ATOM   5032   H  HE2    . LYS A 1 15  ? 8.954   -0.966  20.469  1.00 0.00  ? 15   LYS A HE2    2  
ATOM   5033   H  HE3    . LYS A 1 15  ? 7.689   0.029   19.724  1.00 0.00  ? 15   LYS A HE3    2  
ATOM   5034   H  HZ1    . LYS A 1 15  ? 8.575   -2.624  18.715  1.00 0.00  ? 15   LYS A HZ1    2  
ATOM   5035   H  HZ2    . LYS A 1 15  ? 7.317   -1.675  18.080  1.00 0.00  ? 15   LYS A HZ2    2  
ATOM   5036   H  HZ3    . LYS A 1 15  ? 7.170   -2.363  19.627  1.00 0.00  ? 15   LYS A HZ3    2  
ATOM   5037   N  N      . SER A 1 16  ? 12.598  4.293   16.790  1.00 25.48 ? 16   SER A N      2  
ATOM   5038   C  CA     . SER A 1 16  ? 13.916  4.817   16.356  1.00 21.30 ? 16   SER A CA     2  
ATOM   5039   C  C      . SER A 1 16  ? 13.697  5.955   15.346  1.00 24.91 ? 16   SER A C      2  
ATOM   5040   O  O      . SER A 1 16  ? 12.572  6.258   14.988  1.00 20.61 ? 16   SER A O      2  
ATOM   5041   C  CB     . SER A 1 16  ? 14.608  3.637   15.687  1.00 23.39 ? 16   SER A CB     2  
ATOM   5042   O  OG     . SER A 1 16  ? 14.353  3.671   14.288  1.00 25.58 ? 16   SER A OG     2  
ATOM   5043   H  H      . SER A 1 16  ? 11.833  4.369   16.185  1.00 0.00  ? 16   SER A H      2  
ATOM   5044   H  HA     . SER A 1 16  ? 14.490  5.154   17.204  1.00 0.00  ? 16   SER A HA     2  
ATOM   5045   H  HB2    . SER A 1 16  ? 15.668  3.698   15.858  1.00 0.00  ? 16   SER A HB2    2  
ATOM   5046   H  HB3    . SER A 1 16  ? 14.229  2.716   16.110  1.00 0.00  ? 16   SER A HB3    2  
ATOM   5047   H  HG     . SER A 1 16  ? 14.424  2.778   13.951  1.00 0.00  ? 16   SER A HG     2  
ATOM   5048   N  N      . GLY A 1 17  ? 14.754  6.581   14.883  1.00 24.25 ? 17   GLY A N      2  
ATOM   5049   C  CA     . GLY A 1 17  ? 14.584  7.700   13.914  1.00 20.02 ? 17   GLY A CA     2  
ATOM   5050   C  C      . GLY A 1 17  ? 15.163  7.276   12.561  1.00 23.96 ? 17   GLY A C      2  
ATOM   5051   O  O      . GLY A 1 17  ? 15.485  8.100   11.727  1.00 19.85 ? 17   GLY A O      2  
ATOM   5052   H  H      . GLY A 1 17  ? 15.639  6.345   15.231  1.00 0.00  ? 17   GLY A H      2  
ATOM   5053   H  HA2    . GLY A 1 17  ? 13.533  7.927   13.806  1.00 0.00  ? 17   GLY A HA2    2  
ATOM   5054   H  HA3    . GLY A 1 17  ? 15.107  8.577   14.267  1.00 0.00  ? 17   GLY A HA3    2  
ATOM   5055   N  N      . ARG A 1 18  ? 15.312  5.987   12.344  1.00 20.35 ? 18   ARG A N      2  
ATOM   5056   C  CA     . ARG A 1 18  ? 15.895  5.492   11.058  1.00 21.35 ? 18   ARG A CA     2  
ATOM   5057   C  C      . ARG A 1 18  ? 14.817  5.126   10.027  1.00 22.05 ? 18   ARG A C      2  
ATOM   5058   O  O      . ARG A 1 18  ? 15.105  4.998   8.850   1.00 21.05 ? 18   ARG A O      2  
ATOM   5059   C  CB     . ARG A 1 18  ? 16.668  4.228   11.452  1.00 23.28 ? 18   ARG A CB     2  
ATOM   5060   C  CG     . ARG A 1 18  ? 18.069  4.607   11.943  1.00 30.52 ? 18   ARG A CG     2  
ATOM   5061   C  CD     . ARG A 1 18  ? 18.516  3.620   13.017  1.00 39.33 ? 18   ARG A CD     2  
ATOM   5062   N  NE     . ARG A 1 18  ? 18.743  2.340   12.289  1.00 41.65 ? 18   ARG A NE     2  
ATOM   5063   C  CZ     . ARG A 1 18  ? 18.797  1.210   12.944  1.00 47.92 ? 18   ARG A CZ     2  
ATOM   5064   N  NH1    . ARG A 1 18  ? 18.665  1.195   14.247  1.00 48.84 ? 18   ARG A NH1    2  
ATOM   5065   N  NH2    . ARG A 1 18  ? 18.987  0.094   12.294  1.00 49.24 ? 18   ARG A NH2    2  
ATOM   5066   H  H      . ARG A 1 18  ? 15.061  5.343   13.037  1.00 0.00  ? 18   ARG A H      2  
ATOM   5067   H  HA     . ARG A 1 18  ? 16.580  6.220   10.652  1.00 0.00  ? 18   ARG A HA     2  
ATOM   5068   H  HB2    . ARG A 1 18  ? 16.137  3.713   12.240  1.00 0.00  ? 18   ARG A HB2    2  
ATOM   5069   H  HB3    . ARG A 1 18  ? 16.754  3.578   10.595  1.00 0.00  ? 18   ARG A HB3    2  
ATOM   5070   H  HG2    . ARG A 1 18  ? 18.763  4.572   11.116  1.00 0.00  ? 18   ARG A HG2    2  
ATOM   5071   H  HG3    . ARG A 1 18  ? 18.052  5.602   12.359  1.00 0.00  ? 18   ARG A HG3    2  
ATOM   5072   H  HD2    . ARG A 1 18  ? 19.432  3.957   13.481  1.00 0.00  ? 18   ARG A HD2    2  
ATOM   5073   H  HD3    . ARG A 1 18  ? 17.741  3.490   13.756  1.00 0.00  ? 18   ARG A HD3    2  
ATOM   5074   H  HE     . ARG A 1 18  ? 18.851  2.343   11.314  1.00 0.00  ? 18   ARG A HE     2  
ATOM   5075   H  HH11   . ARG A 1 18  ? 18.525  2.049   14.749  1.00 0.00  ? 18   ARG A HH11   2  
ATOM   5076   H  HH12   . ARG A 1 18  ? 18.707  0.328   14.744  1.00 0.00  ? 18   ARG A HH12   2  
ATOM   5077   H  HH21   . ARG A 1 18  ? 19.093  0.105   11.301  1.00 0.00  ? 18   ARG A HH21   2  
ATOM   5078   H  HH22   . ARG A 1 18  ? 19.021  -0.772  12.791  1.00 0.00  ? 18   ARG A HH22   2  
ATOM   5079   N  N      . ALA A 1 19  ? 13.595  4.953   10.439  1.00 20.84 ? 19   ALA A N      2  
ATOM   5080   C  CA     . ALA A 1 19  ? 12.516  4.611   9.437   1.00 18.95 ? 19   ALA A CA     2  
ATOM   5081   C  C      . ALA A 1 19  ? 12.273  5.772   8.462   1.00 21.42 ? 19   ALA A C      2  
ATOM   5082   O  O      . ALA A 1 19  ? 12.292  6.930   8.838   1.00 20.64 ? 19   ALA A O      2  
ATOM   5083   C  CB     . ALA A 1 19  ? 11.267  4.352   10.272  1.00 18.52 ? 19   ALA A CB     2  
ATOM   5084   H  H      . ALA A 1 19  ? 13.310  5.103   11.363  1.00 0.00  ? 19   ALA A H      2  
ATOM   5085   H  HA     . ALA A 1 19  ? 12.788  3.719   8.897   1.00 0.00  ? 19   ALA A HA     2  
ATOM   5086   H  HB1    . ALA A 1 19  ? 10.410  4.264   9.622   1.00 0.00  ? 19   ALA A HB1    2  
ATOM   5087   H  HB2    . ALA A 1 19  ? 11.119  5.173   10.957  1.00 0.00  ? 19   ALA A HB2    2  
ATOM   5088   H  HB3    . ALA A 1 19  ? 11.395  3.436   10.829  1.00 0.00  ? 19   ALA A HB3    2  
ATOM   5089   N  N      . SER A 1 20  ? 12.048  5.460   7.211   1.00 22.34 ? 20   SER A N      2  
ATOM   5090   C  CA     . SER A 1 20  ? 11.811  6.514   6.196   1.00 24.12 ? 20   SER A CA     2  
ATOM   5091   C  C      . SER A 1 20  ? 10.350  6.470   5.763   1.00 21.61 ? 20   SER A C      2  
ATOM   5092   O  O      . SER A 1 20  ? 9.796   5.417   5.508   1.00 22.04 ? 20   SER A O      2  
ATOM   5093   C  CB     . SER A 1 20  ? 12.733  6.158   5.032   1.00 21.65 ? 20   SER A CB     2  
ATOM   5094   O  OG     . SER A 1 20  ? 12.679  4.755   4.806   1.00 33.05 ? 20   SER A OG     2  
ATOM   5095   H  H      . SER A 1 20  ? 12.050  4.524   6.948   1.00 0.00  ? 20   SER A H      2  
ATOM   5096   H  HA     . SER A 1 20  ? 12.064  7.487   6.587   1.00 0.00  ? 20   SER A HA     2  
ATOM   5097   H  HB2    . SER A 1 20  ? 12.410  6.673   4.142   1.00 0.00  ? 20   SER A HB2    2  
ATOM   5098   H  HB3    . SER A 1 20  ? 13.745  6.457   5.270   1.00 0.00  ? 20   SER A HB3    2  
ATOM   5099   H  HG     . SER A 1 20  ? 13.562  4.400   4.933   1.00 0.00  ? 20   SER A HG     2  
ATOM   5100   N  N      . CYS A 1 21  ? 9.736   7.603   5.689   1.00 17.15 ? 21   CYS A N      2  
ATOM   5101   C  CA     . CYS A 1 21  ? 8.301   7.668   5.276   1.00 15.04 ? 21   CYS A CA     2  
ATOM   5102   C  C      . CYS A 1 21  ? 8.123   7.139   3.850   1.00 20.02 ? 21   CYS A C      2  
ATOM   5103   O  O      . CYS A 1 21  ? 8.805   7.560   2.936   1.00 18.74 ? 21   CYS A O      2  
ATOM   5104   C  CB     . CYS A 1 21  ? 7.974   9.151   5.347   1.00 15.75 ? 21   CYS A CB     2  
ATOM   5105   S  SG     . CYS A 1 21  ? 6.247   9.430   4.902   1.00 17.32 ? 21   CYS A SG     2  
ATOM   5106   H  H      . CYS A 1 21  ? 10.207  8.438   5.900   1.00 0.00  ? 21   CYS A H      2  
ATOM   5107   H  HA     . CYS A 1 21  ? 7.680   7.122   5.965   1.00 0.00  ? 21   CYS A HA     2  
ATOM   5108   H  HB2    . CYS A 1 21  ? 8.146   9.500   6.355   1.00 0.00  ? 21   CYS A HB2    2  
ATOM   5109   H  HB3    . CYS A 1 21  ? 8.613   9.695   4.667   1.00 0.00  ? 21   CYS A HB3    2  
ATOM   5110   N  N      . LYS A 1 22  ? 7.218   6.212   3.659   1.00 19.10 ? 22   LYS A N      2  
ATOM   5111   C  CA     . LYS A 1 22  ? 7.003   5.637   2.292   1.00 14.89 ? 22   LYS A CA     2  
ATOM   5112   C  C      . LYS A 1 22  ? 6.306   6.637   1.351   1.00 18.50 ? 22   LYS A C      2  
ATOM   5113   O  O      . LYS A 1 22  ? 6.140   6.369   0.177   1.00 20.27 ? 22   LYS A O      2  
ATOM   5114   C  CB     . LYS A 1 22  ? 6.119   4.418   2.524   1.00 18.82 ? 22   LYS A CB     2  
ATOM   5115   C  CG     . LYS A 1 22  ? 6.978   3.153   2.506   1.00 15.21 ? 22   LYS A CG     2  
ATOM   5116   C  CD     . LYS A 1 22  ? 7.465   2.868   1.081   1.00 19.41 ? 22   LYS A CD     2  
ATOM   5117   C  CE     . LYS A 1 22  ? 8.201   1.523   1.050   1.00 19.64 ? 22   LYS A CE     2  
ATOM   5118   N  NZ     . LYS A 1 22  ? 9.423   1.725   1.880   1.00 21.87 ? 22   LYS A NZ     2  
ATOM   5119   H  H      . LYS A 1 22  ? 6.702   5.880   4.426   1.00 0.00  ? 22   LYS A H      2  
ATOM   5120   H  HA     . LYS A 1 22  ? 7.944   5.324   1.867   1.00 0.00  ? 22   LYS A HA     2  
ATOM   5121   H  HB2    . LYS A 1 22  ? 5.635   4.511   3.483   1.00 0.00  ? 22   LYS A HB2    2  
ATOM   5122   H  HB3    . LYS A 1 22  ? 5.373   4.359   1.747   1.00 0.00  ? 22   LYS A HB3    2  
ATOM   5123   H  HG2    . LYS A 1 22  ? 7.830   3.294   3.155   1.00 0.00  ? 22   LYS A HG2    2  
ATOM   5124   H  HG3    . LYS A 1 22  ? 6.392   2.319   2.859   1.00 0.00  ? 22   LYS A HG3    2  
ATOM   5125   H  HD2    . LYS A 1 22  ? 6.617   2.830   0.412   1.00 0.00  ? 22   LYS A HD2    2  
ATOM   5126   H  HD3    . LYS A 1 22  ? 8.138   3.651   0.765   1.00 0.00  ? 22   LYS A HD3    2  
ATOM   5127   H  HE2    . LYS A 1 22  ? 7.580   0.748   1.476   1.00 0.00  ? 22   LYS A HE2    2  
ATOM   5128   H  HE3    . LYS A 1 22  ? 8.479   1.270   0.039   1.00 0.00  ? 22   LYS A HE3    2  
ATOM   5129   H  HZ1    . LYS A 1 22  ? 9.153   1.806   2.881   1.00 0.00  ? 22   LYS A HZ1    2  
ATOM   5130   H  HZ2    . LYS A 1 22  ? 9.907   2.596   1.579   1.00 0.00  ? 22   LYS A HZ2    2  
ATOM   5131   H  HZ3    . LYS A 1 22  ? 10.061  0.913   1.761   1.00 0.00  ? 22   LYS A HZ3    2  
ATOM   5132   N  N      . LYS A 1 23  ? 5.905   7.784   1.851   1.00 17.56 ? 23   LYS A N      2  
ATOM   5133   C  CA     . LYS A 1 23  ? 5.229   8.799   0.981   1.00 19.86 ? 23   LYS A CA     2  
ATOM   5134   C  C      . LYS A 1 23  ? 6.195   9.935   0.588   1.00 28.53 ? 23   LYS A C      2  
ATOM   5135   O  O      . LYS A 1 23  ? 6.422   10.184  -0.582  1.00 29.86 ? 23   LYS A O      2  
ATOM   5136   C  CB     . LYS A 1 23  ? 4.091   9.364   1.830   1.00 15.31 ? 23   LYS A CB     2  
ATOM   5137   C  CG     . LYS A 1 23  ? 3.289   10.363  0.994   1.00 14.68 ? 23   LYS A CG     2  
ATOM   5138   C  CD     . LYS A 1 23  ? 2.676   11.421  1.913   1.00 27.02 ? 23   LYS A CD     2  
ATOM   5139   C  CE     . LYS A 1 23  ? 2.168   12.603  1.079   1.00 26.91 ? 23   LYS A CE     2  
ATOM   5140   N  NZ     . LYS A 1 23  ? 3.385   13.392  0.742   1.00 24.85 ? 23   LYS A NZ     2  
ATOM   5141   H  H      . LYS A 1 23  ? 6.049   7.974   2.790   1.00 0.00  ? 23   LYS A H      2  
ATOM   5142   H  HA     . LYS A 1 23  ? 4.826   8.323   0.100   1.00 0.00  ? 23   LYS A HA     2  
ATOM   5143   H  HB2    . LYS A 1 23  ? 3.444   8.561   2.157   1.00 0.00  ? 23   LYS A HB2    2  
ATOM   5144   H  HB3    . LYS A 1 23  ? 4.503   9.869   2.689   1.00 0.00  ? 23   LYS A HB3    2  
ATOM   5145   H  HG2    . LYS A 1 23  ? 3.945   10.841  0.279   1.00 0.00  ? 23   LYS A HG2    2  
ATOM   5146   H  HG3    . LYS A 1 23  ? 2.503   9.844   0.467   1.00 0.00  ? 23   LYS A HG3    2  
ATOM   5147   H  HD2    . LYS A 1 23  ? 1.851   10.986  2.457   1.00 0.00  ? 23   LYS A HD2    2  
ATOM   5148   H  HD3    . LYS A 1 23  ? 3.423   11.771  2.609   1.00 0.00  ? 23   LYS A HD3    2  
ATOM   5149   H  HE2    . LYS A 1 23  ? 1.683   12.249  0.179   1.00 0.00  ? 23   LYS A HE2    2  
ATOM   5150   H  HE3    . LYS A 1 23  ? 1.487   13.207  1.660   1.00 0.00  ? 23   LYS A HE3    2  
ATOM   5151   H  HZ1    . LYS A 1 23  ? 3.930   13.573  1.608   1.00 0.00  ? 23   LYS A HZ1    2  
ATOM   5152   H  HZ2    . LYS A 1 23  ? 3.105   14.297  0.312   1.00 0.00  ? 23   LYS A HZ2    2  
ATOM   5153   H  HZ3    . LYS A 1 23  ? 3.972   12.854  0.072   1.00 0.00  ? 23   LYS A HZ3    2  
ATOM   5154   N  N      . CYS A 1 24  ? 6.739   10.640  1.554   1.00 27.41 ? 24   CYS A N      2  
ATOM   5155   C  CA     . CYS A 1 24  ? 7.665   11.775  1.223   1.00 17.42 ? 24   CYS A CA     2  
ATOM   5156   C  C      . CYS A 1 24  ? 9.157   11.387  1.326   1.00 20.96 ? 24   CYS A C      2  
ATOM   5157   O  O      . CYS A 1 24  ? 10.020  12.173  0.989   1.00 27.34 ? 24   CYS A O      2  
ATOM   5158   C  CB     . CYS A 1 24  ? 7.304   12.880  2.213   1.00 17.55 ? 24   CYS A CB     2  
ATOM   5159   S  SG     . CYS A 1 24  ? 7.911   12.480  3.871   1.00 25.74 ? 24   CYS A SG     2  
ATOM   5160   H  H      . CYS A 1 24  ? 6.520   10.438  2.486   1.00 0.00  ? 24   CYS A H      2  
ATOM   5161   H  HA     . CYS A 1 24  ? 7.458   12.121  0.225   1.00 0.00  ? 24   CYS A HA     2  
ATOM   5162   H  HB2    . CYS A 1 24  ? 7.749   13.805  1.885   1.00 0.00  ? 24   CYS A HB2    2  
ATOM   5163   H  HB3    . CYS A 1 24  ? 6.232   12.988  2.244   1.00 0.00  ? 24   CYS A HB3    2  
ATOM   5164   N  N      . SER A 1 25  ? 9.466   10.178  1.756   1.00 18.85 ? 25   SER A N      2  
ATOM   5165   C  CA     . SER A 1 25  ? 10.898  9.696   1.850   1.00 23.24 ? 25   SER A CA     2  
ATOM   5166   C  C      . SER A 1 25  ? 11.707  10.317  3.017   1.00 25.40 ? 25   SER A C      2  
ATOM   5167   O  O      . SER A 1 25  ? 12.806  9.869   3.306   1.00 24.73 ? 25   SER A O      2  
ATOM   5168   C  CB     . SER A 1 25  ? 11.524  10.058  0.510   1.00 22.84 ? 25   SER A CB     2  
ATOM   5169   O  OG     . SER A 1 25  ? 12.206  11.299  0.626   1.00 20.16 ? 25   SER A OG     2  
ATOM   5170   H  H      . SER A 1 25  ? 8.750   9.559   2.003   1.00 0.00  ? 25   SER A H      2  
ATOM   5171   H  HA     . SER A 1 25  ? 10.902  8.622   1.953   1.00 0.00  ? 25   SER A HA     2  
ATOM   5172   H  HB2    . SER A 1 25  ? 12.222  9.292   0.222   1.00 0.00  ? 25   SER A HB2    2  
ATOM   5173   H  HB3    . SER A 1 25  ? 10.742  10.131  -0.234  1.00 0.00  ? 25   SER A HB3    2  
ATOM   5174   H  HG     . SER A 1 25  ? 13.077  11.125  0.991   1.00 0.00  ? 25   SER A HG     2  
ATOM   5175   N  N      . GLU A 1 26  ? 11.200  11.325  3.692   1.00 24.15 ? 26   GLU A N      2  
ATOM   5176   C  CA     . GLU A 1 26  ? 11.977  11.923  4.825   1.00 25.41 ? 26   GLU A CA     2  
ATOM   5177   C  C      . GLU A 1 26  ? 11.993  10.953  6.012   1.00 23.73 ? 26   GLU A C      2  
ATOM   5178   O  O      . GLU A 1 26  ? 11.123  10.113  6.145   1.00 23.58 ? 26   GLU A O      2  
ATOM   5179   C  CB     . GLU A 1 26  ? 11.242  13.211  5.179   1.00 23.95 ? 26   GLU A CB     2  
ATOM   5180   C  CG     . GLU A 1 26  ? 11.544  14.278  4.121   1.00 26.20 ? 26   GLU A CG     2  
ATOM   5181   C  CD     . GLU A 1 26  ? 13.035  14.626  4.151   1.00 43.32 ? 26   GLU A CD     2  
ATOM   5182   O  OE1    . GLU A 1 26  ? 13.542  14.872  5.234   1.00 44.60 ? 26   GLU A OE1    2  
ATOM   5183   O  OE2    . GLU A 1 26  ? 13.642  14.641  3.095   1.00 50.67 ? 26   GLU A OE2    2  
ATOM   5184   H  H      . GLU A 1 26  ? 10.322  11.680  3.460   1.00 0.00  ? 26   GLU A H      2  
ATOM   5185   H  HA     . GLU A 1 26  ? 12.987  12.147  4.511   1.00 0.00  ? 26   GLU A HA     2  
ATOM   5186   H  HB2    . GLU A 1 26  ? 10.180  13.018  5.203   1.00 0.00  ? 26   GLU A HB2    2  
ATOM   5187   H  HB3    . GLU A 1 26  ? 11.571  13.560  6.143   1.00 0.00  ? 26   GLU A HB3    2  
ATOM   5188   H  HG2    . GLU A 1 26  ? 11.282  13.901  3.142   1.00 0.00  ? 26   GLU A HG2    2  
ATOM   5189   H  HG3    . GLU A 1 26  ? 10.966  15.165  4.332   1.00 0.00  ? 26   GLU A HG3    2  
ATOM   5190   N  N      . SER A 1 27  ? 12.990  11.049  6.859   1.00 21.94 ? 27   SER A N      2  
ATOM   5191   C  CA     . SER A 1 27  ? 13.079  10.121  8.016   1.00 21.97 ? 27   SER A CA     2  
ATOM   5192   C  C      . SER A 1 27  ? 12.006  10.428  9.060   1.00 20.79 ? 27   SER A C      2  
ATOM   5193   O  O      . SER A 1 27  ? 11.610  11.563  9.251   1.00 21.38 ? 27   SER A O      2  
ATOM   5194   C  CB     . SER A 1 27  ? 14.471  10.368  8.596   1.00 17.24 ? 27   SER A CB     2  
ATOM   5195   O  OG     . SER A 1 27  ? 14.648  11.763  8.811   1.00 24.24 ? 27   SER A OG     2  
ATOM   5196   H  H      . SER A 1 27  ? 13.680  11.734  6.714   1.00 0.00  ? 27   SER A H      2  
ATOM   5197   H  HA     . SER A 1 27  ? 13.000  9.098   7.685   1.00 0.00  ? 27   SER A HA     2  
ATOM   5198   H  HB2    . SER A 1 27  ? 14.575  9.848   9.533   1.00 0.00  ? 27   SER A HB2    2  
ATOM   5199   H  HB3    . SER A 1 27  ? 15.217  10.006  7.900   1.00 0.00  ? 27   SER A HB3    2  
ATOM   5200   H  HG     . SER A 1 27  ? 14.047  12.034  9.510   1.00 0.00  ? 27   SER A HG     2  
ATOM   5201   N  N      . ILE A 1 28  ? 11.563  9.418   9.757   1.00 18.84 ? 28   ILE A N      2  
ATOM   5202   C  CA     . ILE A 1 28  ? 10.551  9.630   10.824  1.00 21.99 ? 28   ILE A CA     2  
ATOM   5203   C  C      . ILE A 1 28  ? 11.312  9.740   12.155  1.00 18.71 ? 28   ILE A C      2  
ATOM   5204   O  O      . ILE A 1 28  ? 12.003  8.818   12.530  1.00 18.80 ? 28   ILE A O      2  
ATOM   5205   C  CB     . ILE A 1 28  ? 9.669   8.385   10.766  1.00 17.83 ? 28   ILE A CB     2  
ATOM   5206   C  CG1    . ILE A 1 28  ? 9.015   8.302   9.382   1.00 14.25 ? 28   ILE A CG1    2  
ATOM   5207   C  CG2    . ILE A 1 28  ? 8.588   8.470   11.842  1.00 13.51 ? 28   ILE A CG2    2  
ATOM   5208   C  CD1    . ILE A 1 28  ? 8.332   6.945   9.218   1.00 16.62 ? 28   ILE A CD1    2  
ATOM   5209   H  H      . ILE A 1 28  ? 11.927  8.521   9.594   1.00 0.00  ? 28   ILE A H      2  
ATOM   5210   H  HA     . ILE A 1 28  ? 9.973   10.519  10.629  1.00 0.00  ? 28   ILE A HA     2  
ATOM   5211   H  HB     . ILE A 1 28  ? 10.276  7.506   10.931  1.00 0.00  ? 28   ILE A HB     2  
ATOM   5212   H  HG12   . ILE A 1 28  ? 8.285   9.089   9.280   1.00 0.00  ? 28   ILE A HG12   2  
ATOM   5213   H  HG13   . ILE A 1 28  ? 9.774   8.413   8.619   1.00 0.00  ? 28   ILE A HG13   2  
ATOM   5214   H  HG21   . ILE A 1 28  ? 7.781   9.096   11.494  1.00 0.00  ? 28   ILE A HG21   2  
ATOM   5215   H  HG22   . ILE A 1 28  ? 9.008   8.890   12.744  1.00 0.00  ? 28   ILE A HG22   2  
ATOM   5216   H  HG23   . ILE A 1 28  ? 8.211   7.478   12.049  1.00 0.00  ? 28   ILE A HG23   2  
ATOM   5217   H  HD11   . ILE A 1 28  ? 8.371   6.644   8.182   1.00 0.00  ? 28   ILE A HD11   2  
ATOM   5218   H  HD12   . ILE A 1 28  ? 7.303   7.021   9.534   1.00 0.00  ? 28   ILE A HD12   2  
ATOM   5219   H  HD13   . ILE A 1 28  ? 8.841   6.210   9.825   1.00 0.00  ? 28   ILE A HD13   2  
ATOM   5220   N  N      . PRO A 1 29  ? 11.230  10.891  12.799  1.00 18.92 ? 29   PRO A N      2  
ATOM   5221   C  CA     . PRO A 1 29  ? 12.005  11.110  14.052  1.00 20.83 ? 29   PRO A CA     2  
ATOM   5222   C  C      . PRO A 1 29  ? 11.555  10.200  15.201  1.00 19.21 ? 29   PRO A C      2  
ATOM   5223   O  O      . PRO A 1 29  ? 10.385  9.923   15.385  1.00 18.77 ? 29   PRO A O      2  
ATOM   5224   C  CB     . PRO A 1 29  ? 11.764  12.582  14.364  1.00 21.91 ? 29   PRO A CB     2  
ATOM   5225   C  CG     . PRO A 1 29  ? 10.481  12.916  13.673  1.00 20.62 ? 29   PRO A CG     2  
ATOM   5226   C  CD     . PRO A 1 29  ? 10.422  12.057  12.440  1.00 17.84 ? 29   PRO A CD     2  
ATOM   5227   H  HA     . PRO A 1 29  ? 13.055  10.960  13.859  1.00 0.00  ? 29   PRO A HA     2  
ATOM   5228   H  HB2    . PRO A 1 29  ? 11.671  12.727  15.431  1.00 0.00  ? 29   PRO A HB2    2  
ATOM   5229   H  HB3    . PRO A 1 29  ? 12.566  13.186  13.967  1.00 0.00  ? 29   PRO A HB3    2  
ATOM   5230   H  HG2    . PRO A 1 29  ? 9.643   12.696  14.319  1.00 0.00  ? 29   PRO A HG2    2  
ATOM   5231   H  HG3    . PRO A 1 29  ? 10.473  13.955  13.389  1.00 0.00  ? 29   PRO A HG3    2  
ATOM   5232   H  HD2    . PRO A 1 29  ? 9.403   11.767  12.229  1.00 0.00  ? 29   PRO A HD2    2  
ATOM   5233   H  HD3    . PRO A 1 29  ? 10.860  12.566  11.596  1.00 0.00  ? 29   PRO A HD3    2  
ATOM   5234   N  N      . LYS A 1 30  ? 12.513  9.733   15.972  1.00 21.31 ? 30   LYS A N      2  
ATOM   5235   C  CA     . LYS A 1 30  ? 12.212  8.825   17.124  1.00 24.75 ? 30   LYS A CA     2  
ATOM   5236   C  C      . LYS A 1 30  ? 11.182  9.462   18.065  1.00 22.59 ? 30   LYS A C      2  
ATOM   5237   O  O      . LYS A 1 30  ? 11.191  10.658  18.276  1.00 18.62 ? 30   LYS A O      2  
ATOM   5238   C  CB     . LYS A 1 30  ? 13.555  8.664   17.840  1.00 16.88 ? 30   LYS A CB     2  
ATOM   5239   C  CG     . LYS A 1 30  ? 13.404  7.688   19.009  1.00 29.63 ? 30   LYS A CG     2  
ATOM   5240   C  CD     . LYS A 1 30  ? 14.787  7.358   19.577  1.00 26.13 ? 30   LYS A CD     2  
ATOM   5241   C  CE     . LYS A 1 30  ? 14.639  6.610   20.906  1.00 30.85 ? 30   LYS A CE     2  
ATOM   5242   N  NZ     . LYS A 1 30  ? 15.957  5.952   21.126  1.00 60.43 ? 30   LYS A NZ     2  
ATOM   5243   H  H      . LYS A 1 30  ? 13.441  9.975   15.772  1.00 0.00  ? 30   LYS A H      2  
ATOM   5244   H  HA     . LYS A 1 30  ? 11.864  7.866   16.775  1.00 0.00  ? 30   LYS A HA     2  
ATOM   5245   H  HB2    . LYS A 1 30  ? 14.288  8.282   17.144  1.00 0.00  ? 30   LYS A HB2    2  
ATOM   5246   H  HB3    . LYS A 1 30  ? 13.881  9.624   18.214  1.00 0.00  ? 30   LYS A HB3    2  
ATOM   5247   H  HG2    . LYS A 1 30  ? 12.795  8.141   19.777  1.00 0.00  ? 30   LYS A HG2    2  
ATOM   5248   H  HG3    . LYS A 1 30  ? 12.933  6.782   18.661  1.00 0.00  ? 30   LYS A HG3    2  
ATOM   5249   H  HD2    . LYS A 1 30  ? 15.325  6.738   18.874  1.00 0.00  ? 30   LYS A HD2    2  
ATOM   5250   H  HD3    . LYS A 1 30  ? 15.337  8.273   19.741  1.00 0.00  ? 30   LYS A HD3    2  
ATOM   5251   H  HE2    . LYS A 1 30  ? 14.426  7.307   21.705  1.00 0.00  ? 30   LYS A HE2    2  
ATOM   5252   H  HE3    . LYS A 1 30  ? 13.861  5.866   20.836  1.00 0.00  ? 30   LYS A HE3    2  
ATOM   5253   H  HZ1    . LYS A 1 30  ? 15.983  5.531   22.075  1.00 0.00  ? 30   LYS A HZ1    2  
ATOM   5254   H  HZ2    . LYS A 1 30  ? 16.716  6.660   21.038  1.00 0.00  ? 30   LYS A HZ2    2  
ATOM   5255   H  HZ3    . LYS A 1 30  ? 16.096  5.206   20.416  1.00 0.00  ? 30   LYS A HZ3    2  
ATOM   5256   N  N      . ASP A 1 31  ? 10.299  8.655   18.630  1.00 23.87 ? 31   ASP A N      2  
ATOM   5257   C  CA     . ASP A 1 31  ? 9.238   9.156   19.581  1.00 24.13 ? 31   ASP A CA     2  
ATOM   5258   C  C      . ASP A 1 31  ? 8.101   9.904   18.858  1.00 24.72 ? 31   ASP A C      2  
ATOM   5259   O  O      . ASP A 1 31  ? 7.084   10.202  19.459  1.00 25.43 ? 31   ASP A O      2  
ATOM   5260   C  CB     . ASP A 1 31  ? 9.947   10.094  20.558  1.00 20.67 ? 31   ASP A CB     2  
ATOM   5261   C  CG     . ASP A 1 31  ? 11.167  9.390   21.151  1.00 30.42 ? 31   ASP A CG     2  
ATOM   5262   O  OD1    . ASP A 1 31  ? 11.064  8.209   21.445  1.00 34.09 ? 31   ASP A OD1    2  
ATOM   5263   O  OD2    . ASP A 1 31  ? 12.188  10.042  21.294  1.00 36.24 ? 31   ASP A OD2    2  
ATOM   5264   H  H      . ASP A 1 31  ? 10.339  7.695   18.431  1.00 0.00  ? 31   ASP A H      2  
ATOM   5265   H  HA     . ASP A 1 31  ? 8.827   8.322   20.128  1.00 0.00  ? 31   ASP A HA     2  
ATOM   5266   H  HB2    . ASP A 1 31  ? 10.258  10.986  20.035  1.00 0.00  ? 31   ASP A HB2    2  
ATOM   5267   H  HB3    . ASP A 1 31  ? 9.265   10.366  21.355  1.00 0.00  ? 31   ASP A HB3    2  
ATOM   5268   N  N      . SER A 1 32  ? 8.246   10.204  17.590  1.00 16.38 ? 32   SER A N      2  
ATOM   5269   C  CA     . SER A 1 32  ? 7.157   10.922  16.873  1.00 18.83 ? 32   SER A CA     2  
ATOM   5270   C  C      . SER A 1 32  ? 6.025   9.949   16.564  1.00 19.83 ? 32   SER A C      2  
ATOM   5271   O  O      . SER A 1 32  ? 6.238   8.754   16.469  1.00 18.96 ? 32   SER A O      2  
ATOM   5272   C  CB     . SER A 1 32  ? 7.800   11.434  15.588  1.00 18.06 ? 32   SER A CB     2  
ATOM   5273   O  OG     . SER A 1 32  ? 7.970   10.349  14.686  1.00 20.49 ? 32   SER A OG     2  
ATOM   5274   H  H      . SER A 1 32  ? 9.059   9.953   17.110  1.00 0.00  ? 32   SER A H      2  
ATOM   5275   H  HA     . SER A 1 32  ? 6.795   11.751  17.463  1.00 0.00  ? 32   SER A HA     2  
ATOM   5276   H  HB2    . SER A 1 32  ? 7.168   12.180  15.138  1.00 0.00  ? 32   SER A HB2    2  
ATOM   5277   H  HB3    . SER A 1 32  ? 8.761   11.872  15.825  1.00 0.00  ? 32   SER A HB3    2  
ATOM   5278   H  HG     . SER A 1 32  ? 8.900   10.301  14.453  1.00 0.00  ? 32   SER A HG     2  
ATOM   5279   N  N      . LEU A 1 33  ? 4.827   10.446  16.407  1.00 17.48 ? 33   LEU A N      2  
ATOM   5280   C  CA     . LEU A 1 33  ? 3.684   9.548   16.102  1.00 16.64 ? 33   LEU A CA     2  
ATOM   5281   C  C      . LEU A 1 33  ? 3.735   9.124   14.634  1.00 22.88 ? 33   LEU A C      2  
ATOM   5282   O  O      . LEU A 1 33  ? 3.688   9.948   13.741  1.00 24.44 ? 33   LEU A O      2  
ATOM   5283   C  CB     . LEU A 1 33  ? 2.431   10.384  16.384  1.00 13.16 ? 33   LEU A CB     2  
ATOM   5284   C  CG     . LEU A 1 33  ? 1.190   9.517   16.168  1.00 18.91 ? 33   LEU A CG     2  
ATOM   5285   C  CD1    . LEU A 1 33  ? 1.047   8.532   17.329  1.00 17.77 ? 33   LEU A CD1    2  
ATOM   5286   C  CD2    . LEU A 1 33  ? -0.058  10.403  16.097  1.00 17.47 ? 33   LEU A CD2    2  
ATOM   5287   H  H      . LEU A 1 33  ? 4.688   11.414  16.483  1.00 0.00  ? 33   LEU A H      2  
ATOM   5288   H  HA     . LEU A 1 33  ? 3.703   8.682   16.747  1.00 0.00  ? 33   LEU A HA     2  
ATOM   5289   H  HB2    . LEU A 1 33  ? 2.455   10.733  17.407  1.00 0.00  ? 33   LEU A HB2    2  
ATOM   5290   H  HB3    . LEU A 1 33  ? 2.403   11.228  15.714  1.00 0.00  ? 33   LEU A HB3    2  
ATOM   5291   H  HG     . LEU A 1 33  ? 1.294   8.968   15.242  1.00 0.00  ? 33   LEU A HG     2  
ATOM   5292   H  HD11   . LEU A 1 33  ? 0.000   8.355   17.525  1.00 0.00  ? 33   LEU A HD11   2  
ATOM   5293   H  HD12   . LEU A 1 33  ? 1.514   8.945   18.210  1.00 0.00  ? 33   LEU A HD12   2  
ATOM   5294   H  HD13   . LEU A 1 33  ? 1.527   7.601   17.071  1.00 0.00  ? 33   LEU A HD13   2  
ATOM   5295   H  HD21   . LEU A 1 33  ? -0.216  10.722  15.078  1.00 0.00  ? 33   LEU A HD21   2  
ATOM   5296   H  HD22   . LEU A 1 33  ? 0.076   11.269  16.729  1.00 0.00  ? 33   LEU A HD22   2  
ATOM   5297   H  HD23   . LEU A 1 33  ? -0.917  9.841   16.434  1.00 0.00  ? 33   LEU A HD23   2  
ATOM   5298   N  N      . ARG A 1 34  ? 3.834   7.836   14.383  1.00 17.81 ? 34   ARG A N      2  
ATOM   5299   C  CA     . ARG A 1 34  ? 3.896   7.344   12.986  1.00 14.68 ? 34   ARG A CA     2  
ATOM   5300   C  C      . ARG A 1 34  ? 2.868   6.232   12.788  1.00 18.38 ? 34   ARG A C      2  
ATOM   5301   O  O      . ARG A 1 34  ? 2.456   5.584   13.733  1.00 17.19 ? 34   ARG A O      2  
ATOM   5302   C  CB     . ARG A 1 34  ? 5.323   6.810   12.795  1.00 12.94 ? 34   ARG A CB     2  
ATOM   5303   C  CG     . ARG A 1 34  ? 5.658   5.780   13.881  1.00 14.70 ? 34   ARG A CG     2  
ATOM   5304   C  CD     . ARG A 1 34  ? 6.356   4.577   13.250  1.00 16.52 ? 34   ARG A CD     2  
ATOM   5305   N  NE     . ARG A 1 34  ? 7.777   4.662   13.701  1.00 16.01 ? 34   ARG A NE     2  
ATOM   5306   C  CZ     . ARG A 1 34  ? 8.428   3.577   14.044  1.00 18.84 ? 34   ARG A CZ     2  
ATOM   5307   N  NH1    . ARG A 1 34  ? 7.840   2.408   14.000  1.00 19.66 ? 34   ARG A NH1    2  
ATOM   5308   N  NH2    . ARG A 1 34  ? 9.672   3.662   14.433  1.00 18.47 ? 34   ARG A NH2    2  
ATOM   5309   H  H      . ARG A 1 34  ? 3.880   7.222   15.147  1.00 0.00  ? 34   ARG A H      2  
ATOM   5310   H  HA     . ARG A 1 34  ? 3.713   8.153   12.294  1.00 0.00  ? 34   ARG A HA     2  
ATOM   5311   H  HB2    . ARG A 1 34  ? 5.399   6.342   11.823  1.00 0.00  ? 34   ARG A HB2    2  
ATOM   5312   H  HB3    . ARG A 1 34  ? 6.024   7.629   12.851  1.00 0.00  ? 34   ARG A HB3    2  
ATOM   5313   H  HG2    . ARG A 1 34  ? 6.310   6.228   14.616  1.00 0.00  ? 34   ARG A HG2    2  
ATOM   5314   H  HG3    . ARG A 1 34  ? 4.749   5.451   14.358  1.00 0.00  ? 34   ARG A HG3    2  
ATOM   5315   H  HD2    . ARG A 1 34  ? 5.902   3.664   13.607  1.00 0.00  ? 34   ARG A HD2    2  
ATOM   5316   H  HD3    . ARG A 1 34  ? 6.303   4.631   12.174  1.00 0.00  ? 34   ARG A HD3    2  
ATOM   5317   H  HE     . ARG A 1 34  ? 8.227   5.532   13.742  1.00 0.00  ? 34   ARG A HE     2  
ATOM   5318   H  HH11   . ARG A 1 34  ? 6.888   2.337   13.703  1.00 0.00  ? 34   ARG A HH11   2  
ATOM   5319   H  HH12   . ARG A 1 34  ? 8.341   1.587   14.270  1.00 0.00  ? 34   ARG A HH12   2  
ATOM   5320   H  HH21   . ARG A 1 34  ? 10.126  4.553   14.468  1.00 0.00  ? 34   ARG A HH21   2  
ATOM   5321   H  HH22   . ARG A 1 34  ? 10.172  2.836   14.694  1.00 0.00  ? 34   ARG A HH22   2  
ATOM   5322   N  N      . MET A 1 35  ? 2.452   6.012   11.570  1.00 17.10 ? 35   MET A N      2  
ATOM   5323   C  CA     . MET A 1 35  ? 1.450   4.943   11.297  1.00 15.54 ? 35   MET A CA     2  
ATOM   5324   C  C      . MET A 1 35  ? 1.943   4.058   10.155  1.00 18.06 ? 35   MET A C      2  
ATOM   5325   O  O      . MET A 1 35  ? 2.710   4.492   9.311   1.00 12.57 ? 35   MET A O      2  
ATOM   5326   C  CB     . MET A 1 35  ? 0.180   5.689   10.890  1.00 14.43 ? 35   MET A CB     2  
ATOM   5327   C  CG     . MET A 1 35  ? -0.534  6.200   12.142  1.00 21.23 ? 35   MET A CG     2  
ATOM   5328   S  SD     . MET A 1 35  ? -2.278  6.502   11.760  1.00 32.33 ? 35   MET A SD     2  
ATOM   5329   C  CE     . MET A 1 35  ? -2.828  4.776   11.768  1.00 24.23 ? 35   MET A CE     2  
ATOM   5330   H  H      . MET A 1 35  ? 2.806   6.553   10.831  1.00 0.00  ? 35   MET A H      2  
ATOM   5331   H  HA     . MET A 1 35  ? 1.269   4.355   12.183  1.00 0.00  ? 35   MET A HA     2  
ATOM   5332   H  HB2    . MET A 1 35  ? 0.444   6.526   10.258  1.00 0.00  ? 35   MET A HB2    2  
ATOM   5333   H  HB3    . MET A 1 35  ? -0.474  5.022   10.350  1.00 0.00  ? 35   MET A HB3    2  
ATOM   5334   H  HG2    . MET A 1 35  ? -0.457  5.462   12.927  1.00 0.00  ? 35   MET A HG2    2  
ATOM   5335   H  HG3    . MET A 1 35  ? -0.072  7.121   12.467  1.00 0.00  ? 35   MET A HG3    2  
ATOM   5336   H  HE1    . MET A 1 35  ? -1.966  4.123   11.785  1.00 0.00  ? 35   MET A HE1    2  
ATOM   5337   H  HE2    . MET A 1 35  ? -3.408  4.578   10.881  1.00 0.00  ? 35   MET A HE2    2  
ATOM   5338   H  HE3    . MET A 1 35  ? -3.439  4.598   12.642  1.00 0.00  ? 35   MET A HE3    2  
ATOM   5339   N  N      . ALA A 1 36  ? 1.527   2.818   10.125  1.00 14.04 ? 36   ALA A N      2  
ATOM   5340   C  CA     . ALA A 1 36  ? 2.004   1.928   9.038   1.00 14.62 ? 36   ALA A CA     2  
ATOM   5341   C  C      . ALA A 1 36  ? 0.929   0.941   8.607   1.00 17.40 ? 36   ALA A C      2  
ATOM   5342   O  O      . ALA A 1 36  ? 0.111   0.496   9.392   1.00 18.72 ? 36   ALA A O      2  
ATOM   5343   C  CB     . ALA A 1 36  ? 3.182   1.168   9.641   1.00 12.78 ? 36   ALA A CB     2  
ATOM   5344   H  H      . ALA A 1 36  ? 0.929   2.471   10.824  1.00 0.00  ? 36   ALA A H      2  
ATOM   5345   H  HA     . ALA A 1 36  ? 2.341   2.511   8.195   1.00 0.00  ? 36   ALA A HA     2  
ATOM   5346   H  HB1    . ALA A 1 36  ? 3.080   1.138   10.716  1.00 0.00  ? 36   ALA A HB1    2  
ATOM   5347   H  HB2    . ALA A 1 36  ? 4.099   1.672   9.379   1.00 0.00  ? 36   ALA A HB2    2  
ATOM   5348   H  HB3    . ALA A 1 36  ? 3.197   0.158   9.254   1.00 0.00  ? 36   ALA A HB3    2  
ATOM   5349   N  N      . ILE A 1 37  ? 0.994   0.513   7.374   1.00 16.10 ? 37   ILE A N      2  
ATOM   5350   C  CA     . ILE A 1 37  ? 0.045   -0.534  6.891   1.00 22.59 ? 37   ILE A CA     2  
ATOM   5351   C  C      . ILE A 1 37  ? 0.766   -1.887  6.985   1.00 23.48 ? 37   ILE A C      2  
ATOM   5352   O  O      . ILE A 1 37  ? 1.770   -2.112  6.341   1.00 19.72 ? 37   ILE A O      2  
ATOM   5353   C  CB     . ILE A 1 37  ? -0.304  -0.185  5.429   1.00 16.82 ? 37   ILE A CB     2  
ATOM   5354   C  CG1    . ILE A 1 37  ? -1.008  -1.386  4.769   1.00 27.02 ? 37   ILE A CG1    2  
ATOM   5355   C  CG2    . ILE A 1 37  ? 0.965   0.149   4.639   1.00 15.86 ? 37   ILE A CG2    2  
ATOM   5356   C  CD1    . ILE A 1 37  ? -2.381  -0.964  4.241   1.00 33.55 ? 37   ILE A CD1    2  
ATOM   5357   H  H      . ILE A 1 37  ? 1.711   0.831   6.788   1.00 0.00  ? 37   ILE A H      2  
ATOM   5358   H  HA     . ILE A 1 37  ? -0.847  -0.539  7.500   1.00 0.00  ? 37   ILE A HA     2  
ATOM   5359   H  HB     . ILE A 1 37  ? -0.965  0.669   5.417   1.00 0.00  ? 37   ILE A HB     2  
ATOM   5360   H  HG12   . ILE A 1 37  ? -0.406  -1.748  3.948   1.00 0.00  ? 37   ILE A HG12   2  
ATOM   5361   H  HG13   . ILE A 1 37  ? -1.134  -2.175  5.494   1.00 0.00  ? 37   ILE A HG13   2  
ATOM   5362   H  HG21   . ILE A 1 37  ? 1.302   1.141   4.899   1.00 0.00  ? 37   ILE A HG21   2  
ATOM   5363   H  HG22   . ILE A 1 37  ? 0.752   0.108   3.581   1.00 0.00  ? 37   ILE A HG22   2  
ATOM   5364   H  HG23   . ILE A 1 37  ? 1.737   -0.567  4.876   1.00 0.00  ? 37   ILE A HG23   2  
ATOM   5365   H  HD11   . ILE A 1 37  ? -2.572  -1.454  3.298   1.00 0.00  ? 37   ILE A HD11   2  
ATOM   5366   H  HD12   . ILE A 1 37  ? -2.401  0.107   4.101   1.00 0.00  ? 37   ILE A HD12   2  
ATOM   5367   H  HD13   . ILE A 1 37  ? -3.142  -1.250  4.954   1.00 0.00  ? 37   ILE A HD13   2  
ATOM   5368   N  N      . MET A 1 38  ? 0.279   -2.774  7.808   1.00 23.23 ? 38   MET A N      2  
ATOM   5369   C  CA     . MET A 1 38  ? 0.953   -4.098  7.974   1.00 22.50 ? 38   MET A CA     2  
ATOM   5370   C  C      . MET A 1 38  ? 1.011   -4.866  6.652   1.00 27.87 ? 38   MET A C      2  
ATOM   5371   O  O      . MET A 1 38  ? 0.173   -4.707  5.786   1.00 27.66 ? 38   MET A O      2  
ATOM   5372   C  CB     . MET A 1 38  ? 0.101   -4.856  8.997   1.00 19.89 ? 38   MET A CB     2  
ATOM   5373   C  CG     . MET A 1 38  ? 0.849   -4.930  10.332  1.00 23.67 ? 38   MET A CG     2  
ATOM   5374   S  SD     . MET A 1 38  ? -0.328  -4.756  11.698  1.00 20.20 ? 38   MET A SD     2  
ATOM   5375   C  CE     . MET A 1 38  ? 0.889   -4.526  13.017  1.00 28.61 ? 38   MET A CE     2  
ATOM   5376   H  H      . MET A 1 38  ? -0.518  -2.561  8.337   1.00 0.00  ? 38   MET A H      2  
ATOM   5377   H  HA     . MET A 1 38  ? 1.949   -3.960  8.364   1.00 0.00  ? 38   MET A HA     2  
ATOM   5378   H  HB2    . MET A 1 38  ? -0.838  -4.340  9.136   1.00 0.00  ? 38   MET A HB2    2  
ATOM   5379   H  HB3    . MET A 1 38  ? -0.088  -5.856  8.637   1.00 0.00  ? 38   MET A HB3    2  
ATOM   5380   H  HG2    . MET A 1 38  ? 1.352   -5.882  10.410  1.00 0.00  ? 38   MET A HG2    2  
ATOM   5381   H  HG3    . MET A 1 38  ? 1.576   -4.135  10.382  1.00 0.00  ? 38   MET A HG3    2  
ATOM   5382   H  HE1    . MET A 1 38  ? 1.422   -5.452  13.181  1.00 0.00  ? 38   MET A HE1    2  
ATOM   5383   H  HE2    . MET A 1 38  ? 0.386   -4.237  13.926  1.00 0.00  ? 38   MET A HE2    2  
ATOM   5384   H  HE3    . MET A 1 38  ? 1.585   -3.748  12.732  1.00 0.00  ? 38   MET A HE3    2  
ATOM   5385   N  N      . VAL A 1 39  ? 2.005   -5.698  6.502   1.00 25.82 ? 39   VAL A N      2  
ATOM   5386   C  CA     . VAL A 1 39  ? 2.156   -6.492  5.251   1.00 26.62 ? 39   VAL A CA     2  
ATOM   5387   C  C      . VAL A 1 39  ? 2.825   -7.834  5.567   1.00 31.41 ? 39   VAL A C      2  
ATOM   5388   O  O      . VAL A 1 39  ? 3.854   -7.884  6.212   1.00 30.06 ? 39   VAL A O      2  
ATOM   5389   C  CB     . VAL A 1 39  ? 3.061   -5.626  4.375   1.00 25.20 ? 39   VAL A CB     2  
ATOM   5390   C  CG1    . VAL A 1 39  ? 3.590   -6.434  3.184   1.00 34.96 ? 39   VAL A CG1    2  
ATOM   5391   C  CG2    . VAL A 1 39  ? 2.259   -4.428  3.874   1.00 21.52 ? 39   VAL A CG2    2  
ATOM   5392   H  H      . VAL A 1 39  ? 2.663   -5.800  7.221   1.00 0.00  ? 39   VAL A H      2  
ATOM   5393   H  HA     . VAL A 1 39  ? 1.202   -6.641  4.772   1.00 0.00  ? 39   VAL A HA     2  
ATOM   5394   H  HB     . VAL A 1 39  ? 3.895   -5.275  4.964   1.00 0.00  ? 39   VAL A HB     2  
ATOM   5395   H  HG11   . VAL A 1 39  ? 4.647   -6.619  3.317   1.00 0.00  ? 39   VAL A HG11   2  
ATOM   5396   H  HG12   . VAL A 1 39  ? 3.436   -5.877  2.272   1.00 0.00  ? 39   VAL A HG12   2  
ATOM   5397   H  HG13   . VAL A 1 39  ? 3.066   -7.376  3.125   1.00 0.00  ? 39   VAL A HG13   2  
ATOM   5398   H  HG21   . VAL A 1 39  ? 1.217   -4.688  3.819   1.00 0.00  ? 39   VAL A HG21   2  
ATOM   5399   H  HG22   . VAL A 1 39  ? 2.609   -4.141  2.894   1.00 0.00  ? 39   VAL A HG22   2  
ATOM   5400   H  HG23   . VAL A 1 39  ? 2.384   -3.604  4.559   1.00 0.00  ? 39   VAL A HG23   2  
ATOM   5401   N  N      . GLN A 1 40  ? 2.256   -8.920  5.116   1.00 37.04 ? 40   GLN A N      2  
ATOM   5402   C  CA     . GLN A 1 40  ? 2.872   -10.253 5.390   1.00 34.73 ? 40   GLN A CA     2  
ATOM   5403   C  C      . GLN A 1 40  ? 4.061   -10.480 4.452   1.00 33.18 ? 40   GLN A C      2  
ATOM   5404   O  O      . GLN A 1 40  ? 3.961   -10.293 3.255   1.00 37.40 ? 40   GLN A O      2  
ATOM   5405   C  CB     . GLN A 1 40  ? 1.765   -11.268 5.110   1.00 17.44 ? 40   GLN A CB     2  
ATOM   5406   C  CG     . GLN A 1 40  ? 2.209   -12.653 5.586   1.00 40.93 ? 40   GLN A CG     2  
ATOM   5407   C  CD     . GLN A 1 40  ? 1.128   -13.681 5.248   1.00 58.69 ? 40   GLN A CD     2  
ATOM   5408   O  OE1    . GLN A 1 40  ? 1.083   -14.193 4.147   1.00 63.94 ? 40   GLN A OE1    2  
ATOM   5409   N  NE2    . GLN A 1 40  ? 0.248   -14.007 6.155   1.00 54.01 ? 40   GLN A NE2    2  
ATOM   5410   H  H      . GLN A 1 40  ? 1.429   -8.860  4.594   1.00 0.00  ? 40   GLN A H      2  
ATOM   5411   H  HA     . GLN A 1 40  ? 3.184   -10.319 6.420   1.00 0.00  ? 40   GLN A HA     2  
ATOM   5412   H  HB2    . GLN A 1 40  ? 0.867   -10.977 5.638   1.00 0.00  ? 40   GLN A HB2    2  
ATOM   5413   H  HB3    . GLN A 1 40  ? 1.564   -11.301 4.050   1.00 0.00  ? 40   GLN A HB3    2  
ATOM   5414   H  HG2    . GLN A 1 40  ? 3.132   -12.924 5.092   1.00 0.00  ? 40   GLN A HG2    2  
ATOM   5415   H  HG3    . GLN A 1 40  ? 2.364   -12.634 6.653   1.00 0.00  ? 40   GLN A HG3    2  
ATOM   5416   H  HE21   . GLN A 1 40  ? 0.284   -13.595 7.043   1.00 0.00  ? 40   GLN A HE21   2  
ATOM   5417   H  HE22   . GLN A 1 40  ? -0.448  -14.664 5.948   1.00 0.00  ? 40   GLN A HE22   2  
ATOM   5418   N  N      . SER A 1 41  ? 5.186   -10.877 4.985   1.00 36.90 ? 41   SER A N      2  
ATOM   5419   C  CA     . SER A 1 41  ? 6.382   -11.110 4.121   1.00 42.69 ? 41   SER A CA     2  
ATOM   5420   C  C      . SER A 1 41  ? 6.460   -12.584 3.695   1.00 45.47 ? 41   SER A C      2  
ATOM   5421   O  O      . SER A 1 41  ? 6.309   -13.469 4.513   1.00 44.27 ? 41   SER A O      2  
ATOM   5422   C  CB     . SER A 1 41  ? 7.578   -10.745 4.999   1.00 43.88 ? 41   SER A CB     2  
ATOM   5423   O  OG     . SER A 1 41  ? 8.695   -10.448 4.172   1.00 48.72 ? 41   SER A OG     2  
ATOM   5424   H  H      . SER A 1 41  ? 5.247   -11.018 5.953   1.00 0.00  ? 41   SER A H      2  
ATOM   5425   H  HA     . SER A 1 41  ? 6.351   -10.466 3.257   1.00 0.00  ? 41   SER A HA     2  
ATOM   5426   H  HB2    . SER A 1 41  ? 7.339   -9.881  5.596   1.00 0.00  ? 41   SER A HB2    2  
ATOM   5427   H  HB3    . SER A 1 41  ? 7.811   -11.578 5.651   1.00 0.00  ? 41   SER A HB3    2  
ATOM   5428   H  HG     . SER A 1 41  ? 9.150   -11.271 3.980   1.00 0.00  ? 41   SER A HG     2  
ATOM   5429   N  N      . PRO A 1 42  ? 6.694   -12.803 2.422   1.00 52.87 ? 42   PRO A N      2  
ATOM   5430   C  CA     . PRO A 1 42  ? 6.793   -14.183 1.895   1.00 51.98 ? 42   PRO A CA     2  
ATOM   5431   C  C      . PRO A 1 42  ? 8.204   -14.753 2.106   1.00 54.26 ? 42   PRO A C      2  
ATOM   5432   O  O      . PRO A 1 42  ? 8.470   -15.896 1.784   1.00 57.82 ? 42   PRO A O      2  
ATOM   5433   C  CB     . PRO A 1 42  ? 6.503   -14.015 0.409   1.00 40.31 ? 42   PRO A CB     2  
ATOM   5434   C  CG     . PRO A 1 42  ? 6.877   -12.600 0.081   1.00 34.32 ? 42   PRO A CG     2  
ATOM   5435   C  CD     . PRO A 1 42  ? 6.882   -11.802 1.364   1.00 41.31 ? 42   PRO A CD     2  
ATOM   5436   H  HA     . PRO A 1 42  ? 6.050   -14.820 2.347   1.00 0.00  ? 42   PRO A HA     2  
ATOM   5437   H  HB2    . PRO A 1 42  ? 7.103   -14.706 -0.168  1.00 0.00  ? 42   PRO A HB2    2  
ATOM   5438   H  HB3    . PRO A 1 42  ? 5.455   -14.173 0.212   1.00 0.00  ? 42   PRO A HB3    2  
ATOM   5439   H  HG2    . PRO A 1 42  ? 7.860   -12.577 -0.369  1.00 0.00  ? 42   PRO A HG2    2  
ATOM   5440   H  HG3    . PRO A 1 42  ? 6.154   -12.180 -0.601  1.00 0.00  ? 42   PRO A HG3    2  
ATOM   5441   H  HD2    . PRO A 1 42  ? 7.828   -11.293 1.487   1.00 0.00  ? 42   PRO A HD2    2  
ATOM   5442   H  HD3    . PRO A 1 42  ? 6.067   -11.096 1.374   1.00 0.00  ? 42   PRO A HD3    2  
ATOM   5443   N  N      . MET A 1 43  ? 9.110   -13.971 2.632   1.00 54.47 ? 43   MET A N      2  
ATOM   5444   C  CA     . MET A 1 43  ? 10.500  -14.474 2.850   1.00 54.93 ? 43   MET A CA     2  
ATOM   5445   C  C      . MET A 1 43  ? 10.676  -14.984 4.284   1.00 52.89 ? 43   MET A C      2  
ATOM   5446   O  O      . MET A 1 43  ? 11.630  -15.671 4.591   1.00 50.52 ? 43   MET A O      2  
ATOM   5447   C  CB     . MET A 1 43  ? 11.400  -13.265 2.597   1.00 51.06 ? 43   MET A CB     2  
ATOM   5448   C  CG     . MET A 1 43  ? 11.460  -12.977 1.097   1.00 69.08 ? 43   MET A CG     2  
ATOM   5449   S  SD     . MET A 1 43  ? 12.595  -14.141 0.302   1.00 52.35 ? 43   MET A SD     2  
ATOM   5450   C  CE     . MET A 1 43  ? 11.401  -14.878 -0.840  1.00 65.97 ? 43   MET A CE     2  
ATOM   5451   H  H      . MET A 1 43  ? 8.880   -13.051 2.881   1.00 0.00  ? 43   MET A H      2  
ATOM   5452   H  HA     . MET A 1 43  ? 10.729  -15.256 2.143   1.00 0.00  ? 43   MET A HA     2  
ATOM   5453   H  HB2    . MET A 1 43  ? 11.001  -12.405 3.116   1.00 0.00  ? 43   MET A HB2    2  
ATOM   5454   H  HB3    . MET A 1 43  ? 12.395  -13.475 2.961   1.00 0.00  ? 43   MET A HB3    2  
ATOM   5455   H  HG2    . MET A 1 43  ? 10.473  -13.086 0.669   1.00 0.00  ? 43   MET A HG2    2  
ATOM   5456   H  HG3    . MET A 1 43  ? 11.810  -11.967 0.938   1.00 0.00  ? 43   MET A HG3    2  
ATOM   5457   H  HE1    . MET A 1 43  ? 11.776  -15.832 -1.186  1.00 0.00  ? 43   MET A HE1    2  
ATOM   5458   H  HE2    . MET A 1 43  ? 11.257  -14.224 -1.685  1.00 0.00  ? 43   MET A HE2    2  
ATOM   5459   H  HE3    . MET A 1 43  ? 10.457  -15.019 -0.331  1.00 0.00  ? 43   MET A HE3    2  
ATOM   5460   N  N      . PHE A 1 44  ? 9.768   -14.654 5.164   1.00 45.91 ? 44   PHE A N      2  
ATOM   5461   C  CA     . PHE A 1 44  ? 9.893   -15.122 6.577   1.00 45.62 ? 44   PHE A CA     2  
ATOM   5462   C  C      . PHE A 1 44  ? 8.591   -14.864 7.341   1.00 52.47 ? 44   PHE A C      2  
ATOM   5463   O  O      . PHE A 1 44  ? 7.866   -13.933 7.053   1.00 58.31 ? 44   PHE A O      2  
ATOM   5464   C  CB     . PHE A 1 44  ? 11.035  -14.293 7.172   1.00 49.72 ? 44   PHE A CB     2  
ATOM   5465   C  CG     . PHE A 1 44  ? 10.710  -12.821 7.062   1.00 51.73 ? 44   PHE A CG     2  
ATOM   5466   C  CD1    . PHE A 1 44  ? 9.922   -12.198 8.047   1.00 46.78 ? 44   PHE A CD1    2  
ATOM   5467   C  CD2    . PHE A 1 44  ? 11.197  -12.073 5.974   1.00 51.42 ? 44   PHE A CD2    2  
ATOM   5468   C  CE1    . PHE A 1 44  ? 9.621   -10.828 7.944   1.00 40.68 ? 44   PHE A CE1    2  
ATOM   5469   C  CE2    . PHE A 1 44  ? 10.896  -10.704 5.872   1.00 41.97 ? 44   PHE A CE2    2  
ATOM   5470   C  CZ     . PHE A 1 44  ? 10.109  -10.082 6.857   1.00 43.62 ? 44   PHE A CZ     2  
ATOM   5471   H  H      . PHE A 1 44  ? 9.006   -14.098 4.899   1.00 0.00  ? 44   PHE A H      2  
ATOM   5472   H  HA     . PHE A 1 44  ? 10.146  -16.169 6.604   1.00 0.00  ? 44   PHE A HA     2  
ATOM   5473   H  HB2    . PHE A 1 44  ? 11.165  -14.555 8.212   1.00 0.00  ? 44   PHE A HB2    2  
ATOM   5474   H  HB3    . PHE A 1 44  ? 11.948  -14.500 6.633   1.00 0.00  ? 44   PHE A HB3    2  
ATOM   5475   H  HD1    . PHE A 1 44  ? 9.549   -12.772 8.882   1.00 0.00  ? 44   PHE A HD1    2  
ATOM   5476   H  HD2    . PHE A 1 44  ? 11.802  -12.551 5.218   1.00 0.00  ? 44   PHE A HD2    2  
ATOM   5477   H  HE1    . PHE A 1 44  ? 9.017   -10.350 8.701   1.00 0.00  ? 44   PHE A HE1    2  
ATOM   5478   H  HE2    . PHE A 1 44  ? 11.270  -10.129 5.037   1.00 0.00  ? 44   PHE A HE2    2  
ATOM   5479   H  HZ     . PHE A 1 44  ? 9.879   -9.030  6.779   1.00 0.00  ? 44   PHE A HZ     2  
ATOM   5480   N  N      . ASP A 1 45  ? 8.297   -15.679 8.318   1.00 54.42 ? 45   ASP A N      2  
ATOM   5481   C  CA     . ASP A 1 45  ? 7.047   -15.477 9.107   1.00 58.10 ? 45   ASP A CA     2  
ATOM   5482   C  C      . ASP A 1 45  ? 7.127   -14.150 9.865   1.00 66.11 ? 45   ASP A C      2  
ATOM   5483   O  O      . ASP A 1 45  ? 8.037   -13.920 10.638  1.00 68.92 ? 45   ASP A O      2  
ATOM   5484   C  CB     . ASP A 1 45  ? 6.994   -16.653 10.083  1.00 59.34 ? 45   ASP A CB     2  
ATOM   5485   C  CG     . ASP A 1 45  ? 5.586   -16.770 10.666  1.00 76.02 ? 45   ASP A CG     2  
ATOM   5486   O  OD1    . ASP A 1 45  ? 4.712   -17.250 9.962   1.00 66.91 ? 45   ASP A OD1    2  
ATOM   5487   O  OD2    . ASP A 1 45  ? 5.403   -16.378 11.807  1.00 80.62 ? 45   ASP A OD2    2  
ATOM   5488   H  H      . ASP A 1 45  ? 8.900   -16.421 8.535   1.00 0.00  ? 45   ASP A H      2  
ATOM   5489   H  HA     . ASP A 1 45  ? 6.185   -15.492 8.460   1.00 0.00  ? 45   ASP A HA     2  
ATOM   5490   H  HB2    . ASP A 1 45  ? 7.246   -17.565 9.561   1.00 0.00  ? 45   ASP A HB2    2  
ATOM   5491   H  HB3    . ASP A 1 45  ? 7.701   -16.490 10.884  1.00 0.00  ? 45   ASP A HB3    2  
ATOM   5492   N  N      . GLY A 1 46  ? 6.187   -13.275 9.643   1.00 66.60 ? 46   GLY A N      2  
ATOM   5493   C  CA     . GLY A 1 46  ? 6.208   -11.957 10.339  1.00 62.39 ? 46   GLY A CA     2  
ATOM   5494   C  C      . GLY A 1 46  ? 5.668   -10.889 9.389   1.00 57.06 ? 46   GLY A C      2  
ATOM   5495   O  O      . GLY A 1 46  ? 5.682   -11.060 8.185   1.00 50.09 ? 46   GLY A O      2  
ATOM   5496   H  H      . GLY A 1 46  ? 5.468   -13.481 9.010   1.00 0.00  ? 46   GLY A H      2  
ATOM   5497   H  HA2    . GLY A 1 46  ? 5.589   -12.005 11.224  1.00 0.00  ? 46   GLY A HA2    2  
ATOM   5498   H  HA3    . GLY A 1 46  ? 7.222   -11.709 10.617  1.00 0.00  ? 46   GLY A HA3    2  
ATOM   5499   N  N      . LYS A 1 47  ? 5.182   -9.797  9.912   1.00 43.68 ? 47   LYS A N      2  
ATOM   5500   C  CA     . LYS A 1 47  ? 4.630   -8.732  9.024   1.00 37.59 ? 47   LYS A CA     2  
ATOM   5501   C  C      . LYS A 1 47  ? 5.585   -7.536  8.935   1.00 32.28 ? 47   LYS A C      2  
ATOM   5502   O  O      . LYS A 1 47  ? 6.138   -7.092  9.922   1.00 39.08 ? 47   LYS A O      2  
ATOM   5503   C  CB     . LYS A 1 47  ? 3.315   -8.316  9.683   1.00 33.15 ? 47   LYS A CB     2  
ATOM   5504   C  CG     . LYS A 1 47  ? 2.180   -9.200  9.161   1.00 33.38 ? 47   LYS A CG     2  
ATOM   5505   C  CD     . LYS A 1 47  ? 2.091   -10.470 10.011  1.00 50.59 ? 47   LYS A CD     2  
ATOM   5506   C  CE     . LYS A 1 47  ? 1.211   -10.206 11.234  1.00 55.67 ? 47   LYS A CE     2  
ATOM   5507   N  NZ     . LYS A 1 47  ? 0.934   -11.553 11.806  1.00 54.16 ? 47   LYS A NZ     2  
ATOM   5508   H  H      . LYS A 1 47  ? 5.170   -9.681  10.885  1.00 0.00  ? 47   LYS A H      2  
ATOM   5509   H  HA     . LYS A 1 47  ? 4.435   -9.129  8.040   1.00 0.00  ? 47   LYS A HA     2  
ATOM   5510   H  HB2    . LYS A 1 47  ? 3.398   -8.430  10.754  1.00 0.00  ? 47   LYS A HB2    2  
ATOM   5511   H  HB3    . LYS A 1 47  ? 3.104   -7.285  9.445   1.00 0.00  ? 47   LYS A HB3    2  
ATOM   5512   H  HG2    . LYS A 1 47  ? 1.247   -8.660  9.221   1.00 0.00  ? 47   LYS A HG2    2  
ATOM   5513   H  HG3    . LYS A 1 47  ? 2.376   -9.469  8.135   1.00 0.00  ? 47   LYS A HG3    2  
ATOM   5514   H  HD2    . LYS A 1 47  ? 1.661   -11.267 9.421   1.00 0.00  ? 47   LYS A HD2    2  
ATOM   5515   H  HD3    . LYS A 1 47  ? 3.080   -10.757 10.336  1.00 0.00  ? 47   LYS A HD3    2  
ATOM   5516   H  HE2    . LYS A 1 47  ? 1.741   -9.591  11.950  1.00 0.00  ? 47   LYS A HE2    2  
ATOM   5517   H  HE3    . LYS A 1 47  ? 0.288   -9.732  10.939  1.00 0.00  ? 47   LYS A HE3    2  
ATOM   5518   H  HZ1    . LYS A 1 47  ? 0.509   -12.159 11.076  1.00 0.00  ? 47   LYS A HZ1    2  
ATOM   5519   H  HZ2    . LYS A 1 47  ? 0.277   -11.460 12.608  1.00 0.00  ? 47   LYS A HZ2    2  
ATOM   5520   H  HZ3    . LYS A 1 47  ? 1.823   -11.980 12.133  1.00 0.00  ? 47   LYS A HZ3    2  
ATOM   5521   N  N      . VAL A 1 48  ? 5.763   -7.003  7.753   1.00 29.00 ? 48   VAL A N      2  
ATOM   5522   C  CA     . VAL A 1 48  ? 6.660   -5.820  7.580   1.00 28.38 ? 48   VAL A CA     2  
ATOM   5523   C  C      . VAL A 1 48  ? 5.806   -4.547  7.549   1.00 30.79 ? 48   VAL A C      2  
ATOM   5524   O  O      . VAL A 1 48  ? 4.827   -4.489  6.830   1.00 32.45 ? 48   VAL A O      2  
ATOM   5525   C  CB     . VAL A 1 48  ? 7.353   -6.037  6.233   1.00 31.12 ? 48   VAL A CB     2  
ATOM   5526   C  CG1    . VAL A 1 48  ? 8.293   -4.864  5.946   1.00 29.70 ? 48   VAL A CG1    2  
ATOM   5527   C  CG2    . VAL A 1 48  ? 8.162   -7.335  6.277   1.00 36.91 ? 48   VAL A CG2    2  
ATOM   5528   H  H      . VAL A 1 48  ? 5.294   -7.373  6.977   1.00 0.00  ? 48   VAL A H      2  
ATOM   5529   H  HA     . VAL A 1 48  ? 7.389   -5.777  8.373   1.00 0.00  ? 48   VAL A HA     2  
ATOM   5530   H  HB     . VAL A 1 48  ? 6.608   -6.101  5.453   1.00 0.00  ? 48   VAL A HB     2  
ATOM   5531   H  HG11   . VAL A 1 48  ? 9.025   -4.786  6.736   1.00 0.00  ? 48   VAL A HG11   2  
ATOM   5532   H  HG12   . VAL A 1 48  ? 7.721   -3.949  5.892   1.00 0.00  ? 48   VAL A HG12   2  
ATOM   5533   H  HG13   . VAL A 1 48  ? 8.796   -5.029  5.004   1.00 0.00  ? 48   VAL A HG13   2  
ATOM   5534   H  HG21   . VAL A 1 48  ? 9.168   -7.121  6.608   1.00 0.00  ? 48   VAL A HG21   2  
ATOM   5535   H  HG22   . VAL A 1 48  ? 8.194   -7.773  5.291   1.00 0.00  ? 48   VAL A HG22   2  
ATOM   5536   H  HG23   . VAL A 1 48  ? 7.698   -8.026  6.964   1.00 0.00  ? 48   VAL A HG23   2  
ATOM   5537   N  N      . PRO A 1 49  ? 6.172   -3.573  8.345   1.00 27.88 ? 49   PRO A N      2  
ATOM   5538   C  CA     . PRO A 1 49  ? 5.389   -2.335  8.403   1.00 22.81 ? 49   PRO A CA     2  
ATOM   5539   C  C      . PRO A 1 49  ? 5.887   -1.291  7.407   1.00 17.10 ? 49   PRO A C      2  
ATOM   5540   O  O      . PRO A 1 49  ? 7.051   -0.934  7.402   1.00 26.81 ? 49   PRO A O      2  
ATOM   5541   C  CB     . PRO A 1 49  ? 5.645   -1.850  9.825   1.00 22.13 ? 49   PRO A CB     2  
ATOM   5542   C  CG     . PRO A 1 49  ? 6.975   -2.436  10.224  1.00 23.53 ? 49   PRO A CG     2  
ATOM   5543   C  CD     . PRO A 1 49  ? 7.313   -3.540  9.255   1.00 22.30 ? 49   PRO A CD     2  
ATOM   5544   H  HA     . PRO A 1 49  ? 4.340   -2.534  8.266   1.00 0.00  ? 49   PRO A HA     2  
ATOM   5545   H  HB2    . PRO A 1 49  ? 5.686   -0.770  9.851   1.00 0.00  ? 49   PRO A HB2    2  
ATOM   5546   H  HB3    . PRO A 1 49  ? 4.873   -2.214  10.485  1.00 0.00  ? 49   PRO A HB3    2  
ATOM   5547   H  HG2    . PRO A 1 49  ? 7.736   -1.672  10.186  1.00 0.00  ? 49   PRO A HG2    2  
ATOM   5548   H  HG3    . PRO A 1 49  ? 6.912   -2.843  11.221  1.00 0.00  ? 49   PRO A HG3    2  
ATOM   5549   H  HD2    . PRO A 1 49  ? 8.223   -3.308  8.719   1.00 0.00  ? 49   PRO A HD2    2  
ATOM   5550   H  HD3    . PRO A 1 49  ? 7.402   -4.481  9.773   1.00 0.00  ? 49   PRO A HD3    2  
ATOM   5551   N  N      . HIS A 1 50  ? 4.998   -0.735  6.633   1.00 17.20 ? 50   HIS A N      2  
ATOM   5552   C  CA     . HIS A 1 50  ? 5.395   0.370   5.721   1.00 19.81 ? 50   HIS A CA     2  
ATOM   5553   C  C      . HIS A 1 50  ? 5.074   1.644   6.506   1.00 18.47 ? 50   HIS A C      2  
ATOM   5554   O  O      . HIS A 1 50  ? 3.922   2.003   6.649   1.00 18.67 ? 50   HIS A O      2  
ATOM   5555   C  CB     . HIS A 1 50  ? 4.512   0.242   4.474   1.00 16.01 ? 50   HIS A CB     2  
ATOM   5556   C  CG     . HIS A 1 50  ? 4.774   -1.078  3.801   1.00 21.18 ? 50   HIS A CG     2  
ATOM   5557   N  ND1    . HIS A 1 50  ? 6.049   -1.477  3.427   1.00 22.74 ? 50   HIS A ND1    2  
ATOM   5558   C  CD2    . HIS A 1 50  ? 3.938   -2.099  3.428   1.00 22.09 ? 50   HIS A CD2    2  
ATOM   5559   C  CE1    . HIS A 1 50  ? 5.943   -2.691  2.858   1.00 26.01 ? 50   HIS A CE1    2  
ATOM   5560   N  NE2    . HIS A 1 50  ? 4.677   -3.118  2.832   1.00 23.91 ? 50   HIS A NE2    2  
ATOM   5561   H  H      . HIS A 1 50  ? 4.054   -0.992  6.708   1.00 0.00  ? 50   HIS A H      2  
ATOM   5562   H  HA     . HIS A 1 50  ? 6.443   0.311   5.469   1.00 0.00  ? 50   HIS A HA     2  
ATOM   5563   H  HB2    . HIS A 1 50  ? 3.473   0.301   4.760   1.00 0.00  ? 50   HIS A HB2    2  
ATOM   5564   H  HB3    . HIS A 1 50  ? 4.743   1.045   3.789   1.00 0.00  ? 50   HIS A HB3    2  
ATOM   5565   H  HD1    . HIS A 1 50  ? 6.875   -0.966  3.550   1.00 0.00  ? 50   HIS A HD1    2  
ATOM   5566   H  HD2    . HIS A 1 50  ? 2.868   -2.110  3.571   1.00 0.00  ? 50   HIS A HD2    2  
ATOM   5567   H  HE1    . HIS A 1 50  ? 6.780   -3.254  2.470   1.00 0.00  ? 50   HIS A HE1    2  
ATOM   5568   N  N      . TRP A 1 51  ? 6.069   2.268   7.104   1.00 14.75 ? 51   TRP A N      2  
ATOM   5569   C  CA     . TRP A 1 51  ? 5.794   3.446   7.968   1.00 12.99 ? 51   TRP A CA     2  
ATOM   5570   C  C      . TRP A 1 51  ? 5.646   4.763   7.205   1.00 13.82 ? 51   TRP A C      2  
ATOM   5571   O  O      . TRP A 1 51  ? 6.169   4.962   6.122   1.00 14.73 ? 51   TRP A O      2  
ATOM   5572   C  CB     . TRP A 1 51  ? 6.988   3.508   8.924   1.00 13.82 ? 51   TRP A CB     2  
ATOM   5573   C  CG     . TRP A 1 51  ? 6.843   2.441   9.964   1.00 16.33 ? 51   TRP A CG     2  
ATOM   5574   C  CD1    . TRP A 1 51  ? 7.689   1.397   10.138  1.00 13.99 ? 51   TRP A CD1    2  
ATOM   5575   C  CD2    . TRP A 1 51  ? 5.811   2.304   10.976  1.00 15.07 ? 51   TRP A CD2    2  
ATOM   5576   N  NE1    . TRP A 1 51  ? 7.229   0.621   11.184  1.00 15.84 ? 51   TRP A NE1    2  
ATOM   5577   C  CE2    . TRP A 1 51  ? 6.077   1.135   11.733  1.00 18.14 ? 51   TRP A CE2    2  
ATOM   5578   C  CE3    . TRP A 1 51  ? 4.676   3.073   11.300  1.00 17.08 ? 51   TRP A CE3    2  
ATOM   5579   C  CZ2    . TRP A 1 51  ? 5.252   0.731   12.778  1.00 14.13 ? 51   TRP A CZ2    2  
ATOM   5580   C  CZ3    . TRP A 1 51  ? 3.834   2.676   12.357  1.00 18.03 ? 51   TRP A CZ3    2  
ATOM   5581   C  CH2    . TRP A 1 51  ? 4.123   1.501   13.096  1.00 17.28 ? 51   TRP A CH2    2  
ATOM   5582   H  H      . TRP A 1 51  ? 6.968   1.883   7.003   1.00 0.00  ? 51   TRP A H      2  
ATOM   5583   H  HA     . TRP A 1 51  ? 4.895   3.267   8.542   1.00 0.00  ? 51   TRP A HA     2  
ATOM   5584   H  HB2    . TRP A 1 51  ? 7.901   3.351   8.373   1.00 0.00  ? 51   TRP A HB2    2  
ATOM   5585   H  HB3    . TRP A 1 51  ? 7.015   4.475   9.403   1.00 0.00  ? 51   TRP A HB3    2  
ATOM   5586   H  HD1    . TRP A 1 51  ? 8.577   1.200   9.554   1.00 0.00  ? 51   TRP A HD1    2  
ATOM   5587   H  HE1    . TRP A 1 51  ? 7.658   -0.199  11.513  1.00 0.00  ? 51   TRP A HE1    2  
ATOM   5588   H  HE3    . TRP A 1 51  ? 4.456   3.976   10.734  1.00 0.00  ? 51   TRP A HE3    2  
ATOM   5589   H  HZ2    . TRP A 1 51  ? 5.483   -0.167  13.335  1.00 0.00  ? 51   TRP A HZ2    2  
ATOM   5590   H  HZ3    . TRP A 1 51  ? 2.963   3.269   12.603  1.00 0.00  ? 51   TRP A HZ3    2  
ATOM   5591   H  HH2    . TRP A 1 51  ? 3.475   1.195   13.908  1.00 0.00  ? 51   TRP A HH2    2  
ATOM   5592   N  N      . TYR A 1 52  ? 4.926   5.656   7.817   1.00 14.59 ? 52   TYR A N      2  
ATOM   5593   C  CA     . TYR A 1 52  ? 4.674   7.005   7.228   1.00 12.79 ? 52   TYR A CA     2  
ATOM   5594   C  C      . TYR A 1 52  ? 4.535   8.018   8.370   1.00 14.74 ? 52   TYR A C      2  
ATOM   5595   O  O      . TYR A 1 52  ? 4.043   7.680   9.435   1.00 15.94 ? 52   TYR A O      2  
ATOM   5596   C  CB     . TYR A 1 52  ? 3.305   6.923   6.532   1.00 15.01 ? 52   TYR A CB     2  
ATOM   5597   C  CG     . TYR A 1 52  ? 3.299   5.931   5.410   1.00 17.85 ? 52   TYR A CG     2  
ATOM   5598   C  CD1    . TYR A 1 52  ? 3.081   4.566   5.682   1.00 14.07 ? 52   TYR A CD1    2  
ATOM   5599   C  CD2    . TYR A 1 52  ? 3.460   6.377   4.083   1.00 19.44 ? 52   TYR A CD2    2  
ATOM   5600   C  CE1    . TYR A 1 52  ? 3.032   3.644   4.624   1.00 16.41 ? 52   TYR A CE1    2  
ATOM   5601   C  CE2    . TYR A 1 52  ? 3.405   5.455   3.026   1.00 16.81 ? 52   TYR A CE2    2  
ATOM   5602   C  CZ     . TYR A 1 52  ? 3.191   4.090   3.299   1.00 17.11 ? 52   TYR A CZ     2  
ATOM   5603   O  OH     . TYR A 1 52  ? 3.145   3.184   2.266   1.00 17.53 ? 52   TYR A OH     2  
ATOM   5604   H  H      . TYR A 1 52  ? 4.509   5.451   8.682   1.00 0.00  ? 52   TYR A H      2  
ATOM   5605   H  HA     . TYR A 1 52  ? 5.443   7.286   6.533   1.00 0.00  ? 52   TYR A HA     2  
ATOM   5606   H  HB2    . TYR A 1 52  ? 2.558   6.627   7.253   1.00 0.00  ? 52   TYR A HB2    2  
ATOM   5607   H  HB3    . TYR A 1 52  ? 3.045   7.896   6.141   1.00 0.00  ? 52   TYR A HB3    2  
ATOM   5608   H  HD1    . TYR A 1 52  ? 2.961   4.226   6.705   1.00 0.00  ? 52   TYR A HD1    2  
ATOM   5609   H  HD2    . TYR A 1 52  ? 3.630   7.429   3.877   1.00 0.00  ? 52   TYR A HD2    2  
ATOM   5610   H  HE1    . TYR A 1 52  ? 2.859   2.589   4.828   1.00 0.00  ? 52   TYR A HE1    2  
ATOM   5611   H  HE2    . TYR A 1 52  ? 3.524   5.795   1.999   1.00 0.00  ? 52   TYR A HE2    2  
ATOM   5612   H  HH     . TYR A 1 52  ? 4.027   2.837   2.143   1.00 0.00  ? 52   TYR A HH     2  
ATOM   5613   N  N      . HIS A 1 53  ? 4.867   9.269   8.147   1.00 13.44 ? 53   HIS A N      2  
ATOM   5614   C  CA     . HIS A 1 53  ? 4.627   10.284  9.212   1.00 15.88 ? 53   HIS A CA     2  
ATOM   5615   C  C      . HIS A 1 53  ? 3.116   10.329  9.392   1.00 21.42 ? 53   HIS A C      2  
ATOM   5616   O  O      . HIS A 1 53  ? 2.393   9.978   8.476   1.00 20.21 ? 53   HIS A O      2  
ATOM   5617   C  CB     . HIS A 1 53  ? 5.114   11.622  8.649   1.00 17.24 ? 53   HIS A CB     2  
ATOM   5618   C  CG     . HIS A 1 53  ? 6.603   11.607  8.435   1.00 18.26 ? 53   HIS A CG     2  
ATOM   5619   N  ND1    . HIS A 1 53  ? 7.168   11.646  7.169   1.00 17.99 ? 53   HIS A ND1    2  
ATOM   5620   C  CD2    . HIS A 1 53  ? 7.651   11.594  9.326   1.00 23.33 ? 53   HIS A CD2    2  
ATOM   5621   C  CE1    . HIS A 1 53  ? 8.506   11.658  7.326   1.00 24.41 ? 53   HIS A CE1    2  
ATOM   5622   N  NE2    . HIS A 1 53  ? 8.857   11.628  8.624   1.00 23.92 ? 53   HIS A NE2    2  
ATOM   5623   H  H      . HIS A 1 53  ? 5.189   9.544   7.272   1.00 0.00  ? 53   HIS A H      2  
ATOM   5624   H  HA     . HIS A 1 53  ? 5.137   10.034  10.136  1.00 0.00  ? 53   HIS A HA     2  
ATOM   5625   H  HB2    . HIS A 1 53  ? 4.621   11.811  7.715   1.00 0.00  ? 53   HIS A HB2    2  
ATOM   5626   H  HB3    . HIS A 1 53  ? 4.868   12.410  9.348   1.00 0.00  ? 53   HIS A HB3    2  
ATOM   5627   H  HD2    . HIS A 1 53  ? 7.546   11.570  10.410  1.00 0.00  ? 53   HIS A HD2    2  
ATOM   5628   H  HE1    . HIS A 1 53  ? 9.200   11.686  6.502   1.00 0.00  ? 53   HIS A HE1    2  
ATOM   5629   H  HE2    . HIS A 1 53  ? 9.768   11.631  9.001   1.00 0.00  ? 53   HIS A HE2    2  
ATOM   5630   N  N      . PHE A 1 54  ? 2.624   10.712  10.537  1.00 18.07 ? 54   PHE A N      2  
ATOM   5631   C  CA     . PHE A 1 54  ? 1.129   10.727  10.754  1.00 20.20 ? 54   PHE A CA     2  
ATOM   5632   C  C      . PHE A 1 54  ? 0.359   11.349  9.571   1.00 21.07 ? 54   PHE A C      2  
ATOM   5633   O  O      . PHE A 1 54  ? -0.574  10.761  9.056   1.00 25.87 ? 54   PHE A O      2  
ATOM   5634   C  CB     . PHE A 1 54  ? 0.917   11.557  12.019  1.00 15.88 ? 54   PHE A CB     2  
ATOM   5635   C  CG     . PHE A 1 54  ? -0.530  11.473  12.417  1.00 19.30 ? 54   PHE A CG     2  
ATOM   5636   C  CD1    . PHE A 1 54  ? -1.111  10.213  12.652  1.00 21.48 ? 54   PHE A CD1    2  
ATOM   5637   C  CD2    . PHE A 1 54  ? -1.297  12.647  12.556  1.00 22.09 ? 54   PHE A CD2    2  
ATOM   5638   C  CE1    . PHE A 1 54  ? -2.462  10.120  13.032  1.00 26.90 ? 54   PHE A CE1    2  
ATOM   5639   C  CE2    . PHE A 1 54  ? -2.651  12.560  12.934  1.00 22.26 ? 54   PHE A CE2    2  
ATOM   5640   C  CZ     . PHE A 1 54  ? -3.233  11.295  13.173  1.00 24.85 ? 54   PHE A CZ     2  
ATOM   5641   H  H      . PHE A 1 54  ? 3.228   10.962  11.268  1.00 0.00  ? 54   PHE A H      2  
ATOM   5642   H  HA     . PHE A 1 54  ? 0.778   9.725   10.925  1.00 0.00  ? 54   PHE A HA     2  
ATOM   5643   H  HB2    . PHE A 1 54  ? 1.533   11.166  12.815  1.00 0.00  ? 54   PHE A HB2    2  
ATOM   5644   H  HB3    . PHE A 1 54  ? 1.181   12.588  11.830  1.00 0.00  ? 54   PHE A HB3    2  
ATOM   5645   H  HD1    . PHE A 1 54  ? -0.515  9.313   12.541  1.00 0.00  ? 54   PHE A HD1    2  
ATOM   5646   H  HD2    . PHE A 1 54  ? -0.846  13.617  12.369  1.00 0.00  ? 54   PHE A HD2    2  
ATOM   5647   H  HE1    . PHE A 1 54  ? -2.909  9.144   13.213  1.00 0.00  ? 54   PHE A HE1    2  
ATOM   5648   H  HE2    . PHE A 1 54  ? -3.247  13.466  13.041  1.00 0.00  ? 54   PHE A HE2    2  
ATOM   5649   H  HZ     . PHE A 1 54  ? -4.275  11.224  13.465  1.00 0.00  ? 54   PHE A HZ     2  
ATOM   5650   N  N      . SER A 1 55  ? 0.729   12.532  9.152   1.00 19.62 ? 55   SER A N      2  
ATOM   5651   C  CA     . SER A 1 55  ? 0.004   13.203  8.021   1.00 24.28 ? 55   SER A CA     2  
ATOM   5652   C  C      . SER A 1 55  ? 0.185   12.465  6.681   1.00 27.29 ? 55   SER A C      2  
ATOM   5653   O  O      . SER A 1 55  ? -0.766  12.270  5.943   1.00 31.32 ? 55   SER A O      2  
ATOM   5654   C  CB     . SER A 1 55  ? 0.627   14.593  7.941   1.00 28.94 ? 55   SER A CB     2  
ATOM   5655   O  OG     . SER A 1 55  ? 1.943   14.484  7.416   1.00 42.24 ? 55   SER A OG     2  
ATOM   5656   H  H      . SER A 1 55  ? 1.477   12.981  9.599   1.00 0.00  ? 55   SER A H      2  
ATOM   5657   H  HA     . SER A 1 55  ? -1.043  13.293  8.255   1.00 0.00  ? 55   SER A HA     2  
ATOM   5658   H  HB2    . SER A 1 55  ? 0.036   15.217  7.295   1.00 0.00  ? 55   SER A HB2    2  
ATOM   5659   H  HB3    . SER A 1 55  ? 0.659   15.027  8.931   1.00 0.00  ? 55   SER A HB3    2  
ATOM   5660   H  HG     . SER A 1 55  ? 2.555   14.808  8.080   1.00 0.00  ? 55   SER A HG     2  
ATOM   5661   N  N      . CYS A 1 56  ? 1.394   12.079  6.347   1.00 24.51 ? 56   CYS A N      2  
ATOM   5662   C  CA     . CYS A 1 56  ? 1.636   11.381  5.042   1.00 18.27 ? 56   CYS A CA     2  
ATOM   5663   C  C      . CYS A 1 56  ? 0.764   10.122  4.894   1.00 23.54 ? 56   CYS A C      2  
ATOM   5664   O  O      . CYS A 1 56  ? 0.307   9.793   3.813   1.00 21.88 ? 56   CYS A O      2  
ATOM   5665   C  CB     . CYS A 1 56  ? 3.115   10.983  5.073   1.00 16.25 ? 56   CYS A CB     2  
ATOM   5666   S  SG     . CYS A 1 56  ? 4.160   12.457  5.233   1.00 17.54 ? 56   CYS A SG     2  
ATOM   5667   H  H      . CYS A 1 56  ? 2.144   12.265  6.951   1.00 0.00  ? 56   CYS A H      2  
ATOM   5668   H  HA     . CYS A 1 56  ? 1.462   12.058  4.220   1.00 0.00  ? 56   CYS A HA     2  
ATOM   5669   H  HB2    . CYS A 1 56  ? 3.291   10.327  5.913   1.00 0.00  ? 56   CYS A HB2    2  
ATOM   5670   H  HB3    . CYS A 1 56  ? 3.363   10.467  4.159   1.00 0.00  ? 56   CYS A HB3    2  
ATOM   5671   N  N      . PHE A 1 57  ? 0.556   9.406   5.965   1.00 19.45 ? 57   PHE A N      2  
ATOM   5672   C  CA     . PHE A 1 57  ? -0.260  8.142   5.893   1.00 19.37 ? 57   PHE A CA     2  
ATOM   5673   C  C      . PHE A 1 57  ? -1.627  8.355   5.208   1.00 21.13 ? 57   PHE A C      2  
ATOM   5674   O  O      . PHE A 1 57  ? -2.121  7.475   4.527   1.00 24.24 ? 57   PHE A O      2  
ATOM   5675   C  CB     . PHE A 1 57  ? -0.462  7.734   7.346   1.00 19.62 ? 57   PHE A CB     2  
ATOM   5676   C  CG     . PHE A 1 57  ? -1.209  6.435   7.407   1.00 21.25 ? 57   PHE A CG     2  
ATOM   5677   C  CD1    . PHE A 1 57  ? -0.499  5.224   7.365   1.00 15.87 ? 57   PHE A CD1    2  
ATOM   5678   C  CD2    . PHE A 1 57  ? -2.611  6.437   7.522   1.00 19.91 ? 57   PHE A CD2    2  
ATOM   5679   C  CE1    . PHE A 1 57  ? -1.192  4.003   7.439   1.00 14.54 ? 57   PHE A CE1    2  
ATOM   5680   C  CE2    . PHE A 1 57  ? -3.311  5.219   7.601   1.00 17.33 ? 57   PHE A CE2    2  
ATOM   5681   C  CZ     . PHE A 1 57  ? -2.600  3.999   7.559   1.00 17.80 ? 57   PHE A CZ     2  
ATOM   5682   H  H      . PHE A 1 57  ? 0.954   9.687   6.816   1.00 0.00  ? 57   PHE A H      2  
ATOM   5683   H  HA     . PHE A 1 57  ? 0.295   7.377   5.378   1.00 0.00  ? 57   PHE A HA     2  
ATOM   5684   H  HB2    . PHE A 1 57  ? 0.499   7.617   7.825   1.00 0.00  ? 57   PHE A HB2    2  
ATOM   5685   H  HB3    . PHE A 1 57  ? -1.031  8.497   7.859   1.00 0.00  ? 57   PHE A HB3    2  
ATOM   5686   H  HD1    . PHE A 1 57  ? 0.582   5.232   7.269   1.00 0.00  ? 57   PHE A HD1    2  
ATOM   5687   H  HD2    . PHE A 1 57  ? -3.154  7.379   7.551   1.00 0.00  ? 57   PHE A HD2    2  
ATOM   5688   H  HE1    . PHE A 1 57  ? -0.641  3.063   7.406   1.00 0.00  ? 57   PHE A HE1    2  
ATOM   5689   H  HE2    . PHE A 1 57  ? -4.396  5.219   7.691   1.00 0.00  ? 57   PHE A HE2    2  
ATOM   5690   H  HZ     . PHE A 1 57  ? -3.134  3.059   7.621   1.00 0.00  ? 57   PHE A HZ     2  
ATOM   5691   N  N      . TRP A 1 58  ? -2.264  9.501   5.417   1.00 24.66 ? 58   TRP A N      2  
ATOM   5692   C  CA     . TRP A 1 58  ? -3.607  9.722   4.828   1.00 22.46 ? 58   TRP A CA     2  
ATOM   5693   C  C      . TRP A 1 58  ? -3.523  10.289  3.406   1.00 25.18 ? 58   TRP A C      2  
ATOM   5694   O  O      . TRP A 1 58  ? -4.488  10.252  2.662   1.00 26.94 ? 58   TRP A O      2  
ATOM   5695   C  CB     . TRP A 1 58  ? -4.267  10.733  5.762   1.00 17.86 ? 58   TRP A CB     2  
ATOM   5696   C  CG     . TRP A 1 58  ? -4.373  10.161  7.138   1.00 23.66 ? 58   TRP A CG     2  
ATOM   5697   C  CD1    . TRP A 1 58  ? -3.493  10.375  8.143   1.00 24.53 ? 58   TRP A CD1    2  
ATOM   5698   C  CD2    . TRP A 1 58  ? -5.407  9.292   7.678   1.00 18.42 ? 58   TRP A CD2    2  
ATOM   5699   N  NE1    . TRP A 1 58  ? -3.920  9.691   9.264   1.00 26.19 ? 58   TRP A NE1    2  
ATOM   5700   C  CE2    . TRP A 1 58  ? -5.091  9.011   9.032   1.00 23.99 ? 58   TRP A CE2    2  
ATOM   5701   C  CE3    . TRP A 1 58  ? -6.575  8.730   7.128   1.00 25.59 ? 58   TRP A CE3    2  
ATOM   5702   C  CZ2    . TRP A 1 58  ? -5.898  8.199   9.822   1.00 25.34 ? 58   TRP A CZ2    2  
ATOM   5703   C  CZ3    . TRP A 1 58  ? -7.400  7.906   7.920   1.00 30.00 ? 58   TRP A CZ3    2  
ATOM   5704   C  CH2    . TRP A 1 58  ? -7.059  7.641   9.270   1.00 32.08 ? 58   TRP A CH2    2  
ATOM   5705   H  H      . TRP A 1 58  ? -1.824  10.127  6.025   1.00 0.00  ? 58   TRP A H      2  
ATOM   5706   H  HA     . TRP A 1 58  ? -4.175  8.803   4.830   1.00 0.00  ? 58   TRP A HA     2  
ATOM   5707   H  HB2    . TRP A 1 58  ? -3.672  11.633  5.794   1.00 0.00  ? 58   TRP A HB2    2  
ATOM   5708   H  HB3    . TRP A 1 58  ? -5.253  10.969  5.392   1.00 0.00  ? 58   TRP A HB3    2  
ATOM   5709   H  HD1    . TRP A 1 58  ? -2.601  10.980  8.082   1.00 0.00  ? 58   TRP A HD1    2  
ATOM   5710   H  HE1    . TRP A 1 58  ? -3.459  9.680   10.130  1.00 0.00  ? 58   TRP A HE1    2  
ATOM   5711   H  HE3    . TRP A 1 58  ? -6.837  8.934   6.091   1.00 0.00  ? 58   TRP A HE3    2  
ATOM   5712   H  HZ2    . TRP A 1 58  ? -5.628  8.005   10.852  1.00 0.00  ? 58   TRP A HZ2    2  
ATOM   5713   H  HZ3    . TRP A 1 58  ? -8.298  7.476   7.493   1.00 0.00  ? 58   TRP A HZ3    2  
ATOM   5714   H  HH2    . TRP A 1 58  ? -7.694  7.010   9.879   1.00 0.00  ? 58   TRP A HH2    2  
ATOM   5715   N  N      . LYS A 1 59  ? -2.396  10.829  3.028   1.00 23.59 ? 59   LYS A N      2  
ATOM   5716   C  CA     . LYS A 1 59  ? -2.276  11.420  1.661   1.00 20.86 ? 59   LYS A CA     2  
ATOM   5717   C  C      . LYS A 1 59  ? -1.960  10.358  0.594   1.00 21.54 ? 59   LYS A C      2  
ATOM   5718   O  O      . LYS A 1 59  ? -1.821  10.681  -0.573  1.00 29.40 ? 59   LYS A O      2  
ATOM   5719   C  CB     . LYS A 1 59  ? -1.128  12.418  1.773   1.00 22.71 ? 59   LYS A CB     2  
ATOM   5720   C  CG     . LYS A 1 59  ? -1.514  13.526  2.751   1.00 22.99 ? 59   LYS A CG     2  
ATOM   5721   C  CD     . LYS A 1 59  ? -0.371  14.538  2.856   1.00 27.65 ? 59   LYS A CD     2  
ATOM   5722   C  CE     . LYS A 1 59  ? -0.749  15.637  3.854   1.00 34.62 ? 59   LYS A CE     2  
ATOM   5723   N  NZ     . LYS A 1 59  ? 0.537   16.302  4.210   1.00 33.06 ? 59   LYS A NZ     2  
ATOM   5724   H  H      . LYS A 1 59  ? -1.639  10.865  3.649   1.00 0.00  ? 59   LYS A H      2  
ATOM   5725   H  HA     . LYS A 1 59  ? -3.183  11.943  1.406   1.00 0.00  ? 59   LYS A HA     2  
ATOM   5726   H  HB2    . LYS A 1 59  ? -0.243  11.912  2.130   1.00 0.00  ? 59   LYS A HB2    2  
ATOM   5727   H  HB3    . LYS A 1 59  ? -0.932  12.849  0.804   1.00 0.00  ? 59   LYS A HB3    2  
ATOM   5728   H  HG2    . LYS A 1 59  ? -2.407  14.023  2.398   1.00 0.00  ? 59   LYS A HG2    2  
ATOM   5729   H  HG3    . LYS A 1 59  ? -1.704  13.097  3.724   1.00 0.00  ? 59   LYS A HG3    2  
ATOM   5730   H  HD2    . LYS A 1 59  ? 0.524   14.035  3.192   1.00 0.00  ? 59   LYS A HD2    2  
ATOM   5731   H  HD3    . LYS A 1 59  ? -0.193  14.980  1.886   1.00 0.00  ? 59   LYS A HD3    2  
ATOM   5732   H  HE2    . LYS A 1 59  ? -1.424  16.344  3.392   1.00 0.00  ? 59   LYS A HE2    2  
ATOM   5733   H  HE3    . LYS A 1 59  ? -1.198  15.205  4.735   1.00 0.00  ? 59   LYS A HE3    2  
ATOM   5734   H  HZ1    . LYS A 1 59  ? 0.375   16.979  4.982   1.00 0.00  ? 59   LYS A HZ1    2  
ATOM   5735   H  HZ2    . LYS A 1 59  ? 0.909   16.806  3.379   1.00 0.00  ? 59   LYS A HZ2    2  
ATOM   5736   H  HZ3    . LYS A 1 59  ? 1.225   15.587  4.519   1.00 0.00  ? 59   LYS A HZ3    2  
ATOM   5737   N  N      . VAL A 1 60  ? -1.853  9.106   0.977   1.00 25.01 ? 60   VAL A N      2  
ATOM   5738   C  CA     . VAL A 1 60  ? -1.544  8.036   -0.024  1.00 16.41 ? 60   VAL A CA     2  
ATOM   5739   C  C      . VAL A 1 60  ? -2.814  7.284   -0.441  1.00 26.16 ? 60   VAL A C      2  
ATOM   5740   O  O      . VAL A 1 60  ? -2.875  6.698   -1.504  1.00 26.58 ? 60   VAL A O      2  
ATOM   5741   C  CB     . VAL A 1 60  ? -0.576  7.087   0.692   1.00 21.20 ? 60   VAL A CB     2  
ATOM   5742   C  CG1    . VAL A 1 60  ? -1.328  6.282   1.761   1.00 14.94 ? 60   VAL A CG1    2  
ATOM   5743   C  CG2    . VAL A 1 60  ? 0.036   6.125   -0.327  1.00 14.54 ? 60   VAL A CG2    2  
ATOM   5744   H  H      . VAL A 1 60  ? -1.973  8.872   1.920   1.00 0.00  ? 60   VAL A H      2  
ATOM   5745   H  HA     . VAL A 1 60  ? -1.061  8.463   -0.889  1.00 0.00  ? 60   VAL A HA     2  
ATOM   5746   H  HB     . VAL A 1 60  ? 0.208   7.662   1.163   1.00 0.00  ? 60   VAL A HB     2  
ATOM   5747   H  HG11   . VAL A 1 60  ? -1.903  6.953   2.379   1.00 0.00  ? 60   VAL A HG11   2  
ATOM   5748   H  HG12   . VAL A 1 60  ? -0.618  5.747   2.374   1.00 0.00  ? 60   VAL A HG12   2  
ATOM   5749   H  HG13   . VAL A 1 60  ? -1.992  5.575   1.280   1.00 0.00  ? 60   VAL A HG13   2  
ATOM   5750   H  HG21   . VAL A 1 60  ? 0.194   6.642   -1.262  1.00 0.00  ? 60   VAL A HG21   2  
ATOM   5751   H  HG22   . VAL A 1 60  ? -0.636  5.293   -0.484  1.00 0.00  ? 60   VAL A HG22   2  
ATOM   5752   H  HG23   . VAL A 1 60  ? 0.981   5.758   0.046   1.00 0.00  ? 60   VAL A HG23   2  
ATOM   5753   N  N      . GLY A 1 61  ? -3.820  7.284   0.390   1.00 21.21 ? 61   GLY A N      2  
ATOM   5754   C  CA     . GLY A 1 61  ? -5.073  6.557   0.042   1.00 23.96 ? 61   GLY A CA     2  
ATOM   5755   C  C      . GLY A 1 61  ? -5.492  5.658   1.211   1.00 31.77 ? 61   GLY A C      2  
ATOM   5756   O  O      . GLY A 1 61  ? -6.589  5.135   1.235   1.00 33.85 ? 61   GLY A O      2  
ATOM   5757   H  H      . GLY A 1 61  ? -3.749  7.755   1.246   1.00 0.00  ? 61   GLY A H      2  
ATOM   5758   H  HA2    . GLY A 1 61  ? -5.858  7.271   -0.162  1.00 0.00  ? 61   GLY A HA2    2  
ATOM   5759   H  HA3    . GLY A 1 61  ? -4.905  5.948   -0.833  1.00 0.00  ? 61   GLY A HA3    2  
ATOM   5760   N  N      . HIS A 1 62  ? -4.634  5.479   2.187   1.00 26.70 ? 62   HIS A N      2  
ATOM   5761   C  CA     . HIS A 1 62  ? -4.998  4.619   3.354   1.00 31.48 ? 62   HIS A CA     2  
ATOM   5762   C  C      . HIS A 1 62  ? -6.248  5.180   4.035   1.00 35.71 ? 62   HIS A C      2  
ATOM   5763   O  O      . HIS A 1 62  ? -6.392  6.378   4.187   1.00 39.58 ? 62   HIS A O      2  
ATOM   5764   C  CB     . HIS A 1 62  ? -3.795  4.691   4.296   1.00 24.97 ? 62   HIS A CB     2  
ATOM   5765   C  CG     . HIS A 1 62  ? -2.671  3.862   3.738   1.00 24.92 ? 62   HIS A CG     2  
ATOM   5766   N  ND1    . HIS A 1 62  ? -1.340  4.168   3.973   1.00 25.48 ? 62   HIS A ND1    2  
ATOM   5767   C  CD2    . HIS A 1 62  ? -2.664  2.734   2.954   1.00 29.35 ? 62   HIS A CD2    2  
ATOM   5768   C  CE1    . HIS A 1 62  ? -0.594  3.244   3.342   1.00 26.64 ? 62   HIS A CE1    2  
ATOM   5769   N  NE2    . HIS A 1 62  ? -1.351  2.345   2.705   1.00 23.96 ? 62   HIS A NE2    2  
ATOM   5770   H  H      . HIS A 1 62  ? -3.756  5.914   2.155   1.00 0.00  ? 62   HIS A H      2  
ATOM   5771   H  HA     . HIS A 1 62  ? -5.162  3.602   3.039   1.00 0.00  ? 62   HIS A HA     2  
ATOM   5772   H  HB2    . HIS A 1 62  ? -3.474  5.717   4.392   1.00 0.00  ? 62   HIS A HB2    2  
ATOM   5773   H  HB3    . HIS A 1 62  ? -4.075  4.309   5.266   1.00 0.00  ? 62   HIS A HB3    2  
ATOM   5774   H  HD1    . HIS A 1 62  ? -1.003  4.922   4.501   1.00 0.00  ? 62   HIS A HD1    2  
ATOM   5775   H  HD2    . HIS A 1 62  ? -3.543  2.226   2.586   1.00 0.00  ? 62   HIS A HD2    2  
ATOM   5776   H  HE1    . HIS A 1 62  ? 0.487   3.228   3.349   1.00 0.00  ? 62   HIS A HE1    2  
ATOM   5777   N  N      . SER A 1 63  ? -7.161  4.333   4.433   1.00 41.17 ? 63   SER A N      2  
ATOM   5778   C  CA     . SER A 1 63  ? -8.403  4.843   5.087   1.00 44.57 ? 63   SER A CA     2  
ATOM   5779   C  C      . SER A 1 63  ? -8.772  4.001   6.310   1.00 45.48 ? 63   SER A C      2  
ATOM   5780   O  O      . SER A 1 63  ? -8.588  2.800   6.334   1.00 52.79 ? 63   SER A O      2  
ATOM   5781   C  CB     . SER A 1 63  ? -9.486  4.724   4.014   1.00 38.69 ? 63   SER A CB     2  
ATOM   5782   O  OG     . SER A 1 63  ? -8.978  5.208   2.778   1.00 42.82 ? 63   SER A OG     2  
ATOM   5783   H  H      . SER A 1 63  ? -7.036  3.372   4.293   1.00 0.00  ? 63   SER A H      2  
ATOM   5784   H  HA     . SER A 1 63  ? -8.281  5.877   5.367   1.00 0.00  ? 63   SER A HA     2  
ATOM   5785   H  HB2    . SER A 1 63  ? -9.771  3.692   3.900   1.00 0.00  ? 63   SER A HB2    2  
ATOM   5786   H  HB3    . SER A 1 63  ? -10.351 5.303   4.312   1.00 0.00  ? 63   SER A HB3    2  
ATOM   5787   H  HG     . SER A 1 63  ? -9.385  6.060   2.604   1.00 0.00  ? 63   SER A HG     2  
ATOM   5788   N  N      . ILE A 1 64  ? -9.302  4.633   7.325   1.00 36.94 ? 64   ILE A N      2  
ATOM   5789   C  CA     . ILE A 1 64  ? -9.702  3.893   8.556   1.00 42.22 ? 64   ILE A CA     2  
ATOM   5790   C  C      . ILE A 1 64  ? -10.990 4.498   9.128   1.00 46.52 ? 64   ILE A C      2  
ATOM   5791   O  O      . ILE A 1 64  ? -11.035 5.661   9.478   1.00 38.70 ? 64   ILE A O      2  
ATOM   5792   C  CB     . ILE A 1 64  ? -8.539  4.086   9.536   1.00 46.28 ? 64   ILE A CB     2  
ATOM   5793   C  CG1    . ILE A 1 64  ? -7.273  3.425   8.977   1.00 43.11 ? 64   ILE A CG1    2  
ATOM   5794   C  CG2    . ILE A 1 64  ? -8.891  3.452   10.886  1.00 52.58 ? 64   ILE A CG2    2  
ATOM   5795   C  CD1    . ILE A 1 64  ? -7.491  1.916   8.821   1.00 38.04 ? 64   ILE A CD1    2  
ATOM   5796   H  H      . ILE A 1 64  ? -9.444  5.602   7.272   1.00 0.00  ? 64   ILE A H      2  
ATOM   5797   H  HA     . ILE A 1 64  ? -9.839  2.846   8.342   1.00 0.00  ? 64   ILE A HA     2  
ATOM   5798   H  HB     . ILE A 1 64  ? -8.362  5.143   9.675   1.00 0.00  ? 64   ILE A HB     2  
ATOM   5799   H  HG12   . ILE A 1 64  ? -7.037  3.855   8.015   1.00 0.00  ? 64   ILE A HG12   2  
ATOM   5800   H  HG13   . ILE A 1 64  ? -6.451  3.597   9.657   1.00 0.00  ? 64   ILE A HG13   2  
ATOM   5801   H  HG21   . ILE A 1 64  ? -7.994  3.351   11.480  1.00 0.00  ? 64   ILE A HG21   2  
ATOM   5802   H  HG22   . ILE A 1 64  ? -9.327  2.478   10.725  1.00 0.00  ? 64   ILE A HG22   2  
ATOM   5803   H  HG23   . ILE A 1 64  ? -9.597  4.082   11.406  1.00 0.00  ? 64   ILE A HG23   2  
ATOM   5804   H  HD11   . ILE A 1 64  ? -7.300  1.628   7.799   1.00 0.00  ? 64   ILE A HD11   2  
ATOM   5805   H  HD12   . ILE A 1 64  ? -8.510  1.669   9.081   1.00 0.00  ? 64   ILE A HD12   2  
ATOM   5806   H  HD13   . ILE A 1 64  ? -6.817  1.387   9.478   1.00 0.00  ? 64   ILE A HD13   2  
ATOM   5807   N  N      . ARG A 1 65  ? -12.035 3.721   9.229   1.00 48.83 ? 65   ARG A N      2  
ATOM   5808   C  CA     . ARG A 1 65  ? -13.314 4.255   9.784   1.00 55.64 ? 65   ARG A CA     2  
ATOM   5809   C  C      . ARG A 1 65  ? -13.306 4.134   11.308  1.00 47.04 ? 65   ARG A C      2  
ATOM   5810   O  O      . ARG A 1 65  ? -13.690 5.040   12.021  1.00 37.84 ? 65   ARG A O      2  
ATOM   5811   C  CB     . ARG A 1 65  ? -14.409 3.375   9.180   1.00 56.74 ? 65   ARG A CB     2  
ATOM   5812   C  CG     . ARG A 1 65  ? -15.751 4.105   9.256   1.00 63.05 ? 65   ARG A CG     2  
ATOM   5813   C  CD     . ARG A 1 65  ? -15.776 5.238   8.226   1.00 69.43 ? 65   ARG A CD     2  
ATOM   5814   N  NE     . ARG A 1 65  ? -16.491 6.360   8.903   1.00 69.52 ? 65   ARG A NE     2  
ATOM   5815   C  CZ     . ARG A 1 65  ? -16.446 7.575   8.412   1.00 79.60 ? 65   ARG A CZ     2  
ATOM   5816   N  NH1    . ARG A 1 65  ? -15.774 7.830   7.318   1.00 67.57 ? 65   ARG A NH1    2  
ATOM   5817   N  NH2    . ARG A 1 65  ? -17.079 8.540   9.021   1.00 64.90 ? 65   ARG A NH2    2  
ATOM   5818   H  H      . ARG A 1 65  ? -11.978 2.785   8.944   1.00 0.00  ? 65   ARG A H      2  
ATOM   5819   H  HA     . ARG A 1 65  ? -13.457 5.282   9.486   1.00 0.00  ? 65   ARG A HA     2  
ATOM   5820   H  HB2    . ARG A 1 65  ? -14.171 3.162   8.147   1.00 0.00  ? 65   ARG A HB2    2  
ATOM   5821   H  HB3    . ARG A 1 65  ? -14.473 2.450   9.732   1.00 0.00  ? 65   ARG A HB3    2  
ATOM   5822   H  HG2    . ARG A 1 65  ? -16.552 3.409   9.044   1.00 0.00  ? 65   ARG A HG2    2  
ATOM   5823   H  HG3    . ARG A 1 65  ? -15.883 4.516   10.245  1.00 0.00  ? 65   ARG A HG3    2  
ATOM   5824   H  HD2    . ARG A 1 65  ? -14.768 5.532   7.970   1.00 0.00  ? 65   ARG A HD2    2  
ATOM   5825   H  HD3    . ARG A 1 65  ? -16.317 4.935   7.344   1.00 0.00  ? 65   ARG A HD3    2  
ATOM   5826   H  HE     . ARG A 1 65  ? -17.000 6.186   9.724   1.00 0.00  ? 65   ARG A HE     2  
ATOM   5827   H  HH11   . ARG A 1 65  ? -15.286 7.096   6.846   1.00 0.00  ? 65   ARG A HH11   2  
ATOM   5828   H  HH12   . ARG A 1 65  ? -15.748 8.761   6.955   1.00 0.00  ? 65   ARG A HH12   2  
ATOM   5829   H  HH21   . ARG A 1 65  ? -17.595 8.352   9.856   1.00 0.00  ? 65   ARG A HH21   2  
ATOM   5830   H  HH22   . ARG A 1 65  ? -17.049 9.469   8.650   1.00 0.00  ? 65   ARG A HH22   2  
ATOM   5831   N  N      . HIS A 1 66  ? -12.854 3.019   11.806  1.00 44.11 ? 66   HIS A N      2  
ATOM   5832   C  CA     . HIS A 1 66  ? -12.790 2.801   13.290  1.00 39.24 ? 66   HIS A CA     2  
ATOM   5833   C  C      . HIS A 1 66  ? -11.357 2.451   13.718  1.00 34.92 ? 66   HIS A C      2  
ATOM   5834   O  O      . HIS A 1 66  ? -10.958 1.302   13.671  1.00 38.19 ? 66   HIS A O      2  
ATOM   5835   C  CB     . HIS A 1 66  ? -13.723 1.622   13.545  1.00 43.17 ? 66   HIS A CB     2  
ATOM   5836   C  CG     . HIS A 1 66  ? -15.099 1.966   13.050  1.00 53.53 ? 66   HIS A CG     2  
ATOM   5837   N  ND1    . HIS A 1 66  ? -15.815 3.052   13.535  1.00 57.74 ? 66   HIS A ND1    2  
ATOM   5838   C  CD2    . HIS A 1 66  ? -15.909 1.371   12.119  1.00 50.38 ? 66   HIS A CD2    2  
ATOM   5839   C  CE1    . HIS A 1 66  ? -17.001 3.069   12.901  1.00 55.76 ? 66   HIS A CE1    2  
ATOM   5840   N  NE2    . HIS A 1 66  ? -17.109 2.065   12.026  1.00 57.84 ? 66   HIS A NE2    2  
ATOM   5841   H  H      . HIS A 1 66  ? -12.539 2.303   11.218  1.00 0.00  ? 66   HIS A H      2  
ATOM   5842   H  HA     . HIS A 1 66  ? -13.142 3.673   13.815  1.00 0.00  ? 66   HIS A HA     2  
ATOM   5843   H  HB2    . HIS A 1 66  ? -13.357 0.750   13.020  1.00 0.00  ? 66   HIS A HB2    2  
ATOM   5844   H  HB3    . HIS A 1 66  ? -13.761 1.420   14.603  1.00 0.00  ? 66   HIS A HB3    2  
ATOM   5845   H  HD1    . HIS A 1 66  ? -15.507 3.697   14.205  1.00 0.00  ? 66   HIS A HD1    2  
ATOM   5846   H  HD2    . HIS A 1 66  ? -15.648 0.496   11.540  1.00 0.00  ? 66   HIS A HD2    2  
ATOM   5847   H  HE1    . HIS A 1 66  ? -17.777 3.798   13.084  1.00 0.00  ? 66   HIS A HE1    2  
ATOM   5848   N  N      . PRO A 1 67  ? -10.616 3.460   14.125  1.00 42.90 ? 67   PRO A N      2  
ATOM   5849   C  CA     . PRO A 1 67  ? -9.201  3.247   14.547  1.00 40.77 ? 67   PRO A CA     2  
ATOM   5850   C  C      . PRO A 1 67  ? -9.079  2.277   15.747  1.00 37.61 ? 67   PRO A C      2  
ATOM   5851   O  O      . PRO A 1 67  ? -8.268  1.374   15.727  1.00 33.87 ? 67   PRO A O      2  
ATOM   5852   C  CB     . PRO A 1 67  ? -8.738  4.651   14.930  1.00 34.55 ? 67   PRO A CB     2  
ATOM   5853   C  CG     . PRO A 1 67  ? -10.000 5.381   15.240  1.00 39.24 ? 67   PRO A CG     2  
ATOM   5854   C  CD     . PRO A 1 67  ? -11.017 4.861   14.267  1.00 49.91 ? 67   PRO A CD     2  
ATOM   5855   H  HA     . PRO A 1 67  ? -8.613  2.889   13.716  1.00 0.00  ? 67   PRO A HA     2  
ATOM   5856   H  HB2    . PRO A 1 67  ? -8.101  4.607   15.803  1.00 0.00  ? 67   PRO A HB2    2  
ATOM   5857   H  HB3    . PRO A 1 67  ? -8.226  5.122   14.108  1.00 0.00  ? 67   PRO A HB3    2  
ATOM   5858   H  HG2    . PRO A 1 67  ? -10.312 5.168   16.254  1.00 0.00  ? 67   PRO A HG2    2  
ATOM   5859   H  HG3    . PRO A 1 67  ? -9.865  6.441   15.100  1.00 0.00  ? 67   PRO A HG3    2  
ATOM   5860   H  HD2    . PRO A 1 67  ? -12.014 4.938   14.683  1.00 0.00  ? 67   PRO A HD2    2  
ATOM   5861   H  HD3    . PRO A 1 67  ? -10.949 5.372   13.320  1.00 0.00  ? 67   PRO A HD3    2  
ATOM   5862   N  N      . ASP A 1 68  ? -9.870  2.461   16.791  1.00 37.92 ? 68   ASP A N      2  
ATOM   5863   C  CA     . ASP A 1 68  ? -9.798  1.551   17.972  1.00 32.31 ? 68   ASP A CA     2  
ATOM   5864   C  C      . ASP A 1 68  ? -9.777  0.049   17.600  1.00 35.25 ? 68   ASP A C      2  
ATOM   5865   O  O      . ASP A 1 68  ? -9.129  -0.745  18.264  1.00 38.80 ? 68   ASP A O      2  
ATOM   5866   C  CB     . ASP A 1 68  ? -11.054 1.875   18.774  1.00 47.41 ? 68   ASP A CB     2  
ATOM   5867   C  CG     . ASP A 1 68  ? -12.300 1.546   17.943  1.00 53.79 ? 68   ASP A CG     2  
ATOM   5868   O  OD1    . ASP A 1 68  ? -12.364 1.983   16.804  1.00 49.61 ? 68   ASP A OD1    2  
ATOM   5869   O  OD2    . ASP A 1 68  ? -13.167 0.859   18.458  1.00 51.97 ? 68   ASP A OD2    2  
ATOM   5870   H  H      . ASP A 1 68  ? -10.532 3.181   16.714  1.00 0.00  ? 68   ASP A H      2  
ATOM   5871   H  HA     . ASP A 1 68  ? -8.927  1.793   18.554  1.00 0.00  ? 68   ASP A HA     2  
ATOM   5872   H  HB2    . ASP A 1 68  ? -11.060 1.288   19.682  1.00 0.00  ? 68   ASP A HB2    2  
ATOM   5873   H  HB3    . ASP A 1 68  ? -11.057 2.925   19.024  1.00 0.00  ? 68   ASP A HB3    2  
ATOM   5874   N  N      . VAL A 1 69  ? -10.498 -0.352  16.585  1.00 33.89 ? 69   VAL A N      2  
ATOM   5875   C  CA     . VAL A 1 69  ? -10.531 -1.815  16.217  1.00 34.92 ? 69   VAL A CA     2  
ATOM   5876   C  C      . VAL A 1 69  ? -9.657  -2.159  14.993  1.00 32.22 ? 69   VAL A C      2  
ATOM   5877   O  O      . VAL A 1 69  ? -9.273  -3.303  14.816  1.00 38.20 ? 69   VAL A O      2  
ATOM   5878   C  CB     . VAL A 1 69  ? -11.994 -2.104  15.892  1.00 40.60 ? 69   VAL A CB     2  
ATOM   5879   C  CG1    . VAL A 1 69  ? -12.847 -1.827  17.125  1.00 41.77 ? 69   VAL A CG1    2  
ATOM   5880   C  CG2    . VAL A 1 69  ? -12.461 -1.204  14.741  1.00 34.27 ? 69   VAL A CG2    2  
ATOM   5881   H  H      . VAL A 1 69  ? -11.037 0.286   16.073  1.00 0.00  ? 69   VAL A H      2  
ATOM   5882   H  HA     . VAL A 1 69  ? -10.231 -2.413  17.062  1.00 0.00  ? 69   VAL A HA     2  
ATOM   5883   H  HB     . VAL A 1 69  ? -12.099 -3.140  15.605  1.00 0.00  ? 69   VAL A HB     2  
ATOM   5884   H  HG11   . VAL A 1 69  ? -13.309 -0.857  17.031  1.00 0.00  ? 69   VAL A HG11   2  
ATOM   5885   H  HG12   . VAL A 1 69  ? -12.222 -1.846  18.006  1.00 0.00  ? 69   VAL A HG12   2  
ATOM   5886   H  HG13   . VAL A 1 69  ? -13.611 -2.584  17.209  1.00 0.00  ? 69   VAL A HG13   2  
ATOM   5887   H  HG21   . VAL A 1 69  ? -11.680 -1.131  13.997  1.00 0.00  ? 69   VAL A HG21   2  
ATOM   5888   H  HG22   . VAL A 1 69  ? -12.685 -0.221  15.125  1.00 0.00  ? 69   VAL A HG22   2  
ATOM   5889   H  HG23   . VAL A 1 69  ? -13.347 -1.626  14.291  1.00 0.00  ? 69   VAL A HG23   2  
ATOM   5890   N  N      . GLU A 1 70  ? -9.374  -1.209  14.128  1.00 27.45 ? 70   GLU A N      2  
ATOM   5891   C  CA     . GLU A 1 70  ? -8.567  -1.531  12.903  1.00 27.31 ? 70   GLU A CA     2  
ATOM   5892   C  C      . GLU A 1 70  ? -7.073  -1.197  13.057  1.00 30.12 ? 70   GLU A C      2  
ATOM   5893   O  O      . GLU A 1 70  ? -6.260  -1.634  12.261  1.00 34.42 ? 70   GLU A O      2  
ATOM   5894   C  CB     . GLU A 1 70  ? -9.172  -0.649  11.810  1.00 26.74 ? 70   GLU A CB     2  
ATOM   5895   C  CG     . GLU A 1 70  ? -10.413 -1.322  11.221  1.00 27.57 ? 70   GLU A CG     2  
ATOM   5896   C  CD     . GLU A 1 70  ? -10.943 -0.477  10.060  1.00 38.38 ? 70   GLU A CD     2  
ATOM   5897   O  OE1    . GLU A 1 70  ? -10.458 -0.657  8.955   1.00 46.14 ? 70   GLU A OE1    2  
ATOM   5898   O  OE2    . GLU A 1 70  ? -11.820 0.336   10.296  1.00 37.29 ? 70   GLU A OE2    2  
ATOM   5899   H  H      . GLU A 1 70  ? -9.719  -0.301  14.266  1.00 0.00  ? 70   GLU A H      2  
ATOM   5900   H  HA     . GLU A 1 70  ? -8.692  -2.569  12.638  1.00 0.00  ? 70   GLU A HA     2  
ATOM   5901   H  HB2    . GLU A 1 70  ? -9.449  0.306   12.232  1.00 0.00  ? 70   GLU A HB2    2  
ATOM   5902   H  HB3    . GLU A 1 70  ? -8.444  -0.499  11.028  1.00 0.00  ? 70   GLU A HB3    2  
ATOM   5903   H  HG2    . GLU A 1 70  ? -10.153 -2.309  10.863  1.00 0.00  ? 70   GLU A HG2    2  
ATOM   5904   H  HG3    . GLU A 1 70  ? -11.175 -1.403  11.981  1.00 0.00  ? 70   GLU A HG3    2  
ATOM   5905   N  N      . VAL A 1 71  ? -6.702  -0.411  14.033  1.00 26.02 ? 71   VAL A N      2  
ATOM   5906   C  CA     . VAL A 1 71  ? -5.254  -0.049  14.170  1.00 23.39 ? 71   VAL A CA     2  
ATOM   5907   C  C      . VAL A 1 71  ? -4.652  -0.577  15.475  1.00 23.58 ? 71   VAL A C      2  
ATOM   5908   O  O      . VAL A 1 71  ? -5.027  -0.171  16.560  1.00 26.27 ? 71   VAL A O      2  
ATOM   5909   C  CB     . VAL A 1 71  ? -5.224  1.475   14.144  1.00 19.60 ? 71   VAL A CB     2  
ATOM   5910   C  CG1    . VAL A 1 71  ? -3.778  1.964   14.196  1.00 16.73 ? 71   VAL A CG1    2  
ATOM   5911   C  CG2    . VAL A 1 71  ? -5.873  1.964   12.852  1.00 20.23 ? 71   VAL A CG2    2  
ATOM   5912   H  H      . VAL A 1 71  ? -7.368  -0.042  14.655  1.00 0.00  ? 71   VAL A H      2  
ATOM   5913   H  HA     . VAL A 1 71  ? -4.694  -0.433  13.328  1.00 0.00  ? 71   VAL A HA     2  
ATOM   5914   H  HB     . VAL A 1 71  ? -5.768  1.863   14.994  1.00 0.00  ? 71   VAL A HB     2  
ATOM   5915   H  HG11   . VAL A 1 71  ? -3.492  2.127   15.223  1.00 0.00  ? 71   VAL A HG11   2  
ATOM   5916   H  HG12   . VAL A 1 71  ? -3.694  2.891   13.646  1.00 0.00  ? 71   VAL A HG12   2  
ATOM   5917   H  HG13   . VAL A 1 71  ? -3.130  1.222   13.752  1.00 0.00  ? 71   VAL A HG13   2  
ATOM   5918   H  HG21   . VAL A 1 71  ? -5.296  1.616   12.007  1.00 0.00  ? 71   VAL A HG21   2  
ATOM   5919   H  HG22   . VAL A 1 71  ? -5.900  3.043   12.850  1.00 0.00  ? 71   VAL A HG22   2  
ATOM   5920   H  HG23   . VAL A 1 71  ? -6.877  1.575   12.787  1.00 0.00  ? 71   VAL A HG23   2  
ATOM   5921   N  N      . ASP A 1 72  ? -3.697  -1.480  15.364  1.00 21.35 ? 72   ASP A N      2  
ATOM   5922   C  CA     . ASP A 1 72  ? -3.045  -2.041  16.575  1.00 22.04 ? 72   ASP A CA     2  
ATOM   5923   C  C      . ASP A 1 72  ? -2.218  -0.952  17.281  1.00 25.75 ? 72   ASP A C      2  
ATOM   5924   O  O      . ASP A 1 72  ? -1.589  -0.134  16.636  1.00 26.86 ? 72   ASP A O      2  
ATOM   5925   C  CB     . ASP A 1 72  ? -2.132  -3.134  16.034  1.00 26.18 ? 72   ASP A CB     2  
ATOM   5926   C  CG     . ASP A 1 72  ? -1.529  -3.920  17.195  1.00 38.25 ? 72   ASP A CG     2  
ATOM   5927   O  OD1    . ASP A 1 72  ? -2.228  -4.122  18.173  1.00 36.89 ? 72   ASP A OD1    2  
ATOM   5928   O  OD2    . ASP A 1 72  ? -0.379  -4.308  17.083  1.00 36.16 ? 72   ASP A OD2    2  
ATOM   5929   H  H      . ASP A 1 72  ? -3.436  -1.758  14.456  1.00 0.00  ? 72   ASP A H      2  
ATOM   5930   H  HA     . ASP A 1 72  ? -3.779  -2.462  17.246  1.00 0.00  ? 72   ASP A HA     2  
ATOM   5931   H  HB2    . ASP A 1 72  ? -2.703  -3.800  15.403  1.00 0.00  ? 72   ASP A HB2    2  
ATOM   5932   H  HB3    . ASP A 1 72  ? -1.339  -2.682  15.457  1.00 0.00  ? 72   ASP A HB3    2  
ATOM   5933   N  N      . GLY A 1 73  ? -2.204  -0.935  18.597  1.00 22.24 ? 73   GLY A N      2  
ATOM   5934   C  CA     . GLY A 1 73  ? -1.407  0.096   19.336  1.00 17.23 ? 73   GLY A CA     2  
ATOM   5935   C  C      . GLY A 1 73  ? -2.229  1.375   19.572  1.00 18.95 ? 73   GLY A C      2  
ATOM   5936   O  O      . GLY A 1 73  ? -1.794  2.276   20.268  1.00 27.56 ? 73   GLY A O      2  
ATOM   5937   H  H      . GLY A 1 73  ? -2.713  -1.608  19.097  1.00 0.00  ? 73   GLY A H      2  
ATOM   5938   H  HA2    . GLY A 1 73  ? -1.112  -0.311  20.293  1.00 0.00  ? 73   GLY A HA2    2  
ATOM   5939   H  HA3    . GLY A 1 73  ? -0.523  0.339   18.768  1.00 0.00  ? 73   GLY A HA3    2  
ATOM   5940   N  N      . PHE A 1 74  ? -3.394  1.470   18.996  1.00 17.74 ? 74   PHE A N      2  
ATOM   5941   C  CA     . PHE A 1 74  ? -4.227  2.711   19.179  1.00 21.03 ? 74   PHE A CA     2  
ATOM   5942   C  C      . PHE A 1 74  ? -4.521  2.972   20.659  1.00 22.41 ? 74   PHE A C      2  
ATOM   5943   O  O      . PHE A 1 74  ? -4.346  4.071   21.149  1.00 25.52 ? 74   PHE A O      2  
ATOM   5944   C  CB     . PHE A 1 74  ? -5.532  2.429   18.434  1.00 22.08 ? 74   PHE A CB     2  
ATOM   5945   C  CG     . PHE A 1 74  ? -6.450  3.615   18.563  1.00 24.18 ? 74   PHE A CG     2  
ATOM   5946   C  CD1    . PHE A 1 74  ? -6.279  4.723   17.715  1.00 27.19 ? 74   PHE A CD1    2  
ATOM   5947   C  CD2    . PHE A 1 74  ? -7.483  3.602   19.518  1.00 21.94 ? 74   PHE A CD2    2  
ATOM   5948   C  CE1    . PHE A 1 74  ? -7.144  5.826   17.819  1.00 25.71 ? 74   PHE A CE1    2  
ATOM   5949   C  CE2    . PHE A 1 74  ? -8.355  4.702   19.625  1.00 27.03 ? 74   PHE A CE2    2  
ATOM   5950   C  CZ     . PHE A 1 74  ? -8.185  5.816   18.774  1.00 27.42 ? 74   PHE A CZ     2  
ATOM   5951   H  H      . PHE A 1 74  ? -3.738  0.762   18.416  1.00 0.00  ? 74   PHE A H      2  
ATOM   5952   H  HA     . PHE A 1 74  ? -3.731  3.558   18.739  1.00 0.00  ? 74   PHE A HA     2  
ATOM   5953   H  HB2    . PHE A 1 74  ? -5.322  2.253   17.390  1.00 0.00  ? 74   PHE A HB2    2  
ATOM   5954   H  HB3    . PHE A 1 74  ? -6.012  1.559   18.858  1.00 0.00  ? 74   PHE A HB3    2  
ATOM   5955   H  HD1    . PHE A 1 74  ? -5.477  4.728   16.985  1.00 0.00  ? 74   PHE A HD1    2  
ATOM   5956   H  HD2    . PHE A 1 74  ? -7.608  2.744   20.172  1.00 0.00  ? 74   PHE A HD2    2  
ATOM   5957   H  HE1    . PHE A 1 74  ? -7.012  6.684   17.161  1.00 0.00  ? 74   PHE A HE1    2  
ATOM   5958   H  HE2    . PHE A 1 74  ? -9.155  4.692   20.363  1.00 0.00  ? 74   PHE A HE2    2  
ATOM   5959   H  HZ     . PHE A 1 74  ? -8.855  6.664   18.853  1.00 0.00  ? 74   PHE A HZ     2  
ATOM   5960   N  N      . SER A 1 75  ? -4.996  1.983   21.357  1.00 22.85 ? 75   SER A N      2  
ATOM   5961   C  CA     . SER A 1 75  ? -5.337  2.165   22.804  1.00 25.37 ? 75   SER A CA     2  
ATOM   5962   C  C      . SER A 1 75  ? -4.115  2.555   23.667  1.00 21.35 ? 75   SER A C      2  
ATOM   5963   O  O      . SER A 1 75  ? -4.283  3.094   24.743  1.00 30.44 ? 75   SER A O      2  
ATOM   5964   C  CB     . SER A 1 75  ? -5.877  0.805   23.255  1.00 24.40 ? 75   SER A CB     2  
ATOM   5965   O  OG     . SER A 1 75  ? -4.980  -0.218  22.847  1.00 35.52 ? 75   SER A OG     2  
ATOM   5966   H  H      . SER A 1 75  ? -5.133  1.108   20.935  1.00 0.00  ? 75   SER A H      2  
ATOM   5967   H  HA     . SER A 1 75  ? -6.113  2.905   22.903  1.00 0.00  ? 75   SER A HA     2  
ATOM   5968   H  HB2    . SER A 1 75  ? -5.967  0.789   24.329  1.00 0.00  ? 75   SER A HB2    2  
ATOM   5969   H  HB3    . SER A 1 75  ? -6.853  0.641   22.813  1.00 0.00  ? 75   SER A HB3    2  
ATOM   5970   H  HG     . SER A 1 75  ? -4.814  -0.786  23.605  1.00 0.00  ? 75   SER A HG     2  
ATOM   5971   N  N      . GLU A 1 76  ? -2.891  2.288   23.222  1.00 22.71 ? 76   GLU A N      2  
ATOM   5972   C  CA     . GLU A 1 76  ? -1.717  2.670   24.045  1.00 21.23 ? 76   GLU A CA     2  
ATOM   5973   C  C      . GLU A 1 76  ? -1.206  4.090   23.723  1.00 21.91 ? 76   GLU A C      2  
ATOM   5974   O  O      . GLU A 1 76  ? -0.280  4.570   24.351  1.00 26.42 ? 76   GLU A O      2  
ATOM   5975   C  CB     . GLU A 1 76  ? -0.664  1.624   23.705  1.00 13.99 ? 76   GLU A CB     2  
ATOM   5976   C  CG     . GLU A 1 76  ? -0.943  0.343   24.498  1.00 27.64 ? 76   GLU A CG     2  
ATOM   5977   C  CD     . GLU A 1 76  ? -1.797  -0.607  23.656  1.00 39.35 ? 76   GLU A CD     2  
ATOM   5978   O  OE1    . GLU A 1 76  ? -1.379  -0.930  22.556  1.00 44.01 ? 76   GLU A OE1    2  
ATOM   5979   O  OE2    . GLU A 1 76  ? -2.853  -0.997  24.126  1.00 37.68 ? 76   GLU A OE2    2  
ATOM   5980   H  H      . GLU A 1 76  ? -2.824  1.897   22.328  1.00 0.00  ? 76   GLU A H      2  
ATOM   5981   H  HA     . GLU A 1 76  ? -1.968  2.603   25.092  1.00 0.00  ? 76   GLU A HA     2  
ATOM   5982   H  HB2    . GLU A 1 76  ? -0.700  1.410   22.648  1.00 0.00  ? 76   GLU A HB2    2  
ATOM   5983   H  HB3    . GLU A 1 76  ? 0.313   2.000   23.965  1.00 0.00  ? 76   GLU A HB3    2  
ATOM   5984   H  HG2    . GLU A 1 76  ? -0.007  -0.137  24.745  1.00 0.00  ? 76   GLU A HG2    2  
ATOM   5985   H  HG3    . GLU A 1 76  ? -1.472  0.590   25.406  1.00 0.00  ? 76   GLU A HG3    2  
ATOM   5986   N  N      . LEU A 1 77  ? -1.805  4.771   22.768  1.00 20.08 ? 77   LEU A N      2  
ATOM   5987   C  CA     . LEU A 1 77  ? -1.357  6.154   22.439  1.00 19.19 ? 77   LEU A CA     2  
ATOM   5988   C  C      . LEU A 1 77  ? -1.823  7.113   23.528  1.00 22.81 ? 77   LEU A C      2  
ATOM   5989   O  O      . LEU A 1 77  ? -2.782  6.840   24.229  1.00 23.38 ? 77   LEU A O      2  
ATOM   5990   C  CB     . LEU A 1 77  ? -2.073  6.516   21.131  1.00 21.85 ? 77   LEU A CB     2  
ATOM   5991   C  CG     . LEU A 1 77  ? -1.684  5.546   20.019  1.00 19.61 ? 77   LEU A CG     2  
ATOM   5992   C  CD1    . LEU A 1 77  ? -2.558  5.813   18.788  1.00 16.91 ? 77   LEU A CD1    2  
ATOM   5993   C  CD2    . LEU A 1 77  ? -0.214  5.755   19.652  1.00 14.85 ? 77   LEU A CD2    2  
ATOM   5994   H  H      . LEU A 1 77  ? -2.562  4.359   22.302  1.00 0.00  ? 77   LEU A H      2  
ATOM   5995   H  HA     . LEU A 1 77  ? -0.284  6.199   22.311  1.00 0.00  ? 77   LEU A HA     2  
ATOM   5996   H  HB2    . LEU A 1 77  ? -3.140  6.466   21.289  1.00 0.00  ? 77   LEU A HB2    2  
ATOM   5997   H  HB3    . LEU A 1 77  ? -1.802  7.521   20.841  1.00 0.00  ? 77   LEU A HB3    2  
ATOM   5998   H  HG     . LEU A 1 77  ? -1.835  4.532   20.356  1.00 0.00  ? 77   LEU A HG     2  
ATOM   5999   H  HD11   . LEU A 1 77  ? -2.158  5.280   17.940  1.00 0.00  ? 77   LEU A HD11   2  
ATOM   6000   H  HD12   . LEU A 1 77  ? -2.567  6.872   18.574  1.00 0.00  ? 77   LEU A HD12   2  
ATOM   6001   H  HD13   . LEU A 1 77  ? -3.567  5.478   18.981  1.00 0.00  ? 77   LEU A HD13   2  
ATOM   6002   H  HD21   . LEU A 1 77  ? 0.405   5.528   20.508  1.00 0.00  ? 77   LEU A HD21   2  
ATOM   6003   H  HD22   . LEU A 1 77  ? -0.059  6.784   19.360  1.00 0.00  ? 77   LEU A HD22   2  
ATOM   6004   H  HD23   . LEU A 1 77  ? 0.050   5.104   18.831  1.00 0.00  ? 77   LEU A HD23   2  
ATOM   6005   N  N      . ARG A 1 78  ? -1.191  8.252   23.649  1.00 25.50 ? 78   ARG A N      2  
ATOM   6006   C  CA     . ARG A 1 78  ? -1.651  9.244   24.660  1.00 16.88 ? 78   ARG A CA     2  
ATOM   6007   C  C      . ARG A 1 78  ? -3.058  9.709   24.263  1.00 24.75 ? 78   ARG A C      2  
ATOM   6008   O  O      . ARG A 1 78  ? -3.432  9.642   23.104  1.00 33.16 ? 78   ARG A O      2  
ATOM   6009   C  CB     . ARG A 1 78  ? -0.633  10.385  24.601  1.00 22.08 ? 78   ARG A CB     2  
ATOM   6010   C  CG     . ARG A 1 78  ? 0.679   9.926   25.247  1.00 23.66 ? 78   ARG A CG     2  
ATOM   6011   C  CD     . ARG A 1 78  ? 1.399   11.134  25.855  1.00 31.82 ? 78   ARG A CD     2  
ATOM   6012   N  NE     . ARG A 1 78  ? 2.849   10.798  25.770  1.00 46.69 ? 78   ARG A NE     2  
ATOM   6013   C  CZ     . ARG A 1 78  ? 3.454   10.814  24.611  1.00 45.08 ? 78   ARG A CZ     2  
ATOM   6014   N  NH1    . ARG A 1 78  ? 2.781   11.101  23.522  1.00 41.34 ? 78   ARG A NH1    2  
ATOM   6015   N  NH2    . ARG A 1 78  ? 4.727   10.536  24.536  1.00 41.10 ? 78   ARG A NH2    2  
ATOM   6016   H  H      . ARG A 1 78  ? -0.450  8.473   23.048  1.00 0.00  ? 78   ARG A H      2  
ATOM   6017   H  HA     . ARG A 1 78  ? -1.664  8.804   25.647  1.00 0.00  ? 78   ARG A HA     2  
ATOM   6018   H  HB2    . ARG A 1 78  ? -0.456  10.653  23.568  1.00 0.00  ? 78   ARG A HB2    2  
ATOM   6019   H  HB3    . ARG A 1 78  ? -1.017  11.240  25.136  1.00 0.00  ? 78   ARG A HB3    2  
ATOM   6020   H  HG2    . ARG A 1 78  ? 0.470   9.203   26.022  1.00 0.00  ? 78   ARG A HG2    2  
ATOM   6021   H  HG3    . ARG A 1 78  ? 1.314   9.475   24.496  1.00 0.00  ? 78   ARG A HG3    2  
ATOM   6022   H  HD2    . ARG A 1 78  ? 1.189   12.023  25.276  1.00 0.00  ? 78   ARG A HD2    2  
ATOM   6023   H  HD3    . ARG A 1 78  ? 1.111   11.276  26.884  1.00 0.00  ? 78   ARG A HD3    2  
ATOM   6024   H  HE     . ARG A 1 78  ? 3.350   10.571  26.584  1.00 0.00  ? 78   ARG A HE     2  
ATOM   6025   H  HH11   . ARG A 1 78  ? 1.803   11.309  23.576  1.00 0.00  ? 78   ARG A HH11   2  
ATOM   6026   H  HH12   . ARG A 1 78  ? 3.242   11.114  22.638  1.00 0.00  ? 78   ARG A HH12   2  
ATOM   6027   H  HH21   . ARG A 1 78  ? 5.240   10.311  25.364  1.00 0.00  ? 78   ARG A HH21   2  
ATOM   6028   H  HH22   . ARG A 1 78  ? 5.191   10.551  23.649  1.00 0.00  ? 78   ARG A HH22   2  
ATOM   6029   N  N      . TRP A 1 79  ? -3.851  10.126  25.213  1.00 26.73 ? 79   TRP A N      2  
ATOM   6030   C  CA     . TRP A 1 79  ? -5.262  10.544  24.907  1.00 24.29 ? 79   TRP A CA     2  
ATOM   6031   C  C      . TRP A 1 79  ? -5.352  11.499  23.706  1.00 26.70 ? 79   TRP A C      2  
ATOM   6032   O  O      . TRP A 1 79  ? -6.075  11.237  22.761  1.00 26.13 ? 79   TRP A O      2  
ATOM   6033   C  CB     . TRP A 1 79  ? -5.759  11.242  26.176  1.00 26.62 ? 79   TRP A CB     2  
ATOM   6034   C  CG     . TRP A 1 79  ? -7.246  11.404  26.103  1.00 27.81 ? 79   TRP A CG     2  
ATOM   6035   C  CD1    . TRP A 1 79  ? -7.903  12.586  26.015  1.00 32.00 ? 79   TRP A CD1    2  
ATOM   6036   C  CD2    . TRP A 1 79  ? -8.268  10.370  26.114  1.00 31.19 ? 79   TRP A CD2    2  
ATOM   6037   N  NE1    . TRP A 1 79  ? -9.260  12.338  25.955  1.00 37.20 ? 79   TRP A NE1    2  
ATOM   6038   C  CE2    . TRP A 1 79  ? -9.537  10.993  26.013  1.00 32.63 ? 79   TRP A CE2    2  
ATOM   6039   C  CE3    . TRP A 1 79  ? -8.213  8.965   26.195  1.00 33.68 ? 79   TRP A CE3    2  
ATOM   6040   C  CZ2    . TRP A 1 79  ? -10.721 10.259  25.990  1.00 44.57 ? 79   TRP A CZ2    2  
ATOM   6041   C  CZ3    . TRP A 1 79  ? -9.404  8.211   26.175  1.00 45.90 ? 79   TRP A CZ3    2  
ATOM   6042   C  CH2    . TRP A 1 79  ? -10.660 8.861   26.070  1.00 50.09 ? 79   TRP A CH2    2  
ATOM   6043   H  H      . TRP A 1 79  ? -3.531  10.131  26.140  1.00 0.00  ? 79   TRP A H      2  
ATOM   6044   H  HA     . TRP A 1 79  ? -5.869  9.672   24.724  1.00 0.00  ? 79   TRP A HA     2  
ATOM   6045   H  HB2    . TRP A 1 79  ? -5.504  10.642  27.038  1.00 0.00  ? 79   TRP A HB2    2  
ATOM   6046   H  HB3    . TRP A 1 79  ? -5.294  12.213  26.258  1.00 0.00  ? 79   TRP A HB3    2  
ATOM   6047   H  HD1    . TRP A 1 79  ? -7.442  13.563  25.989  1.00 0.00  ? 79   TRP A HD1    2  
ATOM   6048   H  HE1    . TRP A 1 79  ? -9.958  13.024  25.880  1.00 0.00  ? 79   TRP A HE1    2  
ATOM   6049   H  HE3    . TRP A 1 79  ? -7.250  8.467   26.277  1.00 0.00  ? 79   TRP A HE3    2  
ATOM   6050   H  HZ2    . TRP A 1 79  ? -11.674 10.765  25.907  1.00 0.00  ? 79   TRP A HZ2    2  
ATOM   6051   H  HZ3    . TRP A 1 79  ? -9.357  7.131   26.239  1.00 0.00  ? 79   TRP A HZ3    2  
ATOM   6052   H  HH2    . TRP A 1 79  ? -11.574 8.280   26.055  1.00 0.00  ? 79   TRP A HH2    2  
ATOM   6053   N  N      . ASP A 1 80  ? -4.651  12.604  23.739  1.00 20.85 ? 80   ASP A N      2  
ATOM   6054   C  CA     . ASP A 1 80  ? -4.724  13.580  22.603  1.00 23.23 ? 80   ASP A CA     2  
ATOM   6055   C  C      . ASP A 1 80  ? -4.412  12.903  21.258  1.00 26.89 ? 80   ASP A C      2  
ATOM   6056   O  O      . ASP A 1 80  ? -5.062  13.165  20.262  1.00 31.93 ? 80   ASP A O      2  
ATOM   6057   C  CB     . ASP A 1 80  ? -3.679  14.651  22.929  1.00 21.03 ? 80   ASP A CB     2  
ATOM   6058   C  CG     . ASP A 1 80  ? -2.292  14.013  23.028  1.00 39.98 ? 80   ASP A CG     2  
ATOM   6059   O  OD1    . ASP A 1 80  ? -2.078  13.243  23.949  1.00 43.13 ? 80   ASP A OD1    2  
ATOM   6060   O  OD2    . ASP A 1 80  ? -1.466  14.306  22.179  1.00 51.81 ? 80   ASP A OD2    2  
ATOM   6061   H  H      . ASP A 1 80  ? -4.092  12.796  24.520  1.00 0.00  ? 80   ASP A H      2  
ATOM   6062   H  HA     . ASP A 1 80  ? -5.703  14.030  22.569  1.00 0.00  ? 80   ASP A HA     2  
ATOM   6063   H  HB2    . ASP A 1 80  ? -3.678  15.399  22.149  1.00 0.00  ? 80   ASP A HB2    2  
ATOM   6064   H  HB3    . ASP A 1 80  ? -3.925  15.116  23.872  1.00 0.00  ? 80   ASP A HB3    2  
ATOM   6065   N  N      . ASP A 1 81  ? -3.427  12.039  21.218  1.00 26.67 ? 81   ASP A N      2  
ATOM   6066   C  CA     . ASP A 1 81  ? -3.088  11.357  19.933  1.00 21.47 ? 81   ASP A CA     2  
ATOM   6067   C  C      . ASP A 1 81  ? -4.221  10.402  19.544  1.00 27.28 ? 81   ASP A C      2  
ATOM   6068   O  O      . ASP A 1 81  ? -4.494  10.190  18.376  1.00 29.57 ? 81   ASP A O      2  
ATOM   6069   C  CB     . ASP A 1 81  ? -1.793  10.595  20.211  1.00 23.57 ? 81   ASP A CB     2  
ATOM   6070   C  CG     . ASP A 1 81  ? -0.597  11.542  20.068  1.00 26.63 ? 81   ASP A CG     2  
ATOM   6071   O  OD1    . ASP A 1 81  ? -0.620  12.365  19.167  1.00 35.67 ? 81   ASP A OD1    2  
ATOM   6072   O  OD2    . ASP A 1 81  ? 0.322   11.426  20.862  1.00 18.16 ? 81   ASP A OD2    2  
ATOM   6073   H  H      . ASP A 1 81  ? -2.915  11.841  22.031  1.00 0.00  ? 81   ASP A H      2  
ATOM   6074   H  HA     . ASP A 1 81  ? -2.928  12.086  19.153  1.00 0.00  ? 81   ASP A HA     2  
ATOM   6075   H  HB2    . ASP A 1 81  ? -1.821  10.198  21.215  1.00 0.00  ? 81   ASP A HB2    2  
ATOM   6076   H  HB3    . ASP A 1 81  ? -1.694  9.785   19.505  1.00 0.00  ? 81   ASP A HB3    2  
ATOM   6077   N  N      . GLN A 1 82  ? -4.899  9.849   20.519  1.00 24.99 ? 82   GLN A N      2  
ATOM   6078   C  CA     . GLN A 1 82  ? -6.040  8.935   20.214  1.00 21.39 ? 82   GLN A CA     2  
ATOM   6079   C  C      . GLN A 1 82  ? -7.171  9.752   19.586  1.00 24.45 ? 82   GLN A C      2  
ATOM   6080   O  O      . GLN A 1 82  ? -7.861  9.300   18.692  1.00 32.47 ? 82   GLN A O      2  
ATOM   6081   C  CB     . GLN A 1 82  ? -6.468  8.360   21.566  1.00 19.69 ? 82   GLN A CB     2  
ATOM   6082   C  CG     . GLN A 1 82  ? -5.930  6.934   21.717  1.00 22.38 ? 82   GLN A CG     2  
ATOM   6083   C  CD     . GLN A 1 82  ? -6.912  6.109   22.548  1.00 27.93 ? 82   GLN A CD     2  
ATOM   6084   O  OE1    . GLN A 1 82  ? -8.038  5.897   22.145  1.00 19.85 ? 82   GLN A OE1    2  
ATOM   6085   N  NE2    . GLN A 1 82  ? -6.531  5.632   23.700  1.00 24.87 ? 82   GLN A NE2    2  
ATOM   6086   H  H      . GLN A 1 82  ? -4.668  10.054  21.450  1.00 0.00  ? 82   GLN A H      2  
ATOM   6087   H  HA     . GLN A 1 82  ? -5.727  8.142   19.549  1.00 0.00  ? 82   GLN A HA     2  
ATOM   6088   H  HB2    . GLN A 1 82  ? -6.074  8.977   22.358  1.00 0.00  ? 82   GLN A HB2    2  
ATOM   6089   H  HB3    . GLN A 1 82  ? -7.545  8.341   21.625  1.00 0.00  ? 82   GLN A HB3    2  
ATOM   6090   H  HG2    . GLN A 1 82  ? -5.816  6.486   20.740  1.00 0.00  ? 82   GLN A HG2    2  
ATOM   6091   H  HG3    . GLN A 1 82  ? -4.973  6.962   22.215  1.00 0.00  ? 82   GLN A HG3    2  
ATOM   6092   H  HE21   . GLN A 1 82  ? -5.621  5.802   24.025  1.00 0.00  ? 82   GLN A HE21   2  
ATOM   6093   H  HE22   . GLN A 1 82  ? -7.152  5.102   24.240  1.00 0.00  ? 82   GLN A HE22   2  
ATOM   6094   N  N      . GLN A 1 83  ? -7.345  10.974  20.044  1.00 26.76 ? 83   GLN A N      2  
ATOM   6095   C  CA     . GLN A 1 83  ? -8.410  11.840  19.478  1.00 30.55 ? 83   GLN A CA     2  
ATOM   6096   C  C      . GLN A 1 83  ? -7.978  12.327  18.095  1.00 33.82 ? 83   GLN A C      2  
ATOM   6097   O  O      . GLN A 1 83  ? -8.759  12.359  17.160  1.00 36.61 ? 83   GLN A O      2  
ATOM   6098   C  CB     . GLN A 1 83  ? -8.525  13.018  20.446  1.00 36.04 ? 83   GLN A CB     2  
ATOM   6099   C  CG     . GLN A 1 83  ? -8.971  12.514  21.821  1.00 37.85 ? 83   GLN A CG     2  
ATOM   6100   C  CD     . GLN A 1 83  ? -10.400 11.972  21.727  1.00 49.20 ? 83   GLN A CD     2  
ATOM   6101   O  OE1    . GLN A 1 83  ? -10.610 10.854  21.302  1.00 39.57 ? 83   GLN A OE1    2  
ATOM   6102   N  NE2    . GLN A 1 83  ? -11.396 12.723  22.110  1.00 67.28 ? 83   GLN A NE2    2  
ATOM   6103   H  H      . GLN A 1 83  ? -6.762  11.289  20.767  1.00 0.00  ? 83   GLN A H      2  
ATOM   6104   H  HA     . GLN A 1 83  ? -9.348  11.308  19.423  1.00 0.00  ? 83   GLN A HA     2  
ATOM   6105   H  HB2    . GLN A 1 83  ? -7.564  13.505  20.535  1.00 0.00  ? 83   GLN A HB2    2  
ATOM   6106   H  HB3    . GLN A 1 83  ? -9.252  13.722  20.070  1.00 0.00  ? 83   GLN A HB3    2  
ATOM   6107   H  HG2    . GLN A 1 83  ? -8.307  11.728  22.149  1.00 0.00  ? 83   GLN A HG2    2  
ATOM   6108   H  HG3    . GLN A 1 83  ? -8.943  13.328  22.530  1.00 0.00  ? 83   GLN A HG3    2  
ATOM   6109   H  HE21   . GLN A 1 83  ? -11.228 13.624  22.453  1.00 0.00  ? 83   GLN A HE21   2  
ATOM   6110   H  HE22   . GLN A 1 83  ? -12.314 12.383  22.054  1.00 0.00  ? 83   GLN A HE22   2  
ATOM   6111   N  N      . LYS A 1 84  ? -6.734  12.694  17.962  1.00 23.41 ? 84   LYS A N      2  
ATOM   6112   C  CA     . LYS A 1 84  ? -6.221  13.167  16.634  1.00 22.31 ? 84   LYS A CA     2  
ATOM   6113   C  C      . LYS A 1 84  ? -6.415  12.077  15.577  1.00 25.36 ? 84   LYS A C      2  
ATOM   6114   O  O      . LYS A 1 84  ? -6.906  12.333  14.491  1.00 36.03 ? 84   LYS A O      2  
ATOM   6115   C  CB     . LYS A 1 84  ? -4.732  13.445  16.852  1.00 22.23 ? 84   LYS A CB     2  
ATOM   6116   C  CG     . LYS A 1 84  ? -4.197  14.279  15.686  1.00 24.28 ? 84   LYS A CG     2  
ATOM   6117   C  CD     . LYS A 1 84  ? -2.692  14.047  15.533  1.00 31.62 ? 84   LYS A CD     2  
ATOM   6118   C  CE     . LYS A 1 84  ? -1.944  14.799  16.638  1.00 39.44 ? 84   LYS A CE     2  
ATOM   6119   N  NZ     . LYS A 1 84  ? -0.503  14.661  16.290  1.00 57.57 ? 84   LYS A NZ     2  
ATOM   6120   H  H      . LYS A 1 84  ? -6.111  12.638  18.717  1.00 0.00  ? 84   LYS A H      2  
ATOM   6121   H  HA     . LYS A 1 84  ? -6.726  14.073  16.338  1.00 0.00  ? 84   LYS A HA     2  
ATOM   6122   H  HB2    . LYS A 1 84  ? -4.601  13.989  17.776  1.00 0.00  ? 84   LYS A HB2    2  
ATOM   6123   H  HB3    . LYS A 1 84  ? -4.194  12.510  16.901  1.00 0.00  ? 84   LYS A HB3    2  
ATOM   6124   H  HG2    . LYS A 1 84  ? -4.701  13.988  14.776  1.00 0.00  ? 84   LYS A HG2    2  
ATOM   6125   H  HG3    . LYS A 1 84  ? -4.380  15.325  15.879  1.00 0.00  ? 84   LYS A HG3    2  
ATOM   6126   H  HD2    . LYS A 1 84  ? -2.481  12.990  15.608  1.00 0.00  ? 84   LYS A HD2    2  
ATOM   6127   H  HD3    . LYS A 1 84  ? -2.369  14.413  14.571  1.00 0.00  ? 84   LYS A HD3    2  
ATOM   6128   H  HE2    . LYS A 1 84  ? -2.236  15.841  16.645  1.00 0.00  ? 84   LYS A HE2    2  
ATOM   6129   H  HE3    . LYS A 1 84  ? -2.138  14.346  17.599  1.00 0.00  ? 84   LYS A HE3    2  
ATOM   6130   H  HZ1    . LYS A 1 84  ? 0.079   15.037  17.065  1.00 0.00  ? 84   LYS A HZ1    2  
ATOM   6131   H  HZ2    . LYS A 1 84  ? -0.305  15.193  15.418  1.00 0.00  ? 84   LYS A HZ2    2  
ATOM   6132   H  HZ3    . LYS A 1 84  ? -0.275  13.658  16.144  1.00 0.00  ? 84   LYS A HZ3    2  
ATOM   6133   N  N      . VAL A 1 85  ? -6.051  10.863  15.897  1.00 22.84 ? 85   VAL A N      2  
ATOM   6134   C  CA     . VAL A 1 85  ? -6.234  9.750   14.923  1.00 24.64 ? 85   VAL A CA     2  
ATOM   6135   C  C      . VAL A 1 85  ? -7.733  9.520   14.695  1.00 26.98 ? 85   VAL A C      2  
ATOM   6136   O  O      . VAL A 1 85  ? -8.172  9.282   13.587  1.00 30.14 ? 85   VAL A O      2  
ATOM   6137   C  CB     . VAL A 1 85  ? -5.590  8.534   15.587  1.00 23.90 ? 85   VAL A CB     2  
ATOM   6138   C  CG1    . VAL A 1 85  ? -5.739  7.319   14.672  1.00 18.40 ? 85   VAL A CG1    2  
ATOM   6139   C  CG2    . VAL A 1 85  ? -4.103  8.809   15.826  1.00 16.10 ? 85   VAL A CG2    2  
ATOM   6140   H  H      . VAL A 1 85  ? -5.668  10.685  16.783  1.00 0.00  ? 85   VAL A H      2  
ATOM   6141   H  HA     . VAL A 1 85  ? -5.737  9.974   13.991  1.00 0.00  ? 85   VAL A HA     2  
ATOM   6142   H  HB     . VAL A 1 85  ? -6.079  8.338   16.531  1.00 0.00  ? 85   VAL A HB     2  
ATOM   6143   H  HG11   . VAL A 1 85  ? -4.848  7.211   14.070  1.00 0.00  ? 85   VAL A HG11   2  
ATOM   6144   H  HG12   . VAL A 1 85  ? -6.594  7.456   14.028  1.00 0.00  ? 85   VAL A HG12   2  
ATOM   6145   H  HG13   . VAL A 1 85  ? -5.879  6.433   15.272  1.00 0.00  ? 85   VAL A HG13   2  
ATOM   6146   H  HG21   . VAL A 1 85  ? -3.788  8.317   16.733  1.00 0.00  ? 85   VAL A HG21   2  
ATOM   6147   H  HG22   . VAL A 1 85  ? -3.943  9.873   15.921  1.00 0.00  ? 85   VAL A HG22   2  
ATOM   6148   H  HG23   . VAL A 1 85  ? -3.528  8.432   14.993  1.00 0.00  ? 85   VAL A HG23   2  
ATOM   6149   N  N      . LYS A 1 86  ? -8.518  9.586   15.745  1.00 28.36 ? 86   LYS A N      2  
ATOM   6150   C  CA     . LYS A 1 86  ? -9.985  9.354   15.603  1.00 35.07 ? 86   LYS A CA     2  
ATOM   6151   C  C      . LYS A 1 86  ? -10.611 10.426  14.708  1.00 42.55 ? 86   LYS A C      2  
ATOM   6152   O  O      . LYS A 1 86  ? -11.424 10.129  13.851  1.00 34.77 ? 86   LYS A O      2  
ATOM   6153   C  CB     . LYS A 1 86  ? -10.541 9.448   17.023  1.00 31.46 ? 86   LYS A CB     2  
ATOM   6154   C  CG     . LYS A 1 86  ? -12.017 9.050   17.015  1.00 48.63 ? 86   LYS A CG     2  
ATOM   6155   C  CD     . LYS A 1 86  ? -12.439 8.608   18.417  1.00 54.92 ? 86   LYS A CD     2  
ATOM   6156   C  CE     . LYS A 1 86  ? -11.881 7.213   18.705  1.00 53.73 ? 86   LYS A CE     2  
ATOM   6157   N  NZ     . LYS A 1 86  ? -12.556 6.781   19.960  1.00 64.34 ? 86   LYS A NZ     2  
ATOM   6158   H  H      . LYS A 1 86  ? -8.116  9.743   16.626  1.00 0.00  ? 86   LYS A H      2  
ATOM   6159   H  HA     . LYS A 1 86  ? -10.176 8.372   15.199  1.00 0.00  ? 86   LYS A HA     2  
ATOM   6160   H  HB2    . LYS A 1 86  ? -9.989  8.781   17.670  1.00 0.00  ? 86   LYS A HB2    2  
ATOM   6161   H  HB3    . LYS A 1 86  ? -10.445 10.462  17.383  1.00 0.00  ? 86   LYS A HB3    2  
ATOM   6162   H  HG2    . LYS A 1 86  ? -12.616 9.895   16.707  1.00 0.00  ? 86   LYS A HG2    2  
ATOM   6163   H  HG3    . LYS A 1 86  ? -12.164 8.233   16.324  1.00 0.00  ? 86   LYS A HG3    2  
ATOM   6164   H  HD2    . LYS A 1 86  ? -12.058 9.309   19.147  1.00 0.00  ? 86   LYS A HD2    2  
ATOM   6165   H  HD3    . LYS A 1 86  ? -13.517 8.581   18.476  1.00 0.00  ? 86   LYS A HD3    2  
ATOM   6166   H  HE2    . LYS A 1 86  ? -12.121 6.540   17.893  1.00 0.00  ? 86   LYS A HE2    2  
ATOM   6167   H  HE3    . LYS A 1 86  ? -10.813 7.258   18.855  1.00 0.00  ? 86   LYS A HE3    2  
ATOM   6168   H  HZ1    . LYS A 1 86  ? -13.586 6.790   19.821  1.00 0.00  ? 86   LYS A HZ1    2  
ATOM   6169   H  HZ2    . LYS A 1 86  ? -12.303 7.434   20.731  1.00 0.00  ? 86   LYS A HZ2    2  
ATOM   6170   H  HZ3    . LYS A 1 86  ? -12.250 5.818   20.205  1.00 0.00  ? 86   LYS A HZ3    2  
ATOM   6171   N  N      . LYS A 1 87  ? -10.248 11.670  14.906  1.00 37.77 ? 87   LYS A N      2  
ATOM   6172   C  CA     . LYS A 1 87  ? -10.835 12.756  14.079  1.00 37.13 ? 87   LYS A CA     2  
ATOM   6173   C  C      . LYS A 1 87  ? -10.274 12.707  12.656  1.00 38.41 ? 87   LYS A C      2  
ATOM   6174   O  O      . LYS A 1 87  ? -11.006 12.829  11.691  1.00 41.02 ? 87   LYS A O      2  
ATOM   6175   C  CB     . LYS A 1 87  ? -10.436 14.052  14.779  1.00 32.41 ? 87   LYS A CB     2  
ATOM   6176   C  CG     . LYS A 1 87  ? -11.440 14.353  15.895  1.00 62.80 ? 87   LYS A CG     2  
ATOM   6177   C  CD     . LYS A 1 87  ? -10.726 15.046  17.055  1.00 68.45 ? 87   LYS A CD     2  
ATOM   6178   C  CE     . LYS A 1 87  ? -11.377 14.631  18.376  1.00 63.12 ? 87   LYS A CE     2  
ATOM   6179   N  NZ     . LYS A 1 87  ? -11.240 15.818  19.266  1.00 67.24 ? 87   LYS A NZ     2  
ATOM   6180   H  H      . LYS A 1 87  ? -9.605  11.865  15.622  1.00 0.00  ? 87   LYS A H      2  
ATOM   6181   H  HA     . LYS A 1 87  ? -11.913 12.668  14.057  1.00 0.00  ? 87   LYS A HA     2  
ATOM   6182   H  HB2    . LYS A 1 87  ? -9.448  13.945  15.198  1.00 0.00  ? 87   LYS A HB2    2  
ATOM   6183   H  HB3    . LYS A 1 87  ? -10.442 14.862  14.065  1.00 0.00  ? 87   LYS A HB3    2  
ATOM   6184   H  HG2    . LYS A 1 87  ? -12.220 14.996  15.514  1.00 0.00  ? 87   LYS A HG2    2  
ATOM   6185   H  HG3    . LYS A 1 87  ? -11.876 13.428  16.245  1.00 0.00  ? 87   LYS A HG3    2  
ATOM   6186   H  HD2    . LYS A 1 87  ? -9.685  14.759  17.059  1.00 0.00  ? 87   LYS A HD2    2  
ATOM   6187   H  HD3    . LYS A 1 87  ? -10.803 16.117  16.937  1.00 0.00  ? 87   LYS A HD3    2  
ATOM   6188   H  HE2    . LYS A 1 87  ? -12.420 14.392  18.221  1.00 0.00  ? 87   LYS A HE2    2  
ATOM   6189   H  HE3    . LYS A 1 87  ? -10.856 13.787  18.803  1.00 0.00  ? 87   LYS A HE3    2  
ATOM   6190   H  HZ1    . LYS A 1 87  ? -11.622 16.657  18.787  1.00 0.00  ? 87   LYS A HZ1    2  
ATOM   6191   H  HZ2    . LYS A 1 87  ? -10.234 15.970  19.486  1.00 0.00  ? 87   LYS A HZ2    2  
ATOM   6192   H  HZ3    . LYS A 1 87  ? -11.767 15.655  20.147  1.00 0.00  ? 87   LYS A HZ3    2  
ATOM   6193   N  N      . THR A 1 88  ? -8.985  12.516  12.519  1.00 34.04 ? 88   THR A N      2  
ATOM   6194   C  CA     . THR A 1 88  ? -8.378  12.447  11.153  1.00 28.84 ? 88   THR A CA     2  
ATOM   6195   C  C      . THR A 1 88  ? -9.010  11.289  10.375  1.00 34.04 ? 88   THR A C      2  
ATOM   6196   O  O      . THR A 1 88  ? -9.253  11.382  9.186   1.00 41.39 ? 88   THR A O      2  
ATOM   6197   C  CB     . THR A 1 88  ? -6.885  12.205  11.381  1.00 30.77 ? 88   THR A CB     2  
ATOM   6198   O  OG1    . THR A 1 88  ? -6.356  13.247  12.191  1.00 25.21 ? 88   THR A OG1    2  
ATOM   6199   C  CG2    . THR A 1 88  ? -6.164  12.187  10.034  1.00 30.16 ? 88   THR A CG2    2  
ATOM   6200   H  H      . THR A 1 88  ? -8.419  12.411  13.314  1.00 0.00  ? 88   THR A H      2  
ATOM   6201   H  HA     . THR A 1 88  ? -8.527  13.378  10.627  1.00 0.00  ? 88   THR A HA     2  
ATOM   6202   H  HB     . THR A 1 88  ? -6.744  11.255  11.874  1.00 0.00  ? 88   THR A HB     2  
ATOM   6203   H  HG1    . THR A 1 88  ? -6.199  12.889  13.069  1.00 0.00  ? 88   THR A HG1    2  
ATOM   6204   H  HG21   . THR A 1 88  ? -5.100  12.094  10.195  1.00 0.00  ? 88   THR A HG21   2  
ATOM   6205   H  HG22   . THR A 1 88  ? -6.369  13.105  9.504   1.00 0.00  ? 88   THR A HG22   2  
ATOM   6206   H  HG23   . THR A 1 88  ? -6.514  11.349  9.451   1.00 0.00  ? 88   THR A HG23   2  
ATOM   6207   N  N      . ALA A 1 89  ? -9.296  10.207  11.052  1.00 29.13 ? 89   ALA A N      2  
ATOM   6208   C  CA     . ALA A 1 89  ? -9.926  9.041   10.366  1.00 33.74 ? 89   ALA A CA     2  
ATOM   6209   C  C      . ALA A 1 89  ? -11.310 9.452   9.860   1.00 45.58 ? 89   ALA A C      2  
ATOM   6210   O  O      . ALA A 1 89  ? -11.681 9.167   8.737   1.00 50.12 ? 89   ALA A O      2  
ATOM   6211   C  CB     . ALA A 1 89  ? -10.043 7.956   11.437  1.00 35.15 ? 89   ALA A CB     2  
ATOM   6212   H  H      . ALA A 1 89  ? -9.075  10.159  12.006  1.00 0.00  ? 89   ALA A H      2  
ATOM   6213   H  HA     . ALA A 1 89  ? -9.309  8.695   9.549   1.00 0.00  ? 89   ALA A HA     2  
ATOM   6214   H  HB1    . ALA A 1 89  ? -10.950 8.109   12.005  1.00 0.00  ? 89   ALA A HB1    2  
ATOM   6215   H  HB2    . ALA A 1 89  ? -9.190  8.010   12.097  1.00 0.00  ? 89   ALA A HB2    2  
ATOM   6216   H  HB3    . ALA A 1 89  ? -10.072 6.985   10.963  1.00 0.00  ? 89   ALA A HB3    2  
ATOM   6217   N  N      . GLU A 1 90  ? -12.076 10.122  10.680  1.00 47.40 ? 90   GLU A N      2  
ATOM   6218   C  CA     . GLU A 1 90  ? -13.438 10.554  10.249  1.00 49.84 ? 90   GLU A CA     2  
ATOM   6219   C  C      . GLU A 1 90  ? -13.338 11.519  9.065   1.00 56.71 ? 90   GLU A C      2  
ATOM   6220   O  O      . GLU A 1 90  ? -13.994 11.349  8.056   1.00 52.06 ? 90   GLU A O      2  
ATOM   6221   C  CB     . GLU A 1 90  ? -14.037 11.260  11.466  1.00 47.00 ? 90   GLU A CB     2  
ATOM   6222   C  CG     . GLU A 1 90  ? -14.843 10.257  12.293  1.00 57.68 ? 90   GLU A CG     2  
ATOM   6223   C  CD     . GLU A 1 90  ? -15.938 10.995  13.065  1.00 70.85 ? 90   GLU A CD     2  
ATOM   6224   O  OE1    . GLU A 1 90  ? -15.606 11.913  13.795  1.00 75.12 ? 90   GLU A OE1    2  
ATOM   6225   O  OE2    . GLU A 1 90  ? -17.092 10.627  12.913  1.00 62.59 ? 90   GLU A OE2    2  
ATOM   6226   H  H      . GLU A 1 90  ? -11.754 10.342  11.580  1.00 0.00  ? 90   GLU A H      2  
ATOM   6227   H  HA     . GLU A 1 90  ? -14.039 9.698   9.987   1.00 0.00  ? 90   GLU A HA     2  
ATOM   6228   H  HB2    . GLU A 1 90  ? -13.242 11.671  12.071  1.00 0.00  ? 90   GLU A HB2    2  
ATOM   6229   H  HB3    . GLU A 1 90  ? -14.688 12.057  11.137  1.00 0.00  ? 90   GLU A HB3    2  
ATOM   6230   H  HG2    . GLU A 1 90  ? -15.292 9.527   11.637  1.00 0.00  ? 90   GLU A HG2    2  
ATOM   6231   H  HG3    . GLU A 1 90  ? -14.187 9.758   12.992  1.00 0.00  ? 90   GLU A HG3    2  
ATOM   6232   N  N      . ALA A 1 91  ? -12.520 12.532  9.180   1.00 47.08 ? 91   ALA A N      2  
ATOM   6233   C  CA     . ALA A 1 91  ? -12.374 13.512  8.061   1.00 42.07 ? 91   ALA A CA     2  
ATOM   6234   C  C      . ALA A 1 91  ? -11.948 12.793  6.777   1.00 52.34 ? 91   ALA A C      2  
ATOM   6235   O  O      . ALA A 1 91  ? -10.922 12.142  6.732   1.00 0.00  ? 91   ALA A O      2  
ATOM   6236   C  CB     . ALA A 1 91  ? -11.283 14.481  8.519   1.00 35.58 ? 91   ALA A CB     2  
ATOM   6237   H  H      . ALA A 1 91  ? -12.001 12.649  10.004  1.00 0.00  ? 91   ALA A H      2  
ATOM   6238   H  HA     . ALA A 1 91  ? -13.298 14.045  7.905   1.00 0.00  ? 91   ALA A HA     2  
ATOM   6239   H  HB1    . ALA A 1 91  ? -10.683 14.011  9.284   1.00 0.00  ? 91   ALA A HB1    2  
ATOM   6240   H  HB2    . ALA A 1 91  ? -11.739 15.375  8.917   1.00 0.00  ? 91   ALA A HB2    2  
ATOM   6241   H  HB3    . ALA A 1 91  ? -10.657 14.740  7.679   1.00 0.00  ? 91   ALA A HB3    2  
ATOM   6242   N  N      . GLY A 1 92  ? -12.729 12.906  5.736   1.00 0.00  ? 92   GLY A N      2  
ATOM   6243   C  CA     . GLY A 1 92  ? -12.369 12.230  4.456   1.00 0.00  ? 92   GLY A CA     2  
ATOM   6244   C  C      . GLY A 1 92  ? -13.477 12.460  3.427   1.00 0.00  ? 92   GLY A C      2  
ATOM   6245   O  O      . GLY A 1 92  ? -13.253 13.037  2.380   1.00 0.00  ? 92   GLY A O      2  
ATOM   6246   H  H      . GLY A 1 92  ? -13.551 13.436  5.795   1.00 0.00  ? 92   GLY A H      2  
ATOM   6247   H  HA2    . GLY A 1 92  ? -11.440 12.636  4.084   1.00 0.00  ? 92   GLY A HA2    2  
ATOM   6248   H  HA3    . GLY A 1 92  ? -12.257 11.170  4.628   1.00 0.00  ? 92   GLY A HA3    2  
ATOM   6249   N  N      . GLY A 1 93  ? -14.671 12.015  3.716   1.00 0.00  ? 93   GLY A N      2  
ATOM   6250   C  CA     . GLY A 1 93  ? -15.795 12.207  2.755   1.00 0.00  ? 93   GLY A CA     2  
ATOM   6251   C  C      . GLY A 1 93  ? -16.063 13.702  2.574   1.00 0.00  ? 93   GLY A C      2  
ATOM   6252   O  O      . GLY A 1 93  ? -15.851 14.493  3.472   1.00 0.00  ? 93   GLY A O      2  
ATOM   6253   H  H      . GLY A 1 93  ? -14.827 11.553  4.567   1.00 0.00  ? 93   GLY A H      2  
ATOM   6254   H  HA2    . GLY A 1 93  ? -15.532 11.769  1.803   1.00 0.00  ? 93   GLY A HA2    2  
ATOM   6255   H  HA3    . GLY A 1 93  ? -16.683 11.729  3.139   1.00 0.00  ? 93   GLY A HA3    2  
ATOM   6256   N  N      . VAL A 1 94  ? -16.529 14.095  1.419   1.00 0.00  ? 94   VAL A N      2  
ATOM   6257   C  CA     . VAL A 1 94  ? -16.813 15.540  1.178   1.00 0.00  ? 94   VAL A CA     2  
ATOM   6258   C  C      . VAL A 1 94  ? -18.302 15.743  0.877   1.00 0.00  ? 94   VAL A C      2  
ATOM   6259   O  O      . VAL A 1 94  ? -18.943 14.905  0.274   1.00 0.00  ? 94   VAL A O      2  
ATOM   6260   C  CB     . VAL A 1 94  ? -15.956 15.917  -0.035  1.00 0.00  ? 94   VAL A CB     2  
ATOM   6261   C  CG1    . VAL A 1 94  ? -16.352 15.057  -1.238  1.00 0.00  ? 94   VAL A CG1    2  
ATOM   6262   C  CG2    . VAL A 1 94  ? -16.173 17.394  -0.372  1.00 0.00  ? 94   VAL A CG2    2  
ATOM   6263   H  H      . VAL A 1 94  ? -16.693 13.439  0.709   1.00 0.00  ? 94   VAL A H      2  
ATOM   6264   H  HA     . VAL A 1 94  ? -16.519 16.127  2.033   1.00 0.00  ? 94   VAL A HA     2  
ATOM   6265   H  HB     . VAL A 1 94  ? -14.914 15.749  0.197   1.00 0.00  ? 94   VAL A HB     2  
ATOM   6266   H  HG11   . VAL A 1 94  ? -16.044 14.036  -1.068  1.00 0.00  ? 94   VAL A HG11   2  
ATOM   6267   H  HG12   . VAL A 1 94  ? -15.867 15.437  -2.126  1.00 0.00  ? 94   VAL A HG12   2  
ATOM   6268   H  HG13   . VAL A 1 94  ? -17.423 15.093  -1.369  1.00 0.00  ? 94   VAL A HG13   2  
ATOM   6269   H  HG21   . VAL A 1 94  ? -15.271 17.801  -0.809  1.00 0.00  ? 94   VAL A HG21   2  
ATOM   6270   H  HG22   . VAL A 1 94  ? -16.413 17.939  0.529   1.00 0.00  ? 94   VAL A HG22   2  
ATOM   6271   H  HG23   . VAL A 1 94  ? -16.986 17.487  -1.077  1.00 0.00  ? 94   VAL A HG23   2  
ATOM   6272   N  N      . THR A 1 95  ? -18.852 16.852  1.294   1.00 0.00  ? 95   THR A N      2  
ATOM   6273   C  CA     . THR A 1 95  ? -20.300 17.113  1.035   1.00 0.00  ? 95   THR A CA     2  
ATOM   6274   C  C      . THR A 1 95  ? -20.515 18.576  0.632   1.00 0.00  ? 95   THR A C      2  
ATOM   6275   O  O      . THR A 1 95  ? -21.302 18.877  -0.244  1.00 0.00  ? 95   THR A O      2  
ATOM   6276   C  CB     . THR A 1 95  ? -21.005 16.805  2.359   1.00 0.00  ? 95   THR A CB     2  
ATOM   6277   O  OG1    . THR A 1 95  ? -22.397 17.055  2.221   1.00 0.00  ? 95   THR A OG1    2  
ATOM   6278   C  CG2    . THR A 1 95  ? -20.435 17.690  3.470   1.00 0.00  ? 95   THR A CG2    2  
ATOM   6279   H  H      . THR A 1 95  ? -18.316 17.513  1.778   1.00 0.00  ? 95   THR A H      2  
ATOM   6280   H  HA     . THR A 1 95  ? -20.666 16.454  0.263   1.00 0.00  ? 95   THR A HA     2  
ATOM   6281   H  HB     . THR A 1 95  ? -20.851 15.769  2.617   1.00 0.00  ? 95   THR A HB     2  
ATOM   6282   H  HG1    . THR A 1 95  ? -22.809 16.259  1.877   1.00 0.00  ? 95   THR A HG1    2  
ATOM   6283   H  HG21   . THR A 1 95  ? -20.724 18.716  3.296   1.00 0.00  ? 95   THR A HG21   2  
ATOM   6284   H  HG22   . THR A 1 95  ? -19.357 17.615  3.472   1.00 0.00  ? 95   THR A HG22   2  
ATOM   6285   H  HG23   . THR A 1 95  ? -20.820 17.363  4.424   1.00 0.00  ? 95   THR A HG23   2  
ATOM   6286   N  N      . GLY A 1 96  ? -19.824 19.487  1.266   1.00 0.00  ? 96   GLY A N      2  
ATOM   6287   C  CA     . GLY A 1 96  ? -19.991 20.926  0.919   1.00 0.00  ? 96   GLY A CA     2  
ATOM   6288   C  C      . GLY A 1 96  ? -19.317 21.791  1.986   1.00 0.00  ? 96   GLY A C      2  
ATOM   6289   O  O      . GLY A 1 96  ? -18.109 21.785  2.131   1.00 0.00  ? 96   GLY A O      2  
ATOM   6290   H  H      . GLY A 1 96  ? -19.195 19.223  1.969   1.00 0.00  ? 96   GLY A H      2  
ATOM   6291   H  HA2    . GLY A 1 96  ? -19.536 21.119  -0.043  1.00 0.00  ? 96   GLY A HA2    2  
ATOM   6292   H  HA3    . GLY A 1 96  ? -21.042 21.168  0.876   1.00 0.00  ? 96   GLY A HA3    2  
ATOM   6293   N  N      . LYS A 1 97  ? -20.087 22.537  2.732   1.00 0.00  ? 97   LYS A N      2  
ATOM   6294   C  CA     . LYS A 1 97  ? -19.494 23.403  3.791   1.00 0.00  ? 97   LYS A CA     2  
ATOM   6295   C  C      . LYS A 1 97  ? -19.881 22.884  5.179   1.00 0.00  ? 97   LYS A C      2  
ATOM   6296   O  O      . LYS A 1 97  ? -20.038 23.644  6.114   1.00 0.00  ? 97   LYS A O      2  
ATOM   6297   C  CB     . LYS A 1 97  ? -20.094 24.789  3.550   1.00 0.00  ? 97   LYS A CB     2  
ATOM   6298   C  CG     . LYS A 1 97  ? -19.095 25.654  2.778   1.00 0.00  ? 97   LYS A CG     2  
ATOM   6299   C  CD     . LYS A 1 97  ? -19.648 27.074  2.642   1.00 0.00  ? 97   LYS A CD     2  
ATOM   6300   C  CE     . LYS A 1 97  ? -19.726 27.728  4.023   1.00 0.00  ? 97   LYS A CE     2  
ATOM   6301   N  NZ     . LYS A 1 97  ? -19.314 29.142  3.802   1.00 0.00  ? 97   LYS A NZ     2  
ATOM   6302   H  H      . LYS A 1 97  ? -21.057 22.525  2.597   1.00 0.00  ? 97   LYS A H      2  
ATOM   6303   H  HA     . LYS A 1 97  ? -18.421 23.443  3.689   1.00 0.00  ? 97   LYS A HA     2  
ATOM   6304   H  HB2    . LYS A 1 97  ? -21.005 24.691  2.977   1.00 0.00  ? 97   LYS A HB2    2  
ATOM   6305   H  HB3    . LYS A 1 97  ? -20.314 25.256  4.498   1.00 0.00  ? 97   LYS A HB3    2  
ATOM   6306   H  HG2    . LYS A 1 97  ? -18.155 25.681  3.312   1.00 0.00  ? 97   LYS A HG2    2  
ATOM   6307   H  HG3    . LYS A 1 97  ? -18.939 25.234  1.796   1.00 0.00  ? 97   LYS A HG3    2  
ATOM   6308   H  HD2    . LYS A 1 97  ? -18.995 27.654  2.004   1.00 0.00  ? 97   LYS A HD2    2  
ATOM   6309   H  HD3    . LYS A 1 97  ? -20.635 27.036  2.207   1.00 0.00  ? 97   LYS A HD3    2  
ATOM   6310   H  HE2    . LYS A 1 97  ? -20.738 27.683  4.402   1.00 0.00  ? 97   LYS A HE2    2  
ATOM   6311   H  HE3    . LYS A 1 97  ? -19.044 27.247  4.707   1.00 0.00  ? 97   LYS A HE3    2  
ATOM   6312   H  HZ1    . LYS A 1 97  ? -19.233 29.628  4.718   1.00 0.00  ? 97   LYS A HZ1    2  
ATOM   6313   H  HZ2    . LYS A 1 97  ? -20.028 29.623  3.216   1.00 0.00  ? 97   LYS A HZ2    2  
ATOM   6314   H  HZ3    . LYS A 1 97  ? -18.395 29.165  3.317   1.00 0.00  ? 97   LYS A HZ3    2  
ATOM   6315   N  N      . GLY A 1 98  ? -20.037 21.594  5.317   1.00 0.00  ? 98   GLY A N      2  
ATOM   6316   C  CA     . GLY A 1 98  ? -20.415 21.023  6.641   1.00 0.00  ? 98   GLY A CA     2  
ATOM   6317   C  C      . GLY A 1 98  ? -19.151 20.727  7.450   1.00 0.00  ? 98   GLY A C      2  
ATOM   6318   O  O      . GLY A 1 98  ? -18.171 20.228  6.930   1.00 0.00  ? 98   GLY A O      2  
ATOM   6319   H  H      . GLY A 1 98  ? -19.906 21.001  4.548   1.00 0.00  ? 98   GLY A H      2  
ATOM   6320   H  HA2    . GLY A 1 98  ? -21.028 21.734  7.176   1.00 0.00  ? 98   GLY A HA2    2  
ATOM   6321   H  HA3    . GLY A 1 98  ? -20.966 20.107  6.495   1.00 0.00  ? 98   GLY A HA3    2  
ATOM   6322   N  N      . GLN A 1 99  ? -19.165 21.030  8.722   1.00 0.00  ? 99   GLN A N      2  
ATOM   6323   C  CA     . GLN A 1 99  ? -17.965 20.767  9.568   1.00 0.00  ? 99   GLN A CA     2  
ATOM   6324   C  C      . GLN A 1 99  ? -18.355 19.930  10.791  1.00 0.00  ? 99   GLN A C      2  
ATOM   6325   O  O      . GLN A 1 99  ? -18.041 20.272  11.914  1.00 0.00  ? 99   GLN A O      2  
ATOM   6326   C  CB     . GLN A 1 99  ? -17.473 22.150  9.998   1.00 0.00  ? 99   GLN A CB     2  
ATOM   6327   C  CG     . GLN A 1 99  ? -16.361 22.612  9.055   1.00 0.00  ? 99   GLN A CG     2  
ATOM   6328   C  CD     . GLN A 1 99  ? -15.505 23.671  9.755   1.00 0.00  ? 99   GLN A CD     2  
ATOM   6329   O  OE1    . GLN A 1 99  ? -15.507 24.823  9.368   1.00 0.00  ? 99   GLN A OE1    2  
ATOM   6330   N  NE2    . GLN A 1 99  ? -14.769 23.326  10.775  1.00 0.00  ? 99   GLN A NE2    2  
ATOM   6331   H  H      . GLN A 1 99  ? -19.966 21.431  9.120   1.00 0.00  ? 99   GLN A H      2  
ATOM   6332   H  HA     . GLN A 1 99  ? -17.202 20.265  8.995   1.00 0.00  ? 99   GLN A HA     2  
ATOM   6333   H  HB2    . GLN A 1 99  ? -18.295 22.851  9.961   1.00 0.00  ? 99   GLN A HB2    2  
ATOM   6334   H  HB3    . GLN A 1 99  ? -17.089 22.098  11.007  1.00 0.00  ? 99   GLN A HB3    2  
ATOM   6335   H  HG2    . GLN A 1 99  ? -15.743 21.768  8.787   1.00 0.00  ? 99   GLN A HG2    2  
ATOM   6336   H  HG3    . GLN A 1 99  ? -16.798 23.038  8.165   1.00 0.00  ? 99   GLN A HG3    2  
ATOM   6337   H  HE21   . GLN A 1 99  ? -14.768 22.397  11.087  1.00 0.00  ? 99   GLN A HE21   2  
ATOM   6338   H  HE22   . GLN A 1 99  ? -14.217 23.997  11.230  1.00 0.00  ? 99   GLN A HE22   2  
ATOM   6339   N  N      . ASP A 1 100 ? -19.039 18.835  10.578  1.00 0.00  ? 100  ASP A N      2  
ATOM   6340   C  CA     . ASP A 1 100 ? -19.454 17.967  11.723  1.00 0.00  ? 100  ASP A CA     2  
ATOM   6341   C  C      . ASP A 1 100 ? -20.199 18.794  12.777  1.00 0.00  ? 100  ASP A C      2  
ATOM   6342   O  O      . ASP A 1 100 ? -19.731 18.972  13.885  1.00 0.00  ? 100  ASP A O      2  
ATOM   6343   C  CB     . ASP A 1 100 ? -18.149 17.411  12.299  1.00 0.00  ? 100  ASP A CB     2  
ATOM   6344   C  CG     . ASP A 1 100 ? -18.365 15.964  12.747  1.00 0.00  ? 100  ASP A CG     2  
ATOM   6345   O  OD1    . ASP A 1 100 ? -19.384 15.701  13.363  1.00 0.00  ? 100  ASP A OD1    2  
ATOM   6346   O  OD2    . ASP A 1 100 ? -17.506 15.144  12.465  1.00 0.00  ? 100  ASP A OD2    2  
ATOM   6347   H  H      . ASP A 1 100 ? -19.280 18.581  9.662   1.00 0.00  ? 100  ASP A H      2  
ATOM   6348   H  HA     . ASP A 1 100 ? -20.075 17.159  11.374  1.00 0.00  ? 100  ASP A HA     2  
ATOM   6349   H  HB2    . ASP A 1 100 ? -17.380 17.444  11.541  1.00 0.00  ? 100  ASP A HB2    2  
ATOM   6350   H  HB3    . ASP A 1 100 ? -17.847 18.007  13.146  1.00 0.00  ? 100  ASP A HB3    2  
ATOM   6351   N  N      . GLY A 1 101 ? -21.355 19.300  12.438  1.00 0.00  ? 101  GLY A N      2  
ATOM   6352   C  CA     . GLY A 1 101 ? -22.132 20.114  13.416  1.00 0.00  ? 101  GLY A CA     2  
ATOM   6353   C  C      . GLY A 1 101 ? -22.566 19.231  14.587  1.00 0.00  ? 101  GLY A C      2  
ATOM   6354   O  O      . GLY A 1 101 ? -22.222 18.067  14.659  1.00 0.00  ? 101  GLY A O      2  
ATOM   6355   H  H      . GLY A 1 101 ? -21.713 19.142  11.539  1.00 0.00  ? 101  GLY A H      2  
ATOM   6356   H  HA2    . GLY A 1 101 ? -21.514 20.922  13.782  1.00 0.00  ? 101  GLY A HA2    2  
ATOM   6357   H  HA3    . GLY A 1 101 ? -23.008 20.520  12.932  1.00 0.00  ? 101  GLY A HA3    2  
ATOM   6358   N  N      . ILE A 1 102 ? -23.320 19.776  15.505  1.00 0.00  ? 102  ILE A N      2  
ATOM   6359   C  CA     . ILE A 1 102 ? -23.779 18.968  16.673  1.00 0.00  ? 102  ILE A CA     2  
ATOM   6360   C  C      . ILE A 1 102 ? -25.057 18.204  16.317  1.00 0.00  ? 102  ILE A C      2  
ATOM   6361   O  O      . ILE A 1 102 ? -26.136 18.764  16.283  1.00 0.00  ? 102  ILE A O      2  
ATOM   6362   C  CB     . ILE A 1 102 ? -24.052 19.988  17.782  1.00 0.00  ? 102  ILE A CB     2  
ATOM   6363   C  CG1    . ILE A 1 102 ? -22.778 20.792  18.071  1.00 0.00  ? 102  ILE A CG1    2  
ATOM   6364   C  CG2    . ILE A 1 102 ? -24.495 19.258  19.052  1.00 0.00  ? 102  ILE A CG2    2  
ATOM   6365   C  CD1    . ILE A 1 102 ? -21.653 19.847  18.507  1.00 0.00  ? 102  ILE A CD1    2  
ATOM   6366   H  H      . ILE A 1 102 ? -23.585 20.716  15.426  1.00 0.00  ? 102  ILE A H      2  
ATOM   6367   H  HA     . ILE A 1 102 ? -23.005 18.284  16.985  1.00 0.00  ? 102  ILE A HA     2  
ATOM   6368   H  HB     . ILE A 1 102 ? -24.838 20.659  17.464  1.00 0.00  ? 102  ILE A HB     2  
ATOM   6369   H  HG12   . ILE A 1 102 ? -22.478 21.321  17.178  1.00 0.00  ? 102  ILE A HG12   2  
ATOM   6370   H  HG13   . ILE A 1 102 ? -22.974 21.502  18.861  1.00 0.00  ? 102  ILE A HG13   2  
ATOM   6371   H  HG21   . ILE A 1 102 ? -23.882 18.380  19.195  1.00 0.00  ? 102  ILE A HG21   2  
ATOM   6372   H  HG22   . ILE A 1 102 ? -25.530 18.963  18.956  1.00 0.00  ? 102  ILE A HG22   2  
ATOM   6373   H  HG23   . ILE A 1 102 ? -24.386 19.915  19.902  1.00 0.00  ? 102  ILE A HG23   2  
ATOM   6374   H  HD11   . ILE A 1 102 ? -20.798 20.427  18.822  1.00 0.00  ? 102  ILE A HD11   2  
ATOM   6375   H  HD12   . ILE A 1 102 ? -21.372 19.215  17.678  1.00 0.00  ? 102  ILE A HD12   2  
ATOM   6376   H  HD13   . ILE A 1 102 ? -21.995 19.235  19.328  1.00 0.00  ? 102  ILE A HD13   2  
ATOM   6377   N  N      . GLY A 1 103 ? -24.943 16.930  16.052  1.00 0.00  ? 103  GLY A N      2  
ATOM   6378   C  CA     . GLY A 1 103 ? -26.150 16.129  15.698  1.00 0.00  ? 103  GLY A CA     2  
ATOM   6379   C  C      . GLY A 1 103 ? -25.935 15.455  14.342  1.00 0.00  ? 103  GLY A C      2  
ATOM   6380   O  O      . GLY A 1 103 ? -26.799 15.472  13.486  1.00 0.00  ? 103  GLY A O      2  
ATOM   6381   H  H      . GLY A 1 103 ? -24.063 16.501  16.085  1.00 0.00  ? 103  GLY A H      2  
ATOM   6382   H  HA2    . GLY A 1 103 ? -26.315 15.375  16.454  1.00 0.00  ? 103  GLY A HA2    2  
ATOM   6383   H  HA3    . GLY A 1 103 ? -27.010 16.778  15.641  1.00 0.00  ? 103  GLY A HA3    2  
ATOM   6384   N  N      . SER A 1 104 ? -24.789 14.861  14.139  1.00 0.00  ? 104  SER A N      2  
ATOM   6385   C  CA     . SER A 1 104 ? -24.516 14.184  12.837  1.00 0.00  ? 104  SER A CA     2  
ATOM   6386   C  C      . SER A 1 104 ? -24.705 12.672  12.977  1.00 0.00  ? 104  SER A C      2  
ATOM   6387   O  O      . SER A 1 104 ? -23.754 11.917  13.011  1.00 0.00  ? 104  SER A O      2  
ATOM   6388   C  CB     . SER A 1 104 ? -23.059 14.516  12.518  1.00 0.00  ? 104  SER A CB     2  
ATOM   6389   O  OG     . SER A 1 104 ? -22.879 15.926  12.557  1.00 0.00  ? 104  SER A OG     2  
ATOM   6390   H  H      . SER A 1 104 ? -24.108 14.861  14.843  1.00 0.00  ? 104  SER A H      2  
ATOM   6391   H  HA     . SER A 1 104 ? -25.161 14.576  12.066  1.00 0.00  ? 104  SER A HA     2  
ATOM   6392   H  HB2    . SER A 1 104 ? -22.414 14.056  13.248  1.00 0.00  ? 104  SER A HB2    2  
ATOM   6393   H  HB3    . SER A 1 104 ? -22.812 14.138  11.535  1.00 0.00  ? 104  SER A HB3    2  
ATOM   6394   H  HG     . SER A 1 104 ? -22.871 16.249  11.653  1.00 0.00  ? 104  SER A HG     2  
ATOM   6395   N  N      . LYS A 1 105 ? -25.931 12.225  13.060  1.00 0.00  ? 105  LYS A N      2  
ATOM   6396   C  CA     . LYS A 1 105 ? -26.186 10.761  13.198  1.00 0.00  ? 105  LYS A CA     2  
ATOM   6397   C  C      . LYS A 1 105 ? -27.277 10.320  12.219  1.00 0.00  ? 105  LYS A C      2  
ATOM   6398   O  O      . LYS A 1 105 ? -28.326 9.847   12.614  1.00 0.00  ? 105  LYS A O      2  
ATOM   6399   C  CB     . LYS A 1 105 ? -26.652 10.576  14.643  1.00 0.00  ? 105  LYS A CB     2  
ATOM   6400   C  CG     . LYS A 1 105 ? -26.263 9.179   15.131  1.00 0.00  ? 105  LYS A CG     2  
ATOM   6401   C  CD     . LYS A 1 105 ? -26.481 9.087   16.642  1.00 0.00  ? 105  LYS A CD     2  
ATOM   6402   C  CE     . LYS A 1 105 ? -26.521 7.615   17.065  1.00 0.00  ? 105  LYS A CE     2  
ATOM   6403   N  NZ     . LYS A 1 105 ? -27.970 7.278   17.144  1.00 0.00  ? 105  LYS A NZ     2  
ATOM   6404   H  H      . LYS A 1 105 ? -26.683 12.851  13.031  1.00 0.00  ? 105  LYS A H      2  
ATOM   6405   H  HA     . LYS A 1 105 ? -25.279 10.203  13.030  1.00 0.00  ? 105  LYS A HA     2  
ATOM   6406   H  HB2    . LYS A 1 105 ? -26.185 11.320  15.270  1.00 0.00  ? 105  LYS A HB2    2  
ATOM   6407   H  HB3    . LYS A 1 105 ? -27.725 10.685  14.692  1.00 0.00  ? 105  LYS A HB3    2  
ATOM   6408   H  HG2    . LYS A 1 105 ? -26.874 8.440   14.631  1.00 0.00  ? 105  LYS A HG2    2  
ATOM   6409   H  HG3    . LYS A 1 105 ? -25.223 8.996   14.908  1.00 0.00  ? 105  LYS A HG3    2  
ATOM   6410   H  HD2    . LYS A 1 105 ? -25.673 9.587   17.153  1.00 0.00  ? 105  LYS A HD2    2  
ATOM   6411   H  HD3    . LYS A 1 105 ? -27.418 9.558   16.900  1.00 0.00  ? 105  LYS A HD3    2  
ATOM   6412   H  HE2    . LYS A 1 105 ? -26.028 7.000   16.324  1.00 0.00  ? 105  LYS A HE2    2  
ATOM   6413   H  HE3    . LYS A 1 105 ? -26.058 7.489   18.030  1.00 0.00  ? 105  LYS A HE3    2  
ATOM   6414   H  HZ1    . LYS A 1 105 ? -28.081 6.313   17.516  1.00 0.00  ? 105  LYS A HZ1    2  
ATOM   6415   H  HZ2    . LYS A 1 105 ? -28.391 7.336   16.195  1.00 0.00  ? 105  LYS A HZ2    2  
ATOM   6416   H  HZ3    . LYS A 1 105 ? -28.448 7.949   17.779  1.00 0.00  ? 105  LYS A HZ3    2  
ATOM   6417   N  N      . ALA A 1 106 ? -27.037 10.469  10.944  1.00 0.00  ? 106  ALA A N      2  
ATOM   6418   C  CA     . ALA A 1 106 ? -28.059 10.059  9.936   1.00 0.00  ? 106  ALA A CA     2  
ATOM   6419   C  C      . ALA A 1 106 ? -27.423 9.973   8.545   1.00 0.00  ? 106  ALA A C      2  
ATOM   6420   O  O      . ALA A 1 106 ? -27.212 8.900   8.015   1.00 0.00  ? 106  ALA A O      2  
ATOM   6421   C  CB     . ALA A 1 106 ? -29.118 11.161  9.975   1.00 0.00  ? 106  ALA A CB     2  
ATOM   6422   H  H      . ALA A 1 106 ? -26.184 10.851  10.648  1.00 0.00  ? 106  ALA A H      2  
ATOM   6423   H  HA     . ALA A 1 106 ? -28.499 9.113   10.209  1.00 0.00  ? 106  ALA A HA     2  
ATOM   6424   H  HB1    . ALA A 1 106 ? -28.636 12.125  9.926   1.00 0.00  ? 106  ALA A HB1    2  
ATOM   6425   H  HB2    . ALA A 1 106 ? -29.682 11.085  10.893  1.00 0.00  ? 106  ALA A HB2    2  
ATOM   6426   H  HB3    . ALA A 1 106 ? -29.785 11.048  9.133   1.00 0.00  ? 106  ALA A HB3    2  
ATOM   6427   N  N      . GLU A 1 107 ? -27.119 11.096  7.952   1.00 0.00  ? 107  GLU A N      2  
ATOM   6428   C  CA     . GLU A 1 107 ? -26.497 11.084  6.596   1.00 0.00  ? 107  GLU A CA     2  
ATOM   6429   C  C      . GLU A 1 107 ? -24.994 10.815  6.705   1.00 0.00  ? 107  GLU A C      2  
ATOM   6430   O  O      . GLU A 1 107 ? -24.308 11.401  7.519   1.00 0.00  ? 107  GLU A O      2  
ATOM   6431   C  CB     . GLU A 1 107 ? -26.752 12.482  6.030   1.00 0.00  ? 107  GLU A CB     2  
ATOM   6432   C  CG     . GLU A 1 107 ? -28.260 12.724  5.922   1.00 0.00  ? 107  GLU A CG     2  
ATOM   6433   C  CD     . GLU A 1 107 ? -28.571 14.178  6.287   1.00 0.00  ? 107  GLU A CD     2  
ATOM   6434   O  OE1    . GLU A 1 107 ? -28.273 15.046  5.483   1.00 0.00  ? 107  GLU A OE1    2  
ATOM   6435   O  OE2    . GLU A 1 107 ? -29.103 14.398  7.362   1.00 0.00  ? 107  GLU A OE2    2  
ATOM   6436   H  H      . GLU A 1 107 ? -27.299 11.950  8.399   1.00 0.00  ? 107  GLU A H      2  
ATOM   6437   H  HA     . GLU A 1 107 ? -26.970 10.342  5.972   1.00 0.00  ? 107  GLU A HA     2  
ATOM   6438   H  HB2    . GLU A 1 107 ? -26.313 13.220  6.686   1.00 0.00  ? 107  GLU A HB2    2  
ATOM   6439   H  HB3    . GLU A 1 107 ? -26.307 12.560  5.050   1.00 0.00  ? 107  GLU A HB3    2  
ATOM   6440   H  HG2    . GLU A 1 107 ? -28.584 12.529  4.910   1.00 0.00  ? 107  GLU A HG2    2  
ATOM   6441   H  HG3    . GLU A 1 107 ? -28.781 12.066  6.602   1.00 0.00  ? 107  GLU A HG3    2  
ATOM   6442   N  N      . LYS A 1 108 ? -24.480 9.932   5.891   1.00 0.00  ? 108  LYS A N      2  
ATOM   6443   C  CA     . LYS A 1 108 ? -23.020 9.625   5.946   1.00 0.00  ? 108  LYS A CA     2  
ATOM   6444   C  C      . LYS A 1 108 ? -22.579 8.921   4.659   1.00 0.00  ? 108  LYS A C      2  
ATOM   6445   O  O      . LYS A 1 108 ? -23.355 8.739   3.742   1.00 0.00  ? 108  LYS A O      2  
ATOM   6446   C  CB     . LYS A 1 108 ? -22.856 8.697   7.151   1.00 0.00  ? 108  LYS A CB     2  
ATOM   6447   C  CG     . LYS A 1 108 ? -21.437 8.829   7.712   1.00 0.00  ? 108  LYS A CG     2  
ATOM   6448   C  CD     . LYS A 1 108 ? -21.493 8.933   9.238   1.00 0.00  ? 108  LYS A CD     2  
ATOM   6449   C  CE     . LYS A 1 108 ? -22.083 10.288  9.639   1.00 0.00  ? 108  LYS A CE     2  
ATOM   6450   N  NZ     . LYS A 1 108 ? -21.025 11.284  9.309   1.00 0.00  ? 108  LYS A NZ     2  
ATOM   6451   H  H      . LYS A 1 108 ? -25.052 9.473   5.243   1.00 0.00  ? 108  LYS A H      2  
ATOM   6452   H  HA     . LYS A 1 108 ? -22.451 10.528  6.097   1.00 0.00  ? 108  LYS A HA     2  
ATOM   6453   H  HB2    . LYS A 1 108 ? -23.573 8.968   7.913   1.00 0.00  ? 108  LYS A HB2    2  
ATOM   6454   H  HB3    . LYS A 1 108 ? -23.025 7.676   6.845   1.00 0.00  ? 108  LYS A HB3    2  
ATOM   6455   H  HG2    . LYS A 1 108 ? -20.857 7.961   7.431   1.00 0.00  ? 108  LYS A HG2    2  
ATOM   6456   H  HG3    . LYS A 1 108 ? -20.970 9.716   7.311   1.00 0.00  ? 108  LYS A HG3    2  
ATOM   6457   H  HD2    . LYS A 1 108 ? -22.114 8.139   9.629   1.00 0.00  ? 108  LYS A HD2    2  
ATOM   6458   H  HD3    . LYS A 1 108 ? -20.497 8.843   9.643   1.00 0.00  ? 108  LYS A HD3    2  
ATOM   6459   H  HE2    . LYS A 1 108 ? -22.981 10.487  9.072   1.00 0.00  ? 108  LYS A HE2    2  
ATOM   6460   H  HE3    . LYS A 1 108 ? -22.293 10.308  10.698  1.00 0.00  ? 108  LYS A HE3    2  
ATOM   6461   H  HZ1    . LYS A 1 108 ? -20.102 10.933  9.634   1.00 0.00  ? 108  LYS A HZ1    2  
ATOM   6462   H  HZ2    . LYS A 1 108 ? -21.239 12.186  9.782   1.00 0.00  ? 108  LYS A HZ2    2  
ATOM   6463   H  HZ3    . LYS A 1 108 ? -20.995 11.431  8.280   1.00 0.00  ? 108  LYS A HZ3    2  
ATOM   6464   N  N      . THR A 1 109 ? -21.335 8.526   4.585   1.00 60.27 ? 109  THR A N      2  
ATOM   6465   C  CA     . THR A 1 109 ? -20.838 7.836   3.359   1.00 53.76 ? 109  THR A CA     2  
ATOM   6466   C  C      . THR A 1 109 ? -20.010 6.605   3.741   1.00 52.62 ? 109  THR A C      2  
ATOM   6467   O  O      . THR A 1 109 ? -19.088 6.686   4.529   1.00 50.52 ? 109  THR A O      2  
ATOM   6468   C  CB     . THR A 1 109 ? -19.967 8.870   2.635   1.00 50.95 ? 109  THR A CB     2  
ATOM   6469   O  OG1    . THR A 1 109 ? -19.415 8.283   1.465   1.00 55.74 ? 109  THR A OG1    2  
ATOM   6470   C  CG2    . THR A 1 109 ? -18.836 9.336   3.555   1.00 43.46 ? 109  THR A CG2    2  
ATOM   6471   H  H      . THR A 1 109 ? -20.728 8.685   5.337   1.00 0.00  ? 109  THR A H      2  
ATOM   6472   H  HA     . THR A 1 109 ? -21.666 7.549   2.729   1.00 0.00  ? 109  THR A HA     2  
ATOM   6473   H  HB     . THR A 1 109 ? -20.573 9.720   2.360   1.00 0.00  ? 109  THR A HB     2  
ATOM   6474   H  HG1    . THR A 1 109 ? -20.110 8.228   0.804   1.00 0.00  ? 109  THR A HG1    2  
ATOM   6475   H  HG21   . THR A 1 109 ? -18.964 8.902   4.535   1.00 0.00  ? 109  THR A HG21   2  
ATOM   6476   H  HG22   . THR A 1 109 ? -18.857 10.413  3.632   1.00 0.00  ? 109  THR A HG22   2  
ATOM   6477   H  HG23   . THR A 1 109 ? -17.888 9.023   3.145   1.00 0.00  ? 109  THR A HG23   2  
ATOM   6478   N  N      . LEU A 1 110 ? -20.332 5.467   3.186   1.00 44.37 ? 110  LEU A N      2  
ATOM   6479   C  CA     . LEU A 1 110 ? -19.564 4.230   3.514   1.00 44.68 ? 110  LEU A CA     2  
ATOM   6480   C  C      . LEU A 1 110 ? -18.136 4.342   2.974   1.00 52.00 ? 110  LEU A C      2  
ATOM   6481   O  O      . LEU A 1 110 ? -17.898 4.951   1.950   1.00 52.30 ? 110  LEU A O      2  
ATOM   6482   C  CB     . LEU A 1 110 ? -20.316 3.096   2.814   1.00 46.27 ? 110  LEU A CB     2  
ATOM   6483   C  CG     . LEU A 1 110 ? -21.311 2.464   3.787   1.00 45.42 ? 110  LEU A CG     2  
ATOM   6484   C  CD1    . LEU A 1 110 ? -22.249 1.528   3.025   1.00 43.31 ? 110  LEU A CD1    2  
ATOM   6485   C  CD2    . LEU A 1 110 ? -20.547 1.667   4.848   1.00 46.72 ? 110  LEU A CD2    2  
ATOM   6486   H  H      . LEU A 1 110 ? -21.080 5.426   2.554   1.00 0.00  ? 110  LEU A H      2  
ATOM   6487   H  HA     . LEU A 1 110 ? -19.554 4.062   4.580   1.00 0.00  ? 110  LEU A HA     2  
ATOM   6488   H  HB2    . LEU A 1 110 ? -20.847 3.492   1.960   1.00 0.00  ? 110  LEU A HB2    2  
ATOM   6489   H  HB3    . LEU A 1 110 ? -19.612 2.347   2.485   1.00 0.00  ? 110  LEU A HB3    2  
ATOM   6490   H  HG     . LEU A 1 110 ? -21.889 3.242   4.266   1.00 0.00  ? 110  LEU A HG     2  
ATOM   6491   H  HD11   . LEU A 1 110 ? -22.339 1.864   2.002   1.00 0.00  ? 110  LEU A HD11   2  
ATOM   6492   H  HD12   . LEU A 1 110 ? -23.222 1.534   3.493   1.00 0.00  ? 110  LEU A HD12   2  
ATOM   6493   H  HD13   . LEU A 1 110 ? -21.848 0.525   3.040   1.00 0.00  ? 110  LEU A HD13   2  
ATOM   6494   H  HD21   . LEU A 1 110 ? -21.084 1.707   5.784   1.00 0.00  ? 110  LEU A HD21   2  
ATOM   6495   H  HD22   . LEU A 1 110 ? -19.563 2.091   4.978   1.00 0.00  ? 110  LEU A HD22   2  
ATOM   6496   H  HD23   . LEU A 1 110 ? -20.458 0.639   4.529   1.00 0.00  ? 110  LEU A HD23   2  
ATOM   6497   N  N      . GLY A 1 111 ? -17.185 3.763   3.656   1.00 43.43 ? 111  GLY A N      2  
ATOM   6498   C  CA     . GLY A 1 111 ? -15.773 3.842   3.183   1.00 38.75 ? 111  GLY A CA     2  
ATOM   6499   C  C      . GLY A 1 111 ? -15.377 2.543   2.469   1.00 40.16 ? 111  GLY A C      2  
ATOM   6500   O  O      . GLY A 1 111 ? -14.311 2.450   1.891   1.00 43.00 ? 111  GLY A O      2  
ATOM   6501   H  H      . GLY A 1 111 ? -17.398 3.279   4.482   1.00 0.00  ? 111  GLY A H      2  
ATOM   6502   H  HA2    . GLY A 1 111 ? -15.673 4.672   2.498   1.00 0.00  ? 111  GLY A HA2    2  
ATOM   6503   H  HA3    . GLY A 1 111 ? -15.120 3.995   4.028   1.00 0.00  ? 111  GLY A HA3    2  
ATOM   6504   N  N      . ASP A 1 112 ? -16.216 1.537   2.505   1.00 39.52 ? 112  ASP A N      2  
ATOM   6505   C  CA     . ASP A 1 112 ? -15.866 0.250   1.830   1.00 33.80 ? 112  ASP A CA     2  
ATOM   6506   C  C      . ASP A 1 112 ? -16.834 -0.054  0.674   1.00 35.98 ? 112  ASP A C      2  
ATOM   6507   O  O      . ASP A 1 112 ? -16.807 -1.126  0.103   1.00 38.37 ? 112  ASP A O      2  
ATOM   6508   C  CB     . ASP A 1 112 ? -15.993 -0.813  2.923   1.00 41.74 ? 112  ASP A CB     2  
ATOM   6509   C  CG     . ASP A 1 112 ? -14.720 -0.827  3.771   1.00 43.78 ? 112  ASP A CG     2  
ATOM   6510   O  OD1    . ASP A 1 112 ? -14.446 0.175   4.411   1.00 46.62 ? 112  ASP A OD1    2  
ATOM   6511   O  OD2    . ASP A 1 112 ? -14.042 -1.841  3.766   1.00 36.84 ? 112  ASP A OD2    2  
ATOM   6512   H  H      . ASP A 1 112 ? -17.069 1.625   2.979   1.00 0.00  ? 112  ASP A H      2  
ATOM   6513   H  HA     . ASP A 1 112 ? -14.850 0.281   1.468   1.00 0.00  ? 112  ASP A HA     2  
ATOM   6514   H  HB2    . ASP A 1 112 ? -16.842 -0.583  3.550   1.00 0.00  ? 112  ASP A HB2    2  
ATOM   6515   H  HB3    . ASP A 1 112 ? -16.132 -1.782  2.468   1.00 0.00  ? 112  ASP A HB3    2  
ATOM   6516   N  N      . PHE A 1 113 ? -17.681 0.878   0.319   1.00 38.62 ? 113  PHE A N      2  
ATOM   6517   C  CA     . PHE A 1 113 ? -18.640 0.636   -0.806  1.00 39.56 ? 113  PHE A CA     2  
ATOM   6518   C  C      . PHE A 1 113 ? -18.600 1.820   -1.780  1.00 39.08 ? 113  PHE A C      2  
ATOM   6519   O  O      . PHE A 1 113 ? -18.623 2.964   -1.369  1.00 41.89 ? 113  PHE A O      2  
ATOM   6520   C  CB     . PHE A 1 113 ? -20.015 0.533   -0.142  1.00 37.99 ? 113  PHE A CB     2  
ATOM   6521   C  CG     . PHE A 1 113 ? -20.080 -0.727  0.687   1.00 33.82 ? 113  PHE A CG     2  
ATOM   6522   C  CD1    . PHE A 1 113 ? -20.437 -1.947  0.086   1.00 30.84 ? 113  PHE A CD1    2  
ATOM   6523   C  CD2    . PHE A 1 113 ? -19.785 -0.681  2.061   1.00 34.82 ? 113  PHE A CD2    2  
ATOM   6524   C  CE1    . PHE A 1 113 ? -20.499 -3.120  0.857   1.00 31.72 ? 113  PHE A CE1    2  
ATOM   6525   C  CE2    . PHE A 1 113 ? -19.847 -1.854  2.834   1.00 31.20 ? 113  PHE A CE2    2  
ATOM   6526   C  CZ     . PHE A 1 113 ? -20.204 -3.074  2.232   1.00 34.31 ? 113  PHE A CZ     2  
ATOM   6527   H  H      . PHE A 1 113 ? -17.686 1.739   0.787   1.00 0.00  ? 113  PHE A H      2  
ATOM   6528   H  HA     . PHE A 1 113 ? -18.402 -0.284  -1.315  1.00 0.00  ? 113  PHE A HA     2  
ATOM   6529   H  HB2    . PHE A 1 113 ? -20.173 1.391   0.495   1.00 0.00  ? 113  PHE A HB2    2  
ATOM   6530   H  HB3    . PHE A 1 113 ? -20.780 0.502   -0.903  1.00 0.00  ? 113  PHE A HB3    2  
ATOM   6531   H  HD1    . PHE A 1 113 ? -20.664 -1.983  -0.969  1.00 0.00  ? 113  PHE A HD1    2  
ATOM   6532   H  HD2    . PHE A 1 113 ? -19.511 0.256   2.523   1.00 0.00  ? 113  PHE A HD2    2  
ATOM   6533   H  HE1    . PHE A 1 113 ? -20.774 -4.057  0.396   1.00 0.00  ? 113  PHE A HE1    2  
ATOM   6534   H  HE2    . PHE A 1 113 ? -19.620 -1.818  3.889   1.00 0.00  ? 113  PHE A HE2    2  
ATOM   6535   H  HZ     . PHE A 1 113 ? -20.252 -3.975  2.824   1.00 0.00  ? 113  PHE A HZ     2  
ATOM   6536   N  N      . ALA A 1 114 ? -18.512 1.565   -3.065  1.00 37.45 ? 114  ALA A N      2  
ATOM   6537   C  CA     . ALA A 1 114 ? -18.439 2.705   -4.029  1.00 35.35 ? 114  ALA A CA     2  
ATOM   6538   C  C      . ALA A 1 114 ? -19.248 2.459   -5.303  1.00 38.09 ? 114  ALA A C      2  
ATOM   6539   O  O      . ALA A 1 114 ? -19.541 1.338   -5.684  1.00 37.61 ? 114  ALA A O      2  
ATOM   6540   C  CB     . ALA A 1 114 ? -16.954 2.821   -4.370  1.00 36.74 ? 114  ALA A CB     2  
ATOM   6541   H  H      . ALA A 1 114 ? -18.468 0.634   -3.382  1.00 0.00  ? 114  ALA A H      2  
ATOM   6542   H  HA     . ALA A 1 114 ? -18.768 3.616   -3.552  1.00 0.00  ? 114  ALA A HA     2  
ATOM   6543   H  HB1    . ALA A 1 114 ? -16.736 2.218   -5.240  1.00 0.00  ? 114  ALA A HB1    2  
ATOM   6544   H  HB2    . ALA A 1 114 ? -16.366 2.472   -3.534  1.00 0.00  ? 114  ALA A HB2    2  
ATOM   6545   H  HB3    . ALA A 1 114 ? -16.711 3.852   -4.576  1.00 0.00  ? 114  ALA A HB3    2  
ATOM   6546   N  N      . ALA A 1 115 ? -19.583 3.527   -5.964  1.00 37.57 ? 115  ALA A N      2  
ATOM   6547   C  CA     . ALA A 1 115 ? -20.357 3.442   -7.237  1.00 34.00 ? 115  ALA A CA     2  
ATOM   6548   C  C      . ALA A 1 115 ? -19.756 4.436   -8.236  1.00 37.69 ? 115  ALA A C      2  
ATOM   6549   O  O      . ALA A 1 115 ? -19.515 5.584   -7.909  1.00 42.69 ? 115  ALA A O      2  
ATOM   6550   C  CB     . ALA A 1 115 ? -21.785 3.842   -6.867  1.00 32.44 ? 115  ALA A CB     2  
ATOM   6551   H  H      . ALA A 1 115 ? -19.330 4.414   -5.635  1.00 0.00  ? 115  ALA A H      2  
ATOM   6552   H  HA     . ALA A 1 115 ? -20.336 2.438   -7.630  1.00 0.00  ? 115  ALA A HA     2  
ATOM   6553   H  HB1    . ALA A 1 115 ? -21.831 4.909   -6.721  1.00 0.00  ? 115  ALA A HB1    2  
ATOM   6554   H  HB2    . ALA A 1 115 ? -22.074 3.340   -5.954  1.00 0.00  ? 115  ALA A HB2    2  
ATOM   6555   H  HB3    . ALA A 1 115 ? -22.459 3.556   -7.660  1.00 0.00  ? 115  ALA A HB3    2  
ATOM   6556   N  N      . GLU A 1 116 ? -19.495 4.008   -9.441  1.00 33.15 ? 116  GLU A N      2  
ATOM   6557   C  CA     . GLU A 1 116 ? -18.906 4.938   -10.446 1.00 36.74 ? 116  GLU A CA     2  
ATOM   6558   C  C      . GLU A 1 116 ? -19.082 4.373   -11.850 1.00 39.74 ? 116  GLU A C      2  
ATOM   6559   O  O      . GLU A 1 116 ? -19.362 3.200   -12.022 1.00 37.52 ? 116  GLU A O      2  
ATOM   6560   C  CB     . GLU A 1 116 ? -17.424 5.001   -10.081 1.00 36.59 ? 116  GLU A CB     2  
ATOM   6561   C  CG     . GLU A 1 116 ? -16.826 3.590   -10.141 1.00 37.24 ? 116  GLU A CG     2  
ATOM   6562   C  CD     . GLU A 1 116 ? -15.303 3.680   -10.181 1.00 40.69 ? 116  GLU A CD     2  
ATOM   6563   O  OE1    . GLU A 1 116 ? -14.729 4.130   -9.205  1.00 44.48 ? 116  GLU A OE1    2  
ATOM   6564   O  OE2    . GLU A 1 116 ? -14.735 3.295   -11.191 1.00 38.07 ? 116  GLU A OE2    2  
ATOM   6565   H  H      . GLU A 1 116 ? -19.700 3.081   -9.689  1.00 0.00  ? 116  GLU A H      2  
ATOM   6566   H  HA     . GLU A 1 116 ? -19.349 5.920   -10.371 1.00 0.00  ? 116  GLU A HA     2  
ATOM   6567   H  HB2    . GLU A 1 116 ? -16.908 5.645   -10.777 1.00 0.00  ? 116  GLU A HB2    2  
ATOM   6568   H  HB3    . GLU A 1 116 ? -17.317 5.391   -9.080  1.00 0.00  ? 116  GLU A HB3    2  
ATOM   6569   H  HG2    . GLU A 1 116 ? -17.128 3.033   -9.268  1.00 0.00  ? 116  GLU A HG2    2  
ATOM   6570   H  HG3    . GLU A 1 116 ? -17.176 3.087   -11.031 1.00 0.00  ? 116  GLU A HG3    2  
ATOM   6571   N  N      . TYR A 1 117 ? -18.884 5.182   -12.854 1.00 36.42 ? 117  TYR A N      2  
ATOM   6572   C  CA     . TYR A 1 117 ? -18.996 4.667   -14.238 1.00 35.12 ? 117  TYR A CA     2  
ATOM   6573   C  C      . TYR A 1 117 ? -17.685 3.949   -14.566 1.00 32.35 ? 117  TYR A C      2  
ATOM   6574   O  O      . TYR A 1 117 ? -16.617 4.427   -14.230 1.00 38.47 ? 117  TYR A O      2  
ATOM   6575   C  CB     . TYR A 1 117 ? -19.197 5.904   -15.123 1.00 36.64 ? 117  TYR A CB     2  
ATOM   6576   C  CG     . TYR A 1 117 ? -20.542 6.510   -14.836 1.00 35.51 ? 117  TYR A CG     2  
ATOM   6577   C  CD1    . TYR A 1 117 ? -21.717 5.811   -15.185 1.00 39.08 ? 117  TYR A CD1    2  
ATOM   6578   C  CD2    . TYR A 1 117 ? -20.624 7.779   -14.229 1.00 37.06 ? 117  TYR A CD2    2  
ATOM   6579   C  CE1    . TYR A 1 117 ? -22.974 6.385   -14.925 1.00 38.20 ? 117  TYR A CE1    2  
ATOM   6580   C  CE2    . TYR A 1 117 ? -21.881 8.349   -13.969 1.00 37.73 ? 117  TYR A CE2    2  
ATOM   6581   C  CZ     . TYR A 1 117 ? -23.053 7.654   -14.318 1.00 41.02 ? 117  TYR A CZ     2  
ATOM   6582   O  OH     . TYR A 1 117 ? -24.283 8.208   -14.049 1.00 45.70 ? 117  TYR A OH     2  
ATOM   6583   H  H      . TYR A 1 117 ? -18.606 6.109   -12.691 1.00 0.00  ? 117  TYR A H      2  
ATOM   6584   H  HA     . TYR A 1 117 ? -19.833 3.992   -14.327 1.00 0.00  ? 117  TYR A HA     2  
ATOM   6585   H  HB2    . TYR A 1 117 ? -18.428 6.632   -14.913 1.00 0.00  ? 117  TYR A HB2    2  
ATOM   6586   H  HB3    . TYR A 1 117 ? -19.149 5.618   -16.162 1.00 0.00  ? 117  TYR A HB3    2  
ATOM   6587   H  HD1    . TYR A 1 117 ? -21.654 4.832   -15.650 1.00 0.00  ? 117  TYR A HD1    2  
ATOM   6588   H  HD2    . TYR A 1 117 ? -19.721 8.314   -13.959 1.00 0.00  ? 117  TYR A HD2    2  
ATOM   6589   H  HE1    . TYR A 1 117 ? -23.883 5.852   -15.199 1.00 0.00  ? 117  TYR A HE1    2  
ATOM   6590   H  HE2    . TYR A 1 117 ? -21.948 9.331   -13.503 1.00 0.00  ? 117  TYR A HE2    2  
ATOM   6591   H  HH     . TYR A 1 117 ? -24.469 8.066   -13.122 1.00 0.00  ? 117  TYR A HH     2  
ATOM   6592   N  N      . ALA A 1 118 ? -17.751 2.795   -15.184 1.00 31.35 ? 118  ALA A N      2  
ATOM   6593   C  CA     . ALA A 1 118 ? -16.500 2.032   -15.498 1.00 35.96 ? 118  ALA A CA     2  
ATOM   6594   C  C      . ALA A 1 118 ? -15.457 2.915   -16.201 1.00 43.19 ? 118  ALA A C      2  
ATOM   6595   O  O      . ALA A 1 118 ? -15.645 3.343   -17.323 1.00 48.02 ? 118  ALA A O      2  
ATOM   6596   C  CB     . ALA A 1 118 ? -16.956 0.902   -16.415 1.00 35.11 ? 118  ALA A CB     2  
ATOM   6597   H  H      . ALA A 1 118 ? -18.625 2.419   -15.415 1.00 0.00  ? 118  ALA A H      2  
ATOM   6598   H  HA     . ALA A 1 118 ? -16.083 1.619   -14.594 1.00 0.00  ? 118  ALA A HA     2  
ATOM   6599   H  HB1    . ALA A 1 118 ? -17.608 1.302   -17.178 1.00 0.00  ? 118  ALA A HB1    2  
ATOM   6600   H  HB2    . ALA A 1 118 ? -17.489 0.163   -15.838 1.00 0.00  ? 118  ALA A HB2    2  
ATOM   6601   H  HB3    . ALA A 1 118 ? -16.094 0.447   -16.879 1.00 0.00  ? 118  ALA A HB3    2  
ATOM   6602   N  N      . LYS A 1 119 ? -14.341 3.173   -15.534 1.00 44.04 ? 119  LYS A N      2  
ATOM   6603   C  CA     . LYS A 1 119 ? -13.275 3.992   -16.151 1.00 44.06 ? 119  LYS A CA     2  
ATOM   6604   C  C      . LYS A 1 119 ? -12.692 3.282   -17.381 1.00 45.49 ? 119  LYS A C      2  
ATOM   6605   O  O      . LYS A 1 119 ? -12.062 3.898   -18.221 1.00 46.54 ? 119  LYS A O      2  
ATOM   6606   C  CB     . LYS A 1 119 ? -12.220 4.137   -15.060 1.00 40.16 ? 119  LYS A CB     2  
ATOM   6607   C  CG     . LYS A 1 119 ? -12.617 5.273   -14.116 1.00 35.98 ? 119  LYS A CG     2  
ATOM   6608   C  CD     . LYS A 1 119 ? -11.724 5.241   -12.872 1.00 39.76 ? 119  LYS A CD     2  
ATOM   6609   C  CE     . LYS A 1 119 ? -12.196 6.307   -11.876 1.00 47.92 ? 119  LYS A CE     2  
ATOM   6610   N  NZ     . LYS A 1 119 ? -11.603 5.906   -10.568 1.00 55.65 ? 119  LYS A NZ     2  
ATOM   6611   H  H      . LYS A 1 119 ? -14.252 2.758   -14.653 1.00 0.00  ? 119  LYS A H      2  
ATOM   6612   H  HA     . LYS A 1 119 ? -13.661 4.961   -16.426 1.00 0.00  ? 119  LYS A HA     2  
ATOM   6613   H  HB2    . LYS A 1 119 ? -12.149 3.211   -14.504 1.00 0.00  ? 119  LYS A HB2    2  
ATOM   6614   H  HB3    . LYS A 1 119 ? -11.265 4.360   -15.510 1.00 0.00  ? 119  LYS A HB3    2  
ATOM   6615   H  HG2    . LYS A 1 119 ? -12.498 6.220   -14.623 1.00 0.00  ? 119  LYS A HG2    2  
ATOM   6616   H  HG3    . LYS A 1 119 ? -13.648 5.151   -13.821 1.00 0.00  ? 119  LYS A HG3    2  
ATOM   6617   H  HD2    . LYS A 1 119 ? -11.783 4.266   -12.413 1.00 0.00  ? 119  LYS A HD2    2  
ATOM   6618   H  HD3    . LYS A 1 119 ? -10.704 5.446   -13.158 1.00 0.00  ? 119  LYS A HD3    2  
ATOM   6619   H  HE2    . LYS A 1 119 ? -11.832 7.282   -12.172 1.00 0.00  ? 119  LYS A HE2    2  
ATOM   6620   H  HE3    . LYS A 1 119 ? -13.272 6.310   -11.809 1.00 0.00  ? 119  LYS A HE3    2  
ATOM   6621   H  HZ1    . LYS A 1 119 ? -11.870 4.923   -10.352 1.00 0.00  ? 119  LYS A HZ1    2  
ATOM   6622   H  HZ2    . LYS A 1 119 ? -11.961 6.535   -9.819  1.00 0.00  ? 119  LYS A HZ2    2  
ATOM   6623   H  HZ3    . LYS A 1 119 ? -10.568 5.979   -10.617 1.00 0.00  ? 119  LYS A HZ3    2  
ATOM   6624   N  N      . SER A 1 120 ? -12.904 1.993   -17.493 1.00 40.36 ? 120  SER A N      2  
ATOM   6625   C  CA     . SER A 1 120 ? -12.377 1.238   -18.666 1.00 39.99 ? 120  SER A CA     2  
ATOM   6626   C  C      . SER A 1 120 ? -13.256 0.009   -18.927 1.00 46.50 ? 120  SER A C      2  
ATOM   6627   O  O      . SER A 1 120 ? -14.332 -0.116  -18.370 1.00 49.28 ? 120  SER A O      2  
ATOM   6628   C  CB     . SER A 1 120 ? -10.963 0.820   -18.271 1.00 45.15 ? 120  SER A CB     2  
ATOM   6629   O  OG     . SER A 1 120 ? -11.023 -0.317  -17.420 1.00 47.94 ? 120  SER A OG     2  
ATOM   6630   H  H      . SER A 1 120 ? -13.415 1.520   -16.804 1.00 0.00  ? 120  SER A H      2  
ATOM   6631   H  HA     . SER A 1 120 ? -12.346 1.872   -19.538 1.00 0.00  ? 120  SER A HA     2  
ATOM   6632   H  HB2    . SER A 1 120 ? -10.402 0.572   -19.155 1.00 0.00  ? 120  SER A HB2    2  
ATOM   6633   H  HB3    . SER A 1 120 ? -10.476 1.642   -17.760 1.00 0.00  ? 120  SER A HB3    2  
ATOM   6634   H  HG     . SER A 1 120 ? -10.299 -0.256  -16.792 1.00 0.00  ? 120  SER A HG     2  
ATOM   6635   N  N      . ASN A 1 121 ? -12.816 -0.890  -19.775 1.00 47.10 ? 121  ASN A N      2  
ATOM   6636   C  CA     . ASN A 1 121 ? -13.641 -2.101  -20.072 1.00 48.56 ? 121  ASN A CA     2  
ATOM   6637   C  C      . ASN A 1 121 ? -12.889 -3.393  -19.719 1.00 55.46 ? 121  ASN A C      2  
ATOM   6638   O  O      . ASN A 1 121 ? -13.287 -4.472  -20.126 1.00 55.35 ? 121  ASN A O      2  
ATOM   6639   C  CB     . ASN A 1 121 ? -13.913 -2.032  -21.576 1.00 52.31 ? 121  ASN A CB     2  
ATOM   6640   C  CG     . ASN A 1 121 ? -12.586 -2.050  -22.343 1.00 57.84 ? 121  ASN A CG     2  
ATOM   6641   O  OD1    . ASN A 1 121 ? -11.810 -1.119  -22.263 1.00 54.16 ? 121  ASN A OD1    2  
ATOM   6642   N  ND2    . ASN A 1 121 ? -12.291 -3.082  -23.085 1.00 58.78 ? 121  ASN A ND2    2  
ATOM   6643   H  H      . ASN A 1 121 ? -11.948 -0.763  -20.217 1.00 0.00  ? 121  ASN A H      2  
ATOM   6644   H  HA     . ASN A 1 121 ? -14.574 -2.056  -19.534 1.00 0.00  ? 121  ASN A HA     2  
ATOM   6645   H  HB2    . ASN A 1 121 ? -14.511 -2.881  -21.871 1.00 0.00  ? 121  ASN A HB2    2  
ATOM   6646   H  HB3    . ASN A 1 121 ? -14.444 -1.119  -21.803 1.00 0.00  ? 121  ASN A HB3    2  
ATOM   6647   H  HD21   . ASN A 1 121 ? -12.916 -3.836  -23.147 1.00 0.00  ? 121  ASN A HD21   2  
ATOM   6648   H  HD22   . ASN A 1 121 ? -11.447 -3.104  -23.582 1.00 0.00  ? 121  ASN A HD22   2  
ATOM   6649   N  N      . ARG A 1 122 ? -11.818 -3.302  -18.965 1.00 55.33 ? 122  ARG A N      2  
ATOM   6650   C  CA     . ARG A 1 122 ? -11.066 -4.539  -18.597 1.00 54.48 ? 122  ARG A CA     2  
ATOM   6651   C  C      . ARG A 1 122 ? -11.434 -5.003  -17.173 1.00 50.96 ? 122  ARG A C      2  
ATOM   6652   O  O      . ARG A 1 122 ? -10.912 -5.990  -16.692 1.00 54.74 ? 122  ARG A O      2  
ATOM   6653   C  CB     . ARG A 1 122 ? -9.578  -4.172  -18.707 1.00 55.11 ? 122  ARG A CB     2  
ATOM   6654   C  CG     . ARG A 1 122 ? -9.256  -2.960  -17.830 1.00 60.75 ? 122  ARG A CG     2  
ATOM   6655   C  CD     . ARG A 1 122 ? -8.704  -1.833  -18.695 1.00 65.04 ? 122  ARG A CD     2  
ATOM   6656   N  NE     . ARG A 1 122 ? -7.572  -1.267  -17.911 1.00 71.01 ? 122  ARG A NE     2  
ATOM   6657   C  CZ     . ARG A 1 122 ? -6.810  -0.343  -18.435 1.00 65.69 ? 122  ARG A CZ     2  
ATOM   6658   N  NH1    . ARG A 1 122 ? -7.033  0.077   -19.654 1.00 56.82 ? 122  ARG A NH1    2  
ATOM   6659   N  NH2    . ARG A 1 122 ? -5.824  0.159   -17.742 1.00 58.41 ? 122  ARG A NH2    2  
ATOM   6660   H  H      . ARG A 1 122 ? -11.516 -2.428  -18.643 1.00 0.00  ? 122  ARG A H      2  
ATOM   6661   H  HA     . ARG A 1 122 ? -11.293 -5.325  -19.302 1.00 0.00  ? 122  ARG A HA     2  
ATOM   6662   H  HB2    . ARG A 1 122 ? -8.979  -5.011  -18.386 1.00 0.00  ? 122  ARG A HB2    2  
ATOM   6663   H  HB3    . ARG A 1 122 ? -9.343  -3.941  -19.737 1.00 0.00  ? 122  ARG A HB3    2  
ATOM   6664   H  HG2    . ARG A 1 122 ? -10.151 -2.622  -17.333 1.00 0.00  ? 122  ARG A HG2    2  
ATOM   6665   H  HG3    . ARG A 1 122 ? -8.517  -3.237  -17.096 1.00 0.00  ? 122  ARG A HG3    2  
ATOM   6666   H  HD2    . ARG A 1 122 ? -8.350  -2.223  -19.641 1.00 0.00  ? 122  ARG A HD2    2  
ATOM   6667   H  HD3    . ARG A 1 122 ? -9.455  -1.077  -18.856 1.00 0.00  ? 122  ARG A HD3    2  
ATOM   6668   H  HE     . ARG A 1 122 ? -7.398  -1.584  -16.998 1.00 0.00  ? 122  ARG A HE     2  
ATOM   6669   H  HH11   . ARG A 1 122 ? -7.789  -0.306  -20.188 1.00 0.00  ? 122  ARG A HH11   2  
ATOM   6670   H  HH12   . ARG A 1 122 ? -6.450  0.784   -20.054 1.00 0.00  ? 122  ARG A HH12   2  
ATOM   6671   H  HH21   . ARG A 1 122 ? -5.651  -0.163  -16.810 1.00 0.00  ? 122  ARG A HH21   2  
ATOM   6672   H  HH22   . ARG A 1 122 ? -5.239  0.863   -18.144 1.00 0.00  ? 122  ARG A HH22   2  
ATOM   6673   N  N      . SER A 1 123 ? -12.346 -4.325  -16.509 1.00 47.25 ? 123  SER A N      2  
ATOM   6674   C  CA     . SER A 1 123 ? -12.753 -4.772  -15.145 1.00 47.80 ? 123  SER A CA     2  
ATOM   6675   C  C      . SER A 1 123 ? -13.699 -5.961  -15.302 1.00 43.86 ? 123  SER A C      2  
ATOM   6676   O  O      . SER A 1 123 ? -14.101 -6.282  -16.408 1.00 47.35 ? 123  SER A O      2  
ATOM   6677   C  CB     . SER A 1 123 ? -13.476 -3.577  -14.528 1.00 44.04 ? 123  SER A CB     2  
ATOM   6678   O  OG     . SER A 1 123 ? -14.613 -3.261  -15.320 1.00 47.12 ? 123  SER A OG     2  
ATOM   6679   H  H      . SER A 1 123 ? -12.779 -3.543  -16.915 1.00 0.00  ? 123  SER A H      2  
ATOM   6680   H  HA     . SER A 1 123 ? -11.889 -5.040  -14.556 1.00 0.00  ? 123  SER A HA     2  
ATOM   6681   H  HB2    . SER A 1 123 ? -13.794 -3.824  -13.529 1.00 0.00  ? 123  SER A HB2    2  
ATOM   6682   H  HB3    . SER A 1 123 ? -12.802 -2.732  -14.492 1.00 0.00  ? 123  SER A HB3    2  
ATOM   6683   H  HG     . SER A 1 123 ? -15.307 -2.958  -14.730 1.00 0.00  ? 123  SER A HG     2  
ATOM   6684   N  N      . THR A 1 124 ? -14.050 -6.627  -14.238 1.00 44.35 ? 124  THR A N      2  
ATOM   6685   C  CA     . THR A 1 124 ? -14.954 -7.808  -14.380 1.00 42.43 ? 124  THR A CA     2  
ATOM   6686   C  C      . THR A 1 124 ? -15.888 -7.921  -13.175 1.00 46.41 ? 124  THR A C      2  
ATOM   6687   O  O      . THR A 1 124 ? -15.455 -7.917  -12.038 1.00 45.95 ? 124  THR A O      2  
ATOM   6688   C  CB     . THR A 1 124 ? -14.019 -9.019  -14.453 1.00 45.58 ? 124  THR A CB     2  
ATOM   6689   O  OG1    . THR A 1 124 ? -12.963 -8.752  -15.369 1.00 56.73 ? 124  THR A OG1    2  
ATOM   6690   C  CG2    . THR A 1 124 ? -14.808 -10.242 -14.921 1.00 47.70 ? 124  THR A CG2    2  
ATOM   6691   H  H      . THR A 1 124 ? -13.702 -6.383  -13.354 1.00 0.00  ? 124  THR A H      2  
ATOM   6692   H  HA     . THR A 1 124 ? -15.527 -7.736  -15.291 1.00 0.00  ? 124  THR A HA     2  
ATOM   6693   H  HB     . THR A 1 124 ? -13.607 -9.217  -13.476 1.00 0.00  ? 124  THR A HB     2  
ATOM   6694   H  HG1    . THR A 1 124 ? -13.352 -8.442  -16.191 1.00 0.00  ? 124  THR A HG1    2  
ATOM   6695   H  HG21   . THR A 1 124 ? -15.401 -9.980  -15.786 1.00 0.00  ? 124  THR A HG21   2  
ATOM   6696   H  HG22   . THR A 1 124 ? -15.459 -10.576 -14.128 1.00 0.00  ? 124  THR A HG22   2  
ATOM   6697   H  HG23   . THR A 1 124 ? -14.122 -11.037 -15.181 1.00 0.00  ? 124  THR A HG23   2  
ATOM   6698   N  N      . CYS A 1 125 ? -17.174 -8.060  -13.428 1.00 44.31 ? 125  CYS A N      2  
ATOM   6699   C  CA     . CYS A 1 125 ? -18.120 -8.231  -12.307 1.00 42.17 ? 125  CYS A CA     2  
ATOM   6700   C  C      . CYS A 1 125 ? -17.779 -9.523  -11.555 1.00 43.68 ? 125  CYS A C      2  
ATOM   6701   O  O      . CYS A 1 125 ? -17.754 -10.597 -12.127 1.00 47.65 ? 125  CYS A O      2  
ATOM   6702   C  CB     . CYS A 1 125 ? -19.475 -8.329  -12.974 1.00 42.46 ? 125  CYS A CB     2  
ATOM   6703   S  SG     . CYS A 1 125 ? -20.711 -8.872  -11.770 1.00 48.65 ? 125  CYS A SG     2  
ATOM   6704   H  H      . CYS A 1 125 ? -17.449 -8.123  -14.367 1.00 0.00  ? 125  CYS A H      2  
ATOM   6705   H  HA     . CYS A 1 125 ? -18.081 -7.380  -11.645 1.00 0.00  ? 125  CYS A HA     2  
ATOM   6706   H  HB2    . CYS A 1 125 ? -19.751 -7.359  -13.365 1.00 0.00  ? 125  CYS A HB2    2  
ATOM   6707   H  HB3    . CYS A 1 125 ? -19.422 -9.042  -13.783 1.00 0.00  ? 125  CYS A HB3    2  
ATOM   6708   N  N      . LYS A 1 126 ? -17.503 -9.420  -10.275 1.00 44.47 ? 126  LYS A N      2  
ATOM   6709   C  CA     . LYS A 1 126 ? -17.149 -10.635 -9.475  1.00 41.38 ? 126  LYS A CA     2  
ATOM   6710   C  C      . LYS A 1 126 ? -18.385 -11.449 -9.043  1.00 44.22 ? 126  LYS A C      2  
ATOM   6711   O  O      . LYS A 1 126 ? -18.319 -12.238 -8.120  1.00 49.96 ? 126  LYS A O      2  
ATOM   6712   C  CB     . LYS A 1 126 ? -16.410 -10.093 -8.260  1.00 37.65 ? 126  LYS A CB     2  
ATOM   6713   C  CG     . LYS A 1 126 ? -14.926 -9.938  -8.602  1.00 43.92 ? 126  LYS A CG     2  
ATOM   6714   C  CD     . LYS A 1 126 ? -14.303 -11.320 -8.832  1.00 47.90 ? 126  LYS A CD     2  
ATOM   6715   C  CE     . LYS A 1 126 ? -12.787 -11.245 -8.606  1.00 52.12 ? 126  LYS A CE     2  
ATOM   6716   N  NZ     . LYS A 1 126 ? -12.192 -12.134 -9.644  1.00 58.19 ? 126  LYS A NZ     2  
ATOM   6717   H  H      . LYS A 1 126 ? -17.547 -8.534  -9.856  1.00 0.00  ? 126  LYS A H      2  
ATOM   6718   H  HA     . LYS A 1 126 ? -16.484 -11.265 -10.045 1.00 0.00  ? 126  LYS A HA     2  
ATOM   6719   H  HB2    . LYS A 1 126 ? -16.823 -9.130  -7.990  1.00 0.00  ? 126  LYS A HB2    2  
ATOM   6720   H  HB3    . LYS A 1 126 ? -16.520 -10.779 -7.435  1.00 0.00  ? 126  LYS A HB3    2  
ATOM   6721   H  HG2    . LYS A 1 126 ? -14.825 -9.343  -9.499  1.00 0.00  ? 126  LYS A HG2    2  
ATOM   6722   H  HG3    . LYS A 1 126 ? -14.419 -9.447  -7.786  1.00 0.00  ? 126  LYS A HG3    2  
ATOM   6723   H  HD2    . LYS A 1 126 ? -14.737 -12.028 -8.141  1.00 0.00  ? 126  LYS A HD2    2  
ATOM   6724   H  HD3    . LYS A 1 126 ? -14.499 -11.639 -9.845  1.00 0.00  ? 126  LYS A HD3    2  
ATOM   6725   H  HE2    . LYS A 1 126 ? -12.440 -10.228 -8.734  1.00 0.00  ? 126  LYS A HE2    2  
ATOM   6726   H  HE3    . LYS A 1 126 ? -12.537 -11.607 -7.622  1.00 0.00  ? 126  LYS A HE3    2  
ATOM   6727   H  HZ1    . LYS A 1 126 ? -12.566 -11.878 -10.579 1.00 0.00  ? 126  LYS A HZ1    2  
ATOM   6728   H  HZ2    . LYS A 1 126 ? -12.432 -13.123 -9.432  1.00 0.00  ? 126  LYS A HZ2    2  
ATOM   6729   H  HZ3    . LYS A 1 126 ? -11.158 -12.022 -9.645  1.00 0.00  ? 126  LYS A HZ3    2  
ATOM   6730   N  N      . GLY A 1 127 ? -19.506 -11.273 -9.709  1.00 43.53 ? 127  GLY A N      2  
ATOM   6731   C  CA     . GLY A 1 127 ? -20.735 -12.024 -9.343  1.00 41.57 ? 127  GLY A CA     2  
ATOM   6732   C  C      . GLY A 1 127 ? -21.059 -12.968 -10.499 1.00 46.45 ? 127  GLY A C      2  
ATOM   6733   O  O      . GLY A 1 127 ? -21.368 -14.126 -10.299 1.00 46.31 ? 127  GLY A O      2  
ATOM   6734   H  H      . GLY A 1 127 ? -19.519 -10.604 -10.400 1.00 0.00  ? 127  GLY A H      2  
ATOM   6735   H  HA2    . GLY A 1 127 ? -20.556 -12.595 -8.439  1.00 0.00  ? 127  GLY A HA2    2  
ATOM   6736   H  HA3    . GLY A 1 127 ? -21.558 -11.344 -9.185  1.00 0.00  ? 127  GLY A HA3    2  
ATOM   6737   N  N      . CYS A 1 128 ? -20.951 -12.483 -11.715 1.00 48.54 ? 128  CYS A N      2  
ATOM   6738   C  CA     . CYS A 1 128 ? -21.207 -13.354 -12.901 1.00 46.61 ? 128  CYS A CA     2  
ATOM   6739   C  C      . CYS A 1 128 ? -19.914 -13.516 -13.744 1.00 51.31 ? 128  CYS A C      2  
ATOM   6740   O  O      . CYS A 1 128 ? -19.912 -14.171 -14.767 1.00 55.23 ? 128  CYS A O      2  
ATOM   6741   C  CB     . CYS A 1 128 ? -22.337 -12.669 -13.676 1.00 46.98 ? 128  CYS A CB     2  
ATOM   6742   S  SG     . CYS A 1 128 ? -21.783 -11.086 -14.360 1.00 48.35 ? 128  CYS A SG     2  
ATOM   6743   H  H      . CYS A 1 128 ? -20.675 -11.553 -11.844 1.00 0.00  ? 128  CYS A H      2  
ATOM   6744   H  HA     . CYS A 1 128 ? -21.537 -14.327 -12.570 1.00 0.00  ? 128  CYS A HA     2  
ATOM   6745   H  HB2    . CYS A 1 128 ? -22.656 -13.311 -14.481 1.00 0.00  ? 128  CYS A HB2    2  
ATOM   6746   H  HB3    . CYS A 1 128 ? -23.169 -12.496 -13.007 1.00 0.00  ? 128  CYS A HB3    2  
ATOM   6747   N  N      . MET A 1 129 ? -18.801 -12.927 -13.300 1.00 50.88 ? 129  MET A N      2  
ATOM   6748   C  CA     . MET A 1 129 ? -17.516 -13.029 -14.055 1.00 49.35 ? 129  MET A CA     2  
ATOM   6749   C  C      . MET A 1 129 ? -17.597 -12.464 -15.486 1.00 47.29 ? 129  MET A C      2  
ATOM   6750   O  O      . MET A 1 129 ? -16.693 -12.665 -16.279 1.00 47.32 ? 129  MET A O      2  
ATOM   6751   C  CB     . MET A 1 129 ? -17.203 -14.523 -14.089 1.00 48.23 ? 129  MET A CB     2  
ATOM   6752   C  CG     . MET A 1 129 ? -17.195 -15.072 -12.659 1.00 47.27 ? 129  MET A CG     2  
ATOM   6753   S  SD     . MET A 1 129 ? -15.802 -14.363 -11.743 1.00 67.85 ? 129  MET A SD     2  
ATOM   6754   C  CE     . MET A 1 129 ? -14.482 -15.348 -12.498 1.00 51.47 ? 129  MET A CE     2  
ATOM   6755   H  H      . MET A 1 129 ? -18.885 -12.361 -12.511 1.00 0.00  ? 129  MET A H      2  
ATOM   6756   H  HA     . MET A 1 129 ? -16.744 -12.516 -13.512 1.00 0.00  ? 129  MET A HA     2  
ATOM   6757   H  HB2    . MET A 1 129 ? -17.955 -15.039 -14.669 1.00 0.00  ? 129  MET A HB2    2  
ATOM   6758   H  HB3    . MET A 1 129 ? -16.234 -14.678 -14.536 1.00 0.00  ? 129  MET A HB3    2  
ATOM   6759   H  HG2    . MET A 1 129 ? -18.120 -14.802 -12.167 1.00 0.00  ? 129  MET A HG2    2  
ATOM   6760   H  HG3    . MET A 1 129 ? -17.103 -16.147 -12.685 1.00 0.00  ? 129  MET A HG3    2  
ATOM   6761   H  HE1    . MET A 1 129 ? -14.163 -14.876 -13.418 1.00 0.00  ? 129  MET A HE1    2  
ATOM   6762   H  HE2    . MET A 1 129 ? -14.845 -16.339 -12.712 1.00 0.00  ? 129  MET A HE2    2  
ATOM   6763   H  HE3    . MET A 1 129 ? -13.648 -15.413 -11.813 1.00 0.00  ? 129  MET A HE3    2  
ATOM   6764   N  N      . GLU A 1 130 ? -18.635 -11.738 -15.815 1.00 44.62 ? 130  GLU A N      2  
ATOM   6765   C  CA     . GLU A 1 130 ? -18.730 -11.145 -17.180 1.00 49.65 ? 130  GLU A CA     2  
ATOM   6766   C  C      . GLU A 1 130 ? -18.046 -9.778  -17.160 1.00 50.15 ? 130  GLU A C      2  
ATOM   6767   O  O      . GLU A 1 130 ? -18.079 -9.080  -16.163 1.00 50.94 ? 130  GLU A O      2  
ATOM   6768   C  CB     . GLU A 1 130 ? -20.227 -11.014 -17.464 1.00 48.89 ? 130  GLU A CB     2  
ATOM   6769   C  CG     . GLU A 1 130 ? -20.859 -12.409 -17.501 1.00 48.74 ? 130  GLU A CG     2  
ATOM   6770   C  CD     . GLU A 1 130 ? -22.272 -12.316 -18.078 1.00 53.37 ? 130  GLU A CD     2  
ATOM   6771   O  OE1    . GLU A 1 130 ? -22.449 -11.595 -19.046 1.00 48.29 ? 130  GLU A OE1    2  
ATOM   6772   O  OE2    . GLU A 1 130 ? -23.154 -12.970 -17.545 1.00 57.70 ? 130  GLU A OE2    2  
ATOM   6773   H  H      . GLU A 1 130 ? -19.337 -11.560 -15.160 1.00 0.00  ? 130  GLU A H      2  
ATOM   6774   H  HA     . GLU A 1 130 ? -18.264 -11.792 -17.910 1.00 0.00  ? 130  GLU A HA     2  
ATOM   6775   H  HB2    . GLU A 1 130 ? -20.688 -10.427 -16.684 1.00 0.00  ? 130  GLU A HB2    2  
ATOM   6776   H  HB3    . GLU A 1 130 ? -20.372 -10.530 -18.417 1.00 0.00  ? 130  GLU A HB3    2  
ATOM   6777   H  HG2    . GLU A 1 130 ? -20.258 -13.060 -18.121 1.00 0.00  ? 130  GLU A HG2    2  
ATOM   6778   H  HG3    . GLU A 1 130 ? -20.907 -12.810 -16.499 1.00 0.00  ? 130  GLU A HG3    2  
ATOM   6779   N  N      . LYS A 1 131 ? -17.395 -9.407  -18.232 1.00 54.84 ? 131  LYS A N      2  
ATOM   6780   C  CA     . LYS A 1 131 ? -16.671 -8.102  -18.248 1.00 51.76 ? 131  LYS A CA     2  
ATOM   6781   C  C      . LYS A 1 131 ? -17.643 -6.920  -18.171 1.00 51.84 ? 131  LYS A C      2  
ATOM   6782   O  O      . LYS A 1 131 ? -18.710 -6.940  -18.753 1.00 55.05 ? 131  LYS A O      2  
ATOM   6783   C  CB     . LYS A 1 131 ? -15.921 -8.091  -19.577 1.00 54.22 ? 131  LYS A CB     2  
ATOM   6784   C  CG     . LYS A 1 131 ? -14.499 -7.575  -19.354 1.00 60.53 ? 131  LYS A CG     2  
ATOM   6785   C  CD     . LYS A 1 131 ? -13.622 -8.707  -18.809 1.00 59.53 ? 131  LYS A CD     2  
ATOM   6786   C  CE     . LYS A 1 131 ? -12.240 -8.156  -18.446 1.00 65.23 ? 131  LYS A CE     2  
ATOM   6787   N  NZ     . LYS A 1 131 ? -11.483 -8.144  -19.729 1.00 68.69 ? 131  LYS A NZ     2  
ATOM   6788   H  H      . LYS A 1 131 ? -17.356 -10.003 -19.013 1.00 0.00  ? 131  LYS A H      2  
ATOM   6789   H  HA     . LYS A 1 131 ? -15.967 -8.056  -17.433 1.00 0.00  ? 131  LYS A HA     2  
ATOM   6790   H  HB2    . LYS A 1 131 ? -15.883 -9.094  -19.976 1.00 0.00  ? 131  LYS A HB2    2  
ATOM   6791   H  HB3    . LYS A 1 131 ? -16.433 -7.443  -20.272 1.00 0.00  ? 131  LYS A HB3    2  
ATOM   6792   H  HG2    . LYS A 1 131 ? -14.096 -7.224  -20.292 1.00 0.00  ? 131  LYS A HG2    2  
ATOM   6793   H  HG3    . LYS A 1 131 ? -14.519 -6.764  -18.643 1.00 0.00  ? 131  LYS A HG3    2  
ATOM   6794   H  HD2    . LYS A 1 131 ? -14.085 -9.128  -17.929 1.00 0.00  ? 131  LYS A HD2    2  
ATOM   6795   H  HD3    . LYS A 1 131 ? -13.516 -9.474  -19.562 1.00 0.00  ? 131  LYS A HD3    2  
ATOM   6796   H  HE2    . LYS A 1 131 ? -12.327 -7.155  -18.049 1.00 0.00  ? 131  LYS A HE2    2  
ATOM   6797   H  HE3    . LYS A 1 131 ? -11.751 -8.805  -17.736 1.00 0.00  ? 131  LYS A HE3    2  
ATOM   6798   H  HZ1    . LYS A 1 131 ? -11.867 -7.405  -20.352 1.00 0.00  ? 131  LYS A HZ1    2  
ATOM   6799   H  HZ2    . LYS A 1 131 ? -11.574 -9.071  -20.193 1.00 0.00  ? 131  LYS A HZ2    2  
ATOM   6800   H  HZ3    . LYS A 1 131 ? -10.480 -7.948  -19.540 1.00 0.00  ? 131  LYS A HZ3    2  
ATOM   6801   N  N      . ILE A 1 132 ? -17.238 -5.865  -17.489 1.00 48.15 ? 132  ILE A N      2  
ATOM   6802   C  CA     . ILE A 1 132 ? -18.079 -4.652  -17.423 1.00 45.47 ? 132  ILE A CA     2  
ATOM   6803   C  C      . ILE A 1 132 ? -17.622 -3.700  -18.534 1.00 49.65 ? 132  ILE A C      2  
ATOM   6804   O  O      . ILE A 1 132 ? -16.439 -3.479  -18.711 1.00 54.03 ? 132  ILE A O      2  
ATOM   6805   C  CB     . ILE A 1 132 ? -17.808 -4.067  -16.039 1.00 41.64 ? 132  ILE A CB     2  
ATOM   6806   C  CG1    . ILE A 1 132 ? -18.274 -5.060  -14.968 1.00 44.04 ? 132  ILE A CG1    2  
ATOM   6807   C  CG2    . ILE A 1 132 ? -18.574 -2.753  -15.884 1.00 40.40 ? 132  ILE A CG2    2  
ATOM   6808   C  CD1    . ILE A 1 132 ? -17.747 -4.623  -13.600 1.00 40.50 ? 132  ILE A CD1    2  
ATOM   6809   H  H      . ILE A 1 132 ? -16.332 -5.888  -17.118 1.00 0.00  ? 132  ILE A H      2  
ATOM   6810   H  HA     . ILE A 1 132 ? -19.123 -4.904  -17.537 1.00 0.00  ? 132  ILE A HA     2  
ATOM   6811   H  HB     . ILE A 1 132 ? -16.750 -3.884  -15.927 1.00 0.00  ? 132  ILE A HB     2  
ATOM   6812   H  HG12   . ILE A 1 132 ? -19.353 -5.086  -14.947 1.00 0.00  ? 132  ILE A HG12   2  
ATOM   6813   H  HG13   . ILE A 1 132 ? -17.894 -6.043  -15.199 1.00 0.00  ? 132  ILE A HG13   2  
ATOM   6814   H  HG21   . ILE A 1 132 ? -18.379 -2.335  -14.907 1.00 0.00  ? 132  ILE A HG21   2  
ATOM   6815   H  HG22   . ILE A 1 132 ? -19.633 -2.938  -15.991 1.00 0.00  ? 132  ILE A HG22   2  
ATOM   6816   H  HG23   . ILE A 1 132 ? -18.252 -2.057  -16.644 1.00 0.00  ? 132  ILE A HG23   2  
ATOM   6817   H  HD11   . ILE A 1 132 ? -17.855 -5.434  -12.896 1.00 0.00  ? 132  ILE A HD11   2  
ATOM   6818   H  HD12   . ILE A 1 132 ? -18.308 -3.768  -13.252 1.00 0.00  ? 132  ILE A HD12   2  
ATOM   6819   H  HD13   . ILE A 1 132 ? -16.703 -4.357  -13.682 1.00 0.00  ? 132  ILE A HD13   2  
ATOM   6820   N  N      . GLU A 1 133 ? -18.535 -3.163  -19.306 1.00 46.35 ? 133  GLU A N      2  
ATOM   6821   C  CA     . GLU A 1 133 ? -18.123 -2.254  -20.422 1.00 49.59 ? 133  GLU A CA     2  
ATOM   6822   C  C      . GLU A 1 133 ? -17.798 -0.855  -19.900 1.00 46.85 ? 133  GLU A C      2  
ATOM   6823   O  O      . GLU A 1 133 ? -18.453 -0.341  -19.010 1.00 45.38 ? 133  GLU A O      2  
ATOM   6824   C  CB     . GLU A 1 133 ? -19.314 -2.234  -21.366 1.00 51.52 ? 133  GLU A CB     2  
ATOM   6825   C  CG     . GLU A 1 133 ? -19.287 -3.490  -22.242 1.00 51.58 ? 133  GLU A CG     2  
ATOM   6826   C  CD     . GLU A 1 133 ? -18.110 -3.417  -23.219 1.00 61.90 ? 133  GLU A CD     2  
ATOM   6827   O  OE1    . GLU A 1 133 ? -17.862 -2.341  -23.738 1.00 59.50 ? 133  GLU A OE1    2  
ATOM   6828   O  OE2    . GLU A 1 133 ? -17.478 -4.439  -23.433 1.00 64.14 ? 133  GLU A OE2    2  
ATOM   6829   H  H      . GLU A 1 133 ? -19.484 -3.361  -19.151 1.00 0.00  ? 133  GLU A H      2  
ATOM   6830   H  HA     . GLU A 1 133 ? -17.261 -2.663  -20.927 1.00 0.00  ? 133  GLU A HA     2  
ATOM   6831   H  HB2    . GLU A 1 133 ? -20.226 -2.215  -20.788 1.00 0.00  ? 133  GLU A HB2    2  
ATOM   6832   H  HB3    . GLU A 1 133 ? -19.261 -1.358  -21.991 1.00 0.00  ? 133  GLU A HB3    2  
ATOM   6833   H  HG2    . GLU A 1 133 ? -19.179 -4.364  -21.616 1.00 0.00  ? 133  GLU A HG2    2  
ATOM   6834   H  HG3    . GLU A 1 133 ? -20.209 -3.557  -22.798 1.00 0.00  ? 133  GLU A HG3    2  
ATOM   6835   N  N      . LYS A 1 134 ? -16.802 -0.226  -20.476 1.00 45.12 ? 134  LYS A N      2  
ATOM   6836   C  CA     . LYS A 1 134 ? -16.459 1.183   -20.067 1.00 39.75 ? 134  LYS A CA     2  
ATOM   6837   C  C      . LYS A 1 134 ? -17.696 2.100   -20.128 1.00 37.30 ? 134  LYS A C      2  
ATOM   6838   O  O      . LYS A 1 134 ? -18.457 2.065   -21.076 1.00 40.40 ? 134  LYS A O      2  
ATOM   6839   C  CB     . LYS A 1 134 ? -15.410 1.645   -21.082 1.00 42.85 ? 134  LYS A CB     2  
ATOM   6840   C  CG     . LYS A 1 134 ? -14.948 3.062   -20.733 1.00 47.59 ? 134  LYS A CG     2  
ATOM   6841   C  CD     . LYS A 1 134 ? -13.863 3.503   -21.721 1.00 45.02 ? 134  LYS A CD     2  
ATOM   6842   C  CE     . LYS A 1 134 ? -13.599 5.004   -21.560 1.00 48.52 ? 134  LYS A CE     2  
ATOM   6843   N  NZ     . LYS A 1 134 ? -12.452 5.296   -22.467 1.00 60.73 ? 134  LYS A NZ     2  
ATOM   6844   H  H      . LYS A 1 134 ? -16.377 -0.598  -21.272 1.00 0.00  ? 134  LYS A H      2  
ATOM   6845   H  HA     . LYS A 1 134 ? -16.042 1.181   -19.077 1.00 0.00  ? 134  LYS A HA     2  
ATOM   6846   H  HB2    . LYS A 1 134 ? -14.567 0.972   -21.055 1.00 0.00  ? 134  LYS A HB2    2  
ATOM   6847   H  HB3    . LYS A 1 134 ? -15.843 1.645   -22.071 1.00 0.00  ? 134  LYS A HB3    2  
ATOM   6848   H  HG2    . LYS A 1 134 ? -15.788 3.738   -20.792 1.00 0.00  ? 134  LYS A HG2    2  
ATOM   6849   H  HG3    . LYS A 1 134 ? -14.545 3.071   -19.731 1.00 0.00  ? 134  LYS A HG3    2  
ATOM   6850   H  HD2    . LYS A 1 134 ? -12.954 2.952   -21.524 1.00 0.00  ? 134  LYS A HD2    2  
ATOM   6851   H  HD3    . LYS A 1 134 ? -14.193 3.303   -22.730 1.00 0.00  ? 134  LYS A HD3    2  
ATOM   6852   H  HE2    . LYS A 1 134 ? -14.470 5.572   -21.856 1.00 0.00  ? 134  LYS A HE2    2  
ATOM   6853   H  HE3    . LYS A 1 134 ? -13.329 5.231   -20.539 1.00 0.00  ? 134  LYS A HE3    2  
ATOM   6854   H  HZ1    . LYS A 1 134 ? -12.269 6.320   -22.479 1.00 0.00  ? 134  LYS A HZ1    2  
ATOM   6855   H  HZ2    . LYS A 1 134 ? -12.681 4.973   -23.429 1.00 0.00  ? 134  LYS A HZ2    2  
ATOM   6856   H  HZ3    . LYS A 1 134 ? -11.604 4.799   -22.126 1.00 0.00  ? 134  LYS A HZ3    2  
ATOM   6857   N  N      . GLY A 1 135 ? -17.900 2.921   -19.119 1.00 40.63 ? 135  GLY A N      2  
ATOM   6858   C  CA     . GLY A 1 135 ? -19.079 3.836   -19.119 1.00 33.58 ? 135  GLY A CA     2  
ATOM   6859   C  C      . GLY A 1 135 ? -20.229 3.208   -18.317 1.00 35.53 ? 135  GLY A C      2  
ATOM   6860   O  O      . GLY A 1 135 ? -21.039 3.905   -17.736 1.00 38.59 ? 135  GLY A O      2  
ATOM   6861   H  H      . GLY A 1 135 ? -17.261 2.936   -18.377 1.00 0.00  ? 135  GLY A H      2  
ATOM   6862   H  HA2    . GLY A 1 135 ? -18.799 4.776   -18.667 1.00 0.00  ? 135  GLY A HA2    2  
ATOM   6863   H  HA3    . GLY A 1 135 ? -19.403 4.008   -20.134 1.00 0.00  ? 135  GLY A HA3    2  
ATOM   6864   N  N      . GLN A 1 136 ? -20.311 1.893   -18.290 1.00 37.63 ? 136  GLN A N      2  
ATOM   6865   C  CA     . GLN A 1 136 ? -21.412 1.223   -17.544 1.00 40.73 ? 136  GLN A CA     2  
ATOM   6866   C  C      . GLN A 1 136 ? -21.290 1.476   -16.037 1.00 38.85 ? 136  GLN A C      2  
ATOM   6867   O  O      . GLN A 1 136 ? -20.208 1.454   -15.478 1.00 41.28 ? 136  GLN A O      2  
ATOM   6868   C  CB     . GLN A 1 136 ? -21.238 -0.265  -17.840 1.00 41.74 ? 136  GLN A CB     2  
ATOM   6869   C  CG     . GLN A 1 136 ? -21.665 -0.565  -19.279 1.00 40.64 ? 136  GLN A CG     2  
ATOM   6870   C  CD     . GLN A 1 136 ? -22.242 -1.983  -19.349 1.00 41.59 ? 136  GLN A CD     2  
ATOM   6871   O  OE1    . GLN A 1 136 ? -21.561 -2.941  -19.045 1.00 40.64 ? 136  GLN A OE1    2  
ATOM   6872   N  NE2    . GLN A 1 136 ? -23.476 -2.161  -19.740 1.00 45.59 ? 136  GLN A NE2    2  
ATOM   6873   H  H      . GLN A 1 136 ? -19.647 1.375   -18.790 1.00 0.00  ? 136  GLN A H      2  
ATOM   6874   H  HA     . GLN A 1 136 ? -22.372 1.559   -17.907 1.00 0.00  ? 136  GLN A HA     2  
ATOM   6875   H  HB2    . GLN A 1 136 ? -20.200 -0.535  -17.710 1.00 0.00  ? 136  GLN A HB2    2  
ATOM   6876   H  HB3    . GLN A 1 136 ? -21.847 -0.838  -17.159 1.00 0.00  ? 136  GLN A HB3    2  
ATOM   6877   H  HG2    . GLN A 1 136 ? -22.414 0.149   -19.591 1.00 0.00  ? 136  GLN A HG2    2  
ATOM   6878   H  HG3    . GLN A 1 136 ? -20.806 -0.495  -19.930 1.00 0.00  ? 136  GLN A HG3    2  
ATOM   6879   H  HE21   . GLN A 1 136 ? -24.029 -1.390  -19.987 1.00 0.00  ? 136  GLN A HE21   2  
ATOM   6880   H  HE22   . GLN A 1 136 ? -23.849 -3.066  -19.785 1.00 0.00  ? 136  GLN A HE22   2  
ATOM   6881   N  N      . VAL A 1 137 ? -22.401 1.693   -15.382 1.00 39.86 ? 137  VAL A N      2  
ATOM   6882   C  CA     . VAL A 1 137 ? -22.373 1.924   -13.917 1.00 37.99 ? 137  VAL A CA     2  
ATOM   6883   C  C      . VAL A 1 137 ? -21.972 0.629   -13.206 1.00 39.63 ? 137  VAL A C      2  
ATOM   6884   O  O      . VAL A 1 137 ? -22.484 -0.434  -13.509 1.00 41.36 ? 137  VAL A O      2  
ATOM   6885   C  CB     . VAL A 1 137 ? -23.807 2.307   -13.546 1.00 35.63 ? 137  VAL A CB     2  
ATOM   6886   C  CG1    . VAL A 1 137 ? -23.893 2.507   -12.035 1.00 38.53 ? 137  VAL A CG1    2  
ATOM   6887   C  CG2    . VAL A 1 137 ? -24.199 3.608   -14.252 1.00 36.67 ? 137  VAL A CG2    2  
ATOM   6888   H  H      . VAL A 1 137 ? -23.257 1.687   -15.860 1.00 0.00  ? 137  VAL A H      2  
ATOM   6889   H  HA     . VAL A 1 137 ? -21.696 2.727   -13.668 1.00 0.00  ? 137  VAL A HA     2  
ATOM   6890   H  HB     . VAL A 1 137 ? -24.482 1.515   -13.844 1.00 0.00  ? 137  VAL A HB     2  
ATOM   6891   H  HG11   . VAL A 1 137 ? -23.566 1.605   -11.538 1.00 0.00  ? 137  VAL A HG11   2  
ATOM   6892   H  HG12   . VAL A 1 137 ? -24.913 2.724   -11.756 1.00 0.00  ? 137  VAL A HG12   2  
ATOM   6893   H  HG13   . VAL A 1 137 ? -23.255 3.328   -11.745 1.00 0.00  ? 137  VAL A HG13   2  
ATOM   6894   H  HG21   . VAL A 1 137 ? -23.988 4.447   -13.604 1.00 0.00  ? 137  VAL A HG21   2  
ATOM   6895   H  HG22   . VAL A 1 137 ? -25.255 3.589   -14.480 1.00 0.00  ? 137  VAL A HG22   2  
ATOM   6896   H  HG23   . VAL A 1 137 ? -23.635 3.709   -15.166 1.00 0.00  ? 137  VAL A HG23   2  
ATOM   6897   N  N      . ARG A 1 138 ? -21.077 0.716   -12.270 1.00 37.09 ? 138  ARG A N      2  
ATOM   6898   C  CA     . ARG A 1 138 ? -20.642 -0.508  -11.536 1.00 34.38 ? 138  ARG A CA     2  
ATOM   6899   C  C      . ARG A 1 138 ? -20.539 -0.205  -10.044 1.00 35.36 ? 138  ARG A C      2  
ATOM   6900   O  O      . ARG A 1 138 ? -20.297 0.919   -9.646  1.00 36.41 ? 138  ARG A O      2  
ATOM   6901   C  CB     . ARG A 1 138 ? -19.273 -0.890  -12.118 1.00 32.50 ? 138  ARG A CB     2  
ATOM   6902   C  CG     . ARG A 1 138 ? -18.351 0.334   -12.175 1.00 35.31 ? 138  ARG A CG     2  
ATOM   6903   C  CD     . ARG A 1 138 ? -16.957 -0.052  -11.701 1.00 31.34 ? 138  ARG A CD     2  
ATOM   6904   N  NE     . ARG A 1 138 ? -16.092 0.075   -12.908 1.00 34.13 ? 138  ARG A NE     2  
ATOM   6905   C  CZ     . ARG A 1 138 ? -14.838 0.436   -12.787 1.00 41.40 ? 138  ARG A CZ     2  
ATOM   6906   N  NH1    . ARG A 1 138 ? -14.314 0.637   -11.603 1.00 36.69 ? 138  ARG A NH1    2  
ATOM   6907   N  NH2    . ARG A 1 138 ? -14.102 0.588   -13.855 1.00 37.39 ? 138  ARG A NH2    2  
ATOM   6908   H  H      . ARG A 1 138 ? -20.680 1.584   -12.040 1.00 0.00  ? 138  ARG A H      2  
ATOM   6909   H  HA     . ARG A 1 138 ? -21.347 -1.310  -11.705 1.00 0.00  ? 138  ARG A HA     2  
ATOM   6910   H  HB2    . ARG A 1 138 ? -18.821 -1.648  -11.495 1.00 0.00  ? 138  ARG A HB2    2  
ATOM   6911   H  HB3    . ARG A 1 138 ? -19.406 -1.282  -13.114 1.00 0.00  ? 138  ARG A HB3    2  
ATOM   6912   H  HG2    . ARG A 1 138 ? -18.295 0.695   -13.190 1.00 0.00  ? 138  ARG A HG2    2  
ATOM   6913   H  HG3    . ARG A 1 138 ? -18.740 1.112   -11.537 1.00 0.00  ? 138  ARG A HG3    2  
ATOM   6914   H  HD2    . ARG A 1 138 ? -16.630 0.630   -10.930 1.00 0.00  ? 138  ARG A HD2    2  
ATOM   6915   H  HD3    . ARG A 1 138 ? -16.944 -1.068  -11.339 1.00 0.00  ? 138  ARG A HD3    2  
ATOM   6916   H  HE     . ARG A 1 138 ? -16.466 -0.095  -13.797 1.00 0.00  ? 138  ARG A HE     2  
ATOM   6917   H  HH11   . ARG A 1 138 ? -14.868 0.516   -10.778 1.00 0.00  ? 138  ARG A HH11   2  
ATOM   6918   H  HH12   . ARG A 1 138 ? -13.355 0.911   -11.520 1.00 0.00  ? 138  ARG A HH12   2  
ATOM   6919   H  HH21   . ARG A 1 138 ? -14.497 0.431   -14.763 1.00 0.00  ? 138  ARG A HH21   2  
ATOM   6920   H  HH22   . ARG A 1 138 ? -13.144 0.859   -13.769 1.00 0.00  ? 138  ARG A HH22   2  
ATOM   6921   N  N      . LEU A 1 139 ? -20.721 -1.201  -9.224  1.00 35.01 ? 139  LEU A N      2  
ATOM   6922   C  CA     . LEU A 1 139 ? -20.631 -0.997  -7.745  1.00 38.09 ? 139  LEU A CA     2  
ATOM   6923   C  C      . LEU A 1 139 ? -19.492 -1.842  -7.197  1.00 34.86 ? 139  LEU A C      2  
ATOM   6924   O  O      . LEU A 1 139 ? -19.043 -2.765  -7.854  1.00 38.61 ? 139  LEU A O      2  
ATOM   6925   C  CB     . LEU A 1 139 ? -21.973 -1.494  -7.188  1.00 34.52 ? 139  LEU A CB     2  
ATOM   6926   C  CG     . LEU A 1 139 ? -23.039 -0.412  -7.374  1.00 35.09 ? 139  LEU A CG     2  
ATOM   6927   C  CD1    . LEU A 1 139 ? -24.412 -0.953  -6.962  1.00 35.39 ? 139  LEU A CD1    2  
ATOM   6928   C  CD2    . LEU A 1 139 ? -22.687 0.796   -6.505  1.00 34.66 ? 139  LEU A CD2    2  
ATOM   6929   H  H      . LEU A 1 139 ? -20.896 -2.103  -9.574  1.00 0.00  ? 139  LEU A H      2  
ATOM   6930   H  HA     . LEU A 1 139 ? -20.487 0.046   -7.507  1.00 0.00  ? 139  LEU A HA     2  
ATOM   6931   H  HB2    . LEU A 1 139 ? -22.271 -2.390  -7.714  1.00 0.00  ? 139  LEU A HB2    2  
ATOM   6932   H  HB3    . LEU A 1 139 ? -21.865 -1.713  -6.136  1.00 0.00  ? 139  LEU A HB3    2  
ATOM   6933   H  HG     . LEU A 1 139 ? -23.068 -0.113  -8.410  1.00 0.00  ? 139  LEU A HG     2  
ATOM   6934   H  HD11   . LEU A 1 139 ? -24.465 -2.011  -7.175  1.00 0.00  ? 139  LEU A HD11   2  
ATOM   6935   H  HD12   . LEU A 1 139 ? -25.181 -0.435  -7.517  1.00 0.00  ? 139  LEU A HD12   2  
ATOM   6936   H  HD13   . LEU A 1 139 ? -24.562 -0.791  -5.904  1.00 0.00  ? 139  LEU A HD13   2  
ATOM   6937   H  HD21   . LEU A 1 139 ? -22.365 0.457   -5.530  1.00 0.00  ? 139  LEU A HD21   2  
ATOM   6938   H  HD22   . LEU A 1 139 ? -23.554 1.427   -6.397  1.00 0.00  ? 139  LEU A HD22   2  
ATOM   6939   H  HD23   . LEU A 1 139 ? -21.889 1.353   -6.971  1.00 0.00  ? 139  LEU A HD23   2  
ATOM   6940   N  N      . SER A 1 140 ? -19.006 -1.549  -6.007  1.00 32.60 ? 140  SER A N      2  
ATOM   6941   C  CA     . SER A 1 140 ? -17.894 -2.372  -5.493  1.00 34.84 ? 140  SER A CA     2  
ATOM   6942   C  C      . SER A 1 140 ? -17.828 -2.429  -3.970  1.00 36.67 ? 140  SER A C      2  
ATOM   6943   O  O      . SER A 1 140 ? -18.106 -1.474  -3.268  1.00 36.81 ? 140  SER A O      2  
ATOM   6944   C  CB     . SER A 1 140 ? -16.641 -1.700  -6.035  1.00 33.31 ? 140  SER A CB     2  
ATOM   6945   O  OG     . SER A 1 140 ? -16.838 -0.291  -6.083  1.00 33.56 ? 140  SER A OG     2  
ATOM   6946   H  H      . SER A 1 140 ? -19.380 -0.793  -5.505  1.00 0.00  ? 140  SER A H      2  
ATOM   6947   H  HA     . SER A 1 140 ? -17.964 -3.368  -5.894  1.00 0.00  ? 140  SER A HA     2  
ATOM   6948   H  HB2    . SER A 1 140 ? -15.806 -1.921  -5.393  1.00 0.00  ? 140  SER A HB2    2  
ATOM   6949   H  HB3    . SER A 1 140 ? -16.442 -2.079  -7.025  1.00 0.00  ? 140  SER A HB3    2  
ATOM   6950   H  HG     . SER A 1 140 ? -16.654 0.062   -5.211  1.00 0.00  ? 140  SER A HG     2  
ATOM   6951   N  N      . LYS A 1 141 ? -17.393 -3.557  -3.473  1.00 32.92 ? 141  LYS A N      2  
ATOM   6952   C  CA     . LYS A 1 141 ? -17.222 -3.736  -2.010  1.00 33.23 ? 141  LYS A CA     2  
ATOM   6953   C  C      . LYS A 1 141 ? -15.723 -3.767  -1.697  1.00 34.29 ? 141  LYS A C      2  
ATOM   6954   O  O      . LYS A 1 141 ? -15.050 -4.755  -1.918  1.00 37.89 ? 141  LYS A O      2  
ATOM   6955   C  CB     . LYS A 1 141 ? -17.871 -5.085  -1.689  1.00 32.65 ? 141  LYS A CB     2  
ATOM   6956   C  CG     . LYS A 1 141 ? -17.797 -5.346  -0.182  1.00 32.87 ? 141  LYS A CG     2  
ATOM   6957   C  CD     . LYS A 1 141 ? -17.364 -6.792  0.068   1.00 31.53 ? 141  LYS A CD     2  
ATOM   6958   C  CE     . LYS A 1 141 ? -17.696 -7.184  1.510   1.00 35.56 ? 141  LYS A CE     2  
ATOM   6959   N  NZ     . LYS A 1 141 ? -16.537 -8.002  1.962   1.00 32.31 ? 141  LYS A NZ     2  
ATOM   6960   H  H      . LYS A 1 141 ? -17.140 -4.284  -4.080  1.00 0.00  ? 141  LYS A H      2  
ATOM   6961   H  HA     . LYS A 1 141 ? -17.712 -2.943  -1.467  1.00 0.00  ? 141  LYS A HA     2  
ATOM   6962   H  HB2    . LYS A 1 141 ? -18.906 -5.068  -2.002  1.00 0.00  ? 141  LYS A HB2    2  
ATOM   6963   H  HB3    . LYS A 1 141 ? -17.348 -5.870  -2.216  1.00 0.00  ? 141  LYS A HB3    2  
ATOM   6964   H  HG2    . LYS A 1 141 ? -17.080 -4.673  0.266   1.00 0.00  ? 141  LYS A HG2    2  
ATOM   6965   H  HG3    . LYS A 1 141 ? -18.768 -5.181  0.260   1.00 0.00  ? 141  LYS A HG3    2  
ATOM   6966   H  HD2    . LYS A 1 141 ? -17.888 -7.447  -0.613  1.00 0.00  ? 141  LYS A HD2    2  
ATOM   6967   H  HD3    . LYS A 1 141 ? -16.301 -6.883  -0.091  1.00 0.00  ? 141  LYS A HD3    2  
ATOM   6968   H  HE2    . LYS A 1 141 ? -17.797 -6.299  2.125   1.00 0.00  ? 141  LYS A HE2    2  
ATOM   6969   H  HE3    . LYS A 1 141 ? -18.600 -7.771  1.543   1.00 0.00  ? 141  LYS A HE3    2  
ATOM   6970   H  HZ1    . LYS A 1 141 ? -15.675 -7.423  1.945   1.00 0.00  ? 141  LYS A HZ1    2  
ATOM   6971   H  HZ2    . LYS A 1 141 ? -16.421 -8.818  1.326   1.00 0.00  ? 141  LYS A HZ2    2  
ATOM   6972   H  HZ3    . LYS A 1 141 ? -16.707 -8.340  2.931   1.00 0.00  ? 141  LYS A HZ3    2  
ATOM   6973   N  N      . LYS A 1 142 ? -15.195 -2.681  -1.206  1.00 31.61 ? 142  LYS A N      2  
ATOM   6974   C  CA     . LYS A 1 142 ? -13.734 -2.612  -0.892  1.00 33.67 ? 142  LYS A CA     2  
ATOM   6975   C  C      . LYS A 1 142 ? -13.291 -3.793  -0.020  1.00 36.23 ? 142  LYS A C      2  
ATOM   6976   O  O      . LYS A 1 142 ? -13.980 -4.194  0.898   1.00 43.09 ? 142  LYS A O      2  
ATOM   6977   C  CB     . LYS A 1 142 ? -13.563 -1.297  -0.125  1.00 34.08 ? 142  LYS A CB     2  
ATOM   6978   C  CG     . LYS A 1 142 ? -12.380 -0.513  -0.695  1.00 35.52 ? 142  LYS A CG     2  
ATOM   6979   C  CD     . LYS A 1 142 ? -12.830 0.264   -1.932  1.00 36.89 ? 142  LYS A CD     2  
ATOM   6980   C  CE     . LYS A 1 142 ? -13.227 1.685   -1.527  1.00 45.22 ? 142  LYS A CE     2  
ATOM   6981   N  NZ     . LYS A 1 142 ? -14.312 2.065   -2.475  1.00 48.99 ? 142  LYS A NZ     2  
ATOM   6982   H  H      . LYS A 1 142 ? -15.762 -1.896  -1.053  1.00 0.00  ? 142  LYS A H      2  
ATOM   6983   H  HA     . LYS A 1 142 ? -13.156 -2.581  -1.801  1.00 0.00  ? 142  LYS A HA     2  
ATOM   6984   H  HB2    . LYS A 1 142 ? -14.463 -0.706  -0.220  1.00 0.00  ? 142  LYS A HB2    2  
ATOM   6985   H  HB3    . LYS A 1 142 ? -13.382 -1.508  0.919   1.00 0.00  ? 142  LYS A HB3    2  
ATOM   6986   H  HG2    . LYS A 1 142 ? -12.015 0.179   0.051   1.00 0.00  ? 142  LYS A HG2    2  
ATOM   6987   H  HG3    . LYS A 1 142 ? -11.592 -1.198  -0.968  1.00 0.00  ? 142  LYS A HG3    2  
ATOM   6988   H  HD2    . LYS A 1 142 ? -12.018 0.305   -2.645  1.00 0.00  ? 142  LYS A HD2    2  
ATOM   6989   H  HD3    . LYS A 1 142 ? -13.678 -0.231  -2.380  1.00 0.00  ? 142  LYS A HD3    2  
ATOM   6990   H  HE2    . LYS A 1 142 ? -13.591 1.697   -0.509  1.00 0.00  ? 142  LYS A HE2    2  
ATOM   6991   H  HE3    . LYS A 1 142 ? -12.389 2.357   -1.638  1.00 0.00  ? 142  LYS A HE3    2  
ATOM   6992   H  HZ1    . LYS A 1 142 ? -15.162 1.500   -2.273  1.00 0.00  ? 142  LYS A HZ1    2  
ATOM   6993   H  HZ2    . LYS A 1 142 ? -13.998 1.885   -3.451  1.00 0.00  ? 142  LYS A HZ2    2  
ATOM   6994   H  HZ3    . LYS A 1 142 ? -14.534 3.074   -2.361  1.00 0.00  ? 142  LYS A HZ3    2  
ATOM   6995   N  N      . MET A 1 143 ? -12.137 -4.337  -0.297  1.00 36.23 ? 143  MET A N      2  
ATOM   6996   C  CA     . MET A 1 143 ? -11.623 -5.482  0.513   1.00 40.14 ? 143  MET A CA     2  
ATOM   6997   C  C      . MET A 1 143 ? -10.098 -5.549  0.385   1.00 40.65 ? 143  MET A C      2  
ATOM   6998   O  O      . MET A 1 143 ? -9.544  -5.210  -0.638  1.00 46.33 ? 143  MET A O      2  
ATOM   6999   C  CB     . MET A 1 143 ? -12.270 -6.725  -0.097  1.00 39.76 ? 143  MET A CB     2  
ATOM   7000   C  CG     . MET A 1 143 ? -13.458 -7.159  0.765   1.00 49.10 ? 143  MET A CG     2  
ATOM   7001   S  SD     . MET A 1 143 ? -13.889 -8.874  0.379   1.00 53.45 ? 143  MET A SD     2  
ATOM   7002   C  CE     . MET A 1 143 ? -13.444 -9.585  1.983   1.00 51.62 ? 143  MET A CE     2  
ATOM   7003   H  H      . MET A 1 143 ? -11.598 -3.985  -1.036  1.00 0.00  ? 143  MET A H      2  
ATOM   7004   H  HA     . MET A 1 143 ? -11.914 -5.377  1.546   1.00 0.00  ? 143  MET A HA     2  
ATOM   7005   H  HB2    . MET A 1 143 ? -12.614 -6.499  -1.096  1.00 0.00  ? 143  MET A HB2    2  
ATOM   7006   H  HB3    . MET A 1 143 ? -11.547 -7.526  -0.137  1.00 0.00  ? 143  MET A HB3    2  
ATOM   7007   H  HG2    . MET A 1 143 ? -13.193 -7.080  1.809   1.00 0.00  ? 143  MET A HG2    2  
ATOM   7008   H  HG3    . MET A 1 143 ? -14.305 -6.520  0.559   1.00 0.00  ? 143  MET A HG3    2  
ATOM   7009   H  HE1    . MET A 1 143 ? -13.184 -10.627 1.855   1.00 0.00  ? 143  MET A HE1    2  
ATOM   7010   H  HE2    . MET A 1 143 ? -14.282 -9.507  2.658   1.00 0.00  ? 143  MET A HE2    2  
ATOM   7011   H  HE3    . MET A 1 143 ? -12.603 -9.045  2.394   1.00 0.00  ? 143  MET A HE3    2  
ATOM   7012   N  N      . VAL A 1 144 ? -9.414  -5.976  1.413   1.00 36.98 ? 144  VAL A N      2  
ATOM   7013   C  CA     . VAL A 1 144 ? -7.923  -6.051  1.324   1.00 39.13 ? 144  VAL A CA     2  
ATOM   7014   C  C      . VAL A 1 144 ? -7.473  -7.487  1.054   1.00 44.66 ? 144  VAL A C      2  
ATOM   7015   O  O      . VAL A 1 144 ? -8.053  -8.436  1.548   1.00 41.82 ? 144  VAL A O      2  
ATOM   7016   C  CB     . VAL A 1 144 ? -7.385  -5.569  2.679   1.00 35.25 ? 144  VAL A CB     2  
ATOM   7017   C  CG1    . VAL A 1 144 ? -7.612  -4.062  2.822   1.00 43.19 ? 144  VAL A CG1    2  
ATOM   7018   C  CG2    . VAL A 1 144 ? -8.096  -6.307  3.819   1.00 34.54 ? 144  VAL A CG2    2  
ATOM   7019   H  H      . VAL A 1 144 ? -9.875  -6.243  2.234   1.00 0.00  ? 144  VAL A H      2  
ATOM   7020   H  HA     . VAL A 1 144 ? -7.566  -5.400  0.541   1.00 0.00  ? 144  VAL A HA     2  
ATOM   7021   H  HB     . VAL A 1 144 ? -6.324  -5.772  2.729   1.00 0.00  ? 144  VAL A HB     2  
ATOM   7022   H  HG11   . VAL A 1 144 ? -7.804  -3.633  1.851   1.00 0.00  ? 144  VAL A HG11   2  
ATOM   7023   H  HG12   . VAL A 1 144 ? -6.730  -3.603  3.249   1.00 0.00  ? 144  VAL A HG12   2  
ATOM   7024   H  HG13   . VAL A 1 144 ? -8.459  -3.884  3.469   1.00 0.00  ? 144  VAL A HG13   2  
ATOM   7025   H  HG21   . VAL A 1 144 ? -8.245  -7.340  3.543   1.00 0.00  ? 144  VAL A HG21   2  
ATOM   7026   H  HG22   . VAL A 1 144 ? -9.052  -5.841  4.007   1.00 0.00  ? 144  VAL A HG22   2  
ATOM   7027   H  HG23   . VAL A 1 144 ? -7.491  -6.257  4.712   1.00 0.00  ? 144  VAL A HG23   2  
ATOM   7028   N  N      . ASP A 1 145 ? -6.433  -7.650  0.284   1.00 44.34 ? 145  ASP A N      2  
ATOM   7029   C  CA     . ASP A 1 145 ? -5.924  -9.016  -0.014  1.00 46.92 ? 145  ASP A CA     2  
ATOM   7030   C  C      . ASP A 1 145 ? -4.673  -9.286  0.831   1.00 51.42 ? 145  ASP A C      2  
ATOM   7031   O  O      . ASP A 1 145 ? -3.755  -8.491  0.836   1.00 58.55 ? 145  ASP A O      2  
ATOM   7032   C  CB     . ASP A 1 145 ? -5.575  -8.995  -1.502  1.00 46.52 ? 145  ASP A CB     2  
ATOM   7033   C  CG     . ASP A 1 145 ? -5.598  -10.423 -2.053  1.00 55.13 ? 145  ASP A CG     2  
ATOM   7034   O  OD1    . ASP A 1 145 ? -6.440  -11.190 -1.617  1.00 61.11 ? 145  ASP A OD1    2  
ATOM   7035   O  OD2    . ASP A 1 145 ? -4.774  -10.724 -2.900  1.00 53.77 ? 145  ASP A OD2    2  
ATOM   7036   H  H      . ASP A 1 145 ? -5.978  -6.867  -0.092  1.00 0.00  ? 145  ASP A H      2  
ATOM   7037   H  HA     . ASP A 1 145 ? -6.686  -9.753  0.180   1.00 0.00  ? 145  ASP A HA     2  
ATOM   7038   H  HB2    . ASP A 1 145 ? -6.296  -8.391  -2.033  1.00 0.00  ? 145  ASP A HB2    2  
ATOM   7039   H  HB3    . ASP A 1 145 ? -4.587  -8.577  -1.634  1.00 0.00  ? 145  ASP A HB3    2  
ATOM   7040   N  N      . PRO A 1 146 ? -4.673  -10.396 1.526   1.00 47.05 ? 146  PRO A N      2  
ATOM   7041   C  CA     . PRO A 1 146 ? -3.510  -10.745 2.382   1.00 48.39 ? 146  PRO A CA     2  
ATOM   7042   C  C      . PRO A 1 146 ? -2.284  -11.037 1.513   1.00 54.08 ? 146  PRO A C      2  
ATOM   7043   O  O      . PRO A 1 146 ? -1.160  -10.992 1.974   1.00 51.88 ? 146  PRO A O      2  
ATOM   7044   C  CB     . PRO A 1 146 ? -3.975  -11.994 3.129   1.00 41.67 ? 146  PRO A CB     2  
ATOM   7045   C  CG     . PRO A 1 146 ? -5.038  -12.582 2.259   1.00 44.11 ? 146  PRO A CG     2  
ATOM   7046   C  CD     . PRO A 1 146 ? -5.721  -11.424 1.582   1.00 46.93 ? 146  PRO A CD     2  
ATOM   7047   H  HA     . PRO A 1 146 ? -3.302  -9.952  3.081   1.00 0.00  ? 146  PRO A HA     2  
ATOM   7048   H  HB2    . PRO A 1 146 ? -3.154  -12.688 3.249   1.00 0.00  ? 146  PRO A HB2    2  
ATOM   7049   H  HB3    . PRO A 1 146 ? -4.389  -11.727 4.089   1.00 0.00  ? 146  PRO A HB3    2  
ATOM   7050   H  HG2    . PRO A 1 146 ? -4.591  -13.237 1.522   1.00 0.00  ? 146  PRO A HG2    2  
ATOM   7051   H  HG3    . PRO A 1 146 ? -5.750  -13.127 2.858   1.00 0.00  ? 146  PRO A HG3    2  
ATOM   7052   H  HD2    . PRO A 1 146 ? -6.042  -11.701 0.587   1.00 0.00  ? 146  PRO A HD2    2  
ATOM   7053   H  HD3    . PRO A 1 146 ? -6.554  -11.075 2.171   1.00 0.00  ? 146  PRO A HD3    2  
ATOM   7054   N  N      . GLU A 1 147 ? -2.491  -11.324 0.254   1.00 55.07 ? 147  GLU A N      2  
ATOM   7055   C  CA     . GLU A 1 147 ? -1.340  -11.606 -0.652  1.00 56.92 ? 147  GLU A CA     2  
ATOM   7056   C  C      . GLU A 1 147 ? -0.758  -10.291 -1.180  1.00 58.35 ? 147  GLU A C      2  
ATOM   7057   O  O      . GLU A 1 147 ? 0.408   -10.204 -1.510  1.00 61.95 ? 147  GLU A O      2  
ATOM   7058   C  CB     . GLU A 1 147 ? -1.929  -12.432 -1.797  1.00 54.16 ? 147  GLU A CB     2  
ATOM   7059   C  CG     . GLU A 1 147 ? -0.839  -13.324 -2.396  1.00 61.94 ? 147  GLU A CG     2  
ATOM   7060   C  CD     . GLU A 1 147 ? -1.473  -14.319 -3.369  1.00 73.53 ? 147  GLU A CD     2  
ATOM   7061   O  OE1    . GLU A 1 147 ? -1.933  -15.353 -2.913  1.00 77.53 ? 147  GLU A OE1    2  
ATOM   7062   O  OE2    . GLU A 1 147 ? -1.488  -14.031 -4.555  1.00 69.13 ? 147  GLU A OE2    2  
ATOM   7063   H  H      . GLU A 1 147 ? -3.405  -11.348 -0.098  1.00 0.00  ? 147  GLU A H      2  
ATOM   7064   H  HA     . GLU A 1 147 ? -0.584  -12.177 -0.136  1.00 0.00  ? 147  GLU A HA     2  
ATOM   7065   H  HB2    . GLU A 1 147 ? -2.733  -13.047 -1.421  1.00 0.00  ? 147  GLU A HB2    2  
ATOM   7066   H  HB3    . GLU A 1 147 ? -2.308  -11.768 -2.560  1.00 0.00  ? 147  GLU A HB3    2  
ATOM   7067   H  HG2    . GLU A 1 147 ? -0.123  -12.710 -2.923  1.00 0.00  ? 147  GLU A HG2    2  
ATOM   7068   H  HG3    . GLU A 1 147 ? -0.341  -13.864 -1.606  1.00 0.00  ? 147  GLU A HG3    2  
ATOM   7069   N  N      . LYS A 1 148 ? -1.566  -9.265  -1.251  1.00 58.30 ? 148  LYS A N      2  
ATOM   7070   C  CA     . LYS A 1 148 ? -1.071  -7.944  -1.745  1.00 56.84 ? 148  LYS A CA     2  
ATOM   7071   C  C      . LYS A 1 148 ? -1.424  -6.857  -0.723  1.00 53.22 ? 148  LYS A C      2  
ATOM   7072   O  O      . LYS A 1 148 ? -2.285  -6.034  -0.965  1.00 51.19 ? 148  LYS A O      2  
ATOM   7073   C  CB     . LYS A 1 148 ? -1.809  -7.709  -3.064  1.00 54.81 ? 148  LYS A CB     2  
ATOM   7074   C  CG     . LYS A 1 148 ? -0.921  -8.144  -4.231  1.00 58.53 ? 148  LYS A CG     2  
ATOM   7075   C  CD     . LYS A 1 148 ? -1.570  -7.724  -5.552  1.00 65.18 ? 148  LYS A CD     2  
ATOM   7076   C  CE     . LYS A 1 148 ? -2.525  -8.822  -6.024  1.00 71.28 ? 148  LYS A CE     2  
ATOM   7077   N  NZ     . LYS A 1 148 ? -2.494  -8.746  -7.511  1.00 67.48 ? 148  LYS A NZ     2  
ATOM   7078   H  H      . LYS A 1 148 ? -2.500  -9.360  -0.973  1.00 0.00  ? 148  LYS A H      2  
ATOM   7079   H  HA     . LYS A 1 148 ? -0.005  -7.976  -1.913  1.00 0.00  ? 148  LYS A HA     2  
ATOM   7080   H  HB2    . LYS A 1 148 ? -2.723  -8.285  -3.071  1.00 0.00  ? 148  LYS A HB2    2  
ATOM   7081   H  HB3    . LYS A 1 148 ? -2.042  -6.660  -3.164  1.00 0.00  ? 148  LYS A HB3    2  
ATOM   7082   H  HG2    . LYS A 1 148 ? 0.048   -7.675  -4.140  1.00 0.00  ? 148  LYS A HG2    2  
ATOM   7083   H  HG3    . LYS A 1 148 ? -0.805  -9.218  -4.214  1.00 0.00  ? 148  LYS A HG3    2  
ATOM   7084   H  HD2    . LYS A 1 148 ? -2.120  -6.805  -5.405  1.00 0.00  ? 148  LYS A HD2    2  
ATOM   7085   H  HD3    . LYS A 1 148 ? -0.804  -7.571  -6.297  1.00 0.00  ? 148  LYS A HD3    2  
ATOM   7086   H  HE2    . LYS A 1 148 ? -2.179  -9.790  -5.687  1.00 0.00  ? 148  LYS A HE2    2  
ATOM   7087   H  HE3    . LYS A 1 148 ? -3.525  -8.632  -5.665  1.00 0.00  ? 148  LYS A HE3    2  
ATOM   7088   H  HZ1    . LYS A 1 148 ? -3.185  -9.413  -7.908  1.00 0.00  ? 148  LYS A HZ1    2  
ATOM   7089   H  HZ2    . LYS A 1 148 ? -1.540  -8.988  -7.850  1.00 0.00  ? 148  LYS A HZ2    2  
ATOM   7090   H  HZ3    . LYS A 1 148 ? -2.734  -7.780  -7.814  1.00 0.00  ? 148  LYS A HZ3    2  
ATOM   7091   N  N      . PRO A 1 149 ? -0.761  -6.911  0.401   1.00 58.89 ? 149  PRO A N      2  
ATOM   7092   C  CA     . PRO A 1 149 ? -1.024  -5.936  1.494   1.00 59.99 ? 149  PRO A CA     2  
ATOM   7093   C  C      . PRO A 1 149 ? -0.567  -4.516  1.122   1.00 56.51 ? 149  PRO A C      2  
ATOM   7094   O  O      . PRO A 1 149 ? -1.069  -3.544  1.652   1.00 54.80 ? 149  PRO A O      2  
ATOM   7095   C  CB     . PRO A 1 149 ? -0.213  -6.489  2.661   1.00 57.56 ? 149  PRO A CB     2  
ATOM   7096   C  CG     . PRO A 1 149 ? 0.869   -7.295  2.022   1.00 61.96 ? 149  PRO A CG     2  
ATOM   7097   C  CD     . PRO A 1 149 ? 0.287   -7.871  0.764   1.00 60.91 ? 149  PRO A CD     2  
ATOM   7098   H  HA     . PRO A 1 149 ? -2.070  -5.936  1.752   1.00 0.00  ? 149  PRO A HA     2  
ATOM   7099   H  HB2    . PRO A 1 149 ? 0.204   -5.684  3.242   1.00 0.00  ? 149  PRO A HB2    2  
ATOM   7100   H  HB3    . PRO A 1 149 ? -0.827  -7.123  3.280   1.00 0.00  ? 149  PRO A HB3    2  
ATOM   7101   H  HG2    . PRO A 1 149 ? 1.708   -6.659  1.782   1.00 0.00  ? 149  PRO A HG2    2  
ATOM   7102   H  HG3    . PRO A 1 149 ? 1.180   -8.092  2.679   1.00 0.00  ? 149  PRO A HG3    2  
ATOM   7103   H  HD2    . PRO A 1 149 ? 1.041   -7.930  -0.011  1.00 0.00  ? 149  PRO A HD2    2  
ATOM   7104   H  HD3    . PRO A 1 149 ? -0.145  -8.842  0.952   1.00 0.00  ? 149  PRO A HD3    2  
ATOM   7105   N  N      . GLN A 1 150 ? 0.371   -4.378  0.223   1.00 54.30 ? 150  GLN A N      2  
ATOM   7106   C  CA     . GLN A 1 150 ? 0.836   -3.010  -0.165  1.00 57.16 ? 150  GLN A CA     2  
ATOM   7107   C  C      . GLN A 1 150 ? -0.291  -2.240  -0.869  1.00 59.15 ? 150  GLN A C      2  
ATOM   7108   O  O      . GLN A 1 150 ? -0.296  -1.025  -0.901  1.00 53.18 ? 150  GLN A O      2  
ATOM   7109   C  CB     . GLN A 1 150 ? 2.005   -3.243  -1.124  1.00 53.00 ? 150  GLN A CB     2  
ATOM   7110   C  CG     . GLN A 1 150 ? 3.253   -3.623  -0.324  1.00 55.35 ? 150  GLN A CG     2  
ATOM   7111   C  CD     . GLN A 1 150 ? 4.379   -4.002  -1.286  1.00 65.02 ? 150  GLN A CD     2  
ATOM   7112   O  OE1    . GLN A 1 150 ? 4.149   -4.659  -2.282  1.00 64.40 ? 150  GLN A OE1    2  
ATOM   7113   N  NE2    . GLN A 1 150 ? 5.598   -3.614  -1.030  1.00 55.83 ? 150  GLN A NE2    2  
ATOM   7114   H  H      . GLN A 1 150 ? 0.767   -5.171  -0.199  1.00 0.00  ? 150  GLN A H      2  
ATOM   7115   H  HA     . GLN A 1 150 ? 1.175   -2.469  0.703   1.00 0.00  ? 150  GLN A HA     2  
ATOM   7116   H  HB2    . GLN A 1 150 ? 1.755   -4.043  -1.806  1.00 0.00  ? 150  GLN A HB2    2  
ATOM   7117   H  HB3    . GLN A 1 150 ? 2.198   -2.340  -1.682  1.00 0.00  ? 150  GLN A HB3    2  
ATOM   7118   H  HG2    . GLN A 1 150 ? 3.562   -2.783  0.280   1.00 0.00  ? 150  GLN A HG2    2  
ATOM   7119   H  HG3    . GLN A 1 150 ? 3.028   -4.464  0.315   1.00 0.00  ? 150  GLN A HG3    2  
ATOM   7120   H  HE21   . GLN A 1 150 ? 5.785   -3.084  -0.227  1.00 0.00  ? 150  GLN A HE21   2  
ATOM   7121   H  HE22   . GLN A 1 150 ? 6.328   -3.853  -1.640  1.00 0.00  ? 150  GLN A HE22   2  
ATOM   7122   N  N      . LEU A 1 151 ? -1.242  -2.938  -1.435  1.00 56.65 ? 151  LEU A N      2  
ATOM   7123   C  CA     . LEU A 1 151 ? -2.364  -2.246  -2.140  1.00 54.82 ? 151  LEU A CA     2  
ATOM   7124   C  C      . LEU A 1 151 ? -3.381  -1.713  -1.126  1.00 55.75 ? 151  LEU A C      2  
ATOM   7125   O  O      . LEU A 1 151 ? -3.812  -0.579  -1.204  1.00 54.90 ? 151  LEU A O      2  
ATOM   7126   C  CB     . LEU A 1 151 ? -3.001  -3.320  -3.023  1.00 49.16 ? 151  LEU A CB     2  
ATOM   7127   C  CG     . LEU A 1 151 ? -4.097  -2.689  -3.884  1.00 52.18 ? 151  LEU A CG     2  
ATOM   7128   C  CD1    . LEU A 1 151 ? -3.469  -1.702  -4.868  1.00 49.51 ? 151  LEU A CD1    2  
ATOM   7129   C  CD2    . LEU A 1 151 ? -4.829  -3.785  -4.660  1.00 49.31 ? 151  LEU A CD2    2  
ATOM   7130   H  H      . LEU A 1 151 ? -1.217  -3.917  -1.400  1.00 0.00  ? 151  LEU A H      2  
ATOM   7131   H  HA     . LEU A 1 151 ? -1.986  -1.443  -2.753  1.00 0.00  ? 151  LEU A HA     2  
ATOM   7132   H  HB2    . LEU A 1 151 ? -2.246  -3.754  -3.662  1.00 0.00  ? 151  LEU A HB2    2  
ATOM   7133   H  HB3    . LEU A 1 151 ? -3.432  -4.089  -2.401  1.00 0.00  ? 151  LEU A HB3    2  
ATOM   7134   H  HG     . LEU A 1 151 ? -4.796  -2.165  -3.248  1.00 0.00  ? 151  LEU A HG     2  
ATOM   7135   H  HD11   . LEU A 1 151 ? -3.084  -0.850  -4.329  1.00 0.00  ? 151  LEU A HD11   2  
ATOM   7136   H  HD12   . LEU A 1 151 ? -4.217  -1.372  -5.575  1.00 0.00  ? 151  LEU A HD12   2  
ATOM   7137   H  HD13   . LEU A 1 151 ? -2.662  -2.187  -5.399  1.00 0.00  ? 151  LEU A HD13   2  
ATOM   7138   H  HD21   . LEU A 1 151 ? -5.296  -4.467  -3.965  1.00 0.00  ? 151  LEU A HD21   2  
ATOM   7139   H  HD22   . LEU A 1 151 ? -4.124  -4.324  -5.274  1.00 0.00  ? 151  LEU A HD22   2  
ATOM   7140   H  HD23   . LEU A 1 151 ? -5.585  -3.337  -5.287  1.00 0.00  ? 151  LEU A HD23   2  
ATOM   7141   N  N      . GLY A 1 152 ? -3.761  -2.522  -0.174  1.00 50.85 ? 152  GLY A N      2  
ATOM   7142   C  CA     . GLY A 1 152 ? -4.743  -2.065  0.848   1.00 45.84 ? 152  GLY A CA     2  
ATOM   7143   C  C      . GLY A 1 152 ? -6.169  -2.304  0.345   1.00 42.33 ? 152  GLY A C      2  
ATOM   7144   O  O      . GLY A 1 152 ? -6.446  -3.264  -0.347  1.00 44.12 ? 152  GLY A O      2  
ATOM   7145   H  H      . GLY A 1 152 ? -3.395  -3.430  -0.130  1.00 0.00  ? 152  GLY A H      2  
ATOM   7146   H  HA2    . GLY A 1 152 ? -4.587  -2.615  1.764   1.00 0.00  ? 152  GLY A HA2    2  
ATOM   7147   H  HA3    . GLY A 1 152 ? -4.604  -1.011  1.033   1.00 0.00  ? 152  GLY A HA3    2  
ATOM   7148   N  N      . MET A 1 153 ? -7.071  -1.433  0.701   1.00 46.44 ? 153  MET A N      2  
ATOM   7149   C  CA     . MET A 1 153 ? -8.493  -1.583  0.268   1.00 42.93 ? 153  MET A CA     2  
ATOM   7150   C  C      . MET A 1 153 ? -8.607  -1.591  -1.263  1.00 43.25 ? 153  MET A C      2  
ATOM   7151   O  O      . MET A 1 153 ? -8.439  -0.576  -1.913  1.00 38.94 ? 153  MET A O      2  
ATOM   7152   C  CB     . MET A 1 153 ? -9.199  -0.353  0.850   1.00 38.58 ? 153  MET A CB     2  
ATOM   7153   C  CG     . MET A 1 153 ? -8.494  0.928   0.375   1.00 44.64 ? 153  MET A CG     2  
ATOM   7154   S  SD     . MET A 1 153 ? -7.723  1.771   1.784   1.00 45.93 ? 153  MET A SD     2  
ATOM   7155   C  CE     . MET A 1 153 ? -6.108  2.075   1.018   1.00 41.58 ? 153  MET A CE     2  
ATOM   7156   H  H      . MET A 1 153 ? -6.812  -0.675  1.264   1.00 0.00  ? 153  MET A H      2  
ATOM   7157   H  HA     . MET A 1 153 ? -8.921  -2.480  0.683   1.00 0.00  ? 153  MET A HA     2  
ATOM   7158   H  HB2    . MET A 1 153 ? -10.226 -0.341  0.519   1.00 0.00  ? 153  MET A HB2    2  
ATOM   7159   H  HB3    . MET A 1 153 ? -9.171  -0.400  1.928   1.00 0.00  ? 153  MET A HB3    2  
ATOM   7160   H  HG2    . MET A 1 153 ? -7.731  0.675   -0.346  1.00 0.00  ? 153  MET A HG2    2  
ATOM   7161   H  HG3    . MET A 1 153 ? -9.216  1.586   -0.085  1.00 0.00  ? 153  MET A HG3    2  
ATOM   7162   H  HE1    . MET A 1 153 ? -5.391  1.360   1.396   1.00 0.00  ? 153  MET A HE1    2  
ATOM   7163   H  HE2    . MET A 1 153 ? -5.774  3.073   1.255   1.00 0.00  ? 153  MET A HE2    2  
ATOM   7164   H  HE3    . MET A 1 153 ? -6.194  1.973   -0.055  1.00 0.00  ? 153  MET A HE3    2  
ATOM   7165   N  N      . ILE A 1 154 ? -8.905  -2.724  -1.846  1.00 38.82 ? 154  ILE A N      2  
ATOM   7166   C  CA     . ILE A 1 154 ? -9.043  -2.785  -3.333  1.00 38.02 ? 154  ILE A CA     2  
ATOM   7167   C  C      . ILE A 1 154 ? -10.520 -2.961  -3.705  1.00 37.98 ? 154  ILE A C      2  
ATOM   7168   O  O      . ILE A 1 154 ? -11.261 -3.640  -3.021  1.00 41.70 ? 154  ILE A O      2  
ATOM   7169   C  CB     . ILE A 1 154 ? -8.199  -3.992  -3.765  1.00 44.96 ? 154  ILE A CB     2  
ATOM   7170   C  CG1    . ILE A 1 154 ? -8.191  -4.094  -5.292  1.00 49.09 ? 154  ILE A CG1    2  
ATOM   7171   C  CG2    . ILE A 1 154 ? -8.771  -5.287  -3.175  1.00 44.19 ? 154  ILE A CG2    2  
ATOM   7172   C  CD1    . ILE A 1 154 ? -7.237  -5.213  -5.721  1.00 46.71 ? 154  ILE A CD1    2  
ATOM   7173   H  H      . ILE A 1 154 ? -9.046  -3.529  -1.307  1.00 0.00  ? 154  ILE A H      2  
ATOM   7174   H  HA     . ILE A 1 154 ? -8.651  -1.884  -3.779  1.00 0.00  ? 154  ILE A HA     2  
ATOM   7175   H  HB     . ILE A 1 154 ? -7.187  -3.860  -3.411  1.00 0.00  ? 154  ILE A HB     2  
ATOM   7176   H  HG12   . ILE A 1 154 ? -9.188  -4.313  -5.644  1.00 0.00  ? 154  ILE A HG12   2  
ATOM   7177   H  HG13   . ILE A 1 154 ? -7.856  -3.158  -5.713  1.00 0.00  ? 154  ILE A HG13   2  
ATOM   7178   H  HG21   . ILE A 1 154 ? -9.777  -5.116  -2.829  1.00 0.00  ? 154  ILE A HG21   2  
ATOM   7179   H  HG22   . ILE A 1 154 ? -8.157  -5.605  -2.346  1.00 0.00  ? 154  ILE A HG22   2  
ATOM   7180   H  HG23   . ILE A 1 154 ? -8.777  -6.056  -3.932  1.00 0.00  ? 154  ILE A HG23   2  
ATOM   7181   H  HD11   . ILE A 1 154 ? -6.520  -4.825  -6.429  1.00 0.00  ? 154  ILE A HD11   2  
ATOM   7182   H  HD12   . ILE A 1 154 ? -7.801  -6.010  -6.180  1.00 0.00  ? 154  ILE A HD12   2  
ATOM   7183   H  HD13   . ILE A 1 154 ? -6.715  -5.597  -4.856  1.00 0.00  ? 154  ILE A HD13   2  
ATOM   7184   N  N      . ASP A 1 155 ? -10.964 -2.339  -4.766  1.00 38.26 ? 155  ASP A N      2  
ATOM   7185   C  CA     . ASP A 1 155 ? -12.397 -2.470  -5.147  1.00 31.66 ? 155  ASP A CA     2  
ATOM   7186   C  C      . ASP A 1 155 ? -12.716 -3.819  -5.809  1.00 36.59 ? 155  ASP A C      2  
ATOM   7187   O  O      . ASP A 1 155 ? -12.088 -4.228  -6.766  1.00 36.40 ? 155  ASP A O      2  
ATOM   7188   C  CB     . ASP A 1 155 ? -12.635 -1.336  -6.152  1.00 33.84 ? 155  ASP A CB     2  
ATOM   7189   C  CG     . ASP A 1 155 ? -12.486 0.019   -5.456  1.00 37.07 ? 155  ASP A CG     2  
ATOM   7190   O  OD1    . ASP A 1 155 ? -13.293 0.312   -4.586  1.00 35.73 ? 155  ASP A OD1    2  
ATOM   7191   O  OD2    . ASP A 1 155 ? -11.573 0.745   -5.810  1.00 37.99 ? 155  ASP A OD2    2  
ATOM   7192   H  H      . ASP A 1 155 ? -10.363 -1.779  -5.303  1.00 0.00  ? 155  ASP A H      2  
ATOM   7193   H  HA     . ASP A 1 155 ? -13.029 -2.322  -4.285  1.00 0.00  ? 155  ASP A HA     2  
ATOM   7194   H  HB2    . ASP A 1 155 ? -11.910 -1.411  -6.950  1.00 0.00  ? 155  ASP A HB2    2  
ATOM   7195   H  HB3    . ASP A 1 155 ? -13.630 -1.421  -6.561  1.00 0.00  ? 155  ASP A HB3    2  
ATOM   7196   N  N      . ARG A 1 156 ? -13.761 -4.449  -5.350  1.00 36.82 ? 156  ARG A N      2  
ATOM   7197   C  CA     . ARG A 1 156 ? -14.248 -5.710  -5.974  1.00 36.08 ? 156  ARG A CA     2  
ATOM   7198   C  C      . ARG A 1 156 ? -15.480 -5.265  -6.757  1.00 37.49 ? 156  ARG A C      2  
ATOM   7199   O  O      . ARG A 1 156 ? -16.476 -4.902  -6.168  1.00 39.29 ? 156  ARG A O      2  
ATOM   7200   C  CB     . ARG A 1 156 ? -14.603 -6.635  -4.798  1.00 38.75 ? 156  ARG A CB     2  
ATOM   7201   C  CG     . ARG A 1 156 ? -14.814 -8.067  -5.308  1.00 46.12 ? 156  ARG A CG     2  
ATOM   7202   C  CD     . ARG A 1 156 ? -14.006 -9.050  -4.466  1.00 47.82 ? 156  ARG A CD     2  
ATOM   7203   N  NE     . ARG A 1 156 ? -14.179 -10.361 -5.154  1.00 59.93 ? 156  ARG A NE     2  
ATOM   7204   C  CZ     . ARG A 1 156 ? -13.336 -11.334 -4.936  1.00 63.34 ? 156  ARG A CZ     2  
ATOM   7205   N  NH1    . ARG A 1 156 ? -12.342 -11.170 -4.102  1.00 57.22 ? 156  ARG A NH1    2  
ATOM   7206   N  NH2    . ARG A 1 156 ? -13.487 -12.476 -5.552  1.00 62.27 ? 156  ARG A NH2    2  
ATOM   7207   H  H      . ARG A 1 156 ? -14.289 -4.041  -4.631  1.00 0.00  ? 156  ARG A H      2  
ATOM   7208   H  HA     . ARG A 1 156 ? -13.501 -6.147  -6.617  1.00 0.00  ? 156  ARG A HA     2  
ATOM   7209   H  HB2    . ARG A 1 156 ? -13.798 -6.623  -4.076  1.00 0.00  ? 156  ARG A HB2    2  
ATOM   7210   H  HB3    . ARG A 1 156 ? -15.510 -6.289  -4.327  1.00 0.00  ? 156  ARG A HB3    2  
ATOM   7211   H  HG2    . ARG A 1 156 ? -15.859 -8.322  -5.242  1.00 0.00  ? 156  ARG A HG2    2  
ATOM   7212   H  HG3    . ARG A 1 156 ? -14.491 -8.132  -6.335  1.00 0.00  ? 156  ARG A HG3    2  
ATOM   7213   H  HD2    . ARG A 1 156 ? -12.962 -8.764  -4.452  1.00 0.00  ? 156  ARG A HD2    2  
ATOM   7214   H  HD3    . ARG A 1 156 ? -14.398 -9.105  -3.463  1.00 0.00  ? 156  ARG A HD3    2  
ATOM   7215   H  HE     . ARG A 1 156 ? -14.926 -10.491 -5.777  1.00 0.00  ? 156  ARG A HE     2  
ATOM   7216   H  HH11   . ARG A 1 156 ? -12.225 -10.299 -3.627  1.00 0.00  ? 156  ARG A HH11   2  
ATOM   7217   H  HH12   . ARG A 1 156 ? -11.699 -11.917 -3.939  1.00 0.00  ? 156  ARG A HH12   2  
ATOM   7218   H  HH21   . ARG A 1 156 ? -14.247 -12.604 -6.190  1.00 0.00  ? 156  ARG A HH21   2  
ATOM   7219   H  HH22   . ARG A 1 156 ? -12.842 -13.221 -5.387  1.00 0.00  ? 156  ARG A HH22   2  
ATOM   7220   N  N      . TRP A 1 157 ? -15.389 -5.169  -8.059  1.00 38.11 ? 157  TRP A N      2  
ATOM   7221   C  CA     . TRP A 1 157 ? -16.535 -4.614  -8.844  1.00 37.45 ? 157  TRP A CA     2  
ATOM   7222   C  C      . TRP A 1 157 ? -17.640 -5.616  -9.164  1.00 40.27 ? 157  TRP A C      2  
ATOM   7223   O  O      . TRP A 1 157 ? -17.459 -6.821  -9.155  1.00 41.73 ? 157  TRP A O      2  
ATOM   7224   C  CB     . TRP A 1 157 ? -15.903 -4.073  -10.127 1.00 34.90 ? 157  TRP A CB     2  
ATOM   7225   C  CG     . TRP A 1 157 ? -14.845 -3.071  -9.767  1.00 36.27 ? 157  TRP A CG     2  
ATOM   7226   C  CD1    . TRP A 1 157 ? -13.511 -3.292  -9.829  1.00 31.97 ? 157  TRP A CD1    2  
ATOM   7227   C  CD2    . TRP A 1 157 ? -15.009 -1.708  -9.284  1.00 34.77 ? 157  TRP A CD2    2  
ATOM   7228   N  NE1    . TRP A 1 157 ? -12.847 -2.154  -9.416  1.00 30.69 ? 157  TRP A NE1    2  
ATOM   7229   C  CE2    . TRP A 1 157 ? -13.721 -1.152  -9.070  1.00 32.19 ? 157  TRP A CE2    2  
ATOM   7230   C  CE3    . TRP A 1 157 ? -16.138 -0.909  -9.015  1.00 34.83 ? 157  TRP A CE3    2  
ATOM   7231   C  CZ2    . TRP A 1 157 ? -13.548 0.147   -8.605  1.00 31.62 ? 157  TRP A CZ2    2  
ATOM   7232   C  CZ3    . TRP A 1 157 ? -15.973 0.408   -8.544  1.00 34.07 ? 157  TRP A CZ3    2  
ATOM   7233   C  CH2    . TRP A 1 157 ? -14.674 0.935   -8.338  1.00 33.14 ? 157  TRP A CH2    2  
ATOM   7234   H  H      . TRP A 1 157 ? -14.551 -5.415  -8.510  1.00 0.00  ? 157  TRP A H      2  
ATOM   7235   H  HA     . TRP A 1 157 ? -16.961 -3.786  -8.297  1.00 0.00  ? 157  TRP A HA     2  
ATOM   7236   H  HB2    . TRP A 1 157 ? -15.459 -4.883  -10.686 1.00 0.00  ? 157  TRP A HB2    2  
ATOM   7237   H  HB3    . TRP A 1 157 ? -16.663 -3.592  -10.725 1.00 0.00  ? 157  TRP A HB3    2  
ATOM   7238   H  HD1    . TRP A 1 157 ? -13.042 -4.207  -10.150 1.00 0.00  ? 157  TRP A HD1    2  
ATOM   7239   H  HE1    . TRP A 1 157 ? -11.871 -2.051  -9.368  1.00 0.00  ? 157  TRP A HE1    2  
ATOM   7240   H  HE3    . TRP A 1 157 ? -17.135 -1.312  -9.175  1.00 0.00  ? 157  TRP A HE3    2  
ATOM   7241   H  HZ2    . TRP A 1 157 ? -12.550 0.539   -8.453  1.00 0.00  ? 157  TRP A HZ2    2  
ATOM   7242   H  HZ3    . TRP A 1 157 ? -16.844 1.019   -8.339  1.00 0.00  ? 157  TRP A HZ3    2  
ATOM   7243   H  HH2    . TRP A 1 157 ? -14.548 1.948   -7.977  1.00 0.00  ? 157  TRP A HH2    2  
ATOM   7244   N  N      . TYR A 1 158 ? -18.795 -5.075  -9.451  1.00 40.16 ? 158  TYR A N      2  
ATOM   7245   C  CA     . TYR A 1 158 ? -19.979 -5.903  -9.782  1.00 38.93 ? 158  TYR A CA     2  
ATOM   7246   C  C      . TYR A 1 158 ? -20.979 -5.056  -10.574 1.00 40.47 ? 158  TYR A C      2  
ATOM   7247   O  O      . TYR A 1 158 ? -21.012 -3.846  -10.445 1.00 39.12 ? 158  TYR A O      2  
ATOM   7248   C  CB     . TYR A 1 158 ? -20.640 -6.225  -8.434  1.00 38.66 ? 158  TYR A CB     2  
ATOM   7249   C  CG     . TYR A 1 158 ? -19.807 -7.152  -7.607  1.00 40.25 ? 158  TYR A CG     2  
ATOM   7250   C  CD1    . TYR A 1 158 ? -19.985 -8.542  -7.727  1.00 37.43 ? 158  TYR A CD1    2  
ATOM   7251   C  CD2    . TYR A 1 158 ? -18.886 -6.626  -6.682  1.00 37.55 ? 158  TYR A CD2    2  
ATOM   7252   C  CE1    . TYR A 1 158 ? -19.233 -9.410  -6.921  1.00 38.45 ? 158  TYR A CE1    2  
ATOM   7253   C  CE2    . TYR A 1 158 ? -18.138 -7.493  -5.871  1.00 38.65 ? 158  TYR A CE2    2  
ATOM   7254   C  CZ     . TYR A 1 158 ? -18.312 -8.887  -5.993  1.00 42.94 ? 158  TYR A CZ     2  
ATOM   7255   O  OH     . TYR A 1 158 ? -17.580 -9.742  -5.200  1.00 43.40 ? 158  TYR A OH     2  
ATOM   7256   H  H      . TYR A 1 158 ? -18.887 -4.095  -9.438  1.00 0.00  ? 158  TYR A H      2  
ATOM   7257   H  HA     . TYR A 1 158 ? -19.709 -6.803  -10.305 1.00 0.00  ? 158  TYR A HA     2  
ATOM   7258   H  HB2    . TYR A 1 158 ? -20.783 -5.309  -7.878  1.00 0.00  ? 158  TYR A HB2    2  
ATOM   7259   H  HB3    . TYR A 1 158 ? -21.604 -6.680  -8.609  1.00 0.00  ? 158  TYR A HB3    2  
ATOM   7260   H  HD1    . TYR A 1 158 ? -20.693 -8.944  -8.444  1.00 0.00  ? 158  TYR A HD1    2  
ATOM   7261   H  HD2    . TYR A 1 158 ? -18.753 -5.553  -6.594  1.00 0.00  ? 158  TYR A HD2    2  
ATOM   7262   H  HE1    . TYR A 1 158 ? -19.367 -10.485 -7.006  1.00 0.00  ? 158  TYR A HE1    2  
ATOM   7263   H  HE2    . TYR A 1 158 ? -17.426 -7.089  -5.151  1.00 0.00  ? 158  TYR A HE2    2  
ATOM   7264   H  HH     . TYR A 1 158 ? -17.436 -10.548 -5.695  1.00 0.00  ? 158  TYR A HH     2  
ATOM   7265   N  N      . HIS A 1 159 ? -21.865 -5.687  -11.295 1.00 41.59 ? 159  HIS A N      2  
ATOM   7266   C  CA     . HIS A 1 159 ? -22.938 -4.917  -11.970 1.00 35.86 ? 159  HIS A CA     2  
ATOM   7267   C  C      . HIS A 1 159 ? -23.902 -4.552  -10.845 1.00 36.55 ? 159  HIS A C      2  
ATOM   7268   O  O      . HIS A 1 159 ? -23.990 -5.300  -9.890  1.00 38.38 ? 159  HIS A O      2  
ATOM   7269   C  CB     . HIS A 1 159 ? -23.614 -5.892  -12.938 1.00 39.03 ? 159  HIS A CB     2  
ATOM   7270   C  CG     . HIS A 1 159 ? -22.700 -6.235  -14.083 1.00 41.27 ? 159  HIS A CG     2  
ATOM   7271   N  ND1    . HIS A 1 159 ? -22.216 -7.521  -14.292 1.00 40.43 ? 159  HIS A ND1    2  
ATOM   7272   C  CD2    . HIS A 1 159 ? -22.215 -5.467  -15.118 1.00 32.47 ? 159  HIS A CD2    2  
ATOM   7273   C  CE1    . HIS A 1 159 ? -21.479 -7.496  -15.418 1.00 39.34 ? 159  HIS A CE1    2  
ATOM   7274   N  NE2    . HIS A 1 159 ? -21.445 -6.266  -15.966 1.00 37.14 ? 159  HIS A NE2    2  
ATOM   7275   H  H      . HIS A 1 159 ? -21.879 -6.658  -11.308 1.00 0.00  ? 159  HIS A H      2  
ATOM   7276   H  HA     . HIS A 1 159 ? -22.553 -4.042  -12.482 1.00 0.00  ? 159  HIS A HA     2  
ATOM   7277   H  HB2    . HIS A 1 159 ? -23.875 -6.791  -12.408 1.00 0.00  ? 159  HIS A HB2    2  
ATOM   7278   H  HB3    . HIS A 1 159 ? -24.510 -5.433  -13.329 1.00 0.00  ? 159  HIS A HB3    2  
ATOM   7279   H  HD2    . HIS A 1 159 ? -22.417 -4.404  -15.252 1.00 0.00  ? 159  HIS A HD2    2  
ATOM   7280   H  HE1    . HIS A 1 159 ? -20.988 -8.364  -15.827 1.00 0.00  ? 159  HIS A HE1    2  
ATOM   7281   H  HE2    . HIS A 1 159 ? -20.986 -5.987  -16.793 1.00 0.00  ? 159  HIS A HE2    2  
ATOM   7282   N  N      . PRO A 1 160 ? -24.595 -3.448  -10.938 1.00 37.28 ? 160  PRO A N      2  
ATOM   7283   C  CA     . PRO A 1 160 ? -25.523 -3.065  -9.838  1.00 34.29 ? 160  PRO A CA     2  
ATOM   7284   C  C      . PRO A 1 160 ? -26.510 -4.210  -9.534  1.00 36.50 ? 160  PRO A C      2  
ATOM   7285   O  O      . PRO A 1 160 ? -26.745 -4.543  -8.386  1.00 37.39 ? 160  PRO A O      2  
ATOM   7286   C  CB     . PRO A 1 160 ? -26.198 -1.800  -10.382 1.00 35.05 ? 160  PRO A CB     2  
ATOM   7287   C  CG     . PRO A 1 160 ? -26.015 -1.892  -11.862 1.00 33.55 ? 160  PRO A CG     2  
ATOM   7288   C  CD     . PRO A 1 160 ? -24.646 -2.497  -12.045 1.00 33.56 ? 160  PRO A CD     2  
ATOM   7289   H  HA     . PRO A 1 160 ? -24.959 -2.820  -8.951  1.00 0.00  ? 160  PRO A HA     2  
ATOM   7290   H  HB2    . PRO A 1 160 ? -27.249 -1.795  -10.127 1.00 0.00  ? 160  PRO A HB2    2  
ATOM   7291   H  HB3    . PRO A 1 160 ? -25.710 -0.915  -10.001 1.00 0.00  ? 160  PRO A HB3    2  
ATOM   7292   H  HG2    . PRO A 1 160 ? -26.774 -2.530  -12.294 1.00 0.00  ? 160  PRO A HG2    2  
ATOM   7293   H  HG3    . PRO A 1 160 ? -26.045 -0.911  -12.306 1.00 0.00  ? 160  PRO A HG3    2  
ATOM   7294   H  HD2    . PRO A 1 160 ? -24.576 -3.005  -12.998 1.00 0.00  ? 160  PRO A HD2    2  
ATOM   7295   H  HD3    . PRO A 1 160 ? -23.873 -1.753  -11.943 1.00 0.00  ? 160  PRO A HD3    2  
ATOM   7296   N  N      . GLY A 1 161 ? -27.056 -4.835  -10.546 1.00 36.49 ? 161  GLY A N      2  
ATOM   7297   C  CA     . GLY A 1 161 ? -27.995 -5.974  -10.304 1.00 35.51 ? 161  GLY A CA     2  
ATOM   7298   C  C      . GLY A 1 161 ? -27.241 -7.111  -9.597  1.00 37.90 ? 161  GLY A C      2  
ATOM   7299   O  O      . GLY A 1 161 ? -27.664 -7.602  -8.567  1.00 40.53 ? 161  GLY A O      2  
ATOM   7300   H  H      . GLY A 1 161 ? -26.850 -4.571  -11.467 1.00 0.00  ? 161  GLY A H      2  
ATOM   7301   H  HA2    . GLY A 1 161 ? -28.819 -5.643  -9.687  1.00 0.00  ? 161  GLY A HA2    2  
ATOM   7302   H  HA3    . GLY A 1 161 ? -28.376 -6.335  -11.249 1.00 0.00  ? 161  GLY A HA3    2  
ATOM   7303   N  N      . CYS A 1 162 ? -26.117 -7.523  -10.138 1.00 39.98 ? 162  CYS A N      2  
ATOM   7304   C  CA     . CYS A 1 162 ? -25.326 -8.618  -9.490  1.00 40.24 ? 162  CYS A CA     2  
ATOM   7305   C  C      . CYS A 1 162 ? -24.976 -8.239  -8.036  1.00 39.36 ? 162  CYS A C      2  
ATOM   7306   O  O      . CYS A 1 162 ? -25.036 -9.058  -7.137  1.00 39.63 ? 162  CYS A O      2  
ATOM   7307   C  CB     . CYS A 1 162 ? -24.044 -8.741  -10.322 1.00 40.16 ? 162  CYS A CB     2  
ATOM   7308   S  SG     . CYS A 1 162 ? -24.436 -9.294  -12.004 1.00 45.50 ? 162  CYS A SG     2  
ATOM   7309   H  H      . CYS A 1 162 ? -25.786 -7.106  -10.962 1.00 0.00  ? 162  CYS A H      2  
ATOM   7310   H  HA     . CYS A 1 162 ? -25.877 -9.546  -9.521  1.00 0.00  ? 162  CYS A HA     2  
ATOM   7311   H  HB2    . CYS A 1 162 ? -23.551 -7.781  -10.367 1.00 0.00  ? 162  CYS A HB2    2  
ATOM   7312   H  HB3    . CYS A 1 162 ? -23.384 -9.459  -9.855  1.00 0.00  ? 162  CYS A HB3    2  
ATOM   7313   N  N      . PHE A 1 163 ? -24.610 -6.994  -7.810  1.00 36.66 ? 163  PHE A N      2  
ATOM   7314   C  CA     . PHE A 1 163 ? -24.254 -6.542  -6.430  1.00 36.06 ? 163  PHE A CA     2  
ATOM   7315   C  C      . PHE A 1 163 ? -25.461 -6.698  -5.502  1.00 38.77 ? 163  PHE A C      2  
ATOM   7316   O  O      . PHE A 1 163 ? -25.344 -7.176  -4.391  1.00 38.96 ? 163  PHE A O      2  
ATOM   7317   C  CB     . PHE A 1 163 ? -23.866 -5.070  -6.583  1.00 35.09 ? 163  PHE A CB     2  
ATOM   7318   C  CG     . PHE A 1 163 ? -23.367 -4.546  -5.268  1.00 34.98 ? 163  PHE A CG     2  
ATOM   7319   C  CD1    . PHE A 1 163 ? -24.285 -4.127  -4.287  1.00 37.79 ? 163  PHE A CD1    2  
ATOM   7320   C  CD2    . PHE A 1 163 ? -21.983 -4.467  -5.027  1.00 35.00 ? 163  PHE A CD2    2  
ATOM   7321   C  CE1    . PHE A 1 163 ? -23.820 -3.625  -3.058  1.00 36.87 ? 163  PHE A CE1    2  
ATOM   7322   C  CE2    . PHE A 1 163 ? -21.511 -3.967  -3.799  1.00 33.70 ? 163  PHE A CE2    2  
ATOM   7323   C  CZ     . PHE A 1 163 ? -22.430 -3.544  -2.813  1.00 37.86 ? 163  PHE A CZ     2  
ATOM   7324   H  H      . PHE A 1 163 ? -24.581 -6.374  -8.570  1.00 0.00  ? 163  PHE A H      2  
ATOM   7325   H  HA     . PHE A 1 163 ? -23.417 -7.111  -6.056  1.00 0.00  ? 163  PHE A HA     2  
ATOM   7326   H  HB2    . PHE A 1 163 ? -23.087 -4.978  -7.326  1.00 0.00  ? 163  PHE A HB2    2  
ATOM   7327   H  HB3    . PHE A 1 163 ? -24.729 -4.498  -6.894  1.00 0.00  ? 163  PHE A HB3    2  
ATOM   7328   H  HD1    . PHE A 1 163 ? -25.352 -4.191  -4.479  1.00 0.00  ? 163  PHE A HD1    2  
ATOM   7329   H  HD2    . PHE A 1 163 ? -21.280 -4.792  -5.787  1.00 0.00  ? 163  PHE A HD2    2  
ATOM   7330   H  HE1    . PHE A 1 163 ? -24.530 -3.302  -2.299  1.00 0.00  ? 163  PHE A HE1    2  
ATOM   7331   H  HE2    . PHE A 1 163 ? -20.439 -3.906  -3.611  1.00 0.00  ? 163  PHE A HE2    2  
ATOM   7332   H  HZ     . PHE A 1 163 ? -22.070 -3.160  -1.866  1.00 0.00  ? 163  PHE A HZ     2  
ATOM   7333   N  N      . VAL A 1 164 ? -26.622 -6.286  -5.955  1.00 38.52 ? 164  VAL A N      2  
ATOM   7334   C  CA     . VAL A 1 164 ? -27.833 -6.385  -5.098  1.00 37.41 ? 164  VAL A CA     2  
ATOM   7335   C  C      . VAL A 1 164 ? -28.127 -7.852  -4.777  1.00 39.01 ? 164  VAL A C      2  
ATOM   7336   O  O      . VAL A 1 164 ? -28.516 -8.179  -3.675  1.00 35.35 ? 164  VAL A O      2  
ATOM   7337   C  CB     . VAL A 1 164 ? -28.955 -5.770  -5.929  1.00 33.41 ? 164  VAL A CB     2  
ATOM   7338   C  CG1    . VAL A 1 164 ? -30.274 -5.841  -5.153  1.00 29.14 ? 164  VAL A CG1    2  
ATOM   7339   C  CG2    . VAL A 1 164 ? -28.616 -4.310  -6.215  1.00 37.85 ? 164  VAL A CG2    2  
ATOM   7340   H  H      . VAL A 1 164 ? -26.642 -5.853  -6.834  1.00 0.00  ? 164  VAL A H      2  
ATOM   7341   H  HA     . VAL A 1 164 ? -27.705 -5.822  -4.184  1.00 0.00  ? 164  VAL A HA     2  
ATOM   7342   H  HB     . VAL A 1 164 ? -29.054 -6.310  -6.859  1.00 0.00  ? 164  VAL A HB     2  
ATOM   7343   H  HG11   . VAL A 1 164 ? -30.155 -5.358  -4.195  1.00 0.00  ? 164  VAL A HG11   2  
ATOM   7344   H  HG12   . VAL A 1 164 ? -30.551 -6.875  -5.005  1.00 0.00  ? 164  VAL A HG12   2  
ATOM   7345   H  HG13   . VAL A 1 164 ? -31.049 -5.338  -5.715  1.00 0.00  ? 164  VAL A HG13   2  
ATOM   7346   H  HG21   . VAL A 1 164 ? -27.544 -4.178  -6.179  1.00 0.00  ? 164  VAL A HG21   2  
ATOM   7347   H  HG22   . VAL A 1 164 ? -29.079 -3.682  -5.468  1.00 0.00  ? 164  VAL A HG22   2  
ATOM   7348   H  HG23   . VAL A 1 164 ? -28.981 -4.039  -7.193  1.00 0.00  ? 164  VAL A HG23   2  
ATOM   7349   N  N      . LYS A 1 165 ? -27.946 -8.741  -5.722  1.00 37.09 ? 165  LYS A N      2  
ATOM   7350   C  CA     . LYS A 1 165 ? -28.230 -10.189 -5.446  1.00 40.62 ? 165  LYS A CA     2  
ATOM   7351   C  C      . LYS A 1 165 ? -27.376 -10.710 -4.281  1.00 43.07 ? 165  LYS A C      2  
ATOM   7352   O  O      . LYS A 1 165 ? -27.808 -11.541 -3.501  1.00 42.59 ? 165  LYS A O      2  
ATOM   7353   C  CB     . LYS A 1 165 ? -27.864 -10.917 -6.736  1.00 42.78 ? 165  LYS A CB     2  
ATOM   7354   C  CG     . LYS A 1 165 ? -28.830 -12.082 -6.957  1.00 48.35 ? 165  LYS A CG     2  
ATOM   7355   C  CD     . LYS A 1 165 ? -28.830 -12.472 -8.438  1.00 58.08 ? 165  LYS A CD     2  
ATOM   7356   C  CE     . LYS A 1 165 ? -27.536 -13.221 -8.774  1.00 64.74 ? 165  LYS A CE     2  
ATOM   7357   N  NZ     . LYS A 1 165 ? -27.417 -13.139 -10.259 1.00 65.53 ? 165  LYS A NZ     2  
ATOM   7358   H  H      . LYS A 1 165 ? -27.630 -8.457  -6.608  1.00 0.00  ? 165  LYS A H      2  
ATOM   7359   H  HA     . LYS A 1 165 ? -29.279 -10.330 -5.231  1.00 0.00  ? 165  LYS A HA     2  
ATOM   7360   H  HB2    . LYS A 1 165 ? -27.933 -10.228 -7.564  1.00 0.00  ? 165  LYS A HB2    2  
ATOM   7361   H  HB3    . LYS A 1 165 ? -26.856 -11.295 -6.661  1.00 0.00  ? 165  LYS A HB3    2  
ATOM   7362   H  HG2    . LYS A 1 165 ? -28.519 -12.927 -6.359  1.00 0.00  ? 165  LYS A HG2    2  
ATOM   7363   H  HG3    . LYS A 1 165 ? -29.827 -11.784 -6.667  1.00 0.00  ? 165  LYS A HG3    2  
ATOM   7364   H  HD2    . LYS A 1 165 ? -29.678 -13.109 -8.640  1.00 0.00  ? 165  LYS A HD2    2  
ATOM   7365   H  HD3    . LYS A 1 165 ? -28.896 -11.582 -9.044  1.00 0.00  ? 165  LYS A HD3    2  
ATOM   7366   H  HE2    . LYS A 1 165 ? -26.691 -12.742 -8.301  1.00 0.00  ? 165  LYS A HE2    2  
ATOM   7367   H  HE3    . LYS A 1 165 ? -27.608 -14.253 -8.467  1.00 0.00  ? 165  LYS A HE3    2  
ATOM   7368   H  HZ1    . LYS A 1 165 ? -27.411 -12.141 -10.553 1.00 0.00  ? 165  LYS A HZ1    2  
ATOM   7369   H  HZ2    . LYS A 1 165 ? -28.224 -13.628 -10.700 1.00 0.00  ? 165  LYS A HZ2    2  
ATOM   7370   H  HZ3    . LYS A 1 165 ? -26.529 -13.591 -10.561 1.00 0.00  ? 165  LYS A HZ3    2  
ATOM   7371   N  N      . ASN A 1 166 ? -26.172 -10.230 -4.160  1.00 38.21 ? 166  ASN A N      2  
ATOM   7372   C  CA     . ASN A 1 166 ? -25.268 -10.682 -3.038  1.00 40.49 ? 166  ASN A CA     2  
ATOM   7373   C  C      . ASN A 1 166 ? -25.122 -9.602  -1.954  1.00 40.40 ? 166  ASN A C      2  
ATOM   7374   O  O      . ASN A 1 166 ? -24.111 -9.534  -1.277  1.00 38.20 ? 166  ASN A O      2  
ATOM   7375   C  CB     . ASN A 1 166 ? -23.919 -10.912 -3.709  1.00 42.92 ? 166  ASN A CB     2  
ATOM   7376   C  CG     . ASN A 1 166 ? -24.048 -12.048 -4.718  1.00 48.43 ? 166  ASN A CG     2  
ATOM   7377   O  OD1    . ASN A 1 166 ? -24.031 -13.204 -4.348  1.00 50.79 ? 166  ASN A OD1    2  
ATOM   7378   N  ND2    . ASN A 1 166 ? -24.190 -11.771 -5.988  1.00 42.15 ? 166  ASN A ND2    2  
ATOM   7379   H  H      . ASN A 1 166 ? -25.836 -9.548  -4.778  1.00 0.00  ? 166  ASN A H      2  
ATOM   7380   H  HA     . ASN A 1 166 ? -25.626 -11.602 -2.606  1.00 0.00  ? 166  ASN A HA     2  
ATOM   7381   H  HB2    . ASN A 1 166 ? -23.614 -10.007 -4.218  1.00 0.00  ? 166  ASN A HB2    2  
ATOM   7382   H  HB3    . ASN A 1 166 ? -23.181 -11.172 -2.965  1.00 0.00  ? 166  ASN A HB3    2  
ATOM   7383   H  HD21   . ASN A 1 166 ? -24.209 -10.838 -6.288  1.00 0.00  ? 166  ASN A HD21   2  
ATOM   7384   H  HD22   . ASN A 1 166 ? -24.275 -12.498 -6.639  1.00 0.00  ? 166  ASN A HD22   2  
ATOM   7385   N  N      . ARG A 1 167 ? -26.115 -8.752  -1.785  1.00 37.94 ? 167  ARG A N      2  
ATOM   7386   C  CA     . ARG A 1 167 ? -26.004 -7.669  -0.755  1.00 39.05 ? 167  ARG A CA     2  
ATOM   7387   C  C      . ARG A 1 167 ? -25.658 -8.229  0.630   1.00 39.34 ? 167  ARG A C      2  
ATOM   7388   O  O      . ARG A 1 167 ? -24.907 -7.634  1.382   1.00 38.35 ? 167  ARG A O      2  
ATOM   7389   C  CB     . ARG A 1 167 ? -27.375 -6.978  -0.712  1.00 39.99 ? 167  ARG A CB     2  
ATOM   7390   C  CG     . ARG A 1 167 ? -28.509 -8.010  -0.667  1.00 42.58 ? 167  ARG A CG     2  
ATOM   7391   C  CD     . ARG A 1 167 ? -29.457 -7.677  0.479   1.00 35.34 ? 167  ARG A CD     2  
ATOM   7392   N  NE     . ARG A 1 167 ? -28.617 -7.725  1.715   1.00 41.05 ? 167  ARG A NE     2  
ATOM   7393   C  CZ     . ARG A 1 167 ? -29.167 -7.918  2.886   1.00 51.93 ? 167  ARG A CZ     2  
ATOM   7394   N  NH1    . ARG A 1 167 ? -30.462 -8.057  2.999   1.00 43.20 ? 167  ARG A NH1    2  
ATOM   7395   N  NH2    . ARG A 1 167 ? -28.417 -7.966  3.955   1.00 41.96 ? 167  ARG A NH2    2  
ATOM   7396   H  H      . ARG A 1 167 ? -26.905 -8.821  -2.365  1.00 0.00  ? 167  ARG A H      2  
ATOM   7397   H  HA     . ARG A 1 167 ? -25.255 -6.952  -1.057  1.00 0.00  ? 167  ARG A HA     2  
ATOM   7398   H  HB2    . ARG A 1 167 ? -27.427 -6.358  0.170   1.00 0.00  ? 167  ARG A HB2    2  
ATOM   7399   H  HB3    . ARG A 1 167 ? -27.493 -6.359  -1.588  1.00 0.00  ? 167  ARG A HB3    2  
ATOM   7400   H  HG2    . ARG A 1 167 ? -29.058 -7.980  -1.597  1.00 0.00  ? 167  ARG A HG2    2  
ATOM   7401   H  HG3    . ARG A 1 167 ? -28.102 -9.000  -0.521  1.00 0.00  ? 167  ARG A HG3    2  
ATOM   7402   H  HD2    . ARG A 1 167 ? -29.875 -6.689  0.340   1.00 0.00  ? 167  ARG A HD2    2  
ATOM   7403   H  HD3    . ARG A 1 167 ? -30.244 -8.413  0.534   1.00 0.00  ? 167  ARG A HD3    2  
ATOM   7404   H  HE     . ARG A 1 167 ? -27.649 -7.611  1.652   1.00 0.00  ? 167  ARG A HE     2  
ATOM   7405   H  HH11   . ARG A 1 167 ? -31.045 -8.014  2.188   1.00 0.00  ? 167  ARG A HH11   2  
ATOM   7406   H  HH12   . ARG A 1 167 ? -30.868 -8.208  3.899   1.00 0.00  ? 167  ARG A HH12   2  
ATOM   7407   H  HH21   . ARG A 1 167 ? -27.426 -7.857  3.877   1.00 0.00  ? 167  ARG A HH21   2  
ATOM   7408   H  HH22   . ARG A 1 167 ? -28.833 -8.113  4.853   1.00 0.00  ? 167  ARG A HH22   2  
ATOM   7409   N  N      . GLU A 1 168 ? -26.207 -9.347  0.974   1.00 40.65 ? 168  GLU A N      2  
ATOM   7410   C  CA     . GLU A 1 168 ? -25.931 -9.941  2.327   1.00 42.51 ? 168  GLU A CA     2  
ATOM   7411   C  C      . GLU A 1 168 ? -24.468 -10.360 2.477   1.00 40.26 ? 168  GLU A C      2  
ATOM   7412   O  O      . GLU A 1 168 ? -23.781 -9.936  3.394   1.00 40.66 ? 168  GLU A O      2  
ATOM   7413   C  CB     . GLU A 1 168 ? -26.839 -11.168 2.413   1.00 45.78 ? 168  GLU A CB     2  
ATOM   7414   C  CG     . GLU A 1 168 ? -26.965 -11.618 3.870   1.00 50.57 ? 168  GLU A CG     2  
ATOM   7415   C  CD     . GLU A 1 168 ? -28.256 -12.420 4.038   1.00 52.78 ? 168  GLU A CD     2  
ATOM   7416   O  OE1    . GLU A 1 168 ? -28.509 -13.285 3.216   1.00 57.98 ? 168  GLU A OE1    2  
ATOM   7417   O  OE2    . GLU A 1 168 ? -28.978 -12.154 4.988   1.00 52.91 ? 168  GLU A OE2    2  
ATOM   7418   H  H      . GLU A 1 168 ? -26.804 -9.828  0.370   1.00 0.00  ? 168  GLU A H      2  
ATOM   7419   H  HA     . GLU A 1 168 ? -26.199 -9.241  3.098   1.00 0.00  ? 168  GLU A HA     2  
ATOM   7420   H  HB2    . GLU A 1 168 ? -27.815 -10.918 2.029   1.00 0.00  ? 168  GLU A HB2    2  
ATOM   7421   H  HB3    . GLU A 1 168 ? -26.415 -11.969 1.826   1.00 0.00  ? 168  GLU A HB3    2  
ATOM   7422   H  HG2    . GLU A 1 168 ? -26.117 -12.237 4.134   1.00 0.00  ? 168  GLU A HG2    2  
ATOM   7423   H  HG3    . GLU A 1 168 ? -26.994 -10.752 4.513   1.00 0.00  ? 168  GLU A HG3    2  
ATOM   7424   N  N      . GLU A 1 169 ? -23.998 -11.203 1.603   1.00 39.56 ? 169  GLU A N      2  
ATOM   7425   C  CA     . GLU A 1 169 ? -22.587 -11.680 1.706   1.00 36.41 ? 169  GLU A CA     2  
ATOM   7426   C  C      . GLU A 1 169 ? -21.602 -10.527 1.516   1.00 35.30 ? 169  GLU A C      2  
ATOM   7427   O  O      . GLU A 1 169 ? -20.503 -10.554 2.042   1.00 35.66 ? 169  GLU A O      2  
ATOM   7428   C  CB     . GLU A 1 169 ? -22.429 -12.704 0.594   1.00 39.10 ? 169  GLU A CB     2  
ATOM   7429   C  CG     . GLU A 1 169 ? -21.124 -13.479 0.798   1.00 41.60 ? 169  GLU A CG     2  
ATOM   7430   C  CD     . GLU A 1 169 ? -21.391 -14.727 1.643   1.00 42.42 ? 169  GLU A CD     2  
ATOM   7431   O  OE1    . GLU A 1 169 ? -21.298 -14.632 2.857   1.00 36.23 ? 169  GLU A OE1    2  
ATOM   7432   O  OE2    . GLU A 1 169 ? -21.680 -15.761 1.061   1.00 45.68 ? 169  GLU A OE2    2  
ATOM   7433   H  H      . GLU A 1 169 ? -24.580 -11.535 0.889   1.00 0.00  ? 169  GLU A H      2  
ATOM   7434   H  HA     . GLU A 1 169 ? -22.427 -12.151 2.662   1.00 0.00  ? 169  GLU A HA     2  
ATOM   7435   H  HB2    . GLU A 1 169 ? -23.267 -13.386 0.612   1.00 0.00  ? 169  GLU A HB2    2  
ATOM   7436   H  HB3    . GLU A 1 169 ? -22.396 -12.195 -0.357  1.00 0.00  ? 169  GLU A HB3    2  
ATOM   7437   H  HG2    . GLU A 1 169 ? -20.727 -13.773 -0.162  1.00 0.00  ? 169  GLU A HG2    2  
ATOM   7438   H  HG3    . GLU A 1 169 ? -20.408 -12.851 1.308   1.00 0.00  ? 169  GLU A HG3    2  
ATOM   7439   N  N      . LEU A 1 170 ? -21.982 -9.514  0.781   1.00 40.94 ? 170  LEU A N      2  
ATOM   7440   C  CA     . LEU A 1 170 ? -21.058 -8.358  0.568   1.00 32.36 ? 170  LEU A CA     2  
ATOM   7441   C  C      . LEU A 1 170 ? -21.082 -7.398  1.773   1.00 35.34 ? 170  LEU A C      2  
ATOM   7442   O  O      . LEU A 1 170 ? -20.371 -6.408  1.795   1.00 36.62 ? 170  LEU A O      2  
ATOM   7443   C  CB     . LEU A 1 170 ? -21.567 -7.678  -0.700  1.00 31.48 ? 170  LEU A CB     2  
ATOM   7444   C  CG     . LEU A 1 170 ? -21.160 -8.520  -1.911  1.00 36.31 ? 170  LEU A CG     2  
ATOM   7445   C  CD1    . LEU A 1 170 ? -21.853 -7.992  -3.167  1.00 32.37 ? 170  LEU A CD1    2  
ATOM   7446   C  CD2    . LEU A 1 170 ? -19.645 -8.437  -2.093  1.00 36.50 ? 170  LEU A CD2    2  
ATOM   7447   H  H      . LEU A 1 170 ? -22.873 -9.514  0.372   1.00 0.00  ? 170  LEU A H      2  
ATOM   7448   H  HA     . LEU A 1 170 ? -20.053 -8.718  0.406   1.00 0.00  ? 170  LEU A HA     2  
ATOM   7449   H  HB2    . LEU A 1 170 ? -22.643 -7.596  -0.659  1.00 0.00  ? 170  LEU A HB2    2  
ATOM   7450   H  HB3    . LEU A 1 170 ? -21.130 -6.695  -0.784  1.00 0.00  ? 170  LEU A HB3    2  
ATOM   7451   H  HG     . LEU A 1 170 ? -21.449 -9.550  -1.747  1.00 0.00  ? 170  LEU A HG     2  
ATOM   7452   H  HD11   . LEU A 1 170 ? -21.855 -6.912  -3.150  1.00 0.00  ? 170  LEU A HD11   2  
ATOM   7453   H  HD12   . LEU A 1 170 ? -22.871 -8.354  -3.198  1.00 0.00  ? 170  LEU A HD12   2  
ATOM   7454   H  HD13   . LEU A 1 170 ? -21.322 -8.337  -4.042  1.00 0.00  ? 170  LEU A HD13   2  
ATOM   7455   H  HD21   . LEU A 1 170 ? -19.380 -8.788  -3.080  1.00 0.00  ? 170  LEU A HD21   2  
ATOM   7456   H  HD22   . LEU A 1 170 ? -19.158 -9.051  -1.351  1.00 0.00  ? 170  LEU A HD22   2  
ATOM   7457   H  HD23   . LEU A 1 170 ? -19.326 -7.412  -1.977  1.00 0.00  ? 170  LEU A HD23   2  
ATOM   7458   N  N      . GLY A 1 171 ? -21.864 -7.696  2.786   1.00 35.81 ? 171  GLY A N      2  
ATOM   7459   C  CA     . GLY A 1 171 ? -21.891 -6.818  3.995   1.00 36.27 ? 171  GLY A CA     2  
ATOM   7460   C  C      . GLY A 1 171 ? -22.672 -5.524  3.732   1.00 40.04 ? 171  GLY A C      2  
ATOM   7461   O  O      . GLY A 1 171 ? -22.482 -4.540  4.422   1.00 41.86 ? 171  GLY A O      2  
ATOM   7462   H  H      . GLY A 1 171 ? -22.408 -8.508  2.763   1.00 0.00  ? 171  GLY A H      2  
ATOM   7463   H  HA2    . GLY A 1 171 ? -22.356 -7.351  4.811   1.00 0.00  ? 171  GLY A HA2    2  
ATOM   7464   H  HA3    . GLY A 1 171 ? -20.875 -6.566  4.269   1.00 0.00  ? 171  GLY A HA3    2  
ATOM   7465   N  N      . PHE A 1 172 ? -23.553 -5.514  2.763   1.00 40.28 ? 172  PHE A N      2  
ATOM   7466   C  CA     . PHE A 1 172 ? -24.346 -4.271  2.495   1.00 39.66 ? 172  PHE A CA     2  
ATOM   7467   C  C      . PHE A 1 172 ? -25.654 -4.345  3.283   1.00 43.81 ? 172  PHE A C      2  
ATOM   7468   O  O      . PHE A 1 172 ? -26.691 -4.695  2.757   1.00 45.55 ? 172  PHE A O      2  
ATOM   7469   C  CB     . PHE A 1 172 ? -24.613 -4.261  0.990   1.00 37.86 ? 172  PHE A CB     2  
ATOM   7470   C  CG     . PHE A 1 172 ? -24.968 -2.866  0.564   1.00 39.33 ? 172  PHE A CG     2  
ATOM   7471   C  CD1    . PHE A 1 172 ? -26.312 -2.448  0.582   1.00 44.07 ? 172  PHE A CD1    2  
ATOM   7472   C  CD2    . PHE A 1 172 ? -23.955 -1.989  0.139   1.00 40.82 ? 172  PHE A CD2    2  
ATOM   7473   C  CE1    . PHE A 1 172 ? -26.648 -1.146  0.171   1.00 43.51 ? 172  PHE A CE1    2  
ATOM   7474   C  CE2    . PHE A 1 172 ? -24.283 -0.684  -0.272  1.00 37.60 ? 172  PHE A CE2    2  
ATOM   7475   C  CZ     . PHE A 1 172 ? -25.632 -0.262  -0.257  1.00 43.33 ? 172  PHE A CZ     2  
ATOM   7476   H  H      . PHE A 1 172 ? -23.704 -6.322  2.228   1.00 0.00  ? 172  PHE A H      2  
ATOM   7477   H  HA     . PHE A 1 172 ? -23.783 -3.398  2.782   1.00 0.00  ? 172  PHE A HA     2  
ATOM   7478   H  HB2    . PHE A 1 172 ? -23.727 -4.583  0.462   1.00 0.00  ? 172  PHE A HB2    2  
ATOM   7479   H  HB3    . PHE A 1 172 ? -25.433 -4.926  0.761   1.00 0.00  ? 172  PHE A HB3    2  
ATOM   7480   H  HD1    . PHE A 1 172 ? -27.089 -3.132  0.914   1.00 0.00  ? 172  PHE A HD1    2  
ATOM   7481   H  HD2    . PHE A 1 172 ? -22.922 -2.317  0.132   1.00 0.00  ? 172  PHE A HD2    2  
ATOM   7482   H  HE1    . PHE A 1 172 ? -27.686 -0.822  0.185   1.00 0.00  ? 172  PHE A HE1    2  
ATOM   7483   H  HE2    . PHE A 1 172 ? -23.499 -0.004  -0.600  1.00 0.00  ? 172  PHE A HE2    2  
ATOM   7484   H  HZ     . PHE A 1 172 ? -25.887 0.743   -0.573  1.00 0.00  ? 172  PHE A HZ     2  
ATOM   7485   N  N      . ARG A 1 173 ? -25.590 -4.042  4.556   1.00 46.94 ? 173  ARG A N      2  
ATOM   7486   C  CA     . ARG A 1 173 ? -26.805 -4.118  5.443   1.00 50.53 ? 173  ARG A CA     2  
ATOM   7487   C  C      . ARG A 1 173 ? -28.043 -3.464  4.795   1.00 50.08 ? 173  ARG A C      2  
ATOM   7488   O  O      . ARG A 1 173 ? -27.914 -2.658  3.895   1.00 48.26 ? 173  ARG A O      2  
ATOM   7489   C  CB     . ARG A 1 173 ? -26.408 -3.376  6.713   1.00 54.02 ? 173  ARG A CB     2  
ATOM   7490   C  CG     . ARG A 1 173 ? -25.331 -4.172  7.456   1.00 52.18 ? 173  ARG A CG     2  
ATOM   7491   C  CD     . ARG A 1 173 ? -25.983 -5.306  8.257   1.00 55.52 ? 173  ARG A CD     2  
ATOM   7492   N  NE     . ARG A 1 173 ? -26.854 -4.618  9.255   1.00 67.99 ? 173  ARG A NE     2  
ATOM   7493   C  CZ     . ARG A 1 173 ? -26.325 -4.066  10.320  1.00 68.62 ? 173  ARG A CZ     2  
ATOM   7494   N  NH1    . ARG A 1 173 ? -25.029 -4.115  10.513  1.00 68.72 ? 173  ARG A NH1    2  
ATOM   7495   N  NH2    . ARG A 1 173 ? -27.089 -3.467  11.193  1.00 69.41 ? 173  ARG A NH2    2  
ATOM   7496   H  H      . ARG A 1 173 ? -24.724 -3.785  4.942   1.00 0.00  ? 173  ARG A H      2  
ATOM   7497   H  HA     . ARG A 1 173 ? -27.016 -5.149  5.680   1.00 0.00  ? 173  ARG A HA     2  
ATOM   7498   H  HB2    . ARG A 1 173 ? -26.024 -2.400  6.455   1.00 0.00  ? 173  ARG A HB2    2  
ATOM   7499   H  HB3    . ARG A 1 173 ? -27.274 -3.265  7.348   1.00 0.00  ? 173  ARG A HB3    2  
ATOM   7500   H  HG2    . ARG A 1 173 ? -24.637 -4.590  6.743   1.00 0.00  ? 173  ARG A HG2    2  
ATOM   7501   H  HG3    . ARG A 1 173 ? -24.803 -3.514  8.131   1.00 0.00  ? 173  ARG A HG3    2  
ATOM   7502   H  HD2    . ARG A 1 173 ? -26.570 -5.939  7.610   1.00 0.00  ? 173  ARG A HD2    2  
ATOM   7503   H  HD3    . ARG A 1 173 ? -25.227 -5.883  8.767   1.00 0.00  ? 173  ARG A HD3    2  
ATOM   7504   H  HE     . ARG A 1 173 ? -27.825 -4.582  9.117   1.00 0.00  ? 173  ARG A HE     2  
ATOM   7505   H  HH11   . ARG A 1 173 ? -24.438 -4.575  9.848   1.00 0.00  ? 173  ARG A HH11   2  
ATOM   7506   H  HH12   . ARG A 1 173 ? -24.628 -3.694  11.326  1.00 0.00  ? 173  ARG A HH12   2  
ATOM   7507   H  HH21   . ARG A 1 173 ? -28.079 -3.430  11.051  1.00 0.00  ? 173  ARG A HH21   2  
ATOM   7508   H  HH22   . ARG A 1 173 ? -26.685 -3.043  12.004  1.00 0.00  ? 173  ARG A HH22   2  
ATOM   7509   N  N      . PRO A 1 174 ? -29.214 -3.861  5.268   1.00 53.54 ? 174  PRO A N      2  
ATOM   7510   C  CA     . PRO A 1 174 ? -30.485 -3.329  4.711   1.00 51.08 ? 174  PRO A CA     2  
ATOM   7511   C  C      . PRO A 1 174 ? -30.741 -1.876  5.139   1.00 50.21 ? 174  PRO A C      2  
ATOM   7512   O  O      . PRO A 1 174 ? -31.571 -1.198  4.559   1.00 56.63 ? 174  PRO A O      2  
ATOM   7513   C  CB     . PRO A 1 174 ? -31.544 -4.262  5.279   1.00 52.06 ? 174  PRO A CB     2  
ATOM   7514   C  CG     . PRO A 1 174 ? -30.943 -4.828  6.526   1.00 48.54 ? 174  PRO A CG     2  
ATOM   7515   C  CD     . PRO A 1 174 ? -29.449 -4.826  6.347   1.00 50.81 ? 174  PRO A CD     2  
ATOM   7516   H  HA     . PRO A 1 174 ? -30.479 -3.404  3.636   1.00 0.00  ? 174  PRO A HA     2  
ATOM   7517   H  HB2    . PRO A 1 174 ? -32.443 -3.709  5.509   1.00 0.00  ? 174  PRO A HB2    2  
ATOM   7518   H  HB3    . PRO A 1 174 ? -31.758 -5.056  4.580   1.00 0.00  ? 174  PRO A HB3    2  
ATOM   7519   H  HG2    . PRO A 1 174 ? -31.214 -4.215  7.374   1.00 0.00  ? 174  PRO A HG2    2  
ATOM   7520   H  HG3    . PRO A 1 174 ? -31.286 -5.838  6.674   1.00 0.00  ? 174  PRO A HG3    2  
ATOM   7521   H  HD2    . PRO A 1 174 ? -28.959 -4.504  7.255   1.00 0.00  ? 174  PRO A HD2    2  
ATOM   7522   H  HD3    . PRO A 1 174 ? -29.099 -5.802  6.050   1.00 0.00  ? 174  PRO A HD3    2  
ATOM   7523   N  N      . GLU A 1 175 ? -30.037 -1.384  6.130   1.00 48.34 ? 175  GLU A N      2  
ATOM   7524   C  CA     . GLU A 1 175 ? -30.248 0.033   6.560   1.00 48.29 ? 175  GLU A CA     2  
ATOM   7525   C  C      . GLU A 1 175 ? -29.491 0.989   5.619   1.00 50.93 ? 175  GLU A C      2  
ATOM   7526   O  O      . GLU A 1 175 ? -29.747 2.179   5.588   1.00 52.91 ? 175  GLU A O      2  
ATOM   7527   C  CB     . GLU A 1 175 ? -29.670 0.112   7.971   1.00 44.65 ? 175  GLU A CB     2  
ATOM   7528   C  CG     . GLU A 1 175 ? -30.585 -0.629  8.950   1.00 51.95 ? 175  GLU A CG     2  
ATOM   7529   C  CD     . GLU A 1 175 ? -30.084 -2.062  9.131   1.00 58.34 ? 175  GLU A CD     2  
ATOM   7530   O  OE1    . GLU A 1 175 ? -28.879 -2.240  9.223   1.00 53.48 ? 175  GLU A OE1    2  
ATOM   7531   O  OE2    . GLU A 1 175 ? -30.909 -2.957  9.176   1.00 58.67 ? 175  GLU A OE2    2  
ATOM   7532   H  H      . GLU A 1 175 ? -29.364 -1.940  6.582   1.00 0.00  ? 175  GLU A H      2  
ATOM   7533   H  HA     . GLU A 1 175 ? -31.299 0.272   6.575   1.00 0.00  ? 175  GLU A HA     2  
ATOM   7534   H  HB2    . GLU A 1 175 ? -28.691 -0.343  7.980   1.00 0.00  ? 175  GLU A HB2    2  
ATOM   7535   H  HB3    . GLU A 1 175 ? -29.589 1.146   8.268   1.00 0.00  ? 175  GLU A HB3    2  
ATOM   7536   H  HG2    . GLU A 1 175 ? -30.575 -0.121  9.903   1.00 0.00  ? 175  GLU A HG2    2  
ATOM   7537   H  HG3    . GLU A 1 175 ? -31.592 -0.648  8.563   1.00 0.00  ? 175  GLU A HG3    2  
ATOM   7538   N  N      . TYR A 1 176 ? -28.561 0.469   4.854   1.00 46.61 ? 176  TYR A N      2  
ATOM   7539   C  CA     . TYR A 1 176 ? -27.786 1.329   3.919   1.00 46.24 ? 176  TYR A CA     2  
ATOM   7540   C  C      . TYR A 1 176 ? -28.609 1.647   2.667   1.00 46.12 ? 176  TYR A C      2  
ATOM   7541   O  O      . TYR A 1 176 ? -29.373 0.834   2.184   1.00 46.97 ? 176  TYR A O      2  
ATOM   7542   C  CB     . TYR A 1 176 ? -26.553 0.500   3.550   1.00 48.41 ? 176  TYR A CB     2  
ATOM   7543   C  CG     . TYR A 1 176 ? -25.527 0.598   4.639   1.00 47.61 ? 176  TYR A CG     2  
ATOM   7544   C  CD1    . TYR A 1 176 ? -25.141 1.861   5.129   1.00 48.89 ? 176  TYR A CD1    2  
ATOM   7545   C  CD2    . TYR A 1 176 ? -24.941 -0.575  5.151   1.00 48.49 ? 176  TYR A CD2    2  
ATOM   7546   C  CE1    . TYR A 1 176 ? -24.166 1.951   6.132   1.00 49.64 ? 176  TYR A CE1    2  
ATOM   7547   C  CE2    . TYR A 1 176 ? -23.966 -0.485  6.157   1.00 46.81 ? 176  TYR A CE2    2  
ATOM   7548   C  CZ     . TYR A 1 176 ? -23.579 0.777   6.645   1.00 49.77 ? 176  TYR A CZ     2  
ATOM   7549   O  OH     . TYR A 1 176 ? -22.626 0.864   7.631   1.00 55.28 ? 176  TYR A OH     2  
ATOM   7550   H  H      . TYR A 1 176 ? -28.371 -0.490  4.899   1.00 0.00  ? 176  TYR A H      2  
ATOM   7551   H  HA     . TYR A 1 176 ? -27.486 2.241   4.410   1.00 0.00  ? 176  TYR A HA     2  
ATOM   7552   H  HB2    . TYR A 1 176 ? -26.835 -0.533  3.424   1.00 0.00  ? 176  TYR A HB2    2  
ATOM   7553   H  HB3    . TYR A 1 176 ? -26.129 0.873   2.630   1.00 0.00  ? 176  TYR A HB3    2  
ATOM   7554   H  HD1    . TYR A 1 176 ? -25.597 2.763   4.734   1.00 0.00  ? 176  TYR A HD1    2  
ATOM   7555   H  HD2    . TYR A 1 176 ? -25.243 -1.547  4.776   1.00 0.00  ? 176  TYR A HD2    2  
ATOM   7556   H  HE1    . TYR A 1 176 ? -23.864 2.926   6.511   1.00 0.00  ? 176  TYR A HE1    2  
ATOM   7557   H  HE2    . TYR A 1 176 ? -23.506 -1.388  6.555   1.00 0.00  ? 176  TYR A HE2    2  
ATOM   7558   H  HH     . TYR A 1 176 ? -22.952 0.384   8.392   1.00 0.00  ? 176  TYR A HH     2  
ATOM   7559   N  N      . SER A 1 177 ? -28.435 2.829   2.143   1.00 42.97 ? 177  SER A N      2  
ATOM   7560   C  CA     . SER A 1 177 ? -29.174 3.238   0.917   1.00 45.09 ? 177  SER A CA     2  
ATOM   7561   C  C      . SER A 1 177 ? -28.167 3.587   -0.181  1.00 46.15 ? 177  SER A C      2  
ATOM   7562   O  O      . SER A 1 177 ? -26.990 3.760   0.080   1.00 50.58 ? 177  SER A O      2  
ATOM   7563   C  CB     . SER A 1 177 ? -29.977 4.472   1.325   1.00 50.61 ? 177  SER A CB     2  
ATOM   7564   O  OG     . SER A 1 177 ? -29.092 5.572   1.499   1.00 52.63 ? 177  SER A OG     2  
ATOM   7565   H  H      . SER A 1 177 ? -27.801 3.452   2.556   1.00 0.00  ? 177  SER A H      2  
ATOM   7566   H  HA     . SER A 1 177 ? -29.837 2.452   0.590   1.00 0.00  ? 177  SER A HA     2  
ATOM   7567   H  HB2    . SER A 1 177 ? -30.692 4.711   0.555   1.00 0.00  ? 177  SER A HB2    2  
ATOM   7568   H  HB3    . SER A 1 177 ? -30.502 4.269   2.249   1.00 0.00  ? 177  SER A HB3    2  
ATOM   7569   H  HG     . SER A 1 177 ? -28.639 5.460   2.338   1.00 0.00  ? 177  SER A HG     2  
ATOM   7570   N  N      . ALA A 1 178 ? -28.615 3.676   -1.402  1.00 43.60 ? 178  ALA A N      2  
ATOM   7571   C  CA     . ALA A 1 178 ? -27.679 3.996   -2.531  1.00 41.74 ? 178  ALA A CA     2  
ATOM   7572   C  C      . ALA A 1 178 ? -26.933 5.317   -2.289  1.00 44.01 ? 178  ALA A C      2  
ATOM   7573   O  O      . ALA A 1 178 ? -25.805 5.490   -2.715  1.00 44.88 ? 178  ALA A O      2  
ATOM   7574   C  CB     . ALA A 1 178 ? -28.580 4.121   -3.756  1.00 46.11 ? 178  ALA A CB     2  
ATOM   7575   H  H      . ALA A 1 178 ? -29.569 3.519   -1.581  1.00 0.00  ? 178  ALA A H      2  
ATOM   7576   H  HA     . ALA A 1 178 ? -26.978 3.191   -2.675  1.00 0.00  ? 178  ALA A HA     2  
ATOM   7577   H  HB1    . ALA A 1 178 ? -29.236 4.971   -3.633  1.00 0.00  ? 178  ALA A HB1    2  
ATOM   7578   H  HB2    . ALA A 1 178 ? -29.168 3.224   -3.863  1.00 0.00  ? 178  ALA A HB2    2  
ATOM   7579   H  HB3    . ALA A 1 178 ? -27.971 4.262   -4.636  1.00 0.00  ? 178  ALA A HB3    2  
ATOM   7580   N  N      . SER A 1 179 ? -27.561 6.251   -1.631  1.00 45.30 ? 179  SER A N      2  
ATOM   7581   C  CA     . SER A 1 179 ? -26.911 7.581   -1.378  1.00 46.30 ? 179  SER A CA     2  
ATOM   7582   C  C      . SER A 1 179 ? -25.643 7.462   -0.512  1.00 47.45 ? 179  SER A C      2  
ATOM   7583   O  O      . SER A 1 179 ? -24.866 8.397   -0.418  1.00 49.37 ? 179  SER A O      2  
ATOM   7584   C  CB     . SER A 1 179 ? -27.973 8.398   -0.644  1.00 46.00 ? 179  SER A CB     2  
ATOM   7585   O  OG     . SER A 1 179 ? -28.111 7.903   0.682   1.00 44.77 ? 179  SER A OG     2  
ATOM   7586   H  H      . SER A 1 179 ? -28.476 6.088   -1.318  1.00 0.00  ? 179  SER A H      2  
ATOM   7587   H  HA     . SER A 1 179 ? -26.675 8.060   -2.314  1.00 0.00  ? 179  SER A HA     2  
ATOM   7588   H  HB2    . SER A 1 179 ? -27.674 9.433   -0.607  1.00 0.00  ? 179  SER A HB2    2  
ATOM   7589   H  HB3    . SER A 1 179 ? -28.916 8.318   -1.170  1.00 0.00  ? 179  SER A HB3    2  
ATOM   7590   H  HG     . SER A 1 179 ? -28.408 6.991   0.628   1.00 0.00  ? 179  SER A HG     2  
ATOM   7591   N  N      . GLN A 1 180 ? -25.433 6.341   0.131   1.00 46.18 ? 180  GLN A N      2  
ATOM   7592   C  CA     . GLN A 1 180 ? -24.222 6.195   1.005   1.00 48.26 ? 180  GLN A CA     2  
ATOM   7593   C  C      . GLN A 1 180 ? -23.010 5.635   0.239   1.00 46.01 ? 180  GLN A C      2  
ATOM   7594   O  O      . GLN A 1 180 ? -21.920 5.562   0.776   1.00 48.40 ? 180  GLN A O      2  
ATOM   7595   C  CB     . GLN A 1 180 ? -24.652 5.217   2.099   1.00 48.28 ? 180  GLN A CB     2  
ATOM   7596   C  CG     . GLN A 1 180 ? -25.171 5.998   3.307   1.00 51.25 ? 180  GLN A CG     2  
ATOM   7597   C  CD     . GLN A 1 180 ? -26.141 5.122   4.103   1.00 53.56 ? 180  GLN A CD     2  
ATOM   7598   O  OE1    . GLN A 1 180 ? -27.060 4.555   3.548   1.00 48.11 ? 180  GLN A OE1    2  
ATOM   7599   N  NE2    . GLN A 1 180 ? -25.975 4.988   5.391   1.00 61.14 ? 180  GLN A NE2    2  
ATOM   7600   H  H      . GLN A 1 180 ? -26.076 5.605   0.057   1.00 0.00  ? 180  GLN A H      2  
ATOM   7601   H  HA     . GLN A 1 180 ? -23.971 7.144   1.451   1.00 0.00  ? 180  GLN A HA     2  
ATOM   7602   H  HB2    . GLN A 1 180 ? -25.434 4.574   1.720   1.00 0.00  ? 180  GLN A HB2    2  
ATOM   7603   H  HB3    . GLN A 1 180 ? -23.805 4.618   2.397   1.00 0.00  ? 180  GLN A HB3    2  
ATOM   7604   H  HG2    . GLN A 1 180 ? -24.339 6.279   3.937   1.00 0.00  ? 180  GLN A HG2    2  
ATOM   7605   H  HG3    . GLN A 1 180 ? -25.685 6.887   2.971   1.00 0.00  ? 180  GLN A HG3    2  
ATOM   7606   H  HE21   . GLN A 1 180 ? -25.234 5.446   5.841   1.00 0.00  ? 180  GLN A HE21   2  
ATOM   7607   H  HE22   . GLN A 1 180 ? -26.592 4.429   5.908   1.00 0.00  ? 180  GLN A HE22   2  
ATOM   7608   N  N      . LEU A 1 181 ? -23.181 5.233   -0.995  1.00 43.34 ? 181  LEU A N      2  
ATOM   7609   C  CA     . LEU A 1 181 ? -22.029 4.672   -1.769  1.00 40.87 ? 181  LEU A CA     2  
ATOM   7610   C  C      . LEU A 1 181 ? -20.995 5.760   -2.079  1.00 41.65 ? 181  LEU A C      2  
ATOM   7611   O  O      . LEU A 1 181 ? -21.335 6.850   -2.505  1.00 43.49 ? 181  LEU A O      2  
ATOM   7612   C  CB     . LEU A 1 181 ? -22.645 4.147   -3.066  1.00 40.18 ? 181  LEU A CB     2  
ATOM   7613   C  CG     . LEU A 1 181 ? -23.432 2.867   -2.777  1.00 41.15 ? 181  LEU A CG     2  
ATOM   7614   C  CD1    . LEU A 1 181 ? -24.518 2.678   -3.837  1.00 39.95 ? 181  LEU A CD1    2  
ATOM   7615   C  CD2    . LEU A 1 181 ? -22.485 1.666   -2.809  1.00 37.39 ? 181  LEU A CD2    2  
ATOM   7616   H  H      . LEU A 1 181 ? -24.068 5.293   -1.410  1.00 0.00  ? 181  LEU A H      2  
ATOM   7617   H  HA     . LEU A 1 181 ? -21.569 3.859   -1.227  1.00 0.00  ? 181  LEU A HA     2  
ATOM   7618   H  HB2    . LEU A 1 181 ? -23.309 4.896   -3.473  1.00 0.00  ? 181  LEU A HB2    2  
ATOM   7619   H  HB3    . LEU A 1 181 ? -21.861 3.935   -3.778  1.00 0.00  ? 181  LEU A HB3    2  
ATOM   7620   H  HG     . LEU A 1 181 ? -23.890 2.939   -1.802  1.00 0.00  ? 181  LEU A HG     2  
ATOM   7621   H  HD11   . LEU A 1 181 ? -25.103 3.581   -3.918  1.00 0.00  ? 181  LEU A HD11   2  
ATOM   7622   H  HD12   . LEU A 1 181 ? -25.159 1.857   -3.552  1.00 0.00  ? 181  LEU A HD12   2  
ATOM   7623   H  HD13   . LEU A 1 181 ? -24.058 2.461   -4.790  1.00 0.00  ? 181  LEU A HD13   2  
ATOM   7624   H  HD21   . LEU A 1 181 ? -22.185 1.471   -3.828  1.00 0.00  ? 181  LEU A HD21   2  
ATOM   7625   H  HD22   . LEU A 1 181 ? -22.990 0.798   -2.410  1.00 0.00  ? 181  LEU A HD22   2  
ATOM   7626   H  HD23   . LEU A 1 181 ? -21.611 1.880   -2.212  1.00 0.00  ? 181  LEU A HD23   2  
ATOM   7627   N  N      . LYS A 1 182 ? -19.735 5.460   -1.883  1.00 42.66 ? 182  LYS A N      2  
ATOM   7628   C  CA     . LYS A 1 182 ? -18.670 6.466   -2.186  1.00 45.85 ? 182  LYS A CA     2  
ATOM   7629   C  C      . LYS A 1 182 ? -18.665 6.771   -3.691  1.00 44.68 ? 182  LYS A C      2  
ATOM   7630   O  O      . LYS A 1 182 ? -18.454 5.891   -4.506  1.00 43.04 ? 182  LYS A O      2  
ATOM   7631   C  CB     . LYS A 1 182 ? -17.364 5.786   -1.772  1.00 42.83 ? 182  LYS A CB     2  
ATOM   7632   C  CG     . LYS A 1 182 ? -16.189 6.731   -2.022  1.00 44.71 ? 182  LYS A CG     2  
ATOM   7633   C  CD     . LYS A 1 182 ? -14.948 6.201   -1.299  1.00 58.68 ? 182  LYS A CD     2  
ATOM   7634   C  CE     . LYS A 1 182 ? -13.734 7.063   -1.658  1.00 65.16 ? 182  LYS A CE     2  
ATOM   7635   N  NZ     . LYS A 1 182 ? -13.101 6.373   -2.816  1.00 60.88 ? 182  LYS A NZ     2  
ATOM   7636   H  H      . LYS A 1 182 ? -19.493 4.569   -1.552  1.00 0.00  ? 182  LYS A H      2  
ATOM   7637   H  HA     . LYS A 1 182 ? -18.820 7.367   -1.612  1.00 0.00  ? 182  LYS A HA     2  
ATOM   7638   H  HB2    . LYS A 1 182 ? -17.407 5.532   -0.722  1.00 0.00  ? 182  LYS A HB2    2  
ATOM   7639   H  HB3    . LYS A 1 182 ? -17.230 4.887   -2.353  1.00 0.00  ? 182  LYS A HB3    2  
ATOM   7640   H  HG2    . LYS A 1 182 ? -15.992 6.787   -3.083  1.00 0.00  ? 182  LYS A HG2    2  
ATOM   7641   H  HG3    . LYS A 1 182 ? -16.430 7.715   -1.647  1.00 0.00  ? 182  LYS A HG3    2  
ATOM   7642   H  HD2    . LYS A 1 182 ? -15.113 6.237   -0.231  1.00 0.00  ? 182  LYS A HD2    2  
ATOM   7643   H  HD3    . LYS A 1 182 ? -14.764 5.181   -1.600  1.00 0.00  ? 182  LYS A HD3    2  
ATOM   7644   H  HE2    . LYS A 1 182 ? -14.049 8.060   -1.935  1.00 0.00  ? 182  LYS A HE2    2  
ATOM   7645   H  HE3    . LYS A 1 182 ? -13.043 7.102   -0.829  1.00 0.00  ? 182  LYS A HE3    2  
ATOM   7646   H  HZ1    . LYS A 1 182 ? -13.741 6.410   -3.634  1.00 0.00  ? 182  LYS A HZ1    2  
ATOM   7647   H  HZ2    . LYS A 1 182 ? -12.913 5.381   -2.566  1.00 0.00  ? 182  LYS A HZ2    2  
ATOM   7648   H  HZ3    . LYS A 1 182 ? -12.207 6.846   -3.056  1.00 0.00  ? 182  LYS A HZ3    2  
ATOM   7649   N  N      . GLY A 1 183 ? -18.905 8.005   -4.068  1.00 41.16 ? 183  GLY A N      2  
ATOM   7650   C  CA     . GLY A 1 183 ? -18.917 8.367   -5.523  1.00 48.70 ? 183  GLY A CA     2  
ATOM   7651   C  C      . GLY A 1 183 ? -20.358 8.590   -6.020  1.00 51.68 ? 183  GLY A C      2  
ATOM   7652   O  O      . GLY A 1 183 ? -20.578 9.042   -7.129  1.00 51.64 ? 183  GLY A O      2  
ATOM   7653   H  H      . GLY A 1 183 ? -19.077 8.696   -3.394  1.00 0.00  ? 183  GLY A H      2  
ATOM   7654   H  HA2    . GLY A 1 183 ? -18.349 9.272   -5.669  1.00 0.00  ? 183  GLY A HA2    2  
ATOM   7655   H  HA3    . GLY A 1 183 ? -18.465 7.567   -6.092  1.00 0.00  ? 183  GLY A HA3    2  
ATOM   7656   N  N      . PHE A 1 184 ? -21.340 8.265   -5.213  1.00 47.93 ? 184  PHE A N      2  
ATOM   7657   C  CA     . PHE A 1 184 ? -22.770 8.437   -5.641  1.00 49.95 ? 184  PHE A CA     2  
ATOM   7658   C  C      . PHE A 1 184 ? -23.040 9.842   -6.190  1.00 53.69 ? 184  PHE A C      2  
ATOM   7659   O  O      . PHE A 1 184 ? -23.590 10.009  -7.260  1.00 52.36 ? 184  PHE A O      2  
ATOM   7660   C  CB     . PHE A 1 184 ? -23.580 8.218   -4.367  1.00 49.22 ? 184  PHE A CB     2  
ATOM   7661   C  CG     . PHE A 1 184 ? -25.040 8.140   -4.704  1.00 49.36 ? 184  PHE A CG     2  
ATOM   7662   C  CD1    . PHE A 1 184 ? -25.559 6.965   -5.272  1.00 49.16 ? 184  PHE A CD1    2  
ATOM   7663   C  CD2    . PHE A 1 184 ? -25.881 9.235   -4.431  1.00 49.53 ? 184  PHE A CD2    2  
ATOM   7664   C  CE1    . PHE A 1 184 ? -26.931 6.879   -5.572  1.00 44.63 ? 184  PHE A CE1    2  
ATOM   7665   C  CE2    . PHE A 1 184 ? -27.255 9.155   -4.725  1.00 50.18 ? 184  PHE A CE2    2  
ATOM   7666   C  CZ     . PHE A 1 184 ? -27.781 7.975   -5.297  1.00 47.46 ? 184  PHE A CZ     2  
ATOM   7667   H  H      . PHE A 1 184 ? -21.140 7.895   -4.329  1.00 0.00  ? 184  PHE A H      2  
ATOM   7668   H  HA     . PHE A 1 184 ? -23.029 7.692   -6.372  1.00 0.00  ? 184  PHE A HA     2  
ATOM   7669   H  HB2    . PHE A 1 184 ? -23.272 7.296   -3.897  1.00 0.00  ? 184  PHE A HB2    2  
ATOM   7670   H  HB3    . PHE A 1 184 ? -23.414 9.042   -3.687  1.00 0.00  ? 184  PHE A HB3    2  
ATOM   7671   H  HD1    . PHE A 1 184 ? -24.904 6.128   -5.484  1.00 0.00  ? 184  PHE A HD1    2  
ATOM   7672   H  HD2    . PHE A 1 184 ? -25.470 10.142  -3.996  1.00 0.00  ? 184  PHE A HD2    2  
ATOM   7673   H  HE1    . PHE A 1 184 ? -27.336 5.969   -6.013  1.00 0.00  ? 184  PHE A HE1    2  
ATOM   7674   H  HE2    . PHE A 1 184 ? -27.906 10.001  -4.514  1.00 0.00  ? 184  PHE A HE2    2  
ATOM   7675   H  HZ     . PHE A 1 184 ? -28.839 7.910   -5.524  1.00 0.00  ? 184  PHE A HZ     2  
ATOM   7676   N  N      . SER A 1 185 ? -22.686 10.840  -5.439  1.00 53.34 ? 185  SER A N      2  
ATOM   7677   C  CA     . SER A 1 185 ? -22.942 12.258  -5.857  1.00 55.93 ? 185  SER A CA     2  
ATOM   7678   C  C      . SER A 1 185 ? -22.457 12.580  -7.286  1.00 55.28 ? 185  SER A C      2  
ATOM   7679   O  O      . SER A 1 185 ? -22.952 13.508  -7.902  1.00 58.63 ? 185  SER A O      2  
ATOM   7680   C  CB     . SER A 1 185 ? -22.165 13.103  -4.849  1.00 53.89 ? 185  SER A CB     2  
ATOM   7681   O  OG     . SER A 1 185 ? -20.769 12.889  -5.038  1.00 53.62 ? 185  SER A OG     2  
ATOM   7682   H  H      . SER A 1 185 ? -22.273 10.656  -4.568  1.00 0.00  ? 185  SER A H      2  
ATOM   7683   H  HA     . SER A 1 185 ? -23.991 12.480  -5.767  1.00 0.00  ? 185  SER A HA     2  
ATOM   7684   H  HB2    . SER A 1 185 ? -22.386 14.145  -5.004  1.00 0.00  ? 185  SER A HB2    2  
ATOM   7685   H  HB3    . SER A 1 185 ? -22.450 12.820  -3.844  1.00 0.00  ? 185  SER A HB3    2  
ATOM   7686   H  HG     . SER A 1 185 ? -20.609 11.943  -5.040  1.00 0.00  ? 185  SER A HG     2  
ATOM   7687   N  N      . LEU A 1 186 ? -21.486 11.865  -7.811  1.00 50.26 ? 186  LEU A N      2  
ATOM   7688   C  CA     . LEU A 1 186 ? -20.969 12.191  -9.188  1.00 49.68 ? 186  LEU A CA     2  
ATOM   7689   C  C      . LEU A 1 186 ? -21.767 11.493  -10.308 1.00 49.71 ? 186  LEU A C      2  
ATOM   7690   O  O      . LEU A 1 186 ? -21.398 11.563  -11.469 1.00 51.56 ? 186  LEU A O      2  
ATOM   7691   C  CB     . LEU A 1 186 ? -19.527 11.689  -9.189  1.00 51.10 ? 186  LEU A CB     2  
ATOM   7692   C  CG     . LEU A 1 186 ? -18.706 12.463  -8.156  1.00 52.54 ? 186  LEU A CG     2  
ATOM   7693   C  CD1    . LEU A 1 186 ? -17.352 11.777  -7.966  1.00 43.83 ? 186  LEU A CD1    2  
ATOM   7694   C  CD2    . LEU A 1 186 ? -18.482 13.891  -8.657  1.00 39.08 ? 186  LEU A CD2    2  
ATOM   7695   H  H      . LEU A 1 186 ? -21.080 11.137  -7.294  1.00 0.00  ? 186  LEU A H      2  
ATOM   7696   H  HA     . LEU A 1 186 ? -20.978 13.259  -9.343  1.00 0.00  ? 186  LEU A HA     2  
ATOM   7697   H  HB2    . LEU A 1 186 ? -19.513 10.637  -8.946  1.00 0.00  ? 186  LEU A HB2    2  
ATOM   7698   H  HB3    . LEU A 1 186 ? -19.098 11.837  -10.169 1.00 0.00  ? 186  LEU A HB3    2  
ATOM   7699   H  HG     . LEU A 1 186 ? -19.235 12.486  -7.214  1.00 0.00  ? 186  LEU A HG     2  
ATOM   7700   H  HD11   . LEU A 1 186 ? -17.014 11.379  -8.912  1.00 0.00  ? 186  LEU A HD11   2  
ATOM   7701   H  HD12   . LEU A 1 186 ? -17.451 10.972  -7.253  1.00 0.00  ? 186  LEU A HD12   2  
ATOM   7702   H  HD13   . LEU A 1 186 ? -16.631 12.495  -7.602  1.00 0.00  ? 186  LEU A HD13   2  
ATOM   7703   H  HD21   . LEU A 1 186 ? -17.663 14.339  -8.112  1.00 0.00  ? 186  LEU A HD21   2  
ATOM   7704   H  HD22   . LEU A 1 186 ? -19.378 14.471  -8.501  1.00 0.00  ? 186  LEU A HD22   2  
ATOM   7705   H  HD23   . LEU A 1 186 ? -18.243 13.869  -9.710  1.00 0.00  ? 186  LEU A HD23   2  
ATOM   7706   N  N      . LEU A 1 187 ? -22.840 10.824  -9.978  1.00 49.68 ? 187  LEU A N      2  
ATOM   7707   C  CA     . LEU A 1 187 ? -23.633 10.122  -11.025 1.00 50.19 ? 187  LEU A CA     2  
ATOM   7708   C  C      . LEU A 1 187 ? -24.768 11.013  -11.534 1.00 52.94 ? 187  LEU A C      2  
ATOM   7709   O  O      . LEU A 1 187 ? -25.331 11.806  -10.799 1.00 54.11 ? 187  LEU A O      2  
ATOM   7710   C  CB     . LEU A 1 187 ? -24.201 8.890   -10.320 1.00 53.46 ? 187  LEU A CB     2  
ATOM   7711   C  CG     . LEU A 1 187 ? -23.053 7.986   -9.863  1.00 44.36 ? 187  LEU A CG     2  
ATOM   7712   C  CD1    . LEU A 1 187 ? -23.591 6.900   -8.928  1.00 39.36 ? 187  LEU A CD1    2  
ATOM   7713   C  CD2    . LEU A 1 187 ? -22.412 7.325   -11.084 1.00 38.22 ? 187  LEU A CD2    2  
ATOM   7714   H  H      . LEU A 1 187 ? -23.112 10.771  -9.040  1.00 0.00  ? 187  LEU A H      2  
ATOM   7715   H  HA     . LEU A 1 187 ? -22.998 9.817   -11.845 1.00 0.00  ? 187  LEU A HA     2  
ATOM   7716   H  HB2    . LEU A 1 187 ? -24.776 9.204   -9.461  1.00 0.00  ? 187  LEU A HB2    2  
ATOM   7717   H  HB3    . LEU A 1 187 ? -24.837 8.344   -11.001 1.00 0.00  ? 187  LEU A HB3    2  
ATOM   7718   H  HG     . LEU A 1 187 ? -22.314 8.578   -9.342  1.00 0.00  ? 187  LEU A HG     2  
ATOM   7719   H  HD11   . LEU A 1 187 ? -24.259 6.252   -9.475  1.00 0.00  ? 187  LEU A HD11   2  
ATOM   7720   H  HD12   . LEU A 1 187 ? -24.126 7.361   -8.111  1.00 0.00  ? 187  LEU A HD12   2  
ATOM   7721   H  HD13   . LEU A 1 187 ? -22.766 6.322   -8.538  1.00 0.00  ? 187  LEU A HD13   2  
ATOM   7722   H  HD21   . LEU A 1 187 ? -23.167 7.157   -11.837 1.00 0.00  ? 187  LEU A HD21   2  
ATOM   7723   H  HD22   . LEU A 1 187 ? -21.976 6.381   -10.794 1.00 0.00  ? 187  LEU A HD22   2  
ATOM   7724   H  HD23   . LEU A 1 187 ? -21.645 7.971   -11.480 1.00 0.00  ? 187  LEU A HD23   2  
ATOM   7725   N  N      . ALA A 1 188 ? -25.118 10.867  -12.789 1.00 51.35 ? 188  ALA A N      2  
ATOM   7726   C  CA     . ALA A 1 188 ? -26.232 11.679  -13.357 1.00 50.16 ? 188  ALA A CA     2  
ATOM   7727   C  C      . ALA A 1 188 ? -27.519 11.368  -12.589 1.00 51.12 ? 188  ALA A C      2  
ATOM   7728   O  O      . ALA A 1 188 ? -27.687 10.276  -12.080 1.00 54.95 ? 188  ALA A O      2  
ATOM   7729   C  CB     . ALA A 1 188 ? -26.351 11.226  -14.812 1.00 48.65 ? 188  ALA A CB     2  
ATOM   7730   H  H      . ALA A 1 188 ? -24.649 10.204  -13.338 1.00 0.00  ? 188  ALA A H      2  
ATOM   7731   H  HA     . ALA A 1 188 ? -26.002 12.733  -13.309 1.00 0.00  ? 188  ALA A HA     2  
ATOM   7732   H  HB1    . ALA A 1 188 ? -26.852 11.989  -15.389 1.00 0.00  ? 188  ALA A HB1    2  
ATOM   7733   H  HB2    . ALA A 1 188 ? -26.922 10.310  -14.856 1.00 0.00  ? 188  ALA A HB2    2  
ATOM   7734   H  HB3    . ALA A 1 188 ? -25.365 11.054  -15.217 1.00 0.00  ? 188  ALA A HB3    2  
ATOM   7735   N  N      . THR A 1 189 ? -28.421 12.319  -12.489 1.00 53.35 ? 189  THR A N      2  
ATOM   7736   C  CA     . THR A 1 189 ? -29.704 12.085  -11.733 1.00 58.31 ? 189  THR A CA     2  
ATOM   7737   C  C      . THR A 1 189 ? -30.357 10.748  -12.116 1.00 53.52 ? 189  THR A C      2  
ATOM   7738   O  O      . THR A 1 189 ? -30.761 9.981   -11.260 1.00 54.49 ? 189  THR A O      2  
ATOM   7739   C  CB     . THR A 1 189 ? -30.608 13.249  -12.128 1.00 61.24 ? 189  THR A CB     2  
ATOM   7740   O  OG1    . THR A 1 189 ? -29.924 14.470  -11.895 1.00 63.22 ? 189  THR A OG1    2  
ATOM   7741   C  CG2    . THR A 1 189 ? -31.892 13.209  -11.298 1.00 53.24 ? 189  THR A CG2    2  
ATOM   7742   H  H      . THR A 1 189 ? -28.251 13.191  -12.904 1.00 0.00  ? 189  THR A H      2  
ATOM   7743   H  HA     . THR A 1 189 ? -29.523 12.114  -10.672 1.00 0.00  ? 189  THR A HA     2  
ATOM   7744   H  HB     . THR A 1 189 ? -30.858 13.168  -13.175 1.00 0.00  ? 189  THR A HB     2  
ATOM   7745   H  HG1    . THR A 1 189 ? -29.603 14.461  -10.989 1.00 0.00  ? 189  THR A HG1    2  
ATOM   7746   H  HG21   . THR A 1 189 ? -31.642 13.222  -10.247 1.00 0.00  ? 189  THR A HG21   2  
ATOM   7747   H  HG22   . THR A 1 189 ? -32.443 12.308  -11.526 1.00 0.00  ? 189  THR A HG22   2  
ATOM   7748   H  HG23   . THR A 1 189 ? -32.499 14.071  -11.535 1.00 0.00  ? 189  THR A HG23   2  
ATOM   7749   N  N      . GLU A 1 190 ? -30.455 10.468  -13.387 1.00 54.58 ? 190  GLU A N      2  
ATOM   7750   C  CA     . GLU A 1 190 ? -31.083 9.178   -13.843 1.00 55.79 ? 190  GLU A CA     2  
ATOM   7751   C  C      . GLU A 1 190 ? -30.383 7.973   -13.198 1.00 55.46 ? 190  GLU A C      2  
ATOM   7752   O  O      . GLU A 1 190 ? -31.015 7.083   -12.661 1.00 50.71 ? 190  GLU A O      2  
ATOM   7753   C  CB     . GLU A 1 190 ? -30.877 9.167   -15.360 1.00 55.89 ? 190  GLU A CB     2  
ATOM   7754   C  CG     . GLU A 1 190 ? -31.560 7.937   -15.955 1.00 60.99 ? 190  GLU A CG     2  
ATOM   7755   C  CD     . GLU A 1 190 ? -31.064 7.709   -17.384 1.00 71.84 ? 190  GLU A CD     2  
ATOM   7756   O  OE1    . GLU A 1 190 ? -31.010 8.673   -18.133 1.00 70.78 ? 190  GLU A OE1    2  
ATOM   7757   O  OE2    . GLU A 1 190 ? -30.751 6.576   -17.709 1.00 75.36 ? 190  GLU A OE2    2  
ATOM   7758   H  H      . GLU A 1 190 ? -30.127 11.098  -14.064 1.00 0.00  ? 190  GLU A H      2  
ATOM   7759   H  HA     . GLU A 1 190 ? -32.137 9.168   -13.616 1.00 0.00  ? 190  GLU A HA     2  
ATOM   7760   H  HB2    . GLU A 1 190 ? -31.307 10.062  -15.786 1.00 0.00  ? 190  GLU A HB2    2  
ATOM   7761   H  HB3    . GLU A 1 190 ? -29.820 9.133   -15.582 1.00 0.00  ? 190  GLU A HB3    2  
ATOM   7762   H  HG2    . GLU A 1 190 ? -31.329 7.071   -15.351 1.00 0.00  ? 190  GLU A HG2    2  
ATOM   7763   H  HG3    . GLU A 1 190 ? -32.628 8.092   -15.968 1.00 0.00  ? 190  GLU A HG3    2  
ATOM   7764   N  N      . ASP A 1 191 ? -29.081 7.946   -13.252 1.00 50.50 ? 191  ASP A N      2  
ATOM   7765   C  CA     . ASP A 1 191 ? -28.324 6.809   -12.644 1.00 50.21 ? 191  ASP A CA     2  
ATOM   7766   C  C      . ASP A 1 191 ? -28.545 6.760   -11.127 1.00 52.24 ? 191  ASP A C      2  
ATOM   7767   O  O      . ASP A 1 191 ? -28.664 5.696   -10.544 1.00 48.44 ? 191  ASP A O      2  
ATOM   7768   C  CB     . ASP A 1 191 ? -26.857 7.099   -12.956 1.00 46.56 ? 191  ASP A CB     2  
ATOM   7769   C  CG     . ASP A 1 191 ? -26.547 6.644   -14.381 1.00 51.39 ? 191  ASP A CG     2  
ATOM   7770   O  OD1    . ASP A 1 191 ? -26.468 5.446   -14.598 1.00 50.19 ? 191  ASP A OD1    2  
ATOM   7771   O  OD2    . ASP A 1 191 ? -26.398 7.501   -15.235 1.00 46.23 ? 191  ASP A OD2    2  
ATOM   7772   H  H      . ASP A 1 191 ? -28.600 8.676   -13.698 1.00 0.00  ? 191  ASP A H      2  
ATOM   7773   H  HA     . ASP A 1 191 ? -28.619 5.874   -13.097 1.00 0.00  ? 191  ASP A HA     2  
ATOM   7774   H  HB2    . ASP A 1 191 ? -26.675 8.159   -12.866 1.00 0.00  ? 191  ASP A HB2    2  
ATOM   7775   H  HB3    . ASP A 1 191 ? -26.228 6.563   -12.263 1.00 0.00  ? 191  ASP A HB3    2  
ATOM   7776   N  N      . LYS A 1 192 ? -28.597 7.906   -10.479 1.00 51.98 ? 192  LYS A N      2  
ATOM   7777   C  CA     . LYS A 1 192 ? -28.804 7.923   -9.002  1.00 47.84 ? 192  LYS A CA     2  
ATOM   7778   C  C      . LYS A 1 192 ? -30.183 7.363   -8.643  1.00 52.77 ? 192  LYS A C      2  
ATOM   7779   O  O      . LYS A 1 192 ? -30.338 6.639   -7.673  1.00 52.10 ? 192  LYS A O      2  
ATOM   7780   C  CB     . LYS A 1 192 ? -28.710 9.395   -8.608  1.00 45.07 ? 192  LYS A CB     2  
ATOM   7781   C  CG     . LYS A 1 192 ? -27.248 9.844   -8.641  1.00 48.10 ? 192  LYS A CG     2  
ATOM   7782   C  CD     . LYS A 1 192 ? -27.072 11.074  -7.745  1.00 50.66 ? 192  LYS A CD     2  
ATOM   7783   C  CE     . LYS A 1 192 ? -27.788 12.275  -8.369  1.00 48.85 ? 192  LYS A CE     2  
ATOM   7784   N  NZ     . LYS A 1 192 ? -27.212 13.466  -7.683  1.00 52.46 ? 192  LYS A NZ     2  
ATOM   7785   H  H      . LYS A 1 192 ? -28.497 8.740   -10.985 1.00 0.00  ? 192  LYS A H      2  
ATOM   7786   H  HA     . LYS A 1 192 ? -28.028 7.358   -8.509  1.00 0.00  ? 192  LYS A HA     2  
ATOM   7787   H  HB2    . LYS A 1 192 ? -29.285 9.989   -9.305  1.00 0.00  ? 192  LYS A HB2    2  
ATOM   7788   H  HB3    . LYS A 1 192 ? -29.103 9.525   -7.613  1.00 0.00  ? 192  LYS A HB3    2  
ATOM   7789   H  HG2    . LYS A 1 192 ? -26.617 9.042   -8.282  1.00 0.00  ? 192  LYS A HG2    2  
ATOM   7790   H  HG3    . LYS A 1 192 ? -26.970 10.096  -9.654  1.00 0.00  ? 192  LYS A HG3    2  
ATOM   7791   H  HD2    . LYS A 1 192 ? -27.493 10.870  -6.771  1.00 0.00  ? 192  LYS A HD2    2  
ATOM   7792   H  HD3    . LYS A 1 192 ? -26.021 11.297  -7.643  1.00 0.00  ? 192  LYS A HD3    2  
ATOM   7793   H  HE2    . LYS A 1 192 ? -27.591 12.318  -9.431  1.00 0.00  ? 192  LYS A HE2    2  
ATOM   7794   H  HE3    . LYS A 1 192 ? -28.849 12.219  -8.183  1.00 0.00  ? 192  LYS A HE3    2  
ATOM   7795   H  HZ1    . LYS A 1 192 ? -27.421 13.417  -6.666  1.00 0.00  ? 192  LYS A HZ1    2  
ATOM   7796   H  HZ2    . LYS A 1 192 ? -27.630 14.332  -8.082  1.00 0.00  ? 192  LYS A HZ2    2  
ATOM   7797   H  HZ3    . LYS A 1 192 ? -26.181 13.483  -7.822  1.00 0.00  ? 192  LYS A HZ3    2  
ATOM   7798   N  N      . GLU A 1 193 ? -31.182 7.692   -9.414  1.00 55.35 ? 193  GLU A N      2  
ATOM   7799   C  CA     . GLU A 1 193 ? -32.556 7.182   -9.120  1.00 53.45 ? 193  GLU A CA     2  
ATOM   7800   C  C      . GLU A 1 193 ? -32.601 5.656   -9.262  1.00 51.79 ? 193  GLU A C      2  
ATOM   7801   O  O      . GLU A 1 193 ? -33.156 4.963   -8.427  1.00 50.91 ? 193  GLU A O      2  
ATOM   7802   C  CB     . GLU A 1 193 ? -33.459 7.841   -10.164 1.00 55.20 ? 193  GLU A CB     2  
ATOM   7803   C  CG     . GLU A 1 193 ? -34.902 7.867   -9.655  1.00 61.06 ? 193  GLU A CG     2  
ATOM   7804   C  CD     . GLU A 1 193 ? -35.119 9.106   -8.783  1.00 61.93 ? 193  GLU A CD     2  
ATOM   7805   O  OE1    . GLU A 1 193 ? -34.585 10.148  -9.128  1.00 61.45 ? 193  GLU A OE1    2  
ATOM   7806   O  OE2    . GLU A 1 193 ? -35.814 8.993   -7.788  1.00 61.21 ? 193  GLU A OE2    2  
ATOM   7807   H  H      . GLU A 1 193 ? -31.026 8.279   -10.187 1.00 0.00  ? 193  GLU A H      2  
ATOM   7808   H  HA     . GLU A 1 193 ? -32.865 7.476   -8.128  1.00 0.00  ? 193  GLU A HA     2  
ATOM   7809   H  HB2    . GLU A 1 193 ? -33.122 8.850   -10.342 1.00 0.00  ? 193  GLU A HB2    2  
ATOM   7810   H  HB3    . GLU A 1 193 ? -33.415 7.278   -11.082 1.00 0.00  ? 193  GLU A HB3    2  
ATOM   7811   H  HG2    . GLU A 1 193 ? -35.578 7.896   -10.497 1.00 0.00  ? 193  GLU A HG2    2  
ATOM   7812   H  HG3    . GLU A 1 193 ? -35.095 6.980   -9.069  1.00 0.00  ? 193  GLU A HG3    2  
ATOM   7813   N  N      . ALA A 1 194 ? -32.018 5.132   -10.313 1.00 46.17 ? 194  ALA A N      2  
ATOM   7814   C  CA     . ALA A 1 194 ? -32.021 3.649   -10.518 1.00 45.61 ? 194  ALA A CA     2  
ATOM   7815   C  C      . ALA A 1 194 ? -31.411 2.939   -9.304  1.00 51.75 ? 194  ALA A C      2  
ATOM   7816   O  O      . ALA A 1 194 ? -31.895 1.912   -8.866  1.00 54.43 ? 194  ALA A O      2  
ATOM   7817   C  CB     . ALA A 1 194 ? -31.167 3.424   -11.761 1.00 45.08 ? 194  ALA A CB     2  
ATOM   7818   H  H      . ALA A 1 194 ? -31.579 5.718   -10.964 1.00 0.00  ? 194  ALA A H      2  
ATOM   7819   H  HA     . ALA A 1 194 ? -33.026 3.297   -10.692 1.00 0.00  ? 194  ALA A HA     2  
ATOM   7820   H  HB1    . ALA A 1 194 ? -31.510 4.075   -12.552 1.00 0.00  ? 194  ALA A HB1    2  
ATOM   7821   H  HB2    . ALA A 1 194 ? -31.256 2.396   -12.076 1.00 0.00  ? 194  ALA A HB2    2  
ATOM   7822   H  HB3    . ALA A 1 194 ? -30.137 3.646   -11.533 1.00 0.00  ? 194  ALA A HB3    2  
ATOM   7823   N  N      . LEU A 1 195 ? -30.352 3.486   -8.760  1.00 49.32 ? 195  LEU A N      2  
ATOM   7824   C  CA     . LEU A 1 195 ? -29.698 2.850   -7.583  1.00 46.46 ? 195  LEU A CA     2  
ATOM   7825   C  C      . LEU A 1 195 ? -30.606 2.969   -6.352  1.00 50.56 ? 195  LEU A C      2  
ATOM   7826   O  O      . LEU A 1 195 ? -30.931 1.983   -5.718  1.00 52.14 ? 195  LEU A O      2  
ATOM   7827   C  CB     . LEU A 1 195 ? -28.401 3.633   -7.377  1.00 47.30 ? 195  LEU A CB     2  
ATOM   7828   C  CG     . LEU A 1 195 ? -27.402 3.256   -8.473  1.00 41.33 ? 195  LEU A CG     2  
ATOM   7829   C  CD1    . LEU A 1 195 ? -26.231 4.240   -8.468  1.00 37.99 ? 195  LEU A CD1    2  
ATOM   7830   C  CD2    . LEU A 1 195 ? -26.876 1.843   -8.217  1.00 39.79 ? 195  LEU A CD2    2  
ATOM   7831   H  H      . LEU A 1 195 ? -29.978 4.294   -9.169  1.00 0.00  ? 195  LEU A H      2  
ATOM   7832   H  HA     . LEU A 1 195 ? -29.474 1.813   -7.785  1.00 0.00  ? 195  LEU A HA     2  
ATOM   7833   H  HB2    . LEU A 1 195 ? -28.611 4.692   -7.425  1.00 0.00  ? 195  LEU A HB2    2  
ATOM   7834   H  HB3    . LEU A 1 195 ? -27.983 3.390   -6.412  1.00 0.00  ? 195  LEU A HB3    2  
ATOM   7835   H  HG     . LEU A 1 195 ? -27.896 3.290   -9.433  1.00 0.00  ? 195  LEU A HG     2  
ATOM   7836   H  HD11   . LEU A 1 195 ? -25.442 3.856   -7.838  1.00 0.00  ? 195  LEU A HD11   2  
ATOM   7837   H  HD12   . LEU A 1 195 ? -26.562 5.196   -8.090  1.00 0.00  ? 195  LEU A HD12   2  
ATOM   7838   H  HD13   . LEU A 1 195 ? -25.859 4.360   -9.475  1.00 0.00  ? 195  LEU A HD13   2  
ATOM   7839   H  HD21   . LEU A 1 195 ? -27.661 1.126   -8.404  1.00 0.00  ? 195  LEU A HD21   2  
ATOM   7840   H  HD22   . LEU A 1 195 ? -26.550 1.761   -7.191  1.00 0.00  ? 195  LEU A HD22   2  
ATOM   7841   H  HD23   . LEU A 1 195 ? -26.044 1.646   -8.877  1.00 0.00  ? 195  LEU A HD23   2  
ATOM   7842   N  N      . LYS A 1 196 ? -31.034 4.174   -6.020  1.00 50.38 ? 196  LYS A N      2  
ATOM   7843   C  CA     . LYS A 1 196 ? -31.942 4.351   -4.844  1.00 46.79 ? 196  LYS A CA     2  
ATOM   7844   C  C      . LYS A 1 196 ? -33.138 3.395   -4.949  1.00 50.43 ? 196  LYS A C      2  
ATOM   7845   O  O      . LYS A 1 196 ? -33.697 2.955   -3.961  1.00 53.20 ? 196  LYS A O      2  
ATOM   7846   C  CB     . LYS A 1 196 ? -32.409 5.804   -4.925  1.00 49.24 ? 196  LYS A CB     2  
ATOM   7847   C  CG     . LYS A 1 196 ? -31.386 6.714   -4.240  1.00 51.25 ? 196  LYS A CG     2  
ATOM   7848   C  CD     . LYS A 1 196 ? -31.789 8.176   -4.444  1.00 52.27 ? 196  LYS A CD     2  
ATOM   7849   C  CE     . LYS A 1 196 ? -30.944 9.073   -3.537  1.00 64.52 ? 196  LYS A CE     2  
ATOM   7850   N  NZ     . LYS A 1 196 ? -31.479 10.448  -3.742  1.00 64.60 ? 196  LYS A NZ     2  
ATOM   7851   H  H      . LYS A 1 196 ? -30.776 4.932   -6.588  1.00 0.00  ? 196  LYS A H      2  
ATOM   7852   H  HA     . LYS A 1 196 ? -31.402 4.181   -3.926  1.00 0.00  ? 196  LYS A HA     2  
ATOM   7853   H  HB2    . LYS A 1 196 ? -32.510 6.091   -5.962  1.00 0.00  ? 196  LYS A HB2    2  
ATOM   7854   H  HB3    . LYS A 1 196 ? -33.363 5.902   -4.430  1.00 0.00  ? 196  LYS A HB3    2  
ATOM   7855   H  HG2    . LYS A 1 196 ? -31.355 6.492   -3.183  1.00 0.00  ? 196  LYS A HG2    2  
ATOM   7856   H  HG3    . LYS A 1 196 ? -30.410 6.549   -4.672  1.00 0.00  ? 196  LYS A HG3    2  
ATOM   7857   H  HD2    . LYS A 1 196 ? -31.628 8.453   -5.477  1.00 0.00  ? 196  LYS A HD2    2  
ATOM   7858   H  HD3    . LYS A 1 196 ? -32.834 8.299   -4.198  1.00 0.00  ? 196  LYS A HD3    2  
ATOM   7859   H  HE2    . LYS A 1 196 ? -31.060 8.773   -2.504  1.00 0.00  ? 196  LYS A HE2    2  
ATOM   7860   H  HE3    . LYS A 1 196 ? -29.906 9.033   -3.828  1.00 0.00  ? 196  LYS A HE3    2  
ATOM   7861   H  HZ1    . LYS A 1 196 ? -31.010 11.105  -3.087  1.00 0.00  ? 196  LYS A HZ1    2  
ATOM   7862   H  HZ2    . LYS A 1 196 ? -32.505 10.452  -3.562  1.00 0.00  ? 196  LYS A HZ2    2  
ATOM   7863   H  HZ3    . LYS A 1 196 ? -31.297 10.750  -4.720  1.00 0.00  ? 196  LYS A HZ3    2  
ATOM   7864   N  N      . LYS A 1 197 ? -33.518 3.080   -6.151  1.00 51.52 ? 197  LYS A N      2  
ATOM   7865   C  CA     . LYS A 1 197 ? -34.674 2.154   -6.377  1.00 53.19 ? 197  LYS A CA     2  
ATOM   7866   C  C      . LYS A 1 197 ? -34.342 0.733   -5.892  1.00 49.70 ? 197  LYS A C      2  
ATOM   7867   O  O      . LYS A 1 197 ? -35.152 0.078   -5.262  1.00 49.11 ? 197  LYS A O      2  
ATOM   7868   C  CB     . LYS A 1 197 ? -34.870 2.157   -7.896  1.00 58.77 ? 197  LYS A CB     2  
ATOM   7869   C  CG     . LYS A 1 197 ? -36.351 1.977   -8.223  1.00 59.14 ? 197  LYS A CG     2  
ATOM   7870   C  CD     . LYS A 1 197 ? -37.019 3.350   -8.331  1.00 69.57 ? 197  LYS A CD     2  
ATOM   7871   C  CE     . LYS A 1 197 ? -38.349 3.216   -9.079  1.00 78.01 ? 197  LYS A CE     2  
ATOM   7872   N  NZ     . LYS A 1 197 ? -39.227 2.436   -8.163  1.00 68.68 ? 197  LYS A NZ     2  
ATOM   7873   H  H      . LYS A 1 197 ? -33.060 3.462   -6.930  1.00 0.00  ? 197  LYS A H      2  
ATOM   7874   H  HA     . LYS A 1 197 ? -35.562 2.527   -5.892  1.00 0.00  ? 197  LYS A HA     2  
ATOM   7875   H  HB2    . LYS A 1 197 ? -34.522 3.097   -8.302  1.00 0.00  ? 197  LYS A HB2    2  
ATOM   7876   H  HB3    . LYS A 1 197 ? -34.305 1.345   -8.332  1.00 0.00  ? 197  LYS A HB3    2  
ATOM   7877   H  HG2    . LYS A 1 197 ? -36.448 1.451   -9.162  1.00 0.00  ? 197  LYS A HG2    2  
ATOM   7878   H  HG3    . LYS A 1 197 ? -36.826 1.408   -7.440  1.00 0.00  ? 197  LYS A HG3    2  
ATOM   7879   H  HD2    . LYS A 1 197 ? -37.200 3.741   -7.342  1.00 0.00  ? 197  LYS A HD2    2  
ATOM   7880   H  HD3    . LYS A 1 197 ? -36.372 4.025   -8.872  1.00 0.00  ? 197  LYS A HD3    2  
ATOM   7881   H  HE2    . LYS A 1 197 ? -38.773 4.193   -9.268  1.00 0.00  ? 197  LYS A HE2    2  
ATOM   7882   H  HE3    . LYS A 1 197 ? -38.210 2.679   -10.005 1.00 0.00  ? 197  LYS A HE3    2  
ATOM   7883   H  HZ1    . LYS A 1 197 ? -40.169 2.331   -8.590  1.00 0.00  ? 197  LYS A HZ1    2  
ATOM   7884   H  HZ2    . LYS A 1 197 ? -39.311 2.936   -7.254  1.00 0.00  ? 197  LYS A HZ2    2  
ATOM   7885   H  HZ3    . LYS A 1 197 ? -38.814 1.495   -8.004  1.00 0.00  ? 197  LYS A HZ3    2  
ATOM   7886   N  N      . GLN A 1 198 ? -33.164 0.244   -6.204  1.00 49.57 ? 198  GLN A N      2  
ATOM   7887   C  CA     . GLN A 1 198 ? -32.794 -1.149  -5.785  1.00 48.13 ? 198  GLN A CA     2  
ATOM   7888   C  C      . GLN A 1 198 ? -32.224 -1.165  -4.362  1.00 52.04 ? 198  GLN A C      2  
ATOM   7889   O  O      . GLN A 1 198 ? -32.364 -2.139  -3.646  1.00 46.08 ? 198  GLN A O      2  
ATOM   7890   C  CB     . GLN A 1 198 ? -31.754 -1.625  -6.804  1.00 46.76 ? 198  GLN A CB     2  
ATOM   7891   C  CG     . GLN A 1 198 ? -30.536 -0.700  -6.784  1.00 49.05 ? 198  GLN A CG     2  
ATOM   7892   C  CD     . GLN A 1 198 ? -29.336 -1.432  -7.385  1.00 49.38 ? 198  GLN A CD     2  
ATOM   7893   O  OE1    . GLN A 1 198 ? -28.268 -1.440  -6.810  1.00 46.53 ? 198  GLN A OE1    2  
ATOM   7894   N  NE2    . GLN A 1 198 ? -29.467 -2.053  -8.525  1.00 50.07 ? 198  GLN A NE2    2  
ATOM   7895   H  H      . GLN A 1 198 ? -32.544 0.785   -6.736  1.00 0.00  ? 198  GLN A H      2  
ATOM   7896   H  HA     . GLN A 1 198 ? -33.662 -1.788  -5.836  1.00 0.00  ? 198  GLN A HA     2  
ATOM   7897   H  HB2    . GLN A 1 198 ? -31.444 -2.629  -6.555  1.00 0.00  ? 198  GLN A HB2    2  
ATOM   7898   H  HB3    . GLN A 1 198 ? -32.191 -1.618  -7.790  1.00 0.00  ? 198  GLN A HB3    2  
ATOM   7899   H  HG2    . GLN A 1 198 ? -30.746 0.188   -7.365  1.00 0.00  ? 198  GLN A HG2    2  
ATOM   7900   H  HG3    . GLN A 1 198 ? -30.311 -0.421  -5.767  1.00 0.00  ? 198  GLN A HG3    2  
ATOM   7901   H  HE21   . GLN A 1 198 ? -30.329 -2.047  -8.991  1.00 0.00  ? 198  GLN A HE21   2  
ATOM   7902   H  HE22   . GLN A 1 198 ? -28.702 -2.526  -8.914  1.00 0.00  ? 198  GLN A HE22   2  
ATOM   7903   N  N      . LEU A 1 199 ? -31.608 -0.094  -3.941  1.00 48.92 ? 199  LEU A N      2  
ATOM   7904   C  CA     . LEU A 1 199 ? -31.064 -0.035  -2.553  1.00 47.12 ? 199  LEU A CA     2  
ATOM   7905   C  C      . LEU A 1 199 ? -31.736 1.140   -1.830  1.00 50.23 ? 199  LEU A C      2  
ATOM   7906   O  O      . LEU A 1 199 ? -31.170 2.209   -1.725  1.00 50.04 ? 199  LEU A O      2  
ATOM   7907   C  CB     . LEU A 1 199 ? -29.562 0.201   -2.709  1.00 43.00 ? 199  LEU A CB     2  
ATOM   7908   C  CG     . LEU A 1 199 ? -28.902 -1.073  -3.244  1.00 43.42 ? 199  LEU A CG     2  
ATOM   7909   C  CD1    . LEU A 1 199 ? -27.443 -0.783  -3.591  1.00 42.18 ? 199  LEU A CD1    2  
ATOM   7910   C  CD2    . LEU A 1 199 ? -28.961 -2.164  -2.173  1.00 34.79 ? 199  LEU A CD2    2  
ATOM   7911   H  H      . LEU A 1 199 ? -31.524 0.685   -4.534  1.00 0.00  ? 199  LEU A H      2  
ATOM   7912   H  HA     . LEU A 1 199 ? -31.250 -0.962  -2.031  1.00 0.00  ? 199  LEU A HA     2  
ATOM   7913   H  HB2    . LEU A 1 199 ? -29.393 1.015   -3.398  1.00 0.00  ? 199  LEU A HB2    2  
ATOM   7914   H  HB3    . LEU A 1 199 ? -29.137 0.445   -1.748  1.00 0.00  ? 199  LEU A HB3    2  
ATOM   7915   H  HG     . LEU A 1 199 ? -29.424 -1.406  -4.130  1.00 0.00  ? 199  LEU A HG     2  
ATOM   7916   H  HD11   . LEU A 1 199 ? -27.384 -0.380  -4.593  1.00 0.00  ? 199  LEU A HD11   2  
ATOM   7917   H  HD12   . LEU A 1 199 ? -26.869 -1.696  -3.537  1.00 0.00  ? 199  LEU A HD12   2  
ATOM   7918   H  HD13   . LEU A 1 199 ? -27.042 -0.064  -2.891  1.00 0.00  ? 199  LEU A HD13   2  
ATOM   7919   H  HD21   . LEU A 1 199 ? -29.921 -2.657  -2.213  1.00 0.00  ? 199  LEU A HD21   2  
ATOM   7920   H  HD22   . LEU A 1 199 ? -28.825 -1.719  -1.198  1.00 0.00  ? 199  LEU A HD22   2  
ATOM   7921   H  HD23   . LEU A 1 199 ? -28.179 -2.886  -2.351  1.00 0.00  ? 199  LEU A HD23   2  
ATOM   7922   N  N      . PRO A 1 200 ? -32.956 0.919   -1.394  1.00 52.86 ? 200  PRO A N      2  
ATOM   7923   C  CA     . PRO A 1 200 ? -33.737 1.991   -0.716  1.00 53.87 ? 200  PRO A CA     2  
ATOM   7924   C  C      . PRO A 1 200 ? -33.209 2.269   0.695   1.00 54.76 ? 200  PRO A C      2  
ATOM   7925   O  O      . PRO A 1 200 ? -33.104 3.404   1.113   1.00 54.47 ? 200  PRO A O      2  
ATOM   7926   C  CB     . PRO A 1 200 ? -35.151 1.420   -0.658  1.00 52.58 ? 200  PRO A CB     2  
ATOM   7927   C  CG     . PRO A 1 200 ? -34.975 -0.064  -0.708  1.00 50.31 ? 200  PRO A CG     2  
ATOM   7928   C  CD     . PRO A 1 200 ? -33.715 -0.336  -1.489  1.00 52.27 ? 200  PRO A CD     2  
ATOM   7929   H  HA     . PRO A 1 200 ? -33.731 2.893   -1.305  1.00 0.00  ? 200  PRO A HA     2  
ATOM   7930   H  HB2    . PRO A 1 200 ? -35.635 1.713   0.265   1.00 0.00  ? 200  PRO A HB2    2  
ATOM   7931   H  HB3    . PRO A 1 200 ? -35.726 1.752   -1.508  1.00 0.00  ? 200  PRO A HB3    2  
ATOM   7932   H  HG2    . PRO A 1 200 ? -34.882 -0.458  0.294   1.00 0.00  ? 200  PRO A HG2    2  
ATOM   7933   H  HG3    . PRO A 1 200 ? -35.815 -0.518  -1.208  1.00 0.00  ? 200  PRO A HG3    2  
ATOM   7934   H  HD2    . PRO A 1 200 ? -33.163 -1.152  -1.042  1.00 0.00  ? 200  PRO A HD2    2  
ATOM   7935   H  HD3    . PRO A 1 200 ? -33.947 -0.552  -2.520  1.00 0.00  ? 200  PRO A HD3    2  
ATOM   7936   N  N      . GLY A 1 201 ? -32.885 1.244   1.434   1.00 51.33 ? 201  GLY A N      2  
ATOM   7937   C  CA     . GLY A 1 201 ? -32.376 1.455   2.819   1.00 53.17 ? 201  GLY A CA     2  
ATOM   7938   C  C      . GLY A 1 201 ? -33.554 1.733   3.755   1.00 60.86 ? 201  GLY A C      2  
ATOM   7939   O  O      . GLY A 1 201 ? -33.371 2.133   4.889   1.00 0.00  ? 201  GLY A O      2  
ATOM   7940   H  H      . GLY A 1 201 ? -32.983 0.335   1.081   1.00 0.00  ? 201  GLY A H      2  
ATOM   7941   H  HA2    . GLY A 1 201 ? -31.851 0.569   3.149   1.00 0.00  ? 201  GLY A HA2    2  
ATOM   7942   H  HA3    . GLY A 1 201 ? -31.704 2.299   2.831   1.00 0.00  ? 201  GLY A HA3    2  
ATOM   7943   N  N      . VAL A 1 202 ? -34.762 1.530   3.295   1.00 0.00  ? 202  VAL A N      2  
ATOM   7944   C  CA     . VAL A 1 202 ? -35.947 1.790   4.164   1.00 0.00  ? 202  VAL A CA     2  
ATOM   7945   C  C      . VAL A 1 202 ? -36.030 0.742   5.280   1.00 0.00  ? 202  VAL A C      2  
ATOM   7946   O  O      . VAL A 1 202 ? -35.516 -0.353  5.156   1.00 0.00  ? 202  VAL A O      2  
ATOM   7947   C  CB     . VAL A 1 202 ? -37.158 1.688   3.230   1.00 0.00  ? 202  VAL A CB     2  
ATOM   7948   C  CG1    . VAL A 1 202 ? -37.200 0.300   2.582   1.00 0.00  ? 202  VAL A CG1    2  
ATOM   7949   C  CG2    . VAL A 1 202 ? -38.443 1.916   4.032   1.00 0.00  ? 202  VAL A CG2    2  
ATOM   7950   H  H      . VAL A 1 202 ? -34.890 1.211   2.378   1.00 0.00  ? 202  VAL A H      2  
ATOM   7951   H  HA     . VAL A 1 202 ? -35.893 2.781   4.585   1.00 0.00  ? 202  VAL A HA     2  
ATOM   7952   H  HB     . VAL A 1 202 ? -37.078 2.439   2.458   1.00 0.00  ? 202  VAL A HB     2  
ATOM   7953   H  HG11   . VAL A 1 202 ? -38.224 -0.040  2.524   1.00 0.00  ? 202  VAL A HG11   2  
ATOM   7954   H  HG12   . VAL A 1 202 ? -36.624 -0.394  3.176   1.00 0.00  ? 202  VAL A HG12   2  
ATOM   7955   H  HG13   . VAL A 1 202 ? -36.783 0.354   1.587   1.00 0.00  ? 202  VAL A HG13   2  
ATOM   7956   H  HG21   . VAL A 1 202 ? -39.278 2.006   3.354   1.00 0.00  ? 202  VAL A HG21   2  
ATOM   7957   H  HG22   . VAL A 1 202 ? -38.349 2.821   4.612   1.00 0.00  ? 202  VAL A HG22   2  
ATOM   7958   H  HG23   . VAL A 1 202 ? -38.607 1.079   4.695   1.00 0.00  ? 202  VAL A HG23   2  
ATOM   7959   N  N      . LYS A 1 203 ? -36.675 1.072   6.366   1.00 0.00  ? 203  LYS A N      2  
ATOM   7960   C  CA     . LYS A 1 203 ? -36.796 0.100   7.493   1.00 0.00  ? 203  LYS A CA     2  
ATOM   7961   C  C      . LYS A 1 203 ? -38.271 -0.112  7.849   1.00 0.00  ? 203  LYS A C      2  
ATOM   7962   O  O      . LYS A 1 203 ? -39.156 0.205   7.080   1.00 0.00  ? 203  LYS A O      2  
ATOM   7963   C  CB     . LYS A 1 203 ? -36.043 0.745   8.660   1.00 0.00  ? 203  LYS A CB     2  
ATOM   7964   C  CG     . LYS A 1 203 ? -36.651 2.115   8.979   1.00 0.00  ? 203  LYS A CG     2  
ATOM   7965   C  CD     . LYS A 1 203 ? -35.772 3.218   8.385   1.00 0.00  ? 203  LYS A CD     2  
ATOM   7966   C  CE     . LYS A 1 203 ? -35.811 4.447   9.295   1.00 0.00  ? 203  LYS A CE     2  
ATOM   7967   N  NZ     . LYS A 1 203 ? -35.072 5.502   8.547   1.00 0.00  ? 203  LYS A NZ     2  
ATOM   7968   H  H      . LYS A 1 203 ? -37.082 1.960   6.443   1.00 0.00  ? 203  LYS A H      2  
ATOM   7969   H  HA     . LYS A 1 203 ? -36.334 -0.839  7.230   1.00 0.00  ? 203  LYS A HA     2  
ATOM   7970   H  HB2    . LYS A 1 203 ? -36.115 0.108   9.529   1.00 0.00  ? 203  LYS A HB2    2  
ATOM   7971   H  HB3    . LYS A 1 203 ? -35.004 0.868   8.391   1.00 0.00  ? 203  LYS A HB3    2  
ATOM   7972   H  HG2    . LYS A 1 203 ? -37.643 2.177   8.555   1.00 0.00  ? 203  LYS A HG2    2  
ATOM   7973   H  HG3    . LYS A 1 203 ? -36.710 2.242   10.049  1.00 0.00  ? 203  LYS A HG3    2  
ATOM   7974   H  HD2    . LYS A 1 203 ? -34.755 2.861   8.302   1.00 0.00  ? 203  LYS A HD2    2  
ATOM   7975   H  HD3    . LYS A 1 203 ? -36.141 3.485   7.407   1.00 0.00  ? 203  LYS A HD3    2  
ATOM   7976   H  HE2    . LYS A 1 203 ? -36.833 4.752   9.470   1.00 0.00  ? 203  LYS A HE2    2  
ATOM   7977   H  HE3    . LYS A 1 203 ? -35.313 4.240   10.230  1.00 0.00  ? 203  LYS A HE3    2  
ATOM   7978   H  HZ1    . LYS A 1 203 ? -35.620 5.783   7.710   1.00 0.00  ? 203  LYS A HZ1    2  
ATOM   7979   H  HZ2    . LYS A 1 203 ? -34.147 5.131   8.248   1.00 0.00  ? 203  LYS A HZ2    2  
ATOM   7980   H  HZ3    . LYS A 1 203 ? -34.932 6.329   9.161   1.00 0.00  ? 203  LYS A HZ3    2  
ATOM   7981   N  N      . SER A 1 204 ? -38.540 -0.647  9.011   1.00 0.00  ? 204  SER A N      2  
ATOM   7982   C  CA     . SER A 1 204 ? -39.958 -0.879  9.417   1.00 0.00  ? 204  SER A CA     2  
ATOM   7983   C  C      . SER A 1 204 ? -40.658 0.458   9.680   1.00 0.00  ? 204  SER A C      2  
ATOM   7984   O  O      . SER A 1 204 ? -40.622 0.982   10.776  1.00 0.00  ? 204  SER A O      2  
ATOM   7985   C  CB     . SER A 1 204 ? -39.874 -1.702  10.701  1.00 0.00  ? 204  SER A CB     2  
ATOM   7986   O  OG     . SER A 1 204 ? -40.879 -2.709  10.680  1.00 0.00  ? 204  SER A OG     2  
ATOM   7987   H  H      . SER A 1 204 ? -37.811 -0.895  9.615   1.00 0.00  ? 204  SER A H      2  
ATOM   7988   H  HA     . SER A 1 204 ? -40.481 -1.435  8.655   1.00 0.00  ? 204  SER A HA     2  
ATOM   7989   H  HB2    . SER A 1 204 ? -38.906 -2.170  10.769  1.00 0.00  ? 204  SER A HB2    2  
ATOM   7990   H  HB3    . SER A 1 204 ? -40.018 -1.053  11.554  1.00 0.00  ? 204  SER A HB3    2  
ATOM   7991   H  HG     . SER A 1 204 ? -40.680 -3.311  9.959   1.00 0.00  ? 204  SER A HG     2  
ATOM   7992   N  N      . GLU A 1 205 ? -41.295 1.011   8.682   1.00 0.00  ? 205  GLU A N      2  
ATOM   7993   C  CA     . GLU A 1 205 ? -41.999 2.314   8.872   1.00 0.00  ? 205  GLU A CA     2  
ATOM   7994   C  C      . GLU A 1 205 ? -43.326 2.101   9.607   1.00 0.00  ? 205  GLU A C      2  
ATOM   7995   O  O      . GLU A 1 205 ? -43.860 3.007   10.216  1.00 0.00  ? 205  GLU A O      2  
ATOM   7996   C  CB     . GLU A 1 205 ? -42.248 2.841   7.458   1.00 0.00  ? 205  GLU A CB     2  
ATOM   7997   C  CG     . GLU A 1 205 ? -42.535 4.343   7.516   1.00 0.00  ? 205  GLU A CG     2  
ATOM   7998   C  CD     . GLU A 1 205 ? -41.252 5.094   7.879   1.00 0.00  ? 205  GLU A CD     2  
ATOM   7999   O  OE1    . GLU A 1 205 ? -40.462 5.343   6.984   1.00 0.00  ? 205  GLU A OE1    2  
ATOM   8000   O  OE2    . GLU A 1 205 ? -41.083 5.407   9.046   1.00 0.00  ? 205  GLU A OE2    2  
ATOM   8001   H  H      . GLU A 1 205 ? -41.311 0.569   7.807   1.00 0.00  ? 205  GLU A H      2  
ATOM   8002   H  HA     . GLU A 1 205 ? -41.373 3.003   9.416   1.00 0.00  ? 205  GLU A HA     2  
ATOM   8003   H  HB2    . GLU A 1 205 ? -41.374 2.663   6.849   1.00 0.00  ? 205  GLU A HB2    2  
ATOM   8004   H  HB3    . GLU A 1 205 ? -43.096 2.330   7.028   1.00 0.00  ? 205  GLU A HB3    2  
ATOM   8005   H  HG2    . GLU A 1 205 ? -42.890 4.678   6.552   1.00 0.00  ? 205  GLU A HG2    2  
ATOM   8006   H  HG3    . GLU A 1 205 ? -43.288 4.537   8.264   1.00 0.00  ? 205  GLU A HG3    2  
ATOM   8007   N  N      . GLY A 1 206 ? -43.862 0.909   9.556   1.00 0.00  ? 206  GLY A N      2  
ATOM   8008   C  CA     . GLY A 1 206 ? -45.154 0.638   10.251  1.00 0.00  ? 206  GLY A CA     2  
ATOM   8009   C  C      . GLY A 1 206 ? -44.989 0.876   11.753  1.00 0.00  ? 206  GLY A C      2  
ATOM   8010   O  O      . GLY A 1 206 ? -43.989 0.513   12.342  1.00 0.00  ? 206  GLY A O      2  
ATOM   8011   H  H      . GLY A 1 206 ? -43.415 0.192   9.059   1.00 0.00  ? 206  GLY A H      2  
ATOM   8012   H  HA2    . GLY A 1 206 ? -45.916 1.299   9.861   1.00 0.00  ? 206  GLY A HA2    2  
ATOM   8013   H  HA3    . GLY A 1 206 ? -45.446 -0.388  10.082  1.00 0.00  ? 206  GLY A HA3    2  
ATOM   8014   N  N      . LYS A 1 207 ? -45.963 1.484   12.376  1.00 0.00  ? 207  LYS A N      2  
ATOM   8015   C  CA     . LYS A 1 207 ? -45.865 1.747   13.842  1.00 0.00  ? 207  LYS A CA     2  
ATOM   8016   C  C      . LYS A 1 207 ? -46.105 0.456   14.629  1.00 0.00  ? 207  LYS A C      2  
ATOM   8017   O  O      . LYS A 1 207 ? -47.206 0.179   15.064  1.00 0.00  ? 207  LYS A O      2  
ATOM   8018   C  CB     . LYS A 1 207 ? -46.965 2.768   14.137  1.00 0.00  ? 207  LYS A CB     2  
ATOM   8019   C  CG     . LYS A 1 207 ? -46.462 3.781   15.165  1.00 0.00  ? 207  LYS A CG     2  
ATOM   8020   C  CD     . LYS A 1 207 ? -47.374 5.010   15.162  1.00 0.00  ? 207  LYS A CD     2  
ATOM   8021   C  CE     . LYS A 1 207 ? -46.539 6.269   15.409  1.00 0.00  ? 207  LYS A CE     2  
ATOM   8022   N  NZ     . LYS A 1 207 ? -45.899 6.567   14.099  1.00 0.00  ? 207  LYS A NZ     2  
ATOM   8023   H  H      . LYS A 1 207 ? -46.759 1.767   11.880  1.00 0.00  ? 207  LYS A H      2  
ATOM   8024   H  HA     . LYS A 1 207 ? -44.901 2.164   14.087  1.00 0.00  ? 207  LYS A HA     2  
ATOM   8025   H  HB2    . LYS A 1 207 ? -47.233 3.281   13.225  1.00 0.00  ? 207  LYS A HB2    2  
ATOM   8026   H  HB3    . LYS A 1 207 ? -47.833 2.259   14.530  1.00 0.00  ? 207  LYS A HB3    2  
ATOM   8027   H  HG2    . LYS A 1 207 ? -46.467 3.330   16.148  1.00 0.00  ? 207  LYS A HG2    2  
ATOM   8028   H  HG3    . LYS A 1 207 ? -45.457 4.082   14.912  1.00 0.00  ? 207  LYS A HG3    2  
ATOM   8029   H  HD2    . LYS A 1 207 ? -47.870 5.087   14.205  1.00 0.00  ? 207  LYS A HD2    2  
ATOM   8030   H  HD3    . LYS A 1 207 ? -48.113 4.912   15.944  1.00 0.00  ? 207  LYS A HD3    2  
ATOM   8031   H  HE2    . LYS A 1 207 ? -47.177 7.086   15.716  1.00 0.00  ? 207  LYS A HE2    2  
ATOM   8032   H  HE3    . LYS A 1 207 ? -45.784 6.078   16.155  1.00 0.00  ? 207  LYS A HE3    2  
ATOM   8033   H  HZ1    . LYS A 1 207 ? -45.333 5.750   13.795  1.00 0.00  ? 207  LYS A HZ1    2  
ATOM   8034   H  HZ2    . LYS A 1 207 ? -45.283 7.400   14.196  1.00 0.00  ? 207  LYS A HZ2    2  
ATOM   8035   H  HZ3    . LYS A 1 207 ? -46.635 6.760   13.389  1.00 0.00  ? 207  LYS A HZ3    2  
ATOM   8036   N  N      . ARG A 1 208 ? -45.083 -0.335  14.816  1.00 0.00  ? 208  ARG A N      2  
ATOM   8037   C  CA     . ARG A 1 208 ? -45.250 -1.609  15.573  1.00 0.00  ? 208  ARG A CA     2  
ATOM   8038   C  C      . ARG A 1 208 ? -43.910 -2.048  16.171  1.00 0.00  ? 208  ARG A C      2  
ATOM   8039   O  O      . ARG A 1 208 ? -43.439 -3.143  15.927  1.00 0.00  ? 208  ARG A O      2  
ATOM   8040   C  CB     . ARG A 1 208 ? -45.736 -2.625  14.539  1.00 0.00  ? 208  ARG A CB     2  
ATOM   8041   C  CG     . ARG A 1 208 ? -47.260 -2.729  14.602  1.00 0.00  ? 208  ARG A CG     2  
ATOM   8042   C  CD     . ARG A 1 208 ? -47.726 -3.924  13.766  1.00 0.00  ? 208  ARG A CD     2  
ATOM   8043   N  NE     . ARG A 1 208 ? -47.633 -3.462  12.351  1.00 0.00  ? 208  ARG A NE     2  
ATOM   8044   C  CZ     . ARG A 1 208 ? -48.487 -2.587  11.876  1.00 0.00  ? 208  ARG A CZ     2  
ATOM   8045   N  NH1    . ARG A 1 208 ? -49.435 -2.099  12.634  1.00 0.00  ? 208  ARG A NH1    2  
ATOM   8046   N  NH2    . ARG A 1 208 ? -48.389 -2.198  10.634  1.00 0.00  ? 208  ARG A NH2    2  
ATOM   8047   H  H      . ARG A 1 208 ? -44.204 -0.091  14.456  1.00 0.00  ? 208  ARG A H      2  
ATOM   8048   H  HA     . ARG A 1 208 ? -45.989 -1.492  16.351  1.00 0.00  ? 208  ARG A HA     2  
ATOM   8049   H  HB2    . ARG A 1 208 ? -45.436 -2.303  13.551  1.00 0.00  ? 208  ARG A HB2    2  
ATOM   8050   H  HB3    . ARG A 1 208 ? -45.301 -3.590  14.750  1.00 0.00  ? 208  ARG A HB3    2  
ATOM   8051   H  HG2    . ARG A 1 208 ? -47.570 -2.863  15.628  1.00 0.00  ? 208  ARG A HG2    2  
ATOM   8052   H  HG3    . ARG A 1 208 ? -47.699 -1.825  14.208  1.00 0.00  ? 208  ARG A HG3    2  
ATOM   8053   H  HD2    . ARG A 1 208 ? -47.074 -4.772  13.932  1.00 0.00  ? 208  ARG A HD2    2  
ATOM   8054   H  HD3    . ARG A 1 208 ? -48.746 -4.178  14.007  1.00 0.00  ? 208  ARG A HD3    2  
ATOM   8055   H  HE     . ARG A 1 208 ? -46.928 -3.817  11.770  1.00 0.00  ? 208  ARG A HE     2  
ATOM   8056   H  HH11   . ARG A 1 208 ? -49.518 -2.389  13.587  1.00 0.00  ? 208  ARG A HH11   2  
ATOM   8057   H  HH12   . ARG A 1 208 ? -50.079 -1.431  12.260  1.00 0.00  ? 208  ARG A HH12   2  
ATOM   8058   H  HH21   . ARG A 1 208 ? -47.666 -2.566  10.050  1.00 0.00  ? 208  ARG A HH21   2  
ATOM   8059   H  HH22   . ARG A 1 208 ? -49.036 -1.530  10.267  1.00 0.00  ? 208  ARG A HH22   2  
ATOM   8060   N  N      . LYS A 1 209 ? -43.294 -1.202  16.951  1.00 0.00  ? 209  LYS A N      2  
ATOM   8061   C  CA     . LYS A 1 209 ? -41.984 -1.566  17.567  1.00 0.00  ? 209  LYS A CA     2  
ATOM   8062   C  C      . LYS A 1 209 ? -42.105 -1.586  19.093  1.00 0.00  ? 209  LYS A C      2  
ATOM   8063   O  O      . LYS A 1 209 ? -43.189 -1.667  19.637  1.00 0.00  ? 209  LYS A O      2  
ATOM   8064   C  CB     . LYS A 1 209 ? -41.017 -0.470  17.119  1.00 0.00  ? 209  LYS A CB     2  
ATOM   8065   C  CG     . LYS A 1 209 ? -39.659 -1.088  16.787  1.00 0.00  ? 209  LYS A CG     2  
ATOM   8066   C  CD     . LYS A 1 209 ? -38.576 -0.011  16.867  1.00 0.00  ? 209  LYS A CD     2  
ATOM   8067   C  CE     . LYS A 1 209 ? -37.257 -0.643  17.317  1.00 0.00  ? 209  LYS A CE     2  
ATOM   8068   N  NZ     . LYS A 1 209 ? -36.200 0.121   16.599  1.00 0.00  ? 209  LYS A NZ     2  
ATOM   8069   H  H      . LYS A 1 209 ? -43.692 -0.325  17.134  1.00 0.00  ? 209  LYS A H      2  
ATOM   8070   H  HA     . LYS A 1 209 ? -41.650 -2.525  17.202  1.00 0.00  ? 209  LYS A HA     2  
ATOM   8071   H  HB2    . LYS A 1 209 ? -41.414 0.023   16.242  1.00 0.00  ? 209  LYS A HB2    2  
ATOM   8072   H  HB3    . LYS A 1 209 ? -40.898 0.252   17.913  1.00 0.00  ? 209  LYS A HB3    2  
ATOM   8073   H  HG2    . LYS A 1 209 ? -39.439 -1.875  17.494  1.00 0.00  ? 209  LYS A HG2    2  
ATOM   8074   H  HG3    . LYS A 1 209 ? -39.683 -1.497  15.788  1.00 0.00  ? 209  LYS A HG3    2  
ATOM   8075   H  HD2    . LYS A 1 209 ? -38.446 0.442   15.895  1.00 0.00  ? 209  LYS A HD2    2  
ATOM   8076   H  HD3    . LYS A 1 209 ? -38.871 0.745   17.580  1.00 0.00  ? 209  LYS A HD3    2  
ATOM   8077   H  HE2    . LYS A 1 209 ? -37.138 -0.542  18.387  1.00 0.00  ? 209  LYS A HE2    2  
ATOM   8078   H  HE3    . LYS A 1 209 ? -37.221 -1.683  17.029  1.00 0.00  ? 209  LYS A HE3    2  
ATOM   8079   H  HZ1    . LYS A 1 209 ? -35.276 -0.322  16.767  1.00 0.00  ? 209  LYS A HZ1    2  
ATOM   8080   H  HZ2    . LYS A 1 209 ? -36.184 1.102   16.948  1.00 0.00  ? 209  LYS A HZ2    2  
ATOM   8081   H  HZ3    . LYS A 1 209 ? -36.402 0.120   15.579  1.00 0.00  ? 209  LYS A HZ3    2  
ATOM   8082   N  N      . GLY A 1 210 ? -41.001 -1.510  19.786  1.00 0.00  ? 210  GLY A N      2  
ATOM   8083   C  CA     . GLY A 1 210 ? -41.051 -1.523  21.276  1.00 0.00  ? 210  GLY A CA     2  
ATOM   8084   C  C      . GLY A 1 210 ? -40.904 -2.959  21.781  1.00 0.00  ? 210  GLY A C      2  
ATOM   8085   O  O      . GLY A 1 210 ? -41.877 -3.634  22.054  1.00 0.00  ? 210  GLY A O      2  
ATOM   8086   H  H      . GLY A 1 210 ? -40.138 -1.446  19.326  1.00 0.00  ? 210  GLY A H      2  
ATOM   8087   H  HA2    . GLY A 1 210 ? -40.246 -0.917  21.668  1.00 0.00  ? 210  GLY A HA2    2  
ATOM   8088   H  HA3    . GLY A 1 210 ? -41.997 -1.124  21.608  1.00 0.00  ? 210  GLY A HA3    2  
ATOM   8089   N  N      . ASP A 1 211 ? -39.692 -3.431  21.908  1.00 0.00  ? 211  ASP A N      2  
ATOM   8090   C  CA     . ASP A 1 211 ? -39.479 -4.825  22.397  1.00 0.00  ? 211  ASP A CA     2  
ATOM   8091   C  C      . ASP A 1 211 ? -38.121 -4.936  23.096  1.00 0.00  ? 211  ASP A C      2  
ATOM   8092   O  O      . ASP A 1 211 ? -37.097 -4.585  22.541  1.00 0.00  ? 211  ASP A O      2  
ATOM   8093   C  CB     . ASP A 1 211 ? -39.510 -5.695  21.140  1.00 0.00  ? 211  ASP A CB     2  
ATOM   8094   C  CG     . ASP A 1 211 ? -40.911 -6.284  20.960  1.00 0.00  ? 211  ASP A CG     2  
ATOM   8095   O  OD1    . ASP A 1 211 ? -41.479 -6.721  21.947  1.00 0.00  ? 211  ASP A OD1    2  
ATOM   8096   O  OD2    . ASP A 1 211 ? -41.390 -6.289  19.839  1.00 0.00  ? 211  ASP A OD2    2  
ATOM   8097   H  H      . ASP A 1 211 ? -38.923 -2.868  21.683  1.00 0.00  ? 211  ASP A H      2  
ATOM   8098   H  HA     . ASP A 1 211 ? -40.272 -5.116  23.066  1.00 0.00  ? 211  ASP A HA     2  
ATOM   8099   H  HB2    . ASP A 1 211 ? -39.259 -5.091  20.279  1.00 0.00  ? 211  ASP A HB2    2  
ATOM   8100   H  HB3    . ASP A 1 211 ? -38.794 -6.497  21.239  1.00 0.00  ? 211  ASP A HB3    2  
ATOM   8101   N  N      . GLU A 1 212 ? -38.106 -5.421  24.308  1.00 0.00  ? 212  GLU A N      2  
ATOM   8102   C  CA     . GLU A 1 212 ? -36.815 -5.556  25.046  1.00 0.00  ? 212  GLU A CA     2  
ATOM   8103   C  C      . GLU A 1 212 ? -36.393 -7.026  25.111  1.00 0.00  ? 212  GLU A C      2  
ATOM   8104   O  O      . GLU A 1 212 ? -35.785 -7.464  26.068  1.00 0.00  ? 212  GLU A O      2  
ATOM   8105   C  CB     . GLU A 1 212 ? -37.102 -5.017  26.447  1.00 0.00  ? 212  GLU A CB     2  
ATOM   8106   C  CG     . GLU A 1 212 ? -35.803 -4.975  27.254  1.00 0.00  ? 212  GLU A CG     2  
ATOM   8107   C  CD     . GLU A 1 212 ? -35.835 -3.781  28.210  1.00 0.00  ? 212  GLU A CD     2  
ATOM   8108   O  OE1    . GLU A 1 212 ? -36.887 -3.523  28.770  1.00 0.00  ? 212  GLU A OE1    2  
ATOM   8109   O  OE2    . GLU A 1 212 ? -34.805 -3.145  28.365  1.00 0.00  ? 212  GLU A OE2    2  
ATOM   8110   H  H      . GLU A 1 212 ? -38.944 -5.697  24.735  1.00 0.00  ? 212  GLU A H      2  
ATOM   8111   H  HA     . GLU A 1 212 ? -36.048 -4.962  24.573  1.00 0.00  ? 212  GLU A HA     2  
ATOM   8112   H  HB2    . GLU A 1 212 ? -37.515 -4.022  26.373  1.00 0.00  ? 212  GLU A HB2    2  
ATOM   8113   H  HB3    . GLU A 1 212 ? -37.811 -5.664  26.944  1.00 0.00  ? 212  GLU A HB3    2  
ATOM   8114   H  HG2    . GLU A 1 212 ? -35.702 -5.889  27.821  1.00 0.00  ? 212  GLU A HG2    2  
ATOM   8115   H  HG3    . GLU A 1 212 ? -34.965 -4.874  26.581  1.00 0.00  ? 212  GLU A HG3    2  
ATOM   8116   N  N      . VAL A 1 213 ? -36.710 -7.790  24.099  1.00 0.00  ? 213  VAL A N      2  
ATOM   8117   C  CA     . VAL A 1 213 ? -36.327 -9.232  24.102  1.00 0.00  ? 213  VAL A CA     2  
ATOM   8118   C  C      . VAL A 1 213 ? -36.047 -9.707  22.671  1.00 0.00  ? 213  VAL A C      2  
ATOM   8119   O  O      . VAL A 1 213 ? -36.206 -10.869 22.349  1.00 0.00  ? 213  VAL A O      2  
ATOM   8120   C  CB     . VAL A 1 213 ? -37.537 -9.960  24.695  1.00 0.00  ? 213  VAL A CB     2  
ATOM   8121   C  CG1    . VAL A 1 213 ? -38.762 -9.736  23.806  1.00 0.00  ? 213  VAL A CG1    2  
ATOM   8122   C  CG2    . VAL A 1 213 ? -37.239 -11.459 24.784  1.00 0.00  ? 213  VAL A CG2    2  
ATOM   8123   H  H      . VAL A 1 213 ? -37.200 -7.415  23.338  1.00 0.00  ? 213  VAL A H      2  
ATOM   8124   H  HA     . VAL A 1 213 ? -35.461 -9.389  24.726  1.00 0.00  ? 213  VAL A HA     2  
ATOM   8125   H  HB     . VAL A 1 213 ? -37.737 -9.573  25.683  1.00 0.00  ? 213  VAL A HB     2  
ATOM   8126   H  HG11   . VAL A 1 213 ? -38.849 -8.686  23.571  1.00 0.00  ? 213  VAL A HG11   2  
ATOM   8127   H  HG12   . VAL A 1 213 ? -39.650 -10.064 24.327  1.00 0.00  ? 213  VAL A HG12   2  
ATOM   8128   H  HG13   . VAL A 1 213 ? -38.652 -10.302 22.893  1.00 0.00  ? 213  VAL A HG13   2  
ATOM   8129   H  HG21   . VAL A 1 213 ? -37.587 -11.949 23.887  1.00 0.00  ? 213  VAL A HG21   2  
ATOM   8130   H  HG22   . VAL A 1 213 ? -37.745 -11.876 25.643  1.00 0.00  ? 213  VAL A HG22   2  
ATOM   8131   H  HG23   . VAL A 1 213 ? -36.174 -11.609 24.885  1.00 0.00  ? 213  VAL A HG23   2  
ATOM   8132   N  N      . ASP A 1 214 ? -35.630 -8.815  21.810  1.00 0.00  ? 214  ASP A N      2  
ATOM   8133   C  CA     . ASP A 1 214 ? -35.336 -9.207  20.397  1.00 0.00  ? 214  ASP A CA     2  
ATOM   8134   C  C      . ASP A 1 214 ? -36.533 -9.944  19.784  1.00 0.00  ? 214  ASP A C      2  
ATOM   8135   O  O      . ASP A 1 214 ? -37.376 -9.280  19.203  1.00 0.00  ? 214  ASP A O      2  
ATOM   8136   C  CB     . ASP A 1 214 ? -34.120 -10.133 20.483  1.00 0.00  ? 214  ASP A CB     2  
ATOM   8137   C  CG     . ASP A 1 214 ? -33.478 -10.265 19.101  1.00 0.00  ? 214  ASP A CG     2  
ATOM   8138   O  OD1    . ASP A 1 214 ? -33.466 -9.281  18.379  1.00 0.00  ? 214  ASP A OD1    2  
ATOM   8139   O  OD2    . ASP A 1 214 ? -33.010 -11.347 18.788  1.00 0.00  ? 214  ASP A OD2    2  
ATOM   8140   O  OXT    . ASP A 1 214 ? -36.584 -11.156 19.907  1.00 0.00  ? 214  ASP A OXT    2  
ATOM   8141   H  H      . ASP A 1 214 ? -35.508 -7.885  22.092  1.00 0.00  ? 214  ASP A H      2  
ATOM   8142   H  HA     . ASP A 1 214 ? -35.091 -8.335  19.809  1.00 0.00  ? 214  ASP A HA     2  
ATOM   8143   H  HB2    . ASP A 1 214 ? -33.402 -9.720  21.177  1.00 0.00  ? 214  ASP A HB2    2  
ATOM   8144   H  HB3    . ASP A 1 214 ? -34.434 -11.107 20.826  1.00 0.00  ? 214  ASP A HB3    2  
ATOM   8145   O  OP3    . DG  B 2 1   ? 15.225  -16.425 11.880  1.00 0.00  ? 1    DG  B OP3    2  
ATOM   8146   P  P      . DG  B 2 1   ? 14.606  -16.983 10.521  1.00 0.00  ? 1    DG  B P      2  
ATOM   8147   O  OP1    . DG  B 2 1   ? 13.260  -16.382 10.340  1.00 0.00  ? 1    DG  B OP1    2  
ATOM   8148   O  OP2    . DG  B 2 1   ? 14.758  -18.460 10.511  1.00 0.00  ? 1    DG  B OP2    2  
ATOM   8149   O  "O5'"  . DG  B 2 1   ? 15.576  -16.370 9.416   1.00 0.00  ? 1    DG  B "O5'"  2  
ATOM   8150   C  "C5'"  . DG  B 2 1   ? 15.901  -17.107 8.233   1.00 0.00  ? 1    DG  B "C5'"  2  
ATOM   8151   C  "C4'"  . DG  B 2 1   ? 15.973  -16.192 7.034   1.00 0.00  ? 1    DG  B "C4'"  2  
ATOM   8152   O  "O4'"  . DG  B 2 1   ? 14.724  -15.477 6.917   1.00 0.00  ? 1    DG  B "O4'"  2  
ATOM   8153   C  "C3'"  . DG  B 2 1   ? 17.058  -15.124 7.116   1.00 0.00  ? 1    DG  B "C3'"  2  
ATOM   8154   O  "O3'"  . DG  B 2 1   ? 18.216  -15.587 6.422   1.00 0.00  ? 1    DG  B "O3'"  2  
ATOM   8155   C  "C2'"  . DG  B 2 1   ? 16.453  -13.918 6.416   1.00 0.00  ? 1    DG  B "C2'"  2  
ATOM   8156   C  "C1'"  . DG  B 2 1   ? 14.943  -14.146 6.482   1.00 0.00  ? 1    DG  B "C1'"  2  
ATOM   8157   N  N9     . DG  B 2 1   ? 14.234  -13.263 7.401   1.00 0.00  ? 1    DG  B N9     2  
ATOM   8158   C  C8     . DG  B 2 1   ? 13.650  -13.613 8.593   1.00 0.00  ? 1    DG  B C8     2  
ATOM   8159   N  N7     . DG  B 2 1   ? 13.077  -12.611 9.198   1.00 0.00  ? 1    DG  B N7     2  
ATOM   8160   C  C5     . DG  B 2 1   ? 13.298  -11.532 8.355   1.00 0.00  ? 1    DG  B C5     2  
ATOM   8161   C  C6     . DG  B 2 1   ? 12.909  -10.174 8.481   1.00 0.00  ? 1    DG  B C6     2  
ATOM   8162   O  O6     . DG  B 2 1   ? 12.270  -9.636  9.394   1.00 0.00  ? 1    DG  B O6     2  
ATOM   8163   N  N1     . DG  B 2 1   ? 13.341  -9.415  7.397   1.00 0.00  ? 1    DG  B N1     2  
ATOM   8164   C  C2     . DG  B 2 1   ? 14.056  -9.901  6.328   1.00 0.00  ? 1    DG  B C2     2  
ATOM   8165   N  N2     . DG  B 2 1   ? 14.382  -9.015  5.380   1.00 0.00  ? 1    DG  B N2     2  
ATOM   8166   N  N3     . DG  B 2 1   ? 14.425  -11.165 6.200   1.00 0.00  ? 1    DG  B N3     2  
ATOM   8167   C  C4     . DG  B 2 1   ? 14.014  -11.918 7.242   1.00 0.00  ? 1    DG  B C4     2  
ATOM   8168   H  "H5'"  . DG  B 2 1   ? 15.139  -17.866 8.056   1.00 0.00  ? 1    DG  B "H5'"  2  
ATOM   8169   H  "H5''" . DG  B 2 1   ? 16.866  -17.598 8.363   1.00 0.00  ? 1    DG  B "H5''" 2  
ATOM   8170   H  "H4'"  . DG  B 2 1   ? 16.201  -16.807 6.162   1.00 0.00  ? 1    DG  B "H4'"  2  
ATOM   8171   H  "H3'"  . DG  B 2 1   ? 17.322  -14.907 8.150   1.00 0.00  ? 1    DG  B "H3'"  2  
ATOM   8172   H  "H2'"  . DG  B 2 1   ? 16.747  -12.994 6.914   1.00 0.00  ? 1    DG  B "H2'"  2  
ATOM   8173   H  "H2''" . DG  B 2 1   ? 16.805  -13.850 5.388   1.00 0.00  ? 1    DG  B "H2''" 2  
ATOM   8174   H  "H1'"  . DG  B 2 1   ? 14.494  -14.041 5.494   1.00 0.00  ? 1    DG  B "H1'"  2  
ATOM   8175   H  H8     . DG  B 2 1   ? 13.663  -14.618 8.989   1.00 0.00  ? 1    DG  B H8     2  
ATOM   8176   H  H1     . DG  B 2 1   ? 13.111  -8.431  7.397   1.00 0.00  ? 1    DG  B H1     2  
ATOM   8177   H  H21    . DG  B 2 1   ? 14.908  -9.313  4.570   1.00 0.00  ? 1    DG  B H21    2  
ATOM   8178   H  H22    . DG  B 2 1   ? 14.102  -8.049  5.473   1.00 0.00  ? 1    DG  B H22    2  
ATOM   8179   H  "HO5'" . DG  B 2 1   ? 14.496  -16.287 12.489  1.00 0.00  ? 1    DG  B "HO5'" 2  
ATOM   8180   P  P      . DC  B 2 2   ? 19.658  -14.988 6.784   1.00 0.00  ? 2    DC  B P      2  
ATOM   8181   O  OP1    . DC  B 2 2   ? 20.675  -15.777 6.042   1.00 0.00  ? 2    DC  B OP1    2  
ATOM   8182   O  OP2    . DC  B 2 2   ? 19.762  -14.852 8.256   1.00 0.00  ? 2    DC  B OP2    2  
ATOM   8183   O  "O5'"  . DC  B 2 2   ? 19.629  -13.539 6.137   1.00 0.00  ? 2    DC  B "O5'"  2  
ATOM   8184   C  "C5'"  . DC  B 2 2   ? 19.790  -13.371 4.733   1.00 0.00  ? 2    DC  B "C5'"  2  
ATOM   8185   C  "C4'"  . DC  B 2 2   ? 20.043  -11.920 4.422   1.00 0.00  ? 2    DC  B "C4'"  2  
ATOM   8186   O  "O4'"  . DC  B 2 2   ? 18.938  -11.185 4.978   1.00 0.00  ? 2    DC  B "O4'"  2  
ATOM   8187   C  "C3'"  . DC  B 2 2   ? 21.303  -11.333 5.053   1.00 0.00  ? 2    DC  B "C3'"  2  
ATOM   8188   O  "O3'"  . DC  B 2 2   ? 21.814  -10.285 4.237   1.00 0.00  ? 2    DC  B "O3'"  2  
ATOM   8189   C  "C2'"  . DC  B 2 2   ? 20.800  -10.799 6.383   1.00 0.00  ? 2    DC  B "C2'"  2  
ATOM   8190   C  "C1'"  . DC  B 2 2   ? 19.379  -10.376 6.046   1.00 0.00  ? 2    DC  B "C1'"  2  
ATOM   8191   N  N1     . DC  B 2 2   ? 18.385  -10.470 7.124   1.00 0.00  ? 2    DC  B N1     2  
ATOM   8192   C  C2     . DC  B 2 2   ? 17.523  -9.410  7.250   1.00 0.00  ? 2    DC  B C2     2  
ATOM   8193   O  O2     . DC  B 2 2   ? 17.507  -8.558  6.354   1.00 0.00  ? 2    DC  B O2     2  
ATOM   8194   N  N3     . DC  B 2 2   ? 16.712  -9.328  8.313   1.00 0.00  ? 2    DC  B N3     2  
ATOM   8195   C  C4     . DC  B 2 2   ? 16.705  -10.300 9.217   1.00 0.00  ? 2    DC  B C4     2  
ATOM   8196   N  N4     . DC  B 2 2   ? 15.958  -10.107 10.299  1.00 0.00  ? 2    DC  B N4     2  
ATOM   8197   C  C5     . DC  B 2 2   ? 17.485  -11.486 9.056   1.00 0.00  ? 2    DC  B C5     2  
ATOM   8198   C  C6     . DC  B 2 2   ? 18.321  -11.522 8.002   1.00 0.00  ? 2    DC  B C6     2  
ATOM   8199   H  "H5'"  . DC  B 2 2   ? 18.886  -13.690 4.219   1.00 0.00  ? 2    DC  B "H5'"  2  
ATOM   8200   H  "H5''" . DC  B 2 2   ? 20.633  -13.967 4.386   1.00 0.00  ? 2    DC  B "H5''" 2  
ATOM   8201   H  "H4'"  . DC  B 2 2   ? 20.135  -11.808 3.340   1.00 0.00  ? 2    DC  B "H4'"  2  
ATOM   8202   H  "H3'"  . DC  B 2 2   ? 22.072  -12.092 5.182   1.00 0.00  ? 2    DC  B "H3'"  2  
ATOM   8203   H  "H2'"  . DC  B 2 2   ? 20.835  -11.562 7.154   1.00 0.00  ? 2    DC  B "H2'"  2  
ATOM   8204   H  "H2''" . DC  B 2 2   ? 21.406  -9.956  6.728   1.00 0.00  ? 2    DC  B "H2''" 2  
ATOM   8205   H  "H1'"  . DC  B 2 2   ? 19.376  -9.348  5.688   1.00 0.00  ? 2    DC  B "H1'"  2  
ATOM   8206   H  H41    . DC  B 2 2   ? 15.927  -10.802 11.025  1.00 0.00  ? 2    DC  B H41    2  
ATOM   8207   H  H42    . DC  B 2 2   ? 15.536  -9.187  10.404  1.00 0.00  ? 2    DC  B H42    2  
ATOM   8208   H  H5     . DC  B 2 2   ? 17.386  -12.333 9.739   1.00 0.00  ? 2    DC  B H5     2  
ATOM   8209   H  H6     . DC  B 2 2   ? 18.932  -12.408 7.832   1.00 0.00  ? 2    DC  B H6     2  
ATOM   8210   P  P      . DT  B 2 3   ? 23.142  -9.514  4.687   1.00 0.00  ? 3    DT  B P      2  
ATOM   8211   O  OP1    . DT  B 2 3   ? 23.651  -8.871  3.451   1.00 0.00  ? 3    DT  B OP1    2  
ATOM   8212   O  OP2    . DT  B 2 3   ? 24.009  -10.447 5.458   1.00 0.00  ? 3    DT  B OP2    2  
ATOM   8213   O  "O5'"  . DT  B 2 3   ? 22.594  -8.370  5.642   1.00 0.00  ? 3    DT  B "O5'"  2  
ATOM   8214   C  "C5'"  . DT  B 2 3   ? 21.407  -7.674  5.292   1.00 0.00  ? 3    DT  B "C5'"  2  
ATOM   8215   C  "C4'"  . DT  B 2 3   ? 21.652  -6.187  5.317   1.00 0.00  ? 3    DT  B "C4'"  2  
ATOM   8216   O  "O4'"  . DT  B 2 3   ? 20.940  -5.609  6.423   1.00 0.00  ? 3    DT  B "O4'"  2  
ATOM   8217   C  "C3'"  . DT  B 2 3   ? 23.108  -5.769  5.528   1.00 0.00  ? 3    DT  B "C3'"  2  
ATOM   8218   O  "O3'"  . DT  B 2 3   ? 23.364  -4.468  5.027   1.00 0.00  ? 3    DT  B "O3'"  2  
ATOM   8219   C  "C2'"  . DT  B 2 3   ? 23.245  -5.686  7.028   1.00 0.00  ? 3    DT  B "C2'"  2  
ATOM   8220   C  "C1'"  . DT  B 2 3   ? 21.854  -5.303  7.468   1.00 0.00  ? 3    DT  B "C1'"  2  
ATOM   8221   N  N1     . DT  B 2 3   ? 21.476  -6.068  8.616   1.00 0.00  ? 3    DT  B N1     2  
ATOM   8222   C  C2     . DT  B 2 3   ? 20.959  -5.403  9.685   1.00 0.00  ? 3    DT  B C2     2  
ATOM   8223   O  O2     . DT  B 2 3   ? 20.884  -4.185  9.739   1.00 0.00  ? 3    DT  B O2     2  
ATOM   8224   N  N3     . DT  B 2 3   ? 20.545  -6.208  10.705  1.00 0.00  ? 3    DT  B N3     2  
ATOM   8225   C  C4     . DT  B 2 3   ? 20.638  -7.598  10.766  1.00 0.00  ? 3    DT  B C4     2  
ATOM   8226   O  O4     . DT  B 2 3   ? 19.958  -8.210  11.588  1.00 0.00  ? 3    DT  B O4     2  
ATOM   8227   C  C5     . DT  B 2 3   ? 21.261  -8.211  9.611   1.00 0.00  ? 3    DT  B C5     2  
ATOM   8228   C  C7     . DT  B 2 3   ? 21.390  -9.692  9.557   1.00 0.00  ? 3    DT  B C7     2  
ATOM   8229   C  C6     . DT  B 2 3   ? 21.635  -7.433  8.604   1.00 0.00  ? 3    DT  B C6     2  
ATOM   8230   H  "H5'"  . DT  B 2 3   ? 20.612  -7.920  5.994   1.00 0.00  ? 3    DT  B "H5'"  2  
ATOM   8231   H  "H5''" . DT  B 2 3   ? 21.100  -7.961  4.286   1.00 0.00  ? 3    DT  B "H5''" 2  
ATOM   8232   H  "H4'"  . DT  B 2 3   ? 21.339  -5.790  4.352   1.00 0.00  ? 3    DT  B "H4'"  2  
ATOM   8233   H  "H3'"  . DT  B 2 3   ? 23.801  -6.481  5.082   1.00 0.00  ? 3    DT  B "H3'"  2  
ATOM   8234   H  "H2'"  . DT  B 2 3   ? 23.565  -6.639  7.448   1.00 0.00  ? 3    DT  B "H2'"  2  
ATOM   8235   H  "H2''" . DT  B 2 3   ? 23.983  -4.938  7.320   1.00 0.00  ? 3    DT  B "H2''" 2  
ATOM   8236   H  "H1'"  . DT  B 2 3   ? 21.773  -4.244  7.704   1.00 0.00  ? 3    DT  B "H1'"  2  
ATOM   8237   H  H3     . DT  B 2 3   ? 19.994  -5.669  11.370  1.00 0.00  ? 3    DT  B H3     2  
ATOM   8238   H  H71    . DT  B 2 3   ? 20.549  -10.103 9.001   1.00 0.00  ? 3    DT  B H71    2  
ATOM   8239   H  H72    . DT  B 2 3   ? 22.322  -9.956  9.058   1.00 0.00  ? 3    DT  B H72    2  
ATOM   8240   H  H73    . DT  B 2 3   ? 21.390  -10.092 10.568  1.00 0.00  ? 3    DT  B H73    2  
ATOM   8241   H  H6     . DT  B 2 3   ? 22.095  -7.903  7.727   1.00 0.00  ? 3    DT  B H6     2  
ATOM   8242   P  P      . DG  B 2 4   ? 24.747  -3.738  5.389   1.00 0.00  ? 4    DG  B P      2  
ATOM   8243   O  OP1    . DG  B 2 4   ? 25.066  -2.983  4.161   1.00 0.00  ? 4    DG  B OP1    2  
ATOM   8244   O  OP2    . DG  B 2 4   ? 25.731  -4.709  5.953   1.00 0.00  ? 4    DG  B OP2    2  
ATOM   8245   O  "O5'"  . DG  B 2 4   ? 24.387  -2.680  6.525   1.00 0.00  ? 4    DG  B "O5'"  2  
ATOM   8246   C  "C5'"  . DG  B 2 4   ? 23.040  -2.279  6.747   1.00 0.00  ? 4    DG  B "C5'"  2  
ATOM   8247   C  "C4'"  . DG  B 2 4   ? 22.956  -1.341  7.932   1.00 0.00  ? 4    DG  B "C4'"  2  
ATOM   8248   O  "O4'"  . DG  B 2 4   ? 22.236  -2.120  8.918   1.00 0.00  ? 4    DG  B "O4'"  2  
ATOM   8249   C  "C3'"  . DG  B 2 4   ? 24.280  -0.910  8.620   1.00 0.00  ? 4    DG  B "C3'"  2  
ATOM   8250   O  "O3'"  . DG  B 2 4   ? 24.181  0.274   9.536   1.00 0.00  ? 4    DG  B "O3'"  2  
ATOM   8251   C  "C2'"  . DG  B 2 4   ? 24.492  -2.144  9.494   1.00 0.00  ? 4    DG  B "C2'"  2  
ATOM   8252   C  "C1'"  . DG  B 2 4   ? 23.098  -2.376  10.010  1.00 0.00  ? 4    DG  B "C1'"  2  
ATOM   8253   N  N9     . DG  B 2 4   ? 22.823  -3.703  10.552  1.00 0.00  ? 4    DG  B N9     2  
ATOM   8254   C  C8     . DG  B 2 4   ? 23.291  -4.939  10.165  1.00 0.00  ? 4    DG  B C8     2  
ATOM   8255   N  N7     . DG  B 2 4   ? 22.829  -5.915  10.909  1.00 0.00  ? 4    DG  B N7     2  
ATOM   8256   C  C5     . DG  B 2 4   ? 22.005  -5.275  11.830  1.00 0.00  ? 4    DG  B C5     2  
ATOM   8257   C  C6     . DG  B 2 4   ? 21.182  -5.795  12.871  1.00 0.00  ? 4    DG  B C6     2  
ATOM   8258   O  O6     . DG  B 2 4   ? 21.016  -6.970  13.211  1.00 0.00  ? 4    DG  B O6     2  
ATOM   8259   N  N1     . DG  B 2 4   ? 20.486  -4.780  13.524  1.00 0.00  ? 4    DG  B N1     2  
ATOM   8260   C  C2     . DG  B 2 4   ? 20.585  -3.442  13.232  1.00 0.00  ? 4    DG  B C2     2  
ATOM   8261   N  N2     . DG  B 2 4   ? 19.872  -2.605  13.986  1.00 0.00  ? 4    DG  B N2     2  
ATOM   8262   N  N3     . DG  B 2 4   ? 21.332  -2.956  12.272  1.00 0.00  ? 4    DG  B N3     2  
ATOM   8263   C  C4     . DG  B 2 4   ? 22.000  -3.916  11.614  1.00 0.00  ? 4    DG  B C4     2  
ATOM   8264   H  "H5'"  . DG  B 2 4   ? 22.433  -3.160  6.954   1.00 0.00  ? 4    DG  B "H5'"  2  
ATOM   8265   H  "H5''" . DG  B 2 4   ? 22.645  -1.780  5.864   1.00 0.00  ? 4    DG  B "H5''" 2  
ATOM   8266   H  "H4'"  . DG  B 2 4   ? 22.428  -0.445  7.624   1.00 0.00  ? 4    DG  B "H4'"  2  
ATOM   8267   H  "H3'"  . DG  B 2 4   ? 25.093  -0.761  7.888   1.00 0.00  ? 4    DG  B "H3'"  2  
ATOM   8268   H  "H2'"  . DG  B 2 4   ? 24.854  -2.992  8.915   1.00 0.00  ? 4    DG  B "H2'"  2  
ATOM   8269   H  "H2''" . DG  B 2 4   ? 25.198  -1.960  10.297  1.00 0.00  ? 4    DG  B "H2''" 2  
ATOM   8270   H  "H1'"  . DG  B 2 4   ? 22.857  -1.655  10.776  1.00 0.00  ? 4    DG  B "H1'"  2  
ATOM   8271   H  H8     . DG  B 2 4   ? 23.933  -5.093  9.314   1.00 0.00  ? 4    DG  B H8     2  
ATOM   8272   H  H1     . DG  B 2 4   ? 19.849  -5.040  14.258  1.00 0.00  ? 4    DG  B H1     2  
ATOM   8273   H  H21    . DG  B 2 4   ? 19.917  -1.608  13.813  1.00 0.00  ? 4    DG  B H21    2  
ATOM   8274   H  H22    . DG  B 2 4   ? 19.270  -2.975  14.704  1.00 0.00  ? 4    DG  B H22    2  
ATOM   8275   P  P      . DG  B 2 5   ? 25.049  1.663   9.297   1.00 0.00  ? 5    DG  B P      2  
ATOM   8276   O  OP1    . DG  B 2 5   ? 24.588  2.329   8.051   1.00 0.00  ? 5    DG  B OP1    2  
ATOM   8277   O  OP2    . DG  B 2 5   ? 26.511  1.544   9.547   1.00 0.00  ? 5    DG  B OP2    2  
ATOM   8278   O  "O5'"  . DG  B 2 5   ? 24.600  2.641   10.479  1.00 0.00  ? 5    DG  B "O5'"  2  
ATOM   8279   C  "C5'"  . DG  B 2 5   ? 23.244  2.722   10.912  1.00 0.00  ? 5    DG  B "C5'"  2  
ATOM   8280   C  "C4'"  . DG  B 2 5   ? 23.166  2.648   12.421  1.00 0.00  ? 5    DG  B "C4'"  2  
ATOM   8281   O  "O4'"  . DG  B 2 5   ? 22.956  1.267   12.823  1.00 0.00  ? 5    DG  B "O4'"  2  
ATOM   8282   C  "C3'"  . DG  B 2 5   ? 24.394  3.114   13.215  1.00 0.00  ? 5    DG  B "C3'"  2  
ATOM   8283   O  "O3'"  . DG  B 2 5   ? 23.940  3.762   14.410  1.00 0.00  ? 5    DG  B "O3'"  2  
ATOM   8284   C  "C2'"  . DG  B 2 5   ? 25.100  1.812   13.551  1.00 0.00  ? 5    DG  B "C2'"  2  
ATOM   8285   C  "C1'"  . DG  B 2 5   ? 23.921  0.909   13.806  1.00 0.00  ? 5    DG  B "C1'"  2  
ATOM   8286   N  N9     . DG  B 2 5   ? 24.236  -0.505  13.653  1.00 0.00  ? 5    DG  B N9     2  
ATOM   8287   C  C8     . DG  B 2 5   ? 25.096  -1.004  12.727  1.00 0.00  ? 5    DG  B C8     2  
ATOM   8288   N  N7     . DG  B 2 5   ? 25.209  -2.303  12.764  1.00 0.00  ? 5    DG  B N7     2  
ATOM   8289   C  C5     . DG  B 2 5   ? 24.367  -2.687  13.794  1.00 0.00  ? 5    DG  B C5     2  
ATOM   8290   C  C6     . DG  B 2 5   ? 24.065  -3.978  14.299  1.00 0.00  ? 5    DG  B C6     2  
ATOM   8291   O  O6     . DG  B 2 5   ? 24.487  -5.076  13.914  1.00 0.00  ? 5    DG  B O6     2  
ATOM   8292   N  N1     . DG  B 2 5   ? 23.167  -3.914  15.355  1.00 0.00  ? 5    DG  B N1     2  
ATOM   8293   C  C2     . DG  B 2 5   ? 22.623  -2.758  15.860  1.00 0.00  ? 5    DG  B C2     2  
ATOM   8294   N  N2     . DG  B 2 5   ? 21.782  -2.903  16.884  1.00 0.00  ? 5    DG  B N2     2  
ATOM   8295   N  N3     . DG  B 2 5   ? 22.889  -1.548  15.394  1.00 0.00  ? 5    DG  B N3     2  
ATOM   8296   C  C4     . DG  B 2 5   ? 23.762  -1.587  14.366  1.00 0.00  ? 5    DG  B C4     2  
ATOM   8297   H  "H5'"  . DG  B 2 5   ? 22.677  1.897   10.484  1.00 0.00  ? 5    DG  B "H5'"  2  
ATOM   8298   H  "H5''" . DG  B 2 5   ? 22.804  3.667   10.581  1.00 0.00  ? 5    DG  B "H5''" 2  
ATOM   8299   H  "H4'"  . DG  B 2 5   ? 22.347  3.302   12.727  1.00 0.00  ? 5    DG  B "H4'"  2  
ATOM   8300   H  "H3'"  . DG  B 2 5   ? 25.025  3.796   12.642  1.00 0.00  ? 5    DG  B "H3'"  2  
ATOM   8301   H  "H2'"  . DG  B 2 5   ? 25.717  1.463   12.722  1.00 0.00  ? 5    DG  B "H2'"  2  
ATOM   8302   H  "H2''" . DG  B 2 5   ? 25.747  1.910   14.424  1.00 0.00  ? 5    DG  B "H2''" 2  
ATOM   8303   H  "H1'"  . DG  B 2 5   ? 23.495  1.078   14.789  1.00 0.00  ? 5    DG  B "H1'"  2  
ATOM   8304   H  H8     . DG  B 2 5   ? 25.632  -0.377  12.037  1.00 0.00  ? 5    DG  B H8     2  
ATOM   8305   H  H1     . DG  B 2 5   ? 22.899  -4.789  15.774  1.00 0.00  ? 5    DG  B H1     2  
ATOM   8306   H  H21    . DG  B 2 5   ? 21.372  -2.068  17.270  1.00 0.00  ? 5    DG  B H21    2  
ATOM   8307   H  H22    . DG  B 2 5   ? 21.554  -3.814  17.260  1.00 0.00  ? 5    DG  B H22    2  
ATOM   8308   P  P      . DC  B 2 6   ? 24.962  4.621   15.301  1.00 0.00  ? 6    DC  B P      2  
ATOM   8309   O  OP1    . DC  B 2 6   ? 24.365  5.975   15.434  1.00 0.00  ? 6    DC  B OP1    2  
ATOM   8310   O  OP2    . DC  B 2 6   ? 26.325  4.473   14.733  1.00 0.00  ? 6    DC  B OP2    2  
ATOM   8311   O  "O5'"  . DC  B 2 6   ? 24.924  3.912   16.730  1.00 0.00  ? 6    DC  B "O5'"  2  
ATOM   8312   C  "C5'"  . DC  B 2 6   ? 23.678  3.617   17.370  1.00 0.00  ? 6    DC  B "C5'"  2  
ATOM   8313   C  "C4'"  . DC  B 2 6   ? 23.876  2.598   18.470  1.00 0.00  ? 6    DC  B "C4'"  2  
ATOM   8314   O  "O4'"  . DC  B 2 6   ? 23.989  1.275   17.882  1.00 0.00  ? 6    DC  B "O4'"  2  
ATOM   8315   C  "C3'"  . DC  B 2 6   ? 25.140  2.766   19.318  1.00 0.00  ? 6    DC  B "C3'"  2  
ATOM   8316   O  "O3'"  . DC  B 2 6   ? 24.899  2.353   20.664  1.00 0.00  ? 6    DC  B "O3'"  2  
ATOM   8317   C  "C2'"  . DC  B 2 6   ? 26.098  1.781   18.682  1.00 0.00  ? 6    DC  B "C2'"  2  
ATOM   8318   C  "C1'"  . DC  B 2 6   ? 25.143  0.650   18.417  1.00 0.00  ? 6    DC  B "C1'"  2  
ATOM   8319   N  N1     . DC  B 2 6   ? 25.621  -0.354  17.463  1.00 0.00  ? 6    DC  B N1     2  
ATOM   8320   C  C2     . DC  B 2 6   ? 25.297  -1.693  17.671  1.00 0.00  ? 6    DC  B C2     2  
ATOM   8321   O  O2     . DC  B 2 6   ? 24.608  -2.001  18.649  1.00 0.00  ? 6    DC  B O2     2  
ATOM   8322   N  N3     . DC  B 2 6   ? 25.747  -2.622  16.800  1.00 0.00  ? 6    DC  B N3     2  
ATOM   8323   C  C4     . DC  B 2 6   ? 26.493  -2.248  15.761  1.00 0.00  ? 6    DC  B C4     2  
ATOM   8324   N  N4     . DC  B 2 6   ? 26.911  -3.195  14.921  1.00 0.00  ? 6    DC  B N4     2  
ATOM   8325   C  C5     . DC  B 2 6   ? 26.838  -0.885  15.534  1.00 0.00  ? 6    DC  B C5     2  
ATOM   8326   C  C6     . DC  B 2 6   ? 26.381  0.016   16.395  1.00 0.00  ? 6    DC  B C6     2  
ATOM   8327   H  "H5'"  . DC  B 2 6   ? 22.978  3.217   16.638  1.00 0.00  ? 6    DC  B "H5'"  2  
ATOM   8328   H  "H5''" . DC  B 2 6   ? 23.264  4.527   17.802  1.00 0.00  ? 6    DC  B "H5''" 2  
ATOM   8329   H  "H4'"  . DC  B 2 6   ? 23.031  2.688   19.153  1.00 0.00  ? 6    DC  B "H4'"  2  
ATOM   8330   H  "H3'"  . DC  B 2 6   ? 25.513  3.791   19.303  1.00 0.00  ? 6    DC  B "H3'"  2  
ATOM   8331   H  "H2'"  . DC  B 2 6   ? 26.538  2.175   17.771  1.00 0.00  ? 6    DC  B "H2'"  2  
ATOM   8332   H  "H2''" . DC  B 2 6   ? 26.907  1.504   19.357  1.00 0.00  ? 6    DC  B "H2''" 2  
ATOM   8333   H  "H1'"  . DC  B 2 6   ? 24.861  0.151   19.339  1.00 0.00  ? 6    DC  B "H1'"  2  
ATOM   8334   H  H41    . DC  B 2 6   ? 27.476  -2.962  14.115  1.00 0.00  ? 6    DC  B H41    2  
ATOM   8335   H  H42    . DC  B 2 6   ? 26.642  -4.151  15.108  1.00 0.00  ? 6    DC  B H42    2  
ATOM   8336   H  H5     . DC  B 2 6   ? 27.454  -0.593  14.695  1.00 0.00  ? 6    DC  B H5     2  
ATOM   8337   H  H6     . DC  B 2 6   ? 26.619  1.067   16.241  1.00 0.00  ? 6    DC  B H6     2  
ATOM   8338   P  P      . DT  B 2 7   ? 24.594  3.445   21.792  1.00 0.00  ? 7    DT  B P      2  
ATOM   8339   O  OP1    . DT  B 2 7   ? 23.542  4.360   21.277  1.00 0.00  ? 7    DT  B OP1    2  
ATOM   8340   O  OP2    . DT  B 2 7   ? 25.903  3.998   22.224  1.00 0.00  ? 7    DT  B OP2    2  
ATOM   8341   O  "O5'"  . DT  B 2 7   ? 23.993  2.580   22.986  1.00 0.00  ? 7    DT  B "O5'"  2  
ATOM   8342   C  "C5'"  . DT  B 2 7   ? 22.892  1.694   22.771  1.00 0.00  ? 7    DT  B "C5'"  2  
ATOM   8343   C  "C4'"  . DT  B 2 7   ? 23.176  0.348   23.395  1.00 0.00  ? 7    DT  B "C4'"  2  
ATOM   8344   O  "O4'"  . DT  B 2 7   ? 24.080  -0.387  22.535  1.00 0.00  ? 7    DT  B "O4'"  2  
ATOM   8345   C  "C3'"  . DT  B 2 7   ? 23.846  0.398   24.772  1.00 0.00  ? 7    DT  B "C3'"  2  
ATOM   8346   O  "O3'"  . DT  B 2 7   ? 23.222  -0.543  25.651  1.00 0.00  ? 7    DT  B "O3'"  2  
ATOM   8347   C  "C2'"  . DT  B 2 7   ? 25.284  -0.005  24.491  1.00 0.00  ? 7    DT  B "C2'"  2  
ATOM   8348   C  "C1'"  . DT  B 2 7   ? 25.115  -0.945  23.319  1.00 0.00  ? 7    DT  B "C1'"  2  
ATOM   8349   N  N1     . DT  B 2 7   ? 26.306  -1.085  22.469  1.00 0.00  ? 7    DT  B N1     2  
ATOM   8350   C  C2     . DT  B 2 7   ? 26.673  -2.348  22.070  1.00 0.00  ? 7    DT  B C2     2  
ATOM   8351   O  O2     . DT  B 2 7   ? 26.063  -3.353  22.397  1.00 0.00  ? 7    DT  B O2     2  
ATOM   8352   N  N3     . DT  B 2 7   ? 27.786  -2.395  21.273  1.00 0.00  ? 7    DT  B N3     2  
ATOM   8353   C  C4     . DT  B 2 7   ? 28.550  -1.328  20.846  1.00 0.00  ? 7    DT  B C4     2  
ATOM   8354   O  O4     . DT  B 2 7   ? 29.529  -1.522  20.131  1.00 0.00  ? 7    DT  B O4     2  
ATOM   8355   C  C5     . DT  B 2 7   ? 28.109  -0.031  21.309  1.00 0.00  ? 7    DT  B C5     2  
ATOM   8356   C  C7     . DT  B 2 7   ? 28.882  1.183   20.906  1.00 0.00  ? 7    DT  B C7     2  
ATOM   8357   C  C6     . DT  B 2 7   ? 27.023  0.029   22.090  1.00 0.00  ? 7    DT  B C6     2  
ATOM   8358   H  "H5'"  . DT  B 2 7   ? 22.728  1.565   21.700  1.00 0.00  ? 7    DT  B "H5'"  2  
ATOM   8359   H  "H5''" . DT  B 2 7   ? 21.994  2.114   23.222  1.00 0.00  ? 7    DT  B "H5''" 2  
ATOM   8360   H  "H4'"  . DT  B 2 7   ? 22.218  -0.155  23.535  1.00 0.00  ? 7    DT  B "H4'"  2  
ATOM   8361   H  "H3'"  . DT  B 2 7   ? 23.779  1.395   25.207  1.00 0.00  ? 7    DT  B "H3'"  2  
ATOM   8362   H  "H2'"  . DT  B 2 7   ? 25.899  0.860   24.244  1.00 0.00  ? 7    DT  B "H2'"  2  
ATOM   8363   H  "H2''" . DT  B 2 7   ? 25.736  -0.496  25.354  1.00 0.00  ? 7    DT  B "H2''" 2  
ATOM   8364   H  "H1'"  . DT  B 2 7   ? 24.798  -1.937  23.648  1.00 0.00  ? 7    DT  B "H1'"  2  
ATOM   8365   H  H3     . DT  B 2 7   ? 28.078  -3.313  20.970  1.00 0.00  ? 7    DT  B H3     2  
ATOM   8366   H  H71    . DT  B 2 7   ? 28.293  2.076   21.117  1.00 0.00  ? 7    DT  B H71    2  
ATOM   8367   H  H72    . DT  B 2 7   ? 29.815  1.222   21.467  1.00 0.00  ? 7    DT  B H72    2  
ATOM   8368   H  H73    . DT  B 2 7   ? 29.101  1.138   19.838  1.00 0.00  ? 7    DT  B H73    2  
ATOM   8369   H  H6     . DT  B 2 7   ? 26.692  1.005   22.445  1.00 0.00  ? 7    DT  B H6     2  
ATOM   8370   P  P      . DT  B 2 8   ? 23.727  -0.674  27.170  1.00 0.00  ? 8    DT  B P      2  
ATOM   8371   O  OP1    . DT  B 2 8   ? 22.543  -1.018  27.999  1.00 0.00  ? 8    DT  B OP1    2  
ATOM   8372   O  OP2    . DT  B 2 8   ? 24.531  0.528   27.504  1.00 0.00  ? 8    DT  B OP2    2  
ATOM   8373   O  "O5'"  . DT  B 2 8   ? 24.691  -1.940  27.147  1.00 0.00  ? 8    DT  B "O5'"  2  
ATOM   8374   C  "C5'"  . DT  B 2 8   ? 24.162  -3.260  27.039  1.00 0.00  ? 8    DT  B "C5'"  2  
ATOM   8375   C  "C4'"  . DT  B 2 8   ? 25.279  -4.275  27.103  1.00 0.00  ? 8    DT  B "C4'"  2  
ATOM   8376   O  "O4'"  . DT  B 2 8   ? 26.155  -4.075  25.969  1.00 0.00  ? 8    DT  B "O4'"  2  
ATOM   8377   C  "C3'"  . DT  B 2 8   ? 26.164  -4.179  28.353  1.00 0.00  ? 8    DT  B "C3'"  2  
ATOM   8378   O  "O3'"  . DT  B 2 8   ? 26.188  -5.437  29.030  1.00 0.00  ? 8    DT  B "O3'"  2  
ATOM   8379   C  "C2'"  . DT  B 2 8   ? 27.546  -3.833  27.821  1.00 0.00  ? 8    DT  B "C2'"  2  
ATOM   8380   C  "C1'"  . DT  B 2 8   ? 27.482  -4.303  26.383  1.00 0.00  ? 8    DT  B "C1'"  2  
ATOM   8381   N  N1     . DT  B 2 8   ? 28.379  -3.580  25.466  1.00 0.00  ? 8    DT  B N1     2  
ATOM   8382   C  C2     . DT  B 2 8   ? 29.238  -4.322  24.689  1.00 0.00  ? 8    DT  B C2     2  
ATOM   8383   O  O2     . DT  B 2 8   ? 29.282  -5.539  24.722  1.00 0.00  ? 8    DT  B O2     2  
ATOM   8384   N  N3     . DT  B 2 8   ? 30.046  -3.581  23.867  1.00 0.00  ? 8    DT  B N3     2  
ATOM   8385   C  C4     . DT  B 2 8   ? 30.078  -2.206  23.748  1.00 0.00  ? 8    DT  B C4     2  
ATOM   8386   O  O4     . DT  B 2 8   ? 30.860  -1.678  22.962  1.00 0.00  ? 8    DT  B O4     2  
ATOM   8387   C  C5     . DT  B 2 8   ? 29.148  -1.492  24.594  1.00 0.00  ? 8    DT  B C5     2  
ATOM   8388   C  C7     . DT  B 2 8   ? 29.120  0.002   24.535  1.00 0.00  ? 8    DT  B C7     2  
ATOM   8389   C  C6     . DT  B 2 8   ? 28.351  -2.202  25.402  1.00 0.00  ? 8    DT  B C6     2  
ATOM   8390   H  "H5'"  . DT  B 2 8   ? 23.634  -3.367  26.091  1.00 0.00  ? 8    DT  B "H5'"  2  
ATOM   8391   H  "H5''" . DT  B 2 8   ? 23.466  -3.443  27.858  1.00 0.00  ? 8    DT  B "H5''" 2  
ATOM   8392   H  "H4'"  . DT  B 2 8   ? 24.821  -5.265  27.122  1.00 0.00  ? 8    DT  B "H4'"  2  
ATOM   8393   H  "H3'"  . DT  B 2 8   ? 25.792  -3.416  29.036  1.00 0.00  ? 8    DT  B "H3'"  2  
ATOM   8394   H  "H2'"  . DT  B 2 8   ? 27.742  -2.760  27.898  1.00 0.00  ? 8    DT  B "H2'"  2  
ATOM   8395   H  "H2''" . DT  B 2 8   ? 28.326  -4.345  28.384  1.00 0.00  ? 8    DT  B "H2''" 2  
ATOM   8396   H  "H1'"  . DT  B 2 8   ? 27.686  -5.375  26.304  1.00 0.00  ? 8    DT  B "H1'"  2  
ATOM   8397   H  H3     . DT  B 2 8   ? 30.692  -4.100  23.293  1.00 0.00  ? 8    DT  B H3     2  
ATOM   8398   H  H71    . DT  B 2 8   ? 28.110  0.355   24.744  1.00 0.00  ? 8    DT  B H71    2  
ATOM   8399   H  H72    . DT  B 2 8   ? 29.808  0.408   25.278  1.00 0.00  ? 8    DT  B H72    2  
ATOM   8400   H  H73    . DT  B 2 8   ? 29.422  0.333   23.542  1.00 0.00  ? 8    DT  B H73    2  
ATOM   8401   H  H6     . DT  B 2 8   ? 27.649  -1.667  26.041  1.00 0.00  ? 8    DT  B H6     2  
ATOM   8402   P  P      . DC  B 2 9   ? 27.058  -5.604  30.369  1.00 0.00  ? 9    DC  B P      2  
ATOM   8403   O  OP1    . DC  B 2 9   ? 26.419  -6.636  31.224  1.00 0.00  ? 9    DC  B OP1    2  
ATOM   8404   O  OP2    . DC  B 2 9   ? 27.298  -4.244  30.914  1.00 0.00  ? 9    DC  B OP2    2  
ATOM   8405   O  "O5'"  . DC  B 2 9   ? 28.448  -6.175  29.850  1.00 0.00  ? 9    DC  B "O5'"  2  
ATOM   8406   C  "C5'"  . DC  B 2 9   ? 28.622  -7.567  29.599  1.00 0.00  ? 9    DC  B "C5'"  2  
ATOM   8407   C  "C4'"  . DC  B 2 9   ? 30.048  -7.838  29.185  1.00 0.00  ? 9    DC  B "C4'"  2  
ATOM   8408   O  "O4'"  . DC  B 2 9   ? 30.334  -7.073  27.995  1.00 0.00  ? 9    DC  B "O4'"  2  
ATOM   8409   C  "C3'"  . DC  B 2 9   ? 31.108  -7.417  30.211  1.00 0.00  ? 9    DC  B "C3'"  2  
ATOM   8410   O  "O3'"  . DC  B 2 9   ? 31.707  -8.568  30.802  1.00 0.00  ? 9    DC  B "O3'"  2  
ATOM   8411   C  "C2'"  . DC  B 2 9   ? 32.149  -6.645  29.413  1.00 0.00  ? 9    DC  B "C2'"  2  
ATOM   8412   C  "C1'"  . DC  B 2 9   ? 31.719  -6.837  27.964  1.00 0.00  ? 9    DC  B "C1'"  2  
ATOM   8413   N  N1     . DC  B 2 9   ? 31.969  -5.669  27.111  1.00 0.00  ? 9    DC  B N1     2  
ATOM   8414   C  C2     . DC  B 2 9   ? 32.862  -5.801  26.049  1.00 0.00  ? 9    DC  B C2     2  
ATOM   8415   O  O2     . DC  B 2 9   ? 33.377  -6.908  25.835  1.00 0.00  ? 9    DC  B O2     2  
ATOM   8416   N  N3     . DC  B 2 9   ? 33.140  -4.725  25.282  1.00 0.00  ? 9    DC  B N3     2  
ATOM   8417   C  C4     . DC  B 2 9   ? 32.559  -3.553  25.544  1.00 0.00  ? 9    DC  B C4     2  
ATOM   8418   N  N4     . DC  B 2 9   ? 32.886  -2.513  24.779  1.00 0.00  ? 9    DC  B N4     2  
ATOM   8419   C  C5     . DC  B 2 9   ? 31.626  -3.393  26.610  1.00 0.00  ? 9    DC  B C5     2  
ATOM   8420   C  C6     . DC  B 2 9   ? 31.358  -4.469  27.358  1.00 0.00  ? 9    DC  B C6     2  
ATOM   8421   H  "H5'"  . DC  B 2 9   ? 27.949  -7.885  28.802  1.00 0.00  ? 9    DC  B "H5'"  2  
ATOM   8422   H  "H5''" . DC  B 2 9   ? 28.396  -8.133  30.505  1.00 0.00  ? 9    DC  B "H5''" 2  
ATOM   8423   H  "H4'"  . DC  B 2 9   ? 30.155  -8.916  29.043  1.00 0.00  ? 9    DC  B "H4'"  2  
ATOM   8424   H  "H3'"  . DC  B 2 9   ? 30.665  -6.804  30.996  1.00 0.00  ? 9    DC  B "H3'"  2  
ATOM   8425   H  "H2'"  . DC  B 2 9   ? 32.160  -5.590  29.707  1.00 0.00  ? 9    DC  B "H2'"  2  
ATOM   8426   H  "H2''" . DC  B 2 9   ? 33.150  -7.038  29.594  1.00 0.00  ? 9    DC  B "H2''" 2  
ATOM   8427   H  "H1'"  . DC  B 2 9   ? 32.206  -7.710  27.516  1.00 0.00  ? 9    DC  B "H1'"  2  
ATOM   8428   H  H41    . DC  B 2 9   ? 32.470  -1.610  24.959  1.00 0.00  ? 9    DC  B H41    2  
ATOM   8429   H  H42    . DC  B 2 9   ? 33.539  -2.636  24.018  1.00 0.00  ? 9    DC  B H42    2  
ATOM   8430   H  H5     . DC  B 2 9   ? 31.152  -2.433  26.808  1.00 0.00  ? 9    DC  B H5     2  
ATOM   8431   H  H6     . DC  B 2 9   ? 30.638  -4.387  28.171  1.00 0.00  ? 9    DC  B H6     2  
ATOM   8432   P  P      . DG  B 2 10  ? 32.887  -8.387  31.874  1.00 0.00  ? 10   DG  B P      2  
ATOM   8433   O  OP1    . DG  B 2 10  ? 33.099  -9.701  32.532  1.00 0.00  ? 10   DG  B OP1    2  
ATOM   8434   O  OP2    . DG  B 2 10  ? 32.551  -7.198  32.697  1.00 0.00  ? 10   DG  B OP2    2  
ATOM   8435   O  "O5'"  . DG  B 2 10  ? 34.173  -8.033  30.998  1.00 0.00  ? 10   DG  B "O5'"  2  
ATOM   8436   C  "C5'"  . DG  B 2 10  ? 34.838  -9.031  30.224  1.00 0.00  ? 10   DG  B "C5'"  2  
ATOM   8437   C  "C4'"  . DG  B 2 10  ? 36.108  -8.471  29.623  1.00 0.00  ? 10   DG  B "C4'"  2  
ATOM   8438   O  "O4'"  . DG  B 2 10  ? 35.788  -7.636  28.488  1.00 0.00  ? 10   DG  B "O4'"  2  
ATOM   8439   C  "C3'"  . DG  B 2 10  ? 36.934  -7.568  30.532  1.00 0.00  ? 10   DG  B "C3'"  2  
ATOM   8440   O  "O3'"  . DG  B 2 10  ? 37.811  -8.338  31.359  1.00 0.00  ? 10   DG  B "O3'"  2  
ATOM   8441   C  "C2'"  . DG  B 2 10  ? 37.730  -6.743  29.537  1.00 0.00  ? 10   DG  B "C2'"  2  
ATOM   8442   C  "C1'"  . DG  B 2 10  ? 36.782  -6.621  28.344  1.00 0.00  ? 10   DG  B "C1'"  2  
ATOM   8443   N  N9     . DG  B 2 10  ? 36.101  -5.334  28.251  1.00 0.00  ? 10   DG  B N9     2  
ATOM   8444   C  C8     . DG  B 2 10  ? 34.897  -4.990  28.814  1.00 0.00  ? 10   DG  B C8     2  
ATOM   8445   N  N7     . DG  B 2 10  ? 34.537  -3.764  28.553  1.00 0.00  ? 10   DG  B N7     2  
ATOM   8446   C  C5     . DG  B 2 10  ? 35.569  -3.265  27.772  1.00 0.00  ? 10   DG  B C5     2  
ATOM   8447   C  C6     . DG  B 2 10  ? 35.741  -1.983  27.188  1.00 0.00  ? 10   DG  B C6     2  
ATOM   8448   O  O6     . DG  B 2 10  ? 34.991  -1.002  27.250  1.00 0.00  ? 10   DG  B O6     2  
ATOM   8449   N  N1     . DG  B 2 10  ? 36.931  -1.902  26.472  1.00 0.00  ? 10   DG  B N1     2  
ATOM   8450   C  C2     . DG  B 2 10  ? 37.843  -2.922  26.339  1.00 0.00  ? 10   DG  B C2     2  
ATOM   8451   N  N2     . DG  B 2 10  ? 38.934  -2.648  25.612  1.00 0.00  ? 10   DG  B N2     2  
ATOM   8452   N  N3     . DG  B 2 10  ? 37.695  -4.121  26.880  1.00 0.00  ? 10   DG  B N3     2  
ATOM   8453   C  C4     . DG  B 2 10  ? 36.543  -4.222  27.577  1.00 0.00  ? 10   DG  B C4     2  
ATOM   8454   H  "H5'"  . DG  B 2 10  ? 34.182  -9.367  29.420  1.00 0.00  ? 10   DG  B "H5'"  2  
ATOM   8455   H  "H5''" . DG  B 2 10  ? 35.088  -9.882  30.858  1.00 0.00  ? 10   DG  B "H5''" 2  
ATOM   8456   H  "H4'"  . DG  B 2 10  ? 36.746  -9.317  29.362  1.00 0.00  ? 10   DG  B "H4'"  2  
ATOM   8457   H  "H3'"  . DG  B 2 10  ? 36.296  -6.946  31.160  1.00 0.00  ? 10   DG  B "H3'"  2  
ATOM   8458   H  "H2'"  . DG  B 2 10  ? 37.997  -5.770  29.954  1.00 0.00  ? 10   DG  B "H2'"  2  
ATOM   8459   H  "H2''" . DG  B 2 10  ? 38.661  -7.245  29.267  1.00 0.00  ? 10   DG  B "H2''" 2  
ATOM   8460   H  "H1'"  . DG  B 2 10  ? 37.311  -6.803  27.406  1.00 0.00  ? 10   DG  B "H1'"  2  
ATOM   8461   H  H8     . DG  B 2 10  ? 34.312  -5.664  29.418  1.00 0.00  ? 10   DG  B H8     2  
ATOM   8462   H  H1     . DG  B 2 10  ? 37.144  -1.027  26.013  1.00 0.00  ? 10   DG  B H1     2  
ATOM   8463   H  H21    . DG  B 2 10  ? 39.644  -3.353  25.473  1.00 0.00  ? 10   DG  B H21    2  
ATOM   8464   H  H22    . DG  B 2 10  ? 39.047  -1.732  25.201  1.00 0.00  ? 10   DG  B H22    2  
ATOM   8465   P  P      . DT  B 2 11  ? 38.178  -7.817  32.835  1.00 0.00  ? 11   DT  B P      2  
ATOM   8466   O  OP1    . DT  B 2 11  ? 38.914  -8.896  33.545  1.00 0.00  ? 11   DT  B OP1    2  
ATOM   8467   O  OP2    . DT  B 2 11  ? 36.934  -7.264  33.429  1.00 0.00  ? 11   DT  B OP2    2  
ATOM   8468   O  "O5'"  . DT  B 2 11  ? 39.183  -6.608  32.585  1.00 0.00  ? 11   DT  B "O5'"  2  
ATOM   8469   C  "C5'"  . DT  B 2 11  ? 39.339  -5.573  33.556  1.00 0.00  ? 11   DT  B "C5'"  2  
ATOM   8470   C  "C4'"  . DT  B 2 11  ? 40.771  -5.093  33.583  1.00 0.00  ? 11   DT  B "C4'"  2  
ATOM   8471   O  "O4'"  . DT  B 2 11  ? 41.641  -6.191  33.937  1.00 0.00  ? 11   DT  B "O4'"  2  
ATOM   8472   C  "C3'"  . DT  B 2 11  ? 41.304  -4.586  32.246  1.00 0.00  ? 11   DT  B "C3'"  2  
ATOM   8473   O  "O3'"  . DT  B 2 11  ? 41.036  -3.190  32.105  1.00 0.00  ? 11   DT  B "O3'"  2  
ATOM   8474   C  "C2'"  . DT  B 2 11  ? 42.797  -4.841  32.357  1.00 0.00  ? 11   DT  B "C2'"  2  
ATOM   8475   C  "C1'"  . DT  B 2 11  ? 42.876  -6.085  33.237  1.00 0.00  ? 11   DT  B "C1'"  2  
ATOM   8476   N  N1     . DT  B 2 11  ? 43.083  -7.338  32.490  1.00 0.00  ? 11   DT  B N1     2  
ATOM   8477   C  C2     . DT  B 2 11  ? 44.338  -7.584  31.982  1.00 0.00  ? 11   DT  B C2     2  
ATOM   8478   O  O2     . DT  B 2 11  ? 45.275  -6.815  32.121  1.00 0.00  ? 11   DT  B O2     2  
ATOM   8479   N  N3     . DT  B 2 11  ? 44.458  -8.768  31.301  1.00 0.00  ? 11   DT  B N3     2  
ATOM   8480   C  C4     . DT  B 2 11  ? 43.469  -9.707  31.084  1.00 0.00  ? 11   DT  B C4     2  
ATOM   8481   O  O4     . DT  B 2 11  ? 43.725  -10.728 30.453  1.00 0.00  ? 11   DT  B O4     2  
ATOM   8482   C  C5     . DT  B 2 11  ? 42.176  -9.384  31.645  1.00 0.00  ? 11   DT  B C5     2  
ATOM   8483   C  C7     . DT  B 2 11  ? 41.048  -10.347 31.460  1.00 0.00  ? 11   DT  B C7     2  
ATOM   8484   C  C6     . DT  B 2 11  ? 42.044  -8.230  32.313  1.00 0.00  ? 11   DT  B C6     2  
ATOM   8485   H  "H5'"  . DT  B 2 11  ? 39.072  -5.954  34.543  1.00 0.00  ? 11   DT  B "H5'"  2  
ATOM   8486   H  "H5''" . DT  B 2 11  ? 38.686  -4.737  33.309  1.00 0.00  ? 11   DT  B "H5''" 2  
ATOM   8487   H  "H4'"  . DT  B 2 11  ? 40.827  -4.255  34.281  1.00 0.00  ? 11   DT  B "H4'"  2  
ATOM   8488   H  "H3'"  . DT  B 2 11  ? 40.859  -5.128  31.412  1.00 0.00  ? 11   DT  B "H3'"  2  
ATOM   8489   H  "H2'"  . DT  B 2 11  ? 43.240  -5.002  31.374  1.00 0.00  ? 11   DT  B "H2'"  2  
ATOM   8490   H  "H2''" . DT  B 2 11  ? 43.308  -3.991  32.808  1.00 0.00  ? 11   DT  B "H2''" 2  
ATOM   8491   H  "H1'"  . DT  B 2 11  ? 43.673  -5.990  33.977  1.00 0.00  ? 11   DT  B "H1'"  2  
ATOM   8492   H  H3     . DT  B 2 11  ? 45.368  -8.975  30.916  1.00 0.00  ? 11   DT  B H3     2  
ATOM   8493   H  H71    . DT  B 2 11  ? 40.379  -10.295 32.319  1.00 0.00  ? 11   DT  B H71    2  
ATOM   8494   H  H72    . DT  B 2 11  ? 40.497  -10.091 30.555  1.00 0.00  ? 11   DT  B H72    2  
ATOM   8495   H  H73    . DT  B 2 11  ? 41.443  -11.359 31.369  1.00 0.00  ? 11   DT  B H73    2  
ATOM   8496   H  H6     . DT  B 2 11  ? 41.071  -7.984  32.738  1.00 0.00  ? 11   DT  B H6     2  
ATOM   8497   P  P      . DA  B 2 12  ? 40.025  -2.688  30.960  1.00 0.00  ? 12   DA  B P      2  
ATOM   8498   O  OP1    . DA  B 2 12  ? 39.552  -1.331  31.338  1.00 0.00  ? 12   DA  B OP1    2  
ATOM   8499   O  OP2    . DA  B 2 12  ? 39.037  -3.766  30.713  1.00 0.00  ? 12   DA  B OP2    2  
ATOM   8500   O  "O5'"  . DA  B 2 12  ? 40.947  -2.550  29.669  1.00 0.00  ? 12   DA  B "O5'"  2  
ATOM   8501   C  "C5'"  . DA  B 2 12  ? 41.855  -1.458  29.527  1.00 0.00  ? 12   DA  B "C5'"  2  
ATOM   8502   C  "C4'"  . DA  B 2 12  ? 43.063  -1.886  28.726  1.00 0.00  ? 12   DA  B "C4'"  2  
ATOM   8503   O  "O4'"  . DA  B 2 12  ? 43.508  -3.178  29.204  1.00 0.00  ? 12   DA  B "O4'"  2  
ATOM   8504   C  "C3'"  . DA  B 2 12  ? 42.812  -2.064  27.229  1.00 0.00  ? 12   DA  B "C3'"  2  
ATOM   8505   O  "O3'"  . DA  B 2 12  ? 43.159  -0.872  26.515  1.00 0.00  ? 12   DA  B "O3'"  2  
ATOM   8506   C  "C2'"  . DA  B 2 12  ? 43.748  -3.198  26.857  1.00 0.00  ? 12   DA  B "C2'"  2  
ATOM   8507   C  "C1'"  . DA  B 2 12  ? 43.738  -4.057  28.112  1.00 0.00  ? 12   DA  B "C1'"  2  
ATOM   8508   N  N9     . DA  B 2 12  ? 42.696  -5.083  28.132  1.00 0.00  ? 12   DA  B N9     2  
ATOM   8509   C  C8     . DA  B 2 12  ? 41.348  -4.911  28.330  1.00 0.00  ? 12   DA  B C8     2  
ATOM   8510   N  N7     . DA  B 2 12  ? 40.662  -6.028  28.292  1.00 0.00  ? 12   DA  B N7     2  
ATOM   8511   C  C5     . DA  B 2 12  ? 41.623  -7.001  28.054  1.00 0.00  ? 12   DA  B C5     2  
ATOM   8512   C  C6     . DA  B 2 12  ? 41.539  -8.397  27.905  1.00 0.00  ? 12   DA  B C6     2  
ATOM   8513   N  N6     . DA  B 2 12  ? 40.397  -9.082  27.978  1.00 0.00  ? 12   DA  B N6     2  
ATOM   8514   N  N1     . DA  B 2 12  ? 42.686  -9.073  27.675  1.00 0.00  ? 12   DA  B N1     2  
ATOM   8515   C  C2     . DA  B 2 12  ? 43.834  -8.386  27.601  1.00 0.00  ? 12   DA  B C2     2  
ATOM   8516   N  N3     . DA  B 2 12  ? 44.038  -7.075  27.725  1.00 0.00  ? 12   DA  B N3     2  
ATOM   8517   C  C4     . DA  B 2 12  ? 42.880  -6.432  27.952  1.00 0.00  ? 12   DA  B C4     2  
ATOM   8518   H  "H5'"  . DA  B 2 12  ? 42.181  -1.123  30.512  1.00 0.00  ? 12   DA  B "H5'"  2  
ATOM   8519   H  "H5''" . DA  B 2 12  ? 41.360  -0.634  29.015  1.00 0.00  ? 12   DA  B "H5''" 2  
ATOM   8520   H  "H4'"  . DA  B 2 12  ? 43.819  -1.105  28.827  1.00 0.00  ? 12   DA  B "H4'"  2  
ATOM   8521   H  "H3'"  . DA  B 2 12  ? 41.769  -2.312  27.030  1.00 0.00  ? 12   DA  B "H3'"  2  
ATOM   8522   H  "H2'"  . DA  B 2 12  ? 43.386  -3.739  25.983  1.00 0.00  ? 12   DA  B "H2'"  2  
ATOM   8523   H  "H2''" . DA  B 2 12  ? 44.746  -2.827  26.623  1.00 0.00  ? 12   DA  B "H2''" 2  
ATOM   8524   H  "H1'"  . DA  B 2 12  ? 44.705  -4.540  28.264  1.00 0.00  ? 12   DA  B "H1'"  2  
ATOM   8525   H  H8     . DA  B 2 12  ? 40.895  -3.946  28.500  1.00 0.00  ? 12   DA  B H8     2  
ATOM   8526   H  H61    . DA  B 2 12  ? 40.402  -10.086 27.863  1.00 0.00  ? 12   DA  B H61    2  
ATOM   8527   H  H62    . DA  B 2 12  ? 39.527  -8.598  28.150  1.00 0.00  ? 12   DA  B H62    2  
ATOM   8528   H  H2     . DA  B 2 12  ? 44.725  -8.983  27.414  1.00 0.00  ? 12   DA  B H2     2  
ATOM   8529   P  P      . DA  B 2 13  ? 42.294  -0.428  25.235  1.00 0.00  ? 13   DA  B P      2  
ATOM   8530   O  OP1    . DA  B 2 13  ? 42.775  0.913   24.813  1.00 0.00  ? 13   DA  B OP1    2  
ATOM   8531   O  OP2    . DA  B 2 13  ? 40.857  -0.625  25.552  1.00 0.00  ? 13   DA  B OP2    2  
ATOM   8532   O  "O5'"  . DA  B 2 13  ? 42.701  -1.478  24.109  1.00 0.00  ? 13   DA  B "O5'"  2  
ATOM   8533   C  "C5'"  . DA  B 2 13  ? 43.927  -1.349  23.393  1.00 0.00  ? 13   DA  B "C5'"  2  
ATOM   8534   C  "C4'"  . DA  B 2 13  ? 44.126  -2.539  22.485  1.00 0.00  ? 13   DA  B "C4'"  2  
ATOM   8535   O  "O4'"  . DA  B 2 13  ? 44.221  -3.734  23.296  1.00 0.00  ? 13   DA  B "O4'"  2  
ATOM   8536   C  "C3'"  . DA  B 2 13  ? 42.984  -2.804  21.509  1.00 0.00  ? 13   DA  B "C3'"  2  
ATOM   8537   O  "O3'"  . DA  B 2 13  ? 43.221  -2.131  20.266  1.00 0.00  ? 13   DA  B "O3'"  2  
ATOM   8538   C  "C2'"  . DA  B 2 13  ? 43.038  -4.309  21.329  1.00 0.00  ? 13   DA  B "C2'"  2  
ATOM   8539   C  "C1'"  . DA  B 2 13  ? 43.490  -4.797  22.698  1.00 0.00  ? 13   DA  B "C1'"  2  
ATOM   8540   N  N9     . DA  B 2 13  ? 42.397  -5.158  23.597  1.00 0.00  ? 13   DA  B N9     2  
ATOM   8541   C  C8     . DA  B 2 13  ? 41.513  -4.322  24.235  1.00 0.00  ? 13   DA  B C8     2  
ATOM   8542   N  N7     . DA  B 2 13  ? 40.633  -4.951  24.976  1.00 0.00  ? 13   DA  B N7     2  
ATOM   8543   C  C5     . DA  B 2 13  ? 40.960  -6.290  24.814  1.00 0.00  ? 13   DA  B C5     2  
ATOM   8544   C  C6     . DA  B 2 13  ? 40.403  -7.472  25.339  1.00 0.00  ? 13   DA  B C6     2  
ATOM   8545   N  N6     . DA  B 2 13  ? 39.357  -7.494  26.168  1.00 0.00  ? 13   DA  B N6     2  
ATOM   8546   N  N1     . DA  B 2 13  ? 40.968  -8.646  24.979  1.00 0.00  ? 13   DA  B N1     2  
ATOM   8547   C  C2     . DA  B 2 13  ? 42.018  -8.624  24.147  1.00 0.00  ? 13   DA  B C2     2  
ATOM   8548   N  N3     . DA  B 2 13  ? 42.629  -7.581  23.591  1.00 0.00  ? 13   DA  B N3     2  
ATOM   8549   C  C4     . DA  B 2 13  ? 42.044  -6.431  23.969  1.00 0.00  ? 13   DA  B C4     2  
ATOM   8550   H  "H5'"  . DA  B 2 13  ? 44.757  -1.295  24.097  1.00 0.00  ? 13   DA  B "H5'"  2  
ATOM   8551   H  "H5''" . DA  B 2 13  ? 43.908  -0.439  22.792  1.00 0.00  ? 13   DA  B "H5''" 2  
ATOM   8552   H  "H4'"  . DA  B 2 13  ? 45.018  -2.353  21.884  1.00 0.00  ? 13   DA  B "H4'"  2  
ATOM   8553   H  "H3'"  . DA  B 2 13  ? 42.030  -2.476  21.919  1.00 0.00  ? 13   DA  B "H3'"  2  
ATOM   8554   H  "H2'"  . DA  B 2 13  ? 42.061  -4.707  21.049  1.00 0.00  ? 13   DA  B "H2'"  2  
ATOM   8555   H  "H2''" . DA  B 2 13  ? 43.740  -4.588  20.545  1.00 0.00  ? 13   DA  B "H2''" 2  
ATOM   8556   H  "H1'"  . DA  B 2 13  ? 44.159  -5.655  22.604  1.00 0.00  ? 13   DA  B "H1'"  2  
ATOM   8557   H  H8     . DA  B 2 13  ? 41.540  -3.248  24.133  1.00 0.00  ? 13   DA  B H8     2  
ATOM   8558   H  H61    . DA  B 2 13  ? 39.003  -8.374  26.513  1.00 0.00  ? 13   DA  B H61    2  
ATOM   8559   H  H62    . DA  B 2 13  ? 38.919  -6.628  26.452  1.00 0.00  ? 13   DA  B H62    2  
ATOM   8560   H  H2     . DA  B 2 13  ? 42.432  -9.598  23.889  1.00 0.00  ? 13   DA  B H2     2  
ATOM   8561   P  P      . DG  B 2 14  ? 42.372  -2.539  18.963  1.00 0.00  ? 14   DG  B P      2  
ATOM   8562   O  OP1    . DG  B 2 14  ? 43.261  -2.432  17.779  1.00 0.00  ? 14   DG  B OP1    2  
ATOM   8563   O  OP2    . DG  B 2 14  ? 41.099  -1.772  18.995  1.00 0.00  ? 14   DG  B OP2    2  
ATOM   8564   O  "O5'"  . DG  B 2 14  ? 42.027  -4.075  19.194  1.00 0.00  ? 14   DG  B "O5'"  2  
ATOM   8565   C  "C5'"  . DG  B 2 14  ? 41.761  -4.940  18.097  1.00 0.00  ? 14   DG  B "C5'"  2  
ATOM   8566   C  "C4'"  . DG  B 2 14  ? 40.805  -6.031  18.516  1.00 0.00  ? 14   DG  B "C4'"  2  
ATOM   8567   O  "O4'"  . DG  B 2 14  ? 40.093  -5.592  19.699  1.00 0.00  ? 14   DG  B "O4'"  2  
ATOM   8568   C  "C3'"  . DG  B 2 14  ? 39.737  -6.367  17.473  1.00 0.00  ? 14   DG  B "C3'"  2  
ATOM   8569   O  "O3'"  . DG  B 2 14  ? 39.516  -7.777  17.408  1.00 0.00  ? 14   DG  B "O3'"  2  
ATOM   8570   C  "C2'"  . DG  B 2 14  ? 38.498  -5.658  17.990  1.00 0.00  ? 14   DG  B "C2'"  2  
ATOM   8571   C  "C1'"  . DG  B 2 14  ? 38.699  -5.707  19.490  1.00 0.00  ? 14   DG  B "C1'"  2  
ATOM   8572   N  N9     . DG  B 2 14  ? 38.042  -4.636  20.233  1.00 0.00  ? 14   DG  B N9     2  
ATOM   8573   C  C8     . DG  B 2 14  ? 38.137  -3.283  20.012  1.00 0.00  ? 14   DG  B C8     2  
ATOM   8574   N  N7     . DG  B 2 14  ? 37.420  -2.574  20.841  1.00 0.00  ? 14   DG  B N7     2  
ATOM   8575   C  C5     . DG  B 2 14  ? 36.816  -3.517  21.662  1.00 0.00  ? 14   DG  B C5     2  
ATOM   8576   C  C6     . DG  B 2 14  ? 35.921  -3.350  22.752  1.00 0.00  ? 14   DG  B C6     2  
ATOM   8577   O  O6     . DG  B 2 14  ? 35.465  -2.300  23.221  1.00 0.00  ? 14   DG  B O6     2  
ATOM   8578   N  N1     . DG  B 2 14  ? 35.556  -4.572  23.308  1.00 0.00  ? 14   DG  B N1     2  
ATOM   8579   C  C2     . DG  B 2 14  ? 35.995  -5.800  22.872  1.00 0.00  ? 14   DG  B C2     2  
ATOM   8580   N  N2     . DG  B 2 14  ? 35.537  -6.863  23.545  1.00 0.00  ? 14   DG  B N2     2  
ATOM   8581   N  N3     . DG  B 2 14  ? 36.824  -5.969  21.854  1.00 0.00  ? 14   DG  B N3     2  
ATOM   8582   C  C4     . DG  B 2 14  ? 37.192  -4.794  21.300  1.00 0.00  ? 14   DG  B C4     2  
ATOM   8583   H  "H5'"  . DG  B 2 14  ? 42.689  -5.395  17.754  1.00 0.00  ? 14   DG  B "H5'"  2  
ATOM   8584   H  "H5''" . DG  B 2 14  ? 41.318  -4.370  17.281  1.00 0.00  ? 14   DG  B "H5''" 2  
ATOM   8585   H  "H4'"  . DG  B 2 14  ? 41.388  -6.938  18.673  1.00 0.00  ? 14   DG  B "H4'"  2  
ATOM   8586   H  "H3'"  . DG  B 2 14  ? 40.029  -6.007  16.487  1.00 0.00  ? 14   DG  B "H3'"  2  
ATOM   8587   H  "H2'"  . DG  B 2 14  ? 38.440  -4.637  17.614  1.00 0.00  ? 14   DG  B "H2'"  2  
ATOM   8588   H  "H2''" . DG  B 2 14  ? 37.588  -6.172  17.681  1.00 0.00  ? 14   DG  B "H2''" 2  
ATOM   8589   H  "H1'"  . DG  B 2 14  ? 38.374  -6.665  19.898  1.00 0.00  ? 14   DG  B "H1'"  2  
ATOM   8590   H  H8     . DG  B 2 14  ? 38.749  -2.850  19.236  1.00 0.00  ? 14   DG  B H8     2  
ATOM   8591   H  H1     . DG  B 2 14  ? 34.921  -4.557  24.092  1.00 0.00  ? 14   DG  B H1     2  
ATOM   8592   H  H21    . DG  B 2 14  ? 35.823  -7.793  23.277  1.00 0.00  ? 14   DG  B H21    2  
ATOM   8593   H  H22    . DG  B 2 14  ? 34.904  -6.731  24.319  1.00 0.00  ? 14   DG  B H22    2  
ATOM   8594   P  P      . DA  B 2 15  ? 38.405  -8.358  16.402  1.00 0.00  ? 15   DA  B P      2  
ATOM   8595   O  OP1    . DA  B 2 15  ? 38.710  -9.796  16.187  1.00 0.00  ? 15   DA  B OP1    2  
ATOM   8596   O  OP2    . DA  B 2 15  ? 38.311  -7.446  15.233  1.00 0.00  ? 15   DA  B OP2    2  
ATOM   8597   O  "O5'"  . DA  B 2 15  ? 37.045  -8.241  17.226  1.00 0.00  ? 15   DA  B "O5'"  2  
ATOM   8598   C  "C5'"  . DA  B 2 15  ? 36.985  -8.596  18.609  1.00 0.00  ? 15   DA  B "C5'"  2  
ATOM   8599   C  "C4'"  . DA  B 2 15  ? 36.003  -9.726  18.813  1.00 0.00  ? 15   DA  B "C4'"  2  
ATOM   8600   O  "O4'"  . DA  B 2 15  ? 35.010  -9.348  19.786  1.00 0.00  ? 15   DA  B "O4'"  2  
ATOM   8601   C  "C3'"  . DA  B 2 15  ? 35.183  -10.085 17.583  1.00 0.00  ? 15   DA  B "C3'"  2  
ATOM   8602   O  "O3'"  . DA  B 2 15  ? 34.640  -11.402 17.726  1.00 0.00  ? 15   DA  B "O3'"  2  
ATOM   8603   C  "C2'"  . DA  B 2 15  ? 34.092  -9.031  17.613  1.00 0.00  ? 15   DA  B "C2'"  2  
ATOM   8604   C  "C1'"  . DA  B 2 15  ? 33.873  -8.817  19.110  1.00 0.00  ? 15   DA  B "C1'"  2  
ATOM   8605   N  N9     . DA  B 2 15  ? 33.747  -7.419  19.507  1.00 0.00  ? 15   DA  B N9     2  
ATOM   8606   C  C8     . DA  B 2 15  ? 34.352  -6.316  18.959  1.00 0.00  ? 15   DA  B C8     2  
ATOM   8607   N  N7     . DA  B 2 15  ? 34.049  -5.194  19.565  1.00 0.00  ? 15   DA  B N7     2  
ATOM   8608   C  C5     . DA  B 2 15  ? 33.186  -5.586  20.578  1.00 0.00  ? 15   DA  B C5     2  
ATOM   8609   C  C6     . DA  B 2 15  ? 32.511  -4.867  21.575  1.00 0.00  ? 15   DA  B C6     2  
ATOM   8610   N  N6     . DA  B 2 15  ? 32.601  -3.545  21.723  1.00 0.00  ? 15   DA  B N6     2  
ATOM   8611   N  N1     . DA  B 2 15  ? 31.728  -5.561  22.430  1.00 0.00  ? 15   DA  B N1     2  
ATOM   8612   C  C2     . DA  B 2 15  ? 31.634  -6.890  22.281  1.00 0.00  ? 15   DA  B C2     2  
ATOM   8613   N  N3     . DA  B 2 15  ? 32.216  -7.675  21.380  1.00 0.00  ? 15   DA  B N3     2  
ATOM   8614   C  C4     . DA  B 2 15  ? 32.988  -6.953  20.550  1.00 0.00  ? 15   DA  B C4     2  
ATOM   8615   H  "H5'"  . DA  B 2 15  ? 36.664  -7.733  19.195  1.00 0.00  ? 15   DA  B "H5'"  2  
ATOM   8616   H  "H5''" . DA  B 2 15  ? 37.970  -8.912  18.950  1.00 0.00  ? 15   DA  B "H5''" 2  
ATOM   8617   H  "H4'"  . DA  B 2 15  ? 36.568  -10.616 19.093  1.00 0.00  ? 15   DA  B "H4'"  2  
ATOM   8618   H  "H3'"  . DA  B 2 15  ? 35.786  -10.028 16.675  1.00 0.00  ? 15   DA  B "H3'"  2  
ATOM   8619   H  "H2'"  . DA  B 2 15  ? 34.417  -8.121  17.112  1.00 0.00  ? 15   DA  B "H2'"  2  
ATOM   8620   H  "H2''" . DA  B 2 15  ? 33.189  -9.375  17.110  1.00 0.00  ? 15   DA  B "H2''" 2  
ATOM   8621   H  "H1'"  . DA  B 2 15  ? 32.989  -9.357  19.455  1.00 0.00  ? 15   DA  B "H1'"  2  
ATOM   8622   H  H8     . DA  B 2 15  ? 35.020  -6.368  18.113  1.00 0.00  ? 15   DA  B H8     2  
ATOM   8623   H  H61    . DA  B 2 15  ? 32.080  -3.095  22.460  1.00 0.00  ? 15   DA  B H61    2  
ATOM   8624   H  H62    . DA  B 2 15  ? 33.180  -3.000  21.099  1.00 0.00  ? 15   DA  B H62    2  
ATOM   8625   H  H2     . DA  B 2 15  ? 30.993  -7.399  23.000  1.00 0.00  ? 15   DA  B H2     2  
ATOM   8626   P  P      . DA  B 2 16  ? 33.403  -11.862 16.810  1.00 0.00  ? 16   DA  B P      2  
ATOM   8627   O  OP1    . DA  B 2 16  ? 33.573  -13.306 16.509  1.00 0.00  ? 16   DA  B OP1    2  
ATOM   8628   O  OP2    . DA  B 2 16  ? 33.316  -10.887 15.693  1.00 0.00  ? 16   DA  B OP2    2  
ATOM   8629   O  "O5'"  . DA  B 2 16  ? 32.126  -11.675 17.747  1.00 0.00  ? 16   DA  B "O5'"  2  
ATOM   8630   C  "C5'"  . DA  B 2 16  ? 31.948  -12.461 18.930  1.00 0.00  ? 16   DA  B "C5'"  2  
ATOM   8631   C  "C4'"  . DA  B 2 16  ? 30.660  -12.077 19.626  1.00 0.00  ? 16   DA  B "C4'"  2  
ATOM   8632   O  "O4'"  . DA  B 2 16  ? 30.677  -10.653 19.879  1.00 0.00  ? 16   DA  B "O4'"  2  
ATOM   8633   C  "C3'"  . DA  B 2 16  ? 29.370  -12.361 18.845  1.00 0.00  ? 16   DA  B "C3'"  2  
ATOM   8634   O  "O3'"  . DA  B 2 16  ? 28.443  -13.059 19.677  1.00 0.00  ? 16   DA  B "O3'"  2  
ATOM   8635   C  "C2'"  . DA  B 2 16  ? 28.826  -10.985 18.492  1.00 0.00  ? 16   DA  B "C2'"  2  
ATOM   8636   C  "C1'"  . DA  B 2 16  ? 29.410  -10.104 19.579  1.00 0.00  ? 16   DA  B "C1'"  2  
ATOM   8637   N  N9     . DA  B 2 16  ? 29.611  -8.708  19.192  1.00 0.00  ? 16   DA  B N9     2  
ATOM   8638   C  C8     . DA  B 2 16  ? 30.482  -8.222  18.247  1.00 0.00  ? 16   DA  B C8     2  
ATOM   8639   N  N7     . DA  B 2 16  ? 30.454  -6.918  18.124  1.00 0.00  ? 16   DA  B N7     2  
ATOM   8640   C  C5     . DA  B 2 16  ? 29.500  -6.517  19.048  1.00 0.00  ? 16   DA  B C5     2  
ATOM   8641   C  C6     . DA  B 2 16  ? 29.006  -5.251  19.408  1.00 0.00  ? 16   DA  B C6     2  
ATOM   8642   N  N6     . DA  B 2 16  ? 29.424  -4.107  18.858  1.00 0.00  ? 16   DA  B N6     2  
ATOM   8643   N  N1     . DA  B 2 16  ? 28.055  -5.195  20.365  1.00 0.00  ? 16   DA  B N1     2  
ATOM   8644   C  C2     . DA  B 2 16  ? 27.633  -6.340  20.918  1.00 0.00  ? 16   DA  B C2     2  
ATOM   8645   N  N3     . DA  B 2 16  ? 28.020  -7.591  20.665  1.00 0.00  ? 16   DA  B N3     2  
ATOM   8646   C  C4     . DA  B 2 16  ? 28.967  -7.610  19.709  1.00 0.00  ? 16   DA  B C4     2  
ATOM   8647   H  "H5'"  . DA  B 2 16  ? 32.785  -12.293 19.611  1.00 0.00  ? 16   DA  B "H5'"  2  
ATOM   8648   H  "H5''" . DA  B 2 16  ? 31.911  -13.519 18.666  1.00 0.00  ? 16   DA  B "H5''" 2  
ATOM   8649   H  "H4'"  . DA  B 2 16  ? 30.600  -12.668 20.541  1.00 0.00  ? 16   DA  B "H4'"  2  
ATOM   8650   H  "H3'"  . DA  B 2 16  ? 29.570  -12.958 17.957  1.00 0.00  ? 16   DA  B "H3'"  2  
ATOM   8651   H  "H2'"  . DA  B 2 16  ? 29.143  -10.679 17.492  1.00 0.00  ? 16   DA  B "H2'"  2  
ATOM   8652   H  "H2''" . DA  B 2 16  ? 27.736  -10.980 18.504  1.00 0.00  ? 16   DA  B "H2''" 2  
ATOM   8653   H  "H1'"  . DA  B 2 16  ? 28.800  -10.135 20.487  1.00 0.00  ? 16   DA  B "H1'"  2  
ATOM   8654   H  H8     . DA  B 2 16  ? 31.132  -8.856  17.659  1.00 0.00  ? 16   DA  B H8     2  
ATOM   8655   H  H61    . DA  B 2 16  ? 29.035  -3.228  19.165  1.00 0.00  ? 16   DA  B H61    2  
ATOM   8656   H  H62    . DA  B 2 16  ? 30.135  -4.123  18.139  1.00 0.00  ? 16   DA  B H62    2  
ATOM   8657   H  H2     . DA  B 2 16  ? 26.867  -6.236  21.685  1.00 0.00  ? 16   DA  B H2     2  
ATOM   8658   P  P      . DG  B 2 17  ? 26.991  -13.445 19.106  1.00 0.00  ? 17   DG  B P      2  
ATOM   8659   O  OP1    . DG  B 2 17  ? 26.909  -14.927 19.085  1.00 0.00  ? 17   DG  B OP1    2  
ATOM   8660   O  OP2    . DG  B 2 17  ? 26.754  -12.682 17.855  1.00 0.00  ? 17   DG  B OP2    2  
ATOM   8661   O  "O5'"  . DG  B 2 17  ? 25.989  -12.903 20.222  1.00 0.00  ? 17   DG  B "O5'"  2  
ATOM   8662   C  "C5'"  . DG  B 2 17  ? 26.394  -11.872 21.124  1.00 0.00  ? 17   DG  B "C5'"  2  
ATOM   8663   C  "C4'"  . DG  B 2 17  ? 25.187  -11.247 21.782  1.00 0.00  ? 17   DG  B "C4'"  2  
ATOM   8664   O  "O4'"  . DG  B 2 17  ? 25.121  -9.848  21.427  1.00 0.00  ? 17   DG  B "O4'"  2  
ATOM   8665   C  "C3'"  . DG  B 2 17  ? 23.849  -11.826 21.344  1.00 0.00  ? 17   DG  B "C3'"  2  
ATOM   8666   O  "O3'"  . DG  B 2 17  ? 22.871  -11.629 22.366  1.00 0.00  ? 17   DG  B "O3'"  2  
ATOM   8667   C  "C2'"  . DG  B 2 17  ? 23.519  -11.006 20.111  1.00 0.00  ? 17   DG  B "C2'"  2  
ATOM   8668   C  "C1'"  . DG  B 2 17  ? 24.108  -9.641  20.447  1.00 0.00  ? 17   DG  B "C1'"  2  
ATOM   8669   N  N9     . DG  B 2 17  ? 24.724  -8.968  19.310  1.00 0.00  ? 17   DG  B N9     2  
ATOM   8670   C  C8     . DG  B 2 17  ? 25.387  -9.554  18.259  1.00 0.00  ? 17   DG  B C8     2  
ATOM   8671   N  N7     . DG  B 2 17  ? 25.842  -8.691  17.393  1.00 0.00  ? 17   DG  B N7     2  
ATOM   8672   C  C5     . DG  B 2 17  ? 25.453  -7.460  17.903  1.00 0.00  ? 17   DG  B C5     2  
ATOM   8673   C  C6     . DG  B 2 17  ? 25.663  -6.153  17.400  1.00 0.00  ? 17   DG  B C6     2  
ATOM   8674   O  O6     . DG  B 2 17  ? 26.254  -5.808  16.371  1.00 0.00  ? 17   DG  B O6     2  
ATOM   8675   N  N1     . DG  B 2 17  ? 25.099  -5.189  18.231  1.00 0.00  ? 17   DG  B N1     2  
ATOM   8676   C  C2     . DG  B 2 17  ? 24.420  -5.451  19.397  1.00 0.00  ? 17   DG  B C2     2  
ATOM   8677   N  N2     . DG  B 2 17  ? 23.950  -4.388  20.064  1.00 0.00  ? 17   DG  B N2     2  
ATOM   8678   N  N3     . DG  B 2 17  ? 24.219  -6.666  19.876  1.00 0.00  ? 17   DG  B N3     2  
ATOM   8679   C  C4     . DG  B 2 17  ? 24.759  -7.616  19.084  1.00 0.00  ? 17   DG  B C4     2  
ATOM   8680   H  "H5'"  . DG  B 2 17  ? 26.939  -11.103 20.580  1.00 0.00  ? 17   DG  B "H5'"  2  
ATOM   8681   H  "H5''" . DG  B 2 17  ? 27.040  -12.291 21.893  1.00 0.00  ? 17   DG  B "H5''" 2  
ATOM   8682   H  "H4'"  . DG  B 2 17  ? 25.268  -11.415 22.857  1.00 0.00  ? 17   DG  B "H4'"  2  
ATOM   8683   H  "H3'"  . DG  B 2 17  ? 23.933  -12.889 21.120  1.00 0.00  ? 17   DG  B "H3'"  2  
ATOM   8684   H  "H2'"  . DG  B 2 17  ? 23.972  -11.439 19.218  1.00 0.00  ? 17   DG  B "H2'"  2  
ATOM   8685   H  "H2''" . DG  B 2 17  ? 22.445  -10.959 19.942  1.00 0.00  ? 17   DG  B "H2''" 2  
ATOM   8686   H  "H1'"  . DG  B 2 17  ? 23.352  -8.980  20.876  1.00 0.00  ? 17   DG  B "H1'"  2  
ATOM   8687   H  H8     . DG  B 2 17  ? 25.518  -10.621 18.160  1.00 0.00  ? 17   DG  B H8     2  
ATOM   8688   H  H1     . DG  B 2 17  ? 25.197  -4.225  17.955  1.00 0.00  ? 17   DG  B H1     2  
ATOM   8689   H  H21    . DG  B 2 17  ? 23.444  -4.525  20.927  1.00 0.00  ? 17   DG  B H21    2  
ATOM   8690   H  H22    . DG  B 2 17  ? 24.099  -3.456  19.706  1.00 0.00  ? 17   DG  B H22    2  
ATOM   8691   P  P      . DC  B 2 18  ? 21.313  -11.795 22.017  1.00 0.00  ? 18   DC  B P      2  
ATOM   8692   O  OP1    . DC  B 2 18  ? 20.593  -12.087 23.282  1.00 0.00  ? 18   DC  B OP1    2  
ATOM   8693   O  OP2    . DC  B 2 18  ? 21.209  -12.741 20.877  1.00 0.00  ? 18   DC  B OP2    2  
ATOM   8694   O  "O5'"  . DC  B 2 18  ? 20.875  -10.350 21.506  1.00 0.00  ? 18   DC  B "O5'"  2  
ATOM   8695   C  "C5'"  . DC  B 2 18  ? 20.983  -9.209  22.360  1.00 0.00  ? 18   DC  B "C5'"  2  
ATOM   8696   C  "C4'"  . DC  B 2 18  ? 20.327  -8.009  21.721  1.00 0.00  ? 18   DC  B "C4'"  2  
ATOM   8697   O  "O4'"  . DC  B 2 18  ? 21.200  -7.493  20.684  1.00 0.00  ? 18   DC  B "O4'"  2  
ATOM   8698   C  "C3'"  . DC  B 2 18  ? 18.988  -8.281  21.032  1.00 0.00  ? 18   DC  B "C3'"  2  
ATOM   8699   O  "O3'"  . DC  B 2 18  ? 18.100  -7.179  21.242  1.00 0.00  ? 18   DC  B "O3'"  2  
ATOM   8700   C  "C2'"  . DC  B 2 18  ? 19.369  -8.378  19.565  1.00 0.00  ? 18   DC  B "C2'"  2  
ATOM   8701   C  "C1'"  . DC  B 2 18  ? 20.458  -7.339  19.489  1.00 0.00  ? 18   DC  B "C1'"  2  
ATOM   8702   N  N1     . DC  B 2 18  ? 21.380  -7.473  18.354  1.00 0.00  ? 18   DC  B N1     2  
ATOM   8703   C  C2     . DC  B 2 18  ? 21.728  -6.325  17.639  1.00 0.00  ? 18   DC  B C2     2  
ATOM   8704   O  O2     . DC  B 2 18  ? 21.253  -5.235  17.989  1.00 0.00  ? 18   DC  B O2     2  
ATOM   8705   N  N3     . DC  B 2 18  ? 22.569  -6.429  16.588  1.00 0.00  ? 18   DC  B N3     2  
ATOM   8706   C  C4     . DC  B 2 18  ? 23.059  -7.622  16.243  1.00 0.00  ? 18   DC  B C4     2  
ATOM   8707   N  N4     . DC  B 2 18  ? 23.886  -7.676  15.199  1.00 0.00  ? 18   DC  B N4     2  
ATOM   8708   C  C5     . DC  B 2 18  ? 22.724  -8.812  16.956  1.00 0.00  ? 18   DC  B C5     2  
ATOM   8709   C  C6     . DC  B 2 18  ? 21.887  -8.690  17.996  1.00 0.00  ? 18   DC  B C6     2  
ATOM   8710   H  "H5'"  . DC  B 2 18  ? 22.034  -8.985  22.541  1.00 0.00  ? 18   DC  B "H5'"  2  
ATOM   8711   H  "H5''" . DC  B 2 18  ? 20.493  -9.417  23.311  1.00 0.00  ? 18   DC  B "H5''" 2  
ATOM   8712   H  "H4'"  . DC  B 2 18  ? 20.126  -7.285  22.511  1.00 0.00  ? 18   DC  B "H4'"  2  
ATOM   8713   H  "H3'"  . DC  B 2 18  ? 18.527  -9.196  21.403  1.00 0.00  ? 18   DC  B "H3'"  2  
ATOM   8714   H  "H2'"  . DC  B 2 18  ? 19.728  -9.373  19.306  1.00 0.00  ? 18   DC  B "H2'"  2  
ATOM   8715   H  "H2''" . DC  B 2 18  ? 18.527  -8.150  18.913  1.00 0.00  ? 18   DC  B "H2''" 2  
ATOM   8716   H  "H1'"  . DC  B 2 18  ? 20.039  -6.335  19.482  1.00 0.00  ? 18   DC  B "H1'"  2  
ATOM   8717   H  H41    . DC  B 2 18  ? 24.281  -8.558  14.905  1.00 0.00  ? 18   DC  B H41    2  
ATOM   8718   H  H42    . DC  B 2 18  ? 24.110  -6.823  14.706  1.00 0.00  ? 18   DC  B H42    2  
ATOM   8719   H  H5     . DC  B 2 18  ? 23.132  -9.779  16.665  1.00 0.00  ? 18   DC  B H5     2  
ATOM   8720   H  H6     . DC  B 2 18  ? 21.606  -9.578  18.564  1.00 0.00  ? 18   DC  B H6     2  
ATOM   8721   P  P      . DC  B 2 19  ? 16.530  -7.447  21.432  1.00 0.00  ? 19   DC  B P      2  
ATOM   8722   O  OP1    . DC  B 2 19  ? 16.322  -7.935  22.821  1.00 0.00  ? 19   DC  B OP1    2  
ATOM   8723   O  OP2    . DC  B 2 19  ? 16.053  -8.266  20.289  1.00 0.00  ? 19   DC  B OP2    2  
ATOM   8724   O  "O5'"  . DC  B 2 19  ? 15.884  -5.996  21.310  1.00 0.00  ? 19   DC  B "O5'"  2  
ATOM   8725   C  "C5'"  . DC  B 2 19  ? 16.498  -4.864  21.926  1.00 0.00  ? 19   DC  B "C5'"  2  
ATOM   8726   C  "C4'"  . DC  B 2 19  ? 16.477  -3.684  20.982  1.00 0.00  ? 19   DC  B "C4'"  2  
ATOM   8727   O  "O4'"  . DC  B 2 19  ? 17.384  -3.950  19.884  1.00 0.00  ? 19   DC  B "O4'"  2  
ATOM   8728   C  "C3'"  . DC  B 2 19  ? 15.117  -3.391  20.343  1.00 0.00  ? 19   DC  B "C3'"  2  
ATOM   8729   O  "O3'"  . DC  B 2 19  ? 14.906  -1.980  20.275  1.00 0.00  ? 19   DC  B "O3'"  2  
ATOM   8730   C  "C2'"  . DC  B 2 19  ? 15.242  -3.987  18.950  1.00 0.00  ? 19   DC  B "C2'"  2  
ATOM   8731   C  "C1'"  . DC  B 2 19  ? 16.712  -3.773  18.651  1.00 0.00  ? 19   DC  B "C1'"  2  
ATOM   8732   N  N1     . DC  B 2 19  ? 17.294  -4.712  17.683  1.00 0.00  ? 19   DC  B N1     2  
ATOM   8733   C  C2     . DC  B 2 19  ? 18.044  -4.204  16.623  1.00 0.00  ? 19   DC  B C2     2  
ATOM   8734   O  O2     . DC  B 2 19  ? 18.185  -2.976  16.522  1.00 0.00  ? 19   DC  B O2     2  
ATOM   8735   N  N3     . DC  B 2 19  ? 18.598  -5.061  15.737  1.00 0.00  ? 19   DC  B N3     2  
ATOM   8736   C  C4     . DC  B 2 19  ? 18.428  -6.377  15.885  1.00 0.00  ? 19   DC  B C4     2  
ATOM   8737   N  N4     . DC  B 2 19  ? 18.992  -7.183  14.989  1.00 0.00  ? 19   DC  B N4     2  
ATOM   8738   C  C5     . DC  B 2 19  ? 17.668  -6.922  16.959  1.00 0.00  ? 19   DC  B C5     2  
ATOM   8739   C  C6     . DC  B 2 19  ? 17.113  -6.061  17.820  1.00 0.00  ? 19   DC  B C6     2  
ATOM   8740   H  "H5'"  . DC  B 2 19  ? 17.531  -5.097  22.183  1.00 0.00  ? 19   DC  B "H5'"  2  
ATOM   8741   H  "H5''" . DC  B 2 19  ? 15.954  -4.603  22.834  1.00 0.00  ? 19   DC  B "H5''" 2  
ATOM   8742   H  "H4'"  . DC  B 2 19  ? 16.749  -2.799  21.557  1.00 0.00  ? 19   DC  B "H4'"  2  
ATOM   8743   H  "H3'"  . DC  B 2 19  ? 14.309  -3.850  20.913  1.00 0.00  ? 19   DC  B "H3'"  2  
ATOM   8744   H  "H2'"  . DC  B 2 19  ? 14.968  -5.040  18.943  1.00 0.00  ? 19   DC  B "H2'"  2  
ATOM   8745   H  "H2''" . DC  B 2 19  ? 14.597  -3.473  18.236  1.00 0.00  ? 19   DC  B "H2''" 2  
ATOM   8746   H  "H1'"  . DC  B 2 19  ? 16.899  -2.756  18.305  1.00 0.00  ? 19   DC  B "H1'"  2  
ATOM   8747   H  H41    . DC  B 2 19  ? 18.883  -8.184  15.069  1.00 0.00  ? 19   DC  B H41    2  
ATOM   8748   H  H42    . DC  B 2 19  ? 19.510  -6.785  14.220  1.00 0.00  ? 19   DC  B H42    2  
ATOM   8749   H  H5     . DC  B 2 19  ? 17.553  -7.998  17.082  1.00 0.00  ? 19   DC  B H5     2  
ATOM   8750   H  H6     . DC  B 2 19  ? 16.498  -6.441  18.635  1.00 0.00  ? 19   DC  B H6     2  
ATOM   8751   P  P      . DA  B 2 20  ? 13.453  -1.408  19.900  1.00 0.00  ? 20   DA  B P      2  
ATOM   8752   O  OP1    . DA  B 2 20  ? 13.229  -0.204  20.739  1.00 0.00  ? 20   DA  B OP1    2  
ATOM   8753   O  OP2    . DA  B 2 20  ? 12.478  -2.528  19.945  1.00 0.00  ? 20   DA  B OP2    2  
ATOM   8754   O  "O5'"  . DA  B 2 20  ? 13.606  -0.940  18.387  1.00 0.00  ? 20   DA  B "O5'"  2  
ATOM   8755   C  "C5'"  . DA  B 2 20  ? 14.666  -0.072  17.993  1.00 0.00  ? 20   DA  B "C5'"  2  
ATOM   8756   C  "C4'"  . DA  B 2 20  ? 14.875  -0.154  16.499  1.00 0.00  ? 20   DA  B "C4'"  2  
ATOM   8757   O  "O4'"  . DA  B 2 20  ? 15.542  -1.396  16.192  1.00 0.00  ? 20   DA  B "O4'"  2  
ATOM   8758   C  "C3'"  . DA  B 2 20  ? 13.593  -0.147  15.655  1.00 0.00  ? 20   DA  B "C3'"  2  
ATOM   8759   O  "O3'"  . DA  B 2 20  ? 13.536  1.044   14.867  1.00 0.00  ? 20   DA  B "O3'"  2  
ATOM   8760   C  "C2'"  . DA  B 2 20  ? 13.713  -1.372  14.755  1.00 0.00  ? 20   DA  B "C2'"  2  
ATOM   8761   C  "C1'"  . DA  B 2 20  ? 15.177  -1.754  14.883  1.00 0.00  ? 20   DA  B "C1'"  2  
ATOM   8762   N  N9     . DA  B 2 20  ? 15.468  -3.177  14.704  1.00 0.00  ? 20   DA  B N9     2  
ATOM   8763   C  C8     . DA  B 2 20  ? 14.952  -4.249  15.393  1.00 0.00  ? 20   DA  B C8     2  
ATOM   8764   N  N7     . DA  B 2 20  ? 15.418  -5.407  14.991  1.00 0.00  ? 20   DA  B N7     2  
ATOM   8765   C  C5     . DA  B 2 20  ? 16.298  -5.076  13.971  1.00 0.00  ? 20   DA  B C5     2  
ATOM   8766   C  C6     . DA  B 2 20  ? 17.118  -5.856  13.135  1.00 0.00  ? 20   DA  B C6     2  
ATOM   8767   N  N6     . DA  B 2 20  ? 17.179  -7.189  13.190  1.00 0.00  ? 20   DA  B N6     2  
ATOM   8768   N  N1     . DA  B 2 20  ? 17.880  -5.212  12.225  1.00 0.00  ? 20   DA  B N1     2  
ATOM   8769   C  C2     . DA  B 2 20  ? 17.816  -3.877  12.161  1.00 0.00  ? 20   DA  B C2     2  
ATOM   8770   N  N3     . DA  B 2 20  ? 17.084  -3.035  12.887  1.00 0.00  ? 20   DA  B N3     2  
ATOM   8771   C  C4     . DA  B 2 20  ? 16.341  -3.705  13.785  1.00 0.00  ? 20   DA  B C4     2  
ATOM   8772   H  "H5'"  . DA  B 2 20  ? 15.585  -0.364  18.500  1.00 0.00  ? 20   DA  B "H5'"  2  
ATOM   8773   H  "H5''" . DA  B 2 20  ? 14.418  0.956   18.265  1.00 0.00  ? 20   DA  B "H5''" 2  
ATOM   8774   H  "H4'"  . DA  B 2 20  ? 15.450  0.724   16.202  1.00 0.00  ? 20   DA  B "H4'"  2  
ATOM   8775   H  "H3'"  . DA  B 2 20  ? 12.707  -0.197  16.288  1.00 0.00  ? 20   DA  B "H3'"  2  
ATOM   8776   H  "H2'"  . DA  B 2 20  ? 13.045  -2.169  15.087  1.00 0.00  ? 20   DA  B "H2'"  2  
ATOM   8777   H  "H2''" . DA  B 2 20  ? 13.443  -1.131  13.726  1.00 0.00  ? 20   DA  B "H2''" 2  
ATOM   8778   H  "H1'"  . DA  B 2 20  ? 15.798  -1.179  14.190  1.00 0.00  ? 20   DA  B "H1'"  2  
ATOM   8779   H  H8     . DA  B 2 20  ? 14.235  -4.147  16.194  1.00 0.00  ? 20   DA  B H8     2  
ATOM   8780   H  H61    . DA  B 2 20  ? 17.791  -7.690  12.563  1.00 0.00  ? 20   DA  B H61    2  
ATOM   8781   H  H62    . DA  B 2 20  ? 16.617  -7.696  13.857  1.00 0.00  ? 20   DA  B H62    2  
ATOM   8782   H  H2     . DA  B 2 20  ? 18.454  -3.413  11.409  1.00 0.00  ? 20   DA  B H2     2  
ATOM   8783   P  P      . DG  B 2 21  ? 12.325  1.262   13.833  1.00 0.00  ? 21   DG  B P      2  
ATOM   8784   O  OP1    . DG  B 2 21  ? 12.099  2.724   13.714  1.00 0.00  ? 21   DG  B OP1    2  
ATOM   8785   O  OP2    . DG  B 2 21  ? 11.202  0.375   14.224  1.00 0.00  ? 21   DG  B OP2    2  
ATOM   8786   O  "O5'"  . DG  B 2 21  ? 12.911  0.755   12.443  1.00 0.00  ? 21   DG  B "O5'"  2  
ATOM   8787   C  "C5'"  . DG  B 2 21  ? 13.895  1.514   11.746  1.00 0.00  ? 21   DG  B "C5'"  2  
ATOM   8788   C  "C4'"  . DG  B 2 21  ? 14.236  0.838   10.441  1.00 0.00  ? 21   DG  B "C4'"  2  
ATOM   8789   O  "O4'"  . DG  B 2 21  ? 14.707  -0.487  10.753  1.00 0.00  ? 21   DG  B "O4'"  2  
ATOM   8790   C  "C3'"  . DG  B 2 21  ? 13.054  0.664   9.480   1.00 0.00  ? 21   DG  B "C3'"  2  
ATOM   8791   O  "O3'"  . DG  B 2 21  ? 13.287  1.395   8.277   1.00 0.00  ? 21   DG  B "O3'"  2  
ATOM   8792   C  "C2'"  . DG  B 2 21  ? 12.994  -0.827  9.186   1.00 0.00  ? 21   DG  B "C2'"  2  
ATOM   8793   C  "C1'"  . DG  B 2 21  ? 14.294  -1.370  9.739   1.00 0.00  ? 21   DG  B "C1'"  2  
ATOM   8794   N  N9     . DG  B 2 21  ? 14.178  -2.698  10.324  1.00 0.00  ? 21   DG  B N9     2  
ATOM   8795   C  C8     . DG  B 2 21  ? 13.533  -3.080  11.475  1.00 0.00  ? 21   DG  B C8     2  
ATOM   8796   N  N7     . DG  B 2 21  ? 13.663  -4.353  11.736  1.00 0.00  ? 21   DG  B N7     2  
ATOM   8797   C  C5     . DG  B 2 21  ? 14.425  -4.832  10.682  1.00 0.00  ? 21   DG  B C5     2  
ATOM   8798   C  C6     . DG  B 2 21  ? 14.903  -6.136  10.399  1.00 0.00  ? 21   DG  B C6     2  
ATOM   8799   O  O6     . DG  B 2 21  ? 14.759  -7.175  11.053  1.00 0.00  ? 21   DG  B O6     2  
ATOM   8800   N  N1     . DG  B 2 21  ? 15.621  -6.158  9.211   1.00 0.00  ? 21   DG  B N1     2  
ATOM   8801   C  C2     . DG  B 2 21  ? 15.838  -5.070  8.414   1.00 0.00  ? 21   DG  B C2     2  
ATOM   8802   N  N2     . DG  B 2 21  ? 16.489  -5.280  7.324   1.00 0.00  ? 21   DG  B N2     2  
ATOM   8803   N  N3     . DG  B 2 21  ? 15.426  -3.866  8.671   1.00 0.00  ? 21   DG  B N3     2  
ATOM   8804   C  C4     . DG  B 2 21  ? 14.730  -3.815  9.804   1.00 0.00  ? 21   DG  B C4     2  
ATOM   8805   H  "H5'"  . DG  B 2 21  ? 14.795  1.594   12.355  1.00 0.00  ? 21   DG  B "H5'"  2  
ATOM   8806   H  "H5''" . DG  B 2 21  ? 13.510  2.514   11.541  1.00 0.00  ? 21   DG  B "H5''" 2  
ATOM   8807   H  "H4'"  . DG  B 2 21  ? 14.979  1.452   9.928   1.00 0.00  ? 21   DG  B "H4'"  2  
ATOM   8808   H  "H3'"  . DG  B 2 21  ? 12.130  1.018   9.934   1.00 0.00  ? 21   DG  B "H3'"  2  
ATOM   8809   H  "H2'"  . DG  B 2 21  ? 12.121  -1.284  9.660   1.00 0.00  ? 21   DG  B "H2'"  2  
ATOM   8810   H  "H2''" . DG  B 2 21  ? 12.908  -1.011  8.113   1.00 0.00  ? 21   DG  B "H2''" 2  
ATOM   8811   H  "H1'"  . DG  B 2 21  ? 15.073  -1.390  8.971   1.00 0.00  ? 21   DG  B "H1'"  2  
ATOM   8812   H  H8     . DG  B 2 21  ? 12.955  -2.401  12.088  1.00 0.00  ? 21   DG  B H8     2  
ATOM   8813   H  H1     . DG  B 2 21  ? 16.026  -7.026  8.887   1.00 0.00  ? 21   DG  B H1     2  
ATOM   8814   H  H21    . DG  B 2 21  ? 16.641  -4.494  6.724   1.00 0.00  ? 21   DG  B H21    2  
ATOM   8815   H  H22    . DG  B 2 21  ? 16.868  -6.192  7.190   1.00 0.00  ? 21   DG  B H22    2  
ATOM   8816   P  P      . DC  B 2 22  ? 12.162  1.420   7.132   1.00 0.00  ? 22   DC  B P      2  
ATOM   8817   O  OP1    . DC  B 2 22  ? 12.479  2.528   6.195   1.00 0.00  ? 22   DC  B OP1    2  
ATOM   8818   O  OP2    . DC  B 2 22  ? 10.838  1.384   7.803   1.00 0.00  ? 22   DC  B OP2    2  
ATOM   8819   O  "O5'"  . DC  B 2 22  ? 12.375  0.049   6.353   1.00 0.00  ? 22   DC  B "O5'"  2  
ATOM   8820   C  "C5'"  . DC  B 2 22  ? 13.613  -0.225  5.704   1.00 0.00  ? 22   DC  B "C5'"  2  
ATOM   8821   C  "C4'"  . DC  B 2 22  ? 13.586  -1.592  5.060   1.00 0.00  ? 22   DC  B "C4'"  2  
ATOM   8822   O  "O4'"  . DC  B 2 22  ? 13.620  -2.598  6.095   1.00 0.00  ? 22   DC  B "O4'"  2  
ATOM   8823   C  "C3'"  . DC  B 2 22  ? 12.356  -1.901  4.199   1.00 0.00  ? 22   DC  B "C3'"  2  
ATOM   8824   O  "O3'"  . DC  B 2 22  ? 12.768  -2.143  2.848   1.00 0.00  ? 22   DC  B "O3'"  2  
ATOM   8825   C  "C2'"  . DC  B 2 22  ? 11.755  -3.156  4.819   1.00 0.00  ? 22   DC  B "C2'"  2  
ATOM   8826   C  "C1'"  . DC  B 2 22  ? 12.899  -3.719  5.642   1.00 0.00  ? 22   DC  B "C1'"  2  
ATOM   8827   N  N1     . DC  B 2 22  ? 12.494  -4.501  6.817   1.00 0.00  ? 22   DC  B N1     2  
ATOM   8828   C  C2     . DC  B 2 22  ? 12.842  -5.852  6.873   1.00 0.00  ? 22   DC  B C2     2  
ATOM   8829   O  O2     . DC  B 2 22  ? 13.492  -6.343  5.936   1.00 0.00  ? 22   DC  B O2     2  
ATOM   8830   N  N3     . DC  B 2 22  ? 12.465  -6.588  7.943   1.00 0.00  ? 22   DC  B N3     2  
ATOM   8831   C  C4     . DC  B 2 22  ? 11.767  -6.020  8.929   1.00 0.00  ? 22   DC  B C4     2  
ATOM   8832   N  N4     . DC  B 2 22  ? 11.407  -6.786  9.960   1.00 0.00  ? 22   DC  B N4     2  
ATOM   8833   C  C5     . DC  B 2 22  ? 11.404  -4.641  8.901   1.00 0.00  ? 22   DC  B C5     2  
ATOM   8834   C  C6     . DC  B 2 22  ? 11.787  -3.926  7.836   1.00 0.00  ? 22   DC  B C6     2  
ATOM   8835   H  "H5'"  . DC  B 2 22  ? 14.421  -0.193  6.436   1.00 0.00  ? 22   DC  B "H5'"  2  
ATOM   8836   H  "H5''" . DC  B 2 22  ? 13.799  0.528   4.937   1.00 0.00  ? 22   DC  B "H5''" 2  
ATOM   8837   H  "H4'"  . DC  B 2 22  ? 14.441  -1.645  4.388   1.00 0.00  ? 22   DC  B "H4'"  2  
ATOM   8838   H  "H3'"  . DC  B 2 22  ? 11.651  -1.072  4.211   1.00 0.00  ? 22   DC  B "H3'"  2  
ATOM   8839   H  "H2'"  . DC  B 2 22  ? 10.885  -2.911  5.433   1.00 0.00  ? 22   DC  B "H2'"  2  
ATOM   8840   H  "H2''" . DC  B 2 22  ? 11.423  -3.855  4.051   1.00 0.00  ? 22   DC  B "H2''" 2  
ATOM   8841   H  "H1'"  . DC  B 2 22  ? 13.567  -4.328  5.027   1.00 0.00  ? 22   DC  B "H1'"  2  
ATOM   8842   H  H41    . DC  B 2 22  ? 10.876  -6.390  10.722  1.00 0.00  ? 22   DC  B H41    2  
ATOM   8843   H  H42    . DC  B 2 22  ? 11.667  -7.762  9.976   1.00 0.00  ? 22   DC  B H42    2  
ATOM   8844   H  H5     . DC  B 2 22  ? 10.839  -4.187  9.714   1.00 0.00  ? 22   DC  B H5     2  
ATOM   8845   H  H6     . DC  B 2 22  ? 11.533  -2.866  7.784   1.00 0.00  ? 22   DC  B H6     2  
ATOM   8846   P  P      . DT  B 2 23  ? 12.322  -1.128  1.684   1.00 0.00  ? 23   DT  B P      2  
ATOM   8847   O  OP1    . DT  B 2 23  ? 13.378  -1.159  0.641   1.00 0.00  ? 23   DT  B OP1    2  
ATOM   8848   O  OP2    . DT  B 2 23  ? 11.954  0.165   2.316   1.00 0.00  ? 23   DT  B OP2    2  
ATOM   8849   O  "O5'"  . DT  B 2 23  ? 11.006  -1.788  1.074   1.00 0.00  ? 23   DT  B "O5'"  2  
ATOM   8850   C  "C5'"  . DT  B 2 23  ? 10.210  -1.092  0.112   1.00 0.00  ? 23   DT  B "C5'"  2  
ATOM   8851   C  "C4'"  . DT  B 2 23  ? 10.457  -1.650  -1.271  1.00 0.00  ? 23   DT  B "C4'"  2  
ATOM   8852   O  "O4'"  . DT  B 2 23  ? 11.614  -2.519  -1.222  1.00 0.00  ? 23   DT  B "O4'"  2  
ATOM   8853   C  "C3'"  . DT  B 2 23  ? 9.322   -2.502  -1.840  1.00 0.00  ? 23   DT  B "C3'"  2  
ATOM   8854   O  "O3'"  . DT  B 2 23  ? 8.460   -1.703  -2.662  1.00 0.00  ? 23   DT  B "O3'"  2  
ATOM   8855   C  "C2'"  . DT  B 2 23  ? 10.057  -3.537  -2.670  1.00 0.00  ? 23   DT  B "C2'"  2  
ATOM   8856   C  "C1'"  . DT  B 2 23  ? 11.334  -3.750  -1.873  1.00 0.00  ? 23   DT  B "C1'"  2  
ATOM   8857   N  N1     . DT  B 2 23  ? 11.240  -4.798  -0.841  1.00 0.00  ? 23   DT  B N1     2  
ATOM   8858   C  C2     . DT  B 2 23  ? 11.886  -5.992  -1.070  1.00 0.00  ? 23   DT  B C2     2  
ATOM   8859   O  O2     . DT  B 2 23  ? 12.528  -6.220  -2.083  1.00 0.00  ? 23   DT  B O2     2  
ATOM   8860   N  N3     . DT  B 2 23  ? 11.753  -6.915  -0.064  1.00 0.00  ? 23   DT  B N3     2  
ATOM   8861   C  C4     . DT  B 2 23  ? 11.056  -6.765  1.118   1.00 0.00  ? 23   DT  B C4     2  
ATOM   8862   O  O4     . DT  B 2 23  ? 11.025  -7.685  1.931   1.00 0.00  ? 23   DT  B O4     2  
ATOM   8863   C  C5     . DT  B 2 23  ? 10.401  -5.486  1.292   1.00 0.00  ? 23   DT  B C5     2  
ATOM   8864   C  C7     . DT  B 2 23  ? 9.622   -5.237  2.544   1.00 0.00  ? 23   DT  B C7     2  
ATOM   8865   C  C6     . DT  B 2 23  ? 10.522  -4.574  0.316   1.00 0.00  ? 23   DT  B C6     2  
ATOM   8866   H  "H5'"  . DT  B 2 23  ? 10.468  -0.033  0.120   1.00 0.00  ? 23   DT  B "H5'"  2  
ATOM   8867   H  "H5''" . DT  B 2 23  ? 9.154   -1.205  0.359   1.00 0.00  ? 23   DT  B "H5''" 2  
ATOM   8868   H  "H4'"  . DT  B 2 23  ? 10.584  -0.804  -1.949  1.00 0.00  ? 23   DT  B "H4'"  2  
ATOM   8869   H  "H3'"  . DT  B 2 23  ? 8.737   -2.959  -1.043  1.00 0.00  ? 23   DT  B "H3'"  2  
ATOM   8870   H  "H2'"  . DT  B 2 23  ? 9.474   -4.453  -2.767  1.00 0.00  ? 23   DT  B "H2'"  2  
ATOM   8871   H  "H2''" . DT  B 2 23  ? 10.256  -3.169  -3.676  1.00 0.00  ? 23   DT  B "H2''" 2  
ATOM   8872   H  "H1'"  . DT  B 2 23  ? 12.172  -3.983  -2.531  1.00 0.00  ? 23   DT  B "H1'"  2  
ATOM   8873   H  H3     . DT  B 2 23  ? 12.218  -7.802  -0.203  1.00 0.00  ? 23   DT  B H3     2  
ATOM   8874   H  H71    . DT  B 2 23  ? 8.611   -5.628  2.427   1.00 0.00  ? 23   DT  B H71    2  
ATOM   8875   H  H72    . DT  B 2 23  ? 10.109  -5.735  3.382   1.00 0.00  ? 23   DT  B H72    2  
ATOM   8876   H  H73    . DT  B 2 23  ? 9.576   -4.165  2.737   1.00 0.00  ? 23   DT  B H73    2  
ATOM   8877   H  H6     . DT  B 2 23  ? 10.030  -3.610  0.444   1.00 0.00  ? 23   DT  B H6     2  
ATOM   8878   P  P      . DC  B 2 24  ? 7.731   -2.364  -3.936  1.00 0.00  ? 24   DC  B P      2  
ATOM   8879   O  OP1    . DC  B 2 24  ? 7.574   -3.817  -3.679  1.00 0.00  ? 24   DC  B OP1    2  
ATOM   8880   O  OP2    . DC  B 2 24  ? 8.457   -1.907  -5.148  1.00 0.00  ? 24   DC  B OP2    2  
ATOM   8881   O  "O5'"  . DC  B 2 24  ? 6.282   -1.700  -3.948  1.00 0.00  ? 24   DC  B "O5'"  2  
ATOM   8882   C  "C5'"  . DC  B 2 24  ? 5.535   -1.582  -5.162  1.00 0.00  ? 24   DC  B "C5'"  2  
ATOM   8883   C  "C4'"  . DC  B 2 24  ? 5.483   -2.917  -5.879  1.00 0.00  ? 24   DC  B "C4'"  2  
ATOM   8884   O  "O4'"  . DC  B 2 24  ? 4.114   -3.385  -5.928  1.00 0.00  ? 24   DC  B "O4'"  2  
ATOM   8885   C  "C3'"  . DC  B 2 24  ? 5.969   -3.001  -7.332  1.00 0.00  ? 24   DC  B "C3'"  2  
ATOM   8886   O  "O3'"  . DC  B 2 24  ? 6.458   -4.355  -7.585  1.00 0.00  ? 24   DC  B "O3'"  2  
ATOM   8887   C  "C2'"  . DC  B 2 24  ? 4.706   -2.733  -8.138  1.00 0.00  ? 24   DC  B "C2'"  2  
ATOM   8888   C  "C1'"  . DC  B 2 24  ? 3.608   -3.343  -7.258  1.00 0.00  ? 24   DC  B "C1'"  2  
ATOM   8889   N  N1     . DC  B 2 24  ? 2.344   -2.586  -7.219  1.00 0.00  ? 24   DC  B N1     2  
ATOM   8890   C  C2     . DC  B 2 24  ? 1.162   -3.204  -7.646  1.00 0.00  ? 24   DC  B C2     2  
ATOM   8891   O  O2     . DC  B 2 24  ? 1.214   -4.373  -8.063  1.00 0.00  ? 24   DC  B O2     2  
ATOM   8892   N  N3     . DC  B 2 24  ? -0.003  -2.511  -7.591  1.00 0.00  ? 24   DC  B N3     2  
ATOM   8893   C  C4     . DC  B 2 24  ? -0.008  -1.252  -7.141  1.00 0.00  ? 24   DC  B C4     2  
ATOM   8894   N  N4     . DC  B 2 24  ? -1.169  -0.597  -7.095  1.00 0.00  ? 24   DC  B N4     2  
ATOM   8895   C  C5     . DC  B 2 24  ? 1.183   -0.599  -6.712  1.00 0.00  ? 24   DC  B C5     2  
ATOM   8896   C  C6     . DC  B 2 24  ? 2.323   -1.298  -6.763  1.00 0.00  ? 24   DC  B C6     2  
ATOM   8897   H  "H5'"  . DC  B 2 24  ? 6.008   -0.846  -5.813  1.00 0.00  ? 24   DC  B "H5'"  2  
ATOM   8898   H  "H5''" . DC  B 2 24  ? 4.519   -1.257  -4.936  1.00 0.00  ? 24   DC  B "H5''" 2  
ATOM   8899   H  "H4'"  . DC  B 2 24  ? 6.123   -3.595  -5.315  1.00 0.00  ? 24   DC  B "H4'"  2  
ATOM   8900   H  "H3'"  . DC  B 2 24  ? 6.759   -2.281  -7.539  1.00 0.00  ? 24   DC  B "H3'"  2  
ATOM   8901   H  "H2'"  . DC  B 2 24  ? 4.559   -1.665  -8.298  1.00 0.00  ? 24   DC  B "H2'"  2  
ATOM   8902   H  "H2''" . DC  B 2 24  ? 4.756   -3.204  -9.119  1.00 0.00  ? 24   DC  B "H2''" 2  
ATOM   8903   H  "H1'"  . DC  B 2 24  ? 3.388   -4.366  -7.565  1.00 0.00  ? 24   DC  B "H1'"  2  
ATOM   8904   H  H41    . DC  B 2 24  ? -1.199  0.355   -6.759  1.00 0.00  ? 24   DC  B H41    2  
ATOM   8905   H  H42    . DC  B 2 24  ? -2.017  -1.053  -7.397  1.00 0.00  ? 24   DC  B H42    2  
ATOM   8906   H  H5     . DC  B 2 24  ? 1.167   0.431   -6.356  1.00 0.00  ? 24   DC  B H5     2  
ATOM   8907   H  H6     . DC  B 2 24  ? 3.251   -0.830  -6.435  1.00 0.00  ? 24   DC  B H6     2  
ATOM   8908   P  P      . DG  B 2 25  ? 6.941   -4.810  -9.075  1.00 0.00  ? 25   DG  B P      2  
ATOM   8909   O  OP1    . DG  B 2 25  ? 8.267   -5.497  -8.937  1.00 0.00  ? 25   DG  B OP1    2  
ATOM   8910   O  OP2    . DG  B 2 25  ? 6.908   -3.492  -9.745  1.00 0.00  ? 25   DG  B OP2    2  
ATOM   8911   O  "O5'"  . DG  B 2 25  ? 5.758   -5.728  -9.755  1.00 0.00  ? 25   DG  B "O5'"  2  
ATOM   8912   C  "C5'"  . DG  B 2 25  ? 5.395   -7.156  -9.405  1.00 0.00  ? 25   DG  B "C5'"  2  
ATOM   8913   C  "C4'"  . DG  B 2 25  ? 4.512   -7.819  -10.468 1.00 0.00  ? 25   DG  B "C4'"  2  
ATOM   8914   O  "O4'"  . DG  B 2 25  ? 3.199   -7.224  -10.495 1.00 0.00  ? 25   DG  B "O4'"  2  
ATOM   8915   C  "C3'"  . DG  B 2 25  ? 5.038   -7.723  -11.901 1.00 0.00  ? 25   DG  B "C3'"  2  
ATOM   8916   O  "O3'"  . DG  B 2 25  ? 4.817   -8.894  -12.693 1.00 0.00  ? 25   DG  B "O3'"  2  
ATOM   8917   C  "C2'"  . DG  B 2 25  ? 4.289   -6.546  -12.477 1.00 0.00  ? 25   DG  B "C2'"  2  
ATOM   8918   C  "C1'"  . DG  B 2 25  ? 2.969   -6.593  -11.740 1.00 0.00  ? 25   DG  B "C1'"  2  
ATOM   8919   N  N9     . DG  B 2 25  ? 2.398   -5.295  -11.440 1.00 0.00  ? 25   DG  B N9     2  
ATOM   8920   C  C8     . DG  B 2 25  ? 3.028   -4.174  -10.968 1.00 0.00  ? 25   DG  B C8     2  
ATOM   8921   N  N7     . DG  B 2 25  ? 2.217   -3.167  -10.796 1.00 0.00  ? 25   DG  B N7     2  
ATOM   8922   C  C5     . DG  B 2 25  ? 0.979   -3.674  -11.163 1.00 0.00  ? 25   DG  B C5     2  
ATOM   8923   C  C6     . DG  B 2 25  ? -0.300  -3.071  -11.184 1.00 0.00  ? 25   DG  B C6     2  
ATOM   8924   O  O6     . DG  B 2 25  ? -0.613  -1.908  -10.893 1.00 0.00  ? 25   DG  B O6     2  
ATOM   8925   N  N1     . DG  B 2 25  ? -1.278  -3.972  -11.603 1.00 0.00  ? 25   DG  B N1     2  
ATOM   8926   C  C2     . DG  B 2 25  ? -1.048  -5.279  -11.965 1.00 0.00  ? 25   DG  B C2     2  
ATOM   8927   N  N2     . DG  B 2 25  ? -2.101  -6.017  -12.308 1.00 0.00  ? 25   DG  B N2     2  
ATOM   8928   N  N3     . DG  B 2 25  ? 0.135   -5.832  -11.977 1.00 0.00  ? 25   DG  B N3     2  
ATOM   8929   C  C4     . DG  B 2 25  ? 1.090   -4.985  -11.561 1.00 0.00  ? 25   DG  B C4     2  
ATOM   8930   H  "H5'"  . DG  B 2 25  ? 4.858   -7.176  -8.447  1.00 0.00  ? 25   DG  B "H5'"  2  
ATOM   8931   H  "H5''" . DG  B 2 25  ? 6.301   -7.758  -9.310  1.00 0.00  ? 25   DG  B "H5''" 2  
ATOM   8932   H  "H4'"  . DG  B 2 25  ? 4.470   -8.889  -10.232 1.00 0.00  ? 25   DG  B "H4'"  2  
ATOM   8933   H  "H3'"  . DG  B 2 25  ? 6.099   -7.522  -11.883 1.00 0.00  ? 25   DG  B "H3'"  2  
ATOM   8934   H  "H2'"  . DG  B 2 25  ? 4.834   -5.626  -12.288 1.00 0.00  ? 25   DG  B "H2'"  2  
ATOM   8935   H  "H2''" . DG  B 2 25  ? 4.166   -6.639  -13.556 1.00 0.00  ? 25   DG  B "H2''" 2  
ATOM   8936   H  "H1'"  . DG  B 2 25  ? 2.230   -7.179  -12.296 1.00 0.00  ? 25   DG  B "H1'"  2  
ATOM   8937   H  H8     . DG  B 2 25  ? 4.078   -4.143  -10.720 1.00 0.00  ? 25   DG  B H8     2  
ATOM   8938   H  H1     . DG  B 2 25  ? -2.229  -3.651  -11.643 1.00 0.00  ? 25   DG  B H1     2  
ATOM   8939   H  H21    . DG  B 2 25  ? -1.952  -6.983  -12.565 1.00 0.00  ? 25   DG  B H21    2  
ATOM   8940   H  H22    . DG  B 2 25  ? -3.023  -5.620  -12.285 1.00 0.00  ? 25   DG  B H22    2  
ATOM   8941   P  P      . DC  B 2 26  ? 5.053   -8.804  -14.283 1.00 0.00  ? 26   DC  B P      2  
ATOM   8942   O  OP1    . DC  B 2 26  ? 5.211   -10.152 -14.888 1.00 0.00  ? 26   DC  B OP1    2  
ATOM   8943   O  OP2    . DC  B 2 26  ? 6.047   -7.742  -14.574 1.00 0.00  ? 26   DC  B OP2    2  
ATOM   8944   O  "O5'"  . DC  B 2 26  ? 3.641   -8.308  -14.786 1.00 0.00  ? 26   DC  B "O5'"  2  
ATOM   8945   C  "C5'"  . DC  B 2 26  ? 2.532   -9.145  -14.568 1.00 0.00  ? 26   DC  B "C5'"  2  
ATOM   8946   C  "C4'"  . DC  B 2 26  ? 1.356   -8.636  -15.347 1.00 0.00  ? 26   DC  B "C4'"  2  
ATOM   8947   O  "O4'"  . DC  B 2 26  ? 0.886   -7.419  -14.725 1.00 0.00  ? 26   DC  B "O4'"  2  
ATOM   8948   C  "C3'"  . DC  B 2 26  ? 1.706   -8.282  -16.789 1.00 0.00  ? 26   DC  B "C3'"  2  
ATOM   8949   O  "O3'"  . DC  B 2 26  ? 0.684   -8.780  -17.641 1.00 0.00  ? 26   DC  B "O3'"  2  
ATOM   8950   C  "C2'"  . DC  B 2 26  ? 1.750   -6.764  -16.785 1.00 0.00  ? 26   DC  B "C2'"  2  
ATOM   8951   C  "C1'"  . DC  B 2 26  ? 0.736   -6.431  -15.714 1.00 0.00  ? 26   DC  B "C1'"  2  
ATOM   8952   N  N1     . DC  B 2 26  ? 0.886   -5.120  -15.072 1.00 0.00  ? 26   DC  B N1     2  
ATOM   8953   C  C2     . DC  B 2 26  ? -0.225  -4.289  -15.049 1.00 0.00  ? 26   DC  B C2     2  
ATOM   8954   O  O2     . DC  B 2 26  ? -1.278  -4.694  -15.560 1.00 0.00  ? 26   DC  B O2     2  
ATOM   8955   N  N3     . DC  B 2 26  ? -0.133  -3.071  -14.476 1.00 0.00  ? 26   DC  B N3     2  
ATOM   8956   C  C4     . DC  B 2 26  ? 1.018   -2.675  -13.934 1.00 0.00  ? 26   DC  B C4     2  
ATOM   8957   N  N4     . DC  B 2 26  ? 1.056   -1.461  -13.385 1.00 0.00  ? 26   DC  B N4     2  
ATOM   8958   C  C5     . DC  B 2 26  ? 2.179   -3.507  -13.934 1.00 0.00  ? 26   DC  B C5     2  
ATOM   8959   C  C6     . DC  B 2 26  ? 2.068   -4.715  -14.511 1.00 0.00  ? 26   DC  B C6     2  
ATOM   8960   H  "H5'"  . DC  B 2 26  ? 2.286   -9.160  -13.509 1.00 0.00  ? 26   DC  B "H5'"  2  
ATOM   8961   H  "H5''" . DC  B 2 26  ? 2.772   -10.155 -14.899 1.00 0.00  ? 26   DC  B "H5''" 2  
ATOM   8962   H  "H4'"  . DC  B 2 26  ? 0.613   -9.430  -15.382 1.00 0.00  ? 26   DC  B "H4'"  2  
ATOM   8963   H  "H3'"  . DC  B 2 26  ? 2.662   -8.717  -17.082 1.00 0.00  ? 26   DC  B "H3'"  2  
ATOM   8964   H  "H2'"  . DC  B 2 26  ? 2.746   -6.397  -16.542 1.00 0.00  ? 26   DC  B "H2'"  2  
ATOM   8965   H  "H2''" . DC  B 2 26  ? 1.476   -6.355  -17.757 1.00 0.00  ? 26   DC  B "H2''" 2  
ATOM   8966   H  "H1'"  . DC  B 2 26  ? -0.279  -6.506  -16.105 1.00 0.00  ? 26   DC  B "H1'"  2  
ATOM   8967   H  H41    . DC  B 2 26  ? 1.906   -1.119  -12.963 1.00 0.00  ? 26   DC  B H41    2  
ATOM   8968   H  H42    . DC  B 2 26  ? 0.227   -0.883  -13.405 1.00 0.00  ? 26   DC  B H42    2  
ATOM   8969   H  H5     . DC  B 2 26  ? 3.114   -3.175  -13.482 1.00 0.00  ? 26   DC  B H5     2  
ATOM   8970   H  H6     . DC  B 2 26  ? 2.934   -5.379  -14.530 1.00 0.00  ? 26   DC  B H6     2  
ATOM   8971   P  P      . DG  B 2 27  ? 1.010   -9.112  -19.173 1.00 0.00  ? 27   DG  B P      2  
ATOM   8972   O  OP1    . DG  B 2 27  ? 1.532   -10.502 -19.249 1.00 0.00  ? 27   DG  B OP1    2  
ATOM   8973   O  OP2    . DG  B 2 27  ? 1.823   -7.992  -19.716 1.00 0.00  ? 27   DG  B OP2    2  
ATOM   8974   O  "O5'"  . DG  B 2 27  ? -0.440  -9.065  -19.820 1.00 0.00  ? 27   DG  B "O5'"  2  
ATOM   8975   C  "C5'"  . DG  B 2 27  ? -1.582  -8.840  -18.989 1.00 0.00  ? 27   DG  B "C5'"  2  
ATOM   8976   C  "C4'"  . DG  B 2 27  ? -2.245  -7.533  -19.351 1.00 0.00  ? 27   DG  B "C4'"  2  
ATOM   8977   O  "O4'"  . DG  B 2 27  ? -1.531  -6.443  -18.729 1.00 0.00  ? 27   DG  B "O4'"  2  
ATOM   8978   C  "C3'"  . DG  B 2 27  ? -2.255  -7.216  -20.849 1.00 0.00  ? 27   DG  B "C3'"  2  
ATOM   8979   O  "O3'"  . DG  B 2 27  ? -3.578  -7.380  -21.363 1.00 0.00  ? 27   DG  B "O3'"  2  
ATOM   8980   C  "C2'"  . DG  B 2 27  ? -1.815  -5.759  -20.943 1.00 0.00  ? 27   DG  B "C2'"  2  
ATOM   8981   C  "C1'"  . DG  B 2 27  ? -1.786  -5.288  -19.494 1.00 0.00  ? 27   DG  B "C1'"  2  
ATOM   8982   N  N9     . DG  B 2 27  ? -0.766  -4.292  -19.176 1.00 0.00  ? 27   DG  B N9     2  
ATOM   8983   C  C8     . DG  B 2 27  ? 0.601   -4.436  -19.222 1.00 0.00  ? 27   DG  B C8     2  
ATOM   8984   N  N7     . DG  B 2 27  ? 1.244   -3.351  -18.888 1.00 0.00  ? 27   DG  B N7     2  
ATOM   8985   C  C5     . DG  B 2 27  ? 0.243   -2.434  -18.596 1.00 0.00  ? 27   DG  B C5     2  
ATOM   8986   C  C6     . DG  B 2 27  ? 0.325   -1.076  -18.171 1.00 0.00  ? 27   DG  B C6     2  
ATOM   8987   O  O6     . DG  B 2 27  ? 1.334   -0.390  -17.967 1.00 0.00  ? 27   DG  B O6     2  
ATOM   8988   N  N1     . DG  B 2 27  ? -0.939  -0.521  -17.985 1.00 0.00  ? 27   DG  B N1     2  
ATOM   8989   C  C2     . DG  B 2 27  ? -2.127  -1.181  -18.185 1.00 0.00  ? 27   DG  B C2     2  
ATOM   8990   N  N2     . DG  B 2 27  ? -3.244  -0.481  -17.946 1.00 0.00  ? 27   DG  B N2     2  
ATOM   8991   N  N3     . DG  B 2 27  ? -2.217  -2.439  -18.584 1.00 0.00  ? 27   DG  B N3     2  
ATOM   8992   C  C4     . DG  B 2 27  ? -1.003  -3.001  -18.768 1.00 0.00  ? 27   DG  B C4     2  
ATOM   8993   H  "H5'"  . DG  B 2 27  ? -1.272  -8.803  -17.944 1.00 0.00  ? 27   DG  B "H5'"  2  
ATOM   8994   H  "H5''" . DG  B 2 27  ? -2.297  -9.652  -19.120 1.00 0.00  ? 27   DG  B "H5''" 2  
ATOM   8995   H  "H4'"  . DG  B 2 27  ? -3.288  -7.598  -19.040 1.00 0.00  ? 27   DG  B "H4'"  2  
ATOM   8996   H  "H3'"  . DG  B 2 27  ? -1.580  -7.877  -21.392 1.00 0.00  ? 27   DG  B "H3'"  2  
ATOM   8997   H  "H2'"  . DG  B 2 27  ? -0.838  -5.678  -21.426 1.00 0.00  ? 27   DG  B "H2'"  2  
ATOM   8998   H  "H2''" . DG  B 2 27  ? -2.518  -5.178  -21.542 1.00 0.00  ? 27   DG  B "H2''" 2  
ATOM   8999   H  "H1'"  . DG  B 2 27  ? -2.763  -4.896  -19.193 1.00 0.00  ? 27   DG  B "H1'"  2  
ATOM   9000   H  H8     . DG  B 2 27  ? 1.093   -5.357  -19.502 1.00 0.00  ? 27   DG  B H8     2  
ATOM   9001   H  H1     . DG  B 2 27  ? -0.989  0.443   -17.679 1.00 0.00  ? 27   DG  B H1     2  
ATOM   9002   H  H21    . DG  B 2 27  ? -4.142  -0.923  -18.074 1.00 0.00  ? 27   DG  B H21    2  
ATOM   9003   H  H22    . DG  B 2 27  ? -3.187  0.480   -17.640 1.00 0.00  ? 27   DG  B H22    2  
ATOM   9004   P  P      . DG  B 2 28  ? -3.842  -7.255  -22.942 1.00 0.00  ? 28   DG  B P      2  
ATOM   9005   O  OP1    . DG  B 2 28  ? -5.091  -7.988  -23.274 1.00 0.00  ? 28   DG  B OP1    2  
ATOM   9006   O  OP2    . DG  B 2 28  ? -2.577  -7.609  -23.632 1.00 0.00  ? 28   DG  B OP2    2  
ATOM   9007   O  "O5'"  . DG  B 2 28  ? -4.094  -5.698  -23.169 1.00 0.00  ? 28   DG  B "O5'"  2  
ATOM   9008   C  "C5'"  . DG  B 2 28  ? -5.262  -5.056  -22.656 1.00 0.00  ? 28   DG  B "C5'"  2  
ATOM   9009   C  "C4'"  . DG  B 2 28  ? -5.268  -3.596  -23.049 1.00 0.00  ? 28   DG  B "C4'"  2  
ATOM   9010   O  "O4'"  . DG  B 2 28  ? -4.194  -2.924  -22.344 1.00 0.00  ? 28   DG  B "O4'"  2  
ATOM   9011   C  "C3'"  . DG  B 2 28  ? -5.010  -3.319  -24.534 1.00 0.00  ? 28   DG  B "C3'"  2  
ATOM   9012   O  "O3'"  . DG  B 2 28  ? -5.694  -2.135  -24.967 1.00 0.00  ? 28   DG  B "O3'"  2  
ATOM   9013   C  "C2'"  . DG  B 2 28  ? -3.515  -3.068  -24.563 1.00 0.00  ? 28   DG  B "C2'"  2  
ATOM   9014   C  "C1'"  . DG  B 2 28  ? -3.359  -2.277  -23.289 1.00 0.00  ? 28   DG  B "C1'"  2  
ATOM   9015   N  N9     . DG  B 2 28  ? -2.006  -2.216  -22.746 1.00 0.00  ? 28   DG  B N9     2  
ATOM   9016   C  C8     . DG  B 2 28  ? -1.058  -3.208  -22.744 1.00 0.00  ? 28   DG  B C8     2  
ATOM   9017   N  N7     . DG  B 2 28  ? 0.071   -2.838  -22.200 1.00 0.00  ? 28   DG  B N7     2  
ATOM   9018   C  C5     . DG  B 2 28  ? -0.150  -1.523  -21.817 1.00 0.00  ? 28   DG  B C5     2  
ATOM   9019   C  C6     . DG  B 2 28  ? 0.709   -0.591  -21.176 1.00 0.00  ? 28   DG  B C6     2  
ATOM   9020   O  O6     . DG  B 2 28  ? 1.880   -0.747  -20.806 1.00 0.00  ? 28   DG  B O6     2  
ATOM   9021   N  N1     . DG  B 2 28  ? 0.077   0.635   -20.975 1.00 0.00  ? 28   DG  B N1     2  
ATOM   9022   C  C2     . DG  B 2 28  ? -1.216  0.925   -21.343 1.00 0.00  ? 28   DG  B C2     2  
ATOM   9023   N  N2     . DG  B 2 28  ? -1.650  2.162   -21.067 1.00 0.00  ? 28   DG  B N2     2  
ATOM   9024   N  N3     . DG  B 2 28  ? -2.023  0.066   -21.938 1.00 0.00  ? 28   DG  B N3     2  
ATOM   9025   C  C4     . DG  B 2 28  ? -1.430  -1.128  -22.143 1.00 0.00  ? 28   DG  B C4     2  
ATOM   9026   H  "H5'"  . DG  B 2 28  ? -5.273  -5.131  -21.568 1.00 0.00  ? 28   DG  B "H5'"  2  
ATOM   9027   H  "H5''" . DG  B 2 28  ? -6.154  -5.539  -23.056 1.00 0.00  ? 28   DG  B "H5''" 2  
ATOM   9028   H  "H4'"  . DG  B 2 28  ? -6.256  -3.192  -22.816 1.00 0.00  ? 28   DG  B "H4'"  2  
ATOM   9029   H  "H3'"  . DG  B 2 28  ? -5.304  -4.165  -25.157 1.00 0.00  ? 28   DG  B "H3'"  2  
ATOM   9030   H  "H2'"  . DG  B 2 28  ? -2.951  -3.998  -24.547 1.00 0.00  ? 28   DG  B "H2'"  2  
ATOM   9031   H  "H2''" . DG  B 2 28  ? -3.215  -2.509  -25.449 1.00 0.00  ? 28   DG  B "H2''" 2  
ATOM   9032   H  "H1'"  . DG  B 2 28  ? -3.726  -1.263  -23.419 1.00 0.00  ? 28   DG  B "H1'"  2  
ATOM   9033   H  H8     . DG  B 2 28  ? -1.226  -4.190  -23.156 1.00 0.00  ? 28   DG  B H8     2  
ATOM   9034   H  H1     . DG  B 2 28  ? 0.604   1.367   -20.526 1.00 0.00  ? 28   DG  B H1     2  
ATOM   9035   H  H21    . DG  B 2 28  ? -2.591  2.433   -21.314 1.00 0.00  ? 28   DG  B H21    2  
ATOM   9036   H  H22    . DG  B 2 28  ? -1.040  2.824   -20.611 1.00 0.00  ? 28   DG  B H22    2  
ATOM   9037   P  P      . DT  B 2 29  ? -7.219  -2.223  -25.462 1.00 0.00  ? 29   DT  B P      2  
ATOM   9038   O  OP1    . DT  B 2 29  ? -7.814  -3.449  -24.867 1.00 0.00  ? 29   DT  B OP1    2  
ATOM   9039   O  OP2    . DT  B 2 29  ? -7.242  -2.039  -26.934 1.00 0.00  ? 29   DT  B OP2    2  
ATOM   9040   O  "O5'"  . DT  B 2 29  ? -7.904  -0.946  -24.801 1.00 0.00  ? 29   DT  B "O5'"  2  
ATOM   9041   C  "C5'"  . DT  B 2 29  ? -7.266  -0.227  -23.744 1.00 0.00  ? 29   DT  B "C5'"  2  
ATOM   9042   C  "C4'"  . DT  B 2 29  ? -7.764  1.202   -23.708 1.00 0.00  ? 29   DT  B "C4'"  2  
ATOM   9043   O  "O4'"  . DT  B 2 29  ? -6.641  2.102   -23.739 1.00 0.00  ? 29   DT  B "O4'"  2  
ATOM   9044   C  "C3'"  . DT  B 2 29  ? -8.613  1.641   -24.894 1.00 0.00  ? 29   DT  B "C3'"  2  
ATOM   9045   O  "O3'"  . DT  B 2 29  ? -9.401  2.782   -24.525 1.00 0.00  ? 29   DT  B "O3'"  2  
ATOM   9046   C  "C2'"  . DT  B 2 29  ? -7.567  2.003   -25.935 1.00 0.00  ? 29   DT  B "C2'"  2  
ATOM   9047   C  "C1'"  . DT  B 2 29  ? -6.354  2.428   -25.095 1.00 0.00  ? 29   DT  B "C1'"  2  
ATOM   9048   N  N1     . DT  B 2 29  ? -5.088  1.760   -25.449 1.00 0.00  ? 29   DT  B N1     2  
ATOM   9049   C  C2     . DT  B 2 29  ? -3.940  2.289   -24.913 1.00 0.00  ? 29   DT  B C2     2  
ATOM   9050   O  O2     . DT  B 2 29  ? -3.937  3.269   -24.188 1.00 0.00  ? 29   DT  B O2     2  
ATOM   9051   N  N3     . DT  B 2 29  ? -2.790  1.626   -25.255 1.00 0.00  ? 29   DT  B N3     2  
ATOM   9052   C  C4     . DT  B 2 29  ? -2.678  0.517   -26.066 1.00 0.00  ? 29   DT  B C4     2  
ATOM   9053   O  O4     . DT  B 2 29  ? -1.573  0.030   -26.286 1.00 0.00  ? 29   DT  B O4     2  
ATOM   9054   C  C5     . DT  B 2 29  ? -3.923  0.018   -26.602 1.00 0.00  ? 29   DT  B C5     2  
ATOM   9055   C  C7     . DT  B 2 29  ? -3.892  -1.164  -27.516 1.00 0.00  ? 29   DT  B C7     2  
ATOM   9056   C  C6     . DT  B 2 29  ? -5.057  0.651   -26.273 1.00 0.00  ? 29   DT  B C6     2  
ATOM   9057   H  "H5'"  . DT  B 2 29  ? -6.185  -0.227  -23.899 1.00 0.00  ? 29   DT  B "H5'"  2  
ATOM   9058   H  "H5''" . DT  B 2 29  ? -7.489  -0.708  -22.792 1.00 0.00  ? 29   DT  B "H5''" 2  
ATOM   9059   H  "H4'"  . DT  B 2 29  ? -8.380  1.315   -22.816 1.00 0.00  ? 29   DT  B "H4'"  2  
ATOM   9060   H  "H3'"  . DT  B 2 29  ? -9.269  0.839   -25.233 1.00 0.00  ? 29   DT  B "H3'"  2  
ATOM   9061   H  "H2'"  . DT  B 2 29  ? -7.347  1.150   -26.577 1.00 0.00  ? 29   DT  B "H2'"  2  
ATOM   9062   H  "H2''" . DT  B 2 29  ? -7.916  2.808   -26.580 1.00 0.00  ? 29   DT  B "H2''" 2  
ATOM   9063   H  "H1'"  . DT  B 2 29  ? -6.200  3.509   -25.155 1.00 0.00  ? 29   DT  B "H1'"  2  
ATOM   9064   H  H3     . DT  B 2 29  ? -1.934  1.986   -24.866 1.00 0.00  ? 29   DT  B H3     2  
ATOM   9065   H  H71    . DT  B 2 29  ? -4.614  -1.906  -27.176 1.00 0.00  ? 29   DT  B H71    2  
ATOM   9066   H  H72    . DT  B 2 29  ? -2.894  -1.600  -27.513 1.00 0.00  ? 29   DT  B H72    2  
ATOM   9067   H  H73    . DT  B 2 29  ? -4.146  -0.847  -28.528 1.00 0.00  ? 29   DT  B H73    2  
ATOM   9068   H  H6     . DT  B 2 29  ? -5.997  0.272   -26.674 1.00 0.00  ? 29   DT  B H6     2  
ATOM   9069   P  P      . DC  B 2 30  ? -9.713  3.932   -25.608 1.00 0.00  ? 30   DC  B P      2  
ATOM   9070   O  OP1    . DC  B 2 30  ? -10.631 4.914   -24.977 1.00 0.00  ? 30   DC  B OP1    2  
ATOM   9071   O  OP2    . DC  B 2 30  ? -10.112 3.264   -26.874 1.00 0.00  ? 30   DC  B OP2    2  
ATOM   9072   O  "O5'"  . DC  B 2 30  ? -8.305  4.644   -25.843 1.00 0.00  ? 30   DC  B "O5'"  2  
ATOM   9073   C  "C5'"  . DC  B 2 30  ? -7.949  5.819   -25.113 1.00 0.00  ? 30   DC  B "C5'"  2  
ATOM   9074   C  "C4'"  . DC  B 2 30  ? -6.756  6.494   -25.750 1.00 0.00  ? 30   DC  B "C4'"  2  
ATOM   9075   O  "O4'"  . DC  B 2 30  ? -5.725  5.507   -25.988 1.00 0.00  ? 30   DC  B "O4'"  2  
ATOM   9076   C  "C3'"  . DC  B 2 30  ? -7.029  7.162   -27.105 1.00 0.00  ? 30   DC  B "C3'"  2  
ATOM   9077   O  "O3'"  . DC  B 2 30  ? -6.589  8.524   -27.076 1.00 0.00  ? 30   DC  B "O3'"  2  
ATOM   9078   C  "C2'"  . DC  B 2 30  ? -6.197  6.358   -28.095 1.00 0.00  ? 30   DC  B "C2'"  2  
ATOM   9079   C  "C1'"  . DC  B 2 30  ? -5.098  5.805   -27.216 1.00 0.00  ? 30   DC  B "C1'"  2  
ATOM   9080   N  N1     . DC  B 2 30  ? -4.456  4.578   -27.712 1.00 0.00  ? 30   DC  B N1     2  
ATOM   9081   C  C2     . DC  B 2 30  ? -3.063  4.541   -27.791 1.00 0.00  ? 30   DC  B C2     2  
ATOM   9082   O  O2     . DC  B 2 30  ? -2.417  5.539   -27.442 1.00 0.00  ? 30   DC  B O2     2  
ATOM   9083   N  N3     . DC  B 2 30  ? -2.456  3.420   -28.242 1.00 0.00  ? 30   DC  B N3     2  
ATOM   9084   C  C4     . DC  B 2 30  ? -3.189  2.365   -28.605 1.00 0.00  ? 30   DC  B C4     2  
ATOM   9085   N  N4     . DC  B 2 30  ? -2.545  1.279   -29.039 1.00 0.00  ? 30   DC  B N4     2  
ATOM   9086   C  C5     . DC  B 2 30  ? -4.613  2.376   -28.537 1.00 0.00  ? 30   DC  B C5     2  
ATOM   9087   C  C6     . DC  B 2 30  ? -5.199  3.495   -28.090 1.00 0.00  ? 30   DC  B C6     2  
ATOM   9088   H  "H5'"  . DC  B 2 30  ? -7.699  5.550   -24.087 1.00 0.00  ? 30   DC  B "H5'"  2  
ATOM   9089   H  "H5''" . DC  B 2 30  ? -8.790  6.514   -25.104 1.00 0.00  ? 30   DC  B "H5''" 2  
ATOM   9090   H  "H4'"  . DC  B 2 30  ? -6.435  7.290   -25.074 1.00 0.00  ? 30   DC  B "H4'"  2  
ATOM   9091   H  "H3'"  . DC  B 2 30  ? -8.089  7.135   -27.350 1.00 0.00  ? 30   DC  B "H3'"  2  
ATOM   9092   H  "H2'"  . DC  B 2 30  ? -6.790  5.571   -28.562 1.00 0.00  ? 30   DC  B "H2'"  2  
ATOM   9093   H  "H2''" . DC  B 2 30  ? -5.807  6.991   -28.892 1.00 0.00  ? 30   DC  B "H2''" 2  
ATOM   9094   H  "H1'"  . DC  B 2 30  ? -4.327  6.554   -27.030 1.00 0.00  ? 30   DC  B "H1'"  2  
ATOM   9095   H  H41    . DC  B 2 30  ? -3.065  0.460   -29.318 1.00 0.00  ? 30   DC  B H41    2  
ATOM   9096   H  H42    . DC  B 2 30  ? -1.537  1.289   -29.104 1.00 0.00  ? 30   DC  B H42    2  
ATOM   9097   H  H5     . DC  B 2 30  ? -5.200  1.507   -28.834 1.00 0.00  ? 30   DC  B H5     2  
ATOM   9098   H  H6     . DC  B 2 30  ? -6.287  3.541   -28.030 1.00 0.00  ? 30   DC  B H6     2  
ATOM   9099   P  P      . DA  B 2 31  ? -6.938  9.503   -28.303 1.00 0.00  ? 31   DA  B P      2  
ATOM   9100   O  OP1    . DA  B 2 31  ? -6.686  10.901  -27.869 1.00 0.00  ? 31   DA  B OP1    2  
ATOM   9101   O  OP2    . DA  B 2 31  ? -8.281  9.125   -28.813 1.00 0.00  ? 31   DA  B OP2    2  
ATOM   9102   O  "O5'"  . DA  B 2 31  ? -5.861  9.132   -29.414 1.00 0.00  ? 31   DA  B "O5'"  2  
ATOM   9103   C  "C5'"  . DA  B 2 31  ? -4.759  9.999   -29.677 1.00 0.00  ? 31   DA  B "C5'"  2  
ATOM   9104   C  "C4'"  . DA  B 2 31  ? -3.556  9.572   -28.871 1.00 0.00  ? 31   DA  B "C4'"  2  
ATOM   9105   O  "O4'"  . DA  B 2 31  ? -3.404  8.136   -28.987 1.00 0.00  ? 31   DA  B "O4'"  2  
ATOM   9106   C  "C3'"  . DA  B 2 31  ? -2.227  10.181  -29.327 1.00 0.00  ? 31   DA  B "C3'"  2  
ATOM   9107   O  "O3'"  . DA  B 2 31  ? -1.442  10.564  -28.194 1.00 0.00  ? 31   DA  B "O3'"  2  
ATOM   9108   C  "C2'"  . DA  B 2 31  ? -1.552  9.052   -30.087 1.00 0.00  ? 31   DA  B "C2'"  2  
ATOM   9109   C  "C1'"  . DA  B 2 31  ? -2.080  7.823   -29.374 1.00 0.00  ? 31   DA  B "C1'"  2  
ATOM   9110   N  N9     . DA  B 2 31  ? -2.124  6.615   -30.197 1.00 0.00  ? 31   DA  B N9     2  
ATOM   9111   C  C8     . DA  B 2 31  ? -3.231  5.948   -30.662 1.00 0.00  ? 31   DA  B C8     2  
ATOM   9112   N  N7     . DA  B 2 31  ? -2.947  4.889   -31.380 1.00 0.00  ? 31   DA  B N7     2  
ATOM   9113   C  C5     . DA  B 2 31  ? -1.559  4.855   -31.390 1.00 0.00  ? 31   DA  B C5     2  
ATOM   9114   C  C6     . DA  B 2 31  ? -0.638  3.973   -31.980 1.00 0.00  ? 31   DA  B C6     2  
ATOM   9115   N  N6     . DA  B 2 31  ? -0.990  2.910   -32.707 1.00 0.00  ? 31   DA  B N6     2  
ATOM   9116   N  N1     . DA  B 2 31  ? 0.678   4.222   -31.796 1.00 0.00  ? 31   DA  B N1     2  
ATOM   9117   C  C2     . DA  B 2 31  ? 1.033   5.289   -31.067 1.00 0.00  ? 31   DA  B C2     2  
ATOM   9118   N  N3     . DA  B 2 31  ? 0.261   6.190   -30.463 1.00 0.00  ? 31   DA  B N3     2  
ATOM   9119   C  C4     . DA  B 2 31  ? -1.040  5.912   -30.665 1.00 0.00  ? 31   DA  B C4     2  
ATOM   9120   H  "H5'"  . DA  B 2 31  ? -5.025  11.021  -29.407 1.00 0.00  ? 31   DA  B "H5'"  2  
ATOM   9121   H  "H5''" . DA  B 2 31  ? -4.509  9.964   -30.738 1.00 0.00  ? 31   DA  B "H5''" 2  
ATOM   9122   H  "H4'"  . DA  B 2 31  ? -3.714  9.905   -27.842 1.00 0.00  ? 31   DA  B "H4'"  2  
ATOM   9123   H  "H3'"  . DA  B 2 31  ? -2.392  11.053  -29.958 1.00 0.00  ? 31   DA  B "H3'"  2  
ATOM   9124   H  "H2'"  . DA  B 2 31  ? -1.823  9.067   -31.142 1.00 0.00  ? 31   DA  B "H2'"  2  
ATOM   9125   H  "H2''" . DA  B 2 31  ? -0.466  9.128   -30.026 1.00 0.00  ? 31   DA  B "H2''" 2  
ATOM   9126   H  "H1'"  . DA  B 2 31  ? -1.503  7.612   -28.471 1.00 0.00  ? 31   DA  B "H1'"  2  
ATOM   9127   H  H8     . DA  B 2 31  ? -4.242  6.267   -30.454 1.00 0.00  ? 31   DA  B H8     2  
ATOM   9128   H  H61    . DA  B 2 31  ? -0.279  2.315   -33.107 1.00 0.00  ? 31   DA  B H61    2  
ATOM   9129   H  H62    . DA  B 2 31  ? -1.968  2.701   -32.860 1.00 0.00  ? 31   DA  B H62    2  
ATOM   9130   H  H2     . DA  B 2 31  ? 2.105   5.441   -30.952 1.00 0.00  ? 31   DA  B H2     2  
ATOM   9131   P  P      . DG  B 2 32  ? -0.069  11.370  -28.412 1.00 0.00  ? 32   DG  B P      2  
ATOM   9132   O  OP1    . DG  B 2 32  ? 0.698   11.296  -27.143 1.00 0.00  ? 32   DG  B OP1    2  
ATOM   9133   O  OP2    . DG  B 2 32  ? -0.394  12.696  -28.997 1.00 0.00  ? 32   DG  B OP2    2  
ATOM   9134   O  "O5'"  . DG  B 2 32  ? 0.708   10.517  -29.511 1.00 0.00  ? 32   DG  B "O5'"  2  
ATOM   9135   C  "C5'"  . DG  B 2 32  ? 1.120   11.110  -30.743 1.00 0.00  ? 32   DG  B "C5'"  2  
ATOM   9136   C  "C4'"  . DG  B 2 32  ? 2.436   10.519  -31.190 1.00 0.00  ? 32   DG  B "C4'"  2  
ATOM   9137   O  "O4'"  . DG  B 2 32  ? 2.209   9.159   -31.635 1.00 0.00  ? 32   DG  B "O4'"  2  
ATOM   9138   C  "C3'"  . DG  B 2 32  ? 3.099   11.241  -32.365 1.00 0.00  ? 32   DG  B "C3'"  2  
ATOM   9139   O  "O3'"  . DG  B 2 32  ? 4.519   11.273  -32.187 1.00 0.00  ? 32   DG  B "O3'"  2  
ATOM   9140   C  "C2'"  . DG  B 2 32  ? 2.731   10.382  -33.560 1.00 0.00  ? 32   DG  B "C2'"  2  
ATOM   9141   C  "C1'"  . DG  B 2 32  ? 2.707   8.995   -32.951 1.00 0.00  ? 32   DG  B "C1'"  2  
ATOM   9142   N  N9     . DG  B 2 32  ? 1.850   8.038   -33.642 1.00 0.00  ? 32   DG  B N9     2  
ATOM   9143   C  C8     . DG  B 2 32  ? 0.508   8.165   -33.908 1.00 0.00  ? 32   DG  B C8     2  
ATOM   9144   N  N7     . DG  B 2 32  ? 0.010   7.140   -34.545 1.00 0.00  ? 32   DG  B N7     2  
ATOM   9145   C  C5     . DG  B 2 32  ? 1.089   6.283   -34.710 1.00 0.00  ? 32   DG  B C5     2  
ATOM   9146   C  C6     . DG  B 2 32  ? 1.165   5.009   -35.331 1.00 0.00  ? 32   DG  B C6     2  
ATOM   9147   O  O6     . DG  B 2 32  ? 0.264   4.361   -35.877 1.00 0.00  ? 32   DG  B O6     2  
ATOM   9148   N  N1     . DG  B 2 32  ? 2.456   4.489   -35.276 1.00 0.00  ? 32   DG  B N1     2  
ATOM   9149   C  C2     . DG  B 2 32  ? 3.534   5.112   -34.697 1.00 0.00  ? 32   DG  B C2     2  
ATOM   9150   N  N2     . DG  B 2 32  ? 4.697   4.448   -34.744 1.00 0.00  ? 32   DG  B N2     2  
ATOM   9151   N  N3     . DG  B 2 32  ? 3.476   6.300   -34.115 1.00 0.00  ? 32   DG  B N3     2  
ATOM   9152   C  C4     . DG  B 2 32  ? 2.233   6.823   -34.158 1.00 0.00  ? 32   DG  B C4     2  
ATOM   9153   H  "H5'"  . DG  B 2 32  ? 1.238   12.185  -30.611 1.00 0.00  ? 32   DG  B "H5'"  2  
ATOM   9154   H  "H5''" . DG  B 2 32  ? 0.366   10.925  -31.509 1.00 0.00  ? 32   DG  B "H5''" 2  
ATOM   9155   H  "H4'"  . DG  B 2 32  ? 3.129   10.586  -30.350 1.00 0.00  ? 32   DG  B "H4'"  2  
ATOM   9156   H  "H3'"  . DG  B 2 32  ? 2.727   12.259  -32.463 1.00 0.00  ? 32   DG  B "H3'"  2  
ATOM   9157   H  "H2'"  . DG  B 2 32  ? 1.765   10.670  -33.974 1.00 0.00  ? 32   DG  B "H2'"  2  
ATOM   9158   H  "H2''" . DG  B 2 32  ? 3.470   10.472  -34.357 1.00 0.00  ? 32   DG  B "H2''" 2  
ATOM   9159   H  "H1'"  . DG  B 2 32  ? 3.713   8.579   -32.882 1.00 0.00  ? 32   DG  B "H1'"  2  
ATOM   9160   H  H8     . DG  B 2 32  ? -0.076  9.026   -33.618 1.00 0.00  ? 32   DG  B H8     2  
ATOM   9161   H  H1     . DG  B 2 32  ? 2.609   3.582   -35.695 1.00 0.00  ? 32   DG  B H1     2  
ATOM   9162   H  H21    . DG  B 2 32  ? 5.528   4.853   -34.334 1.00 0.00  ? 32   DG  B H21    2  
ATOM   9163   H  H22    . DG  B 2 32  ? 4.745   3.544   -35.190 1.00 0.00  ? 32   DG  B H22    2  
ATOM   9164   P  P      . DC  B 2 33  ? 5.399   12.335  -33.011 1.00 0.00  ? 33   DC  B P      2  
ATOM   9165   O  OP1    . DC  B 2 33  ? 5.212   13.675  -32.401 1.00 0.00  ? 33   DC  B OP1    2  
ATOM   9166   O  OP2    . DC  B 2 33  ? 5.100   12.137  -34.452 1.00 0.00  ? 33   DC  B OP2    2  
ATOM   9167   O  "O5'"  . DC  B 2 33  ? 6.900   11.869  -32.758 1.00 0.00  ? 33   DC  B "O5'"  2  
ATOM   9168   C  "C5'"  . DC  B 2 33  ? 7.841   11.834  -33.829 1.00 0.00  ? 33   DC  B "C5'"  2  
ATOM   9169   C  "C4'"  . DC  B 2 33  ? 8.195   10.405  -34.165 1.00 0.00  ? 33   DC  B "C4'"  2  
ATOM   9170   O  "O4'"  . DC  B 2 33  ? 7.016   9.733   -34.672 1.00 0.00  ? 33   DC  B "O4'"  2  
ATOM   9171   C  "C3'"  . DC  B 2 33  ? 9.270   10.257  -35.247 1.00 0.00  ? 33   DC  B "C3'"  2  
ATOM   9172   O  "O3'"  . DC  B 2 33  ? 10.253  9.303   -34.840 1.00 0.00  ? 33   DC  B "O3'"  2  
ATOM   9173   C  "C2'"  . DC  B 2 33  ? 8.505   9.748   -36.458 1.00 0.00  ? 33   DC  B "C2'"  2  
ATOM   9174   C  "C1'"  . DC  B 2 33  ? 7.370   8.982   -35.816 1.00 0.00  ? 33   DC  B "C1'"  2  
ATOM   9175   N  N1     . DC  B 2 33  ? 6.170   8.827   -36.653 1.00 0.00  ? 33   DC  B N1     2  
ATOM   9176   C  C2     . DC  B 2 33  ? 5.919   7.583   -37.237 1.00 0.00  ? 33   DC  B C2     2  
ATOM   9177   O  O2     . DC  B 2 33  ? 6.708   6.650   -37.025 1.00 0.00  ? 33   DC  B O2     2  
ATOM   9178   N  N3     . DC  B 2 33  ? 4.823   7.427   -38.015 1.00 0.00  ? 33   DC  B N3     2  
ATOM   9179   C  C4     . DC  B 2 33  ? 3.996   8.455   -38.217 1.00 0.00  ? 33   DC  B C4     2  
ATOM   9180   N  N4     . DC  B 2 33  ? 2.932   8.255   -38.996 1.00 0.00  ? 33   DC  B N4     2  
ATOM   9181   C  C5     . DC  B 2 33  ? 4.227   9.736   -37.630 1.00 0.00  ? 33   DC  B C5     2  
ATOM   9182   C  C6     . DC  B 2 33  ? 5.316   9.874   -36.861 1.00 0.00  ? 33   DC  B C6     2  
ATOM   9183   H  "H5'"  . DC  B 2 33  ? 8.747   12.367  -33.539 1.00 0.00  ? 33   DC  B "H5'"  2  
ATOM   9184   H  "H5''" . DC  B 2 33  ? 7.411   12.312  -34.708 1.00 0.00  ? 33   DC  B "H5''" 2  
ATOM   9185   H  "H4'"  . DC  B 2 33  ? 8.597   9.944   -33.260 1.00 0.00  ? 33   DC  B "H4'"  2  
ATOM   9186   H  "H3'"  . DC  B 2 33  ? 9.757   11.211  -35.446 1.00 0.00  ? 33   DC  B "H3'"  2  
ATOM   9187   H  "H2'"  . DC  B 2 33  ? 8.150   10.571  -37.076 1.00 0.00  ? 33   DC  B "H2'"  2  
ATOM   9188   H  "H2''" . DC  B 2 33  ? 9.129   9.112   -37.085 1.00 0.00  ? 33   DC  B "H2''" 2  
ATOM   9189   H  "H1'"  . DC  B 2 33  ? 7.697   7.995   -35.487 1.00 0.00  ? 33   DC  B "H1'"  2  
ATOM   9190   H  H41    . DC  B 2 33  ? 2.284   9.009   -39.173 1.00 0.00  ? 33   DC  B H41    2  
ATOM   9191   H  H42    . DC  B 2 33  ? 2.777   7.345   -39.405 1.00 0.00  ? 33   DC  B H42    2  
ATOM   9192   H  H5     . DC  B 2 33  ? 3.543   10.567  -37.799 1.00 0.00  ? 33   DC  B H5     2  
ATOM   9193   H  H6     . DC  B 2 33  ? 5.521   10.838  -36.395 1.00 0.00  ? 33   DC  B H6     2  
ATOM   9194   P  P      . DT  B 2 34  ? 11.684  9.274   -35.569 1.00 0.00  ? 34   DT  B P      2  
ATOM   9195   O  OP1    . DT  B 2 34  ? 12.580  8.386   -34.786 1.00 0.00  ? 34   DT  B OP1    2  
ATOM   9196   O  OP2    . DT  B 2 34  ? 12.091  10.679  -35.833 1.00 0.00  ? 34   DT  B OP2    2  
ATOM   9197   O  "O5'"  . DT  B 2 34  ? 11.392  8.575   -36.969 1.00 0.00  ? 34   DT  B "O5'"  2  
ATOM   9198   C  "C5'"  . DT  B 2 34  ? 12.413  7.844   -37.642 1.00 0.00  ? 34   DT  B "C5'"  2  
ATOM   9199   C  "C4'"  . DT  B 2 34  ? 11.970  6.419   -37.869 1.00 0.00  ? 34   DT  B "C4'"  2  
ATOM   9200   O  "O4'"  . DT  B 2 34  ? 11.598  5.835   -36.596 1.00 0.00  ? 34   DT  B "O4'"  2  
ATOM   9201   C  "C3'"  . DT  B 2 34  ? 10.749  6.264   -38.782 1.00 0.00  ? 34   DT  B "C3'"  2  
ATOM   9202   O  "O3'"  . DT  B 2 34  ? 10.965  5.202   -39.715 1.00 0.00  ? 34   DT  B "O3'"  2  
ATOM   9203   C  "C2'"  . DT  B 2 34  ? 9.622   5.914   -37.826 1.00 0.00  ? 34   DT  B "C2'"  2  
ATOM   9204   C  "C1'"  . DT  B 2 34  ? 10.359  5.169   -36.735 1.00 0.00  ? 34   DT  B "C1'"  2  
ATOM   9205   N  N1     . DT  B 2 34  ? 9.687   5.164   -35.423 1.00 0.00  ? 34   DT  B N1     2  
ATOM   9206   C  C2     . DT  B 2 34  ? 8.696   4.233   -35.219 1.00 0.00  ? 34   DT  B C2     2  
ATOM   9207   O  O2     . DT  B 2 34  ? 8.357   3.427   -36.069 1.00 0.00  ? 34   DT  B O2     2  
ATOM   9208   N  N3     . DT  B 2 34  ? 8.115   4.278   -33.979 1.00 0.00  ? 34   DT  B N3     2  
ATOM   9209   C  C4     . DT  B 2 34  ? 8.420   5.142   -32.947 1.00 0.00  ? 34   DT  B C4     2  
ATOM   9210   O  O4     . DT  B 2 34  ? 7.811   5.062   -31.884 1.00 0.00  ? 34   DT  B O4     2  
ATOM   9211   C  C5     . DT  B 2 34  ? 9.469   6.096   -33.229 1.00 0.00  ? 34   DT  B C5     2  
ATOM   9212   C  C7     . DT  B 2 34  ? 9.864   7.069   -32.163 1.00 0.00  ? 34   DT  B C7     2  
ATOM   9213   C  C6     . DT  B 2 34  ? 10.047  6.065   -34.439 1.00 0.00  ? 34   DT  B C6     2  
ATOM   9214   H  "H5'"  . DT  B 2 34  ? 13.320  7.843   -37.039 1.00 0.00  ? 34   DT  B "H5'"  2  
ATOM   9215   H  "H5''" . DT  B 2 34  ? 12.625  8.311   -38.604 1.00 0.00  ? 34   DT  B "H5''" 2  
ATOM   9216   H  "H4'"  . DT  B 2 34  ? 12.794  5.893   -38.359 1.00 0.00  ? 34   DT  B "H4'"  2  
ATOM   9217   H  "H3'"  . DT  B 2 34  ? 10.549  7.185   -39.329 1.00 0.00  ? 34   DT  B "H3'"  2  
ATOM   9218   H  "H2'"  . DT  B 2 34  ? 9.125   6.810   -37.453 1.00 0.00  ? 34   DT  B "H2'"  2  
ATOM   9219   H  "H2''" . DT  B 2 34  ? 8.866   5.298   -38.312 1.00 0.00  ? 34   DT  B "H2''" 2  
ATOM   9220   H  "H1'"  . DT  B 2 34  ? 10.560  4.137   -37.030 1.00 0.00  ? 34   DT  B "H1'"  2  
ATOM   9221   H  H3     . DT  B 2 34  ? 7.386   3.602   -33.802 1.00 0.00  ? 34   DT  B H3     2  
ATOM   9222   H  H71    . DT  B 2 34  ? 9.737   6.608   -31.183 1.00 0.00  ? 34   DT  B H71    2  
ATOM   9223   H  H72    . DT  B 2 34  ? 10.909  7.352   -32.298 1.00 0.00  ? 34   DT  B H72    2  
ATOM   9224   H  H73    . DT  B 2 34  ? 9.237   7.958   -32.230 1.00 0.00  ? 34   DT  B H73    2  
ATOM   9225   H  H6     . DT  B 2 34  ? 10.838  6.782   -34.655 1.00 0.00  ? 34   DT  B H6     2  
ATOM   9226   P  P      . DT  B 2 35  ? 11.737  5.500   -41.092 1.00 0.00  ? 35   DT  B P      2  
ATOM   9227   O  OP1    . DT  B 2 35  ? 13.155  5.088   -40.930 1.00 0.00  ? 35   DT  B OP1    2  
ATOM   9228   O  OP2    . DT  B 2 35  ? 11.419  6.895   -41.488 1.00 0.00  ? 35   DT  B OP2    2  
ATOM   9229   O  "O5'"  . DT  B 2 35  ? 11.050  4.520   -42.142 1.00 0.00  ? 35   DT  B "O5'"  2  
ATOM   9230   C  "C5'"  . DT  B 2 35  ? 10.794  3.155   -41.813 1.00 0.00  ? 35   DT  B "C5'"  2  
ATOM   9231   C  "C4'"  . DT  B 2 35  ? 9.307   2.890   -41.826 1.00 0.00  ? 35   DT  B "C4'"  2  
ATOM   9232   O  "O4'"  . DT  B 2 35  ? 8.609   4.149   -41.832 1.00 0.00  ? 35   DT  B "O4'"  2  
ATOM   9233   C  "C3'"  . DT  B 2 35  ? 8.801   2.144   -43.062 1.00 0.00  ? 35   DT  B "C3'"  2  
ATOM   9234   O  "O3'"  . DT  B 2 35  ? 8.597   0.764   -42.753 1.00 0.00  ? 35   DT  B "O3'"  2  
ATOM   9235   C  "C2'"  . DT  B 2 35  ? 7.476   2.812   -43.409 1.00 0.00  ? 35   DT  B "C2'"  2  
ATOM   9236   C  "C1'"  . DT  B 2 35  ? 7.326   3.933   -42.381 1.00 0.00  ? 35   DT  B "C1'"  2  
ATOM   9237   N  N1     . DT  B 2 35  ? 6.844   5.209   -42.937 1.00 0.00  ? 35   DT  B N1     2  
ATOM   9238   C  C2     . DT  B 2 35  ? 5.778   5.175   -43.810 1.00 0.00  ? 35   DT  B C2     2  
ATOM   9239   O  O2     . DT  B 2 35  ? 5.220   4.142   -44.144 1.00 0.00  ? 35   DT  B O2     2  
ATOM   9240   N  N3     . DT  B 2 35  ? 5.386   6.403   -44.279 1.00 0.00  ? 35   DT  B N3     2  
ATOM   9241   C  C4     . DT  B 2 35  ? 5.939   7.628   -43.970 1.00 0.00  ? 35   DT  B C4     2  
ATOM   9242   O  O4     . DT  B 2 35  ? 5.478   8.650   -44.470 1.00 0.00  ? 35   DT  B O4     2  
ATOM   9243   C  C5     . DT  B 2 35  ? 7.054   7.588   -43.049 1.00 0.00  ? 35   DT  B C5     2  
ATOM   9244   C  C7     . DT  B 2 35  ? 7.712   8.872   -42.658 1.00 0.00  ? 35   DT  B C7     2  
ATOM   9245   C  C6     . DT  B 2 35  ? 7.448   6.396   -42.581 1.00 0.00  ? 35   DT  B C6     2  
ATOM   9246   H  "H5'"  . DT  B 2 35  ? 11.190  2.933   -40.823 1.00 0.00  ? 35   DT  B "H5'"  2  
ATOM   9247   H  "H5''" . DT  B 2 35  ? 11.277  2.506   -42.545 1.00 0.00  ? 35   DT  B "H5''" 2  
ATOM   9248   H  "H4'"  . DT  B 2 35  ? 9.072   2.266   -40.959 1.00 0.00  ? 35   DT  B "H4'"  2  
ATOM   9249   H  "H3'"  . DT  B 2 35  ? 9.515   2.220   -43.882 1.00 0.00  ? 35   DT  B "H3'"  2  
ATOM   9250   H  "H2'"  . DT  B 2 35  ? 7.493   3.190   -44.435 1.00 0.00  ? 35   DT  B "H2'"  2  
ATOM   9251   H  "H2''" . DT  B 2 35  ? 6.653   2.100   -43.344 1.00 0.00  ? 35   DT  B "H2''" 2  
ATOM   9252   H  "H1'"  . DT  B 2 35  ? 6.659   3.635   -41.570 1.00 0.00  ? 35   DT  B "H1'"  2  
ATOM   9253   H  H3     . DT  B 2 35  ? 4.607   6.407   -44.924 1.00 0.00  ? 35   DT  B H3     2  
ATOM   9254   H  H71    . DT  B 2 35  ? 7.650   9.579   -43.485 1.00 0.00  ? 35   DT  B H71    2  
ATOM   9255   H  H72    . DT  B 2 35  ? 7.209   9.290   -41.785 1.00 0.00  ? 35   DT  B H72    2  
ATOM   9256   H  H73    . DT  B 2 35  ? 8.758   8.686   -42.418 1.00 0.00  ? 35   DT  B H73    2  
ATOM   9257   H  H6     . DT  B 2 35  ? 8.287   6.363   -41.886 1.00 0.00  ? 35   DT  B H6     2  
ATOM   9258   P  P      . DG  B 2 36  ? 8.618   -0.325  -43.933 1.00 0.00  ? 36   DG  B P      2  
ATOM   9259   O  OP1    . DG  B 2 36  ? 9.387   -1.509  -43.474 1.00 0.00  ? 36   DG  B OP1    2  
ATOM   9260   O  OP2    . DG  B 2 36  ? 9.028   0.384   -45.169 1.00 0.00  ? 36   DG  B OP2    2  
ATOM   9261   O  "O5'"  . DG  B 2 36  ? 7.091   -0.750  -44.090 1.00 0.00  ? 36   DG  B "O5'"  2  
ATOM   9262   C  "C5'"  . DG  B 2 36  ? 6.554   -1.845  -43.350 1.00 0.00  ? 36   DG  B "C5'"  2  
ATOM   9263   C  "C4'"  . DG  B 2 36  ? 6.683   -1.585  -41.868 1.00 0.00  ? 36   DG  B "C4'"  2  
ATOM   9264   O  "O4'"  . DG  B 2 36  ? 6.350   -0.199  -41.603 1.00 0.00  ? 36   DG  B "O4'"  2  
ATOM   9265   C  "C3'"  . DG  B 2 36  ? 5.756   -2.418  -40.976 1.00 0.00  ? 36   DG  B "C3'"  2  
ATOM   9266   O  "O3'"  . DG  B 2 36  ? 6.465   -2.887  -39.827 1.00 0.00  ? 36   DG  B "O3'"  2  
ATOM   9267   C  "C2'"  . DG  B 2 36  ? 4.678   -1.433  -40.558 1.00 0.00  ? 36   DG  B "C2'"  2  
ATOM   9268   C  "C1'"  . DG  B 2 36  ? 5.455   -0.140  -40.509 1.00 0.00  ? 36   DG  B "C1'"  2  
ATOM   9269   N  N9     . DG  B 2 36  ? 4.648   1.068   -40.646 1.00 0.00  ? 36   DG  B N9     2  
ATOM   9270   C  C8     . DG  B 2 36  ? 3.531   1.235   -41.425 1.00 0.00  ? 36   DG  B C8     2  
ATOM   9271   N  N7     . DG  B 2 36  ? 3.019   2.433   -41.339 1.00 0.00  ? 36   DG  B N7     2  
ATOM   9272   C  C5     . DG  B 2 36  ? 3.852   3.096   -40.447 1.00 0.00  ? 36   DG  B C5     2  
ATOM   9273   C  C6     . DG  B 2 36  ? 3.804   4.427   -39.958 1.00 0.00  ? 36   DG  B C6     2  
ATOM   9274   O  O6     . DG  B 2 36  ? 2.989   5.318   -40.226 1.00 0.00  ? 36   DG  B O6     2  
ATOM   9275   N  N1     . DG  B 2 36  ? 4.842   4.683   -39.067 1.00 0.00  ? 36   DG  B N1     2  
ATOM   9276   C  C2     . DG  B 2 36  ? 5.806   3.775   -38.696 1.00 0.00  ? 36   DG  B C2     2  
ATOM   9277   N  N2     . DG  B 2 36  ? 6.727   4.207   -37.822 1.00 0.00  ? 36   DG  B N2     2  
ATOM   9278   N  N3     . DG  B 2 36  ? 5.863   2.535   -39.147 1.00 0.00  ? 36   DG  B N3     2  
ATOM   9279   C  C4     . DG  B 2 36  ? 4.863   2.265   -40.011 1.00 0.00  ? 36   DG  B C4     2  
ATOM   9280   H  "H5'"  . DG  B 2 36  ? 7.097   -2.757  -43.601 1.00 0.00  ? 36   DG  B "H5'"  2  
ATOM   9281   H  "H5''" . DG  B 2 36  ? 5.502   -1.975  -43.602 1.00 0.00  ? 36   DG  B "H5''" 2  
ATOM   9282   H  "H4'"  . DG  B 2 36  ? 7.703   -1.842  -41.579 1.00 0.00  ? 36   DG  B "H4'"  2  
ATOM   9283   H  "H3'"  . DG  B 2 36  ? 5.344   -3.269  -41.518 1.00 0.00  ? 36   DG  B "H3'"  2  
ATOM   9284   H  "H2'"  . DG  B 2 36  ? 3.864   -1.400  -41.282 1.00 0.00  ? 36   DG  B "H2'"  2  
ATOM   9285   H  "H2''" . DG  B 2 36  ? 4.249   -1.697  -39.591 1.00 0.00  ? 36   DG  B "H2''" 2  
ATOM   9286   H  "H1'"  . DG  B 2 36  ? 6.043   -0.068  -39.595 1.00 0.00  ? 36   DG  B "H1'"  2  
ATOM   9287   H  H8     . DG  B 2 36  ? 3.114   0.454   -42.042 1.00 0.00  ? 36   DG  B H8     2  
ATOM   9288   H  H1     . DG  B 2 36  ? 4.891   5.606   -38.662 1.00 0.00  ? 36   DG  B H1     2  
ATOM   9289   H  H21    . DG  B 2 36  ? 7.457   3.580   -37.515 1.00 0.00  ? 36   DG  B H21    2  
ATOM   9290   H  H22    . DG  B 2 36  ? 6.689   5.151   -37.468 1.00 0.00  ? 36   DG  B H22    2  
ATOM   9291   P  P      . DC  B 2 37  ? 6.573   -4.466  -39.546 1.00 0.00  ? 37   DC  B P      2  
ATOM   9292   O  OP1    . DC  B 2 37  ? 7.762   -4.963  -40.280 1.00 0.00  ? 37   DC  B OP1    2  
ATOM   9293   O  OP2    . DC  B 2 37  ? 5.243   -5.078  -39.800 1.00 0.00  ? 37   DC  B OP2    2  
ATOM   9294   O  "O5'"  . DC  B 2 37  ? 6.881   -4.560  -37.986 1.00 0.00  ? 37   DC  B "O5'"  2  
ATOM   9295   C  "C5'"  . DC  B 2 37  ? 5.931   -4.106  -37.024 1.00 0.00  ? 37   DC  B "C5'"  2  
ATOM   9296   C  "C4'"  . DC  B 2 37  ? 6.259   -2.697  -36.588 1.00 0.00  ? 37   DC  B "C4'"  2  
ATOM   9297   O  "O4'"  . DC  B 2 37  ? 5.431   -1.765  -37.309 1.00 0.00  ? 37   DC  B "O4'"  2  
ATOM   9298   C  "C3'"  . DC  B 2 37  ? 5.983   -2.394  -35.120 1.00 0.00  ? 37   DC  B "C3'"  2  
ATOM   9299   O  "O3'"  . DC  B 2 37  ? 7.135   -2.689  -34.329 1.00 0.00  ? 37   DC  B "O3'"  2  
ATOM   9300   C  "C2'"  . DC  B 2 37  ? 5.701   -0.899  -35.107 1.00 0.00  ? 37   DC  B "C2'"  2  
ATOM   9301   C  "C1'"  . DC  B 2 37  ? 5.338   -0.563  -36.560 1.00 0.00  ? 37   DC  B "C1'"  2  
ATOM   9302   N  N1     . DC  B 2 37  ? 3.982   -0.025  -36.731 1.00 0.00  ? 37   DC  B N1     2  
ATOM   9303   C  C2     . DC  B 2 37  ? 3.736   1.303   -36.371 1.00 0.00  ? 37   DC  B C2     2  
ATOM   9304   O  O2     . DC  B 2 37  ? 4.667   1.984   -35.917 1.00 0.00  ? 37   DC  B O2     2  
ATOM   9305   N  N3     . DC  B 2 37  ? 2.492   1.809   -36.526 1.00 0.00  ? 37   DC  B N3     2  
ATOM   9306   C  C4     . DC  B 2 37  ? 1.516   1.041   -37.013 1.00 0.00  ? 37   DC  B C4     2  
ATOM   9307   N  N4     . DC  B 2 37  ? 0.302   1.583   -37.146 1.00 0.00  ? 37   DC  B N4     2  
ATOM   9308   C  C5     . DC  B 2 37  ? 1.739   -0.317  -37.386 1.00 0.00  ? 37   DC  B C5     2  
ATOM   9309   C  C6     . DC  B 2 37  ? 2.975   -0.803  -37.232 1.00 0.00  ? 37   DC  B C6     2  
ATOM   9310   H  "H5'"  . DC  B 2 37  ? 5.949   -4.761  -36.153 1.00 0.00  ? 37   DC  B "H5'"  2  
ATOM   9311   H  "H5''" . DC  B 2 37  ? 4.931   -4.120  -37.460 1.00 0.00  ? 37   DC  B "H5''" 2  
ATOM   9312   H  "H4'"  . DC  B 2 37  ? 7.329   -2.540  -36.749 1.00 0.00  ? 37   DC  B "H4'"  2  
ATOM   9313   H  "H3'"  . DC  B 2 37  ? 5.135   -2.972  -34.750 1.00 0.00  ? 37   DC  B "H3'"  2  
ATOM   9314   H  "H2'"  . DC  B 2 37  ? 4.888   -0.667  -34.414 1.00 0.00  ? 37   DC  B "H2'"  2  
ATOM   9315   H  "H2''" . DC  B 2 37  ? 6.575   -0.341  -34.776 1.00 0.00  ? 37   DC  B "H2''" 2  
ATOM   9316   H  "H1'"  . DC  B 2 37  ? 6.048   0.150   -36.983 1.00 0.00  ? 37   DC  B "H1'"  2  
ATOM   9317   H  H41    . DC  B 2 37  ? -0.463  1.033   -37.511 1.00 0.00  ? 37   DC  B H41    2  
ATOM   9318   H  H42    . DC  B 2 37  ? 0.152   2.547   -36.886 1.00 0.00  ? 37   DC  B H42    2  
ATOM   9319   H  H5     . DC  B 2 37  ? 0.936   -0.932  -37.791 1.00 0.00  ? 37   DC  B H5     2  
ATOM   9320   H  H6     . DC  B 2 37  ? 3.182   -1.835  -37.516 1.00 0.00  ? 37   DC  B H6     2  
ATOM   9321   P  P      . DT  B 2 38  ? 6.967   -2.971  -32.755 1.00 0.00  ? 38   DT  B P      2  
ATOM   9322   O  OP1    . DT  B 2 38  ? 7.944   -4.014  -32.349 1.00 0.00  ? 38   DT  B OP1    2  
ATOM   9323   O  OP2    . DT  B 2 38  ? 5.521   -3.184  -32.508 1.00 0.00  ? 38   DT  B OP2    2  
ATOM   9324   O  "O5'"  . DT  B 2 38  ? 7.385   -1.594  -32.069 1.00 0.00  ? 38   DT  B "O5'"  2  
ATOM   9325   C  "C5'"  . DT  B 2 38  ? 8.518   -0.856  -32.529 1.00 0.00  ? 38   DT  B "C5'"  2  
ATOM   9326   C  "C4'"  . DT  B 2 38  ? 8.530   0.520   -31.908 1.00 0.00  ? 38   DT  B "C4'"  2  
ATOM   9327   O  "O4'"  . DT  B 2 38  ? 7.349   1.238   -32.342 1.00 0.00  ? 38   DT  B "O4'"  2  
ATOM   9328   C  "C3'"  . DT  B 2 38  ? 8.481   0.539   -30.382 1.00 0.00  ? 38   DT  B "C3'"  2  
ATOM   9329   O  "O3'"  . DT  B 2 38  ? 9.193   1.675   -29.876 1.00 0.00  ? 38   DT  B "O3'"  2  
ATOM   9330   C  "C2'"  . DT  B 2 38  ? 6.996   0.671   -30.095 1.00 0.00  ? 38   DT  B "C2'"  2  
ATOM   9331   C  "C1'"  . DT  B 2 38  ? 6.556   1.587   -31.219 1.00 0.00  ? 38   DT  B "C1'"  2  
ATOM   9332   N  N1     . DT  B 2 38  ? 5.141   1.465   -31.607 1.00 0.00  ? 38   DT  B N1     2  
ATOM   9333   C  C2     . DT  B 2 38  ? 4.359   2.591   -31.527 1.00 0.00  ? 38   DT  B C2     2  
ATOM   9334   O  O2     . DT  B 2 38  ? 4.783   3.670   -31.142 1.00 0.00  ? 38   DT  B O2     2  
ATOM   9335   N  N3     . DT  B 2 38  ? 3.058   2.412   -31.911 1.00 0.00  ? 38   DT  B N3     2  
ATOM   9336   C  C4     . DT  B 2 38  ? 2.473   1.242   -32.352 1.00 0.00  ? 38   DT  B C4     2  
ATOM   9337   O  O4     . DT  B 2 38  ? 1.282   1.229   -32.656 1.00 0.00  ? 38   DT  B O4     2  
ATOM   9338   C  C5     . DT  B 2 38  ? 3.352   0.094   -32.409 1.00 0.00  ? 38   DT  B C5     2  
ATOM   9339   C  C7     . DT  B 2 38  ? 2.802   -1.217  -32.875 1.00 0.00  ? 38   DT  B C7     2  
ATOM   9340   C  C6     . DT  B 2 38  ? 4.631   0.258   -32.039 1.00 0.00  ? 38   DT  B C6     2  
ATOM   9341   H  "H5'"  . DT  B 2 38  ? 8.476   -0.755  -33.613 1.00 0.00  ? 38   DT  B "H5'"  2  
ATOM   9342   H  "H5''" . DT  B 2 38  ? 9.431   -1.378  -32.252 1.00 0.00  ? 38   DT  B "H5''" 2  
ATOM   9343   H  "H4'"  . DT  B 2 38  ? 9.461   1.009   -32.199 1.00 0.00  ? 38   DT  B "H4'"  2  
ATOM   9344   H  "H3'"  . DT  B 2 38  ? 8.902   -0.371  -29.959 1.00 0.00  ? 38   DT  B "H3'"  2  
ATOM   9345   H  "H2'"  . DT  B 2 38  ? 6.495   -0.294  -30.130 1.00 0.00  ? 38   DT  B "H2'"  2  
ATOM   9346   H  "H2''" . DT  B 2 38  ? 6.813   1.102   -29.110 1.00 0.00  ? 38   DT  B "H2''" 2  
ATOM   9347   H  "H1'"  . DT  B 2 38  ? 6.757   2.629   -30.974 1.00 0.00  ? 38   DT  B "H1'"  2  
ATOM   9348   H  H3     . DT  B 2 38  ? 2.471   3.232   -31.872 1.00 0.00  ? 38   DT  B H3     2  
ATOM   9349   H  H71    . DT  B 2 38  ? 2.667   -1.193  -33.956 1.00 0.00  ? 38   DT  B H71    2  
ATOM   9350   H  H72    . DT  B 2 38  ? 3.496   -2.016  -32.613 1.00 0.00  ? 38   DT  B H72    2  
ATOM   9351   H  H73    . DT  B 2 38  ? 1.841   -1.400  -32.393 1.00 0.00  ? 38   DT  B H73    2  
ATOM   9352   H  H6     . DT  B 2 38  ? 5.298   -0.603  -32.081 1.00 0.00  ? 38   DT  B H6     2  
ATOM   9353   P  P      . DG  B 2 39  ? 9.678   1.692   -28.344 1.00 0.00  ? 39   DG  B P      2  
ATOM   9354   O  OP1    . DG  B 2 39  ? 11.043  2.271   -28.330 1.00 0.00  ? 39   DG  B OP1    2  
ATOM   9355   O  OP2    . DG  B 2 39  ? 9.444   0.345   -27.766 1.00 0.00  ? 39   DG  B OP2    2  
ATOM   9356   O  "O5'"  . DG  B 2 39  ? 8.690   2.721   -27.635 1.00 0.00  ? 39   DG  B "O5'"  2  
ATOM   9357   C  "C5'"  . DG  B 2 39  ? 8.722   4.110   -27.957 1.00 0.00  ? 39   DG  B "C5'"  2  
ATOM   9358   C  "C4'"  . DG  B 2 39  ? 7.673   4.855   -27.163 1.00 0.00  ? 39   DG  B "C4'"  2  
ATOM   9359   O  "O4'"  . DG  B 2 39  ? 6.373   4.532   -27.704 1.00 0.00  ? 39   DG  B "O4'"  2  
ATOM   9360   C  "C3'"  . DG  B 2 39  ? 7.621   4.504   -25.670 1.00 0.00  ? 39   DG  B "C3'"  2  
ATOM   9361   O  "O3'"  . DG  B 2 39  ? 7.775   5.690   -24.885 1.00 0.00  ? 39   DG  B "O3'"  2  
ATOM   9362   C  "C2'"  . DG  B 2 39  ? 6.239   3.905   -25.456 1.00 0.00  ? 39   DG  B "C2'"  2  
ATOM   9363   C  "C1'"  . DG  B 2 39  ? 5.446   4.416   -26.647 1.00 0.00  ? 39   DG  B "C1'"  2  
ATOM   9364   N  N9     . DG  B 2 39  ? 4.374   3.531   -27.090 1.00 0.00  ? 39   DG  B N9     2  
ATOM   9365   C  C8     . DG  B 2 39  ? 4.493   2.220   -27.483 1.00 0.00  ? 39   DG  B C8     2  
ATOM   9366   N  N7     . DG  B 2 39  ? 3.357   1.682   -27.834 1.00 0.00  ? 39   DG  B N7     2  
ATOM   9367   C  C5     . DG  B 2 39  ? 2.429   2.700   -27.662 1.00 0.00  ? 39   DG  B C5     2  
ATOM   9368   C  C6     . DG  B 2 39  ? 1.028   2.713   -27.886 1.00 0.00  ? 39   DG  B C6     2  
ATOM   9369   O  O6     . DG  B 2 39  ? 0.304   1.796   -28.289 1.00 0.00  ? 39   DG  B O6     2  
ATOM   9370   N  N1     . DG  B 2 39  ? 0.473   3.954   -27.588 1.00 0.00  ? 39   DG  B N1     2  
ATOM   9371   C  C2     . DG  B 2 39  ? 1.174   5.043   -27.131 1.00 0.00  ? 39   DG  B C2     2  
ATOM   9372   N  N2     . DG  B 2 39  ? 0.458   6.153   -26.902 1.00 0.00  ? 39   DG  B N2     2  
ATOM   9373   N  N3     . DG  B 2 39  ? 2.481   5.044   -26.915 1.00 0.00  ? 39   DG  B N3     2  
ATOM   9374   C  C4     . DG  B 2 39  ? 3.041   3.848   -27.203 1.00 0.00  ? 39   DG  B C4     2  
ATOM   9375   H  "H5'"  . DG  B 2 39  ? 8.526   4.243   -29.022 1.00 0.00  ? 39   DG  B "H5'"  2  
ATOM   9376   H  "H5''" . DG  B 2 39  ? 9.706   4.519   -27.722 1.00 0.00  ? 39   DG  B "H5''" 2  
ATOM   9377   H  "H4'"  . DG  B 2 39  ? 7.910   5.917   -27.224 1.00 0.00  ? 39   DG  B "H4'"  2  
ATOM   9378   H  "H3'"  . DG  B 2 39  ? 8.410   3.802   -25.406 1.00 0.00  ? 39   DG  B "H3'"  2  
ATOM   9379   H  "H2'"  . DG  B 2 39  ? 6.285   2.814   -25.426 1.00 0.00  ? 39   DG  B "H2'"  2  
ATOM   9380   H  "H2''" . DG  B 2 39  ? 5.810   4.236   -24.508 1.00 0.00  ? 39   DG  B "H2''" 2  
ATOM   9381   H  "H1'"  . DG  B 2 39  ? 5.027   5.409   -26.451 1.00 0.00  ? 39   DG  B "H1'"  2  
ATOM   9382   H  H8     . DG  B 2 39  ? 5.432   1.688   -27.505 1.00 0.00  ? 39   DG  B H8     2  
ATOM   9383   H  H1     . DG  B 2 39  ? -0.521  4.060   -27.720 1.00 0.00  ? 39   DG  B H1     2  
ATOM   9384   H  H21    . DG  B 2 39  ? 0.915   6.988   -26.566 1.00 0.00  ? 39   DG  B H21    2  
ATOM   9385   H  H22    . DG  B 2 39  ? -0.539  6.153   -27.070 1.00 0.00  ? 39   DG  B H22    2  
ATOM   9386   P  P      . DA  B 2 40  ? 8.185   5.571   -23.337 1.00 0.00  ? 40   DA  B P      2  
ATOM   9387   O  OP1    . DA  B 2 40  ? 8.981   6.774   -22.981 1.00 0.00  ? 40   DA  B OP1    2  
ATOM   9388   O  OP2    . DA  B 2 40  ? 8.757   4.220   -23.111 1.00 0.00  ? 40   DA  B OP2    2  
ATOM   9389   O  "O5'"  . DA  B 2 40  ? 6.796   5.645   -22.561 1.00 0.00  ? 40   DA  B "O5'"  2  
ATOM   9390   C  "C5'"  . DA  B 2 40  ? 5.970   6.808   -22.637 1.00 0.00  ? 40   DA  B "C5'"  2  
ATOM   9391   C  "C4'"  . DA  B 2 40  ? 4.755   6.643   -21.756 1.00 0.00  ? 40   DA  B "C4'"  2  
ATOM   9392   O  "O4'"  . DA  B 2 40  ? 3.788   5.820   -22.455 1.00 0.00  ? 40   DA  B "O4'"  2  
ATOM   9393   C  "C3'"  . DA  B 2 40  ? 5.001   5.924   -20.431 1.00 0.00  ? 40   DA  B "C3'"  2  
ATOM   9394   O  "O3'"  . DA  B 2 40  ? 4.041   6.328   -19.447 1.00 0.00  ? 40   DA  B "O3'"  2  
ATOM   9395   C  "C2'"  . DA  B 2 40  ? 4.760   4.477   -20.811 1.00 0.00  ? 40   DA  B "C2'"  2  
ATOM   9396   C  "C1'"  . DA  B 2 40  ? 3.558   4.633   -21.710 1.00 0.00  ? 40   DA  B "C1'"  2  
ATOM   9397   N  N9     . DA  B 2 40  ? 3.328   3.540   -22.650 1.00 0.00  ? 40   DA  B N9     2  
ATOM   9398   C  C8     . DA  B 2 40  ? 4.221   2.645   -23.178 1.00 0.00  ? 40   DA  B C8     2  
ATOM   9399   N  N7     . DA  B 2 40  ? 3.676   1.773   -23.992 1.00 0.00  ? 40   DA  B N7     2  
ATOM   9400   C  C5     . DA  B 2 40  ? 2.334   2.122   -24.003 1.00 0.00  ? 40   DA  B C5     2  
ATOM   9401   C  C6     . DA  B 2 40  ? 1.218   1.588   -24.670 1.00 0.00  ? 40   DA  B C6     2  
ATOM   9402   N  N6     . DA  B 2 40  ? 1.276   0.540   -25.493 1.00 0.00  ? 40   DA  B N6     2  
ATOM   9403   N  N1     . DA  B 2 40  ? 0.019   2.178   -24.460 1.00 0.00  ? 40   DA  B N1     2  
ATOM   9404   C  C2     . DA  B 2 40  ? -0.042  3.230   -23.630 1.00 0.00  ? 40   DA  B C2     2  
ATOM   9405   N  N3     . DA  B 2 40  ? 0.934   3.820   -22.950 1.00 0.00  ? 40   DA  B N3     2  
ATOM   9406   C  C4     . DA  B 2 40  ? 2.108   3.210   -23.182 1.00 0.00  ? 40   DA  B C4     2  
ATOM   9407   H  "H5'"  . DA  B 2 40  ? 5.645   6.958   -23.667 1.00 0.00  ? 40   DA  B "H5'"  2  
ATOM   9408   H  "H5''" . DA  B 2 40  ? 6.533   7.680   -22.308 1.00 0.00  ? 40   DA  B "H5''" 2  
ATOM   9409   H  "H4'"  . DA  B 2 40  ? 4.379   7.639   -21.515 1.00 0.00  ? 40   DA  B "H4'"  2  
ATOM   9410   H  "H3'"  . DA  B 2 40  ? 6.011   6.101   -20.058 1.00 0.00  ? 40   DA  B "H3'"  2  
ATOM   9411   H  "H2'"  . DA  B 2 40  ? 5.613   4.051   -21.333 1.00 0.00  ? 40   DA  B "H2'"  2  
ATOM   9412   H  "H2''" . DA  B 2 40  ? 4.559   3.858   -19.938 1.00 0.00  ? 40   DA  B "H2''" 2  
ATOM   9413   H  "H1'"  . DA  B 2 40  ? 2.657   4.780   -21.122 1.00 0.00  ? 40   DA  B "H1'"  2  
ATOM   9414   H  H8     . DA  B 2 40  ? 5.275   2.655   -22.942 1.00 0.00  ? 40   DA  B H8     2  
ATOM   9415   H  H61    . DA  B 2 40  ? 0.432   0.211   -25.939 1.00 0.00  ? 40   DA  B H61    2  
ATOM   9416   H  H62    . DA  B 2 40  ? 2.157   0.077   -25.670 1.00 0.00  ? 40   DA  B H62    2  
ATOM   9417   H  H2     . DA  B 2 40  ? -1.032  3.661   -23.496 1.00 0.00  ? 40   DA  B H2     2  
ATOM   9418   P  P      . DC  B 2 41  ? 4.381   7.529   -18.438 1.00 0.00  ? 41   DC  B P      2  
ATOM   9419   O  OP1    . DC  B 2 41  ? 5.052   8.598   -19.223 1.00 0.00  ? 41   DC  B OP1    2  
ATOM   9420   O  OP2    . DC  B 2 41  ? 5.067   6.949   -17.254 1.00 0.00  ? 41   DC  B OP2    2  
ATOM   9421   O  "O5'"  . DC  B 2 41  ? 2.944   8.042   -17.982 1.00 0.00  ? 41   DC  B "O5'"  2  
ATOM   9422   C  "C5'"  . DC  B 2 41  ? 2.268   9.076   -18.694 1.00 0.00  ? 41   DC  B "C5'"  2  
ATOM   9423   C  "C4'"  . DC  B 2 41  ? 0.783   8.793   -18.746 1.00 0.00  ? 41   DC  B "C4'"  2  
ATOM   9424   O  "O4'"  . DC  B 2 41  ? 0.566   7.520   -19.400 1.00 0.00  ? 41   DC  B "O4'"  2  
ATOM   9425   C  "C3'"  . DC  B 2 41  ? 0.096   8.665   -17.388 1.00 0.00  ? 41   DC  B "C3'"  2  
ATOM   9426   O  "O3'"  . DC  B 2 41  ? -1.284  9.026   -17.487 1.00 0.00  ? 41   DC  B "O3'"  2  
ATOM   9427   C  "C2'"  . DC  B 2 41  ? 0.234   7.186   -17.086 1.00 0.00  ? 41   DC  B "C2'"  2  
ATOM   9428   C  "C1'"  . DC  B 2 41  ? 0.063   6.571   -18.465 1.00 0.00  ? 41   DC  B "C1'"  2  
ATOM   9429   N  N1     . DC  B 2 41  ? 0.801   5.317   -18.661 1.00 0.00  ? 41   DC  B N1     2  
ATOM   9430   C  C2     . DC  B 2 41  ? 0.216   4.303   -19.421 1.00 0.00  ? 41   DC  B C2     2  
ATOM   9431   O  O2     . DC  B 2 41  ? -0.915  4.484   -19.899 1.00 0.00  ? 41   DC  B O2     2  
ATOM   9432   N  N3     . DC  B 2 41  ? 0.896   3.150   -19.616 1.00 0.00  ? 41   DC  B N3     2  
ATOM   9433   C  C4     . DC  B 2 41  ? 2.109   2.994   -19.083 1.00 0.00  ? 41   DC  B C4     2  
ATOM   9434   N  N4     . DC  B 2 41  ? 2.745   1.844   -19.306 1.00 0.00  ? 41   DC  B N4     2  
ATOM   9435   C  C5     . DC  B 2 41  ? 2.727   4.008   -18.297 1.00 0.00  ? 41   DC  B C5     2  
ATOM   9436   C  C6     . DC  B 2 41  ? 2.040   5.143   -18.112 1.00 0.00  ? 41   DC  B C6     2  
ATOM   9437   H  "H5'"  . DC  B 2 41  ? 2.656   9.135   -19.711 1.00 0.00  ? 41   DC  B "H5'"  2  
ATOM   9438   H  "H5''" . DC  B 2 41  ? 2.432   10.029  -18.192 1.00 0.00  ? 41   DC  B "H5''" 2  
ATOM   9439   H  "H4'"  . DC  B 2 41  ? 0.305   9.627   -19.262 1.00 0.00  ? 41   DC  B "H4'"  2  
ATOM   9440   H  "H3'"  . DC  B 2 41  ? 0.583   9.286   -16.636 1.00 0.00  ? 41   DC  B "H3'"  2  
ATOM   9441   H  "H2'"  . DC  B 2 41  ? 1.207   6.959   -16.650 1.00 0.00  ? 41   DC  B "H2'"  2  
ATOM   9442   H  "H2''" . DC  B 2 41  ? -0.528  6.850   -16.383 1.00 0.00  ? 41   DC  B "H2''" 2  
ATOM   9443   H  "H1'"  . DC  B 2 41  ? -0.991  6.398   -18.692 1.00 0.00  ? 41   DC  B "H1'"  2  
ATOM   9444   H  H41    . DC  B 2 41  ? 3.665   1.688   -18.919 1.00 0.00  ? 41   DC  B H41    2  
ATOM   9445   H  H42    . DC  B 2 41  ? 2.301   1.136   -19.868 1.00 0.00  ? 41   DC  B H42    2  
ATOM   9446   H  H5     . DC  B 2 41  ? 3.718   3.869   -17.869 1.00 0.00  ? 41   DC  B H5     2  
ATOM   9447   H  H6     . DC  B 2 41  ? 2.478   5.938   -17.507 1.00 0.00  ? 41   DC  B H6     2  
ATOM   9448   P  P      . DC  B 2 42  ? -2.135  9.294   -16.151 1.00 0.00  ? 42   DC  B P      2  
ATOM   9449   O  OP1    . DC  B 2 42  ? -2.419  10.748  -16.071 1.00 0.00  ? 42   DC  B OP1    2  
ATOM   9450   O  OP2    . DC  B 2 42  ? -1.427  8.622   -15.030 1.00 0.00  ? 42   DC  B OP2    2  
ATOM   9451   O  "O5'"  . DC  B 2 42  ? -3.516  8.541   -16.404 1.00 0.00  ? 42   DC  B "O5'"  2  
ATOM   9452   C  "C5'"  . DC  B 2 42  ? -3.601  7.412   -17.276 1.00 0.00  ? 42   DC  B "C5'"  2  
ATOM   9453   C  "C4'"  . DC  B 2 42  ? -4.380  6.300   -16.614 1.00 0.00  ? 42   DC  B "C4'"  2  
ATOM   9454   O  "O4'"  . DC  B 2 42  ? -3.675  5.056   -16.823 1.00 0.00  ? 42   DC  B "O4'"  2  
ATOM   9455   C  "C3'"  . DC  B 2 42  ? -4.513  6.407   -15.099 1.00 0.00  ? 42   DC  B "C3'"  2  
ATOM   9456   O  "O3'"  . DC  B 2 42  ? -5.584  5.593   -14.603 1.00 0.00  ? 42   DC  B "O3'"  2  
ATOM   9457   C  "C2'"  . DC  B 2 42  ? -3.210  5.785   -14.647 1.00 0.00  ? 42   DC  B "C2'"  2  
ATOM   9458   C  "C1'"  . DC  B 2 42  ? -3.172  4.591   -15.577 1.00 0.00  ? 42   DC  B "C1'"  2  
ATOM   9459   N  N1     . DC  B 2 42  ? -1.853  3.994   -15.820 1.00 0.00  ? 42   DC  B N1     2  
ATOM   9460   C  C2     . DC  B 2 42  ? -1.783  2.846   -16.605 1.00 0.00  ? 42   DC  B C2     2  
ATOM   9461   O  O2     . DC  B 2 42  ? -2.828  2.383   -17.086 1.00 0.00  ? 42   DC  B O2     2  
ATOM   9462   N  N3     . DC  B 2 42  ? -0.583  2.265   -16.825 1.00 0.00  ? 42   DC  B N3     2  
ATOM   9463   C  C4     . DC  B 2 42  ? 0.518   2.791   -16.288 1.00 0.00  ? 42   DC  B C4     2  
ATOM   9464   N  N4     . DC  B 2 42  ? 1.673   2.172   -16.515 1.00 0.00  ? 42   DC  B N4     2  
ATOM   9465   C  C5     . DC  B 2 42  ? 0.481   3.969   -15.488 1.00 0.00  ? 42   DC  B C5     2  
ATOM   9466   C  C6     . DC  B 2 42  ? -0.717  4.538   -15.287 1.00 0.00  ? 42   DC  B C6     2  
ATOM   9467   H  "H5'"  . DC  B 2 42  ? -2.598  7.055   -17.514 1.00 0.00  ? 42   DC  B "H5'"  2  
ATOM   9468   H  "H5''" . DC  B 2 42  ? -4.106  7.698   -18.196 1.00 0.00  ? 42   DC  B "H5''" 2  
ATOM   9469   H  "H4'"  . DC  B 2 42  ? -5.387  6.301   -17.029 1.00 0.00  ? 42   DC  B "H4'"  2  
ATOM   9470   H  "H3'"  . DC  B 2 42  ? -4.636  7.441   -14.769 1.00 0.00  ? 42   DC  B "H3'"  2  
ATOM   9471   H  "H2'"  . DC  B 2 42  ? -2.368  6.453   -14.798 1.00 0.00  ? 42   DC  B "H2'"  2  
ATOM   9472   H  "H2''" . DC  B 2 42  ? -3.237  5.506   -13.594 1.00 0.00  ? 42   DC  B "H2''" 2  
ATOM   9473   H  "H1'"  . DC  B 2 42  ? -3.840  3.814   -15.220 1.00 0.00  ? 42   DC  B "H1'"  2  
ATOM   9474   H  H41    . DC  B 2 42  ? 2.533   2.530   -16.124 1.00 0.00  ? 42   DC  B H41    2  
ATOM   9475   H  H42    . DC  B 2 42  ? 1.668   1.340   -17.091 1.00 0.00  ? 42   DC  B H42    2  
ATOM   9476   H  H5     . DC  B 2 42  ? 1.389   4.393   -15.062 1.00 0.00  ? 42   DC  B H5     2  
ATOM   9477   H  H6     . DC  B 2 42  ? -0.784  5.451   -14.698 1.00 0.00  ? 42   DC  B H6     2  
ATOM   9478   P  P      . DG  B 2 43  ? -7.100  6.108   -14.685 1.00 0.00  ? 43   DG  B P      2  
ATOM   9479   O  OP1    . DG  B 2 43  ? -7.240  6.996   -15.871 1.00 0.00  ? 43   DG  B OP1    2  
ATOM   9480   O  OP2    . DG  B 2 43  ? -7.461  6.620   -13.340 1.00 0.00  ? 43   DG  B OP2    2  
ATOM   9481   O  "O5'"  . DG  B 2 43  ? -7.924  4.769   -14.945 1.00 0.00  ? 43   DG  B "O5'"  2  
ATOM   9482   C  "C5'"  . DG  B 2 43  ? -7.958  4.165   -16.239 1.00 0.00  ? 43   DG  B "C5'"  2  
ATOM   9483   C  "C4'"  . DG  B 2 43  ? -8.049  2.660   -16.117 1.00 0.00  ? 43   DG  B "C4'"  2  
ATOM   9484   O  "O4'"  . DG  B 2 43  ? -6.715  2.127   -15.926 1.00 0.00  ? 43   DG  B "O4'"  2  
ATOM   9485   C  "C3'"  . DG  B 2 43  ? -8.884  2.130   -14.945 1.00 0.00  ? 43   DG  B "C3'"  2  
ATOM   9486   O  "O3'"  . DG  B 2 43  ? -9.661  1.003   -15.369 1.00 0.00  ? 43   DG  B "O3'"  2  
ATOM   9487   C  "C2'"  . DG  B 2 43  ? -7.846  1.703   -13.924 1.00 0.00  ? 43   DG  B "C2'"  2  
ATOM   9488   C  "C1'"  . DG  B 2 43  ? -6.697  1.260   -14.805 1.00 0.00  ? 43   DG  B "C1'"  2  
ATOM   9489   N  N9     . DG  B 2 43  ? -5.379  1.354   -14.185 1.00 0.00  ? 43   DG  B N9     2  
ATOM   9490   C  C8     . DG  B 2 43  ? -4.890  2.398   -13.439 1.00 0.00  ? 43   DG  B C8     2  
ATOM   9491   N  N7     . DG  B 2 43  ? -3.672  2.200   -13.013 1.00 0.00  ? 43   DG  B N7     2  
ATOM   9492   C  C5     . DG  B 2 43  ? -3.335  0.950   -13.510 1.00 0.00  ? 43   DG  B C5     2  
ATOM   9493   C  C6     . DG  B 2 43  ? -2.136  0.200   -13.378 1.00 0.00  ? 43   DG  B C6     2  
ATOM   9494   O  O6     . DG  B 2 43  ? -1.099  0.506   -12.779 1.00 0.00  ? 43   DG  B O6     2  
ATOM   9495   N  N1     . DG  B 2 43  ? -2.220  -1.021  -14.040 1.00 0.00  ? 43   DG  B N1     2  
ATOM   9496   C  C2     . DG  B 2 43  ? -3.315  -1.466  -14.739 1.00 0.00  ? 43   DG  B C2     2  
ATOM   9497   N  N2     . DG  B 2 43  ? -3.203  -2.674  -15.311 1.00 0.00  ? 43   DG  B N2     2  
ATOM   9498   N  N3     . DG  B 2 43  ? -4.439  -0.777  -14.872 1.00 0.00  ? 43   DG  B N3     2  
ATOM   9499   C  C4     . DG  B 2 43  ? -4.379  0.412   -14.235 1.00 0.00  ? 43   DG  B C4     2  
ATOM   9500   H  "H5'"  . DG  B 2 43  ? -7.054  4.423   -16.790 1.00 0.00  ? 43   DG  B "H5'"  2  
ATOM   9501   H  "H5''" . DG  B 2 43  ? -8.826  4.529   -16.787 1.00 0.00  ? 43   DG  B "H5''" 2  
ATOM   9502   H  "H4'"  . DG  B 2 43  ? -8.526  2.291   -17.027 1.00 0.00  ? 43   DG  B "H4'"  2  
ATOM   9503   H  "H3'"  . DG  B 2 43  ? -9.551  2.899   -14.555 1.00 0.00  ? 43   DG  B "H3'"  2  
ATOM   9504   H  "H2'"  . DG  B 2 43  ? -7.569  2.529   -13.269 1.00 0.00  ? 43   DG  B "H2'"  2  
ATOM   9505   H  "H2''" . DG  B 2 43  ? -8.217  0.894   -13.293 1.00 0.00  ? 43   DG  B "H2''" 2  
ATOM   9506   H  "H1'"  . DG  B 2 43  ? -6.845  0.239   -15.163 1.00 0.00  ? 43   DG  B "H1'"  2  
ATOM   9507   H  H8     . DG  B 2 43  ? -5.456  3.292   -13.226 1.00 0.00  ? 43   DG  B H8     2  
ATOM   9508   H  H1     . DG  B 2 43  ? -1.414  -1.628  -14.002 1.00 0.00  ? 43   DG  B H1     2  
ATOM   9509   H  H21    . DG  B 2 43  ? -3.973  -3.056  -15.839 1.00 0.00  ? 43   DG  B H21    2  
ATOM   9510   H  H22    . DG  B 2 43  ? -2.347  -3.201  -15.212 1.00 0.00  ? 43   DG  B H22    2  
ATOM   9511   P  P      . DC  B 2 44  ? -10.624 0.255   -14.321 1.00 0.00  ? 44   DC  B P      2  
ATOM   9512   O  OP1    . DC  B 2 44  ? -11.825 -0.184  -15.079 1.00 0.00  ? 44   DC  B OP1    2  
ATOM   9513   O  OP2    . DC  B 2 44  ? -10.789 1.118   -13.124 1.00 0.00  ? 44   DC  B OP2    2  
ATOM   9514   O  "O5'"  . DC  B 2 44  ? -9.810  -1.049  -13.903 1.00 0.00  ? 44   DC  B "O5'"  2  
ATOM   9515   C  "C5'"  . DC  B 2 44  ? -9.647  -2.130  -14.819 1.00 0.00  ? 44   DC  B "C5'"  2  
ATOM   9516   C  "C4'"  . DC  B 2 44  ? -8.829  -3.235  -14.191 1.00 0.00  ? 44   DC  B "C4'"  2  
ATOM   9517   O  "O4'"  . DC  B 2 44  ? -7.496  -2.737  -13.945 1.00 0.00  ? 44   DC  B "O4'"  2  
ATOM   9518   C  "C3'"  . DC  B 2 44  ? -9.347  -3.750  -12.842 1.00 0.00  ? 44   DC  B "C3'"  2  
ATOM   9519   O  "O3'"  . DC  B 2 44  ? -9.672  -5.139  -12.937 1.00 0.00  ? 44   DC  B "O3'"  2  
ATOM   9520   C  "C2'"  . DC  B 2 44  ? -8.190  -3.551  -11.873 1.00 0.00  ? 44   DC  B "C2'"  2  
ATOM   9521   C  "C1'"  . DC  B 2 44  ? -6.994  -3.365  -12.790 1.00 0.00  ? 44   DC  B "C1'"  2  
ATOM   9522   N  N1     . DC  B 2 44  ? -5.921  -2.522  -12.246 1.00 0.00  ? 44   DC  B N1     2  
ATOM   9523   C  C2     . DC  B 2 44  ? -4.668  -3.097  -12.031 1.00 0.00  ? 44   DC  B C2     2  
ATOM   9524   O  O2     . DC  B 2 44  ? -4.505  -4.295  -12.302 1.00 0.00  ? 44   DC  B O2     2  
ATOM   9525   N  N3     . DC  B 2 44  ? -3.667  -2.335  -11.536 1.00 0.00  ? 44   DC  B N3     2  
ATOM   9526   C  C4     . DC  B 2 44  ? -3.881  -1.048  -11.258 1.00 0.00  ? 44   DC  B C4     2  
ATOM   9527   N  N4     . DC  B 2 44  ? -2.864  -0.335  -10.774 1.00 0.00  ? 44   DC  B N4     2  
ATOM   9528   C  C5     . DC  B 2 44  ? -5.152  -0.433  -11.466 1.00 0.00  ? 44   DC  B C5     2  
ATOM   9529   C  C6     . DC  B 2 44  ? -6.135  -1.202  -11.955 1.00 0.00  ? 44   DC  B C6     2  
ATOM   9530   H  "H5'"  . DC  B 2 44  ? -9.138  -1.774  -15.714 1.00 0.00  ? 44   DC  B "H5'"  2  
ATOM   9531   H  "H5''" . DC  B 2 44  ? -10.625 -2.523  -15.100 1.00 0.00  ? 44   DC  B "H5''" 2  
ATOM   9532   H  "H4'"  . DC  B 2 44  ? -8.849  -4.084  -14.876 1.00 0.00  ? 44   DC  B "H4'"  2  
ATOM   9533   H  "H3'"  . DC  B 2 44  ? -10.235 -3.202  -12.529 1.00 0.00  ? 44   DC  B "H3'"  2  
ATOM   9534   H  "H2'"  . DC  B 2 44  ? -8.362  -2.681  -11.234 1.00 0.00  ? 44   DC  B "H2'"  2  
ATOM   9535   H  "H2''" . DC  B 2 44  ? -8.072  -4.415  -11.219 1.00 0.00  ? 44   DC  B "H2''" 2  
ATOM   9536   H  "H1'"  . DC  B 2 44  ? -6.569  -4.329  -13.083 1.00 0.00  ? 44   DC  B "H1'"  2  
ATOM   9537   H  H41    . DC  B 2 44  ? -2.991  0.643   -10.554 1.00 0.00  ? 44   DC  B H41    2  
ATOM   9538   H  H42    . DC  B 2 44  ? -1.968  -0.775  -10.620 1.00 0.00  ? 44   DC  B H42    2  
ATOM   9539   H  H5     . DC  B 2 44  ? -5.317  0.618   -11.234 1.00 0.00  ? 44   DC  B H5     2  
ATOM   9540   H  H6     . DC  B 2 44  ? -7.118  -0.766  -12.124 1.00 0.00  ? 44   DC  B H6     2  
ATOM   9541   P  P      . DG  B 2 45  ? -10.721 -5.777  -11.906 1.00 0.00  ? 45   DG  B P      2  
ATOM   9542   O  OP1    . DG  B 2 45  ? -11.626 -6.671  -12.673 1.00 0.00  ? 45   DG  B OP1    2  
ATOM   9543   O  OP2    . DG  B 2 45  ? -11.290 -4.665  -11.108 1.00 0.00  ? 45   DG  B OP2    2  
ATOM   9544   O  "O5'"  . DG  B 2 45  ? -9.826  -6.677  -10.945 1.00 0.00  ? 45   DG  B "O5'"  2  
ATOM   9545   C  "C5'"  . DG  B 2 45  ? -9.016  -7.728  -11.466 1.00 0.00  ? 45   DG  B "C5'"  2  
ATOM   9546   C  "C4'"  . DG  B 2 45  ? -7.850  -7.994  -10.544 1.00 0.00  ? 45   DG  B "C4'"  2  
ATOM   9547   O  "O4'"  . DG  B 2 45  ? -7.066  -6.787  -10.420 1.00 0.00  ? 45   DG  B "O4'"  2  
ATOM   9548   C  "C3'"  . DG  B 2 45  ? -8.239  -8.400  -9.117  1.00 0.00  ? 45   DG  B "C3'"  2  
ATOM   9549   O  "O3'"  . DG  B 2 45  ? -7.737  -9.704  -8.826  1.00 0.00  ? 45   DG  B "O3'"  2  
ATOM   9550   C  "C2'"  . DG  B 2 45  ? -7.567  -7.368  -8.221  1.00 0.00  ? 45   DG  B "C2'"  2  
ATOM   9551   C  "C1'"  . DG  B 2 45  ? -6.513  -6.754  -9.124  1.00 0.00  ? 45   DG  B "C1'"  2  
ATOM   9552   N  N9     . DG  B 2 45  ? -6.174  -5.369  -8.813  1.00 0.00  ? 45   DG  B N9     2  
ATOM   9553   C  C8     . DG  B 2 45  ? -7.037  -4.303  -8.722  1.00 0.00  ? 45   DG  B C8     2  
ATOM   9554   N  N7     . DG  B 2 45  ? -6.440  -3.181  -8.426  1.00 0.00  ? 45   DG  B N7     2  
ATOM   9555   C  C5     . DG  B 2 45  ? -5.099  -3.526  -8.316  1.00 0.00  ? 45   DG  B C5     2  
ATOM   9556   C  C6     . DG  B 2 45  ? -3.965  -2.725  -8.012  1.00 0.00  ? 45   DG  B C6     2  
ATOM   9557   O  O6     . DG  B 2 45  ? -3.921  -1.513  -7.770  1.00 0.00  ? 45   DG  B O6     2  
ATOM   9558   N  N1     . DG  B 2 45  ? -2.795  -3.477  -8.004  1.00 0.00  ? 45   DG  B N1     2  
ATOM   9559   C  C2     . DG  B 2 45  ? -2.721  -4.827  -8.256  1.00 0.00  ? 45   DG  B C2     2  
ATOM   9560   N  N2     . DG  B 2 45  ? -1.498  -5.372  -8.203  1.00 0.00  ? 45   DG  B N2     2  
ATOM   9561   N  N3     . DG  B 2 45  ? -3.769  -5.584  -8.538  1.00 0.00  ? 45   DG  B N3     2  
ATOM   9562   C  C4     . DG  B 2 45  ? -4.918  -4.873  -8.552  1.00 0.00  ? 45   DG  B C4     2  
ATOM   9563   H  "H5'"  . DG  B 2 45  ? -8.638  -7.446  -12.449 1.00 0.00  ? 45   DG  B "H5'"  2  
ATOM   9564   H  "H5''" . DG  B 2 45  ? -9.612  -8.637  -11.561 1.00 0.00  ? 45   DG  B "H5''" 2  
ATOM   9565   H  "H4'"  . DG  B 2 45  ? -7.287  -8.831  -10.962 1.00 0.00  ? 45   DG  B "H4'"  2  
ATOM   9566   H  "H3'"  . DG  B 2 45  ? -9.321  -8.402  -8.992  1.00 0.00  ? 45   DG  B "H3'"  2  
ATOM   9567   H  "HO3'" . DG  B 2 45  ? -7.911  -10.263 -9.587  1.00 0.00  ? 45   DG  B "HO3'" 2  
ATOM   9568   H  "H2'"  . DG  B 2 45  ? -8.289  -6.629  -7.863  1.00 0.00  ? 45   DG  B "H2'"  2  
ATOM   9569   H  "H2''" . DG  B 2 45  ? -7.126  -7.839  -7.342  1.00 0.00  ? 45   DG  B "H2''" 2  
ATOM   9570   H  "H1'"  . DG  B 2 45  ? -5.598  -7.351  -9.129  1.00 0.00  ? 45   DG  B "H1'"  2  
ATOM   9571   H  H8     . DG  B 2 45  ? -8.102  -4.385  -8.880  1.00 0.00  ? 45   DG  B H8     2  
ATOM   9572   H  H1     . DG  B 2 45  ? -1.933  -2.992  -7.799  1.00 0.00  ? 45   DG  B H1     2  
ATOM   9573   H  H21    . DG  B 2 45  ? -1.381  -6.359  -8.379  1.00 0.00  ? 45   DG  B H21    2  
ATOM   9574   H  H22    . DG  B 2 45  ? -0.696  -4.797  -7.988  1.00 0.00  ? 45   DG  B H22    2  
HETATM 9575   ZN ZN     . ZN  C 3 .   ? 6.327   11.668  5.346   1.00 18.88 ? 1000 ZN  A ZN     2  
HETATM 9576   ZN ZN     . ZN  D 3 .   ? -22.459 -9.196  -13.205 1.00 45.67 ? 1001 ZN  A ZN     2  
ATOM   9577   N  N      . MET A 1 1   ? 3.474   -17.996 23.137  1.00 0.00  ? 1    MET A N      3  
ATOM   9578   C  CA     . MET A 1 1   ? 2.079   -17.821 22.638  1.00 0.00  ? 1    MET A CA     3  
ATOM   9579   C  C      . MET A 1 1   ? 1.888   -16.406 22.086  1.00 0.00  ? 1    MET A C      3  
ATOM   9580   O  O      . MET A 1 1   ? 2.620   -15.496 22.420  1.00 0.00  ? 1    MET A O      3  
ATOM   9581   C  CB     . MET A 1 1   ? 1.184   -18.051 23.858  1.00 0.00  ? 1    MET A CB     3  
ATOM   9582   C  CG     . MET A 1 1   ? 1.569   -17.075 24.975  1.00 0.00  ? 1    MET A CG     3  
ATOM   9583   S  SD     . MET A 1 1   ? 0.172   -16.876 26.108  1.00 0.00  ? 1    MET A SD     3  
ATOM   9584   C  CE     . MET A 1 1   ? -0.011  -18.621 26.552  1.00 0.00  ? 1    MET A CE     3  
ATOM   9585   H  H1     . MET A 1 1   ? 4.127   -18.057 22.330  1.00 0.00  ? 1    MET A H1     3  
ATOM   9586   H  H2     . MET A 1 1   ? 3.534   -18.871 23.700  1.00 0.00  ? 1    MET A H2     3  
ATOM   9587   H  H3     . MET A 1 1   ? 3.735   -17.184 23.730  1.00 0.00  ? 1    MET A H3     3  
ATOM   9588   H  HA     . MET A 1 1   ? 1.858   -18.554 21.878  1.00 0.00  ? 1    MET A HA     3  
ATOM   9589   H  HB2    . MET A 1 1   ? 0.152   -17.890 23.582  1.00 0.00  ? 1    MET A HB2    3  
ATOM   9590   H  HB3    . MET A 1 1   ? 1.309   -19.064 24.211  1.00 0.00  ? 1    MET A HB3    3  
ATOM   9591   H  HG2    . MET A 1 1   ? 2.418   -17.466 25.517  1.00 0.00  ? 1    MET A HG2    3  
ATOM   9592   H  HG3    . MET A 1 1   ? 1.824   -16.119 24.547  1.00 0.00  ? 1    MET A HG3    3  
ATOM   9593   H  HE1    . MET A 1 1   ? 0.877   -18.955 27.068  1.00 0.00  ? 1    MET A HE1    3  
ATOM   9594   H  HE2    . MET A 1 1   ? -0.147  -19.208 25.658  1.00 0.00  ? 1    MET A HE2    3  
ATOM   9595   H  HE3    . MET A 1 1   ? -0.874  -18.740 27.192  1.00 0.00  ? 1    MET A HE3    3  
ATOM   9596   N  N      . ALA A 1 2   ? 0.907   -16.215 21.244  1.00 0.00  ? 2    ALA A N      3  
ATOM   9597   C  CA     . ALA A 1 2   ? 0.666   -14.860 20.669  1.00 0.00  ? 2    ALA A CA     3  
ATOM   9598   C  C      . ALA A 1 2   ? -0.701  -14.333 21.116  1.00 0.00  ? 2    ALA A C      3  
ATOM   9599   O  O      . ALA A 1 2   ? -1.393  -14.957 21.894  1.00 0.00  ? 2    ALA A O      3  
ATOM   9600   C  CB     . ALA A 1 2   ? 0.696   -15.060 19.154  1.00 0.00  ? 2    ALA A CB     3  
ATOM   9601   H  H      . ALA A 1 2   ? 0.328   -16.964 20.989  1.00 0.00  ? 2    ALA A H      3  
ATOM   9602   H  HA     . ALA A 1 2   ? 1.449   -14.180 20.966  1.00 0.00  ? 2    ALA A HA     3  
ATOM   9603   H  HB1    . ALA A 1 2   ? 1.115   -14.183 18.683  1.00 0.00  ? 2    ALA A HB1    3  
ATOM   9604   H  HB2    . ALA A 1 2   ? -0.309  -15.218 18.792  1.00 0.00  ? 2    ALA A HB2    3  
ATOM   9605   H  HB3    . ALA A 1 2   ? 1.303   -15.922 18.917  1.00 0.00  ? 2    ALA A HB3    3  
ATOM   9606   N  N      . GLU A 1 3   ? -1.091  -13.186 20.627  1.00 0.00  ? 3    GLU A N      3  
ATOM   9607   C  CA     . GLU A 1 3   ? -2.413  -12.615 21.021  1.00 0.00  ? 3    GLU A CA     3  
ATOM   9608   C  C      . GLU A 1 3   ? -3.290  -12.408 19.785  1.00 0.00  ? 3    GLU A C      3  
ATOM   9609   O  O      . GLU A 1 3   ? -4.421  -12.851 19.734  1.00 0.00  ? 3    GLU A O      3  
ATOM   9610   C  CB     . GLU A 1 3   ? -2.084  -11.274 21.679  1.00 0.00  ? 3    GLU A CB     3  
ATOM   9611   C  CG     . GLU A 1 3   ? -1.289  -11.514 22.965  1.00 0.00  ? 3    GLU A CG     3  
ATOM   9612   C  CD     . GLU A 1 3   ? 0.198   -11.261 22.706  1.00 0.00  ? 3    GLU A CD     3  
ATOM   9613   O  OE1    . GLU A 1 3   ? 0.641   -11.526 21.599  1.00 0.00  ? 3    GLU A OE1    3  
ATOM   9614   O  OE2    . GLU A 1 3   ? 0.869   -10.806 23.617  1.00 0.00  ? 3    GLU A OE2    3  
ATOM   9615   H  H      . GLU A 1 3   ? -0.516  -12.699 20.001  1.00 0.00  ? 3    GLU A H      3  
ATOM   9616   H  HA     . GLU A 1 3   ? -2.906  -13.261 21.730  1.00 0.00  ? 3    GLU A HA     3  
ATOM   9617   H  HB2    . GLU A 1 3   ? -1.498  -10.673 20.997  1.00 0.00  ? 3    GLU A HB2    3  
ATOM   9618   H  HB3    . GLU A 1 3   ? -3.001  -10.756 21.917  1.00 0.00  ? 3    GLU A HB3    3  
ATOM   9619   H  HG2    . GLU A 1 3   ? -1.640  -10.842 23.735  1.00 0.00  ? 3    GLU A HG2    3  
ATOM   9620   H  HG3    . GLU A 1 3   ? -1.426  -12.534 23.290  1.00 0.00  ? 3    GLU A HG3    3  
ATOM   9621   N  N      . SER A 1 4   ? -2.778  -11.738 18.787  1.00 0.00  ? 4    SER A N      3  
ATOM   9622   C  CA     . SER A 1 4   ? -3.582  -11.501 17.553  1.00 0.00  ? 4    SER A CA     3  
ATOM   9623   C  C      . SER A 1 4   ? -2.675  -11.028 16.412  1.00 0.00  ? 4    SER A C      3  
ATOM   9624   O  O      . SER A 1 4   ? -2.380  -11.768 15.495  1.00 0.00  ? 4    SER A O      3  
ATOM   9625   C  CB     . SER A 1 4   ? -4.580  -10.409 17.934  1.00 0.00  ? 4    SER A CB     3  
ATOM   9626   O  OG     . SER A 1 4   ? -5.239  -9.945  16.763  1.00 0.00  ? 4    SER A OG     3  
ATOM   9627   H  H      . SER A 1 4   ? -1.864  -11.389 18.850  1.00 0.00  ? 4    SER A H      3  
ATOM   9628   H  HA     . SER A 1 4   ? -4.108  -12.398 17.269  1.00 0.00  ? 4    SER A HA     3  
ATOM   9629   H  HB2    . SER A 1 4   ? -5.310  -10.808 18.617  1.00 0.00  ? 4    SER A HB2    3  
ATOM   9630   H  HB3    . SER A 1 4   ? -4.053  -9.592  18.410  1.00 0.00  ? 4    SER A HB3    3  
ATOM   9631   H  HG     . SER A 1 4   ? -6.113  -9.641  17.016  1.00 0.00  ? 4    SER A HG     3  
ATOM   9632   N  N      . SER A 1 5   ? -2.230  -9.798  16.464  1.00 0.00  ? 5    SER A N      3  
ATOM   9633   C  CA     . SER A 1 5   ? -1.341  -9.269  15.385  1.00 0.00  ? 5    SER A CA     3  
ATOM   9634   C  C      . SER A 1 5   ? -1.979  -9.490  14.009  1.00 0.00  ? 5    SER A C      3  
ATOM   9635   O  O      . SER A 1 5   ? -1.320  -9.882  13.065  1.00 0.00  ? 5    SER A O      3  
ATOM   9636   C  CB     . SER A 1 5   ? -0.043  -10.068 15.509  1.00 0.00  ? 5    SER A CB     3  
ATOM   9637   O  OG     . SER A 1 5   ? 1.048   -9.258  15.092  1.00 0.00  ? 5    SER A OG     3  
ATOM   9638   H  H      . SER A 1 5   ? -2.483  -9.220  17.214  1.00 0.00  ? 5    SER A H      3  
ATOM   9639   H  HA     . SER A 1 5   ? -1.143  -8.221  15.543  1.00 0.00  ? 5    SER A HA     3  
ATOM   9640   H  HB2    . SER A 1 5   ? 0.105   -10.363 16.534  1.00 0.00  ? 5    SER A HB2    3  
ATOM   9641   H  HB3    . SER A 1 5   ? -0.106  -10.953 14.888  1.00 0.00  ? 5    SER A HB3    3  
ATOM   9642   H  HG     . SER A 1 5   ? 1.818   -9.824  14.995  1.00 0.00  ? 5    SER A HG     3  
ATOM   9643   N  N      . ASP A 1 6   ? -3.256  -9.241  13.891  1.00 54.80 ? 6    ASP A N      3  
ATOM   9644   C  CA     . ASP A 1 6   ? -3.938  -9.436  12.578  1.00 64.03 ? 6    ASP A CA     3  
ATOM   9645   C  C      . ASP A 1 6   ? -4.444  -8.095  12.029  1.00 53.30 ? 6    ASP A C      3  
ATOM   9646   O  O      . ASP A 1 6   ? -4.888  -8.008  10.901  1.00 46.74 ? 6    ASP A O      3  
ATOM   9647   C  CB     . ASP A 1 6   ? -5.112  -10.368 12.879  1.00 72.60 ? 6    ASP A CB     3  
ATOM   9648   C  CG     . ASP A 1 6   ? -4.605  -11.807 12.990  1.00 85.58 ? 6    ASP A CG     3  
ATOM   9649   O  OD1    . ASP A 1 6   ? -3.747  -12.174 12.205  1.00 0.00  ? 6    ASP A OD1    3  
ATOM   9650   O  OD2    . ASP A 1 6   ? -5.085  -12.518 13.859  1.00 78.13 ? 6    ASP A OD2    3  
ATOM   9651   H  H      . ASP A 1 6   ? -3.767  -8.925  14.666  1.00 0.00  ? 6    ASP A H      3  
ATOM   9652   H  HA     . ASP A 1 6   ? -3.270  -9.903  11.872  1.00 0.00  ? 6    ASP A HA     3  
ATOM   9653   H  HB2    . ASP A 1 6   ? -5.574  -10.075 13.811  1.00 0.00  ? 6    ASP A HB2    3  
ATOM   9654   H  HB3    . ASP A 1 6   ? -5.836  -10.304 12.081  1.00 0.00  ? 6    ASP A HB3    3  
ATOM   9655   N  N      . LYS A 1 7   ? -4.380  -7.049  12.815  1.00 51.81 ? 7    LYS A N      3  
ATOM   9656   C  CA     . LYS A 1 7   ? -4.856  -5.718  12.330  1.00 31.86 ? 7    LYS A CA     3  
ATOM   9657   C  C      . LYS A 1 7   ? -4.101  -5.327  11.057  1.00 39.85 ? 7    LYS A C      3  
ATOM   9658   O  O      . LYS A 1 7   ? -2.982  -5.748  10.837  1.00 40.95 ? 7    LYS A O      3  
ATOM   9659   C  CB     . LYS A 1 7   ? -4.540  -4.742  13.465  1.00 32.50 ? 7    LYS A CB     3  
ATOM   9660   C  CG     . LYS A 1 7   ? -5.811  -4.462  14.270  1.00 35.73 ? 7    LYS A CG     3  
ATOM   9661   C  CD     . LYS A 1 7   ? -6.027  -5.584  15.288  1.00 29.85 ? 7    LYS A CD     3  
ATOM   9662   C  CE     . LYS A 1 7   ? -7.345  -5.351  16.032  1.00 29.89 ? 7    LYS A CE     3  
ATOM   9663   N  NZ     . LYS A 1 7   ? -8.384  -5.994  15.180  1.00 29.51 ? 7    LYS A NZ     3  
ATOM   9664   H  H      . LYS A 1 7   ? -4.018  -7.137  13.721  1.00 0.00  ? 7    LYS A H      3  
ATOM   9665   H  HA     . LYS A 1 7   ? -5.919  -5.742  12.147  1.00 0.00  ? 7    LYS A HA     3  
ATOM   9666   H  HB2    . LYS A 1 7   ? -3.791  -5.174  14.111  1.00 0.00  ? 7    LYS A HB2    3  
ATOM   9667   H  HB3    . LYS A 1 7   ? -4.168  -3.817  13.050  1.00 0.00  ? 7    LYS A HB3    3  
ATOM   9668   H  HG2    . LYS A 1 7   ? -5.708  -3.520  14.787  1.00 0.00  ? 7    LYS A HG2    3  
ATOM   9669   H  HG3    . LYS A 1 7   ? -6.658  -4.418  13.602  1.00 0.00  ? 7    LYS A HG3    3  
ATOM   9670   H  HD2    . LYS A 1 7   ? -6.064  -6.533  14.775  1.00 0.00  ? 7    LYS A HD2    3  
ATOM   9671   H  HD3    . LYS A 1 7   ? -5.212  -5.589  15.997  1.00 0.00  ? 7    LYS A HD3    3  
ATOM   9672   H  HE2    . LYS A 1 7   ? -7.311  -5.818  17.006  1.00 0.00  ? 7    LYS A HE2    3  
ATOM   9673   H  HE3    . LYS A 1 7   ? -7.544  -4.296  16.123  1.00 0.00  ? 7    LYS A HE3    3  
ATOM   9674   H  HZ1    . LYS A 1 7   ? -9.328  -5.762  15.549  1.00 0.00  ? 7    LYS A HZ1    3  
ATOM   9675   H  HZ2    . LYS A 1 7   ? -8.250  -7.026  15.190  1.00 0.00  ? 7    LYS A HZ2    3  
ATOM   9676   H  HZ3    . LYS A 1 7   ? -8.300  -5.643  14.205  1.00 0.00  ? 7    LYS A HZ3    3  
ATOM   9677   N  N      . LEU A 1 8   ? -4.705  -4.536  10.215  1.00 34.86 ? 8    LEU A N      3  
ATOM   9678   C  CA     . LEU A 1 8   ? -4.022  -4.132  8.953   1.00 26.44 ? 8    LEU A CA     3  
ATOM   9679   C  C      . LEU A 1 8   ? -3.154  -2.887  9.170   1.00 31.60 ? 8    LEU A C      3  
ATOM   9680   O  O      . LEU A 1 8   ? -2.278  -2.596  8.379   1.00 29.79 ? 8    LEU A O      3  
ATOM   9681   C  CB     . LEU A 1 8   ? -5.157  -3.828  7.973   1.00 27.59 ? 8    LEU A CB     3  
ATOM   9682   C  CG     . LEU A 1 8   ? -5.585  -5.118  7.272   1.00 38.31 ? 8    LEU A CG     3  
ATOM   9683   C  CD1    . LEU A 1 8   ? -6.932  -4.902  6.581   1.00 41.64 ? 8    LEU A CD1    3  
ATOM   9684   C  CD2    . LEU A 1 8   ? -4.534  -5.503  6.227   1.00 38.17 ? 8    LEU A CD2    3  
ATOM   9685   H  H      . LEU A 1 8   ? -5.612  -4.215  10.407  1.00 0.00  ? 8    LEU A H      3  
ATOM   9686   H  HA     . LEU A 1 8   ? -3.423  -4.945  8.575   1.00 0.00  ? 8    LEU A HA     3  
ATOM   9687   H  HB2    . LEU A 1 8   ? -5.996  -3.414  8.513   1.00 0.00  ? 8    LEU A HB2    3  
ATOM   9688   H  HB3    . LEU A 1 8   ? -4.815  -3.117  7.236   1.00 0.00  ? 8    LEU A HB3    3  
ATOM   9689   H  HG     . LEU A 1 8   ? -5.677  -5.910  8.001   1.00 0.00  ? 8    LEU A HG     3  
ATOM   9690   H  HD11   . LEU A 1 8   ? -6.769  -4.499  5.593   1.00 0.00  ? 8    LEU A HD11   3  
ATOM   9691   H  HD12   . LEU A 1 8   ? -7.526  -4.208  7.160   1.00 0.00  ? 8    LEU A HD12   3  
ATOM   9692   H  HD13   . LEU A 1 8   ? -7.453  -5.844  6.506   1.00 0.00  ? 8    LEU A HD13   3  
ATOM   9693   H  HD21   . LEU A 1 8   ? -4.916  -6.302  5.611   1.00 0.00  ? 8    LEU A HD21   3  
ATOM   9694   H  HD22   . LEU A 1 8   ? -3.634  -5.830  6.726   1.00 0.00  ? 8    LEU A HD22   3  
ATOM   9695   H  HD23   . LEU A 1 8   ? -4.311  -4.645  5.609   1.00 0.00  ? 8    LEU A HD23   3  
ATOM   9696   N  N      . TYR A 1 9   ? -3.396  -2.136  10.215  1.00 29.00 ? 9    TYR A N      3  
ATOM   9697   C  CA     . TYR A 1 9   ? -2.579  -0.902  10.434  1.00 21.84 ? 9    TYR A CA     3  
ATOM   9698   C  C      . TYR A 1 9   ? -1.984  -0.851  11.847  1.00 25.22 ? 9    TYR A C      3  
ATOM   9699   O  O      . TYR A 1 9   ? -2.451  -1.504  12.762  1.00 24.44 ? 9    TYR A O      3  
ATOM   9700   C  CB     . TYR A 1 9   ? -3.560  0.255   10.235  1.00 21.43 ? 9    TYR A CB     3  
ATOM   9701   C  CG     . TYR A 1 9   ? -4.061  0.248   8.820   1.00 28.57 ? 9    TYR A CG     3  
ATOM   9702   C  CD1    . TYR A 1 9   ? -3.230  0.704   7.782   1.00 27.44 ? 9    TYR A CD1    3  
ATOM   9703   C  CD2    . TYR A 1 9   ? -5.363  -0.207  8.540   1.00 31.67 ? 9    TYR A CD2    3  
ATOM   9704   C  CE1    . TYR A 1 9   ? -3.702  0.705   6.462   1.00 31.63 ? 9    TYR A CE1    3  
ATOM   9705   C  CE2    . TYR A 1 9   ? -5.834  -0.205  7.219   1.00 29.62 ? 9    TYR A CE2    3  
ATOM   9706   C  CZ     . TYR A 1 9   ? -5.002  0.252   6.182   1.00 34.34 ? 9    TYR A CZ     3  
ATOM   9707   O  OH     . TYR A 1 9   ? -5.454  0.248   4.884   1.00 40.45 ? 9    TYR A OH     3  
ATOM   9708   H  H      . TYR A 1 9   ? -4.120  -2.371  10.833  1.00 0.00  ? 9    TYR A H      3  
ATOM   9709   H  HA     . TYR A 1 9   ? -1.792  -0.841  9.701   1.00 0.00  ? 9    TYR A HA     3  
ATOM   9710   H  HB2    . TYR A 1 9   ? -4.399  0.141   10.908  1.00 0.00  ? 9    TYR A HB2    3  
ATOM   9711   H  HB3    . TYR A 1 9   ? -3.064  1.192   10.432  1.00 0.00  ? 9    TYR A HB3    3  
ATOM   9712   H  HD1    . TYR A 1 9   ? -2.227  1.054   7.999   1.00 0.00  ? 9    TYR A HD1    3  
ATOM   9713   H  HD2    . TYR A 1 9   ? -6.000  -0.559  9.342   1.00 0.00  ? 9    TYR A HD2    3  
ATOM   9714   H  HE1    . TYR A 1 9   ? -3.064  1.059   5.658   1.00 0.00  ? 9    TYR A HE1    3  
ATOM   9715   H  HE2    . TYR A 1 9   ? -6.841  -0.554  7.001   1.00 0.00  ? 9    TYR A HE2    3  
ATOM   9716   H  HH     . TYR A 1 9   ? -4.797  -0.196  4.349   1.00 0.00  ? 9    TYR A HH     3  
ATOM   9717   N  N      . ARG A 1 10  ? -0.958  -0.057  12.015  1.00 20.35 ? 10   ARG A N      3  
ATOM   9718   C  CA     . ARG A 1 10  ? -0.317  0.074   13.349  1.00 18.98 ? 10   ARG A CA     3  
ATOM   9719   C  C      . ARG A 1 10  ? 0.042   1.544   13.604  1.00 15.07 ? 10   ARG A C      3  
ATOM   9720   O  O      . ARG A 1 10  ? 0.489   2.250   12.720  1.00 21.03 ? 10   ARG A O      3  
ATOM   9721   C  CB     . ARG A 1 10  ? 0.947   -0.795  13.273  1.00 17.85 ? 10   ARG A CB     3  
ATOM   9722   C  CG     . ARG A 1 10  ? 1.755   -0.650  14.569  1.00 23.08 ? 10   ARG A CG     3  
ATOM   9723   C  CD     . ARG A 1 10  ? 1.488   -1.837  15.492  1.00 22.56 ? 10   ARG A CD     3  
ATOM   9724   N  NE     . ARG A 1 10  ? 1.363   -1.235  16.852  1.00 46.91 ? 10   ARG A NE     3  
ATOM   9725   C  CZ     . ARG A 1 10  ? 1.511   -1.975  17.921  1.00 43.06 ? 10   ARG A CZ     3  
ATOM   9726   N  NH1    . ARG A 1 10  ? 1.770   -3.254  17.810  1.00 38.56 ? 10   ARG A NH1    3  
ATOM   9727   N  NH2    . ARG A 1 10  ? 1.400   -1.435  19.104  1.00 16.57 ? 10   ARG A NH2    3  
ATOM   9728   H  H      . ARG A 1 10  ? -0.615  0.461   11.256  1.00 0.00  ? 10   ARG A H      3  
ATOM   9729   H  HA     . ARG A 1 10  ? -0.974  -0.296  14.120  1.00 0.00  ? 10   ARG A HA     3  
ATOM   9730   H  HB2    . ARG A 1 10  ? 0.667   -1.831  13.134  1.00 0.00  ? 10   ARG A HB2    3  
ATOM   9731   H  HB3    . ARG A 1 10  ? 1.555   -0.474  12.439  1.00 0.00  ? 10   ARG A HB3    3  
ATOM   9732   H  HG2    . ARG A 1 10  ? 2.808   -0.614  14.334  1.00 0.00  ? 10   ARG A HG2    3  
ATOM   9733   H  HG3    . ARG A 1 10  ? 1.468   0.262   15.070  1.00 0.00  ? 10   ARG A HG3    3  
ATOM   9734   H  HD2    . ARG A 1 10  ? 0.572   -2.338  15.210  1.00 0.00  ? 10   ARG A HD2    3  
ATOM   9735   H  HD3    . ARG A 1 10  ? 2.318   -2.525  15.469  1.00 0.00  ? 10   ARG A HD3    3  
ATOM   9736   H  HE     . ARG A 1 10  ? 1.170   -0.278  16.945  1.00 0.00  ? 10   ARG A HE     3  
ATOM   9737   H  HH11   . ARG A 1 10  ? 1.855   -3.674  16.907  1.00 0.00  ? 10   ARG A HH11   3  
ATOM   9738   H  HH12   . ARG A 1 10  ? 1.883   -3.813  18.631  1.00 0.00  ? 10   ARG A HH12   3  
ATOM   9739   H  HH21   . ARG A 1 10  ? 1.201   -0.458  19.194  1.00 0.00  ? 10   ARG A HH21   3  
ATOM   9740   H  HH22   . ARG A 1 10  ? 1.512   -1.997  19.924  1.00 0.00  ? 10   ARG A HH22   3  
ATOM   9741   N  N      . VAL A 1 11  ? -0.131  1.985   14.813  1.00 16.36 ? 11   VAL A N      3  
ATOM   9742   C  CA     . VAL A 1 11  ? 0.215   3.389   15.161  1.00 15.61 ? 11   VAL A CA     3  
ATOM   9743   C  C      . VAL A 1 11  ? 1.049   3.375   16.435  1.00 20.09 ? 11   VAL A C      3  
ATOM   9744   O  O      . VAL A 1 11  ? 0.771   2.623   17.352  1.00 21.30 ? 11   VAL A O      3  
ATOM   9745   C  CB     . VAL A 1 11  ? -1.122  4.100   15.385  1.00 14.54 ? 11   VAL A CB     3  
ATOM   9746   C  CG1    . VAL A 1 11  ? -1.888  3.408   16.513  1.00 15.65 ? 11   VAL A CG1    3  
ATOM   9747   C  CG2    . VAL A 1 11  ? -0.868  5.563   15.767  1.00 13.69 ? 11   VAL A CG2    3  
ATOM   9748   H  H      . VAL A 1 11  ? -0.472  1.380   15.505  1.00 0.00  ? 11   VAL A H      3  
ATOM   9749   H  HA     . VAL A 1 11  ? 0.759   3.856   14.355  1.00 0.00  ? 11   VAL A HA     3  
ATOM   9750   H  HB     . VAL A 1 11  ? -1.707  4.062   14.477  1.00 0.00  ? 11   VAL A HB     3  
ATOM   9751   H  HG11   . VAL A 1 11  ? -2.871  3.846   16.605  1.00 0.00  ? 11   VAL A HG11   3  
ATOM   9752   H  HG12   . VAL A 1 11  ? -1.350  3.531   17.442  1.00 0.00  ? 11   VAL A HG12   3  
ATOM   9753   H  HG13   . VAL A 1 11  ? -1.982  2.357   16.289  1.00 0.00  ? 11   VAL A HG13   3  
ATOM   9754   H  HG21   . VAL A 1 11  ? -1.809  6.095   15.799  1.00 0.00  ? 11   VAL A HG21   3  
ATOM   9755   H  HG22   . VAL A 1 11  ? -0.221  6.021   15.035  1.00 0.00  ? 11   VAL A HG22   3  
ATOM   9756   H  HG23   . VAL A 1 11  ? -0.398  5.607   16.739  1.00 0.00  ? 11   VAL A HG23   3  
ATOM   9757   N  N      . GLU A 1 12  ? 2.075   4.177   16.501  1.00 14.48 ? 12   GLU A N      3  
ATOM   9758   C  CA     . GLU A 1 12  ? 2.923   4.178   17.726  1.00 13.47 ? 12   GLU A CA     3  
ATOM   9759   C  C      . GLU A 1 12  ? 3.956   5.296   17.667  1.00 17.08 ? 12   GLU A C      3  
ATOM   9760   O  O      . GLU A 1 12  ? 4.190   5.892   16.631  1.00 19.42 ? 12   GLU A O      3  
ATOM   9761   C  CB     . GLU A 1 12  ? 3.625   2.818   17.715  1.00 15.15 ? 12   GLU A CB     3  
ATOM   9762   C  CG     . GLU A 1 12  ? 4.438   2.675   16.424  1.00 18.26 ? 12   GLU A CG     3  
ATOM   9763   C  CD     . GLU A 1 12  ? 5.333   1.441   16.507  1.00 22.80 ? 12   GLU A CD     3  
ATOM   9764   O  OE1    . GLU A 1 12  ? 4.851   0.410   16.943  1.00 24.21 ? 12   GLU A OE1    3  
ATOM   9765   O  OE2    . GLU A 1 12  ? 6.489   1.548   16.125  1.00 21.80 ? 12   GLU A OE2    3  
ATOM   9766   H  H      . GLU A 1 12  ? 2.295   4.765   15.745  1.00 0.00  ? 12   GLU A H      3  
ATOM   9767   H  HA     . GLU A 1 12  ? 2.312   4.272   18.611  1.00 0.00  ? 12   GLU A HA     3  
ATOM   9768   H  HB2    . GLU A 1 12  ? 4.283   2.744   18.569  1.00 0.00  ? 12   GLU A HB2    3  
ATOM   9769   H  HB3    . GLU A 1 12  ? 2.885   2.032   17.761  1.00 0.00  ? 12   GLU A HB3    3  
ATOM   9770   H  HG2    . GLU A 1 12  ? 3.765   2.573   15.587  1.00 0.00  ? 12   GLU A HG2    3  
ATOM   9771   H  HG3    . GLU A 1 12  ? 5.052   3.553   16.286  1.00 0.00  ? 12   GLU A HG3    3  
ATOM   9772   N  N      . TYR A 1 13  ? 4.604   5.547   18.769  1.00 14.81 ? 13   TYR A N      3  
ATOM   9773   C  CA     . TYR A 1 13  ? 5.656   6.582   18.783  1.00 16.02 ? 13   TYR A CA     3  
ATOM   9774   C  C      . TYR A 1 13  ? 6.924   5.933   18.225  1.00 19.33 ? 13   TYR A C      3  
ATOM   9775   O  O      . TYR A 1 13  ? 7.316   4.865   18.655  1.00 17.84 ? 13   TYR A O      3  
ATOM   9776   C  CB     . TYR A 1 13  ? 5.810   6.987   20.251  1.00 17.04 ? 13   TYR A CB     3  
ATOM   9777   C  CG     . TYR A 1 13  ? 4.547   7.665   20.708  1.00 17.46 ? 13   TYR A CG     3  
ATOM   9778   C  CD1    . TYR A 1 13  ? 4.111   8.843   20.075  1.00 16.26 ? 13   TYR A CD1    3  
ATOM   9779   C  CD2    . TYR A 1 13  ? 3.808   7.118   21.773  1.00 15.25 ? 13   TYR A CD2    3  
ATOM   9780   C  CE1    . TYR A 1 13  ? 2.934   9.473   20.507  1.00 18.44 ? 13   TYR A CE1    3  
ATOM   9781   C  CE2    . TYR A 1 13  ? 2.630   7.749   22.206  1.00 16.23 ? 13   TYR A CE2    3  
ATOM   9782   C  CZ     . TYR A 1 13  ? 2.196   8.926   21.570  1.00 21.10 ? 13   TYR A CZ     3  
ATOM   9783   O  OH     . TYR A 1 13  ? 1.038   9.544   21.981  1.00 23.72 ? 13   TYR A OH     3  
ATOM   9784   H  H      . TYR A 1 13  ? 4.411   5.018   19.570  1.00 0.00  ? 13   TYR A H      3  
ATOM   9785   H  HA     . TYR A 1 13  ? 5.366   7.429   18.181  1.00 0.00  ? 13   TYR A HA     3  
ATOM   9786   H  HB2    . TYR A 1 13  ? 5.982   6.108   20.854  1.00 0.00  ? 13   TYR A HB2    3  
ATOM   9787   H  HB3    . TYR A 1 13  ? 6.640   7.669   20.357  1.00 0.00  ? 13   TYR A HB3    3  
ATOM   9788   H  HD1    . TYR A 1 13  ? 4.678   9.266   19.255  1.00 0.00  ? 13   TYR A HD1    3  
ATOM   9789   H  HD2    . TYR A 1 13  ? 4.143   6.210   22.261  1.00 0.00  ? 13   TYR A HD2    3  
ATOM   9790   H  HE1    . TYR A 1 13  ? 2.594   10.384  20.022  1.00 0.00  ? 13   TYR A HE1    3  
ATOM   9791   H  HE2    . TYR A 1 13  ? 2.059   7.330   23.030  1.00 0.00  ? 13   TYR A HE2    3  
ATOM   9792   H  HH     . TYR A 1 13  ? 0.545   9.788   21.196  1.00 0.00  ? 13   TYR A HH     3  
ATOM   9793   N  N      . ALA A 1 14  ? 7.518   6.538   17.232  1.00 20.52 ? 14   ALA A N      3  
ATOM   9794   C  CA     . ALA A 1 14  ? 8.731   5.947   16.559  1.00 17.91 ? 14   ALA A CA     3  
ATOM   9795   C  C      . ALA A 1 14  ? 9.729   5.314   17.539  1.00 19.42 ? 14   ALA A C      3  
ATOM   9796   O  O      . ALA A 1 14  ? 10.307  5.977   18.378  1.00 23.20 ? 14   ALA A O      3  
ATOM   9797   C  CB     . ALA A 1 14  ? 9.377   7.126   15.842  1.00 18.67 ? 14   ALA A CB     3  
ATOM   9798   H  H      . ALA A 1 14  ? 7.136   7.365   16.870  1.00 0.00  ? 14   ALA A H      3  
ATOM   9799   H  HA     . ALA A 1 14  ? 8.426   5.217   15.829  1.00 0.00  ? 14   ALA A HA     3  
ATOM   9800   H  HB1    . ALA A 1 14  ? 10.437  6.951   15.747  1.00 0.00  ? 14   ALA A HB1    3  
ATOM   9801   H  HB2    . ALA A 1 14  ? 9.208   8.027   16.413  1.00 0.00  ? 14   ALA A HB2    3  
ATOM   9802   H  HB3    . ALA A 1 14  ? 8.940   7.232   14.860  1.00 0.00  ? 14   ALA A HB3    3  
ATOM   9803   N  N      . LYS A 1 15  ? 9.952   4.029   17.402  1.00 17.87 ? 15   LYS A N      3  
ATOM   9804   C  CA     . LYS A 1 15  ? 10.936  3.329   18.288  1.00 13.86 ? 15   LYS A CA     3  
ATOM   9805   C  C      . LYS A 1 15  ? 12.355  3.795   17.938  1.00 22.04 ? 15   LYS A C      3  
ATOM   9806   O  O      . LYS A 1 15  ? 13.274  3.684   18.729  1.00 27.53 ? 15   LYS A O      3  
ATOM   9807   C  CB     . LYS A 1 15  ? 10.761  1.844   17.978  1.00 14.26 ? 15   LYS A CB     3  
ATOM   9808   C  CG     . LYS A 1 15  ? 9.389   1.377   18.469  1.00 21.40 ? 15   LYS A CG     3  
ATOM   9809   C  CD     . LYS A 1 15  ? 9.340   -0.153  18.462  1.00 27.44 ? 15   LYS A CD     3  
ATOM   9810   C  CE     . LYS A 1 15  ? 8.321   -0.641  19.498  1.00 36.58 ? 15   LYS A CE     3  
ATOM   9811   N  NZ     . LYS A 1 15  ? 7.700   -1.856  18.898  1.00 57.35 ? 15   LYS A NZ     3  
ATOM   9812   H  H      . LYS A 1 15  ? 9.488   3.530   16.699  1.00 0.00  ? 15   LYS A H      3  
ATOM   9813   H  HA     . LYS A 1 15  ? 10.716  3.523   19.325  1.00 0.00  ? 15   LYS A HA     3  
ATOM   9814   H  HB2    . LYS A 1 15  ? 10.834  1.690   16.911  1.00 0.00  ? 15   LYS A HB2    3  
ATOM   9815   H  HB3    . LYS A 1 15  ? 11.532  1.279   18.478  1.00 0.00  ? 15   LYS A HB3    3  
ATOM   9816   H  HG2    . LYS A 1 15  ? 9.223   1.741   19.474  1.00 0.00  ? 15   LYS A HG2    3  
ATOM   9817   H  HG3    . LYS A 1 15  ? 8.622   1.763   17.815  1.00 0.00  ? 15   LYS A HG3    3  
ATOM   9818   H  HD2    . LYS A 1 15  ? 9.051   -0.498  17.481  1.00 0.00  ? 15   LYS A HD2    3  
ATOM   9819   H  HD3    . LYS A 1 15  ? 10.314  -0.544  18.708  1.00 0.00  ? 15   LYS A HD3    3  
ATOM   9820   H  HE2    . LYS A 1 15  ? 8.821   -0.891  20.425  1.00 0.00  ? 15   LYS A HE2    3  
ATOM   9821   H  HE3    . LYS A 1 15  ? 7.568   0.113   19.670  1.00 0.00  ? 15   LYS A HE3    3  
ATOM   9822   H  HZ1    . LYS A 1 15  ? 8.440   -2.550  18.672  1.00 0.00  ? 15   LYS A HZ1    3  
ATOM   9823   H  HZ2    . LYS A 1 15  ? 7.192   -1.592  18.028  1.00 0.00  ? 15   LYS A HZ2    3  
ATOM   9824   H  HZ3    . LYS A 1 15  ? 7.032   -2.274  19.576  1.00 0.00  ? 15   LYS A HZ3    3  
ATOM   9825   N  N      . SER A 1 16  ? 12.526  4.334   16.756  1.00 25.48 ? 16   SER A N      3  
ATOM   9826   C  CA     . SER A 1 16  ? 13.851  4.847   16.328  1.00 21.30 ? 16   SER A CA     3  
ATOM   9827   C  C      . SER A 1 16  ? 13.645  5.985   15.315  1.00 24.91 ? 16   SER A C      3  
ATOM   9828   O  O      . SER A 1 16  ? 12.524  6.295   14.950  1.00 20.61 ? 16   SER A O      3  
ATOM   9829   C  CB     . SER A 1 16  ? 14.537  3.660   15.664  1.00 23.39 ? 16   SER A CB     3  
ATOM   9830   O  OG     . SER A 1 16  ? 14.292  3.695   14.263  1.00 25.58 ? 16   SER A OG     3  
ATOM   9831   H  H      . SER A 1 16  ? 11.765  4.414   16.148  1.00 0.00  ? 16   SER A H      3  
ATOM   9832   H  HA     . SER A 1 16  ? 14.422  5.181   17.178  1.00 0.00  ? 16   SER A HA     3  
ATOM   9833   H  HB2    . SER A 1 16  ? 15.597  3.712   15.842  1.00 0.00  ? 16   SER A HB2    3  
ATOM   9834   H  HB3    . SER A 1 16  ? 14.149  2.743   16.085  1.00 0.00  ? 16   SER A HB3    3  
ATOM   9835   H  HG     . SER A 1 16  ? 14.355  2.799   13.928  1.00 0.00  ? 16   SER A HG     3  
ATOM   9836   N  N      . GLY A 1 17  ? 14.708  6.602   14.857  1.00 24.25 ? 17   GLY A N      3  
ATOM   9837   C  CA     . GLY A 1 17  ? 14.553  7.721   13.885  1.00 20.02 ? 17   GLY A CA     3  
ATOM   9838   C  C      . GLY A 1 17  ? 15.136  7.289   12.535  1.00 23.96 ? 17   GLY A C      3  
ATOM   9839   O  O      . GLY A 1 17  ? 15.470  8.110   11.702  1.00 19.85 ? 17   GLY A O      3  
ATOM   9840   H  H      . GLY A 1 17  ? 15.591  6.360   15.210  1.00 0.00  ? 17   GLY A H      3  
ATOM   9841   H  HA2    . GLY A 1 17  ? 13.505  7.956   13.771  1.00 0.00  ? 17   GLY A HA2    3  
ATOM   9842   H  HA3    . GLY A 1 17  ? 15.082  8.594   14.240  1.00 0.00  ? 17   GLY A HA3    3  
ATOM   9843   N  N      . ARG A 1 18  ? 15.276  5.999   12.322  1.00 20.35 ? 18   ARG A N      3  
ATOM   9844   C  CA     . ARG A 1 18  ? 15.863  5.497   11.040  1.00 21.35 ? 18   ARG A CA     3  
ATOM   9845   C  C      . ARG A 1 18  ? 14.788  5.136   10.004  1.00 22.05 ? 18   ARG A C      3  
ATOM   9846   O  O      . ARG A 1 18  ? 15.082  5.004   8.828   1.00 21.05 ? 18   ARG A O      3  
ATOM   9847   C  CB     . ARG A 1 18  ? 16.624  4.228   11.442  1.00 23.28 ? 18   ARG A CB     3  
ATOM   9848   C  CG     . ARG A 1 18  ? 18.025  4.598   11.938  1.00 30.52 ? 18   ARG A CG     3  
ATOM   9849   C  CD     . ARG A 1 18  ? 18.460  3.608   13.017  1.00 39.33 ? 18   ARG A CD     3  
ATOM   9850   N  NE     . ARG A 1 18  ? 18.681  2.325   12.294  1.00 41.65 ? 18   ARG A NE     3  
ATOM   9851   C  CZ     . ARG A 1 18  ? 18.722  1.195   12.952  1.00 47.92 ? 18   ARG A CZ     3  
ATOM   9852   N  NH1    . ARG A 1 18  ? 18.584  1.182   14.254  1.00 48.84 ? 18   ARG A NH1    3  
ATOM   9853   N  NH2    . ARG A 1 18  ? 18.908  0.077   12.305  1.00 49.24 ? 18   ARG A NH2    3  
ATOM   9854   H  H      . ARG A 1 18  ? 15.017  5.357   13.015  1.00 0.00  ? 18   ARG A H      3  
ATOM   9855   H  HA     . ARG A 1 18  ? 16.554  6.219   10.636  1.00 0.00  ? 18   ARG A HA     3  
ATOM   9856   H  HB2    . ARG A 1 18  ? 16.084  3.720   12.229  1.00 0.00  ? 18   ARG A HB2    3  
ATOM   9857   H  HB3    . ARG A 1 18  ? 16.709  3.575   10.586  1.00 0.00  ? 18   ARG A HB3    3  
ATOM   9858   H  HG2    . ARG A 1 18  ? 18.723  4.555   11.114  1.00 0.00  ? 18   ARG A HG2    3  
ATOM   9859   H  HG3    . ARG A 1 18  ? 18.014  5.593   12.351  1.00 0.00  ? 18   ARG A HG3    3  
ATOM   9860   H  HD2    . ARG A 1 18  ? 19.376  3.941   13.486  1.00 0.00  ? 18   ARG A HD2    3  
ATOM   9861   H  HD3    . ARG A 1 18  ? 17.680  3.488   13.753  1.00 0.00  ? 18   ARG A HD3    3  
ATOM   9862   H  HE     . ARG A 1 18  ? 18.793  2.326   11.320  1.00 0.00  ? 18   ARG A HE     3  
ATOM   9863   H  HH11   . ARG A 1 18  ? 18.447  2.038   14.754  1.00 0.00  ? 18   ARG A HH11   3  
ATOM   9864   H  HH12   . ARG A 1 18  ? 18.616  0.315   14.751  1.00 0.00  ? 18   ARG A HH12   3  
ATOM   9865   H  HH21   . ARG A 1 18  ? 19.020  0.087   11.312  1.00 0.00  ? 18   ARG A HH21   3  
ATOM   9866   H  HH22   . ARG A 1 18  ? 18.934  -0.789  12.802  1.00 0.00  ? 18   ARG A HH22   3  
ATOM   9867   N  N      . ALA A 1 19  ? 13.562  4.974   10.410  1.00 20.84 ? 19   ALA A N      3  
ATOM   9868   C  CA     . ALA A 1 19  ? 12.487  4.638   9.403   1.00 18.95 ? 19   ALA A CA     3  
ATOM   9869   C  C      . ALA A 1 19  ? 12.257  5.800   8.424   1.00 21.42 ? 19   ALA A C      3  
ATOM   9870   O  O      . ALA A 1 19  ? 12.283  6.957   8.797   1.00 20.64 ? 19   ALA A O      3  
ATOM   9871   C  CB     . ALA A 1 19  ? 11.229  4.388   10.229  1.00 18.52 ? 19   ALA A CB     3  
ATOM   9872   H  H      . ALA A 1 19  ? 13.275  5.127   11.332  1.00 0.00  ? 19   ALA A H      3  
ATOM   9873   H  HA     . ALA A 1 19  ? 12.755  3.744   8.865   1.00 0.00  ? 19   ALA A HA     3  
ATOM   9874   H  HB1    . ALA A 1 19  ? 10.376  4.304   9.574   1.00 0.00  ? 19   ALA A HB1    3  
ATOM   9875   H  HB2    . ALA A 1 19  ? 11.081  5.210   10.913  1.00 0.00  ? 19   ALA A HB2    3  
ATOM   9876   H  HB3    . ALA A 1 19  ? 11.348  3.471   10.788  1.00 0.00  ? 19   ALA A HB3    3  
ATOM   9877   N  N      . SER A 1 20  ? 12.037  5.487   7.172   1.00 22.34 ? 20   SER A N      3  
ATOM   9878   C  CA     . SER A 1 20  ? 11.814  6.540   6.154   1.00 24.12 ? 20   SER A CA     3  
ATOM   9879   C  C      . SER A 1 20  ? 10.355  6.507   5.713   1.00 21.61 ? 20   SER A C      3  
ATOM   9880   O  O      . SER A 1 20  ? 9.794   5.458   5.456   1.00 22.04 ? 20   SER A O      3  
ATOM   9881   C  CB     . SER A 1 20  ? 12.738  6.175   4.994   1.00 21.65 ? 20   SER A CB     3  
ATOM   9882   O  OG     . SER A 1 20  ? 12.676  4.772   4.770   1.00 33.05 ? 20   SER A OG     3  
ATOM   9883   H  H      . SER A 1 20  ? 12.034  4.550   6.911   1.00 0.00  ? 20   SER A H      3  
ATOM   9884   H  HA     . SER A 1 20  ? 12.072  7.512   6.545   1.00 0.00  ? 20   SER A HA     3  
ATOM   9885   H  HB2    . SER A 1 20  ? 12.422  6.691   4.102   1.00 0.00  ? 20   SER A HB2    3  
ATOM   9886   H  HB3    . SER A 1 20  ? 13.752  6.468   5.237   1.00 0.00  ? 20   SER A HB3    3  
ATOM   9887   H  HG     . SER A 1 20  ? 13.554  4.411   4.904   1.00 0.00  ? 20   SER A HG     3  
ATOM   9888   N  N      . CYS A 1 21  ? 9.750   7.643   5.634   1.00 17.15 ? 21   CYS A N      3  
ATOM   9889   C  CA     . CYS A 1 21  ? 8.320   7.717   5.213   1.00 15.04 ? 21   CYS A CA     3  
ATOM   9890   C  C      . CYS A 1 21  ? 8.144   7.189   3.786   1.00 20.02 ? 21   CYS A C      3  
ATOM   9891   O  O      . CYS A 1 21  ? 8.832   7.604   2.874   1.00 18.74 ? 21   CYS A O      3  
ATOM   9892   C  CB     . CYS A 1 21  ? 8.001   9.203   5.281   1.00 15.75 ? 21   CYS A CB     3  
ATOM   9893   S  SG     . CYS A 1 21  ? 6.278   9.494   4.824   1.00 17.32 ? 21   CYS A SG     3  
ATOM   9894   H  H      . CYS A 1 21  ? 10.225  8.476   5.845   1.00 0.00  ? 21   CYS A H      3  
ATOM   9895   H  HA     . CYS A 1 21  ? 7.692   7.176   5.900   1.00 0.00  ? 21   CYS A HA     3  
ATOM   9896   H  HB2    . CYS A 1 21  ? 8.169   9.554   6.288   1.00 0.00  ? 21   CYS A HB2    3  
ATOM   9897   H  HB3    . CYS A 1 21  ? 8.649   9.741   4.603   1.00 0.00  ? 21   CYS A HB3    3  
ATOM   9898   N  N      . LYS A 1 22  ? 7.229   6.273   3.592   1.00 19.10 ? 22   LYS A N      3  
ATOM   9899   C  CA     . LYS A 1 22  ? 6.980   5.703   2.243   1.00 14.89 ? 22   LYS A CA     3  
ATOM   9900   C  C      . LYS A 1 22  ? 6.334   6.699   1.280   1.00 18.50 ? 22   LYS A C      3  
ATOM   9901   O  O      . LYS A 1 22  ? 6.174   6.426   0.105   1.00 20.27 ? 22   LYS A O      3  
ATOM   9902   C  CB     . LYS A 1 22  ? 5.991   4.612   2.535   1.00 18.82 ? 22   LYS A CB     3  
ATOM   9903   C  CG     . LYS A 1 22  ? 6.744   3.372   2.627   1.00 15.21 ? 22   LYS A CG     3  
ATOM   9904   C  CD     . LYS A 1 22  ? 7.167   2.941   1.270   1.00 19.41 ? 22   LYS A CD     3  
ATOM   9905   C  CE     . LYS A 1 22  ? 7.817   1.631   1.590   1.00 19.64 ? 22   LYS A CE     3  
ATOM   9906   N  NZ     . LYS A 1 22  ? 8.969   1.997   2.496   1.00 21.87 ? 22   LYS A NZ     3  
ATOM   9907   H  H      . LYS A 1 22  ? 6.711   5.944   4.358   1.00 0.00  ? 22   LYS A H      3  
ATOM   9908   H  HA     . LYS A 1 22  ? 7.886   5.288   1.822   1.00 0.00  ? 22   LYS A HA     3  
ATOM   9909   H  HB2    . LYS A 1 22  ? 5.513   4.793   3.479   1.00 0.00  ? 22   LYS A HB2    3  
ATOM   9910   H  HB3    . LYS A 1 22  ? 5.264   4.538   1.745   1.00 0.00  ? 22   LYS A HB3    3  
ATOM   9911   H  HG2    . LYS A 1 22  ? 7.623   3.533   3.232   1.00 0.00  ? 22   LYS A HG2    3  
ATOM   9912   H  HG3    . LYS A 1 22  ? 6.141   2.598   3.059   1.00 0.00  ? 22   LYS A HG3    3  
ATOM   9913   H  HD2    . LYS A 1 22  ? 6.303   2.817   0.626   1.00 0.00  ? 22   LYS A HD2    3  
ATOM   9914   H  HD3    . LYS A 1 22  ? 7.882   3.640   0.836   1.00 0.00  ? 22   LYS A HD3    3  
ATOM   9915   H  HE2    . LYS A 1 22  ? 7.107   1.021   2.132   1.00 0.00  ? 22   LYS A HE2    3  
ATOM   9916   H  HE3    . LYS A 1 22  ? 8.144   1.127   0.716   1.00 0.00  ? 22   LYS A HE3    3  
ATOM   9917   H  HZ1    . LYS A 1 22  ? 8.628   2.054   3.477   1.00 0.00  ? 22   LYS A HZ1    3  
ATOM   9918   H  HZ2    . LYS A 1 22  ? 9.367   2.922   2.224   1.00 0.00  ? 22   LYS A HZ2    3  
ATOM   9919   H  HZ3    . LYS A 1 22  ? 9.700   1.276   2.435   1.00 0.00  ? 22   LYS A HZ3    3  
ATOM   9920   N  N      . LYS A 1 23  ? 5.941   7.849   1.773   1.00 17.56 ? 23   LYS A N      3  
ATOM   9921   C  CA     . LYS A 1 23  ? 5.280   8.867   0.897   1.00 19.86 ? 23   LYS A CA     3  
ATOM   9922   C  C      . LYS A 1 23  ? 6.255   9.994   0.508   1.00 28.53 ? 23   LYS A C      3  
ATOM   9923   O  O      . LYS A 1 23  ? 6.489   10.238  -0.660  1.00 29.86 ? 23   LYS A O      3  
ATOM   9924   C  CB     . LYS A 1 23  ? 4.141   9.442   1.740   1.00 15.31 ? 23   LYS A CB     3  
ATOM   9925   C  CG     . LYS A 1 23  ? 3.349   10.445  0.899   1.00 14.68 ? 23   LYS A CG     3  
ATOM   9926   C  CD     . LYS A 1 23  ? 2.738   11.510  1.811   1.00 27.02 ? 23   LYS A CD     3  
ATOM   9927   C  CE     . LYS A 1 23  ? 2.244   12.693  0.972   1.00 26.91 ? 23   LYS A CE     3  
ATOM   9928   N  NZ     . LYS A 1 23  ? 3.470   13.471  0.640   1.00 24.85 ? 23   LYS A NZ     3  
ATOM   9929   H  H      . LYS A 1 23  ? 6.079   8.036   2.714   1.00 0.00  ? 23   LYS A H      3  
ATOM   9930   H  HA     . LYS A 1 23  ? 4.877   8.395   0.015   1.00 0.00  ? 23   LYS A HA     3  
ATOM   9931   H  HB2    . LYS A 1 23  ? 3.488   8.644   2.065   1.00 0.00  ? 23   LYS A HB2    3  
ATOM   9932   H  HB3    . LYS A 1 23  ? 4.552   9.947   2.602   1.00 0.00  ? 23   LYS A HB3    3  
ATOM   9933   H  HG2    . LYS A 1 23  ? 4.012   10.918  0.187   1.00 0.00  ? 23   LYS A HG2    3  
ATOM   9934   H  HG3    . LYS A 1 23  ? 2.563   9.930   0.369   1.00 0.00  ? 23   LYS A HG3    3  
ATOM   9935   H  HD2    . LYS A 1 23  ? 1.906   11.082  2.352   1.00 0.00  ? 23   LYS A HD2    3  
ATOM   9936   H  HD3    . LYS A 1 23  ? 3.483   11.857  2.511   1.00 0.00  ? 23   LYS A HD3    3  
ATOM   9937   H  HE2    . LYS A 1 23  ? 1.763   12.341  0.069   1.00 0.00  ? 23   LYS A HE2    3  
ATOM   9938   H  HE3    . LYS A 1 23  ? 1.564   13.305  1.546   1.00 0.00  ? 23   LYS A HE3    3  
ATOM   9939   H  HZ1    . LYS A 1 23  ? 4.012   13.649  1.509   1.00 0.00  ? 23   LYS A HZ1    3  
ATOM   9940   H  HZ2    . LYS A 1 23  ? 3.199   14.378  0.207   1.00 0.00  ? 23   LYS A HZ2    3  
ATOM   9941   H  HZ3    . LYS A 1 23  ? 4.056   12.929  -0.025  1.00 0.00  ? 23   LYS A HZ3    3  
ATOM   9942   N  N      . CYS A 1 24  ? 6.798   10.696  1.476   1.00 27.41 ? 24   CYS A N      3  
ATOM   9943   C  CA     . CYS A 1 24  ? 7.734   11.823  1.149   1.00 17.42 ? 24   CYS A CA     3  
ATOM   9944   C  C      . CYS A 1 24  ? 9.224   11.424  1.260   1.00 20.96 ? 24   CYS A C      3  
ATOM   9945   O  O      . CYS A 1 24  ? 10.094  12.203  0.926   1.00 27.34 ? 24   CYS A O      3  
ATOM   9946   C  CB     . CYS A 1 24  ? 7.374   12.933  2.136   1.00 17.55 ? 24   CYS A CB     3  
ATOM   9947   S  SG     . CYS A 1 24  ? 7.969   12.533  3.798   1.00 25.74 ? 24   CYS A SG     3  
ATOM   9948   H  H      . CYS A 1 24  ? 6.573   10.497  2.407   1.00 0.00  ? 24   CYS A H      3  
ATOM   9949   H  HA     . CYS A 1 24  ? 7.535   12.169  0.148   1.00 0.00  ? 24   CYS A HA     3  
ATOM   9950   H  HB2    . CYS A 1 24  ? 7.828   13.855  1.807   1.00 0.00  ? 24   CYS A HB2    3  
ATOM   9951   H  HB3    . CYS A 1 24  ? 6.303   13.051  2.159   1.00 0.00  ? 24   CYS A HB3    3  
ATOM   9952   N  N      . SER A 1 25  ? 9.521   10.213  1.694   1.00 18.85 ? 25   SER A N      3  
ATOM   9953   C  CA     . SER A 1 25  ? 10.949  9.721   1.797   1.00 23.24 ? 25   SER A CA     3  
ATOM   9954   C  C      . SER A 1 25  ? 11.756  10.338  2.968   1.00 25.40 ? 25   SER A C      3  
ATOM   9955   O  O      . SER A 1 25  ? 12.849  9.882   3.263   1.00 24.73 ? 25   SER A O      3  
ATOM   9956   C  CB     . SER A 1 25  ? 11.587  10.072  0.459   1.00 22.84 ? 25   SER A CB     3  
ATOM   9957   O  OG     . SER A 1 25  ? 12.277  11.310  0.576   1.00 20.16 ? 25   SER A OG     3  
ATOM   9958   H  H      . SER A 1 25  ? 8.799   9.600   1.938   1.00 0.00  ? 25   SER A H      3  
ATOM   9959   H  HA     . SER A 1 25  ? 10.944  8.649   1.904   1.00 0.00  ? 25   SER A HA     3  
ATOM   9960   H  HB2    . SER A 1 25  ? 12.283  9.301   0.181   1.00 0.00  ? 25   SER A HB2    3  
ATOM   9961   H  HB3    . SER A 1 25  ? 10.814  10.148  -0.291  1.00 0.00  ? 25   SER A HB3    3  
ATOM   9962   H  HG     . SER A 1 25  ? 13.144  11.132  0.949   1.00 0.00  ? 25   SER A HG     3  
ATOM   9963   N  N      . GLU A 1 26  ? 11.253  11.350  3.638   1.00 24.15 ? 26   GLU A N      3  
ATOM   9964   C  CA     . GLU A 1 26  ? 12.029  11.944  4.773   1.00 25.41 ? 26   GLU A CA     3  
ATOM   9965   C  C      . GLU A 1 26  ? 12.031  10.976  5.963   1.00 23.73 ? 26   GLU A C      3  
ATOM   9966   O  O      . GLU A 1 26  ? 11.152  10.144  6.092   1.00 23.58 ? 26   GLU A O      3  
ATOM   9967   C  CB     . GLU A 1 26  ? 11.302  13.240  5.121   1.00 23.95 ? 26   GLU A CB     3  
ATOM   9968   C  CG     . GLU A 1 26  ? 11.618  14.303  4.064   1.00 26.20 ? 26   GLU A CG     3  
ATOM   9969   C  CD     . GLU A 1 26  ? 13.111  14.639  4.101   1.00 43.32 ? 26   GLU A CD     3  
ATOM   9970   O  OE1    . GLU A 1 26  ? 13.615  14.884  5.185   1.00 44.60 ? 26   GLU A OE1    3  
ATOM   9971   O  OE2    . GLU A 1 26  ? 13.725  14.648  3.047   1.00 50.67 ? 26   GLU A OE2    3  
ATOM   9972   H  H      . GLU A 1 26  ? 10.378  11.713  3.400   1.00 0.00  ? 26   GLU A H      3  
ATOM   9973   H  HA     . GLU A 1 26  ? 13.041  12.159  4.464   1.00 0.00  ? 26   GLU A HA     3  
ATOM   9974   H  HB2    . GLU A 1 26  ? 10.238  13.057  5.144   1.00 0.00  ? 26   GLU A HB2    3  
ATOM   9975   H  HB3    . GLU A 1 26  ? 11.630  13.588  6.087   1.00 0.00  ? 26   GLU A HB3    3  
ATOM   9976   H  HG2    . GLU A 1 26  ? 11.358  13.925  3.084   1.00 0.00  ? 26   GLU A HG2    3  
ATOM   9977   H  HG3    . GLU A 1 26  ? 11.045  15.194  4.269   1.00 0.00  ? 26   GLU A HG3    3  
ATOM   9978   N  N      . SER A 1 27  ? 13.023  11.068  6.816   1.00 21.94 ? 27   SER A N      3  
ATOM   9979   C  CA     . SER A 1 27  ? 13.100  10.141  7.976   1.00 21.97 ? 27   SER A CA     3  
ATOM   9980   C  C      . SER A 1 27  ? 12.022  10.457  9.012   1.00 20.79 ? 27   SER A C      3  
ATOM   9981   O  O      . SER A 1 27  ? 11.633  11.596  9.199   1.00 21.38 ? 27   SER A O      3  
ATOM   9982   C  CB     . SER A 1 27  ? 14.489  10.379  8.563   1.00 17.24 ? 27   SER A CB     3  
ATOM   9983   O  OG     . SER A 1 27  ? 14.674  11.773  8.777   1.00 24.24 ? 27   SER A OG     3  
ATOM   9984   H  H      . SER A 1 27  ? 13.718  11.746  6.672   1.00 0.00  ? 27   SER A H      3  
ATOM   9985   H  HA     . SER A 1 27  ? 13.014  9.118   7.646   1.00 0.00  ? 27   SER A HA     3  
ATOM   9986   H  HB2    . SER A 1 27  ? 14.581  9.861   9.503   1.00 0.00  ? 27   SER A HB2    3  
ATOM   9987   H  HB3    . SER A 1 27  ? 15.237  10.009  7.875   1.00 0.00  ? 27   SER A HB3    3  
ATOM   9988   H  HG     . SER A 1 27  ? 14.071  12.050  9.471   1.00 0.00  ? 27   SER A HG     3  
ATOM   9989   N  N      . ILE A 1 28  ? 11.568  9.453   9.708   1.00 18.84 ? 28   ILE A N      3  
ATOM   9990   C  CA     . ILE A 1 28  ? 10.552  9.676   10.769  1.00 21.99 ? 28   ILE A CA     3  
ATOM   9991   C  C      . ILE A 1 28  ? 11.306  9.782   12.105  1.00 18.71 ? 28   ILE A C      3  
ATOM   9992   O  O      . ILE A 1 28  ? 11.988  8.855   12.485  1.00 18.80 ? 28   ILE A O      3  
ATOM   9993   C  CB     . ILE A 1 28  ? 9.660   8.435   10.708  1.00 17.83 ? 28   ILE A CB     3  
ATOM   9994   C  CG1    . ILE A 1 28  ? 9.014   8.355   9.320   1.00 14.25 ? 28   ILE A CG1    3  
ATOM   9995   C  CG2    . ILE A 1 28  ? 8.572   8.528   11.777  1.00 13.51 ? 28   ILE A CG2    3  
ATOM   9996   C  CD1    . ILE A 1 28  ? 8.320   7.003   9.154   1.00 16.62 ? 28   ILE A CD1    3  
ATOM   9997   H  H      . ILE A 1 28  ? 11.926  8.553   9.549   1.00 0.00  ? 28   ILE A H      3  
ATOM   9998   H  HA     . ILE A 1 28  ? 9.980   10.568  10.570  1.00 0.00  ? 28   ILE A HA     3  
ATOM   9999   H  HB     . ILE A 1 28  ? 10.259  7.552   10.878  1.00 0.00  ? 28   ILE A HB     3  
ATOM   10000  H  HG12   . ILE A 1 28  ? 8.290   9.148   9.213   1.00 0.00  ? 28   ILE A HG12   3  
ATOM   10001  H  HG13   . ILE A 1 28  ? 9.776   8.460   8.562   1.00 0.00  ? 28   ILE A HG13   3  
ATOM   10002  H  HG21   . ILE A 1 28  ? 7.771   9.160   11.423  1.00 0.00  ? 28   ILE A HG21   3  
ATOM   10003  H  HG22   . ILE A 1 28  ? 8.990   8.946   12.682  1.00 0.00  ? 28   ILE A HG22   3  
ATOM   10004  H  HG23   . ILE A 1 28  ? 8.186   7.540   11.983  1.00 0.00  ? 28   ILE A HG23   3  
ATOM   10005  H  HD11   . ILE A 1 28  ? 8.362   6.701   8.117   1.00 0.00  ? 28   ILE A HD11   3  
ATOM   10006  H  HD12   . ILE A 1 28  ? 7.289   7.087   9.464   1.00 0.00  ? 28   ILE A HD12   3  
ATOM   10007  H  HD13   . ILE A 1 28  ? 8.820   6.265   9.764   1.00 0.00  ? 28   ILE A HD13   3  
ATOM   10008  N  N      . PRO A 1 29  ? 11.230  10.933  12.745  1.00 18.92 ? 29   PRO A N      3  
ATOM   10009  C  CA     . PRO A 1 29  ? 11.999  11.150  14.002  1.00 20.83 ? 29   PRO A CA     3  
ATOM   10010  C  C      . PRO A 1 29  ? 11.537  10.245  15.151  1.00 19.21 ? 29   PRO A C      3  
ATOM   10011  O  O      . PRO A 1 29  ? 10.363  9.978   15.328  1.00 18.77 ? 29   PRO A O      3  
ATOM   10012  C  CB     . PRO A 1 29  ? 11.768  12.625  14.311  1.00 21.91 ? 29   PRO A CB     3  
ATOM   10013  C  CG     . PRO A 1 29  ? 10.492  12.968  13.612  1.00 20.62 ? 29   PRO A CG     3  
ATOM   10014  C  CD     . PRO A 1 29  ? 10.431  12.106  12.381  1.00 17.84 ? 29   PRO A CD     3  
ATOM   10015  H  HA     . PRO A 1 29  ? 13.048  10.990  13.815  1.00 0.00  ? 29   PRO A HA     3  
ATOM   10016  H  HB2    . PRO A 1 29  ? 11.671  12.772  15.377  1.00 0.00  ? 29   PRO A HB2    3  
ATOM   10017  H  HB3    . PRO A 1 29  ? 12.578  13.221  13.918  1.00 0.00  ? 29   PRO A HB3    3  
ATOM   10018  H  HG2    . PRO A 1 29  ? 9.650   12.758  14.255  1.00 0.00  ? 29   PRO A HG2    3  
ATOM   10019  H  HG3    . PRO A 1 29  ? 10.494  14.007  13.326  1.00 0.00  ? 29   PRO A HG3    3  
ATOM   10020  H  HD2    . PRO A 1 29  ? 9.411   11.824  12.165  1.00 0.00  ? 29   PRO A HD2    3  
ATOM   10021  H  HD3    . PRO A 1 29  ? 10.878  12.610  11.538  1.00 0.00  ? 29   PRO A HD3    3  
ATOM   10022  N  N      . LYS A 1 30  ? 12.486  9.773   15.927  1.00 21.31 ? 30   LYS A N      3  
ATOM   10023  C  CA     . LYS A 1 30  ? 12.173  8.870   17.081  1.00 24.75 ? 30   LYS A CA     3  
ATOM   10024  C  C      . LYS A 1 30  ? 11.142  9.516   18.014  1.00 22.59 ? 30   LYS A C      3  
ATOM   10025  O  O      . LYS A 1 30  ? 11.158  10.711  18.223  1.00 18.62 ? 30   LYS A O      3  
ATOM   10026  C  CB     . LYS A 1 30  ? 13.510  8.700   17.804  1.00 16.88 ? 30   LYS A CB     3  
ATOM   10027  C  CG     . LYS A 1 30  ? 13.346  7.728   18.973  1.00 29.63 ? 30   LYS A CG     3  
ATOM   10028  C  CD     . LYS A 1 30  ? 14.724  7.387   19.550  1.00 26.13 ? 30   LYS A CD     3  
ATOM   10029  C  CE     . LYS A 1 30  ? 14.561  6.643   20.879  1.00 30.85 ? 30   LYS A CE     3  
ATOM   10030  N  NZ     . LYS A 1 30  ? 15.874  5.975   21.108  1.00 60.43 ? 30   LYS A NZ     3  
ATOM   10031  H  H      . LYS A 1 30  ? 13.417  10.007  15.732  1.00 0.00  ? 30   LYS A H      3  
ATOM   10032  H  HA     . LYS A 1 30  ? 11.820  7.913   16.731  1.00 0.00  ? 30   LYS A HA     3  
ATOM   10033  H  HB2    . LYS A 1 30  ? 14.245  8.313   17.113  1.00 0.00  ? 30   LYS A HB2    3  
ATOM   10034  H  HB3    . LYS A 1 30  ? 13.841  9.659   18.179  1.00 0.00  ? 30   LYS A HB3    3  
ATOM   10035  H  HG2    . LYS A 1 30  ? 12.737  8.187   19.738  1.00 0.00  ? 30   LYS A HG2    3  
ATOM   10036  H  HG3    . LYS A 1 30  ? 12.870  6.824   18.626  1.00 0.00  ? 30   LYS A HG3    3  
ATOM   10037  H  HD2    . LYS A 1 30  ? 15.261  6.762   18.851  1.00 0.00  ? 30   LYS A HD2    3  
ATOM   10038  H  HD3    . LYS A 1 30  ? 15.279  8.298   19.715  1.00 0.00  ? 30   LYS A HD3    3  
ATOM   10039  H  HE2    . LYS A 1 30  ? 14.350  7.343   21.676  1.00 0.00  ? 30   LYS A HE2    3  
ATOM   10040  H  HE3    . LYS A 1 30  ? 13.779  5.905   20.805  1.00 0.00  ? 30   LYS A HE3    3  
ATOM   10041  H  HZ1    . LYS A 1 30  ? 15.890  5.555   22.058  1.00 0.00  ? 30   LYS A HZ1    3  
ATOM   10042  H  HZ2    . LYS A 1 30  ? 16.639  6.676   21.024  1.00 0.00  ? 30   LYS A HZ2    3  
ATOM   10043  H  HZ3    . LYS A 1 30  ? 16.011  5.226   20.400  1.00 0.00  ? 30   LYS A HZ3    3  
ATOM   10044  N  N      . ASP A 1 31  ? 10.250  8.716   18.575  1.00 23.87 ? 31   ASP A N      3  
ATOM   10045  C  CA     . ASP A 1 31  ? 9.187   9.228   19.520  1.00 24.13 ? 31   ASP A CA     3  
ATOM   10046  C  C      . ASP A 1 31  ? 8.060   9.982   18.789  1.00 24.72 ? 31   ASP A C      3  
ATOM   10047  O  O      . ASP A 1 31  ? 7.041   10.289  19.383  1.00 25.43 ? 31   ASP A O      3  
ATOM   10048  C  CB     . ASP A 1 31  ? 9.894   10.161  20.502  1.00 20.67 ? 31   ASP A CB     3  
ATOM   10049  C  CG     . ASP A 1 31  ? 11.109  9.452   21.103  1.00 30.42 ? 31   ASP A CG     3  
ATOM   10050  O  OD1    . ASP A 1 31  ? 10.996  8.272   21.401  1.00 34.09 ? 31   ASP A OD1    3  
ATOM   10051  O  OD2    . ASP A 1 31  ? 12.131  10.097  21.252  1.00 36.24 ? 31   ASP A OD2    3  
ATOM   10052  H  H      . ASP A 1 31  ? 10.284  7.756   18.378  1.00 0.00  ? 31   ASP A H      3  
ATOM   10053  H  HA     . ASP A 1 31  ? 8.766   8.397   20.064  1.00 0.00  ? 31   ASP A HA     3  
ATOM   10054  H  HB2    . ASP A 1 31  ? 10.214  11.052  19.982  1.00 0.00  ? 31   ASP A HB2    3  
ATOM   10055  H  HB3    . ASP A 1 31  ? 9.211   10.434  21.294  1.00 0.00  ? 31   ASP A HB3    3  
ATOM   10056  N  N      . SER A 1 32  ? 8.215   10.279  17.521  1.00 16.38 ? 32   SER A N      3  
ATOM   10057  C  CA     . SER A 1 32  ? 7.134   11.004  16.797  1.00 18.83 ? 32   SER A CA     3  
ATOM   10058  C  C      . SER A 1 32  ? 5.996   10.039  16.483  1.00 19.83 ? 32   SER A C      3  
ATOM   10059  O  O      . SER A 1 32  ? 6.202   8.842   16.393  1.00 18.96 ? 32   SER A O      3  
ATOM   10060  C  CB     . SER A 1 32  ? 7.788   11.509  15.514  1.00 18.06 ? 32   SER A CB     3  
ATOM   10061  O  OG     . SER A 1 32  ? 7.954   10.421  14.614  1.00 20.49 ? 32   SER A OG     3  
ATOM   10062  H  H      . SER A 1 32  ? 9.029   10.022  17.046  1.00 0.00  ? 32   SER A H      3  
ATOM   10063  H  HA     . SER A 1 32  ? 6.775   11.836  17.384  1.00 0.00  ? 32   SER A HA     3  
ATOM   10064  H  HB2    . SER A 1 32  ? 7.162   12.257  15.059  1.00 0.00  ? 32   SER A HB2    3  
ATOM   10065  H  HB3    . SER A 1 32  ? 8.750   11.941  15.753  1.00 0.00  ? 32   SER A HB3    3  
ATOM   10066  H  HG     . SER A 1 32  ? 8.885   10.364  14.387  1.00 0.00  ? 32   SER A HG     3  
ATOM   10067  N  N      . LEU A 1 33  ? 4.804   10.545  16.319  1.00 17.48 ? 33   LEU A N      3  
ATOM   10068  C  CA     . LEU A 1 33  ? 3.655   9.654   16.010  1.00 16.64 ? 33   LEU A CA     3  
ATOM   10069  C  C      . LEU A 1 33  ? 3.711   9.227   14.543  1.00 22.88 ? 33   LEU A C      3  
ATOM   10070  O  O      . LEU A 1 33  ? 3.675   10.050  13.647  1.00 24.44 ? 33   LEU A O      3  
ATOM   10071  C  CB     . LEU A 1 33  ? 2.408   10.499  16.283  1.00 13.16 ? 33   LEU A CB     3  
ATOM   10072  C  CG     . LEU A 1 33  ? 1.161   9.641   16.061  1.00 18.91 ? 33   LEU A CG     3  
ATOM   10073  C  CD1    . LEU A 1 33  ? 1.004   8.659   17.223  1.00 17.77 ? 33   LEU A CD1    3  
ATOM   10074  C  CD2    . LEU A 1 33  ? -0.079  10.538  15.982  1.00 17.47 ? 33   LEU A CD2    3  
ATOM   10075  H  H      . LEU A 1 33  ? 4.671   11.514  16.393  1.00 0.00  ? 33   LEU A H      3  
ATOM   10076  H  HA     . LEU A 1 33  ? 3.664   8.790   16.656  1.00 0.00  ? 33   LEU A HA     3  
ATOM   10077  H  HB2    . LEU A 1 33  ? 2.429   10.851  17.305  1.00 0.00  ? 33   LEU A HB2    3  
ATOM   10078  H  HB3    . LEU A 1 33  ? 2.388   11.342  15.610  1.00 0.00  ? 33   LEU A HB3    3  
ATOM   10079  H  HG     . LEU A 1 33  ? 1.266   9.089   15.138  1.00 0.00  ? 33   LEU A HG     3  
ATOM   10080  H  HD11   . LEU A 1 33  ? -0.046  8.491   17.414  1.00 0.00  ? 33   LEU A HD11   3  
ATOM   10081  H  HD12   . LEU A 1 33  ? 1.469   9.071   18.108  1.00 0.00  ? 33   LEU A HD12   3  
ATOM   10082  H  HD13   . LEU A 1 33  ? 1.478   7.724   16.970  1.00 0.00  ? 33   LEU A HD13   3  
ATOM   10083  H  HD21   . LEU A 1 33  ? -0.229  10.856  14.962  1.00 0.00  ? 33   LEU A HD21   3  
ATOM   10084  H  HD22   . LEU A 1 33  ? 0.060   11.403  16.613  1.00 0.00  ? 33   LEU A HD22   3  
ATOM   10085  H  HD23   . LEU A 1 33  ? -0.944  9.984   16.316  1.00 0.00  ? 33   LEU A HD23   3  
ATOM   10086  N  N      . ARG A 1 34  ? 3.801   7.938   14.295  1.00 17.81 ? 34   ARG A N      3  
ATOM   10087  C  CA     . ARG A 1 34  ? 3.867   7.443   12.899  1.00 14.68 ? 34   ARG A CA     3  
ATOM   10088  C  C      . ARG A 1 34  ? 2.832   6.338   12.698  1.00 18.38 ? 34   ARG A C      3  
ATOM   10089  O  O      . ARG A 1 34  ? 2.410   5.696   13.641  1.00 17.19 ? 34   ARG A O      3  
ATOM   10090  C  CB     . ARG A 1 34  ? 5.292   6.898   12.715  1.00 12.94 ? 34   ARG A CB     3  
ATOM   10091  C  CG     . ARG A 1 34  ? 5.614   5.868   13.805  1.00 14.70 ? 34   ARG A CG     3  
ATOM   10092  C  CD     . ARG A 1 34  ? 6.305   4.657   13.180  1.00 16.52 ? 34   ARG A CD     3  
ATOM   10093  N  NE     . ARG A 1 34  ? 7.724   4.730   13.640  1.00 16.01 ? 34   ARG A NE     3  
ATOM   10094  C  CZ     . ARG A 1 34  ? 8.366   3.641   13.989  1.00 18.84 ? 34   ARG A CZ     3  
ATOM   10095  N  NH1    . ARG A 1 34  ? 7.771   2.476   13.946  1.00 19.66 ? 34   ARG A NH1    3  
ATOM   10096  N  NH2    . ARG A 1 34  ? 9.608   3.720   14.384  1.00 18.47 ? 34   ARG A NH2    3  
ATOM   10097  H  H      . ARG A 1 34  ? 3.840   7.325   15.059  1.00 0.00  ? 34   ARG A H      3  
ATOM   10098  H  HA     . ARG A 1 34  ? 3.693   8.252   12.204  1.00 0.00  ? 34   ARG A HA     3  
ATOM   10099  H  HB2    . ARG A 1 34  ? 5.370   6.428   11.745  1.00 0.00  ? 34   ARG A HB2    3  
ATOM   10100  H  HB3    . ARG A 1 34  ? 5.998   7.713   12.774  1.00 0.00  ? 34   ARG A HB3    3  
ATOM   10101  H  HG2    . ARG A 1 34  ? 6.266   6.313   14.541  1.00 0.00  ? 34   ARG A HG2    3  
ATOM   10102  H  HG3    . ARG A 1 34  ? 4.699   5.549   14.281  1.00 0.00  ? 34   ARG A HG3    3  
ATOM   10103  H  HD2    . ARG A 1 34  ? 5.841   3.747   13.533  1.00 0.00  ? 34   ARG A HD2    3  
ATOM   10104  H  HD3    . ARG A 1 34  ? 6.260   4.710   12.103  1.00 0.00  ? 34   ARG A HD3    3  
ATOM   10105  H  HE     . ARG A 1 34  ? 8.179   5.597   13.682  1.00 0.00  ? 34   ARG A HE     3  
ATOM   10106  H  HH11   . ARG A 1 34  ? 6.821   2.408   13.644  1.00 0.00  ? 34   ARG A HH11   3  
ATOM   10107  H  HH12   . ARG A 1 34  ? 8.267   1.652   14.218  1.00 0.00  ? 34   ARG A HH12   3  
ATOM   10108  H  HH21   . ARG A 1 34  ? 10.066  4.608   14.418  1.00 0.00  ? 34   ARG A HH21   3  
ATOM   10109  H  HH22   . ARG A 1 34  ? 10.102  2.891   14.650  1.00 0.00  ? 34   ARG A HH22   3  
ATOM   10110  N  N      . MET A 1 35  ? 2.422   6.119   11.477  1.00 17.10 ? 35   MET A N      3  
ATOM   10111  C  CA     . MET A 1 35  ? 1.413   5.057   11.201  1.00 15.54 ? 35   MET A CA     3  
ATOM   10112  C  C      . MET A 1 35  ? 1.906   4.166   10.064  1.00 18.06 ? 35   MET A C      3  
ATOM   10113  O  O      . MET A 1 35  ? 2.681   4.594   9.222   1.00 12.57 ? 35   MET A O      3  
ATOM   10114  C  CB     . MET A 1 35  ? 0.152   5.813   10.786  1.00 14.43 ? 35   MET A CB     3  
ATOM   10115  C  CG     . MET A 1 35  ? -0.566  6.330   12.033  1.00 21.23 ? 35   MET A CG     3  
ATOM   10116  S  SD     . MET A 1 35  ? -2.305  6.646   11.641  1.00 32.33 ? 35   MET A SD     3  
ATOM   10117  C  CE     . MET A 1 35  ? -2.867  4.924   11.649  1.00 24.23 ? 35   MET A CE     3  
ATOM   10118  H  H      . MET A 1 35  ? 2.784   6.657   10.738  1.00 0.00  ? 35   MET A H      3  
ATOM   10119  H  HA     . MET A 1 35  ? 1.222   4.473   12.088  1.00 0.00  ? 35   MET A HA     3  
ATOM   10120  H  HB2    . MET A 1 35  ? 0.424   6.647   10.154  1.00 0.00  ? 35   MET A HB2    3  
ATOM   10121  H  HB3    . MET A 1 35  ? -0.505  5.150   10.243  1.00 0.00  ? 35   MET A HB3    3  
ATOM   10122  H  HG2    . MET A 1 35  ? -0.500  5.592   12.819  1.00 0.00  ? 35   MET A HG2    3  
ATOM   10123  H  HG3    . MET A 1 35  ? -0.098  7.248   12.359  1.00 0.00  ? 35   MET A HG3    3  
ATOM   10124  H  HE1    . MET A 1 35  ? -2.010  4.266   11.672  1.00 0.00  ? 35   MET A HE1    3  
ATOM   10125  H  HE2    . MET A 1 35  ? -3.444  4.728   10.759  1.00 0.00  ? 35   MET A HE2    3  
ATOM   10126  H  HE3    . MET A 1 35  ? -3.484  4.752   12.521  1.00 0.00  ? 35   MET A HE3    3  
ATOM   10127  N  N      . ALA A 1 36  ? 1.481   2.929   10.032  1.00 14.04 ? 36   ALA A N      3  
ATOM   10128  C  CA     . ALA A 1 36  ? 1.956   2.033   8.952   1.00 14.62 ? 36   ALA A CA     3  
ATOM   10129  C  C      . ALA A 1 36  ? 0.877   1.055   8.516   1.00 17.40 ? 36   ALA A C      3  
ATOM   10130  O  O      . ALA A 1 36  ? 0.051   0.616   9.297   1.00 18.72 ? 36   ALA A O      3  
ATOM   10131  C  CB     . ALA A 1 36  ? 3.124   1.262   9.564   1.00 12.78 ? 36   ALA A CB     3  
ATOM   10132  H  H      . ALA A 1 36  ? 0.876   2.589   10.729  1.00 0.00  ? 36   ALA A H      3  
ATOM   10133  H  HA     . ALA A 1 36  ? 2.305   2.612   8.110   1.00 0.00  ? 36   ALA A HA     3  
ATOM   10134  H  HB1    . ALA A 1 36  ? 3.013   1.234   10.637  1.00 0.00  ? 36   ALA A HB1    3  
ATOM   10135  H  HB2    . ALA A 1 36  ? 4.047   1.755   9.307   1.00 0.00  ? 36   ALA A HB2    3  
ATOM   10136  H  HB3    . ALA A 1 36  ? 3.131   0.252   9.177   1.00 0.00  ? 36   ALA A HB3    3  
ATOM   10137  N  N      . ILE A 1 37  ? 0.946   0.637   7.280   1.00 16.10 ? 37   ILE A N      3  
ATOM   10138  C  CA     . ILE A 1 37  ? -0.003  -0.394  6.778   1.00 22.59 ? 37   ILE A CA     3  
ATOM   10139  C  C      . ILE A 1 37  ? 0.712   -1.751  6.854   1.00 23.48 ? 37   ILE A C      3  
ATOM   10140  O  O      . ILE A 1 37  ? 1.702   -1.981  6.190   1.00 19.72 ? 37   ILE A O      3  
ATOM   10141  C  CB     . ILE A 1 37  ? -0.334  -0.004  5.326   1.00 16.82 ? 37   ILE A CB     3  
ATOM   10142  C  CG1    . ILE A 1 37  ? -1.143  -1.126  4.669   1.00 27.02 ? 37   ILE A CG1    3  
ATOM   10143  C  CG2    . ILE A 1 37  ? 0.950   0.232   4.523   1.00 15.86 ? 37   ILE A CG2    3  
ATOM   10144  C  CD1    . ILE A 1 37  ? -2.095  -0.533  3.629   1.00 33.55 ? 37   ILE A CD1    3  
ATOM   10145  H  H      . ILE A 1 37  ? 1.668   0.958   6.702   1.00 0.00  ? 37   ILE A H      3  
ATOM   10146  H  HA     . ILE A 1 37  ? -0.900  -0.405  7.379   1.00 0.00  ? 37   ILE A HA     3  
ATOM   10147  H  HB     . ILE A 1 37  ? -0.922  0.903   5.329   1.00 0.00  ? 37   ILE A HB     3  
ATOM   10148  H  HG12   . ILE A 1 37  ? -0.468  -1.819  4.186   1.00 0.00  ? 37   ILE A HG12   3  
ATOM   10149  H  HG13   . ILE A 1 37  ? -1.714  -1.647  5.422   1.00 0.00  ? 37   ILE A HG13   3  
ATOM   10150  H  HG21   . ILE A 1 37  ? 1.670   -0.535  4.755   1.00 0.00  ? 37   ILE A HG21   3  
ATOM   10151  H  HG22   . ILE A 1 37  ? 1.360   1.199   4.774   1.00 0.00  ? 37   ILE A HG22   3  
ATOM   10152  H  HG23   . ILE A 1 37  ? 0.722   0.204   3.468   1.00 0.00  ? 37   ILE A HG23   3  
ATOM   10153  H  HD11   . ILE A 1 37  ? -1.663  -0.635  2.645   1.00 0.00  ? 37   ILE A HD11   3  
ATOM   10154  H  HD12   . ILE A 1 37  ? -2.258  0.512   3.844   1.00 0.00  ? 37   ILE A HD12   3  
ATOM   10155  H  HD13   . ILE A 1 37  ? -3.038  -1.059  3.663   1.00