data_2NL9
# 
_entry.id   2NL9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NL9         
RCSB  RCSB040001   
WWPDB D_1000040001 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1WSX 'Solution structure of Mcl-1' unspecified 
PDB 2NLA .                             unspecified 
# 
_pdbx_database_status.entry_id                        2NL9 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Czabotar, P.E.' 1 
'Colman, P.M.'   2 
# 
_citation.id                        primary 
_citation.title                     'Structural insights into the degradation of Mcl-1 induced by BH3 domains.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            104 
_citation.page_first                6217 
_citation.page_last                 6222 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17389404 
_citation.pdbx_database_id_DOI      10.1073/pnas.0701297104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Czabotar, P.E.'  1 
primary 'Lee, E.F.'       2 
primary 'van Delft, M.F.' 3 
primary 'Day, C.L.'       4 
primary 'Smith, B.J.'     5 
primary 'Huang, D.C.'     6 
primary 'Fairlie, W.D.'   7 
primary 'Hinds, M.G.'     8 
primary 'Colman, P.M.'    9 
# 
_cell.length_a           52.380 
_cell.length_b           70.080 
_cell.length_c           117.180 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2NL9 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.entry_id                         2NL9 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                23 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog' 17909.926 1   
? ? 'residues 171-208 and residues 209-327' ? 
2 polymer     nat 'Bcl-2-like protein 11'                                                                            3274.691  1   
? ? ?                                       ? 
3 non-polymer syn 'ZINC ION'                                                                                         65.409    7   
? ? ?                                       ? 
4 non-polymer syn 'CHLORIDE ION'                                                                                     35.453    1   
? ? ?                                       ? 
5 water       nat water                                                                                              18.015    201 
? ? ?                                       ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Bcl2-interacting mediator of cell death' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;EDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQG(MSE)LRKLDIKNEDDVKSL
SRV(MSE)IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
DLEGG
;
;EDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
;
A ? 
2 'polypeptide(L)' no no  DMRPEIWIAQELRRIGDEFNAYYARR DMRPEIWIAQELRRIGDEFNAYYARR B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   LEU n 
1 5   TYR n 
1 6   ARG n 
1 7   GLN n 
1 8   SER n 
1 9   LEU n 
1 10  GLU n 
1 11  ILE n 
1 12  ILE n 
1 13  SER n 
1 14  ARG n 
1 15  TYR n 
1 16  LEU n 
1 17  ARG n 
1 18  GLU n 
1 19  GLN n 
1 20  ALA n 
1 21  THR n 
1 22  GLY n 
1 23  SER n 
1 24  LYS n 
1 25  ASP n 
1 26  SER n 
1 27  LYS n 
1 28  PRO n 
1 29  LEU n 
1 30  GLY n 
1 31  GLU n 
1 32  ALA n 
1 33  GLY n 
1 34  ALA n 
1 35  ALA n 
1 36  GLY n 
1 37  ARG n 
1 38  ARG n 
1 39  ALA n 
1 40  LEU n 
1 41  GLU n 
1 42  THR n 
1 43  LEU n 
1 44  ARG n 
1 45  ARG n 
1 46  VAL n 
1 47  GLY n 
1 48  ASP n 
1 49  GLY n 
1 50  VAL n 
1 51  GLN n 
1 52  ARG n 
1 53  ASN n 
1 54  HIS n 
1 55  GLU n 
1 56  THR n 
1 57  ALA n 
1 58  PHE n 
1 59  GLN n 
1 60  GLY n 
1 61  MSE n 
1 62  LEU n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  ASP n 
1 67  ILE n 
1 68  LYS n 
1 69  ASN n 
1 70  GLU n 
1 71  ASP n 
1 72  ASP n 
1 73  VAL n 
1 74  LYS n 
1 75  SER n 
1 76  LEU n 
1 77  SER n 
1 78  ARG n 
1 79  VAL n 
1 80  MSE n 
1 81  ILE n 
1 82  HIS n 
1 83  VAL n 
1 84  PHE n 
1 85  SER n 
1 86  ASP n 
1 87  GLY n 
1 88  VAL n 
1 89  THR n 
1 90  ASN n 
1 91  TRP n 
1 92  GLY n 
1 93  ARG n 
1 94  ILE n 
1 95  VAL n 
1 96  THR n 
1 97  LEU n 
1 98  ILE n 
1 99  SER n 
1 100 PHE n 
1 101 GLY n 
1 102 ALA n 
1 103 PHE n 
1 104 VAL n 
1 105 ALA n 
1 106 LYS n 
1 107 HIS n 
1 108 LEU n 
1 109 LYS n 
1 110 THR n 
1 111 ILE n 
1 112 ASN n 
1 113 GLN n 
1 114 GLU n 
1 115 SER n 
1 116 CYS n 
1 117 ILE n 
1 118 GLU n 
1 119 PRO n 
1 120 LEU n 
1 121 ALA n 
1 122 GLU n 
1 123 SER n 
1 124 ILE n 
1 125 THR n 
1 126 ASP n 
1 127 VAL n 
1 128 LEU n 
1 129 VAL n 
1 130 ARG n 
1 131 THR n 
1 132 LYS n 
1 133 ARG n 
1 134 ASP n 
1 135 TRP n 
1 136 LEU n 
1 137 VAL n 
1 138 LYS n 
1 139 GLN n 
1 140 ARG n 
1 141 GLY n 
1 142 TRP n 
1 143 ASP n 
1 144 GLY n 
1 145 PHE n 
1 146 VAL n 
1 147 GLU n 
1 148 PHE n 
1 149 PHE n 
1 150 HIS n 
1 151 VAL n 
1 152 GLU n 
1 153 ASP n 
1 154 LEU n 
1 155 GLU n 
1 156 GLY n 
1 157 GLY n 
2 1   ASP n 
2 2   MET n 
2 3   ARG n 
2 4   PRO n 
2 5   GLU n 
2 6   ILE n 
2 7   TRP n 
2 8   ILE n 
2 9   ALA n 
2 10  GLN n 
2 11  GLU n 
2 12  LEU n 
2 13  ARG n 
2 14  ARG n 
2 15  ILE n 
2 16  GLY n 
2 17  ASP n 
2 18  GLU n 
2 19  PHE n 
2 20  ASN n 
2 21  ALA n 
2 22  TYR n 
2 23  TYR n 
2 24  ALA n 
2 25  ARG n 
2 26  ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? Mouse ? Mcl1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' 
? ? ? ? ? ? ? Plasmid ? ? ? pGEX-6P3 ? ? 
1 2 sample ? ? ? human ? ?    ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' 
? ? ? ? ? ? ? Plasmid ? ? ? pGEX-6P3 ? ? 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MCL1_MOUSE P97287 1 EDDELYRQSLEIISRYLREQATGSKDAKPLGEAGAAGRR 151 ? 
2 UNP MCL1_HUMAN Q07820 1 
;ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE
PLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
;
209 ? 
3 UNP BIM_HUMAN  O43521 2 DMRPEIWIAQELRRIGDEFNAYYARR 141 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2NL9 A 1  ? 38  ? P97287 152 ? 189 ? 171 208 
2 2 2NL9 A 39 ? 157 ? Q07820 209 ? 327 ? 209 327 
3 3 2NL9 B 1  ? 26  ? O43521 141 ? 166 ? 51  76  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'       ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          2NL9 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.75 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.2M zinc acetate, 0.2M imidazole, 2mM TCEP, pH 5.75, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-11-08 
_diffrn_detector.details                monochrometer 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock double crystal sagittal focusing monochrometer' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9791 1.0 
2 0.9792 1.0 
3 0.9715 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9791, 0.9792, 0.9715' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     2NL9 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.50 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   ? 
_reflns.number_obs                   29809 
_reflns.percent_possible_obs         85.1 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        160.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   28.2 
_reflns_shell.Rmerge_I_obs           0.503 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      976 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2NL9 
_refine.ls_d_res_high                            1.550 
_refine.ls_d_res_low                             34.120 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    91.110 
_refine.ls_number_reflns_obs                     28898 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.174 
_refine.ls_R_factor_R_work                       0.173 
_refine.ls_R_factor_R_free                       0.203 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1469 
_refine.B_iso_mean                               24.336 
_refine.aniso_B[1][1]                            -0.530 
_refine.aniso_B[2][2]                            -0.140 
_refine.aniso_B[3][3]                            0.670 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.pdbx_overall_ESU_R                       0.078 
_refine.pdbx_overall_ESU_R_Free                  0.080 
_refine.overall_SU_ML                            0.044 
_refine.overall_SU_B                             2.279 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1349 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             201 
_refine_hist.number_atoms_total               1558 
_refine_hist.d_res_high                       1.550 
_refine_hist.d_res_low                        34.120 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             1422 0.015  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1928 1.386  1.939  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       180  4.407  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       76   30.736 22.763 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       260  12.505 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17   15.317 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               211  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         1089 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                830  0.213  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              1026 0.320  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        167  0.157  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          2    0.044  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       39   0.230  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     33   0.217  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 5    0.043  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  863  1.061  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1357 1.604  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  635  2.491  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 562  3.590  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.550 
_refine_ls_shell.d_res_low                        1.590 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               47.100 
_refine_ls_shell.number_reflns_R_work             1046 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.286 
_refine_ls_shell.R_factor_R_free                  0.271 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             52 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1098 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NL9 
_struct.title                     'Crystal structure of the Mcl-1:Bim BH3 complex' 
_struct.pdbx_descriptor           
'FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog, Bcl-2-like protein 11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NL9 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'Apoptosis, Bcl-2, Mcl-1, Bim' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 2   ? GLY A 22  ? ASP A 172 GLY A 192 1 ? 21 
HELX_P HELX_P2  2  GLY A 33  ? ARG A 52  ? GLY A 203 ARG A 222 1 ? 20 
HELX_P HELX_P3  3  HIS A 54  ? ASP A 66  ? HIS A 224 ASP A 236 1 ? 13 
HELX_P HELX_P4  4  VAL A 73  ? PHE A 84  ? VAL A 243 PHE A 254 1 ? 12 
HELX_P HELX_P5  5  SER A 85  ? GLY A 87  ? SER A 255 GLY A 257 5 ? 3  
HELX_P HELX_P6  6  ASN A 90  ? ASN A 112 ? ASN A 260 ASN A 282 1 ? 23 
HELX_P HELX_P7  7  ILE A 117 ? LYS A 132 ? ILE A 287 LYS A 302 1 ? 16 
HELX_P HELX_P8  8  LYS A 132 ? GLN A 139 ? LYS A 302 GLN A 309 1 ? 8  
HELX_P HELX_P9  9  GLY A 141 ? PHE A 149 ? GLY A 311 PHE A 319 1 ? 9  
HELX_P HELX_P10 10 ARG B 3   ? ARG B 25  ? ARG B 53  ARG B 75  1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLY 60  C   ? ? ? 1_555 A MSE 61  N   ? ? A GLY 230  A MSE 231  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2  covale ? ? A MSE 61  C   ? ? ? 1_555 A LEU 62  N   ? ? A MSE 231  A LEU 232  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3  covale ? ? A VAL 79  C   ? ? ? 1_555 A MSE 80  N   ? ? A VAL 249  A MSE 250  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale4  covale ? ? A MSE 80  C   ? ? ? 1_555 A ILE 81  N   ? ? A MSE 250  A ILE 251  1_555 ? ? ? ? ? ? ? 1.325 ? 
metalc1  metalc ? ? A HIS 82  NE2 ? ? ? 1_555 E ZN  .   ZN  ? ? A HIS 252  A ZN  1003 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc2  metalc ? ? A HIS 82  NE2 ? ? ? 1_555 F ZN  .   ZN  ? ? A HIS 252  A ZN  1004 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc3  metalc ? ? A CYS 116 SG  A ? ? 1_555 G ZN  .   ZN  ? ? A CYS 286  A ZN  1005 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc4  metalc ? ? A CYS 116 SG  A ? ? 1_555 H ZN  .   ZN  ? ? A CYS 286  A ZN  1006 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc5  metalc ? ? A CYS 116 SG  B ? ? 1_555 G ZN  .   ZN  ? ? A CYS 286  A ZN  1005 1_555 ? ? ? ? ? ? ? 2.948 ? 
metalc6  metalc ? ? A CYS 116 SG  B ? ? 1_555 H ZN  .   ZN  ? ? A CYS 286  A ZN  1006 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc7  metalc ? ? A GLU 122 OE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A GLU 292  A ZN  1001 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc8  metalc ? ? A ASP 143 OD1 ? ? ? 1_555 D ZN  .   ZN  ? ? A ASP 313  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc9  metalc ? ? A GLU 147 OE2 ? ? ? 1_555 D ZN  .   ZN  ? ? A GLU 317  A ZN  1002 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc10 metalc ? ? B GLU 11  OE1 ? ? ? 1_555 J ZN  .   ZN  ? ? B GLU 61   B ZN  1007 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc11 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1003 A HOH 2106 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc12 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 L HOH .   O   ? ? A ZN  1003 B HOH 1035 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc13 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1004 A HOH 2106 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc14 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1004 A HOH 2107 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc15 metalc ? ? G ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1005 A HOH 2104 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc16 metalc ? ? G ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1005 A HOH 2103 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc17 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 L HOH .   O   ? ? B ZN  1007 B HOH 1034 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc18 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 A ASP 71  OD2 ? ? A ZN  1001 A ASP 241  3_656 ? ? ? ? ? ? ? 2.242 ? 
metalc19 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 A GLU 122 OE1 ? ? A ZN  1001 A GLU 292  1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc20 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1001 A HOH 2099 3_656 ? ? ? ? ? ? ? 2.216 ? 
metalc21 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 A ASP 71  OD1 ? ? A ZN  1001 A ASP 241  3_656 ? ? ? ? ? ? ? 2.399 ? 
metalc22 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 A GLU 70  OE2 ? ? A ZN  1001 A GLU 240  3_656 ? ? ? ? ? ? ? 2.190 ? 
metalc23 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 A HIS 54  NE2 ? ? A ZN  1002 A HIS 224  8_555 ? ? ? ? ? ? ? 2.035 ? 
metalc24 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 B GLU 18  OE1 ? ? A ZN  1002 B GLU 68   8_555 ? ? ? ? ? ? ? 2.435 ? 
metalc25 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 B GLU 18  OE2 ? ? A ZN  1002 B GLU 68   8_555 ? ? ? ? ? ? ? 2.099 ? 
metalc26 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 A ASP 134 OD2 ? ? A ZN  1003 A ASP 304  2_655 ? ? ? ? ? ? ? 2.011 ? 
metalc27 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 F ZN  .   ZN  ? ? A ZN  1003 A ZN  1004 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc28 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 A ASP 134 OD1 ? ? A ZN  1004 A ASP 304  2_655 ? ? ? ? ? ? ? 1.978 ? 
metalc29 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 A ASP 134 OD2 ? ? A ZN  1004 A ASP 304  2_655 ? ? ? ? ? ? ? 2.770 ? 
metalc30 metalc ? ? G ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1005 A HOH 2102 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc31 metalc ? ? H ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1006 A HOH 2115 3_656 ? ? ? ? ? ? ? 2.465 ? 
metalc32 metalc ? ? H ZN  .   ZN  ? ? ? 1_555 K HOH .   O   ? ? A ZN  1006 A HOH 2115 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc33 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 A GLU 152 OE1 ? ? B ZN  1007 A GLU 322  8_455 ? ? ? ? ? ? ? 2.202 ? 
metalc34 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 A GLU 152 OE2 ? ? B ZN  1007 A GLU 322  8_455 ? ? ? ? ? ? ? 1.981 ? 
metalc35 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 B GLU 11  OE2 ? ? B ZN  1007 B GLU 61   1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc36 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 A HIS 150 NE2 ? ? B ZN  1007 A HIS 320  8_455 ? ? ? ? ? ? ? 1.986 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1002' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1003' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1004' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1005' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1006' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1007' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLU A 70  ? GLU A 240  . ? 3_656 ? 
2  AC1 4 ASP A 71  ? ASP A 241  . ? 3_656 ? 
3  AC1 4 GLU A 122 ? GLU A 292  . ? 1_555 ? 
4  AC1 4 HOH K .   ? HOH A 2099 . ? 3_656 ? 
5  AC2 4 HIS A 54  ? HIS A 224  . ? 8_555 ? 
6  AC2 4 ASP A 143 ? ASP A 313  . ? 1_555 ? 
7  AC2 4 GLU A 147 ? GLU A 317  . ? 1_555 ? 
8  AC2 4 GLU B 18  ? GLU B 68   . ? 8_555 ? 
9  AC3 5 HIS A 82  ? HIS A 252  . ? 1_555 ? 
10 AC3 5 ASP A 134 ? ASP A 304  . ? 2_655 ? 
11 AC3 5 ZN  F .   ? ZN  A 1004 . ? 1_555 ? 
12 AC3 5 HOH K .   ? HOH A 2106 . ? 1_555 ? 
13 AC3 5 HOH L .   ? HOH B 1035 . ? 1_555 ? 
14 AC4 5 HIS A 82  ? HIS A 252  . ? 1_555 ? 
15 AC4 5 ASP A 134 ? ASP A 304  . ? 2_655 ? 
16 AC4 5 ZN  E .   ? ZN  A 1003 . ? 1_555 ? 
17 AC4 5 HOH K .   ? HOH A 2106 . ? 1_555 ? 
18 AC4 5 HOH K .   ? HOH A 2107 . ? 1_555 ? 
19 AC5 4 CYS A 116 ? CYS A 286  . ? 1_555 ? 
20 AC5 4 HOH K .   ? HOH A 2102 . ? 1_555 ? 
21 AC5 4 HOH K .   ? HOH A 2103 . ? 1_555 ? 
22 AC5 4 HOH K .   ? HOH A 2104 . ? 1_555 ? 
23 AC6 4 CYS A 116 ? CYS A 286  . ? 1_555 ? 
24 AC6 4 CYS A 116 ? CYS A 286  . ? 3_656 ? 
25 AC6 4 HOH K .   ? HOH A 2115 . ? 3_656 ? 
26 AC6 4 HOH K .   ? HOH A 2115 . ? 1_555 ? 
27 AC7 4 HIS A 150 ? HIS A 320  . ? 8_455 ? 
28 AC7 4 GLU A 152 ? GLU A 322  . ? 8_455 ? 
29 AC7 4 GLU B 11  ? GLU B 61   . ? 1_555 ? 
30 AC7 4 HOH L .   ? HOH B 1034 . ? 1_555 ? 
31 AC8 2 ARG A 130 ? ARG A 300  . ? 2_655 ? 
32 AC8 2 ARG A 130 ? ARG A 300  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2NL9 
_atom_sites.fract_transf_matrix[1][1]   0.019091 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014269 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008534 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
SE 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 2   ? 41.306 12.006 47.606 1.00 28.40 ? 172  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 2   ? 40.310 11.592 46.549 1.00 26.57 ? 172  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 2   ? 39.718 12.834 45.887 1.00 25.78 ? 172  ASP A C   1 
ATOM   4    O  O   . ASP A 1 2   ? 38.624 13.312 46.245 1.00 24.65 ? 172  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 2   ? 39.207 10.734 47.145 1.00 27.05 ? 172  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 2   ? 38.324 10.074 46.090 1.00 29.36 ? 172  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 2   ? 37.651 9.101  46.501 1.00 33.09 ? 172  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 2   ? 38.282 10.522 44.897 1.00 27.85 ? 172  ASP A OD2 1 
ATOM   9    N  N   . ASP A 1 3   ? 40.472 13.334 44.917 1.00 23.88 ? 173  ASP A N   1 
ATOM   10   C  CA  . ASP A 1 3   ? 40.194 14.572 44.244 1.00 23.24 ? 173  ASP A CA  1 
ATOM   11   C  C   . ASP A 1 3   ? 38.837 14.504 43.565 1.00 22.05 ? 173  ASP A C   1 
ATOM   12   O  O   . ASP A 1 3   ? 38.057 15.440 43.661 1.00 22.58 ? 173  ASP A O   1 
ATOM   13   C  CB  . ASP A 1 3   ? 41.288 14.881 43.230 1.00 22.94 ? 173  ASP A CB  1 
ATOM   14   C  CG  . ASP A 1 3   ? 42.641 15.136 43.875 0.00 21.63 ? 173  ASP A CG  1 
ATOM   15   O  OD1 . ASP A 1 3   ? 43.651 15.059 43.151 0.00 20.25 ? 173  ASP A OD1 1 
ATOM   16   O  OD2 . ASP A 1 3   ? 42.703 15.410 45.092 0.00 19.00 ? 173  ASP A OD2 1 
ATOM   17   N  N   . LEU A 1 4   ? 38.547 13.393 42.894 1.00 22.02 ? 174  LEU A N   1 
ATOM   18   C  CA  . LEU A 1 4   ? 37.254 13.297 42.185 1.00 21.29 ? 174  LEU A CA  1 
ATOM   19   C  C   . LEU A 1 4   ? 36.107 13.360 43.178 1.00 20.36 ? 174  LEU A C   1 
ATOM   20   O  O   . LEU A 1 4   ? 35.106 14.020 42.921 1.00 19.83 ? 174  LEU A O   1 
ATOM   21   C  CB  . LEU A 1 4   ? 37.165 12.013 41.354 1.00 21.96 ? 174  LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 4   ? 35.865 11.842 40.575 1.00 21.44 ? 174  LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 4   ? 35.520 13.063 39.700 1.00 24.03 ? 174  LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 4   ? 35.913 10.529 39.775 1.00 22.50 ? 174  LEU A CD2 1 
ATOM   25   N  N   . TYR A 1 5   ? 36.200 12.612 44.273 1.00 19.51 ? 175  TYR A N   1 
ATOM   26   C  CA  A TYR A 1 5   ? 35.149 12.658 45.308 0.50 19.49 ? 175  TYR A CA  1 
ATOM   27   C  CA  B TYR A 1 5   ? 35.148 12.645 45.271 0.50 20.01 ? 175  TYR A CA  1 
ATOM   28   C  C   . TYR A 1 5   ? 34.996 14.068 45.836 1.00 19.48 ? 175  TYR A C   1 
ATOM   29   O  O   . TYR A 1 5   ? 33.894 14.589 45.926 1.00 19.68 ? 175  TYR A O   1 
ATOM   30   C  CB  A TYR A 1 5   ? 35.443 11.740 46.516 0.50 20.11 ? 175  TYR A CB  1 
ATOM   31   C  CB  B TYR A 1 5   ? 35.423 11.618 46.389 0.50 21.47 ? 175  TYR A CB  1 
ATOM   32   C  CG  A TYR A 1 5   ? 34.401 11.912 47.622 0.50 19.00 ? 175  TYR A CG  1 
ATOM   33   C  CG  B TYR A 1 5   ? 34.242 11.478 47.305 0.50 21.62 ? 175  TYR A CG  1 
ATOM   34   C  CD1 A TYR A 1 5   ? 33.173 11.265 47.544 0.50 20.56 ? 175  TYR A CD1 1 
ATOM   35   C  CD1 B TYR A 1 5   ? 33.304 10.459 47.124 0.50 25.43 ? 175  TYR A CD1 1 
ATOM   36   C  CD2 A TYR A 1 5   ? 34.631 12.733 48.727 0.50 19.38 ? 175  TYR A CD2 1 
ATOM   37   C  CD2 B TYR A 1 5   ? 34.027 12.402 48.323 0.50 23.90 ? 175  TYR A CD2 1 
ATOM   38   C  CE1 A TYR A 1 5   ? 32.203 11.411 48.505 0.50 22.02 ? 175  TYR A CE1 1 
ATOM   39   C  CE1 B TYR A 1 5   ? 32.186 10.363 47.957 0.50 25.32 ? 175  TYR A CE1 1 
ATOM   40   C  CE2 A TYR A 1 5   ? 33.642 12.892 49.725 0.50 20.50 ? 175  TYR A CE2 1 
ATOM   41   C  CE2 B TYR A 1 5   ? 32.926 12.307 49.159 0.50 25.77 ? 175  TYR A CE2 1 
ATOM   42   C  CZ  A TYR A 1 5   ? 32.434 12.211 49.599 0.50 21.14 ? 175  TYR A CZ  1 
ATOM   43   C  CZ  B TYR A 1 5   ? 32.007 11.297 48.966 0.50 25.47 ? 175  TYR A CZ  1 
ATOM   44   O  OH  A TYR A 1 5   ? 31.443 12.339 50.541 0.50 22.12 ? 175  TYR A OH  1 
ATOM   45   O  OH  B TYR A 1 5   ? 30.916 11.208 49.788 0.50 26.86 ? 175  TYR A OH  1 
ATOM   46   N  N   . ARG A 1 6   ? 36.112 14.702 46.191 1.00 19.12 ? 176  ARG A N   1 
ATOM   47   C  CA  . ARG A 1 6   ? 36.052 16.023 46.799 1.00 19.54 ? 176  ARG A CA  1 
ATOM   48   C  C   . ARG A 1 6   ? 35.450 17.033 45.813 1.00 18.29 ? 176  ARG A C   1 
ATOM   49   O  O   . ARG A 1 6   ? 34.594 17.848 46.192 1.00 18.89 ? 176  ARG A O   1 
ATOM   50   C  CB  . ARG A 1 6   ? 37.450 16.486 47.248 1.00 19.98 ? 176  ARG A CB  1 
ATOM   51   C  CG  . ARG A 1 6   ? 37.497 17.913 47.694 1.00 24.47 ? 176  ARG A CG  1 
ATOM   52   C  CD  . ARG A 1 6   ? 38.938 18.380 47.856 0.00 22.36 ? 176  ARG A CD  1 
ATOM   53   N  NE  . ARG A 1 6   ? 39.033 19.693 48.493 0.00 22.88 ? 176  ARG A NE  1 
ATOM   54   C  CZ  . ARG A 1 6   ? 39.168 19.890 49.802 0.00 22.98 ? 176  ARG A CZ  1 
ATOM   55   N  NH1 . ARG A 1 6   ? 39.220 18.861 50.639 0.00 23.00 ? 176  ARG A NH1 1 
ATOM   56   N  NH2 . ARG A 1 6   ? 39.246 21.126 50.278 0.00 23.16 ? 176  ARG A NH2 1 
ATOM   57   N  N   . GLN A 1 7   ? 35.900 17.001 44.550 1.00 18.43 ? 177  GLN A N   1 
ATOM   58   C  CA  . GLN A 1 7   ? 35.369 17.895 43.528 1.00 18.01 ? 177  GLN A CA  1 
ATOM   59   C  C   . GLN A 1 7   ? 33.873 17.677 43.336 1.00 17.39 ? 177  GLN A C   1 
ATOM   60   O  O   . GLN A 1 7   ? 33.097 18.635 43.250 1.00 18.42 ? 177  GLN A O   1 
ATOM   61   C  CB  . GLN A 1 7   ? 36.067 17.660 42.184 1.00 18.96 ? 177  GLN A CB  1 
ATOM   62   C  CG  . GLN A 1 7   ? 35.527 18.543 41.040 1.00 22.67 ? 177  GLN A CG  1 
ATOM   63   C  CD  . GLN A 1 7   ? 36.340 18.328 39.801 1.00 26.90 ? 177  GLN A CD  1 
ATOM   64   O  OE1 . GLN A 1 7   ? 36.890 19.271 39.222 1.00 31.26 ? 177  GLN A OE1 1 
ATOM   65   N  NE2 . GLN A 1 7   ? 36.479 17.080 39.426 1.00 24.58 ? 177  GLN A NE2 1 
ATOM   66   N  N   . SER A 1 8   ? 33.472 16.403 43.272 1.00 16.38 ? 178  SER A N   1 
ATOM   67   C  CA  . SER A 1 8   ? 32.074 16.097 43.058 1.00 15.69 ? 178  SER A CA  1 
ATOM   68   C  C   . SER A 1 8   ? 31.215 16.549 44.223 1.00 16.45 ? 178  SER A C   1 
ATOM   69   O  O   . SER A 1 8   ? 30.120 17.085 44.025 1.00 16.94 ? 178  SER A O   1 
ATOM   70   C  CB  . SER A 1 8   ? 31.927 14.585 42.879 1.00 17.31 ? 178  SER A CB  1 
ATOM   71   O  OG  . SER A 1 8   ? 32.682 14.191 41.733 1.00 16.20 ? 178  SER A OG  1 
ATOM   72   N  N   . LEU A 1 9   ? 31.715 16.299 45.425 1.00 16.75 ? 179  LEU A N   1 
ATOM   73   C  CA  . LEU A 1 9   ? 30.974 16.662 46.617 1.00 18.00 ? 179  LEU A CA  1 
ATOM   74   C  C   . LEU A 1 9   ? 30.829 18.188 46.673 1.00 17.45 ? 179  LEU A C   1 
ATOM   75   O  O   . LEU A 1 9   ? 29.801 18.706 47.111 1.00 17.54 ? 179  LEU A O   1 
ATOM   76   C  CB  . LEU A 1 9   ? 31.698 16.195 47.875 1.00 17.95 ? 179  LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 9   ? 30.968 16.513 49.178 1.00 18.28 ? 179  LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 9   ? 29.582 15.906 49.230 1.00 20.47 ? 179  LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 9   ? 31.847 16.040 50.368 1.00 18.63 ? 179  LEU A CD2 1 
ATOM   80   N  N   . GLU A 1 10  ? 31.879 18.907 46.264 1.00 17.31 ? 180  GLU A N   1 
ATOM   81   C  CA  . GLU A 1 10  ? 31.828 20.366 46.285 1.00 18.38 ? 180  GLU A CA  1 
ATOM   82   C  C   . GLU A 1 10  ? 30.724 20.844 45.350 1.00 17.27 ? 180  GLU A C   1 
ATOM   83   O  O   . GLU A 1 10  ? 29.887 21.663 45.698 1.00 18.05 ? 180  GLU A O   1 
ATOM   84   C  CB  . GLU A 1 10  ? 33.182 20.965 45.910 1.00 18.33 ? 180  GLU A CB  1 
ATOM   85   C  CG  . GLU A 1 10  ? 33.302 22.501 45.898 1.00 21.42 ? 180  GLU A CG  1 
ATOM   86   C  CD  . GLU A 1 10  ? 34.730 23.007 46.264 1.00 22.38 ? 180  GLU A CD  1 
ATOM   87   O  OE1 . GLU A 1 10  ? 35.546 22.224 46.797 0.00 22.21 ? 180  GLU A OE1 1 
ATOM   88   O  OE2 . GLU A 1 10  ? 35.008 24.197 46.006 0.00 22.41 ? 180  GLU A OE2 1 
ATOM   89   N  N   . ILE A 1 11  ? 30.716 20.329 44.138 1.00 17.11 ? 181  ILE A N   1 
ATOM   90   C  CA  . ILE A 1 11  ? 29.741 20.789 43.144 1.00 17.76 ? 181  ILE A CA  1 
ATOM   91   C  C   . ILE A 1 11  ? 28.314 20.461 43.608 1.00 16.13 ? 181  ILE A C   1 
ATOM   92   O  O   . ILE A 1 11  ? 27.423 21.293 43.578 1.00 17.03 ? 181  ILE A O   1 
ATOM   93   C  CB  . ILE A 1 11  ? 30.022 20.072 41.803 1.00 18.46 ? 181  ILE A CB  1 
ATOM   94   C  CG1 . ILE A 1 11  ? 31.399 20.489 41.254 1.00 19.56 ? 181  ILE A CG1 1 
ATOM   95   C  CG2 . ILE A 1 11  ? 28.880 20.269 40.821 1.00 18.99 ? 181  ILE A CG2 1 
ATOM   96   C  CD1 . ILE A 1 11  ? 31.892 19.553 40.124 1.00 20.02 ? 181  ILE A CD1 1 
ATOM   97   N  N   . ILE A 1 12  ? 28.109 19.223 44.043 1.00 15.31 ? 182  ILE A N   1 
ATOM   98   C  CA  . ILE A 1 12  ? 26.785 18.785 44.404 1.00 16.32 ? 182  ILE A CA  1 
ATOM   99   C  C   . ILE A 1 12  ? 26.313 19.470 45.672 1.00 17.09 ? 182  ILE A C   1 
ATOM   100  O  O   . ILE A 1 12  ? 25.146 19.879 45.750 1.00 17.39 ? 182  ILE A O   1 
ATOM   101  C  CB  . ILE A 1 12  ? 26.739 17.272 44.510 1.00 16.73 ? 182  ILE A CB  1 
ATOM   102  C  CG1 . ILE A 1 12  ? 26.903 16.659 43.116 1.00 15.69 ? 182  ILE A CG1 1 
ATOM   103  C  CG2 . ILE A 1 12  ? 25.446 16.796 45.184 1.00 16.50 ? 182  ILE A CG2 1 
ATOM   104  C  CD1 . ILE A 1 12  ? 27.182 15.121 43.148 1.00 15.45 ? 182  ILE A CD1 1 
ATOM   105  N  N   . SER A 1 13  ? 27.214 19.600 46.648 1.00 16.53 ? 183  SER A N   1 
ATOM   106  C  CA  . SER A 1 13  ? 26.861 20.259 47.925 1.00 16.78 ? 183  SER A CA  1 
ATOM   107  C  C   . SER A 1 13  ? 26.479 21.711 47.661 1.00 17.40 ? 183  SER A C   1 
ATOM   108  O  O   . SER A 1 13  ? 25.493 22.205 48.205 1.00 18.38 ? 183  SER A O   1 
ATOM   109  C  CB  . SER A 1 13  ? 28.006 20.231 48.956 1.00 17.21 ? 183  SER A CB  1 
ATOM   110  O  OG  . SER A 1 13  ? 28.214 18.890 49.374 1.00 21.48 ? 183  SER A OG  1 
ATOM   111  N  N   . ARG A 1 14  ? 27.268 22.395 46.841 1.00 18.55 ? 184  ARG A N   1 
ATOM   112  C  CA  . ARG A 1 14  ? 26.996 23.804 46.563 1.00 18.80 ? 184  ARG A CA  1 
ATOM   113  C  C   . ARG A 1 14  ? 25.650 23.963 45.886 1.00 18.34 ? 184  ARG A C   1 
ATOM   114  O  O   . ARG A 1 14  ? 24.848 24.797 46.305 1.00 19.52 ? 184  ARG A O   1 
ATOM   115  C  CB  . ARG A 1 14  ? 28.125 24.428 45.758 1.00 20.16 ? 184  ARG A CB  1 
ATOM   116  C  CG  . ARG A 1 14  ? 29.394 24.632 46.578 1.00 21.74 ? 184  ARG A CG  1 
ATOM   117  C  CD  . ARG A 1 14  ? 30.399 25.527 45.898 1.00 31.34 ? 184  ARG A CD  1 
ATOM   118  N  NE  . ARG A 1 14  ? 29.806 26.853 45.751 1.00 36.16 ? 184  ARG A NE  1 
ATOM   119  C  CZ  . ARG A 1 14  ? 30.255 27.816 44.950 1.00 39.02 ? 184  ARG A CZ  1 
ATOM   120  N  NH1 . ARG A 1 14  ? 31.328 27.627 44.183 1.00 40.61 ? 184  ARG A NH1 1 
ATOM   121  N  NH2 . ARG A 1 14  ? 29.602 28.966 44.899 1.00 37.59 ? 184  ARG A NH2 1 
ATOM   122  N  N   . TYR A 1 15  ? 25.375 23.134 44.875 1.00 18.30 ? 185  TYR A N   1 
ATOM   123  C  CA  . TYR A 1 15  ? 24.095 23.215 44.185 1.00 18.95 ? 185  TYR A CA  1 
ATOM   124  C  C   . TYR A 1 15  ? 22.936 22.946 45.151 1.00 18.83 ? 185  TYR A C   1 
ATOM   125  O  O   . TYR A 1 15  ? 21.953 23.692 45.174 1.00 20.10 ? 185  TYR A O   1 
ATOM   126  C  CB  . TYR A 1 15  ? 24.038 22.218 43.022 1.00 19.96 ? 185  TYR A CB  1 
ATOM   127  C  CG  . TYR A 1 15  ? 22.747 22.263 42.281 1.00 19.81 ? 185  TYR A CG  1 
ATOM   128  C  CD1 . TYR A 1 15  ? 22.330 23.446 41.673 1.00 23.47 ? 185  TYR A CD1 1 
ATOM   129  C  CD2 . TYR A 1 15  ? 21.933 21.121 42.160 1.00 20.41 ? 185  TYR A CD2 1 
ATOM   130  C  CE1 . TYR A 1 15  ? 21.154 23.487 40.961 1.00 23.91 ? 185  TYR A CE1 1 
ATOM   131  C  CE2 . TYR A 1 15  ? 20.722 21.190 41.452 1.00 21.51 ? 185  TYR A CE2 1 
ATOM   132  C  CZ  . TYR A 1 15  ? 20.376 22.372 40.856 1.00 23.58 ? 185  TYR A CZ  1 
ATOM   133  O  OH  . TYR A 1 15  ? 19.205 22.522 40.147 1.00 28.33 ? 185  TYR A OH  1 
ATOM   134  N  N   . LEU A 1 16  ? 23.036 21.872 45.938 1.00 18.50 ? 186  LEU A N   1 
ATOM   135  C  CA  . LEU A 1 16  ? 21.967 21.557 46.865 1.00 17.81 ? 186  LEU A CA  1 
ATOM   136  C  C   . LEU A 1 16  ? 21.745 22.710 47.851 1.00 18.68 ? 186  LEU A C   1 
ATOM   137  O  O   . LEU A 1 16  ? 20.607 23.082 48.100 1.00 19.63 ? 186  LEU A O   1 
ATOM   138  C  CB  . LEU A 1 16  ? 22.286 20.268 47.619 1.00 19.24 ? 186  LEU A CB  1 
ATOM   139  C  CG  . LEU A 1 16  ? 21.587 19.051 47.017 1.00 18.84 ? 186  LEU A CG  1 
ATOM   140  C  CD1 . LEU A 1 16  ? 21.975 18.843 45.559 1.00 20.36 ? 186  LEU A CD1 1 
ATOM   141  C  CD2 . LEU A 1 16  ? 21.951 17.816 47.838 1.00 21.35 ? 186  LEU A CD2 1 
ATOM   142  N  N   . ARG A 1 17  ? 22.830 23.249 48.389 1.00 17.82 ? 187  ARG A N   1 
ATOM   143  C  CA  . ARG A 1 17  ? 22.722 24.362 49.350 1.00 19.35 ? 187  ARG A CA  1 
ATOM   144  C  C   . ARG A 1 17  ? 22.087 25.596 48.718 1.00 20.17 ? 187  ARG A C   1 
ATOM   145  O  O   . ARG A 1 17  ? 21.251 26.243 49.341 1.00 20.69 ? 187  ARG A O   1 
ATOM   146  C  CB  . ARG A 1 17  ? 24.079 24.684 49.957 1.00 19.93 ? 187  ARG A CB  1 
ATOM   147  C  CG  . ARG A 1 17  ? 23.978 25.602 51.154 1.00 22.10 ? 187  ARG A CG  1 
ATOM   148  C  CD  . ARG A 1 17  ? 25.338 25.813 51.798 1.00 27.19 ? 187  ARG A CD  1 
ATOM   149  N  NE  . ARG A 1 17  ? 25.910 24.593 52.379 1.00 30.43 ? 187  ARG A NE  1 
ATOM   150  C  CZ  . ARG A 1 17  ? 26.907 23.893 51.833 1.00 35.29 ? 187  ARG A CZ  1 
ATOM   151  N  NH1 . ARG A 1 17  ? 27.449 24.269 50.673 1.00 37.96 ? 187  ARG A NH1 1 
ATOM   152  N  NH2 . ARG A 1 17  ? 27.360 22.807 52.446 1.00 37.61 ? 187  ARG A NH2 1 
ATOM   153  N  N   . GLU A 1 18  ? 22.470 25.911 47.480 1.00 20.28 ? 188  GLU A N   1 
ATOM   154  C  CA  . GLU A 1 18  ? 21.933 27.097 46.789 1.00 21.49 ? 188  GLU A CA  1 
ATOM   155  C  C   . GLU A 1 18  ? 20.448 26.895 46.601 1.00 22.32 ? 188  GLU A C   1 
ATOM   156  O  O   . GLU A 1 18  ? 19.652 27.792 46.821 1.00 21.61 ? 188  GLU A O   1 
ATOM   157  C  CB  . GLU A 1 18  ? 22.602 27.274 45.422 1.00 22.32 ? 188  GLU A CB  1 
ATOM   158  C  CG  . GLU A 1 18  ? 24.026 27.760 45.499 1.00 23.37 ? 188  GLU A CG  1 
ATOM   159  C  CD  . GLU A 1 18  ? 24.692 27.851 44.148 1.00 27.67 ? 188  GLU A CD  1 
ATOM   160  O  OE1 . GLU A 1 18  ? 24.009 27.677 43.112 1.00 27.34 ? 188  GLU A OE1 1 
ATOM   161  O  OE2 . GLU A 1 18  ? 25.920 28.091 44.125 1.00 29.58 ? 188  GLU A OE2 1 
ATOM   162  N  N   . GLN A 1 19  ? 20.074 25.689 46.201 1.00 21.14 ? 189  GLN A N   1 
ATOM   163  C  CA  . GLN A 1 19  ? 18.671 25.360 45.953 1.00 22.54 ? 189  GLN A CA  1 
ATOM   164  C  C   . GLN A 1 19  ? 17.841 25.428 47.229 1.00 23.07 ? 189  GLN A C   1 
ATOM   165  O  O   . GLN A 1 19  ? 16.734 25.994 47.235 1.00 23.98 ? 189  GLN A O   1 
ATOM   166  C  CB  . GLN A 1 19  ? 18.555 23.963 45.327 1.00 22.17 ? 189  GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 19  ? 19.020 23.935 43.880 1.00 24.64 ? 189  GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 19  ? 18.173 24.846 42.987 1.00 31.10 ? 189  GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 19  ? 18.693 25.747 42.316 1.00 31.27 ? 189  GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 19  ? 16.853 24.628 43.001 1.00 33.15 ? 189  GLN A NE2 1 
ATOM   171  N  N   . ALA A 1 20  ? 18.396 24.890 48.311 1.00 23.49 ? 190  ALA A N   1 
ATOM   172  C  CA  . ALA A 1 20  ? 17.645 24.732 49.558 1.00 24.33 ? 190  ALA A CA  1 
ATOM   173  C  C   . ALA A 1 20  ? 17.494 26.054 50.280 1.00 24.81 ? 190  ALA A C   1 
ATOM   174  O  O   . ALA A 1 20  ? 16.482 26.283 50.964 1.00 26.02 ? 190  ALA A O   1 
ATOM   175  C  CB  . ALA A 1 20  ? 18.314 23.712 50.461 1.00 24.57 ? 190  ALA A CB  1 
ATOM   176  N  N   . THR A 1 21  ? 18.505 26.914 50.145 1.00 24.87 ? 191  THR A N   1 
ATOM   177  C  CA  . THR A 1 21  ? 18.516 28.203 50.852 1.00 25.96 ? 191  THR A CA  1 
ATOM   178  C  C   . THR A 1 21  ? 18.080 29.379 49.998 1.00 27.09 ? 191  THR A C   1 
ATOM   179  O  O   . THR A 1 21  ? 17.793 30.456 50.533 1.00 27.37 ? 191  THR A O   1 
ATOM   180  C  CB  . THR A 1 21  ? 19.910 28.566 51.393 1.00 25.03 ? 191  THR A CB  1 
ATOM   181  O  OG1 . THR A 1 21  ? 20.790 28.863 50.304 1.00 25.31 ? 191  THR A OG1 1 
ATOM   182  C  CG2 . THR A 1 21  ? 20.479 27.473 52.273 1.00 26.54 ? 191  THR A CG2 1 
ATOM   183  N  N   . GLY A 1 22  ? 18.042 29.196 48.683 1.00 28.71 ? 192  GLY A N   1 
ATOM   184  C  CA  . GLY A 1 22  ? 17.908 30.324 47.761 1.00 31.13 ? 192  GLY A CA  1 
ATOM   185  C  C   . GLY A 1 22  ? 19.277 30.949 47.490 1.00 32.77 ? 192  GLY A C   1 
ATOM   186  O  O   . GLY A 1 22  ? 19.642 31.192 46.333 1.00 33.83 ? 192  GLY A O   1 
ATOM   187  N  N   . SER A 1 23  ? 20.056 31.165 48.550 1.00 33.52 ? 193  SER A N   1 
ATOM   188  C  CA  . SER A 1 23  ? 21.331 31.888 48.454 1.00 34.19 ? 193  SER A CA  1 
ATOM   189  C  C   . SER A 1 23  ? 22.389 31.173 47.617 1.00 34.28 ? 193  SER A C   1 
ATOM   190  O  O   . SER A 1 23  ? 22.796 30.055 47.938 1.00 35.39 ? 193  SER A O   1 
ATOM   191  C  CB  . SER A 1 23  ? 21.877 32.217 49.849 0.00 34.04 ? 193  SER A CB  1 
ATOM   192  O  OG  . SER A 1 23  ? 22.179 31.039 50.576 0.00 34.10 ? 193  SER A OG  1 
ATOM   193  N  N   . GLY A 1 33  ? 38.899 23.699 40.184 1.00 39.54 ? 203  GLY A N   1 
ATOM   194  C  CA  . GLY A 1 33  ? 38.897 25.158 40.261 1.00 38.73 ? 203  GLY A CA  1 
ATOM   195  C  C   . GLY A 1 33  ? 37.846 25.718 39.320 1.00 38.23 ? 203  GLY A C   1 
ATOM   196  O  O   . GLY A 1 33  ? 36.644 25.613 39.588 1.00 38.45 ? 203  GLY A O   1 
ATOM   197  N  N   . ALA A 1 34  ? 38.306 26.303 38.212 1.00 36.88 ? 204  ALA A N   1 
ATOM   198  C  CA  . ALA A 1 34  ? 37.426 26.807 37.154 1.00 35.24 ? 204  ALA A CA  1 
ATOM   199  C  C   . ALA A 1 34  ? 36.607 25.682 36.479 1.00 33.66 ? 204  ALA A C   1 
ATOM   200  O  O   . ALA A 1 34  ? 35.491 25.914 35.972 1.00 33.86 ? 204  ALA A O   1 
ATOM   201  C  CB  . ALA A 1 34  ? 38.232 27.575 36.128 1.00 35.61 ? 204  ALA A CB  1 
ATOM   202  N  N   . ALA A 1 35  ? 37.183 24.483 36.456 1.00 31.39 ? 205  ALA A N   1 
ATOM   203  C  CA  . ALA A 1 35  ? 36.498 23.291 35.970 1.00 28.92 ? 205  ALA A CA  1 
ATOM   204  C  C   . ALA A 1 35  ? 35.284 22.986 36.853 1.00 27.67 ? 205  ALA A C   1 
ATOM   205  O  O   . ALA A 1 35  ? 34.176 22.700 36.348 1.00 24.81 ? 205  ALA A O   1 
ATOM   206  C  CB  . ALA A 1 35  ? 37.442 22.134 35.963 1.00 29.96 ? 205  ALA A CB  1 
ATOM   207  N  N   . GLY A 1 36  ? 35.516 23.017 38.170 1.00 26.11 ? 206  GLY A N   1 
ATOM   208  C  CA  . GLY A 1 36  ? 34.428 22.864 39.154 1.00 25.55 ? 206  GLY A CA  1 
ATOM   209  C  C   . GLY A 1 36  ? 33.412 23.989 39.002 1.00 25.13 ? 206  GLY A C   1 
ATOM   210  O  O   . GLY A 1 36  ? 32.202 23.750 39.067 1.00 23.96 ? 206  GLY A O   1 
ATOM   211  N  N   . ARG A 1 37  ? 33.886 25.207 38.771 1.00 23.49 ? 207  ARG A N   1 
ATOM   212  C  CA  . ARG A 1 37  ? 33.002 26.344 38.557 1.00 23.73 ? 207  ARG A CA  1 
ATOM   213  C  C   . ARG A 1 37  ? 32.132 26.136 37.296 1.00 22.24 ? 207  ARG A C   1 
ATOM   214  O  O   . ARG A 1 37  ? 30.934 26.427 37.311 1.00 21.61 ? 207  ARG A O   1 
ATOM   215  C  CB  . ARG A 1 37  ? 33.810 27.649 38.476 1.00 24.29 ? 207  ARG A CB  1 
ATOM   216  C  CG  . ARG A 1 37  ? 32.967 28.912 38.334 1.00 25.83 ? 207  ARG A CG  1 
ATOM   217  C  CD  . ARG A 1 37  ? 33.790 30.199 38.480 1.00 26.34 ? 207  ARG A CD  1 
ATOM   218  N  NE  . ARG A 1 37  ? 34.849 30.293 37.473 0.00 26.06 ? 207  ARG A NE  1 
ATOM   219  C  CZ  . ARG A 1 37  ? 35.835 31.188 37.488 0.00 25.93 ? 207  ARG A CZ  1 
ATOM   220  N  NH1 . ARG A 1 37  ? 35.918 32.086 38.461 0.00 26.25 ? 207  ARG A NH1 1 
ATOM   221  N  NH2 . ARG A 1 37  ? 36.746 31.181 36.524 0.00 25.64 ? 207  ARG A NH2 1 
ATOM   222  N  N   . ARG A 1 38  ? 32.724 25.666 36.204 1.00 21.30 ? 208  ARG A N   1 
ATOM   223  C  CA  . ARG A 1 38  ? 31.932 25.464 34.976 1.00 21.08 ? 208  ARG A CA  1 
ATOM   224  C  C   . ARG A 1 38  ? 30.921 24.337 35.187 1.00 19.57 ? 208  ARG A C   1 
ATOM   225  O  O   . ARG A 1 38  ? 29.777 24.395 34.710 1.00 19.35 ? 208  ARG A O   1 
ATOM   226  C  CB  . ARG A 1 38  ? 32.829 25.176 33.770 1.00 21.90 ? 208  ARG A CB  1 
ATOM   227  C  CG  . ARG A 1 38  ? 33.694 26.396 33.360 1.00 23.41 ? 208  ARG A CG  1 
ATOM   228  C  CD  . ARG A 1 38  ? 35.060 25.992 32.846 0.00 21.61 ? 208  ARG A CD  1 
ATOM   229  N  NE  . ARG A 1 38  ? 35.912 27.155 32.610 0.00 19.53 ? 208  ARG A NE  1 
ATOM   230  C  CZ  . ARG A 1 38  ? 36.246 27.617 31.408 0.00 18.61 ? 208  ARG A CZ  1 
ATOM   231  N  NH1 . ARG A 1 38  ? 35.817 27.011 30.308 0.00 16.02 ? 208  ARG A NH1 1 
ATOM   232  N  NH2 . ARG A 1 38  ? 37.024 28.686 31.304 0.00 18.57 ? 208  ARG A NH2 1 
ATOM   233  N  N   . ALA A 1 39  ? 31.334 23.307 35.915 1.00 18.41 ? 209  ALA A N   1 
ATOM   234  C  CA  . ALA A 1 39  ? 30.401 22.222 36.249 1.00 17.65 ? 209  ALA A CA  1 
ATOM   235  C  C   . ALA A 1 39  ? 29.237 22.749 37.070 1.00 18.66 ? 209  ALA A C   1 
ATOM   236  O  O   . ALA A 1 39  ? 28.082 22.377 36.827 1.00 18.03 ? 209  ALA A O   1 
ATOM   237  C  CB  . ALA A 1 39  ? 31.122 21.059 36.980 1.00 18.40 ? 209  ALA A CB  1 
ATOM   238  N  N   . LEU A 1 40  ? 29.520 23.580 38.067 1.00 17.65 ? 210  LEU A N   1 
ATOM   239  C  CA  . LEU A 1 40  ? 28.442 24.094 38.923 1.00 17.92 ? 210  LEU A CA  1 
ATOM   240  C  C   . LEU A 1 40  ? 27.535 25.014 38.110 1.00 17.80 ? 210  LEU A C   1 
ATOM   241  O  O   . LEU A 1 40  ? 26.297 24.944 38.248 1.00 18.75 ? 210  LEU A O   1 
ATOM   242  C  CB  . LEU A 1 40  ? 28.999 24.832 40.161 1.00 18.49 ? 210  LEU A CB  1 
ATOM   243  C  CG  . LEU A 1 40  ? 27.993 25.399 41.162 1.00 19.59 ? 210  LEU A CG  1 
ATOM   244  C  CD1 . LEU A 1 40  ? 26.981 24.385 41.630 1.00 19.64 ? 210  LEU A CD1 1 
ATOM   245  C  CD2 . LEU A 1 40  ? 28.706 26.012 42.368 1.00 18.05 ? 210  LEU A CD2 1 
ATOM   246  N  N   . GLU A 1 41  ? 28.116 25.819 37.226 1.00 17.74 ? 211  GLU A N   1 
ATOM   247  C  CA  . GLU A 1 41  ? 27.297 26.703 36.393 1.00 17.80 ? 211  GLU A CA  1 
ATOM   248  C  C   . GLU A 1 41  ? 26.370 25.855 35.499 1.00 18.15 ? 211  GLU A C   1 
ATOM   249  O  O   . GLU A 1 41  ? 25.193 26.147 35.311 1.00 19.16 ? 211  GLU A O   1 
ATOM   250  C  CB  . GLU A 1 41  ? 28.180 27.587 35.557 1.00 19.38 ? 211  GLU A CB  1 
ATOM   251  C  CG  . GLU A 1 41  ? 28.859 28.616 36.431 1.00 21.99 ? 211  GLU A CG  1 
ATOM   252  C  CD  . GLU A 1 41  ? 29.950 29.367 35.720 1.00 29.11 ? 211  GLU A CD  1 
ATOM   253  O  OE1 . GLU A 1 41  ? 30.230 29.045 34.543 1.00 30.02 ? 211  GLU A OE1 1 
ATOM   254  O  OE2 . GLU A 1 41  ? 30.516 30.283 36.359 1.00 31.04 ? 211  GLU A OE2 1 
ATOM   255  N  N   . THR A 1 42  ? 26.927 24.784 34.958 1.00 16.87 ? 212  THR A N   1 
ATOM   256  C  CA  . THR A 1 42  ? 26.130 23.882 34.123 1.00 16.96 ? 212  THR A CA  1 
ATOM   257  C  C   . THR A 1 42  ? 25.026 23.240 34.960 1.00 18.04 ? 212  THR A C   1 
ATOM   258  O  O   . THR A 1 42  ? 23.869 23.129 34.514 1.00 18.30 ? 212  THR A O   1 
ATOM   259  C  CB  . THR A 1 42  ? 27.050 22.808 33.476 1.00 17.71 ? 212  THR A CB  1 
ATOM   260  O  OG1 . THR A 1 42  ? 27.994 23.484 32.654 1.00 18.07 ? 212  THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 42  ? 26.247 21.813 32.627 1.00 17.98 ? 212  THR A CG2 1 
ATOM   262  N  N   . LEU A 1 43  ? 25.381 22.855 36.181 1.00 17.50 ? 213  LEU A N   1 
ATOM   263  C  CA  . LEU A 1 43  ? 24.449 22.139 37.036 1.00 17.27 ? 213  LEU A CA  1 
ATOM   264  C  C   . LEU A 1 43  ? 23.298 23.078 37.416 1.00 18.37 ? 213  LEU A C   1 
ATOM   265  O  O   . LEU A 1 43  ? 22.137 22.652 37.424 1.00 18.33 ? 213  LEU A O   1 
ATOM   266  C  CB  . LEU A 1 43  ? 25.179 21.620 38.270 1.00 19.04 ? 213  LEU A CB  1 
ATOM   267  C  CG  . LEU A 1 43  ? 24.292 20.861 39.238 1.00 18.84 ? 213  LEU A CG  1 
ATOM   268  C  CD1 . LEU A 1 43  ? 23.557 19.699 38.533 1.00 20.43 ? 213  LEU A CD1 1 
ATOM   269  C  CD2 . LEU A 1 43  ? 25.159 20.322 40.344 1.00 19.84 ? 213  LEU A CD2 1 
ATOM   270  N  N   . ARG A 1 44  ? 23.609 24.321 37.712 1.00 18.48 ? 214  ARG A N   1 
ATOM   271  C  CA  . ARG A 1 44  ? 22.537 25.288 37.994 1.00 19.63 ? 214  ARG A CA  1 
ATOM   272  C  C   . ARG A 1 44  ? 21.578 25.332 36.827 1.00 20.23 ? 214  ARG A C   1 
ATOM   273  O  O   . ARG A 1 44  ? 20.333 25.241 37.013 1.00 21.60 ? 214  ARG A O   1 
ATOM   274  C  CB  . ARG A 1 44  ? 23.127 26.666 38.209 1.00 19.13 ? 214  ARG A CB  1 
ATOM   275  C  CG  . ARG A 1 44  ? 23.878 26.767 39.501 1.00 20.46 ? 214  ARG A CG  1 
ATOM   276  C  CD  . ARG A 1 44  ? 24.421 28.162 39.621 1.00 22.40 ? 214  ARG A CD  1 
ATOM   277  N  NE  . ARG A 1 44  ? 25.206 28.341 40.834 1.00 23.91 ? 214  ARG A NE  1 
ATOM   278  C  CZ  . ARG A 1 44  ? 26.407 28.915 40.842 1.00 27.20 ? 214  ARG A CZ  1 
ATOM   279  N  NH1 . ARG A 1 44  ? 26.935 29.344 39.697 1.00 28.32 ? 214  ARG A NH1 1 
ATOM   280  N  NH2 . ARG A 1 44  ? 27.064 29.094 41.982 1.00 25.84 ? 214  ARG A NH2 1 
ATOM   281  N  N   . ARG A 1 45  ? 22.133 25.453 35.621 1.00 19.32 ? 215  ARG A N   1 
ATOM   282  C  CA  . ARG A 1 45  ? 21.311 25.642 34.441 1.00 19.25 ? 215  ARG A CA  1 
ATOM   283  C  C   . ARG A 1 45  ? 20.463 24.400 34.183 1.00 19.09 ? 215  ARG A C   1 
ATOM   284  O  O   . ARG A 1 45  ? 19.229 24.481 34.134 1.00 19.26 ? 215  ARG A O   1 
ATOM   285  C  CB  . ARG A 1 45  ? 22.187 25.929 33.225 1.00 19.39 ? 215  ARG A CB  1 
ATOM   286  C  CG  . ARG A 1 45  ? 21.447 26.000 31.904 1.00 20.49 ? 215  ARG A CG  1 
ATOM   287  C  CD  . ARG A 1 45  ? 22.335 26.591 30.817 1.00 22.68 ? 215  ARG A CD  1 
ATOM   288  N  NE  . ARG A 1 45  ? 23.694 26.035 30.777 1.00 24.39 ? 215  ARG A NE  1 
ATOM   289  C  CZ  . ARG A 1 45  ? 24.060 24.956 30.085 1.00 22.50 ? 215  ARG A CZ  1 
ATOM   290  N  NH1 . ARG A 1 45  ? 23.189 24.289 29.351 1.00 24.69 ? 215  ARG A NH1 1 
ATOM   291  N  NH2 . ARG A 1 45  ? 25.327 24.562 30.121 1.00 23.08 ? 215  ARG A NH2 1 
ATOM   292  N  N   . VAL A 1 46  ? 21.117 23.258 34.025 1.00 18.71 ? 216  VAL A N   1 
ATOM   293  C  CA  . VAL A 1 46  ? 20.374 22.047 33.662 1.00 18.82 ? 216  VAL A CA  1 
ATOM   294  C  C   . VAL A 1 46  ? 19.706 21.359 34.840 1.00 18.75 ? 216  VAL A C   1 
ATOM   295  O  O   . VAL A 1 46  ? 18.707 20.638 34.650 1.00 20.91 ? 216  VAL A O   1 
ATOM   296  C  CB  . VAL A 1 46  ? 21.214 21.049 32.830 1.00 19.33 ? 216  VAL A CB  1 
ATOM   297  C  CG1 . VAL A 1 46  ? 21.761 21.773 31.595 1.00 20.45 ? 216  VAL A CG1 1 
ATOM   298  C  CG2 . VAL A 1 46  ? 22.367 20.479 33.638 1.00 20.87 ? 216  VAL A CG2 1 
ATOM   299  N  N   . GLY A 1 47  ? 20.236 21.530 36.051 1.00 20.08 ? 217  GLY A N   1 
ATOM   300  C  CA  . GLY A 1 47  ? 19.545 21.029 37.263 1.00 20.37 ? 217  GLY A CA  1 
ATOM   301  C  C   . GLY A 1 47  ? 18.201 21.738 37.388 1.00 20.73 ? 217  GLY A C   1 
ATOM   302  O  O   . GLY A 1 47  ? 17.158 21.112 37.664 1.00 21.29 ? 217  GLY A O   1 
ATOM   303  N  N   . ASP A 1 48  ? 18.218 23.049 37.220 1.00 19.54 ? 218  ASP A N   1 
ATOM   304  C  CA  . ASP A 1 48  ? 16.956 23.772 37.206 1.00 21.47 ? 218  ASP A CA  1 
ATOM   305  C  C   . ASP A 1 48  ? 16.091 23.330 36.010 1.00 21.27 ? 218  ASP A C   1 
ATOM   306  O  O   . ASP A 1 48  ? 14.862 23.150 36.143 1.00 23.07 ? 218  ASP A O   1 
ATOM   307  C  CB  . ASP A 1 48  ? 17.192 25.285 37.183 1.00 22.44 ? 218  ASP A CB  1 
ATOM   308  C  CG  . ASP A 1 48  ? 17.826 25.822 38.486 1.00 25.44 ? 218  ASP A CG  1 
ATOM   309  O  OD1 . ASP A 1 48  ? 18.207 25.052 39.411 1.00 27.67 ? 218  ASP A OD1 1 
ATOM   310  O  OD2 . ASP A 1 48  ? 17.987 27.050 38.531 1.00 27.83 ? 218  ASP A OD2 1 
ATOM   311  N  N   . GLY A 1 49  ? 16.724 23.211 34.839 1.00 19.38 ? 219  GLY A N   1 
ATOM   312  C  CA  . GLY A 1 49  ? 16.067 22.828 33.590 1.00 19.29 ? 219  GLY A CA  1 
ATOM   313  C  C   . GLY A 1 49  ? 15.284 21.535 33.725 1.00 19.28 ? 219  GLY A C   1 
ATOM   314  O  O   . GLY A 1 49  ? 14.119 21.454 33.349 1.00 20.28 ? 219  GLY A O   1 
ATOM   315  N  N   . VAL A 1 50  ? 15.908 20.498 34.273 1.00 17.90 ? 220  VAL A N   1 
ATOM   316  C  CA  . VAL A 1 50  ? 15.227 19.213 34.347 1.00 18.81 ? 220  VAL A CA  1 
ATOM   317  C  C   . VAL A 1 50  ? 14.019 19.229 35.284 1.00 19.30 ? 220  VAL A C   1 
ATOM   318  O  O   . VAL A 1 50  ? 13.109 18.455 35.109 1.00 20.66 ? 220  VAL A O   1 
ATOM   319  C  CB  . VAL A 1 50  ? 16.199 18.045 34.661 1.00 19.73 ? 220  VAL A CB  1 
ATOM   320  C  CG1 . VAL A 1 50  ? 16.638 18.102 36.124 1.00 22.13 ? 220  VAL A CG1 1 
ATOM   321  C  CG2 . VAL A 1 50  ? 15.509 16.744 34.333 1.00 21.28 ? 220  VAL A CG2 1 
ATOM   322  N  N   . GLN A 1 51  ? 13.979 20.160 36.233 1.00 19.44 ? 221  GLN A N   1 
ATOM   323  C  CA  . GLN A 1 51  ? 12.786 20.259 37.071 1.00 19.61 ? 221  GLN A CA  1 
ATOM   324  C  C   . GLN A 1 51  ? 11.625 20.821 36.271 1.00 19.23 ? 221  GLN A C   1 
ATOM   325  O  O   . GLN A 1 51  ? 10.455 20.500 36.558 1.00 19.74 ? 221  GLN A O   1 
ATOM   326  C  CB  . GLN A 1 51  ? 13.048 21.136 38.302 1.00 19.88 ? 221  GLN A CB  1 
ATOM   327  C  CG  . GLN A 1 51  ? 13.954 20.417 39.274 1.00 23.41 ? 221  GLN A CG  1 
ATOM   328  C  CD  . GLN A 1 51  ? 14.146 21.101 40.620 1.00 26.37 ? 221  GLN A CD  1 
ATOM   329  O  OE1 . GLN A 1 51  ? 15.172 20.891 41.304 1.00 27.58 ? 221  GLN A OE1 1 
ATOM   330  N  NE2 . GLN A 1 51  ? 13.170 21.877 41.026 1.00 24.28 ? 221  GLN A NE2 1 
ATOM   331  N  N   . ARG A 1 52  ? 11.941 21.647 35.284 1.00 19.45 ? 222  ARG A N   1 
ATOM   332  C  CA  . ARG A 1 52  ? 10.885 22.298 34.488 1.00 19.44 ? 222  ARG A CA  1 
ATOM   333  C  C   . ARG A 1 52  ? 10.084 21.275 33.685 1.00 17.64 ? 222  ARG A C   1 
ATOM   334  O  O   . ARG A 1 52  ? 10.654 20.402 32.985 1.00 18.39 ? 222  ARG A O   1 
ATOM   335  C  CB  . ARG A 1 52  ? 11.467 23.435 33.649 1.00 19.92 ? 222  ARG A CB  1 
ATOM   336  C  CG  . ARG A 1 52  ? 11.914 24.627 34.556 1.00 23.02 ? 222  ARG A CG  1 
ATOM   337  C  CD  . ARG A 1 52  ? 12.156 25.951 33.787 1.00 24.02 ? 222  ARG A CD  1 
ATOM   338  N  NE  . ARG A 1 52  ? 13.170 25.798 32.742 1.00 30.66 ? 222  ARG A NE  1 
ATOM   339  C  CZ  . ARG A 1 52  ? 14.466 26.087 32.883 1.00 29.24 ? 222  ARG A CZ  1 
ATOM   340  N  NH1 . ARG A 1 52  ? 14.943 26.560 34.037 1.00 31.82 ? 222  ARG A NH1 1 
ATOM   341  N  NH2 . ARG A 1 52  ? 15.285 25.898 31.856 1.00 32.40 ? 222  ARG A NH2 1 
ATOM   342  N  N   . ASN A 1 53  ? 8.755  21.347 33.838 1.00 17.26 ? 223  ASN A N   1 
ATOM   343  C  CA  . ASN A 1 53  ? 7.792  20.336 33.342 1.00 16.78 ? 223  ASN A CA  1 
ATOM   344  C  C   . ASN A 1 53  ? 7.625  19.132 34.230 1.00 17.34 ? 223  ASN A C   1 
ATOM   345  O  O   . ASN A 1 53  ? 6.626  18.412 34.099 1.00 18.48 ? 223  ASN A O   1 
ATOM   346  C  CB  . ASN A 1 53  ? 8.062  19.825 31.928 1.00 17.90 ? 223  ASN A CB  1 
ATOM   347  C  CG  . ASN A 1 53  ? 8.219  20.940 30.912 1.00 15.90 ? 223  ASN A CG  1 
ATOM   348  O  OD1 . ASN A 1 53  ? 7.693  22.067 31.044 1.00 16.97 ? 223  ASN A OD1 1 
ATOM   349  N  ND2 . ASN A 1 53  ? 8.985  20.602 29.856 1.00 15.66 ? 223  ASN A ND2 1 
ATOM   350  N  N   . HIS A 1 54  ? 8.591  18.927 35.123 1.00 15.77 ? 224  HIS A N   1 
ATOM   351  C  CA  . HIS A 1 54  ? 8.577  17.735 35.954 1.00 16.23 ? 224  HIS A CA  1 
ATOM   352  C  C   . HIS A 1 54  ? 8.274  18.057 37.387 1.00 17.32 ? 224  HIS A C   1 
ATOM   353  O  O   . HIS A 1 54  ? 8.493  17.220 38.262 1.00 18.38 ? 224  HIS A O   1 
ATOM   354  C  CB  . HIS A 1 54  ? 9.919  16.999 35.851 1.00 16.10 ? 224  HIS A CB  1 
ATOM   355  C  CG  . HIS A 1 54  ? 10.237 16.586 34.448 1.00 16.59 ? 224  HIS A CG  1 
ATOM   356  N  ND1 . HIS A 1 54  ? 11.325 17.082 33.770 1.00 17.31 ? 224  HIS A ND1 1 
ATOM   357  C  CD2 . HIS A 1 54  ? 9.552  15.822 33.557 1.00 15.84 ? 224  HIS A CD2 1 
ATOM   358  C  CE1 . HIS A 1 54  ? 11.327 16.594 32.540 1.00 18.88 ? 224  HIS A CE1 1 
ATOM   359  N  NE2 . HIS A 1 54  ? 10.250 15.851 32.377 1.00 16.79 ? 224  HIS A NE2 1 
ATOM   360  N  N   . GLU A 1 55  ? 7.721  19.244 37.615 1.00 18.58 ? 225  GLU A N   1 
ATOM   361  C  CA  . GLU A 1 55  ? 7.428  19.676 38.975 1.00 19.25 ? 225  GLU A CA  1 
ATOM   362  C  C   . GLU A 1 55  ? 6.463  18.738 39.673 1.00 19.11 ? 225  GLU A C   1 
ATOM   363  O  O   . GLU A 1 55  ? 6.650  18.406 40.836 1.00 18.25 ? 225  GLU A O   1 
ATOM   364  C  CB  . GLU A 1 55  ? 6.907  21.110 38.980 1.00 20.27 ? 225  GLU A CB  1 
ATOM   365  C  CG  . GLU A 1 55  ? 7.877  22.114 38.365 1.00 21.69 ? 225  GLU A CG  1 
ATOM   366  C  CD  . GLU A 1 55  ? 7.663  22.327 36.868 1.00 22.84 ? 225  GLU A CD  1 
ATOM   367  O  OE1 . GLU A 1 55  ? 6.908  21.558 36.214 1.00 24.19 ? 225  GLU A OE1 1 
ATOM   368  O  OE2 . GLU A 1 55  ? 8.266  23.283 36.328 1.00 25.04 ? 225  GLU A OE2 1 
ATOM   369  N  N   . THR A 1 56  ? 5.412  18.324 38.961 1.00 19.26 ? 226  THR A N   1 
ATOM   370  C  CA  . THR A 1 56  ? 4.404  17.446 39.550 1.00 19.88 ? 226  THR A CA  1 
ATOM   371  C  C   . THR A 1 56  ? 5.007  16.091 39.870 1.00 18.97 ? 226  THR A C   1 
ATOM   372  O  O   . THR A 1 56  ? 4.744  15.501 40.938 1.00 20.01 ? 226  THR A O   1 
ATOM   373  C  CB  . THR A 1 56  ? 3.212  17.279 38.606 1.00 20.13 ? 226  THR A CB  1 
ATOM   374  O  OG1 . THR A 1 56  ? 2.555  18.537 38.538 1.00 23.02 ? 226  THR A OG1 1 
ATOM   375  C  CG2 . THR A 1 56  ? 2.223  16.255 39.168 1.00 21.99 ? 226  THR A CG2 1 
ATOM   376  N  N   . ALA A 1 57  ? 5.819  15.596 38.935 1.00 18.08 ? 227  ALA A N   1 
ATOM   377  C  CA  . ALA A 1 57  ? 6.518  14.337 39.108 1.00 18.54 ? 227  ALA A CA  1 
ATOM   378  C  C   . ALA A 1 57  ? 7.420  14.423 40.344 1.00 18.19 ? 227  ALA A C   1 
ATOM   379  O  O   . ALA A 1 57  ? 7.434  13.496 41.186 1.00 19.20 ? 227  ALA A O   1 
ATOM   380  C  CB  . ALA A 1 57  ? 7.349  13.997 37.860 1.00 18.74 ? 227  ALA A CB  1 
ATOM   381  N  N   . PHE A 1 58  ? 8.150  15.534 40.466 1.00 17.72 ? 228  PHE A N   1 
ATOM   382  C  CA  . PHE A 1 58  ? 9.094  15.697 41.603 1.00 18.15 ? 228  PHE A CA  1 
ATOM   383  C  C   . PHE A 1 58  ? 8.343  15.726 42.909 1.00 19.04 ? 228  PHE A C   1 
ATOM   384  O  O   . PHE A 1 58  ? 8.735  15.085 43.886 1.00 19.26 ? 228  PHE A O   1 
ATOM   385  C  CB  . PHE A 1 58  ? 9.937  16.942 41.462 1.00 18.68 ? 228  PHE A CB  1 
ATOM   386  C  CG  . PHE A 1 58  ? 11.190 16.723 40.631 1.00 19.16 ? 228  PHE A CG  1 
ATOM   387  C  CD1 . PHE A 1 58  ? 11.175 15.866 39.516 1.00 21.40 ? 228  PHE A CD1 1 
ATOM   388  C  CD2 . PHE A 1 58  ? 12.387 17.327 40.975 1.00 20.19 ? 228  PHE A CD2 1 
ATOM   389  C  CE1 . PHE A 1 58  ? 12.367 15.644 38.739 1.00 22.24 ? 228  PHE A CE1 1 
ATOM   390  C  CE2 . PHE A 1 58  ? 13.566 17.094 40.210 1.00 19.37 ? 228  PHE A CE2 1 
ATOM   391  C  CZ  . PHE A 1 58  ? 13.544 16.286 39.107 1.00 22.15 ? 228  PHE A CZ  1 
ATOM   392  N  N   . GLN A 1 59  ? 7.239  16.447 42.914 1.00 18.16 ? 229  GLN A N   1 
ATOM   393  C  CA  A GLN A 1 59  ? 6.375  16.537 44.102 0.50 18.82 ? 229  GLN A CA  1 
ATOM   394  C  CA  B GLN A 1 59  ? 6.429  16.528 44.137 0.50 19.05 ? 229  GLN A CA  1 
ATOM   395  C  C   . GLN A 1 59  ? 5.907  15.154 44.525 1.00 19.39 ? 229  GLN A C   1 
ATOM   396  O  O   . GLN A 1 59  ? 5.924  14.814 45.710 1.00 19.47 ? 229  GLN A O   1 
ATOM   397  C  CB  A GLN A 1 59  ? 5.179  17.423 43.781 0.50 18.82 ? 229  GLN A CB  1 
ATOM   398  C  CB  B GLN A 1 59  ? 5.295  17.550 44.011 0.50 19.42 ? 229  GLN A CB  1 
ATOM   399  C  CG  A GLN A 1 59  ? 5.554  18.872 43.611 0.50 19.38 ? 229  GLN A CG  1 
ATOM   400  C  CG  B GLN A 1 59  ? 4.565  17.809 45.339 0.50 20.37 ? 229  GLN A CG  1 
ATOM   401  C  CD  A GLN A 1 59  ? 4.469  19.676 42.926 0.50 22.12 ? 229  GLN A CD  1 
ATOM   402  C  CD  B GLN A 1 59  ? 5.507  18.056 46.529 0.50 23.99 ? 229  GLN A CD  1 
ATOM   403  O  OE1 A GLN A 1 59  ? 3.309  19.260 42.860 0.50 23.83 ? 229  GLN A OE1 1 
ATOM   404  O  OE1 B GLN A 1 59  ? 6.429  18.880 46.460 0.50 24.26 ? 229  GLN A OE1 1 
ATOM   405  N  NE2 A GLN A 1 59  ? 4.844  20.840 42.406 0.50 25.58 ? 229  GLN A NE2 1 
ATOM   406  N  NE2 B GLN A 1 59  ? 5.271  17.335 47.626 0.50 22.65 ? 229  GLN A NE2 1 
ATOM   407  N  N   . GLY A 1 60  ? 5.468  14.364 43.538 1.00 19.49 ? 230  GLY A N   1 
ATOM   408  C  CA  . GLY A 1 60  ? 4.917  13.031 43.787 1.00 20.58 ? 230  GLY A CA  1 
ATOM   409  C  C   . GLY A 1 60  ? 5.989  12.092 44.300 1.00 21.45 ? 230  GLY A C   1 
ATOM   410  O  O   . GLY A 1 60  ? 5.746  11.296 45.207 1.00 22.96 ? 230  GLY A O   1 
HETATM 411  N  N   . MSE A 1 61  ? 7.179  12.193 43.716 1.00 22.13 ? 231  MSE A N   1 
HETATM 412  C  CA  . MSE A 1 61  ? 8.328  11.418 44.186 1.00 22.88 ? 231  MSE A CA  1 
HETATM 413  C  C   . MSE A 1 61  ? 8.717  11.764 45.626 1.00 22.49 ? 231  MSE A C   1 
HETATM 414  O  O   . MSE A 1 61  ? 8.946  10.873 46.459 1.00 21.88 ? 231  MSE A O   1 
HETATM 415  C  CB  . MSE A 1 61  ? 9.517  11.625 43.255 1.00 22.61 ? 231  MSE A CB  1 
HETATM 416  C  CG  . MSE A 1 61  ? 9.215  11.090 41.906 1.00 23.30 ? 231  MSE A CG  1 
HETATM 417  SE SE  . MSE A 1 61  ? 10.840 11.002 40.838 0.70 30.69 ? 231  MSE A SE  1 
HETATM 418  C  CE  . MSE A 1 61  ? 11.252 12.647 40.867 1.00 25.89 ? 231  MSE A CE  1 
ATOM   419  N  N   . LEU A 1 62  ? 8.778  13.060 45.909 1.00 21.78 ? 232  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 62  ? 9.082  13.525 47.269 1.00 21.81 ? 232  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 62  ? 8.093  12.950 48.284 1.00 23.11 ? 232  LEU A C   1 
ATOM   422  O  O   . LEU A 1 62  ? 8.500  12.491 49.351 1.00 22.15 ? 232  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 62  ? 9.068  15.050 47.341 1.00 22.23 ? 232  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 62  ? 9.356  15.683 48.711 1.00 22.15 ? 232  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 62  ? 10.819 15.373 49.200 1.00 22.49 ? 232  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 62  ? 9.078  17.175 48.643 1.00 22.93 ? 232  LEU A CD2 1 
ATOM   427  N  N   . ARG A 1 63  ? 6.804  12.985 47.952 1.00 23.88 ? 233  ARG A N   1 
ATOM   428  C  CA  . ARG A 1 63  ? 5.771  12.437 48.835 1.00 25.85 ? 233  ARG A CA  1 
ATOM   429  C  C   . ARG A 1 63  ? 6.001  10.943 49.093 1.00 25.80 ? 233  ARG A C   1 
ATOM   430  O  O   . ARG A 1 63  ? 5.910  10.501 50.233 1.00 26.41 ? 233  ARG A O   1 
ATOM   431  C  CB  . ARG A 1 63  ? 4.372  12.673 48.259 1.00 26.22 ? 233  ARG A CB  1 
ATOM   432  C  CG  . ARG A 1 63  ? 3.931  14.130 48.257 1.00 29.93 ? 233  ARG A CG  1 
ATOM   433  C  CD  . ARG A 1 63  ? 2.407  14.247 48.091 1.00 35.95 ? 233  ARG A CD  1 
ATOM   434  N  NE  . ARG A 1 63  ? 1.918  13.472 46.943 1.00 39.44 ? 233  ARG A NE  1 
ATOM   435  C  CZ  . ARG A 1 63  ? 1.865  13.923 45.688 1.00 39.62 ? 233  ARG A CZ  1 
ATOM   436  N  NH1 . ARG A 1 63  ? 2.259  15.157 45.395 1.00 40.42 ? 233  ARG A NH1 1 
ATOM   437  N  NH2 . ARG A 1 63  ? 1.407  13.137 44.721 1.00 39.97 ? 233  ARG A NH2 1 
ATOM   438  N  N   . LYS A 1 64  ? 6.291  10.170 48.044 1.00 26.39 ? 234  LYS A N   1 
ATOM   439  C  CA  . LYS A 1 64  ? 6.557  8.730  48.208 1.00 27.25 ? 234  LYS A CA  1 
ATOM   440  C  C   . LYS A 1 64  ? 7.853  8.472  48.965 1.00 26.96 ? 234  LYS A C   1 
ATOM   441  O  O   . LYS A 1 64  ? 7.979  7.446  49.664 1.00 26.35 ? 234  LYS A O   1 
ATOM   442  C  CB  . LYS A 1 64  ? 6.615  7.994  46.869 1.00 28.14 ? 234  LYS A CB  1 
ATOM   443  C  CG  . LYS A 1 64  ? 5.347  8.031  46.036 1.00 30.78 ? 234  LYS A CG  1 
ATOM   444  C  CD  . LYS A 1 64  ? 4.354  6.964  46.464 1.00 35.92 ? 234  LYS A CD  1 
ATOM   445  C  CE  . LYS A 1 64  ? 3.188  6.857  45.465 1.00 38.61 ? 234  LYS A CE  1 
ATOM   446  N  NZ  . LYS A 1 64  ? 3.684  6.518  44.096 1.00 42.68 ? 234  LYS A NZ  1 
ATOM   447  N  N   . LEU A 1 65  ? 8.809  9.388  48.824 1.00 26.49 ? 235  LEU A N   1 
ATOM   448  C  CA  . LEU A 1 65  ? 10.111 9.225  49.457 1.00 27.18 ? 235  LEU A CA  1 
ATOM   449  C  C   . LEU A 1 65  ? 9.979  9.353  50.969 1.00 27.87 ? 235  LEU A C   1 
ATOM   450  O  O   . LEU A 1 65  ? 10.621 8.608  51.701 1.00 28.14 ? 235  LEU A O   1 
ATOM   451  C  CB  . LEU A 1 65  ? 11.124 10.233 48.916 1.00 27.31 ? 235  LEU A CB  1 
ATOM   452  C  CG  . LEU A 1 65  ? 12.546 10.137 49.474 1.00 26.20 ? 235  LEU A CG  1 
ATOM   453  C  CD1 . LEU A 1 65  ? 13.251 8.886  48.977 1.00 27.98 ? 235  LEU A CD1 1 
ATOM   454  C  CD2 . LEU A 1 65  ? 13.343 11.406 49.152 1.00 26.77 ? 235  LEU A CD2 1 
ATOM   455  N  N   . ASP A 1 66  ? 9.161  10.317 51.399 1.00 27.86 ? 236  ASP A N   1 
ATOM   456  C  CA  . ASP A 1 66  ? 8.766  10.489 52.794 1.00 29.59 ? 236  ASP A CA  1 
ATOM   457  C  C   . ASP A 1 66  ? 10.010 10.654 53.673 1.00 29.30 ? 236  ASP A C   1 
ATOM   458  O  O   . ASP A 1 66  ? 10.161 9.979  54.691 1.00 30.19 ? 236  ASP A O   1 
ATOM   459  C  CB  . ASP A 1 66  ? 7.901  9.295  53.220 1.00 29.63 ? 236  ASP A CB  1 
ATOM   460  C  CG  . ASP A 1 66  ? 7.244  9.491  54.569 1.00 32.21 ? 236  ASP A CG  1 
ATOM   461  O  OD1 . ASP A 1 66  ? 7.058  10.655 54.988 1.00 34.61 ? 236  ASP A OD1 1 
ATOM   462  O  OD2 . ASP A 1 66  ? 6.909  8.470  55.204 1.00 35.60 ? 236  ASP A OD2 1 
ATOM   463  N  N   . ILE A 1 67  ? 10.915 11.541 53.255 1.00 29.17 ? 237  ILE A N   1 
ATOM   464  C  CA  . ILE A 1 67  ? 12.175 11.717 53.979 1.00 29.04 ? 237  ILE A CA  1 
ATOM   465  C  C   . ILE A 1 67  ? 11.879 12.316 55.365 1.00 28.41 ? 237  ILE A C   1 
ATOM   466  O  O   . ILE A 1 67  ? 11.078 13.258 55.491 1.00 28.59 ? 237  ILE A O   1 
ATOM   467  C  CB  . ILE A 1 67  ? 13.258 12.506 53.162 1.00 28.89 ? 237  ILE A CB  1 
ATOM   468  C  CG1 . ILE A 1 67  ? 14.596 12.513 53.919 1.00 29.01 ? 237  ILE A CG1 1 
ATOM   469  C  CG2 . ILE A 1 67  ? 12.782 13.907 52.793 1.00 29.69 ? 237  ILE A CG2 1 
ATOM   470  C  CD1 . ILE A 1 67  ? 15.797 12.995 53.102 1.00 29.16 ? 237  ILE A CD1 1 
ATOM   471  N  N   . LYS A 1 68  ? 12.490 11.731 56.394 1.00 27.93 ? 238  LYS A N   1 
ATOM   472  C  CA  . LYS A 1 68  ? 12.136 12.066 57.785 1.00 27.77 ? 238  LYS A CA  1 
ATOM   473  C  C   . LYS A 1 68  ? 12.905 13.259 58.321 1.00 27.23 ? 238  LYS A C   1 
ATOM   474  O  O   . LYS A 1 68  ? 12.373 14.041 59.113 1.00 26.89 ? 238  LYS A O   1 
ATOM   475  C  CB  . LYS A 1 68  ? 12.339 10.857 58.709 1.00 28.49 ? 238  LYS A CB  1 
ATOM   476  C  CG  . LYS A 1 68  ? 11.465 9.638  58.372 1.00 30.21 ? 238  LYS A CG  1 
ATOM   477  C  CD  . LYS A 1 68  ? 9.988  10.032 58.199 1.00 33.22 ? 238  LYS A CD  1 
ATOM   478  C  CE  . LYS A 1 68  ? 9.108  8.842  57.801 1.00 33.50 ? 238  LYS A CE  1 
ATOM   479  N  NZ  . LYS A 1 68  ? 9.518  8.190  56.516 1.00 37.04 ? 238  LYS A NZ  1 
ATOM   480  N  N   . ASN A 1 69  ? 14.156 13.387 57.878 1.00 26.20 ? 239  ASN A N   1 
ATOM   481  C  CA  . ASN A 1 69  ? 15.085 14.396 58.382 1.00 25.59 ? 239  ASN A CA  1 
ATOM   482  C  C   . ASN A 1 69  ? 16.348 14.429 57.530 1.00 24.44 ? 239  ASN A C   1 
ATOM   483  O  O   . ASN A 1 69  ? 16.524 13.607 56.623 1.00 24.06 ? 239  ASN A O   1 
ATOM   484  C  CB  . ASN A 1 69  ? 15.465 14.108 59.839 1.00 25.49 ? 239  ASN A CB  1 
ATOM   485  C  CG  . ASN A 1 69  ? 16.083 12.722 60.023 1.00 26.54 ? 239  ASN A CG  1 
ATOM   486  O  OD1 . ASN A 1 69  ? 17.144 12.411 59.471 1.00 24.60 ? 239  ASN A OD1 1 
ATOM   487  N  ND2 . ASN A 1 69  ? 15.421 11.889 60.815 1.00 27.79 ? 239  ASN A ND2 1 
ATOM   488  N  N   . GLU A 1 70  ? 17.249 15.350 57.864 1.00 23.68 ? 240  GLU A N   1 
ATOM   489  C  CA  . GLU A 1 70  ? 18.451 15.614 57.067 1.00 24.17 ? 240  GLU A CA  1 
ATOM   490  C  C   . GLU A 1 70  ? 19.318 14.378 56.878 1.00 22.79 ? 240  GLU A C   1 
ATOM   491  O  O   . GLU A 1 70  ? 20.075 14.305 55.937 1.00 22.64 ? 240  GLU A O   1 
ATOM   492  C  CB  . GLU A 1 70  ? 19.302 16.698 57.729 1.00 23.91 ? 240  GLU A CB  1 
ATOM   493  C  CG  . GLU A 1 70  ? 20.163 16.173 58.874 1.00 26.01 ? 240  GLU A CG  1 
ATOM   494  C  CD  . GLU A 1 70  ? 20.764 17.266 59.728 1.00 27.02 ? 240  GLU A CD  1 
ATOM   495  O  OE1 . GLU A 1 70  ? 20.322 18.426 59.623 1.00 30.67 ? 240  GLU A OE1 1 
ATOM   496  O  OE2 . GLU A 1 70  ? 21.677 16.960 60.523 1.00 32.18 ? 240  GLU A OE2 1 
ATOM   497  N  N   . ASP A 1 71  ? 19.212 13.416 57.787 1.00 21.74 ? 241  ASP A N   1 
ATOM   498  C  CA  . ASP A 1 71  ? 20.121 12.282 57.788 1.00 22.27 ? 241  ASP A CA  1 
ATOM   499  C  C   . ASP A 1 71  ? 19.505 11.056 57.138 1.00 22.10 ? 241  ASP A C   1 
ATOM   500  O  O   . ASP A 1 71  ? 20.175 10.049 56.962 1.00 21.96 ? 241  ASP A O   1 
ATOM   501  C  CB  . ASP A 1 71  ? 20.494 11.914 59.233 1.00 21.22 ? 241  ASP A CB  1 
ATOM   502  C  CG  . ASP A 1 71  ? 21.277 12.996 59.915 1.00 22.70 ? 241  ASP A CG  1 
ATOM   503  O  OD1 . ASP A 1 71  ? 20.901 13.422 61.019 1.00 27.02 ? 241  ASP A OD1 1 
ATOM   504  O  OD2 . ASP A 1 71  ? 22.282 13.427 59.344 1.00 25.04 ? 241  ASP A OD2 1 
ATOM   505  N  N   . ASP A 1 72  ? 18.221 11.141 56.831 1.00 22.80 ? 242  ASP A N   1 
ATOM   506  C  CA  . ASP A 1 72  ? 17.447 9.996  56.388 1.00 24.12 ? 242  ASP A CA  1 
ATOM   507  C  C   . ASP A 1 72  ? 17.651 9.772  54.898 1.00 24.43 ? 242  ASP A C   1 
ATOM   508  O  O   . ASP A 1 72  ? 16.744 9.996  54.101 1.00 25.11 ? 242  ASP A O   1 
ATOM   509  C  CB  . ASP A 1 72  ? 15.965 10.239 56.679 1.00 24.99 ? 242  ASP A CB  1 
ATOM   510  C  CG  . ASP A 1 72  ? 15.094 9.051  56.330 1.00 27.06 ? 242  ASP A CG  1 
ATOM   511  O  OD1 . ASP A 1 72  ? 15.607 7.910  56.373 1.00 29.29 ? 242  ASP A OD1 1 
ATOM   512  O  OD2 . ASP A 1 72  ? 13.903 9.274  56.012 1.00 29.76 ? 242  ASP A OD2 1 
ATOM   513  N  N   . VAL A 1 73  ? 18.847 9.323  54.535 1.00 23.54 ? 243  VAL A N   1 
ATOM   514  C  CA  . VAL A 1 73  ? 19.230 9.270  53.119 1.00 23.70 ? 243  VAL A CA  1 
ATOM   515  C  C   . VAL A 1 73  ? 19.209 7.862  52.549 1.00 22.88 ? 243  VAL A C   1 
ATOM   516  O  O   . VAL A 1 73  ? 19.474 7.673  51.346 1.00 22.73 ? 243  VAL A O   1 
ATOM   517  C  CB  . VAL A 1 73  ? 20.649 9.855  52.942 1.00 22.54 ? 243  VAL A CB  1 
ATOM   518  C  CG1 . VAL A 1 73  ? 20.630 11.334 53.239 1.00 25.29 ? 243  VAL A CG1 1 
ATOM   519  C  CG2 . VAL A 1 73  ? 21.673 9.110  53.816 1.00 26.11 ? 243  VAL A CG2 1 
ATOM   520  N  N   . LYS A 1 74  ? 18.915 6.866  53.375 1.00 23.06 ? 244  LYS A N   1 
ATOM   521  C  CA  . LYS A 1 74  ? 19.086 5.489  52.909 1.00 23.99 ? 244  LYS A CA  1 
ATOM   522  C  C   . LYS A 1 74  ? 18.114 5.150  51.780 1.00 24.03 ? 244  LYS A C   1 
ATOM   523  O  O   . LYS A 1 74  ? 18.498 4.503  50.804 1.00 23.73 ? 244  LYS A O   1 
ATOM   524  C  CB  . LYS A 1 74  ? 18.984 4.491  54.053 1.00 24.93 ? 244  LYS A CB  1 
ATOM   525  C  CG  . LYS A 1 74  ? 20.357 4.134  54.614 1.00 28.22 ? 244  LYS A CG  1 
ATOM   526  C  CD  . LYS A 1 74  ? 20.255 3.045  55.686 1.00 33.83 ? 244  LYS A CD  1 
ATOM   527  C  CE  . LYS A 1 74  ? 20.491 3.620  57.087 1.00 35.51 ? 244  LYS A CE  1 
ATOM   528  N  NZ  . LYS A 1 74  ? 20.823 2.558  58.088 1.00 38.63 ? 244  LYS A NZ  1 
ATOM   529  N  N   . SER A 1 75  ? 16.862 5.570  51.925 1.00 23.11 ? 245  SER A N   1 
ATOM   530  C  CA  . SER A 1 75  ? 15.881 5.309  50.874 1.00 23.27 ? 245  SER A CA  1 
ATOM   531  C  C   . SER A 1 75  ? 16.306 5.932  49.538 1.00 22.39 ? 245  SER A C   1 
ATOM   532  O  O   . SER A 1 75  ? 16.205 5.306  48.470 1.00 21.33 ? 245  SER A O   1 
ATOM   533  C  CB  . SER A 1 75  ? 14.509 5.826  51.281 1.00 23.90 ? 245  SER A CB  1 
ATOM   534  O  OG  . SER A 1 75  ? 13.550 5.442  50.308 1.00 29.29 ? 245  SER A OG  1 
ATOM   535  N  N   . LEU A 1 76  ? 16.755 7.183  49.570 1.00 21.25 ? 246  LEU A N   1 
ATOM   536  C  CA  . LEU A 1 76  ? 17.153 7.836  48.351 1.00 21.01 ? 246  LEU A CA  1 
ATOM   537  C  C   . LEU A 1 76  ? 18.336 7.104  47.706 1.00 19.93 ? 246  LEU A C   1 
ATOM   538  O  O   . LEU A 1 76  ? 18.389 6.941  46.486 1.00 19.52 ? 246  LEU A O   1 
ATOM   539  C  CB  . LEU A 1 76  ? 17.489 9.318  48.589 1.00 21.16 ? 246  LEU A CB  1 
ATOM   540  C  CG  . LEU A 1 76  ? 17.743 10.056 47.267 1.00 22.32 ? 246  LEU A CG  1 
ATOM   541  C  CD1 . LEU A 1 76  ? 16.494 10.054 46.364 1.00 25.69 ? 246  LEU A CD1 1 
ATOM   542  C  CD2 . LEU A 1 76  ? 18.247 11.480 47.473 1.00 24.30 ? 246  LEU A CD2 1 
ATOM   543  N  N   . SER A 1 77  ? 19.282 6.658  48.528 1.00 19.04 ? 247  SER A N   1 
ATOM   544  C  CA  A SER A 1 77  ? 20.400 5.914  47.985 0.50 19.08 ? 247  SER A CA  1 
ATOM   545  C  CA  B SER A 1 77  ? 20.403 5.910  47.985 0.50 19.21 ? 247  SER A CA  1 
ATOM   546  C  C   . SER A 1 77  ? 19.916 4.637  47.288 1.00 18.78 ? 247  SER A C   1 
ATOM   547  O  O   . SER A 1 77  ? 20.377 4.303  46.165 1.00 18.82 ? 247  SER A O   1 
ATOM   548  C  CB  A SER A 1 77  ? 21.391 5.571  49.079 0.50 18.90 ? 247  SER A CB  1 
ATOM   549  C  CB  B SER A 1 77  ? 21.402 5.585  49.082 0.50 19.06 ? 247  SER A CB  1 
ATOM   550  O  OG  A SER A 1 77  ? 22.555 5.025  48.498 0.50 19.56 ? 247  SER A OG  1 
ATOM   551  O  OG  B SER A 1 77  ? 22.077 6.762  49.480 0.50 20.50 ? 247  SER A OG  1 
ATOM   552  N  N   . ARG A 1 78  ? 18.989 3.934  47.923 1.00 17.82 ? 248  ARG A N   1 
ATOM   553  C  CA  . ARG A 1 78  ? 18.436 2.714  47.289 1.00 17.89 ? 248  ARG A CA  1 
ATOM   554  C  C   . ARG A 1 78  ? 17.783 3.052  45.969 1.00 17.88 ? 248  ARG A C   1 
ATOM   555  O  O   . ARG A 1 78  ? 17.968 2.341  44.988 1.00 18.25 ? 248  ARG A O   1 
ATOM   556  C  CB  . ARG A 1 78  ? 17.429 1.990  48.178 1.00 18.18 ? 248  ARG A CB  1 
ATOM   557  C  CG  . ARG A 1 78  ? 18.061 1.396  49.422 1.00 20.54 ? 248  ARG A CG  1 
ATOM   558  C  CD  . ARG A 1 78  ? 17.077 0.461  50.134 1.00 24.12 ? 248  ARG A CD  1 
ATOM   559  N  NE  . ARG A 1 78  ? 16.028 1.239  50.794 1.00 28.67 ? 248  ARG A NE  1 
ATOM   560  C  CZ  . ARG A 1 78  ? 16.080 1.643  52.065 1.00 30.28 ? 248  ARG A CZ  1 
ATOM   561  N  NH1 . ARG A 1 78  ? 17.122 1.336  52.819 1.00 30.21 ? 248  ARG A NH1 1 
ATOM   562  N  NH2 . ARG A 1 78  ? 15.079 2.348  52.583 1.00 31.36 ? 248  ARG A NH2 1 
ATOM   563  N  N   . VAL A 1 79  ? 17.003 4.135  45.957 1.00 16.48 ? 249  VAL A N   1 
ATOM   564  C  CA  . VAL A 1 79  ? 16.406 4.592  44.728 1.00 16.72 ? 249  VAL A CA  1 
ATOM   565  C  C   . VAL A 1 79  ? 17.446 4.829  43.651 1.00 17.57 ? 249  VAL A C   1 
ATOM   566  O  O   . VAL A 1 79  ? 17.279 4.386  42.537 1.00 18.56 ? 249  VAL A O   1 
ATOM   567  C  CB  . VAL A 1 79  ? 15.570 5.862  44.988 1.00 16.85 ? 249  VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 79  ? 15.179 6.530  43.684 1.00 17.41 ? 249  VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 79  ? 14.346 5.496  45.845 1.00 17.44 ? 249  VAL A CG2 1 
HETATM 570  N  N   . MSE A 1 80  ? 18.508 5.553  43.969 1.00 16.57 ? 250  MSE A N   1 
HETATM 571  C  CA  A MSE A 1 80  ? 19.510 5.893  42.963 0.60 17.57 ? 250  MSE A CA  1 
HETATM 572  C  CA  B MSE A 1 80  ? 19.538 5.877  42.975 0.40 18.07 ? 250  MSE A CA  1 
HETATM 573  C  C   . MSE A 1 80  ? 20.174 4.625  42.439 1.00 17.26 ? 250  MSE A C   1 
HETATM 574  O  O   . MSE A 1 80  ? 20.329 4.450  41.245 1.00 17.29 ? 250  MSE A O   1 
HETATM 575  C  CB  A MSE A 1 80  ? 20.511 6.874  43.551 0.60 18.47 ? 250  MSE A CB  1 
HETATM 576  C  CB  B MSE A 1 80  ? 20.621 6.727  43.593 0.40 18.39 ? 250  MSE A CB  1 
HETATM 577  C  CG  A MSE A 1 80  ? 19.782 8.135  44.018 0.60 17.51 ? 250  MSE A CG  1 
HETATM 578  C  CG  B MSE A 1 80  ? 20.185 8.140  43.750 0.40 19.16 ? 250  MSE A CG  1 
HETATM 579  SE SE  A MSE A 1 80  ? 20.926 9.634  44.459 0.42 21.20 ? 250  MSE A SE  1 
HETATM 580  SE SE  B MSE A 1 80  ? 21.621 9.129  44.512 0.28 22.60 ? 250  MSE A SE  1 
HETATM 581  C  CE  A MSE A 1 80  ? 21.530 9.026  46.179 0.60 21.10 ? 250  MSE A CE  1 
HETATM 582  C  CE  B MSE A 1 80  ? 22.769 9.380  42.988 0.40 24.19 ? 250  MSE A CE  1 
ATOM   583  N  N   . ILE A 1 81  ? 20.531 3.716  43.335 1.00 16.54 ? 251  ILE A N   1 
ATOM   584  C  CA  . ILE A 1 81  ? 21.113 2.462  42.860 1.00 16.53 ? 251  ILE A CA  1 
ATOM   585  C  C   . ILE A 1 81  ? 20.132 1.718  41.962 1.00 17.06 ? 251  ILE A C   1 
ATOM   586  O  O   . ILE A 1 81  ? 20.480 1.172  40.902 1.00 17.98 ? 251  ILE A O   1 
ATOM   587  C  CB  . ILE A 1 81  ? 21.514 1.599  44.054 1.00 17.90 ? 251  ILE A CB  1 
ATOM   588  C  CG1 . ILE A 1 81  ? 22.641 2.279  44.856 1.00 19.75 ? 251  ILE A CG1 1 
ATOM   589  C  CG2 . ILE A 1 81  ? 21.869 0.200  43.601 1.00 17.60 ? 251  ILE A CG2 1 
ATOM   590  C  CD1 . ILE A 1 81  ? 23.906 2.561  44.108 1.00 24.69 ? 251  ILE A CD1 1 
ATOM   591  N  N   . HIS A 1 82  ? 18.857 1.764  42.334 1.00 16.10 ? 252  HIS A N   1 
ATOM   592  C  CA  . HIS A 1 82  ? 17.895 1.064  41.493 1.00 17.11 ? 252  HIS A CA  1 
ATOM   593  C  C   . HIS A 1 82  ? 17.779 1.700  40.099 1.00 16.04 ? 252  HIS A C   1 
ATOM   594  O  O   . HIS A 1 82  ? 17.648 1.040  39.079 1.00 16.25 ? 252  HIS A O   1 
ATOM   595  C  CB  . HIS A 1 82  ? 16.522 1.033  42.140 1.00 18.54 ? 252  HIS A CB  1 
ATOM   596  C  CG  . HIS A 1 82  ? 15.600 0.148  41.375 1.00 18.75 ? 252  HIS A CG  1 
ATOM   597  N  ND1 . HIS A 1 82  ? 15.618 -1.217 41.516 1.00 28.19 ? 252  HIS A ND1 1 
ATOM   598  C  CD2 . HIS A 1 82  ? 14.749 0.418  40.357 1.00 23.86 ? 252  HIS A CD2 1 
ATOM   599  C  CE1 . HIS A 1 82  ? 14.749 -1.743 40.670 1.00 24.70 ? 252  HIS A CE1 1 
ATOM   600  N  NE2 . HIS A 1 82  ? 14.245 -0.780 39.927 1.00 25.00 ? 252  HIS A NE2 1 
ATOM   601  N  N   . VAL A 1 83  ? 17.800 3.038  40.066 1.00 15.83 ? 253  VAL A N   1 
ATOM   602  C  CA  . VAL A 1 83  ? 17.750 3.736  38.774 1.00 16.69 ? 253  VAL A CA  1 
ATOM   603  C  C   . VAL A 1 83  ? 18.833 3.179  37.849 1.00 16.32 ? 253  VAL A C   1 
ATOM   604  O  O   . VAL A 1 83  ? 18.557 2.916  36.702 1.00 17.50 ? 253  VAL A O   1 
ATOM   605  C  CB  . VAL A 1 83  ? 17.989 5.226  38.956 1.00 16.15 ? 253  VAL A CB  1 
ATOM   606  C  CG1 . VAL A 1 83  ? 18.273 5.923  37.612 1.00 18.57 ? 253  VAL A CG1 1 
ATOM   607  C  CG2 . VAL A 1 83  ? 16.721 5.848  39.602 1.00 17.07 ? 253  VAL A CG2 1 
ATOM   608  N  N   . PHE A 1 84  ? 20.048 2.997  38.365 1.00 15.70 ? 254  PHE A N   1 
ATOM   609  C  CA  . PHE A 1 84  ? 21.138 2.535  37.544 1.00 16.33 ? 254  PHE A CA  1 
ATOM   610  C  C   . PHE A 1 84  ? 21.158 1.027  37.292 1.00 15.45 ? 254  PHE A C   1 
ATOM   611  O  O   . PHE A 1 84  ? 22.054 0.502  36.610 1.00 16.30 ? 254  PHE A O   1 
ATOM   612  C  CB  . PHE A 1 84  ? 22.440 2.971  38.216 1.00 16.79 ? 254  PHE A CB  1 
ATOM   613  C  CG  . PHE A 1 84  ? 22.668 4.448  38.105 1.00 17.16 ? 254  PHE A CG  1 
ATOM   614  C  CD1 . PHE A 1 84  ? 22.696 5.054  36.856 1.00 17.35 ? 254  PHE A CD1 1 
ATOM   615  C  CD2 . PHE A 1 84  ? 22.829 5.184  39.230 1.00 18.26 ? 254  PHE A CD2 1 
ATOM   616  C  CE1 . PHE A 1 84  ? 22.931 6.444  36.726 1.00 19.52 ? 254  PHE A CE1 1 
ATOM   617  C  CE2 . PHE A 1 84  ? 23.021 6.573  39.154 1.00 21.08 ? 254  PHE A CE2 1 
ATOM   618  C  CZ  . PHE A 1 84  ? 23.075 7.197  37.879 1.00 21.35 ? 254  PHE A CZ  1 
ATOM   619  N  N   . SER A 1 85  ? 20.204 0.318  37.885 1.00 15.37 ? 255  SER A N   1 
ATOM   620  C  CA  . SER A 1 85  ? 20.314 -1.139 37.947 1.00 15.51 ? 255  SER A CA  1 
ATOM   621  C  C   . SER A 1 85  ? 19.992 -1.824 36.619 1.00 14.44 ? 255  SER A C   1 
ATOM   622  O  O   . SER A 1 85  ? 20.151 -3.038 36.544 1.00 15.08 ? 255  SER A O   1 
ATOM   623  C  CB  . SER A 1 85  ? 19.407 -1.721 39.057 1.00 16.20 ? 255  SER A CB  1 
ATOM   624  O  OG  . SER A 1 85  ? 18.031 -1.707 38.681 1.00 16.63 ? 255  SER A OG  1 
ATOM   625  N  N   . ASP A 1 86  ? 19.514 -1.039 35.627 1.00 15.55 ? 256  ASP A N   1 
ATOM   626  C  CA  . ASP A 1 86  ? 19.394 -1.561 34.278 1.00 14.90 ? 256  ASP A CA  1 
ATOM   627  C  C   . ASP A 1 86  ? 20.712 -1.570 33.509 1.00 15.64 ? 256  ASP A C   1 
ATOM   628  O  O   . ASP A 1 86  ? 20.745 -2.046 32.375 1.00 17.46 ? 256  ASP A O   1 
ATOM   629  C  CB  . ASP A 1 86  ? 18.335 -0.838 33.461 1.00 15.53 ? 256  ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 86  ? 18.642 0.618  33.264 1.00 18.00 ? 256  ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 86  ? 19.632 1.113  33.852 1.00 18.62 ? 256  ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 86  ? 17.838 1.269  32.515 1.00 19.53 ? 256  ASP A OD2 1 
ATOM   633  N  N   . GLY A 1 87  ? 21.773 -1.086 34.156 1.00 16.82 ? 257  GLY A N   1 
ATOM   634  C  CA  . GLY A 1 87  ? 23.098 -1.060 33.544 1.00 17.54 ? 257  GLY A CA  1 
ATOM   635  C  C   . GLY A 1 87  ? 23.329 0.145  32.649 1.00 18.35 ? 257  GLY A C   1 
ATOM   636  O  O   . GLY A 1 87  ? 24.387 0.224  32.042 1.00 21.11 ? 257  GLY A O   1 
ATOM   637  N  N   . VAL A 1 88  ? 22.397 1.090  32.595 1.00 17.45 ? 258  VAL A N   1 
ATOM   638  C  CA  . VAL A 1 88  ? 22.612 2.268  31.743 1.00 17.61 ? 258  VAL A CA  1 
ATOM   639  C  C   . VAL A 1 88  ? 23.058 3.429  32.607 1.00 16.48 ? 258  VAL A C   1 
ATOM   640  O  O   . VAL A 1 88  ? 22.563 3.641  33.701 1.00 16.19 ? 258  VAL A O   1 
ATOM   641  C  CB  . VAL A 1 88  ? 21.272 2.636  31.056 1.00 17.00 ? 258  VAL A CB  1 
ATOM   642  C  CG1 . VAL A 1 88  ? 21.376 3.930  30.321 1.00 19.55 ? 258  VAL A CG1 1 
ATOM   643  C  CG2 . VAL A 1 88  ? 20.906 1.551  30.091 1.00 20.21 ? 258  VAL A CG2 1 
ATOM   644  N  N   . THR A 1 89  ? 24.042 4.181  32.111 1.00 17.76 ? 259  THR A N   1 
ATOM   645  C  CA  . THR A 1 89  ? 24.555 5.336  32.839 1.00 17.62 ? 259  THR A CA  1 
ATOM   646  C  C   . THR A 1 89  ? 24.659 6.458  31.818 1.00 17.80 ? 259  THR A C   1 
ATOM   647  O  O   . THR A 1 89  ? 25.200 6.251  30.728 1.00 18.28 ? 259  THR A O   1 
ATOM   648  C  CB  . THR A 1 89  ? 25.982 5.119  33.395 1.00 19.31 ? 259  THR A CB  1 
ATOM   649  O  OG1 . THR A 1 89  ? 25.999 3.893  34.150 1.00 19.70 ? 259  THR A OG1 1 
ATOM   650  C  CG2 . THR A 1 89  ? 26.387 6.251  34.306 1.00 19.55 ? 259  THR A CG2 1 
ATOM   651  N  N   . ASN A 1 90  ? 24.080 7.597  32.142 1.00 16.70 ? 260  ASN A N   1 
ATOM   652  C  CA  . ASN A 1 90  ? 24.276 8.780  31.330 1.00 16.93 ? 260  ASN A CA  1 
ATOM   653  C  C   . ASN A 1 90  ? 24.085 10.001 32.172 1.00 15.52 ? 260  ASN A C   1 
ATOM   654  O  O   . ASN A 1 90  ? 23.654 9.939  33.331 1.00 15.92 ? 260  ASN A O   1 
ATOM   655  C  CB  . ASN A 1 90  ? 23.315 8.760  30.116 1.00 16.56 ? 260  ASN A CB  1 
ATOM   656  C  CG  . ASN A 1 90  ? 21.865 8.737  30.492 1.00 17.93 ? 260  ASN A CG  1 
ATOM   657  O  OD1 . ASN A 1 90  ? 21.412 9.504  31.335 1.00 17.27 ? 260  ASN A OD1 1 
ATOM   658  N  ND2 . ASN A 1 90  ? 21.094 7.837  29.834 1.00 17.92 ? 260  ASN A ND2 1 
ATOM   659  N  N   . TRP A 1 91  ? 24.448 11.136 31.585 1.00 16.43 ? 261  TRP A N   1 
ATOM   660  C  CA  . TRP A 1 91  ? 24.456 12.363 32.358 1.00 15.99 ? 261  TRP A CA  1 
ATOM   661  C  C   . TRP A 1 91  ? 23.052 12.884 32.606 1.00 16.35 ? 261  TRP A C   1 
ATOM   662  O  O   . TRP A 1 91  ? 22.810 13.555 33.625 1.00 16.45 ? 261  TRP A O   1 
ATOM   663  C  CB  . TRP A 1 91  ? 25.292 13.430 31.691 1.00 16.29 ? 261  TRP A CB  1 
ATOM   664  C  CG  . TRP A 1 91  ? 26.746 13.173 31.933 1.00 15.83 ? 261  TRP A CG  1 
ATOM   665  C  CD1 . TRP A 1 91  ? 27.631 12.819 31.011 1.00 17.39 ? 261  TRP A CD1 1 
ATOM   666  C  CD2 . TRP A 1 91  ? 27.445 13.329 33.175 1.00 16.54 ? 261  TRP A CD2 1 
ATOM   667  N  NE1 . TRP A 1 91  ? 28.908 12.698 31.596 1.00 17.31 ? 261  TRP A NE1 1 
ATOM   668  C  CE2 . TRP A 1 91  ? 28.814 13.009 32.917 1.00 17.09 ? 261  TRP A CE2 1 
ATOM   669  C  CE3 . TRP A 1 91  ? 27.057 13.687 34.475 1.00 16.79 ? 261  TRP A CE3 1 
ATOM   670  C  CZ2 . TRP A 1 91  ? 29.810 13.058 33.919 1.00 17.19 ? 261  TRP A CZ2 1 
ATOM   671  C  CZ3 . TRP A 1 91  ? 28.076 13.762 35.479 1.00 17.16 ? 261  TRP A CZ3 1 
ATOM   672  C  CH2 . TRP A 1 91  ? 29.414 13.431 35.185 1.00 16.69 ? 261  TRP A CH2 1 
ATOM   673  N  N   . GLY A 1 92  ? 22.120 12.590 31.709 1.00 15.70 ? 262  GLY A N   1 
ATOM   674  C  CA  . GLY A 1 92  ? 20.712 12.968 31.995 1.00 16.16 ? 262  GLY A CA  1 
ATOM   675  C  C   . GLY A 1 92  ? 20.209 12.312 33.265 1.00 16.00 ? 262  GLY A C   1 
ATOM   676  O  O   . GLY A 1 92  ? 19.584 12.946 34.093 1.00 16.25 ? 262  GLY A O   1 
ATOM   677  N  N   . ARG A 1 93  ? 20.539 11.022 33.436 1.00 15.60 ? 263  ARG A N   1 
ATOM   678  C  CA  . ARG A 1 93  ? 20.140 10.352 34.686 1.00 16.63 ? 263  ARG A CA  1 
ATOM   679  C  C   . ARG A 1 93  ? 20.813 10.977 35.870 1.00 17.77 ? 263  ARG A C   1 
ATOM   680  O  O   . ARG A 1 93  ? 20.189 11.275 36.888 1.00 16.97 ? 263  ARG A O   1 
ATOM   681  C  CB  . ARG A 1 93  ? 20.477 8.858  34.636 1.00 16.41 ? 263  ARG A CB  1 
ATOM   682  C  CG  . ARG A 1 93  ? 19.564 8.107  33.720 1.00 15.95 ? 263  ARG A CG  1 
ATOM   683  C  CD  . ARG A 1 93  ? 20.037 6.667  33.731 1.00 17.55 ? 263  ARG A CD  1 
ATOM   684  N  NE  . ARG A 1 93  ? 19.178 5.882  32.841 1.00 16.92 ? 263  ARG A NE  1 
ATOM   685  C  CZ  . ARG A 1 93  ? 19.012 4.562  32.943 1.00 17.27 ? 263  ARG A CZ  1 
ATOM   686  N  NH1 . ARG A 1 93  ? 19.634 3.881  33.939 1.00 17.55 ? 263  ARG A NH1 1 
ATOM   687  N  NH2 . ARG A 1 93  ? 18.201 3.957  32.095 1.00 18.16 ? 263  ARG A NH2 1 
ATOM   688  N  N   . ILE A 1 94  ? 22.106 11.207 35.738 1.00 16.00 ? 264  ILE A N   1 
ATOM   689  C  CA  . ILE A 1 94  ? 22.840 11.735 36.889 1.00 16.84 ? 264  ILE A CA  1 
ATOM   690  C  C   . ILE A 1 94  ? 22.301 13.104 37.279 1.00 16.33 ? 264  ILE A C   1 
ATOM   691  O  O   . ILE A 1 94  ? 22.100 13.379 38.447 1.00 17.34 ? 264  ILE A O   1 
ATOM   692  C  CB  . ILE A 1 94  ? 24.334 11.750 36.541 1.00 16.41 ? 264  ILE A CB  1 
ATOM   693  C  CG1 . ILE A 1 94  ? 24.824 10.313 36.436 1.00 16.39 ? 264  ILE A CG1 1 
ATOM   694  C  CG2 . ILE A 1 94  ? 25.132 12.596 37.552 1.00 16.76 ? 264  ILE A CG2 1 
ATOM   695  C  CD1 . ILE A 1 94  ? 26.200 10.220 35.733 1.00 17.14 ? 264  ILE A CD1 1 
ATOM   696  N  N   . VAL A 1 95  ? 22.112 14.001 36.296 1.00 16.75 ? 265  VAL A N   1 
ATOM   697  C  CA  . VAL A 1 95  ? 21.620 15.313 36.661 1.00 17.58 ? 265  VAL A CA  1 
ATOM   698  C  C   . VAL A 1 95  ? 20.188 15.283 37.223 1.00 17.25 ? 265  VAL A C   1 
ATOM   699  O  O   . VAL A 1 95  ? 19.842 16.069 38.089 1.00 18.66 ? 265  VAL A O   1 
ATOM   700  C  CB  . VAL A 1 95  ? 21.795 16.298 35.494 1.00 19.16 ? 265  VAL A CB  1 
ATOM   701  C  CG1 . VAL A 1 95  ? 20.709 16.183 34.449 1.00 20.55 ? 265  VAL A CG1 1 
ATOM   702  C  CG2 . VAL A 1 95  ? 21.853 17.725 36.068 1.00 20.42 ? 265  VAL A CG2 1 
ATOM   703  N  N   . THR A 1 96  ? 19.376 14.335 36.744 1.00 16.18 ? 266  THR A N   1 
ATOM   704  C  CA  . THR A 1 96  ? 18.042 14.201 37.297 1.00 16.96 ? 266  THR A CA  1 
ATOM   705  C  C   . THR A 1 96  ? 18.088 13.786 38.753 1.00 16.71 ? 266  THR A C   1 
ATOM   706  O  O   . THR A 1 96  ? 17.345 14.301 39.588 1.00 18.21 ? 266  THR A O   1 
ATOM   707  C  CB  . THR A 1 96  ? 17.226 13.215 36.437 1.00 17.23 ? 266  THR A CB  1 
ATOM   708  O  OG1 . THR A 1 96  ? 17.133 13.746 35.110 1.00 17.39 ? 266  THR A OG1 1 
ATOM   709  C  CG2 . THR A 1 96  ? 15.836 13.005 37.036 1.00 18.42 ? 266  THR A CG2 1 
ATOM   710  N  N   . LEU A 1 97  ? 19.002 12.853 39.060 1.00 17.33 ? 267  LEU A N   1 
ATOM   711  C  CA  . LEU A 1 97  ? 19.156 12.448 40.478 1.00 17.46 ? 267  LEU A CA  1 
ATOM   712  C  C   . LEU A 1 97  ? 19.629 13.638 41.325 1.00 17.91 ? 267  LEU A C   1 
ATOM   713  O  O   . LEU A 1 97  ? 19.125 13.863 42.428 1.00 18.47 ? 267  LEU A O   1 
ATOM   714  C  CB  . LEU A 1 97  ? 20.174 11.293 40.558 1.00 18.10 ? 267  LEU A CB  1 
ATOM   715  C  CG  . LEU A 1 97  ? 19.635 10.002 39.917 1.00 22.76 ? 267  LEU A CG  1 
ATOM   716  C  CD1 . LEU A 1 97  ? 20.636 8.881  40.038 1.00 22.88 ? 267  LEU A CD1 1 
ATOM   717  C  CD2 . LEU A 1 97  ? 18.370 9.591  40.489 1.00 24.51 ? 267  LEU A CD2 1 
ATOM   718  N  N   . ILE A 1 98  ? 20.586 14.412 40.822 1.00 16.43 ? 268  ILE A N   1 
ATOM   719  C  CA  . ILE A 1 98  ? 21.088 15.552 41.623 1.00 16.94 ? 268  ILE A CA  1 
ATOM   720  C  C   . ILE A 1 98  ? 19.995 16.577 41.769 1.00 17.79 ? 268  ILE A C   1 
ATOM   721  O  O   . ILE A 1 98  ? 19.797 17.123 42.862 1.00 18.35 ? 268  ILE A O   1 
ATOM   722  C  CB  . ILE A 1 98  ? 22.343 16.163 40.957 1.00 17.25 ? 268  ILE A CB  1 
ATOM   723  C  CG1 . ILE A 1 98  ? 23.461 15.124 40.961 1.00 18.23 ? 268  ILE A CG1 1 
ATOM   724  C  CG2 . ILE A 1 98  ? 22.748 17.437 41.647 1.00 18.99 ? 268  ILE A CG2 1 
ATOM   725  C  CD1 . ILE A 1 98  ? 24.617 15.583 40.091 1.00 19.12 ? 268  ILE A CD1 1 
ATOM   726  N  N   . SER A 1 99  ? 19.272 16.837 40.686 1.00 17.45 ? 269  SER A N   1 
ATOM   727  C  CA  . SER A 1 99  ? 18.179 17.816 40.709 1.00 17.95 ? 269  SER A CA  1 
ATOM   728  C  C   . SER A 1 99  ? 17.080 17.407 41.693 1.00 18.05 ? 269  SER A C   1 
ATOM   729  O  O   . SER A 1 99  ? 16.549 18.239 42.432 1.00 19.86 ? 269  SER A O   1 
ATOM   730  C  CB  . SER A 1 99  ? 17.614 18.010 39.306 1.00 18.33 ? 269  SER A CB  1 
ATOM   731  O  OG  . SER A 1 99  ? 16.631 19.045 39.366 1.00 21.12 ? 269  SER A OG  1 
ATOM   732  N  N   . PHE A 1 100 ? 16.741 16.120 41.680 1.00 18.69 ? 270  PHE A N   1 
ATOM   733  C  CA  . PHE A 1 100 ? 15.770 15.619 42.642 1.00 18.70 ? 270  PHE A CA  1 
ATOM   734  C  C   . PHE A 1 100 ? 16.325 15.761 44.062 1.00 18.50 ? 270  PHE A C   1 
ATOM   735  O  O   . PHE A 1 100 ? 15.609 16.158 44.986 1.00 19.09 ? 270  PHE A O   1 
ATOM   736  C  CB  . PHE A 1 100 ? 15.359 14.188 42.344 1.00 18.16 ? 270  PHE A CB  1 
ATOM   737  C  CG  . PHE A 1 100 ? 14.328 13.664 43.302 1.00 19.27 ? 270  PHE A CG  1 
ATOM   738  C  CD1 . PHE A 1 100 ? 13.075 14.269 43.356 1.00 19.29 ? 270  PHE A CD1 1 
ATOM   739  C  CD2 . PHE A 1 100 ? 14.589 12.585 44.147 1.00 20.77 ? 270  PHE A CD2 1 
ATOM   740  C  CE1 . PHE A 1 100 ? 12.095 13.816 44.249 1.00 20.53 ? 270  PHE A CE1 1 
ATOM   741  C  CE2 . PHE A 1 100 ? 13.586 12.110 45.047 1.00 20.08 ? 270  PHE A CE2 1 
ATOM   742  C  CZ  . PHE A 1 100 ? 12.352 12.749 45.086 1.00 19.03 ? 270  PHE A CZ  1 
ATOM   743  N  N   . GLY A 1 101 ? 17.619 15.481 44.216 1.00 19.01 ? 271  GLY A N   1 
ATOM   744  C  CA  . GLY A 1 101 ? 18.299 15.711 45.493 1.00 19.90 ? 271  GLY A CA  1 
ATOM   745  C  C   . GLY A 1 101 ? 18.130 17.147 45.987 1.00 20.21 ? 271  GLY A C   1 
ATOM   746  O  O   . GLY A 1 101 ? 17.808 17.391 47.143 1.00 20.57 ? 271  GLY A O   1 
ATOM   747  N  N   . ALA A 1 102 ? 18.311 18.100 45.094 1.00 19.93 ? 272  ALA A N   1 
ATOM   748  C  CA  . ALA A 1 102 ? 18.140 19.507 45.437 1.00 20.07 ? 272  ALA A CA  1 
ATOM   749  C  C   . ALA A 1 102 ? 16.688 19.793 45.821 1.00 20.38 ? 272  ALA A C   1 
ATOM   750  O  O   . ALA A 1 102 ? 16.409 20.586 46.739 1.00 20.18 ? 272  ALA A O   1 
ATOM   751  C  CB  . ALA A 1 102 ? 18.559 20.368 44.280 1.00 19.95 ? 272  ALA A CB  1 
ATOM   752  N  N   . PHE A 1 103 ? 15.761 19.172 45.090 1.00 18.90 ? 273  PHE A N   1 
ATOM   753  C  CA  . PHE A 1 103 ? 14.319 19.336 45.371 1.00 19.62 ? 273  PHE A CA  1 
ATOM   754  C  C   . PHE A 1 103 ? 14.007 18.842 46.795 1.00 20.44 ? 273  PHE A C   1 
ATOM   755  O  O   . PHE A 1 103 ? 13.275 19.488 47.566 1.00 18.74 ? 273  PHE A O   1 
ATOM   756  C  CB  . PHE A 1 103 ? 13.491 18.603 44.297 1.00 19.48 ? 273  PHE A CB  1 
ATOM   757  C  CG  . PHE A 1 103 ? 11.998 18.816 44.390 1.00 19.47 ? 273  PHE A CG  1 
ATOM   758  C  CD1 . PHE A 1 103 ? 11.399 19.941 43.804 1.00 23.17 ? 273  PHE A CD1 1 
ATOM   759  C  CD2 . PHE A 1 103 ? 11.201 17.883 45.032 1.00 18.83 ? 273  PHE A CD2 1 
ATOM   760  C  CE1 . PHE A 1 103 ? 10.024 20.129 43.899 1.00 23.39 ? 273  PHE A CE1 1 
ATOM   761  C  CE2 . PHE A 1 103 ? 9.812  18.049 45.096 1.00 17.87 ? 273  PHE A CE2 1 
ATOM   762  C  CZ  . PHE A 1 103 ? 9.235  19.164 44.538 1.00 20.46 ? 273  PHE A CZ  1 
ATOM   763  N  N   . VAL A 1 104 ? 14.584 17.707 47.142 1.00 20.18 ? 274  VAL A N   1 
ATOM   764  C  CA  . VAL A 1 104 ? 14.422 17.104 48.460 1.00 21.26 ? 274  VAL A CA  1 
ATOM   765  C  C   . VAL A 1 104 ? 15.095 17.996 49.513 1.00 20.85 ? 274  VAL A C   1 
ATOM   766  O  O   . VAL A 1 104 ? 14.509 18.229 50.565 1.00 21.64 ? 274  VAL A O   1 
ATOM   767  C  CB  . VAL A 1 104 ? 15.046 15.688 48.488 1.00 21.30 ? 274  VAL A CB  1 
ATOM   768  C  CG1 . VAL A 1 104 ? 15.024 15.090 49.891 1.00 22.89 ? 274  VAL A CG1 1 
ATOM   769  C  CG2 . VAL A 1 104 ? 14.291 14.760 47.535 1.00 22.33 ? 274  VAL A CG2 1 
ATOM   770  N  N   . ALA A 1 105 ? 16.282 18.529 49.197 1.00 20.51 ? 275  ALA A N   1 
ATOM   771  C  CA  . ALA A 1 105 ? 17.012 19.401 50.138 1.00 21.71 ? 275  ALA A CA  1 
ATOM   772  C  C   . ALA A 1 105 ? 16.215 20.656 50.431 1.00 22.11 ? 275  ALA A C   1 
ATOM   773  O  O   . ALA A 1 105 ? 16.165 21.117 51.592 1.00 22.50 ? 275  ALA A O   1 
ATOM   774  C  CB  . ALA A 1 105 ? 18.364 19.777 49.572 1.00 21.83 ? 275  ALA A CB  1 
ATOM   775  N  N   . LYS A 1 106 ? 15.589 21.207 49.389 1.00 22.31 ? 276  LYS A N   1 
ATOM   776  C  CA  . LYS A 1 106 ? 14.745 22.396 49.534 1.00 23.92 ? 276  LYS A CA  1 
ATOM   777  C  C   . LYS A 1 106 ? 13.560 22.115 50.452 1.00 23.70 ? 276  LYS A C   1 
ATOM   778  O  O   . LYS A 1 106 ? 13.206 22.945 51.309 1.00 23.94 ? 276  LYS A O   1 
ATOM   779  C  CB  . LYS A 1 106 ? 14.283 22.895 48.164 1.00 23.04 ? 276  LYS A CB  1 
ATOM   780  C  CG  . LYS A 1 106 ? 13.509 24.218 48.230 1.00 25.85 ? 276  LYS A CG  1 
ATOM   781  C  CD  . LYS A 1 106 ? 13.289 24.819 46.845 1.00 26.99 ? 276  LYS A CD  1 
ATOM   782  C  CE  . LYS A 1 106 ? 12.503 26.126 46.925 1.00 30.20 ? 276  LYS A CE  1 
ATOM   783  N  NZ  . LYS A 1 106 ? 11.034 25.905 46.845 0.00 28.56 ? 276  LYS A NZ  1 
ATOM   784  N  N   . HIS A 1 107 ? 12.954 20.946 50.283 1.00 24.10 ? 277  HIS A N   1 
ATOM   785  C  CA  . HIS A 1 107 ? 11.915 20.486 51.183 1.00 26.98 ? 277  HIS A CA  1 
ATOM   786  C  C   . HIS A 1 107 ? 12.386 20.361 52.650 1.00 27.29 ? 277  HIS A C   1 
ATOM   787  O  O   . HIS A 1 107 ? 11.685 20.803 53.576 1.00 27.44 ? 277  HIS A O   1 
ATOM   788  C  CB  . HIS A 1 107 ? 11.348 19.158 50.700 1.00 26.92 ? 277  HIS A CB  1 
ATOM   789  C  CG  . HIS A 1 107 ? 10.386 18.546 51.666 1.00 30.57 ? 277  HIS A CG  1 
ATOM   790  N  ND1 . HIS A 1 107 ? 9.115  19.041 51.860 1.00 32.03 ? 277  HIS A ND1 1 
ATOM   791  C  CD2 . HIS A 1 107 ? 10.513 17.488 52.502 1.00 33.06 ? 277  HIS A CD2 1 
ATOM   792  C  CE1 . HIS A 1 107 ? 8.497  18.313 52.772 1.00 33.68 ? 277  HIS A CE1 1 
ATOM   793  N  NE2 . HIS A 1 107 ? 9.323  17.364 53.175 1.00 34.53 ? 277  HIS A NE2 1 
ATOM   794  N  N   . LEU A 1 108 ? 13.554 19.755 52.866 1.00 28.43 ? 278  LEU A N   1 
ATOM   795  C  CA  . LEU A 1 108 ? 14.100 19.581 54.224 1.00 29.96 ? 278  LEU A CA  1 
ATOM   796  C  C   . LEU A 1 108 ? 14.320 20.918 54.935 1.00 30.85 ? 278  LEU A C   1 
ATOM   797  O  O   . LEU A 1 108 ? 14.030 21.047 56.129 1.00 30.80 ? 278  LEU A O   1 
ATOM   798  C  CB  . LEU A 1 108 ? 15.401 18.781 54.207 1.00 30.50 ? 278  LEU A CB  1 
ATOM   799  C  CG  . LEU A 1 108 ? 15.326 17.333 53.729 1.00 31.37 ? 278  LEU A CG  1 
ATOM   800  C  CD1 . LEU A 1 108 ? 16.732 16.765 53.598 1.00 32.40 ? 278  LEU A CD1 1 
ATOM   801  C  CD2 . LEU A 1 108 ? 14.453 16.482 54.656 1.00 33.61 ? 278  LEU A CD2 1 
ATOM   802  N  N   . LYS A 1 109 ? 14.821 21.912 54.201 1.00 31.76 ? 279  LYS A N   1 
ATOM   803  C  CA  . LYS A 1 109 ? 14.995 23.252 54.760 1.00 33.34 ? 279  LYS A CA  1 
ATOM   804  C  C   . LYS A 1 109 ? 13.666 23.942 55.039 1.00 33.75 ? 279  LYS A C   1 
ATOM   805  O  O   . LYS A 1 109 ? 13.533 24.643 56.051 1.00 34.09 ? 279  LYS A O   1 
ATOM   806  C  CB  . LYS A 1 109 ? 15.880 24.129 53.874 1.00 33.39 ? 279  LYS A CB  1 
ATOM   807  C  CG  . LYS A 1 109 ? 17.353 23.804 54.036 1.00 35.45 ? 279  LYS A CG  1 
ATOM   808  C  CD  . LYS A 1 109 ? 18.213 25.044 53.970 1.00 38.48 ? 279  LYS A CD  1 
ATOM   809  C  CE  . LYS A 1 109 ? 19.576 24.795 54.610 1.00 39.02 ? 279  LYS A CE  1 
ATOM   810  N  NZ  . LYS A 1 109 ? 19.539 25.067 56.079 1.00 39.29 ? 279  LYS A NZ  1 
ATOM   811  N  N   . THR A 1 110 ? 12.690 23.734 54.156 1.00 34.55 ? 280  THR A N   1 
ATOM   812  C  CA  . THR A 1 110 ? 11.340 24.293 54.329 1.00 35.54 ? 280  THR A CA  1 
ATOM   813  C  C   . THR A 1 110 ? 10.695 23.823 55.634 1.00 35.95 ? 280  THR A C   1 
ATOM   814  O  O   . THR A 1 110 ? 10.013 24.601 56.307 1.00 36.07 ? 280  THR A O   1 
ATOM   815  C  CB  . THR A 1 110 ? 10.418 23.964 53.124 1.00 35.50 ? 280  THR A CB  1 
ATOM   816  O  OG1 . THR A 1 110 ? 11.048 24.395 51.913 1.00 35.86 ? 280  THR A OG1 1 
ATOM   817  C  CG2 . THR A 1 110 ? 9.071  24.671 53.249 1.00 36.49 ? 280  THR A CG2 1 
ATOM   818  N  N   . ILE A 1 111 ? 10.919 22.562 55.995 1.00 36.47 ? 281  ILE A N   1 
ATOM   819  C  CA  . ILE A 1 111 ? 10.363 22.020 57.243 1.00 36.94 ? 281  ILE A CA  1 
ATOM   820  C  C   . ILE A 1 111 ? 11.206 22.418 58.460 1.00 36.56 ? 281  ILE A C   1 
ATOM   821  O  O   . ILE A 1 111 ? 10.663 22.808 59.502 1.00 37.00 ? 281  ILE A O   1 
ATOM   822  C  CB  . ILE A 1 111 ? 10.066 20.481 57.164 1.00 37.32 ? 281  ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 111 ? 11.314 19.648 56.826 1.00 38.52 ? 281  ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 111 ? 8.993  20.199 56.103 1.00 37.81 ? 281  ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 111 ? 11.964 18.932 58.021 1.00 40.28 ? 281  ILE A CD1 1 
ATOM   826  N  N   . ASN A 1 112 ? 12.526 22.361 58.310 1.00 36.11 ? 282  ASN A N   1 
ATOM   827  C  CA  . ASN A 1 112 ? 13.444 22.778 59.365 1.00 35.04 ? 282  ASN A CA  1 
ATOM   828  C  C   . ASN A 1 112 ? 14.610 23.545 58.763 1.00 34.18 ? 282  ASN A C   1 
ATOM   829  O  O   . ASN A 1 112 ? 15.489 22.958 58.124 1.00 33.46 ? 282  ASN A O   1 
ATOM   830  C  CB  . ASN A 1 112 ? 13.944 21.564 60.159 1.00 35.46 ? 282  ASN A CB  1 
ATOM   831  C  CG  . ASN A 1 112 ? 14.527 21.949 61.509 1.00 36.97 ? 282  ASN A CG  1 
ATOM   832  O  OD1 . ASN A 1 112 ? 15.548 22.640 61.592 1.00 37.61 ? 282  ASN A OD1 1 
ATOM   833  N  ND2 . ASN A 1 112 ? 13.872 21.505 62.583 1.00 37.85 ? 282  ASN A ND2 1 
ATOM   834  N  N   . GLN A 1 113 ? 14.608 24.862 58.957 1.00 32.94 ? 283  GLN A N   1 
ATOM   835  C  CA  . GLN A 1 113 ? 15.653 25.731 58.413 1.00 32.23 ? 283  GLN A CA  1 
ATOM   836  C  C   . GLN A 1 113 ? 17.050 25.456 58.983 1.00 31.33 ? 283  GLN A C   1 
ATOM   837  O  O   . GLN A 1 113 ? 18.050 25.924 58.433 1.00 31.36 ? 283  GLN A O   1 
ATOM   838  C  CB  . GLN A 1 113 ? 15.276 27.217 58.540 1.00 32.75 ? 283  GLN A CB  1 
ATOM   839  C  CG  . GLN A 1 113 ? 14.446 27.746 57.352 1.00 33.86 ? 283  GLN A CG  1 
ATOM   840  C  CD  . GLN A 1 113 ? 15.176 27.665 56.009 1.00 33.23 ? 283  GLN A CD  1 
ATOM   841  O  OE1 . GLN A 1 113 ? 16.390 27.869 55.926 0.00 33.34 ? 283  GLN A OE1 1 
ATOM   842  N  NE2 . GLN A 1 113 ? 14.425 27.375 54.951 0.00 33.31 ? 283  GLN A NE2 1 
ATOM   843  N  N   . GLU A 1 114 ? 17.123 24.681 60.063 1.00 30.46 ? 284  GLU A N   1 
ATOM   844  C  CA  . GLU A 1 114 ? 18.422 24.286 60.611 1.00 30.02 ? 284  GLU A CA  1 
ATOM   845  C  C   . GLU A 1 114 ? 18.949 23.005 59.950 1.00 29.49 ? 284  GLU A C   1 
ATOM   846  O  O   . GLU A 1 114 ? 20.052 22.541 60.265 1.00 29.36 ? 284  GLU A O   1 
ATOM   847  C  CB  . GLU A 1 114 ? 18.381 24.159 62.135 1.00 30.17 ? 284  GLU A CB  1 
ATOM   848  C  CG  . GLU A 1 114 ? 18.452 25.507 62.849 1.00 30.17 ? 284  GLU A CG  1 
ATOM   849  C  CD  . GLU A 1 114 ? 19.775 26.225 62.626 0.00 29.81 ? 284  GLU A CD  1 
ATOM   850  O  OE1 . GLU A 1 114 ? 20.827 25.731 63.128 0.00 29.82 ? 284  GLU A OE1 1 
ATOM   851  O  OE2 . GLU A 1 114 ? 19.760 27.286 61.951 0.00 29.73 ? 284  GLU A OE2 1 
ATOM   852  N  N   . SER A 1 115 ? 18.163 22.453 59.026 1.00 28.84 ? 285  SER A N   1 
ATOM   853  C  CA  . SER A 1 115 ? 18.575 21.248 58.295 1.00 28.84 ? 285  SER A CA  1 
ATOM   854  C  C   . SER A 1 115 ? 19.810 21.491 57.439 1.00 27.59 ? 285  SER A C   1 
ATOM   855  O  O   . SER A 1 115 ? 19.931 22.530 56.774 1.00 28.36 ? 285  SER A O   1 
ATOM   856  C  CB  . SER A 1 115 ? 17.441 20.701 57.427 1.00 29.26 ? 285  SER A CB  1 
ATOM   857  O  OG  . SER A 1 115 ? 16.514 19.978 58.224 1.00 33.03 ? 285  SER A OG  1 
ATOM   858  N  N   . CYS A 1 116 ? 20.716 20.516 57.467 1.00 25.11 ? 286  CYS A N   1 
ATOM   859  C  CA  A CYS A 1 116 ? 21.931 20.553 56.681 0.50 24.25 ? 286  CYS A CA  1 
ATOM   860  C  CA  B CYS A 1 116 ? 21.930 20.560 56.667 0.50 24.23 ? 286  CYS A CA  1 
ATOM   861  C  C   . CYS A 1 116 ? 21.685 19.731 55.428 1.00 23.40 ? 286  CYS A C   1 
ATOM   862  O  O   . CYS A 1 116 ? 21.047 18.692 55.489 1.00 23.73 ? 286  CYS A O   1 
ATOM   863  C  CB  A CYS A 1 116 ? 23.080 19.937 57.476 0.50 24.25 ? 286  CYS A CB  1 
ATOM   864  C  CB  B CYS A 1 116 ? 23.126 19.971 57.421 0.50 24.20 ? 286  CYS A CB  1 
ATOM   865  S  SG  A CYS A 1 116 ? 24.704 20.177 56.770 0.50 23.40 ? 286  CYS A SG  1 
ATOM   866  S  SG  B CYS A 1 116 ? 23.706 20.950 58.820 0.50 23.32 ? 286  CYS A SG  1 
ATOM   867  N  N   . ILE A 1 117 ? 22.201 20.198 54.306 1.00 22.91 ? 287  ILE A N   1 
ATOM   868  C  CA  . ILE A 1 117 ? 22.031 19.444 53.057 1.00 21.78 ? 287  ILE A CA  1 
ATOM   869  C  C   . ILE A 1 117 ? 23.164 18.425 52.888 1.00 21.08 ? 287  ILE A C   1 
ATOM   870  O  O   . ILE A 1 117 ? 23.164 17.604 51.950 1.00 19.98 ? 287  ILE A O   1 
ATOM   871  C  CB  . ILE A 1 117 ? 21.916 20.409 51.847 1.00 21.99 ? 287  ILE A CB  1 
ATOM   872  C  CG1 . ILE A 1 117 ? 23.184 21.274 51.684 1.00 22.15 ? 287  ILE A CG1 1 
ATOM   873  C  CG2 . ILE A 1 117 ? 20.689 21.290 52.018 1.00 23.05 ? 287  ILE A CG2 1 
ATOM   874  C  CD1 . ILE A 1 117 ? 24.396 20.555 51.040 1.00 23.48 ? 287  ILE A CD1 1 
ATOM   875  N  N   . GLU A 1 118 ? 24.141 18.495 53.782 1.00 21.00 ? 288  GLU A N   1 
ATOM   876  C  CA  A GLU A 1 118 ? 25.373 17.750 53.621 1.00 21.07 ? 288  GLU A CA  1 
ATOM   877  C  C   . GLU A 1 118 ? 25.189 16.226 53.585 1.00 20.31 ? 288  GLU A C   1 
ATOM   878  O  O   . GLU A 1 118 ? 25.755 15.581 52.711 1.00 19.83 ? 288  GLU A O   1 
ATOM   879  C  CB  A GLU A 1 118 ? 26.424 18.191 54.659 1.00 22.07 ? 288  GLU A CB  1 
ATOM   880  C  CG  A GLU A 1 118 ? 27.800 18.143 54.111 1.00 28.58 ? 288  GLU A CG  1 
ATOM   881  C  CD  A GLU A 1 118 ? 27.865 18.714 52.699 1.00 36.52 ? 288  GLU A CD  1 
ATOM   882  O  OE1 A GLU A 1 118 ? 28.154 17.938 51.767 1.00 41.34 ? 288  GLU A OE1 1 
ATOM   883  O  OE2 A GLU A 1 118 ? 27.601 19.931 52.523 1.00 41.67 ? 288  GLU A OE2 1 
ATOM   884  N  N   . PRO A 1 119 ? 24.409 15.643 54.521 1.00 19.82 ? 289  PRO A N   1 
ATOM   885  C  CA  . PRO A 1 119 ? 24.200 14.192 54.411 1.00 19.30 ? 289  PRO A CA  1 
ATOM   886  C  C   . PRO A 1 119 ? 23.614 13.778 53.037 1.00 19.12 ? 289  PRO A C   1 
ATOM   887  O  O   . PRO A 1 119 ? 24.056 12.784 52.450 1.00 19.15 ? 289  PRO A O   1 
ATOM   888  C  CB  . PRO A 1 119 ? 23.246 13.886 55.570 1.00 20.34 ? 289  PRO A CB  1 
ATOM   889  C  CG  . PRO A 1 119 ? 23.597 14.969 56.591 1.00 20.19 ? 289  PRO A CG  1 
ATOM   890  C  CD  . PRO A 1 119 ? 23.796 16.199 55.751 1.00 19.66 ? 289  PRO A CD  1 
ATOM   891  N  N   . LEU A 1 120 ? 22.634 14.535 52.541 1.00 18.37 ? 290  LEU A N   1 
ATOM   892  C  CA  A LEU A 1 120 ? 22.059 14.278 51.210 0.50 18.92 ? 290  LEU A CA  1 
ATOM   893  C  CA  B LEU A 1 120 ? 22.065 14.281 51.229 0.50 18.83 ? 290  LEU A CA  1 
ATOM   894  C  C   . LEU A 1 120 ? 23.119 14.413 50.119 1.00 19.00 ? 290  LEU A C   1 
ATOM   895  O  O   . LEU A 1 120 ? 23.259 13.537 49.264 1.00 18.73 ? 290  LEU A O   1 
ATOM   896  C  CB  A LEU A 1 120 ? 20.878 15.212 50.908 0.50 19.56 ? 290  LEU A CB  1 
ATOM   897  C  CB  B LEU A 1 120 ? 20.895 15.232 51.008 0.50 19.54 ? 290  LEU A CB  1 
ATOM   898  C  CG  A LEU A 1 120 ? 19.428 14.897 51.294 0.50 20.72 ? 290  LEU A CG  1 
ATOM   899  C  CG  B LEU A 1 120 ? 20.085 15.107 49.731 0.50 19.82 ? 290  LEU A CG  1 
ATOM   900  C  CD1 A LEU A 1 120 ? 18.559 16.073 50.959 0.50 20.84 ? 290  LEU A CD1 1 
ATOM   901  C  CD1 B LEU A 1 120 ? 19.460 13.723 49.639 0.50 22.92 ? 290  LEU A CD1 1 
ATOM   902  C  CD2 A LEU A 1 120 ? 18.905 13.669 50.575 0.50 18.92 ? 290  LEU A CD2 1 
ATOM   903  C  CD2 B LEU A 1 120 ? 19.015 16.183 49.733 0.50 20.49 ? 290  LEU A CD2 1 
ATOM   904  N  N   . ALA A 1 121 ? 23.889 15.499 50.156 1.00 17.87 ? 291  ALA A N   1 
ATOM   905  C  CA  . ALA A 1 121 ? 24.886 15.693 49.116 1.00 17.44 ? 291  ALA A CA  1 
ATOM   906  C  C   . ALA A 1 121 ? 25.920 14.576 49.168 1.00 17.09 ? 291  ALA A C   1 
ATOM   907  O  O   . ALA A 1 121 ? 26.351 14.056 48.115 1.00 17.68 ? 291  ALA A O   1 
ATOM   908  C  CB  . ALA A 1 121 ? 25.572 17.073 49.271 1.00 17.44 ? 291  ALA A CB  1 
ATOM   909  N  N   . GLU A 1 122 ? 26.309 14.189 50.383 1.00 16.83 ? 292  GLU A N   1 
ATOM   910  C  CA  . GLU A 1 122 ? 27.271 13.095 50.524 1.00 18.05 ? 292  GLU A CA  1 
ATOM   911  C  C   . GLU A 1 122 ? 26.709 11.775 49.998 1.00 18.53 ? 292  GLU A C   1 
ATOM   912  O  O   . GLU A 1 122 ? 27.421 10.986 49.340 1.00 19.15 ? 292  GLU A O   1 
ATOM   913  C  CB  . GLU A 1 122 ? 27.691 12.953 51.986 1.00 17.61 ? 292  GLU A CB  1 
ATOM   914  C  CG  . GLU A 1 122 ? 28.535 14.137 52.374 1.00 19.77 ? 292  GLU A CG  1 
ATOM   915  C  CD  . GLU A 1 122 ? 28.896 14.175 53.836 1.00 23.48 ? 292  GLU A CD  1 
ATOM   916  O  OE1 . GLU A 1 122 ? 28.458 13.289 54.628 1.00 26.56 ? 292  GLU A OE1 1 
ATOM   917  O  OE2 . GLU A 1 122 ? 29.630 15.106 54.225 1.00 26.82 ? 292  GLU A OE2 1 
ATOM   918  N  N   . SER A 1 123 ? 25.430 11.529 50.248 1.00 18.69 ? 293  SER A N   1 
ATOM   919  C  CA  A SER A 1 123 ? 24.789 10.301 49.789 0.50 19.59 ? 293  SER A CA  1 
ATOM   920  C  CA  B SER A 1 123 ? 24.804 10.289 49.790 0.50 19.55 ? 293  SER A CA  1 
ATOM   921  C  C   . SER A 1 123 ? 24.758 10.227 48.259 1.00 19.61 ? 293  SER A C   1 
ATOM   922  O  O   . SER A 1 123 ? 25.050 9.170  47.651 1.00 21.29 ? 293  SER A O   1 
ATOM   923  C  CB  A SER A 1 123 ? 23.378 10.213 50.378 0.50 19.73 ? 293  SER A CB  1 
ATOM   924  C  CB  B SER A 1 123 ? 23.410 10.133 50.418 0.50 19.71 ? 293  SER A CB  1 
ATOM   925  O  OG  A SER A 1 123 ? 22.713 9.072  49.880 0.50 21.51 ? 293  SER A OG  1 
ATOM   926  O  OG  B SER A 1 123 ? 22.463 10.983 49.798 0.50 21.23 ? 293  SER A OG  1 
ATOM   927  N  N   . ILE A 1 124 ? 24.411 11.354 47.626 1.00 18.32 ? 294  ILE A N   1 
ATOM   928  C  CA  . ILE A 1 124 ? 24.341 11.438 46.185 1.00 18.56 ? 294  ILE A CA  1 
ATOM   929  C  C   . ILE A 1 124 ? 25.737 11.276 45.607 1.00 18.89 ? 294  ILE A C   1 
ATOM   930  O  O   . ILE A 1 124 ? 25.936 10.577 44.614 1.00 19.11 ? 294  ILE A O   1 
ATOM   931  C  CB  . ILE A 1 124 ? 23.727 12.760 45.784 1.00 19.08 ? 294  ILE A CB  1 
ATOM   932  C  CG1 . ILE A 1 124 ? 22.264 12.758 46.232 1.00 18.93 ? 294  ILE A CG1 1 
ATOM   933  C  CG2 . ILE A 1 124 ? 23.769 12.931 44.286 1.00 20.30 ? 294  ILE A CG2 1 
ATOM   934  C  CD1 . ILE A 1 124 ? 21.593 14.166 46.120 1.00 18.60 ? 294  ILE A CD1 1 
ATOM   935  N  N   . THR A 1 125 ? 26.699 11.967 46.210 1.00 16.62 ? 295  THR A N   1 
ATOM   936  C  CA  . THR A 1 125 ? 28.060 11.915 45.681 1.00 17.09 ? 295  THR A CA  1 
ATOM   937  C  C   . THR A 1 125 ? 28.610 10.512 45.817 1.00 18.89 ? 295  THR A C   1 
ATOM   938  O  O   . THR A 1 125 ? 29.318 10.024 44.938 1.00 19.59 ? 295  THR A O   1 
ATOM   939  C  CB  . THR A 1 125 ? 28.969 12.900 46.439 1.00 16.36 ? 295  THR A CB  1 
ATOM   940  O  OG1 . THR A 1 125 ? 28.401 14.209 46.318 1.00 17.63 ? 295  THR A OG1 1 
ATOM   941  C  CG2 . THR A 1 125 ? 30.391 12.891 45.869 1.00 19.57 ? 295  THR A CG2 1 
ATOM   942  N  N   . ASP A 1 126 ? 28.311 9.868  46.946 1.00 20.07 ? 296  ASP A N   1 
ATOM   943  C  CA  A ASP A 1 126 ? 28.757 8.495  47.191 0.50 21.16 ? 296  ASP A CA  1 
ATOM   944  C  CA  B ASP A 1 126 ? 28.806 8.504  47.157 0.50 21.44 ? 296  ASP A CA  1 
ATOM   945  C  C   . ASP A 1 126 ? 28.294 7.597  46.065 1.00 21.87 ? 296  ASP A C   1 
ATOM   946  O  O   . ASP A 1 126 ? 29.074 6.852  45.474 1.00 21.42 ? 296  ASP A O   1 
ATOM   947  C  CB  A ASP A 1 126 ? 28.152 7.989  48.503 0.50 22.01 ? 296  ASP A CB  1 
ATOM   948  C  CB  B ASP A 1 126 ? 28.379 7.962  48.518 0.50 22.78 ? 296  ASP A CB  1 
ATOM   949  C  CG  A ASP A 1 126 ? 28.268 6.484  48.651 0.50 22.86 ? 296  ASP A CG  1 
ATOM   950  C  CG  B ASP A 1 126 ? 29.114 8.602  49.655 0.50 24.58 ? 296  ASP A CG  1 
ATOM   951  O  OD1 A ASP A 1 126 ? 29.401 6.028  48.823 0.50 24.36 ? 296  ASP A OD1 1 
ATOM   952  O  OD1 B ASP A 1 126 ? 30.073 9.374  49.410 0.50 31.14 ? 296  ASP A OD1 1 
ATOM   953  O  OD2 A ASP A 1 126 ? 27.231 5.789  48.580 0.50 26.05 ? 296  ASP A OD2 1 
ATOM   954  O  OD2 B ASP A 1 126 ? 28.713 8.348  50.820 0.50 30.79 ? 296  ASP A OD2 1 
ATOM   955  N  N   . VAL A 1 127 ? 26.996 7.622  45.798 1.00 21.92 ? 297  VAL A N   1 
ATOM   956  C  CA  . VAL A 1 127 ? 26.451 6.771  44.717 1.00 23.40 ? 297  VAL A CA  1 
ATOM   957  C  C   . VAL A 1 127 ? 27.163 7.054  43.409 1.00 21.62 ? 297  VAL A C   1 
ATOM   958  O  O   . VAL A 1 127 ? 27.689 6.134  42.749 1.00 21.88 ? 297  VAL A O   1 
ATOM   959  C  CB  . VAL A 1 127 ? 24.924 6.930  44.524 1.00 24.04 ? 297  VAL A CB  1 
ATOM   960  C  CG1 . VAL A 1 127 ? 24.489 6.254  43.196 1.00 26.50 ? 297  VAL A CG1 1 
ATOM   961  C  CG2 . VAL A 1 127 ? 24.202 6.367  45.725 1.00 27.16 ? 297  VAL A CG2 1 
ATOM   962  N  N   . LEU A 1 128 ? 27.274 8.330  43.050 1.00 19.00 ? 298  LEU A N   1 
ATOM   963  C  CA  A LEU A 1 128 ? 27.846 8.681  41.776 0.50 18.94 ? 298  LEU A CA  1 
ATOM   964  C  CA  B LEU A 1 128 ? 27.849 8.708  41.773 0.50 18.92 ? 298  LEU A CA  1 
ATOM   965  C  C   . LEU A 1 128 ? 29.314 8.305  41.703 1.00 19.45 ? 298  LEU A C   1 
ATOM   966  O  O   . LEU A 1 128 ? 29.747 7.627  40.776 1.00 19.65 ? 298  LEU A O   1 
ATOM   967  C  CB  A LEU A 1 128 ? 27.633 10.173 41.514 0.50 19.33 ? 298  LEU A CB  1 
ATOM   968  C  CB  B LEU A 1 128 ? 27.691 10.228 41.538 0.50 19.00 ? 298  LEU A CB  1 
ATOM   969  C  CG  A LEU A 1 128 ? 26.156 10.524 41.369 0.50 19.30 ? 298  LEU A CG  1 
ATOM   970  C  CG  B LEU A 1 128 ? 28.432 10.855 40.338 0.50 19.06 ? 298  LEU A CG  1 
ATOM   971  C  CD1 A LEU A 1 128 ? 26.019 12.005 41.043 0.50 22.25 ? 298  LEU A CD1 1 
ATOM   972  C  CD1 B LEU A 1 128 ? 27.957 10.294 39.004 0.50 18.92 ? 298  LEU A CD1 1 
ATOM   973  C  CD2 A LEU A 1 128 ? 25.429 9.630  40.319 0.50 21.60 ? 298  LEU A CD2 1 
ATOM   974  C  CD2 B LEU A 1 128 ? 28.299 12.375 40.294 0.50 19.11 ? 298  LEU A CD2 1 
ATOM   975  N  N   . VAL A 1 129 ? 30.095 8.741  42.682 1.00 16.78 ? 299  VAL A N   1 
ATOM   976  C  CA  . VAL A 1 129 ? 31.544 8.558  42.555 1.00 17.40 ? 299  VAL A CA  1 
ATOM   977  C  C   . VAL A 1 129 ? 31.956 7.111  42.829 1.00 17.97 ? 299  VAL A C   1 
ATOM   978  O  O   . VAL A 1 129 ? 32.781 6.545  42.088 1.00 19.98 ? 299  VAL A O   1 
ATOM   979  C  CB  . VAL A 1 129 ? 32.337 9.580  43.393 1.00 17.27 ? 299  VAL A CB  1 
ATOM   980  C  CG1 . VAL A 1 129 ? 33.833 9.287  43.307 1.00 17.76 ? 299  VAL A CG1 1 
ATOM   981  C  CG2 . VAL A 1 129 ? 31.989 10.989 42.953 1.00 18.66 ? 299  VAL A CG2 1 
ATOM   982  N  N   . ARG A 1 130 ? 31.383 6.474  43.839 1.00 17.48 ? 300  ARG A N   1 
ATOM   983  C  CA  . ARG A 1 130 ? 31.792 5.104  44.160 1.00 18.69 ? 300  ARG A CA  1 
ATOM   984  C  C   . ARG A 1 130 ? 31.288 4.163  43.060 1.00 17.63 ? 300  ARG A C   1 
ATOM   985  O  O   . ARG A 1 130 ? 32.048 3.319  42.535 1.00 19.17 ? 300  ARG A O   1 
ATOM   986  C  CB  . ARG A 1 130 ? 31.264 4.715  45.540 1.00 19.58 ? 300  ARG A CB  1 
ATOM   987  C  CG  . ARG A 1 130 ? 31.691 3.404  46.081 1.00 21.71 ? 300  ARG A CG  1 
ATOM   988  C  CD  . ARG A 1 130 ? 31.207 3.261  47.555 1.00 22.82 ? 300  ARG A CD  1 
ATOM   989  N  NE  . ARG A 1 130 ? 29.779 3.575  47.669 1.00 24.46 ? 300  ARG A NE  1 
ATOM   990  C  CZ  . ARG A 1 130 ? 28.793 2.745  47.324 1.00 25.99 ? 300  ARG A CZ  1 
ATOM   991  N  NH1 . ARG A 1 130 ? 29.064 1.511  46.862 1.00 21.64 ? 300  ARG A NH1 1 
ATOM   992  N  NH2 . ARG A 1 130 ? 27.529 3.148  47.433 1.00 29.09 ? 300  ARG A NH2 1 
ATOM   993  N  N   . THR A 1 131 ? 30.020 4.283  42.696 1.00 16.83 ? 301  THR A N   1 
ATOM   994  C  CA  . THR A 1 131 ? 29.491 3.272  41.797 1.00 17.75 ? 301  THR A CA  1 
ATOM   995  C  C   . THR A 1 131 ? 29.814 3.539  40.321 1.00 16.83 ? 301  THR A C   1 
ATOM   996  O  O   . THR A 1 131 ? 29.761 2.625  39.515 1.00 17.09 ? 301  THR A O   1 
ATOM   997  C  CB  . THR A 1 131 ? 27.999 3.000  41.997 1.00 19.40 ? 301  THR A CB  1 
ATOM   998  O  OG1 . THR A 1 131 ? 27.256 4.019  41.346 1.00 19.64 ? 301  THR A OG1 1 
ATOM   999  C  CG2 . THR A 1 131 ? 27.632 2.883  43.519 1.00 20.63 ? 301  THR A CG2 1 
ATOM   1000 N  N   . LYS A 1 132 ? 30.147 4.783  39.960 1.00 15.79 ? 302  LYS A N   1 
ATOM   1001 C  CA  . LYS A 1 132 ? 30.535 5.091  38.573 1.00 15.86 ? 302  LYS A CA  1 
ATOM   1002 C  C   . LYS A 1 132 ? 31.937 5.635  38.469 1.00 15.61 ? 302  LYS A C   1 
ATOM   1003 O  O   . LYS A 1 132 ? 32.280 6.289  37.486 1.00 16.27 ? 302  LYS A O   1 
ATOM   1004 C  CB  . LYS A 1 132 ? 29.528 6.098  37.978 1.00 16.63 ? 302  LYS A CB  1 
ATOM   1005 C  CG  . LYS A 1 132 ? 28.052 5.704  38.111 1.00 21.22 ? 302  LYS A CG  1 
ATOM   1006 C  CD  . LYS A 1 132 ? 27.835 4.433  37.387 1.00 23.37 ? 302  LYS A CD  1 
ATOM   1007 C  CE  . LYS A 1 132 ? 26.367 4.077  37.375 1.00 26.08 ? 302  LYS A CE  1 
ATOM   1008 N  NZ  . LYS A 1 132 ? 26.207 2.763  36.805 1.00 28.64 ? 302  LYS A NZ  1 
ATOM   1009 N  N   . ARG A 1 133 ? 32.798 5.280  39.423 1.00 14.56 ? 303  ARG A N   1 
ATOM   1010 C  CA  . ARG A 1 133 ? 34.154 5.827  39.455 1.00 15.55 ? 303  ARG A CA  1 
ATOM   1011 C  C   . ARG A 1 133 ? 34.837 5.761  38.106 1.00 15.96 ? 303  ARG A C   1 
ATOM   1012 O  O   . ARG A 1 133 ? 35.285 6.782  37.568 1.00 14.77 ? 303  ARG A O   1 
ATOM   1013 C  CB  . ARG A 1 133 ? 34.991 5.070  40.516 1.00 16.94 ? 303  ARG A CB  1 
ATOM   1014 C  CG  . ARG A 1 133 ? 36.463 5.383  40.422 1.00 18.07 ? 303  ARG A CG  1 
ATOM   1015 C  CD  . ARG A 1 133 ? 36.769 6.689  41.096 1.00 25.49 ? 303  ARG A CD  1 
ATOM   1016 N  NE  . ARG A 1 133 ? 36.463 6.613  42.521 1.00 27.37 ? 303  ARG A NE  1 
ATOM   1017 C  CZ  . ARG A 1 133 ? 36.846 7.533  43.416 1.00 26.96 ? 303  ARG A CZ  1 
ATOM   1018 N  NH1 . ARG A 1 133 ? 37.550 8.575  43.024 1.00 25.51 ? 303  ARG A NH1 1 
ATOM   1019 N  NH2 . ARG A 1 133 ? 36.496 7.412  44.684 1.00 28.61 ? 303  ARG A NH2 1 
ATOM   1020 N  N   . ASP A 1 134 ? 34.981 4.552  37.556 1.00 15.15 ? 304  ASP A N   1 
ATOM   1021 C  CA  . ASP A 1 134 ? 35.760 4.478  36.338 1.00 14.36 ? 304  ASP A CA  1 
ATOM   1022 C  C   . ASP A 1 134 ? 35.060 5.132  35.140 1.00 14.31 ? 304  ASP A C   1 
ATOM   1023 O  O   . ASP A 1 134 ? 35.735 5.684  34.244 1.00 16.14 ? 304  ASP A O   1 
ATOM   1024 C  CB  . ASP A 1 134 ? 36.138 3.045  36.044 1.00 14.51 ? 304  ASP A CB  1 
ATOM   1025 C  CG  . ASP A 1 134 ? 37.144 2.566  36.996 1.00 15.87 ? 304  ASP A CG  1 
ATOM   1026 O  OD1 . ASP A 1 134 ? 37.743 3.363  37.747 1.00 15.43 ? 304  ASP A OD1 1 
ATOM   1027 O  OD2 . ASP A 1 134 ? 37.383 1.364  36.998 1.00 16.86 ? 304  ASP A OD2 1 
ATOM   1028 N  N   . TRP A 1 135 ? 33.744 5.040  35.120 1.00 14.11 ? 305  TRP A N   1 
ATOM   1029 C  CA  . TRP A 1 135 ? 32.953 5.695  34.072 1.00 13.59 ? 305  TRP A CA  1 
ATOM   1030 C  C   . TRP A 1 135 ? 33.227 7.204  34.104 1.00 15.63 ? 305  TRP A C   1 
ATOM   1031 O  O   . TRP A 1 135 ? 33.386 7.815  33.043 1.00 17.32 ? 305  TRP A O   1 
ATOM   1032 C  CB  . TRP A 1 135 ? 31.485 5.390  34.318 1.00 15.43 ? 305  TRP A CB  1 
ATOM   1033 C  CG  . TRP A 1 135 ? 30.561 5.926  33.278 1.00 15.73 ? 305  TRP A CG  1 
ATOM   1034 C  CD1 . TRP A 1 135 ? 30.186 5.302  32.098 1.00 18.75 ? 305  TRP A CD1 1 
ATOM   1035 C  CD2 . TRP A 1 135 ? 29.870 7.176  33.297 1.00 17.21 ? 305  TRP A CD2 1 
ATOM   1036 N  NE1 . TRP A 1 135 ? 29.294 6.091  31.406 1.00 20.75 ? 305  TRP A NE1 1 
ATOM   1037 C  CE2 . TRP A 1 135 ? 29.077 7.235  32.124 1.00 18.29 ? 305  TRP A CE2 1 
ATOM   1038 C  CE3 . TRP A 1 135 ? 29.825 8.246  34.199 1.00 16.01 ? 305  TRP A CE3 1 
ATOM   1039 C  CZ2 . TRP A 1 135 ? 28.271 8.342  31.829 1.00 18.59 ? 305  TRP A CZ2 1 
ATOM   1040 C  CZ3 . TRP A 1 135 ? 28.999 9.327  33.901 1.00 15.69 ? 305  TRP A CZ3 1 
ATOM   1041 C  CH2 . TRP A 1 135 ? 28.270 9.361  32.722 1.00 16.47 ? 305  TRP A CH2 1 
ATOM   1042 N  N   . LEU A 1 136 ? 33.336 7.748  35.310 1.00 15.81 ? 306  LEU A N   1 
ATOM   1043 C  CA  . LEU A 1 136 ? 33.635 9.193  35.464 1.00 16.25 ? 306  LEU A CA  1 
ATOM   1044 C  C   . LEU A 1 136 ? 35.083 9.449  35.062 1.00 17.16 ? 306  LEU A C   1 
ATOM   1045 O  O   . LEU A 1 136 ? 35.375 10.362 34.269 1.00 17.66 ? 306  LEU A O   1 
ATOM   1046 C  CB  . LEU A 1 136 ? 33.432 9.633  36.908 1.00 16.85 ? 306  LEU A CB  1 
ATOM   1047 C  CG  . LEU A 1 136 ? 31.990 9.648  37.297 1.00 17.13 ? 306  LEU A CG  1 
ATOM   1048 C  CD1 . LEU A 1 136 ? 31.914 9.733  38.810 1.00 17.59 ? 306  LEU A CD1 1 
ATOM   1049 C  CD2 . LEU A 1 136 ? 31.277 10.837 36.608 1.00 18.17 ? 306  LEU A CD2 1 
ATOM   1050 N  N   . VAL A 1 137 ? 36.021 8.639  35.548 1.00 16.46 ? 307  VAL A N   1 
ATOM   1051 C  CA  . VAL A 1 137 ? 37.413 8.944  35.326 1.00 17.18 ? 307  VAL A CA  1 
ATOM   1052 C  C   . VAL A 1 137 ? 37.742 8.934  33.859 1.00 17.30 ? 307  VAL A C   1 
ATOM   1053 O  O   . VAL A 1 137 ? 38.510 9.794  33.373 1.00 19.24 ? 307  VAL A O   1 
ATOM   1054 C  CB  . VAL A 1 137 ? 38.293 7.948  36.073 1.00 17.54 ? 307  VAL A CB  1 
ATOM   1055 C  CG1 . VAL A 1 137 ? 39.772 8.079  35.645 1.00 18.95 ? 307  VAL A CG1 1 
ATOM   1056 C  CG2 . VAL A 1 137 ? 38.140 8.139  37.551 1.00 18.44 ? 307  VAL A CG2 1 
ATOM   1057 N  N   . LYS A 1 138 ? 37.156 7.982  33.127 1.00 18.59 ? 308  LYS A N   1 
ATOM   1058 C  CA  . LYS A 1 138 ? 37.527 7.800  31.713 1.00 19.70 ? 308  LYS A CA  1 
ATOM   1059 C  C   . LYS A 1 138 ? 37.159 9.049  30.932 1.00 19.55 ? 308  LYS A C   1 
ATOM   1060 O  O   . LYS A 1 138 ? 37.805 9.360  29.936 1.00 22.19 ? 308  LYS A O   1 
ATOM   1061 C  CB  . LYS A 1 138 ? 36.851 6.554  31.112 1.00 21.35 ? 308  LYS A CB  1 
ATOM   1062 C  CG  . LYS A 1 138 ? 37.492 6.026  29.836 0.00 19.81 ? 308  LYS A CG  1 
ATOM   1063 C  CD  . LYS A 1 138 ? 36.882 4.695  29.434 0.00 19.79 ? 308  LYS A CD  1 
ATOM   1064 C  CE  . LYS A 1 138 ? 37.701 4.011  28.349 0.00 19.67 ? 308  LYS A CE  1 
ATOM   1065 N  NZ  . LYS A 1 138 ? 37.128 2.681  27.991 0.00 19.76 ? 308  LYS A NZ  1 
ATOM   1066 N  N   . GLN A 1 139 ? 36.161 9.800  31.390 1.00 17.56 ? 309  GLN A N   1 
ATOM   1067 C  CA  . GLN A 1 139 ? 35.763 11.014 30.659 1.00 18.01 ? 309  GLN A CA  1 
ATOM   1068 C  C   . GLN A 1 139 ? 36.198 12.304 31.367 1.00 16.72 ? 309  GLN A C   1 
ATOM   1069 O  O   . GLN A 1 139 ? 35.604 13.376 31.177 1.00 17.78 ? 309  GLN A O   1 
ATOM   1070 C  CB  . GLN A 1 139 ? 34.265 11.053 30.438 1.00 18.37 ? 309  GLN A CB  1 
ATOM   1071 C  CG  . GLN A 1 139 ? 33.438 11.093 31.725 1.00 17.20 ? 309  GLN A CG  1 
ATOM   1072 C  CD  . GLN A 1 139 ? 31.993 10.846 31.380 1.00 19.43 ? 309  GLN A CD  1 
ATOM   1073 O  OE1 . GLN A 1 139 ? 31.359 11.628 30.644 1.00 20.13 ? 309  GLN A OE1 1 
ATOM   1074 N  NE2 . GLN A 1 139 ? 31.448 9.729  31.880 1.00 19.55 ? 309  GLN A NE2 1 
ATOM   1075 N  N   . ARG A 1 140 ? 37.210 12.169 32.209 1.00 16.38 ? 310  ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 140 ? 37.753 13.318 32.950 1.00 15.27 ? 310  ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 140 ? 36.639 13.950 33.756 1.00 16.14 ? 310  ARG A C   1 
ATOM   1078 O  O   . ARG A 1 140 ? 36.491 15.193 33.848 1.00 17.16 ? 310  ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 140 ? 38.422 14.374 32.034 1.00 15.18 ? 310  ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 140 ? 39.604 13.788 31.258 1.00 15.29 ? 310  ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 140 ? 40.382 14.884 30.547 1.00 15.83 ? 310  ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 140 ? 39.489 15.553 29.594 1.00 14.68 ? 310  ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 140 ? 39.202 15.092 28.375 1.00 16.35 ? 310  ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 140 ? 39.778 13.953 27.942 1.00 17.07 ? 310  ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 140 ? 38.368 15.775 27.595 1.00 16.94 ? 310  ARG A NH2 1 
ATOM   1086 N  N   . GLY A 1 141 ? 35.873 13.070 34.396 1.00 15.88 ? 311  GLY A N   1 
ATOM   1087 C  CA  . GLY A 1 141 ? 34.932 13.485 35.401 1.00 16.74 ? 311  GLY A CA  1 
ATOM   1088 C  C   . GLY A 1 141 ? 33.889 14.459 34.858 1.00 16.56 ? 311  GLY A C   1 
ATOM   1089 O  O   . GLY A 1 141 ? 33.184 14.188 33.855 1.00 18.00 ? 311  GLY A O   1 
ATOM   1090 N  N   . TRP A 1 142 ? 33.864 15.617 35.500 1.00 15.73 ? 312  TRP A N   1 
ATOM   1091 C  CA  . TRP A 1 142 ? 32.834 16.601 35.216 1.00 15.40 ? 312  TRP A CA  1 
ATOM   1092 C  C   . TRP A 1 142 ? 32.982 17.204 33.824 1.00 15.41 ? 312  TRP A C   1 
ATOM   1093 O  O   . TRP A 1 142 ? 32.037 17.840 33.330 1.00 15.37 ? 312  TRP A O   1 
ATOM   1094 C  CB  . TRP A 1 142 ? 32.754 17.637 36.321 1.00 17.96 ? 312  TRP A CB  1 
ATOM   1095 C  CG  . TRP A 1 142 ? 32.228 16.997 37.554 1.00 16.84 ? 312  TRP A CG  1 
ATOM   1096 C  CD1 . TRP A 1 142 ? 32.953 16.382 38.549 1.00 19.19 ? 312  TRP A CD1 1 
ATOM   1097 C  CD2 . TRP A 1 142 ? 30.850 16.912 37.943 1.00 18.83 ? 312  TRP A CD2 1 
ATOM   1098 N  NE1 . TRP A 1 142 ? 32.099 15.891 39.524 1.00 19.16 ? 312  TRP A NE1 1 
ATOM   1099 C  CE2 . TRP A 1 142 ? 30.801 16.203 39.179 1.00 19.49 ? 312  TRP A CE2 1 
ATOM   1100 C  CE3 . TRP A 1 142 ? 29.651 17.328 37.360 1.00 19.22 ? 312  TRP A CE3 1 
ATOM   1101 C  CZ2 . TRP A 1 142 ? 29.597 15.916 39.840 1.00 21.10 ? 312  TRP A CZ2 1 
ATOM   1102 C  CZ3 . TRP A 1 142 ? 28.453 17.077 38.041 1.00 21.19 ? 312  TRP A CZ3 1 
ATOM   1103 C  CH2 . TRP A 1 142 ? 28.436 16.372 39.270 1.00 20.93 ? 312  TRP A CH2 1 
ATOM   1104 N  N   . ASP A 1 143 ? 34.126 16.987 33.173 1.00 14.98 ? 313  ASP A N   1 
ATOM   1105 C  CA  . ASP A 1 143 ? 34.234 17.471 31.777 1.00 13.54 ? 313  ASP A CA  1 
ATOM   1106 C  C   . ASP A 1 143 ? 33.181 16.804 30.944 1.00 13.91 ? 313  ASP A C   1 
ATOM   1107 O  O   . ASP A 1 143 ? 32.588 17.460 30.100 1.00 13.79 ? 313  ASP A O   1 
ATOM   1108 C  CB  . ASP A 1 143 ? 35.586 17.185 31.135 1.00 14.87 ? 313  ASP A CB  1 
ATOM   1109 C  CG  . ASP A 1 143 ? 35.709 17.830 29.768 1.00 17.04 ? 313  ASP A CG  1 
ATOM   1110 O  OD1 . ASP A 1 143 ? 35.303 19.004 29.690 1.00 13.81 ? 313  ASP A OD1 1 
ATOM   1111 O  OD2 . ASP A 1 143 ? 36.159 17.157 28.713 1.00 15.59 ? 313  ASP A OD2 1 
ATOM   1112 N  N   . GLY A 1 144 ? 32.921 15.523 31.174 1.00 13.11 ? 314  GLY A N   1 
ATOM   1113 C  CA  . GLY A 1 144 ? 31.864 14.890 30.377 1.00 15.32 ? 314  GLY A CA  1 
ATOM   1114 C  C   . GLY A 1 144 ? 30.507 15.593 30.555 1.00 14.23 ? 314  GLY A C   1 
ATOM   1115 O  O   . GLY A 1 144 ? 29.720 15.689 29.609 1.00 15.35 ? 314  GLY A O   1 
ATOM   1116 N  N   . PHE A 1 145 ? 30.197 15.973 31.791 1.00 14.05 ? 315  PHE A N   1 
ATOM   1117 C  CA  . PHE A 1 145 ? 28.948 16.684 32.132 1.00 15.02 ? 315  PHE A CA  1 
ATOM   1118 C  C   . PHE A 1 145 ? 28.912 18.047 31.451 1.00 14.64 ? 315  PHE A C   1 
ATOM   1119 O  O   . PHE A 1 145 ? 27.914 18.402 30.809 1.00 15.24 ? 315  PHE A O   1 
ATOM   1120 C  CB  . PHE A 1 145 ? 28.932 16.823 33.639 1.00 14.37 ? 315  PHE A CB  1 
ATOM   1121 C  CG  . PHE A 1 145 ? 27.781 17.623 34.190 1.00 15.74 ? 315  PHE A CG  1 
ATOM   1122 C  CD1 . PHE A 1 145 ? 26.488 17.085 34.275 1.00 17.11 ? 315  PHE A CD1 1 
ATOM   1123 C  CD2 . PHE A 1 145 ? 27.997 18.901 34.632 1.00 16.71 ? 315  PHE A CD2 1 
ATOM   1124 C  CE1 . PHE A 1 145 ? 25.433 17.843 34.837 1.00 18.28 ? 315  PHE A CE1 1 
ATOM   1125 C  CE2 . PHE A 1 145 ? 26.962 19.642 35.196 1.00 18.73 ? 315  PHE A CE2 1 
ATOM   1126 C  CZ  . PHE A 1 145 ? 25.683 19.097 35.306 1.00 18.10 ? 315  PHE A CZ  1 
ATOM   1127 N  N   . VAL A 1 146 ? 29.990 18.821 31.644 1.00 14.29 ? 316  VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 146 ? 30.055 20.153 31.039 1.00 15.92 ? 316  VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 146 ? 29.856 20.076 29.530 1.00 14.76 ? 316  VAL A C   1 
ATOM   1130 O  O   . VAL A 1 146 ? 29.116 20.868 28.970 1.00 16.22 ? 316  VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 146 ? 31.407 20.777 31.375 1.00 15.67 ? 316  VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 146 ? 31.711 22.014 30.529 1.00 18.16 ? 316  VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 146 ? 31.426 21.128 32.846 1.00 18.60 ? 316  VAL A CG2 1 
ATOM   1134 N  N   . GLU A 1 147 ? 30.493 19.111 28.871 1.00 15.32 ? 317  GLU A N   1 
ATOM   1135 C  CA  . GLU A 1 147 ? 30.423 19.108 27.411 1.00 15.32 ? 317  GLU A CA  1 
ATOM   1136 C  C   . GLU A 1 147 ? 29.080 18.572 26.974 1.00 15.67 ? 317  GLU A C   1 
ATOM   1137 O  O   . GLU A 1 147 ? 28.557 19.040 25.980 1.00 16.63 ? 317  GLU A O   1 
ATOM   1138 C  CB  . GLU A 1 147 ? 31.540 18.298 26.813 1.00 15.18 ? 317  GLU A CB  1 
ATOM   1139 C  CG  . GLU A 1 147 ? 32.935 18.871 27.211 1.00 13.18 ? 317  GLU A CG  1 
ATOM   1140 C  CD  . GLU A 1 147 ? 33.169 20.300 26.760 1.00 14.54 ? 317  GLU A CD  1 
ATOM   1141 O  OE1 . GLU A 1 147 ? 32.405 20.803 25.892 1.00 16.73 ? 317  GLU A OE1 1 
ATOM   1142 O  OE2 . GLU A 1 147 ? 34.122 20.943 27.302 1.00 14.32 ? 317  GLU A OE2 1 
ATOM   1143 N  N   . PHE A 1 148 ? 28.542 17.595 27.702 1.00 15.09 ? 318  PHE A N   1 
ATOM   1144 C  CA  . PHE A 1 148 ? 27.275 17.025 27.283 1.00 15.93 ? 318  PHE A CA  1 
ATOM   1145 C  C   . PHE A 1 148 ? 26.185 18.085 27.245 1.00 16.95 ? 318  PHE A C   1 
ATOM   1146 O  O   . PHE A 1 148 ? 25.358 18.097 26.346 1.00 17.75 ? 318  PHE A O   1 
ATOM   1147 C  CB  . PHE A 1 148 ? 26.858 15.876 28.208 1.00 14.95 ? 318  PHE A CB  1 
ATOM   1148 C  CG  . PHE A 1 148 ? 25.614 15.181 27.739 1.00 16.99 ? 318  PHE A CG  1 
ATOM   1149 C  CD1 . PHE A 1 148 ? 25.674 14.412 26.595 1.00 17.99 ? 318  PHE A CD1 1 
ATOM   1150 C  CD2 . PHE A 1 148 ? 24.406 15.351 28.405 1.00 16.56 ? 318  PHE A CD2 1 
ATOM   1151 C  CE1 . PHE A 1 148 ? 24.532 13.759 26.119 1.00 18.33 ? 318  PHE A CE1 1 
ATOM   1152 C  CE2 . PHE A 1 148 ? 23.237 14.711 27.923 1.00 17.82 ? 318  PHE A CE2 1 
ATOM   1153 C  CZ  . PHE A 1 148 ? 23.320 13.936 26.795 1.00 18.83 ? 318  PHE A CZ  1 
ATOM   1154 N  N   . PHE A 1 149 ? 26.214 18.979 28.220 1.00 15.94 ? 319  PHE A N   1 
ATOM   1155 C  CA  . PHE A 1 149 ? 25.176 19.985 28.346 1.00 17.07 ? 319  PHE A CA  1 
ATOM   1156 C  C   . PHE A 1 149 ? 25.633 21.349 27.819 1.00 19.43 ? 319  PHE A C   1 
ATOM   1157 O  O   . PHE A 1 149 ? 24.951 22.324 28.105 1.00 21.24 ? 319  PHE A O   1 
ATOM   1158 C  CB  . PHE A 1 149 ? 24.786 20.072 29.822 1.00 16.70 ? 319  PHE A CB  1 
ATOM   1159 C  CG  . PHE A 1 149 ? 24.066 18.869 30.330 1.00 16.15 ? 319  PHE A CG  1 
ATOM   1160 C  CD1 . PHE A 1 149 ? 24.648 18.070 31.313 1.00 17.78 ? 319  PHE A CD1 1 
ATOM   1161 C  CD2 . PHE A 1 149 ? 22.793 18.551 29.870 1.00 17.55 ? 319  PHE A CD2 1 
ATOM   1162 C  CE1 . PHE A 1 149 ? 23.974 16.976 31.792 1.00 18.35 ? 319  PHE A CE1 1 
ATOM   1163 C  CE2 . PHE A 1 149 ? 22.112 17.438 30.333 1.00 17.63 ? 319  PHE A CE2 1 
ATOM   1164 C  CZ  . PHE A 1 149 ? 22.693 16.657 31.299 1.00 19.15 ? 319  PHE A CZ  1 
ATOM   1165 N  N   . HIS A 1 150 ? 26.753 21.393 27.073 1.00 20.99 ? 320  HIS A N   1 
ATOM   1166 C  CA  . HIS A 1 150 ? 27.369 22.641 26.559 1.00 24.35 ? 320  HIS A CA  1 
ATOM   1167 C  C   . HIS A 1 150 ? 26.473 23.161 25.498 1.00 27.59 ? 320  HIS A C   1 
ATOM   1168 O  O   . HIS A 1 150 ? 26.089 22.407 24.599 1.00 28.47 ? 320  HIS A O   1 
ATOM   1169 C  CB  . HIS A 1 150 ? 28.765 22.351 25.970 1.00 24.46 ? 320  HIS A CB  1 
ATOM   1170 C  CG  . HIS A 1 150 ? 29.492 23.562 25.449 1.00 23.42 ? 320  HIS A CG  1 
ATOM   1171 N  ND1 . HIS A 1 150 ? 29.996 24.547 26.270 1.00 23.69 ? 320  HIS A ND1 1 
ATOM   1172 C  CD2 . HIS A 1 150 ? 29.840 23.910 24.190 1.00 23.13 ? 320  HIS A CD2 1 
ATOM   1173 C  CE1 . HIS A 1 150 ? 30.587 25.480 25.533 1.00 22.40 ? 320  HIS A CE1 1 
ATOM   1174 N  NE2 . HIS A 1 150 ? 30.502 25.114 24.267 1.00 17.57 ? 320  HIS A NE2 1 
ATOM   1175 N  N   . VAL A 1 151 ? 26.128 24.448 25.624 1.00 30.18 ? 321  VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 151 ? 25.310 25.158 24.637 1.00 34.42 ? 321  VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 151 ? 26.127 26.289 24.014 1.00 35.66 ? 321  VAL A C   1 
ATOM   1178 O  O   . VAL A 1 151 ? 26.923 26.946 24.713 1.00 36.47 ? 321  VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 151 ? 23.997 25.700 25.280 1.00 33.74 ? 321  VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 151 ? 23.159 24.548 25.850 1.00 36.40 ? 321  VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 151 ? 24.283 26.751 26.369 1.00 34.88 ? 321  VAL A CG2 1 
ATOM   1182 N  N   . GLU A 1 152 ? 25.951 26.493 22.705 1.00 38.15 ? 322  GLU A N   1 
ATOM   1183 C  CA  . GLU A 1 152 ? 26.613 27.586 21.953 1.00 39.74 ? 322  GLU A CA  1 
ATOM   1184 C  C   . GLU A 1 152 ? 25.686 28.782 21.729 1.00 40.48 ? 322  GLU A C   1 
ATOM   1185 O  O   . GLU A 1 152 ? 24.700 28.965 22.453 1.00 41.98 ? 322  GLU A O   1 
ATOM   1186 C  CB  . GLU A 1 152 ? 27.146 27.108 20.590 1.00 39.86 ? 322  GLU A CB  1 
ATOM   1187 C  CG  . GLU A 1 152 ? 28.071 25.896 20.627 1.00 41.08 ? 322  GLU A CG  1 
ATOM   1188 C  CD  . GLU A 1 152 ? 29.387 26.154 21.364 1.00 41.21 ? 322  GLU A CD  1 
ATOM   1189 O  OE1 . GLU A 1 152 ? 29.649 27.306 21.793 1.00 42.15 ? 322  GLU A OE1 1 
ATOM   1190 O  OE2 . GLU A 1 152 ? 30.178 25.192 21.518 1.00 42.31 ? 322  GLU A OE2 1 
ATOM   1191 N  N   . ARG B 2 3   ? 7.841  -1.098 46.683 1.00 34.79 ? 53   ARG B N   1 
ATOM   1192 C  CA  . ARG B 2 3   ? 7.090  -0.393 45.597 1.00 33.88 ? 53   ARG B CA  1 
ATOM   1193 C  C   . ARG B 2 3   ? 7.326  1.119  45.519 1.00 33.06 ? 53   ARG B C   1 
ATOM   1194 O  O   . ARG B 2 3   ? 7.645  1.587  44.440 1.00 32.81 ? 53   ARG B O   1 
ATOM   1195 C  CB  . ARG B 2 3   ? 5.590  -0.707 45.610 1.00 35.12 ? 53   ARG B CB  1 
ATOM   1196 C  CG  . ARG B 2 3   ? 4.804  -0.083 44.440 1.00 35.24 ? 53   ARG B CG  1 
ATOM   1197 C  CD  . ARG B 2 3   ? 5.060  -0.795 43.119 0.00 35.19 ? 53   ARG B CD  1 
ATOM   1198 N  NE  . ARG B 2 3   ? 4.048  -0.454 42.121 0.00 34.89 ? 53   ARG B NE  1 
ATOM   1199 C  CZ  . ARG B 2 3   ? 4.088  -0.822 40.843 0.00 34.96 ? 53   ARG B CZ  1 
ATOM   1200 N  NH1 . ARG B 2 3   ? 5.101  -1.546 40.380 0.00 34.81 ? 53   ARG B NH1 1 
ATOM   1201 N  NH2 . ARG B 2 3   ? 3.112  -0.461 40.022 0.00 34.63 ? 53   ARG B NH2 1 
ATOM   1202 N  N   . PRO B 2 4   ? 7.117  1.891  46.620 1.00 31.74 ? 54   PRO B N   1 
ATOM   1203 C  CA  . PRO B 2 4   ? 7.405  3.349  46.540 1.00 30.72 ? 54   PRO B CA  1 
ATOM   1204 C  C   . PRO B 2 4   ? 8.793  3.656  45.958 1.00 29.54 ? 54   PRO B C   1 
ATOM   1205 O  O   . PRO B 2 4   ? 8.905  4.485  45.055 1.00 28.17 ? 54   PRO B O   1 
ATOM   1206 C  CB  . PRO B 2 4   ? 7.373  3.806  47.995 1.00 31.13 ? 54   PRO B CB  1 
ATOM   1207 C  CG  . PRO B 2 4   ? 6.512  2.817  48.677 1.00 31.25 ? 54   PRO B CG  1 
ATOM   1208 C  CD  . PRO B 2 4   ? 6.596  1.512  47.951 1.00 32.08 ? 54   PRO B CD  1 
ATOM   1209 N  N   . GLU B 2 5   ? 9.834  3.001  46.469 1.00 28.21 ? 55   GLU B N   1 
ATOM   1210 C  CA  . GLU B 2 5   ? 11.185 3.250  45.957 1.00 27.92 ? 55   GLU B CA  1 
ATOM   1211 C  C   . GLU B 2 5   ? 11.301 2.909  44.466 1.00 26.94 ? 55   GLU B C   1 
ATOM   1212 O  O   . GLU B 2 5   ? 11.959 3.633  43.690 1.00 25.32 ? 55   GLU B O   1 
ATOM   1213 C  CB  . GLU B 2 5   ? 12.229 2.513  46.803 1.00 28.56 ? 55   GLU B CB  1 
ATOM   1214 C  CG  . GLU B 2 5   ? 12.386 3.152  48.213 1.00 30.36 ? 55   GLU B CG  1 
ATOM   1215 C  CD  . GLU B 2 5   ? 13.325 2.392  49.146 1.00 30.60 ? 55   GLU B CD  1 
ATOM   1216 O  OE1 . GLU B 2 5   ? 13.950 1.394  48.737 1.00 36.46 ? 55   GLU B OE1 1 
ATOM   1217 O  OE2 . GLU B 2 5   ? 13.425 2.791  50.325 1.00 36.64 ? 55   GLU B OE2 1 
ATOM   1218 N  N   . ILE B 2 6   ? 10.640 1.836  44.052 1.00 25.51 ? 56   ILE B N   1 
ATOM   1219 C  CA  . ILE B 2 6   ? 10.652 1.420  42.652 1.00 25.54 ? 56   ILE B CA  1 
ATOM   1220 C  C   . ILE B 2 6   ? 9.896  2.437  41.773 1.00 25.03 ? 56   ILE B C   1 
ATOM   1221 O  O   . ILE B 2 6   ? 10.347 2.793  40.674 1.00 23.04 ? 56   ILE B O   1 
ATOM   1222 C  CB  . ILE B 2 6   ? 10.075 0.015  42.467 1.00 27.44 ? 56   ILE B CB  1 
ATOM   1223 C  CG1 . ILE B 2 6   ? 10.901 -0.990 43.283 1.00 28.11 ? 56   ILE B CG1 1 
ATOM   1224 C  CG2 . ILE B 2 6   ? 10.071 -0.381 40.987 1.00 28.71 ? 56   ILE B CG2 1 
ATOM   1225 C  CD1 . ILE B 2 6   ? 12.406 -0.912 43.053 1.00 30.49 ? 56   ILE B CD1 1 
ATOM   1226 N  N   . TRP B 2 7   ? 8.756  2.900  42.274 1.00 23.68 ? 57   TRP B N   1 
ATOM   1227 C  CA  . TRP B 2 7   ? 7.991  3.925  41.571 1.00 23.67 ? 57   TRP B CA  1 
ATOM   1228 C  C   . TRP B 2 7   ? 8.879  5.163  41.367 1.00 21.05 ? 57   TRP B C   1 
ATOM   1229 O  O   . TRP B 2 7   ? 8.953  5.723  40.259 1.00 21.12 ? 57   TRP B O   1 
ATOM   1230 C  CB  . TRP B 2 7   ? 6.729  4.309  42.375 1.00 26.71 ? 57   TRP B CB  1 
ATOM   1231 C  CG  . TRP B 2 7   ? 5.810  5.234  41.643 1.00 30.94 ? 57   TRP B CG  1 
ATOM   1232 C  CD1 . TRP B 2 7   ? 4.683  4.884  40.936 1.00 35.60 ? 57   TRP B CD1 1 
ATOM   1233 C  CD2 . TRP B 2 7   ? 5.903  6.672  41.561 1.00 33.18 ? 57   TRP B CD2 1 
ATOM   1234 N  NE1 . TRP B 2 7   ? 4.080  6.011  40.415 1.00 37.10 ? 57   TRP B NE1 1 
ATOM   1235 C  CE2 . TRP B 2 7   ? 4.817  7.117  40.768 1.00 36.86 ? 57   TRP B CE2 1 
ATOM   1236 C  CE3 . TRP B 2 7   ? 6.793  7.623  42.081 1.00 33.90 ? 57   TRP B CE3 1 
ATOM   1237 C  CZ2 . TRP B 2 7   ? 4.603  8.474  40.483 1.00 34.79 ? 57   TRP B CZ2 1 
ATOM   1238 C  CZ3 . TRP B 2 7   ? 6.582  8.964  41.795 1.00 34.76 ? 57   TRP B CZ3 1 
ATOM   1239 C  CH2 . TRP B 2 7   ? 5.500  9.377  40.992 1.00 33.38 ? 57   TRP B CH2 1 
ATOM   1240 N  N   . ILE B 2 8   ? 9.539  5.593  42.447 1.00 19.24 ? 58   ILE B N   1 
ATOM   1241 C  CA  . ILE B 2 8   ? 10.379 6.791  42.387 1.00 18.50 ? 58   ILE B CA  1 
ATOM   1242 C  C   . ILE B 2 8   ? 11.498 6.521  41.358 1.00 18.61 ? 58   ILE B C   1 
ATOM   1243 O  O   . ILE B 2 8   ? 11.772 7.337  40.464 1.00 18.04 ? 58   ILE B O   1 
ATOM   1244 C  CB  . ILE B 2 8   ? 10.990 7.184  43.759 1.00 18.47 ? 58   ILE B CB  1 
ATOM   1245 C  CG1 . ILE B 2 8   ? 9.884  7.566  44.771 1.00 19.41 ? 58   ILE B CG1 1 
ATOM   1246 C  CG2 . ILE B 2 8   ? 11.996 8.283  43.595 1.00 18.75 ? 58   ILE B CG2 1 
ATOM   1247 C  CD1 . ILE B 2 8   ? 10.414 7.603  46.222 1.00 21.73 ? 58   ILE B CD1 1 
ATOM   1248 N  N   . ALA B 2 9   ? 12.132 5.356  41.466 1.00 18.07 ? 59   ALA B N   1 
ATOM   1249 C  CA  . ALA B 2 9   ? 13.236 5.072  40.537 1.00 18.31 ? 59   ALA B CA  1 
ATOM   1250 C  C   . ALA B 2 9   ? 12.771 5.024  39.093 1.00 18.55 ? 59   ALA B C   1 
ATOM   1251 O  O   . ALA B 2 9   ? 13.470 5.570  38.215 1.00 19.31 ? 59   ALA B O   1 
ATOM   1252 C  CB  . ALA B 2 9   ? 13.897 3.775  40.916 1.00 17.60 ? 59   ALA B CB  1 
ATOM   1253 N  N   . GLN B 2 10  ? 11.605 4.421  38.827 1.00 18.00 ? 60   GLN B N   1 
ATOM   1254 C  CA  . GLN B 2 10  ? 11.099 4.374  37.471 1.00 20.05 ? 60   GLN B CA  1 
ATOM   1255 C  C   . GLN B 2 10  ? 10.940 5.785  36.907 1.00 19.47 ? 60   GLN B C   1 
ATOM   1256 O  O   . GLN B 2 10  ? 11.304 6.035  35.751 1.00 19.86 ? 60   GLN B O   1 
ATOM   1257 C  CB  . GLN B 2 10  ? 9.780  3.639  37.409 1.00 21.55 ? 60   GLN B CB  1 
ATOM   1258 C  CG  . GLN B 2 10  ? 9.878  2.144  37.415 1.00 28.88 ? 60   GLN B CG  1 
ATOM   1259 C  CD  . GLN B 2 10  ? 8.541  1.503  36.998 1.00 34.88 ? 60   GLN B CD  1 
ATOM   1260 O  OE1 . GLN B 2 10  ? 7.622  2.192  36.530 1.00 39.30 ? 60   GLN B OE1 1 
ATOM   1261 N  NE2 . GLN B 2 10  ? 8.441  0.189  37.157 1.00 39.77 ? 60   GLN B NE2 1 
ATOM   1262 N  N   . GLU B 2 11  ? 10.407 6.693  37.715 1.00 19.35 ? 61   GLU B N   1 
ATOM   1263 C  CA  . GLU B 2 11  ? 10.110 8.057  37.252 1.00 19.33 ? 61   GLU B CA  1 
ATOM   1264 C  C   . GLU B 2 11  ? 11.406 8.829  37.015 1.00 18.85 ? 61   GLU B C   1 
ATOM   1265 O  O   . GLU B 2 11  ? 11.554 9.555  36.016 1.00 18.55 ? 61   GLU B O   1 
ATOM   1266 C  CB  . GLU B 2 11  ? 9.248  8.749  38.315 1.00 20.27 ? 61   GLU B CB  1 
ATOM   1267 C  CG  . GLU B 2 11  ? 8.519  9.949  37.815 1.00 24.54 ? 61   GLU B CG  1 
ATOM   1268 C  CD  . GLU B 2 11  ? 7.421  9.543  36.868 1.00 29.79 ? 61   GLU B CD  1 
ATOM   1269 O  OE1 . GLU B 2 11  ? 6.607  8.665  37.238 1.00 33.32 ? 61   GLU B OE1 1 
ATOM   1270 O  OE2 . GLU B 2 11  ? 7.388  10.080 35.754 1.00 33.69 ? 61   GLU B OE2 1 
ATOM   1271 N  N   . LEU B 2 12  ? 12.360 8.666  37.939 1.00 17.60 ? 62   LEU B N   1 
ATOM   1272 C  CA  . LEU B 2 12  ? 13.663 9.308  37.779 1.00 17.72 ? 62   LEU B CA  1 
ATOM   1273 C  C   . LEU B 2 12  ? 14.357 8.800  36.542 1.00 18.09 ? 62   LEU B C   1 
ATOM   1274 O  O   . LEU B 2 12  ? 14.956 9.568  35.818 1.00 17.61 ? 62   LEU B O   1 
ATOM   1275 C  CB  . LEU B 2 12  ? 14.540 9.086  39.020 1.00 18.71 ? 62   LEU B CB  1 
ATOM   1276 C  CG  . LEU B 2 12  ? 14.090 9.792  40.295 1.00 20.29 ? 62   LEU B CG  1 
ATOM   1277 C  CD1 . LEU B 2 12  ? 14.938 9.318  41.448 1.00 21.16 ? 62   LEU B CD1 1 
ATOM   1278 C  CD2 . LEU B 2 12  ? 14.319 11.296 40.083 1.00 22.85 ? 62   LEU B CD2 1 
ATOM   1279 N  N   . ARG B 2 13  ? 14.332 7.496  36.342 1.00 17.47 ? 63   ARG B N   1 
ATOM   1280 C  CA  . ARG B 2 13  ? 14.959 6.934  35.132 1.00 17.15 ? 63   ARG B CA  1 
ATOM   1281 C  C   . ARG B 2 13  ? 14.279 7.478  33.852 1.00 16.42 ? 63   ARG B C   1 
ATOM   1282 O  O   . ARG B 2 13  ? 14.960 7.862  32.889 1.00 17.59 ? 63   ARG B O   1 
ATOM   1283 C  CB  . ARG B 2 13  ? 14.890 5.409  35.175 1.00 18.09 ? 63   ARG B CB  1 
ATOM   1284 C  CG  . ARG B 2 13  ? 15.607 4.836  33.983 1.00 18.62 ? 63   ARG B CG  1 
ATOM   1285 C  CD  . ARG B 2 13  ? 15.390 3.346  33.922 1.00 18.05 ? 63   ARG B CD  1 
ATOM   1286 N  NE  . ARG B 2 13  ? 16.127 2.638  34.946 1.00 19.16 ? 63   ARG B NE  1 
ATOM   1287 C  CZ  . ARG B 2 13  ? 15.870 1.393  35.301 1.00 19.82 ? 63   ARG B CZ  1 
ATOM   1288 N  NH1 . ARG B 2 13  ? 14.892 0.703  34.700 1.00 22.34 ? 63   ARG B NH1 1 
ATOM   1289 N  NH2 . ARG B 2 13  ? 16.605 0.832  36.249 1.00 18.75 ? 63   ARG B NH2 1 
ATOM   1290 N  N   . ARG B 2 14  ? 12.940 7.510  33.832 1.00 16.42 ? 64   ARG B N   1 
ATOM   1291 C  CA  . ARG B 2 14  ? 12.221 8.013  32.663 1.00 17.31 ? 64   ARG B CA  1 
ATOM   1292 C  C   . ARG B 2 14  ? 12.646 9.454  32.378 1.00 16.18 ? 64   ARG B C   1 
ATOM   1293 O  O   . ARG B 2 14  ? 12.964 9.784  31.260 1.00 16.86 ? 64   ARG B O   1 
ATOM   1294 C  CB  . ARG B 2 14  ? 10.722 8.003  32.913 1.00 18.09 ? 64   ARG B CB  1 
ATOM   1295 C  CG  . ARG B 2 14  ? 9.925  8.489  31.714 1.00 18.05 ? 64   ARG B CG  1 
ATOM   1296 C  CD  . ARG B 2 14  ? 8.414  8.594  32.027 1.00 17.69 ? 64   ARG B CD  1 
ATOM   1297 N  NE  . ARG B 2 14  ? 8.062  9.586  33.026 1.00 19.71 ? 64   ARG B NE  1 
ATOM   1298 C  CZ  . ARG B 2 14  ? 7.874  10.882 32.751 1.00 22.18 ? 64   ARG B CZ  1 
ATOM   1299 N  NH1 . ARG B 2 14  ? 8.062  11.311 31.519 1.00 20.83 ? 64   ARG B NH1 1 
ATOM   1300 N  NH2 . ARG B 2 14  ? 7.520  11.732 33.702 1.00 21.39 ? 64   ARG B NH2 1 
ATOM   1301 N  N   . ILE B 2 15  ? 12.600 10.299 33.401 1.00 15.80 ? 65   ILE B N   1 
ATOM   1302 C  CA  . ILE B 2 15  ? 12.939 11.687 33.210 1.00 15.72 ? 65   ILE B CA  1 
ATOM   1303 C  C   . ILE B 2 15  ? 14.421 11.814 32.821 1.00 15.94 ? 65   ILE B C   1 
ATOM   1304 O  O   . ILE B 2 15  ? 14.779 12.586 31.933 1.00 16.72 ? 65   ILE B O   1 
ATOM   1305 C  CB  . ILE B 2 15  ? 12.639 12.484 34.493 1.00 15.45 ? 65   ILE B CB  1 
ATOM   1306 C  CG1 . ILE B 2 15  ? 11.110 12.536 34.656 1.00 17.14 ? 65   ILE B CG1 1 
ATOM   1307 C  CG2 . ILE B 2 15  ? 13.173 13.915 34.385 1.00 18.47 ? 65   ILE B CG2 1 
ATOM   1308 C  CD1 . ILE B 2 15  ? 10.699 12.964 36.069 1.00 19.96 ? 65   ILE B CD1 1 
ATOM   1309 N  N   . GLY B 2 16  ? 15.299 11.046 33.475 1.00 15.91 ? 66   GLY B N   1 
ATOM   1310 C  CA  . GLY B 2 16  ? 16.749 11.139 33.178 1.00 16.04 ? 66   GLY B CA  1 
ATOM   1311 C  C   . GLY B 2 16  ? 17.051 10.784 31.738 1.00 16.05 ? 66   GLY B C   1 
ATOM   1312 O  O   . GLY B 2 16  ? 17.827 11.470 31.076 1.00 17.28 ? 66   GLY B O   1 
ATOM   1313 N  N   . ASP B 2 17  ? 16.477 9.670  31.299 1.00 16.29 ? 67   ASP B N   1 
ATOM   1314 C  CA  . ASP B 2 17  ? 16.706 9.263  29.924 1.00 15.96 ? 67   ASP B CA  1 
ATOM   1315 C  C   . ASP B 2 17  ? 16.092 10.237 28.914 1.00 16.09 ? 67   ASP B C   1 
ATOM   1316 O  O   . ASP B 2 17  ? 16.651 10.488 27.847 1.00 16.87 ? 67   ASP B O   1 
ATOM   1317 C  CB  . ASP B 2 17  ? 16.187 7.843  29.669 1.00 17.10 ? 67   ASP B CB  1 
ATOM   1318 C  CG  . ASP B 2 17  ? 17.093 6.775  30.273 1.00 18.89 ? 67   ASP B CG  1 
ATOM   1319 O  OD1 . ASP B 2 17  ? 18.281 7.083  30.589 1.00 18.41 ? 67   ASP B OD1 1 
ATOM   1320 O  OD2 . ASP B 2 17  ? 16.616 5.635  30.413 1.00 21.53 ? 67   ASP B OD2 1 
ATOM   1321 N  N   . GLU B 2 18  ? 14.918 10.784 29.266 1.00 16.29 ? 68   GLU B N   1 
ATOM   1322 C  CA  . GLU B 2 18  ? 14.312 11.788 28.429 1.00 17.17 ? 68   GLU B CA  1 
ATOM   1323 C  C   . GLU B 2 18  ? 15.235 12.987 28.296 1.00 15.82 ? 68   GLU B C   1 
ATOM   1324 O  O   . GLU B 2 18  ? 15.476 13.490 27.201 1.00 16.83 ? 68   GLU B O   1 
ATOM   1325 C  CB  . GLU B 2 18  ? 13.048 12.232 29.109 1.00 16.65 ? 68   GLU B CB  1 
ATOM   1326 C  CG  . GLU B 2 18  ? 12.383 13.369 28.357 1.00 18.03 ? 68   GLU B CG  1 
ATOM   1327 C  CD  . GLU B 2 18  ? 11.486 14.064 29.350 1.00 18.03 ? 68   GLU B CD  1 
ATOM   1328 O  OE1 . GLU B 2 18  ? 11.843 15.174 29.795 1.00 18.86 ? 68   GLU B OE1 1 
ATOM   1329 O  OE2 . GLU B 2 18  ? 10.493 13.409 29.741 1.00 18.22 ? 68   GLU B OE2 1 
ATOM   1330 N  N   . PHE B 2 19  ? 15.731 13.438 29.438 1.00 16.28 ? 69   PHE B N   1 
ATOM   1331 C  CA  . PHE B 2 19  ? 16.558 14.638 29.455 1.00 16.43 ? 69   PHE B CA  1 
ATOM   1332 C  C   . PHE B 2 19  ? 17.891 14.359 28.737 1.00 17.53 ? 69   PHE B C   1 
ATOM   1333 O  O   . PHE B 2 19  ? 18.386 15.191 27.962 1.00 17.36 ? 69   PHE B O   1 
ATOM   1334 C  CB  . PHE B 2 19  ? 16.748 15.063 30.902 1.00 17.00 ? 69   PHE B CB  1 
ATOM   1335 C  CG  . PHE B 2 19  ? 17.161 16.490 31.083 1.00 15.31 ? 69   PHE B CG  1 
ATOM   1336 C  CD1 . PHE B 2 19  ? 16.356 17.547 30.740 1.00 17.00 ? 69   PHE B CD1 1 
ATOM   1337 C  CD2 . PHE B 2 19  ? 18.391 16.775 31.598 1.00 18.09 ? 69   PHE B CD2 1 
ATOM   1338 C  CE1 . PHE B 2 19  ? 16.769 18.855 30.961 1.00 18.57 ? 69   PHE B CE1 1 
ATOM   1339 C  CE2 . PHE B 2 19  ? 18.810 18.064 31.807 1.00 17.41 ? 69   PHE B CE2 1 
ATOM   1340 C  CZ  . PHE B 2 19  ? 18.005 19.114 31.489 1.00 18.51 ? 69   PHE B CZ  1 
ATOM   1341 N  N   . ASN B 2 20  ? 18.414 13.150 28.914 1.00 16.58 ? 70   ASN B N   1 
ATOM   1342 C  CA  . ASN B 2 20  ? 19.600 12.785 28.188 1.00 16.71 ? 70   ASN B CA  1 
ATOM   1343 C  C   . ASN B 2 20  ? 19.362 12.824 26.683 1.00 17.24 ? 70   ASN B C   1 
ATOM   1344 O  O   . ASN B 2 20  ? 20.157 13.380 25.943 1.00 18.14 ? 70   ASN B O   1 
ATOM   1345 C  CB  . ASN B 2 20  ? 20.053 11.390 28.576 1.00 16.84 ? 70   ASN B CB  1 
ATOM   1346 C  CG  . ASN B 2 20  ? 21.525 11.175 28.220 1.00 18.54 ? 70   ASN B CG  1 
ATOM   1347 O  OD1 . ASN B 2 20  ? 22.390 11.659 28.945 1.00 17.41 ? 70   ASN B OD1 1 
ATOM   1348 N  ND2 . ASN B 2 20  ? 21.803 10.542 27.096 1.00 18.98 ? 70   ASN B ND2 1 
ATOM   1349 N  N   . ALA B 2 21  ? 18.240 12.254 26.223 1.00 16.57 ? 71   ALA B N   1 
ATOM   1350 C  CA  . ALA B 2 21  ? 17.970 12.217 24.789 1.00 16.16 ? 71   ALA B CA  1 
ATOM   1351 C  C   . ALA B 2 21  ? 17.803 13.613 24.248 1.00 17.09 ? 71   ALA B C   1 
ATOM   1352 O  O   . ALA B 2 21  ? 18.199 13.881 23.129 1.00 17.77 ? 71   ALA B O   1 
ATOM   1353 C  CB  . ALA B 2 21  ? 16.705 11.412 24.537 1.00 16.39 ? 71   ALA B CB  1 
ATOM   1354 N  N   . TYR B 2 22  ? 17.230 14.483 25.075 1.00 17.34 ? 72   TYR B N   1 
ATOM   1355 C  CA  . TYR B 2 22  ? 16.976 15.849 24.641 1.00 17.45 ? 72   TYR B CA  1 
ATOM   1356 C  C   . TYR B 2 22  ? 18.298 16.506 24.303 1.00 17.68 ? 72   TYR B C   1 
ATOM   1357 O  O   . TYR B 2 22  ? 18.453 17.165 23.254 1.00 17.89 ? 72   TYR B O   1 
ATOM   1358 C  CB  . TYR B 2 22  ? 16.266 16.636 25.742 1.00 18.08 ? 72   TYR B CB  1 
ATOM   1359 C  CG  . TYR B 2 22  ? 15.897 17.997 25.282 1.00 20.24 ? 72   TYR B CG  1 
ATOM   1360 C  CD1 . TYR B 2 22  ? 14.770 18.147 24.487 1.00 20.75 ? 72   TYR B CD1 1 
ATOM   1361 C  CD2 . TYR B 2 22  ? 16.676 19.100 25.586 1.00 23.64 ? 72   TYR B CD2 1 
ATOM   1362 C  CE1 . TYR B 2 22  ? 14.392 19.348 24.004 1.00 24.72 ? 72   TYR B CE1 1 
ATOM   1363 C  CE2 . TYR B 2 22  ? 16.281 20.389 25.078 1.00 24.00 ? 72   TYR B CE2 1 
ATOM   1364 C  CZ  . TYR B 2 22  ? 15.124 20.436 24.285 1.00 22.16 ? 72   TYR B CZ  1 
ATOM   1365 O  OH  . TYR B 2 22  ? 14.586 21.588 23.722 1.00 25.95 ? 72   TYR B OH  1 
ATOM   1366 N  N   . TYR B 2 23  ? 19.280 16.305 25.184 1.00 17.90 ? 73   TYR B N   1 
ATOM   1367 C  CA  . TYR B 2 23  ? 20.593 16.975 24.985 1.00 18.56 ? 73   TYR B CA  1 
ATOM   1368 C  C   . TYR B 2 23  ? 21.497 16.225 24.040 1.00 19.68 ? 73   TYR B C   1 
ATOM   1369 O  O   . TYR B 2 23  ? 22.398 16.820 23.440 1.00 21.06 ? 73   TYR B O   1 
ATOM   1370 C  CB  . TYR B 2 23  ? 21.303 17.225 26.315 1.00 20.11 ? 73   TYR B CB  1 
ATOM   1371 C  CG  . TYR B 2 23  ? 20.854 18.521 26.914 1.00 19.66 ? 73   TYR B CG  1 
ATOM   1372 C  CD1 . TYR B 2 23  ? 19.754 18.543 27.774 1.00 22.62 ? 73   TYR B CD1 1 
ATOM   1373 C  CD2 . TYR B 2 23  ? 21.513 19.726 26.624 1.00 21.13 ? 73   TYR B CD2 1 
ATOM   1374 C  CE1 . TYR B 2 23  ? 19.307 19.736 28.326 1.00 22.51 ? 73   TYR B CE1 1 
ATOM   1375 C  CE2 . TYR B 2 23  ? 21.078 20.930 27.177 1.00 21.92 ? 73   TYR B CE2 1 
ATOM   1376 C  CZ  . TYR B 2 23  ? 19.992 20.918 28.031 1.00 23.52 ? 73   TYR B CZ  1 
ATOM   1377 O  OH  . TYR B 2 23  ? 19.523 22.116 28.555 1.00 26.67 ? 73   TYR B OH  1 
ATOM   1378 N  N   . ALA B 2 24  ? 21.218 14.947 23.850 1.00 20.18 ? 74   ALA B N   1 
ATOM   1379 C  CA  . ALA B 2 24  ? 22.046 14.139 22.973 1.00 23.54 ? 74   ALA B CA  1 
ATOM   1380 C  C   . ALA B 2 24  ? 21.739 14.473 21.521 1.00 25.68 ? 74   ALA B C   1 
ATOM   1381 O  O   . ALA B 2 24  ? 22.556 14.201 20.658 1.00 28.22 ? 74   ALA B O   1 
ATOM   1382 C  CB  . ALA B 2 24  ? 21.848 12.649 23.219 1.00 22.30 ? 74   ALA B CB  1 
ATOM   1383 N  N   . ARG B 2 25  ? 20.551 15.025 21.283 1.00 28.04 ? 75   ARG B N   1 
ATOM   1384 C  CA  . ARG B 2 25  ? 19.999 15.290 19.941 1.00 31.65 ? 75   ARG B CA  1 
ATOM   1385 C  C   . ARG B 2 25  ? 20.673 16.524 19.327 1.00 32.14 ? 75   ARG B C   1 
ATOM   1386 O  O   . ARG B 2 25  ? 21.114 17.435 20.052 1.00 33.88 ? 75   ARG B O   1 
ATOM   1387 C  CB  . ARG B 2 25  ? 18.477 15.488 20.058 1.00 31.36 ? 75   ARG B CB  1 
ATOM   1388 C  CG  . ARG B 2 25  ? 17.702 15.398 18.746 1.00 34.07 ? 75   ARG B CG  1 
ATOM   1389 C  CD  . ARG B 2 25  ? 16.274 15.903 18.947 1.00 33.37 ? 75   ARG B CD  1 
ATOM   1390 N  NE  . ARG B 2 25  ? 15.795 16.006 17.453 0.00 31.20 ? 75   ARG B NE  1 
ATOM   1391 C  CZ  . ARG B 2 25  ? 14.643 16.635 17.240 0.00 43.16 ? 75   ARG B CZ  1 
ATOM   1392 N  NH1 . ARG B 2 25  ? 13.961 17.138 18.260 0.00 45.15 ? 75   ARG B NH1 1 
ATOM   1393 N  NH2 . ARG B 2 25  ? 14.173 16.762 16.007 0.00 44.19 ? 75   ARG B NH2 1 
HETATM 1394 ZN ZN  . ZN  C 3 .   ? 29.711 15.036 56.323 0.80 37.90 ? 1001 ZN  A ZN  1 
HETATM 1395 ZN ZN  . ZN  D 3 .   ? 35.749 19.977 27.957 0.90 14.53 ? 1002 ZN  A ZN  1 
HETATM 1396 ZN ZN  . ZN  E 3 .   ? 13.452 -0.687 38.093 0.50 15.24 ? 1003 ZN  A ZN  1 
HETATM 1397 ZN ZN  . ZN  F 3 .   ? 13.416 -2.441 39.001 0.50 22.14 ? 1004 ZN  A ZN  1 
HETATM 1398 ZN ZN  . ZN  G 3 .   ? 24.441 22.429 56.378 0.50 44.97 ? 1005 ZN  A ZN  1 
HETATM 1399 ZN ZN  . ZN  H 3 .   ? 25.785 19.931 59.092 0.25 35.71 ? 1006 ZN  A ZN  1 
HETATM 1400 CL CL  . CL  I 4 .   ? 26.190 0.000  45.935 0.50 32.01 ? 2001 CL  A CL  1 
HETATM 1401 ZN ZN  . ZN  J 3 .   ? 5.083  8.820  35.781 0.60 24.73 ? 1007 ZN  B ZN  1 
HETATM 1402 O  O   . HOH K 5 .   ? 37.689 17.594 34.782 1.00 21.72 ? 2002 HOH A O   1 
HETATM 1403 O  O   . HOH K 5 .   ? 26.498 2.054  32.079 1.00 22.95 ? 2003 HOH A O   1 
HETATM 1404 O  O   . HOH K 5 .   ? 38.060 19.415 32.876 1.00 18.54 ? 2004 HOH A O   1 
HETATM 1405 O  O   . HOH K 5 .   ? 23.807 4.253  27.458 1.00 35.31 ? 2005 HOH A O   1 
HETATM 1406 O  O   . HOH K 5 .   ? 35.743 4.303  44.274 1.00 31.37 ? 2006 HOH A O   1 
HETATM 1407 O  O   . HOH K 5 .   ? 22.158 6.285  27.621 1.00 21.45 ? 2007 HOH A O   1 
HETATM 1408 O  O   . HOH K 5 .   ? 35.607 20.594 32.087 1.00 17.89 ? 2008 HOH A O   1 
HETATM 1409 O  O   . HOH K 5 .   ? 25.027 3.180  29.523 1.00 20.08 ? 2009 HOH A O   1 
HETATM 1410 O  O   . HOH K 5 .   ? 34.241 1.971  43.088 1.00 21.58 ? 2010 HOH A O   1 
HETATM 1411 O  O   . HOH K 5 .   ? 18.633 -0.308 45.372 1.00 22.01 ? 2011 HOH A O   1 
HETATM 1412 O  O   . HOH K 5 .   ? 30.011 14.363 27.276 1.00 23.13 ? 2012 HOH A O   1 
HETATM 1413 O  O   . HOH K 5 .   ? 11.033 21.028 47.399 1.00 31.22 ? 2013 HOH A O   1 
HETATM 1414 O  O   . HOH K 5 .   ? 27.964 23.141 29.845 1.00 22.28 ? 2014 HOH A O   1 
HETATM 1415 O  O   . HOH K 5 .   ? 20.873 16.255 54.075 1.00 25.13 ? 2015 HOH A O   1 
HETATM 1416 O  O   . HOH K 5 .   ? 25.021 10.742 53.932 1.00 27.09 ? 2016 HOH A O   1 
HETATM 1417 O  O   . HOH K 5 .   ? 3.840  19.354 33.659 1.00 28.16 ? 2017 HOH A O   1 
HETATM 1418 O  O   . HOH K 5 .   ? 13.369 24.761 37.699 1.00 35.02 ? 2018 HOH A O   1 
HETATM 1419 O  O   . HOH K 5 .   ? 30.593 20.131 24.043 1.00 27.16 ? 2019 HOH A O   1 
HETATM 1420 O  O   . HOH K 5 .   ? 17.773 26.568 33.822 1.00 33.83 ? 2020 HOH A O   1 
HETATM 1421 O  O   . HOH K 5 .   ? 24.198 28.636 35.318 1.00 29.47 ? 2021 HOH A O   1 
HETATM 1422 O  O   . HOH K 5 .   ? 24.806 0.262  29.073 1.00 32.10 ? 2022 HOH A O   1 
HETATM 1423 O  O   . HOH K 5 .   ? 16.038 0.309  30.957 1.00 27.79 ? 2023 HOH A O   1 
HETATM 1424 O  O   . HOH K 5 .   ? 13.313 8.333  53.202 1.00 35.78 ? 2024 HOH A O   1 
HETATM 1425 O  O   . HOH K 5 .   ? 24.705 6.848  48.930 1.00 30.20 ? 2025 HOH A O   1 
HETATM 1426 O  O   . HOH K 5 .   ? 22.655 -1.902 30.227 1.00 33.90 ? 2026 HOH A O   1 
HETATM 1427 O  O   . HOH K 5 .   ? 26.426 26.806 31.820 1.00 33.31 ? 2027 HOH A O   1 
HETATM 1428 O  O   . HOH K 5 .   ? 39.466 9.245  40.706 1.00 32.15 ? 2028 HOH A O   1 
HETATM 1429 O  O   . HOH K 5 .   ? 25.591 30.249 37.128 1.00 29.70 ? 2029 HOH A O   1 
HETATM 1430 O  O   . HOH K 5 .   ? 15.375 6.460  54.251 1.00 32.50 ? 2030 HOH A O   1 
HETATM 1431 O  O   . HOH K 5 .   ? 34.511 18.683 48.672 1.00 32.77 ? 2031 HOH A O   1 
HETATM 1432 O  O   . HOH K 5 .   ? 39.559 5.277  37.541 1.00 36.37 ? 2032 HOH A O   1 
HETATM 1433 O  O   . HOH K 5 .   ? 21.999 2.224  48.667 1.00 29.15 ? 2033 HOH A O   1 
HETATM 1434 O  O   . HOH K 5 .   ? 20.560 24.795 28.563 1.00 36.32 ? 2034 HOH A O   1 
HETATM 1435 O  O   . HOH K 5 .   ? 10.610 24.314 37.990 1.00 52.23 ? 2035 HOH A O   1 
HETATM 1436 O  O   . HOH K 5 .   ? 27.948 3.693  29.872 1.00 35.81 ? 2036 HOH A O   1 
HETATM 1437 O  O   . HOH K 5 .   ? 22.836 0.069  40.026 1.00 13.33 ? 2037 HOH A O   1 
HETATM 1438 O  O   . HOH K 5 .   ? 24.434 31.730 42.901 1.00 60.87 ? 2038 HOH A O   1 
HETATM 1439 O  O   . HOH K 5 .   ? 5.587  16.758 36.147 1.00 26.07 ? 2039 HOH A O   1 
HETATM 1440 O  O   . HOH K 5 .   ? 26.190 0.000  34.941 0.50 21.45 ? 2040 HOH A O   1 
HETATM 1441 O  O   . HOH K 5 .   ? 34.654 4.766  27.148 1.00 62.05 ? 2041 HOH A O   1 
HETATM 1442 O  O   . HOH K 5 .   ? 38.606 12.669 36.642 0.50 19.29 ? 2042 HOH A O   1 
HETATM 1443 O  O   . HOH K 5 .   ? 15.851 8.909  51.792 1.00 25.44 ? 2043 HOH A O   1 
HETATM 1444 O  O   . HOH K 5 .   ? 24.063 1.840  35.347 1.00 21.09 ? 2044 HOH A O   1 
HETATM 1445 O  O   . HOH K 5 .   ? 33.367 3.576  30.985 1.00 27.16 ? 2045 HOH A O   1 
HETATM 1446 O  O   . HOH K 5 .   ? 20.844 2.882  51.182 1.00 32.60 ? 2046 HOH A O   1 
HETATM 1447 O  O   . HOH K 5 .   ? 15.407 22.239 43.835 1.00 33.29 ? 2047 HOH A O   1 
HETATM 1448 O  O   . HOH K 5 .   ? 36.139 16.242 37.098 1.00 23.65 ? 2048 HOH A O   1 
HETATM 1449 O  O   . HOH K 5 .   ? 34.315 20.468 34.726 1.00 27.26 ? 2049 HOH A O   1 
HETATM 1450 O  O   . HOH K 5 .   ? 5.319  22.739 31.758 1.00 29.80 ? 2050 HOH A O   1 
HETATM 1451 O  O   . HOH K 5 .   ? 25.209 16.598 23.996 1.00 30.62 ? 2051 HOH A O   1 
HETATM 1452 O  O   . HOH K 5 .   ? 8.339  20.469 47.659 1.00 38.13 ? 2052 HOH A O   1 
HETATM 1453 O  O   . HOH K 5 .   ? 19.925 0.577  52.138 1.00 32.83 ? 2053 HOH A O   1 
HETATM 1454 O  O   . HOH K 5 .   ? 4.722  19.876 36.496 1.00 32.21 ? 2054 HOH A O   1 
HETATM 1455 O  O   . HOH K 5 .   ? 40.274 11.115 42.471 1.00 32.79 ? 2055 HOH A O   1 
HETATM 1456 O  O   . HOH K 5 .   ? 39.282 18.448 36.921 1.00 30.30 ? 2056 HOH A O   1 
HETATM 1457 O  O   . HOH K 5 .   ? 28.109 16.299 23.367 1.00 43.13 ? 2057 HOH A O   1 
HETATM 1458 O  O   . HOH K 5 .   ? 34.792 5.474  46.268 1.00 40.28 ? 2058 HOH A O   1 
HETATM 1459 O  O   . HOH K 5 .   ? 32.146 4.974  29.067 1.00 40.38 ? 2059 HOH A O   1 
HETATM 1460 O  O   . HOH K 5 .   ? 38.986 24.185 33.498 1.00 30.24 ? 2060 HOH A O   1 
HETATM 1461 O  O   . HOH K 5 .   ? 30.251 19.301 51.342 1.00 41.62 ? 2061 HOH A O   1 
HETATM 1462 O  O   . HOH K 5 .   ? 14.546 3.859  54.863 1.00 40.52 ? 2062 HOH A O   1 
HETATM 1463 O  O   . HOH K 5 .   ? 8.724  24.573 31.540 1.00 33.67 ? 2063 HOH A O   1 
HETATM 1464 O  O   . HOH K 5 .   ? 44.917 16.925 44.594 1.00 57.84 ? 2064 HOH A O   1 
HETATM 1465 O  O   . HOH K 5 .   ? 36.989 9.108  49.104 1.00 53.72 ? 2065 HOH A O   1 
HETATM 1466 O  O   . HOH K 5 .   ? 17.769 9.682  59.945 1.00 46.35 ? 2066 HOH A O   1 
HETATM 1467 O  O   . HOH K 5 .   ? 24.449 -1.008 37.094 1.00 34.60 ? 2067 HOH A O   1 
HETATM 1468 O  O   . HOH K 5 .   ? 18.052 6.683  56.267 1.00 35.42 ? 2068 HOH A O   1 
HETATM 1469 O  O   . HOH K 5 .   ? 13.664 27.023 36.839 1.00 38.41 ? 2069 HOH A O   1 
HETATM 1470 O  O   . HOH K 5 .   ? 24.610 20.204 24.763 1.00 35.64 ? 2070 HOH A O   1 
HETATM 1471 O  O   . HOH K 5 .   ? 2.538  15.733 42.641 1.00 48.24 ? 2071 HOH A O   1 
HETATM 1472 O  O   . HOH K 5 .   ? 27.223 20.680 23.314 1.00 68.45 ? 2072 HOH A O   1 
HETATM 1473 O  O   . HOH K 5 .   ? 26.556 7.075  28.612 1.00 47.04 ? 2073 HOH A O   1 
HETATM 1474 O  O   . HOH K 5 .   ? 30.529 17.370 53.422 1.00 39.57 ? 2074 HOH A O   1 
HETATM 1475 O  O   . HOH K 5 .   ? 10.742 22.564 40.562 1.00 39.47 ? 2075 HOH A O   1 
HETATM 1476 O  O   . HOH K 5 .   ? 24.796 2.710  41.259 1.00 36.79 ? 2076 HOH A O   1 
HETATM 1477 O  O   . HOH K 5 .   ? 40.429 15.356 48.493 1.00 51.97 ? 2077 HOH A O   1 
HETATM 1478 O  O   . HOH K 5 .   ? 41.097 9.611  32.635 1.00 51.12 ? 2078 HOH A O   1 
HETATM 1479 O  O   . HOH K 5 .   ? 39.944 24.695 36.004 1.00 41.53 ? 2079 HOH A O   1 
HETATM 1480 O  O   . HOH K 5 .   ? 21.724 31.328 44.521 1.00 68.92 ? 2080 HOH A O   1 
HETATM 1481 O  O   . HOH K 5 .   ? 18.169 25.299 30.772 1.00 39.56 ? 2081 HOH A O   1 
HETATM 1482 O  O   . HOH K 5 .   ? 8.230  20.978 50.398 1.00 50.91 ? 2082 HOH A O   1 
HETATM 1483 O  O   . HOH K 5 .   ? 21.236 27.181 42.233 1.00 37.48 ? 2083 HOH A O   1 
HETATM 1484 O  O   . HOH K 5 .   ? 16.775 1.941  55.599 1.00 43.78 ? 2084 HOH A O   1 
HETATM 1485 O  O   . HOH K 5 .   ? 22.066 19.833 60.502 1.00 23.41 ? 2085 HOH A O   1 
HETATM 1486 O  O   . HOH K 5 .   ? 23.887 6.966  51.430 1.00 48.80 ? 2086 HOH A O   1 
HETATM 1487 O  O   . HOH K 5 .   ? 25.657 30.895 47.954 1.00 53.24 ? 2087 HOH A O   1 
HETATM 1488 O  O   . HOH K 5 .   ? 8.931  16.107 54.891 1.00 41.71 ? 2088 HOH A O   1 
HETATM 1489 O  O   . HOH K 5 .   ? 31.537 0.067  47.393 1.00 25.51 ? 2089 HOH A O   1 
HETATM 1490 O  O   . HOH K 5 .   ? 12.738 23.230 43.245 1.00 44.64 ? 2090 HOH A O   1 
HETATM 1491 O  O   . HOH K 5 .   ? 27.424 26.069 27.408 1.00 37.51 ? 2091 HOH A O   1 
HETATM 1492 O  O   . HOH K 5 .   ? 35.425 3.701  32.273 1.00 37.90 ? 2092 HOH A O   1 
HETATM 1493 O  O   . HOH K 5 .   ? 9.462  13.668 51.628 1.00 37.68 ? 2093 HOH A O   1 
HETATM 1494 O  O   . HOH K 5 .   ? 38.906 15.909 39.991 1.00 48.00 ? 2094 HOH A O   1 
HETATM 1495 O  O   . HOH K 5 .   ? 26.229 26.926 48.126 1.00 44.81 ? 2095 HOH A O   1 
HETATM 1496 O  O   . HOH K 5 .   ? 32.260 13.526 52.691 1.00 42.21 ? 2096 HOH A O   1 
HETATM 1497 O  O   . HOH K 5 .   ? 5.314  22.879 34.576 1.00 47.02 ? 2097 HOH A O   1 
HETATM 1498 O  O   . HOH K 5 .   ? 11.107 5.845  51.074 1.00 47.25 ? 2098 HOH A O   1 
HETATM 1499 O  O   . HOH K 5 .   ? 24.198 16.255 59.814 1.00 41.66 ? 2099 HOH A O   1 
HETATM 1500 O  O   . HOH K 5 .   ? 24.978 31.546 45.698 1.00 47.89 ? 2100 HOH A O   1 
HETATM 1501 O  O   . HOH K 5 .   ? 21.604 29.215 35.624 1.00 36.94 ? 2101 HOH A O   1 
HETATM 1502 O  O   . HOH K 5 .   ? 23.071 23.309 54.600 1.00 27.49 ? 2102 HOH A O   1 
HETATM 1503 O  O   . HOH K 5 .   ? 23.890 24.037 57.992 0.50 37.02 ? 2103 HOH A O   1 
HETATM 1504 O  O   . HOH K 5 .   ? 25.923 23.299 55.230 0.50 45.65 ? 2104 HOH A O   1 
HETATM 1505 O  O   . HOH K 5 .   ? 39.892 21.396 33.494 1.00 16.86 ? 2105 HOH A O   1 
HETATM 1506 O  O   . HOH K 5 .   ? 11.649 -1.606 37.957 1.00 24.25 ? 2106 HOH A O   1 
HETATM 1507 O  O   . HOH K 5 .   ? 12.303 -4.015 40.093 1.00 29.66 ? 2107 HOH A O   1 
HETATM 1508 O  O   . HOH K 5 .   ? 3.398  22.540 41.011 1.00 74.60 ? 2108 HOH A O   1 
HETATM 1509 O  O   . HOH K 5 .   ? 16.314 17.624 59.660 1.00 42.98 ? 2109 HOH A O   1 
HETATM 1510 O  O   . HOH K 5 .   ? 39.902 4.136  35.388 1.00 52.26 ? 2110 HOH A O   1 
HETATM 1511 O  O   . HOH K 5 .   ? 10.128 22.698 49.532 1.00 50.00 ? 2111 HOH A O   1 
HETATM 1512 O  O   . HOH K 5 .   ? 35.817 23.995 29.357 1.00 44.76 ? 2112 HOH A O   1 
HETATM 1513 O  O   . HOH K 5 .   ? 27.373 28.282 46.285 1.00 45.04 ? 2113 HOH A O   1 
HETATM 1514 O  O   . HOH K 5 .   ? 37.750 20.568 44.117 1.00 47.45 ? 2114 HOH A O   1 
HETATM 1515 O  O   . HOH K 5 .   ? 26.166 17.557 58.593 0.50 44.86 ? 2115 HOH A O   1 
HETATM 1516 O  O   . HOH K 5 .   ? 19.926 28.054 40.019 1.00 53.93 ? 2116 HOH A O   1 
HETATM 1517 O  O   . HOH K 5 .   ? 33.099 6.969  30.405 1.00 28.05 ? 2117 HOH A O   1 
HETATM 1518 O  O   . HOH K 5 .   ? 40.701 20.857 36.098 1.00 22.95 ? 2118 HOH A O   1 
HETATM 1519 O  O   . HOH K 5 .   ? 41.154 22.848 37.624 1.00 44.47 ? 2119 HOH A O   1 
HETATM 1520 O  O   . HOH K 5 .   ? 25.338 19.141 22.078 1.00 19.68 ? 2120 HOH A O   1 
HETATM 1521 O  O   . HOH K 5 .   ? 16.733 27.979 40.849 1.00 46.57 ? 2121 HOH A O   1 
HETATM 1522 O  O   . HOH K 5 .   ? 29.744 21.418 21.941 1.00 35.91 ? 2122 HOH A O   1 
HETATM 1523 O  O   . HOH K 5 .   ? 40.549 6.750  40.239 1.00 38.97 ? 2123 HOH A O   1 
HETATM 1524 O  O   . HOH K 5 .   ? 27.791 12.125 27.605 1.00 27.41 ? 2124 HOH A O   1 
HETATM 1525 O  O   . HOH K 5 .   ? 24.906 7.658  26.903 1.00 37.26 ? 2125 HOH A O   1 
HETATM 1526 O  O   . HOH K 5 .   ? 31.691 7.309  48.954 1.00 49.51 ? 2126 HOH A O   1 
HETATM 1527 O  O   . HOH K 5 .   ? 40.027 11.319 38.747 1.00 35.52 ? 2127 HOH A O   1 
HETATM 1528 O  O   . HOH K 5 .   ? 32.467 19.906 49.932 1.00 35.34 ? 2128 HOH A O   1 
HETATM 1529 O  O   . HOH K 5 .   ? 19.104 28.322 35.853 1.00 46.83 ? 2129 HOH A O   1 
HETATM 1530 O  O   . HOH K 5 .   ? 23.148 20.559 20.738 1.00 64.11 ? 2130 HOH A O   1 
HETATM 1531 O  O   . HOH K 5 .   ? 28.904 31.280 46.213 1.00 59.79 ? 2131 HOH A O   1 
HETATM 1532 O  O   . HOH K 5 .   ? 14.932 25.008 40.305 1.00 55.04 ? 2132 HOH A O   1 
HETATM 1533 O  O   . HOH K 5 .   ? 37.566 11.959 49.913 1.00 66.48 ? 2133 HOH A O   1 
HETATM 1534 O  O   . HOH K 5 .   ? 29.561 25.003 28.890 1.00 30.85 ? 2134 HOH A O   1 
HETATM 1535 O  O   . HOH K 5 .   ? 18.235 11.799 43.997 1.00 39.18 ? 2135 HOH A O   1 
HETATM 1536 O  O   . HOH K 5 .   ? 33.101 25.606 43.511 1.00 52.12 ? 2136 HOH A O   1 
HETATM 1537 O  O   . HOH K 5 .   ? 39.241 18.279 44.154 1.00 58.01 ? 2137 HOH A O   1 
HETATM 1538 O  O   . HOH K 5 .   ? 6.364  16.847 50.722 1.00 71.34 ? 2138 HOH A O   1 
HETATM 1539 O  O   . HOH K 5 .   ? 39.088 7.166  48.664 1.00 59.46 ? 2139 HOH A O   1 
HETATM 1540 O  O   . HOH K 5 .   ? 35.418 27.748 43.559 1.00 62.56 ? 2140 HOH A O   1 
HETATM 1541 O  O   . HOH K 5 .   ? 3.954  3.567  44.520 1.00 66.75 ? 2141 HOH A O   1 
HETATM 1542 O  O   . HOH K 5 .   ? 30.134 10.710 28.502 1.00 40.70 ? 2142 HOH A O   1 
HETATM 1543 O  O   . HOH K 5 .   ? 3.090  21.878 37.969 1.00 49.51 ? 2143 HOH A O   1 
HETATM 1544 O  O   . HOH K 5 .   ? 40.156 11.454 34.985 1.00 46.40 ? 2144 HOH A O   1 
HETATM 1545 O  O   . HOH K 5 .   ? 41.760 17.803 45.650 1.00 59.59 ? 2145 HOH A O   1 
HETATM 1546 O  O   . HOH K 5 .   ? 24.533 28.447 49.387 1.00 44.03 ? 2146 HOH A O   1 
HETATM 1547 O  O   . HOH K 5 .   ? 32.541 22.777 49.175 1.00 91.85 ? 2147 HOH A O   1 
HETATM 1548 O  O   . HOH K 5 .   ? 9.650  24.953 48.806 1.00 63.01 ? 2148 HOH A O   1 
HETATM 1549 O  O   . HOH K 5 .   ? 20.437 10.967 62.817 1.00 63.83 ? 2149 HOH A O   1 
HETATM 1550 O  O   . HOH K 5 .   ? 39.912 6.641  44.832 1.00 59.82 ? 2150 HOH A O   1 
HETATM 1551 O  O   . HOH K 5 .   ? 2.966  10.717 45.462 1.00 59.41 ? 2151 HOH A O   1 
HETATM 1552 O  O   . HOH K 5 .   ? 36.312 20.839 48.877 1.00 58.95 ? 2152 HOH A O   1 
HETATM 1553 O  O   . HOH K 5 .   ? 24.148 11.620 58.423 1.00 45.19 ? 2153 HOH A O   1 
HETATM 1554 O  O   . HOH K 5 .   ? 24.231 24.826 21.501 1.00 70.34 ? 2154 HOH A O   1 
HETATM 1555 O  O   . HOH K 5 .   ? 10.876 22.955 45.555 1.00 49.02 ? 2155 HOH A O   1 
HETATM 1556 O  O   . HOH K 5 .   ? 37.321 21.942 40.594 1.00 41.92 ? 2156 HOH A O   1 
HETATM 1557 O  O   . HOH K 5 .   ? 25.300 0.703  40.278 1.00 35.21 ? 2157 HOH A O   1 
HETATM 1558 O  O   . HOH K 5 .   ? 37.761 2.069  32.417 0.50 27.65 ? 2158 HOH A O   1 
HETATM 1559 O  O   . HOH K 5 .   ? 38.317 14.137 36.679 0.50 20.54 ? 2159 HOH A O   1 
HETATM 1560 O  O   . HOH K 5 .   ? 35.474 23.272 31.832 1.00 35.18 ? 2160 HOH A O   1 
HETATM 1561 O  O   . HOH K 5 .   ? 26.887 11.111 25.387 1.00 35.88 ? 2161 HOH A O   1 
HETATM 1562 O  O   . HOH K 5 .   ? 26.579 9.352  28.873 1.00 39.33 ? 2162 HOH A O   1 
HETATM 1563 O  O   . HOH K 5 .   ? 29.743 23.113 20.172 1.00 57.70 ? 2163 HOH A O   1 
HETATM 1564 O  O   . HOH L 5 .   ? 19.567 9.626  22.662 1.00 29.27 ? 1008 HOH B O   1 
HETATM 1565 O  O   . HOH L 5 .   ? 18.191 22.817 30.646 1.00 24.31 ? 1009 HOH B O   1 
HETATM 1566 O  O   . HOH L 5 .   ? 24.352 9.931  25.765 1.00 24.67 ? 1010 HOH B O   1 
HETATM 1567 O  O   . HOH L 5 .   ? 12.991 16.884 28.089 1.00 17.55 ? 1011 HOH B O   1 
HETATM 1568 O  O   . HOH L 5 .   ? 19.989 9.298  25.186 1.00 21.25 ? 1012 HOH B O   1 
HETATM 1569 O  O   . HOH L 5 .   ? 12.401 8.334  29.036 1.00 21.61 ? 1013 HOH B O   1 
HETATM 1570 O  O   . HOH L 5 .   ? 11.401 4.216  33.776 1.00 26.46 ? 1014 HOH B O   1 
HETATM 1571 O  O   . HOH L 5 .   ? 18.618 11.836 21.394 1.00 24.82 ? 1015 HOH B O   1 
HETATM 1572 O  O   . HOH L 5 .   ? 14.095 5.114  30.068 1.00 33.41 ? 1016 HOH B O   1 
HETATM 1573 O  O   . HOH L 5 .   ? 17.660 4.155  28.235 1.00 34.56 ? 1017 HOH B O   1 
HETATM 1574 O  O   . HOH L 5 .   ? 13.783 8.879  26.652 1.00 28.00 ? 1018 HOH B O   1 
HETATM 1575 O  O   . HOH L 5 .   ? 7.019  5.565  38.317 1.00 42.88 ? 1019 HOH B O   1 
HETATM 1576 O  O   . HOH L 5 .   ? 25.171 11.482 28.856 1.00 16.97 ? 1020 HOH B O   1 
HETATM 1577 O  O   . HOH L 5 .   ? 15.451 22.864 29.553 1.00 32.34 ? 1021 HOH B O   1 
HETATM 1578 O  O   . HOH L 5 .   ? 17.792 9.366  36.615 1.00 29.48 ? 1022 HOH B O   1 
HETATM 1579 O  O   . HOH L 5 .   ? 10.033 0.929  48.940 1.00 40.02 ? 1023 HOH B O   1 
HETATM 1580 O  O   . HOH L 5 .   ? 19.212 6.036  27.665 1.00 46.76 ? 1024 HOH B O   1 
HETATM 1581 O  O   . HOH L 5 .   ? 16.519 18.298 21.567 1.00 40.80 ? 1025 HOH B O   1 
HETATM 1582 O  O   . HOH L 5 .   ? 0.673  0.454  40.809 0.50 50.16 ? 1026 HOH B O   1 
HETATM 1583 O  O   . HOH L 5 .   ? 14.575 0.056  46.182 1.00 50.00 ? 1027 HOH B O   1 
HETATM 1584 O  O   . HOH L 5 .   ? 11.238 -1.727 47.170 1.00 64.23 ? 1028 HOH B O   1 
HETATM 1585 O  O   . HOH L 5 .   ? 13.625 -1.979 33.940 0.50 20.61 ? 1029 HOH B O   1 
HETATM 1586 O  O   . HOH L 5 .   ? 18.015 8.357  26.673 1.00 28.61 ? 1030 HOH B O   1 
HETATM 1587 O  O   . HOH L 5 .   ? 11.908 1.803  34.719 1.00 31.02 ? 1031 HOH B O   1 
HETATM 1588 O  O   . HOH L 5 .   ? 7.842  9.785  28.829 1.00 36.92 ? 1032 HOH B O   1 
HETATM 1589 O  O   . HOH L 5 .   ? 7.829  6.009  35.825 1.00 41.94 ? 1033 HOH B O   1 
HETATM 1590 O  O   . HOH L 5 .   ? 6.041  7.309  34.393 1.00 52.45 ? 1034 HOH B O   1 
HETATM 1591 O  O   . HOH L 5 .   ? 13.194 1.482  37.518 1.00 15.23 ? 1035 HOH B O   1 
HETATM 1592 O  O   . HOH L 5 .   ? 15.859 7.623  25.629 1.00 40.23 ? 1036 HOH B O   1 
HETATM 1593 O  O   . HOH L 5 .   ? 14.267 18.675 20.682 1.00 44.60 ? 1037 HOH B O   1 
HETATM 1594 O  O   . HOH L 5 .   ? 24.969 12.974 21.189 1.00 47.43 ? 1038 HOH B O   1 
HETATM 1595 O  O   . HOH L 5 .   ? 13.490 1.347  32.087 1.00 45.31 ? 1039 HOH B O   1 
HETATM 1596 O  O   . HOH L 5 .   ? 17.201 18.825 17.723 1.00 69.94 ? 1040 HOH B O   1 
HETATM 1597 O  O   . HOH L 5 .   ? 19.153 24.024 26.352 1.00 47.92 ? 1041 HOH B O   1 
HETATM 1598 O  O   . HOH L 5 .   ? 16.375 23.614 26.743 1.00 45.79 ? 1042 HOH B O   1 
HETATM 1599 O  O   . HOH L 5 .   ? 18.881 -0.793 28.390 1.00 48.43 ? 1043 HOH B O   1 
HETATM 1600 O  O   . HOH L 5 .   ? 21.227 2.077  26.378 1.00 46.00 ? 1044 HOH B O   1 
HETATM 1601 O  O   . HOH L 5 .   ? 18.513 1.983  27.394 1.00 48.58 ? 1045 HOH B O   1 
HETATM 1602 O  O   . HOH L 5 .   ? 26.397 13.708 23.381 1.00 50.36 ? 1046 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1394 ZN ZN . ZN C . ? 0.6102 0.4610 0.3685 0.0165  -0.0719 -0.0072 1001 ZN A ZN 
1395 ZN ZN . ZN D . ? 0.1505 0.1818 0.2194 -0.0597 -0.0081 0.0356  1002 ZN A ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   171 ?   ?   ?   A . n 
A 1 2   ASP 2   172 172 ASP ASP A . n 
A 1 3   ASP 3   173 173 ASP ASP A . n 
A 1 4   LEU 4   174 174 LEU LEU A . n 
A 1 5   TYR 5   175 175 TYR TYR A . n 
A 1 6   ARG 6   176 176 ARG ARG A . n 
A 1 7   GLN 7   177 177 GLN GLN A . n 
A 1 8   SER 8   178 178 SER SER A . n 
A 1 9   LEU 9   179 179 LEU LEU A . n 
A 1 10  GLU 10  180 180 GLU GLU A . n 
A 1 11  ILE 11  181 181 ILE ILE A . n 
A 1 12  ILE 12  182 182 ILE ILE A . n 
A 1 13  SER 13  183 183 SER SER A . n 
A 1 14  ARG 14  184 184 ARG ARG A . n 
A 1 15  TYR 15  185 185 TYR TYR A . n 
A 1 16  LEU 16  186 186 LEU LEU A . n 
A 1 17  ARG 17  187 187 ARG ARG A . n 
A 1 18  GLU 18  188 188 GLU GLU A . n 
A 1 19  GLN 19  189 189 GLN GLN A . n 
A 1 20  ALA 20  190 190 ALA ALA A . n 
A 1 21  THR 21  191 191 THR THR A . n 
A 1 22  GLY 22  192 192 GLY GLY A . n 
A 1 23  SER 23  193 193 SER SER A . n 
A 1 24  LYS 24  194 ?   ?   ?   A . n 
A 1 25  ASP 25  195 ?   ?   ?   A . n 
A 1 26  SER 26  196 ?   ?   ?   A . n 
A 1 27  LYS 27  197 ?   ?   ?   A . n 
A 1 28  PRO 28  198 ?   ?   ?   A . n 
A 1 29  LEU 29  199 ?   ?   ?   A . n 
A 1 30  GLY 30  200 ?   ?   ?   A . n 
A 1 31  GLU 31  201 ?   ?   ?   A . n 
A 1 32  ALA 32  202 ?   ?   ?   A . n 
A 1 33  GLY 33  203 203 GLY GLY A . n 
A 1 34  ALA 34  204 204 ALA ALA A . n 
A 1 35  ALA 35  205 205 ALA ALA A . n 
A 1 36  GLY 36  206 206 GLY GLY A . n 
A 1 37  ARG 37  207 207 ARG ARG A . n 
A 1 38  ARG 38  208 208 ARG ARG A . n 
A 1 39  ALA 39  209 209 ALA ALA A . n 
A 1 40  LEU 40  210 210 LEU LEU A . n 
A 1 41  GLU 41  211 211 GLU GLU A . n 
A 1 42  THR 42  212 212 THR THR A . n 
A 1 43  LEU 43  213 213 LEU LEU A . n 
A 1 44  ARG 44  214 214 ARG ARG A . n 
A 1 45  ARG 45  215 215 ARG ARG A . n 
A 1 46  VAL 46  216 216 VAL VAL A . n 
A 1 47  GLY 47  217 217 GLY GLY A . n 
A 1 48  ASP 48  218 218 ASP ASP A . n 
A 1 49  GLY 49  219 219 GLY GLY A . n 
A 1 50  VAL 50  220 220 VAL VAL A . n 
A 1 51  GLN 51  221 221 GLN GLN A . n 
A 1 52  ARG 52  222 222 ARG ARG A . n 
A 1 53  ASN 53  223 223 ASN ASN A . n 
A 1 54  HIS 54  224 224 HIS HIS A . n 
A 1 55  GLU 55  225 225 GLU GLU A . n 
A 1 56  THR 56  226 226 THR THR A . n 
A 1 57  ALA 57  227 227 ALA ALA A . n 
A 1 58  PHE 58  228 228 PHE PHE A . n 
A 1 59  GLN 59  229 229 GLN GLN A . n 
A 1 60  GLY 60  230 230 GLY GLY A . n 
A 1 61  MSE 61  231 231 MSE MSE A . n 
A 1 62  LEU 62  232 232 LEU LEU A . n 
A 1 63  ARG 63  233 233 ARG ARG A . n 
A 1 64  LYS 64  234 234 LYS LYS A . n 
A 1 65  LEU 65  235 235 LEU LEU A . n 
A 1 66  ASP 66  236 236 ASP ASP A . n 
A 1 67  ILE 67  237 237 ILE ILE A . n 
A 1 68  LYS 68  238 238 LYS LYS A . n 
A 1 69  ASN 69  239 239 ASN ASN A . n 
A 1 70  GLU 70  240 240 GLU GLU A . n 
A 1 71  ASP 71  241 241 ASP ASP A . n 
A 1 72  ASP 72  242 242 ASP ASP A . n 
A 1 73  VAL 73  243 243 VAL VAL A . n 
A 1 74  LYS 74  244 244 LYS LYS A . n 
A 1 75  SER 75  245 245 SER SER A . n 
A 1 76  LEU 76  246 246 LEU LEU A . n 
A 1 77  SER 77  247 247 SER SER A . n 
A 1 78  ARG 78  248 248 ARG ARG A . n 
A 1 79  VAL 79  249 249 VAL VAL A . n 
A 1 80  MSE 80  250 250 MSE MSE A . n 
A 1 81  ILE 81  251 251 ILE ILE A . n 
A 1 82  HIS 82  252 252 HIS HIS A . n 
A 1 83  VAL 83  253 253 VAL VAL A . n 
A 1 84  PHE 84  254 254 PHE PHE A . n 
A 1 85  SER 85  255 255 SER SER A . n 
A 1 86  ASP 86  256 256 ASP ASP A . n 
A 1 87  GLY 87  257 257 GLY GLY A . n 
A 1 88  VAL 88  258 258 VAL VAL A . n 
A 1 89  THR 89  259 259 THR THR A . n 
A 1 90  ASN 90  260 260 ASN ASN A . n 
A 1 91  TRP 91  261 261 TRP TRP A . n 
A 1 92  GLY 92  262 262 GLY GLY A . n 
A 1 93  ARG 93  263 263 ARG ARG A . n 
A 1 94  ILE 94  264 264 ILE ILE A . n 
A 1 95  VAL 95  265 265 VAL VAL A . n 
A 1 96  THR 96  266 266 THR THR A . n 
A 1 97  LEU 97  267 267 LEU LEU A . n 
A 1 98  ILE 98  268 268 ILE ILE A . n 
A 1 99  SER 99  269 269 SER SER A . n 
A 1 100 PHE 100 270 270 PHE PHE A . n 
A 1 101 GLY 101 271 271 GLY GLY A . n 
A 1 102 ALA 102 272 272 ALA ALA A . n 
A 1 103 PHE 103 273 273 PHE PHE A . n 
A 1 104 VAL 104 274 274 VAL VAL A . n 
A 1 105 ALA 105 275 275 ALA ALA A . n 
A 1 106 LYS 106 276 276 LYS LYS A . n 
A 1 107 HIS 107 277 277 HIS HIS A . n 
A 1 108 LEU 108 278 278 LEU LEU A . n 
A 1 109 LYS 109 279 279 LYS LYS A . n 
A 1 110 THR 110 280 280 THR THR A . n 
A 1 111 ILE 111 281 281 ILE ILE A . n 
A 1 112 ASN 112 282 282 ASN ASN A . n 
A 1 113 GLN 113 283 283 GLN GLN A . n 
A 1 114 GLU 114 284 284 GLU GLU A . n 
A 1 115 SER 115 285 285 SER SER A . n 
A 1 116 CYS 116 286 286 CYS CYS A . n 
A 1 117 ILE 117 287 287 ILE ILE A . n 
A 1 118 GLU 118 288 288 GLU GLU A . n 
A 1 119 PRO 119 289 289 PRO PRO A . n 
A 1 120 LEU 120 290 290 LEU LEU A . n 
A 1 121 ALA 121 291 291 ALA ALA A . n 
A 1 122 GLU 122 292 292 GLU GLU A . n 
A 1 123 SER 123 293 293 SER SER A . n 
A 1 124 ILE 124 294 294 ILE ILE A . n 
A 1 125 THR 125 295 295 THR THR A . n 
A 1 126 ASP 126 296 296 ASP ASP A . n 
A 1 127 VAL 127 297 297 VAL VAL A . n 
A 1 128 LEU 128 298 298 LEU LEU A . n 
A 1 129 VAL 129 299 299 VAL VAL A . n 
A 1 130 ARG 130 300 300 ARG ARG A . n 
A 1 131 THR 131 301 301 THR THR A . n 
A 1 132 LYS 132 302 302 LYS LYS A . n 
A 1 133 ARG 133 303 303 ARG ARG A . n 
A 1 134 ASP 134 304 304 ASP ASP A . n 
A 1 135 TRP 135 305 305 TRP TRP A . n 
A 1 136 LEU 136 306 306 LEU LEU A . n 
A 1 137 VAL 137 307 307 VAL VAL A . n 
A 1 138 LYS 138 308 308 LYS LYS A . n 
A 1 139 GLN 139 309 309 GLN GLN A . n 
A 1 140 ARG 140 310 310 ARG ARG A . n 
A 1 141 GLY 141 311 311 GLY GLY A . n 
A 1 142 TRP 142 312 312 TRP TRP A . n 
A 1 143 ASP 143 313 313 ASP ASP A . n 
A 1 144 GLY 144 314 314 GLY GLY A . n 
A 1 145 PHE 145 315 315 PHE PHE A . n 
A 1 146 VAL 146 316 316 VAL VAL A . n 
A 1 147 GLU 147 317 317 GLU GLU A . n 
A 1 148 PHE 148 318 318 PHE PHE A . n 
A 1 149 PHE 149 319 319 PHE PHE A . n 
A 1 150 HIS 150 320 320 HIS HIS A . n 
A 1 151 VAL 151 321 321 VAL VAL A . n 
A 1 152 GLU 152 322 322 GLU GLU A . n 
A 1 153 ASP 153 323 ?   ?   ?   A . n 
A 1 154 LEU 154 324 ?   ?   ?   A . n 
A 1 155 GLU 155 325 ?   ?   ?   A . n 
A 1 156 GLY 156 326 ?   ?   ?   A . n 
A 1 157 GLY 157 327 ?   ?   ?   A . n 
B 2 1   ASP 1   51  ?   ?   ?   B . n 
B 2 2   MET 2   52  ?   ?   ?   B . n 
B 2 3   ARG 3   53  53  ARG ARG B . n 
B 2 4   PRO 4   54  54  PRO PRO B . n 
B 2 5   GLU 5   55  55  GLU GLU B . n 
B 2 6   ILE 6   56  56  ILE ILE B . n 
B 2 7   TRP 7   57  57  TRP TRP B . n 
B 2 8   ILE 8   58  58  ILE ILE B . n 
B 2 9   ALA 9   59  59  ALA ALA B . n 
B 2 10  GLN 10  60  60  GLN GLN B . n 
B 2 11  GLU 11  61  61  GLU GLU B . n 
B 2 12  LEU 12  62  62  LEU LEU B . n 
B 2 13  ARG 13  63  63  ARG ARG B . n 
B 2 14  ARG 14  64  64  ARG ARG B . n 
B 2 15  ILE 15  65  65  ILE ILE B . n 
B 2 16  GLY 16  66  66  GLY GLY B . n 
B 2 17  ASP 17  67  67  ASP ASP B . n 
B 2 18  GLU 18  68  68  GLU GLU B . n 
B 2 19  PHE 19  69  69  PHE PHE B . n 
B 2 20  ASN 20  70  70  ASN ASN B . n 
B 2 21  ALA 21  71  71  ALA ALA B . n 
B 2 22  TYR 22  72  72  TYR TYR B . n 
B 2 23  TYR 23  73  73  TYR TYR B . n 
B 2 24  ALA 24  74  74  ALA ALA B . n 
B 2 25  ARG 25  75  75  ARG ARG B . n 
B 2 26  ARG 26  76  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1   1001 1   ZN  ZN  A . 
D 3 ZN  1   1002 2   ZN  ZN  A . 
E 3 ZN  1   1003 3   ZN  ZN  A . 
F 3 ZN  1   1004 4   ZN  ZN  A . 
G 3 ZN  1   1005 5   ZN  ZN  A . 
H 3 ZN  1   1006 6   ZN  ZN  A . 
I 4 CL  1   2001 1   CL  CL  A . 
J 3 ZN  1   1007 7   ZN  ZN  B . 
K 5 HOH 1   2002 1   HOH HOH A . 
K 5 HOH 2   2003 3   HOH HOH A . 
K 5 HOH 3   2004 4   HOH HOH A . 
K 5 HOH 4   2005 6   HOH HOH A . 
K 5 HOH 5   2006 7   HOH HOH A . 
K 5 HOH 6   2007 8   HOH HOH A . 
K 5 HOH 7   2008 11  HOH HOH A . 
K 5 HOH 8   2009 14  HOH HOH A . 
K 5 HOH 9   2010 15  HOH HOH A . 
K 5 HOH 10  2011 16  HOH HOH A . 
K 5 HOH 11  2012 17  HOH HOH A . 
K 5 HOH 12  2013 18  HOH HOH A . 
K 5 HOH 13  2014 19  HOH HOH A . 
K 5 HOH 14  2015 20  HOH HOH A . 
K 5 HOH 15  2016 21  HOH HOH A . 
K 5 HOH 16  2017 22  HOH HOH A . 
K 5 HOH 17  2018 25  HOH HOH A . 
K 5 HOH 18  2019 26  HOH HOH A . 
K 5 HOH 19  2020 27  HOH HOH A . 
K 5 HOH 20  2021 28  HOH HOH A . 
K 5 HOH 21  2022 29  HOH HOH A . 
K 5 HOH 22  2023 30  HOH HOH A . 
K 5 HOH 23  2024 31  HOH HOH A . 
K 5 HOH 24  2025 32  HOH HOH A . 
K 5 HOH 25  2026 33  HOH HOH A . 
K 5 HOH 26  2027 35  HOH HOH A . 
K 5 HOH 27  2028 36  HOH HOH A . 
K 5 HOH 28  2029 38  HOH HOH A . 
K 5 HOH 29  2030 39  HOH HOH A . 
K 5 HOH 30  2031 40  HOH HOH A . 
K 5 HOH 31  2032 41  HOH HOH A . 
K 5 HOH 32  2033 42  HOH HOH A . 
K 5 HOH 33  2034 43  HOH HOH A . 
K 5 HOH 34  2035 44  HOH HOH A . 
K 5 HOH 35  2036 45  HOH HOH A . 
K 5 HOH 36  2037 46  HOH HOH A . 
K 5 HOH 37  2038 47  HOH HOH A . 
K 5 HOH 38  2039 48  HOH HOH A . 
K 5 HOH 39  2040 49  HOH HOH A . 
K 5 HOH 40  2041 50  HOH HOH A . 
K 5 HOH 41  2042 51  HOH HOH A . 
K 5 HOH 42  2043 52  HOH HOH A . 
K 5 HOH 43  2044 53  HOH HOH A . 
K 5 HOH 44  2045 54  HOH HOH A . 
K 5 HOH 45  2046 55  HOH HOH A . 
K 5 HOH 46  2047 56  HOH HOH A . 
K 5 HOH 47  2048 57  HOH HOH A . 
K 5 HOH 48  2049 58  HOH HOH A . 
K 5 HOH 49  2050 59  HOH HOH A . 
K 5 HOH 50  2051 61  HOH HOH A . 
K 5 HOH 51  2052 63  HOH HOH A . 
K 5 HOH 52  2053 64  HOH HOH A . 
K 5 HOH 53  2054 65  HOH HOH A . 
K 5 HOH 54  2055 66  HOH HOH A . 
K 5 HOH 55  2056 67  HOH HOH A . 
K 5 HOH 56  2057 68  HOH HOH A . 
K 5 HOH 57  2058 71  HOH HOH A . 
K 5 HOH 58  2059 72  HOH HOH A . 
K 5 HOH 59  2060 73  HOH HOH A . 
K 5 HOH 60  2061 76  HOH HOH A . 
K 5 HOH 61  2062 77  HOH HOH A . 
K 5 HOH 62  2063 78  HOH HOH A . 
K 5 HOH 63  2064 80  HOH HOH A . 
K 5 HOH 64  2065 81  HOH HOH A . 
K 5 HOH 65  2066 82  HOH HOH A . 
K 5 HOH 66  2067 83  HOH HOH A . 
K 5 HOH 67  2068 84  HOH HOH A . 
K 5 HOH 68  2069 85  HOH HOH A . 
K 5 HOH 69  2070 86  HOH HOH A . 
K 5 HOH 70  2071 88  HOH HOH A . 
K 5 HOH 71  2072 89  HOH HOH A . 
K 5 HOH 72  2073 91  HOH HOH A . 
K 5 HOH 73  2074 92  HOH HOH A . 
K 5 HOH 74  2075 93  HOH HOH A . 
K 5 HOH 75  2076 95  HOH HOH A . 
K 5 HOH 76  2077 97  HOH HOH A . 
K 5 HOH 77  2078 98  HOH HOH A . 
K 5 HOH 78  2079 99  HOH HOH A . 
K 5 HOH 79  2080 100 HOH HOH A . 
K 5 HOH 80  2081 101 HOH HOH A . 
K 5 HOH 81  2082 103 HOH HOH A . 
K 5 HOH 82  2083 105 HOH HOH A . 
K 5 HOH 83  2084 107 HOH HOH A . 
K 5 HOH 84  2085 108 HOH HOH A . 
K 5 HOH 85  2086 109 HOH HOH A . 
K 5 HOH 86  2087 110 HOH HOH A . 
K 5 HOH 87  2088 111 HOH HOH A . 
K 5 HOH 88  2089 112 HOH HOH A . 
K 5 HOH 89  2090 113 HOH HOH A . 
K 5 HOH 90  2091 114 HOH HOH A . 
K 5 HOH 91  2092 115 HOH HOH A . 
K 5 HOH 92  2093 118 HOH HOH A . 
K 5 HOH 93  2094 119 HOH HOH A . 
K 5 HOH 94  2095 120 HOH HOH A . 
K 5 HOH 95  2096 121 HOH HOH A . 
K 5 HOH 96  2097 123 HOH HOH A . 
K 5 HOH 97  2098 124 HOH HOH A . 
K 5 HOH 98  2099 125 HOH HOH A . 
K 5 HOH 99  2100 126 HOH HOH A . 
K 5 HOH 100 2101 127 HOH HOH A . 
K 5 HOH 101 2102 128 HOH HOH A . 
K 5 HOH 102 2103 129 HOH HOH A . 
K 5 HOH 103 2104 130 HOH HOH A . 
K 5 HOH 104 2105 131 HOH HOH A . 
K 5 HOH 105 2106 133 HOH HOH A . 
K 5 HOH 106 2107 134 HOH HOH A . 
K 5 HOH 107 2108 135 HOH HOH A . 
K 5 HOH 108 2109 136 HOH HOH A . 
K 5 HOH 109 2110 137 HOH HOH A . 
K 5 HOH 110 2111 138 HOH HOH A . 
K 5 HOH 111 2112 139 HOH HOH A . 
K 5 HOH 112 2113 140 HOH HOH A . 
K 5 HOH 113 2114 141 HOH HOH A . 
K 5 HOH 114 2115 142 HOH HOH A . 
K 5 HOH 115 2116 143 HOH HOH A . 
K 5 HOH 116 2117 144 HOH HOH A . 
K 5 HOH 117 2118 145 HOH HOH A . 
K 5 HOH 118 2119 146 HOH HOH A . 
K 5 HOH 119 2120 147 HOH HOH A . 
K 5 HOH 120 2121 148 HOH HOH A . 
K 5 HOH 121 2122 149 HOH HOH A . 
K 5 HOH 122 2123 150 HOH HOH A . 
K 5 HOH 123 2124 151 HOH HOH A . 
K 5 HOH 124 2125 152 HOH HOH A . 
K 5 HOH 125 2126 154 HOH HOH A . 
K 5 HOH 126 2127 155 HOH HOH A . 
K 5 HOH 127 2128 156 HOH HOH A . 
K 5 HOH 128 2129 157 HOH HOH A . 
K 5 HOH 129 2130 159 HOH HOH A . 
K 5 HOH 130 2131 160 HOH HOH A . 
K 5 HOH 131 2132 161 HOH HOH A . 
K 5 HOH 132 2133 162 HOH HOH A . 
K 5 HOH 133 2134 163 HOH HOH A . 
K 5 HOH 134 2135 165 HOH HOH A . 
K 5 HOH 135 2136 167 HOH HOH A . 
K 5 HOH 136 2137 169 HOH HOH A . 
K 5 HOH 137 2138 170 HOH HOH A . 
K 5 HOH 138 2139 171 HOH HOH A . 
K 5 HOH 139 2140 172 HOH HOH A . 
K 5 HOH 140 2141 173 HOH HOH A . 
K 5 HOH 141 2142 174 HOH HOH A . 
K 5 HOH 142 2143 175 HOH HOH A . 
K 5 HOH 143 2144 176 HOH HOH A . 
K 5 HOH 144 2145 177 HOH HOH A . 
K 5 HOH 145 2146 178 HOH HOH A . 
K 5 HOH 146 2147 179 HOH HOH A . 
K 5 HOH 147 2148 180 HOH HOH A . 
K 5 HOH 148 2149 181 HOH HOH A . 
K 5 HOH 149 2150 182 HOH HOH A . 
K 5 HOH 150 2151 183 HOH HOH A . 
K 5 HOH 151 2152 184 HOH HOH A . 
K 5 HOH 152 2153 186 HOH HOH A . 
K 5 HOH 153 2154 187 HOH HOH A . 
K 5 HOH 154 2155 188 HOH HOH A . 
K 5 HOH 155 2156 190 HOH HOH A . 
K 5 HOH 156 2157 191 HOH HOH A . 
K 5 HOH 157 2158 192 HOH HOH A . 
K 5 HOH 158 2159 196 HOH HOH A . 
K 5 HOH 159 2160 197 HOH HOH A . 
K 5 HOH 160 2161 199 HOH HOH A . 
K 5 HOH 161 2162 200 HOH HOH A . 
K 5 HOH 162 2163 201 HOH HOH A . 
L 5 HOH 1   1008 2   HOH HOH B . 
L 5 HOH 2   1009 5   HOH HOH B . 
L 5 HOH 3   1010 9   HOH HOH B . 
L 5 HOH 4   1011 10  HOH HOH B . 
L 5 HOH 5   1012 12  HOH HOH B . 
L 5 HOH 6   1013 13  HOH HOH B . 
L 5 HOH 7   1014 23  HOH HOH B . 
L 5 HOH 8   1015 24  HOH HOH B . 
L 5 HOH 9   1016 34  HOH HOH B . 
L 5 HOH 10  1017 37  HOH HOH B . 
L 5 HOH 11  1018 60  HOH HOH B . 
L 5 HOH 12  1019 62  HOH HOH B . 
L 5 HOH 13  1020 69  HOH HOH B . 
L 5 HOH 14  1021 70  HOH HOH B . 
L 5 HOH 15  1022 74  HOH HOH B . 
L 5 HOH 16  1023 75  HOH HOH B . 
L 5 HOH 17  1024 79  HOH HOH B . 
L 5 HOH 18  1025 87  HOH HOH B . 
L 5 HOH 19  1026 90  HOH HOH B . 
L 5 HOH 20  1027 94  HOH HOH B . 
L 5 HOH 21  1028 96  HOH HOH B . 
L 5 HOH 22  1029 102 HOH HOH B . 
L 5 HOH 23  1030 104 HOH HOH B . 
L 5 HOH 24  1031 106 HOH HOH B . 
L 5 HOH 25  1032 116 HOH HOH B . 
L 5 HOH 26  1033 117 HOH HOH B . 
L 5 HOH 27  1034 122 HOH HOH B . 
L 5 HOH 28  1035 132 HOH HOH B . 
L 5 HOH 29  1036 153 HOH HOH B . 
L 5 HOH 30  1037 158 HOH HOH B . 
L 5 HOH 31  1038 164 HOH HOH B . 
L 5 HOH 32  1039 166 HOH HOH B . 
L 5 HOH 33  1040 168 HOH HOH B . 
L 5 HOH 34  1041 185 HOH HOH B . 
L 5 HOH 35  1042 189 HOH HOH B . 
L 5 HOH 36  1043 193 HOH HOH B . 
L 5 HOH 37  1044 194 HOH HOH B . 
L 5 HOH 38  1045 195 HOH HOH B . 
L 5 HOH 39  1046 198 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 61 A MSE 231 ? MET SELENOMETHIONINE 
2 A MSE 80 A MSE 250 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA,PQS dimeric   2 
2 software_defined_assembly            PISA     octameric 8 
3 software_defined_assembly            PISA     octameric 8 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1       A,B,C,D,E,F,G,H,I,J,K,L 
2 1,2,3,4 A,B,C,D,E,F,G,H,I,J,K,L 
3 1,2,3,4 A,C,D,E,F,G,H,I,K       
3 5,6,7,8 B,J,L                   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2550  ? 
1 MORE         -162  ? 
1 'SSA (A^2)'  8700  ? 
2 'ABSA (A^2)' 15130 ? 
2 MORE         -1121 ? 
2 'SSA (A^2)'  30490 ? 
3 'ABSA (A^2)' 9840  ? 
3 MORE         -1004 ? 
3 'SSA (A^2)'  35780 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z               1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_655 -x+1,-y,z           -1.0000000000 0.0000000000 0.0000000000 52.3800000000 0.0000000000 
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
3 'crystal symmetry operation' 3_656 -x+1,y,-z+1         -1.0000000000 0.0000000000 0.0000000000 52.3800000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 117.1800000000 
4 'crystal symmetry operation' 4_556 x,-y,-z+1           1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 117.1800000000 
5 'crystal symmetry operation' 5_545 x+1/2,y-1/2,z+1/2   1.0000000000  0.0000000000 0.0000000000 26.1900000000 0.0000000000 
1.0000000000  0.0000000000 -35.0400000000 0.0000000000 0.0000000000 1.0000000000  58.5900000000  
6 'crystal symmetry operation' 6_555 -x+1/2,-y+1/2,z+1/2 -1.0000000000 0.0000000000 0.0000000000 26.1900000000 0.0000000000 
-1.0000000000 0.0000000000 35.0400000000  0.0000000000 0.0000000000 1.0000000000  58.5900000000  
7 'crystal symmetry operation' 7_545 -x+1/2,y-1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 26.1900000000 0.0000000000 
1.0000000000  0.0000000000 -35.0400000000 0.0000000000 0.0000000000 -1.0000000000 58.5900000000  
8 'crystal symmetry operation' 8_555 x+1/2,-y+1/2,-z+1/2 1.0000000000  0.0000000000 0.0000000000 26.1900000000 0.0000000000 
-1.0000000000 0.0000000000 35.0400000000  0.0000000000 0.0000000000 -1.0000000000 58.5900000000  
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CL  2001 ? I CL  . 
2 1 A HOH 2040 ? K HOH . 
3 1 A HOH 2115 ? K HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 O   ? K HOH .   ? A HOH 2106 ? 1_555 113.1 ? 
2  NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 O   ? L HOH .   ? B HOH 1035 ? 1_555 108.9 ? 
3  O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 O   ? L HOH .   ? B HOH 1035 ? 1_555 108.5 ? 
4  NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 100.3 ? 
5  O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 119.6 ? 
6  O   ? L HOH .   ? B HOH 1035 ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 105.8 ? 
7  NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 ZN  ? F ZN  .   ? A ZN  1004 ? 1_555 62.9  ? 
8  O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 ZN  ? F ZN  .   ? A ZN  1004 ? 1_555 67.2  ? 
9  O   ? L HOH .   ? B HOH 1035 ? 1_555 ZN ? E ZN . ? A ZN 1003 ? 1_555 ZN  ? F ZN  .   ? A ZN  1004 ? 1_555 165.4 ? 
10 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 ZN ? E ZN . ? A ZN 1003 ? 1_555 ZN  ? F ZN  .   ? A ZN  1004 ? 1_555 88.0  ? 
11 NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 O   ? K HOH .   ? A HOH 2106 ? 1_555 103.1 ? 
12 NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 O   ? K HOH .   ? A HOH 2107 ? 1_555 123.3 ? 
13 O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 O   ? K HOH .   ? A HOH 2107 ? 1_555 95.7  ? 
14 NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD1 ? A ASP 134 ? A ASP 304  ? 2_655 114.2 ? 
15 O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD1 ? A ASP 134 ? A ASP 304  ? 2_655 111.7 ? 
16 O   ? K HOH .   ? A HOH 2107 ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD1 ? A ASP 134 ? A ASP 304  ? 2_655 106.9 ? 
17 NE2 ? A HIS 82  ? A HIS 252  ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 77.5  ? 
18 O   ? K HOH .   ? A HOH 2106 ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 88.2  ? 
19 O   ? K HOH .   ? A HOH 2107 ? 1_555 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 156.8 ? 
20 OD1 ? A ASP 134 ? A ASP 304  ? 2_655 ZN ? F ZN . ? A ZN 1004 ? 1_555 OD2 ? A ASP 134 ? A ASP 304  ? 2_655 51.0  ? 
21 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 SG  B A CYS 116 ? A CYS 286  ? 1_555 52.9  ? 
22 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2104 ? 1_555 115.1 ? 
23 SG  B A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2104 ? 1_555 148.2 ? 
24 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2103 ? 1_555 125.5 ? 
25 SG  B A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2103 ? 1_555 73.5  ? 
26 O   ? K HOH .   ? A HOH 2104 ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2103 ? 1_555 105.2 ? 
27 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2102 ? 1_555 123.2 ? 
28 SG  B A CYS 116 ? A CYS 286  ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2102 ? 1_555 130.7 ? 
29 O   ? K HOH .   ? A HOH 2104 ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2102 ? 1_555 81.0  ? 
30 O   ? K HOH .   ? A HOH 2103 ? 1_555 ZN ? G ZN . ? A ZN 1005 ? 1_555 O   ? K HOH .   ? A HOH 2102 ? 1_555 97.1  ? 
31 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? H ZN . ? A ZN 1006 ? 1_555 SG  B A CYS 116 ? A CYS 286  ? 1_555 58.6  ? 
32 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? H ZN . ? A ZN 1006 ? 1_555 O   ? K HOH .   ? A HOH 2115 ? 3_656 88.9  ? 
33 SG  B A CYS 116 ? A CYS 286  ? 1_555 ZN ? H ZN . ? A ZN 1006 ? 1_555 O   ? K HOH .   ? A HOH 2115 ? 3_656 123.5 ? 
34 SG  A A CYS 116 ? A CYS 286  ? 1_555 ZN ? H ZN . ? A ZN 1006 ? 1_555 O   ? K HOH .   ? A HOH 2115 ? 1_555 88.5  ? 
35 SG  B A CYS 116 ? A CYS 286  ? 1_555 ZN ? H ZN . ? A ZN 1006 ? 1_555 O   ? K HOH .   ? A HOH 2115 ? 1_555 122.5 ? 
36 O   ? K HOH .   ? A HOH 2115 ? 3_656 ZN ? H ZN . ? A ZN 1006 ? 1_555 O   ? K HOH .   ? A HOH 2115 ? 1_555 1.1   ? 
37 OE2 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OD2 ? A ASP 71  ? A ASP 241  ? 3_656 134.8 ? 
38 OE2 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE1 ? A GLU 122 ? A GLU 292  ? 1_555 52.1  ? 
39 OD2 ? A ASP 71  ? A ASP 241  ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE1 ? A GLU 122 ? A GLU 292  ? 1_555 92.2  ? 
40 OE2 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 O   ? K HOH .   ? A HOH 2099 ? 3_656 115.2 ? 
41 OD2 ? A ASP 71  ? A ASP 241  ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 O   ? K HOH .   ? A HOH 2099 ? 3_656 101.3 ? 
42 OE1 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 O   ? K HOH .   ? A HOH 2099 ? 3_656 109.1 ? 
43 OE2 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OD1 ? A ASP 71  ? A ASP 241  ? 3_656 89.0  ? 
44 OD2 ? A ASP 71  ? A ASP 241  ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OD1 ? A ASP 71  ? A ASP 241  ? 3_656 55.6  ? 
45 OE1 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OD1 ? A ASP 71  ? A ASP 241  ? 3_656 82.3  ? 
46 O   ? K HOH .   ? A HOH 2099 ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OD1 ? A ASP 71  ? A ASP 241  ? 3_656 155.5 ? 
47 OE2 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE2 ? A GLU 70  ? A GLU 240  ? 3_656 98.1  ? 
48 OD2 ? A ASP 71  ? A ASP 241  ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE2 ? A GLU 70  ? A GLU 240  ? 3_656 116.7 ? 
49 OE1 ? A GLU 122 ? A GLU 292  ? 1_555 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE2 ? A GLU 70  ? A GLU 240  ? 3_656 149.6 ? 
50 O   ? K HOH .   ? A HOH 2099 ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE2 ? A GLU 70  ? A GLU 240  ? 3_656 76.0  ? 
51 OD1 ? A ASP 71  ? A ASP 241  ? 3_656 ZN ? C ZN . ? A ZN 1001 ? 1_555 OE2 ? A GLU 70  ? A GLU 240  ? 3_656 105.5 ? 
52 OD1 ? A ASP 143 ? A ASP 313  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE2 ? A GLU 147 ? A GLU 317  ? 1_555 109.3 ? 
53 OD1 ? A ASP 143 ? A ASP 313  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 NE2 ? A HIS 54  ? A HIS 224  ? 8_555 128.2 ? 
54 OE2 ? A GLU 147 ? A GLU 317  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 NE2 ? A HIS 54  ? A HIS 224  ? 8_555 100.5 ? 
55 OD1 ? A ASP 143 ? A ASP 313  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE1 ? B GLU 18  ? B GLU 68   ? 8_555 83.7  ? 
56 OE2 ? A GLU 147 ? A GLU 317  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE1 ? B GLU 18  ? B GLU 68   ? 8_555 153.7 ? 
57 NE2 ? A HIS 54  ? A HIS 224  ? 8_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE1 ? B GLU 18  ? B GLU 68   ? 8_555 87.6  ? 
58 OD1 ? A ASP 143 ? A ASP 313  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE2 ? B GLU 18  ? B GLU 68   ? 8_555 96.4  ? 
59 OE2 ? A GLU 147 ? A GLU 317  ? 1_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE2 ? B GLU 18  ? B GLU 68   ? 8_555 96.9  ? 
60 NE2 ? A HIS 54  ? A HIS 224  ? 8_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE2 ? B GLU 18  ? B GLU 68   ? 8_555 121.2 ? 
61 OE1 ? B GLU 18  ? B GLU 68   ? 8_555 ZN ? D ZN . ? A ZN 1002 ? 1_555 OE2 ? B GLU 18  ? B GLU 68   ? 8_555 58.1  ? 
62 OE1 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 O   ? L HOH .   ? B HOH 1034 ? 1_555 93.9  ? 
63 OE1 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE1 ? A GLU 152 ? A GLU 322  ? 8_455 100.2 ? 
64 O   ? L HOH .   ? B HOH 1034 ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE1 ? A GLU 152 ? A GLU 322  ? 8_455 105.4 ? 
65 OE1 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? A GLU 152 ? A GLU 322  ? 8_455 89.3  ? 
66 O   ? L HOH .   ? B HOH 1034 ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? A GLU 152 ? A GLU 322  ? 8_455 168.5 ? 
67 OE1 ? A GLU 152 ? A GLU 322  ? 8_455 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? A GLU 152 ? A GLU 322  ? 8_455 63.1  ? 
68 OE1 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? B GLU 11  ? B GLU 61   ? 1_555 53.8  ? 
69 O   ? L HOH .   ? B HOH 1034 ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? B GLU 11  ? B GLU 61   ? 1_555 86.7  ? 
70 OE1 ? A GLU 152 ? A GLU 322  ? 8_455 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? B GLU 11  ? B GLU 61   ? 1_555 152.7 ? 
71 OE2 ? A GLU 152 ? A GLU 322  ? 8_455 ZN ? J ZN . ? B ZN 1007 ? 1_555 OE2 ? B GLU 11  ? B GLU 61   ? 1_555 104.1 ? 
72 OE1 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 NE2 ? A HIS 150 ? A HIS 320  ? 8_455 145.8 ? 
73 O   ? L HOH .   ? B HOH 1034 ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 NE2 ? A HIS 150 ? A HIS 320  ? 8_455 94.9  ? 
74 OE1 ? A GLU 152 ? A GLU 322  ? 8_455 ZN ? J ZN . ? B ZN 1007 ? 1_555 NE2 ? A HIS 150 ? A HIS 320  ? 8_455 109.1 ? 
75 OE2 ? A GLU 152 ? A GLU 322  ? 8_455 ZN ? J ZN . ? B ZN 1007 ? 1_555 NE2 ? A HIS 150 ? A HIS 320  ? 8_455 88.6  ? 
76 OE2 ? B GLU 11  ? B GLU 61   ? 1_555 ZN ? J ZN . ? B ZN 1007 ? 1_555 NE2 ? A HIS 150 ? A HIS 320  ? 8_455 93.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-03-27 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-06-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Source and taxonomy'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         21.1054 
_pdbx_refine_tls.origin_y         14.6340 
_pdbx_refine_tls.origin_z         41.2183 
_pdbx_refine_tls.T[1][1]          -0.0190 
_pdbx_refine_tls.T[2][2]          -0.0556 
_pdbx_refine_tls.T[3][3]          -0.0338 
_pdbx_refine_tls.T[1][2]          0.0218 
_pdbx_refine_tls.T[1][3]          0.0046 
_pdbx_refine_tls.T[2][3]          -0.0139 
_pdbx_refine_tls.L[1][1]          1.5437 
_pdbx_refine_tls.L[2][2]          1.1915 
_pdbx_refine_tls.L[3][3]          1.4584 
_pdbx_refine_tls.L[1][2]          0.1293 
_pdbx_refine_tls.L[1][3]          0.3883 
_pdbx_refine_tls.L[2][3]          -0.2469 
_pdbx_refine_tls.S[1][1]          -0.0281 
_pdbx_refine_tls.S[2][2]          -0.0008 
_pdbx_refine_tls.S[3][3]          0.0290 
_pdbx_refine_tls.S[1][2]          -0.1429 
_pdbx_refine_tls.S[1][3]          0.1107 
_pdbx_refine_tls.S[2][3]          0.0233 
_pdbx_refine_tls.S[2][1]          0.1842 
_pdbx_refine_tls.S[3][1]          -0.2472 
_pdbx_refine_tls.S[3][2]          -0.0717 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2 A 152 ALL A 172 A 322 'X-RAY DIFFRACTION' ? 
2 1 B 3 B 25  ALL B 53  B 75  'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0005 ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-2000    .        ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-2000    .        ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
HKL-2000    .        ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
SHELXE      .        ?                ?       ?                 ?                        'model building'  ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HIS 
_pdbx_validate_close_contact.auth_seq_id_1    277 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2088 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH2 B ARG 75 ? ? 1_555 O A HOH 2137 ? ? 8_455 1.93 
2 1 OH  B TYR 72 ? ? 1_555 O A HOH 2144 ? ? 8_455 2.10 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             75 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             75 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.572 
_pdbx_validate_rmsd_bond.bond_target_value         1.460 
_pdbx_validate_rmsd_bond.bond_deviation            0.112 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.017 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     223 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             81.90 
_pdbx_validate_torsion.psi             -18.08 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 171 ? A GLU 1   
2  1 Y 1 A LYS 194 ? A LYS 24  
3  1 Y 1 A ASP 195 ? A ASP 25  
4  1 Y 1 A SER 196 ? A SER 26  
5  1 Y 1 A LYS 197 ? A LYS 27  
6  1 Y 1 A PRO 198 ? A PRO 28  
7  1 Y 1 A LEU 199 ? A LEU 29  
8  1 Y 1 A GLY 200 ? A GLY 30  
9  1 Y 1 A GLU 201 ? A GLU 31  
10 1 Y 1 A ALA 202 ? A ALA 32  
11 1 Y 1 A ASP 323 ? A ASP 153 
12 1 Y 1 A LEU 324 ? A LEU 154 
13 1 Y 1 A GLU 325 ? A GLU 155 
14 1 Y 1 A GLY 326 ? A GLY 156 
15 1 Y 1 A GLY 327 ? A GLY 157 
16 1 Y 1 B ASP 51  ? B ASP 1   
17 1 Y 1 B MET 52  ? B MET 2   
18 1 Y 1 B ARG 76  ? B ARG 26  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'     ZN  
4 'CHLORIDE ION' CL  
5 water          HOH 
#