data_2NQB
# 
_entry.id   2NQB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NQB         
NDB   PD0914       
RCSB  RCSB040172   
WWPDB D_1000040172 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'Xenopus nucleosome structure' unspecified 
PDB 1ID3 'Yeast nucleosome structure'   unspecified 
PDB 2CV5 'Human nucleosome structure'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NQB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Luger, K.'        1 
'Chakravarthy, S.' 2 
# 
_citation.id                        primary 
_citation.title                     'Comparative analysis of nucleosome structures from different species.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chakravarthy, S.' 1 
primary 'Luger, K.'        2 
# 
_cell.entry_id           2NQB 
_cell.length_a           106.143 
_cell.length_b           109.581 
_cell.length_c           182.045 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NQB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'alpha-satellite DNA' 45054.844 2   ? ? ? ? 
2 polymer man 'Histone H3'          15289.904 2   ? ? ? ? 
3 polymer man 'Histone H4'          11390.414 2   ? ? ? ? 
4 polymer man 'Histone H2A'         13257.529 2   ? ? ? ? 
5 polymer man 'Histone H2B'         13680.951 2   ? ? ? ? 
6 water   nat water                 18.015    264 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;ITGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;ITGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
C,G ? 
5 'polypeptide(L)'        no no 
;IPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;IPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 GLY n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   ILE n 
3 2   THR n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  GLY n 
3 11  LEU n 
3 12  GLY n 
3 13  LYS n 
3 14  GLY n 
3 15  GLY n 
3 16  ALA n 
3 17  LYS n 
3 18  ARG n 
3 19  HIS n 
3 20  ARG n 
3 21  LYS n 
3 22  VAL n 
3 23  LEU n 
3 24  ARG n 
3 25  ASP n 
3 26  ASN n 
3 27  ILE n 
3 28  GLN n 
3 29  GLY n 
3 30  ILE n 
3 31  THR n 
3 32  LYS n 
3 33  PRO n 
3 34  ALA n 
3 35  ILE n 
3 36  ARG n 
3 37  ARG n 
3 38  LEU n 
3 39  ALA n 
3 40  ARG n 
3 41  ARG n 
3 42  GLY n 
3 43  GLY n 
3 44  VAL n 
3 45  LYS n 
3 46  ARG n 
3 47  ILE n 
3 48  SER n 
3 49  GLY n 
3 50  LEU n 
3 51  ILE n 
3 52  TYR n 
3 53  GLU n 
3 54  GLU n 
3 55  THR n 
3 56  ARG n 
3 57  GLY n 
3 58  VAL n 
3 59  LEU n 
3 60  LYS n 
3 61  VAL n 
3 62  PHE n 
3 63  LEU n 
3 64  GLU n 
3 65  ASN n 
3 66  VAL n 
3 67  ILE n 
3 68  ARG n 
3 69  ASP n 
3 70  ALA n 
3 71  VAL n 
3 72  THR n 
3 73  TYR n 
3 74  THR n 
3 75  GLU n 
3 76  HIS n 
3 77  ALA n 
3 78  LYS n 
3 79  ARG n 
3 80  LYS n 
3 81  THR n 
3 82  VAL n 
3 83  THR n 
3 84  ALA n 
3 85  MET n 
3 86  ASP n 
3 87  VAL n 
3 88  VAL n 
3 89  TYR n 
3 90  ALA n 
3 91  LEU n 
3 92  LYS n 
3 93  ARG n 
3 94  GLN n 
3 95  GLY n 
3 96  ARG n 
3 97  THR n 
3 98  LEU n 
3 99  TYR n 
3 100 GLY n 
3 101 PHE n 
3 102 GLY n 
3 103 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLY n 
4 7   GLY n 
4 8   LYS n 
4 9   VAL n 
4 10  LYS n 
4 11  GLY n 
4 12  LYS n 
4 13  ALA n 
4 14  LYS n 
4 15  SER n 
4 16  ARG n 
4 17  SER n 
4 18  ASN n 
4 19  ARG n 
4 20  ALA n 
4 21  GLY n 
4 22  LEU n 
4 23  GLN n 
4 24  PHE n 
4 25  PRO n 
4 26  VAL n 
4 27  GLY n 
4 28  ARG n 
4 29  ILE n 
4 30  HIS n 
4 31  ARG n 
4 32  LEU n 
4 33  LEU n 
4 34  ARG n 
4 35  LYS n 
4 36  GLY n 
4 37  ASN n 
4 38  TYR n 
4 39  ALA n 
4 40  GLU n 
4 41  ARG n 
4 42  VAL n 
4 43  GLY n 
4 44  ALA n 
4 45  GLY n 
4 46  ALA n 
4 47  PRO n 
4 48  VAL n 
4 49  TYR n 
4 50  LEU n 
4 51  ALA n 
4 52  ALA n 
4 53  VAL n 
4 54  MET n 
4 55  GLU n 
4 56  TYR n 
4 57  LEU n 
4 58  ALA n 
4 59  ALA n 
4 60  GLU n 
4 61  VAL n 
4 62  LEU n 
4 63  GLU n 
4 64  LEU n 
4 65  ALA n 
4 66  GLY n 
4 67  ASN n 
4 68  ALA n 
4 69  ALA n 
4 70  ARG n 
4 71  ASP n 
4 72  ASN n 
4 73  LYS n 
4 74  LYS n 
4 75  THR n 
4 76  ARG n 
4 77  ILE n 
4 78  ILE n 
4 79  PRO n 
4 80  ARG n 
4 81  HIS n 
4 82  LEU n 
4 83  GLN n 
4 84  LEU n 
4 85  ALA n 
4 86  ILE n 
4 87  ARG n 
4 88  ASN n 
4 89  ASP n 
4 90  GLU n 
4 91  GLU n 
4 92  LEU n 
4 93  ASN n 
4 94  LYS n 
4 95  LEU n 
4 96  LEU n 
4 97  SER n 
4 98  GLY n 
4 99  VAL n 
4 100 THR n 
4 101 ILE n 
4 102 ALA n 
4 103 GLN n 
4 104 GLY n 
4 105 GLY n 
4 106 VAL n 
4 107 LEU n 
4 108 PRO n 
4 109 ASN n 
4 110 ILE n 
4 111 GLN n 
4 112 ALA n 
4 113 VAL n 
4 114 LEU n 
4 115 LEU n 
4 116 PRO n 
4 117 LYS n 
4 118 LYS n 
4 119 THR n 
4 120 GLU n 
4 121 LYS n 
4 122 LYS n 
4 123 ALA n 
5 1   ILE n 
5 2   PRO n 
5 3   PRO n 
5 4   LYS n 
5 5   THR n 
5 6   SER n 
5 7   GLY n 
5 8   LYS n 
5 9   ALA n 
5 10  ALA n 
5 11  LYS n 
5 12  LYS n 
5 13  ALA n 
5 14  GLY n 
5 15  LYS n 
5 16  ALA n 
5 17  GLN n 
5 18  LYS n 
5 19  ASN n 
5 20  ILE n 
5 21  THR n 
5 22  LYS n 
5 23  THR n 
5 24  ASP n 
5 25  LYS n 
5 26  LYS n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  LYS n 
5 31  ARG n 
5 32  LYS n 
5 33  GLU n 
5 34  SER n 
5 35  TYR n 
5 36  ALA n 
5 37  ILE n 
5 38  TYR n 
5 39  ILE n 
5 40  TYR n 
5 41  THR n 
5 42  VAL n 
5 43  LEU n 
5 44  LYS n 
5 45  GLN n 
5 46  VAL n 
5 47  HIS n 
5 48  PRO n 
5 49  ASP n 
5 50  THR n 
5 51  GLY n 
5 52  ILE n 
5 53  SER n 
5 54  SER n 
5 55  LYS n 
5 56  ALA n 
5 57  MET n 
5 58  SER n 
5 59  ILE n 
5 60  MET n 
5 61  ASN n 
5 62  SER n 
5 63  PHE n 
5 64  VAL n 
5 65  ASN n 
5 66  ASP n 
5 67  ILE n 
5 68  PHE n 
5 69  GLU n 
5 70  ARG n 
5 71  ILE n 
5 72  ALA n 
5 73  ALA n 
5 74  GLU n 
5 75  ALA n 
5 76  SER n 
5 77  ARG n 
5 78  LEU n 
5 79  ALA n 
5 80  HIS n 
5 81  TYR n 
5 82  ASN n 
5 83  LYS n 
5 84  ARG n 
5 85  SER n 
5 86  THR n 
5 87  ILE n 
5 88  THR n 
5 89  SER n 
5 90  ARG n 
5 91  GLU n 
5 92  ILE n 
5 93  GLN n 
5 94  THR n 
5 95  ALA n 
5 96  VAL n 
5 97  ARG n 
5 98  LEU n 
5 99  LEU n 
5 100 LEU n 
5 101 PRO n 
5 102 GLY n 
5 103 GLU n 
5 104 LEU n 
5 105 ALA n 
5 106 LYS n 
5 107 HIS n 
5 108 ALA n 
5 109 VAL n 
5 110 SER n 
5 111 GLU n 
5 112 GLY n 
5 113 THR n 
5 114 LYS n 
5 115 ALA n 
5 116 VAL n 
5 117 THR n 
5 118 LYS n 
5 119 TYR n 
5 120 THR n 
5 121 SER n 
5 122 SER n 
5 123 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human       Homo       His3  ? ? ? ? ? ? 'Homo sapiens'            9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'fruit fly' Drosophila His4  ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'fruit fly' Drosophila His2A ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'fruit fly' Drosophila His2B ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 'fruit fly' Drosophila ?     ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H3_DROME  P02299 2 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 ? 
2 UNP H4_DROME  P84040 3 
;TGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
1 ? 
3 UNP H2A_DROME P84051 4 
;SGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
1 ? 
4 UNP H2B_DROME P02283 5 
;PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
1 ? 
5 PDB 2NQB      2NQB   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2NQB A 1 ? 135 ? P02299 1   ? 135 ? 401  535  
2  1 2NQB E 1 ? 135 ? P02299 1   ? 135 ? 601  735  
3  2 2NQB B 2 ? 103 ? P84040 1   ? 102 ? 1    102  
4  2 2NQB F 2 ? 103 ? P84040 1   ? 102 ? 201  302  
5  3 2NQB C 1 ? 123 ? P84051 1   ? 123 ? 802  924  
6  3 2NQB G 1 ? 123 ? P84051 1   ? 123 ? 1002 1124 
7  4 2NQB D 1 ? 123 ? P02283 1   ? 123 ? 1200 1322 
8  4 2NQB H 1 ? 123 ? P02283 1   ? 123 ? 1400 1522 
9  5 2NQB I 1 ? 146 ? 2NQB   1   ? 146 ? 1    146  
10 5 2NQB J 1 ? 146 ? 2NQB   147 ? 292 ? 147  292  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 2NQB ILE B 1  ? UNP P84040 ?   ?  'EXPRESSION TAG' 0    1 
4 2NQB ILE F 1  ? UNP P84040 ?   ?  'EXPRESSION TAG' 200  2 
7 2NQB ILE D 1  ? UNP P02283 ?   ?  'EXPRESSION TAG' 1200 3 
7 2NQB THR D 41 ? UNP P02283 LYS 40 ENGINEERED       1240 4 
8 2NQB ILE H 1  ? UNP P02283 ?   ?  'EXPRESSION TAG' 1400 5 
8 2NQB THR H 41 ? UNP P02283 LYS 40 ENGINEERED       1440 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2NQB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
;Constituents of the crystallization buffer: Potassium Chloride, Manganese Chloride, and Potassium Cacodylate., pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'Potassium Chloride'   ? ? ? 
1 2 1 'Manganese Chloride'   ? ? ? 
1 3 1 'Potassium Cacodylate' ? ? ? 
1 4 1 H2O                    ? ? ? 
1 5 2 'Potassium Chloride'   ? ? ? 
1 6 2 'Manganese Chloride'   ? ? ? 
1 7 2 'Potassium Cacodylate' ? ? ? 
1 8 2 H2O                    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     2NQB 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.3 
_reflns.d_resolution_low             99 
_reflns.number_all                   94877 
_reflns.number_obs                   93949 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.35 
_reflns_shell.percent_possible_all   85 
_reflns_shell.Rmerge_I_obs           0.302 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5358 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NQB 
_refine.ls_d_res_high                            2.3 
_refine.ls_d_res_low                             99 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     94877 
_refine.ls_number_reflns_obs                     91209 
_refine.ls_number_reflns_R_free                  2267 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2233 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -3.473 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            5.934 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            -2.461 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6050 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             264 
_refine_hist.number_atoms_total               12294 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.005735 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 0.95646  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param ? 'X-RAY DIFFRACTION' 
3 water_rep.param   ? 'X-RAY DIFFRACTION' 
4 ion.param         ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NQB 
_struct.title                     'Drosophila Nucleosome Structure' 
_struct.pdbx_descriptor           'HISTONE protein/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NQB 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'Nucleosome, NCP, chromatin, histone, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;Each nucleosome has two copies each of histones H2A, H2B, H3 and H4, 
and a 146 base pairs long palindromic strand of DNA derived from human 
alpha-satellite sequence.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 444  SER A 457  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 463  ASP A 477  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 485  ALA A 514  1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 520  ARG A 531  1 ? 12 
HELX_P HELX_P5  5  ASP D 25  ? ILE D 30  ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6  6  THR D 31  ? GLY D 42  ? THR B 30   GLY B 41   1 ? 12 
HELX_P HELX_P7  7  LEU D 50  ? ALA D 77  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8  8  THR D 83  ? GLN D 94  ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P9  9  SER E 15  ? GLY E 21  ? SER C 816  GLY C 822  1 ? 7  
HELX_P HELX_P10 10 PRO E 25  ? GLY E 36  ? PRO C 826  GLY C 837  1 ? 12 
HELX_P HELX_P11 11 ALA E 44  ? ASN E 72  ? ALA C 845  ASN C 873  1 ? 29 
HELX_P HELX_P12 12 ILE E 78  ? ASN E 88  ? ILE C 879  ASN C 889  1 ? 11 
HELX_P HELX_P13 13 ASP E 89  ? LEU E 96  ? ASP C 890  LEU C 897  1 ? 8  
HELX_P HELX_P14 14 GLN E 111 ? LEU E 115 ? GLN C 912  LEU C 916  5 ? 5  
HELX_P HELX_P15 15 TYR F 35  ? HIS F 47  ? TYR D 1234 HIS D 1246 1 ? 13 
HELX_P HELX_P16 16 SER F 53  ? ASN F 82  ? SER D 1252 ASN D 1281 1 ? 30 
HELX_P HELX_P17 17 THR F 88  ? LEU F 100 ? THR D 1287 LEU D 1299 1 ? 13 
HELX_P HELX_P18 18 PRO F 101 ? SER F 122 ? PRO D 1300 SER D 1321 1 ? 22 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 644  SER E 657  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? LYS G 79  ? ARG E 663  LYS E 679  1 ? 17 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 685  ALA E 714  1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? GLY G 132 ? MET E 720  GLY E 732  1 ? 13 
HELX_P HELX_P23 23 ASP H 25  ? ILE H 30  ? ASP F 224  ILE F 229  5 ? 6  
HELX_P HELX_P24 24 THR H 31  ? GLY H 42  ? THR F 230  GLY F 241  1 ? 12 
HELX_P HELX_P25 25 LEU H 50  ? ALA H 77  ? LEU F 249  ALA F 276  1 ? 28 
HELX_P HELX_P26 26 THR H 83  ? GLN H 94  ? THR F 282  GLN F 293  1 ? 12 
HELX_P HELX_P27 27 SER I 15  ? GLY I 21  ? SER G 1016 GLY G 1022 1 ? 7  
HELX_P HELX_P28 28 PRO I 25  ? GLY I 36  ? PRO G 1026 GLY G 1037 1 ? 12 
HELX_P HELX_P29 29 ALA I 44  ? ASN I 72  ? ALA G 1045 ASN G 1073 1 ? 29 
HELX_P HELX_P30 30 ILE I 78  ? ASN I 88  ? ILE G 1079 ASN G 1089 1 ? 11 
HELX_P HELX_P31 31 ASP I 89  ? LEU I 96  ? ASP G 1090 LEU G 1097 1 ? 8  
HELX_P HELX_P32 32 GLN I 111 ? LEU I 115 ? GLN G 1112 LEU G 1116 5 ? 5  
HELX_P HELX_P33 33 TYR J 35  ? HIS J 47  ? TYR H 1434 HIS H 1446 1 ? 13 
HELX_P HELX_P34 34 SER J 53  ? ASN J 82  ? SER H 1452 ASN H 1481 1 ? 30 
HELX_P HELX_P35 35 THR J 88  ? LEU J 100 ? THR H 1487 LEU H 1499 1 ? 13 
HELX_P HELX_P36 36 PRO J 101 ? SER J 121 ? PRO H 1500 SER H 1520 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog4   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog7   hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog10  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B DA 139 N1 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B DA 139 N6 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog13  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B DG 137 N1 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B DG 137 O6 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog17  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog18  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog21  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B DG 131 N1 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B DG 131 N2 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog27  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B DT 128 O4 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog28  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B DG 125 N2 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog29  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog30  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 25  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog31  hydrog ? ? A DC 26  N3 ? ? ? 1_555 B DG 121 N1 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? A DC 26  N4 ? ? ? 1_555 B DG 121 O6 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 122 N2 ? ? I DC 26  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog35  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog40  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog41  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog42  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B DC 108 N3 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 108 N4 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog57  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DC 101 N4 ? ? I DT 45  J DC 247 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog60  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DA 102 N6 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog63  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog64  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? A DC 49  N3 ? ? ? 1_555 B DG 98  N1 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DC 49  N4 ? ? ? 1_555 B DG 98  O6 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DC 50  N3 ? ? ? 1_555 B DG 97  N1 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DC 50  N4 ? ? ? 1_555 B DG 97  O6 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog77  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? A DA 55  N6 ? ? ? 1_555 B DT 92  O4 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 55  J DT 239 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog82  hydrog ? ? A DA 56  N1 ? ? ? 1_555 B DT 91  N3 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT 91  O4 ? ? I DA 56  J DT 237 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? A DG 58  N1 ? ? ? 1_555 B DC 89  N3 ? ? I DG 58  J DC 235 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog87  hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog88  hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog89  hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog90  hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog106 hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 77  N3 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DG 70  N2 ? ? ? 1_555 B DC 77  O2 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DG 70  O6 ? ? ? 1_555 B DC 77  N4 ? ? I DG 70  J DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog113 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG 71  N1 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N2 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 70  N1 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 70  O6 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 70  N2 ? ? I DC 77  J DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG 58  N1 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG 58  O6 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA 56  N1 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA 56  N6 ? ? I DT 91  J DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog161 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog182 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog183 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 44  O2 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog184 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog185 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 42  N6 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N2 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog190 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog204 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B DA 30  N6 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog214 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 121 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog215 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B DC 25  N3 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 25  O2 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DA 124 N6 ? ? ? 1_555 B DT 23  O4 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DT 128 N3 ? ? ? 1_555 B DA 19  N1 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog223 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog224 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B DC 13  O2 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DG 134 O6 ? ? ? 1_555 B DC 13  N4 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog241 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog244 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 9   O2 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DG 138 O6 ? ? ? 1_555 B DC 9   N4 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC 3   O2 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC 3   N4 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog261 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog262 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 483  PHE A 484  
A 2 THR D 81  ? VAL D 82  ? THR B 80   VAL B 81   
B 1 THR C 118 ? ILE C 119 ? THR A 518  ILE A 519  
B 2 ARG D 46  ? ILE D 47  ? ARG B 45   ILE B 46   
C 1 LEU D 98  ? TYR D 99  ? LEU B 97   TYR B 98   
C 2 THR I 100 ? ILE I 101 ? THR G 1101 ILE G 1102 
D 1 ARG E 41  ? VAL E 42  ? ARG C 842  VAL C 843  
D 2 THR F 86  ? ILE F 87  ? THR D 1285 ILE D 1286 
E 1 ARG E 76  ? ILE E 77  ? ARG C 877  ILE C 878  
E 2 GLY F 51  ? ILE F 52  ? GLY D 1250 ILE D 1251 
F 1 VAL E 99  ? ILE E 101 ? VAL C 900  ILE C 902  
F 2 THR H 97  ? TYR H 99  ? THR F 296  TYR F 298  
G 1 ARG G 83  ? PHE G 84  ? ARG E 683  PHE E 684  
G 2 THR H 81  ? VAL H 82  ? THR F 280  VAL F 281  
H 1 THR G 118 ? ILE G 119 ? THR E 718  ILE E 719  
H 2 ARG H 46  ? ILE H 47  ? ARG F 245  ILE F 246  
I 1 ARG I 41  ? VAL I 42  ? ARG G 1042 VAL G 1043 
I 2 THR J 86  ? ILE J 87  ? THR H 1485 ILE H 1486 
J 1 ARG I 76  ? ILE I 77  ? ARG G 1077 ILE G 1078 
J 2 GLY J 51  ? ILE J 52  ? GLY H 1450 ILE H 1451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 483  O VAL D 82  ? O VAL B 81   
B 1 2 N ILE C 119 ? N ILE A 519  O ARG D 46  ? O ARG B 45   
C 1 2 N TYR D 99  ? N TYR B 98   O THR I 100 ? O THR G 1101 
D 1 2 N ARG E 41  ? N ARG C 842  O ILE F 87  ? O ILE D 1286 
E 1 2 N ILE E 77  ? N ILE C 878  O GLY F 51  ? O GLY D 1250 
F 1 2 N THR E 100 ? N THR C 901  O TYR H 99  ? O TYR F 298  
G 1 2 N ARG G 83  ? N ARG E 683  O VAL H 82  ? O VAL F 281  
H 1 2 N ILE G 119 ? N ILE E 719  O ARG H 46  ? O ARG F 245  
I 1 2 N ARG I 41  ? N ARG G 1042 O ILE J 87  ? O ILE H 1486 
J 1 2 N ILE I 77  ? N ILE G 1078 O GLY J 51  ? O GLY H 1450 
# 
_database_PDB_matrix.entry_id          2NQB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NQB 
_atom_sites.fract_transf_matrix[1][1]   0.009421 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009126 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005493 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DA  A 1 1   ? 51.047  109.291 -93.352 1.00 134.20 ? 1    DA  I "O5'" 1 
ATOM   2     C "C5'" . DA  A 1 1   ? 50.283  109.701 -94.491 1.00 133.58 ? 1    DA  I "C5'" 1 
ATOM   3     C "C4'" . DA  A 1 1   ? 48.982  108.941 -94.607 1.00 133.23 ? 1    DA  I "C4'" 1 
ATOM   4     O "O4'" . DA  A 1 1   ? 49.262  107.533 -94.806 1.00 132.15 ? 1    DA  I "O4'" 1 
ATOM   5     C "C3'" . DA  A 1 1   ? 48.099  109.021 -93.362 1.00 133.60 ? 1    DA  I "C3'" 1 
ATOM   6     O "O3'" . DA  A 1 1   ? 46.718  109.034 -93.729 1.00 135.59 ? 1    DA  I "O3'" 1 
ATOM   7     C "C2'" . DA  A 1 1   ? 48.416  107.732 -92.634 1.00 132.45 ? 1    DA  I "C2'" 1 
ATOM   8     C "C1'" . DA  A 1 1   ? 48.629  106.772 -93.788 1.00 131.37 ? 1    DA  I "C1'" 1 
ATOM   9     N N9    . DA  A 1 1   ? 49.488  105.631 -93.470 1.00 99.21  ? 1    DA  I N9    1 
ATOM   10    C C8    . DA  A 1 1   ? 50.786  105.642 -93.016 1.00 98.65  ? 1    DA  I C8    1 
ATOM   11    N N7    . DA  A 1 1   ? 51.284  104.447 -92.807 1.00 97.82  ? 1    DA  I N7    1 
ATOM   12    C C5    . DA  A 1 1   ? 50.245  103.589 -93.148 1.00 97.40  ? 1    DA  I C5    1 
ATOM   13    C C6    . DA  A 1 1   ? 50.135  102.184 -93.147 1.00 96.55  ? 1    DA  I C6    1 
ATOM   14    N N6    . DA  A 1 1   ? 51.118  101.362 -92.772 1.00 96.04  ? 1    DA  I N6    1 
ATOM   15    N N1    . DA  A 1 1   ? 48.964  101.646 -93.550 1.00 95.89  ? 1    DA  I N1    1 
ATOM   16    C C2    . DA  A 1 1   ? 47.976  102.470 -93.925 1.00 96.40  ? 1    DA  I C2    1 
ATOM   17    N N3    . DA  A 1 1   ? 47.956  103.801 -93.967 1.00 97.07  ? 1    DA  I N3    1 
ATOM   18    C C4    . DA  A 1 1   ? 49.135  104.305 -93.562 1.00 97.96  ? 1    DA  I C4    1 
ATOM   19    P P     . DT  A 1 2   ? 45.622  109.551 -92.673 1.00 143.29 ? 2    DT  I P     1 
ATOM   20    O OP1   . DT  A 1 2   ? 45.376  110.995 -92.922 1.00 126.70 ? 2    DT  I OP1   1 
ATOM   21    O OP2   . DT  A 1 2   ? 46.059  109.100 -91.325 1.00 126.44 ? 2    DT  I OP2   1 
ATOM   22    O "O5'" . DT  A 1 2   ? 44.304  108.746 -93.058 1.00 143.46 ? 2    DT  I "O5'" 1 
ATOM   23    C "C5'" . DT  A 1 2   ? 43.905  108.605 -94.418 1.00 143.89 ? 2    DT  I "C5'" 1 
ATOM   24    C "C4'" . DT  A 1 2   ? 43.138  107.318 -94.600 1.00 144.22 ? 2    DT  I "C4'" 1 
ATOM   25    O "O4'" . DT  A 1 2   ? 44.017  106.195 -94.341 1.00 144.90 ? 2    DT  I "O4'" 1 
ATOM   26    C "C3'" . DT  A 1 2   ? 41.954  107.150 -93.648 1.00 143.74 ? 2    DT  I "C3'" 1 
ATOM   27    O "O3'" . DT  A 1 2   ? 40.892  106.470 -94.320 1.00 142.53 ? 2    DT  I "O3'" 1 
ATOM   28    C "C2'" . DT  A 1 2   ? 42.520  106.279 -92.542 1.00 144.89 ? 2    DT  I "C2'" 1 
ATOM   29    C "C1'" . DT  A 1 2   ? 43.470  105.382 -93.313 1.00 145.73 ? 2    DT  I "C1'" 1 
ATOM   30    N N1    . DT  A 1 2   ? 44.588  104.835 -92.517 1.00 130.38 ? 2    DT  I N1    1 
ATOM   31    C C2    . DT  A 1 2   ? 44.811  103.476 -92.567 1.00 131.17 ? 2    DT  I C2    1 
ATOM   32    O O2    . DT  A 1 2   ? 44.122  102.710 -93.222 1.00 131.32 ? 2    DT  I O2    1 
ATOM   33    N N3    . DT  A 1 2   ? 45.876  103.043 -91.815 1.00 130.52 ? 2    DT  I N3    1 
ATOM   34    C C4    . DT  A 1 2   ? 46.714  103.814 -91.032 1.00 130.14 ? 2    DT  I C4    1 
ATOM   35    O O4    . DT  A 1 2   ? 47.638  103.285 -90.419 1.00 129.09 ? 2    DT  I O4    1 
ATOM   36    C C5    . DT  A 1 2   ? 46.411  105.226 -91.011 1.00 129.87 ? 2    DT  I C5    1 
ATOM   37    C C7    . DT  A 1 2   ? 47.248  106.133 -90.166 1.00 129.94 ? 2    DT  I C7    1 
ATOM   38    C C6    . DT  A 1 2   ? 45.382  105.661 -91.750 1.00 130.26 ? 2    DT  I C6    1 
ATOM   39    P P     . DC  A 1 3   ? 39.495  106.229 -93.565 1.00 150.70 ? 3    DC  I P     1 
ATOM   40    O OP1   . DC  A 1 3   ? 38.397  106.768 -94.406 1.00 111.24 ? 3    DC  I OP1   1 
ATOM   41    O OP2   . DC  A 1 3   ? 39.652  106.705 -92.165 1.00 110.88 ? 3    DC  I OP2   1 
ATOM   42    O "O5'" . DC  A 1 3   ? 39.362  104.644 -93.535 1.00 148.16 ? 3    DC  I "O5'" 1 
ATOM   43    C "C5'" . DC  A 1 3   ? 40.439  103.842 -93.068 1.00 144.72 ? 3    DC  I "C5'" 1 
ATOM   44    C "C4'" . DC  A 1 3   ? 39.955  102.449 -92.745 1.00 141.35 ? 3    DC  I "C4'" 1 
ATOM   45    O "O4'" . DC  A 1 3   ? 41.064  101.719 -92.173 1.00 140.99 ? 3    DC  I "O4'" 1 
ATOM   46    C "C3'" . DC  A 1 3   ? 38.847  102.405 -91.697 1.00 138.87 ? 3    DC  I "C3'" 1 
ATOM   47    O "O3'" . DC  A 1 3   ? 38.002  101.277 -91.931 1.00 134.77 ? 3    DC  I "O3'" 1 
ATOM   48    C "C2'" . DC  A 1 3   ? 39.603  102.269 -90.390 1.00 139.40 ? 3    DC  I "C2'" 1 
ATOM   49    C "C1'" . DC  A 1 3   ? 40.849  101.488 -90.786 1.00 139.99 ? 3    DC  I "C1'" 1 
ATOM   50    N N1    . DC  A 1 3   ? 42.082  101.877 -90.077 1.00 98.99  ? 3    DC  I N1    1 
ATOM   51    C C2    . DC  A 1 3   ? 42.311  103.235 -89.773 1.00 98.20  ? 3    DC  I C2    1 
ATOM   52    O O2    . DC  A 1 3   ? 41.474  104.083 -90.113 1.00 98.80  ? 3    DC  I O2    1 
ATOM   53    N N3    . DC  A 1 3   ? 43.444  103.583 -89.123 1.00 97.14  ? 3    DC  I N3    1 
ATOM   54    C C4    . DC  A 1 3   ? 44.330  102.647 -88.782 1.00 96.39  ? 3    DC  I C4    1 
ATOM   55    N N4    . DC  A 1 3   ? 45.435  103.037 -88.146 1.00 95.39  ? 3    DC  I N4    1 
ATOM   56    C C5    . DC  A 1 3   ? 44.125  101.269 -89.080 1.00 96.77  ? 3    DC  I C5    1 
ATOM   57    C C6    . DC  A 1 3   ? 42.999  100.931 -89.718 1.00 97.82  ? 3    DC  I C6    1 
ATOM   58    P P     . DA  A 1 4   ? 36.711  101.043 -91.005 1.00 122.73 ? 4    DA  I P     1 
ATOM   59    O OP1   . DA  A 1 4   ? 35.583  100.610 -91.870 1.00 96.19  ? 4    DA  I OP1   1 
ATOM   60    O OP2   . DA  A 1 4   ? 36.557  102.233 -90.125 1.00 95.78  ? 4    DA  I OP2   1 
ATOM   61    O "O5'" . DA  A 1 4   ? 37.122  99.809  -90.093 1.00 118.30 ? 4    DA  I "O5'" 1 
ATOM   62    C "C5'" . DA  A 1 4   ? 37.582  98.598  -90.680 1.00 111.63 ? 4    DA  I "C5'" 1 
ATOM   63    C "C4'" . DA  A 1 4   ? 38.059  97.655  -89.603 1.00 105.93 ? 4    DA  I "C4'" 1 
ATOM   64    O "O4'" . DA  A 1 4   ? 39.243  98.199  -88.972 1.00 103.35 ? 4    DA  I "O4'" 1 
ATOM   65    C "C3'" . DA  A 1 4   ? 37.048  97.445  -88.481 1.00 103.44 ? 4    DA  I "C3'" 1 
ATOM   66    O "O3'" . DA  A 1 4   ? 37.155  96.107  -88.010 1.00 102.24 ? 4    DA  I "O3'" 1 
ATOM   67    C "C2'" . DA  A 1 4   ? 37.503  98.424  -87.414 1.00 102.13 ? 4    DA  I "C2'" 1 
ATOM   68    C "C1'" . DA  A 1 4   ? 39.011  98.393  -87.584 1.00 100.93 ? 4    DA  I "C1'" 1 
ATOM   69    N N9    . DA  A 1 4   ? 39.716  99.612  -87.187 1.00 70.72  ? 4    DA  I N9    1 
ATOM   70    C C8    . DA  A 1 4   ? 39.339  100.920 -87.366 1.00 69.23  ? 4    DA  I C8    1 
ATOM   71    N N7    . DA  A 1 4   ? 40.227  101.789 -86.942 1.00 68.21  ? 4    DA  I N7    1 
ATOM   72    C C5    . DA  A 1 4   ? 41.253  100.999 -86.437 1.00 66.45  ? 4    DA  I C5    1 
ATOM   73    C C6    . DA  A 1 4   ? 42.496  101.312 -85.851 1.00 64.70  ? 4    DA  I C6    1 
ATOM   74    N N6    . DA  A 1 4   ? 42.945  102.559 -85.672 1.00 62.03  ? 4    DA  I N6    1 
ATOM   75    N N1    . DA  A 1 4   ? 43.279  100.283 -85.454 1.00 63.85  ? 4    DA  I N1    1 
ATOM   76    C C2    . DA  A 1 4   ? 42.838  99.034  -85.640 1.00 64.08  ? 4    DA  I C2    1 
ATOM   77    N N3    . DA  A 1 4   ? 41.698  98.613  -86.181 1.00 65.76  ? 4    DA  I N3    1 
ATOM   78    C C4    . DA  A 1 4   ? 40.943  99.657  -86.566 1.00 67.96  ? 4    DA  I C4    1 
ATOM   79    P P     . DA  A 1 5   ? 35.955  95.463  -87.169 1.00 100.69 ? 5    DA  I P     1 
ATOM   80    O OP1   . DA  A 1 5   ? 35.241  94.488  -88.029 1.00 86.97  ? 5    DA  I OP1   1 
ATOM   81    O OP2   . DA  A 1 5   ? 35.208  96.577  -86.529 1.00 86.78  ? 5    DA  I OP2   1 
ATOM   82    O "O5'" . DA  A 1 5   ? 36.707  94.647  -86.033 1.00 100.51 ? 5    DA  I "O5'" 1 
ATOM   83    C "C5'" . DA  A 1 5   ? 37.837  93.837  -86.347 1.00 97.86  ? 5    DA  I "C5'" 1 
ATOM   84    C "C4'" . DA  A 1 5   ? 38.730  93.709  -85.137 1.00 95.84  ? 5    DA  I "C4'" 1 
ATOM   85    O "O4'" . DA  A 1 5   ? 39.427  94.959  -84.897 1.00 93.51  ? 5    DA  I "O4'" 1 
ATOM   86    C "C3'" . DA  A 1 5   ? 37.961  93.397  -83.854 1.00 95.19  ? 5    DA  I "C3'" 1 
ATOM   87    O "O3'" . DA  A 1 5   ? 38.674  92.433  -83.076 1.00 95.81  ? 5    DA  I "O3'" 1 
ATOM   88    C "C2'" . DA  A 1 5   ? 37.882  94.743  -83.153 1.00 92.30  ? 5    DA  I "C2'" 1 
ATOM   89    C "C1'" . DA  A 1 5   ? 39.185  95.400  -83.571 1.00 91.63  ? 5    DA  I "C1'" 1 
ATOM   90    N N9    . DA  A 1 5   ? 39.147  96.863  -83.581 1.00 75.99  ? 5    DA  I N9    1 
ATOM   91    C C8    . DA  A 1 5   ? 38.129  97.669  -84.024 1.00 76.30  ? 5    DA  I C8    1 
ATOM   92    N N7    . DA  A 1 5   ? 38.374  98.951  -83.896 1.00 75.07  ? 5    DA  I N7    1 
ATOM   93    C C5    . DA  A 1 5   ? 39.641  98.994  -83.335 1.00 73.68  ? 5    DA  I C5    1 
ATOM   94    C C6    . DA  A 1 5   ? 40.467  100.065 -82.950 1.00 72.71  ? 5    DA  I C6    1 
ATOM   95    N N6    . DA  A 1 5   ? 40.125  101.348 -83.081 1.00 71.68  ? 5    DA  I N6    1 
ATOM   96    N N1    . DA  A 1 5   ? 41.672  99.769  -82.416 1.00 72.58  ? 5    DA  I N1    1 
ATOM   97    C C2    . DA  A 1 5   ? 42.012  98.479  -82.282 1.00 72.44  ? 5    DA  I C2    1 
ATOM   98    N N3    . DA  A 1 5   ? 41.323  97.385  -82.608 1.00 73.32  ? 5    DA  I N3    1 
ATOM   99    C C4    . DA  A 1 5   ? 40.132  97.715  -83.136 1.00 74.44  ? 5    DA  I C4    1 
ATOM   100   P P     . DT  A 1 6   ? 37.970  91.766  -81.795 1.00 95.49  ? 6    DT  I P     1 
ATOM   101   O OP1   . DT  A 1 6   ? 38.146  90.292  -81.847 1.00 84.09  ? 6    DT  I OP1   1 
ATOM   102   O OP2   . DT  A 1 6   ? 36.607  92.345  -81.667 1.00 84.12  ? 6    DT  I OP2   1 
ATOM   103   O "O5'" . DT  A 1 6   ? 38.834  92.341  -80.594 1.00 94.30  ? 6    DT  I "O5'" 1 
ATOM   104   C "C5'" . DT  A 1 6   ? 39.279  93.684  -80.641 1.00 91.73  ? 6    DT  I "C5'" 1 
ATOM   105   C "C4'" . DT  A 1 6   ? 40.318  93.934  -79.582 1.00 89.08  ? 6    DT  I "C4'" 1 
ATOM   106   O "O4'" . DT  A 1 6   ? 40.739  95.306  -79.732 1.00 87.46  ? 6    DT  I "O4'" 1 
ATOM   107   C "C3'" . DT  A 1 6   ? 39.782  93.805  -78.160 1.00 88.33  ? 6    DT  I "C3'" 1 
ATOM   108   O "O3'" . DT  A 1 6   ? 40.824  93.345  -77.295 1.00 89.11  ? 6    DT  I "O3'" 1 
ATOM   109   C "C2'" . DT  A 1 6   ? 39.341  95.219  -77.831 1.00 87.17  ? 6    DT  I "C2'" 1 
ATOM   110   C "C1'" . DT  A 1 6   ? 40.302  96.088  -78.635 1.00 86.53  ? 6    DT  I "C1'" 1 
ATOM   111   N N1    . DT  A 1 6   ? 39.687  97.311  -79.181 1.00 74.69  ? 6    DT  I N1    1 
ATOM   112   C C2    . DT  A 1 6   ? 40.405  98.482  -79.134 1.00 73.57  ? 6    DT  I C2    1 
ATOM   113   O O2    . DT  A 1 6   ? 41.537  98.548  -78.691 1.00 74.21  ? 6    DT  I O2    1 
ATOM   114   N N3    . DT  A 1 6   ? 39.749  99.578  -79.632 1.00 73.10  ? 6    DT  I N3    1 
ATOM   115   C C4    . DT  A 1 6   ? 38.478  99.616  -80.170 1.00 74.06  ? 6    DT  I C4    1 
ATOM   116   O O4    . DT  A 1 6   ? 38.017  100.681 -80.578 1.00 74.47  ? 6    DT  I O4    1 
ATOM   117   C C5    . DT  A 1 6   ? 37.786  98.347  -80.203 1.00 74.44  ? 6    DT  I C5    1 
ATOM   118   C C7    . DT  A 1 6   ? 36.404  98.285  -80.772 1.00 74.24  ? 6    DT  I C7    1 
ATOM   119   C C6    . DT  A 1 6   ? 38.418  97.273  -79.716 1.00 74.32  ? 6    DT  I C6    1 
ATOM   120   P P     . DA  A 1 7   ? 40.526  93.094  -75.735 1.00 78.57  ? 7    DA  I P     1 
ATOM   121   O OP1   . DA  A 1 7   ? 40.817  91.673  -75.430 1.00 78.51  ? 7    DA  I OP1   1 
ATOM   122   O OP2   . DA  A 1 7   ? 39.193  93.659  -75.402 1.00 79.63  ? 7    DA  I OP2   1 
ATOM   123   O "O5'" . DA  A 1 7   ? 41.617  93.999  -75.017 1.00 78.16  ? 7    DA  I "O5'" 1 
ATOM   124   C "C5'" . DA  A 1 7   ? 42.902  94.174  -75.601 1.00 78.36  ? 7    DA  I "C5'" 1 
ATOM   125   C "C4'" . DA  A 1 7   ? 43.508  95.478  -75.142 1.00 78.16  ? 7    DA  I "C4'" 1 
ATOM   126   O "O4'" . DA  A 1 7   ? 42.812  96.593  -75.748 1.00 77.45  ? 7    DA  I "O4'" 1 
ATOM   127   C "C3'" . DA  A 1 7   ? 43.435  95.700  -73.634 1.00 78.78  ? 7    DA  I "C3'" 1 
ATOM   128   O "O3'" . DA  A 1 7   ? 44.656  96.293  -73.181 1.00 80.42  ? 7    DA  I "O3'" 1 
ATOM   129   C "C2'" . DA  A 1 7   ? 42.256  96.646  -73.472 1.00 78.12  ? 7    DA  I "C2'" 1 
ATOM   130   C "C1'" . DA  A 1 7   ? 42.333  97.476  -74.741 1.00 77.16  ? 7    DA  I "C1'" 1 
ATOM   131   N N9    . DA  A 1 7   ? 41.051  98.019  -75.195 1.00 75.45  ? 7    DA  I N9    1 
ATOM   132   C C8    . DA  A 1 7   ? 39.895  97.325  -75.449 1.00 74.50  ? 7    DA  I C8    1 
ATOM   133   N N7    . DA  A 1 7   ? 38.910  98.076  -75.878 1.00 74.05  ? 7    DA  I N7    1 
ATOM   134   C C5    . DA  A 1 7   ? 39.451  99.354  -75.902 1.00 73.21  ? 7    DA  I C5    1 
ATOM   135   C C6    . DA  A 1 7   ? 38.914  100.599 -76.270 1.00 73.24  ? 7    DA  I C6    1 
ATOM   136   N N6    . DA  A 1 7   ? 37.672  100.762 -76.728 1.00 73.85  ? 7    DA  I N6    1 
ATOM   137   N N1    . DA  A 1 7   ? 39.710  101.684 -76.159 1.00 72.43  ? 7    DA  I N1    1 
ATOM   138   C C2    . DA  A 1 7   ? 40.961  101.515 -75.720 1.00 73.27  ? 7    DA  I C2    1 
ATOM   139   N N3    . DA  A 1 7   ? 41.585  100.395 -75.359 1.00 72.91  ? 7    DA  I N3    1 
ATOM   140   C C4    . DA  A 1 7   ? 40.765  99.337  -75.473 1.00 73.66  ? 7    DA  I C4    1 
ATOM   141   P P     . DT  A 1 8   ? 44.782  96.793  -71.663 1.00 100.58 ? 8    DT  I P     1 
ATOM   142   O OP1   . DT  A 1 8   ? 46.209  96.743  -71.263 1.00 73.81  ? 8    DT  I OP1   1 
ATOM   143   O OP2   . DT  A 1 8   ? 43.765  96.064  -70.861 1.00 73.41  ? 8    DT  I OP2   1 
ATOM   144   O "O5'" . DT  A 1 8   ? 44.383  98.325  -71.772 1.00 102.17 ? 8    DT  I "O5'" 1 
ATOM   145   C "C5'" . DT  A 1 8   ? 45.190  99.210  -72.540 1.00 104.37 ? 8    DT  I "C5'" 1 
ATOM   146   C "C4'" . DT  A 1 8   ? 45.019  100.624 -72.046 1.00 105.72 ? 8    DT  I "C4'" 1 
ATOM   147   O "O4'" . DT  A 1 8   ? 43.787  101.174 -72.571 1.00 104.96 ? 8    DT  I "O4'" 1 
ATOM   148   C "C3'" . DT  A 1 8   ? 44.934  100.736 -70.524 1.00 107.00 ? 8    DT  I "C3'" 1 
ATOM   149   O "O3'" . DT  A 1 8   ? 45.728  101.841 -70.074 1.00 109.11 ? 8    DT  I "O3'" 1 
ATOM   150   C "C2'" . DT  A 1 8   ? 43.445  100.905 -70.259 1.00 105.35 ? 8    DT  I "C2'" 1 
ATOM   151   C "C1'" . DT  A 1 8   ? 42.943  101.603 -71.516 1.00 103.73 ? 8    DT  I "C1'" 1 
ATOM   152   N N1    . DT  A 1 8   ? 41.552  101.278 -71.899 1.00 73.79  ? 8    DT  I N1    1 
ATOM   153   C C2    . DT  A 1 8   ? 40.781  102.274 -72.462 1.00 72.25  ? 8    DT  I C2    1 
ATOM   154   O O2    . DT  A 1 8   ? 41.188  103.414 -72.646 1.00 71.91  ? 8    DT  I O2    1 
ATOM   155   N N3    . DT  A 1 8   ? 39.509  101.885 -72.808 1.00 70.93  ? 8    DT  I N3    1 
ATOM   156   C C4    . DT  A 1 8   ? 38.947  100.630 -72.651 1.00 71.90  ? 8    DT  I C4    1 
ATOM   157   O O4    . DT  A 1 8   ? 37.792  100.420 -73.026 1.00 70.99  ? 8    DT  I O4    1 
ATOM   158   C C5    . DT  A 1 8   ? 39.808  99.641  -72.042 1.00 72.06  ? 8    DT  I C5    1 
ATOM   159   C C7    . DT  A 1 8   ? 39.281  98.258  -71.819 1.00 72.48  ? 8    DT  I C7    1 
ATOM   160   C C6    . DT  A 1 8   ? 41.049  100.010 -71.703 1.00 72.66  ? 8    DT  I C6    1 
ATOM   161   P P     . DC  A 1 9   ? 45.311  102.646 -68.752 1.00 120.79 ? 9    DC  I P     1 
ATOM   162   O OP1   . DC  A 1 9   ? 46.461  103.518 -68.406 1.00 74.34  ? 9    DC  I OP1   1 
ATOM   163   O OP2   . DC  A 1 9   ? 44.753  101.722 -67.727 1.00 74.53  ? 9    DC  I OP2   1 
ATOM   164   O "O5'" . DC  A 1 9   ? 44.142  103.578 -69.286 1.00 121.10 ? 9    DC  I "O5'" 1 
ATOM   165   C "C5'" . DC  A 1 9   ? 44.382  104.477 -70.364 1.00 124.49 ? 9    DC  I "C5'" 1 
ATOM   166   C "C4'" . DC  A 1 9   ? 43.606  105.749 -70.139 1.00 125.85 ? 9    DC  I "C4'" 1 
ATOM   167   O "O4'" . DC  A 1 9   ? 42.217  105.521 -70.469 1.00 124.67 ? 9    DC  I "O4'" 1 
ATOM   168   C "C3'" . DC  A 1 9   ? 43.640  106.173 -68.676 1.00 127.84 ? 9    DC  I "C3'" 1 
ATOM   169   O "O3'" . DC  A 1 9   ? 43.769  107.586 -68.550 1.00 132.45 ? 9    DC  I "O3'" 1 
ATOM   170   C "C2'" . DC  A 1 9   ? 42.332  105.646 -68.111 1.00 124.94 ? 9    DC  I "C2'" 1 
ATOM   171   C "C1'" . DC  A 1 9   ? 41.396  105.611 -69.314 1.00 122.92 ? 9    DC  I "C1'" 1 
ATOM   172   N N1    . DC  A 1 9   ? 40.487  104.450 -69.330 1.00 74.75  ? 9    DC  I N1    1 
ATOM   173   C C2    . DC  A 1 9   ? 39.194  104.612 -69.832 1.00 73.05  ? 9    DC  I C2    1 
ATOM   174   O O2    . DC  A 1 9   ? 38.847  105.727 -70.247 1.00 73.59  ? 9    DC  I O2    1 
ATOM   175   N N3    . DC  A 1 9   ? 38.354  103.550 -69.854 1.00 70.84  ? 9    DC  I N3    1 
ATOM   176   C C4    . DC  A 1 9   ? 38.766  102.365 -69.402 1.00 69.61  ? 9    DC  I C4    1 
ATOM   177   N N4    . DC  A 1 9   ? 37.905  101.344 -69.447 1.00 67.66  ? 9    DC  I N4    1 
ATOM   178   C C5    . DC  A 1 9   ? 40.079  102.172 -68.884 1.00 70.31  ? 9    DC  I C5    1 
ATOM   179   C C6    . DC  A 1 9   ? 40.898  103.230 -68.866 1.00 72.84  ? 9    DC  I C6    1 
ATOM   180   P P     . DC  A 1 10  ? 43.947  108.234 -67.094 1.00 126.99 ? 10   DC  I P     1 
ATOM   181   O OP1   . DC  A 1 10  ? 44.691  109.510 -67.258 1.00 110.30 ? 10   DC  I OP1   1 
ATOM   182   O OP2   . DC  A 1 10  ? 44.463  107.196 -66.161 1.00 110.06 ? 10   DC  I OP2   1 
ATOM   183   O "O5'" . DC  A 1 10  ? 42.448  108.572 -66.693 1.00 127.36 ? 10   DC  I "O5'" 1 
ATOM   184   C "C5'" . DC  A 1 10  ? 41.644  109.371 -67.552 1.00 130.26 ? 10   DC  I "C5'" 1 
ATOM   185   C "C4'" . DC  A 1 10  ? 40.268  109.536 -66.959 1.00 132.23 ? 10   DC  I "C4'" 1 
ATOM   186   O "O4'" . DC  A 1 10  ? 39.411  108.420 -67.304 1.00 132.62 ? 10   DC  I "O4'" 1 
ATOM   187   C "C3'" . DC  A 1 10  ? 40.277  109.616 -65.432 1.00 133.37 ? 10   DC  I "C3'" 1 
ATOM   188   O "O3'" . DC  A 1 10  ? 39.344  110.600 -65.007 1.00 134.75 ? 10   DC  I "O3'" 1 
ATOM   189   C "C2'" . DC  A 1 10  ? 39.782  108.244 -65.014 1.00 133.89 ? 10   DC  I "C2'" 1 
ATOM   190   C "C1'" . DC  A 1 10  ? 38.791  107.950 -66.123 1.00 134.05 ? 10   DC  I "C1'" 1 
ATOM   191   N N1    . DC  A 1 10  ? 38.443  106.533 -66.308 1.00 118.86 ? 10   DC  I N1    1 
ATOM   192   C C2    . DC  A 1 10  ? 37.213  106.217 -66.900 1.00 119.41 ? 10   DC  I C2    1 
ATOM   193   O O2    . DC  A 1 10  ? 36.477  107.140 -67.287 1.00 119.88 ? 10   DC  I O2    1 
ATOM   194   N N3    . DC  A 1 10  ? 36.858  104.919 -67.036 1.00 119.54 ? 10   DC  I N3    1 
ATOM   195   C C4    . DC  A 1 10  ? 37.680  103.956 -66.613 1.00 119.40 ? 10   DC  I C4    1 
ATOM   196   N N4    . DC  A 1 10  ? 37.281  102.690 -66.749 1.00 119.07 ? 10   DC  I N4    1 
ATOM   197   C C5    . DC  A 1 10  ? 38.947  104.249 -66.026 1.00 119.27 ? 10   DC  I C5    1 
ATOM   198   C C6    . DC  A 1 10  ? 39.286  105.538 -65.896 1.00 118.99 ? 10   DC  I C6    1 
ATOM   199   P P     . DA  A 1 11  ? 39.670  111.512 -63.730 1.00 141.59 ? 11   DA  I P     1 
ATOM   200   O OP1   . DA  A 1 11  ? 40.736  112.475 -64.116 1.00 105.65 ? 11   DA  I OP1   1 
ATOM   201   O OP2   . DA  A 1 11  ? 39.869  110.631 -62.549 1.00 106.21 ? 11   DA  I OP2   1 
ATOM   202   O "O5'" . DA  A 1 11  ? 38.311  112.312 -63.542 1.00 139.21 ? 11   DA  I "O5'" 1 
ATOM   203   C "C5'" . DA  A 1 11  ? 37.582  112.761 -64.680 1.00 136.78 ? 11   DA  I "C5'" 1 
ATOM   204   C "C4'" . DA  A 1 11  ? 36.142  112.319 -64.585 1.00 135.19 ? 11   DA  I "C4'" 1 
ATOM   205   O "O4'" . DA  A 1 11  ? 35.992  110.919 -64.931 1.00 134.37 ? 11   DA  I "O4'" 1 
ATOM   206   C "C3'" . DA  A 1 11  ? 35.530  112.481 -63.194 1.00 134.67 ? 11   DA  I "C3'" 1 
ATOM   207   O "O3'" . DA  A 1 11  ? 34.207  112.992 -63.314 1.00 133.88 ? 11   DA  I "O3'" 1 
ATOM   208   C "C2'" . DA  A 1 11  ? 35.474  111.059 -62.667 1.00 134.25 ? 11   DA  I "C2'" 1 
ATOM   209   C "C1'" . DA  A 1 11  ? 35.199  110.285 -63.939 1.00 133.69 ? 11   DA  I "C1'" 1 
ATOM   210   N N9    . DA  A 1 11  ? 35.559  108.866 -63.886 1.00 96.15  ? 11   DA  I N9    1 
ATOM   211   C C8    . DA  A 1 11  ? 36.759  108.310 -63.512 1.00 95.98  ? 11   DA  I C8    1 
ATOM   212   N N7    . DA  A 1 11  ? 36.768  106.998 -63.548 1.00 94.78  ? 11   DA  I N7    1 
ATOM   213   C C5    . DA  A 1 11  ? 35.490  106.667 -63.976 1.00 93.38  ? 11   DA  I C5    1 
ATOM   214   C C6    . DA  A 1 11  ? 34.862  105.431 -64.211 1.00 92.32  ? 11   DA  I C6    1 
ATOM   215   N N6    . DA  A 1 11  ? 35.462  104.252 -64.033 1.00 91.00  ? 11   DA  I N6    1 
ATOM   216   N N1    . DA  A 1 11  ? 33.580  105.448 -64.636 1.00 91.66  ? 11   DA  I N1    1 
ATOM   217   C C2    . DA  A 1 11  ? 32.978  106.631 -64.808 1.00 91.50  ? 11   DA  I C2    1 
ATOM   218   N N3    . DA  A 1 11  ? 33.460  107.858 -64.617 1.00 93.18  ? 11   DA  I N3    1 
ATOM   219   C C4    . DA  A 1 11  ? 34.736  107.807 -64.195 1.00 94.21  ? 11   DA  I C4    1 
ATOM   220   P P     . DC  A 1 12  ? 33.463  113.579 -62.022 1.00 125.08 ? 12   DC  I P     1 
ATOM   221   O OP1   . DC  A 1 12  ? 33.086  114.972 -62.369 1.00 89.38  ? 12   DC  I OP1   1 
ATOM   222   O OP2   . DC  A 1 12  ? 34.303  113.324 -60.824 1.00 87.52  ? 12   DC  I OP2   1 
ATOM   223   O "O5'" . DC  A 1 12  ? 32.146  112.687 -61.933 1.00 125.14 ? 12   DC  I "O5'" 1 
ATOM   224   C "C5'" . DC  A 1 12  ? 31.297  112.531 -63.070 1.00 126.52 ? 12   DC  I "C5'" 1 
ATOM   225   C "C4'" . DC  A 1 12  ? 30.303  111.415 -62.843 1.00 127.78 ? 12   DC  I "C4'" 1 
ATOM   226   O "O4'" . DC  A 1 12  ? 30.941  110.118 -62.965 1.00 127.20 ? 12   DC  I "O4'" 1 
ATOM   227   C "C3'" . DC  A 1 12  ? 29.620  111.425 -61.474 1.00 128.93 ? 12   DC  I "C3'" 1 
ATOM   228   O "O3'" . DC  A 1 12  ? 28.231  111.123 -61.621 1.00 132.24 ? 12   DC  I "O3'" 1 
ATOM   229   C "C2'" . DC  A 1 12  ? 30.315  110.301 -60.726 1.00 127.65 ? 12   DC  I "C2'" 1 
ATOM   230   C "C1'" . DC  A 1 12  ? 30.588  109.317 -61.846 1.00 125.81 ? 12   DC  I "C1'" 1 
ATOM   231   N N1    . DC  A 1 12  ? 31.682  108.361 -61.591 1.00 87.08  ? 12   DC  I N1    1 
ATOM   232   C C2    . DC  A 1 12  ? 31.435  106.991 -61.769 1.00 85.32  ? 12   DC  I C2    1 
ATOM   233   O O2    . DC  A 1 12  ? 30.310  106.630 -62.143 1.00 85.14  ? 12   DC  I O2    1 
ATOM   234   N N3    . DC  A 1 12  ? 32.427  106.101 -61.531 1.00 83.88  ? 12   DC  I N3    1 
ATOM   235   C C4    . DC  A 1 12  ? 33.628  106.531 -61.133 1.00 83.67  ? 12   DC  I C4    1 
ATOM   236   N N4    . DC  A 1 12  ? 34.580  105.615 -60.908 1.00 81.64  ? 12   DC  I N4    1 
ATOM   237   C C5    . DC  A 1 12  ? 33.910  107.919 -60.946 1.00 84.18  ? 12   DC  I C5    1 
ATOM   238   C C6    . DC  A 1 12  ? 32.917  108.791 -61.184 1.00 86.08  ? 12   DC  I C6    1 
ATOM   239   P P     . DC  A 1 13  ? 27.274  111.140 -60.333 1.00 138.68 ? 13   DC  I P     1 
ATOM   240   O OP1   . DC  A 1 13  ? 25.941  111.614 -60.778 1.00 102.25 ? 13   DC  I OP1   1 
ATOM   241   O OP2   . DC  A 1 13  ? 27.974  111.850 -59.232 1.00 100.99 ? 13   DC  I OP2   1 
ATOM   242   O "O5'" . DC  A 1 13  ? 27.143  109.601 -59.947 1.00 140.08 ? 13   DC  I "O5'" 1 
ATOM   243   C "C5'" . DC  A 1 13  ? 26.347  108.722 -60.736 1.00 143.75 ? 13   DC  I "C5'" 1 
ATOM   244   C "C4'" . DC  A 1 13  ? 26.014  107.477 -59.949 1.00 146.37 ? 13   DC  I "C4'" 1 
ATOM   245   O "O4'" . DC  A 1 13  ? 27.173  106.611 -59.881 1.00 146.57 ? 13   DC  I "O4'" 1 
ATOM   246   C "C3'" . DC  A 1 13  ? 25.596  107.750 -58.505 1.00 147.65 ? 13   DC  I "C3'" 1 
ATOM   247   O "O3'" . DC  A 1 13  ? 24.526  106.880 -58.127 1.00 150.37 ? 13   DC  I "O3'" 1 
ATOM   248   C "C2'" . DC  A 1 13  ? 26.848  107.430 -57.709 1.00 147.48 ? 13   DC  I "C2'" 1 
ATOM   249   C "C1'" . DC  A 1 13  ? 27.477  106.313 -58.527 1.00 146.68 ? 13   DC  I "C1'" 1 
ATOM   250   N N1    . DC  A 1 13  ? 28.942  106.213 -58.401 1.00 108.29 ? 13   DC  I N1    1 
ATOM   251   C C2    . DC  A 1 13  ? 29.534  104.943 -58.363 1.00 107.41 ? 13   DC  I C2    1 
ATOM   252   O O2    . DC  A 1 13  ? 28.810  103.938 -58.447 1.00 107.55 ? 13   DC  I O2    1 
ATOM   253   N N3    . DC  A 1 13  ? 30.878  104.844 -58.236 1.00 106.41 ? 13   DC  I N3    1 
ATOM   254   C C4    . DC  A 1 13  ? 31.624  105.949 -58.150 1.00 105.97 ? 13   DC  I C4    1 
ATOM   255   N N4    . DC  A 1 13  ? 32.942  105.805 -58.021 1.00 103.93 ? 13   DC  I N4    1 
ATOM   256   C C5    . DC  A 1 13  ? 31.049  107.251 -58.193 1.00 106.86 ? 13   DC  I C5    1 
ATOM   257   C C6    . DC  A 1 13  ? 29.717  107.337 -58.318 1.00 108.07 ? 13   DC  I C6    1 
ATOM   258   P P     . DT  A 1 14  ? 23.745  107.132 -56.746 1.00 179.72 ? 14   DT  I P     1 
ATOM   259   O OP1   . DT  A 1 14  ? 22.290  107.103 -57.043 1.00 103.37 ? 14   DT  I OP1   1 
ATOM   260   O OP2   . DT  A 1 14  ? 24.335  108.317 -56.070 1.00 102.26 ? 14   DT  I OP2   1 
ATOM   261   O "O5'" . DT  A 1 14  ? 24.092  105.838 -55.888 1.00 181.38 ? 14   DT  I "O5'" 1 
ATOM   262   C "C5'" . DT  A 1 14  ? 23.797  104.536 -56.387 1.00 187.07 ? 14   DT  I "C5'" 1 
ATOM   263   C "C4'" . DT  A 1 14  ? 24.364  103.485 -55.462 1.00 189.75 ? 14   DT  I "C4'" 1 
ATOM   264   O "O4'" . DT  A 1 14  ? 25.811  103.495 -55.538 1.00 191.22 ? 14   DT  I "O4'" 1 
ATOM   265   C "C3'" . DT  A 1 14  ? 24.014  103.694 -53.988 1.00 191.02 ? 14   DT  I "C3'" 1 
ATOM   266   O "O3'" . DT  A 1 14  ? 23.788  102.431 -53.362 1.00 191.07 ? 14   DT  I "O3'" 1 
ATOM   267   C "C2'" . DT  A 1 14  ? 25.270  104.329 -53.420 1.00 191.22 ? 14   DT  I "C2'" 1 
ATOM   268   C "C1'" . DT  A 1 14  ? 26.351  103.640 -54.234 1.00 191.77 ? 14   DT  I "C1'" 1 
ATOM   269   N N1    . DT  A 1 14  ? 27.633  104.370 -54.340 1.00 114.35 ? 14   DT  I N1    1 
ATOM   270   C C2    . DT  A 1 14  ? 28.749  103.652 -54.707 1.00 113.74 ? 14   DT  I C2    1 
ATOM   271   O O2    . DT  A 1 14  ? 28.718  102.459 -54.969 1.00 113.87 ? 14   DT  I O2    1 
ATOM   272   N N3    . DT  A 1 14  ? 29.910  104.384 -54.760 1.00 113.11 ? 14   DT  I N3    1 
ATOM   273   C C4    . DT  A 1 14  ? 30.061  105.732 -54.495 1.00 112.91 ? 14   DT  I C4    1 
ATOM   274   O O4    . DT  A 1 14  ? 31.172  106.251 -54.579 1.00 111.15 ? 14   DT  I O4    1 
ATOM   275   C C5    . DT  A 1 14  ? 28.847  106.428 -54.129 1.00 113.23 ? 14   DT  I C5    1 
ATOM   276   C C7    . DT  A 1 14  ? 28.912  107.893 -53.834 1.00 113.22 ? 14   DT  I C7    1 
ATOM   277   C C6    . DT  A 1 14  ? 27.709  105.721 -54.070 1.00 113.90 ? 14   DT  I C6    1 
ATOM   278   P P     . DG  A 1 15  ? 22.664  102.293 -52.223 1.00 170.69 ? 15   DG  I P     1 
ATOM   279   O OP1   . DG  A 1 15  ? 21.345  102.361 -52.902 1.00 128.51 ? 15   DG  I OP1   1 
ATOM   280   O OP2   . DG  A 1 15  ? 22.975  103.245 -51.124 1.00 128.00 ? 15   DG  I OP2   1 
ATOM   281   O "O5'" . DG  A 1 15  ? 22.874  100.807 -51.687 1.00 170.73 ? 15   DG  I "O5'" 1 
ATOM   282   C "C5'" . DG  A 1 15  ? 22.917  99.705  -52.595 1.00 171.97 ? 15   DG  I "C5'" 1 
ATOM   283   C "C4'" . DG  A 1 15  ? 24.061  98.780  -52.246 1.00 172.35 ? 15   DG  I "C4'" 1 
ATOM   284   O "O4'" . DG  A 1 15  ? 25.324  99.460  -52.453 1.00 173.44 ? 15   DG  I "O4'" 1 
ATOM   285   C "C3'" . DG  A 1 15  ? 24.081  98.291  -50.797 1.00 172.10 ? 15   DG  I "C3'" 1 
ATOM   286   O "O3'" . DG  A 1 15  ? 24.535  96.935  -50.749 1.00 170.46 ? 15   DG  I "O3'" 1 
ATOM   287   C "C2'" . DG  A 1 15  ? 25.104  99.197  -50.139 1.00 173.01 ? 15   DG  I "C2'" 1 
ATOM   288   C "C1'" . DG  A 1 15  ? 26.101  99.389  -51.264 1.00 174.05 ? 15   DG  I "C1'" 1 
ATOM   289   N N9    . DG  A 1 15  ? 26.899  100.607 -51.164 1.00 132.56 ? 15   DG  I N9    1 
ATOM   290   C C8    . DG  A 1 15  ? 26.440  101.895 -51.020 1.00 133.34 ? 15   DG  I C8    1 
ATOM   291   N N7    . DG  A 1 15  ? 27.400  102.777 -50.953 1.00 133.10 ? 15   DG  I N7    1 
ATOM   292   C C5    . DG  A 1 15  ? 28.564  102.028 -51.061 1.00 131.93 ? 15   DG  I C5    1 
ATOM   293   C C6    . DG  A 1 15  ? 29.921  102.435 -51.056 1.00 131.11 ? 15   DG  I C6    1 
ATOM   294   O O6    . DG  A 1 15  ? 30.380  103.579 -50.957 1.00 129.59 ? 15   DG  I O6    1 
ATOM   295   N N1    . DG  A 1 15  ? 30.781  101.349 -51.186 1.00 130.73 ? 15   DG  I N1    1 
ATOM   296   C C2    . DG  A 1 15  ? 30.387  100.037 -51.308 1.00 131.02 ? 15   DG  I C2    1 
ATOM   297   N N2    . DG  A 1 15  ? 31.369  99.129  -51.421 1.00 130.37 ? 15   DG  I N2    1 
ATOM   298   N N3    . DG  A 1 15  ? 29.125  99.645  -51.319 1.00 131.76 ? 15   DG  I N3    1 
ATOM   299   C C4    . DG  A 1 15  ? 28.272  100.686 -51.191 1.00 132.44 ? 15   DG  I C4    1 
ATOM   300   P P     . DC  A 1 16  ? 24.818  96.239  -49.328 1.00 171.56 ? 16   DC  I P     1 
ATOM   301   O OP1   . DC  A 1 16  ? 24.793  94.767  -49.542 1.00 125.47 ? 16   DC  I OP1   1 
ATOM   302   O OP2   . DC  A 1 16  ? 23.924  96.855  -48.312 1.00 125.35 ? 16   DC  I OP2   1 
ATOM   303   O "O5'" . DC  A 1 16  ? 26.311  96.667  -48.979 1.00 169.81 ? 16   DC  I "O5'" 1 
ATOM   304   C "C5'" . DC  A 1 16  ? 27.423  95.982  -49.551 1.00 167.10 ? 16   DC  I "C5'" 1 
ATOM   305   C "C4'" . DC  A 1 16  ? 28.634  96.118  -48.658 1.00 163.82 ? 16   DC  I "C4'" 1 
ATOM   306   O "O4'" . DC  A 1 16  ? 29.098  97.490  -48.660 1.00 163.97 ? 16   DC  I "O4'" 1 
ATOM   307   C "C3'" . DC  A 1 16  ? 28.387  95.760  -47.191 1.00 161.66 ? 16   DC  I "C3'" 1 
ATOM   308   O "O3'" . DC  A 1 16  ? 29.552  95.135  -46.657 1.00 157.20 ? 16   DC  I "O3'" 1 
ATOM   309   C "C2'" . DC  A 1 16  ? 28.200  97.113  -46.532 1.00 162.15 ? 16   DC  I "C2'" 1 
ATOM   310   C "C1'" . DC  A 1 16  ? 29.169  97.969  -47.326 1.00 163.45 ? 16   DC  I "C1'" 1 
ATOM   311   N N1    . DC  A 1 16  ? 28.868  99.409  -47.340 1.00 117.09 ? 16   DC  I N1    1 
ATOM   312   C C2    . DC  A 1 16  ? 29.932  100.310 -47.407 1.00 116.96 ? 16   DC  I C2    1 
ATOM   313   O O2    . DC  A 1 16  ? 31.089  99.865  -47.470 1.00 116.95 ? 16   DC  I O2    1 
ATOM   314   N N3    . DC  A 1 16  ? 29.676  101.639 -47.406 1.00 116.26 ? 16   DC  I N3    1 
ATOM   315   C C4    . DC  A 1 16  ? 28.417  102.075 -47.349 1.00 115.64 ? 16   DC  I C4    1 
ATOM   316   N N4    . DC  A 1 16  ? 28.212  103.394 -47.352 1.00 114.15 ? 16   DC  I N4    1 
ATOM   317   C C5    . DC  A 1 16  ? 27.312  101.178 -47.287 1.00 116.30 ? 16   DC  I C5    1 
ATOM   318   C C6    . DC  A 1 16  ? 27.580  99.865  -47.284 1.00 117.14 ? 16   DC  I C6    1 
ATOM   319   P P     . DA  A 1 17  ? 29.408  93.990  -45.543 1.00 131.03 ? 17   DA  I P     1 
ATOM   320   O OP1   . DA  A 1 17  ? 28.621  92.882  -46.137 1.00 124.38 ? 17   DA  I OP1   1 
ATOM   321   O OP2   . DA  A 1 17  ? 28.960  94.610  -44.271 1.00 123.47 ? 17   DA  I OP2   1 
ATOM   322   O "O5'" . DA  A 1 17  ? 30.907  93.487  -45.370 1.00 128.64 ? 17   DA  I "O5'" 1 
ATOM   323   C "C5'" . DA  A 1 17  ? 31.763  93.402  -46.505 1.00 123.74 ? 17   DA  I "C5'" 1 
ATOM   324   C "C4'" . DA  A 1 17  ? 32.939  94.339  -46.348 1.00 120.32 ? 17   DA  I "C4'" 1 
ATOM   325   O "O4'" . DA  A 1 17  ? 32.465  95.702  -46.197 1.00 119.29 ? 17   DA  I "O4'" 1 
ATOM   326   C "C3'" . DA  A 1 17  ? 33.824  94.064  -45.133 1.00 118.44 ? 17   DA  I "C3'" 1 
ATOM   327   O "O3'" . DA  A 1 17  ? 35.194  94.247  -45.496 1.00 115.64 ? 17   DA  I "O3'" 1 
ATOM   328   C "C2'" . DA  A 1 17  ? 33.390  95.117  -44.129 1.00 118.08 ? 17   DA  I "C2'" 1 
ATOM   329   C "C1'" . DA  A 1 17  ? 33.024  96.282  -45.028 1.00 118.21 ? 17   DA  I "C1'" 1 
ATOM   330   N N9    . DA  A 1 17  ? 32.036  97.200  -44.457 1.00 110.45 ? 17   DA  I N9    1 
ATOM   331   C C8    . DA  A 1 17  ? 30.927  96.890  -43.710 1.00 110.69 ? 17   DA  I C8    1 
ATOM   332   N N7    . DA  A 1 17  ? 30.233  97.938  -43.333 1.00 110.47 ? 17   DA  I N7    1 
ATOM   333   C C5    . DA  A 1 17  ? 30.931  99.010  -43.870 1.00 109.85 ? 17   DA  I C5    1 
ATOM   334   C C6    . DA  A 1 17  ? 30.710  100.399 -43.828 1.00 109.79 ? 17   DA  I C6    1 
ATOM   335   N N6    . DA  A 1 17  ? 29.676  100.967 -43.206 1.00 110.18 ? 17   DA  I N6    1 
ATOM   336   N N1    . DA  A 1 17  ? 31.599  101.195 -44.458 1.00 109.29 ? 17   DA  I N1    1 
ATOM   337   C C2    . DA  A 1 17  ? 32.632  100.625 -45.088 1.00 109.85 ? 17   DA  I C2    1 
ATOM   338   N N3    . DA  A 1 17  ? 32.944  99.335  -45.203 1.00 110.04 ? 17   DA  I N3    1 
ATOM   339   C C4    . DA  A 1 17  ? 32.044  98.571  -44.563 1.00 110.05 ? 17   DA  I C4    1 
ATOM   340   P P     . DG  A 1 18  ? 36.354  93.834  -44.466 1.00 111.64 ? 18   DG  I P     1 
ATOM   341   O OP1   . DG  A 1 18  ? 37.393  93.108  -45.241 1.00 111.64 ? 18   DG  I OP1   1 
ATOM   342   O OP2   . DG  A 1 18  ? 35.742  93.194  -43.271 1.00 111.16 ? 18   DG  I OP2   1 
ATOM   343   O "O5'" . DG  A 1 18  ? 36.956  95.235  -44.022 1.00 108.65 ? 18   DG  I "O5'" 1 
ATOM   344   C "C5'" . DG  A 1 18  ? 37.260  96.224  -44.993 1.00 104.48 ? 18   DG  I "C5'" 1 
ATOM   345   C "C4'" . DG  A 1 18  ? 37.443  97.565  -44.328 1.00 102.30 ? 18   DG  I "C4'" 1 
ATOM   346   O "O4'" . DG  A 1 18  ? 36.168  98.109  -43.901 1.00 101.59 ? 18   DG  I "O4'" 1 
ATOM   347   C "C3'" . DG  A 1 18  ? 38.333  97.539  -43.084 1.00 101.16 ? 18   DG  I "C3'" 1 
ATOM   348   O "O3'" . DG  A 1 18  ? 39.191  98.678  -43.111 1.00 100.02 ? 18   DG  I "O3'" 1 
ATOM   349   C "C2'" . DG  A 1 18  ? 37.341  97.665  -41.940 1.00 100.90 ? 18   DG  I "C2'" 1 
ATOM   350   C "C1'" . DG  A 1 18  ? 36.274  98.548  -42.558 1.00 100.79 ? 18   DG  I "C1'" 1 
ATOM   351   N N9    . DG  A 1 18  ? 34.954  98.458  -41.937 1.00 100.89 ? 18   DG  I N9    1 
ATOM   352   C C8    . DG  A 1 18  ? 34.338  97.327  -41.460 1.00 101.00 ? 18   DG  I C8    1 
ATOM   353   N N7    . DG  A 1 18  ? 33.165  97.562  -40.939 1.00 100.66 ? 18   DG  I N7    1 
ATOM   354   C C5    . DG  A 1 18  ? 32.992  98.932  -41.082 1.00 100.73 ? 18   DG  I C5    1 
ATOM   355   C C6    . DG  A 1 18  ? 31.909  99.767  -40.698 1.00 100.92 ? 18   DG  I C6    1 
ATOM   356   O O6    . DG  A 1 18  ? 30.857  99.453  -40.130 1.00 101.89 ? 18   DG  I O6    1 
ATOM   357   N N1    . DG  A 1 18  ? 32.142  101.094 -41.038 1.00 100.31 ? 18   DG  I N1    1 
ATOM   358   C C2    . DG  A 1 18  ? 33.269  101.562 -41.663 1.00 100.09 ? 18   DG  I C2    1 
ATOM   359   N N2    . DG  A 1 18  ? 33.299  102.879 -41.910 1.00 99.83  ? 18   DG  I N2    1 
ATOM   360   N N3    . DG  A 1 18  ? 34.290  100.797 -42.020 1.00 100.23 ? 18   DG  I N3    1 
ATOM   361   C C4    . DG  A 1 18  ? 34.084  99.500  -41.702 1.00 100.56 ? 18   DG  I C4    1 
ATOM   362   P P     . DA  A 1 19  ? 40.413  98.786  -42.079 1.00 76.64  ? 19   DA  I P     1 
ATOM   363   O OP1   . DA  A 1 19  ? 41.653  98.617  -42.880 1.00 93.00  ? 19   DA  I OP1   1 
ATOM   364   O OP2   . DA  A 1 19  ? 40.154  97.893  -40.920 1.00 93.42  ? 19   DA  I OP2   1 
ATOM   365   O "O5'" . DA  A 1 19  ? 40.320  100.297 -41.590 1.00 77.66  ? 19   DA  I "O5'" 1 
ATOM   366   C "C5'" . DA  A 1 19  ? 40.097  101.339 -42.537 1.00 79.35  ? 19   DA  I "C5'" 1 
ATOM   367   C "C4'" . DA  A 1 19  ? 39.513  102.558 -41.864 1.00 81.34  ? 19   DA  I "C4'" 1 
ATOM   368   O "O4'" . DA  A 1 19  ? 38.138  102.325 -41.467 1.00 80.37  ? 19   DA  I "O4'" 1 
ATOM   369   C "C3'" . DA  A 1 19  ? 40.246  103.023 -40.605 1.00 82.38  ? 19   DA  I "C3'" 1 
ATOM   370   O "O3'" . DA  A 1 19  ? 40.291  104.450 -40.597 1.00 85.20  ? 19   DA  I "O3'" 1 
ATOM   371   C "C2'" . DA  A 1 19  ? 39.350  102.531 -39.482 1.00 81.69  ? 19   DA  I "C2'" 1 
ATOM   372   C "C1'" . DA  A 1 19  ? 37.979  102.695 -40.108 1.00 80.99  ? 19   DA  I "C1'" 1 
ATOM   373   N N9    . DA  A 1 19  ? 36.922  101.865 -39.532 1.00 97.38  ? 19   DA  I N9    1 
ATOM   374   C C8    . DA  A 1 19  ? 36.909  100.506 -39.337 1.00 97.21  ? 19   DA  I C8    1 
ATOM   375   N N7    . DA  A 1 19  ? 35.797  100.060 -38.802 1.00 96.77  ? 19   DA  I N7    1 
ATOM   376   C C5    . DA  A 1 19  ? 35.029  101.203 -38.629 1.00 96.92  ? 19   DA  I C5    1 
ATOM   377   C C6    . DA  A 1 19  ? 33.738  101.409 -38.107 1.00 97.11  ? 19   DA  I C6    1 
ATOM   378   N N6    . DA  A 1 19  ? 32.959  100.428 -37.646 1.00 97.57  ? 19   DA  I N6    1 
ATOM   379   N N1    . DA  A 1 19  ? 33.267  102.675 -38.077 1.00 96.51  ? 19   DA  I N1    1 
ATOM   380   C C2    . DA  A 1 19  ? 34.045  103.658 -38.544 1.00 96.53  ? 19   DA  I C2    1 
ATOM   381   N N3    . DA  A 1 19  ? 35.271  103.591 -39.060 1.00 96.56  ? 19   DA  I N3    1 
ATOM   382   C C4    . DA  A 1 19  ? 35.711  102.321 -39.073 1.00 96.89  ? 19   DA  I C4    1 
ATOM   383   P P     . DT  A 1 20  ? 41.348  105.211 -39.661 1.00 120.80 ? 20   DT  I P     1 
ATOM   384   O OP1   . DT  A 1 20  ? 42.283  105.970 -40.536 1.00 88.32  ? 20   DT  I OP1   1 
ATOM   385   O OP2   . DT  A 1 20  ? 41.892  104.234 -38.685 1.00 88.36  ? 20   DT  I OP2   1 
ATOM   386   O "O5'" . DT  A 1 20  ? 40.431  106.251 -38.880 1.00 122.60 ? 20   DT  I "O5'" 1 
ATOM   387   C "C5'" . DT  A 1 20  ? 39.565  107.121 -39.600 1.00 127.27 ? 20   DT  I "C5'" 1 
ATOM   388   C "C4'" . DT  A 1 20  ? 38.501  107.684 -38.687 1.00 130.37 ? 20   DT  I "C4'" 1 
ATOM   389   O "O4'" . DT  A 1 20  ? 37.554  106.652 -38.315 1.00 131.04 ? 20   DT  I "O4'" 1 
ATOM   390   C "C3'" . DT  A 1 20  ? 39.013  108.286 -37.377 1.00 132.37 ? 20   DT  I "C3'" 1 
ATOM   391   O "O3'" . DT  A 1 20  ? 38.324  109.513 -37.115 1.00 135.18 ? 20   DT  I "O3'" 1 
ATOM   392   C "C2'" . DT  A 1 20  ? 38.650  107.237 -36.341 1.00 132.02 ? 20   DT  I "C2'" 1 
ATOM   393   C "C1'" . DT  A 1 20  ? 37.359  106.683 -36.910 1.00 131.70 ? 20   DT  I "C1'" 1 
ATOM   394   N N1    . DT  A 1 20  ? 37.001  105.320 -36.460 1.00 100.03 ? 20   DT  I N1    1 
ATOM   395   C C2    . DT  A 1 20  ? 35.686  105.080 -36.111 1.00 99.22  ? 20   DT  I C2    1 
ATOM   396   O O2    . DT  A 1 20  ? 34.817  105.937 -36.153 1.00 98.82  ? 20   DT  I O2    1 
ATOM   397   N N3    . DT  A 1 20  ? 35.426  103.791 -35.710 1.00 98.95  ? 20   DT  I N3    1 
ATOM   398   C C4    . DT  A 1 20  ? 36.326  102.744 -35.621 1.00 99.01  ? 20   DT  I C4    1 
ATOM   399   O O4    . DT  A 1 20  ? 35.941  101.637 -35.247 1.00 98.04  ? 20   DT  I O4    1 
ATOM   400   C C5    . DT  A 1 20  ? 37.691  103.068 -35.997 1.00 99.12  ? 20   DT  I C5    1 
ATOM   401   C C7    . DT  A 1 20  ? 38.739  102.001 -35.928 1.00 98.42  ? 20   DT  I C7    1 
ATOM   402   C C6    . DT  A 1 20  ? 37.954  104.322 -36.392 1.00 99.68  ? 20   DT  I C6    1 
ATOM   403   P P     . DT  A 1 21  ? 38.393  110.172 -35.653 1.00 145.91 ? 21   DT  I P     1 
ATOM   404   O OP1   . DT  A 1 21  ? 38.076  111.616 -35.788 1.00 103.52 ? 21   DT  I OP1   1 
ATOM   405   O OP2   . DT  A 1 21  ? 39.673  109.758 -35.023 1.00 103.37 ? 21   DT  I OP2   1 
ATOM   406   O "O5'" . DT  A 1 21  ? 37.196  109.465 -34.877 1.00 148.06 ? 21   DT  I "O5'" 1 
ATOM   407   C "C5'" . DT  A 1 21  ? 35.844  109.705 -35.263 1.00 153.82 ? 21   DT  I "C5'" 1 
ATOM   408   C "C4'" . DT  A 1 21  ? 34.921  109.506 -34.084 1.00 157.61 ? 21   DT  I "C4'" 1 
ATOM   409   O "O4'" . DT  A 1 21  ? 34.680  108.094 -33.865 1.00 158.69 ? 21   DT  I "O4'" 1 
ATOM   410   C "C3'" . DT  A 1 21  ? 35.460  110.058 -32.762 1.00 160.22 ? 21   DT  I "C3'" 1 
ATOM   411   O "O3'" . DT  A 1 21  ? 34.410  110.682 -32.014 1.00 163.39 ? 21   DT  I "O3'" 1 
ATOM   412   C "C2'" . DT  A 1 21  ? 35.953  108.814 -32.045 1.00 159.61 ? 21   DT  I "C2'" 1 
ATOM   413   C "C1'" . DT  A 1 21  ? 34.943  107.780 -32.506 1.00 159.58 ? 21   DT  I "C1'" 1 
ATOM   414   N N1    . DT  A 1 21  ? 35.399  106.377 -32.434 1.00 117.51 ? 21   DT  I N1    1 
ATOM   415   C C2    . DT  A 1 21  ? 34.446  105.397 -32.252 1.00 117.38 ? 21   DT  I C2    1 
ATOM   416   O O2    . DT  A 1 21  ? 33.251  105.636 -32.157 1.00 116.95 ? 21   DT  I O2    1 
ATOM   417   N N3    . DT  A 1 21  ? 34.946  104.120 -32.186 1.00 116.91 ? 21   DT  I N3    1 
ATOM   418   C C4    . DT  A 1 21  ? 36.272  103.734 -32.282 1.00 116.53 ? 21   DT  I C4    1 
ATOM   419   O O4    . DT  A 1 21  ? 36.570  102.545 -32.200 1.00 115.85 ? 21   DT  I O4    1 
ATOM   420   C C5    . DT  A 1 21  ? 37.215  104.813 -32.477 1.00 116.41 ? 21   DT  I C5    1 
ATOM   421   C C7    . DT  A 1 21  ? 38.671  104.492 -32.598 1.00 115.86 ? 21   DT  I C7    1 
ATOM   422   C C6    . DT  A 1 21  ? 36.738  106.063 -32.541 1.00 116.98 ? 21   DT  I C6    1 
ATOM   423   P P     . DC  A 1 22  ? 34.728  111.329 -30.576 1.00 141.05 ? 22   DC  I P     1 
ATOM   424   O OP1   . DC  A 1 22  ? 33.462  111.877 -30.027 1.00 143.65 ? 22   DC  I OP1   1 
ATOM   425   O OP2   . DC  A 1 22  ? 35.910  112.217 -30.722 1.00 143.06 ? 22   DC  I OP2   1 
ATOM   426   O "O5'" . DC  A 1 22  ? 35.154  110.073 -29.692 1.00 143.05 ? 22   DC  I "O5'" 1 
ATOM   427   C "C5'" . DC  A 1 22  ? 34.789  109.984 -28.320 1.00 145.54 ? 22   DC  I "C5'" 1 
ATOM   428   C "C4'" . DC  A 1 22  ? 33.449  109.301 -28.185 1.00 147.41 ? 22   DC  I "C4'" 1 
ATOM   429   O "O4'" . DC  A 1 22  ? 33.476  108.027 -28.871 1.00 148.01 ? 22   DC  I "O4'" 1 
ATOM   430   C "C3'" . DC  A 1 22  ? 33.037  109.004 -26.745 1.00 148.36 ? 22   DC  I "C3'" 1 
ATOM   431   O "O3'" . DC  A 1 22  ? 31.643  109.254 -26.576 1.00 149.41 ? 22   DC  I "O3'" 1 
ATOM   432   C "C2'" . DC  A 1 22  ? 33.351  107.529 -26.581 1.00 149.29 ? 22   DC  I "C2'" 1 
ATOM   433   C "C1'" . DC  A 1 22  ? 33.139  106.977 -27.978 1.00 149.17 ? 22   DC  I "C1'" 1 
ATOM   434   N N1    . DC  A 1 22  ? 33.998  105.827 -28.296 1.00 152.74 ? 22   DC  I N1    1 
ATOM   435   C C2    . DC  A 1 22  ? 33.399  104.597 -28.589 1.00 153.44 ? 22   DC  I C2    1 
ATOM   436   O O2    . DC  A 1 22  ? 32.161  104.514 -28.578 1.00 153.81 ? 22   DC  I O2    1 
ATOM   437   N N3    . DC  A 1 22  ? 34.183  103.531 -28.877 1.00 154.05 ? 22   DC  I N3    1 
ATOM   438   C C4    . DC  A 1 22  ? 35.513  103.662 -28.877 1.00 154.36 ? 22   DC  I C4    1 
ATOM   439   N N4    . DC  A 1 22  ? 36.247  102.582 -29.162 1.00 154.76 ? 22   DC  I N4    1 
ATOM   440   C C5    . DC  A 1 22  ? 36.149  104.904 -28.585 1.00 153.77 ? 22   DC  I C5    1 
ATOM   441   C C6    . DC  A 1 22  ? 35.361  105.950 -28.304 1.00 152.89 ? 22   DC  I C6    1 
ATOM   442   P P     . DT  A 1 23  ? 31.157  110.254 -25.421 1.00 156.03 ? 23   DT  I P     1 
ATOM   443   O OP1   . DT  A 1 23  ? 29.800  110.746 -25.767 1.00 141.00 ? 23   DT  I OP1   1 
ATOM   444   O OP2   . DT  A 1 23  ? 32.253  111.227 -25.181 1.00 140.59 ? 23   DT  I OP2   1 
ATOM   445   O "O5'" . DT  A 1 23  ? 31.036  109.320 -24.141 1.00 156.57 ? 23   DT  I "O5'" 1 
ATOM   446   C "C5'" . DT  A 1 23  ? 29.800  108.699 -23.809 1.00 158.34 ? 23   DT  I "C5'" 1 
ATOM   447   C "C4'" . DT  A 1 23  ? 29.980  107.821 -22.594 1.00 159.46 ? 23   DT  I "C4'" 1 
ATOM   448   O "O4'" . DT  A 1 23  ? 30.812  106.691 -22.957 1.00 158.97 ? 23   DT  I "O4'" 1 
ATOM   449   C "C3'" . DT  A 1 23  ? 30.693  108.520 -21.437 1.00 160.60 ? 23   DT  I "C3'" 1 
ATOM   450   O "O3'" . DT  A 1 23  ? 30.132  108.123 -20.182 1.00 163.09 ? 23   DT  I "O3'" 1 
ATOM   451   C "C2'" . DT  A 1 23  ? 32.129  108.050 -21.571 1.00 159.11 ? 23   DT  I "C2'" 1 
ATOM   452   C "C1'" . DT  A 1 23  ? 31.972  106.651 -22.140 1.00 158.28 ? 23   DT  I "C1'" 1 
ATOM   453   N N1    . DT  A 1 23  ? 33.108  106.227 -22.981 1.00 141.12 ? 23   DT  I N1    1 
ATOM   454   C C2    . DT  A 1 23  ? 33.131  104.938 -23.463 1.00 140.49 ? 23   DT  I C2    1 
ATOM   455   O O2    . DT  A 1 23  ? 32.249  104.125 -23.239 1.00 140.14 ? 23   DT  I O2    1 
ATOM   456   N N3    . DT  A 1 23  ? 34.234  104.633 -24.225 1.00 139.39 ? 23   DT  I N3    1 
ATOM   457   C C4    . DT  A 1 23  ? 35.287  105.472 -24.545 1.00 138.89 ? 23   DT  I C4    1 
ATOM   458   O O4    . DT  A 1 23  ? 36.213  105.060 -25.238 1.00 137.69 ? 23   DT  I O4    1 
ATOM   459   C C5    . DT  A 1 23  ? 35.193  106.807 -24.011 1.00 139.14 ? 23   DT  I C5    1 
ATOM   460   C C7    . DT  A 1 23  ? 36.285  107.785 -24.309 1.00 138.93 ? 23   DT  I C7    1 
ATOM   461   C C6    . DT  A 1 23  ? 34.125  107.114 -23.267 1.00 140.26 ? 23   DT  I C6    1 
ATOM   462   P P     . DA  A 1 24  ? 31.051  108.121 -18.864 1.00 167.91 ? 24   DA  I P     1 
ATOM   463   O OP1   . DA  A 1 24  ? 30.165  108.177 -17.672 1.00 169.56 ? 24   DA  I OP1   1 
ATOM   464   O OP2   . DA  A 1 24  ? 32.117  109.143 -19.034 1.00 169.36 ? 24   DA  I OP2   1 
ATOM   465   O "O5'" . DA  A 1 24  ? 31.728  106.682 -18.911 1.00 169.46 ? 24   DA  I "O5'" 1 
ATOM   466   C "C5'" . DA  A 1 24  ? 30.923  105.511 -19.008 1.00 172.77 ? 24   DA  I "C5'" 1 
ATOM   467   C "C4'" . DA  A 1 24  ? 31.709  104.306 -18.554 1.00 175.52 ? 24   DA  I "C4'" 1 
ATOM   468   O "O4'" . DA  A 1 24  ? 32.710  103.979 -19.548 1.00 176.93 ? 24   DA  I "O4'" 1 
ATOM   469   C "C3'" . DA  A 1 24  ? 32.467  104.529 -17.246 1.00 176.34 ? 24   DA  I "C3'" 1 
ATOM   470   O "O3'" . DA  A 1 24  ? 32.467  103.333 -16.466 1.00 176.16 ? 24   DA  I "O3'" 1 
ATOM   471   C "C2'" . DA  A 1 24  ? 33.876  104.841 -17.713 1.00 177.88 ? 24   DA  I "C2'" 1 
ATOM   472   C "C1'" . DA  A 1 24  ? 33.992  103.963 -18.944 1.00 178.66 ? 24   DA  I "C1'" 1 
ATOM   473   N N9    . DA  A 1 24  ? 34.966  104.422 -19.934 1.00 182.48 ? 24   DA  I N9    1 
ATOM   474   C C8    . DA  A 1 24  ? 35.410  105.701 -20.160 1.00 183.06 ? 24   DA  I C8    1 
ATOM   475   N N7    . DA  A 1 24  ? 36.309  105.788 -21.111 1.00 183.82 ? 24   DA  I N7    1 
ATOM   476   C C5    . DA  A 1 24  ? 36.464  104.478 -21.543 1.00 184.16 ? 24   DA  I C5    1 
ATOM   477   C C6    . DA  A 1 24  ? 37.277  103.898 -22.533 1.00 184.61 ? 24   DA  I C6    1 
ATOM   478   N N6    . DA  A 1 24  ? 38.123  104.592 -23.297 1.00 184.91 ? 24   DA  I N6    1 
ATOM   479   N N1    . DA  A 1 24  ? 37.189  102.562 -22.714 1.00 184.82 ? 24   DA  I N1    1 
ATOM   480   C C2    . DA  A 1 24  ? 36.341  101.866 -21.947 1.00 184.70 ? 24   DA  I C2    1 
ATOM   481   N N3    . DA  A 1 24  ? 35.528  102.296 -20.985 1.00 184.21 ? 24   DA  I N3    1 
ATOM   482   C C4    . DA  A 1 24  ? 35.639  103.627 -20.831 1.00 183.69 ? 24   DA  I C4    1 
ATOM   483   P P     . DC  A 1 25  ? 32.720  103.416 -14.883 1.00 188.33 ? 25   DC  I P     1 
ATOM   484   O OP1   . DC  A 1 25  ? 31.391  103.447 -14.219 1.00 165.10 ? 25   DC  I OP1   1 
ATOM   485   O OP2   . DC  A 1 25  ? 33.701  104.501 -14.615 1.00 165.32 ? 25   DC  I OP2   1 
ATOM   486   O "O5'" . DC  A 1 25  ? 33.414  102.024 -14.550 1.00 186.11 ? 25   DC  I "O5'" 1 
ATOM   487   C "C5'" . DC  A 1 25  ? 32.876  100.803 -15.052 1.00 182.97 ? 25   DC  I "C5'" 1 
ATOM   488   C "C4'" . DC  A 1 25  ? 33.992  99.826  -15.339 1.00 179.98 ? 25   DC  I "C4'" 1 
ATOM   489   O "O4'" . DC  A 1 25  ? 34.742  100.264 -16.500 1.00 180.22 ? 25   DC  I "O4'" 1 
ATOM   490   C "C3'" . DC  A 1 25  ? 35.009  99.694  -14.204 1.00 177.49 ? 25   DC  I "C3'" 1 
ATOM   491   O "O3'" . DC  A 1 25  ? 35.445  98.336  -14.092 1.00 172.22 ? 25   DC  I "O3'" 1 
ATOM   492   C "C2'" . DC  A 1 25  ? 36.156  100.572 -14.669 1.00 178.80 ? 25   DC  I "C2'" 1 
ATOM   493   C "C1'" . DC  A 1 25  ? 36.119  100.334 -16.165 1.00 180.26 ? 25   DC  I "C1'" 1 
ATOM   494   N N1    . DC  A 1 25  ? 36.744  101.389 -16.979 1.00 157.13 ? 25   DC  I N1    1 
ATOM   495   C C2    . DC  A 1 25  ? 37.602  101.014 -18.019 1.00 156.90 ? 25   DC  I C2    1 
ATOM   496   O O2    . DC  A 1 25  ? 37.797  99.807  -18.230 1.00 156.82 ? 25   DC  I O2    1 
ATOM   497   N N3    . DC  A 1 25  ? 38.196  101.972 -18.766 1.00 156.64 ? 25   DC  I N3    1 
ATOM   498   C C4    . DC  A 1 25  ? 37.960  103.260 -18.508 1.00 156.63 ? 25   DC  I C4    1 
ATOM   499   N N4    . DC  A 1 25  ? 38.574  104.171 -19.267 1.00 155.51 ? 25   DC  I N4    1 
ATOM   500   C C5    . DC  A 1 25  ? 37.086  103.671 -17.460 1.00 157.06 ? 25   DC  I C5    1 
ATOM   501   C C6    . DC  A 1 25  ? 36.503  102.711 -16.728 1.00 157.39 ? 25   DC  I C6    1 
ATOM   502   P P     . DC  A 1 26  ? 36.389  97.901  -12.866 1.00 168.73 ? 26   DC  I P     1 
ATOM   503   O OP1   . DC  A 1 26  ? 35.811  96.680  -12.249 1.00 125.95 ? 26   DC  I OP1   1 
ATOM   504   O OP2   . DC  A 1 26  ? 36.626  99.106  -12.028 1.00 125.23 ? 26   DC  I OP2   1 
ATOM   505   O "O5'" . DC  A 1 26  ? 37.763  97.504  -13.569 1.00 165.01 ? 26   DC  I "O5'" 1 
ATOM   506   C "C5'" . DC  A 1 26  ? 38.342  98.353  -14.556 1.00 160.47 ? 26   DC  I "C5'" 1 
ATOM   507   C "C4'" . DC  A 1 26  ? 39.833  98.134  -14.627 1.00 156.74 ? 26   DC  I "C4'" 1 
ATOM   508   O "O4'" . DC  A 1 26  ? 40.386  99.077  -15.574 1.00 155.88 ? 26   DC  I "O4'" 1 
ATOM   509   C "C3'" . DC  A 1 26  ? 40.559  98.391  -13.310 1.00 155.37 ? 26   DC  I "C3'" 1 
ATOM   510   O "O3'" . DC  A 1 26  ? 41.674  97.504  -13.197 1.00 153.44 ? 26   DC  I "O3'" 1 
ATOM   511   C "C2'" . DC  A 1 26  ? 41.023  99.830  -13.439 1.00 154.12 ? 26   DC  I "C2'" 1 
ATOM   512   C "C1'" . DC  A 1 26  ? 41.290  99.964  -14.930 1.00 154.03 ? 26   DC  I "C1'" 1 
ATOM   513   N N1    . DC  A 1 26  ? 41.054  101.314 -15.475 1.00 109.05 ? 26   DC  I N1    1 
ATOM   514   C C2    . DC  A 1 26  ? 40.997  101.476 -16.864 1.00 107.77 ? 26   DC  I C2    1 
ATOM   515   O O2    . DC  A 1 26  ? 41.162  100.487 -17.589 1.00 107.12 ? 26   DC  I O2    1 
ATOM   516   N N3    . DC  A 1 26  ? 40.766  102.704 -17.379 1.00 106.16 ? 26   DC  I N3    1 
ATOM   517   C C4    . DC  A 1 26  ? 40.599  103.747 -16.566 1.00 105.59 ? 26   DC  I C4    1 
ATOM   518   N N4    . DC  A 1 26  ? 40.370  104.939 -17.121 1.00 104.08 ? 26   DC  I N4    1 
ATOM   519   C C5    . DC  A 1 26  ? 40.660  103.614 -15.147 1.00 106.37 ? 26   DC  I C5    1 
ATOM   520   C C6    . DC  A 1 26  ? 40.888  102.391 -14.649 1.00 108.09 ? 26   DC  I C6    1 
ATOM   521   P P     . DA  A 1 27  ? 41.649  96.330  -12.101 1.00 106.98 ? 27   DA  I P     1 
ATOM   522   O OP1   . DA  A 1 27  ? 40.333  95.653  -12.224 1.00 137.89 ? 27   DA  I OP1   1 
ATOM   523   O OP2   . DA  A 1 27  ? 42.069  96.889  -10.788 1.00 137.58 ? 27   DA  I OP2   1 
ATOM   524   O "O5'" . DA  A 1 27  ? 42.775  95.322  -12.606 1.00 106.14 ? 27   DA  I "O5'" 1 
ATOM   525   C "C5'" . DA  A 1 27  ? 42.597  94.574  -13.810 1.00 103.03 ? 27   DA  I "C5'" 1 
ATOM   526   C "C4'" . DA  A 1 27  ? 43.847  94.634  -14.656 1.00 101.32 ? 27   DA  I "C4'" 1 
ATOM   527   O "O4'" . DA  A 1 27  ? 44.061  95.994  -15.101 1.00 100.38 ? 27   DA  I "O4'" 1 
ATOM   528   C "C3'" . DA  A 1 27  ? 45.132  94.218  -13.944 1.00 100.55 ? 27   DA  I "C3'" 1 
ATOM   529   O "O3'" . DA  A 1 27  ? 45.964  93.495  -14.852 1.00 100.77 ? 27   DA  I "O3'" 1 
ATOM   530   C "C2'" . DA  A 1 27  ? 45.758  95.540  -13.536 1.00 100.60 ? 27   DA  I "C2'" 1 
ATOM   531   C "C1'" . DA  A 1 27  ? 45.306  96.491  -14.631 1.00 100.58 ? 27   DA  I "C1'" 1 
ATOM   532   N N9    . DA  A 1 27  ? 45.087  97.865  -14.172 1.00 132.55 ? 27   DA  I N9    1 
ATOM   533   C C8    . DA  A 1 27  ? 45.066  98.325  -12.878 1.00 132.54 ? 27   DA  I C8    1 
ATOM   534   N N7    . DA  A 1 27  ? 44.819  99.609  -12.776 1.00 132.75 ? 27   DA  I N7    1 
ATOM   535   C C5    . DA  A 1 27  ? 44.672  100.026 -14.090 1.00 133.23 ? 27   DA  I C5    1 
ATOM   536   C C6    . DA  A 1 27  ? 44.390  101.281 -14.658 1.00 133.69 ? 27   DA  I C6    1 
ATOM   537   N N6    . DA  A 1 27  ? 44.193  102.391 -13.943 1.00 134.29 ? 27   DA  I N6    1 
ATOM   538   N N1    . DA  A 1 27  ? 44.315  101.357 -16.004 1.00 134.07 ? 27   DA  I N1    1 
ATOM   539   C C2    . DA  A 1 27  ? 44.509  100.244 -16.721 1.00 134.16 ? 27   DA  I C2    1 
ATOM   540   N N3    . DA  A 1 27  ? 44.775  99.008  -16.304 1.00 133.75 ? 27   DA  I N3    1 
ATOM   541   C C4    . DA  A 1 27  ? 44.843  98.965  -14.962 1.00 133.20 ? 27   DA  I C4    1 
ATOM   542   P P     . DA  A 1 28  ? 47.527  93.313  -14.534 1.00 140.63 ? 28   DA  I P     1 
ATOM   543   O OP1   . DA  A 1 28  ? 48.011  92.146  -15.317 1.00 126.23 ? 28   DA  I OP1   1 
ATOM   544   O OP2   . DA  A 1 28  ? 47.724  93.347  -13.062 1.00 126.69 ? 28   DA  I OP2   1 
ATOM   545   O "O5'" . DA  A 1 28  ? 48.168  94.627  -15.158 1.00 139.18 ? 28   DA  I "O5'" 1 
ATOM   546   C "C5'" . DA  A 1 28  ? 47.819  95.040  -16.475 1.00 136.49 ? 28   DA  I "C5'" 1 
ATOM   547   C "C4'" . DA  A 1 28  ? 48.705  96.180  -16.912 1.00 134.14 ? 28   DA  I "C4'" 1 
ATOM   548   O "O4'" . DA  A 1 28  ? 48.335  97.393  -16.211 1.00 133.72 ? 28   DA  I "O4'" 1 
ATOM   549   C "C3'" . DA  A 1 28  ? 50.185  95.951  -16.616 1.00 132.59 ? 28   DA  I "C3'" 1 
ATOM   550   O "O3'" . DA  A 1 28  ? 50.974  96.448  -17.698 1.00 129.16 ? 28   DA  I "O3'" 1 
ATOM   551   C "C2'" . DA  A 1 28  ? 50.418  96.760  -15.352 1.00 132.51 ? 28   DA  I "C2'" 1 
ATOM   552   C "C1'" . DA  A 1 28  ? 49.471  97.930  -15.550 1.00 133.48 ? 28   DA  I "C1'" 1 
ATOM   553   N N9    . DA  A 1 28  ? 49.011  98.579  -14.322 1.00 119.57 ? 28   DA  I N9    1 
ATOM   554   C C8    . DA  A 1 28  ? 49.072  98.112  -13.032 1.00 119.78 ? 28   DA  I C8    1 
ATOM   555   N N7    . DA  A 1 28  ? 48.562  98.936  -12.147 1.00 119.57 ? 28   DA  I N7    1 
ATOM   556   C C5    . DA  A 1 28  ? 48.138  100.019 -12.905 1.00 119.45 ? 28   DA  I C5    1 
ATOM   557   C C6    . DA  A 1 28  ? 47.509  101.230 -12.560 1.00 119.20 ? 28   DA  I C6    1 
ATOM   558   N N6    . DA  A 1 28  ? 47.178  101.564 -11.312 1.00 119.30 ? 28   DA  I N6    1 
ATOM   559   N N1    . DA  A 1 28  ? 47.228  102.097 -13.556 1.00 119.09 ? 28   DA  I N1    1 
ATOM   560   C C2    . DA  A 1 28  ? 47.557  101.762 -14.809 1.00 119.21 ? 28   DA  I C2    1 
ATOM   561   N N3    . DA  A 1 28  ? 48.145  100.655 -15.259 1.00 119.62 ? 28   DA  I N3    1 
ATOM   562   C C4    . DA  A 1 28  ? 48.413  99.815  -14.245 1.00 119.61 ? 28   DA  I C4    1 
ATOM   563   P P     . DA  A 1 29  ? 52.548  96.146  -17.737 1.00 109.55 ? 29   DA  I P     1 
ATOM   564   O OP1   . DA  A 1 29  ? 52.881  95.584  -19.071 1.00 115.11 ? 29   DA  I OP1   1 
ATOM   565   O OP2   . DA  A 1 29  ? 52.892  95.387  -16.507 1.00 114.81 ? 29   DA  I OP2   1 
ATOM   566   O "O5'" . DA  A 1 29  ? 53.193  97.591  -17.612 1.00 107.17 ? 29   DA  I "O5'" 1 
ATOM   567   C "C5'" . DA  A 1 29  ? 52.519  98.594  -16.877 1.00 104.65 ? 29   DA  I "C5'" 1 
ATOM   568   C "C4'" . DA  A 1 29  ? 52.411  99.859  -17.691 1.00 103.01 ? 29   DA  I "C4'" 1 
ATOM   569   O "O4'" . DA  A 1 29  ? 51.493  100.737 -17.009 1.00 102.99 ? 29   DA  I "O4'" 1 
ATOM   570   C "C3'" . DA  A 1 29  ? 53.724  100.623 -17.782 1.00 102.53 ? 29   DA  I "C3'" 1 
ATOM   571   O "O3'" . DA  A 1 29  ? 53.786  101.386 -18.987 1.00 101.33 ? 29   DA  I "O3'" 1 
ATOM   572   C "C2'" . DA  A 1 29  ? 53.685  101.521 -16.561 1.00 103.21 ? 29   DA  I "C2'" 1 
ATOM   573   C "C1'" . DA  A 1 29  ? 52.197  101.757 -16.314 1.00 102.91 ? 29   DA  I "C1'" 1 
ATOM   574   N N9    . DA  A 1 29  ? 51.831  101.647 -14.902 1.00 107.45 ? 29   DA  I N9    1 
ATOM   575   C C8    . DA  A 1 29  ? 52.126  100.613 -14.046 1.00 106.69 ? 29   DA  I C8    1 
ATOM   576   N N7    . DA  A 1 29  ? 51.667  100.783 -12.833 1.00 106.60 ? 29   DA  I N7    1 
ATOM   577   C C5    . DA  A 1 29  ? 51.023  102.012 -12.890 1.00 107.52 ? 29   DA  I C5    1 
ATOM   578   C C6    . DA  A 1 29  ? 50.331  102.762 -11.924 1.00 107.47 ? 29   DA  I C6    1 
ATOM   579   N N6    . DA  A 1 29  ? 50.165  102.369 -10.660 1.00 108.10 ? 29   DA  I N6    1 
ATOM   580   N N1    . DA  A 1 29  ? 49.809  103.948 -12.306 1.00 107.44 ? 29   DA  I N1    1 
ATOM   581   C C2    . DA  A 1 29  ? 49.981  104.344 -13.572 1.00 107.27 ? 29   DA  I C2    1 
ATOM   582   N N3    . DA  A 1 29  ? 50.613  103.731 -14.569 1.00 107.44 ? 29   DA  I N3    1 
ATOM   583   C C4    . DA  A 1 29  ? 51.117  102.555 -14.158 1.00 107.34 ? 29   DA  I C4    1 
ATOM   584   P P     . DA  A 1 30  ? 55.134  102.178 -19.353 1.00 92.75  ? 30   DA  I P     1 
ATOM   585   O OP1   . DA  A 1 30  ? 55.077  102.561 -20.788 1.00 107.83 ? 30   DA  I OP1   1 
ATOM   586   O OP2   . DA  A 1 30  ? 56.273  101.364 -18.847 1.00 106.87 ? 30   DA  I OP2   1 
ATOM   587   O "O5'" . DA  A 1 30  ? 55.038  103.507 -18.489 1.00 90.54  ? 30   DA  I "O5'" 1 
ATOM   588   C "C5'" . DA  A 1 30  ? 54.063  104.492 -18.791 1.00 87.96  ? 30   DA  I "C5'" 1 
ATOM   589   C "C4'" . DA  A 1 30  ? 54.145  105.618 -17.790 1.00 87.23  ? 30   DA  I "C4'" 1 
ATOM   590   O "O4'" . DA  A 1 30  ? 53.648  105.178 -16.500 1.00 87.00  ? 30   DA  I "O4'" 1 
ATOM   591   C "C3'" . DA  A 1 30  ? 55.565  106.125 -17.546 1.00 86.77  ? 30   DA  I "C3'" 1 
ATOM   592   O "O3'" . DA  A 1 30  ? 55.537  107.539 -17.401 1.00 87.60  ? 30   DA  I "O3'" 1 
ATOM   593   C "C2'" . DA  A 1 30  ? 55.938  105.492 -16.219 1.00 86.76  ? 30   DA  I "C2'" 1 
ATOM   594   C "C1'" . DA  A 1 30  ? 54.604  105.490 -15.500 1.00 86.21  ? 30   DA  I "C1'" 1 
ATOM   595   N N9    . DA  A 1 30  ? 54.486  104.504 -14.423 1.00 99.93  ? 30   DA  I N9    1 
ATOM   596   C C8    . DA  A 1 30  ? 54.979  103.223 -14.388 1.00 99.42  ? 30   DA  I C8    1 
ATOM   597   N N7    . DA  A 1 30  ? 54.724  102.587 -13.270 1.00 98.97  ? 30   DA  I N7    1 
ATOM   598   C C5    . DA  A 1 30  ? 54.016  103.511 -12.515 1.00 98.89  ? 30   DA  I C5    1 
ATOM   599   C C6    . DA  A 1 30  ? 53.461  103.452 -11.222 1.00 98.46  ? 30   DA  I C6    1 
ATOM   600   N N6    . DA  A 1 30  ? 53.536  102.381 -10.429 1.00 98.77  ? 30   DA  I N6    1 
ATOM   601   N N1    . DA  A 1 30  ? 52.816  104.548 -10.766 1.00 98.03  ? 30   DA  I N1    1 
ATOM   602   C C2    . DA  A 1 30  ? 52.739  105.623 -11.561 1.00 98.40  ? 30   DA  I C2    1 
ATOM   603   N N3    . DA  A 1 30  ? 53.220  105.800 -12.791 1.00 98.81  ? 30   DA  I N3    1 
ATOM   604   C C4    . DA  A 1 30  ? 53.855  104.694 -13.215 1.00 99.18  ? 30   DA  I C4    1 
ATOM   605   P P     . DG  A 1 31  ? 56.912  108.355 -17.295 1.00 72.69  ? 31   DG  I P     1 
ATOM   606   O OP1   . DG  A 1 31  ? 57.043  109.192 -18.517 1.00 110.01 ? 31   DG  I OP1   1 
ATOM   607   O OP2   . DG  A 1 31  ? 57.992  107.401 -16.938 1.00 109.52 ? 31   DG  I OP2   1 
ATOM   608   O "O5'" . DG  A 1 31  ? 56.665  109.321 -16.056 1.00 76.18  ? 31   DG  I "O5'" 1 
ATOM   609   C "C5'" . DG  A 1 31  ? 55.412  109.982 -15.886 1.00 79.60  ? 31   DG  I "C5'" 1 
ATOM   610   C "C4'" . DG  A 1 31  ? 55.219  110.364 -14.436 1.00 82.11  ? 31   DG  I "C4'" 1 
ATOM   611   O "O4'" . DG  A 1 31  ? 54.920  109.186 -13.643 1.00 80.87  ? 31   DG  I "O4'" 1 
ATOM   612   C "C3'" . DG  A 1 31  ? 56.459  110.998 -13.805 1.00 84.25  ? 31   DG  I "C3'" 1 
ATOM   613   O "O3'" . DG  A 1 31  ? 56.095  112.067 -12.935 1.00 88.47  ? 31   DG  I "O3'" 1 
ATOM   614   C "C2'" . DG  A 1 31  ? 57.055  109.864 -12.995 1.00 83.40  ? 31   DG  I "C2'" 1 
ATOM   615   C "C1'" . DG  A 1 31  ? 55.807  109.141 -12.539 1.00 81.91  ? 31   DG  I "C1'" 1 
ATOM   616   N N9    . DG  A 1 31  ? 56.020  107.746 -12.170 1.00 117.99 ? 31   DG  I N9    1 
ATOM   617   C C8    . DG  A 1 31  ? 56.528  106.740 -12.955 1.00 117.43 ? 31   DG  I C8    1 
ATOM   618   N N7    . DG  A 1 31  ? 56.614  105.597 -12.329 1.00 117.16 ? 31   DG  I N7    1 
ATOM   619   C C5    . DG  A 1 31  ? 56.130  105.866 -11.056 1.00 118.36 ? 31   DG  I C5    1 
ATOM   620   C C6    . DG  A 1 31  ? 55.976  105.015 -9.929  1.00 118.65 ? 31   DG  I C6    1 
ATOM   621   O O6    . DG  A 1 31  ? 56.247  103.812 -9.829  1.00 118.84 ? 31   DG  I O6    1 
ATOM   622   N N1    . DG  A 1 31  ? 55.445  105.699 -8.841  1.00 118.84 ? 31   DG  I N1    1 
ATOM   623   C C2    . DG  A 1 31  ? 55.104  107.029 -8.833  1.00 118.67 ? 31   DG  I C2    1 
ATOM   624   N N2    . DG  A 1 31  ? 54.604  107.507 -7.684  1.00 118.93 ? 31   DG  I N2    1 
ATOM   625   N N3    . DG  A 1 31  ? 55.242  107.832 -9.874  1.00 118.55 ? 31   DG  I N3    1 
ATOM   626   C C4    . DG  A 1 31  ? 55.756  107.187 -10.944 1.00 118.30 ? 31   DG  I C4    1 
ATOM   627   P P     . DT  A 1 32  ? 57.246  112.947 -12.244 1.00 108.76 ? 32   DT  I P     1 
ATOM   628   O OP1   . DT  A 1 32  ? 56.947  114.374 -12.527 1.00 126.67 ? 32   DT  I OP1   1 
ATOM   629   O OP2   . DT  A 1 32  ? 58.572  112.389 -12.612 1.00 125.59 ? 32   DT  I OP2   1 
ATOM   630   O "O5'" . DT  A 1 32  ? 57.018  112.695 -10.689 1.00 112.79 ? 32   DT  I "O5'" 1 
ATOM   631   C "C5'" . DT  A 1 32  ? 55.839  113.165 -10.041 1.00 117.91 ? 32   DT  I "C5'" 1 
ATOM   632   C "C4'" . DT  A 1 32  ? 56.005  113.092 -8.542  1.00 122.00 ? 32   DT  I "C4'" 1 
ATOM   633   O "O4'" . DT  A 1 32  ? 55.940  111.714 -8.103  1.00 122.50 ? 32   DT  I "O4'" 1 
ATOM   634   C "C3'" . DT  A 1 32  ? 57.343  113.634 -8.041  1.00 124.22 ? 32   DT  I "C3'" 1 
ATOM   635   O "O3'" . DT  A 1 32  ? 57.165  114.358 -6.826  1.00 127.98 ? 32   DT  I "O3'" 1 
ATOM   636   C "C2'" . DT  A 1 32  ? 58.157  112.381 -7.782  1.00 124.28 ? 32   DT  I "C2'" 1 
ATOM   637   C "C1'" . DT  A 1 32  ? 57.090  111.402 -7.335  1.00 123.62 ? 32   DT  I "C1'" 1 
ATOM   638   N N1    . DT  A 1 32  ? 57.427  109.989 -7.574  1.00 141.72 ? 32   DT  I N1    1 
ATOM   639   C C2    . DT  A 1 32  ? 57.147  109.081 -6.579  1.00 142.59 ? 32   DT  I C2    1 
ATOM   640   O O2    . DT  A 1 32  ? 56.621  109.391 -5.521  1.00 142.99 ? 32   DT  I O2    1 
ATOM   641   N N3    . DT  A 1 32  ? 57.507  107.788 -6.869  1.00 142.91 ? 32   DT  I N3    1 
ATOM   642   C C4    . DT  A 1 32  ? 58.104  107.327 -8.028  1.00 142.58 ? 32   DT  I C4    1 
ATOM   643   O O4    . DT  A 1 32  ? 58.371  106.135 -8.145  1.00 142.94 ? 32   DT  I O4    1 
ATOM   644   C C5    . DT  A 1 32  ? 58.364  108.334 -9.029  1.00 142.13 ? 32   DT  I C5    1 
ATOM   645   C C7    . DT  A 1 32  ? 59.009  107.927 -10.316 1.00 142.14 ? 32   DT  I C7    1 
ATOM   646   C C6    . DT  A 1 32  ? 58.014  109.597 -8.757  1.00 141.75 ? 32   DT  I C6    1 
ATOM   647   P P     . DG  A 1 33  ? 58.452  114.865 -6.014  1.00 163.10 ? 33   DG  I P     1 
ATOM   648   O OP1   . DG  A 1 33  ? 58.043  116.000 -5.149  1.00 132.83 ? 33   DG  I OP1   1 
ATOM   649   O OP2   . DG  A 1 33  ? 59.553  115.048 -6.995  1.00 132.36 ? 33   DG  I OP2   1 
ATOM   650   O "O5'" . DG  A 1 33  ? 58.813  113.624 -5.083  1.00 164.72 ? 33   DG  I "O5'" 1 
ATOM   651   C "C5'" . DG  A 1 33  ? 57.944  113.237 -4.019  1.00 168.52 ? 33   DG  I "C5'" 1 
ATOM   652   C "C4'" . DG  A 1 33  ? 58.696  112.406 -3.006  1.00 170.58 ? 33   DG  I "C4'" 1 
ATOM   653   O "O4'" . DG  A 1 33  ? 58.916  111.072 -3.526  1.00 171.20 ? 33   DG  I "O4'" 1 
ATOM   654   C "C3'" . DG  A 1 33  ? 60.075  112.957 -2.644  1.00 171.73 ? 33   DG  I "C3'" 1 
ATOM   655   O "O3'" . DG  A 1 33  ? 60.325  112.812 -1.244  1.00 173.19 ? 33   DG  I "O3'" 1 
ATOM   656   C "C2'" . DG  A 1 33  ? 61.025  112.088 -3.448  1.00 171.60 ? 33   DG  I "C2'" 1 
ATOM   657   C "C1'" . DG  A 1 33  ? 60.298  110.755 -3.475  1.00 171.84 ? 33   DG  I "C1'" 1 
ATOM   658   N N9    . DG  A 1 33  ? 60.610  109.915 -4.628  1.00 141.69 ? 33   DG  I N9    1 
ATOM   659   C C8    . DG  A 1 33  ? 60.988  110.331 -5.883  1.00 141.93 ? 33   DG  I C8    1 
ATOM   660   N N7    . DG  A 1 33  ? 61.208  109.342 -6.706  1.00 141.78 ? 33   DG  I N7    1 
ATOM   661   C C5    . DG  A 1 33  ? 60.959  108.204 -5.951  1.00 141.43 ? 33   DG  I C5    1 
ATOM   662   C C6    . DG  A 1 33  ? 61.033  106.830 -6.305  1.00 141.15 ? 33   DG  I C6    1 
ATOM   663   O O6    . DG  A 1 33  ? 61.344  106.329 -7.392  1.00 140.38 ? 33   DG  I O6    1 
ATOM   664   N N1    . DG  A 1 33  ? 60.697  106.009 -5.235  1.00 141.05 ? 33   DG  I N1    1 
ATOM   665   C C2    . DG  A 1 33  ? 60.338  106.447 -3.986  1.00 141.30 ? 33   DG  I C2    1 
ATOM   666   N N2    . DG  A 1 33  ? 60.050  105.496 -3.087  1.00 141.49 ? 33   DG  I N2    1 
ATOM   667   N N3    . DG  A 1 33  ? 60.265  107.723 -3.642  1.00 141.75 ? 33   DG  I N3    1 
ATOM   668   C C4    . DG  A 1 33  ? 60.587  108.540 -4.667  1.00 141.69 ? 33   DG  I C4    1 
ATOM   669   P P     . DT  A 1 34  ? 61.549  113.606 -0.570  1.00 172.08 ? 34   DT  I P     1 
ATOM   670   O OP1   . DT  A 1 34  ? 61.512  113.370 0.896   1.00 153.68 ? 34   DT  I OP1   1 
ATOM   671   O OP2   . DT  A 1 34  ? 61.522  114.998 -1.090  1.00 153.32 ? 34   DT  I OP2   1 
ATOM   672   O "O5'" . DT  A 1 34  ? 62.835  112.882 -1.165  1.00 172.65 ? 34   DT  I "O5'" 1 
ATOM   673   C "C5'" . DT  A 1 34  ? 63.978  112.628 -0.353  1.00 174.27 ? 34   DT  I "C5'" 1 
ATOM   674   C "C4'" . DT  A 1 34  ? 63.784  111.348 0.426   1.00 174.91 ? 34   DT  I "C4'" 1 
ATOM   675   O "O4'" . DT  A 1 34  ? 63.293  110.312 -0.458  1.00 176.52 ? 34   DT  I "O4'" 1 
ATOM   676   C "C3'" . DT  A 1 34  ? 65.059  110.796 1.062   1.00 174.35 ? 34   DT  I "C3'" 1 
ATOM   677   O "O3'" . DT  A 1 34  ? 64.773  110.214 2.336   1.00 171.47 ? 34   DT  I "O3'" 1 
ATOM   678   C "C2'" . DT  A 1 34  ? 65.501  109.727 0.082   1.00 176.23 ? 34   DT  I "C2'" 1 
ATOM   679   C "C1'" . DT  A 1 34  ? 64.177  109.201 -0.448  1.00 177.65 ? 34   DT  I "C1'" 1 
ATOM   680   N N1    . DT  A 1 34  ? 64.247  108.665 -1.821  1.00 160.74 ? 34   DT  I N1    1 
ATOM   681   C C2    . DT  A 1 34  ? 63.522  107.532 -2.112  1.00 161.45 ? 34   DT  I C2    1 
ATOM   682   O O2    . DT  A 1 34  ? 62.818  106.962 -1.295  1.00 162.18 ? 34   DT  I O2    1 
ATOM   683   N N3    . DT  A 1 34  ? 63.651  107.089 -3.406  1.00 161.48 ? 34   DT  I N3    1 
ATOM   684   C C4    . DT  A 1 34  ? 64.411  107.655 -4.412  1.00 161.27 ? 34   DT  I C4    1 
ATOM   685   O O4    . DT  A 1 34  ? 64.432  107.142 -5.526  1.00 160.94 ? 34   DT  I O4    1 
ATOM   686   C C5    . DT  A 1 34  ? 65.140  108.845 -4.038  1.00 161.06 ? 34   DT  I C5    1 
ATOM   687   C C7    . DT  A 1 34  ? 65.986  109.532 -5.063  1.00 161.10 ? 34   DT  I C7    1 
ATOM   688   C C6    . DT  A 1 34  ? 65.022  109.284 -2.779  1.00 160.99 ? 34   DT  I C6    1 
ATOM   689   P P     . DA  A 1 35  ? 65.983  109.717 3.268   1.00 150.83 ? 35   DA  I P     1 
ATOM   690   O OP1   . DA  A 1 35  ? 65.410  109.352 4.588   1.00 131.85 ? 35   DA  I OP1   1 
ATOM   691   O OP2   . DA  A 1 35  ? 67.073  110.722 3.194   1.00 131.71 ? 35   DA  I OP2   1 
ATOM   692   O "O5'" . DA  A 1 35  ? 66.484  108.383 2.558   1.00 148.44 ? 35   DA  I "O5'" 1 
ATOM   693   C "C5'" . DA  A 1 35  ? 65.849  107.136 2.826   1.00 144.39 ? 35   DA  I "C5'" 1 
ATOM   694   C "C4'" . DA  A 1 35  ? 66.732  105.994 2.381   1.00 141.66 ? 35   DA  I "C4'" 1 
ATOM   695   O "O4'" . DA  A 1 35  ? 66.692  105.862 0.939   1.00 140.00 ? 35   DA  I "O4'" 1 
ATOM   696   C "C3'" . DA  A 1 35  ? 68.209  106.145 2.755   1.00 140.30 ? 35   DA  I "C3'" 1 
ATOM   697   O "O3'" . DA  A 1 35  ? 68.740  104.884 3.182   1.00 139.37 ? 35   DA  I "O3'" 1 
ATOM   698   C "C2'" . DA  A 1 35  ? 68.856  106.582 1.453   1.00 139.68 ? 35   DA  I "C2'" 1 
ATOM   699   C "C1'" . DA  A 1 35  ? 68.017  105.844 0.428   1.00 138.53 ? 35   DA  I "C1'" 1 
ATOM   700   N N9    . DA  A 1 35  ? 68.003  106.454 -0.902  1.00 116.53 ? 35   DA  I N9    1 
ATOM   701   C C8    . DA  A 1 35  ? 67.874  107.782 -1.226  1.00 116.29 ? 35   DA  I C8    1 
ATOM   702   N N7    . DA  A 1 35  ? 67.909  108.017 -2.515  1.00 115.34 ? 35   DA  I N7    1 
ATOM   703   C C5    . DA  A 1 35  ? 68.071  106.760 -3.078  1.00 114.45 ? 35   DA  I C5    1 
ATOM   704   C C6    . DA  A 1 35  ? 68.183  106.328 -4.410  1.00 113.70 ? 35   DA  I C6    1 
ATOM   705   N N6    . DA  A 1 35  ? 68.147  107.150 -5.460  1.00 113.01 ? 35   DA  I N6    1 
ATOM   706   N N1    . DA  A 1 35  ? 68.337  105.005 -4.630  1.00 113.22 ? 35   DA  I N1    1 
ATOM   707   C C2    . DA  A 1 35  ? 68.375  104.182 -3.575  1.00 113.53 ? 35   DA  I C2    1 
ATOM   708   N N3    . DA  A 1 35  ? 68.280  104.466 -2.280  1.00 114.23 ? 35   DA  I N3    1 
ATOM   709   C C4    . DA  A 1 35  ? 68.129  105.788 -2.096  1.00 114.95 ? 35   DA  I C4    1 
ATOM   710   P P     . DT  A 1 36  ? 70.330  104.690 3.326   1.00 169.04 ? 36   DT  I P     1 
ATOM   711   O OP1   . DT  A 1 36  ? 70.570  103.726 4.428   1.00 116.90 ? 36   DT  I OP1   1 
ATOM   712   O OP2   . DT  A 1 36  ? 70.971  106.032 3.373   1.00 116.67 ? 36   DT  I OP2   1 
ATOM   713   O "O5'" . DT  A 1 36  ? 70.741  103.979 1.962   1.00 167.64 ? 36   DT  I "O5'" 1 
ATOM   714   C "C5'" . DT  A 1 36  ? 70.200  102.702 1.624   1.00 167.03 ? 36   DT  I "C5'" 1 
ATOM   715   C "C4'" . DT  A 1 36  ? 71.058  102.023 0.583   1.00 165.62 ? 36   DT  I "C4'" 1 
ATOM   716   O "O4'" . DT  A 1 36  ? 70.873  102.658 -0.706  1.00 166.37 ? 36   DT  I "O4'" 1 
ATOM   717   C "C3'" . DT  A 1 36  ? 72.561  102.053 0.864   1.00 164.32 ? 36   DT  I "C3'" 1 
ATOM   718   O "O3'" . DT  A 1 36  ? 73.141  100.782 0.548   1.00 160.70 ? 36   DT  I "O3'" 1 
ATOM   719   C "C2'" . DT  A 1 36  ? 73.071  103.148 -0.057  1.00 165.04 ? 36   DT  I "C2'" 1 
ATOM   720   C "C1'" . DT  A 1 36  ? 72.129  103.043 -1.244  1.00 166.26 ? 36   DT  I "C1'" 1 
ATOM   721   N N1    . DT  A 1 36  ? 71.940  104.308 -1.985  1.00 114.30 ? 36   DT  I N1    1 
ATOM   722   C C2    . DT  A 1 36  ? 71.698  104.242 -3.342  1.00 113.84 ? 36   DT  I C2    1 
ATOM   723   O O2    . DT  A 1 36  ? 71.637  103.191 -3.959  1.00 113.58 ? 36   DT  I O2    1 
ATOM   724   N N3    . DT  A 1 36  ? 71.531  105.461 -3.952  1.00 113.47 ? 36   DT  I N3    1 
ATOM   725   C C4    . DT  A 1 36  ? 71.583  106.709 -3.357  1.00 113.47 ? 36   DT  I C4    1 
ATOM   726   O O4    . DT  A 1 36  ? 71.408  107.718 -4.033  1.00 112.32 ? 36   DT  I O4    1 
ATOM   727   C C5    . DT  A 1 36  ? 71.848  106.703 -1.936  1.00 113.65 ? 36   DT  I C5    1 
ATOM   728   C C7    . DT  A 1 36  ? 71.937  108.008 -1.209  1.00 113.48 ? 36   DT  I C7    1 
ATOM   729   C C6    . DT  A 1 36  ? 72.007  105.520 -1.329  1.00 114.10 ? 36   DT  I C6    1 
ATOM   730   P P     . DT  A 1 37  ? 74.706  100.677 0.193   1.00 139.09 ? 37   DT  I P     1 
ATOM   731   O OP1   . DT  A 1 37  ? 75.167  99.323  0.593   1.00 109.83 ? 37   DT  I OP1   1 
ATOM   732   O OP2   . DT  A 1 37  ? 75.416  101.878 0.712   1.00 109.80 ? 37   DT  I OP2   1 
ATOM   733   O "O5'" . DT  A 1 37  ? 74.708  100.730 -1.397  1.00 136.44 ? 37   DT  I "O5'" 1 
ATOM   734   C "C5'" . DT  A 1 37  ? 73.820  99.901  -2.146  1.00 132.40 ? 37   DT  I "C5'" 1 
ATOM   735   C "C4'" . DT  A 1 37  ? 74.297  99.785  -3.573  1.00 128.60 ? 37   DT  I "C4'" 1 
ATOM   736   O "O4'" . DT  A 1 37  ? 74.082  101.039 -4.263  1.00 128.20 ? 37   DT  I "O4'" 1 
ATOM   737   C "C3'" . DT  A 1 37  ? 75.789  99.484  -3.694  1.00 126.24 ? 37   DT  I "C3'" 1 
ATOM   738   O "O3'" . DT  A 1 37  ? 76.024  98.588  -4.777  1.00 122.00 ? 37   DT  I "O3'" 1 
ATOM   739   C "C2'" . DT  A 1 37  ? 76.403  100.843 -3.973  1.00 126.12 ? 37   DT  I "C2'" 1 
ATOM   740   C "C1'" . DT  A 1 37  ? 75.312  101.538 -4.765  1.00 127.23 ? 37   DT  I "C1'" 1 
ATOM   741   N N1    . DT  A 1 37  ? 75.297  103.005 -4.615  1.00 98.27  ? 37   DT  I N1    1 
ATOM   742   C C2    . DT  A 1 37  ? 75.270  103.773 -5.757  1.00 98.10  ? 37   DT  I C2    1 
ATOM   743   O O2    . DT  A 1 37  ? 75.255  103.296 -6.882  1.00 98.16  ? 37   DT  I O2    1 
ATOM   744   N N3    . DT  A 1 37  ? 75.261  105.130 -5.534  1.00 97.41  ? 37   DT  I N3    1 
ATOM   745   C C4    . DT  A 1 37  ? 75.275  105.776 -4.313  1.00 97.03  ? 37   DT  I C4    1 
ATOM   746   O O4    . DT  A 1 37  ? 75.266  107.003 -4.269  1.00 96.04  ? 37   DT  I O4    1 
ATOM   747   C C5    . DT  A 1 37  ? 75.303  104.906 -3.157  1.00 97.43  ? 37   DT  I C5    1 
ATOM   748   C C7    . DT  A 1 37  ? 75.321  105.516 -1.790  1.00 97.27  ? 37   DT  I C7    1 
ATOM   749   C C6    . DT  A 1 37  ? 75.311  103.583 -3.364  1.00 97.89  ? 37   DT  I C6    1 
ATOM   750   P P     . DT  A 1 38  ? 77.528  98.287  -5.239  1.00 108.06 ? 38   DT  I P     1 
ATOM   751   O OP1   . DT  A 1 38  ? 77.526  96.978  -5.944  1.00 114.75 ? 38   DT  I OP1   1 
ATOM   752   O OP2   . DT  A 1 38  ? 78.422  98.492  -4.072  1.00 115.50 ? 38   DT  I OP2   1 
ATOM   753   O "O5'" . DT  A 1 38  ? 77.818  99.438  -6.302  1.00 106.19 ? 38   DT  I "O5'" 1 
ATOM   754   C "C5'" . DT  A 1 38  ? 76.938  99.635  -7.406  1.00 101.70 ? 38   DT  I "C5'" 1 
ATOM   755   C "C4'" . DT  A 1 38  ? 77.572  100.541 -8.435  1.00 98.22  ? 38   DT  I "C4'" 1 
ATOM   756   O "O4'" . DT  A 1 38  ? 77.468  101.931 -8.045  1.00 98.36  ? 38   DT  I "O4'" 1 
ATOM   757   C "C3'" . DT  A 1 38  ? 79.054  100.277 -8.700  1.00 95.54  ? 38   DT  I "C3'" 1 
ATOM   758   O "O3'" . DT  A 1 38  ? 79.304  100.359 -10.101 1.00 90.56  ? 38   DT  I "O3'" 1 
ATOM   759   C "C2'" . DT  A 1 38  ? 79.743  101.430 -7.992  1.00 96.87  ? 38   DT  I "C2'" 1 
ATOM   760   C "C1'" . DT  A 1 38  ? 78.735  102.547 -8.184  1.00 98.40  ? 38   DT  I "C1'" 1 
ATOM   761   N N1    . DT  A 1 38  ? 78.812  103.658 -7.216  1.00 107.12 ? 38   DT  I N1    1 
ATOM   762   C C2    . DT  A 1 38  ? 78.619  104.934 -7.693  1.00 107.93 ? 38   DT  I C2    1 
ATOM   763   O O2    . DT  A 1 38  ? 78.399  105.178 -8.865  1.00 108.37 ? 38   DT  I O2    1 
ATOM   764   N N3    . DT  A 1 38  ? 78.695  105.920 -6.742  1.00 108.72 ? 38   DT  I N3    1 
ATOM   765   C C4    . DT  A 1 38  ? 78.941  105.762 -5.393  1.00 108.84 ? 38   DT  I C4    1 
ATOM   766   O O4    . DT  A 1 38  ? 78.973  106.745 -4.658  1.00 109.01 ? 38   DT  I O4    1 
ATOM   767   C C5    . DT  A 1 38  ? 79.143  104.395 -4.960  1.00 109.06 ? 38   DT  I C5    1 
ATOM   768   C C7    . DT  A 1 38  ? 79.428  104.125 -3.516  1.00 109.32 ? 38   DT  I C7    1 
ATOM   769   C C6    . DT  A 1 38  ? 79.066  103.425 -5.881  1.00 108.33 ? 38   DT  I C6    1 
ATOM   770   P P     . DG  A 1 39  ? 79.479  99.013  -10.957 1.00 78.40  ? 39   DG  I P     1 
ATOM   771   O OP1   . DG  A 1 39  ? 78.302  98.147  -10.699 1.00 89.89  ? 39   DG  I OP1   1 
ATOM   772   O OP2   . DG  A 1 39  ? 80.845  98.489  -10.712 1.00 89.96  ? 39   DG  I OP2   1 
ATOM   773   O "O5'" . DG  A 1 39  ? 79.398  99.522  -12.464 1.00 75.71  ? 39   DG  I "O5'" 1 
ATOM   774   C "C5'" . DG  A 1 39  ? 78.152  99.915  -13.021 1.00 71.32  ? 39   DG  I "C5'" 1 
ATOM   775   C "C4'" . DG  A 1 39  ? 78.320  101.158 -13.863 1.00 69.49  ? 39   DG  I "C4'" 1 
ATOM   776   O "O4'" . DG  A 1 39  ? 78.658  102.293 -13.032 1.00 69.17  ? 39   DG  I "O4'" 1 
ATOM   777   C "C3'" . DG  A 1 39  ? 79.409  101.079 -14.928 1.00 67.34  ? 39   DG  I "C3'" 1 
ATOM   778   O "O3'" . DG  A 1 39  ? 78.955  101.775 -16.091 1.00 63.28  ? 39   DG  I "O3'" 1 
ATOM   779   C "C2'" . DG  A 1 39  ? 80.589  101.782 -14.277 1.00 67.70  ? 39   DG  I "C2'" 1 
ATOM   780   C "C1'" . DG  A 1 39  ? 79.922  102.832 -13.402 1.00 69.51  ? 39   DG  I "C1'" 1 
ATOM   781   N N9    . DG  A 1 39  ? 80.639  103.143 -12.167 1.00 83.42  ? 39   DG  I N9    1 
ATOM   782   C C8    . DG  A 1 39  ? 81.368  102.273 -11.387 1.00 83.39  ? 39   DG  I C8    1 
ATOM   783   N N7    . DG  A 1 39  ? 81.850  102.831 -10.309 1.00 83.17  ? 39   DG  I N7    1 
ATOM   784   C C5    . DG  A 1 39  ? 81.427  104.152 -10.384 1.00 83.80  ? 39   DG  I C5    1 
ATOM   785   C C6    . DG  A 1 39  ? 81.641  105.240 -9.494  1.00 84.03  ? 39   DG  I C6    1 
ATOM   786   O O6    . DG  A 1 39  ? 82.259  105.252 -8.421  1.00 84.57  ? 39   DG  I O6    1 
ATOM   787   N N1    . DG  A 1 39  ? 81.045  106.406 -9.961  1.00 83.48  ? 39   DG  I N1    1 
ATOM   788   C C2    . DG  A 1 39  ? 80.334  106.516 -11.130 1.00 83.01  ? 39   DG  I C2    1 
ATOM   789   N N2    . DG  A 1 39  ? 79.843  107.730 -11.411 1.00 82.00  ? 39   DG  I N2    1 
ATOM   790   N N3    . DG  A 1 39  ? 80.121  105.509 -11.965 1.00 82.96  ? 39   DG  I N3    1 
ATOM   791   C C4    . DG  A 1 39  ? 80.692  104.366 -11.533 1.00 83.31  ? 39   DG  I C4    1 
ATOM   792   P P     . DG  A 1 40  ? 79.753  101.631 -17.476 1.00 57.34  ? 40   DG  I P     1 
ATOM   793   O OP1   . DG  A 1 40  ? 78.732  101.772 -18.554 1.00 66.57  ? 40   DG  I OP1   1 
ATOM   794   O OP2   . DG  A 1 40  ? 80.607  100.407 -17.420 1.00 64.78  ? 40   DG  I OP2   1 
ATOM   795   O "O5'" . DG  A 1 40  ? 80.708  102.908 -17.490 1.00 57.44  ? 40   DG  I "O5'" 1 
ATOM   796   C "C5'" . DG  A 1 40  ? 80.166  104.225 -17.427 1.00 57.96  ? 40   DG  I "C5'" 1 
ATOM   797   C "C4'" . DG  A 1 40  ? 81.263  105.233 -17.175 1.00 59.93  ? 40   DG  I "C4'" 1 
ATOM   798   O "O4'" . DG  A 1 40  ? 81.735  105.156 -15.806 1.00 60.54  ? 40   DG  I "O4'" 1 
ATOM   799   C "C3'" . DG  A 1 40  ? 82.508  105.083 -18.055 1.00 61.12  ? 40   DG  I "C3'" 1 
ATOM   800   O "O3'" . DG  A 1 40  ? 83.025  106.383 -18.345 1.00 63.74  ? 40   DG  I "O3'" 1 
ATOM   801   C "C2'" . DG  A 1 40  ? 83.499  104.413 -17.122 1.00 61.19  ? 40   DG  I "C2'" 1 
ATOM   802   C "C1'" . DG  A 1 40  ? 83.154  105.127 -15.832 1.00 61.53  ? 40   DG  I "C1'" 1 
ATOM   803   N N9    . DG  A 1 40  ? 83.633  104.519 -14.593 1.00 71.79  ? 40   DG  I N9    1 
ATOM   804   C C8    . DG  A 1 40  ? 83.976  103.203 -14.377 1.00 71.46  ? 40   DG  I C8    1 
ATOM   805   N N7    . DG  A 1 40  ? 84.369  102.971 -13.153 1.00 70.82  ? 40   DG  I N7    1 
ATOM   806   C C5    . DG  A 1 40  ? 84.278  104.207 -12.522 1.00 71.71  ? 40   DG  I C5    1 
ATOM   807   C C6    . DG  A 1 40  ? 84.564  104.580 -11.176 1.00 71.88  ? 40   DG  I C6    1 
ATOM   808   O O6    . DG  A 1 40  ? 84.958  103.862 -10.243 1.00 71.74  ? 40   DG  I O6    1 
ATOM   809   N N1    . DG  A 1 40  ? 84.339  105.941 -10.965 1.00 70.48  ? 40   DG  I N1    1 
ATOM   810   C C2    . DG  A 1 40  ? 83.891  106.827 -11.921 1.00 70.66  ? 40   DG  I C2    1 
ATOM   811   N N2    . DG  A 1 40  ? 83.732  108.098 -11.529 1.00 68.91  ? 40   DG  I N2    1 
ATOM   812   N N3    . DG  A 1 40  ? 83.618  106.489 -13.172 1.00 70.12  ? 40   DG  I N3    1 
ATOM   813   C C4    . DG  A 1 40  ? 83.831  105.173 -13.400 1.00 71.11  ? 40   DG  I C4    1 
ATOM   814   P P     . DA  A 1 41  ? 82.890  106.992 -19.823 1.00 74.35  ? 41   DA  I P     1 
ATOM   815   O OP1   . DA  A 1 41  ? 81.471  106.829 -20.243 1.00 67.69  ? 41   DA  I OP1   1 
ATOM   816   O OP2   . DA  A 1 41  ? 83.983  106.443 -20.673 1.00 67.68  ? 41   DA  I OP2   1 
ATOM   817   O "O5'" . DA  A 1 41  ? 83.165  108.545 -19.594 1.00 75.26  ? 41   DA  I "O5'" 1 
ATOM   818   C "C5'" . DA  A 1 41  ? 82.222  109.360 -18.899 1.00 76.64  ? 41   DA  I "C5'" 1 
ATOM   819   C "C4'" . DA  A 1 41  ? 82.940  110.393 -18.062 1.00 78.85  ? 41   DA  I "C4'" 1 
ATOM   820   O "O4'" . DA  A 1 41  ? 83.527  109.778 -16.890 1.00 78.33  ? 41   DA  I "O4'" 1 
ATOM   821   C "C3'" . DA  A 1 41  ? 84.082  111.116 -18.774 1.00 80.83  ? 41   DA  I "C3'" 1 
ATOM   822   O "O3'" . DA  A 1 41  ? 84.079  112.491 -18.390 1.00 86.23  ? 41   DA  I "O3'" 1 
ATOM   823   C "C2'" . DA  A 1 41  ? 85.324  110.413 -18.251 1.00 78.93  ? 41   DA  I "C2'" 1 
ATOM   824   C "C1'" . DA  A 1 41  ? 84.920  110.058 -16.831 1.00 76.90  ? 41   DA  I "C1'" 1 
ATOM   825   N N9    . DA  A 1 41  ? 85.582  108.878 -16.274 1.00 69.76  ? 41   DA  I N9    1 
ATOM   826   C C8    . DA  A 1 41  ? 85.844  107.683 -16.903 1.00 69.31  ? 41   DA  I C8    1 
ATOM   827   N N7    . DA  A 1 41  ? 86.398  106.786 -16.126 1.00 67.89  ? 41   DA  I N7    1 
ATOM   828   C C5    . DA  A 1 41  ? 86.521  107.433 -14.904 1.00 67.93  ? 41   DA  I C5    1 
ATOM   829   C C6    . DA  A 1 41  ? 87.025  107.015 -13.660 1.00 67.33  ? 41   DA  I C6    1 
ATOM   830   N N6    . DA  A 1 41  ? 87.511  105.793 -13.434 1.00 66.53  ? 41   DA  I N6    1 
ATOM   831   N N1    . DA  A 1 41  ? 87.012  107.907 -12.645 1.00 66.59  ? 41   DA  I N1    1 
ATOM   832   C C2    . DA  A 1 41  ? 86.522  109.132 -12.875 1.00 66.59  ? 41   DA  I C2    1 
ATOM   833   N N3    . DA  A 1 41  ? 86.015  109.642 -13.997 1.00 67.32  ? 41   DA  I N3    1 
ATOM   834   C C4    . DA  A 1 41  ? 86.041  108.729 -14.985 1.00 68.59  ? 41   DA  I C4    1 
ATOM   835   P P     . DA  A 1 42  ? 85.155  113.499 -19.023 1.00 90.96  ? 42   DA  I P     1 
ATOM   836   O OP1   . DA  A 1 42  ? 84.525  114.841 -19.100 1.00 86.45  ? 42   DA  I OP1   1 
ATOM   837   O OP2   . DA  A 1 42  ? 85.715  112.873 -20.251 1.00 85.48  ? 42   DA  I OP2   1 
ATOM   838   O "O5'" . DA  A 1 42  ? 86.298  113.559 -17.919 1.00 93.35  ? 42   DA  I "O5'" 1 
ATOM   839   C "C5'" . DA  A 1 42  ? 86.056  114.186 -16.665 1.00 96.30  ? 42   DA  I "C5'" 1 
ATOM   840   C "C4'" . DA  A 1 42  ? 87.330  114.244 -15.857 1.00 99.34  ? 42   DA  I "C4'" 1 
ATOM   841   O "O4'" . DA  A 1 42  ? 87.664  112.924 -15.361 1.00 98.31  ? 42   DA  I "O4'" 1 
ATOM   842   C "C3'" . DA  A 1 42  ? 88.551  114.729 -16.639 1.00 100.88 ? 42   DA  I "C3'" 1 
ATOM   843   O "O3'" . DA  A 1 42  ? 89.340  115.595 -15.821 1.00 105.57 ? 42   DA  I "O3'" 1 
ATOM   844   C "C2'" . DA  A 1 42  ? 89.314  113.450 -16.926 1.00 99.54  ? 42   DA  I "C2'" 1 
ATOM   845   C "C1'" . DA  A 1 42  ? 89.007  112.626 -15.690 1.00 98.30  ? 42   DA  I "C1'" 1 
ATOM   846   N N9    . DA  A 1 42  ? 89.118  111.181 -15.876 1.00 92.41  ? 42   DA  I N9    1 
ATOM   847   C C8    . DA  A 1 42  ? 88.899  110.451 -17.019 1.00 92.28  ? 42   DA  I C8    1 
ATOM   848   N N7    . DA  A 1 42  ? 89.119  109.166 -16.876 1.00 92.08  ? 42   DA  I N7    1 
ATOM   849   C C5    . DA  A 1 42  ? 89.504  109.040 -15.548 1.00 92.02  ? 42   DA  I C5    1 
ATOM   850   C C6    . DA  A 1 42  ? 89.883  107.928 -14.773 1.00 91.61  ? 42   DA  I C6    1 
ATOM   851   N N6    . DA  A 1 42  ? 89.952  106.681 -15.248 1.00 90.30  ? 42   DA  I N6    1 
ATOM   852   N N1    . DA  A 1 42  ? 90.197  108.145 -13.477 1.00 91.54  ? 42   DA  I N1    1 
ATOM   853   C C2    . DA  A 1 42  ? 90.138  109.398 -13.004 1.00 91.48  ? 42   DA  I C2    1 
ATOM   854   N N3    . DA  A 1 42  ? 89.805  110.523 -13.633 1.00 91.53  ? 42   DA  I N3    1 
ATOM   855   C C4    . DA  A 1 42  ? 89.495  110.272 -14.917 1.00 92.07  ? 42   DA  I C4    1 
ATOM   856   P P     . DA  A 1 43  ? 90.467  116.520 -16.496 1.00 138.25 ? 43   DA  I P     1 
ATOM   857   O OP1   . DA  A 1 43  ? 90.167  117.935 -16.160 1.00 97.18  ? 43   DA  I OP1   1 
ATOM   858   O OP2   . DA  A 1 43  ? 90.614  116.120 -17.919 1.00 97.13  ? 43   DA  I OP2   1 
ATOM   859   O "O5'" . DA  A 1 43  ? 91.796  116.087 -15.734 1.00 139.16 ? 43   DA  I "O5'" 1 
ATOM   860   C "C5'" . DA  A 1 43  ? 91.860  116.118 -14.311 1.00 141.88 ? 43   DA  I "C5'" 1 
ATOM   861   C "C4'" . DA  A 1 43  ? 93.046  115.319 -13.824 1.00 143.08 ? 43   DA  I "C4'" 1 
ATOM   862   O "O4'" . DA  A 1 43  ? 92.797  113.901 -13.992 1.00 143.27 ? 43   DA  I "O4'" 1 
ATOM   863   C "C3'" . DA  A 1 43  ? 94.355  115.612 -14.559 1.00 143.57 ? 43   DA  I "C3'" 1 
ATOM   864   O "O3'" . DA  A 1 43  ? 95.437  115.657 -13.628 1.00 144.63 ? 43   DA  I "O3'" 1 
ATOM   865   C "C2'" . DA  A 1 43  ? 94.511  114.422 -15.488 1.00 143.36 ? 43   DA  I "C2'" 1 
ATOM   866   C "C1'" . DA  A 1 43  ? 93.893  113.307 -14.670 1.00 143.01 ? 43   DA  I "C1'" 1 
ATOM   867   N N9    . DA  A 1 43  ? 93.391  112.179 -15.455 1.00 101.65 ? 43   DA  I N9    1 
ATOM   868   C C8    . DA  A 1 43  ? 92.666  112.211 -16.622 1.00 102.04 ? 43   DA  I C8    1 
ATOM   869   N N7    . DA  A 1 43  ? 92.377  111.023 -17.099 1.00 101.51 ? 43   DA  I N7    1 
ATOM   870   C C5    . DA  A 1 43  ? 92.947  110.149 -16.183 1.00 100.63 ? 43   DA  I C5    1 
ATOM   871   C C6    . DA  A 1 43  ? 92.998  108.744 -16.119 1.00 99.86  ? 43   DA  I C6    1 
ATOM   872   N N6    . DA  A 1 43  ? 92.452  107.941 -17.033 1.00 98.65  ? 43   DA  I N6    1 
ATOM   873   N N1    . DA  A 1 43  ? 93.642  108.186 -15.071 1.00 99.34  ? 43   DA  I N1    1 
ATOM   874   C C2    . DA  A 1 43  ? 94.197  108.992 -14.157 1.00 99.43  ? 43   DA  I C2    1 
ATOM   875   N N3    . DA  A 1 43  ? 94.221  110.322 -14.109 1.00 100.45 ? 43   DA  I N3    1 
ATOM   876   C C4    . DA  A 1 43  ? 93.571  110.847 -15.163 1.00 101.08 ? 43   DA  I C4    1 
ATOM   877   P P     . DC  A 1 44  ? 96.937  115.867 -14.161 1.00 138.70 ? 44   DC  I P     1 
ATOM   878   O OP1   . DC  A 1 44  ? 97.620  116.786 -13.209 1.00 95.43  ? 44   DC  I OP1   1 
ATOM   879   O OP2   . DC  A 1 44  ? 96.896  116.206 -15.607 1.00 95.13  ? 44   DC  I OP2   1 
ATOM   880   O "O5'" . DC  A 1 44  ? 97.581  114.420 -14.016 1.00 138.39 ? 44   DC  I "O5'" 1 
ATOM   881   C "C5'" . DC  A 1 44  ? 97.690  113.802 -12.739 1.00 140.80 ? 44   DC  I "C5'" 1 
ATOM   882   C "C4'" . DC  A 1 44  ? 98.539  112.557 -12.837 1.00 141.85 ? 44   DC  I "C4'" 1 
ATOM   883   O "O4'" . DC  A 1 44  ? 97.790  111.493 -13.477 1.00 141.93 ? 44   DC  I "O4'" 1 
ATOM   884   C "C3'" . DC  A 1 44  ? 99.816  112.735 -13.662 1.00 142.33 ? 44   DC  I "C3'" 1 
ATOM   885   O "O3'" . DC  A 1 44  ? 100.906 112.056 -13.031 1.00 142.60 ? 44   DC  I "O3'" 1 
ATOM   886   C "C2'" . DC  A 1 44  ? 99.469  112.078 -14.985 1.00 142.07 ? 44   DC  I "C2'" 1 
ATOM   887   C "C1'" . DC  A 1 44  ? 98.565  110.951 -14.532 1.00 141.61 ? 44   DC  I "C1'" 1 
ATOM   888   N N1    . DC  A 1 44  ? 97.655  110.432 -15.565 1.00 97.35  ? 44   DC  I N1    1 
ATOM   889   C C2    . DC  A 1 44  ? 97.347  109.065 -15.559 1.00 97.05  ? 44   DC  I C2    1 
ATOM   890   O O2    . DC  A 1 44  ? 97.819  108.349 -14.663 1.00 96.93  ? 44   DC  I O2    1 
ATOM   891   N N3    . DC  A 1 44  ? 96.546  108.561 -16.527 1.00 96.40  ? 44   DC  I N3    1 
ATOM   892   C C4    . DC  A 1 44  ? 96.054  109.366 -17.471 1.00 96.16  ? 44   DC  I C4    1 
ATOM   893   N N4    . DC  A 1 44  ? 95.281  108.818 -18.415 1.00 94.50  ? 44   DC  I N4    1 
ATOM   894   C C5    . DC  A 1 44  ? 96.334  110.767 -17.491 1.00 96.50  ? 44   DC  I C5    1 
ATOM   895   C C6    . DC  A 1 44  ? 97.130  111.253 -16.525 1.00 97.27  ? 44   DC  I C6    1 
ATOM   896   P P     . DT  A 1 45  ? 102.184 111.614 -13.899 1.00 154.27 ? 45   DT  I P     1 
ATOM   897   O OP1   . DT  A 1 45  ? 103.355 111.535 -12.987 1.00 104.59 ? 45   DT  I OP1   1 
ATOM   898   O OP2   . DT  A 1 45  ? 102.253 112.474 -15.108 1.00 104.10 ? 45   DT  I OP2   1 
ATOM   899   O "O5'" . DT  A 1 45  ? 101.809 110.140 -14.368 1.00 153.60 ? 45   DT  I "O5'" 1 
ATOM   900   C "C5'" . DT  A 1 45  ? 101.539 109.123 -13.408 1.00 155.09 ? 45   DT  I "C5'" 1 
ATOM   901   C "C4'" . DT  A 1 45  ? 102.037 107.791 -13.913 1.00 155.10 ? 45   DT  I "C4'" 1 
ATOM   902   O "O4'" . DT  A 1 45  ? 101.126 107.264 -14.907 1.00 156.13 ? 45   DT  I "O4'" 1 
ATOM   903   C "C3'" . DT  A 1 45  ? 103.407 107.869 -14.586 1.00 154.77 ? 45   DT  I "C3'" 1 
ATOM   904   O "O3'" . DT  A 1 45  ? 104.186 106.723 -14.253 1.00 152.12 ? 45   DT  I "O3'" 1 
ATOM   905   C "C2'" . DT  A 1 45  ? 103.071 107.869 -16.066 1.00 155.60 ? 45   DT  I "C2'" 1 
ATOM   906   C "C1'" . DT  A 1 45  ? 101.825 107.002 -16.114 1.00 156.73 ? 45   DT  I "C1'" 1 
ATOM   907   N N1    . DT  A 1 45  ? 100.914 107.297 -17.237 1.00 107.67 ? 45   DT  I N1    1 
ATOM   908   C C2    . DT  A 1 45  ? 100.302 106.238 -17.873 1.00 107.44 ? 45   DT  I C2    1 
ATOM   909   O O2    . DT  A 1 45  ? 100.485 105.072 -17.558 1.00 106.79 ? 45   DT  I O2    1 
ATOM   910   N N3    . DT  A 1 45  ? 99.461  106.597 -18.898 1.00 107.52 ? 45   DT  I N3    1 
ATOM   911   C C4    . DT  A 1 45  ? 99.181  107.877 -19.342 1.00 107.57 ? 45   DT  I C4    1 
ATOM   912   O O4    . DT  A 1 45  ? 98.397  108.046 -20.272 1.00 107.14 ? 45   DT  I O4    1 
ATOM   913   C C5    . DT  A 1 45  ? 99.866  108.938 -18.635 1.00 107.67 ? 45   DT  I C5    1 
ATOM   914   C C7    . DT  A 1 45  ? 99.633  110.356 -19.053 1.00 107.42 ? 45   DT  I C7    1 
ATOM   915   C C6    . DT  A 1 45  ? 100.685 108.599 -17.631 1.00 107.73 ? 45   DT  I C6    1 
ATOM   916   P P     . DG  A 1 46  ? 105.769 106.736 -14.516 1.00 109.46 ? 46   DG  I P     1 
ATOM   917   O OP1   . DG  A 1 46  ? 106.427 106.594 -13.192 1.00 110.41 ? 46   DG  I OP1   1 
ATOM   918   O OP2   . DG  A 1 46  ? 106.106 107.892 -15.385 1.00 109.47 ? 46   DG  I OP2   1 
ATOM   919   O "O5'" . DG  A 1 46  ? 106.007 105.396 -15.339 1.00 108.56 ? 46   DG  I "O5'" 1 
ATOM   920   C "C5'" . DG  A 1 46  ? 105.433 104.167 -14.903 1.00 106.63 ? 46   DG  I "C5'" 1 
ATOM   921   C "C4'" . DG  A 1 46  ? 105.352 103.194 -16.055 1.00 105.61 ? 46   DG  I "C4'" 1 
ATOM   922   O "O4'" . DG  A 1 46  ? 104.362 103.635 -17.015 1.00 105.39 ? 46   DG  I "O4'" 1 
ATOM   923   C "C3'" . DG  A 1 46  ? 106.652 103.033 -16.841 1.00 104.99 ? 46   DG  I "C3'" 1 
ATOM   924   O "O3'" . DG  A 1 46  ? 106.752 101.680 -17.282 1.00 104.10 ? 46   DG  I "O3'" 1 
ATOM   925   C "C2'" . DG  A 1 46  ? 106.446 103.947 -18.035 1.00 104.87 ? 46   DG  I "C2'" 1 
ATOM   926   C "C1'" . DG  A 1 46  ? 104.965 103.753 -18.297 1.00 105.31 ? 46   DG  I "C1'" 1 
ATOM   927   N N9    . DG  A 1 46  ? 104.299 104.840 -19.008 1.00 105.65 ? 46   DG  I N9    1 
ATOM   928   C C8    . DG  A 1 46  ? 104.514 106.191 -18.870 1.00 105.45 ? 46   DG  I C8    1 
ATOM   929   N N7    . DG  A 1 46  ? 103.738 106.913 -19.633 1.00 104.92 ? 46   DG  I N7    1 
ATOM   930   C C5    . DG  A 1 46  ? 102.968 105.983 -20.318 1.00 104.70 ? 46   DG  I C5    1 
ATOM   931   C C6    . DG  A 1 46  ? 101.939 106.168 -21.280 1.00 104.12 ? 46   DG  I C6    1 
ATOM   932   O O6    . DG  A 1 46  ? 101.481 107.225 -21.727 1.00 103.67 ? 46   DG  I O6    1 
ATOM   933   N N1    . DG  A 1 46  ? 101.428 104.952 -21.720 1.00 103.79 ? 46   DG  I N1    1 
ATOM   934   C C2    . DG  A 1 46  ? 101.847 103.717 -21.290 1.00 104.08 ? 46   DG  I C2    1 
ATOM   935   N N2    . DG  A 1 46  ? 101.232 102.658 -21.838 1.00 103.96 ? 46   DG  I N2    1 
ATOM   936   N N3    . DG  A 1 46  ? 102.797 103.532 -20.390 1.00 104.30 ? 46   DG  I N3    1 
ATOM   937   C C4    . DG  A 1 46  ? 103.309 104.699 -19.950 1.00 104.96 ? 46   DG  I C4    1 
ATOM   938   P P     . DC  A 1 47  ? 108.174 101.088 -17.727 1.00 111.42 ? 47   DC  I P     1 
ATOM   939   O OP1   . DC  A 1 47  ? 108.776 100.405 -16.552 1.00 103.73 ? 47   DC  I OP1   1 
ATOM   940   O OP2   . DC  A 1 47  ? 108.924 102.169 -18.420 1.00 103.31 ? 47   DC  I OP2   1 
ATOM   941   O "O5'" . DC  A 1 47  ? 107.772 99.976  -18.790 1.00 109.27 ? 47   DC  I "O5'" 1 
ATOM   942   C "C5'" . DC  A 1 47  ? 106.663 99.123  -18.538 1.00 105.17 ? 47   DC  I "C5'" 1 
ATOM   943   C "C4'" . DC  A 1 47  ? 105.866 98.905  -19.802 1.00 102.16 ? 47   DC  I "C4'" 1 
ATOM   944   O "O4'" . DC  A 1 47  ? 105.328 100.165 -20.274 1.00 100.71 ? 47   DC  I "O4'" 1 
ATOM   945   C "C3'" . DC  A 1 47  ? 106.656 98.314  -20.968 1.00 100.39 ? 47   DC  I "C3'" 1 
ATOM   946   O "O3'" . DC  A 1 47  ? 105.850 97.337  -21.626 1.00 98.91  ? 47   DC  I "O3'" 1 
ATOM   947   C "C2'" . DC  A 1 47  ? 106.897 99.508  -21.875 1.00 99.93  ? 47   DC  I "C2'" 1 
ATOM   948   C "C1'" . DC  A 1 47  ? 105.649 100.338 -21.644 1.00 99.80  ? 47   DC  I "C1'" 1 
ATOM   949   N N1    . DC  A 1 47  ? 105.801 101.782 -21.898 1.00 90.64  ? 47   DC  I N1    1 
ATOM   950   C C2    . DC  A 1 47  ? 104.930 102.404 -22.807 1.00 90.26  ? 47   DC  I C2    1 
ATOM   951   O O2    . DC  A 1 47  ? 104.052 101.725 -23.363 1.00 90.06  ? 47   DC  I O2    1 
ATOM   952   N N3    . DC  A 1 47  ? 105.068 103.726 -23.054 1.00 89.51  ? 47   DC  I N3    1 
ATOM   953   C C4    . DC  A 1 47  ? 106.020 104.426 -22.433 1.00 89.16  ? 47   DC  I C4    1 
ATOM   954   N N4    . DC  A 1 47  ? 106.120 105.728 -22.711 1.00 88.27  ? 47   DC  I N4    1 
ATOM   955   C C5    . DC  A 1 47  ? 106.913 103.821 -21.501 1.00 89.18  ? 47   DC  I C5    1 
ATOM   956   C C6    . DC  A 1 47  ? 106.771 102.509 -21.267 1.00 89.89  ? 47   DC  I C6    1 
ATOM   957   P P     . DT  A 1 48  ? 106.547 96.142  -22.442 1.00 117.45 ? 48   DT  I P     1 
ATOM   958   O OP1   . DT  A 1 48  ? 106.268 94.859  -21.749 1.00 93.03  ? 48   DT  I OP1   1 
ATOM   959   O OP2   . DT  A 1 48  ? 107.950 96.548  -22.720 1.00 92.66  ? 48   DT  I OP2   1 
ATOM   960   O "O5'" . DT  A 1 48  ? 105.750 96.155  -23.815 1.00 115.80 ? 48   DT  I "O5'" 1 
ATOM   961   C "C5'" . DT  A 1 48  ? 105.309 97.392  -24.341 1.00 113.07 ? 48   DT  I "C5'" 1 
ATOM   962   C "C4'" . DT  A 1 48  ? 103.988 97.238  -25.053 1.00 109.99 ? 48   DT  I "C4'" 1 
ATOM   963   O "O4'" . DT  A 1 48  ? 103.494 98.568  -25.293 1.00 110.05 ? 48   DT  I "O4'" 1 
ATOM   964   C "C3'" . DT  A 1 48  ? 104.098 96.601  -26.430 1.00 108.30 ? 48   DT  I "C3'" 1 
ATOM   965   O "O3'" . DT  A 1 48  ? 102.841 96.014  -26.796 1.00 105.58 ? 48   DT  I "O3'" 1 
ATOM   966   C "C2'" . DT  A 1 48  ? 104.468 97.782  -27.309 1.00 108.50 ? 48   DT  I "C2'" 1 
ATOM   967   C "C1'" . DT  A 1 48  ? 103.835 98.984  -26.606 1.00 109.25 ? 48   DT  I "C1'" 1 
ATOM   968   N N1    . DT  A 1 48  ? 104.734 100.144 -26.458 1.00 86.03  ? 48   DT  I N1    1 
ATOM   969   C C2    . DT  A 1 48  ? 104.273 101.383 -26.839 1.00 86.65  ? 48   DT  I C2    1 
ATOM   970   O O2    . DT  A 1 48  ? 103.172 101.560 -27.337 1.00 88.21  ? 48   DT  I O2    1 
ATOM   971   N N3    . DT  A 1 48  ? 105.153 102.414 -26.612 1.00 86.03  ? 48   DT  I N3    1 
ATOM   972   C C4    . DT  A 1 48  ? 106.416 102.329 -26.057 1.00 85.60  ? 48   DT  I C4    1 
ATOM   973   O O4    . DT  A 1 48  ? 107.083 103.348 -25.891 1.00 84.55  ? 48   DT  I O4    1 
ATOM   974   C C5    . DT  A 1 48  ? 106.843 100.994 -25.705 1.00 85.73  ? 48   DT  I C5    1 
ATOM   975   C C7    . DT  A 1 48  ? 108.203 100.798 -25.112 1.00 85.73  ? 48   DT  I C7    1 
ATOM   976   C C6    . DT  A 1 48  ? 105.995 99.983  -25.926 1.00 85.45  ? 48   DT  I C6    1 
ATOM   977   P P     . DC  A 1 49  ? 102.728 95.129  -28.134 1.00 79.52  ? 49   DC  I P     1 
ATOM   978   O OP1   . DC  A 1 49  ? 101.410 94.449  -28.131 1.00 79.77  ? 49   DC  I OP1   1 
ATOM   979   O OP2   . DC  A 1 49  ? 103.971 94.320  -28.237 1.00 79.80  ? 49   DC  I OP2   1 
ATOM   980   O "O5'" . DC  A 1 49  ? 102.731 96.208  -29.306 1.00 77.74  ? 49   DC  I "O5'" 1 
ATOM   981   C "C5'" . DC  A 1 49  ? 101.683 97.170  -29.415 1.00 74.75  ? 49   DC  I "C5'" 1 
ATOM   982   C "C4'" . DC  A 1 49  ? 102.033 98.210  -30.453 1.00 73.74  ? 49   DC  I "C4'" 1 
ATOM   983   O "O4'" . DC  A 1 49  ? 103.092 99.079  -29.985 1.00 73.82  ? 49   DC  I "O4'" 1 
ATOM   984   C "C3'" . DC  A 1 49  ? 102.523 97.646  -31.787 1.00 72.88  ? 49   DC  I "C3'" 1 
ATOM   985   O "O3'" . DC  A 1 49  ? 102.135 98.546  -32.820 1.00 69.64  ? 49   DC  I "O3'" 1 
ATOM   986   C "C2'" . DC  A 1 49  ? 104.030 97.749  -31.655 1.00 74.01  ? 49   DC  I "C2'" 1 
ATOM   987   C "C1'" . DC  A 1 49  ? 104.131 99.090  -30.954 1.00 74.69  ? 49   DC  I "C1'" 1 
ATOM   988   N N1    . DC  A 1 49  ? 105.400 99.385  -30.271 1.00 76.56  ? 49   DC  I N1    1 
ATOM   989   C C2    . DC  A 1 49  ? 105.713 100.722 -30.006 1.00 76.42  ? 49   DC  I C2    1 
ATOM   990   O O2    . DC  A 1 49  ? 104.924 101.605 -30.377 1.00 75.25  ? 49   DC  I O2    1 
ATOM   991   N N3    . DC  A 1 49  ? 106.863 101.016 -29.353 1.00 76.95  ? 49   DC  I N3    1 
ATOM   992   C C4    . DC  A 1 49  ? 107.682 100.033 -28.970 1.00 76.58  ? 49   DC  I C4    1 
ATOM   993   N N4    . DC  A 1 49  ? 108.789 100.367 -28.308 1.00 76.23  ? 49   DC  I N4    1 
ATOM   994   C C5    . DC  A 1 49  ? 107.396 98.662  -29.243 1.00 76.85  ? 49   DC  I C5    1 
ATOM   995   C C6    . DC  A 1 49  ? 106.255 98.386  -29.892 1.00 76.80  ? 49   DC  I C6    1 
ATOM   996   P P     . DC  A 1 50  ? 100.781 98.297  -33.632 1.00 65.43  ? 50   DC  I P     1 
ATOM   997   O OP1   . DC  A 1 50  ? 99.678  98.208  -32.638 1.00 69.95  ? 50   DC  I OP1   1 
ATOM   998   O OP2   . DC  A 1 50  ? 101.000 97.189  -34.601 1.00 71.84  ? 50   DC  I OP2   1 
ATOM   999   O "O5'" . DC  A 1 50  ? 100.622 99.651  -34.456 1.00 64.87  ? 50   DC  I "O5'" 1 
ATOM   1000  C "C5'" . DC  A 1 50  ? 100.101 100.822 -33.836 1.00 62.32  ? 50   DC  I "C5'" 1 
ATOM   1001  C "C4'" . DC  A 1 50  ? 100.820 102.051 -34.342 1.00 62.21  ? 50   DC  I "C4'" 1 
ATOM   1002  O "O4'" . DC  A 1 50  ? 102.094 102.221 -33.670 1.00 63.68  ? 50   DC  I "O4'" 1 
ATOM   1003  C "C3'" . DC  A 1 50  ? 101.115 102.071 -35.843 1.00 60.80  ? 50   DC  I "C3'" 1 
ATOM   1004  O "O3'" . DC  A 1 50  ? 100.807 103.356 -36.378 1.00 59.28  ? 50   DC  I "O3'" 1 
ATOM   1005  C "C2'" . DC  A 1 50  ? 102.613 101.827 -35.915 1.00 62.26  ? 50   DC  I "C2'" 1 
ATOM   1006  C "C1'" . DC  A 1 50  ? 103.112 102.472 -34.629 1.00 63.61  ? 50   DC  I "C1'" 1 
ATOM   1007  N N1    . DC  A 1 50  ? 104.381 101.918 -34.106 1.00 70.43  ? 50   DC  I N1    1 
ATOM   1008  C C2    . DC  A 1 50  ? 105.362 102.800 -33.596 1.00 69.18  ? 50   DC  I C2    1 
ATOM   1009  O O2    . DC  A 1 50  ? 105.133 104.016 -33.579 1.00 68.68  ? 50   DC  I O2    1 
ATOM   1010  N N3    . DC  A 1 50  ? 106.526 102.294 -33.133 1.00 69.12  ? 50   DC  I N3    1 
ATOM   1011  C C4    . DC  A 1 50  ? 106.734 100.973 -33.150 1.00 70.45  ? 50   DC  I C4    1 
ATOM   1012  N N4    . DC  A 1 50  ? 107.894 100.515 -32.674 1.00 70.56  ? 50   DC  I N4    1 
ATOM   1013  C C5    . DC  A 1 50  ? 105.759 100.059 -33.653 1.00 70.30  ? 50   DC  I C5    1 
ATOM   1014  C C6    . DC  A 1 50  ? 104.610 100.570 -34.116 1.00 70.13  ? 50   DC  I C6    1 
ATOM   1015  P P     . DA  A 1 51  ? 100.755 103.565 -37.966 1.00 52.76  ? 51   DA  I P     1 
ATOM   1016  O OP1   . DA  A 1 51  ? 99.388  104.006 -38.330 1.00 62.61  ? 51   DA  I OP1   1 
ATOM   1017  O OP2   . DA  A 1 51  ? 101.337 102.351 -38.599 1.00 60.60  ? 51   DA  I OP2   1 
ATOM   1018  O "O5'" . DA  A 1 51  ? 101.744 104.790 -38.219 1.00 58.38  ? 51   DA  I "O5'" 1 
ATOM   1019  C "C5'" . DA  A 1 51  ? 101.622 105.997 -37.462 1.00 63.78  ? 51   DA  I "C5'" 1 
ATOM   1020  C "C4'" . DA  A 1 51  ? 102.818 106.893 -37.692 1.00 68.14  ? 51   DA  I "C4'" 1 
ATOM   1021  O "O4'" . DA  A 1 51  ? 104.002 106.340 -37.065 1.00 68.44  ? 51   DA  I "O4'" 1 
ATOM   1022  C "C3'" . DA  A 1 51  ? 103.177 107.110 -39.160 1.00 70.52  ? 51   DA  I "C3'" 1 
ATOM   1023  O "O3'" . DA  A 1 51  ? 103.580 108.466 -39.352 1.00 75.57  ? 51   DA  I "O3'" 1 
ATOM   1024  C "C2'" . DA  A 1 51  ? 104.325 106.144 -39.393 1.00 70.07  ? 51   DA  I "C2'" 1 
ATOM   1025  C "C1'" . DA  A 1 51  ? 105.012 106.082 -38.035 1.00 70.04  ? 51   DA  I "C1'" 1 
ATOM   1026  N N9    . DA  A 1 51  ? 105.582 104.770 -37.729 1.00 79.97  ? 51   DA  I N9    1 
ATOM   1027  C C8    . DA  A 1 51  ? 105.068 103.545 -38.076 1.00 80.88  ? 51   DA  I C8    1 
ATOM   1028  N N7    . DA  A 1 51  ? 105.771 102.531 -37.637 1.00 80.93  ? 51   DA  I N7    1 
ATOM   1029  C C5    . DA  A 1 51  ? 106.823 103.125 -36.958 1.00 80.63  ? 51   DA  I C5    1 
ATOM   1030  C C6    . DA  A 1 51  ? 107.914 102.587 -36.256 1.00 80.99  ? 51   DA  I C6    1 
ATOM   1031  N N6    . DA  A 1 51  ? 108.123 101.275 -36.104 1.00 80.04  ? 51   DA  I N6    1 
ATOM   1032  N N1    . DA  A 1 51  ? 108.793 103.452 -35.706 1.00 81.36  ? 51   DA  I N1    1 
ATOM   1033  C C2    . DA  A 1 51  ? 108.576 104.767 -35.853 1.00 82.30  ? 51   DA  I C2    1 
ATOM   1034  N N3    . DA  A 1 51  ? 107.583 105.394 -36.481 1.00 81.89  ? 51   DA  I N3    1 
ATOM   1035  C C4    . DA  A 1 51  ? 106.729 104.505 -37.018 1.00 81.14  ? 51   DA  I C4    1 
ATOM   1036  P P     . DT  A 1 52  ? 104.124 108.942 -40.781 1.00 97.51  ? 52   DT  I P     1 
ATOM   1037  O OP1   . DT  A 1 52  ? 103.755 110.371 -40.956 1.00 83.15  ? 52   DT  I OP1   1 
ATOM   1038  O OP2   . DT  A 1 52  ? 103.703 107.948 -41.795 1.00 83.77  ? 52   DT  I OP2   1 
ATOM   1039  O "O5'" . DT  A 1 52  ? 105.702 108.835 -40.614 1.00 100.74 ? 52   DT  I "O5'" 1 
ATOM   1040  C "C5'" . DT  A 1 52  ? 106.365 109.538 -39.567 1.00 106.55 ? 52   DT  I "C5'" 1 
ATOM   1041  C "C4'" . DT  A 1 52  ? 107.860 109.374 -39.694 1.00 110.71 ? 52   DT  I "C4'" 1 
ATOM   1042  O "O4'" . DT  A 1 52  ? 108.271 108.066 -39.225 1.00 111.29 ? 52   DT  I "O4'" 1 
ATOM   1043  C "C3'" . DT  A 1 52  ? 108.390 109.502 -41.123 1.00 113.66 ? 52   DT  I "C3'" 1 
ATOM   1044  O "O3'" . DT  A 1 52  ? 109.600 110.260 -41.121 1.00 119.51 ? 52   DT  I "O3'" 1 
ATOM   1045  C "C2'" . DT  A 1 52  ? 108.668 108.064 -41.525 1.00 112.36 ? 52   DT  I "C2'" 1 
ATOM   1046  C "C1'" . DT  A 1 52  ? 109.089 107.446 -40.204 1.00 111.18 ? 52   DT  I "C1'" 1 
ATOM   1047  N N1    . DT  A 1 52  ? 108.900 105.985 -40.100 1.00 96.71  ? 52   DT  I N1    1 
ATOM   1048  C C2    . DT  A 1 52  ? 109.689 105.290 -39.209 1.00 96.27  ? 52   DT  I C2    1 
ATOM   1049  O O2    . DT  A 1 52  ? 110.530 105.821 -38.504 1.00 96.14  ? 52   DT  I O2    1 
ATOM   1050  N N3    . DT  A 1 52  ? 109.452 103.938 -39.170 1.00 96.38  ? 52   DT  I N3    1 
ATOM   1051  C C4    . DT  A 1 52  ? 108.524 103.229 -39.912 1.00 96.68  ? 52   DT  I C4    1 
ATOM   1052  O O4    . DT  A 1 52  ? 108.418 102.013 -39.764 1.00 96.38  ? 52   DT  I O4    1 
ATOM   1053  C C5    . DT  A 1 52  ? 107.734 104.021 -40.825 1.00 96.64  ? 52   DT  I C5    1 
ATOM   1054  C C7    . DT  A 1 52  ? 106.705 103.338 -41.670 1.00 96.47  ? 52   DT  I C7    1 
ATOM   1055  C C6    . DT  A 1 52  ? 107.959 105.340 -40.874 1.00 96.74  ? 52   DT  I C6    1 
ATOM   1056  P P     . DC  A 1 53  ? 110.203 110.805 -42.505 1.00 135.60 ? 53   DC  I P     1 
ATOM   1057  O OP1   . DC  A 1 53  ? 110.424 112.265 -42.331 1.00 106.63 ? 53   DC  I OP1   1 
ATOM   1058  O OP2   . DC  A 1 53  ? 109.363 110.321 -43.630 1.00 106.33 ? 53   DC  I OP2   1 
ATOM   1059  O "O5'" . DC  A 1 53  ? 111.618 110.079 -42.591 1.00 138.61 ? 53   DC  I "O5'" 1 
ATOM   1060  C "C5'" . DC  A 1 53  ? 112.591 110.256 -41.563 1.00 145.61 ? 53   DC  I "C5'" 1 
ATOM   1061  C "C4'" . DC  A 1 53  ? 113.760 109.324 -41.780 1.00 150.48 ? 53   DC  I "C4'" 1 
ATOM   1062  O "O4'" . DC  A 1 53  ? 113.419 107.970 -41.390 1.00 151.23 ? 53   DC  I "O4'" 1 
ATOM   1063  C "C3'" . DC  A 1 53  ? 114.238 109.239 -43.231 1.00 154.16 ? 53   DC  I "C3'" 1 
ATOM   1064  O "O3'" . DC  A 1 53  ? 115.664 109.200 -43.276 1.00 159.00 ? 53   DC  I "O3'" 1 
ATOM   1065  C "C2'" . DC  A 1 53  ? 113.682 107.908 -43.704 1.00 152.71 ? 53   DC  I "C2'" 1 
ATOM   1066  C "C1'" . DC  A 1 53  ? 113.780 107.085 -42.437 1.00 151.87 ? 53   DC  I "C1'" 1 
ATOM   1067  N N1    . DC  A 1 53  ? 112.899 105.907 -42.377 1.00 122.72 ? 53   DC  I N1    1 
ATOM   1068  C C2    . DC  A 1 53  ? 113.202 104.895 -41.463 1.00 122.55 ? 53   DC  I C2    1 
ATOM   1069  O O2    . DC  A 1 53  ? 114.183 105.037 -40.717 1.00 121.91 ? 53   DC  I O2    1 
ATOM   1070  N N3    . DC  A 1 53  ? 112.421 103.791 -41.413 1.00 122.17 ? 53   DC  I N3    1 
ATOM   1071  C C4    . DC  A 1 53  ? 111.371 103.681 -42.230 1.00 121.87 ? 53   DC  I C4    1 
ATOM   1072  N N4    . DC  A 1 53  ? 110.634 102.571 -42.153 1.00 121.40 ? 53   DC  I N4    1 
ATOM   1073  C C5    . DC  A 1 53  ? 111.032 104.703 -43.164 1.00 122.23 ? 53   DC  I C5    1 
ATOM   1074  C C6    . DC  A 1 53  ? 111.815 105.789 -43.202 1.00 122.78 ? 53   DC  I C6    1 
ATOM   1075  P P     . DA  A 1 54  ? 116.414 109.246 -44.695 1.00 129.16 ? 54   DA  I P     1 
ATOM   1076  O OP1   . DA  A 1 54  ? 117.305 110.434 -44.706 1.00 157.85 ? 54   DA  I OP1   1 
ATOM   1077  O OP2   . DA  A 1 54  ? 115.384 109.091 -45.755 1.00 157.78 ? 54   DA  I OP2   1 
ATOM   1078  O "O5'" . DA  A 1 54  ? 117.316 107.935 -44.682 1.00 132.49 ? 54   DA  I "O5'" 1 
ATOM   1079  C "C5'" . DA  A 1 54  ? 118.282 107.725 -43.654 1.00 137.62 ? 54   DA  I "C5'" 1 
ATOM   1080  C "C4'" . DA  A 1 54  ? 118.924 106.368 -43.813 1.00 141.91 ? 54   DA  I "C4'" 1 
ATOM   1081  O "O4'" . DA  A 1 54  ? 117.933 105.343 -43.563 1.00 142.69 ? 54   DA  I "O4'" 1 
ATOM   1082  C "C3'" . DA  A 1 54  ? 119.473 106.093 -45.213 1.00 143.79 ? 54   DA  I "C3'" 1 
ATOM   1083  O "O3'" . DA  A 1 54  ? 120.676 105.323 -45.130 1.00 146.45 ? 54   DA  I "O3'" 1 
ATOM   1084  C "C2'" . DA  A 1 54  ? 118.367 105.289 -45.869 1.00 144.91 ? 54   DA  I "C2'" 1 
ATOM   1085  C "C1'" . DA  A 1 54  ? 117.798 104.505 -44.700 1.00 144.56 ? 54   DA  I "C1'" 1 
ATOM   1086  N N9    . DA  A 1 54  ? 116.382 104.168 -44.841 1.00 174.92 ? 54   DA  I N9    1 
ATOM   1087  C C8    . DA  A 1 54  ? 115.334 105.014 -45.111 1.00 175.15 ? 54   DA  I C8    1 
ATOM   1088  N N7    . DA  A 1 54  ? 114.172 104.411 -45.178 1.00 175.85 ? 54   DA  I N7    1 
ATOM   1089  C C5    . DA  A 1 54  ? 114.475 103.078 -44.936 1.00 176.53 ? 54   DA  I C5    1 
ATOM   1090  C C6    . DA  A 1 54  ? 113.677 101.924 -44.870 1.00 177.28 ? 54   DA  I C6    1 
ATOM   1091  N N6    . DA  A 1 54  ? 112.354 101.929 -45.047 1.00 177.91 ? 54   DA  I N6    1 
ATOM   1092  N N1    . DA  A 1 54  ? 114.293 100.749 -44.611 1.00 177.86 ? 54   DA  I N1    1 
ATOM   1093  C C2    . DA  A 1 54  ? 115.620 100.746 -44.431 1.00 177.53 ? 54   DA  I C2    1 
ATOM   1094  N N3    . DA  A 1 54  ? 116.476 101.764 -44.467 1.00 176.60 ? 54   DA  I N3    1 
ATOM   1095  C C4    . DA  A 1 54  ? 115.833 102.915 -44.727 1.00 175.92 ? 54   DA  I C4    1 
ATOM   1096  P P     . DA  A 1 55  ? 121.536 105.043 -46.458 1.00 181.75 ? 55   DA  I P     1 
ATOM   1097  O OP1   . DA  A 1 55  ? 122.973 105.190 -46.117 1.00 155.26 ? 55   DA  I OP1   1 
ATOM   1098  O OP2   . DA  A 1 55  ? 120.954 105.857 -47.555 1.00 155.04 ? 55   DA  I OP2   1 
ATOM   1099  O "O5'" . DA  A 1 55  ? 121.254 103.507 -46.772 1.00 182.45 ? 55   DA  I "O5'" 1 
ATOM   1100  C "C5'" . DA  A 1 55  ? 121.590 102.495 -45.823 1.00 184.75 ? 55   DA  I "C5'" 1 
ATOM   1101  C "C4'" . DA  A 1 55  ? 121.141 101.140 -46.318 1.00 185.76 ? 55   DA  I "C4'" 1 
ATOM   1102  O "O4'" . DA  A 1 55  ? 119.692 101.086 -46.347 1.00 186.41 ? 55   DA  I "O4'" 1 
ATOM   1103  C "C3'" . DA  A 1 55  ? 121.605 100.795 -47.734 1.00 186.05 ? 55   DA  I "C3'" 1 
ATOM   1104  O "O3'" . DA  A 1 55  ? 121.905 99.398  -47.824 1.00 185.72 ? 55   DA  I "O3'" 1 
ATOM   1105  C "C2'" . DA  A 1 55  ? 120.388 101.113 -48.581 1.00 186.41 ? 55   DA  I "C2'" 1 
ATOM   1106  C "C1'" . DA  A 1 55  ? 119.255 100.726 -47.649 1.00 186.51 ? 55   DA  I "C1'" 1 
ATOM   1107  N N9    . DA  A 1 55  ? 117.993 101.415 -47.913 1.00 158.83 ? 55   DA  I N9    1 
ATOM   1108  C C8    . DA  A 1 55  ? 117.800 102.729 -48.262 1.00 159.17 ? 55   DA  I C8    1 
ATOM   1109  N N7    . DA  A 1 55  ? 116.543 103.047 -48.452 1.00 158.92 ? 55   DA  I N7    1 
ATOM   1110  C C5    . DA  A 1 55  ? 115.860 101.864 -48.208 1.00 158.04 ? 55   DA  I C5    1 
ATOM   1111  C C6    . DA  A 1 55  ? 114.494 101.536 -48.245 1.00 157.45 ? 55   DA  I C6    1 
ATOM   1112  N N6    . DA  A 1 55  ? 113.532 102.407 -48.555 1.00 156.45 ? 55   DA  I N6    1 
ATOM   1113  N N1    . DA  A 1 55  ? 114.146 100.264 -47.949 1.00 157.03 ? 55   DA  I N1    1 
ATOM   1114  C C2    . DA  A 1 55  ? 115.113 99.391  -47.638 1.00 157.25 ? 55   DA  I C2    1 
ATOM   1115  N N3    . DA  A 1 55  ? 116.428 99.579  -47.570 1.00 157.99 ? 55   DA  I N3    1 
ATOM   1116  C C4    . DA  A 1 55  ? 116.740 100.852 -47.871 1.00 158.40 ? 55   DA  I C4    1 
ATOM   1117  P P     . DA  A 1 56  ? 122.733 98.837  -49.084 1.00 187.15 ? 56   DA  I P     1 
ATOM   1118  O OP1   . DA  A 1 56  ? 124.107 98.509  -48.627 1.00 157.07 ? 56   DA  I OP1   1 
ATOM   1119  O OP2   . DA  A 1 56  ? 122.541 99.784  -50.213 1.00 156.81 ? 56   DA  I OP2   1 
ATOM   1120  O "O5'" . DA  A 1 56  ? 121.990 97.475  -49.442 1.00 186.98 ? 56   DA  I "O5'" 1 
ATOM   1121  C "C5'" . DA  A 1 56  ? 121.680 96.523  -48.425 1.00 187.77 ? 56   DA  I "C5'" 1 
ATOM   1122  C "C4'" . DA  A 1 56  ? 120.467 95.710  -48.816 1.00 187.57 ? 56   DA  I "C4'" 1 
ATOM   1123  O "O4'" . DA  A 1 56  ? 119.300 96.569  -48.871 1.00 188.46 ? 56   DA  I "O4'" 1 
ATOM   1124  C "C3'" . DA  A 1 56  ? 120.561 95.040  -50.185 1.00 186.88 ? 56   DA  I "C3'" 1 
ATOM   1125  O "O3'" . DA  A 1 56  ? 119.939 93.754  -50.138 1.00 184.56 ? 56   DA  I "O3'" 1 
ATOM   1126  C "C2'" . DA  A 1 56  ? 119.781 95.976  -51.089 1.00 188.03 ? 56   DA  I "C2'" 1 
ATOM   1127  C "C1'" . DA  A 1 56  ? 118.703 96.504  -50.159 1.00 188.98 ? 56   DA  I "C1'" 1 
ATOM   1128  N N9    . DA  A 1 56  ? 118.233 97.846  -50.507 1.00 159.27 ? 56   DA  I N9    1 
ATOM   1129  C C8    . DA  A 1 56  ? 118.991 98.976  -50.689 1.00 160.05 ? 56   DA  I C8    1 
ATOM   1130  N N7    . DA  A 1 56  ? 118.291 100.038 -51.006 1.00 159.84 ? 56   DA  I N7    1 
ATOM   1131  C C5    . DA  A 1 56  ? 116.982 99.578  -51.033 1.00 159.00 ? 56   DA  I C5    1 
ATOM   1132  C C6    . DA  A 1 56  ? 115.762 100.217 -51.307 1.00 158.60 ? 56   DA  I C6    1 
ATOM   1133  N N6    . DA  A 1 56  ? 115.658 101.511 -51.619 1.00 157.59 ? 56   DA  I N6    1 
ATOM   1134  N N1    . DA  A 1 56  ? 114.636 99.473  -51.250 1.00 158.14 ? 56   DA  I N1    1 
ATOM   1135  C C2    . DA  A 1 56  ? 114.742 98.175  -50.937 1.00 158.25 ? 56   DA  I C2    1 
ATOM   1136  N N3    . DA  A 1 56  ? 115.830 97.461  -50.659 1.00 158.88 ? 56   DA  I N3    1 
ATOM   1137  C C4    . DA  A 1 56  ? 116.931 98.230  -50.725 1.00 159.21 ? 56   DA  I C4    1 
ATOM   1138  P P     . DA  A 1 57  ? 119.954 92.809  -51.438 1.00 190.40 ? 57   DA  I P     1 
ATOM   1139  O OP1   . DA  A 1 57  ? 120.587 91.515  -51.072 1.00 154.79 ? 57   DA  I OP1   1 
ATOM   1140  O OP2   . DA  A 1 57  ? 120.490 93.592  -52.584 1.00 154.59 ? 57   DA  I OP2   1 
ATOM   1141  O "O5'" . DA  A 1 57  ? 118.409 92.540  -51.709 1.00 187.44 ? 57   DA  I "O5'" 1 
ATOM   1142  C "C5'" . DA  A 1 57  ? 117.546 92.127  -50.651 1.00 183.38 ? 57   DA  I "C5'" 1 
ATOM   1143  C "C4'" . DA  A 1 57  ? 116.114 92.108  -51.129 1.00 179.10 ? 57   DA  I "C4'" 1 
ATOM   1144  O "O4'" . DA  A 1 57  ? 115.660 93.465  -51.355 1.00 179.53 ? 57   DA  I "O4'" 1 
ATOM   1145  C "C3'" . DA  A 1 57  ? 115.926 91.372  -52.452 1.00 176.24 ? 57   DA  I "C3'" 1 
ATOM   1146  O "O3'" . DA  A 1 57  ? 114.696 90.648  -52.444 1.00 170.31 ? 57   DA  I "O3'" 1 
ATOM   1147  C "C2'" . DA  A 1 57  ? 115.904 92.489  -53.480 1.00 177.15 ? 57   DA  I "C2'" 1 
ATOM   1148  C "C1'" . DA  A 1 57  ? 115.290 93.649  -52.714 1.00 179.05 ? 57   DA  I "C1'" 1 
ATOM   1149  N N9    . DA  A 1 57  ? 115.784 94.961  -53.131 1.00 143.14 ? 57   DA  I N9    1 
ATOM   1150  C C8    . DA  A 1 57  ? 117.057 95.453  -52.983 1.00 144.00 ? 57   DA  I C8    1 
ATOM   1151  N N7    . DA  A 1 57  ? 117.213 96.669  -53.446 1.00 143.76 ? 57   DA  I N7    1 
ATOM   1152  C C5    . DA  A 1 57  ? 115.958 97.003  -53.934 1.00 142.56 ? 57   DA  I C5    1 
ATOM   1153  C C6    . DA  A 1 57  ? 115.464 98.164  -54.553 1.00 141.94 ? 57   DA  I C6    1 
ATOM   1154  N N6    . DA  A 1 57  ? 116.206 99.248  -54.793 1.00 140.51 ? 57   DA  I N6    1 
ATOM   1155  N N1    . DA  A 1 57  ? 114.165 98.174  -54.921 1.00 141.42 ? 57   DA  I N1    1 
ATOM   1156  C C2    . DA  A 1 57  ? 113.422 97.087  -54.678 1.00 141.55 ? 57   DA  I C2    1 
ATOM   1157  N N3    . DA  A 1 57  ? 113.771 95.938  -54.102 1.00 142.29 ? 57   DA  I N3    1 
ATOM   1158  C C4    . DA  A 1 57  ? 115.068 95.960  -53.749 1.00 142.87 ? 57   DA  I C4    1 
ATOM   1159  P P     . DG  A 1 58  ? 114.525 89.368  -53.395 1.00 142.48 ? 58   DG  I P     1 
ATOM   1160  O OP1   . DG  A 1 58  ? 113.854 88.292  -52.621 1.00 132.62 ? 58   DG  I OP1   1 
ATOM   1161  O OP2   . DG  A 1 58  ? 115.842 89.104  -54.029 1.00 132.82 ? 58   DG  I OP2   1 
ATOM   1162  O "O5'" . DG  A 1 58  ? 113.529 89.882  -54.525 1.00 138.85 ? 58   DG  I "O5'" 1 
ATOM   1163  C "C5'" . DG  A 1 58  ? 112.217 90.330  -54.190 1.00 132.01 ? 58   DG  I "C5'" 1 
ATOM   1164  C "C4'" . DG  A 1 58  ? 111.562 90.971  -55.391 1.00 127.03 ? 58   DG  I "C4'" 1 
ATOM   1165  O "O4'" . DG  A 1 58  ? 112.168 92.256  -55.665 1.00 126.22 ? 58   DG  I "O4'" 1 
ATOM   1166  C "C3'" . DG  A 1 58  ? 111.677 90.161  -56.681 1.00 124.10 ? 58   DG  I "C3'" 1 
ATOM   1167  O "O3'" . DG  A 1 58  ? 110.471 90.292  -57.429 1.00 119.02 ? 58   DG  I "O3'" 1 
ATOM   1168  C "C2'" . DG  A 1 58  ? 112.821 90.839  -57.414 1.00 124.28 ? 58   DG  I "C2'" 1 
ATOM   1169  C "C1'" . DG  A 1 58  ? 112.648 92.290  -57.000 1.00 125.20 ? 58   DG  I "C1'" 1 
ATOM   1170  N N9    . DG  A 1 58  ? 113.871 93.088  -57.009 1.00 115.21 ? 58   DG  I N9    1 
ATOM   1171  C C8    . DG  A 1 58  ? 115.140 92.678  -56.668 1.00 114.89 ? 58   DG  I C8    1 
ATOM   1172  N N7    . DG  A 1 58  ? 116.027 93.632  -56.752 1.00 113.50 ? 58   DG  I N7    1 
ATOM   1173  C C5    . DG  A 1 58  ? 115.303 94.737  -57.180 1.00 113.55 ? 58   DG  I C5    1 
ATOM   1174  C C6    . DG  A 1 58  ? 115.724 96.063  -57.443 1.00 112.80 ? 58   DG  I C6    1 
ATOM   1175  O O6    . DG  A 1 58  ? 116.856 96.543  -57.344 1.00 112.32 ? 58   DG  I O6    1 
ATOM   1176  N N1    . DG  A 1 58  ? 114.664 96.863  -57.860 1.00 113.01 ? 58   DG  I N1    1 
ATOM   1177  C C2    . DG  A 1 58  ? 113.363 96.441  -58.007 1.00 113.36 ? 58   DG  I C2    1 
ATOM   1178  N N2    . DG  A 1 58  ? 112.483 97.363  -58.427 1.00 112.61 ? 58   DG  I N2    1 
ATOM   1179  N N3    . DG  A 1 58  ? 112.957 95.207  -57.761 1.00 113.73 ? 58   DG  I N3    1 
ATOM   1180  C C4    . DG  A 1 58  ? 113.972 94.415  -57.352 1.00 114.47 ? 58   DG  I C4    1 
ATOM   1181  P P     . DG  A 1 59  ? 109.281 89.236  -57.210 1.00 90.35  ? 59   DG  I P     1 
ATOM   1182  O OP1   . DG  A 1 59  ? 109.274 88.856  -55.775 1.00 125.10 ? 59   DG  I OP1   1 
ATOM   1183  O OP2   . DG  A 1 59  ? 109.386 88.180  -58.249 1.00 125.84 ? 59   DG  I OP2   1 
ATOM   1184  O "O5'" . DG  A 1 59  ? 107.980 90.105  -57.495 1.00 87.74  ? 59   DG  I "O5'" 1 
ATOM   1185  C "C5'" . DG  A 1 59  ? 107.617 91.165  -56.615 1.00 82.81  ? 59   DG  I "C5'" 1 
ATOM   1186  C "C4'" . DG  A 1 59  ? 107.196 92.387  -57.399 1.00 79.60  ? 59   DG  I "C4'" 1 
ATOM   1187  O "O4'" . DG  A 1 59  ? 108.340 93.008  -58.036 1.00 80.37  ? 59   DG  I "O4'" 1 
ATOM   1188  C "C3'" . DG  A 1 59  ? 106.176 92.130  -58.509 1.00 76.10  ? 59   DG  I "C3'" 1 
ATOM   1189  O "O3'" . DG  A 1 59  ? 105.215 93.189  -58.517 1.00 68.40  ? 59   DG  I "O3'" 1 
ATOM   1190  C "C2'" . DG  A 1 59  ? 107.018 92.168  -59.772 1.00 79.01  ? 59   DG  I "C2'" 1 
ATOM   1191  C "C1'" . DG  A 1 59  ? 108.077 93.195  -59.418 1.00 81.89  ? 59   DG  I "C1'" 1 
ATOM   1192  N N9    . DG  A 1 59  ? 109.335 93.041  -60.142 1.00 121.16 ? 59   DG  I N9    1 
ATOM   1193  C C8    . DG  A 1 59  ? 109.993 91.868  -60.422 1.00 122.32 ? 59   DG  I C8    1 
ATOM   1194  N N7    . DG  A 1 59  ? 111.104 92.050  -61.083 1.00 124.16 ? 59   DG  I N7    1 
ATOM   1195  C C5    . DG  A 1 59  ? 111.185 93.425  -61.249 1.00 125.37 ? 59   DG  I C5    1 
ATOM   1196  C C6    . DG  A 1 59  ? 112.175 94.218  -61.887 1.00 127.08 ? 59   DG  I C6    1 
ATOM   1197  O O6    . DG  A 1 59  ? 113.214 93.851  -62.450 1.00 128.90 ? 59   DG  I O6    1 
ATOM   1198  N N1    . DG  A 1 59  ? 111.862 95.572  -61.826 1.00 127.84 ? 59   DG  I N1    1 
ATOM   1199  C C2    . DG  A 1 59  ? 110.743 96.097  -61.230 1.00 127.51 ? 59   DG  I C2    1 
ATOM   1200  N N2    . DG  A 1 59  ? 110.619 97.433  -61.277 1.00 127.79 ? 59   DG  I N2    1 
ATOM   1201  N N3    . DG  A 1 59  ? 109.815 95.370  -60.631 1.00 125.93 ? 59   DG  I N3    1 
ATOM   1202  C C4    . DG  A 1 59  ? 110.099 94.051  -60.678 1.00 123.87 ? 59   DG  I C4    1 
ATOM   1203  P P     . DC  A 1 60  ? 103.901 93.076  -59.432 1.00 62.90  ? 60   DC  I P     1 
ATOM   1204  O OP1   . DC  A 1 60  ? 102.757 93.247  -58.502 1.00 80.87  ? 60   DC  I OP1   1 
ATOM   1205  O OP2   . DC  A 1 60  ? 103.982 91.869  -60.294 1.00 80.82  ? 60   DC  I OP2   1 
ATOM   1206  O "O5'" . DC  A 1 60  ? 103.992 94.378  -60.346 1.00 61.89  ? 60   DC  I "O5'" 1 
ATOM   1207  C "C5'" . DC  A 1 60  ? 104.175 95.656  -59.738 1.00 60.03  ? 60   DC  I "C5'" 1 
ATOM   1208  C "C4'" . DC  A 1 60  ? 104.640 96.672  -60.753 1.00 59.82  ? 60   DC  I "C4'" 1 
ATOM   1209  O "O4'" . DC  A 1 60  ? 105.956 96.328  -61.248 1.00 60.19  ? 60   DC  I "O4'" 1 
ATOM   1210  C "C3'" . DC  A 1 60  ? 103.750 96.830  -61.986 1.00 59.41  ? 60   DC  I "C3'" 1 
ATOM   1211  O "O3'" . DC  A 1 60  ? 103.678 98.211  -62.310 1.00 57.91  ? 60   DC  I "O3'" 1 
ATOM   1212  C "C2'" . DC  A 1 60  ? 104.505 96.084  -63.071 1.00 59.15  ? 60   DC  I "C2'" 1 
ATOM   1213  C "C1'" . DC  A 1 60  ? 105.946 96.339  -62.670 1.00 60.34  ? 60   DC  I "C1'" 1 
ATOM   1214  N N1    . DC  A 1 60  ? 106.920 95.337  -63.138 1.00 77.33  ? 60   DC  I N1    1 
ATOM   1215  C C2    . DC  A 1 60  ? 108.028 95.771  -63.879 1.00 78.09  ? 60   DC  I C2    1 
ATOM   1216  O O2    . DC  A 1 60  ? 108.149 96.983  -64.126 1.00 77.53  ? 60   DC  I O2    1 
ATOM   1217  N N3    . DC  A 1 60  ? 108.935 94.862  -64.304 1.00 78.07  ? 60   DC  I N3    1 
ATOM   1218  C C4    . DC  A 1 60  ? 108.769 93.571  -64.013 1.00 78.66  ? 60   DC  I C4    1 
ATOM   1219  N N4    . DC  A 1 60  ? 109.691 92.708  -64.446 1.00 80.02  ? 60   DC  I N4    1 
ATOM   1220  C C5    . DC  A 1 60  ? 107.649 93.103  -63.264 1.00 78.17  ? 60   DC  I C5    1 
ATOM   1221  C C6    . DC  A 1 60  ? 106.757 94.012  -62.853 1.00 77.09  ? 60   DC  I C6    1 
ATOM   1222  P P     . DA  A 1 61  ? 102.438 98.767  -63.152 1.00 63.77  ? 61   DA  I P     1 
ATOM   1223  O OP1   . DA  A 1 61  ? 101.688 99.719  -62.293 1.00 78.79  ? 61   DA  I OP1   1 
ATOM   1224  O OP2   . DA  A 1 61  ? 101.737 97.618  -63.772 1.00 79.65  ? 61   DA  I OP2   1 
ATOM   1225  O "O5'" . DA  A 1 61  ? 103.147 99.599  -64.304 1.00 65.63  ? 61   DA  I "O5'" 1 
ATOM   1226  C "C5'" . DA  A 1 61  ? 104.151 100.555 -63.981 1.00 67.04  ? 61   DA  I "C5'" 1 
ATOM   1227  C "C4'" . DA  A 1 61  ? 104.946 100.912 -65.213 1.00 68.88  ? 61   DA  I "C4'" 1 
ATOM   1228  O "O4'" . DA  A 1 61  ? 105.839 99.831  -65.570 1.00 67.51  ? 61   DA  I "O4'" 1 
ATOM   1229  C "C3'" . DA  A 1 61  ? 104.088 101.185 -66.443 1.00 70.82  ? 61   DA  I "C3'" 1 
ATOM   1230  O "O3'" . DA  A 1 61  ? 104.603 102.327 -67.125 1.00 74.61  ? 61   DA  I "O3'" 1 
ATOM   1231  C "C2'" . DA  A 1 61  ? 104.216 99.909  -67.264 1.00 69.70  ? 61   DA  I "C2'" 1 
ATOM   1232  C "C1'" . DA  A 1 61  ? 105.603 99.406  -66.903 1.00 68.64  ? 61   DA  I "C1'" 1 
ATOM   1233  N N9    . DA  A 1 61  ? 105.767 97.952  -66.926 1.00 84.78  ? 61   DA  I N9    1 
ATOM   1234  C C8    . DA  A 1 61  ? 104.979 97.008  -66.318 1.00 84.22  ? 61   DA  I C8    1 
ATOM   1235  N N7    . DA  A 1 61  ? 105.416 95.780  -66.463 1.00 84.15  ? 61   DA  I N7    1 
ATOM   1236  C C5    . DA  A 1 61  ? 106.563 95.922  -67.229 1.00 86.16  ? 61   DA  I C5    1 
ATOM   1237  C C6    . DA  A 1 61  ? 107.494 94.990  -67.721 1.00 87.59  ? 61   DA  I C6    1 
ATOM   1238  N N6    . DA  A 1 61  ? 107.421 93.677  -67.492 1.00 87.83  ? 61   DA  I N6    1 
ATOM   1239  N N1    . DA  A 1 61  ? 108.522 95.459  -68.465 1.00 88.47  ? 61   DA  I N1    1 
ATOM   1240  C C2    . DA  A 1 61  ? 108.600 96.778  -68.687 1.00 88.25  ? 61   DA  I C2    1 
ATOM   1241  N N3    . DA  A 1 61  ? 107.792 97.754  -68.274 1.00 87.15  ? 61   DA  I N3    1 
ATOM   1242  C C4    . DA  A 1 61  ? 106.782 97.254  -67.539 1.00 86.32  ? 61   DA  I C4    1 
ATOM   1243  P P     . DT  A 1 62  ? 103.818 102.917 -68.389 1.00 90.13  ? 62   DT  I P     1 
ATOM   1244  O OP1   . DT  A 1 62  ? 104.009 104.391 -68.404 1.00 89.44  ? 62   DT  I OP1   1 
ATOM   1245  O OP2   . DT  A 1 62  ? 102.444 102.350 -68.409 1.00 88.67  ? 62   DT  I OP2   1 
ATOM   1246  O "O5'" . DT  A 1 62  ? 104.622 102.286 -69.604 1.00 91.70  ? 62   DT  I "O5'" 1 
ATOM   1247  C "C5'" . DT  A 1 62  ? 106.039 102.401 -69.668 1.00 94.45  ? 62   DT  I "C5'" 1 
ATOM   1248  C "C4'" . DT  A 1 62  ? 106.543 101.754 -70.933 1.00 96.59  ? 62   DT  I "C4'" 1 
ATOM   1249  O "O4'" . DT  A 1 62  ? 106.811 100.344 -70.728 1.00 96.39  ? 62   DT  I "O4'" 1 
ATOM   1250  C "C3'" . DT  A 1 62  ? 105.530 101.840 -72.073 1.00 97.56  ? 62   DT  I "C3'" 1 
ATOM   1251  O "O3'" . DT  A 1 62  ? 106.172 102.212 -73.284 1.00 100.14 ? 62   DT  I "O3'" 1 
ATOM   1252  C "C2'" . DT  A 1 62  ? 104.985 100.427 -72.177 1.00 97.42  ? 62   DT  I "C2'" 1 
ATOM   1253  C "C1'" . DT  A 1 62  ? 106.182 99.597  -71.753 1.00 97.16  ? 62   DT  I "C1'" 1 
ATOM   1254  N N1    . DT  A 1 62  ? 105.863 98.257  -71.220 1.00 97.10  ? 62   DT  I N1    1 
ATOM   1255  C C2    . DT  A 1 62  ? 106.804 97.264  -71.379 1.00 97.29  ? 62   DT  I C2    1 
ATOM   1256  O O2    . DT  A 1 62  ? 107.879 97.446  -71.923 1.00 98.29  ? 62   DT  I O2    1 
ATOM   1257  N N3    . DT  A 1 62  ? 106.440 96.042  -70.876 1.00 97.02  ? 62   DT  I N3    1 
ATOM   1258  C C4    . DT  A 1 62  ? 105.258 95.720  -70.245 1.00 96.21  ? 62   DT  I C4    1 
ATOM   1259  O O4    . DT  A 1 62  ? 105.074 94.575  -69.847 1.00 95.18  ? 62   DT  I O4    1 
ATOM   1260  C C5    . DT  A 1 62  ? 104.314 96.809  -70.108 1.00 96.60  ? 62   DT  I C5    1 
ATOM   1261  C C7    . DT  A 1 62  ? 103.000 96.551  -69.440 1.00 96.49  ? 62   DT  I C7    1 
ATOM   1262  C C6    . DT  A 1 62  ? 104.662 98.008  -70.592 1.00 96.48  ? 62   DT  I C6    1 
ATOM   1263  P P     . DG  A 1 63  ? 105.300 102.826 -74.478 1.00 121.85 ? 63   DG  I P     1 
ATOM   1264  O OP1   . DG  A 1 63  ? 105.731 104.230 -74.694 1.00 93.28  ? 63   DG  I OP1   1 
ATOM   1265  O OP2   . DG  A 1 63  ? 103.876 102.533 -74.182 1.00 92.78  ? 63   DG  I OP2   1 
ATOM   1266  O "O5'" . DG  A 1 63  ? 105.754 101.956 -75.727 1.00 121.48 ? 63   DG  I "O5'" 1 
ATOM   1267  C "C5'" . DG  A 1 63  ? 107.136 101.776 -76.008 1.00 122.84 ? 63   DG  I "C5'" 1 
ATOM   1268  C "C4'" . DG  A 1 63  ? 107.325 100.628 -76.969 1.00 123.19 ? 63   DG  I "C4'" 1 
ATOM   1269  O "O4'" . DG  A 1 63  ? 107.098 99.370  -76.288 1.00 123.53 ? 63   DG  I "O4'" 1 
ATOM   1270  C "C3'" . DG  A 1 63  ? 106.368 100.653 -78.158 1.00 123.27 ? 63   DG  I "C3'" 1 
ATOM   1271  O "O3'" . DG  A 1 63  ? 107.076 100.312 -79.351 1.00 122.17 ? 63   DG  I "O3'" 1 
ATOM   1272  C "C2'" . DG  A 1 63  ? 105.319 99.615  -77.797 1.00 122.98 ? 63   DG  I "C2'" 1 
ATOM   1273  C "C1'" . DG  A 1 63  ? 106.099 98.616  -76.959 1.00 122.99 ? 63   DG  I "C1'" 1 
ATOM   1274  N N9    . DG  A 1 63  ? 105.298 97.940  -75.941 1.00 93.10  ? 63   DG  I N9    1 
ATOM   1275  C C8    . DG  A 1 63  ? 104.336 98.505  -75.139 1.00 92.78  ? 63   DG  I C8    1 
ATOM   1276  N N7    . DG  A 1 63  ? 103.797 97.656  -74.307 1.00 91.91  ? 63   DG  I N7    1 
ATOM   1277  C C5    . DG  A 1 63  ? 104.438 96.455  -74.577 1.00 91.43  ? 63   DG  I C5    1 
ATOM   1278  C C6    . DG  A 1 63  ? 104.273 95.173  -73.987 1.00 90.88  ? 63   DG  I C6    1 
ATOM   1279  O O6    . DG  A 1 63  ? 103.504 94.834  -73.079 1.00 89.19  ? 63   DG  I O6    1 
ATOM   1280  N N1    . DG  A 1 63  ? 105.125 94.235  -74.560 1.00 90.91  ? 63   DG  I N1    1 
ATOM   1281  C C2    . DG  A 1 63  ? 106.019 94.493  -75.571 1.00 90.89  ? 63   DG  I C2    1 
ATOM   1282  N N2    . DG  A 1 63  ? 106.750 93.449  -75.988 1.00 90.22  ? 63   DG  I N2    1 
ATOM   1283  N N3    . DG  A 1 63  ? 106.183 95.683  -76.129 1.00 90.87  ? 63   DG  I N3    1 
ATOM   1284  C C4    . DG  A 1 63  ? 105.366 96.610  -75.587 1.00 91.89  ? 63   DG  I C4    1 
ATOM   1285  P P     . DT  A 1 64  ? 106.265 99.877  -80.662 1.00 99.15  ? 64   DT  I P     1 
ATOM   1286  O OP1   . DT  A 1 64  ? 107.025 100.333 -81.853 1.00 96.78  ? 64   DT  I OP1   1 
ATOM   1287  O OP2   . DT  A 1 64  ? 104.849 100.292 -80.495 1.00 96.65  ? 64   DT  I OP2   1 
ATOM   1288  O "O5'" . DT  A 1 64  ? 106.351 98.291  -80.599 1.00 97.79  ? 64   DT  I "O5'" 1 
ATOM   1289  C "C5'" . DT  A 1 64  ? 107.612 97.655  -80.416 1.00 95.47  ? 64   DT  I "C5'" 1 
ATOM   1290  C "C4'" . DT  A 1 64  ? 107.538 96.215  -80.862 1.00 94.18  ? 64   DT  I "C4'" 1 
ATOM   1291  O "O4'" . DT  A 1 64  ? 106.870 95.420  -79.855 1.00 94.17  ? 64   DT  I "O4'" 1 
ATOM   1292  C "C3'" . DT  A 1 64  ? 106.765 96.002  -82.161 1.00 93.50  ? 64   DT  I "C3'" 1 
ATOM   1293  O "O3'" . DT  A 1 64  ? 107.431 95.032  -82.970 1.00 92.50  ? 64   DT  I "O3'" 1 
ATOM   1294  C "C2'" . DT  A 1 64  ? 105.411 95.498  -81.692 1.00 93.16  ? 64   DT  I "C2'" 1 
ATOM   1295  C "C1'" . DT  A 1 64  ? 105.760 94.740  -80.421 1.00 93.22  ? 64   DT  I "C1'" 1 
ATOM   1296  N N1    . DT  A 1 64  ? 104.689 94.706  -79.402 1.00 89.66  ? 64   DT  I N1    1 
ATOM   1297  C C2    . DT  A 1 64  ? 104.442 93.512  -78.757 1.00 88.97  ? 64   DT  I C2    1 
ATOM   1298  O O2    . DT  A 1 64  ? 105.061 92.485  -78.992 1.00 88.54  ? 64   DT  I O2    1 
ATOM   1299  N N3    . DT  A 1 64  ? 103.437 93.567  -77.819 1.00 88.31  ? 64   DT  I N3    1 
ATOM   1300  C C4    . DT  A 1 64  ? 102.677 94.669  -77.472 1.00 88.23  ? 64   DT  I C4    1 
ATOM   1301  O O4    . DT  A 1 64  ? 101.813 94.570  -76.609 1.00 87.42  ? 64   DT  I O4    1 
ATOM   1302  C C5    . DT  A 1 64  ? 102.987 95.881  -78.189 1.00 88.44  ? 64   DT  I C5    1 
ATOM   1303  C C7    . DT  A 1 64  ? 102.210 97.122  -77.881 1.00 88.18  ? 64   DT  I C7    1 
ATOM   1304  C C6    . DT  A 1 64  ? 103.964 95.841  -79.106 1.00 89.25  ? 64   DT  I C6    1 
ATOM   1305  P P     . DT  A 1 65  ? 106.737 94.511  -84.318 1.00 104.71 ? 65   DT  I P     1 
ATOM   1306  O OP1   . DT  A 1 65  ? 107.806 94.028  -85.232 1.00 85.75  ? 65   DT  I OP1   1 
ATOM   1307  O OP2   . DT  A 1 65  ? 105.776 95.546  -84.783 1.00 84.98  ? 65   DT  I OP2   1 
ATOM   1308  O "O5'" . DT  A 1 65  ? 105.901 93.254  -83.824 1.00 102.94 ? 65   DT  I "O5'" 1 
ATOM   1309  C "C5'" . DT  A 1 65  ? 106.563 92.128  -83.262 1.00 100.19 ? 65   DT  I "C5'" 1 
ATOM   1310  C "C4'" . DT  A 1 65  ? 105.625 90.948  -83.217 1.00 97.80  ? 65   DT  I "C4'" 1 
ATOM   1311  O "O4'" . DT  A 1 65  ? 104.678 91.101  -82.133 1.00 96.38  ? 65   DT  I "O4'" 1 
ATOM   1312  C "C3'" . DT  A 1 65  ? 104.795 90.778  -84.488 1.00 96.87  ? 65   DT  I "C3'" 1 
ATOM   1313  O "O3'" . DT  A 1 65  ? 104.688 89.392  -84.802 1.00 96.00  ? 65   DT  I "O3'" 1 
ATOM   1314  C "C2'" . DT  A 1 65  ? 103.443 91.353  -84.102 1.00 95.79  ? 65   DT  I "C2'" 1 
ATOM   1315  C "C1'" . DT  A 1 65  ? 103.358 90.979  -82.634 1.00 95.05  ? 65   DT  I "C1'" 1 
ATOM   1316  N N1    . DT  A 1 65  ? 102.476 91.825  -81.804 1.00 74.54  ? 65   DT  I N1    1 
ATOM   1317  C C2    . DT  A 1 65  ? 101.891 91.239  -80.701 1.00 73.32  ? 65   DT  I C2    1 
ATOM   1318  O O2    . DT  A 1 65  ? 102.075 90.073  -80.391 1.00 71.78  ? 65   DT  I O2    1 
ATOM   1319  N N3    . DT  A 1 65  ? 101.082 92.073  -79.971 1.00 72.78  ? 65   DT  I N3    1 
ATOM   1320  C C4    . DT  A 1 65  ? 100.806 93.403  -80.225 1.00 73.68  ? 65   DT  I C4    1 
ATOM   1321  O O4    . DT  A 1 65  ? 100.056 94.030  -79.475 1.00 73.62  ? 65   DT  I O4    1 
ATOM   1322  C C5    . DT  A 1 65  ? 101.452 93.953  -81.396 1.00 73.48  ? 65   DT  I C5    1 
ATOM   1323  C C7    . DT  A 1 65  ? 101.208 95.386  -81.748 1.00 73.75  ? 65   DT  I C7    1 
ATOM   1324  C C6    . DT  A 1 65  ? 102.245 93.148  -82.117 1.00 73.43  ? 65   DT  I C6    1 
ATOM   1325  P P     . DC  A 1 66  ? 103.973 88.938  -86.163 1.00 95.36  ? 66   DC  I P     1 
ATOM   1326  O OP1   . DC  A 1 66  ? 104.862 87.969  -86.854 1.00 79.92  ? 66   DC  I OP1   1 
ATOM   1327  O OP2   . DC  A 1 66  ? 103.517 90.166  -86.872 1.00 80.42  ? 66   DC  I OP2   1 
ATOM   1328  O "O5'" . DC  A 1 66  ? 102.682 88.160  -85.654 1.00 94.10  ? 66   DC  I "O5'" 1 
ATOM   1329  C "C5'" . DC  A 1 66  ? 102.793 87.151  -84.650 1.00 91.58  ? 66   DC  I "C5'" 1 
ATOM   1330  C "C4'" . DC  A 1 66  ? 101.426 86.786  -84.122 1.00 88.34  ? 66   DC  I "C4'" 1 
ATOM   1331  O "O4'" . DC  A 1 66  ? 100.892 87.857  -83.303 1.00 86.16  ? 66   DC  I "O4'" 1 
ATOM   1332  C "C3'" . DC  A 1 66  ? 100.385 86.526  -85.212 1.00 87.00  ? 66   DC  I "C3'" 1 
ATOM   1333  O "O3'" . DC  A 1 66  ? 99.532  85.465  -84.794 1.00 86.23  ? 66   DC  I "O3'" 1 
ATOM   1334  C "C2'" . DC  A 1 66  ? 99.586  87.815  -85.229 1.00 85.94  ? 66   DC  I "C2'" 1 
ATOM   1335  C "C1'" . DC  A 1 66  ? 99.582  88.150  -83.752 1.00 85.45  ? 66   DC  I "C1'" 1 
ATOM   1336  N N1    . DC  A 1 66  ? 99.258  89.540  -83.391 1.00 70.06  ? 66   DC  I N1    1 
ATOM   1337  C C2    . DC  A 1 66  ? 98.803  89.801  -82.088 1.00 68.52  ? 66   DC  I C2    1 
ATOM   1338  O O2    . DC  A 1 66  ? 98.712  88.863  -81.284 1.00 66.92  ? 66   DC  I O2    1 
ATOM   1339  N N3    . DC  A 1 66  ? 98.475  91.064  -81.743 1.00 67.71  ? 66   DC  I N3    1 
ATOM   1340  C C4    . DC  A 1 66  ? 98.585  92.047  -82.637 1.00 67.73  ? 66   DC  I C4    1 
ATOM   1341  N N4    . DC  A 1 66  ? 98.240  93.277  -82.253 1.00 67.47  ? 66   DC  I N4    1 
ATOM   1342  C C5    . DC  A 1 66  ? 99.053  91.814  -83.965 1.00 67.96  ? 66   DC  I C5    1 
ATOM   1343  C C6    . DC  A 1 66  ? 99.378  90.557  -84.295 1.00 68.39  ? 66   DC  I C6    1 
ATOM   1344  P P     . DA  A 1 67  ? 99.804  83.976  -85.313 1.00 80.18  ? 67   DA  I P     1 
ATOM   1345  O OP1   . DA  A 1 67  ? 101.276 83.774  -85.310 1.00 74.56  ? 67   DA  I OP1   1 
ATOM   1346  O OP2   . DA  A 1 67  ? 99.032  83.768  -86.563 1.00 74.34  ? 67   DA  I OP2   1 
ATOM   1347  O "O5'" . DA  A 1 67  ? 99.158  83.065  -84.176 1.00 79.59  ? 67   DA  I "O5'" 1 
ATOM   1348  C "C5'" . DA  A 1 67  ? 99.675  83.068  -82.841 1.00 75.84  ? 67   DA  I "C5'" 1 
ATOM   1349  C "C4'" . DA  A 1 67  ? 98.545  82.998  -81.838 1.00 72.42  ? 67   DA  I "C4'" 1 
ATOM   1350  O "O4'" . DA  A 1 67  ? 97.897  84.285  -81.706 1.00 70.79  ? 67   DA  I "O4'" 1 
ATOM   1351  C "C3'" . DA  A 1 67  ? 97.439  82.007  -82.186 1.00 71.00  ? 67   DA  I "C3'" 1 
ATOM   1352  O "O3'" . DA  A 1 67  ? 96.971  81.383  -80.991 1.00 71.27  ? 67   DA  I "O3'" 1 
ATOM   1353  C "C2'" . DA  A 1 67  ? 96.365  82.883  -82.810 1.00 69.13  ? 67   DA  I "C2'" 1 
ATOM   1354  C "C1'" . DA  A 1 67  ? 96.521  84.193  -82.055 1.00 68.57  ? 67   DA  I "C1'" 1 
ATOM   1355  N N9    . DA  A 1 67  ? 96.190  85.396  -82.823 1.00 62.18  ? 67   DA  I N9    1 
ATOM   1356  C C8    . DA  A 1 67  ? 96.353  85.608  -84.169 1.00 60.42  ? 67   DA  I C8    1 
ATOM   1357  N N7    . DA  A 1 67  ? 96.035  86.820  -84.556 1.00 59.40  ? 67   DA  I N7    1 
ATOM   1358  C C5    . DA  A 1 67  ? 95.622  87.447  -83.390 1.00 59.81  ? 67   DA  I C5    1 
ATOM   1359  C C6    . DA  A 1 67  ? 95.176  88.758  -83.120 1.00 59.57  ? 67   DA  I C6    1 
ATOM   1360  N N6    . DA  A 1 67  ? 95.091  89.723  -84.041 1.00 59.02  ? 67   DA  I N6    1 
ATOM   1361  N N1    . DA  A 1 67  ? 94.828  89.053  -81.849 1.00 59.32  ? 67   DA  I N1    1 
ATOM   1362  C C2    . DA  A 1 67  ? 94.934  88.100  -80.918 1.00 58.16  ? 67   DA  I C2    1 
ATOM   1363  N N3    . DA  A 1 67  ? 95.352  86.840  -81.043 1.00 60.87  ? 67   DA  I N3    1 
ATOM   1364  C C4    . DA  A 1 67  ? 95.687  86.573  -82.318 1.00 61.25  ? 67   DA  I C4    1 
ATOM   1365  P P     . DG  A 1 68  ? 95.898  80.195  -81.081 1.00 65.67  ? 68   DG  I P     1 
ATOM   1366  O OP1   . DG  A 1 68  ? 96.097  79.301  -79.914 1.00 72.42  ? 68   DG  I OP1   1 
ATOM   1367  O OP2   . DG  A 1 68  ? 95.949  79.630  -82.452 1.00 72.57  ? 68   DG  I OP2   1 
ATOM   1368  O "O5'" . DG  A 1 68  ? 94.505  80.947  -80.897 1.00 67.52  ? 68   DG  I "O5'" 1 
ATOM   1369  C "C5'" . DG  A 1 68  ? 94.234  81.692  -79.706 1.00 65.16  ? 68   DG  I "C5'" 1 
ATOM   1370  C "C4'" . DG  A 1 68  ? 92.909  82.409  -79.818 1.00 65.13  ? 68   DG  I "C4'" 1 
ATOM   1371  O "O4'" . DG  A 1 68  ? 92.994  83.527  -80.736 1.00 64.94  ? 68   DG  I "O4'" 1 
ATOM   1372  C "C3'" . DG  A 1 68  ? 91.746  81.548  -80.316 1.00 65.50  ? 68   DG  I "C3'" 1 
ATOM   1373  O "O3'" . DG  A 1 68  ? 90.553  81.991  -79.676 1.00 64.76  ? 68   DG  I "O3'" 1 
ATOM   1374  C "C2'" . DG  A 1 68  ? 91.644  81.947  -81.777 1.00 65.03  ? 68   DG  I "C2'" 1 
ATOM   1375  C "C1'" . DG  A 1 68  ? 91.917  83.429  -81.651 1.00 65.55  ? 68   DG  I "C1'" 1 
ATOM   1376  N N9    . DG  A 1 68  ? 92.284  84.128  -82.875 1.00 70.98  ? 68   DG  I N9    1 
ATOM   1377  C C8    . DG  A 1 68  ? 92.760  83.585  -84.042 1.00 71.44  ? 68   DG  I C8    1 
ATOM   1378  N N7    . DG  A 1 68  ? 92.985  84.479  -84.967 1.00 73.39  ? 68   DG  I N7    1 
ATOM   1379  C C5    . DG  A 1 68  ? 92.638  85.685  -84.371 1.00 73.08  ? 68   DG  I C5    1 
ATOM   1380  C C6    . DG  A 1 68  ? 92.669  87.015  -84.884 1.00 74.17  ? 68   DG  I C6    1 
ATOM   1381  O O6    . DG  A 1 68  ? 93.028  87.405  -86.005 1.00 76.45  ? 68   DG  I O6    1 
ATOM   1382  N N1    . DG  A 1 68  ? 92.227  87.935  -83.940 1.00 73.64  ? 68   DG  I N1    1 
ATOM   1383  C C2    . DG  A 1 68  ? 91.811  87.624  -82.668 1.00 72.58  ? 68   DG  I C2    1 
ATOM   1384  N N2    . DG  A 1 68  ? 91.420  88.657  -81.907 1.00 72.78  ? 68   DG  I N2    1 
ATOM   1385  N N3    . DG  A 1 68  ? 91.781  86.395  -82.179 1.00 70.40  ? 68   DG  I N3    1 
ATOM   1386  C C4    . DG  A 1 68  ? 92.204  85.483  -83.079 1.00 71.52  ? 68   DG  I C4    1 
ATOM   1387  P P     . DC  A 1 69  ? 89.946  81.173  -78.437 1.00 67.01  ? 69   DC  I P     1 
ATOM   1388  O OP1   . DC  A 1 69  ? 91.060  80.770  -77.540 1.00 62.17  ? 69   DC  I OP1   1 
ATOM   1389  O OP2   . DC  A 1 69  ? 89.021  80.142  -78.975 1.00 63.39  ? 69   DC  I OP2   1 
ATOM   1390  O "O5'" . DC  A 1 69  ? 89.082  82.286  -77.702 1.00 64.03  ? 69   DC  I "O5'" 1 
ATOM   1391  C "C5'" . DC  A 1 69  ? 89.720  83.413  -77.114 1.00 59.43  ? 69   DC  I "C5'" 1 
ATOM   1392  C "C4'" . DC  A 1 69  ? 88.890  84.658  -77.322 1.00 57.28  ? 69   DC  I "C4'" 1 
ATOM   1393  O "O4'" . DC  A 1 69  ? 89.138  85.259  -78.617 1.00 56.12  ? 69   DC  I "O4'" 1 
ATOM   1394  C "C3'" . DC  A 1 69  ? 87.380  84.459  -77.208 1.00 55.37  ? 69   DC  I "C3'" 1 
ATOM   1395  O "O3'" . DC  A 1 69  ? 86.842  85.486  -76.374 1.00 52.21  ? 69   DC  I "O3'" 1 
ATOM   1396  C "C2'" . DC  A 1 69  ? 86.890  84.580  -78.644 1.00 54.65  ? 69   DC  I "C2'" 1 
ATOM   1397  C "C1'" . DC  A 1 69  ? 87.912  85.515  -79.286 1.00 54.89  ? 69   DC  I "C1'" 1 
ATOM   1398  N N1    . DC  A 1 69  ? 88.129  85.289  -80.735 1.00 49.09  ? 69   DC  I N1    1 
ATOM   1399  C C2    . DC  A 1 69  ? 88.268  86.397  -81.587 1.00 49.87  ? 69   DC  I C2    1 
ATOM   1400  O O2    . DC  A 1 69  ? 88.220  87.534  -81.112 1.00 52.69  ? 69   DC  I O2    1 
ATOM   1401  N N3    . DC  A 1 69  ? 88.457  86.199  -82.910 1.00 51.41  ? 69   DC  I N3    1 
ATOM   1402  C C4    . DC  A 1 69  ? 88.518  84.958  -83.394 1.00 51.75  ? 69   DC  I C4    1 
ATOM   1403  N N4    . DC  A 1 69  ? 88.713  84.816  -84.712 1.00 53.13  ? 69   DC  I N4    1 
ATOM   1404  C C5    . DC  A 1 69  ? 88.383  83.809  -82.551 1.00 49.69  ? 69   DC  I C5    1 
ATOM   1405  C C6    . DC  A 1 69  ? 88.192  84.021  -81.242 1.00 48.16  ? 69   DC  I C6    1 
ATOM   1406  P P     . DG  A 1 70  ? 85.306  85.423  -75.901 1.00 43.90  ? 70   DG  I P     1 
ATOM   1407  O OP1   . DG  A 1 70  ? 85.318  85.724  -74.443 1.00 45.98  ? 70   DG  I OP1   1 
ATOM   1408  O OP2   . DG  A 1 70  ? 84.648  84.191  -76.389 1.00 43.90  ? 70   DG  I OP2   1 
ATOM   1409  O "O5'" . DG  A 1 70  ? 84.676  86.660  -76.670 1.00 44.56  ? 70   DG  I "O5'" 1 
ATOM   1410  C "C5'" . DG  A 1 70  ? 85.298  87.938  -76.587 1.00 49.47  ? 70   DG  I "C5'" 1 
ATOM   1411  C "C4'" . DG  A 1 70  ? 84.644  88.897  -77.551 1.00 53.65  ? 70   DG  I "C4'" 1 
ATOM   1412  O "O4'" . DG  A 1 70  ? 84.964  88.524  -78.917 1.00 54.79  ? 70   DG  I "O4'" 1 
ATOM   1413  C "C3'" . DG  A 1 70  ? 83.123  88.909  -77.458 1.00 55.51  ? 70   DG  I "C3'" 1 
ATOM   1414  O "O3'" . DG  A 1 70  ? 82.661  90.249  -77.609 1.00 59.23  ? 70   DG  I "O3'" 1 
ATOM   1415  C "C2'" . DG  A 1 70  ? 82.687  88.015  -78.609 1.00 53.78  ? 70   DG  I "C2'" 1 
ATOM   1416  C "C1'" . DG  A 1 70  ? 83.778  88.245  -79.649 1.00 53.74  ? 70   DG  I "C1'" 1 
ATOM   1417  N N9    . DG  A 1 70  ? 84.059  87.108  -80.527 1.00 53.91  ? 70   DG  I N9    1 
ATOM   1418  C C8    . DG  A 1 70  ? 83.986  85.775  -80.209 1.00 54.51  ? 70   DG  I C8    1 
ATOM   1419  N N7    . DG  A 1 70  ? 84.323  84.989  -81.200 1.00 53.34  ? 70   DG  I N7    1 
ATOM   1420  C C5    . DG  A 1 70  ? 84.638  85.857  -82.237 1.00 52.96  ? 70   DG  I C5    1 
ATOM   1421  C C6    . DG  A 1 70  ? 85.084  85.585  -83.568 1.00 52.45  ? 70   DG  I C6    1 
ATOM   1422  O O6    . DG  A 1 70  ? 85.315  84.483  -84.096 1.00 50.49  ? 70   DG  I O6    1 
ATOM   1423  N N1    . DG  A 1 70  ? 85.263  86.758  -84.297 1.00 48.48  ? 70   DG  I N1    1 
ATOM   1424  C C2    . DG  A 1 70  ? 85.046  88.027  -83.815 1.00 51.33  ? 70   DG  I C2    1 
ATOM   1425  N N2    . DG  A 1 70  ? 85.248  89.037  -84.683 1.00 47.74  ? 70   DG  I N2    1 
ATOM   1426  N N3    . DG  A 1 70  ? 84.651  88.294  -82.572 1.00 53.23  ? 70   DG  I N3    1 
ATOM   1427  C C4    . DG  A 1 70  ? 84.466  87.169  -81.847 1.00 53.08  ? 70   DG  I C4    1 
ATOM   1428  P P     . DG  A 1 71  ? 81.111  90.582  -77.385 1.00 73.68  ? 71   DG  I P     1 
ATOM   1429  O OP1   . DG  A 1 71  ? 81.034  91.849  -76.615 1.00 66.83  ? 71   DG  I OP1   1 
ATOM   1430  O OP2   . DG  A 1 71  ? 80.416  89.366  -76.888 1.00 65.21  ? 71   DG  I OP2   1 
ATOM   1431  O "O5'" . DG  A 1 71  ? 80.577  90.849  -78.856 1.00 72.78  ? 71   DG  I "O5'" 1 
ATOM   1432  C "C5'" . DG  A 1 71  ? 81.261  91.745  -79.722 1.00 73.92  ? 71   DG  I "C5'" 1 
ATOM   1433  C "C4'" . DG  A 1 71  ? 80.777  91.548  -81.136 1.00 74.43  ? 71   DG  I "C4'" 1 
ATOM   1434  O "O4'" . DG  A 1 71  ? 81.317  90.323  -81.689 1.00 73.79  ? 71   DG  I "O4'" 1 
ATOM   1435  C "C3'" . DG  A 1 71  ? 79.257  91.417  -81.236 1.00 76.05  ? 71   DG  I "C3'" 1 
ATOM   1436  O "O3'" . DG  A 1 71  ? 78.810  92.058  -82.422 1.00 79.24  ? 71   DG  I "O3'" 1 
ATOM   1437  C "C2'" . DG  A 1 71  ? 79.046  89.923  -81.380 1.00 74.06  ? 71   DG  I "C2'" 1 
ATOM   1438  C "C1'" . DG  A 1 71  ? 80.250  89.564  -82.220 1.00 72.34  ? 71   DG  I "C1'" 1 
ATOM   1439  N N9    . DG  A 1 71  ? 80.625  88.157  -82.209 1.00 62.93  ? 71   DG  I N9    1 
ATOM   1440  C C8    . DG  A 1 71  ? 80.481  87.254  -81.185 1.00 62.38  ? 71   DG  I C8    1 
ATOM   1441  N N7    . DG  A 1 71  ? 80.869  86.050  -81.507 1.00 61.64  ? 71   DG  I N7    1 
ATOM   1442  C C5    . DG  A 1 71  ? 81.305  86.172  -82.820 1.00 61.90  ? 71   DG  I C5    1 
ATOM   1443  C C6    . DG  A 1 71  ? 81.837  85.201  -83.708 1.00 61.43  ? 71   DG  I C6    1 
ATOM   1444  O O6    . DG  A 1 71  ? 82.037  83.996  -83.503 1.00 61.64  ? 71   DG  I O6    1 
ATOM   1445  N N1    . DG  A 1 71  ? 82.154  85.759  -84.943 1.00 60.50  ? 71   DG  I N1    1 
ATOM   1446  C C2    . DG  A 1 71  ? 81.984  87.078  -85.278 1.00 61.46  ? 71   DG  I C2    1 
ATOM   1447  N N2    . DG  A 1 71  ? 82.357  87.432  -86.511 1.00 63.05  ? 71   DG  I N2    1 
ATOM   1448  N N3    . DG  A 1 71  ? 81.488  87.988  -84.463 1.00 62.42  ? 71   DG  I N3    1 
ATOM   1449  C C4    . DG  A 1 71  ? 81.172  87.469  -83.259 1.00 62.13  ? 71   DG  I C4    1 
ATOM   1450  P P     . DA  A 1 72  ? 77.457  92.909  -82.404 1.00 81.86  ? 72   DA  I P     1 
ATOM   1451  O OP1   . DA  A 1 72  ? 77.668  94.093  -81.536 1.00 65.34  ? 72   DA  I OP1   1 
ATOM   1452  O OP2   . DA  A 1 72  ? 76.335  91.973  -82.130 1.00 65.73  ? 72   DA  I OP2   1 
ATOM   1453  O "O5'" . DA  A 1 72  ? 77.334  93.405  -83.906 1.00 82.25  ? 72   DA  I "O5'" 1 
ATOM   1454  C "C5'" . DA  A 1 72  ? 78.488  93.822  -84.626 1.00 83.99  ? 72   DA  I "C5'" 1 
ATOM   1455  C "C4'" . DA  A 1 72  ? 78.461  93.235  -86.016 1.00 84.47  ? 72   DA  I "C4'" 1 
ATOM   1456  O "O4'" . DA  A 1 72  ? 78.904  91.856  -85.994 1.00 83.41  ? 72   DA  I "O4'" 1 
ATOM   1457  C "C3'" . DA  A 1 72  ? 77.060  93.224  -86.624 1.00 85.60  ? 72   DA  I "C3'" 1 
ATOM   1458  O "O3'" . DA  A 1 72  ? 77.124  93.592  -88.001 1.00 88.54  ? 72   DA  I "O3'" 1 
ATOM   1459  C "C2'" . DA  A 1 72  ? 76.614  91.780  -86.457 1.00 83.58  ? 72   DA  I "C2'" 1 
ATOM   1460  C "C1'" . DA  A 1 72  ? 77.923  91.025  -86.596 1.00 82.23  ? 72   DA  I "C1'" 1 
ATOM   1461  N N9    . DA  A 1 72  ? 77.962  89.725  -85.925 1.00 65.77  ? 72   DA  I N9    1 
ATOM   1462  C C8    . DA  A 1 72  ? 77.629  89.439  -84.624 1.00 65.28  ? 72   DA  I C8    1 
ATOM   1463  N N7    . DA  A 1 72  ? 77.785  88.176  -84.304 1.00 64.11  ? 72   DA  I N7    1 
ATOM   1464  C C5    . DA  A 1 72  ? 78.248  87.588  -85.472 1.00 63.19  ? 72   DA  I C5    1 
ATOM   1465  C C6    . DA  A 1 72  ? 78.609  86.261  -85.791 1.00 62.30  ? 72   DA  I C6    1 
ATOM   1466  N N6    . DA  A 1 72  ? 78.565  85.247  -84.924 1.00 59.82  ? 72   DA  I N6    1 
ATOM   1467  N N1    . DA  A 1 72  ? 79.026  86.011  -87.051 1.00 61.93  ? 72   DA  I N1    1 
ATOM   1468  C C2    . DA  A 1 72  ? 79.076  87.026  -87.922 1.00 63.28  ? 72   DA  I C2    1 
ATOM   1469  N N3    . DA  A 1 72  ? 78.767  88.312  -87.742 1.00 64.56  ? 72   DA  I N3    1 
ATOM   1470  C C4    . DA  A 1 72  ? 78.356  88.530  -86.482 1.00 64.57  ? 72   DA  I C4    1 
ATOM   1471  P P     . DA  A 1 73  ? 75.775  93.957  -88.788 1.00 84.14  ? 73   DA  I P     1 
ATOM   1472  O OP1   . DA  A 1 73  ? 75.919  95.324  -89.348 1.00 78.99  ? 73   DA  I OP1   1 
ATOM   1473  O OP2   . DA  A 1 73  ? 74.627  93.641  -87.900 1.00 77.57  ? 73   DA  I OP2   1 
ATOM   1474  O "O5'" . DA  A 1 73  ? 75.774  92.895  -89.968 1.00 83.09  ? 73   DA  I "O5'" 1 
ATOM   1475  C "C5'" . DA  A 1 73  ? 76.174  91.562  -89.708 1.00 84.00  ? 73   DA  I "C5'" 1 
ATOM   1476  C "C4'" . DA  A 1 73  ? 75.977  90.705  -90.932 1.00 85.38  ? 73   DA  I "C4'" 1 
ATOM   1477  O "O4'" . DA  A 1 73  ? 76.338  89.359  -90.561 1.00 85.65  ? 73   DA  I "O4'" 1 
ATOM   1478  C "C3'" . DA  A 1 73  ? 74.532  90.633  -91.417 1.00 86.67  ? 73   DA  I "C3'" 1 
ATOM   1479  O "O3'" . DA  A 1 73  ? 74.501  90.474  -92.841 1.00 89.10  ? 73   DA  I "O3'" 1 
ATOM   1480  C "C2'" . DA  A 1 73  ? 73.970  89.430  -90.683 1.00 85.62  ? 73   DA  I "C2'" 1 
ATOM   1481  C "C1'" . DA  A 1 73  ? 75.184  88.541  -90.436 1.00 84.93  ? 73   DA  I "C1'" 1 
ATOM   1482  N N9    . DA  A 1 73  ? 75.197  87.980  -89.086 1.00 77.82  ? 73   DA  I N9    1 
ATOM   1483  C C8    . DA  A 1 73  ? 74.832  88.615  -87.926 1.00 76.59  ? 73   DA  I C8    1 
ATOM   1484  N N7    . DA  A 1 73  ? 74.912  87.859  -86.862 1.00 76.73  ? 73   DA  I N7    1 
ATOM   1485  C C5    . DA  A 1 73  ? 75.368  86.643  -87.352 1.00 76.70  ? 73   DA  I C5    1 
ATOM   1486  C C6    . DA  A 1 73  ? 75.652  85.420  -86.725 1.00 76.94  ? 73   DA  I C6    1 
ATOM   1487  N N6    . DA  A 1 73  ? 75.505  85.211  -85.415 1.00 76.39  ? 73   DA  I N6    1 
ATOM   1488  N N1    . DA  A 1 73  ? 76.097  84.404  -87.498 1.00 77.56  ? 73   DA  I N1    1 
ATOM   1489  C C2    . DA  A 1 73  ? 76.239  84.616  -88.812 1.00 77.99  ? 73   DA  I C2    1 
ATOM   1490  N N3    . DA  A 1 73  ? 76.000  85.721  -89.518 1.00 77.53  ? 73   DA  I N3    1 
ATOM   1491  C C4    . DA  A 1 73  ? 75.560  86.708  -88.719 1.00 76.85  ? 73   DA  I C4    1 
ATOM   1492  P P     . DT  A 1 74  ? 73.111  90.154  -93.587 1.00 92.27  ? 74   DT  I P     1 
ATOM   1493  O OP1   . DT  A 1 74  ? 73.291  90.517  -95.018 1.00 82.14  ? 74   DT  I OP1   1 
ATOM   1494  O OP2   . DT  A 1 74  ? 71.990  90.751  -92.810 1.00 81.04  ? 74   DT  I OP2   1 
ATOM   1495  O "O5'" . DT  A 1 74  ? 73.007  88.571  -93.487 1.00 88.90  ? 74   DT  I "O5'" 1 
ATOM   1496  C "C5'" . DT  A 1 74  ? 74.063  87.758  -93.979 1.00 86.98  ? 74   DT  I "C5'" 1 
ATOM   1497  C "C4'" . DT  A 1 74  ? 73.656  86.306  -93.952 1.00 86.65  ? 74   DT  I "C4'" 1 
ATOM   1498  O "O4'" . DT  A 1 74  ? 73.795  85.752  -92.621 1.00 85.31  ? 74   DT  I "O4'" 1 
ATOM   1499  C "C3'" . DT  A 1 74  ? 72.208  86.063  -94.372 1.00 87.67  ? 74   DT  I "C3'" 1 
ATOM   1500  O "O3'" . DT  A 1 74  ? 72.149  84.950  -95.264 1.00 89.75  ? 74   DT  I "O3'" 1 
ATOM   1501  C "C2'" . DT  A 1 74  ? 71.502  85.752  -93.062 1.00 85.81  ? 74   DT  I "C2'" 1 
ATOM   1502  C "C1'" . DT  A 1 74  ? 72.602  85.072  -92.266 1.00 84.13  ? 74   DT  I "C1'" 1 
ATOM   1503  N N1    . DT  A 1 74  ? 72.455  85.137  -90.795 1.00 70.85  ? 74   DT  I N1    1 
ATOM   1504  C C2    . DT  A 1 74  ? 72.746  84.002  -90.065 1.00 68.74  ? 74   DT  I C2    1 
ATOM   1505  O O2    . DT  A 1 74  ? 73.099  82.951  -90.576 1.00 68.25  ? 74   DT  I O2    1 
ATOM   1506  N N3    . DT  A 1 74  ? 72.602  84.142  -88.708 1.00 68.33  ? 74   DT  I N3    1 
ATOM   1507  C C4    . DT  A 1 74  ? 72.196  85.270  -88.022 1.00 68.61  ? 74   DT  I C4    1 
ATOM   1508  O O4    . DT  A 1 74  ? 72.118  85.245  -86.796 1.00 67.66  ? 74   DT  I O4    1 
ATOM   1509  C C5    . DT  A 1 74  ? 71.893  86.420  -88.850 1.00 69.10  ? 74   DT  I C5    1 
ATOM   1510  C C7    . DT  A 1 74  ? 71.430  87.685  -88.195 1.00 68.06  ? 74   DT  I C7    1 
ATOM   1511  C C6    . DT  A 1 74  ? 72.041  86.298  -90.176 1.00 69.59  ? 74   DT  I C6    1 
ATOM   1512  P P     . DT  A 1 75  ? 70.725  84.412  -95.763 1.00 95.68  ? 75   DT  I P     1 
ATOM   1513  O OP1   . DT  A 1 75  ? 70.908  83.838  -97.120 1.00 80.32  ? 75   DT  I OP1   1 
ATOM   1514  O OP2   . DT  A 1 75  ? 69.732  85.499  -95.547 1.00 78.94  ? 75   DT  I OP2   1 
ATOM   1515  O "O5'" . DT  A 1 75  ? 70.432  83.215  -94.757 1.00 93.77  ? 75   DT  I "O5'" 1 
ATOM   1516  C "C5'" . DT  A 1 75  ? 71.354  82.136  -94.651 1.00 92.73  ? 75   DT  I "C5'" 1 
ATOM   1517  C "C4'" . DT  A 1 75  ? 70.724  80.985  -93.906 1.00 91.86  ? 75   DT  I "C4'" 1 
ATOM   1518  O "O4'" . DT  A 1 75  ? 70.757  81.230  -92.480 1.00 90.79  ? 75   DT  I "O4'" 1 
ATOM   1519  C "C3'" . DT  A 1 75  ? 69.261  80.747  -94.270 1.00 91.54  ? 75   DT  I "C3'" 1 
ATOM   1520  O "O3'" . DT  A 1 75  ? 69.010  79.350  -94.377 1.00 93.04  ? 75   DT  I "O3'" 1 
ATOM   1521  C "C2'" . DT  A 1 75  ? 68.503  81.335  -93.093 1.00 90.68  ? 75   DT  I "C2'" 1 
ATOM   1522  C "C1'" . DT  A 1 75  ? 69.457  81.084  -91.938 1.00 89.47  ? 75   DT  I "C1'" 1 
ATOM   1523  N N1    . DT  A 1 75  ? 69.333  82.022  -90.804 1.00 72.01  ? 75   DT  I N1    1 
ATOM   1524  C C2    . DT  A 1 75  ? 69.589  81.541  -89.540 1.00 70.74  ? 75   DT  I C2    1 
ATOM   1525  O O2    . DT  A 1 75  ? 69.910  80.384  -89.319 1.00 71.64  ? 75   DT  I O2    1 
ATOM   1526  N N3    . DT  A 1 75  ? 69.458  82.470  -88.536 1.00 68.77  ? 75   DT  I N3    1 
ATOM   1527  C C4    . DT  A 1 75  ? 69.105  83.799  -88.670 1.00 68.70  ? 75   DT  I C4    1 
ATOM   1528  O O4    . DT  A 1 75  ? 69.029  84.519  -87.678 1.00 66.27  ? 75   DT  I O4    1 
ATOM   1529  C C5    . DT  A 1 75  ? 68.851  84.235  -90.020 1.00 69.37  ? 75   DT  I C5    1 
ATOM   1530  C C7    . DT  A 1 75  ? 68.461  85.660  -90.256 1.00 69.86  ? 75   DT  I C7    1 
ATOM   1531  C C6    . DT  A 1 75  ? 68.976  83.337  -91.008 1.00 70.57  ? 75   DT  I C6    1 
ATOM   1532  P P     . DC  A 1 76  ? 67.668  78.839  -95.090 1.00 98.17  ? 76   DC  I P     1 
ATOM   1533  O OP1   . DC  A 1 76  ? 68.057  77.889  -96.162 1.00 76.36  ? 76   DC  I OP1   1 
ATOM   1534  O OP2   . DC  A 1 76  ? 66.843  80.029  -95.424 1.00 76.14  ? 76   DC  I OP2   1 
ATOM   1535  O "O5'" . DC  A 1 76  ? 66.930  78.030  -93.935 1.00 96.13  ? 76   DC  I "O5'" 1 
ATOM   1536  C "C5'" . DC  A 1 76  ? 67.615  77.007  -93.221 1.00 94.35  ? 76   DC  I "C5'" 1 
ATOM   1537  C "C4'" . DC  A 1 76  ? 66.888  76.690  -91.936 1.00 93.84  ? 76   DC  I "C4'" 1 
ATOM   1538  O "O4'" . DC  A 1 76  ? 67.071  77.743  -90.955 1.00 91.70  ? 76   DC  I "O4'" 1 
ATOM   1539  C "C3'" . DC  A 1 76  ? 65.376  76.519  -92.093 1.00 93.60  ? 76   DC  I "C3'" 1 
ATOM   1540  O "O3'" . DC  A 1 76  ? 64.945  75.473  -91.232 1.00 95.76  ? 76   DC  I "O3'" 1 
ATOM   1541  C "C2'" . DC  A 1 76  ? 64.827  77.829  -91.562 1.00 91.51  ? 76   DC  I "C2'" 1 
ATOM   1542  C "C1'" . DC  A 1 76  ? 65.803  78.098  -90.435 1.00 88.79  ? 76   DC  I "C1'" 1 
ATOM   1543  N N1    . DC  A 1 76  ? 65.861  79.489  -89.968 1.00 64.77  ? 76   DC  I N1    1 
ATOM   1544  C C2    . DC  A 1 76  ? 66.101  79.729  -88.605 1.00 61.96  ? 76   DC  I C2    1 
ATOM   1545  O O2    . DC  A 1 76  ? 66.297  78.762  -87.852 1.00 58.92  ? 76   DC  I O2    1 
ATOM   1546  N N3    . DC  A 1 76  ? 66.114  81.002  -88.149 1.00 60.54  ? 76   DC  I N3    1 
ATOM   1547  C C4    . DC  A 1 76  ? 65.910  82.016  -88.997 1.00 61.66  ? 76   DC  I C4    1 
ATOM   1548  N N4    . DC  A 1 76  ? 65.919  83.260  -88.501 1.00 59.03  ? 76   DC  I N4    1 
ATOM   1549  C C5    . DC  A 1 76  ? 65.685  81.802  -90.392 1.00 61.73  ? 76   DC  I C5    1 
ATOM   1550  C C6    . DC  A 1 76  ? 65.671  80.534  -90.830 1.00 63.20  ? 76   DC  I C6    1 
ATOM   1551  P P     . DC  A 1 77  ? 64.183  74.204  -91.841 1.00 89.65  ? 77   DC  I P     1 
ATOM   1552  O OP1   . DC  A 1 77  ? 65.031  73.633  -92.924 1.00 82.48  ? 77   DC  I OP1   1 
ATOM   1553  O OP2   . DC  A 1 77  ? 62.777  74.603  -92.126 1.00 80.61  ? 77   DC  I OP2   1 
ATOM   1554  O "O5'" . DC  A 1 77  ? 64.178  73.180  -90.626 1.00 87.54  ? 77   DC  I "O5'" 1 
ATOM   1555  C "C5'" . DC  A 1 77  ? 65.361  72.956  -89.869 1.00 85.42  ? 77   DC  I "C5'" 1 
ATOM   1556  C "C4'" . DC  A 1 77  ? 65.070  73.122  -88.397 1.00 83.97  ? 77   DC  I "C4'" 1 
ATOM   1557  O "O4'" . DC  A 1 77  ? 64.913  74.522  -88.054 1.00 83.17  ? 77   DC  I "O4'" 1 
ATOM   1558  C "C3'" . DC  A 1 77  ? 63.788  72.431  -87.941 1.00 83.23  ? 77   DC  I "C3'" 1 
ATOM   1559  O "O3'" . DC  A 1 77  ? 64.015  71.823  -86.674 1.00 83.69  ? 77   DC  I "O3'" 1 
ATOM   1560  C "C2'" . DC  A 1 77  ? 62.790  73.571  -87.824 1.00 82.19  ? 77   DC  I "C2'" 1 
ATOM   1561  C "C1'" . DC  A 1 77  ? 63.680  74.716  -87.377 1.00 81.86  ? 77   DC  I "C1'" 1 
ATOM   1562  N N1    . DC  A 1 77  ? 63.199  76.072  -87.692 1.00 73.37  ? 77   DC  I N1    1 
ATOM   1563  C C2    . DC  A 1 77  ? 63.342  77.083  -86.722 1.00 73.23  ? 77   DC  I C2    1 
ATOM   1564  O O2    . DC  A 1 77  ? 63.816  76.791  -85.612 1.00 72.19  ? 77   DC  I O2    1 
ATOM   1565  N N3    . DC  A 1 77  ? 62.953  78.345  -87.017 1.00 71.89  ? 77   DC  I N3    1 
ATOM   1566  C C4    . DC  A 1 77  ? 62.426  78.617  -88.211 1.00 72.51  ? 77   DC  I C4    1 
ATOM   1567  N N4    . DC  A 1 77  ? 62.069  79.880  -88.463 1.00 70.97  ? 77   DC  I N4    1 
ATOM   1568  C C5    . DC  A 1 77  ? 62.242  77.604  -89.205 1.00 72.46  ? 77   DC  I C5    1 
ATOM   1569  C C6    . DC  A 1 77  ? 62.640  76.358  -88.905 1.00 72.80  ? 77   DC  I C6    1 
ATOM   1570  P P     . DG  A 1 78  ? 63.034  70.664  -86.169 1.00 85.48  ? 78   DG  I P     1 
ATOM   1571  O OP1   . DG  A 1 78  ? 63.846  69.486  -85.767 1.00 79.93  ? 78   DG  I OP1   1 
ATOM   1572  O OP2   . DG  A 1 78  ? 61.964  70.514  -87.186 1.00 80.57  ? 78   DG  I OP2   1 
ATOM   1573  O "O5'" . DG  A 1 78  ? 62.376  71.289  -84.867 1.00 84.91  ? 78   DG  I "O5'" 1 
ATOM   1574  C "C5'" . DG  A 1 78  ? 63.164  72.004  -83.925 1.00 83.01  ? 78   DG  I "C5'" 1 
ATOM   1575  C "C4'" . DG  A 1 78  ? 62.280  72.939  -83.139 1.00 82.69  ? 78   DG  I "C4'" 1 
ATOM   1576  O "O4'" . DG  A 1 78  ? 61.924  74.092  -83.942 1.00 82.60  ? 78   DG  I "O4'" 1 
ATOM   1577  C "C3'" . DG  A 1 78  ? 60.956  72.298  -82.719 1.00 81.01  ? 78   DG  I "C3'" 1 
ATOM   1578  O "O3'" . DG  A 1 78  ? 60.582  72.804  -81.447 1.00 79.48  ? 78   DG  I "O3'" 1 
ATOM   1579  C "C2'" . DG  A 1 78  ? 59.977  72.842  -83.740 1.00 82.04  ? 78   DG  I "C2'" 1 
ATOM   1580  C "C1'" . DG  A 1 78  ? 60.518  74.245  -83.903 1.00 82.51  ? 78   DG  I "C1'" 1 
ATOM   1581  N N9    . DG  A 1 78  ? 60.096  74.953  -85.105 1.00 77.45  ? 78   DG  I N9    1 
ATOM   1582  C C8    . DG  A 1 78  ? 59.735  74.410  -86.313 1.00 77.30  ? 78   DG  I C8    1 
ATOM   1583  N N7    . DG  A 1 78  ? 59.396  75.308  -87.196 1.00 78.07  ? 78   DG  I N7    1 
ATOM   1584  C C5    . DG  A 1 78  ? 59.545  76.517  -86.533 1.00 77.83  ? 78   DG  I C5    1 
ATOM   1585  C C6    . DG  A 1 78  ? 59.325  77.843  -86.982 1.00 78.31  ? 78   DG  I C6    1 
ATOM   1586  O O6    . DG  A 1 78  ? 58.955  78.227  -88.097 1.00 79.26  ? 78   DG  I O6    1 
ATOM   1587  N N1    . DG  A 1 78  ? 59.586  78.773  -85.979 1.00 78.27  ? 78   DG  I N1    1 
ATOM   1588  C C2    . DG  A 1 78  ? 60.011  78.467  -84.709 1.00 78.02  ? 78   DG  I C2    1 
ATOM   1589  N N2    . DG  A 1 78  ? 60.204  79.509  -83.880 1.00 76.54  ? 78   DG  I N2    1 
ATOM   1590  N N3    . DG  A 1 78  ? 60.230  77.233  -84.282 1.00 77.14  ? 78   DG  I N3    1 
ATOM   1591  C C4    . DG  A 1 78  ? 59.975  76.315  -85.240 1.00 77.53  ? 78   DG  I C4    1 
ATOM   1592  P P     . DC  A 1 79  ? 60.519  71.824  -80.185 1.00 72.80  ? 79   DC  I P     1 
ATOM   1593  O OP1   . DC  A 1 79  ? 61.733  70.970  -80.207 1.00 74.65  ? 79   DC  I OP1   1 
ATOM   1594  O OP2   . DC  A 1 79  ? 59.171  71.200  -80.126 1.00 73.35  ? 79   DC  I OP2   1 
ATOM   1595  O "O5'" . DC  A 1 79  ? 60.671  72.834  -78.969 1.00 70.12  ? 79   DC  I "O5'" 1 
ATOM   1596  C "C5'" . DC  A 1 79  ? 61.728  73.788  -78.961 1.00 63.03  ? 79   DC  I "C5'" 1 
ATOM   1597  C "C4'" . DC  A 1 79  ? 61.180  75.165  -78.670 1.00 59.67  ? 79   DC  I "C4'" 1 
ATOM   1598  O "O4'" . DC  A 1 79  ? 60.515  75.737  -79.820 1.00 57.44  ? 79   DC  I "O4'" 1 
ATOM   1599  C "C3'" . DC  A 1 79  ? 60.166  75.224  -77.531 1.00 56.88  ? 79   DC  I "C3'" 1 
ATOM   1600  O "O3'" . DC  A 1 79  ? 60.384  76.446  -76.852 1.00 56.96  ? 79   DC  I "O3'" 1 
ATOM   1601  C "C2'" . DC  A 1 79  ? 58.836  75.290  -78.258 1.00 56.17  ? 79   DC  I "C2'" 1 
ATOM   1602  C "C1'" . DC  A 1 79  ? 59.206  76.149  -79.453 1.00 55.55  ? 79   DC  I "C1'" 1 
ATOM   1603  N N1    . DC  A 1 79  ? 58.351  76.012  -80.639 1.00 56.77  ? 79   DC  I N1    1 
ATOM   1604  C C2    . DC  A 1 79  ? 57.955  77.174  -81.323 1.00 56.71  ? 79   DC  I C2    1 
ATOM   1605  O O2    . DC  A 1 79  ? 58.269  78.283  -80.862 1.00 54.99  ? 79   DC  I O2    1 
ATOM   1606  N N3    . DC  A 1 79  ? 57.242  77.057  -82.465 1.00 56.68  ? 79   DC  I N3    1 
ATOM   1607  C C4    . DC  A 1 79  ? 56.911  75.849  -82.924 1.00 58.72  ? 79   DC  I C4    1 
ATOM   1608  N N4    . DC  A 1 79  ? 56.237  75.787  -84.074 1.00 59.57  ? 79   DC  I N4    1 
ATOM   1609  C C5    . DC  A 1 79  ? 57.263  74.651  -82.229 1.00 57.96  ? 79   DC  I C5    1 
ATOM   1610  C C6    . DC  A 1 79  ? 57.973  74.780  -81.098 1.00 57.73  ? 79   DC  I C6    1 
ATOM   1611  P P     . DT  A 1 80  ? 60.176  76.535  -75.273 1.00 57.80  ? 80   DT  I P     1 
ATOM   1612  O OP1   . DT  A 1 80  ? 61.489  76.953  -74.729 1.00 56.07  ? 80   DT  I OP1   1 
ATOM   1613  O OP2   . DT  A 1 80  ? 59.531  75.298  -74.782 1.00 55.46  ? 80   DT  I OP2   1 
ATOM   1614  O "O5'" . DT  A 1 80  ? 59.167  77.754  -75.144 1.00 55.24  ? 80   DT  I "O5'" 1 
ATOM   1615  C "C5'" . DT  A 1 80  ? 59.512  79.001  -75.730 1.00 50.91  ? 80   DT  I "C5'" 1 
ATOM   1616  C "C4'" . DT  A 1 80  ? 58.274  79.757  -76.147 1.00 48.82  ? 80   DT  I "C4'" 1 
ATOM   1617  O "O4'" . DT  A 1 80  ? 57.664  79.180  -77.336 1.00 48.18  ? 80   DT  I "O4'" 1 
ATOM   1618  C "C3'" . DT  A 1 80  ? 57.175  79.850  -75.086 1.00 46.07  ? 80   DT  I "C3'" 1 
ATOM   1619  O "O3'" . DT  A 1 80  ? 56.787  81.215  -74.988 1.00 44.09  ? 80   DT  I "O3'" 1 
ATOM   1620  C "C2'" . DT  A 1 80  ? 56.046  79.011  -75.665 1.00 47.62  ? 80   DT  I "C2'" 1 
ATOM   1621  C "C1'" . DT  A 1 80  ? 56.256  79.157  -77.169 1.00 48.85  ? 80   DT  I "C1'" 1 
ATOM   1622  N N1    . DT  A 1 80  ? 55.700  78.054  -78.001 1.00 49.02  ? 80   DT  I N1    1 
ATOM   1623  C C2    . DT  A 1 80  ? 55.224  78.338  -79.282 1.00 50.22  ? 80   DT  I C2    1 
ATOM   1624  O O2    . DT  A 1 80  ? 55.250  79.446  -79.791 1.00 46.58  ? 80   DT  I O2    1 
ATOM   1625  N N3    . DT  A 1 80  ? 54.707  77.259  -79.948 1.00 51.45  ? 80   DT  I N3    1 
ATOM   1626  C C4    . DT  A 1 80  ? 54.614  75.964  -79.492 1.00 52.01  ? 80   DT  I C4    1 
ATOM   1627  O O4    . DT  A 1 80  ? 54.106  75.104  -80.199 1.00 55.32  ? 80   DT  I O4    1 
ATOM   1628  C C5    . DT  A 1 80  ? 55.141  75.731  -78.169 1.00 52.45  ? 80   DT  I C5    1 
ATOM   1629  C C7    . DT  A 1 80  ? 55.102  74.340  -77.615 1.00 51.35  ? 80   DT  I C7    1 
ATOM   1630  C C6    . DT  A 1 80  ? 55.649  76.773  -77.497 1.00 48.08  ? 80   DT  I C6    1 
ATOM   1631  P P     . DG  A 1 81  ? 55.742  81.688  -73.869 1.00 37.59  ? 81   DG  I P     1 
ATOM   1632  O OP1   . DG  A 1 81  ? 56.498  82.505  -72.887 1.00 46.80  ? 81   DG  I OP1   1 
ATOM   1633  O OP2   . DG  A 1 81  ? 54.922  80.552  -73.394 1.00 47.90  ? 81   DG  I OP2   1 
ATOM   1634  O "O5'" . DG  A 1 81  ? 54.812  82.665  -74.711 1.00 40.90  ? 81   DG  I "O5'" 1 
ATOM   1635  C "C5'" . DG  A 1 81  ? 55.400  83.515  -75.708 1.00 38.65  ? 81   DG  I "C5'" 1 
ATOM   1636  C "C4'" . DG  A 1 81  ? 54.329  84.121  -76.583 1.00 40.05  ? 81   DG  I "C4'" 1 
ATOM   1637  O "O4'" . DG  A 1 81  ? 53.815  83.148  -77.527 1.00 38.51  ? 81   DG  I "O4'" 1 
ATOM   1638  C "C3'" . DG  A 1 81  ? 53.121  84.640  -75.812 1.00 38.00  ? 81   DG  I "C3'" 1 
ATOM   1639  O "O3'" . DG  A 1 81  ? 52.640  85.796  -76.488 1.00 37.23  ? 81   DG  I "O3'" 1 
ATOM   1640  C "C2'" . DG  A 1 81  ? 52.134  83.489  -75.895 1.00 36.95  ? 81   DG  I "C2'" 1 
ATOM   1641  C "C1'" . DG  A 1 81  ? 52.451  82.860  -77.247 1.00 38.34  ? 81   DG  I "C1'" 1 
ATOM   1642  N N9    . DG  A 1 81  ? 52.302  81.409  -77.290 1.00 47.63  ? 81   DG  I N9    1 
ATOM   1643  C C8    . DG  A 1 81  ? 52.606  80.503  -76.300 1.00 46.13  ? 81   DG  I C8    1 
ATOM   1644  N N7    . DG  A 1 81  ? 52.398  79.266  -76.661 1.00 45.58  ? 81   DG  I N7    1 
ATOM   1645  C C5    . DG  A 1 81  ? 51.922  79.362  -77.960 1.00 47.71  ? 81   DG  I C5    1 
ATOM   1646  C C6    . DG  A 1 81  ? 51.529  78.351  -78.871 1.00 48.56  ? 81   DG  I C6    1 
ATOM   1647  O O6    . DG  A 1 81  ? 51.530  77.130  -78.709 1.00 49.64  ? 81   DG  I O6    1 
ATOM   1648  N N1    . DG  A 1 81  ? 51.096  78.890  -80.076 1.00 47.97  ? 81   DG  I N1    1 
ATOM   1649  C C2    . DG  A 1 81  ? 51.039  80.231  -80.365 1.00 50.42  ? 81   DG  I C2    1 
ATOM   1650  N N2    . DG  A 1 81  ? 50.554  80.567  -81.570 1.00 50.43  ? 81   DG  I N2    1 
ATOM   1651  N N3    . DG  A 1 81  ? 51.417  81.179  -79.529 1.00 48.42  ? 81   DG  I N3    1 
ATOM   1652  C C4    . DG  A 1 81  ? 51.843  80.677  -78.356 1.00 46.99  ? 81   DG  I C4    1 
ATOM   1653  P P     . DA  A 1 82  ? 51.434  86.639  -75.873 1.00 37.55  ? 82   DA  I P     1 
ATOM   1654  O OP1   . DA  A 1 82  ? 51.786  88.062  -76.131 1.00 39.31  ? 82   DA  I OP1   1 
ATOM   1655  O OP2   . DA  A 1 82  ? 51.153  86.177  -74.504 1.00 38.72  ? 82   DA  I OP2   1 
ATOM   1656  O "O5'" . DA  A 1 82  ? 50.188  86.220  -76.772 1.00 38.09  ? 82   DA  I "O5'" 1 
ATOM   1657  C "C5'" . DA  A 1 82  ? 50.215  86.420  -78.178 1.00 37.85  ? 82   DA  I "C5'" 1 
ATOM   1658  C "C4'" . DA  A 1 82  ? 48.947  85.896  -78.810 1.00 40.78  ? 82   DA  I "C4'" 1 
ATOM   1659  O "O4'" . DA  A 1 82  ? 48.973  84.451  -78.907 1.00 40.30  ? 82   DA  I "O4'" 1 
ATOM   1660  C "C3'" . DA  A 1 82  ? 47.632  86.262  -78.115 1.00 41.18  ? 82   DA  I "C3'" 1 
ATOM   1661  O "O3'" . DA  A 1 82  ? 46.716  86.672  -79.134 1.00 41.13  ? 82   DA  I "O3'" 1 
ATOM   1662  C "C2'" . DA  A 1 82  ? 47.209  84.955  -77.458 1.00 39.29  ? 82   DA  I "C2'" 1 
ATOM   1663  C "C1'" . DA  A 1 82  ? 47.776  83.907  -78.404 1.00 38.96  ? 82   DA  I "C1'" 1 
ATOM   1664  N N9    . DA  A 1 82  ? 48.115  82.625  -77.791 1.00 44.35  ? 82   DA  I N9    1 
ATOM   1665  C C8    . DA  A 1 82  ? 48.649  82.391  -76.545 1.00 45.57  ? 82   DA  I C8    1 
ATOM   1666  N N7    . DA  A 1 82  ? 48.868  81.123  -76.293 1.00 44.98  ? 82   DA  I N7    1 
ATOM   1667  C C5    . DA  A 1 82  ? 48.445  80.475  -77.446 1.00 45.70  ? 82   DA  I C5    1 
ATOM   1668  C C6    . DA  A 1 82  ? 48.420  79.113  -77.820 1.00 47.06  ? 82   DA  I C6    1 
ATOM   1669  N N6    . DA  A 1 82  ? 48.847  78.116  -77.038 1.00 42.78  ? 82   DA  I N6    1 
ATOM   1670  N N1    . DA  A 1 82  ? 47.937  78.808  -79.047 1.00 46.76  ? 82   DA  I N1    1 
ATOM   1671  C C2    . DA  A 1 82  ? 47.510  79.805  -79.833 1.00 47.36  ? 82   DA  I C2    1 
ATOM   1672  N N3    . DA  A 1 82  ? 47.483  81.117  -79.595 1.00 46.99  ? 82   DA  I N3    1 
ATOM   1673  C C4    . DA  A 1 82  ? 47.972  81.389  -78.374 1.00 45.60  ? 82   DA  I C4    1 
ATOM   1674  P P     . DA  A 1 83  ? 45.280  87.281  -78.754 1.00 41.48  ? 83   DA  I P     1 
ATOM   1675  O OP1   . DA  A 1 83  ? 45.009  88.336  -79.774 1.00 47.02  ? 83   DA  I OP1   1 
ATOM   1676  O OP2   . DA  A 1 83  ? 45.199  87.608  -77.304 1.00 47.34  ? 83   DA  I OP2   1 
ATOM   1677  O "O5'" . DA  A 1 83  ? 44.311  86.055  -79.043 1.00 46.17  ? 83   DA  I "O5'" 1 
ATOM   1678  C "C5'" . DA  A 1 83  ? 44.316  85.440  -80.328 1.00 47.92  ? 83   DA  I "C5'" 1 
ATOM   1679  C "C4'" . DA  A 1 83  ? 43.357  84.278  -80.351 1.00 52.27  ? 83   DA  I "C4'" 1 
ATOM   1680  O "O4'" . DA  A 1 83  ? 43.959  83.114  -79.738 1.00 52.24  ? 83   DA  I "O4'" 1 
ATOM   1681  C "C3'" . DA  A 1 83  ? 42.040  84.529  -79.613 1.00 54.57  ? 83   DA  I "C3'" 1 
ATOM   1682  O "O3'" . DA  A 1 83  ? 40.960  84.063  -80.425 1.00 59.28  ? 83   DA  I "O3'" 1 
ATOM   1683  C "C2'" . DA  A 1 83  ? 42.180  83.705  -78.341 1.00 51.83  ? 83   DA  I "C2'" 1 
ATOM   1684  C "C1'" . DA  A 1 83  ? 43.060  82.554  -78.801 1.00 51.78  ? 83   DA  I "C1'" 1 
ATOM   1685  N N9    . DA  A 1 83  ? 43.860  81.919  -77.757 1.00 55.58  ? 83   DA  I N9    1 
ATOM   1686  C C8    . DA  A 1 83  ? 44.434  82.496  -76.651 1.00 55.69  ? 83   DA  I C8    1 
ATOM   1687  N N7    . DA  A 1 83  ? 45.112  81.655  -75.908 1.00 53.98  ? 83   DA  I N7    1 
ATOM   1688  C C5    . DA  A 1 83  ? 44.967  80.440  -76.565 1.00 54.84  ? 83   DA  I C5    1 
ATOM   1689  C C6    . DA  A 1 83  ? 45.444  79.147  -76.282 1.00 54.92  ? 83   DA  I C6    1 
ATOM   1690  N N6    . DA  A 1 83  ? 46.203  78.849  -75.224 1.00 54.18  ? 83   DA  I N6    1 
ATOM   1691  N N1    . DA  A 1 83  ? 45.113  78.157  -77.138 1.00 56.69  ? 83   DA  I N1    1 
ATOM   1692  C C2    . DA  A 1 83  ? 44.358  78.455  -78.201 1.00 56.47  ? 83   DA  I C2    1 
ATOM   1693  N N3    . DA  A 1 83  ? 43.853  79.629  -78.574 1.00 55.32  ? 83   DA  I N3    1 
ATOM   1694  C C4    . DA  A 1 83  ? 44.197  80.590  -77.703 1.00 54.90  ? 83   DA  I C4    1 
ATOM   1695  P P     . DC  A 1 84  ? 39.442  84.349  -79.987 1.00 66.86  ? 84   DC  I P     1 
ATOM   1696  O OP1   . DC  A 1 84  ? 38.751  84.967  -81.143 1.00 65.96  ? 84   DC  I OP1   1 
ATOM   1697  O OP2   . DC  A 1 84  ? 39.406  85.021  -78.665 1.00 64.88  ? 84   DC  I OP2   1 
ATOM   1698  O "O5'" . DC  A 1 84  ? 38.883  82.876  -79.800 1.00 67.70  ? 84   DC  I "O5'" 1 
ATOM   1699  C "C5'" . DC  A 1 84  ? 39.295  81.842  -80.688 1.00 69.28  ? 84   DC  I "C5'" 1 
ATOM   1700  C "C4'" . DC  A 1 84  ? 38.860  80.505  -80.145 1.00 70.75  ? 84   DC  I "C4'" 1 
ATOM   1701  O "O4'" . DC  A 1 84  ? 39.866  79.918  -79.282 1.00 71.27  ? 84   DC  I "O4'" 1 
ATOM   1702  C "C3'" . DC  A 1 84  ? 37.592  80.624  -79.307 1.00 71.89  ? 84   DC  I "C3'" 1 
ATOM   1703  O "O3'" . DC  A 1 84  ? 36.716  79.561  -79.624 1.00 75.31  ? 84   DC  I "O3'" 1 
ATOM   1704  C "C2'" . DC  A 1 84  ? 38.091  80.474  -77.883 1.00 71.25  ? 84   DC  I "C2'" 1 
ATOM   1705  C "C1'" . DC  A 1 84  ? 39.254  79.521  -78.067 1.00 69.78  ? 84   DC  I "C1'" 1 
ATOM   1706  N N1    . DC  A 1 84  ? 40.263  79.558  -76.991 1.00 65.41  ? 84   DC  I N1    1 
ATOM   1707  C C2    . DC  A 1 84  ? 40.916  78.364  -76.634 1.00 63.43  ? 84   DC  I C2    1 
ATOM   1708  O O2    . DC  A 1 84  ? 40.659  77.330  -77.262 1.00 62.70  ? 84   DC  I O2    1 
ATOM   1709  N N3    . DC  A 1 84  ? 41.804  78.373  -75.613 1.00 62.40  ? 84   DC  I N3    1 
ATOM   1710  C C4    . DC  A 1 84  ? 42.053  79.509  -74.956 1.00 63.02  ? 84   DC  I C4    1 
ATOM   1711  N N4    . DC  A 1 84  ? 42.915  79.465  -73.937 1.00 61.32  ? 84   DC  I N4    1 
ATOM   1712  C C5    . DC  A 1 84  ? 41.424  80.742  -75.313 1.00 62.73  ? 84   DC  I C5    1 
ATOM   1713  C C6    . DC  A 1 84  ? 40.548  80.722  -76.329 1.00 63.26  ? 84   DC  I C6    1 
ATOM   1714  P P     . DA  A 1 85  ? 35.197  79.620  -79.132 1.00 76.04  ? 85   DA  I P     1 
ATOM   1715  O OP1   . DA  A 1 85  ? 34.369  79.980  -80.312 1.00 75.47  ? 85   DA  I OP1   1 
ATOM   1716  O OP2   . DA  A 1 85  ? 35.114  80.443  -77.897 1.00 72.75  ? 85   DA  I OP2   1 
ATOM   1717  O "O5'" . DA  A 1 85  ? 34.926  78.104  -78.742 1.00 74.49  ? 85   DA  I "O5'" 1 
ATOM   1718  C "C5'" . DA  A 1 85  ? 35.549  77.053  -79.472 1.00 72.63  ? 85   DA  I "C5'" 1 
ATOM   1719  C "C4'" . DA  A 1 85  ? 35.677  75.833  -78.596 1.00 72.70  ? 85   DA  I "C4'" 1 
ATOM   1720  O "O4'" . DA  A 1 85  ? 36.778  76.003  -77.668 1.00 71.48  ? 85   DA  I "O4'" 1 
ATOM   1721  C "C3'" . DA  A 1 85  ? 34.430  75.595  -77.746 1.00 74.40  ? 85   DA  I "C3'" 1 
ATOM   1722  O "O3'" . DA  A 1 85  ? 34.111  74.203  -77.688 1.00 76.23  ? 85   DA  I "O3'" 1 
ATOM   1723  C "C2'" . DA  A 1 85  ? 34.814  76.137  -76.380 1.00 72.72  ? 85   DA  I "C2'" 1 
ATOM   1724  C "C1'" . DA  A 1 85  ? 36.315  75.895  -76.330 1.00 70.71  ? 85   DA  I "C1'" 1 
ATOM   1725  N N9    . DA  A 1 85  ? 37.043  76.874  -75.521 1.00 67.77  ? 85   DA  I N9    1 
ATOM   1726  C C8    . DA  A 1 85  ? 36.964  78.246  -75.576 1.00 67.04  ? 85   DA  I C8    1 
ATOM   1727  N N7    . DA  A 1 85  ? 37.735  78.857  -74.708 1.00 65.85  ? 85   DA  I N7    1 
ATOM   1728  C C5    . DA  A 1 85  ? 38.367  77.818  -74.037 1.00 65.83  ? 85   DA  I C5    1 
ATOM   1729  C C6    . DA  A 1 85  ? 39.308  77.800  -72.992 1.00 65.54  ? 85   DA  I C6    1 
ATOM   1730  N N6    . DA  A 1 85  ? 39.794  78.900  -72.411 1.00 63.54  ? 85   DA  I N6    1 
ATOM   1731  N N1    . DA  A 1 85  ? 39.738  76.594  -72.555 1.00 66.73  ? 85   DA  I N1    1 
ATOM   1732  C C2    . DA  A 1 85  ? 39.247  75.488  -73.135 1.00 65.87  ? 85   DA  I C2    1 
ATOM   1733  N N3    . DA  A 1 85  ? 38.360  75.376  -74.120 1.00 65.17  ? 85   DA  I N3    1 
ATOM   1734  C C4    . DA  A 1 85  ? 37.954  76.591  -74.531 1.00 66.88  ? 85   DA  I C4    1 
ATOM   1735  P P     . DT  A 1 86  ? 32.724  73.737  -77.031 1.00 80.65  ? 86   DT  I P     1 
ATOM   1736  O OP1   . DT  A 1 86  ? 32.213  72.596  -77.835 1.00 74.10  ? 86   DT  I OP1   1 
ATOM   1737  O OP2   . DT  A 1 86  ? 31.874  74.939  -76.828 1.00 71.68  ? 86   DT  I OP2   1 
ATOM   1738  O "O5'" . DT  A 1 86  ? 33.171  73.194  -75.604 1.00 80.06  ? 86   DT  I "O5'" 1 
ATOM   1739  C "C5'" . DT  A 1 86  ? 34.226  72.244  -75.498 1.00 77.22  ? 86   DT  I "C5'" 1 
ATOM   1740  C "C4'" . DT  A 1 86  ? 34.559  71.984  -74.049 1.00 76.08  ? 86   DT  I "C4'" 1 
ATOM   1741  O "O4'" . DT  A 1 86  ? 35.391  73.033  -73.490 1.00 74.71  ? 86   DT  I "O4'" 1 
ATOM   1742  C "C3'" . DT  A 1 86  ? 33.347  71.855  -73.125 1.00 75.26  ? 86   DT  I "C3'" 1 
ATOM   1743  O "O3'" . DT  A 1 86  ? 33.549  70.732  -72.270 1.00 74.76  ? 86   DT  I "O3'" 1 
ATOM   1744  C "C2'" . DT  A 1 86  ? 33.385  73.145  -72.317 1.00 75.02  ? 86   DT  I "C2'" 1 
ATOM   1745  C "C1'" . DT  A 1 86  ? 34.880  73.383  -72.215 1.00 75.42  ? 86   DT  I "C1'" 1 
ATOM   1746  N N1    . DT  A 1 86  ? 35.322  74.762  -71.889 1.00 67.76  ? 86   DT  I N1    1 
ATOM   1747  C C2    . DT  A 1 86  ? 36.468  74.899  -71.127 1.00 67.19  ? 86   DT  I C2    1 
ATOM   1748  O O2    . DT  A 1 86  ? 37.122  73.949  -70.726 1.00 66.32  ? 86   DT  I O2    1 
ATOM   1749  N N3    . DT  A 1 86  ? 36.823  76.197  -70.855 1.00 66.89  ? 86   DT  I N3    1 
ATOM   1750  C C4    . DT  A 1 86  ? 36.167  77.345  -71.259 1.00 67.52  ? 86   DT  I C4    1 
ATOM   1751  O O4    . DT  A 1 86  ? 36.608  78.446  -70.941 1.00 67.09  ? 86   DT  I O4    1 
ATOM   1752  C C5    . DT  A 1 86  ? 34.976  77.129  -72.051 1.00 66.96  ? 86   DT  I C5    1 
ATOM   1753  C C7    . DT  A 1 86  ? 34.200  78.317  -72.527 1.00 64.36  ? 86   DT  I C7    1 
ATOM   1754  C C6    . DT  A 1 86  ? 34.618  75.865  -72.323 1.00 66.83  ? 86   DT  I C6    1 
ATOM   1755  P P     . DG  A 1 87  ? 32.293  70.013  -71.576 1.00 64.85  ? 87   DG  I P     1 
ATOM   1756  O OP1   . DG  A 1 87  ? 32.305  68.589  -71.990 1.00 65.44  ? 87   DG  I OP1   1 
ATOM   1757  O OP2   . DG  A 1 87  ? 31.069  70.832  -71.770 1.00 64.36  ? 87   DG  I OP2   1 
ATOM   1758  O "O5'" . DG  A 1 87  ? 32.660  70.086  -70.032 1.00 65.74  ? 87   DG  I "O5'" 1 
ATOM   1759  C "C5'" . DG  A 1 87  ? 33.946  69.684  -69.568 1.00 63.98  ? 87   DG  I "C5'" 1 
ATOM   1760  C "C4'" . DG  A 1 87  ? 34.205  70.292  -68.211 1.00 63.77  ? 87   DG  I "C4'" 1 
ATOM   1761  O "O4'" . DG  A 1 87  ? 34.627  71.669  -68.348 1.00 63.45  ? 87   DG  I "O4'" 1 
ATOM   1762  C "C3'" . DG  A 1 87  ? 32.959  70.314  -67.321 1.00 63.27  ? 87   DG  I "C3'" 1 
ATOM   1763  O "O3'" . DG  A 1 87  ? 33.322  70.039  -65.977 1.00 62.44  ? 87   DG  I "O3'" 1 
ATOM   1764  C "C2'" . DG  A 1 87  ? 32.498  71.753  -67.412 1.00 63.96  ? 87   DG  I "C2'" 1 
ATOM   1765  C "C1'" . DG  A 1 87  ? 33.830  72.463  -67.493 1.00 64.94  ? 87   DG  I "C1'" 1 
ATOM   1766  N N9    . DG  A 1 87  ? 33.781  73.817  -68.029 1.00 69.36  ? 87   DG  I N9    1 
ATOM   1767  C C8    . DG  A 1 87  ? 32.904  74.325  -68.958 1.00 69.87  ? 87   DG  I C8    1 
ATOM   1768  N N7    . DG  A 1 87  ? 33.084  75.598  -69.187 1.00 70.37  ? 87   DG  I N7    1 
ATOM   1769  C C5    . DG  A 1 87  ? 34.150  75.945  -68.368 1.00 70.58  ? 87   DG  I C5    1 
ATOM   1770  C C6    . DG  A 1 87  ? 34.787  77.192  -68.174 1.00 71.24  ? 87   DG  I C6    1 
ATOM   1771  O O6    . DG  A 1 87  ? 34.522  78.281  -68.699 1.00 70.40  ? 87   DG  I O6    1 
ATOM   1772  N N1    . DG  A 1 87  ? 35.832  77.094  -67.255 1.00 72.87  ? 87   DG  I N1    1 
ATOM   1773  C C2    . DG  A 1 87  ? 36.212  75.940  -66.606 1.00 72.81  ? 87   DG  I C2    1 
ATOM   1774  N N2    . DG  A 1 87  ? 37.254  76.039  -65.761 1.00 71.59  ? 87   DG  I N2    1 
ATOM   1775  N N3    . DG  A 1 87  ? 35.614  74.773  -66.775 1.00 70.79  ? 87   DG  I N3    1 
ATOM   1776  C C4    . DG  A 1 87  ? 34.601  74.850  -67.662 1.00 70.48  ? 87   DG  I C4    1 
ATOM   1777  P P     . DC  A 1 88  ? 33.647  68.537  -65.545 1.00 66.31  ? 88   DC  I P     1 
ATOM   1778  O OP1   . DC  A 1 88  ? 34.147  67.826  -66.749 1.00 60.17  ? 88   DC  I OP1   1 
ATOM   1779  O OP2   . DC  A 1 88  ? 32.475  68.008  -64.805 1.00 61.72  ? 88   DC  I OP2   1 
ATOM   1780  O "O5'" . DC  A 1 88  ? 34.854  68.703  -64.523 1.00 69.19  ? 88   DC  I "O5'" 1 
ATOM   1781  C "C5'" . DC  A 1 88  ? 36.183  68.917  -64.996 1.00 71.44  ? 88   DC  I "C5'" 1 
ATOM   1782  C "C4'" . DC  A 1 88  ? 36.918  69.873  -64.087 1.00 72.39  ? 88   DC  I "C4'" 1 
ATOM   1783  O "O4'" . DC  A 1 88  ? 36.466  71.230  -64.288 1.00 72.10  ? 88   DC  I "O4'" 1 
ATOM   1784  C "C3'" . DC  A 1 88  ? 36.759  69.599  -62.595 1.00 73.68  ? 88   DC  I "C3'" 1 
ATOM   1785  O "O3'" . DC  A 1 88  ? 37.991  69.936  -61.960 1.00 75.74  ? 88   DC  I "O3'" 1 
ATOM   1786  C "C2'" . DC  A 1 88  ? 35.678  70.585  -62.184 1.00 72.55  ? 88   DC  I "C2'" 1 
ATOM   1787  C "C1'" . DC  A 1 88  ? 36.035  71.777  -63.052 1.00 73.18  ? 88   DC  I "C1'" 1 
ATOM   1788  N N1    . DC  A 1 88  ? 34.962  72.733  -63.349 1.00 70.21  ? 88   DC  I N1    1 
ATOM   1789  C C2    . DC  A 1 88  ? 35.257  74.100  -63.304 1.00 71.31  ? 88   DC  I C2    1 
ATOM   1790  O O2    . DC  A 1 88  ? 36.377  74.459  -62.916 1.00 72.68  ? 88   DC  I O2    1 
ATOM   1791  N N3    . DC  A 1 88  ? 34.318  74.993  -63.682 1.00 72.17  ? 88   DC  I N3    1 
ATOM   1792  C C4    . DC  A 1 88  ? 33.120  74.567  -64.084 1.00 72.49  ? 88   DC  I C4    1 
ATOM   1793  N N4    . DC  A 1 88  ? 32.248  75.480  -64.510 1.00 72.92  ? 88   DC  I N4    1 
ATOM   1794  C C5    . DC  A 1 88  ? 32.770  73.184  -64.082 1.00 72.31  ? 88   DC  I C5    1 
ATOM   1795  C C6    . DC  A 1 88  ? 33.714  72.308  -63.706 1.00 71.42  ? 88   DC  I C6    1 
ATOM   1796  P P     . DC  A 1 89  ? 38.578  69.001  -60.796 1.00 75.72  ? 89   DC  I P     1 
ATOM   1797  O OP1   . DC  A 1 89  ? 39.688  68.190  -61.374 1.00 78.61  ? 89   DC  I OP1   1 
ATOM   1798  O OP2   . DC  A 1 89  ? 37.445  68.327  -60.105 1.00 79.25  ? 89   DC  I OP2   1 
ATOM   1799  O "O5'" . DC  A 1 89  ? 39.208  70.051  -59.784 1.00 72.83  ? 89   DC  I "O5'" 1 
ATOM   1800  C "C5'" . DC  A 1 89  ? 39.890  71.200  -60.263 1.00 67.85  ? 89   DC  I "C5'" 1 
ATOM   1801  C "C4'" . DC  A 1 89  ? 39.543  72.388  -59.403 1.00 65.98  ? 89   DC  I "C4'" 1 
ATOM   1802  O "O4'" . DC  A 1 89  ? 38.252  72.942  -59.760 1.00 65.51  ? 89   DC  I "O4'" 1 
ATOM   1803  C "C3'" . DC  A 1 89  ? 39.458  72.055  -57.914 1.00 65.41  ? 89   DC  I "C3'" 1 
ATOM   1804  O "O3'" . DC  A 1 89  ? 39.896  73.194  -57.194 1.00 64.43  ? 89   DC  I "O3'" 1 
ATOM   1805  C "C2'" . DC  A 1 89  ? 37.964  71.932  -57.683 1.00 66.33  ? 89   DC  I "C2'" 1 
ATOM   1806  C "C1'" . DC  A 1 89  ? 37.473  73.055  -58.579 1.00 67.01  ? 89   DC  I "C1'" 1 
ATOM   1807  N N1    . DC  A 1 89  ? 36.046  73.022  -58.946 1.00 71.35  ? 89   DC  I N1    1 
ATOM   1808  C C2    . DC  A 1 89  ? 35.390  74.235  -59.192 1.00 71.27  ? 89   DC  I C2    1 
ATOM   1809  O O2    . DC  A 1 89  ? 36.030  75.297  -59.102 1.00 69.71  ? 89   DC  I O2    1 
ATOM   1810  N N3    . DC  A 1 89  ? 34.083  74.222  -59.524 1.00 72.21  ? 89   DC  I N3    1 
ATOM   1811  C C4    . DC  A 1 89  ? 33.430  73.063  -59.619 1.00 72.74  ? 89   DC  I C4    1 
ATOM   1812  N N4    . DC  A 1 89  ? 32.142  73.099  -59.961 1.00 73.09  ? 89   DC  I N4    1 
ATOM   1813  C C5    . DC  A 1 89  ? 34.069  71.815  -59.372 1.00 72.50  ? 89   DC  I C5    1 
ATOM   1814  C C6    . DC  A 1 89  ? 35.366  71.840  -59.042 1.00 72.17  ? 89   DC  I C6    1 
ATOM   1815  P P     . DT  A 1 90  ? 41.079  73.073  -56.127 1.00 52.68  ? 90   DT  I P     1 
ATOM   1816  O OP1   . DT  A 1 90  ? 42.258  72.472  -56.791 1.00 63.71  ? 90   DT  I OP1   1 
ATOM   1817  O OP2   . DT  A 1 90  ? 40.523  72.456  -54.891 1.00 63.20  ? 90   DT  I OP2   1 
ATOM   1818  O "O5'" . DT  A 1 90  ? 41.381  74.615  -55.879 1.00 50.64  ? 90   DT  I "O5'" 1 
ATOM   1819  C "C5'" . DT  A 1 90  ? 41.596  75.474  -56.996 1.00 46.61  ? 90   DT  I "C5'" 1 
ATOM   1820  C "C4'" . DT  A 1 90  ? 40.767  76.733  -56.878 1.00 45.43  ? 90   DT  I "C4'" 1 
ATOM   1821  O "O4'" . DT  A 1 90  ? 39.363  76.487  -57.165 1.00 45.62  ? 90   DT  I "O4'" 1 
ATOM   1822  C "C3'" . DT  A 1 90  ? 40.817  77.423  -55.516 1.00 44.23  ? 90   DT  I "C3'" 1 
ATOM   1823  O "O3'" . DT  A 1 90  ? 41.080  78.815  -55.691 1.00 39.34  ? 90   DT  I "O3'" 1 
ATOM   1824  C "C2'" . DT  A 1 90  ? 39.426  77.199  -54.943 1.00 44.92  ? 90   DT  I "C2'" 1 
ATOM   1825  C "C1'" . DT  A 1 90  ? 38.559  77.128  -56.189 1.00 48.08  ? 90   DT  I "C1'" 1 
ATOM   1826  N N1    . DT  A 1 90  ? 37.311  76.340  -56.025 1.00 65.10  ? 90   DT  I N1    1 
ATOM   1827  C C2    . DT  A 1 90  ? 36.101  76.923  -56.369 1.00 67.26  ? 90   DT  I C2    1 
ATOM   1828  O O2    . DT  A 1 90  ? 35.997  78.059  -56.809 1.00 67.82  ? 90   DT  I O2    1 
ATOM   1829  N N3    . DT  A 1 90  ? 35.005  76.116  -56.175 1.00 68.88  ? 90   DT  I N3    1 
ATOM   1830  C C4    . DT  A 1 90  ? 34.991  74.822  -55.685 1.00 69.61  ? 90   DT  I C4    1 
ATOM   1831  O O4    . DT  A 1 90  ? 33.928  74.223  -55.566 1.00 72.05  ? 90   DT  I O4    1 
ATOM   1832  C C5    . DT  A 1 90  ? 36.283  74.277  -55.345 1.00 70.03  ? 90   DT  I C5    1 
ATOM   1833  C C7    . DT  A 1 90  ? 36.359  72.885  -54.800 1.00 68.63  ? 90   DT  I C7    1 
ATOM   1834  C C6    . DT  A 1 90  ? 37.365  75.051  -55.534 1.00 67.30  ? 90   DT  I C6    1 
ATOM   1835  P P     . DT  A 1 91  ? 41.254  79.753  -54.408 1.00 44.58  ? 91   DT  I P     1 
ATOM   1836  O OP1   . DT  A 1 91  ? 42.248  80.805  -54.755 1.00 50.22  ? 91   DT  I OP1   1 
ATOM   1837  O OP2   . DT  A 1 91  ? 41.465  78.915  -53.204 1.00 47.70  ? 91   DT  I OP2   1 
ATOM   1838  O "O5'" . DT  A 1 91  ? 39.836  80.455  -54.290 1.00 49.24  ? 91   DT  I "O5'" 1 
ATOM   1839  C "C5'" . DT  A 1 91  ? 39.282  81.130  -55.416 1.00 52.29  ? 91   DT  I "C5'" 1 
ATOM   1840  C "C4'" . DT  A 1 91  ? 37.912  81.663  -55.078 1.00 56.87  ? 91   DT  I "C4'" 1 
ATOM   1841  O "O4'" . DT  A 1 91  ? 36.942  80.587  -55.058 1.00 57.43  ? 91   DT  I "O4'" 1 
ATOM   1842  C "C3'" . DT  A 1 91  ? 37.829  82.339  -53.712 1.00 59.96  ? 91   DT  I "C3'" 1 
ATOM   1843  O "O3'" . DT  A 1 91  ? 37.086  83.549  -53.836 1.00 63.89  ? 91   DT  I "O3'" 1 
ATOM   1844  C "C2'" . DT  A 1 91  ? 37.092  81.324  -52.850 1.00 58.74  ? 91   DT  I "C2'" 1 
ATOM   1845  C "C1'" . DT  A 1 91  ? 36.188  80.647  -53.862 1.00 57.98  ? 91   DT  I "C1'" 1 
ATOM   1846  N N1    . DT  A 1 91  ? 35.752  79.273  -53.534 1.00 63.33  ? 91   DT  I N1    1 
ATOM   1847  C C2    . DT  A 1 91  ? 34.484  78.897  -53.927 1.00 63.70  ? 91   DT  I C2    1 
ATOM   1848  O O2    . DT  A 1 91  ? 33.713  79.648  -54.508 1.00 64.36  ? 91   DT  I O2    1 
ATOM   1849  N N3    . DT  A 1 91  ? 34.147  77.604  -53.616 1.00 62.62  ? 91   DT  I N3    1 
ATOM   1850  C C4    . DT  A 1 91  ? 34.927  76.670  -52.968 1.00 61.94  ? 91   DT  I C4    1 
ATOM   1851  O O4    . DT  A 1 91  ? 34.487  75.541  -52.770 1.00 60.30  ? 91   DT  I O4    1 
ATOM   1852  C C5    . DT  A 1 91  ? 36.245  77.132  -52.574 1.00 62.32  ? 91   DT  I C5    1 
ATOM   1853  C C7    . DT  A 1 91  ? 37.165  76.187  -51.867 1.00 59.99  ? 91   DT  I C7    1 
ATOM   1854  C C6    . DT  A 1 91  ? 36.583  78.395  -52.870 1.00 62.22  ? 91   DT  I C6    1 
ATOM   1855  P P     . DT  A 1 92  ? 36.907  84.504  -52.565 1.00 63.96  ? 92   DT  I P     1 
ATOM   1856  O OP1   . DT  A 1 92  ? 36.936  85.905  -53.059 1.00 72.28  ? 92   DT  I OP1   1 
ATOM   1857  O OP2   . DT  A 1 92  ? 37.861  84.082  -51.510 1.00 70.28  ? 92   DT  I OP2   1 
ATOM   1858  O "O5'" . DT  A 1 92  ? 35.421  84.168  -52.099 1.00 66.24  ? 92   DT  I "O5'" 1 
ATOM   1859  C "C5'" . DT  A 1 92  ? 34.358  84.197  -53.047 1.00 69.70  ? 92   DT  I "C5'" 1 
ATOM   1860  C "C4'" . DT  A 1 92  ? 33.039  83.923  -52.369 1.00 73.00  ? 92   DT  I "C4'" 1 
ATOM   1861  O "O4'" . DT  A 1 92  ? 32.810  82.500  -52.225 1.00 72.51  ? 92   DT  I "O4'" 1 
ATOM   1862  C "C3'" . DT  A 1 92  ? 32.910  84.530  -50.973 1.00 76.52  ? 92   DT  I "C3'" 1 
ATOM   1863  O "O3'" . DT  A 1 92  ? 31.625  85.136  -50.845 1.00 83.17  ? 92   DT  I "O3'" 1 
ATOM   1864  C "C2'" . DT  A 1 92  ? 33.051  83.333  -50.046 1.00 74.59  ? 92   DT  I "C2'" 1 
ATOM   1865  C "C1'" . DT  A 1 92  ? 32.471  82.200  -50.881 1.00 72.60  ? 92   DT  I "C1'" 1 
ATOM   1866  N N1    . DT  A 1 92  ? 33.001  80.855  -50.566 1.00 78.51  ? 92   DT  I N1    1 
ATOM   1867  C C2    . DT  A 1 92  ? 32.177  79.770  -50.769 1.00 78.26  ? 92   DT  I C2    1 
ATOM   1868  O O2    . DT  A 1 92  ? 31.042  79.867  -51.200 1.00 79.07  ? 92   DT  I O2    1 
ATOM   1869  N N3    . DT  A 1 92  ? 32.735  78.557  -50.445 1.00 77.64  ? 92   DT  I N3    1 
ATOM   1870  C C4    . DT  A 1 92  ? 34.002  78.326  -49.946 1.00 77.49  ? 92   DT  I C4    1 
ATOM   1871  O O4    . DT  A 1 92  ? 34.361  77.178  -49.693 1.00 77.79  ? 92   DT  I O4    1 
ATOM   1872  C C5    . DT  A 1 92  ? 34.813  79.505  -49.759 1.00 77.59  ? 92   DT  I C5    1 
ATOM   1873  C C7    . DT  A 1 92  ? 36.198  79.349  -49.217 1.00 76.99  ? 92   DT  I C7    1 
ATOM   1874  C C6    . DT  A 1 92  ? 34.283  80.695  -50.078 1.00 78.12  ? 92   DT  I C6    1 
ATOM   1875  P P     . DT  A 1 93  ? 31.299  86.062  -49.578 1.00 109.06 ? 93   DT  I P     1 
ATOM   1876  O OP1   . DT  A 1 93  ? 30.772  87.356  -50.083 1.00 79.77  ? 93   DT  I OP1   1 
ATOM   1877  O OP2   . DT  A 1 93  ? 32.454  86.054  -48.643 1.00 80.60  ? 93   DT  I OP2   1 
ATOM   1878  O "O5'" . DT  A 1 93  ? 30.112  85.266  -48.888 1.00 112.25 ? 93   DT  I "O5'" 1 
ATOM   1879  C "C5'" . DT  A 1 93  ? 29.076  84.701  -49.683 1.00 117.55 ? 93   DT  I "C5'" 1 
ATOM   1880  C "C4'" . DT  A 1 93  ? 28.267  83.730  -48.860 1.00 121.28 ? 93   DT  I "C4'" 1 
ATOM   1881  O "O4'" . DT  A 1 93  ? 28.915  82.435  -48.803 1.00 121.58 ? 93   DT  I "O4'" 1 
ATOM   1882  C "C3'" . DT  A 1 93  ? 28.082  84.182  -47.412 1.00 123.67 ? 93   DT  I "C3'" 1 
ATOM   1883  O "O3'" . DT  A 1 93  ? 26.736  83.941  -47.003 1.00 127.29 ? 93   DT  I "O3'" 1 
ATOM   1884  C "C2'" . DT  A 1 93  ? 29.054  83.303  -46.643 1.00 123.17 ? 93   DT  I "C2'" 1 
ATOM   1885  C "C1'" . DT  A 1 93  ? 29.001  82.021  -47.451 1.00 122.24 ? 93   DT  I "C1'" 1 
ATOM   1886  N N1    . DT  A 1 93  ? 30.164  81.119  -47.314 1.00 92.70  ? 93   DT  I N1    1 
ATOM   1887  C C2    . DT  A 1 93  ? 29.923  79.762  -47.336 1.00 92.18  ? 93   DT  I C2    1 
ATOM   1888  O O2    . DT  A 1 93  ? 28.808  79.286  -47.468 1.00 92.86  ? 93   DT  I O2    1 
ATOM   1889  N N3    . DT  A 1 93  ? 31.039  78.977  -47.202 1.00 91.31  ? 93   DT  I N3    1 
ATOM   1890  C C4    . DT  A 1 93  ? 32.343  79.402  -47.056 1.00 91.00  ? 93   DT  I C4    1 
ATOM   1891  O O4    . DT  A 1 93  ? 33.244  78.577  -46.954 1.00 89.66  ? 93   DT  I O4    1 
ATOM   1892  C C5    . DT  A 1 93  ? 32.525  80.839  -47.040 1.00 91.29  ? 93   DT  I C5    1 
ATOM   1893  C C7    . DT  A 1 93  ? 33.906  81.392  -46.883 1.00 91.69  ? 93   DT  I C7    1 
ATOM   1894  C C6    . DT  A 1 93  ? 31.441  81.615  -47.167 1.00 91.90  ? 93   DT  I C6    1 
ATOM   1895  P P     . DG  A 1 94  ? 26.235  84.463  -45.572 1.00 148.66 ? 94   DG  I P     1 
ATOM   1896  O OP1   . DG  A 1 94  ? 24.999  85.266  -45.767 1.00 102.35 ? 94   DG  I OP1   1 
ATOM   1897  O OP2   . DG  A 1 94  ? 27.403  85.062  -44.871 1.00 101.31 ? 94   DG  I OP2   1 
ATOM   1898  O "O5'" . DG  A 1 94  ? 25.851  83.113  -44.826 1.00 149.33 ? 94   DG  I "O5'" 1 
ATOM   1899  C "C5'" . DG  A 1 94  ? 26.628  81.938  -45.027 1.00 152.07 ? 94   DG  I "C5'" 1 
ATOM   1900  C "C4'" . DG  A 1 94  ? 26.327  80.929  -43.949 1.00 153.38 ? 94   DG  I "C4'" 1 
ATOM   1901  O "O4'" . DG  A 1 94  ? 27.219  79.799  -44.106 1.00 153.51 ? 94   DG  I "O4'" 1 
ATOM   1902  C "C3'" . DG  A 1 94  ? 26.572  81.467  -42.542 1.00 154.70 ? 94   DG  I "C3'" 1 
ATOM   1903  O "O3'" . DG  A 1 94  ? 25.611  80.910  -41.649 1.00 156.78 ? 94   DG  I "O3'" 1 
ATOM   1904  C "C2'" . DG  A 1 94  ? 27.963  80.966  -42.212 1.00 153.86 ? 94   DG  I "C2'" 1 
ATOM   1905  C "C1'" . DG  A 1 94  ? 28.007  79.635  -42.938 1.00 153.30 ? 94   DG  I "C1'" 1 
ATOM   1906  N N9    . DG  A 1 94  ? 29.349  79.238  -43.348 1.00 105.86 ? 94   DG  I N9    1 
ATOM   1907  C C8    . DG  A 1 94  ? 30.412  80.067  -43.623 1.00 105.85 ? 94   DG  I C8    1 
ATOM   1908  N N7    . DG  A 1 94  ? 31.500  79.418  -43.933 1.00 105.17 ? 94   DG  I N7    1 
ATOM   1909  C C5    . DG  A 1 94  ? 31.131  78.081  -43.868 1.00 104.38 ? 94   DG  I C5    1 
ATOM   1910  C C6    . DG  A 1 94  ? 31.890  76.911  -44.099 1.00 103.68 ? 94   DG  I C6    1 
ATOM   1911  O O6    . DG  A 1 94  ? 33.079  76.818  -44.415 1.00 103.30 ? 94   DG  I O6    1 
ATOM   1912  N N1    . DG  A 1 94  ? 31.127  75.762  -43.925 1.00 103.50 ? 94   DG  I N1    1 
ATOM   1913  C C2    . DG  A 1 94  ? 29.800  75.741  -43.574 1.00 103.91 ? 94   DG  I C2    1 
ATOM   1914  N N2    . DG  A 1 94  ? 29.235  74.527  -43.458 1.00 103.46 ? 94   DG  I N2    1 
ATOM   1915  N N3    . DG  A 1 94  ? 29.079  76.828  -43.354 1.00 104.56 ? 94   DG  I N3    1 
ATOM   1916  C C4    . DG  A 1 94  ? 29.804  77.955  -43.517 1.00 104.97 ? 94   DG  I C4    1 
ATOM   1917  P P     . DA  A 1 95  ? 25.499  81.464  -40.146 1.00 143.27 ? 95   DA  I P     1 
ATOM   1918  O OP1   . DA  A 1 95  ? 24.303  82.339  -40.059 1.00 122.41 ? 95   DA  I OP1   1 
ATOM   1919  O OP2   . DA  A 1 95  ? 26.825  81.992  -39.737 1.00 122.23 ? 95   DA  I OP2   1 
ATOM   1920  O "O5'" . DA  A 1 95  ? 25.214  80.136  -39.320 1.00 142.96 ? 95   DA  I "O5'" 1 
ATOM   1921  C "C5'" . DA  A 1 95  ? 24.510  79.055  -39.925 1.00 144.40 ? 95   DA  I "C5'" 1 
ATOM   1922  C "C4'" . DA  A 1 95  ? 25.092  77.738  -39.472 1.00 145.36 ? 95   DA  I "C4'" 1 
ATOM   1923  O "O4'" . DA  A 1 95  ? 26.366  77.491  -40.123 1.00 146.71 ? 95   DA  I "O4'" 1 
ATOM   1924  C "C3'" . DA  A 1 95  ? 25.360  77.675  -37.968 1.00 145.10 ? 95   DA  I "C3'" 1 
ATOM   1925  O "O3'" . DA  A 1 95  ? 24.964  76.408  -37.446 1.00 142.93 ? 95   DA  I "O3'" 1 
ATOM   1926  C "C2'" . DA  A 1 95  ? 26.867  77.831  -37.871 1.00 146.72 ? 95   DA  I "C2'" 1 
ATOM   1927  C "C1'" . DA  A 1 95  ? 27.329  77.143  -39.139 1.00 147.67 ? 95   DA  I "C1'" 1 
ATOM   1928  N N9    . DA  A 1 95  ? 28.653  77.565  -39.606 1.00 127.88 ? 95   DA  I N9    1 
ATOM   1929  C C8    . DA  A 1 95  ? 29.127  78.845  -39.773 1.00 128.30 ? 95   DA  I C8    1 
ATOM   1930  N N7    . DA  A 1 95  ? 30.375  78.899  -40.172 1.00 128.14 ? 95   DA  I N7    1 
ATOM   1931  C C5    . DA  A 1 95  ? 30.747  77.567  -40.283 1.00 127.68 ? 95   DA  I C5    1 
ATOM   1932  C C6    . DA  A 1 95  ? 31.953  76.952  -40.660 1.00 127.44 ? 95   DA  I C6    1 
ATOM   1933  N N6    . DA  A 1 95  ? 33.049  77.627  -41.007 1.00 126.73 ? 95   DA  I N6    1 
ATOM   1934  N N1    . DA  A 1 95  ? 31.994  75.601  -40.668 1.00 127.15 ? 95   DA  I N1    1 
ATOM   1935  C C2    . DA  A 1 95  ? 30.893  74.924  -40.318 1.00 127.08 ? 95   DA  I C2    1 
ATOM   1936  N N3    . DA  A 1 95  ? 29.702  75.388  -39.943 1.00 127.46 ? 95   DA  I N3    1 
ATOM   1937  C C4    . DA  A 1 95  ? 29.695  76.734  -39.946 1.00 127.73 ? 95   DA  I C4    1 
ATOM   1938  P P     . DT  A 1 96  ? 25.238  76.068  -35.903 1.00 132.93 ? 96   DT  I P     1 
ATOM   1939  O OP1   . DT  A 1 96  ? 24.029  75.412  -35.348 1.00 103.04 ? 96   DT  I OP1   1 
ATOM   1940  O OP2   . DT  A 1 96  ? 25.778  77.289  -35.247 1.00 102.32 ? 96   DT  I OP2   1 
ATOM   1941  O "O5'" . DT  A 1 96  ? 26.404  74.990  -35.971 1.00 130.93 ? 96   DT  I "O5'" 1 
ATOM   1942  C "C5'" . DT  A 1 96  ? 26.214  73.752  -36.651 1.00 127.53 ? 96   DT  I "C5'" 1 
ATOM   1943  C "C4'" . DT  A 1 96  ? 27.256  72.759  -36.197 1.00 125.03 ? 96   DT  I "C4'" 1 
ATOM   1944  O "O4'" . DT  A 1 96  ? 28.546  73.122  -36.747 1.00 123.92 ? 96   DT  I "O4'" 1 
ATOM   1945  C "C3'" . DT  A 1 96  ? 27.431  72.742  -34.680 1.00 123.65 ? 96   DT  I "C3'" 1 
ATOM   1946  O "O3'" . DT  A 1 96  ? 27.692  71.417  -34.226 1.00 121.89 ? 96   DT  I "O3'" 1 
ATOM   1947  C "C2'" . DT  A 1 96  ? 28.643  73.627  -34.456 1.00 123.39 ? 96   DT  I "C2'" 1 
ATOM   1948  C "C1'" . DT  A 1 96  ? 29.475  73.353  -35.697 1.00 122.60 ? 96   DT  I "C1'" 1 
ATOM   1949  N N1    . DT  A 1 96  ? 30.363  74.465  -36.106 1.00 89.36  ? 96   DT  I N1    1 
ATOM   1950  C C2    . DT  A 1 96  ? 31.631  74.150  -36.534 1.00 87.98  ? 96   DT  I C2    1 
ATOM   1951  O O2    . DT  A 1 96  ? 32.048  73.004  -36.592 1.00 87.98  ? 96   DT  I O2    1 
ATOM   1952  N N3    . DT  A 1 96  ? 32.399  75.231  -36.894 1.00 87.21  ? 96   DT  I N3    1 
ATOM   1953  C C4    . DT  A 1 96  ? 32.032  76.564  -36.864 1.00 86.94  ? 96   DT  I C4    1 
ATOM   1954  O O4    . DT  A 1 96  ? 32.831  77.429  -37.220 1.00 86.19  ? 96   DT  I O4    1 
ATOM   1955  C C5    . DT  A 1 96  ? 30.688  76.822  -36.401 1.00 87.00  ? 96   DT  I C5    1 
ATOM   1956  C C7    . DT  A 1 96  ? 30.205  78.237  -36.327 1.00 86.63  ? 96   DT  I C7    1 
ATOM   1957  C C6    . DT  A 1 96  ? 29.931  75.774  -36.053 1.00 87.87  ? 96   DT  I C6    1 
ATOM   1958  P P     . DG  A 1 97  ? 27.298  71.000  -32.727 1.00 144.41 ? 97   DG  I P     1 
ATOM   1959  O OP1   . DG  A 1 97  ? 25.957  70.364  -32.754 1.00 93.73  ? 97   DG  I OP1   1 
ATOM   1960  O OP2   . DG  A 1 97  ? 27.544  72.170  -31.843 1.00 92.42  ? 97   DG  I OP2   1 
ATOM   1961  O "O5'" . DG  A 1 97  ? 28.364  69.876  -32.380 1.00 143.45 ? 97   DG  I "O5'" 1 
ATOM   1962  C "C5'" . DG  A 1 97  ? 28.776  68.948  -33.376 1.00 143.08 ? 97   DG  I "C5'" 1 
ATOM   1963  C "C4'" . DG  A 1 97  ? 30.268  68.730  -33.295 1.00 142.47 ? 97   DG  I "C4'" 1 
ATOM   1964  O "O4'" . DG  A 1 97  ? 30.975  69.915  -33.741 1.00 142.39 ? 97   DG  I "O4'" 1 
ATOM   1965  C "C3'" . DG  A 1 97  ? 30.772  68.443  -31.881 1.00 142.15 ? 97   DG  I "C3'" 1 
ATOM   1966  O "O3'" . DG  A 1 97  ? 31.774  67.427  -31.928 1.00 141.55 ? 97   DG  I "O3'" 1 
ATOM   1967  C "C2'" . DG  A 1 97  ? 31.368  69.769  -31.441 1.00 141.11 ? 97   DG  I "C2'" 1 
ATOM   1968  C "C1'" . DG  A 1 97  ? 31.912  70.308  -32.749 1.00 141.19 ? 97   DG  I "C1'" 1 
ATOM   1969  N N9    . DG  A 1 97  ? 32.072  71.758  -32.819 1.00 89.25  ? 97   DG  I N9    1 
ATOM   1970  C C8    . DG  A 1 97  ? 31.209  72.724  -32.356 1.00 89.50  ? 97   DG  I C8    1 
ATOM   1971  N N7    . DG  A 1 97  ? 31.635  73.942  -32.576 1.00 88.45  ? 97   DG  I N7    1 
ATOM   1972  C C5    . DG  A 1 97  ? 32.853  73.768  -33.223 1.00 87.53  ? 97   DG  I C5    1 
ATOM   1973  C C6    . DG  A 1 97  ? 33.785  74.726  -33.719 1.00 86.16  ? 97   DG  I C6    1 
ATOM   1974  O O6    . DG  A 1 97  ? 33.712  75.961  -33.690 1.00 84.68  ? 97   DG  I O6    1 
ATOM   1975  N N1    . DG  A 1 97  ? 34.890  74.113  -34.298 1.00 85.57  ? 97   DG  I N1    1 
ATOM   1976  C C2    . DG  A 1 97  ? 35.081  72.755  -34.395 1.00 86.47  ? 97   DG  I C2    1 
ATOM   1977  N N2    . DG  A 1 97  ? 36.220  72.356  -34.985 1.00 85.29  ? 97   DG  I N2    1 
ATOM   1978  N N3    . DG  A 1 97  ? 34.221  71.853  -33.946 1.00 87.70  ? 97   DG  I N3    1 
ATOM   1979  C C4    . DG  A 1 97  ? 33.139  72.426  -33.375 1.00 88.46  ? 97   DG  I C4    1 
ATOM   1980  P P     . DG  A 1 98  ? 32.352  66.822  -30.562 1.00 96.89  ? 98   DG  I P     1 
ATOM   1981  O OP1   . DG  A 1 98  ? 32.669  65.388  -30.790 1.00 101.22 ? 98   DG  I OP1   1 
ATOM   1982  O OP2   . DG  A 1 98  ? 31.425  67.210  -29.464 1.00 101.11 ? 98   DG  I OP2   1 
ATOM   1983  O "O5'" . DG  A 1 98  ? 33.715  67.619  -30.348 1.00 96.60  ? 98   DG  I "O5'" 1 
ATOM   1984  C "C5'" . DG  A 1 98  ? 34.808  67.453  -31.249 1.00 93.97  ? 98   DG  I "C5'" 1 
ATOM   1985  C "C4'" . DG  A 1 98  ? 35.988  68.280  -30.796 1.00 92.70  ? 98   DG  I "C4'" 1 
ATOM   1986  O "O4'" . DG  A 1 98  ? 35.739  69.687  -31.032 1.00 91.75  ? 98   DG  I "O4'" 1 
ATOM   1987  C "C3'" . DG  A 1 98  ? 36.324  68.152  -29.308 1.00 92.17  ? 98   DG  I "C3'" 1 
ATOM   1988  O "O3'" . DG  A 1 98  ? 37.740  68.171  -29.141 1.00 92.30  ? 98   DG  I "O3'" 1 
ATOM   1989  C "C2'" . DG  A 1 98  ? 35.746  69.424  -28.717 1.00 91.91  ? 98   DG  I "C2'" 1 
ATOM   1990  C "C1'" . DG  A 1 98  ? 36.006  70.405  -29.841 1.00 91.97  ? 98   DG  I "C1'" 1 
ATOM   1991  N N9    . DG  A 1 98  ? 35.183  71.610  -29.838 1.00 97.03  ? 98   DG  I N9    1 
ATOM   1992  C C8    . DG  A 1 98  ? 33.936  71.775  -29.285 1.00 97.30  ? 98   DG  I C8    1 
ATOM   1993  N N7    . DG  A 1 98  ? 33.468  72.987  -29.428 1.00 97.62  ? 98   DG  I N7    1 
ATOM   1994  C C5    . DG  A 1 98  ? 34.465  73.659  -30.123 1.00 97.71  ? 98   DG  I C5    1 
ATOM   1995  C C6    . DG  A 1 98  ? 34.531  75.007  -30.567 1.00 97.77  ? 98   DG  I C6    1 
ATOM   1996  O O6    . DG  A 1 98  ? 33.694  75.906  -30.431 1.00 98.43  ? 98   DG  I O6    1 
ATOM   1997  N N1    . DG  A 1 98  ? 35.723  75.267  -31.233 1.00 97.37  ? 98   DG  I N1    1 
ATOM   1998  C C2    . DG  A 1 98  ? 36.724  74.352  -31.448 1.00 97.47  ? 98   DG  I C2    1 
ATOM   1999  N N2    . DG  A 1 98  ? 37.798  74.798  -32.114 1.00 97.50  ? 98   DG  I N2    1 
ATOM   2000  N N3    . DG  A 1 98  ? 36.676  73.094  -31.041 1.00 97.08  ? 98   DG  I N3    1 
ATOM   2001  C C4    . DG  A 1 98  ? 35.526  72.820  -30.389 1.00 97.46  ? 98   DG  I C4    1 
ATOM   2002  P P     . DA  A 1 99  ? 38.535  66.796  -28.923 1.00 116.74 ? 99   DA  I P     1 
ATOM   2003  O OP1   . DA  A 1 99  ? 37.896  65.739  -29.750 1.00 95.75  ? 99   DA  I OP1   1 
ATOM   2004  O OP2   . DA  A 1 99  ? 38.696  66.592  -27.461 1.00 96.41  ? 99   DA  I OP2   1 
ATOM   2005  O "O5'" . DA  A 1 99  ? 39.967  67.108  -29.541 1.00 115.85 ? 99   DA  I "O5'" 1 
ATOM   2006  C "C5'" . DA  A 1 99  ? 40.126  67.306  -30.944 1.00 113.72 ? 99   DA  I "C5'" 1 
ATOM   2007  C "C4'" . DA  A 1 99  ? 41.014  68.500  -31.206 1.00 111.38 ? 99   DA  I "C4'" 1 
ATOM   2008  O "O4'" . DA  A 1 99  ? 40.314  69.720  -30.863 1.00 111.59 ? 99   DA  I "O4'" 1 
ATOM   2009  C "C3'" . DA  A 1 99  ? 42.305  68.508  -30.391 1.00 109.67 ? 99   DA  I "C3'" 1 
ATOM   2010  O "O3'" . DA  A 1 99  ? 43.380  68.999  -31.191 1.00 106.67 ? 99   DA  I "O3'" 1 
ATOM   2011  C "C2'" . DA  A 1 99  ? 41.997  69.458  -29.248 1.00 110.31 ? 99   DA  I "C2'" 1 
ATOM   2012  C "C1'" . DA  A 1 99  ? 41.050  70.454  -29.896 1.00 111.45 ? 99   DA  I "C1'" 1 
ATOM   2013  N N9    . DA  A 1 99  ? 40.090  71.066  -28.977 1.00 91.33  ? 99   DA  I N9    1 
ATOM   2014  C C8    . DA  A 1 99  ? 39.377  70.460  -27.971 1.00 91.77  ? 99   DA  I C8    1 
ATOM   2015  N N7    . DA  A 1 99  ? 38.571  71.273  -27.331 1.00 91.95  ? 99   DA  I N7    1 
ATOM   2016  C C5    . DA  A 1 99  ? 38.769  72.498  -27.954 1.00 91.57  ? 99   DA  I C5    1 
ATOM   2017  C C6    . DA  A 1 99  ? 38.203  73.769  -27.746 1.00 91.68  ? 99   DA  I C6    1 
ATOM   2018  N N6    . DA  A 1 99  ? 37.273  74.023  -26.824 1.00 92.21  ? 99   DA  I N6    1 
ATOM   2019  N N1    . DA  A 1 99  ? 38.626  74.783  -28.532 1.00 91.55  ? 99   DA  I N1    1 
ATOM   2020  C C2    . DA  A 1 99  ? 39.550  74.525  -29.466 1.00 91.57  ? 99   DA  I C2    1 
ATOM   2021  N N3    . DA  A 1 99  ? 40.150  73.373  -29.764 1.00 91.51  ? 99   DA  I N3    1 
ATOM   2022  C C4    . DA  A 1 99  ? 39.710  72.387  -28.962 1.00 91.50  ? 99   DA  I C4    1 
ATOM   2023  P P     . DG  A 1 100 ? 44.872  69.000  -30.602 1.00 88.57  ? 100  DG  I P     1 
ATOM   2024  O OP1   . DG  A 1 100 ? 45.821  68.904  -31.743 1.00 94.25  ? 100  DG  I OP1   1 
ATOM   2025  O OP2   . DG  A 1 100 ? 44.934  67.997  -29.507 1.00 94.59  ? 100  DG  I OP2   1 
ATOM   2026  O "O5'" . DG  A 1 100 ? 45.002  70.443  -29.944 1.00 85.81  ? 100  DG  I "O5'" 1 
ATOM   2027  C "C5'" . DG  A 1 100 ? 44.795  71.612  -30.728 1.00 80.27  ? 100  DG  I "C5'" 1 
ATOM   2028  C "C4'" . DG  A 1 100 ? 44.897  72.846  -29.865 1.00 76.33  ? 100  DG  I "C4'" 1 
ATOM   2029  O "O4'" . DG  A 1 100 ? 43.708  73.021  -29.057 1.00 74.56  ? 100  DG  I "O4'" 1 
ATOM   2030  C "C3'" . DG  A 1 100 ? 46.077  72.870  -28.891 1.00 74.27  ? 100  DG  I "C3'" 1 
ATOM   2031  O "O3'" . DG  A 1 100 ? 46.544  74.214  -28.807 1.00 71.36  ? 100  DG  I "O3'" 1 
ATOM   2032  C "C2'" . DG  A 1 100 ? 45.421  72.534  -27.564 1.00 73.99  ? 100  DG  I "C2'" 1 
ATOM   2033  C "C1'" . DG  A 1 100 ? 44.118  73.290  -27.730 1.00 75.20  ? 100  DG  I "C1'" 1 
ATOM   2034  N N9    . DG  A 1 100 ? 43.025  72.944  -26.826 1.00 81.51  ? 100  DG  I N9    1 
ATOM   2035  C C8    . DG  A 1 100 ? 42.787  71.739  -26.209 1.00 81.55  ? 100  DG  I C8    1 
ATOM   2036  N N7    . DG  A 1 100 ? 41.729  71.759  -25.443 1.00 82.05  ? 100  DG  I N7    1 
ATOM   2037  C C5    . DG  A 1 100 ? 41.241  73.052  -25.565 1.00 81.60  ? 100  DG  I C5    1 
ATOM   2038  C C6    . DG  A 1 100 ? 40.113  73.670  -24.968 1.00 81.87  ? 100  DG  I C6    1 
ATOM   2039  O O6    . DG  A 1 100 ? 39.292  73.182  -24.185 1.00 83.46  ? 100  DG  I O6    1 
ATOM   2040  N N1    . DG  A 1 100 ? 39.986  74.997  -25.367 1.00 81.68  ? 100  DG  I N1    1 
ATOM   2041  C C2    . DG  A 1 100 ? 40.832  75.646  -26.231 1.00 81.36  ? 100  DG  I C2    1 
ATOM   2042  N N2    . DG  A 1 100 ? 40.545  76.929  -26.495 1.00 80.73  ? 100  DG  I N2    1 
ATOM   2043  N N3    . DG  A 1 100 ? 41.883  75.079  -26.796 1.00 80.86  ? 100  DG  I N3    1 
ATOM   2044  C C4    . DG  A 1 100 ? 42.027  73.793  -26.419 1.00 81.05  ? 100  DG  I C4    1 
ATOM   2045  P P     . DC  A 1 101 ? 48.099  74.543  -28.982 1.00 60.19  ? 101  DC  I P     1 
ATOM   2046  O OP1   . DC  A 1 101 ? 48.531  74.110  -30.334 1.00 66.07  ? 101  DC  I OP1   1 
ATOM   2047  O OP2   . DC  A 1 101 ? 48.848  74.084  -27.791 1.00 65.11  ? 101  DC  I OP2   1 
ATOM   2048  O "O5'" . DC  A 1 101 ? 48.095  76.130  -28.926 1.00 64.97  ? 101  DC  I "O5'" 1 
ATOM   2049  C "C5'" . DC  A 1 101 ? 47.105  76.876  -29.628 1.00 69.15  ? 101  DC  I "C5'" 1 
ATOM   2050  C "C4'" . DC  A 1 101 ? 46.550  77.958  -28.734 1.00 73.43  ? 101  DC  I "C4'" 1 
ATOM   2051  O "O4'" . DC  A 1 101 ? 45.538  77.428  -27.839 1.00 73.33  ? 101  DC  I "O4'" 1 
ATOM   2052  C "C3'" . DC  A 1 101 ? 47.614  78.595  -27.841 1.00 76.08  ? 101  DC  I "C3'" 1 
ATOM   2053  O "O3'" . DC  A 1 101 ? 47.439  80.008  -27.792 1.00 80.47  ? 101  DC  I "O3'" 1 
ATOM   2054  C "C2'" . DC  A 1 101 ? 47.347  77.982  -26.477 1.00 75.01  ? 101  DC  I "C2'" 1 
ATOM   2055  C "C1'" . DC  A 1 101 ? 45.842  77.811  -26.507 1.00 73.34  ? 101  DC  I "C1'" 1 
ATOM   2056  N N1    . DC  A 1 101 ? 45.312  76.781  -25.599 1.00 77.20  ? 101  DC  I N1    1 
ATOM   2057  C C2    . DC  A 1 101 ? 44.112  77.036  -24.918 1.00 76.90  ? 101  DC  I C2    1 
ATOM   2058  O O2    . DC  A 1 101 ? 43.538  78.125  -25.096 1.00 75.89  ? 101  DC  I O2    1 
ATOM   2059  N N3    . DC  A 1 101 ? 43.610  76.093  -24.084 1.00 76.94  ? 101  DC  I N3    1 
ATOM   2060  C C4    . DC  A 1 101 ? 44.257  74.937  -23.917 1.00 76.71  ? 101  DC  I C4    1 
ATOM   2061  N N4    . DC  A 1 101 ? 43.721  74.036  -23.089 1.00 76.31  ? 101  DC  I N4    1 
ATOM   2062  C C5    . DC  A 1 101 ? 45.482  74.653  -24.592 1.00 76.97  ? 101  DC  I C5    1 
ATOM   2063  C C6    . DC  A 1 101 ? 45.968  75.595  -25.417 1.00 77.09  ? 101  DC  I C6    1 
ATOM   2064  P P     . DA  A 1 102 ? 48.657  80.937  -27.320 1.00 119.08 ? 102  DA  I P     1 
ATOM   2065  O OP1   . DA  A 1 102 ? 48.995  81.840  -28.446 1.00 79.04  ? 102  DA  I OP1   1 
ATOM   2066  O OP2   . DA  A 1 102 ? 49.709  80.065  -26.726 1.00 79.00  ? 102  DA  I OP2   1 
ATOM   2067  O "O5'" . DA  A 1 102 ? 48.027  81.795  -26.142 1.00 119.49 ? 102  DA  I "O5'" 1 
ATOM   2068  C "C5'" . DA  A 1 102 ? 46.782  82.458  -26.311 1.00 122.15 ? 102  DA  I "C5'" 1 
ATOM   2069  C "C4'" . DA  A 1 102 ? 46.180  82.759  -24.961 1.00 123.61 ? 102  DA  I "C4'" 1 
ATOM   2070  O "O4'" . DA  A 1 102 ? 45.630  81.550  -24.384 1.00 123.14 ? 102  DA  I "O4'" 1 
ATOM   2071  C "C3'" . DA  A 1 102 ? 47.202  83.285  -23.954 1.00 125.07 ? 102  DA  I "C3'" 1 
ATOM   2072  O "O3'" . DA  A 1 102 ? 46.625  84.332  -23.176 1.00 128.43 ? 102  DA  I "O3'" 1 
ATOM   2073  C "C2'" . DA  A 1 102 ? 47.505  82.072  -23.094 1.00 123.42 ? 102  DA  I "C2'" 1 
ATOM   2074  C "C1'" . DA  A 1 102 ? 46.174  81.348  -23.090 1.00 122.31 ? 102  DA  I "C1'" 1 
ATOM   2075  N N9    . DA  A 1 102 ? 46.269  79.908  -22.856 1.00 81.10  ? 102  DA  I N9    1 
ATOM   2076  C C8    . DA  A 1 102 ? 47.182  79.025  -23.376 1.00 80.90  ? 102  DA  I C8    1 
ATOM   2077  N N7    . DA  A 1 102 ? 47.014  77.790  -22.968 1.00 79.89  ? 102  DA  I N7    1 
ATOM   2078  C C5    . DA  A 1 102 ? 45.916  77.864  -22.123 1.00 78.44  ? 102  DA  I C5    1 
ATOM   2079  C C6    . DA  A 1 102 ? 45.236  76.893  -21.369 1.00 77.15  ? 102  DA  I C6    1 
ATOM   2080  N N6    . DA  A 1 102 ? 45.582  75.605  -21.336 1.00 76.61  ? 102  DA  I N6    1 
ATOM   2081  N N1    . DA  A 1 102 ? 44.178  77.296  -20.636 1.00 76.33  ? 102  DA  I N1    1 
ATOM   2082  C C2    . DA  A 1 102 ? 43.838  78.590  -20.660 1.00 77.50  ? 102  DA  I C2    1 
ATOM   2083  N N3    . DA  A 1 102 ? 44.400  79.598  -21.324 1.00 78.50  ? 102  DA  I N3    1 
ATOM   2084  C C4    . DA  A 1 102 ? 45.446  79.163  -22.047 1.00 79.49  ? 102  DA  I C4    1 
ATOM   2085  P P     . DG  A 1 103 ? 47.420  84.910  -21.908 1.00 101.50 ? 103  DG  I P     1 
ATOM   2086  O OP1   . DG  A 1 103 ? 47.329  86.391  -21.980 1.00 104.66 ? 103  DG  I OP1   1 
ATOM   2087  O OP2   . DG  A 1 103 ? 48.754  84.259  -21.831 1.00 104.02 ? 103  DG  I OP2   1 
ATOM   2088  O "O5'" . DG  A 1 103 ? 46.541  84.406  -20.681 1.00 103.24 ? 103  DG  I "O5'" 1 
ATOM   2089  C "C5'" . DG  A 1 103 ? 45.123  84.564  -20.696 1.00 106.24 ? 103  DG  I "C5'" 1 
ATOM   2090  C "C4'" . DG  A 1 103 ? 44.524  84.047  -19.410 1.00 108.57 ? 103  DG  I "C4'" 1 
ATOM   2091  O "O4'" . DG  A 1 103 ? 44.523  82.598  -19.397 1.00 108.06 ? 103  DG  I "O4'" 1 
ATOM   2092  C "C3'" . DG  A 1 103 ? 45.270  84.487  -18.152 1.00 110.38 ? 103  DG  I "C3'" 1 
ATOM   2093  O "O3'" . DG  A 1 103 ? 44.340  84.841  -17.126 1.00 113.78 ? 103  DG  I "O3'" 1 
ATOM   2094  C "C2'" . DG  A 1 103 ? 46.069  83.255  -17.764 1.00 109.75 ? 103  DG  I "C2'" 1 
ATOM   2095  C "C1'" . DG  A 1 103 ? 45.176  82.119  -18.232 1.00 108.63 ? 103  DG  I "C1'" 1 
ATOM   2096  N N9    . DG  A 1 103 ? 45.902  80.906  -18.595 1.00 111.76 ? 103  DG  I N9    1 
ATOM   2097  C C8    . DG  A 1 103 ? 46.954  80.807  -19.473 1.00 112.00 ? 103  DG  I C8    1 
ATOM   2098  N N7    . DG  A 1 103 ? 47.404  79.587  -19.600 1.00 111.97 ? 103  DG  I N7    1 
ATOM   2099  C C5    . DG  A 1 103 ? 46.600  78.834  -18.754 1.00 111.74 ? 103  DG  I C5    1 
ATOM   2100  C C6    . DG  A 1 103 ? 46.611  77.440  -18.474 1.00 111.69 ? 103  DG  I C6    1 
ATOM   2101  O O6    . DG  A 1 103 ? 47.358  76.565  -18.931 1.00 111.23 ? 103  DG  I O6    1 
ATOM   2102  N N1    . DG  A 1 103 ? 45.622  77.096  -17.558 1.00 111.38 ? 103  DG  I N1    1 
ATOM   2103  C C2    . DG  A 1 103 ? 44.736  77.975  -16.985 1.00 111.62 ? 103  DG  I C2    1 
ATOM   2104  N N2    . DG  A 1 103 ? 43.854  77.445  -16.121 1.00 111.14 ? 103  DG  I N2    1 
ATOM   2105  N N3    . DG  A 1 103 ? 44.715  79.276  -17.238 1.00 111.63 ? 103  DG  I N3    1 
ATOM   2106  C C4    . DG  A 1 103 ? 45.668  79.633  -18.125 1.00 111.57 ? 103  DG  I C4    1 
ATOM   2107  P P     . DT  A 1 104 ? 44.875  85.176  -15.652 1.00 132.01 ? 104  DT  I P     1 
ATOM   2108  O OP1   . DT  A 1 104 ? 43.928  86.125  -15.012 1.00 102.59 ? 104  DT  I OP1   1 
ATOM   2109  O OP2   . DT  A 1 104 ? 46.312  85.535  -15.765 1.00 103.01 ? 104  DT  I OP2   1 
ATOM   2110  O "O5'" . DT  A 1 104 ? 44.768  83.776  -14.906 1.00 134.11 ? 104  DT  I "O5'" 1 
ATOM   2111  C "C5'" . DT  A 1 104 ? 43.502  83.141  -14.748 1.00 138.35 ? 104  DT  I "C5'" 1 
ATOM   2112  C "C4'" . DT  A 1 104 ? 43.569  82.113  -13.645 1.00 140.61 ? 104  DT  I "C4'" 1 
ATOM   2113  O "O4'" . DT  A 1 104 ? 44.170  80.889  -14.129 1.00 140.79 ? 104  DT  I "O4'" 1 
ATOM   2114  C "C3'" . DT  A 1 104 ? 44.400  82.556  -12.442 1.00 142.21 ? 104  DT  I "C3'" 1 
ATOM   2115  O "O3'" . DT  A 1 104 ? 43.768  82.154  -11.230 1.00 144.42 ? 104  DT  I "O3'" 1 
ATOM   2116  C "C2'" . DT  A 1 104 ? 45.709  81.811  -12.627 1.00 141.83 ? 104  DT  I "C2'" 1 
ATOM   2117  C "C1'" . DT  A 1 104 ? 45.254  80.523  -13.292 1.00 141.17 ? 104  DT  I "C1'" 1 
ATOM   2118  N N1    . DT  A 1 104 ? 46.276  79.875  -14.134 1.00 111.29 ? 104  DT  I N1    1 
ATOM   2119  C C2    . DT  A 1 104 ? 46.429  78.509  -14.036 1.00 110.95 ? 104  DT  I C2    1 
ATOM   2120  O O2    . DT  A 1 104 ? 45.752  77.813  -13.295 1.00 110.78 ? 104  DT  I O2    1 
ATOM   2121  N N3    . DT  A 1 104 ? 47.408  77.985  -14.846 1.00 110.75 ? 104  DT  I N3    1 
ATOM   2122  C C4    . DT  A 1 104 ? 48.224  78.674  -15.724 1.00 110.61 ? 104  DT  I C4    1 
ATOM   2123  O O4    . DT  A 1 104 ? 49.061  78.067  -16.388 1.00 110.42 ? 104  DT  I O4    1 
ATOM   2124  C C5    . DT  A 1 104 ? 48.004  80.102  -15.779 1.00 110.52 ? 104  DT  I C5    1 
ATOM   2125  C C7    . DT  A 1 104 ? 48.837  80.931  -16.704 1.00 110.17 ? 104  DT  I C7    1 
ATOM   2126  C C6    . DT  A 1 104 ? 47.055  80.622  -14.992 1.00 110.90 ? 104  DT  I C6    1 
ATOM   2127  P P     . DT  A 1 105 ? 43.945  83.047  -9.908  1.00 153.96 ? 105  DT  I P     1 
ATOM   2128  O OP1   . DT  A 1 105 ? 42.609  83.601  -9.569  1.00 117.50 ? 105  DT  I OP1   1 
ATOM   2129  O OP2   . DT  A 1 105 ? 45.096  83.968  -10.099 1.00 117.70 ? 105  DT  I OP2   1 
ATOM   2130  O "O5'" . DT  A 1 105 ? 44.337  81.970  -8.806  1.00 154.80 ? 105  DT  I "O5'" 1 
ATOM   2131  C "C5'" . DT  A 1 105 ? 43.510  80.833  -8.587  1.00 157.27 ? 105  DT  I "C5'" 1 
ATOM   2132  C "C4'" . DT  A 1 105 ? 44.313  79.709  -7.978  1.00 158.58 ? 105  DT  I "C4'" 1 
ATOM   2133  O "O4'" . DT  A 1 105 ? 45.167  79.094  -8.976  1.00 158.69 ? 105  DT  I "O4'" 1 
ATOM   2134  C "C3'" . DT  A 1 105 ? 45.229  80.130  -6.828  1.00 159.02 ? 105  DT  I "C3'" 1 
ATOM   2135  O "O3'" . DT  A 1 105 ? 45.120  79.186  -5.761  1.00 159.51 ? 105  DT  I "O3'" 1 
ATOM   2136  C "C2'" . DT  A 1 105 ? 46.615  80.104  -7.449  1.00 159.11 ? 105  DT  I "C2'" 1 
ATOM   2137  C "C1'" . DT  A 1 105 ? 46.488  78.989  -8.469  1.00 158.90 ? 105  DT  I "C1'" 1 
ATOM   2138  N N1    . DT  A 1 105 ? 47.430  79.067  -9.608  1.00 122.45 ? 105  DT  I N1    1 
ATOM   2139  C C2    . DT  A 1 105 ? 47.983  77.891  -10.073 1.00 122.14 ? 105  DT  I C2    1 
ATOM   2140  O O2    . DT  A 1 105 ? 47.730  76.799  -9.592  1.00 122.50 ? 105  DT  I O2    1 
ATOM   2141  N N3    . DT  A 1 105 ? 48.849  78.042  -11.128 1.00 121.55 ? 105  DT  I N3    1 
ATOM   2142  C C4    . DT  A 1 105 ? 49.211  79.221  -11.750 1.00 121.15 ? 105  DT  I C4    1 
ATOM   2143  O O4    . DT  A 1 105 ? 50.000  79.199  -12.690 1.00 120.11 ? 105  DT  I O4    1 
ATOM   2144  C C5    . DT  A 1 105 ? 48.599  80.415  -11.212 1.00 121.32 ? 105  DT  I C5    1 
ATOM   2145  C C7    . DT  A 1 105 ? 48.939  81.740  -11.819 1.00 121.12 ? 105  DT  I C7    1 
ATOM   2146  C C6    . DT  A 1 105 ? 47.749  80.281  -10.183 1.00 121.96 ? 105  DT  I C6    1 
ATOM   2147  P P     . DT  A 1 106 ? 46.218  79.171  -4.591  1.00 169.56 ? 106  DT  I P     1 
ATOM   2148  O OP1   . DT  A 1 106 ? 45.515  78.833  -3.328  1.00 124.05 ? 106  DT  I OP1   1 
ATOM   2149  O OP2   . DT  A 1 106 ? 47.034  80.410  -4.668  1.00 123.99 ? 106  DT  I OP2   1 
ATOM   2150  O "O5'" . DT  A 1 106 ? 47.130  77.933  -4.991  1.00 169.62 ? 106  DT  I "O5'" 1 
ATOM   2151  C "C5'" . DT  A 1 106 ? 46.533  76.689  -5.349  1.00 171.20 ? 106  DT  I "C5'" 1 
ATOM   2152  C "C4'" . DT  A 1 106 ? 47.581  75.605  -5.399  1.00 171.51 ? 106  DT  I "C4'" 1 
ATOM   2153  O "O4'" . DT  A 1 106 ? 48.378  75.743  -6.600  1.00 172.55 ? 106  DT  I "O4'" 1 
ATOM   2154  C "C3'" . DT  A 1 106 ? 48.558  75.655  -4.227  1.00 171.13 ? 106  DT  I "C3'" 1 
ATOM   2155  O "O3'" . DT  A 1 106 ? 48.860  74.337  -3.772  1.00 168.99 ? 106  DT  I "O3'" 1 
ATOM   2156  C "C2'" . DT  A 1 106 ? 49.787  76.324  -4.817  1.00 171.90 ? 106  DT  I "C2'" 1 
ATOM   2157  C "C1'" . DT  A 1 106 ? 49.752  75.864  -6.265  1.00 172.69 ? 106  DT  I "C1'" 1 
ATOM   2158  N N1    . DT  A 1 106 ? 50.371  76.804  -7.223  1.00 126.99 ? 106  DT  I N1    1 
ATOM   2159  C C2    . DT  A 1 106 ? 51.096  76.280  -8.271  1.00 126.59 ? 106  DT  I C2    1 
ATOM   2160  O O2    . DT  A 1 106 ? 51.247  75.082  -8.445  1.00 126.51 ? 106  DT  I O2    1 
ATOM   2161  N N3    . DT  A 1 106 ? 51.641  77.219  -9.115  1.00 126.19 ? 106  DT  I N3    1 
ATOM   2162  C C4    . DT  A 1 106 ? 51.535  78.595  -9.016  1.00 125.94 ? 106  DT  I C4    1 
ATOM   2163  O O4    . DT  A 1 106 ? 52.081  79.312  -9.852  1.00 124.59 ? 106  DT  I O4    1 
ATOM   2164  C C5    . DT  A 1 106 ? 50.761  79.074  -7.891  1.00 126.11 ? 106  DT  I C5    1 
ATOM   2165  C C7    . DT  A 1 106 ? 50.592  80.548  -7.698  1.00 126.18 ? 106  DT  I C7    1 
ATOM   2166  C C6    . DT  A 1 106 ? 50.225  78.166  -7.064  1.00 126.67 ? 106  DT  I C6    1 
ATOM   2167  P P     . DC  A 1 107 ? 49.861  74.141  -2.535  1.00 162.61 ? 107  DC  I P     1 
ATOM   2168  O OP1   . DC  A 1 107 ? 49.622  72.785  -1.977  1.00 125.60 ? 107  DC  I OP1   1 
ATOM   2169  O OP2   . DC  A 1 107 ? 49.751  75.331  -1.651  1.00 125.42 ? 107  DC  I OP2   1 
ATOM   2170  O "O5'" . DC  A 1 107 ? 51.295  74.153  -3.225  1.00 161.08 ? 107  DC  I "O5'" 1 
ATOM   2171  C "C5'" . DC  A 1 107 ? 51.662  73.133  -4.150  1.00 159.24 ? 107  DC  I "C5'" 1 
ATOM   2172  C "C4'" . DC  A 1 107 ? 53.144  73.192  -4.431  1.00 157.40 ? 107  DC  I "C4'" 1 
ATOM   2173  O "O4'" . DC  A 1 107 ? 53.449  74.282  -5.334  1.00 157.68 ? 107  DC  I "O4'" 1 
ATOM   2174  C "C3'" . DC  A 1 107 ? 54.008  73.413  -3.189  1.00 155.88 ? 107  DC  I "C3'" 1 
ATOM   2175  O "O3'" . DC  A 1 107 ? 55.194  72.626  -3.280  1.00 152.70 ? 107  DC  I "O3'" 1 
ATOM   2176  C "C2'" . DC  A 1 107 ? 54.362  74.886  -3.271  1.00 156.74 ? 107  DC  I "C2'" 1 
ATOM   2177  C "C1'" . DC  A 1 107 ? 54.471  75.086  -4.771  1.00 157.51 ? 107  DC  I "C1'" 1 
ATOM   2178  N N1    . DC  A 1 107 ? 54.282  76.466  -5.247  1.00 120.48 ? 107  DC  I N1    1 
ATOM   2179  C C2    . DC  A 1 107 ? 54.835  76.825  -6.477  1.00 120.12 ? 107  DC  I C2    1 
ATOM   2180  O O2    . DC  A 1 107 ? 55.454  75.968  -7.123  1.00 119.91 ? 107  DC  I O2    1 
ATOM   2181  N N3    . DC  A 1 107 ? 54.681  78.090  -6.931  1.00 119.64 ? 107  DC  I N3    1 
ATOM   2182  C C4    . DC  A 1 107 ? 54.003  78.982  -6.204  1.00 119.35 ? 107  DC  I C4    1 
ATOM   2183  N N4    . DC  A 1 107 ? 53.880  80.220  -6.688  1.00 117.99 ? 107  DC  I N4    1 
ATOM   2184  C C5    . DC  A 1 107 ? 53.424  78.643  -4.946  1.00 119.95 ? 107  DC  I C5    1 
ATOM   2185  C C6    . DC  A 1 107 ? 53.585  77.385  -4.510  1.00 120.67 ? 107  DC  I C6    1 
ATOM   2186  P P     . DC  A 1 108 ? 55.699  71.799  -2.001  1.00 128.54 ? 108  DC  I P     1 
ATOM   2187  O OP1   . DC  A 1 108 ? 54.637  70.829  -1.627  1.00 122.29 ? 108  DC  I OP1   1 
ATOM   2188  O OP2   . DC  A 1 108 ? 56.191  72.779  -0.997  1.00 121.76 ? 108  DC  I OP2   1 
ATOM   2189  O "O5'" . DC  A 1 108 ? 56.944  70.981  -2.560  1.00 125.66 ? 108  DC  I "O5'" 1 
ATOM   2190  C "C5'" . DC  A 1 108 ? 56.812  70.170  -3.724  1.00 120.86 ? 108  DC  I "C5'" 1 
ATOM   2191  C "C4'" . DC  A 1 108 ? 57.903  70.499  -4.717  1.00 117.10 ? 108  DC  I "C4'" 1 
ATOM   2192  O "O4'" . DC  A 1 108 ? 57.707  71.833  -5.246  1.00 115.83 ? 108  DC  I "O4'" 1 
ATOM   2193  C "C3'" . DC  A 1 108 ? 59.319  70.480  -4.141  1.00 114.86 ? 108  DC  I "C3'" 1 
ATOM   2194  O "O3'" . DC  A 1 108 ? 60.218  69.963  -5.119  1.00 112.35 ? 108  DC  I "O3'" 1 
ATOM   2195  C "C2'" . DC  A 1 108 ? 59.620  71.949  -3.909  1.00 114.26 ? 108  DC  I "C2'" 1 
ATOM   2196  C "C1'" . DC  A 1 108 ? 58.898  72.584  -5.081  1.00 114.70 ? 108  DC  I "C1'" 1 
ATOM   2197  N N1    . DC  A 1 108 ? 58.529  73.998  -4.907  1.00 107.76 ? 108  DC  I N1    1 
ATOM   2198  C C2    . DC  A 1 108 ? 58.752  74.880  -5.969  1.00 107.55 ? 108  DC  I C2    1 
ATOM   2199  O O2    . DC  A 1 108 ? 59.255  74.443  -7.019  1.00 107.15 ? 108  DC  I O2    1 
ATOM   2200  N N3    . DC  A 1 108 ? 58.415  76.183  -5.829  1.00 106.69 ? 108  DC  I N3    1 
ATOM   2201  C C4    . DC  A 1 108 ? 57.879  76.613  -4.687  1.00 106.04 ? 108  DC  I C4    1 
ATOM   2202  N N4    . DC  A 1 108 ? 57.563  77.906  -4.598  1.00 105.13 ? 108  DC  I N4    1 
ATOM   2203  C C5    . DC  A 1 108 ? 57.643  75.738  -3.587  1.00 106.44 ? 108  DC  I C5    1 
ATOM   2204  C C6    . DC  A 1 108 ? 57.979  74.449  -3.739  1.00 107.43 ? 108  DC  I C6    1 
ATOM   2205  P P     . DA  A 1 109 ? 61.373  68.943  -4.678  1.00 102.93 ? 109  DA  I P     1 
ATOM   2206  O OP1   . DA  A 1 109 ? 60.760  67.592  -4.595  1.00 105.14 ? 109  DA  I OP1   1 
ATOM   2207  O OP2   . DA  A 1 109 ? 62.065  69.513  -3.490  1.00 105.49 ? 109  DA  I OP2   1 
ATOM   2208  O "O5'" . DA  A 1 109 ? 62.371  68.962  -5.919  1.00 100.72 ? 109  DA  I "O5'" 1 
ATOM   2209  C "C5'" . DA  A 1 109 ? 61.880  68.770  -7.245  1.00 96.87  ? 109  DA  I "C5'" 1 
ATOM   2210  C "C4'" . DA  A 1 109 ? 62.556  69.725  -8.202  1.00 94.42  ? 109  DA  I "C4'" 1 
ATOM   2211  O "O4'" . DA  A 1 109 ? 62.222  71.087  -7.842  1.00 93.05  ? 109  DA  I "O4'" 1 
ATOM   2212  C "C3'" . DA  A 1 109 ? 64.083  69.655  -8.214  1.00 93.26  ? 109  DA  I "C3'" 1 
ATOM   2213  O "O3'" . DA  A 1 109 ? 64.567  69.826  -9.550  1.00 92.37  ? 109  DA  I "O3'" 1 
ATOM   2214  C "C2'" . DA  A 1 109 ? 64.499  70.812  -7.325  1.00 92.26  ? 109  DA  I "C2'" 1 
ATOM   2215  C "C1'" . DA  A 1 109 ? 63.399  71.831  -7.559  1.00 92.10  ? 109  DA  I "C1'" 1 
ATOM   2216  N N9    . DA  A 1 109 ? 63.120  72.672  -6.396  1.00 94.22  ? 109  DA  I N9    1 
ATOM   2217  C C8    . DA  A 1 109 ? 63.113  72.295  -5.077  1.00 94.30  ? 109  DA  I C8    1 
ATOM   2218  N N7    . DA  A 1 109 ? 62.810  73.266  -4.252  1.00 94.48  ? 109  DA  I N7    1 
ATOM   2219  C C5    . DA  A 1 109 ? 62.606  74.358  -5.083  1.00 94.03  ? 109  DA  I C5    1 
ATOM   2220  C C6    . DA  A 1 109 ? 62.252  75.697  -4.820  1.00 94.09  ? 109  DA  I C6    1 
ATOM   2221  N N6    . DA  A 1 109 ? 62.032  76.182  -3.595  1.00 93.47  ? 109  DA  I N6    1 
ATOM   2222  N N1    . DA  A 1 109 ? 62.131  76.530  -5.875  1.00 93.61  ? 109  DA  I N1    1 
ATOM   2223  C C2    . DA  A 1 109 ? 62.352  76.044  -7.103  1.00 93.91  ? 109  DA  I C2    1 
ATOM   2224  N N3    . DA  A 1 109 ? 62.687  74.811  -7.475  1.00 94.11  ? 109  DA  I N3    1 
ATOM   2225  C C4    . DA  A 1 109 ? 62.799  74.007  -6.406  1.00 93.95  ? 109  DA  I C4    1 
ATOM   2226  P P     . DA  A 1 110 ? 66.150  69.885  -9.824  1.00 97.36  ? 110  DA  I P     1 
ATOM   2227  O OP1   . DA  A 1 110 ? 66.419  69.164  -11.097 1.00 98.99  ? 110  DA  I OP1   1 
ATOM   2228  O OP2   . DA  A 1 110 ? 66.862  69.477  -8.583  1.00 99.38  ? 110  DA  I OP2   1 
ATOM   2229  O "O5'" . DA  A 1 110 ? 66.421  71.434  -10.060 1.00 95.44  ? 110  DA  I "O5'" 1 
ATOM   2230  C "C5'" . DA  A 1 110 ? 65.648  72.170  -11.002 1.00 92.20  ? 110  DA  I "C5'" 1 
ATOM   2231  C "C4'" . DA  A 1 110 ? 66.042  73.627  -10.971 1.00 90.34  ? 110  DA  I "C4'" 1 
ATOM   2232  O "O4'" . DA  A 1 110 ? 65.563  74.251  -9.755  1.00 90.20  ? 110  DA  I "O4'" 1 
ATOM   2233  C "C3'" . DA  A 1 110 ? 67.550  73.869  -11.001 1.00 89.27  ? 110  DA  I "C3'" 1 
ATOM   2234  O "O3'" . DA  A 1 110 ? 67.821  75.031  -11.781 1.00 87.91  ? 110  DA  I "O3'" 1 
ATOM   2235  C "C2'" . DA  A 1 110 ? 67.884  74.146  -9.546  1.00 89.41  ? 110  DA  I "C2'" 1 
ATOM   2236  C "C1'" . DA  A 1 110 ? 66.644  74.891  -9.097  1.00 89.76  ? 110  DA  I "C1'" 1 
ATOM   2237  N N9    . DA  A 1 110 ? 66.385  74.857  -7.658  1.00 91.95  ? 110  DA  I N9    1 
ATOM   2238  C C8    . DA  A 1 110 ? 66.469  73.783  -6.807  1.00 92.28  ? 110  DA  I C8    1 
ATOM   2239  N N7    . DA  A 1 110 ? 66.166  74.070  -5.563  1.00 92.28  ? 110  DA  I N7    1 
ATOM   2240  C C5    . DA  A 1 110 ? 65.864  75.424  -5.597  1.00 92.32  ? 110  DA  I C5    1 
ATOM   2241  C C6    . DA  A 1 110 ? 65.458  76.330  -4.598  1.00 92.66  ? 110  DA  I C6    1 
ATOM   2242  N N6    . DA  A 1 110 ? 65.270  75.990  -3.320  1.00 92.03  ? 110  DA  I N6    1 
ATOM   2243  N N1    . DA  A 1 110 ? 65.242  77.614  -4.965  1.00 92.41  ? 110  DA  I N1    1 
ATOM   2244  C C2    . DA  A 1 110 ? 65.415  77.950  -6.250  1.00 92.03  ? 110  DA  I C2    1 
ATOM   2245  N N3    . DA  A 1 110 ? 65.786  77.189  -7.278  1.00 91.69  ? 110  DA  I N3    1 
ATOM   2246  C C4    . DA  A 1 110 ? 65.998  75.922  -6.881  1.00 91.87  ? 110  DA  I C4    1 
ATOM   2247  P P     . DA  A 1 111 ? 69.320  75.334  -12.266 1.00 75.92  ? 111  DA  I P     1 
ATOM   2248  O OP1   . DA  A 1 111 ? 69.459  74.838  -13.659 1.00 86.17  ? 111  DA  I OP1   1 
ATOM   2249  O OP2   . DA  A 1 111 ? 70.253  74.854  -11.217 1.00 86.73  ? 111  DA  I OP2   1 
ATOM   2250  O "O5'" . DA  A 1 111 ? 69.377  76.922  -12.270 1.00 74.82  ? 111  DA  I "O5'" 1 
ATOM   2251  C "C5'" . DA  A 1 111 ? 68.225  77.694  -12.599 1.00 74.04  ? 111  DA  I "C5'" 1 
ATOM   2252  C "C4'" . DA  A 1 111 ? 68.280  79.015  -11.873 1.00 74.67  ? 111  DA  I "C4'" 1 
ATOM   2253  O "O4'" . DA  A 1 111 ? 67.835  78.858  -10.500 1.00 74.06  ? 111  DA  I "O4'" 1 
ATOM   2254  C "C3'" . DA  A 1 111 ? 69.705  79.560  -11.797 1.00 74.45  ? 111  DA  I "C3'" 1 
ATOM   2255  O "O3'" . DA  A 1 111 ? 69.716  80.978  -11.923 1.00 74.48  ? 111  DA  I "O3'" 1 
ATOM   2256  C "C2'" . DA  A 1 111 ? 70.148  79.168  -10.402 1.00 74.96  ? 111  DA  I "C2'" 1 
ATOM   2257  C "C1'" . DA  A 1 111 ? 68.856  79.301  -9.619  1.00 74.72  ? 111  DA  I "C1'" 1 
ATOM   2258  N N9    . DA  A 1 111 ? 68.821  78.472  -8.414  1.00 85.49  ? 111  DA  I N9    1 
ATOM   2259  C C8    . DA  A 1 111 ? 69.069  77.127  -8.310  1.00 84.98  ? 111  DA  I C8    1 
ATOM   2260  N N7    . DA  A 1 111 ? 69.003  76.670  -7.084  1.00 85.07  ? 111  DA  I N7    1 
ATOM   2261  C C5    . DA  A 1 111 ? 68.681  77.788  -6.327  1.00 85.00  ? 111  DA  I C5    1 
ATOM   2262  C C6    . DA  A 1 111 ? 68.469  77.969  -4.948  1.00 84.82  ? 111  DA  I C6    1 
ATOM   2263  N N6    . DA  A 1 111 ? 68.567  76.987  -4.051  1.00 84.65  ? 111  DA  I N6    1 
ATOM   2264  N N1    . DA  A 1 111 ? 68.152  79.210  -4.517  1.00 84.55  ? 111  DA  I N1    1 
ATOM   2265  C C2    . DA  A 1 111 ? 68.060  80.195  -5.419  1.00 85.35  ? 111  DA  I C2    1 
ATOM   2266  N N3    . DA  A 1 111 ? 68.243  80.151  -6.740  1.00 85.49  ? 111  DA  I N3    1 
ATOM   2267  C C4    . DA  A 1 111 ? 68.554  78.904  -7.135  1.00 85.19  ? 111  DA  I C4    1 
ATOM   2268  P P     . DT  A 1 112 ? 71.120  81.749  -11.998 1.00 68.74  ? 112  DT  I P     1 
ATOM   2269  O OP1   . DT  A 1 112 ? 71.288  82.326  -13.357 1.00 85.77  ? 112  DT  I OP1   1 
ATOM   2270  O OP2   . DT  A 1 112 ? 72.150  80.834  -11.458 1.00 86.71  ? 112  DT  I OP2   1 
ATOM   2271  O "O5'" . DT  A 1 112 ? 70.941  82.937  -10.960 1.00 72.12  ? 112  DT  I "O5'" 1 
ATOM   2272  C "C5'" . DT  A 1 112 ? 69.733  83.683  -10.923 1.00 78.12  ? 112  DT  I "C5'" 1 
ATOM   2273  C "C4'" . DT  A 1 112 ? 69.645  84.462  -9.634  1.00 82.63  ? 112  DT  I "C4'" 1 
ATOM   2274  O "O4'" . DT  A 1 112 ? 69.484  83.550  -8.517  1.00 82.48  ? 112  DT  I "O4'" 1 
ATOM   2275  C "C3'" . DT  A 1 112 ? 70.885  85.300  -9.323  1.00 85.27  ? 112  DT  I "C3'" 1 
ATOM   2276  O "O3'" . DT  A 1 112 ? 70.481  86.559  -8.782  1.00 90.50  ? 112  DT  I "O3'" 1 
ATOM   2277  C "C2'" . DT  A 1 112 ? 71.620  84.471  -8.282  1.00 84.96  ? 112  DT  I "C2'" 1 
ATOM   2278  C "C1'" . DT  A 1 112 ? 70.471  83.821  -7.536  1.00 83.42  ? 112  DT  I "C1'" 1 
ATOM   2279  N N1    . DT  A 1 112 ? 70.797  82.553  -6.851  1.00 100.23 ? 112  DT  I N1    1 
ATOM   2280  C C2    . DT  A 1 112 ? 70.547  82.473  -5.496  1.00 100.23 ? 112  DT  I C2    1 
ATOM   2281  O O2    . DT  A 1 112 ? 70.085  83.399  -4.847  1.00 100.76 ? 112  DT  I O2    1 
ATOM   2282  N N3    . DT  A 1 112 ? 70.859  81.262  -4.925  1.00 99.81  ? 112  DT  I N3    1 
ATOM   2283  C C4    . DT  A 1 112 ? 71.384  80.151  -5.559  1.00 99.88  ? 112  DT  I C4    1 
ATOM   2284  O O4    . DT  A 1 112 ? 71.601  79.127  -4.917  1.00 99.60  ? 112  DT  I O4    1 
ATOM   2285  C C5    . DT  A 1 112 ? 71.632  80.309  -6.977  1.00 99.64  ? 112  DT  I C5    1 
ATOM   2286  C C7    . DT  A 1 112 ? 72.213  79.163  -7.743  1.00 99.02  ? 112  DT  I C7    1 
ATOM   2287  C C6    . DT  A 1 112 ? 71.328  81.486  -7.545  1.00 99.87  ? 112  DT  I C6    1 
ATOM   2288  P P     . DA  A 1 113 ? 71.591  87.622  -8.324  1.00 136.19 ? 113  DA  I P     1 
ATOM   2289  O OP1   . DA  A 1 113 ? 70.951  88.961  -8.292  1.00 97.58  ? 113  DA  I OP1   1 
ATOM   2290  O OP2   . DA  A 1 113 ? 72.807  87.407  -9.150  1.00 96.39  ? 113  DA  I OP2   1 
ATOM   2291  O "O5'" . DA  A 1 113 ? 71.910  87.191  -6.826  1.00 139.07 ? 113  DA  I "O5'" 1 
ATOM   2292  C "C5'" . DA  A 1 113 ? 70.992  87.487  -5.776  1.00 145.30 ? 113  DA  I "C5'" 1 
ATOM   2293  C "C4'" . DA  A 1 113 ? 71.725  87.551  -4.458  1.00 149.41 ? 113  DA  I "C4'" 1 
ATOM   2294  O "O4'" . DA  A 1 113 ? 72.028  86.210  -4.003  1.00 150.39 ? 113  DA  I "O4'" 1 
ATOM   2295  C "C3'" . DA  A 1 113 ? 73.063  88.283  -4.552  1.00 152.20 ? 113  DA  I "C3'" 1 
ATOM   2296  O "O3'" . DA  A 1 113 ? 73.293  89.077  -3.384  1.00 156.25 ? 113  DA  I "O3'" 1 
ATOM   2297  C "C2'" . DA  A 1 113 ? 74.074  87.155  -4.651  1.00 151.14 ? 113  DA  I "C2'" 1 
ATOM   2298  C "C1'" . DA  A 1 113 ? 73.428  86.065  -3.815  1.00 150.96 ? 113  DA  I "C1'" 1 
ATOM   2299  N N9    . DA  A 1 113 ? 73.794  84.704  -4.207  1.00 112.06 ? 113  DA  I N9    1 
ATOM   2300  C C8    . DA  A 1 113 ? 74.078  84.235  -5.467  1.00 112.45 ? 113  DA  I C8    1 
ATOM   2301  N N7    . DA  A 1 113 ? 74.374  82.958  -5.502  1.00 112.05 ? 113  DA  I N7    1 
ATOM   2302  C C5    . DA  A 1 113 ? 74.279  82.556  -4.177  1.00 111.16 ? 113  DA  I C5    1 
ATOM   2303  C C6    . DA  A 1 113 ? 74.474  81.312  -3.547  1.00 110.48 ? 113  DA  I C6    1 
ATOM   2304  N N6    . DA  A 1 113 ? 74.817  80.198  -4.195  1.00 108.87 ? 113  DA  I N6    1 
ATOM   2305  N N1    . DA  A 1 113 ? 74.302  81.253  -2.210  1.00 110.51 ? 113  DA  I N1    1 
ATOM   2306  C C2    . DA  A 1 113 ? 73.957  82.373  -1.558  1.00 111.14 ? 113  DA  I C2    1 
ATOM   2307  N N3    . DA  A 1 113 ? 73.744  83.598  -2.037  1.00 111.37 ? 113  DA  I N3    1 
ATOM   2308  C C4    . DA  A 1 113 ? 73.923  83.623  -3.368  1.00 111.63 ? 113  DA  I C4    1 
ATOM   2309  P P     . DC  A 1 114 ? 74.459  90.181  -3.395  1.00 130.29 ? 114  DC  I P     1 
ATOM   2310  O OP1   . DC  A 1 114 ? 74.515  90.810  -2.052  1.00 132.43 ? 114  DC  I OP1   1 
ATOM   2311  O OP2   . DC  A 1 114 ? 74.264  91.033  -4.597  1.00 132.03 ? 114  DC  I OP2   1 
ATOM   2312  O "O5'" . DC  A 1 114 ? 75.780  89.317  -3.605  1.00 133.15 ? 114  DC  I "O5'" 1 
ATOM   2313  C "C5'" . DC  A 1 114 ? 76.958  89.579  -2.850  1.00 137.69 ? 114  DC  I "C5'" 1 
ATOM   2314  C "C4'" . DC  A 1 114 ? 76.803  89.047  -1.445  1.00 141.35 ? 114  DC  I "C4'" 1 
ATOM   2315  O "O4'" . DC  A 1 114 ? 76.332  87.678  -1.480  1.00 141.85 ? 114  DC  I "O4'" 1 
ATOM   2316  C "C3'" . DC  A 1 114 ? 78.096  89.029  -0.633  1.00 143.51 ? 114  DC  I "C3'" 1 
ATOM   2317  O "O3'" . DC  A 1 114 ? 77.834  89.386  0.724   1.00 146.95 ? 114  DC  I "O3'" 1 
ATOM   2318  C "C2'" . DC  A 1 114 ? 78.547  87.584  -0.721  1.00 143.72 ? 114  DC  I "C2'" 1 
ATOM   2319  C "C1'" . DC  A 1 114 ? 77.230  86.834  -0.775  1.00 143.11 ? 114  DC  I "C1'" 1 
ATOM   2320  N N1    . DC  A 1 114 ? 77.302  85.551  -1.493  1.00 145.89 ? 114  DC  I N1    1 
ATOM   2321  C C2    . DC  A 1 114 ? 77.033  84.371  -0.793  1.00 146.27 ? 114  DC  I C2    1 
ATOM   2322  O O2    . DC  A 1 114 ? 76.741  84.443  0.409   1.00 146.66 ? 114  DC  I O2    1 
ATOM   2323  N N3    . DC  A 1 114 ? 77.098  83.185  -1.444  1.00 146.32 ? 114  DC  I N3    1 
ATOM   2324  C C4    . DC  A 1 114 ? 77.418  83.153  -2.741  1.00 146.28 ? 114  DC  I C4    1 
ATOM   2325  N N4    . DC  A 1 114 ? 77.472  81.963  -3.344  1.00 145.94 ? 114  DC  I N4    1 
ATOM   2326  C C5    . DC  A 1 114 ? 77.696  84.341  -3.478  1.00 146.09 ? 114  DC  I C5    1 
ATOM   2327  C C6    . DC  A 1 114 ? 77.627  85.507  -2.821  1.00 146.04 ? 114  DC  I C6    1 
ATOM   2328  P P     . DA  A 1 115 ? 79.062  89.666  1.716   1.00 177.78 ? 115  DA  I P     1 
ATOM   2329  O OP1   . DA  A 1 115 ? 78.525  90.222  2.984   1.00 151.68 ? 115  DA  I OP1   1 
ATOM   2330  O OP2   . DA  A 1 115 ? 80.079  90.430  0.952   1.00 151.69 ? 115  DA  I OP2   1 
ATOM   2331  O "O5'" . DA  A 1 115 ? 79.647  88.214  2.006   1.00 179.00 ? 115  DA  I "O5'" 1 
ATOM   2332  C "C5'" . DA  A 1 115 ? 79.093  87.404  3.039   1.00 182.07 ? 115  DA  I "C5'" 1 
ATOM   2333  C "C4'" . DA  A 1 115 ? 79.981  86.212  3.306   1.00 183.46 ? 115  DA  I "C4'" 1 
ATOM   2334  O "O4'" . DA  A 1 115 ? 79.811  85.215  2.269   1.00 185.44 ? 115  DA  I "O4'" 1 
ATOM   2335  C "C3'" . DA  A 1 115 ? 81.479  86.520  3.362   1.00 183.44 ? 115  DA  I "C3'" 1 
ATOM   2336  O "O3'" . DA  A 1 115 ? 82.086  85.786  4.430   1.00 181.10 ? 115  DA  I "O3'" 1 
ATOM   2337  C "C2'" . DA  A 1 115 ? 81.988  86.022  2.022   1.00 185.05 ? 115  DA  I "C2'" 1 
ATOM   2338  C "C1'" . DA  A 1 115 ? 81.083  84.830  1.775   1.00 186.86 ? 115  DA  I "C1'" 1 
ATOM   2339  N N9    . DA  A 1 115 ? 80.929  84.445  0.372   1.00 162.37 ? 115  DA  I N9    1 
ATOM   2340  C C8    . DA  A 1 115 ? 80.816  85.258  -0.729  1.00 163.24 ? 115  DA  I C8    1 
ATOM   2341  N N7    . DA  A 1 115 ? 80.689  84.604  -1.858  1.00 163.84 ? 115  DA  I N7    1 
ATOM   2342  C C5    . DA  A 1 115 ? 80.721  83.270  -1.476  1.00 163.63 ? 115  DA  I C5    1 
ATOM   2343  C C6    . DA  A 1 115 ? 80.633  82.071  -2.208  1.00 163.85 ? 115  DA  I C6    1 
ATOM   2344  N N6    . DA  A 1 115 ? 80.486  82.021  -3.534  1.00 163.61 ? 115  DA  I N6    1 
ATOM   2345  N N1    . DA  A 1 115 ? 80.701  80.909  -1.522  1.00 163.62 ? 115  DA  I N1    1 
ATOM   2346  C C2    . DA  A 1 115 ? 80.847  80.958  -0.192  1.00 163.48 ? 115  DA  I C2    1 
ATOM   2347  N N3    . DA  A 1 115 ? 80.940  82.019  0.607   1.00 163.43 ? 115  DA  I N3    1 
ATOM   2348  C C4    . DA  A 1 115 ? 80.869  83.158  -0.105  1.00 163.29 ? 115  DA  I C4    1 
ATOM   2349  P P     . DC  A 1 116 ? 83.677  85.858  4.648   1.00 159.75 ? 116  DC  I P     1 
ATOM   2350  O OP1   . DC  A 1 116 ? 83.944  85.852  6.108   1.00 142.67 ? 116  DC  I OP1   1 
ATOM   2351  O OP2   . DC  A 1 116 ? 84.212  86.960  3.807   1.00 142.79 ? 116  DC  I OP2   1 
ATOM   2352  O "O5'" . DC  A 1 116 ? 84.189  84.475  4.049   1.00 158.50 ? 116  DC  I "O5'" 1 
ATOM   2353  C "C5'" . DC  A 1 116 ? 83.709  83.242  4.575   1.00 156.58 ? 116  DC  I "C5'" 1 
ATOM   2354  C "C4'" . DC  A 1 116 ? 84.468  82.082  3.975   1.00 154.75 ? 116  DC  I "C4'" 1 
ATOM   2355  O "O4'" . DC  A 1 116 ? 84.079  81.887  2.592   1.00 154.96 ? 116  DC  I "O4'" 1 
ATOM   2356  C "C3'" . DC  A 1 116 ? 85.990  82.245  3.970   1.00 153.07 ? 116  DC  I "C3'" 1 
ATOM   2357  O "O3'" . DC  A 1 116 ? 86.606  80.995  4.285   1.00 149.63 ? 116  DC  I "O3'" 1 
ATOM   2358  C "C2'" . DC  A 1 116 ? 86.292  82.614  2.530   1.00 154.02 ? 116  DC  I "C2'" 1 
ATOM   2359  C "C1'" . DC  A 1 116 ? 85.246  81.804  1.791   1.00 154.81 ? 116  DC  I "C1'" 1 
ATOM   2360  N N1    . DC  A 1 116 ? 84.923  82.288  0.439   1.00 137.60 ? 116  DC  I N1    1 
ATOM   2361  C C2    . DC  A 1 116 ? 84.582  81.350  -0.545  1.00 137.38 ? 116  DC  I C2    1 
ATOM   2362  O O2    . DC  A 1 116 ? 84.533  80.148  -0.238  1.00 137.14 ? 116  DC  I O2    1 
ATOM   2363  N N3    . DC  A 1 116 ? 84.313  81.778  -1.801  1.00 137.07 ? 116  DC  I N3    1 
ATOM   2364  C C4    . DC  A 1 116 ? 84.369  83.081  -2.089  1.00 136.81 ? 116  DC  I C4    1 
ATOM   2365  N N4    . DC  A 1 116 ? 84.105  83.456  -3.342  1.00 135.87 ? 116  DC  I N4    1 
ATOM   2366  C C5    . DC  A 1 116 ? 84.700  84.057  -1.103  1.00 137.09 ? 116  DC  I C5    1 
ATOM   2367  C C6    . DC  A 1 116 ? 84.965  83.621  0.136   1.00 137.57 ? 116  DC  I C6    1 
ATOM   2368  P P     . DT  A 1 117 ? 88.207  80.881  4.331   1.00 149.35 ? 117  DT  I P     1 
ATOM   2369  O OP1   . DT  A 1 117 ? 88.611  80.559  5.723   1.00 130.12 ? 117  DT  I OP1   1 
ATOM   2370  O OP2   . DT  A 1 117 ? 88.789  82.069  3.655   1.00 129.67 ? 117  DT  I OP2   1 
ATOM   2371  O "O5'" . DT  A 1 117 ? 88.502  79.607  3.426   1.00 147.16 ? 117  DT  I "O5'" 1 
ATOM   2372  C "C5'" . DT  A 1 117 ? 87.733  78.417  3.577   1.00 143.27 ? 117  DT  I "C5'" 1 
ATOM   2373  C "C4'" . DT  A 1 117 ? 88.060  77.440  2.474   1.00 140.36 ? 117  DT  I "C4'" 1 
ATOM   2374  O "O4'" . DT  A 1 117 ? 87.581  77.957  1.208   1.00 140.13 ? 117  DT  I "O4'" 1 
ATOM   2375  C "C3'" . DT  A 1 117 ? 89.554  77.174  2.289   1.00 138.50 ? 117  DT  I "C3'" 1 
ATOM   2376  O "O3'" . DT  A 1 117 ? 89.774  75.785  2.032   1.00 135.36 ? 117  DT  I "O3'" 1 
ATOM   2377  C "C2'" . DT  A 1 117 ? 89.924  78.027  1.088   1.00 138.72 ? 117  DT  I "C2'" 1 
ATOM   2378  C "C1'" . DT  A 1 117 ? 88.645  78.031  0.269   1.00 139.30 ? 117  DT  I "C1'" 1 
ATOM   2379  N N1    . DT  A 1 117 ? 88.449  79.250  -0.549  1.00 119.16 ? 117  DT  I N1    1 
ATOM   2380  C C2    . DT  A 1 117 ? 88.131  79.102  -1.883  1.00 118.69 ? 117  DT  I C2    1 
ATOM   2381  O O2    . DT  A 1 117 ? 87.998  78.015  -2.421  1.00 118.71 ? 117  DT  I O2    1 
ATOM   2382  N N3    . DT  A 1 117 ? 87.973  80.282  -2.569  1.00 118.12 ? 117  DT  I N3    1 
ATOM   2383  C C4    . DT  A 1 117 ? 88.098  81.564  -2.068  1.00 118.21 ? 117  DT  I C4    1 
ATOM   2384  O O4    . DT  A 1 117 ? 87.928  82.532  -2.807  1.00 117.39 ? 117  DT  I O4    1 
ATOM   2385  C C5    . DT  A 1 117 ? 88.431  81.646  -0.663  1.00 118.32 ? 117  DT  I C5    1 
ATOM   2386  C C7    . DT  A 1 117 ? 88.587  82.993  -0.032  1.00 118.26 ? 117  DT  I C7    1 
ATOM   2387  C C6    . DT  A 1 117 ? 88.587  80.501  0.016   1.00 118.68 ? 117  DT  I C6    1 
ATOM   2388  P P     . DT  A 1 118 ? 91.242  75.269  1.634   1.00 126.24 ? 118  DT  I P     1 
ATOM   2389  O OP1   . DT  A 1 118 ? 91.416  73.922  2.237   1.00 114.09 ? 118  DT  I OP1   1 
ATOM   2390  O OP2   . DT  A 1 118 ? 92.235  76.339  1.920   1.00 114.21 ? 118  DT  I OP2   1 
ATOM   2391  O "O5'" . DT  A 1 118 ? 91.137  75.089  0.058   1.00 123.85 ? 118  DT  I "O5'" 1 
ATOM   2392  C "C5'" . DT  A 1 118 ? 90.038  74.377  -0.507  1.00 119.96 ? 118  DT  I "C5'" 1 
ATOM   2393  C "C4'" . DT  A 1 118 ? 90.213  74.242  -2.000  1.00 116.27 ? 118  DT  I "C4'" 1 
ATOM   2394  O "O4'" . DT  A 1 118 ? 89.963  75.510  -2.652  1.00 114.75 ? 118  DT  I "O4'" 1 
ATOM   2395  C "C3'" . DT  A 1 118 ? 91.614  73.810  -2.432  1.00 114.34 ? 118  DT  I "C3'" 1 
ATOM   2396  O "O3'" . DT  A 1 118 ? 91.511  72.871  -3.502  1.00 112.49 ? 118  DT  I "O3'" 1 
ATOM   2397  C "C2'" . DT  A 1 118 ? 92.253  75.105  -2.899  1.00 113.26 ? 118  DT  I "C2'" 1 
ATOM   2398  C "C1'" . DT  A 1 118 ? 91.065  75.849  -3.476  1.00 113.50 ? 118  DT  I "C1'" 1 
ATOM   2399  N N1    . DT  A 1 118 ? 91.194  77.316  -3.479  1.00 100.97 ? 118  DT  I N1    1 
ATOM   2400  C C2    . DT  A 1 118 ? 91.064  77.969  -4.682  1.00 100.63 ? 118  DT  I C2    1 
ATOM   2401  O O2    . DT  A 1 118 ? 90.863  77.389  -5.736  1.00 100.47 ? 118  DT  I O2    1 
ATOM   2402  N N3    . DT  A 1 118 ? 91.183  79.335  -4.608  1.00 100.29 ? 118  DT  I N3    1 
ATOM   2403  C C4    . DT  A 1 118 ? 91.419  80.093  -3.478  1.00 100.08 ? 118  DT  I C4    1 
ATOM   2404  O O4    . DT  A 1 118 ? 91.502  81.315  -3.568  1.00 99.19  ? 118  DT  I O4    1 
ATOM   2405  C C5    . DT  A 1 118 ? 91.550  79.341  -2.249  1.00 100.53 ? 118  DT  I C5    1 
ATOM   2406  C C7    . DT  A 1 118 ? 91.809  80.076  -0.972  1.00 100.23 ? 118  DT  I C7    1 
ATOM   2407  C C6    . DT  A 1 118 ? 91.433  78.007  -2.311  1.00 100.84 ? 118  DT  I C6    1 
ATOM   2408  P P     . DT  A 1 119 ? 92.829  72.424  -4.297  1.00 95.65  ? 119  DT  I P     1 
ATOM   2409  O OP1   . DT  A 1 119 ? 92.664  71.005  -4.707  1.00 118.48 ? 119  DT  I OP1   1 
ATOM   2410  O OP2   . DT  A 1 119 ? 94.012  72.823  -3.494  1.00 118.99 ? 119  DT  I OP2   1 
ATOM   2411  O "O5'" . DT  A 1 119 ? 92.791  73.343  -5.596  1.00 95.35  ? 119  DT  I "O5'" 1 
ATOM   2412  C "C5'" . DT  A 1 119 ? 91.651  73.341  -6.454  1.00 92.48  ? 119  DT  I "C5'" 1 
ATOM   2413  C "C4'" . DT  A 1 119 ? 91.969  74.062  -7.742  1.00 90.81  ? 119  DT  I "C4'" 1 
ATOM   2414  O "O4'" . DT  A 1 119 ? 92.049  75.489  -7.506  1.00 90.63  ? 119  DT  I "O4'" 1 
ATOM   2415  C "C3'" . DT  A 1 119 ? 93.305  73.660  -8.367  1.00 89.82  ? 119  DT  I "C3'" 1 
ATOM   2416  O "O3'" . DT  A 1 119 ? 93.185  73.683  -9.784  1.00 87.60  ? 119  DT  I "O3'" 1 
ATOM   2417  C "C2'" . DT  A 1 119 ? 94.231  74.785  -7.942  1.00 91.19  ? 119  DT  I "C2'" 1 
ATOM   2418  C "C1'" . DT  A 1 119 ? 93.291  75.974  -7.986  1.00 91.90  ? 119  DT  I "C1'" 1 
ATOM   2419  N N1    . DT  A 1 119 ? 93.684  77.117  -7.148  1.00 116.83 ? 119  DT  I N1    1 
ATOM   2420  C C2    . DT  A 1 119 ? 93.730  78.361  -7.735  1.00 117.99 ? 119  DT  I C2    1 
ATOM   2421  O O2    . DT  A 1 119 ? 93.478  78.553  -8.913  1.00 117.62 ? 119  DT  I O2    1 
ATOM   2422  N N3    . DT  A 1 119 ? 94.085  79.379  -6.887  1.00 118.63 ? 119  DT  I N3    1 
ATOM   2423  C C4    . DT  A 1 119 ? 94.392  79.278  -5.544  1.00 118.73 ? 119  DT  I C4    1 
ATOM   2424  O O4    . DT  A 1 119 ? 94.680  80.286  -4.907  1.00 119.28 ? 119  DT  I O4    1 
ATOM   2425  C C5    . DT  A 1 119 ? 94.337  77.940  -4.998  1.00 118.70 ? 119  DT  I C5    1 
ATOM   2426  C C7    . DT  A 1 119 ? 94.667  77.730  -3.555  1.00 119.14 ? 119  DT  I C7    1 
ATOM   2427  C C6    . DT  A 1 119 ? 93.990  76.940  -5.817  1.00 117.81 ? 119  DT  I C6    1 
ATOM   2428  P P     . DT  A 1 120 ? 93.267  72.317  -10.621 1.00 94.50  ? 120  DT  I P     1 
ATOM   2429  O OP1   . DT  A 1 120 ? 92.240  71.385  -10.089 1.00 103.70 ? 120  DT  I OP1   1 
ATOM   2430  O OP2   . DT  A 1 120 ? 94.689  71.889  -10.697 1.00 104.18 ? 120  DT  I OP2   1 
ATOM   2431  O "O5'" . DT  A 1 120 ? 92.817  72.791  -12.069 1.00 93.07  ? 120  DT  I "O5'" 1 
ATOM   2432  C "C5'" . DT  A 1 120 ? 91.623  73.549  -12.233 1.00 90.27  ? 120  DT  I "C5'" 1 
ATOM   2433  C "C4'" . DT  A 1 120 ? 91.895  74.796  -13.042 1.00 88.24  ? 120  DT  I "C4'" 1 
ATOM   2434  O "O4'" . DT  A 1 120 ? 92.521  75.835  -12.245 1.00 87.28  ? 120  DT  I "O4'" 1 
ATOM   2435  C "C3'" . DT  A 1 120 ? 92.797  74.582  -14.256 1.00 87.03  ? 120  DT  I "C3'" 1 
ATOM   2436  O "O3'" . DT  A 1 120 ? 92.234  75.248  -15.375 1.00 85.22  ? 120  DT  I "O3'" 1 
ATOM   2437  C "C2'" . DT  A 1 120 ? 94.099  75.258  -13.863 1.00 87.23  ? 120  DT  I "C2'" 1 
ATOM   2438  C "C1'" . DT  A 1 120 ? 93.610  76.384  -12.973 1.00 87.75  ? 120  DT  I "C1'" 1 
ATOM   2439  N N1    . DT  A 1 120 ? 94.606  76.897  -12.006 1.00 99.02  ? 120  DT  I N1    1 
ATOM   2440  C C2    . DT  A 1 120 ? 94.655  78.259  -11.784 1.00 99.54  ? 120  DT  I C2    1 
ATOM   2441  O O2    . DT  A 1 120 ? 93.921  79.055  -12.343 1.00 99.52  ? 120  DT  I O2    1 
ATOM   2442  N N3    . DT  A 1 120 ? 95.604  78.658  -10.878 1.00 99.74  ? 120  DT  I N3    1 
ATOM   2443  C C4    . DT  A 1 120 ? 96.491  77.855  -10.189 1.00 100.54 ? 120  DT  I C4    1 
ATOM   2444  O O4    . DT  A 1 120 ? 97.287  78.361  -9.403  1.00 101.28 ? 120  DT  I O4    1 
ATOM   2445  C C5    . DT  A 1 120 ? 96.391  76.440  -10.472 1.00 100.62 ? 120  DT  I C5    1 
ATOM   2446  C C7    . DT  A 1 120 ? 97.320  75.495  -9.777  1.00 99.92  ? 120  DT  I C7    1 
ATOM   2447  C C6    . DT  A 1 120 ? 95.464  76.036  -11.352 1.00 99.83  ? 120  DT  I C6    1 
ATOM   2448  P P     . DG  A 1 121 ? 92.747  74.894  -16.850 1.00 85.08  ? 121  DG  I P     1 
ATOM   2449  O OP1   . DG  A 1 121 ? 91.677  74.130  -17.549 1.00 91.84  ? 121  DG  I OP1   1 
ATOM   2450  O OP2   . DG  A 1 121 ? 94.117  74.320  -16.741 1.00 93.22  ? 121  DG  I OP2   1 
ATOM   2451  O "O5'" . DG  A 1 121 ? 92.870  76.331  -17.513 1.00 81.01  ? 121  DG  I "O5'" 1 
ATOM   2452  C "C5'" . DG  A 1 121 ? 91.999  77.381  -17.119 1.00 75.24  ? 121  DG  I "C5'" 1 
ATOM   2453  C "C4'" . DG  A 1 121 ? 92.670  78.713  -17.343 1.00 72.46  ? 121  DG  I "C4'" 1 
ATOM   2454  O "O4'" . DG  A 1 121 ? 93.662  78.961  -16.318 1.00 72.20  ? 121  DG  I "O4'" 1 
ATOM   2455  C "C3'" . DG  A 1 121 ? 93.405  78.805  -18.675 1.00 69.29  ? 121  DG  I "C3'" 1 
ATOM   2456  O "O3'" . DG  A 1 121 ? 93.244  80.116  -19.197 1.00 64.88  ? 121  DG  I "O3'" 1 
ATOM   2457  C "C2'" . DG  A 1 121 ? 94.851  78.533  -18.299 1.00 70.99  ? 121  DG  I "C2'" 1 
ATOM   2458  C "C1'" . DG  A 1 121 ? 94.951  79.114  -16.897 1.00 73.18  ? 121  DG  I "C1'" 1 
ATOM   2459  N N9    . DG  A 1 121 ? 95.902  78.428  -16.026 1.00 84.60  ? 121  DG  I N9    1 
ATOM   2460  C C8    . DG  A 1 121 ? 96.185  77.083  -16.006 1.00 85.06  ? 121  DG  I C8    1 
ATOM   2461  N N7    . DG  A 1 121 ? 97.049  76.754  -15.087 1.00 85.59  ? 121  DG  I N7    1 
ATOM   2462  C C5    . DG  A 1 121 ? 97.363  77.954  -14.465 1.00 85.41  ? 121  DG  I C5    1 
ATOM   2463  C C6    . DG  A 1 121 ? 98.237  78.222  -13.378 1.00 85.86  ? 121  DG  I C6    1 
ATOM   2464  O O6    . DG  A 1 121 ? 98.927  77.425  -12.729 1.00 86.06  ? 121  DG  I O6    1 
ATOM   2465  N N1    . DG  A 1 121 ? 98.258  79.578  -13.064 1.00 85.12  ? 121  DG  I N1    1 
ATOM   2466  C C2    . DG  A 1 121 ? 97.533  80.551  -13.713 1.00 85.33  ? 121  DG  I C2    1 
ATOM   2467  N N2    . DG  A 1 121 ? 97.696  81.807  -13.273 1.00 84.28  ? 121  DG  I N2    1 
ATOM   2468  N N3    . DG  A 1 121 ? 96.710  80.311  -14.721 1.00 84.96  ? 121  DG  I N3    1 
ATOM   2469  C C4    . DG  A 1 121 ? 96.674  78.999  -15.041 1.00 84.80  ? 121  DG  I C4    1 
ATOM   2470  P P     . DG  A 1 122 ? 93.770  80.459  -20.668 1.00 51.66  ? 122  DG  I P     1 
ATOM   2471  O OP1   . DG  A 1 122 ? 92.640  81.071  -21.415 1.00 68.20  ? 122  DG  I OP1   1 
ATOM   2472  O OP2   . DG  A 1 122 ? 94.466  79.272  -21.223 1.00 68.82  ? 122  DG  I OP2   1 
ATOM   2473  O "O5'" . DG  A 1 122 ? 94.852  81.591  -20.389 1.00 53.96  ? 122  DG  I "O5'" 1 
ATOM   2474  C "C5'" . DG  A 1 122 ? 94.540  82.670  -19.507 1.00 57.96  ? 122  DG  I "C5'" 1 
ATOM   2475  C "C4'" . DG  A 1 122 ? 95.787  83.455  -19.182 1.00 60.15  ? 122  DG  I "C4'" 1 
ATOM   2476  O "O4'" . DG  A 1 122 ? 96.562  82.807  -18.141 1.00 60.79  ? 122  DG  I "O4'" 1 
ATOM   2477  C "C3'" . DG  A 1 122 ? 96.724  83.616  -20.375 1.00 61.16  ? 122  DG  I "C3'" 1 
ATOM   2478  O "O3'" . DG  A 1 122 ? 97.176  84.957  -20.449 1.00 63.05  ? 122  DG  I "O3'" 1 
ATOM   2479  C "C2'" . DG  A 1 122 ? 97.880  82.682  -20.058 1.00 61.66  ? 122  DG  I "C2'" 1 
ATOM   2480  C "C1'" . DG  A 1 122 ? 97.918  82.737  -18.546 1.00 61.90  ? 122  DG  I "C1'" 1 
ATOM   2481  N N9    . DG  A 1 122 ? 98.531  81.589  -17.885 1.00 80.91  ? 122  DG  I N9    1 
ATOM   2482  C C8    . DG  A 1 122 ? 98.483  80.267  -18.267 1.00 81.41  ? 122  DG  I C8    1 
ATOM   2483  N N7    . DG  A 1 122 ? 99.140  79.476  -17.460 1.00 80.90  ? 122  DG  I N7    1 
ATOM   2484  C C5    . DG  A 1 122 ? 99.651  80.326  -16.486 1.00 82.78  ? 122  DG  I C5    1 
ATOM   2485  C C6    . DG  A 1 122 ? 100.448 80.046  -15.337 1.00 84.50  ? 122  DG  I C6    1 
ATOM   2486  O O6    . DG  A 1 122 ? 100.882 78.952  -14.940 1.00 85.35  ? 122  DG  I O6    1 
ATOM   2487  N N1    . DG  A 1 122 ? 100.733 81.207  -14.619 1.00 84.56  ? 122  DG  I N1    1 
ATOM   2488  C C2    . DG  A 1 122 ? 100.313 82.470  -14.960 1.00 83.47  ? 122  DG  I C2    1 
ATOM   2489  N N2    . DG  A 1 122 ? 100.685 83.464  -14.140 1.00 82.80  ? 122  DG  I N2    1 
ATOM   2490  N N3    . DG  A 1 122 ? 99.580  82.742  -16.026 1.00 82.69  ? 122  DG  I N3    1 
ATOM   2491  C C4    . DG  A 1 122 ? 99.285  81.631  -16.736 1.00 81.85  ? 122  DG  I C4    1 
ATOM   2492  P P     . DT  A 1 123 ? 98.119  85.396  -21.656 1.00 72.92  ? 123  DT  I P     1 
ATOM   2493  O OP1   . DT  A 1 123 ? 97.694  86.735  -22.137 1.00 69.40  ? 123  DT  I OP1   1 
ATOM   2494  O OP2   . DT  A 1 123 ? 98.171  84.252  -22.601 1.00 70.28  ? 123  DT  I OP2   1 
ATOM   2495  O "O5'" . DT  A 1 123 ? 99.538  85.517  -20.951 1.00 78.81  ? 123  DT  I "O5'" 1 
ATOM   2496  C "C5'" . DT  A 1 123 ? 99.685  86.257  -19.741 1.00 85.21  ? 123  DT  I "C5'" 1 
ATOM   2497  C "C4'" . DT  A 1 123 ? 101.118 86.196  -19.274 1.00 90.65  ? 123  DT  I "C4'" 1 
ATOM   2498  O "O4'" . DT  A 1 123 ? 101.379 84.929  -18.620 1.00 90.64  ? 123  DT  I "O4'" 1 
ATOM   2499  C "C3'" . DT  A 1 123 ? 102.123 86.304  -20.423 1.00 94.68  ? 123  DT  I "C3'" 1 
ATOM   2500  O "O3'" . DT  A 1 123 ? 103.215 87.145  -20.058 1.00 101.94 ? 123  DT  I "O3'" 1 
ATOM   2501  C "C2'" . DT  A 1 123 ? 102.601 84.876  -20.609 1.00 93.69  ? 123  DT  I "C2'" 1 
ATOM   2502  C "C1'" . DT  A 1 123 ? 102.541 84.349  -19.188 1.00 91.71  ? 123  DT  I "C1'" 1 
ATOM   2503  N N1    . DT  A 1 123 ? 102.450 82.876  -19.054 1.00 87.48  ? 123  DT  I N1    1 
ATOM   2504  C C2    . DT  A 1 123 ? 102.641 82.330  -17.804 1.00 86.49  ? 123  DT  I C2    1 
ATOM   2505  O O2    . DT  A 1 123 ? 102.828 83.003  -16.803 1.00 85.92  ? 123  DT  I O2    1 
ATOM   2506  N N3    . DT  A 1 123 ? 102.603 80.958  -17.767 1.00 85.87  ? 123  DT  I N3    1 
ATOM   2507  C C4    . DT  A 1 123 ? 102.388 80.100  -18.827 1.00 86.16  ? 123  DT  I C4    1 
ATOM   2508  O O4    . DT  A 1 123 ? 102.399 78.885  -18.644 1.00 85.73  ? 123  DT  I O4    1 
ATOM   2509  C C5    . DT  A 1 123 ? 102.168 80.740  -20.102 1.00 86.52  ? 123  DT  I C5    1 
ATOM   2510  C C7    . DT  A 1 123 ? 101.911 79.888  -21.305 1.00 87.32  ? 123  DT  I C7    1 
ATOM   2511  C C6    . DT  A 1 123 ? 102.206 82.078  -20.151 1.00 86.87  ? 123  DT  I C6    1 
ATOM   2512  P P     . DA  A 1 124 ? 103.639 88.356  -21.023 1.00 145.65 ? 124  DA  I P     1 
ATOM   2513  O OP1   . DA  A 1 124 ? 102.567 89.384  -21.005 1.00 96.00  ? 124  DA  I OP1   1 
ATOM   2514  O OP2   . DA  A 1 124 ? 104.072 87.770  -22.315 1.00 95.79  ? 124  DA  I OP2   1 
ATOM   2515  O "O5'" . DA  A 1 124 ? 104.919 88.963  -20.305 1.00 149.76 ? 124  DA  I "O5'" 1 
ATOM   2516  C "C5'" . DA  A 1 124 ? 104.960 89.118  -18.889 1.00 158.05 ? 124  DA  I "C5'" 1 
ATOM   2517  C "C4'" . DA  A 1 124 ? 106.259 88.566  -18.355 1.00 163.35 ? 124  DA  I "C4'" 1 
ATOM   2518  O "O4'" . DA  A 1 124 ? 106.158 87.133  -18.164 1.00 163.68 ? 124  DA  I "O4'" 1 
ATOM   2519  C "C3'" . DA  A 1 124 ? 107.426 88.789  -19.317 1.00 166.88 ? 124  DA  I "C3'" 1 
ATOM   2520  O "O3'" . DA  A 1 124 ? 108.607 89.166  -18.616 1.00 172.69 ? 124  DA  I "O3'" 1 
ATOM   2521  C "C2'" . DA  A 1 124 ? 107.614 87.431  -19.967 1.00 165.83 ? 124  DA  I "C2'" 1 
ATOM   2522  C "C1'" . DA  A 1 124 ? 107.218 86.486  -18.849 1.00 164.29 ? 124  DA  I "C1'" 1 
ATOM   2523  N N9    . DA  A 1 124 ? 106.739 85.181  -19.305 1.00 113.16 ? 124  DA  I N9    1 
ATOM   2524  C C8    . DA  A 1 124 ? 106.176 84.866  -20.519 1.00 113.57 ? 124  DA  I C8    1 
ATOM   2525  N N7    . DA  A 1 124 ? 105.868 83.598  -20.647 1.00 113.02 ? 124  DA  I N7    1 
ATOM   2526  C C5    . DA  A 1 124 ? 106.246 83.039  -19.433 1.00 111.57 ? 124  DA  I C5    1 
ATOM   2527  C C6    . DA  A 1 124 ? 106.182 81.724  -18.936 1.00 110.61 ? 124  DA  I C6    1 
ATOM   2528  N N6    . DA  A 1 124 ? 105.695 80.694  -19.630 1.00 109.27 ? 124  DA  I N6    1 
ATOM   2529  N N1    . DA  A 1 124 ? 106.643 81.502  -17.685 1.00 109.74 ? 124  DA  I N1    1 
ATOM   2530  C C2    . DA  A 1 124 ? 107.132 82.539  -16.990 1.00 110.19 ? 124  DA  I C2    1 
ATOM   2531  N N3    . DA  A 1 124 ? 107.245 83.818  -17.347 1.00 111.15 ? 124  DA  I N3    1 
ATOM   2532  C C4    . DA  A 1 124 ? 106.779 84.004  -18.595 1.00 112.08 ? 124  DA  I C4    1 
ATOM   2533  P P     . DG  A 1 125 ? 109.727 90.033  -19.371 1.00 189.60 ? 125  DG  I P     1 
ATOM   2534  O OP1   . DG  A 1 125 ? 109.735 91.386  -18.753 1.00 132.22 ? 125  DG  I OP1   1 
ATOM   2535  O OP2   . DG  A 1 125 ? 109.514 89.892  -20.836 1.00 131.89 ? 125  DG  I OP2   1 
ATOM   2536  O "O5'" . DG  A 1 125 ? 111.082 89.292  -18.992 1.00 192.01 ? 125  DG  I "O5'" 1 
ATOM   2537  C "C5'" . DG  A 1 125 ? 111.330 88.871  -17.654 1.00 198.60 ? 125  DG  I "C5'" 1 
ATOM   2538  C "C4'" . DG  A 1 125 ? 112.127 87.589  -17.655 1.00 200.00 ? 125  DG  I "C4'" 1 
ATOM   2539  O "O4'" . DG  A 1 125 ? 111.299 86.503  -18.142 1.00 200.00 ? 125  DG  I "O4'" 1 
ATOM   2540  C "C3'" . DG  A 1 125 ? 113.357 87.623  -18.564 1.00 200.00 ? 125  DG  I "C3'" 1 
ATOM   2541  O "O3'" . DG  A 1 125 ? 114.445 86.935  -17.941 1.00 200.00 ? 125  DG  I "O3'" 1 
ATOM   2542  C "C2'" . DG  A 1 125 ? 112.896 86.881  -19.804 1.00 200.00 ? 125  DG  I "C2'" 1 
ATOM   2543  C "C1'" . DG  A 1 125 ? 111.962 85.848  -19.212 1.00 200.00 ? 125  DG  I "C1'" 1 
ATOM   2544  N N9    . DG  A 1 125 ? 110.954 85.345  -20.139 1.00 145.75 ? 125  DG  I N9    1 
ATOM   2545  C C8    . DG  A 1 125 ? 110.338 86.035  -21.157 1.00 145.99 ? 125  DG  I C8    1 
ATOM   2546  N N7    . DG  A 1 125 ? 109.498 85.303  -21.837 1.00 145.57 ? 125  DG  I N7    1 
ATOM   2547  C C5    . DG  A 1 125 ? 109.558 84.055  -21.229 1.00 144.96 ? 125  DG  I C5    1 
ATOM   2548  C C6    . DG  A 1 125 ? 108.870 82.846  -21.530 1.00 144.19 ? 125  DG  I C6    1 
ATOM   2549  O O6    . DG  A 1 125 ? 108.045 82.628  -22.428 1.00 142.91 ? 125  DG  I O6    1 
ATOM   2550  N N1    . DG  A 1 125 ? 109.230 81.824  -20.656 1.00 143.82 ? 125  DG  I N1    1 
ATOM   2551  C C2    . DG  A 1 125 ? 110.132 81.943  -19.627 1.00 144.02 ? 125  DG  I C2    1 
ATOM   2552  N N2    . DG  A 1 125 ? 110.341 80.840  -18.891 1.00 143.54 ? 125  DG  I N2    1 
ATOM   2553  N N3    . DG  A 1 125 ? 110.780 83.060  -19.338 1.00 144.96 ? 125  DG  I N3    1 
ATOM   2554  C C4    . DG  A 1 125 ? 110.447 84.068  -20.174 1.00 145.42 ? 125  DG  I C4    1 
ATOM   2555  P P     . DA  A 1 126 ? 115.725 86.511  -18.815 1.00 168.74 ? 126  DA  I P     1 
ATOM   2556  O OP1   . DA  A 1 126 ? 116.917 86.643  -17.939 1.00 180.54 ? 126  DA  I OP1   1 
ATOM   2557  O OP2   . DA  A 1 126 ? 115.685 87.233  -20.113 1.00 180.40 ? 126  DA  I OP2   1 
ATOM   2558  O "O5'" . DA  A 1 126 ? 115.482 84.961  -19.092 1.00 171.23 ? 126  DA  I "O5'" 1 
ATOM   2559  C "C5'" . DA  A 1 126 ? 115.533 84.020  -18.023 1.00 174.62 ? 126  DA  I "C5'" 1 
ATOM   2560  C "C4'" . DA  A 1 126 ? 115.890 82.649  -18.547 1.00 177.13 ? 126  DA  I "C4'" 1 
ATOM   2561  O "O4'" . DA  A 1 126 ? 114.727 81.992  -19.111 1.00 178.08 ? 126  DA  I "O4'" 1 
ATOM   2562  C "C3'" . DA  A 1 126 ? 116.955 82.648  -19.646 1.00 178.05 ? 126  DA  I "C3'" 1 
ATOM   2563  O "O3'" . DA  A 1 126 ? 117.880 81.578  -19.424 1.00 178.80 ? 126  DA  I "O3'" 1 
ATOM   2564  C "C2'" . DA  A 1 126 ? 116.147 82.413  -20.909 1.00 179.35 ? 126  DA  I "C2'" 1 
ATOM   2565  C "C1'" . DA  A 1 126 ? 115.059 81.493  -20.396 1.00 179.62 ? 126  DA  I "C1'" 1 
ATOM   2566  N N9    . DA  A 1 126 ? 113.844 81.458  -21.212 1.00 192.75 ? 126  DA  I N9    1 
ATOM   2567  C C8    . DA  A 1 126 ? 113.309 82.459  -21.987 1.00 193.12 ? 126  DA  I C8    1 
ATOM   2568  N N7    . DA  A 1 126 ? 112.217 82.109  -22.623 1.00 193.64 ? 126  DA  I N7    1 
ATOM   2569  C C5    . DA  A 1 126 ? 112.015 80.790  -22.238 1.00 193.65 ? 126  DA  I C5    1 
ATOM   2570  C C6    . DA  A 1 126 ? 111.022 79.849  -22.566 1.00 193.77 ? 126  DA  I C6    1 
ATOM   2571  N N6    . DA  A 1 126 ? 110.006 80.101  -23.395 1.00 193.83 ? 126  DA  I N6    1 
ATOM   2572  N N1    . DA  A 1 126 ? 111.111 78.622  -22.007 1.00 193.75 ? 126  DA  I N1    1 
ATOM   2573  C C2    . DA  A 1 126 ? 112.131 78.369  -21.177 1.00 193.55 ? 126  DA  I C2    1 
ATOM   2574  N N3    . DA  A 1 126 ? 113.124 79.167  -20.793 1.00 193.29 ? 126  DA  I N3    1 
ATOM   2575  C C4    . DA  A 1 126 ? 113.006 80.378  -21.365 1.00 193.34 ? 126  DA  I C4    1 
ATOM   2576  P P     . DA  A 1 127 ? 118.593 80.862  -20.675 1.00 199.20 ? 127  DA  I P     1 
ATOM   2577  O OP1   . DA  A 1 127 ? 119.796 80.148  -20.175 1.00 170.64 ? 127  DA  I OP1   1 
ATOM   2578  O OP2   . DA  A 1 127 ? 118.736 81.862  -21.766 1.00 170.69 ? 127  DA  I OP2   1 
ATOM   2579  O "O5'" . DA  A 1 127 ? 117.524 79.770  -21.121 1.00 198.31 ? 127  DA  I "O5'" 1 
ATOM   2580  C "C5'" . DA  A 1 127 ? 117.098 78.763  -20.204 1.00 196.90 ? 127  DA  I "C5'" 1 
ATOM   2581  C "C4'" . DA  A 1 127 ? 117.030 77.423  -20.896 1.00 195.23 ? 127  DA  I "C4'" 1 
ATOM   2582  O "O4'" . DA  A 1 127 ? 115.777 77.289  -21.613 1.00 194.83 ? 127  DA  I "O4'" 1 
ATOM   2583  C "C3'" . DA  A 1 127 ? 118.142 77.210  -21.922 1.00 194.42 ? 127  DA  I "C3'" 1 
ATOM   2584  O "O3'" . DA  A 1 127 ? 118.683 75.891  -21.817 1.00 193.04 ? 127  DA  I "O3'" 1 
ATOM   2585  C "C2'" . DA  A 1 127 ? 117.443 77.427  -23.254 1.00 194.26 ? 127  DA  I "C2'" 1 
ATOM   2586  C "C1'" . DA  A 1 127 ? 116.026 76.958  -22.971 1.00 194.22 ? 127  DA  I "C1'" 1 
ATOM   2587  N N9    . DA  A 1 127 ? 114.999 77.605  -23.792 1.00 164.01 ? 127  DA  I N9    1 
ATOM   2588  C C8    . DA  A 1 127 ? 114.968 78.911  -24.221 1.00 164.11 ? 127  DA  I C8    1 
ATOM   2589  N N7    . DA  A 1 127 ? 113.920 79.205  -24.952 1.00 163.55 ? 127  DA  I N7    1 
ATOM   2590  C C5    . DA  A 1 127 ? 113.209 78.014  -25.010 1.00 162.71 ? 127  DA  I C5    1 
ATOM   2591  C C6    . DA  A 1 127 ? 111.998 77.665  -25.635 1.00 162.01 ? 127  DA  I C6    1 
ATOM   2592  N N6    . DA  A 1 127 ? 111.261 78.518  -26.351 1.00 160.95 ? 127  DA  I N6    1 
ATOM   2593  N N1    . DA  A 1 127 ? 111.564 76.394  -25.498 1.00 161.50 ? 127  DA  I N1    1 
ATOM   2594  C C2    . DA  A 1 127 ? 112.303 75.539  -24.780 1.00 161.65 ? 127  DA  I C2    1 
ATOM   2595  N N3    . DA  A 1 127 ? 113.457 75.747  -24.145 1.00 162.57 ? 127  DA  I N3    1 
ATOM   2596  C C4    . DA  A 1 127 ? 113.861 77.020  -24.300 1.00 163.17 ? 127  DA  I C4    1 
ATOM   2597  P P     . DT  A 1 128 ? 119.498 75.264  -23.051 1.00 194.44 ? 128  DT  I P     1 
ATOM   2598  O OP1   . DT  A 1 128 ? 120.338 74.157  -22.527 1.00 170.93 ? 128  DT  I OP1   1 
ATOM   2599  O OP2   . DT  A 1 128 ? 120.132 76.369  -23.816 1.00 171.05 ? 128  DT  I OP2   1 
ATOM   2600  O "O5'" . DT  A 1 128 ? 118.337 74.632  -23.936 1.00 193.61 ? 128  DT  I "O5'" 1 
ATOM   2601  C "C5'" . DT  A 1 128 ? 117.274 73.918  -23.309 1.00 192.92 ? 128  DT  I "C5'" 1 
ATOM   2602  C "C4'" . DT  A 1 128 ? 116.419 73.228  -24.344 1.00 191.37 ? 128  DT  I "C4'" 1 
ATOM   2603  O "O4'" . DT  A 1 128 ? 115.496 74.160  -24.960 1.00 192.66 ? 128  DT  I "O4'" 1 
ATOM   2604  C "C3'" . DT  A 1 128 ? 117.204 72.579  -25.483 1.00 189.42 ? 128  DT  I "C3'" 1 
ATOM   2605  O "O3'" . DT  A 1 128 ? 116.650 71.294  -25.755 1.00 184.16 ? 128  DT  I "O3'" 1 
ATOM   2606  C "C2'" . DT  A 1 128 ? 116.976 73.524  -26.651 1.00 191.30 ? 128  DT  I "C2'" 1 
ATOM   2607  C "C1'" . DT  A 1 128 ? 115.576 74.039  -26.370 1.00 193.60 ? 128  DT  I "C1'" 1 
ATOM   2608  N N1    . DT  A 1 128 ? 115.255 75.353  -26.963 1.00 172.34 ? 128  DT  I N1    1 
ATOM   2609  C C2    . DT  A 1 128 ? 114.022 75.505  -27.562 1.00 173.08 ? 128  DT  I C2    1 
ATOM   2610  O O2    . DT  A 1 128 ? 113.194 74.611  -27.619 1.00 173.64 ? 128  DT  I O2    1 
ATOM   2611  N N3    . DT  A 1 128 ? 113.792 76.751  -28.092 1.00 173.46 ? 128  DT  I N3    1 
ATOM   2612  C C4    . DT  A 1 128 ? 114.650 77.834  -28.084 1.00 173.45 ? 128  DT  I C4    1 
ATOM   2613  O O4    . DT  A 1 128 ? 114.303 78.893  -28.600 1.00 173.05 ? 128  DT  I O4    1 
ATOM   2614  C C5    . DT  A 1 128 ? 115.924 77.605  -27.440 1.00 173.45 ? 128  DT  I C5    1 
ATOM   2615  C C7    . DT  A 1 128 ? 116.917 78.722  -27.384 1.00 173.67 ? 128  DT  I C7    1 
ATOM   2616  C C6    . DT  A 1 128 ? 116.159 76.393  -26.919 1.00 173.07 ? 128  DT  I C6    1 
ATOM   2617  P P     . DC  A 1 129 ? 117.327 70.347  -26.860 1.00 174.77 ? 129  DC  I P     1 
ATOM   2618  O OP1   . DC  A 1 129 ? 117.763 69.105  -26.171 1.00 154.50 ? 129  DC  I OP1   1 
ATOM   2619  O OP2   . DC  A 1 129 ? 118.310 71.135  -27.648 1.00 154.61 ? 129  DC  I OP2   1 
ATOM   2620  O "O5'" . DC  A 1 129 ? 116.093 69.991  -27.796 1.00 170.62 ? 129  DC  I "O5'" 1 
ATOM   2621  C "C5'" . DC  A 1 129 ? 114.793 69.841  -27.232 1.00 163.70 ? 129  DC  I "C5'" 1 
ATOM   2622  C "C4'" . DC  A 1 129 ? 113.732 70.032  -28.288 1.00 157.80 ? 129  DC  I "C4'" 1 
ATOM   2623  O "O4'" . DC  A 1 129 ? 113.614 71.428  -28.660 1.00 157.45 ? 129  DC  I "O4'" 1 
ATOM   2624  C "C3'" . DC  A 1 129 ? 113.985 69.264  -29.583 1.00 153.86 ? 129  DC  I "C3'" 1 
ATOM   2625  O "O3'" . DC  A 1 129 ? 112.765 68.677  -30.028 1.00 146.45 ? 129  DC  I "O3'" 1 
ATOM   2626  C "C2'" . DC  A 1 129 ? 114.449 70.340  -30.551 1.00 154.45 ? 129  DC  I "C2'" 1 
ATOM   2627  C "C1'" . DC  A 1 129 ? 113.663 71.546  -30.073 1.00 156.42 ? 129  DC  I "C1'" 1 
ATOM   2628  N N1    . DC  A 1 129 ? 114.255 72.853  -30.404 1.00 136.13 ? 129  DC  I N1    1 
ATOM   2629  C C2    . DC  A 1 129 ? 113.545 73.720  -31.244 1.00 136.06 ? 129  DC  I C2    1 
ATOM   2630  O O2    . DC  A 1 129 ? 112.444 73.359  -31.687 1.00 135.89 ? 129  DC  I O2    1 
ATOM   2631  N N3    . DC  A 1 129 ? 114.075 74.926  -31.552 1.00 135.63 ? 129  DC  I N3    1 
ATOM   2632  C C4    . DC  A 1 129 ? 115.263 75.277  -31.057 1.00 135.40 ? 129  DC  I C4    1 
ATOM   2633  N N4    . DC  A 1 129 ? 115.747 76.476  -31.387 1.00 134.68 ? 129  DC  I N4    1 
ATOM   2634  C C5    . DC  A 1 129 ? 116.008 74.415  -30.200 1.00 135.80 ? 129  DC  I C5    1 
ATOM   2635  C C6    . DC  A 1 129 ? 115.471 73.223  -29.902 1.00 136.20 ? 129  DC  I C6    1 
ATOM   2636  P P     . DT  A 1 130 ? 112.796 67.564  -31.180 1.00 114.11 ? 130  DT  I P     1 
ATOM   2637  O OP1   . DT  A 1 130 ? 111.838 66.485  -30.821 1.00 133.35 ? 130  DT  I OP1   1 
ATOM   2638  O OP2   . DT  A 1 130 ? 114.217 67.227  -31.445 1.00 133.76 ? 130  DT  I OP2   1 
ATOM   2639  O "O5'" . DT  A 1 130 ? 112.234 68.346  -32.446 1.00 109.76 ? 130  DT  I "O5'" 1 
ATOM   2640  C "C5'" . DT  A 1 130 ? 110.914 68.880  -32.443 1.00 99.84  ? 130  DT  I "C5'" 1 
ATOM   2641  C "C4'" . DT  A 1 130 ? 110.621 69.539  -33.769 1.00 93.24  ? 130  DT  I "C4'" 1 
ATOM   2642  O "O4'" . DT  A 1 130 ? 111.220 70.856  -33.836 1.00 92.04  ? 130  DT  I "O4'" 1 
ATOM   2643  C "C3'" . DT  A 1 130 ? 111.157 68.765  -34.975 1.00 88.87  ? 130  DT  I "C3'" 1 
ATOM   2644  O "O3'" . DT  A 1 130 ? 110.211 68.836  -36.034 1.00 82.03  ? 130  DT  I "O3'" 1 
ATOM   2645  C "C2'" . DT  A 1 130 ? 112.395 69.552  -35.366 1.00 90.20  ? 130  DT  I "C2'" 1 
ATOM   2646  C "C1'" . DT  A 1 130 ? 111.958 70.966  -35.039 1.00 91.65  ? 130  DT  I "C1'" 1 
ATOM   2647  N N1    . DT  A 1 130 ? 113.044 71.936  -34.822 1.00 112.35 ? 130  DT  I N1    1 
ATOM   2648  C C2    . DT  A 1 130 ? 112.942 73.154  -35.451 1.00 112.59 ? 130  DT  I C2    1 
ATOM   2649  O O2    . DT  A 1 130 ? 112.007 73.451  -36.171 1.00 111.96 ? 130  DT  I O2    1 
ATOM   2650  N N3    . DT  A 1 130 ? 113.981 74.016  -35.204 1.00 113.39 ? 130  DT  I N3    1 
ATOM   2651  C C4    . DT  A 1 130 ? 115.085 73.785  -34.406 1.00 113.68 ? 130  DT  I C4    1 
ATOM   2652  O O4    . DT  A 1 130 ? 115.936 74.661  -34.271 1.00 113.63 ? 130  DT  I O4    1 
ATOM   2653  C C5    . DT  A 1 130 ? 115.129 72.480  -33.778 1.00 113.66 ? 130  DT  I C5    1 
ATOM   2654  C C7    . DT  A 1 130 ? 116.288 72.133  -32.899 1.00 114.21 ? 130  DT  I C7    1 
ATOM   2655  C C6    . DT  A 1 130 ? 114.119 71.634  -34.016 1.00 113.23 ? 130  DT  I C6    1 
ATOM   2656  P P     . DG  A 1 131 ? 109.285 67.572  -36.358 1.00 77.53  ? 131  DG  I P     1 
ATOM   2657  O OP1   . DG  A 1 131 ? 108.664 67.102  -35.092 1.00 85.23  ? 131  DG  I OP1   1 
ATOM   2658  O OP2   . DG  A 1 131 ? 110.075 66.625  -37.184 1.00 85.77  ? 131  DG  I OP2   1 
ATOM   2659  O "O5'" . DG  A 1 131 ? 108.150 68.206  -37.279 1.00 75.80  ? 131  DG  I "O5'" 1 
ATOM   2660  C "C5'" . DG  A 1 131 ? 107.281 69.222  -36.777 1.00 68.66  ? 131  DG  I "C5'" 1 
ATOM   2661  C "C4'" . DG  A 1 131 ? 107.079 70.305  -37.813 1.00 65.34  ? 131  DG  I "C4'" 1 
ATOM   2662  O "O4'" . DG  A 1 131 ? 108.240 71.166  -37.888 1.00 62.35  ? 131  DG  I "O4'" 1 
ATOM   2663  C "C3'" . DG  A 1 131 ? 106.820 69.818  -39.238 1.00 62.94  ? 131  DG  I "C3'" 1 
ATOM   2664  O "O3'" . DG  A 1 131 ? 105.839 70.663  -39.846 1.00 61.33  ? 131  DG  I "O3'" 1 
ATOM   2665  C "C2'" . DG  A 1 131 ? 108.181 69.947  -39.908 1.00 61.59  ? 131  DG  I "C2'" 1 
ATOM   2666  C "C1'" . DG  A 1 131 ? 108.820 71.128  -39.190 1.00 61.38  ? 131  DG  I "C1'" 1 
ATOM   2667  N N9    . DG  A 1 131 ? 110.263 71.015  -38.998 1.00 69.45  ? 131  DG  I N9    1 
ATOM   2668  C C8    . DG  A 1 131 ? 110.970 69.870  -38.715 1.00 68.19  ? 131  DG  I C8    1 
ATOM   2669  N N7    . DG  A 1 131 ? 112.233 70.094  -38.480 1.00 68.01  ? 131  DG  I N7    1 
ATOM   2670  C C5    . DG  A 1 131 ? 112.376 71.464  -38.638 1.00 69.27  ? 131  DG  I C5    1 
ATOM   2671  C C6    . DG  A 1 131 ? 113.517 72.295  -38.479 1.00 69.96  ? 131  DG  I C6    1 
ATOM   2672  O O6    . DG  A 1 131 ? 114.653 71.981  -38.112 1.00 71.31  ? 131  DG  I O6    1 
ATOM   2673  N N1    . DG  A 1 131 ? 113.227 73.624  -38.768 1.00 69.54  ? 131  DG  I N1    1 
ATOM   2674  C C2    . DG  A 1 131 ? 111.993 74.099  -39.135 1.00 69.02  ? 131  DG  I C2    1 
ATOM   2675  N N2    . DG  A 1 131 ? 111.920 75.415  -39.385 1.00 68.29  ? 131  DG  I N2    1 
ATOM   2676  N N3    . DG  A 1 131 ? 110.914 73.341  -39.253 1.00 69.02  ? 131  DG  I N3    1 
ATOM   2677  C C4    . DG  A 1 131 ? 111.177 72.043  -38.994 1.00 68.80  ? 131  DG  I C4    1 
ATOM   2678  P P     . DC  A 1 132 ? 105.351 70.384  -41.356 1.00 64.68  ? 132  DC  I P     1 
ATOM   2679  O OP1   . DC  A 1 132 ? 103.947 70.864  -41.442 1.00 70.04  ? 132  DC  I OP1   1 
ATOM   2680  O OP2   . DC  A 1 132 ? 105.668 68.986  -41.740 1.00 69.65  ? 132  DC  I OP2   1 
ATOM   2681  O "O5'" . DC  A 1 132 ? 106.279 71.356  -42.210 1.00 64.23  ? 132  DC  I "O5'" 1 
ATOM   2682  C "C5'" . DC  A 1 132 ? 106.358 72.743  -41.886 1.00 65.43  ? 132  DC  I "C5'" 1 
ATOM   2683  C "C4'" . DC  A 1 132 ? 107.387 73.429  -42.754 1.00 67.04  ? 132  DC  I "C4'" 1 
ATOM   2684  O "O4'" . DC  A 1 132 ? 108.729 73.171  -42.278 1.00 67.85  ? 132  DC  I "O4'" 1 
ATOM   2685  C "C3'" . DC  A 1 132 ? 107.374 73.004  -44.224 1.00 67.96  ? 132  DC  I "C3'" 1 
ATOM   2686  O "O3'" . DC  A 1 132 ? 107.688 74.137  -45.028 1.00 69.10  ? 132  DC  I "O3'" 1 
ATOM   2687  C "C2'" . DC  A 1 132 ? 108.543 72.041  -44.306 1.00 68.62  ? 132  DC  I "C2'" 1 
ATOM   2688  C "C1'" . DC  A 1 132 ? 109.519 72.732  -43.374 1.00 68.56  ? 132  DC  I "C1'" 1 
ATOM   2689  N N1    . DC  A 1 132 ? 110.630 71.916  -42.852 1.00 73.46  ? 132  DC  I N1    1 
ATOM   2690  C C2    . DC  A 1 132 ? 111.766 72.575  -42.368 1.00 73.86  ? 132  DC  I C2    1 
ATOM   2691  O O2    . DC  A 1 132 ? 111.799 73.818  -42.399 1.00 73.79  ? 132  DC  I O2    1 
ATOM   2692  N N3    . DC  A 1 132 ? 112.796 71.848  -41.883 1.00 73.77  ? 132  DC  I N3    1 
ATOM   2693  C C4    . DC  A 1 132 ? 112.727 70.515  -41.874 1.00 73.60  ? 132  DC  I C4    1 
ATOM   2694  N N4    . DC  A 1 132 ? 113.772 69.841  -41.385 1.00 74.35  ? 132  DC  I N4    1 
ATOM   2695  C C5    . DC  A 1 132 ? 111.585 69.816  -42.365 1.00 72.91  ? 132  DC  I C5    1 
ATOM   2696  C C6    . DC  A 1 132 ? 110.567 70.549  -42.838 1.00 73.02  ? 132  DC  I C6    1 
ATOM   2697  P P     . DA  A 1 133 ? 106.545 74.837  -45.904 1.00 75.17  ? 133  DA  I P     1 
ATOM   2698  O OP1   . DA  A 1 133 ? 105.410 75.101  -44.988 1.00 71.53  ? 133  DA  I OP1   1 
ATOM   2699  O OP2   . DA  A 1 133 ? 106.326 74.034  -47.133 1.00 70.46  ? 133  DA  I OP2   1 
ATOM   2700  O "O5'" . DA  A 1 133 ? 107.214 76.224  -46.308 1.00 77.94  ? 133  DA  I "O5'" 1 
ATOM   2701  C "C5'" . DA  A 1 133 ? 107.613 77.166  -45.305 1.00 81.24  ? 133  DA  I "C5'" 1 
ATOM   2702  C "C4'" . DA  A 1 133 ? 108.928 77.812  -45.681 1.00 83.96  ? 133  DA  I "C4'" 1 
ATOM   2703  O "O4'" . DA  A 1 133 ? 110.026 76.903  -45.441 1.00 84.49  ? 133  DA  I "O4'" 1 
ATOM   2704  C "C3'" . DA  A 1 133 ? 109.028 78.207  -47.152 1.00 86.10  ? 133  DA  I "C3'" 1 
ATOM   2705  O "O3'" . DA  A 1 133 ? 109.783 79.411  -47.295 1.00 88.75  ? 133  DA  I "O3'" 1 
ATOM   2706  C "C2'" . DA  A 1 133 ? 109.763 77.038  -47.779 1.00 85.05  ? 133  DA  I "C2'" 1 
ATOM   2707  C "C1'" . DA  A 1 133 ? 110.693 76.595  -46.661 1.00 84.38  ? 133  DA  I "C1'" 1 
ATOM   2708  N N9    . DA  A 1 133 ? 110.969 75.159  -46.650 1.00 79.77  ? 133  DA  I N9    1 
ATOM   2709  C C8    . DA  A 1 133 ? 110.215 74.143  -47.183 1.00 79.60  ? 133  DA  I C8    1 
ATOM   2710  N N7    . DA  A 1 133 ? 110.701 72.948  -46.952 1.00 79.55  ? 133  DA  I N7    1 
ATOM   2711  C C5    . DA  A 1 133 ? 111.860 73.196  -46.228 1.00 79.18  ? 133  DA  I C5    1 
ATOM   2712  C C6    . DA  A 1 133 ? 112.827 72.345  -45.669 1.00 78.73  ? 133  DA  I C6    1 
ATOM   2713  N N6    . DA  A 1 133 ? 112.774 71.014  -45.739 1.00 78.38  ? 133  DA  I N6    1 
ATOM   2714  N N1    . DA  A 1 133 ? 113.863 72.916  -45.020 1.00 79.24  ? 133  DA  I N1    1 
ATOM   2715  C C2    . DA  A 1 133 ? 113.913 74.250  -44.942 1.00 78.68  ? 133  DA  I C2    1 
ATOM   2716  N N3    . DA  A 1 133 ? 113.066 75.154  -45.418 1.00 78.92  ? 133  DA  I N3    1 
ATOM   2717  C C4    . DA  A 1 133 ? 112.047 74.555  -46.056 1.00 79.35  ? 133  DA  I C4    1 
ATOM   2718  P P     . DG  A 1 134 ? 109.384 80.459  -48.443 1.00 94.83  ? 134  DG  I P     1 
ATOM   2719  O OP1   . DG  A 1 134 ? 108.984 81.736  -47.803 1.00 85.17  ? 134  DG  I OP1   1 
ATOM   2720  O OP2   . DG  A 1 134 ? 108.452 79.777  -49.375 1.00 82.48  ? 134  DG  I OP2   1 
ATOM   2721  O "O5'" . DG  A 1 134 ? 110.738 80.688  -49.234 1.00 95.50  ? 134  DG  I "O5'" 1 
ATOM   2722  C "C5'" . DG  A 1 134 ? 111.231 79.688  -50.108 1.00 96.30  ? 134  DG  I "C5'" 1 
ATOM   2723  C "C4'" . DG  A 1 134 ? 112.679 79.408  -49.797 1.00 96.84  ? 134  DG  I "C4'" 1 
ATOM   2724  O "O4'" . DG  A 1 134 ? 112.800 78.120  -49.146 1.00 94.99  ? 134  DG  I "O4'" 1 
ATOM   2725  C "C3'" . DG  A 1 134 ? 113.551 79.341  -51.044 1.00 97.81  ? 134  DG  I "C3'" 1 
ATOM   2726  O "O3'" . DG  A 1 134 ? 114.805 79.963  -50.784 1.00 101.16 ? 134  DG  I "O3'" 1 
ATOM   2727  C "C2'" . DG  A 1 134 ? 113.695 77.855  -51.304 1.00 96.09  ? 134  DG  I "C2'" 1 
ATOM   2728  C "C1'" . DG  A 1 134 ? 113.644 77.267  -49.905 1.00 94.15  ? 134  DG  I "C1'" 1 
ATOM   2729  N N9    . DG  A 1 134 ? 113.089 75.918  -49.850 1.00 80.38  ? 134  DG  I N9    1 
ATOM   2730  C C8    . DG  A 1 134 ? 111.852 75.501  -50.284 1.00 79.65  ? 134  DG  I C8    1 
ATOM   2731  N N7    . DG  A 1 134 ? 111.648 74.224  -50.101 1.00 77.69  ? 134  DG  I N7    1 
ATOM   2732  C C5    . DG  A 1 134 ? 112.820 73.773  -49.508 1.00 78.11  ? 134  DG  I C5    1 
ATOM   2733  C C6    . DG  A 1 134 ? 113.193 72.472  -49.071 1.00 76.89  ? 134  DG  I C6    1 
ATOM   2734  O O6    . DG  A 1 134 ? 112.541 71.425  -49.121 1.00 74.84  ? 134  DG  I O6    1 
ATOM   2735  N N1    . DG  A 1 134 ? 114.474 72.464  -48.529 1.00 77.14  ? 134  DG  I N1    1 
ATOM   2736  C C2    . DG  A 1 134 ? 115.293 73.561  -48.419 1.00 78.24  ? 134  DG  I C2    1 
ATOM   2737  N N2    . DG  A 1 134 ? 116.498 73.353  -47.863 1.00 78.02  ? 134  DG  I N2    1 
ATOM   2738  N N3    . DG  A 1 134 ? 114.957 74.775  -48.821 1.00 78.96  ? 134  DG  I N3    1 
ATOM   2739  C C4    . DG  A 1 134 ? 113.717 74.808  -49.350 1.00 78.99  ? 134  DG  I C4    1 
ATOM   2740  P P     . DG  A 1 135 ? 115.648 80.568  -52.003 1.00 109.53 ? 135  DG  I P     1 
ATOM   2741  O OP1   . DG  A 1 135 ? 116.427 81.723  -51.482 1.00 97.51  ? 135  DG  I OP1   1 
ATOM   2742  O OP2   . DG  A 1 135 ? 114.736 80.757  -53.163 1.00 96.33  ? 135  DG  I OP2   1 
ATOM   2743  O "O5'" . DG  A 1 135 ? 116.661 79.392  -52.347 1.00 110.16 ? 135  DG  I "O5'" 1 
ATOM   2744  C "C5'" . DG  A 1 135 ? 117.760 79.106  -51.489 1.00 111.62 ? 135  DG  I "C5'" 1 
ATOM   2745  C "C4'" . DG  A 1 135 ? 118.544 77.939  -52.037 1.00 112.61 ? 135  DG  I "C4'" 1 
ATOM   2746  O "O4'" . DG  A 1 135 ? 117.964 76.683  -51.602 1.00 112.76 ? 135  DG  I "O4'" 1 
ATOM   2747  C "C3'" . DG  A 1 135 ? 118.551 77.902  -53.566 1.00 113.36 ? 135  DG  I "C3'" 1 
ATOM   2748  O "O3'" . DG  A 1 135 ? 119.846 77.558  -54.049 1.00 114.82 ? 135  DG  I "O3'" 1 
ATOM   2749  C "C2'" . DG  A 1 135 ? 117.559 76.802  -53.893 1.00 113.29 ? 135  DG  I "C2'" 1 
ATOM   2750  C "C1'" . DG  A 1 135 ? 117.767 75.852  -52.733 1.00 113.07 ? 135  DG  I "C1'" 1 
ATOM   2751  N N9    . DG  A 1 135 ? 116.631 74.971  -52.477 1.00 101.43 ? 135  DG  I N9    1 
ATOM   2752  C C8    . DG  A 1 135 ? 115.299 75.263  -52.645 1.00 101.53 ? 135  DG  I C8    1 
ATOM   2753  N N7    . DG  A 1 135 ? 114.516 74.246  -52.406 1.00 101.26 ? 135  DG  I N7    1 
ATOM   2754  C C5    . DG  A 1 135 ? 115.383 73.224  -52.042 1.00 100.86 ? 135  DG  I C5    1 
ATOM   2755  C C6    . DG  A 1 135 ? 115.115 71.879  -51.682 1.00 100.38 ? 135  DG  I C6    1 
ATOM   2756  O O6    . DG  A 1 135 ? 114.025 71.297  -51.628 1.00 99.75  ? 135  DG  I O6    1 
ATOM   2757  N N1    . DG  A 1 135 ? 116.284 71.193  -51.370 1.00 100.48 ? 135  DG  I N1    1 
ATOM   2758  C C2    . DG  A 1 135 ? 117.548 71.727  -51.407 1.00 100.78 ? 135  DG  I C2    1 
ATOM   2759  N N2    . DG  A 1 135 ? 118.547 70.904  -51.058 1.00 101.26 ? 135  DG  I N2    1 
ATOM   2760  N N3    . DG  A 1 135 ? 117.812 72.974  -51.758 1.00 100.98 ? 135  DG  I N3    1 
ATOM   2761  C C4    . DG  A 1 135 ? 116.690 73.661  -52.060 1.00 101.14 ? 135  DG  I C4    1 
ATOM   2762  P P     . DT  A 1 136 ? 120.037 77.156  -55.590 1.00 121.98 ? 136  DT  I P     1 
ATOM   2763  O OP1   . DT  A 1 136 ? 121.237 77.865  -56.105 1.00 96.10  ? 136  DT  I OP1   1 
ATOM   2764  O OP2   . DT  A 1 136 ? 118.734 77.310  -56.293 1.00 95.49  ? 136  DT  I OP2   1 
ATOM   2765  O "O5'" . DT  A 1 136 ? 120.370 75.604  -55.509 1.00 121.50 ? 136  DT  I "O5'" 1 
ATOM   2766  C "C5'" . DT  A 1 136 ? 121.466 75.142  -54.727 1.00 121.90 ? 136  DT  I "C5'" 1 
ATOM   2767  C "C4'" . DT  A 1 136 ? 121.886 73.771  -55.197 1.00 122.21 ? 136  DT  I "C4'" 1 
ATOM   2768  O "O4'" . DT  A 1 136 ? 120.931 72.789  -54.724 1.00 121.57 ? 136  DT  I "O4'" 1 
ATOM   2769  C "C3'" . DT  A 1 136 ? 121.907 73.654  -56.720 1.00 122.51 ? 136  DT  I "C3'" 1 
ATOM   2770  O "O3'" . DT  A 1 136 ? 123.036 72.901  -57.167 1.00 123.36 ? 136  DT  I "O3'" 1 
ATOM   2771  C "C2'" . DT  A 1 136 ? 120.607 72.942  -57.042 1.00 122.17 ? 136  DT  I "C2'" 1 
ATOM   2772  C "C1'" . DT  A 1 136 ? 120.380 72.073  -55.817 1.00 121.27 ? 136  DT  I "C1'" 1 
ATOM   2773  N N1    . DT  A 1 136 ? 118.953 71.836  -55.530 1.00 94.61  ? 136  DT  I N1    1 
ATOM   2774  C C2    . DT  A 1 136 ? 118.552 70.569  -55.170 1.00 93.89  ? 136  DT  I C2    1 
ATOM   2775  O O2    . DT  A 1 136 ? 119.325 69.635  -55.044 1.00 94.73  ? 136  DT  I O2    1 
ATOM   2776  N N3    . DT  A 1 136 ? 117.202 70.436  -54.960 1.00 92.96  ? 136  DT  I N3    1 
ATOM   2777  C C4    . DT  A 1 136 ? 116.241 71.422  -55.068 1.00 92.92  ? 136  DT  I C4    1 
ATOM   2778  O O4    . DT  A 1 136 ? 115.064 71.153  -54.858 1.00 92.87  ? 136  DT  I O4    1 
ATOM   2779  C C5    . DT  A 1 136 ? 116.735 72.727  -55.434 1.00 93.17  ? 136  DT  I C5    1 
ATOM   2780  C C7    . DT  A 1 136 ? 115.768 73.860  -55.570 1.00 93.12  ? 136  DT  I C7    1 
ATOM   2781  C C6    . DT  A 1 136 ? 118.048 72.867  -55.640 1.00 93.79  ? 136  DT  I C6    1 
ATOM   2782  P P     . DG  A 1 137 ? 123.033 72.277  -58.645 1.00 130.91 ? 137  DG  I P     1 
ATOM   2783  O OP1   . DG  A 1 137 ? 124.425 71.904  -59.008 1.00 95.67  ? 137  DG  I OP1   1 
ATOM   2784  O OP2   . DG  A 1 137 ? 122.258 73.183  -59.537 1.00 94.97  ? 137  DG  I OP2   1 
ATOM   2785  O "O5'" . DG  A 1 137 ? 122.199 70.941  -58.447 1.00 128.70 ? 137  DG  I "O5'" 1 
ATOM   2786  C "C5'" . DG  A 1 137 ? 122.662 69.930  -57.558 1.00 127.06 ? 137  DG  I "C5'" 1 
ATOM   2787  C "C4'" . DG  A 1 137 ? 122.266 68.576  -58.087 1.00 125.12 ? 137  DG  I "C4'" 1 
ATOM   2788  O "O4'" . DG  A 1 137 ? 120.869 68.337  -57.799 1.00 124.84 ? 137  DG  I "O4'" 1 
ATOM   2789  C "C3'" . DG  A 1 137 ? 122.407 68.500  -59.603 1.00 124.11 ? 137  DG  I "C3'" 1 
ATOM   2790  O "O3'" . DG  A 1 137 ? 122.851 67.210  -60.000 1.00 123.04 ? 137  DG  I "O3'" 1 
ATOM   2791  C "C2'" . DG  A 1 137 ? 121.003 68.778  -60.107 1.00 123.74 ? 137  DG  I "C2'" 1 
ATOM   2792  C "C1'" . DG  A 1 137 ? 120.126 68.211  -59.003 1.00 123.49 ? 137  DG  I "C1'" 1 
ATOM   2793  N N9    . DG  A 1 137 ? 118.866 68.927  -58.820 1.00 86.97  ? 137  DG  I N9    1 
ATOM   2794  C C8    . DG  A 1 137 ? 118.655 70.279  -58.960 1.00 86.87  ? 137  DG  I C8    1 
ATOM   2795  N N7    . DG  A 1 137 ? 117.419 70.631  -58.733 1.00 86.00  ? 137  DG  I N7    1 
ATOM   2796  C C5    . DG  A 1 137 ? 116.775 69.441  -58.424 1.00 84.30  ? 137  DG  I C5    1 
ATOM   2797  C C6    . DG  A 1 137 ? 115.425 69.195  -58.092 1.00 82.88  ? 137  DG  I C6    1 
ATOM   2798  O O6    . DG  A 1 137 ? 114.499 70.005  -58.005 1.00 81.77  ? 137  DG  I O6    1 
ATOM   2799  N N1    . DG  A 1 137 ? 115.195 67.843  -57.848 1.00 81.65  ? 137  DG  I N1    1 
ATOM   2800  C C2    . DG  A 1 137 ? 116.145 66.855  -57.917 1.00 81.77  ? 137  DG  I C2    1 
ATOM   2801  N N2    . DG  A 1 137 ? 115.730 65.609  -57.638 1.00 80.67  ? 137  DG  I N2    1 
ATOM   2802  N N3    . DG  A 1 137 ? 117.410 67.072  -58.234 1.00 83.14  ? 137  DG  I N3    1 
ATOM   2803  C C4    . DG  A 1 137 ? 117.654 68.380  -58.472 1.00 85.10  ? 137  DG  I C4    1 
ATOM   2804  P P     . DG  A 1 138 ? 123.217 66.943  -61.536 1.00 118.81 ? 138  DG  I P     1 
ATOM   2805  O OP1   . DG  A 1 138 ? 124.543 66.284  -61.590 1.00 87.66  ? 138  DG  I OP1   1 
ATOM   2806  O OP2   . DG  A 1 138 ? 122.986 68.200  -62.297 1.00 86.57  ? 138  DG  I OP2   1 
ATOM   2807  O "O5'" . DG  A 1 138 ? 122.115 65.893  -61.982 1.00 116.75 ? 138  DG  I "O5'" 1 
ATOM   2808  C "C5'" . DG  A 1 138 ? 121.684 64.880  -61.083 1.00 114.12 ? 138  DG  I "C5'" 1 
ATOM   2809  C "C4'" . DG  A 1 138 ? 120.342 64.351  -61.520 1.00 111.79 ? 138  DG  I "C4'" 1 
ATOM   2810  O "O4'" . DG  A 1 138 ? 119.285 65.283  -61.171 1.00 110.38 ? 138  DG  I "O4'" 1 
ATOM   2811  C "C3'" . DG  A 1 138 ? 120.253 64.155  -63.033 1.00 111.36 ? 138  DG  I "C3'" 1 
ATOM   2812  O "O3'" . DG  A 1 138 ? 119.556 62.949  -63.315 1.00 111.62 ? 138  DG  I "O3'" 1 
ATOM   2813  C "C2'" . DG  A 1 138 ? 119.439 65.352  -63.494 1.00 109.63 ? 138  DG  I "C2'" 1 
ATOM   2814  C "C1'" . DG  A 1 138 ? 118.498 65.542  -62.323 1.00 108.03 ? 138  DG  I "C1'" 1 
ATOM   2815  N N9    . DG  A 1 138 ? 117.911 66.877  -62.202 1.00 72.53  ? 138  DG  I N9    1 
ATOM   2816  C C8    . DG  A 1 138 ? 118.505 68.083  -62.493 1.00 71.34  ? 138  DG  I C8    1 
ATOM   2817  N N7    . DG  A 1 138 ? 117.710 69.104  -62.310 1.00 69.08  ? 138  DG  I N7    1 
ATOM   2818  C C5    . DG  A 1 138 ? 116.521 68.539  -61.868 1.00 67.89  ? 138  DG  I C5    1 
ATOM   2819  C C6    . DG  A 1 138 ? 115.284 69.149  -61.518 1.00 66.57  ? 138  DG  I C6    1 
ATOM   2820  O O6    . DG  A 1 138 ? 114.982 70.353  -61.531 1.00 65.33  ? 138  DG  I O6    1 
ATOM   2821  N N1    . DG  A 1 138 ? 114.344 68.203  -61.122 1.00 64.55  ? 138  DG  I N1    1 
ATOM   2822  C C2    . DG  A 1 138 ? 114.559 66.848  -61.068 1.00 64.64  ? 138  DG  I C2    1 
ATOM   2823  N N2    . DG  A 1 138 ? 113.527 66.099  -60.651 1.00 62.57  ? 138  DG  I N2    1 
ATOM   2824  N N3    . DG  A 1 138 ? 115.701 66.268  -61.398 1.00 66.80  ? 138  DG  I N3    1 
ATOM   2825  C C4    . DG  A 1 138 ? 116.631 67.166  -61.786 1.00 69.34  ? 138  DG  I C4    1 
ATOM   2826  P P     . DA  A 1 139 ? 119.398 62.458  -64.833 1.00 105.79 ? 139  DA  I P     1 
ATOM   2827  O OP1   . DA  A 1 139 ? 120.422 61.416  -65.108 1.00 85.57  ? 139  DA  I OP1   1 
ATOM   2828  O OP2   . DA  A 1 139 ? 119.320 63.657  -65.706 1.00 85.26  ? 139  DA  I OP2   1 
ATOM   2829  O "O5'" . DA  A 1 139 ? 117.964 61.774  -64.823 1.00 104.62 ? 139  DA  I "O5'" 1 
ATOM   2830  C "C5'" . DA  A 1 139 ? 117.454 61.189  -63.630 1.00 101.35 ? 139  DA  I "C5'" 1 
ATOM   2831  C "C4'" . DA  A 1 139 ? 115.946 61.260  -63.622 1.00 99.80  ? 139  DA  I "C4'" 1 
ATOM   2832  O "O4'" . DA  A 1 139 ? 115.505 62.613  -63.348 1.00 97.88  ? 139  DA  I "O4'" 1 
ATOM   2833  C "C3'" . DA  A 1 139 ? 115.312 60.864  -64.954 1.00 99.46  ? 139  DA  I "C3'" 1 
ATOM   2834  O "O3'" . DA  A 1 139 ? 114.157 60.058  -64.726 1.00 100.65 ? 139  DA  I "O3'" 1 
ATOM   2835  C "C2'" . DA  A 1 139 ? 114.932 62.195  -65.580 1.00 98.09  ? 139  DA  I "C2'" 1 
ATOM   2836  C "C1'" . DA  A 1 139 ? 114.606 63.041  -64.363 1.00 95.89  ? 139  DA  I "C1'" 1 
ATOM   2837  N N9    . DA  A 1 139 ? 114.783 64.484  -64.551 1.00 72.31  ? 139  DA  I N9    1 
ATOM   2838  C C8    . DA  A 1 139 ? 115.911 65.158  -64.954 1.00 71.24  ? 139  DA  I C8    1 
ATOM   2839  N N7    . DA  A 1 139 ? 115.756 66.459  -65.019 1.00 69.02  ? 139  DA  I N7    1 
ATOM   2840  C C5    . DA  A 1 139 ? 114.437 66.656  -64.635 1.00 68.46  ? 139  DA  I C5    1 
ATOM   2841  C C6    . DA  A 1 139 ? 113.656 67.816  -64.499 1.00 66.45  ? 139  DA  I C6    1 
ATOM   2842  N N6    . DA  A 1 139 ? 114.107 69.047  -64.747 1.00 64.45  ? 139  DA  I N6    1 
ATOM   2843  N N1    . DA  A 1 139 ? 112.377 67.666  -64.096 1.00 65.28  ? 139  DA  I N1    1 
ATOM   2844  C C2    . DA  A 1 139 ? 111.922 66.432  -63.853 1.00 66.41  ? 139  DA  I C2    1 
ATOM   2845  N N3    . DA  A 1 139 ? 112.555 65.265  -63.947 1.00 68.07  ? 139  DA  I N3    1 
ATOM   2846  C C4    . DA  A 1 139 ? 113.825 65.449  -64.346 1.00 69.64  ? 139  DA  I C4    1 
ATOM   2847  P P     . DT  A 1 140 ? 113.451 59.323  -65.963 1.00 122.68 ? 140  DT  I P     1 
ATOM   2848  O OP1   . DT  A 1 140 ? 112.952 58.007  -65.493 1.00 78.55  ? 140  DT  I OP1   1 
ATOM   2849  O OP2   . DT  A 1 140 ? 114.369 59.390  -67.128 1.00 77.00  ? 140  DT  I OP2   1 
ATOM   2850  O "O5'" . DT  A 1 140 ? 112.207 60.265  -66.267 1.00 121.77 ? 140  DT  I "O5'" 1 
ATOM   2851  C "C5'" . DT  A 1 140 ? 111.287 60.593  -65.233 1.00 119.89 ? 140  DT  I "C5'" 1 
ATOM   2852  C "C4'" . DT  A 1 140 ? 110.238 61.547  -65.750 1.00 117.78 ? 140  DT  I "C4'" 1 
ATOM   2853  O "O4'" . DT  A 1 140 ? 110.719 62.913  -65.765 1.00 115.84 ? 140  DT  I "O4'" 1 
ATOM   2854  C "C3'" . DT  A 1 140 ? 109.731 61.257  -67.164 1.00 116.75 ? 140  DT  I "C3'" 1 
ATOM   2855  O "O3'" . DT  A 1 140 ? 108.323 61.457  -67.169 1.00 117.52 ? 140  DT  I "O3'" 1 
ATOM   2856  C "C2'" . DT  A 1 140 ? 110.395 62.341  -67.996 1.00 114.22 ? 140  DT  I "C2'" 1 
ATOM   2857  C "C1'" . DT  A 1 140 ? 110.388 63.493  -67.013 1.00 112.75 ? 140  DT  I "C1'" 1 
ATOM   2858  N N1    . DT  A 1 140 ? 111.333 64.592  -67.279 1.00 64.89  ? 140  DT  I N1    1 
ATOM   2859  C C2    . DT  A 1 140 ? 110.873 65.883  -67.093 1.00 62.65  ? 140  DT  I C2    1 
ATOM   2860  O O2    . DT  A 1 140 ? 109.742 66.141  -66.711 1.00 62.22  ? 140  DT  I O2    1 
ATOM   2861  N N3    . DT  A 1 140 ? 111.791 66.863  -67.366 1.00 61.39  ? 140  DT  I N3    1 
ATOM   2862  C C4    . DT  A 1 140 ? 113.091 66.694  -67.788 1.00 61.39  ? 140  DT  I C4    1 
ATOM   2863  O O4    . DT  A 1 140 ? 113.799 67.681  -67.990 1.00 59.33  ? 140  DT  I O4    1 
ATOM   2864  C C5    . DT  A 1 140 ? 113.512 65.313  -67.957 1.00 61.93  ? 140  DT  I C5    1 
ATOM   2865  C C7    . DT  A 1 140 ? 114.911 65.028  -68.408 1.00 61.96  ? 140  DT  I C7    1 
ATOM   2866  C C6    . DT  A 1 140 ? 112.622 64.345  -67.697 1.00 62.37  ? 140  DT  I C6    1 
ATOM   2867  P P     . DA  A 1 141 ? 107.414 60.799  -68.314 1.00 106.78 ? 141  DA  I P     1 
ATOM   2868  O OP1   . DA  A 1 141 ? 107.003 59.456  -67.837 1.00 77.98  ? 141  DA  I OP1   1 
ATOM   2869  O OP2   . DA  A 1 141 ? 108.082 60.938  -69.635 1.00 77.04  ? 141  DA  I OP2   1 
ATOM   2870  O "O5'" . DA  A 1 141 ? 106.138 61.744  -68.272 1.00 104.88 ? 141  DA  I "O5'" 1 
ATOM   2871  C "C5'" . DA  A 1 141 ? 105.743 62.340  -67.036 1.00 102.92 ? 141  DA  I "C5'" 1 
ATOM   2872  C "C4'" . DA  A 1 141 ? 105.271 63.759  -67.252 1.00 101.15 ? 141  DA  I "C4'" 1 
ATOM   2873  O "O4'" . DA  A 1 141 ? 106.371 64.669  -67.501 1.00 99.41  ? 141  DA  I "O4'" 1 
ATOM   2874  C "C3'" . DA  A 1 141 ? 104.303 63.929  -68.416 1.00 100.18 ? 141  DA  I "C3'" 1 
ATOM   2875  O "O3'" . DA  A 1 141 ? 103.230 64.763  -68.003 1.00 99.59  ? 141  DA  I "O3'" 1 
ATOM   2876  C "C2'" . DA  A 1 141 ? 105.141 64.604  -69.489 1.00 97.77  ? 141  DA  I "C2'" 1 
ATOM   2877  C "C1'" . DA  A 1 141 ? 106.121 65.429  -68.675 1.00 96.08  ? 141  DA  I "C1'" 1 
ATOM   2878  N N9    . DA  A 1 141 ? 107.406 65.664  -69.336 1.00 65.77  ? 141  DA  I N9    1 
ATOM   2879  C C8    . DA  A 1 141 ? 108.314 64.716  -69.738 1.00 65.23  ? 141  DA  I C8    1 
ATOM   2880  N N7    . DA  A 1 141 ? 109.405 65.216  -70.265 1.00 63.75  ? 141  DA  I N7    1 
ATOM   2881  C C5    . DA  A 1 141 ? 109.202 66.586  -70.216 1.00 62.02  ? 141  DA  I C5    1 
ATOM   2882  C C6    . DA  A 1 141 ? 110.002 67.673  -70.609 1.00 61.27  ? 141  DA  I C6    1 
ATOM   2883  N N6    . DA  A 1 141 ? 111.224 67.543  -71.131 1.00 59.73  ? 141  DA  I N6    1 
ATOM   2884  N N1    . DA  A 1 141 ? 109.502 68.915  -70.437 1.00 60.01  ? 141  DA  I N1    1 
ATOM   2885  C C2    . DA  A 1 141 ? 108.285 69.043  -69.897 1.00 60.53  ? 141  DA  I C2    1 
ATOM   2886  N N3    . DA  A 1 141 ? 107.445 68.101  -69.475 1.00 61.65  ? 141  DA  I N3    1 
ATOM   2887  C C4    . DA  A 1 141 ? 107.968 66.878  -69.662 1.00 63.33  ? 141  DA  I C4    1 
ATOM   2888  P P     . DT  A 1 142 ? 102.027 65.058  -69.011 1.00 80.49  ? 142  DT  I P     1 
ATOM   2889  O OP1   . DT  A 1 142 ? 100.800 65.138  -68.183 1.00 79.50  ? 142  DT  I OP1   1 
ATOM   2890  O OP2   . DT  A 1 142 ? 102.092 64.110  -70.153 1.00 77.51  ? 142  DT  I OP2   1 
ATOM   2891  O "O5'" . DT  A 1 142 ? 102.379 66.511  -69.536 1.00 78.02  ? 142  DT  I "O5'" 1 
ATOM   2892  C "C5'" . DT  A 1 142 ? 102.739 67.524  -68.615 1.00 74.43  ? 142  DT  I "C5'" 1 
ATOM   2893  C "C4'" . DT  A 1 142 ? 102.878 68.839  -69.335 1.00 73.23  ? 142  DT  I "C4'" 1 
ATOM   2894  O "O4'" . DT  A 1 142 ? 104.202 68.967  -69.905 1.00 71.87  ? 142  DT  I "O4'" 1 
ATOM   2895  C "C3'" . DT  A 1 142 ? 101.888 69.009  -70.487 1.00 72.44  ? 142  DT  I "C3'" 1 
ATOM   2896  O "O3'" . DT  A 1 142 ? 101.304 70.305  -70.411 1.00 71.79  ? 142  DT  I "O3'" 1 
ATOM   2897  C "C2'" . DT  A 1 142 ? 102.751 68.846  -71.731 1.00 71.58  ? 142  DT  I "C2'" 1 
ATOM   2898  C "C1'" . DT  A 1 142 ? 104.105 69.355  -71.263 1.00 70.64  ? 142  DT  I "C1'" 1 
ATOM   2899  N N1    . DT  A 1 142 ? 105.277 68.798  -71.966 1.00 65.96  ? 142  DT  I N1    1 
ATOM   2900  C C2    . DT  A 1 142 ? 106.255 69.673  -72.391 1.00 64.78  ? 142  DT  I C2    1 
ATOM   2901  O O2    . DT  A 1 142 ? 106.187 70.881  -72.234 1.00 64.48  ? 142  DT  I O2    1 
ATOM   2902  N N3    . DT  A 1 142 ? 107.326 69.078  -73.011 1.00 65.20  ? 142  DT  I N3    1 
ATOM   2903  C C4    . DT  A 1 142 ? 107.510 67.729  -73.246 1.00 64.80  ? 142  DT  I C4    1 
ATOM   2904  O O4    . DT  A 1 142 ? 108.530 67.342  -73.806 1.00 67.02  ? 142  DT  I O4    1 
ATOM   2905  C C5    . DT  A 1 142 ? 106.439 66.870  -72.786 1.00 64.15  ? 142  DT  I C5    1 
ATOM   2906  C C7    . DT  A 1 142 ? 106.548 65.395  -73.005 1.00 62.82  ? 142  DT  I C7    1 
ATOM   2907  C C6    . DT  A 1 142 ? 105.390 67.441  -72.178 1.00 64.62  ? 142  DT  I C6    1 
ATOM   2908  P P     . DT  A 1 143 ? 100.141 70.716  -71.435 1.00 70.59  ? 143  DT  I P     1 
ATOM   2909  O OP1   . DT  A 1 143 ? 99.199  71.592  -70.696 1.00 68.76  ? 143  DT  I OP1   1 
ATOM   2910  O OP2   . DT  A 1 143 ? 99.634  69.490  -72.104 1.00 67.84  ? 143  DT  I OP2   1 
ATOM   2911  O "O5'" . DT  A 1 143 ? 100.929 71.614  -72.483 1.00 68.37  ? 143  DT  I "O5'" 1 
ATOM   2912  C "C5'" . DT  A 1 143 ? 101.832 72.609  -72.015 1.00 66.67  ? 143  DT  I "C5'" 1 
ATOM   2913  C "C4'" . DT  A 1 143 ? 102.628 73.180  -73.163 1.00 65.76  ? 143  DT  I "C4'" 1 
ATOM   2914  O "O4'" . DT  A 1 143 ? 103.708 72.296  -73.556 1.00 64.50  ? 143  DT  I "O4'" 1 
ATOM   2915  C "C3'" . DT  A 1 143 ? 101.803 73.441  -74.419 1.00 65.62  ? 143  DT  I "C3'" 1 
ATOM   2916  O "O3'" . DT  A 1 143 ? 102.114 74.736  -74.914 1.00 67.27  ? 143  DT  I "O3'" 1 
ATOM   2917  C "C2'" . DT  A 1 143 ? 102.268 72.362  -75.386 1.00 64.55  ? 143  DT  I "C2'" 1 
ATOM   2918  C "C1'" . DT  A 1 143 ? 103.715 72.168  -74.968 1.00 62.96  ? 143  DT  I "C1'" 1 
ATOM   2919  N N1    . DT  A 1 143 ? 104.333 70.861  -75.319 1.00 57.23  ? 143  DT  I N1    1 
ATOM   2920  C C2    . DT  A 1 143 ? 105.627 70.875  -75.801 1.00 56.14  ? 143  DT  I C2    1 
ATOM   2921  O O2    . DT  A 1 143 ? 106.259 71.903  -75.983 1.00 55.66  ? 143  DT  I O2    1 
ATOM   2922  N N3    . DT  A 1 143 ? 106.152 69.633  -76.074 1.00 55.16  ? 143  DT  I N3    1 
ATOM   2923  C C4    . DT  A 1 143 ? 105.521 68.412  -75.935 1.00 55.63  ? 143  DT  I C4    1 
ATOM   2924  O O4    . DT  A 1 143 ? 106.117 67.378  -76.206 1.00 57.55  ? 143  DT  I O4    1 
ATOM   2925  C C5    . DT  A 1 143 ? 104.162 68.471  -75.458 1.00 55.44  ? 143  DT  I C5    1 
ATOM   2926  C C7    . DT  A 1 143 ? 103.395 67.194  -75.320 1.00 52.79  ? 143  DT  I C7    1 
ATOM   2927  C C6    . DT  A 1 143 ? 103.644 69.674  -75.167 1.00 56.05  ? 143  DT  I C6    1 
ATOM   2928  P P     . DG  A 1 144 ? 101.159 75.420  -76.003 1.00 69.86  ? 144  DG  I P     1 
ATOM   2929  O OP1   . DG  A 1 144 ? 100.881 76.814  -75.571 1.00 59.12  ? 144  DG  I OP1   1 
ATOM   2930  O OP2   . DG  A 1 144 ? 100.034 74.499  -76.292 1.00 58.72  ? 144  DG  I OP2   1 
ATOM   2931  O "O5'" . DG  A 1 144 ? 102.098 75.488  -77.282 1.00 71.75  ? 144  DG  I "O5'" 1 
ATOM   2932  C "C5'" . DG  A 1 144 ? 103.331 76.197  -77.223 1.00 75.01  ? 144  DG  I "C5'" 1 
ATOM   2933  C "C4'" . DG  A 1 144 ? 104.166 75.880  -78.438 1.00 76.89  ? 144  DG  I "C4'" 1 
ATOM   2934  O "O4'" . DG  A 1 144 ? 104.682 74.528  -78.348 1.00 75.65  ? 144  DG  I "O4'" 1 
ATOM   2935  C "C3'" . DG  A 1 144 ? 103.379 75.944  -79.748 1.00 78.76  ? 144  DG  I "C3'" 1 
ATOM   2936  O "O3'" . DG  A 1 144 ? 104.201 76.503  -80.770 1.00 83.64  ? 144  DG  I "O3'" 1 
ATOM   2937  C "C2'" . DG  A 1 144 ? 103.096 74.485  -80.052 1.00 76.12  ? 144  DG  I "C2'" 1 
ATOM   2938  C "C1'" . DG  A 1 144 ? 104.380 73.863  -79.556 1.00 74.05  ? 144  DG  I "C1'" 1 
ATOM   2939  N N9    . DG  A 1 144 ? 104.375 72.424  -79.317 1.00 62.08  ? 144  DG  I N9    1 
ATOM   2940  C C8    . DG  A 1 144 ? 103.332 71.618  -78.925 1.00 60.26  ? 144  DG  I C8    1 
ATOM   2941  N N7    . DG  A 1 144 ? 103.657 70.353  -78.871 1.00 58.34  ? 144  DG  I N7    1 
ATOM   2942  C C5    . DG  A 1 144 ? 104.998 70.330  -79.237 1.00 58.69  ? 144  DG  I C5    1 
ATOM   2943  C C6    . DG  A 1 144 ? 105.902 69.238  -79.382 1.00 58.53  ? 144  DG  I C6    1 
ATOM   2944  O O6    . DG  A 1 144 ? 105.688 68.026  -79.207 1.00 57.47  ? 144  DG  I O6    1 
ATOM   2945  N N1    . DG  A 1 144 ? 107.168 69.672  -79.776 1.00 57.29  ? 144  DG  I N1    1 
ATOM   2946  C C2    . DG  A 1 144 ? 107.522 70.986  -79.996 1.00 59.65  ? 144  DG  I C2    1 
ATOM   2947  N N2    . DG  A 1 144 ? 108.795 71.220  -80.364 1.00 58.89  ? 144  DG  I N2    1 
ATOM   2948  N N3    . DG  A 1 144 ? 106.689 72.004  -79.864 1.00 59.29  ? 144  DG  I N3    1 
ATOM   2949  C C4    . DG  A 1 144 ? 105.456 71.604  -79.492 1.00 60.00  ? 144  DG  I C4    1 
ATOM   2950  P P     . DA  A 1 145 ? 103.544 76.943  -82.166 1.00 102.87 ? 145  DA  I P     1 
ATOM   2951  O OP1   . DA  A 1 145 ? 103.155 78.372  -82.085 1.00 75.22  ? 145  DA  I OP1   1 
ATOM   2952  O OP2   . DA  A 1 145 ? 102.525 75.927  -82.531 1.00 72.88  ? 145  DA  I OP2   1 
ATOM   2953  O "O5'" . DA  A 1 145 ? 104.752 76.812  -83.189 1.00 102.85 ? 145  DA  I "O5'" 1 
ATOM   2954  C "C5'" . DA  A 1 145 ? 106.093 77.074  -82.781 1.00 103.47 ? 145  DA  I "C5'" 1 
ATOM   2955  C "C4'" . DA  A 1 145 ? 107.043 76.222  -83.586 1.00 104.10 ? 145  DA  I "C4'" 1 
ATOM   2956  O "O4'" . DA  A 1 145 ? 107.085 74.878  -83.042 1.00 101.64 ? 145  DA  I "O4'" 1 
ATOM   2957  C "C3'" . DA  A 1 145 ? 106.599 76.082  -85.043 1.00 105.62 ? 145  DA  I "C3'" 1 
ATOM   2958  O "O3'" . DA  A 1 145 ? 107.696 76.165  -85.948 1.00 110.00 ? 145  DA  I "O3'" 1 
ATOM   2959  C "C2'" . DA  A 1 145 ? 105.997 74.693  -85.101 1.00 103.24 ? 145  DA  I "C2'" 1 
ATOM   2960  C "C1'" . DA  A 1 145 ? 106.815 73.941  -84.071 1.00 99.86  ? 145  DA  I "C1'" 1 
ATOM   2961  N N9    . DA  A 1 145 ? 106.077 72.820  -83.495 1.00 68.12  ? 145  DA  I N9    1 
ATOM   2962  C C8    . DA  A 1 145 ? 104.806 72.840  -82.981 1.00 66.96  ? 145  DA  I C8    1 
ATOM   2963  N N7    . DA  A 1 145 ? 104.366 71.662  -82.613 1.00 65.56  ? 145  DA  I N7    1 
ATOM   2964  C C5    . DA  A 1 145 ? 105.426 70.811  -82.885 1.00 63.41  ? 145  DA  I C5    1 
ATOM   2965  C C6    . DA  A 1 145 ? 105.583 69.431  -82.732 1.00 62.28  ? 145  DA  I C6    1 
ATOM   2966  N N6    . DA  A 1 145 ? 104.624 68.630  -82.265 1.00 61.35  ? 145  DA  I N6    1 
ATOM   2967  N N1    . DA  A 1 145 ? 106.767 68.890  -83.088 1.00 61.69  ? 145  DA  I N1    1 
ATOM   2968  C C2    . DA  A 1 145 ? 107.718 69.694  -83.575 1.00 62.17  ? 145  DA  I C2    1 
ATOM   2969  N N3    . DA  A 1 145 ? 107.685 71.008  -83.779 1.00 64.01  ? 145  DA  I N3    1 
ATOM   2970  C C4    . DA  A 1 145 ? 106.495 71.513  -83.408 1.00 65.46  ? 145  DA  I C4    1 
ATOM   2971  P P     . DT  A 1 146 ? 107.417 76.102  -87.529 1.00 133.88 ? 146  DT  I P     1 
ATOM   2972  O OP1   . DT  A 1 146 ? 108.318 77.088  -88.183 1.00 77.18  ? 146  DT  I OP1   1 
ATOM   2973  O OP2   . DT  A 1 146 ? 105.944 76.203  -87.734 1.00 77.59  ? 146  DT  I OP2   1 
ATOM   2974  O "O5'" . DT  A 1 146 ? 107.862 74.625  -87.929 1.00 132.09 ? 146  DT  I "O5'" 1 
ATOM   2975  C "C5'" . DT  A 1 146 ? 109.150 74.132  -87.567 1.00 133.80 ? 146  DT  I "C5'" 1 
ATOM   2976  C "C4'" . DT  A 1 146 ? 109.320 72.704  -88.031 1.00 134.94 ? 146  DT  I "C4'" 1 
ATOM   2977  O "O4'" . DT  A 1 146 ? 108.554 71.799  -87.197 1.00 133.69 ? 146  DT  I "O4'" 1 
ATOM   2978  C "C3'" . DT  A 1 146 ? 108.874 72.434  -89.471 1.00 136.15 ? 146  DT  I "C3'" 1 
ATOM   2979  O "O3'" . DT  A 1 146 ? 109.694 71.418  -90.054 1.00 138.94 ? 146  DT  I "O3'" 1 
ATOM   2980  C "C2'" . DT  A 1 146 ? 107.514 71.788  -89.286 1.00 134.96 ? 146  DT  I "C2'" 1 
ATOM   2981  C "C1'" . DT  A 1 146 ? 107.752 70.975  -88.028 1.00 134.26 ? 146  DT  I "C1'" 1 
ATOM   2982  N N1    . DT  A 1 146 ? 106.535 70.599  -87.283 1.00 78.39  ? 146  DT  I N1    1 
ATOM   2983  C C2    . DT  A 1 146 ? 106.424 69.296  -86.860 1.00 77.45  ? 146  DT  I C2    1 
ATOM   2984  O O2    . DT  A 1 146 ? 107.296 68.464  -87.038 1.00 78.15  ? 146  DT  I O2    1 
ATOM   2985  N N3    . DT  A 1 146 ? 105.249 69.000  -86.216 1.00 76.82  ? 146  DT  I N3    1 
ATOM   2986  C C4    . DT  A 1 146 ? 104.202 69.861  -85.958 1.00 77.22  ? 146  DT  I C4    1 
ATOM   2987  O O4    . DT  A 1 146 ? 103.194 69.447  -85.391 1.00 77.20  ? 146  DT  I O4    1 
ATOM   2988  C C5    . DT  A 1 146 ? 104.396 71.219  -86.405 1.00 77.33  ? 146  DT  I C5    1 
ATOM   2989  C C7    . DT  A 1 146 ? 103.322 72.226  -86.149 1.00 77.92  ? 146  DT  I C7    1 
ATOM   2990  C C6    . DT  A 1 146 ? 105.538 71.518  -87.036 1.00 78.06  ? 146  DT  I C6    1 
ATOM   2991  O "O5'" . DA  B 1 1   ? 102.944 59.389  -84.172 1.00 137.23 ? 147  DA  J "O5'" 1 
ATOM   2992  C "C5'" . DA  B 1 1   ? 103.614 58.411  -84.974 1.00 136.84 ? 147  DA  J "C5'" 1 
ATOM   2993  C "C4'" . DA  B 1 1   ? 104.957 58.897  -85.468 1.00 136.79 ? 147  DA  J "C4'" 1 
ATOM   2994  O "O4'" . DA  B 1 1   ? 104.760 60.143  -86.184 1.00 135.94 ? 147  DA  J "O4'" 1 
ATOM   2995  C "C3'" . DA  B 1 1   ? 105.963 59.199  -84.355 1.00 137.61 ? 147  DA  J "C3'" 1 
ATOM   2996  O "O3'" . DA  B 1 1   ? 107.291 58.808  -84.723 1.00 139.84 ? 147  DA  J "O3'" 1 
ATOM   2997  C "C2'" . DA  B 1 1   ? 105.883 60.703  -84.199 1.00 136.99 ? 147  DA  J "C2'" 1 
ATOM   2998  C "C1'" . DA  B 1 1   ? 105.532 61.180  -85.597 1.00 135.39 ? 147  DA  J "C1'" 1 
ATOM   2999  N N9    . DA  B 1 1   ? 104.719 62.396  -85.569 1.00 79.95  ? 147  DA  J N9    1 
ATOM   3000  C C8    . DA  B 1 1   ? 103.422 62.530  -85.129 1.00 79.34  ? 147  DA  J C8    1 
ATOM   3001  N N7    . DA  B 1 1   ? 102.983 63.767  -85.146 1.00 78.45  ? 147  DA  J N7    1 
ATOM   3002  C C5    . DA  B 1 1   ? 104.056 64.496  -85.646 1.00 77.35  ? 147  DA  J C5    1 
ATOM   3003  C C6    . DA  B 1 1   ? 104.236 65.873  -85.895 1.00 76.04  ? 147  DA  J C6    1 
ATOM   3004  N N6    . DA  B 1 1   ? 103.309 66.798  -85.642 1.00 74.47  ? 147  DA  J N6    1 
ATOM   3005  N N1    . DA  B 1 1   ? 105.421 66.270  -86.411 1.00 75.24  ? 147  DA  J N1    1 
ATOM   3006  C C2    . DA  B 1 1   ? 106.358 65.341  -86.648 1.00 76.57  ? 147  DA  J C2    1 
ATOM   3007  N N3    . DA  B 1 1   ? 106.314 64.021  -86.445 1.00 77.59  ? 147  DA  J N3    1 
ATOM   3008  C C4    . DA  B 1 1   ? 105.123 63.660  -85.935 1.00 78.41  ? 147  DA  J C4    1 
ATOM   3009  P P     . DT  B 1 2   ? 108.517 59.126  -83.728 1.00 132.93 ? 148  DT  J P     1 
ATOM   3010  O OP1   . DT  B 1 2   ? 109.577 58.108  -83.939 1.00 91.71  ? 148  DT  J OP1   1 
ATOM   3011  O OP2   . DT  B 1 2   ? 107.965 59.336  -82.364 1.00 91.04  ? 148  DT  J OP2   1 
ATOM   3012  O "O5'" . DT  B 1 2   ? 109.063 60.527  -84.248 1.00 132.06 ? 148  DT  J "O5'" 1 
ATOM   3013  C "C5'" . DT  B 1 2   ? 109.614 60.653  -85.554 1.00 132.28 ? 148  DT  J "C5'" 1 
ATOM   3014  C "C4'" . DT  B 1 2   ? 110.458 61.901  -85.637 1.00 132.39 ? 148  DT  J "C4'" 1 
ATOM   3015  O "O4'" . DT  B 1 2   ? 109.600 63.066  -85.587 1.00 131.40 ? 148  DT  J "O4'" 1 
ATOM   3016  C "C3'" . DT  B 1 2   ? 111.438 62.050  -84.474 1.00 132.57 ? 148  DT  J "C3'" 1 
ATOM   3017  O "O3'" . DT  B 1 2   ? 112.658 62.642  -84.926 1.00 133.50 ? 148  DT  J "O3'" 1 
ATOM   3018  C "C2'" . DT  B 1 2   ? 110.711 62.983  -83.524 1.00 132.33 ? 148  DT  J "C2'" 1 
ATOM   3019  C "C1'" . DT  B 1 2   ? 109.963 63.888  -84.486 1.00 130.58 ? 148  DT  J "C1'" 1 
ATOM   3020  N N1    . DT  B 1 2   ? 108.729 64.483  -83.938 1.00 85.62  ? 148  DT  J N1    1 
ATOM   3021  C C2    . DT  B 1 2   ? 108.589 65.850  -84.000 1.00 83.90  ? 148  DT  J C2    1 
ATOM   3022  O O2    . DT  B 1 2   ? 109.440 66.588  -84.470 1.00 83.73  ? 148  DT  J O2    1 
ATOM   3023  N N3    . DT  B 1 2   ? 107.410 66.326  -83.485 1.00 82.74  ? 148  DT  J N3    1 
ATOM   3024  C C4    . DT  B 1 2   ? 106.386 65.587  -82.923 1.00 82.42  ? 148  DT  J C4    1 
ATOM   3025  O O4    . DT  B 1 2   ? 105.383 66.151  -82.505 1.00 81.40  ? 148  DT  J O4    1 
ATOM   3026  C C5    . DT  B 1 2   ? 106.604 64.164  -82.880 1.00 82.70  ? 148  DT  J C5    1 
ATOM   3027  C C7    . DT  B 1 2   ? 105.549 63.290  -82.279 1.00 82.66  ? 148  DT  J C7    1 
ATOM   3028  C C6    . DT  B 1 2   ? 107.749 63.687  -83.384 1.00 83.90  ? 148  DT  J C6    1 
ATOM   3029  P P     . DC  B 1 3   ? 113.924 62.704  -83.938 1.00 172.37 ? 149  DC  J P     1 
ATOM   3030  O OP1   . DC  B 1 3   ? 115.063 63.293  -84.690 1.00 88.77  ? 149  DC  J OP1   1 
ATOM   3031  O OP2   . DC  B 1 3   ? 114.069 61.366  -83.307 1.00 89.20  ? 149  DC  J OP2   1 
ATOM   3032  O "O5'" . DC  B 1 3   ? 113.473 63.736  -82.811 1.00 171.53 ? 149  DC  J "O5'" 1 
ATOM   3033  C "C5'" . DC  B 1 3   ? 114.366 64.143  -81.775 1.00 172.28 ? 149  DC  J "C5'" 1 
ATOM   3034  C "C4'" . DC  B 1 3   ? 114.817 65.564  -82.019 1.00 171.34 ? 149  DC  J "C4'" 1 
ATOM   3035  O "O4'" . DC  B 1 3   ? 113.675 66.325  -82.477 1.00 172.40 ? 149  DC  J "O4'" 1 
ATOM   3036  C "C3'" . DC  B 1 3   ? 115.360 66.297  -80.794 1.00 170.20 ? 149  DC  J "C3'" 1 
ATOM   3037  O "O3'" . DC  B 1 3   ? 116.540 67.057  -81.099 1.00 166.43 ? 149  DC  J "O3'" 1 
ATOM   3038  C "C2'" . DC  B 1 3   ? 114.187 67.123  -80.303 1.00 170.89 ? 149  DC  J "C2'" 1 
ATOM   3039  C "C1'" . DC  B 1 3   ? 113.259 67.276  -81.505 1.00 171.73 ? 149  DC  J "C1'" 1 
ATOM   3040  N N1    . DC  B 1 3   ? 111.859 66.966  -81.164 1.00 87.54  ? 149  DC  J N1    1 
ATOM   3041  C C2    . DC  B 1 3   ? 110.904 67.998  -81.136 1.00 86.16  ? 149  DC  J C2    1 
ATOM   3042  O O2    . DC  B 1 3   ? 111.253 69.156  -81.431 1.00 84.52  ? 149  DC  J O2    1 
ATOM   3043  N N3    . DC  B 1 3   ? 109.628 67.702  -80.788 1.00 84.91  ? 149  DC  J N3    1 
ATOM   3044  C C4    . DC  B 1 3   ? 109.294 66.441  -80.479 1.00 84.93  ? 149  DC  J C4    1 
ATOM   3045  N N4    . DC  B 1 3   ? 108.030 66.190  -80.124 1.00 82.82  ? 149  DC  J N4    1 
ATOM   3046  C C5    . DC  B 1 3   ? 110.241 65.379  -80.515 1.00 85.75  ? 149  DC  J C5    1 
ATOM   3047  C C6    . DC  B 1 3   ? 111.496 65.682  -80.861 1.00 87.18  ? 149  DC  J C6    1 
ATOM   3048  P P     . DA  B 1 4   ? 116.436 68.424  -81.941 1.00 120.67 ? 150  DA  J P     1 
ATOM   3049  O OP1   . DA  B 1 4   ? 115.520 68.198  -83.090 1.00 91.74  ? 150  DA  J OP1   1 
ATOM   3050  O OP2   . DA  B 1 4   ? 117.827 68.880  -82.193 1.00 92.20  ? 150  DA  J OP2   1 
ATOM   3051  O "O5'" . DA  B 1 4   ? 115.767 69.496  -80.970 1.00 117.24 ? 150  DA  J "O5'" 1 
ATOM   3052  C "C5'" . DA  B 1 4   ? 115.442 70.792  -81.476 1.00 112.37 ? 150  DA  J "C5'" 1 
ATOM   3053  C "C4'" . DA  B 1 4   ? 114.785 71.645  -80.416 1.00 108.04 ? 150  DA  J "C4'" 1 
ATOM   3054  O "O4'" . DA  B 1 4   ? 113.544 71.047  -79.973 1.00 105.97 ? 150  DA  J "O4'" 1 
ATOM   3055  C "C3'" . DA  B 1 4   ? 115.598 71.905  -79.148 1.00 106.50 ? 150  DA  J "C3'" 1 
ATOM   3056  O "O3'" . DA  B 1 4   ? 115.296 73.227  -78.708 1.00 106.09 ? 150  DA  J "O3'" 1 
ATOM   3057  C "C2'" . DA  B 1 4   ? 114.996 70.926  -78.157 1.00 104.79 ? 150  DA  J "C2'" 1 
ATOM   3058  C "C1'" . DA  B 1 4   ? 113.538 71.006  -78.556 1.00 102.90 ? 150  DA  J "C1'" 1 
ATOM   3059  N N9    . DA  B 1 4   ? 112.699 69.887  -78.139 1.00 71.21  ? 150  DA  J N9    1 
ATOM   3060  C C8    . DA  B 1 4   ? 113.030 68.563  -78.012 1.00 70.11  ? 150  DA  J C8    1 
ATOM   3061  N N7    . DA  B 1 4   ? 112.034 67.802  -77.630 1.00 68.44  ? 150  DA  J N7    1 
ATOM   3062  C C5    . DA  B 1 4   ? 110.977 68.689  -77.484 1.00 67.19  ? 150  DA  J C5    1 
ATOM   3063  C C6    . DA  B 1 4   ? 109.641 68.511  -77.096 1.00 65.61  ? 150  DA  J C6    1 
ATOM   3064  N N6    . DA  B 1 4   ? 109.113 67.325  -76.781 1.00 64.03  ? 150  DA  J N6    1 
ATOM   3065  N N1    . DA  B 1 4   ? 108.853 69.606  -77.045 1.00 64.02  ? 150  DA  J N1    1 
ATOM   3066  C C2    . DA  B 1 4   ? 109.380 70.793  -77.371 1.00 64.56  ? 150  DA  J C2    1 
ATOM   3067  N N3    . DA  B 1 4   ? 110.617 71.087  -77.757 1.00 65.85  ? 150  DA  J N3    1 
ATOM   3068  C C4    . DA  B 1 4   ? 111.374 69.978  -77.792 1.00 68.46  ? 150  DA  J C4    1 
ATOM   3069  P P     . DA  B 1 5   ? 116.432 74.130  -78.030 1.00 109.95 ? 151  DA  J P     1 
ATOM   3070  O OP1   . DA  B 1 5   ? 117.176 74.818  -79.117 1.00 85.76  ? 151  DA  J OP1   1 
ATOM   3071  O OP2   . DA  B 1 5   ? 117.161 73.290  -77.050 1.00 86.15  ? 151  DA  J OP2   1 
ATOM   3072  O "O5'" . DA  B 1 5   ? 115.592 75.217  -77.223 1.00 108.59 ? 151  DA  J "O5'" 1 
ATOM   3073  C "C5'" . DA  B 1 5   ? 114.573 75.980  -77.873 1.00 104.17 ? 151  DA  J "C5'" 1 
ATOM   3074  C "C4'" . DA  B 1 5   ? 113.440 76.280  -76.918 1.00 100.10 ? 151  DA  J "C4'" 1 
ATOM   3075  O "O4'" . DA  B 1 5   ? 112.647 75.096  -76.649 1.00 97.92  ? 151  DA  J "O4'" 1 
ATOM   3076  C "C3'" . DA  B 1 5   ? 113.866 76.819  -75.555 1.00 99.19  ? 151  DA  J "C3'" 1 
ATOM   3077  O "O3'" . DA  B 1 5   ? 112.967 77.862  -75.166 1.00 97.95  ? 151  DA  J "O3'" 1 
ATOM   3078  C "C2'" . DA  B 1 5   ? 113.736 75.607  -74.646 1.00 96.70  ? 151  DA  J "C2'" 1 
ATOM   3079  C "C1'" . DA  B 1 5   ? 112.539 74.893  -75.247 1.00 94.92  ? 151  DA  J "C1'" 1 
ATOM   3080  N N9    . DA  B 1 5   ? 112.489 73.451  -75.010 1.00 67.94  ? 151  DA  J N9    1 
ATOM   3081  C C8    . DA  B 1 5   ? 113.493 72.543  -75.220 1.00 67.04  ? 151  DA  J C8    1 
ATOM   3082  N N7    . DA  B 1 5   ? 113.149 71.303  -74.966 1.00 65.31  ? 151  DA  J N7    1 
ATOM   3083  C C5    . DA  B 1 5   ? 111.832 71.399  -74.551 1.00 62.73  ? 151  DA  J C5    1 
ATOM   3084  C C6    . DA  B 1 5   ? 110.895 70.430  -74.157 1.00 61.54  ? 151  DA  J C6    1 
ATOM   3085  N N6    . DA  B 1 5   ? 111.153 69.120  -74.128 1.00 58.58  ? 151  DA  J N6    1 
ATOM   3086  N N1    . DA  B 1 5   ? 109.663 70.856  -73.797 1.00 61.51  ? 151  DA  J N1    1 
ATOM   3087  C C2    . DA  B 1 5   ? 109.402 72.168  -73.847 1.00 62.48  ? 151  DA  J C2    1 
ATOM   3088  N N3    . DA  B 1 5   ? 110.197 73.175  -74.211 1.00 64.73  ? 151  DA  J N3    1 
ATOM   3089  C C4    . DA  B 1 5   ? 111.413 72.718  -74.557 1.00 65.35  ? 151  DA  J C4    1 
ATOM   3090  P P     . DT  B 1 6   ? 113.268 78.723  -73.849 1.00 87.71  ? 152  DT  J P     1 
ATOM   3091  O OP1   . DT  B 1 6   ? 113.105 80.167  -74.159 1.00 79.13  ? 152  DT  J OP1   1 
ATOM   3092  O OP2   . DT  B 1 6   ? 114.550 78.228  -73.283 1.00 78.19  ? 152  DT  J OP2   1 
ATOM   3093  O "O5'" . DT  B 1 6   ? 112.102 78.283  -72.864 1.00 86.11  ? 152  DT  J "O5'" 1 
ATOM   3094  C "C5'" . DT  B 1 6   ? 111.725 76.917  -72.779 1.00 83.13  ? 152  DT  J "C5'" 1 
ATOM   3095  C "C4'" . DT  B 1 6   ? 110.521 76.758  -71.889 1.00 80.88  ? 152  DT  J "C4'" 1 
ATOM   3096  O "O4'" . DT  B 1 6   ? 110.143 75.363  -71.893 1.00 80.66  ? 152  DT  J "O4'" 1 
ATOM   3097  C "C3'" . DT  B 1 6   ? 110.780 77.125  -70.432 1.00 79.37  ? 152  DT  J "C3'" 1 
ATOM   3098  O "O3'" . DT  B 1 6   ? 109.594 77.698  -69.879 1.00 78.08  ? 152  DT  J "O3'" 1 
ATOM   3099  C "C2'" . DT  B 1 6   ? 111.134 75.794  -69.796 1.00 79.18  ? 152  DT  J "C2'" 1 
ATOM   3100  C "C1'" . DT  B 1 6   ? 110.335 74.787  -70.611 1.00 79.82  ? 152  DT  J "C1'" 1 
ATOM   3101  N N1    . DT  B 1 6   ? 111.025 73.495  -70.803 1.00 70.90  ? 152  DT  J N1    1 
ATOM   3102  C C2    . DT  B 1 6   ? 110.311 72.331  -70.620 1.00 70.09  ? 152  DT  J C2    1 
ATOM   3103  O O2    . DT  B 1 6   ? 109.130 72.312  -70.322 1.00 70.14  ? 152  DT  J O2    1 
ATOM   3104  N N3    . DT  B 1 6   ? 111.037 71.180  -70.801 1.00 70.14  ? 152  DT  J N3    1 
ATOM   3105  C C4    . DT  B 1 6   ? 112.371 71.078  -71.141 1.00 69.71  ? 152  DT  J C4    1 
ATOM   3106  O O4    . DT  B 1 6   ? 112.890 69.972  -71.258 1.00 70.03  ? 152  DT  J O4    1 
ATOM   3107  C C5    . DT  B 1 6   ? 113.055 72.335  -71.331 1.00 70.17  ? 152  DT  J C5    1 
ATOM   3108  C C7    . DT  B 1 6   ? 114.500 72.323  -71.716 1.00 70.42  ? 152  DT  J C7    1 
ATOM   3109  C C6    . DT  B 1 6   ? 112.359 73.466  -71.153 1.00 70.29  ? 152  DT  J C6    1 
ATOM   3110  P P     . DA  B 1 7   ? 109.543 78.105  -68.326 1.00 65.64  ? 153  DA  J P     1 
ATOM   3111  O OP1   . DA  B 1 7   ? 108.946 79.461  -68.258 1.00 67.98  ? 153  DA  J OP1   1 
ATOM   3112  O OP2   . DA  B 1 7   ? 110.871 77.854  -67.707 1.00 67.76  ? 153  DA  J OP2   1 
ATOM   3113  O "O5'" . DA  B 1 7   ? 108.496 77.065  -67.739 1.00 64.14  ? 153  DA  J "O5'" 1 
ATOM   3114  C "C5'" . DA  B 1 7   ? 107.289 76.811  -68.448 1.00 63.33  ? 153  DA  J "C5'" 1 
ATOM   3115  C "C4'" . DA  B 1 7   ? 106.615 75.572  -67.914 1.00 63.02  ? 153  DA  J "C4'" 1 
ATOM   3116  O "O4'" . DA  B 1 7   ? 107.427 74.405  -68.186 1.00 62.74  ? 153  DA  J "O4'" 1 
ATOM   3117  C "C3'" . DA  B 1 7   ? 106.377 75.581  -66.408 1.00 63.83  ? 153  DA  J "C3'" 1 
ATOM   3118  O "O3'" . DA  B 1 7   ? 105.097 75.003  -66.155 1.00 65.07  ? 153  DA  J "O3'" 1 
ATOM   3119  C "C2'" . DA  B 1 7   ? 107.513 74.727  -65.866 1.00 62.53  ? 153  DA  J "C2'" 1 
ATOM   3120  C "C1'" . DA  B 1 7   ? 107.724 73.715  -66.980 1.00 61.36  ? 153  DA  J "C1'" 1 
ATOM   3121  N N9    . DA  B 1 7   ? 109.088 73.196  -67.099 1.00 62.46  ? 153  DA  J N9    1 
ATOM   3122  C C8    . DA  B 1 7   ? 110.236 73.923  -67.273 1.00 62.03  ? 153  DA  J C8    1 
ATOM   3123  N N7    . DA  B 1 7   ? 111.311 73.189  -67.406 1.00 61.13  ? 153  DA  J N7    1 
ATOM   3124  C C5    . DA  B 1 7   ? 110.843 71.890  -67.303 1.00 60.17  ? 153  DA  J C5    1 
ATOM   3125  C C6    . DA  B 1 7   ? 111.492 70.642  -67.380 1.00 60.02  ? 153  DA  J C6    1 
ATOM   3126  N N6    . DA  B 1 7   ? 112.801 70.498  -67.619 1.00 58.61  ? 153  DA  J N6    1 
ATOM   3127  N N1    . DA  B 1 7   ? 110.739 69.533  -67.215 1.00 57.55  ? 153  DA  J N1    1 
ATOM   3128  C C2    . DA  B 1 7   ? 109.426 69.680  -67.006 1.00 58.61  ? 153  DA  J C2    1 
ATOM   3129  N N3    . DA  B 1 7   ? 108.701 70.795  -66.934 1.00 59.64  ? 153  DA  J N3    1 
ATOM   3130  C C4    . DA  B 1 7   ? 109.479 71.878  -67.093 1.00 60.23  ? 153  DA  J C4    1 
ATOM   3131  P P     . DT  B 1 8   ? 104.548 74.910  -64.656 1.00 74.10  ? 154  DT  J P     1 
ATOM   3132  O OP1   . DT  B 1 8   ? 103.068 74.914  -64.741 1.00 64.02  ? 154  DT  J OP1   1 
ATOM   3133  O OP2   . DT  B 1 8   ? 105.246 75.933  -63.828 1.00 61.47  ? 154  DT  J OP2   1 
ATOM   3134  O "O5'" . DT  B 1 8   ? 105.002 73.452  -64.220 1.00 73.36  ? 154  DT  J "O5'" 1 
ATOM   3135  C "C5'" . DT  B 1 8   ? 104.601 72.335  -65.005 1.00 75.34  ? 154  DT  J "C5'" 1 
ATOM   3136  C "C4'" . DT  B 1 8   ? 104.947 71.044  -64.307 1.00 76.15  ? 154  DT  J "C4'" 1 
ATOM   3137  O "O4'" . DT  B 1 8   ? 106.320 70.666  -64.559 1.00 75.44  ? 154  DT  J "O4'" 1 
ATOM   3138  C "C3'" . DT  B 1 8   ? 104.773 71.069  -62.791 1.00 77.59  ? 154  DT  J "C3'" 1 
ATOM   3139  O "O3'" . DT  B 1 8   ? 104.105 69.872  -62.395 1.00 81.52  ? 154  DT  J "O3'" 1 
ATOM   3140  C "C2'" . DT  B 1 8   ? 106.201 71.115  -62.270 1.00 75.44  ? 154  DT  J "C2'" 1 
ATOM   3141  C "C1'" . DT  B 1 8   ? 106.950 70.331  -63.334 1.00 74.70  ? 154  DT  J "C1'" 1 
ATOM   3142  N N1    . DT  B 1 8   ? 108.395 70.622  -63.477 1.00 62.29  ? 154  DT  J N1    1 
ATOM   3143  C C2    . DT  B 1 8   ? 109.244 69.559  -63.720 1.00 60.88  ? 154  DT  J C2    1 
ATOM   3144  O O2    . DT  B 1 8   ? 108.866 68.398  -63.770 1.00 59.46  ? 154  DT  J O2    1 
ATOM   3145  N N3    . DT  B 1 8   ? 110.558 69.908  -63.905 1.00 59.59  ? 154  DT  J N3    1 
ATOM   3146  C C4    . DT  B 1 8   ? 111.099 71.181  -63.865 1.00 60.55  ? 154  DT  J C4    1 
ATOM   3147  O O4    . DT  B 1 8   ? 112.299 71.348  -64.086 1.00 59.35  ? 154  DT  J O4    1 
ATOM   3148  C C5    . DT  B 1 8   ? 110.160 72.240  -63.567 1.00 60.15  ? 154  DT  J C5    1 
ATOM   3149  C C7    . DT  B 1 8   ? 110.664 73.645  -63.468 1.00 59.84  ? 154  DT  J C7    1 
ATOM   3150  C C6    . DT  B 1 8   ? 108.873 71.911  -63.391 1.00 60.92  ? 154  DT  J C6    1 
ATOM   3151  P P     . DC  B 1 9   ? 103.771 69.612  -60.849 1.00 106.47 ? 155  DC  J P     1 
ATOM   3152  O OP1   . DC  B 1 9   ? 102.407 69.027  -60.773 1.00 74.20  ? 155  DC  J OP1   1 
ATOM   3153  O OP2   . DC  B 1 9   ? 104.098 70.828  -60.055 1.00 71.91  ? 155  DC  J OP2   1 
ATOM   3154  O "O5'" . DC  B 1 9   ? 104.804 68.467  -60.482 1.00 103.99 ? 155  DC  J "O5'" 1 
ATOM   3155  C "C5'" . DC  B 1 9   ? 104.949 67.342  -61.339 1.00 105.22 ? 155  DC  J "C5'" 1 
ATOM   3156  C "C4'" . DC  B 1 9   ? 106.017 66.427  -60.798 1.00 105.70 ? 155  DC  J "C4'" 1 
ATOM   3157  O "O4'" . DC  B 1 9   ? 107.333 66.923  -61.146 1.00 105.23 ? 155  DC  J "O4'" 1 
ATOM   3158  C "C3'" . DC  B 1 9   ? 105.974 66.348  -59.274 1.00 105.90 ? 155  DC  J "C3'" 1 
ATOM   3159  O "O3'" . DC  B 1 9   ? 106.169 65.010  -58.845 1.00 106.24 ? 155  DC  J "O3'" 1 
ATOM   3160  C "C2'" . DC  B 1 9   ? 107.132 67.224  -58.836 1.00 104.80 ? 155  DC  J "C2'" 1 
ATOM   3161  C "C1'" . DC  B 1 9   ? 108.119 67.041  -59.973 1.00 103.82 ? 155  DC  J "C1'" 1 
ATOM   3162  N N1    . DC  B 1 9   ? 109.055 68.162  -60.157 1.00 69.42  ? 155  DC  J N1    1 
ATOM   3163  C C2    . DC  B 1 9   ? 110.354 67.887  -60.590 1.00 67.94  ? 155  DC  J C2    1 
ATOM   3164  O O2    . DC  B 1 9   ? 110.674 66.710  -60.819 1.00 68.68  ? 155  DC  J O2    1 
ATOM   3165  N N3    . DC  B 1 9   ? 111.228 68.904  -60.746 1.00 66.45  ? 155  DC  J N3    1 
ATOM   3166  C C4    . DC  B 1 9   ? 110.849 70.155  -60.484 1.00 66.50  ? 155  DC  J C4    1 
ATOM   3167  N N4    . DC  B 1 9   ? 111.750 71.127  -60.643 1.00 65.49  ? 155  DC  J N4    1 
ATOM   3168  C C5    . DC  B 1 9   ? 109.530 70.466  -60.047 1.00 67.75  ? 155  DC  J C5    1 
ATOM   3169  C C6    . DC  B 1 9   ? 108.672 69.449  -59.901 1.00 68.50  ? 155  DC  J C6    1 
ATOM   3170  P P     . DC  B 1 10  ? 105.706 64.579  -57.374 1.00 97.70  ? 156  DC  J P     1 
ATOM   3171  O OP1   . DC  B 1 10  ? 104.511 63.709  -57.489 1.00 70.29  ? 156  DC  J OP1   1 
ATOM   3172  O OP2   . DC  B 1 10  ? 105.649 65.806  -56.533 1.00 70.90  ? 156  DC  J OP2   1 
ATOM   3173  O "O5'" . DC  B 1 10  ? 106.930 63.697  -56.882 1.00 95.82  ? 156  DC  J "O5'" 1 
ATOM   3174  C "C5'" . DC  B 1 10  ? 107.658 62.896  -57.807 1.00 94.41  ? 156  DC  J "C5'" 1 
ATOM   3175  C "C4'" . DC  B 1 10  ? 109.076 62.712  -57.324 1.00 92.78  ? 156  DC  J "C4'" 1 
ATOM   3176  O "O4'" . DC  B 1 10  ? 109.923 63.821  -57.714 1.00 91.79  ? 156  DC  J "O4'" 1 
ATOM   3177  C "C3'" . DC  B 1 10  ? 109.187 62.605  -55.804 1.00 91.91  ? 156  DC  J "C3'" 1 
ATOM   3178  O "O3'" . DC  B 1 10  ? 110.113 61.582  -55.479 1.00 92.83  ? 156  DC  J "O3'" 1 
ATOM   3179  C "C2'" . DC  B 1 10  ? 109.750 63.953  -55.394 1.00 90.73  ? 156  DC  J "C2'" 1 
ATOM   3180  C "C1'" . DC  B 1 10  ? 110.637 64.277  -56.579 1.00 90.24  ? 156  DC  J "C1'" 1 
ATOM   3181  N N1    . DC  B 1 10  ? 110.952 65.701  -56.775 1.00 63.56  ? 156  DC  J N1    1 
ATOM   3182  C C2    . DC  B 1 10  ? 112.228 66.041  -57.231 1.00 62.44  ? 156  DC  J C2    1 
ATOM   3183  O O2    . DC  B 1 10  ? 113.052 65.132  -57.434 1.00 62.82  ? 156  DC  J O2    1 
ATOM   3184  N N3    . DC  B 1 10  ? 112.534 67.345  -57.436 1.00 60.46  ? 156  DC  J N3    1 
ATOM   3185  C C4    . DC  B 1 10  ? 111.621 68.290  -57.197 1.00 59.40  ? 156  DC  J C4    1 
ATOM   3186  N N4    . DC  B 1 10  ? 111.963 69.560  -57.421 1.00 57.54  ? 156  DC  J N4    1 
ATOM   3187  C C5    . DC  B 1 10  ? 110.316 67.973  -56.719 1.00 60.42  ? 156  DC  J C5    1 
ATOM   3188  C C6    . DC  B 1 10  ? 110.027 66.677  -56.524 1.00 62.46  ? 156  DC  J C6    1 
ATOM   3189  P P     . DA  B 1 11  ? 110.063 60.900  -54.033 1.00 81.04  ? 157  DA  J P     1 
ATOM   3190  O OP1   . DA  B 1 11  ? 109.631 59.487  -54.213 1.00 75.48  ? 157  DA  J OP1   1 
ATOM   3191  O OP2   . DA  B 1 11  ? 109.330 61.788  -53.096 1.00 73.12  ? 157  DA  J OP2   1 
ATOM   3192  O "O5'" . DA  B 1 11  ? 111.587 60.907  -53.601 1.00 78.77  ? 157  DA  J "O5'" 1 
ATOM   3193  C "C5'" . DA  B 1 11  ? 112.589 60.485  -54.507 1.00 74.13  ? 157  DA  J "C5'" 1 
ATOM   3194  C "C4'" . DA  B 1 11  ? 113.926 60.993  -54.040 1.00 72.52  ? 157  DA  J "C4'" 1 
ATOM   3195  O "O4'" . DA  B 1 11  ? 114.104 62.372  -54.448 1.00 70.28  ? 157  DA  J "O4'" 1 
ATOM   3196  C "C3'" . DA  B 1 11  ? 114.058 60.964  -52.517 1.00 73.03  ? 157  DA  J "C3'" 1 
ATOM   3197  O "O3'" . DA  B 1 11  ? 115.314 60.391  -52.153 1.00 74.91  ? 157  DA  J "O3'" 1 
ATOM   3198  C "C2'" . DA  B 1 11  ? 113.945 62.427  -52.114 1.00 70.46  ? 157  DA  J "C2'" 1 
ATOM   3199  C "C1'" . DA  B 1 11  ? 114.478 63.162  -53.334 1.00 68.67  ? 157  DA  J "C1'" 1 
ATOM   3200  N N9    . DA  B 1 11  ? 113.928 64.507  -53.530 1.00 60.86  ? 157  DA  J N9    1 
ATOM   3201  C C8    . DA  B 1 11  ? 112.630 64.920  -53.349 1.00 60.45  ? 157  DA  J C8    1 
ATOM   3202  N N7    . DA  B 1 11  ? 112.443 66.196  -53.586 1.00 59.45  ? 157  DA  J N7    1 
ATOM   3203  C C5    . DA  B 1 11  ? 113.698 66.657  -53.955 1.00 58.61  ? 157  DA  J C5    1 
ATOM   3204  C C6    . DA  B 1 11  ? 114.166 67.929  -54.329 1.00 57.28  ? 157  DA  J C6    1 
ATOM   3205  N N6    . DA  B 1 11  ? 113.388 69.008  -54.411 1.00 57.06  ? 157  DA  J N6    1 
ATOM   3206  N N1    . DA  B 1 11  ? 115.478 68.056  -54.622 1.00 58.49  ? 157  DA  J N1    1 
ATOM   3207  C C2    . DA  B 1 11  ? 116.257 66.967  -54.553 1.00 58.57  ? 157  DA  J C2    1 
ATOM   3208  N N3    . DA  B 1 11  ? 115.933 65.717  -54.225 1.00 59.17  ? 157  DA  J N3    1 
ATOM   3209  C C4    . DA  B 1 11  ? 114.624 65.628  -53.928 1.00 59.87  ? 157  DA  J C4    1 
ATOM   3210  P P     . DC  B 1 12  ? 115.716 60.250  -50.605 1.00 76.70  ? 158  DC  J P     1 
ATOM   3211  O OP1   . DC  B 1 12  ? 116.584 59.045  -50.509 1.00 64.17  ? 158  DC  J OP1   1 
ATOM   3212  O OP2   . DC  B 1 12  ? 114.514 60.349  -49.743 1.00 61.70  ? 158  DC  J OP2   1 
ATOM   3213  O "O5'" . DC  B 1 12  ? 116.610 61.549  -50.399 1.00 76.51  ? 158  DC  J "O5'" 1 
ATOM   3214  C "C5'" . DC  B 1 12  ? 117.529 61.935  -51.420 1.00 79.33  ? 158  DC  J "C5'" 1 
ATOM   3215  C "C4'" . DC  B 1 12  ? 118.289 63.173  -51.011 1.00 80.95  ? 158  DC  J "C4'" 1 
ATOM   3216  O "O4'" . DC  B 1 12  ? 117.604 64.379  -51.435 1.00 81.41  ? 158  DC  J "O4'" 1 
ATOM   3217  C "C3'" . DC  B 1 12  ? 118.515 63.307  -49.507 1.00 81.59  ? 158  DC  J "C3'" 1 
ATOM   3218  O "O3'" . DC  B 1 12  ? 119.867 63.680  -49.258 1.00 84.51  ? 158  DC  J "O3'" 1 
ATOM   3219  C "C2'" . DC  B 1 12  ? 117.572 64.428  -49.106 1.00 81.25  ? 158  DC  J "C2'" 1 
ATOM   3220  C "C1'" . DC  B 1 12  ? 117.556 65.292  -50.354 1.00 79.97  ? 158  DC  J "C1'" 1 
ATOM   3221  N N1    . DC  B 1 12  ? 116.360 66.137  -50.519 1.00 65.80  ? 158  DC  J N1    1 
ATOM   3222  C C2    . DC  B 1 12  ? 116.514 67.420  -51.061 1.00 63.86  ? 158  DC  J C2    1 
ATOM   3223  O O2    . DC  B 1 12  ? 117.644 67.797  -51.394 1.00 63.51  ? 158  DC  J O2    1 
ATOM   3224  N N3    . DC  B 1 12  ? 115.430 68.214  -51.206 1.00 62.58  ? 158  DC  J N3    1 
ATOM   3225  C C4    . DC  B 1 12  ? 114.227 67.775  -50.830 1.00 62.46  ? 158  DC  J C4    1 
ATOM   3226  N N4    . DC  B 1 12  ? 113.192 68.598  -50.981 1.00 60.20  ? 158  DC  J N4    1 
ATOM   3227  C C5    . DC  B 1 12  ? 114.037 66.470  -50.279 1.00 63.19  ? 158  DC  J C5    1 
ATOM   3228  C C6    . DC  B 1 12  ? 115.122 65.691  -50.145 1.00 64.57  ? 158  DC  J C6    1 
ATOM   3229  P P     . DC  B 1 13  ? 120.370 63.867  -47.747 1.00 84.17  ? 159  DC  J P     1 
ATOM   3230  O OP1   . DC  B 1 13  ? 121.733 63.292  -47.649 1.00 77.01  ? 159  DC  J OP1   1 
ATOM   3231  O OP2   . DC  B 1 13  ? 119.302 63.382  -46.837 1.00 74.81  ? 159  DC  J OP2   1 
ATOM   3232  O "O5'" . DC  B 1 13  ? 120.487 65.446  -47.606 1.00 84.56  ? 159  DC  J "O5'" 1 
ATOM   3233  C "C5'" . DC  B 1 13  ? 121.284 66.193  -48.522 1.00 86.41  ? 159  DC  J "C5'" 1 
ATOM   3234  C "C4'" . DC  B 1 13  ? 121.323 67.644  -48.111 1.00 88.50  ? 159  DC  J "C4'" 1 
ATOM   3235  O "O4'" . DC  B 1 13  ? 120.072 68.293  -48.451 1.00 88.22  ? 159  DC  J "O4'" 1 
ATOM   3236  C "C3'" . DC  B 1 13  ? 121.510 67.838  -46.606 1.00 89.56  ? 159  DC  J "C3'" 1 
ATOM   3237  O "O3'" . DC  B 1 13  ? 122.393 68.933  -46.348 1.00 91.93  ? 159  DC  J "O3'" 1 
ATOM   3238  C "C2'" . DC  B 1 13  ? 120.108 68.150  -46.115 1.00 89.30  ? 159  DC  J "C2'" 1 
ATOM   3239  C "C1'" . DC  B 1 13  ? 119.524 68.906  -47.296 1.00 87.96  ? 159  DC  J "C1'" 1 
ATOM   3240  N N1    . DC  B 1 13  ? 118.056 68.855  -47.401 1.00 78.01  ? 159  DC  J N1    1 
ATOM   3241  C C2    . DC  B 1 13  ? 117.363 70.033  -47.716 1.00 77.45  ? 159  DC  J C2    1 
ATOM   3242  O O2    . DC  B 1 13  ? 118.008 71.077  -47.899 1.00 77.82  ? 159  DC  J O2    1 
ATOM   3243  N N3    . DC  B 1 13  ? 116.011 70.001  -47.808 1.00 75.62  ? 159  DC  J N3    1 
ATOM   3244  C C4    . DC  B 1 13  ? 115.354 68.858  -47.594 1.00 74.72  ? 159  DC  J C4    1 
ATOM   3245  N N4    . DC  B 1 13  ? 114.025 68.875  -47.684 1.00 71.44  ? 159  DC  J N4    1 
ATOM   3246  C C5    . DC  B 1 13  ? 116.034 67.646  -47.276 1.00 75.49  ? 159  DC  J C5    1 
ATOM   3247  C C6    . DC  B 1 13  ? 117.373 67.689  -47.192 1.00 77.41  ? 159  DC  J C6    1 
ATOM   3248  P P     . DT  B 1 14  ? 123.140 69.029  -44.930 1.00 111.21 ? 160  DT  J P     1 
ATOM   3249  O OP1   . DT  B 1 14  ? 124.575 69.306  -45.190 1.00 72.31  ? 160  DT  J OP1   1 
ATOM   3250  O OP2   . DT  B 1 14  ? 122.755 67.849  -44.115 1.00 70.74  ? 160  DT  J OP2   1 
ATOM   3251  O "O5'" . DT  B 1 14  ? 122.480 70.302  -44.242 1.00 113.06 ? 160  DT  J "O5'" 1 
ATOM   3252  C "C5'" . DT  B 1 14  ? 122.590 71.594  -44.831 1.00 117.48 ? 160  DT  J "C5'" 1 
ATOM   3253  C "C4'" . DT  B 1 14  ? 121.733 72.581  -44.074 1.00 119.64 ? 160  DT  J "C4'" 1 
ATOM   3254  O "O4'" . DT  B 1 14  ? 120.332 72.397  -44.396 1.00 119.54 ? 160  DT  J "O4'" 1 
ATOM   3255  C "C3'" . DT  B 1 14  ? 121.836 72.460  -42.553 1.00 121.34 ? 160  DT  J "C3'" 1 
ATOM   3256  O "O3'" . DT  B 1 14  ? 121.762 73.763  -41.979 1.00 125.12 ? 160  DT  J "O3'" 1 
ATOM   3257  C "C2'" . DT  B 1 14  ? 120.583 71.684  -42.186 1.00 120.08 ? 160  DT  J "C2'" 1 
ATOM   3258  C "C1'" . DT  B 1 14  ? 119.596 72.246  -43.192 1.00 118.91 ? 160  DT  J "C1'" 1 
ATOM   3259  N N1    . DT  B 1 14  ? 118.406 71.418  -43.480 1.00 78.14  ? 160  DT  J N1    1 
ATOM   3260  C C2    . DT  B 1 14  ? 117.351 72.033  -44.123 1.00 76.59  ? 160  DT  J C2    1 
ATOM   3261  O O2    . DT  B 1 14  ? 117.367 73.207  -44.461 1.00 75.61  ? 160  DT  J O2    1 
ATOM   3262  N N3    . DT  B 1 14  ? 116.271 71.219  -44.358 1.00 75.71  ? 160  DT  J N3    1 
ATOM   3263  C C4    . DT  B 1 14  ? 116.143 69.884  -44.026 1.00 75.71  ? 160  DT  J C4    1 
ATOM   3264  O O4    . DT  B 1 14  ? 115.109 69.283  -44.302 1.00 74.57  ? 160  DT  J O4    1 
ATOM   3265  C C5    . DT  B 1 14  ? 117.285 69.300  -43.357 1.00 76.19  ? 160  DT  J C5    1 
ATOM   3266  C C7    . DT  B 1 14  ? 117.232 67.857  -42.965 1.00 75.48  ? 160  DT  J C7    1 
ATOM   3267  C C6    . DT  B 1 14  ? 118.347 70.086  -43.119 1.00 76.95  ? 160  DT  J C6    1 
ATOM   3268  P P     . DG  B 1 15  ? 123.025 74.363  -41.194 1.00 135.06 ? 161  DG  J P     1 
ATOM   3269  O OP1   . DG  B 1 15  ? 124.240 74.144  -42.019 1.00 97.66  ? 161  DG  J OP1   1 
ATOM   3270  O OP2   . DG  B 1 15  ? 122.972 73.841  -39.802 1.00 97.44  ? 161  DG  J OP2   1 
ATOM   3271  O "O5'" . DG  B 1 15  ? 122.720 75.925  -41.171 1.00 135.71 ? 161  DG  J "O5'" 1 
ATOM   3272  C "C5'" . DG  B 1 15  ? 122.508 76.640  -42.388 1.00 137.77 ? 161  DG  J "C5'" 1 
ATOM   3273  C "C4'" . DG  B 1 15  ? 121.236 77.451  -42.302 1.00 138.70 ? 161  DG  J "C4'" 1 
ATOM   3274  O "O4'" . DG  B 1 15  ? 120.080 76.580  -42.357 1.00 138.52 ? 161  DG  J "O4'" 1 
ATOM   3275  C "C3'" . DG  B 1 15  ? 121.098 78.253  -41.012 1.00 139.70 ? 161  DG  J "C3'" 1 
ATOM   3276  O "O3'" . DG  B 1 15  ? 120.505 79.520  -41.290 1.00 141.25 ? 161  DG  J "O3'" 1 
ATOM   3277  C "C2'" . DG  B 1 15  ? 120.179 77.397  -40.159 1.00 138.82 ? 161  DG  J "C2'" 1 
ATOM   3278  C "C1'" . DG  B 1 15  ? 119.278 76.751  -41.197 1.00 138.47 ? 161  DG  J "C1'" 1 
ATOM   3279  N N9    . DG  B 1 15  ? 118.767 75.437  -40.814 1.00 101.09 ? 161  DG  J N9    1 
ATOM   3280  C C8    . DG  B 1 15  ? 119.451 74.444  -40.156 1.00 101.21 ? 161  DG  J C8    1 
ATOM   3281  N N7    . DG  B 1 15  ? 118.741 73.363  -39.979 1.00 100.92 ? 161  DG  J N7    1 
ATOM   3282  C C5    . DG  B 1 15  ? 117.512 73.661  -40.551 1.00 99.97  ? 161  DG  J C5    1 
ATOM   3283  C C6    . DG  B 1 15  ? 116.340 72.870  -40.678 1.00 99.02  ? 161  DG  J C6    1 
ATOM   3284  O O6    . DG  B 1 15  ? 116.155 71.701  -40.318 1.00 97.47  ? 161  DG  J O6    1 
ATOM   3285  N N1    . DG  B 1 15  ? 115.317 73.570  -41.307 1.00 98.78  ? 161  DG  J N1    1 
ATOM   3286  C C2    . DG  B 1 15  ? 115.410 74.860  -41.767 1.00 99.08  ? 161  DG  J C2    1 
ATOM   3287  N N2    . DG  B 1 15  ? 114.307 75.366  -42.333 1.00 98.56  ? 161  DG  J N2    1 
ATOM   3288  N N3    . DG  B 1 15  ? 116.501 75.601  -41.673 1.00 100.00 ? 161  DG  J N3    1 
ATOM   3289  C C4    . DG  B 1 15  ? 117.506 74.944  -41.058 1.00 100.38 ? 161  DG  J C4    1 
ATOM   3290  P P     . DC  B 1 16  ? 120.259 80.559  -40.094 1.00 124.01 ? 162  DC  J P     1 
ATOM   3291  O OP1   . DC  B 1 16  ? 120.313 81.920  -40.686 1.00 111.22 ? 162  DC  J OP1   1 
ATOM   3292  O OP2   . DC  B 1 16  ? 121.152 80.209  -38.957 1.00 110.45 ? 162  DC  J OP2   1 
ATOM   3293  O "O5'" . DC  B 1 16  ? 118.761 80.262  -39.651 1.00 123.95 ? 162  DC  J "O5'" 1 
ATOM   3294  C "C5'" . DC  B 1 16  ? 117.672 80.578  -40.511 1.00 123.85 ? 162  DC  J "C5'" 1 
ATOM   3295  C "C4'" . DC  B 1 16  ? 116.378 80.512  -39.739 1.00 123.95 ? 162  DC  J "C4'" 1 
ATOM   3296  O "O4'" . DC  B 1 16  ? 116.030 79.130  -39.488 1.00 123.72 ? 162  DC  J "O4'" 1 
ATOM   3297  C "C3'" . DC  B 1 16  ? 116.455 81.190  -38.370 1.00 124.35 ? 162  DC  J "C3'" 1 
ATOM   3298  O "O3'" . DC  B 1 16  ? 115.232 81.869  -38.095 1.00 124.74 ? 162  DC  J "O3'" 1 
ATOM   3299  C "C2'" . DC  B 1 16  ? 116.636 80.027  -37.412 1.00 123.94 ? 162  DC  J "C2'" 1 
ATOM   3300  C "C1'" . DC  B 1 16  ? 115.837 78.932  -38.098 1.00 124.32 ? 162  DC  J "C1'" 1 
ATOM   3301  N N1    . DC  B 1 16  ? 116.250 77.558  -37.776 1.00 111.76 ? 162  DC  J N1    1 
ATOM   3302  C C2    . DC  B 1 16  ? 115.428 76.503  -38.178 1.00 111.59 ? 162  DC  J C2    1 
ATOM   3303  O O2    . DC  B 1 16  ? 114.389 76.760  -38.802 1.00 111.23 ? 162  DC  J O2    1 
ATOM   3304  N N3    . DC  B 1 16  ? 115.787 75.234  -37.880 1.00 111.69 ? 162  DC  J N3    1 
ATOM   3305  C C4    . DC  B 1 16  ? 116.919 75.000  -37.213 1.00 111.55 ? 162  DC  J C4    1 
ATOM   3306  N N4    . DC  B 1 16  ? 117.235 73.733  -36.942 1.00 111.00 ? 162  DC  J N4    1 
ATOM   3307  C C5    . DC  B 1 16  ? 117.778 76.057  -36.795 1.00 111.74 ? 162  DC  J C5    1 
ATOM   3308  C C6    . DC  B 1 16  ? 117.409 77.308  -37.095 1.00 111.97 ? 162  DC  J C6    1 
ATOM   3309  P P     . DA  B 1 17  ? 115.213 83.472  -38.021 1.00 118.62 ? 163  DA  J P     1 
ATOM   3310  O OP1   . DA  B 1 17  ? 116.075 83.987  -39.116 1.00 111.37 ? 163  DA  J OP1   1 
ATOM   3311  O OP2   . DA  B 1 17  ? 115.485 83.877  -36.616 1.00 111.80 ? 163  DA  J OP2   1 
ATOM   3312  O "O5'" . DA  B 1 17  ? 113.705 83.835  -38.373 1.00 117.91 ? 163  DA  J "O5'" 1 
ATOM   3313  C "C5'" . DA  B 1 17  ? 113.116 83.398  -39.596 1.00 116.63 ? 163  DA  J "C5'" 1 
ATOM   3314  C "C4'" . DA  B 1 17  ? 111.855 82.616  -39.311 1.00 116.27 ? 163  DA  J "C4'" 1 
ATOM   3315  O "O4'" . DA  B 1 17  ? 112.198 81.346  -38.705 1.00 115.29 ? 163  DA  J "O4'" 1 
ATOM   3316  C "C3'" . DA  B 1 17  ? 110.902 83.307  -38.336 1.00 116.44 ? 163  DA  J "C3'" 1 
ATOM   3317  O "O3'" . DA  B 1 17  ? 109.547 83.072  -38.725 1.00 117.40 ? 163  DA  J "O3'" 1 
ATOM   3318  C "C2'" . DA  B 1 17  ? 111.208 82.635  -37.011 1.00 115.62 ? 163  DA  J "C2'" 1 
ATOM   3319  C "C1'" . DA  B 1 17  ? 111.576 81.225  -37.434 1.00 114.94 ? 163  DA  J "C1'" 1 
ATOM   3320  N N9    . DA  B 1 17  ? 112.518 80.561  -36.534 1.00 107.78 ? 163  DA  J N9    1 
ATOM   3321  C C8    . DA  B 1 17  ? 113.479 81.137  -35.738 1.00 107.52 ? 163  DA  J C8    1 
ATOM   3322  N N7    . DA  B 1 17  ? 114.169 80.274  -35.033 1.00 107.33 ? 163  DA  J N7    1 
ATOM   3323  C C5    . DA  B 1 17  ? 113.631 79.045  -35.390 1.00 107.46 ? 163  DA  J C5    1 
ATOM   3324  C C6    . DA  B 1 17  ? 113.927 77.726  -34.990 1.00 107.22 ? 163  DA  J C6    1 
ATOM   3325  N N6    . DA  B 1 17  ? 114.884 77.413  -34.113 1.00 106.72 ? 163  DA  J N6    1 
ATOM   3326  N N1    . DA  B 1 17  ? 113.197 76.727  -35.532 1.00 107.23 ? 163  DA  J N1    1 
ATOM   3327  C C2    . DA  B 1 17  ? 112.239 77.040  -36.416 1.00 107.65 ? 163  DA  J C2    1 
ATOM   3328  N N3    . DA  B 1 17  ? 111.869 78.236  -36.873 1.00 107.86 ? 163  DA  J N3    1 
ATOM   3329  C C4    . DA  B 1 17  ? 112.612 79.207  -36.314 1.00 107.80 ? 163  DA  J C4    1 
ATOM   3330  P P     . DG  B 1 18  ? 108.348 83.722  -37.875 1.00 128.18 ? 164  DG  J P     1 
ATOM   3331  O OP1   . DG  B 1 18  ? 107.344 84.251  -38.836 1.00 116.57 ? 164  DG  J OP1   1 
ATOM   3332  O OP2   . DG  B 1 18  ? 108.940 84.627  -36.854 1.00 116.32 ? 164  DG  J OP2   1 
ATOM   3333  O "O5'" . DG  B 1 18  ? 107.712 82.470  -37.130 1.00 125.98 ? 164  DG  J "O5'" 1 
ATOM   3334  C "C5'" . DG  B 1 18  ? 107.399 81.293  -37.861 1.00 124.65 ? 164  DG  J "C5'" 1 
ATOM   3335  C "C4'" . DG  B 1 18  ? 107.204 80.125  -36.925 1.00 123.73 ? 164  DG  J "C4'" 1 
ATOM   3336  O "O4'" . DG  B 1 18  ? 108.453 79.775  -36.279 1.00 125.11 ? 164  DG  J "O4'" 1 
ATOM   3337  C "C3'" . DG  B 1 18  ? 106.198 80.358  -35.797 1.00 122.66 ? 164  DG  J "C3'" 1 
ATOM   3338  O "O3'" . DG  B 1 18  ? 105.448 79.161  -35.607 1.00 120.43 ? 164  DG  J "O3'" 1 
ATOM   3339  C "C2'" . DG  B 1 18  ? 107.081 80.584  -34.585 1.00 123.35 ? 164  DG  J "C2'" 1 
ATOM   3340  C "C1'" . DG  B 1 18  ? 108.221 79.636  -34.887 1.00 124.66 ? 164  DG  J "C1'" 1 
ATOM   3341  N N9    . DG  B 1 18  ? 109.468 79.906  -34.178 1.00 114.17 ? 164  DG  J N9    1 
ATOM   3342  C C8    . DG  B 1 18  ? 110.034 81.131  -33.918 1.00 114.31 ? 164  DG  J C8    1 
ATOM   3343  N N7    . DG  B 1 18  ? 111.141 81.047  -33.231 1.00 114.77 ? 164  DG  J N7    1 
ATOM   3344  C C5    . DG  B 1 18  ? 111.321 79.685  -33.031 1.00 114.01 ? 164  DG  J C5    1 
ATOM   3345  C C6    . DG  B 1 18  ? 112.349 78.981  -32.349 1.00 113.82 ? 164  DG  J C6    1 
ATOM   3346  O O6    . DG  B 1 18  ? 113.338 79.438  -31.765 1.00 113.88 ? 164  DG  J O6    1 
ATOM   3347  N N1    . DG  B 1 18  ? 112.144 77.606  -32.393 1.00 113.38 ? 164  DG  J N1    1 
ATOM   3348  C C2    . DG  B 1 18  ? 111.089 76.984  -33.014 1.00 113.17 ? 164  DG  J C2    1 
ATOM   3349  N N2    . DG  B 1 18  ? 111.069 75.645  -32.951 1.00 112.42 ? 164  DG  J N2    1 
ATOM   3350  N N3    . DG  B 1 18  ? 110.125 77.628  -33.650 1.00 113.47 ? 164  DG  J N3    1 
ATOM   3351  C C4    . DG  B 1 18  ? 110.302 78.966  -33.618 1.00 113.96 ? 164  DG  J C4    1 
ATOM   3352  P P     . DA  B 1 19  ? 104.126 79.182  -34.704 1.00 84.20  ? 165  DA  J P     1 
ATOM   3353  O OP1   . DA  B 1 19  ? 102.967 79.206  -35.631 1.00 95.79  ? 165  DA  J OP1   1 
ATOM   3354  O OP2   . DA  B 1 19  ? 104.259 80.229  -33.659 1.00 96.02  ? 165  DA  J OP2   1 
ATOM   3355  O "O5'" . DA  B 1 19  ? 104.165 77.764  -33.990 1.00 84.01  ? 165  DA  J "O5'" 1 
ATOM   3356  C "C5'" . DA  B 1 19  ? 104.451 76.587  -34.736 1.00 83.78  ? 165  DA  J "C5'" 1 
ATOM   3357  C "C4'" . DA  B 1 19  ? 104.933 75.496  -33.812 1.00 83.82  ? 165  DA  J "C4'" 1 
ATOM   3358  O "O4'" . DA  B 1 19  ? 106.270 75.799  -33.344 1.00 81.49  ? 165  DA  J "O4'" 1 
ATOM   3359  C "C3'" . DA  B 1 19  ? 104.073 75.325  -32.560 1.00 84.49  ? 165  DA  J "C3'" 1 
ATOM   3360  O "O3'" . DA  B 1 19  ? 103.964 73.942  -32.237 1.00 88.76  ? 165  DA  J "O3'" 1 
ATOM   3361  C "C2'" . DA  B 1 19  ? 104.859 76.061  -31.492 1.00 82.53  ? 165  DA  J "C2'" 1 
ATOM   3362  C "C1'" . DA  B 1 19  ? 106.291 75.808  -31.926 1.00 80.52  ? 165  DA  J "C1'" 1 
ATOM   3363  N N9    . DA  B 1 19  ? 107.252 76.825  -31.497 1.00 89.36  ? 165  DA  J N9    1 
ATOM   3364  C C8    . DA  B 1 19  ? 107.236 78.172  -31.766 1.00 88.43  ? 165  DA  J C8    1 
ATOM   3365  N N7    . DA  B 1 19  ? 108.249 78.826  -31.249 1.00 87.22  ? 165  DA  J N7    1 
ATOM   3366  C C5    . DA  B 1 19  ? 108.978 77.845  -30.592 1.00 87.00  ? 165  DA  J C5    1 
ATOM   3367  C C6    . DA  B 1 19  ? 110.169 77.892  -29.848 1.00 86.90  ? 165  DA  J C6    1 
ATOM   3368  N N6    . DA  B 1 19  ? 110.858 79.013  -29.624 1.00 87.28  ? 165  DA  J N6    1 
ATOM   3369  N N1    . DA  B 1 19  ? 110.634 76.733  -29.334 1.00 86.44  ? 165  DA  J N1    1 
ATOM   3370  C C2    . DA  B 1 19  ? 109.940 75.610  -29.555 1.00 86.46  ? 165  DA  J C2    1 
ATOM   3371  N N3    . DA  B 1 19  ? 108.809 75.438  -30.232 1.00 86.61  ? 165  DA  J N3    1 
ATOM   3372  C C4    . DA  B 1 19  ? 108.376 76.609  -30.734 1.00 87.64  ? 165  DA  J C4    1 
ATOM   3373  P P     . DT  B 1 20  ? 102.806 73.446  -31.244 1.00 146.68 ? 166  DT  J P     1 
ATOM   3374  O OP1   . DT  B 1 20  ? 101.895 72.553  -32.008 1.00 93.03  ? 166  DT  J OP1   1 
ATOM   3375  O OP2   . DT  B 1 20  ? 102.249 74.627  -30.546 1.00 93.87  ? 166  DT  J OP2   1 
ATOM   3376  O "O5'" . DT  B 1 20  ? 103.613 72.565  -30.195 1.00 149.31 ? 166  DT  J "O5'" 1 
ATOM   3377  C "C5'" . DT  B 1 20  ? 104.562 71.607  -30.649 1.00 155.01 ? 166  DT  J "C5'" 1 
ATOM   3378  C "C4'" . DT  B 1 20  ? 105.521 71.245  -29.540 1.00 159.07 ? 166  DT  J "C4'" 1 
ATOM   3379  O "O4'" . DT  B 1 20  ? 106.480 72.309  -29.313 1.00 159.84 ? 166  DT  J "O4'" 1 
ATOM   3380  C "C3'" . DT  B 1 20  ? 104.866 70.965  -28.186 1.00 161.40 ? 166  DT  J "C3'" 1 
ATOM   3381  O "O3'" . DT  B 1 20  ? 105.467 69.811  -27.592 1.00 164.74 ? 166  DT  J "O3'" 1 
ATOM   3382  C "C2'" . DT  B 1 20  ? 105.203 72.203  -27.374 1.00 161.16 ? 166  DT  J "C2'" 1 
ATOM   3383  C "C1'" . DT  B 1 20  ? 106.576 72.537  -27.918 1.00 160.63 ? 166  DT  J "C1'" 1 
ATOM   3384  N N1    . DT  B 1 20  ? 107.031 73.922  -27.697 1.00 107.61 ? 166  DT  J N1    1 
ATOM   3385  C C2    . DT  B 1 20  ? 108.247 74.098  -27.074 1.00 107.44 ? 166  DT  J C2    1 
ATOM   3386  O O2    . DT  B 1 20  ? 108.947 73.167  -26.706 1.00 107.68 ? 166  DT  J O2    1 
ATOM   3387  N N3    . DT  B 1 20  ? 108.615 75.409  -26.896 1.00 107.19 ? 166  DT  J N3    1 
ATOM   3388  C C4    . DT  B 1 20  ? 107.905 76.535  -27.268 1.00 107.06 ? 166  DT  J C4    1 
ATOM   3389  O O4    . DT  B 1 20  ? 108.369 77.652  -27.046 1.00 106.26 ? 166  DT  J O4    1 
ATOM   3390  C C5    . DT  B 1 20  ? 106.636 76.277  -27.912 1.00 107.22 ? 166  DT  J C5    1 
ATOM   3391  C C7    . DT  B 1 20  ? 105.793 77.436  -28.345 1.00 106.85 ? 166  DT  J C7    1 
ATOM   3392  C C6    . DT  B 1 20  ? 106.268 75.000  -28.094 1.00 107.54 ? 166  DT  J C6    1 
ATOM   3393  P P     . DT  B 1 21  ? 105.249 69.515  -26.030 1.00 158.90 ? 167  DT  J P     1 
ATOM   3394  O OP1   . DT  B 1 21  ? 105.467 68.064  -25.793 1.00 120.05 ? 167  DT  J OP1   1 
ATOM   3395  O OP2   . DT  B 1 21  ? 103.954 70.137  -25.642 1.00 120.10 ? 167  DT  J OP2   1 
ATOM   3396  O "O5'" . DT  B 1 21  ? 106.437 70.318  -25.332 1.00 160.15 ? 167  DT  J "O5'" 1 
ATOM   3397  C "C5'" . DT  B 1 21  ? 107.790 69.897  -25.500 1.00 164.80 ? 167  DT  J "C5'" 1 
ATOM   3398  C "C4'" . DT  B 1 21  ? 108.594 70.204  -24.258 1.00 167.57 ? 167  DT  J "C4'" 1 
ATOM   3399  O "O4'" . DT  B 1 21  ? 108.964 71.604  -24.228 1.00 168.37 ? 167  DT  J "O4'" 1 
ATOM   3400  C "C3'" . DT  B 1 21  ? 107.864 69.926  -22.943 1.00 169.23 ? 167  DT  J "C3'" 1 
ATOM   3401  O "O3'" . DT  B 1 21  ? 108.755 69.337  -21.993 1.00 171.20 ? 167  DT  J "O3'" 1 
ATOM   3402  C "C2'" . DT  B 1 21  ? 107.439 71.308  -22.481 1.00 169.00 ? 167  DT  J "C2'" 1 
ATOM   3403  C "C1'" . DT  B 1 21  ? 108.580 72.170  -22.986 1.00 168.84 ? 167  DT  J "C1'" 1 
ATOM   3404  N N1    . DT  B 1 21  ? 108.235 73.587  -23.214 1.00 130.51 ? 167  DT  J N1    1 
ATOM   3405  C C2    . DT  B 1 21  ? 109.233 74.523  -23.064 1.00 130.35 ? 167  DT  J C2    1 
ATOM   3406  O O2    . DT  B 1 21  ? 110.381 74.231  -22.763 1.00 130.32 ? 167  DT  J O2    1 
ATOM   3407  N N3    . DT  B 1 21  ? 108.837 75.821  -23.279 1.00 129.79 ? 167  DT  J N3    1 
ATOM   3408  C C4    . DT  B 1 21  ? 107.573 76.264  -23.623 1.00 129.05 ? 167  DT  J C4    1 
ATOM   3409  O O4    . DT  B 1 21  ? 107.368 77.466  -23.778 1.00 128.07 ? 167  DT  J O4    1 
ATOM   3410  C C5    . DT  B 1 21  ? 106.576 75.227  -23.769 1.00 129.03 ? 167  DT  J C5    1 
ATOM   3411  C C7    . DT  B 1 21  ? 105.179 75.609  -24.144 1.00 128.75 ? 167  DT  J C7    1 
ATOM   3412  C C6    . DT  B 1 21  ? 106.952 73.958  -23.561 1.00 129.69 ? 167  DT  J C6    1 
ATOM   3413  P P     . DC  B 1 22  ? 108.306 69.206  -20.455 1.00 156.56 ? 168  DC  J P     1 
ATOM   3414  O OP1   . DC  B 1 22  ? 108.969 67.997  -19.905 1.00 143.15 ? 168  DC  J OP1   1 
ATOM   3415  O OP2   . DC  B 1 22  ? 106.829 69.337  -20.366 1.00 142.89 ? 168  DC  J OP2   1 
ATOM   3416  O "O5'" . DC  B 1 22  ? 108.962 70.486  -19.773 1.00 157.86 ? 168  DC  J "O5'" 1 
ATOM   3417  C "C5'" . DC  B 1 22  ? 110.379 70.608  -19.684 1.00 160.88 ? 168  DC  J "C5'" 1 
ATOM   3418  C "C4'" . DC  B 1 22  ? 110.753 71.568  -18.580 1.00 162.62 ? 168  DC  J "C4'" 1 
ATOM   3419  O "O4'" . DC  B 1 22  ? 110.546 72.935  -19.010 1.00 163.39 ? 168  DC  J "O4'" 1 
ATOM   3420  C "C3'" . DC  B 1 22  ? 109.945 71.399  -17.293 1.00 163.40 ? 168  DC  J "C3'" 1 
ATOM   3421  O "O3'" . DC  B 1 22  ? 110.799 71.542  -16.156 1.00 164.02 ? 168  DC  J "O3'" 1 
ATOM   3422  C "C2'" . DC  B 1 22  ? 108.947 72.542  -17.354 1.00 163.81 ? 168  DC  J "C2'" 1 
ATOM   3423  C "C1'" . DC  B 1 22  ? 109.755 73.618  -18.051 1.00 164.06 ? 168  DC  J "C1'" 1 
ATOM   3424  N N1    . DC  B 1 22  ? 108.959 74.633  -18.757 1.00 151.37 ? 168  DC  J N1    1 
ATOM   3425  C C2    . DC  B 1 22  ? 109.459 75.937  -18.844 1.00 151.57 ? 168  DC  J C2    1 
ATOM   3426  O O2    . DC  B 1 22  ? 110.559 76.193  -18.333 1.00 151.62 ? 168  DC  J O2    1 
ATOM   3427  N N3    . DC  B 1 22  ? 108.733 76.882  -19.483 1.00 151.84 ? 168  DC  J N3    1 
ATOM   3428  C C4    . DC  B 1 22  ? 107.554 76.565  -20.025 1.00 151.91 ? 168  DC  J C4    1 
ATOM   3429  N N4    . DC  B 1 22  ? 106.872 77.531  -20.647 1.00 151.57 ? 168  DC  J N4    1 
ATOM   3430  C C5    . DC  B 1 22  ? 107.022 75.244  -19.953 1.00 151.82 ? 168  DC  J C5    1 
ATOM   3431  C C6    . DC  B 1 22  ? 107.751 74.318  -19.316 1.00 151.58 ? 168  DC  J C6    1 
ATOM   3432  P P     . DT  B 1 23  ? 110.157 71.703  -14.693 1.00 162.45 ? 169  DT  J P     1 
ATOM   3433  O OP1   . DT  B 1 23  ? 111.135 71.192  -13.699 1.00 151.58 ? 169  DT  J OP1   1 
ATOM   3434  O OP2   . DT  B 1 23  ? 108.783 71.140  -14.726 1.00 151.31 ? 169  DT  J OP2   1 
ATOM   3435  O "O5'" . DT  B 1 23  ? 110.045 73.280  -14.516 1.00 162.60 ? 169  DT  J "O5'" 1 
ATOM   3436  C "C5'" . DT  B 1 23  ? 111.217 74.075  -14.367 1.00 163.92 ? 169  DT  J "C5'" 1 
ATOM   3437  C "C4'" . DT  B 1 23  ? 110.887 75.351  -13.632 1.00 164.71 ? 169  DT  J "C4'" 1 
ATOM   3438  O "O4'" . DT  B 1 23  ? 110.212 76.275  -14.519 1.00 164.61 ? 169  DT  J "O4'" 1 
ATOM   3439  C "C3'" . DT  B 1 23  ? 109.957 75.152  -12.434 1.00 165.42 ? 169  DT  J "C3'" 1 
ATOM   3440  O "O3'" . DT  B 1 23  ? 110.354 76.000  -11.354 1.00 166.42 ? 169  DT  J "O3'" 1 
ATOM   3441  C "C2'" . DT  B 1 23  ? 108.606 75.595  -12.966 1.00 164.93 ? 169  DT  J "C2'" 1 
ATOM   3442  C "C1'" . DT  B 1 23  ? 109.003 76.707  -13.918 1.00 164.54 ? 169  DT  J "C1'" 1 
ATOM   3443  N N1    . DT  B 1 23  ? 108.034 76.998  -14.992 1.00 152.86 ? 169  DT  J N1    1 
ATOM   3444  C C2    . DT  B 1 23  ? 107.996 78.282  -15.488 1.00 152.90 ? 169  DT  J C2    1 
ATOM   3445  O O2    . DT  B 1 23  ? 108.730 79.171  -15.090 1.00 153.06 ? 169  DT  J O2    1 
ATOM   3446  N N3    . DT  B 1 23  ? 107.064 78.488  -16.473 1.00 152.21 ? 169  DT  J N3    1 
ATOM   3447  C C4    . DT  B 1 23  ? 106.188 77.559  -17.001 1.00 151.63 ? 169  DT  J C4    1 
ATOM   3448  O O4    . DT  B 1 23  ? 105.402 77.894  -17.882 1.00 150.64 ? 169  DT  J O4    1 
ATOM   3449  C C5    . DT  B 1 23  ? 106.287 76.230  -16.439 1.00 151.54 ? 169  DT  J C5    1 
ATOM   3450  C C7    . DT  B 1 23  ? 105.380 75.156  -16.951 1.00 151.34 ? 169  DT  J C7    1 
ATOM   3451  C C6    . DT  B 1 23  ? 107.193 76.019  -15.476 1.00 152.19 ? 169  DT  J C6    1 
ATOM   3452  P P     . DA  B 1 24  ? 109.913 75.637  -9.853  1.00 169.65 ? 170  DA  J P     1 
ATOM   3453  O OP1   . DA  B 1 24  ? 111.072 75.016  -9.161  1.00 155.70 ? 170  DA  J OP1   1 
ATOM   3454  O OP2   . DA  B 1 24  ? 108.619 74.910  -9.914  1.00 155.60 ? 170  DA  J OP2   1 
ATOM   3455  O "O5'" . DA  B 1 24  ? 109.648 77.063  -9.201  1.00 169.65 ? 170  DA  J "O5'" 1 
ATOM   3456  C "C5'" . DA  B 1 24  ? 110.606 78.109  -9.330  1.00 170.60 ? 170  DA  J "C5'" 1 
ATOM   3457  C "C4'" . DA  B 1 24  ? 109.911 79.448  -9.342  1.00 171.05 ? 170  DA  J "C4'" 1 
ATOM   3458  O "O4'" . DA  B 1 24  ? 109.174 79.601  -10.582 1.00 171.77 ? 170  DA  J "O4'" 1 
ATOM   3459  C "C3'" . DA  B 1 24  ? 108.889 79.620  -8.219  1.00 170.90 ? 170  DA  J "C3'" 1 
ATOM   3460  O "O3'" . DA  B 1 24  ? 108.942 80.955  -7.705  1.00 169.59 ? 170  DA  J "O3'" 1 
ATOM   3461  C "C2'" . DA  B 1 24  ? 107.564 79.343  -8.907  1.00 172.04 ? 170  DA  J "C2'" 1 
ATOM   3462  C "C1'" . DA  B 1 24  ? 107.813 79.890  -10.298 1.00 172.79 ? 170  DA  J "C1'" 1 
ATOM   3463  N N9    . DA  B 1 24  ? 106.986 79.278  -11.338 1.00 159.72 ? 170  DA  J N9    1 
ATOM   3464  C C8    . DA  B 1 24  ? 106.666 77.951  -11.490 1.00 160.44 ? 170  DA  J C8    1 
ATOM   3465  N N7    . DA  B 1 24  ? 105.887 77.709  -12.518 1.00 160.57 ? 170  DA  J N7    1 
ATOM   3466  C C5    . DA  B 1 24  ? 105.683 78.960  -13.083 1.00 160.19 ? 170  DA  J C5    1 
ATOM   3467  C C6    . DA  B 1 24  ? 104.945 79.384  -14.203 1.00 160.01 ? 170  DA  J C6    1 
ATOM   3468  N N6    . DA  B 1 24  ? 104.245 78.559  -14.983 1.00 159.43 ? 170  DA  J N6    1 
ATOM   3469  N N1    . DA  B 1 24  ? 104.951 80.702  -14.496 1.00 159.83 ? 170  DA  J N1    1 
ATOM   3470  C C2    . DA  B 1 24  ? 105.651 81.530  -13.711 1.00 159.96 ? 170  DA  J C2    1 
ATOM   3471  N N3    . DA  B 1 24  ? 106.381 81.254  -12.632 1.00 160.14 ? 170  DA  J N3    1 
ATOM   3472  C C4    . DA  B 1 24  ? 106.356 79.935  -12.369 1.00 160.13 ? 170  DA  J C4    1 
ATOM   3473  P P     . DC  B 1 25  ? 107.610 81.640  -7.123  1.00 188.93 ? 171  DC  J P     1 
ATOM   3474  O OP1   . DC  B 1 25  ? 108.005 82.815  -6.305  1.00 155.20 ? 171  DC  J OP1   1 
ATOM   3475  O OP2   . DC  B 1 25  ? 106.763 80.579  -6.520  1.00 155.25 ? 171  DC  J OP2   1 
ATOM   3476  O "O5'" . DC  B 1 25  ? 106.882 82.173  -8.433  1.00 187.09 ? 171  DC  J "O5'" 1 
ATOM   3477  C "C5'" . DC  B 1 25  ? 107.420 83.272  -9.162  1.00 185.56 ? 171  DC  J "C5'" 1 
ATOM   3478  C "C4'" . DC  B 1 25  ? 106.345 84.306  -9.387  1.00 183.25 ? 171  DC  J "C4'" 1 
ATOM   3479  O "O4'" . DC  B 1 25  ? 105.423 83.817  -10.390 1.00 184.33 ? 171  DC  J "O4'" 1 
ATOM   3480  C "C3'" . DC  B 1 25  ? 105.512 84.560  -8.134  1.00 181.30 ? 171  DC  J "C3'" 1 
ATOM   3481  O "O3'" . DC  B 1 25  ? 105.138 85.933  -8.041  1.00 176.36 ? 171  DC  J "O3'" 1 
ATOM   3482  C "C2'" . DC  B 1 25  ? 104.304 83.660  -8.321  1.00 182.37 ? 171  DC  J "C2'" 1 
ATOM   3483  C "C1'" . DC  B 1 25  ? 104.132 83.618  -9.832  1.00 184.12 ? 171  DC  J "C1'" 1 
ATOM   3484  N N1    . DC  B 1 25  ? 103.626 82.333  -10.343 1.00 150.55 ? 171  DC  J N1    1 
ATOM   3485  C C2    . DC  B 1 25  ? 102.632 82.340  -11.326 1.00 150.16 ? 171  DC  J C2    1 
ATOM   3486  O O2    . DC  B 1 25  ? 102.193 83.428  -11.727 1.00 150.04 ? 171  DC  J O2    1 
ATOM   3487  N N3    . DC  B 1 25  ? 102.174 81.163  -11.813 1.00 149.46 ? 171  DC  J N3    1 
ATOM   3488  C C4    . DC  B 1 25  ? 102.671 80.013  -11.352 1.00 149.13 ? 171  DC  J C4    1 
ATOM   3489  N N4    . DC  B 1 25  ? 102.198 78.876  -11.866 1.00 147.65 ? 171  DC  J N4    1 
ATOM   3490  C C5    . DC  B 1 25  ? 103.677 79.976  -10.344 1.00 149.66 ? 171  DC  J C5    1 
ATOM   3491  C C6    . DC  B 1 25  ? 104.122 81.148  -9.872  1.00 150.46 ? 171  DC  J C6    1 
ATOM   3492  P P     . DC  B 1 26  ? 104.216 86.417  -6.822  1.00 127.92 ? 172  DC  J P     1 
ATOM   3493  O OP1   . DC  B 1 26  ? 104.393 87.884  -6.679  1.00 134.50 ? 172  DC  J OP1   1 
ATOM   3494  O OP2   . DC  B 1 26  ? 104.475 85.528  -5.660  1.00 134.63 ? 172  DC  J OP2   1 
ATOM   3495  O "O5'" . DC  B 1 26  ? 102.742 86.132  -7.350  1.00 125.24 ? 172  DC  J "O5'" 1 
ATOM   3496  C "C5'" . DC  B 1 26  ? 102.239 86.819  -8.492  1.00 120.24 ? 172  DC  J "C5'" 1 
ATOM   3497  C "C4'" . DC  B 1 26  ? 100.767 86.534  -8.671  1.00 117.16 ? 172  DC  J "C4'" 1 
ATOM   3498  O "O4'" . DC  B 1 26  ? 100.564 85.232  -9.275  1.00 115.19 ? 172  DC  J "O4'" 1 
ATOM   3499  C "C3'" . DC  B 1 26  ? 99.945  86.541  -7.380  1.00 116.27 ? 172  DC  J "C3'" 1 
ATOM   3500  O "O3'" . DC  B 1 26  ? 98.702  87.205  -7.609  1.00 116.70 ? 172  DC  J "O3'" 1 
ATOM   3501  C "C2'" . DC  B 1 26  ? 99.684  85.066  -7.129  1.00 114.64 ? 172  DC  J "C2'" 1 
ATOM   3502  C "C1'" . DC  B 1 26  ? 99.559  84.549  -8.549  1.00 113.62 ? 172  DC  J "C1'" 1 
ATOM   3503  N N1    . DC  B 1 26  ? 99.749  83.100  -8.743  1.00 118.78 ? 172  DC  J N1    1 
ATOM   3504  C C2    . DC  B 1 26  ? 99.487  82.555  -10.006 1.00 117.98 ? 172  DC  J C2    1 
ATOM   3505  O O2    . DC  B 1 26  ? 99.139  83.310  -10.926 1.00 117.82 ? 172  DC  J O2    1 
ATOM   3506  N N3    . DC  B 1 26  ? 99.623  81.223  -10.194 1.00 116.92 ? 172  DC  J N3    1 
ATOM   3507  C C4    . DC  B 1 26  ? 100.011 80.443  -9.183  1.00 116.40 ? 172  DC  J C4    1 
ATOM   3508  N N4    . DC  B 1 26  ? 100.126 79.135  -9.414  1.00 115.53 ? 172  DC  J N4    1 
ATOM   3509  C C5    . DC  B 1 26  ? 100.298 80.972  -7.892  1.00 116.73 ? 172  DC  J C5    1 
ATOM   3510  C C6    . DC  B 1 26  ? 100.156 82.293  -7.718  1.00 118.19 ? 172  DC  J C6    1 
ATOM   3511  P P     . DA  B 1 27  ? 98.249  88.405  -6.643  1.00 113.75 ? 173  DA  J P     1 
ATOM   3512  O OP1   . DA  B 1 27  ? 99.428  89.280  -6.410  1.00 148.89 ? 173  DA  J OP1   1 
ATOM   3513  O OP2   . DA  B 1 27  ? 97.528  87.819  -5.482  1.00 148.58 ? 173  DA  J OP2   1 
ATOM   3514  O "O5'" . DA  B 1 27  ? 97.195  89.208  -7.526  1.00 114.34 ? 173  DA  J "O5'" 1 
ATOM   3515  C "C5'" . DA  B 1 27  ? 97.577  89.764  -8.783  1.00 113.31 ? 173  DA  J "C5'" 1 
ATOM   3516  C "C4'" . DA  B 1 27  ? 96.623  89.318  -9.867  1.00 112.83 ? 173  DA  J "C4'" 1 
ATOM   3517  O "O4'" . DA  B 1 27  ? 96.706  87.881  -10.016 1.00 112.45 ? 173  DA  J "O4'" 1 
ATOM   3518  C "C3'" . DA  B 1 27  ? 95.153  89.629  -9.593  1.00 112.66 ? 173  DA  J "C3'" 1 
ATOM   3519  O "O3'" . DA  B 1 27  ? 94.508  90.003  -10.812 1.00 112.75 ? 173  DA  J "O3'" 1 
ATOM   3520  C "C2'" . DA  B 1 27  ? 94.604  88.318  -9.061  1.00 112.52 ? 173  DA  J "C2'" 1 
ATOM   3521  C "C1'" . DA  B 1 27  ? 95.437  87.282  -9.795  1.00 112.86 ? 173  DA  J "C1'" 1 
ATOM   3522  N N9    . DA  B 1 27  ? 95.656  86.051  -9.037  1.00 149.24 ? 173  DA  J N9    1 
ATOM   3523  C C8    . DA  B 1 27  ? 95.760  85.912  -7.675  1.00 149.45 ? 173  DA  J C8    1 
ATOM   3524  N N7    . DA  B 1 27  ? 95.966  84.678  -7.282  1.00 150.11 ? 173  DA  J N7    1 
ATOM   3525  C C5    . DA  B 1 27  ? 95.999  83.953  -8.465  1.00 150.92 ? 173  DA  J C5    1 
ATOM   3526  C C6    . DA  B 1 27  ? 96.187  82.584  -8.732  1.00 151.41 ? 173  DA  J C6    1 
ATOM   3527  N N6    . DA  B 1 27  ? 96.388  81.665  -7.786  1.00 151.92 ? 173  DA  J N6    1 
ATOM   3528  N N1    . DA  B 1 27  ? 96.161  82.187  -10.021 1.00 151.94 ? 173  DA  J N1    1 
ATOM   3529  C C2    . DA  B 1 27  ? 95.962  83.109  -10.971 1.00 152.24 ? 173  DA  J C2    1 
ATOM   3530  N N3    . DA  B 1 27  ? 95.776  84.423  -10.847 1.00 151.47 ? 173  DA  J N3    1 
ATOM   3531  C C4    . DA  B 1 27  ? 95.806  84.786  -9.553  1.00 150.50 ? 173  DA  J C4    1 
ATOM   3532  P P     . DA  B 1 28  ? 92.957  90.424  -10.799 1.00 127.09 ? 174  DA  J P     1 
ATOM   3533  O OP1   . DA  B 1 28  ? 92.783  91.632  -11.649 1.00 136.45 ? 174  DA  J OP1   1 
ATOM   3534  O OP2   . DA  B 1 28  ? 92.494  90.444  -9.388  1.00 136.66 ? 174  DA  J OP2   1 
ATOM   3535  O "O5'" . DA  B 1 28  ? 92.256  89.199  -11.525 1.00 125.41 ? 174  DA  J "O5'" 1 
ATOM   3536  C "C5'" . DA  B 1 28  ? 92.863  88.598  -12.664 1.00 122.56 ? 174  DA  J "C5'" 1 
ATOM   3537  C "C4'" . DA  B 1 28  ? 92.192  87.282  -12.968 1.00 120.54 ? 174  DA  J "C4'" 1 
ATOM   3538  O "O4'" . DA  B 1 28  ? 92.577  86.296  -11.979 1.00 119.42 ? 174  DA  J "O4'" 1 
ATOM   3539  C "C3'" . DA  B 1 28  ? 90.668  87.365  -12.922 1.00 119.51 ? 174  DA  J "C3'" 1 
ATOM   3540  O "O3'" . DA  B 1 28  ? 90.102  86.599  -13.987 1.00 118.20 ? 174  DA  J "O3'" 1 
ATOM   3541  C "C2'" . DA  B 1 28  ? 90.323  86.781  -11.563 1.00 119.00 ? 174  DA  J "C2'" 1 
ATOM   3542  C "C1'" . DA  B 1 28  ? 91.421  85.752  -11.362 1.00 118.90 ? 174  DA  J "C1'" 1 
ATOM   3543  N N9    . DA  B 1 28  ? 91.749  85.471  -9.963  1.00 128.02 ? 174  DA  J N9    1 
ATOM   3544  C C8    . DA  B 1 28  ? 91.714  86.336  -8.897  1.00 128.00 ? 174  DA  J C8    1 
ATOM   3545  N N7    . DA  B 1 28  ? 92.060  85.787  -7.758  1.00 127.81 ? 174  DA  J N7    1 
ATOM   3546  C C5    . DA  B 1 28  ? 92.344  84.471  -8.095  1.00 127.76 ? 174  DA  J C5    1 
ATOM   3547  C C6    . DA  B 1 28  ? 92.767  83.368  -7.331  1.00 127.64 ? 174  DA  J C6    1 
ATOM   3548  N N6    . DA  B 1 28  ? 92.983  83.417  -6.016  1.00 127.92 ? 174  DA  J N6    1 
ATOM   3549  N N1    . DA  B 1 28  ? 92.961  82.196  -7.974  1.00 127.63 ? 174  DA  J N1    1 
ATOM   3550  C C2    . DA  B 1 28  ? 92.742  82.146  -9.292  1.00 127.43 ? 174  DA  J C2    1 
ATOM   3551  N N3    . DA  B 1 28  ? 92.343  83.111  -10.118 1.00 127.54 ? 174  DA  J N3    1 
ATOM   3552  C C4    . DA  B 1 28  ? 92.158  84.262  -9.449  1.00 127.70 ? 174  DA  J C4    1 
ATOM   3553  P P     . DA  B 1 29  ? 88.696  87.043  -14.620 1.00 121.66 ? 175  DA  J P     1 
ATOM   3554  O OP1   . DA  B 1 29  ? 88.796  86.969  -16.102 1.00 131.25 ? 175  DA  J OP1   1 
ATOM   3555  O OP2   . DA  B 1 29  ? 88.304  88.321  -13.971 1.00 131.15 ? 175  DA  J OP2   1 
ATOM   3556  O "O5'" . DA  B 1 29  ? 87.703  85.906  -14.119 1.00 120.08 ? 175  DA  J "O5'" 1 
ATOM   3557  C "C5'" . DA  B 1 29  ? 88.024  85.161  -12.959 1.00 117.94 ? 175  DA  J "C5'" 1 
ATOM   3558  C "C4'" . DA  B 1 29  ? 88.190  83.702  -13.303 1.00 116.87 ? 175  DA  J "C4'" 1 
ATOM   3559  O "O4'" . DA  B 1 29  ? 89.008  83.089  -12.286 1.00 117.51 ? 175  DA  J "O4'" 1 
ATOM   3560  C "C3'" . DA  B 1 29  ? 86.882  82.925  -13.307 1.00 116.40 ? 175  DA  J "C3'" 1 
ATOM   3561  O "O3'" . DA  B 1 29  ? 86.960  81.823  -14.211 1.00 114.78 ? 175  DA  J "O3'" 1 
ATOM   3562  C "C2'" . DA  B 1 29  ? 86.768  82.451  -11.871 1.00 117.60 ? 175  DA  J "C2'" 1 
ATOM   3563  C "C1'" . DA  B 1 29  ? 88.218  82.272  -11.434 1.00 118.11 ? 175  DA  J "C1'" 1 
ATOM   3564  N N9    . DA  B 1 29  ? 88.473  82.711  -10.063 1.00 128.59 ? 175  DA  J N9    1 
ATOM   3565  C C8    . DA  B 1 29  ? 88.183  83.937  -9.514  1.00 128.43 ? 175  DA  J C8    1 
ATOM   3566  N N7    . DA  B 1 29  ? 88.542  84.052  -8.260  1.00 128.67 ? 175  DA  J N7    1 
ATOM   3567  C C5    . DA  B 1 29  ? 89.104  82.819  -7.960  1.00 129.28 ? 175  DA  J C5    1 
ATOM   3568  C C6    . DA  B 1 29  ? 89.678  82.303  -6.788  1.00 129.66 ? 175  DA  J C6    1 
ATOM   3569  N N6    . DA  B 1 29  ? 89.788  82.993  -5.651  1.00 130.73 ? 175  DA  J N6    1 
ATOM   3570  N N1    . DA  B 1 29  ? 90.144  81.036  -6.823  1.00 129.45 ? 175  DA  J N1    1 
ATOM   3571  C C2    . DA  B 1 29  ? 90.036  80.345  -7.963  1.00 129.14 ? 175  DA  J C2    1 
ATOM   3572  N N3    . DA  B 1 29  ? 89.518  80.720  -9.129  1.00 128.84 ? 175  DA  J N3    1 
ATOM   3573  C C4    . DA  B 1 29  ? 89.065  81.983  -9.061  1.00 128.82 ? 175  DA  J C4    1 
ATOM   3574  P P     . DA  B 1 30  ? 85.615  81.084  -14.680 1.00 99.29  ? 176  DA  J P     1 
ATOM   3575  O OP1   . DA  B 1 30  ? 85.812  80.651  -16.086 1.00 117.37 ? 176  DA  J OP1   1 
ATOM   3576  O OP2   . DA  B 1 30  ? 84.472  81.972  -14.336 1.00 115.87 ? 176  DA  J OP2   1 
ATOM   3577  O "O5'" . DA  B 1 30  ? 85.550  79.780  -13.765 1.00 98.05  ? 176  DA  J "O5'" 1 
ATOM   3578  C "C5'" . DA  B 1 30  ? 86.497  78.729  -13.933 1.00 95.26  ? 176  DA  J "C5'" 1 
ATOM   3579  C "C4'" . DA  B 1 30  ? 86.440  77.771  -12.765 1.00 94.59  ? 176  DA  J "C4'" 1 
ATOM   3580  O "O4'" . DA  B 1 30  ? 86.863  78.442  -11.550 1.00 93.90  ? 176  DA  J "O4'" 1 
ATOM   3581  C "C3'" . DA  B 1 30  ? 85.064  77.172  -12.458 1.00 94.43  ? 176  DA  J "C3'" 1 
ATOM   3582  O "O3'" . DA  B 1 30  ? 85.203  75.791  -12.110 1.00 95.72  ? 176  DA  J "O3'" 1 
ATOM   3583  C "C2'" . DA  B 1 30  ? 84.608  77.947  -11.236 1.00 94.08  ? 176  DA  J "C2'" 1 
ATOM   3584  C "C1'" . DA  B 1 30  ? 85.922  78.177  -10.519 1.00 93.00  ? 176  DA  J "C1'" 1 
ATOM   3585  N N9    . DA  B 1 30  ? 85.921  79.312  -9.595  1.00 108.95 ? 176  DA  J N9    1 
ATOM   3586  C C8    . DA  B 1 30  ? 85.400  80.564  -9.799  1.00 108.52 ? 176  DA  J C8    1 
ATOM   3587  N N7    . DA  B 1 30  ? 85.547  81.373  -8.778  1.00 107.97 ? 176  DA  J N7    1 
ATOM   3588  C C5    . DA  B 1 30  ? 86.208  80.600  -7.834  1.00 107.85 ? 176  DA  J C5    1 
ATOM   3589  C C6    . DA  B 1 30  ? 86.655  80.877  -6.529  1.00 107.27 ? 176  DA  J C6    1 
ATOM   3590  N N6    . DA  B 1 30  ? 86.499  82.058  -5.926  1.00 106.46 ? 176  DA  J N6    1 
ATOM   3591  N N1    . DA  B 1 30  ? 87.275  79.884  -5.855  1.00 107.14 ? 176  DA  J N1    1 
ATOM   3592  C C2    . DA  B 1 30  ? 87.433  78.700  -6.460  1.00 107.31 ? 176  DA  J C2    1 
ATOM   3593  N N3    . DA  B 1 30  ? 87.060  78.319  -7.679  1.00 107.94 ? 176  DA  J N3    1 
ATOM   3594  C C4    . DA  B 1 30  ? 86.446  79.328  -8.323  1.00 108.31 ? 176  DA  J C4    1 
ATOM   3595  P P     . DG  B 1 31  ? 83.896  74.905  -11.811 1.00 111.91 ? 177  DG  J P     1 
ATOM   3596  O OP1   . DG  B 1 31  ? 83.955  73.686  -12.658 1.00 111.74 ? 177  DG  J OP1   1 
ATOM   3597  O OP2   . DG  B 1 31  ? 82.708  75.793  -11.885 1.00 111.43 ? 177  DG  J OP2   1 
ATOM   3598  O "O5'" . DG  B 1 31  ? 84.081  74.466  -10.293 1.00 114.56 ? 177  DG  J "O5'" 1 
ATOM   3599  C "C5'" . DG  B 1 31  ? 85.226  73.721  -9.882  1.00 118.47 ? 177  DG  J "C5'" 1 
ATOM   3600  C "C4'" . DG  B 1 31  ? 85.199  73.506  -8.386  1.00 120.99 ? 177  DG  J "C4'" 1 
ATOM   3601  O "O4'" . DG  B 1 31  ? 85.441  74.766  -7.709  1.00 121.35 ? 177  DG  J "O4'" 1 
ATOM   3602  C "C3'" . DG  B 1 31  ? 83.861  72.989  -7.858  1.00 123.03 ? 177  DG  J "C3'" 1 
ATOM   3603  O "O3'" . DG  B 1 31  ? 84.061  72.011  -6.835  1.00 125.48 ? 177  DG  J "O3'" 1 
ATOM   3604  C "C2'" . DG  B 1 31  ? 83.202  74.229  -7.283  1.00 122.45 ? 177  DG  J "C2'" 1 
ATOM   3605  C "C1'" . DG  B 1 31  ? 84.393  75.026  -6.787  1.00 122.33 ? 177  DG  J "C1'" 1 
ATOM   3606  N N9    . DG  B 1 31  ? 84.159  76.467  -6.754  1.00 123.36 ? 177  DG  J N9    1 
ATOM   3607  C C8    . DG  B 1 31  ? 83.733  77.263  -7.790  1.00 123.68 ? 177  DG  J C8    1 
ATOM   3608  N N7    . DG  B 1 31  ? 83.576  78.513  -7.445  1.00 123.50 ? 177  DG  J N7    1 
ATOM   3609  C C5    . DG  B 1 31  ? 83.927  78.546  -6.103  1.00 124.18 ? 177  DG  J C5    1 
ATOM   3610  C C6    . DG  B 1 31  ? 83.948  79.628  -5.183  1.00 124.40 ? 177  DG  J C6    1 
ATOM   3611  O O6    . DG  B 1 31  ? 83.646  80.812  -5.377  1.00 124.07 ? 177  DG  J O6    1 
ATOM   3612  N N1    . DG  B 1 31  ? 84.373  79.220  -3.923  1.00 125.02 ? 177  DG  J N1    1 
ATOM   3613  C C2    . DG  B 1 31  ? 84.730  77.935  -3.587  1.00 125.36 ? 177  DG  J C2    1 
ATOM   3614  N N2    . DG  B 1 31  ? 85.117  77.741  -2.317  1.00 125.79 ? 177  DG  J N2    1 
ATOM   3615  N N3    . DG  B 1 31  ? 84.708  76.917  -4.432  1.00 125.01 ? 177  DG  J N3    1 
ATOM   3616  C C4    . DG  B 1 31  ? 84.300  77.292  -5.663  1.00 124.25 ? 177  DG  J C4    1 
ATOM   3617  P P     . DT  B 1 32  ? 82.797  71.455  -6.012  1.00 110.12 ? 178  DT  J P     1 
ATOM   3618  O OP1   . DT  B 1 32  ? 83.154  70.100  -5.521  1.00 139.52 ? 178  DT  J OP1   1 
ATOM   3619  O OP2   . DT  B 1 32  ? 81.571  71.640  -6.829  1.00 139.35 ? 178  DT  J OP2   1 
ATOM   3620  O "O5'" . DT  B 1 32  ? 82.716  72.439  -4.762  1.00 112.51 ? 178  DT  J "O5'" 1 
ATOM   3621  C "C5'" . DT  B 1 32  ? 83.823  72.567  -3.870  1.00 114.90 ? 178  DT  J "C5'" 1 
ATOM   3622  C "C4'" . DT  B 1 32  ? 83.390  73.228  -2.583  1.00 117.08 ? 178  DT  J "C4'" 1 
ATOM   3623  O "O4'" . DT  B 1 32  ? 83.230  74.655  -2.773  1.00 117.42 ? 178  DT  J "O4'" 1 
ATOM   3624  C "C3'" . DT  B 1 32  ? 82.060  72.719  -2.028  1.00 118.21 ? 178  DT  J "C3'" 1 
ATOM   3625  O "O3'" . DT  B 1 32  ? 82.135  72.590  -0.605  1.00 120.09 ? 178  DT  J "O3'" 1 
ATOM   3626  C "C2'" . DT  B 1 32  ? 81.080  73.814  -2.411  1.00 118.77 ? 178  DT  J "C2'" 1 
ATOM   3627  C "C1'" . DT  B 1 32  ? 81.949  75.056  -2.317  1.00 118.56 ? 178  DT  J "C1'" 1 
ATOM   3628  N N1    . DT  B 1 32  ? 81.510  76.197  -3.142  1.00 149.23 ? 178  DT  J N1    1 
ATOM   3629  C C2    . DT  B 1 32  ? 81.486  77.445  -2.559  1.00 150.03 ? 178  DT  J C2    1 
ATOM   3630  O O2    . DT  B 1 32  ? 81.798  77.645  -1.397  1.00 150.28 ? 178  DT  J O2    1 
ATOM   3631  N N3    . DT  B 1 32  ? 81.080  78.458  -3.392  1.00 150.49 ? 178  DT  J N3    1 
ATOM   3632  C C4    . DT  B 1 32  ? 80.702  78.350  -4.717  1.00 150.88 ? 178  DT  J C4    1 
ATOM   3633  O O4    . DT  B 1 32  ? 80.366  79.353  -5.342  1.00 151.67 ? 178  DT  J O4    1 
ATOM   3634  C C5    . DT  B 1 32  ? 80.742  77.011  -5.262  1.00 150.57 ? 178  DT  J C5    1 
ATOM   3635  C C7    . DT  B 1 32  ? 80.344  76.796  -6.688  1.00 150.44 ? 178  DT  J C7    1 
ATOM   3636  C C6    . DT  B 1 32  ? 81.139  76.015  -4.458  1.00 149.92 ? 178  DT  J C6    1 
ATOM   3637  P P     . DG  B 1 33  ? 81.100  71.630  0.163   1.00 148.74 ? 179  DG  J P     1 
ATOM   3638  O OP1   . DG  B 1 33  ? 81.874  70.641  0.954   1.00 137.93 ? 179  DG  J OP1   1 
ATOM   3639  O OP2   . DG  B 1 33  ? 80.099  71.155  -0.825  1.00 138.09 ? 179  DG  J OP2   1 
ATOM   3640  O "O5'" . DG  B 1 33  ? 80.362  72.614  1.173   1.00 149.75 ? 179  DG  J "O5'" 1 
ATOM   3641  C "C5'" . DG  B 1 33  ? 81.072  73.216  2.252   1.00 151.83 ? 179  DG  J "C5'" 1 
ATOM   3642  C "C4'" . DG  B 1 33  ? 80.211  74.261  2.922   1.00 152.86 ? 179  DG  J "C4'" 1 
ATOM   3643  O "O4'" . DG  B 1 33  ? 80.112  75.439  2.082   1.00 153.15 ? 179  DG  J "O4'" 1 
ATOM   3644  C "C3'" . DG  B 1 33  ? 78.777  73.810  3.193   1.00 153.59 ? 179  DG  J "C3'" 1 
ATOM   3645  O "O3'" . DG  B 1 33  ? 78.341  74.293  4.465   1.00 154.50 ? 179  DG  J "O3'" 1 
ATOM   3646  C "C2'" . DG  B 1 33  ? 77.986  74.460  2.072   1.00 153.27 ? 179  DG  J "C2'" 1 
ATOM   3647  C "C1'" . DG  B 1 33  ? 78.746  75.754  1.854   1.00 153.21 ? 179  DG  J "C1'" 1 
ATOM   3648  N N9    . DG  B 1 33  ? 78.625  76.297  0.504   1.00 142.20 ? 179  DG  J N9    1 
ATOM   3649  C C8    . DG  B 1 33  ? 78.810  75.623  -0.679  1.00 142.09 ? 179  DG  J C8    1 
ATOM   3650  N N7    . DG  B 1 33  ? 78.620  76.372  -1.731  1.00 141.96 ? 179  DG  J N7    1 
ATOM   3651  C C5    . DG  B 1 33  ? 78.291  77.617  -1.213  1.00 142.09 ? 179  DG  J C5    1 
ATOM   3652  C C6    . DG  B 1 33  ? 77.973  78.834  -1.873  1.00 142.30 ? 179  DG  J C6    1 
ATOM   3653  O O6    . DG  B 1 33  ? 77.912  79.060  -3.089  1.00 142.23 ? 179  DG  J O6    1 
ATOM   3654  N N1    . DG  B 1 33  ? 77.705  79.852  -0.965  1.00 142.43 ? 179  DG  J N1    1 
ATOM   3655  C C2    . DG  B 1 33  ? 77.734  79.721  0.401   1.00 142.28 ? 179  DG  J C2    1 
ATOM   3656  N N2    . DG  B 1 33  ? 77.443  80.824  1.105   1.00 142.46 ? 179  DG  J N2    1 
ATOM   3657  N N3    . DG  B 1 33  ? 78.027  78.594  1.029   1.00 142.28 ? 179  DG  J N3    1 
ATOM   3658  C C4    . DG  B 1 33  ? 78.293  77.589  0.166   1.00 142.14 ? 179  DG  J C4    1 
ATOM   3659  P P     . DT  B 1 34  ? 76.783  74.231  4.849   1.00 142.62 ? 180  DT  J P     1 
ATOM   3660  O OP1   . DT  B 1 34  ? 76.694  74.043  6.319   1.00 146.97 ? 180  DT  J OP1   1 
ATOM   3661  O OP2   . DT  B 1 34  ? 76.102  73.270  3.942   1.00 146.95 ? 180  DT  J OP2   1 
ATOM   3662  O "O5'" . DT  B 1 34  ? 76.267  75.698  4.512   1.00 142.89 ? 180  DT  J "O5'" 1 
ATOM   3663  C "C5'" . DT  B 1 34  ? 76.775  76.822  5.224   1.00 142.68 ? 180  DT  J "C5'" 1 
ATOM   3664  C "C4'" . DT  B 1 34  ? 75.722  77.899  5.314   1.00 143.07 ? 180  DT  J "C4'" 1 
ATOM   3665  O "O4'" . DT  B 1 34  ? 75.598  78.569  4.036   1.00 142.89 ? 180  DT  J "O4'" 1 
ATOM   3666  C "C3'" . DT  B 1 34  ? 74.328  77.379  5.665   1.00 142.79 ? 180  DT  J "C3'" 1 
ATOM   3667  O "O3'" . DT  B 1 34  ? 73.692  78.259  6.596   1.00 142.43 ? 180  DT  J "O3'" 1 
ATOM   3668  C "C2'" . DT  B 1 34  ? 73.606  77.371  4.329   1.00 143.75 ? 180  DT  J "C2'" 1 
ATOM   3669  C "C1'" . DT  B 1 34  ? 74.246  78.540  3.603   1.00 143.64 ? 180  DT  J "C1'" 1 
ATOM   3670  N N1    . DT  B 1 34  ? 74.239  78.427  2.128   1.00 148.55 ? 180  DT  J N1    1 
ATOM   3671  C C2    . DT  B 1 34  ? 74.085  79.580  1.388   1.00 148.79 ? 180  DT  J C2    1 
ATOM   3672  O O2    . DT  B 1 34  ? 73.965  80.686  1.891   1.00 149.16 ? 180  DT  J O2    1 
ATOM   3673  N N3    . DT  B 1 34  ? 74.076  79.390  0.028   1.00 148.82 ? 180  DT  J N3    1 
ATOM   3674  C C4    . DT  B 1 34  ? 74.204  78.192  -0.650  1.00 148.62 ? 180  DT  J C4    1 
ATOM   3675  O O4    . DT  B 1 34  ? 74.174  78.178  -1.876  1.00 148.44 ? 180  DT  J O4    1 
ATOM   3676  C C5    . DT  B 1 34  ? 74.367  77.025  0.187   1.00 148.46 ? 180  DT  J C5    1 
ATOM   3677  C C7    . DT  B 1 34  ? 74.514  75.684  -0.460  1.00 148.26 ? 180  DT  J C7    1 
ATOM   3678  C C6    . DT  B 1 34  ? 74.377  77.199  1.515   1.00 148.37 ? 180  DT  J C6    1 
ATOM   3679  P P     . DA  B 1 35  ? 72.111  78.138  6.861   1.00 180.57 ? 181  DA  J P     1 
ATOM   3680  O OP1   . DA  B 1 35  ? 71.852  78.498  8.278   1.00 124.42 ? 181  DA  J OP1   1 
ATOM   3681  O OP2   . DA  B 1 35  ? 71.638  76.829  6.340   1.00 123.91 ? 181  DA  J OP2   1 
ATOM   3682  O "O5'" . DA  B 1 35  ? 71.514  79.291  5.943   1.00 178.52 ? 181  DA  J "O5'" 1 
ATOM   3683  C "C5'" . DA  B 1 35  ? 72.063  80.605  5.996   1.00 177.43 ? 181  DA  J "C5'" 1 
ATOM   3684  C "C4'" . DA  B 1 35  ? 71.201  81.563  5.212   1.00 175.69 ? 181  DA  J "C4'" 1 
ATOM   3685  O "O4'" . DA  B 1 35  ? 71.366  81.325  3.793   1.00 175.88 ? 181  DA  J "O4'" 1 
ATOM   3686  C "C3'" . DA  B 1 35  ? 69.706  81.428  5.498   1.00 174.20 ? 181  DA  J "C3'" 1 
ATOM   3687  O "O3'" . DA  B 1 35  ? 69.101  82.724  5.560   1.00 170.68 ? 181  DA  J "O3'" 1 
ATOM   3688  C "C2'" . DA  B 1 35  ? 69.193  80.620  4.318   1.00 174.63 ? 181  DA  J "C2'" 1 
ATOM   3689  C "C1'" . DA  B 1 35  ? 70.105  81.071  3.192   1.00 175.32 ? 181  DA  J "C1'" 1 
ATOM   3690  N N9    . DA  B 1 35  ? 70.298  80.077  2.135   1.00 117.33 ? 181  DA  J N9    1 
ATOM   3691  C C8    . DA  B 1 35  ? 70.263  78.707  2.243   1.00 117.60 ? 181  DA  J C8    1 
ATOM   3692  N N7    . DA  B 1 35  ? 70.470  78.082  1.109   1.00 116.98 ? 181  DA  J N7    1 
ATOM   3693  C C5    . DA  B 1 35  ? 70.655  79.108  0.192   1.00 115.68 ? 181  DA  J C5    1 
ATOM   3694  C C6    . DA  B 1 35  ? 70.917  79.107  -1.190  1.00 114.81 ? 181  DA  J C6    1 
ATOM   3695  N N6    . DA  B 1 35  ? 71.047  77.997  -1.920  1.00 113.16 ? 181  DA  J N6    1 
ATOM   3696  N N1    . DA  B 1 35  ? 71.044  80.303  -1.805  1.00 114.16 ? 181  DA  J N1    1 
ATOM   3697  C C2    . DA  B 1 35  ? 70.915  81.417  -1.073  1.00 114.51 ? 181  DA  J C2    1 
ATOM   3698  N N3    . DA  B 1 35  ? 70.672  81.547  0.228   1.00 115.60 ? 181  DA  J N3    1 
ATOM   3699  C C4    . DA  B 1 35  ? 70.551  80.341  0.810   1.00 116.32 ? 181  DA  J C4    1 
ATOM   3700  P P     . DT  B 1 36  ? 67.517  82.880  5.340   1.00 167.94 ? 182  DT  J P     1 
ATOM   3701  O OP1   . DT  B 1 36  ? 67.057  84.079  6.086   1.00 105.00 ? 182  DT  J OP1   1 
ATOM   3702  O OP2   . DT  B 1 36  ? 66.874  81.564  5.596   1.00 104.95 ? 182  DT  J OP2   1 
ATOM   3703  O "O5'" . DT  B 1 36  ? 67.415  83.206  3.787   1.00 165.45 ? 182  DT  J "O5'" 1 
ATOM   3704  C "C5'" . DT  B 1 36  ? 68.161  84.287  3.233   1.00 163.62 ? 182  DT  J "C5'" 1 
ATOM   3705  C "C4'" . DT  B 1 36  ? 67.515  84.761  1.955   1.00 161.17 ? 182  DT  J "C4'" 1 
ATOM   3706  O "O4'" . DT  B 1 36  ? 67.829  83.846  0.877   1.00 161.05 ? 182  DT  J "O4'" 1 
ATOM   3707  C "C3'" . DT  B 1 36  ? 65.991  84.837  2.029   1.00 159.55 ? 182  DT  J "C3'" 1 
ATOM   3708  O "O3'" . DT  B 1 36  ? 65.523  86.034  1.399   1.00 155.59 ? 182  DT  J "O3'" 1 
ATOM   3709  C "C2'" . DT  B 1 36  ? 65.537  83.582  1.302   1.00 159.40 ? 182  DT  J "C2'" 1 
ATOM   3710  C "C1'" . DT  B 1 36  ? 66.637  83.368  0.275   1.00 160.25 ? 182  DT  J "C1'" 1 
ATOM   3711  N N1    . DT  B 1 36  ? 66.856  81.956  -0.111  1.00 96.70  ? 182  DT  J N1    1 
ATOM   3712  C C2    . DT  B 1 36  ? 67.364  81.694  -1.367  1.00 95.82  ? 182  DT  J C2    1 
ATOM   3713  O O2    . DT  B 1 36  ? 67.639  82.566  -2.175  1.00 95.82  ? 182  DT  J O2    1 
ATOM   3714  N N3    . DT  B 1 36  ? 67.539  80.361  -1.646  1.00 95.06  ? 182  DT  J N3    1 
ATOM   3715  C C4    . DT  B 1 36  ? 67.261  79.290  -0.820  1.00 94.75  ? 182  DT  J C4    1 
ATOM   3716  O O4    . DT  B 1 36  ? 67.474  78.144  -1.210  1.00 93.22  ? 182  DT  J O4    1 
ATOM   3717  C C5    . DT  B 1 36  ? 66.725  79.636  0.479   1.00 95.18  ? 182  DT  J C5    1 
ATOM   3718  C C7    . DT  B 1 36  ? 66.383  78.539  1.436   1.00 95.33  ? 182  DT  J C7    1 
ATOM   3719  C C6    . DT  B 1 36  ? 66.556  80.934  0.766   1.00 95.83  ? 182  DT  J C6    1 
ATOM   3720  P P     . DT  B 1 37  ? 63.990  86.146  0.931   1.00 115.27 ? 183  DT  J P     1 
ATOM   3721  O OP1   . DT  B 1 37  ? 63.582  87.573  0.982   1.00 107.34 ? 183  DT  J OP1   1 
ATOM   3722  O OP2   . DT  B 1 37  ? 63.196  85.127  1.667   1.00 106.87 ? 183  DT  J OP2   1 
ATOM   3723  O "O5'" . DT  B 1 37  ? 64.074  85.711  -0.597  1.00 112.65 ? 183  DT  J "O5'" 1 
ATOM   3724  C "C5'" . DT  B 1 37  ? 65.134  86.193  -1.420  1.00 108.49 ? 183  DT  J "C5'" 1 
ATOM   3725  C "C4'" . DT  B 1 37  ? 64.870  85.845  -2.864  1.00 105.79 ? 183  DT  J "C4'" 1 
ATOM   3726  O "O4'" . DT  B 1 37  ? 65.166  84.449  -3.108  1.00 104.45 ? 183  DT  J "O4'" 1 
ATOM   3727  C "C3'" . DT  B 1 37  ? 63.417  86.054  -3.285  1.00 104.72 ? 183  DT  J "C3'" 1 
ATOM   3728  O "O3'" . DT  B 1 37  ? 63.366  86.627  -4.590  1.00 103.18 ? 183  DT  J "O3'" 1 
ATOM   3729  C "C2'" . DT  B 1 37  ? 62.837  84.650  -3.274  1.00 103.78 ? 183  DT  J "C2'" 1 
ATOM   3730  C "C1'" . DT  B 1 37  ? 64.033  83.805  -3.670  1.00 103.68 ? 183  DT  J "C1'" 1 
ATOM   3731  N N1    . DT  B 1 37  ? 64.010  82.417  -3.172  1.00 95.31  ? 183  DT  J N1    1 
ATOM   3732  C C2    . DT  B 1 37  ? 64.468  81.428  -4.011  1.00 94.94  ? 183  DT  J C2    1 
ATOM   3733  O O2    . DT  B 1 37  ? 64.872  81.646  -5.138  1.00 95.53  ? 183  DT  J O2    1 
ATOM   3734  N N3    . DT  B 1 37  ? 64.437  80.165  -3.479  1.00 94.71  ? 183  DT  J N3    1 
ATOM   3735  C C4    . DT  B 1 37  ? 64.002  79.799  -2.222  1.00 94.68  ? 183  DT  J C4    1 
ATOM   3736  O O4    . DT  B 1 37  ? 64.047  78.621  -1.878  1.00 93.99  ? 183  DT  J O4    1 
ATOM   3737  C C5    . DT  B 1 37  ? 63.521  80.882  -1.399  1.00 95.17  ? 183  DT  J C5    1 
ATOM   3738  C C7    . DT  B 1 37  ? 63.013  80.575  -0.025  1.00 95.59  ? 183  DT  J C7    1 
ATOM   3739  C C6    . DT  B 1 37  ? 63.550  82.122  -1.907  1.00 95.13  ? 183  DT  J C6    1 
ATOM   3740  P P     . DT  B 1 38  ? 61.946  86.909  -5.277  1.00 112.15 ? 184  DT  J P     1 
ATOM   3741  O OP1   . DT  B 1 38  ? 62.044  88.190  -6.024  1.00 105.44 ? 184  DT  J OP1   1 
ATOM   3742  O OP2   . DT  B 1 38  ? 60.888  86.739  -4.247  1.00 105.15 ? 184  DT  J OP2   1 
ATOM   3743  O "O5'" . DT  B 1 38  ? 61.820  85.715  -6.321  1.00 110.54 ? 184  DT  J "O5'" 1 
ATOM   3744  C "C5'" . DT  B 1 38  ? 62.896  85.421  -7.209  1.00 107.09 ? 184  DT  J "C5'" 1 
ATOM   3745  C "C4'" . DT  B 1 38  ? 62.533  84.262  -8.106  1.00 104.75 ? 184  DT  J "C4'" 1 
ATOM   3746  O "O4'" . DT  B 1 38  ? 62.621  83.012  -7.382  1.00 104.01 ? 184  DT  J "O4'" 1 
ATOM   3747  C "C3'" . DT  B 1 38  ? 61.115  84.329  -8.675  1.00 102.92 ? 184  DT  J "C3'" 1 
ATOM   3748  O "O3'" . DT  B 1 38  ? 61.125  83.893  -10.032 1.00 99.58  ? 184  DT  J "O3'" 1 
ATOM   3749  C "C2'" . DT  B 1 38  ? 60.352  83.332  -7.824  1.00 103.27 ? 184  DT  J "C2'" 1 
ATOM   3750  C "C1'" . DT  B 1 38  ? 61.417  82.287  -7.552  1.00 104.30 ? 184  DT  J "C1'" 1 
ATOM   3751  N N1    . DT  B 1 38  ? 61.198  81.478  -6.343  1.00 98.71  ? 184  DT  J N1    1 
ATOM   3752  C C2    . DT  B 1 38  ? 61.343  80.114  -6.448  1.00 99.46  ? 184  DT  J C2    1 
ATOM   3753  O O2    . DT  B 1 38  ? 61.655  79.556  -7.485  1.00 99.19  ? 184  DT  J O2    1 
ATOM   3754  N N3    . DT  B 1 38  ? 61.109  79.422  -5.284  1.00 100.62 ? 184  DT  J N3    1 
ATOM   3755  C C4    . DT  B 1 38  ? 60.756  79.950  -4.057  1.00 100.65 ? 184  DT  J C4    1 
ATOM   3756  O O4    . DT  B 1 38  ? 60.571  79.204  -3.101  1.00 100.73 ? 184  DT  J O4    1 
ATOM   3757  C C5    . DT  B 1 38  ? 60.631  81.389  -4.018  1.00 100.59 ? 184  DT  J C5    1 
ATOM   3758  C C7    . DT  B 1 38  ? 60.260  82.050  -2.729  1.00 101.14 ? 184  DT  J C7    1 
ATOM   3759  C C6    . DT  B 1 38  ? 60.855  82.072  -5.148  1.00 100.04 ? 184  DT  J C6    1 
ATOM   3760  P P     . DG  B 1 39  ? 60.561  84.858  -11.184 1.00 83.32  ? 185  DG  J P     1 
ATOM   3761  O OP1   . DG  B 1 39  ? 61.311  86.139  -11.142 1.00 87.11  ? 185  DG  J OP1   1 
ATOM   3762  O OP2   . DG  B 1 39  ? 59.079  84.870  -11.080 1.00 87.92  ? 185  DG  J OP2   1 
ATOM   3763  O "O5'" . DG  B 1 39  ? 60.956  84.082  -12.515 1.00 80.59  ? 185  DG  J "O5'" 1 
ATOM   3764  C "C5'" . DG  B 1 39  ? 62.286  83.615  -12.709 1.00 76.81  ? 185  DG  J "C5'" 1 
ATOM   3765  C "C4'" . DG  B 1 39  ? 62.269  82.181  -13.180 1.00 75.38  ? 185  DG  J "C4'" 1 
ATOM   3766  O "O4'" . DG  B 1 39  ? 61.852  81.305  -12.109 1.00 74.96  ? 185  DG  J "O4'" 1 
ATOM   3767  C "C3'" . DG  B 1 39  ? 61.311  81.911  -14.335 1.00 74.66  ? 185  DG  J "C3'" 1 
ATOM   3768  O "O3'" . DG  B 1 39  ? 61.888  80.945  -15.213 1.00 71.73  ? 185  DG  J "O3'" 1 
ATOM   3769  C "C2'" . DG  B 1 39  ? 60.072  81.364  -13.649 1.00 74.30  ? 185  DG  J "C2'" 1 
ATOM   3770  C "C1'" . DG  B 1 39  ? 60.642  80.634  -12.444 1.00 74.28  ? 185  DG  J "C1'" 1 
ATOM   3771  N N9    . DG  B 1 39  ? 59.789  80.687  -11.262 1.00 78.65  ? 185  DG  J N9    1 
ATOM   3772  C C8    . DG  B 1 39  ? 59.063  81.766  -10.817 1.00 79.01  ? 185  DG  J C8    1 
ATOM   3773  N N7    . DG  B 1 39  ? 58.451  81.540  -9.687  1.00 78.74  ? 185  DG  J N7    1 
ATOM   3774  C C5    . DG  B 1 39  ? 58.784  80.230  -9.374  1.00 78.18  ? 185  DG  J C5    1 
ATOM   3775  C C6    . DG  B 1 39  ? 58.430  79.436  -8.253  1.00 77.77  ? 185  DG  J C6    1 
ATOM   3776  O O6    . DG  B 1 39  ? 57.749  79.750  -7.273  1.00 77.90  ? 185  DG  J O6    1 
ATOM   3777  N N1    . DG  B 1 39  ? 58.965  78.158  -8.344  1.00 76.85  ? 185  DG  J N1    1 
ATOM   3778  C C2    . DG  B 1 39  ? 59.749  77.704  -9.376  1.00 77.26  ? 185  DG  J C2    1 
ATOM   3779  N N2    . DG  B 1 39  ? 60.157  76.433  -9.289  1.00 76.89  ? 185  DG  J N2    1 
ATOM   3780  N N3    . DG  B 1 39  ? 60.103  78.441  -10.418 1.00 76.72  ? 185  DG  J N3    1 
ATOM   3781  C C4    . DG  B 1 39  ? 59.589  79.683  -10.351 1.00 77.36  ? 185  DG  J C4    1 
ATOM   3782  P P     . DG  B 1 40  ? 61.271  80.736  -16.676 1.00 68.41  ? 186  DG  J P     1 
ATOM   3783  O OP1   . DG  B 1 40  ? 62.397  80.360  -17.570 1.00 72.09  ? 186  DG  J OP1   1 
ATOM   3784  O OP2   . DG  B 1 40  ? 60.435  81.927  -16.995 1.00 71.04  ? 186  DG  J OP2   1 
ATOM   3785  O "O5'" . DG  B 1 40  ? 60.309  79.479  -16.493 1.00 69.19  ? 186  DG  J "O5'" 1 
ATOM   3786  C "C5'" . DG  B 1 40  ? 60.819  78.250  -15.984 1.00 70.87  ? 186  DG  J "C5'" 1 
ATOM   3787  C "C4'" . DG  B 1 40  ? 59.687  77.349  -15.554 1.00 74.09  ? 186  DG  J "C4'" 1 
ATOM   3788  O "O4'" . DG  B 1 40  ? 59.063  77.856  -14.349 1.00 73.22  ? 186  DG  J "O4'" 1 
ATOM   3789  C "C3'" . DG  B 1 40  ? 58.559  77.182  -16.578 1.00 75.86  ? 186  DG  J "C3'" 1 
ATOM   3790  O "O3'" . DG  B 1 40  ? 58.114  75.824  -16.562 1.00 80.36  ? 186  DG  J "O3'" 1 
ATOM   3791  C "C2'" . DG  B 1 40  ? 57.456  78.067  -16.022 1.00 75.03  ? 186  DG  J "C2'" 1 
ATOM   3792  C "C1'" . DG  B 1 40  ? 57.659  77.857  -14.534 1.00 73.78  ? 186  DG  J "C1'" 1 
ATOM   3793  N N9    . DG  B 1 40  ? 57.074  78.848  -13.634 1.00 77.94  ? 186  DG  J N9    1 
ATOM   3794  C C8    . DG  B 1 40  ? 56.798  80.172  -13.886 1.00 77.42  ? 186  DG  J C8    1 
ATOM   3795  N N7    . DG  B 1 40  ? 56.267  80.787  -12.862 1.00 76.50  ? 186  DG  J N7    1 
ATOM   3796  C C5    . DG  B 1 40  ? 56.192  79.810  -11.878 1.00 77.06  ? 186  DG  J C5    1 
ATOM   3797  C C6    . DG  B 1 40  ? 55.706  79.878  -10.539 1.00 77.32  ? 186  DG  J C6    1 
ATOM   3798  O O6    . DG  B 1 40  ? 55.236  80.856  -9.931  1.00 76.45  ? 186  DG  J O6    1 
ATOM   3799  N N1    . DG  B 1 40  ? 55.815  78.645  -9.897  1.00 76.14  ? 186  DG  J N1    1 
ATOM   3800  C C2    . DG  B 1 40  ? 56.330  77.501  -10.462 1.00 75.63  ? 186  DG  J C2    1 
ATOM   3801  N N2    . DG  B 1 40  ? 56.360  76.413  -9.688  1.00 75.30  ? 186  DG  J N2    1 
ATOM   3802  N N3    . DG  B 1 40  ? 56.785  77.429  -11.697 1.00 75.84  ? 186  DG  J N3    1 
ATOM   3803  C C4    . DG  B 1 40  ? 56.686  78.609  -12.342 1.00 76.98  ? 186  DG  J C4    1 
ATOM   3804  P P     . DA  B 1 41  ? 58.236  74.927  -17.888 1.00 106.32 ? 187  DA  J P     1 
ATOM   3805  O OP1   . DA  B 1 41  ? 59.661  74.902  -18.308 1.00 78.19  ? 187  DA  J OP1   1 
ATOM   3806  O OP2   . DA  B 1 41  ? 57.199  75.396  -18.839 1.00 78.64  ? 187  DA  J OP2   1 
ATOM   3807  O "O5'" . DA  B 1 41  ? 57.819  73.471  -17.396 1.00 108.18 ? 187  DA  J "O5'" 1 
ATOM   3808  C "C5'" . DA  B 1 41  ? 58.656  72.728  -16.515 1.00 112.33 ? 187  DA  J "C5'" 1 
ATOM   3809  C "C4'" . DA  B 1 41  ? 57.819  72.016  -15.478 1.00 115.81 ? 187  DA  J "C4'" 1 
ATOM   3810  O "O4'" . DA  B 1 41  ? 57.235  72.984  -14.571 1.00 116.33 ? 187  DA  J "O4'" 1 
ATOM   3811  C "C3'" . DA  B 1 41  ? 56.649  71.204  -16.034 1.00 117.96 ? 187  DA  J "C3'" 1 
ATOM   3812  O "O3'" . DA  B 1 41  ? 56.499  69.999  -15.275 1.00 122.56 ? 187  DA  J "O3'" 1 
ATOM   3813  C "C2'" . DA  B 1 41  ? 55.456  72.120  -15.820 1.00 116.73 ? 187  DA  J "C2'" 1 
ATOM   3814  C "C1'" . DA  B 1 41  ? 55.827  72.814  -14.523 1.00 115.40 ? 187  DA  J "C1'" 1 
ATOM   3815  N N9    . DA  B 1 41  ? 55.221  74.131  -14.316 1.00 86.94  ? 187  DA  J N9    1 
ATOM   3816  C C8    . DA  B 1 41  ? 55.063  75.155  -15.220 1.00 86.61  ? 187  DA  J C8    1 
ATOM   3817  N N7    . DA  B 1 41  ? 54.499  76.227  -14.714 1.00 85.73  ? 187  DA  J N7    1 
ATOM   3818  C C5    . DA  B 1 41  ? 54.267  75.885  -13.388 1.00 85.82  ? 187  DA  J C5    1 
ATOM   3819  C C6    . DA  B 1 41  ? 53.697  76.593  -12.310 1.00 85.78  ? 187  DA  J C6    1 
ATOM   3820  N N6    . DA  B 1 41  ? 53.246  77.848  -12.398 1.00 85.00  ? 187  DA  J N6    1 
ATOM   3821  N N1    . DA  B 1 41  ? 53.608  75.959  -11.120 1.00 85.45  ? 187  DA  J N1    1 
ATOM   3822  C C2    . DA  B 1 41  ? 54.068  74.704  -11.026 1.00 85.71  ? 187  DA  J C2    1 
ATOM   3823  N N3    . DA  B 1 41  ? 54.629  73.938  -11.962 1.00 86.01  ? 187  DA  J N3    1 
ATOM   3824  C C4    . DA  B 1 41  ? 54.699  74.595  -13.132 1.00 86.19  ? 187  DA  J C4    1 
ATOM   3825  P P     . DA  B 1 42  ? 55.472  68.865  -15.769 1.00 126.32 ? 188  DA  J P     1 
ATOM   3826  O OP1   . DA  B 1 42  ? 56.100  67.537  -15.531 1.00 101.27 ? 188  DA  J OP1   1 
ATOM   3827  O OP2   . DA  B 1 42  ? 55.016  69.228  -17.135 1.00 102.26 ? 188  DA  J OP2   1 
ATOM   3828  O "O5'" . DA  B 1 42  ? 54.240  69.015  -14.772 1.00 127.25 ? 188  DA  J "O5'" 1 
ATOM   3829  C "C5'" . DA  B 1 42  ? 54.363  68.611  -13.411 1.00 130.99 ? 188  DA  J "C5'" 1 
ATOM   3830  C "C4'" . DA  B 1 42  ? 53.055  68.812  -12.681 1.00 133.53 ? 188  DA  J "C4'" 1 
ATOM   3831  O "O4'" . DA  B 1 42  ? 52.800  70.222  -12.482 1.00 133.75 ? 188  DA  J "O4'" 1 
ATOM   3832  C "C3'" . DA  B 1 42  ? 51.823  68.255  -13.392 1.00 134.82 ? 188  DA  J "C3'" 1 
ATOM   3833  O "O3'" . DA  B 1 42  ? 50.938  67.693  -12.422 1.00 137.12 ? 188  DA  J "O3'" 1 
ATOM   3834  C "C2'" . DA  B 1 42  ? 51.197  69.489  -14.013 1.00 134.22 ? 188  DA  J "C2'" 1 
ATOM   3835  C "C1'" . DA  B 1 42  ? 51.509  70.546  -12.971 1.00 133.85 ? 188  DA  J "C1'" 1 
ATOM   3836  N N9    . DA  B 1 42  ? 51.551  71.920  -13.470 1.00 110.10 ? 188  DA  J N9    1 
ATOM   3837  C C8    . DA  B 1 42  ? 52.220  72.406  -14.567 1.00 110.43 ? 188  DA  J C8    1 
ATOM   3838  N N7    . DA  B 1 42  ? 52.066  73.696  -14.751 1.00 110.27 ? 188  DA  J N7    1 
ATOM   3839  C C5    . DA  B 1 42  ? 51.238  74.085  -13.707 1.00 109.96 ? 188  DA  J C5    1 
ATOM   3840  C C6    . DA  B 1 42  ? 50.699  75.332  -13.340 1.00 109.79 ? 188  DA  J C6    1 
ATOM   3841  N N6    . DA  B 1 42  ? 50.924  76.464  -14.012 1.00 109.47 ? 188  DA  J N6    1 
ATOM   3842  N N1    . DA  B 1 42  ? 49.910  75.377  -12.244 1.00 109.52 ? 188  DA  J N1    1 
ATOM   3843  C C2    . DA  B 1 42  ? 49.683  74.240  -11.571 1.00 109.85 ? 188  DA  J C2    1 
ATOM   3844  N N3    . DA  B 1 42  ? 50.131  73.010  -11.818 1.00 109.83 ? 188  DA  J N3    1 
ATOM   3845  C C4    . DA  B 1 42  ? 50.912  73.001  -12.911 1.00 109.95 ? 188  DA  J C4    1 
ATOM   3846  P P     . DA  B 1 43  ? 49.862  66.591  -12.869 1.00 138.01 ? 189  DA  J P     1 
ATOM   3847  O OP1   . DA  B 1 43  ? 50.004  65.424  -11.961 1.00 114.47 ? 189  DA  J OP1   1 
ATOM   3848  O OP2   . DA  B 1 43  ? 49.979  66.398  -14.336 1.00 114.53 ? 189  DA  J OP2   1 
ATOM   3849  O "O5'" . DA  B 1 43  ? 48.468  67.300  -12.572 1.00 139.50 ? 189  DA  J "O5'" 1 
ATOM   3850  C "C5'" . DA  B 1 43  ? 48.116  67.684  -11.245 1.00 142.62 ? 189  DA  J "C5'" 1 
ATOM   3851  C "C4'" . DA  B 1 43  ? 46.916  68.602  -11.270 1.00 144.31 ? 189  DA  J "C4'" 1 
ATOM   3852  O "O4'" . DA  B 1 43  ? 47.304  69.918  -11.738 1.00 144.89 ? 189  DA  J "O4'" 1 
ATOM   3853  C "C3'" . DA  B 1 43  ? 45.794  68.133  -12.197 1.00 145.10 ? 189  DA  J "C3'" 1 
ATOM   3854  O "O3'" . DA  B 1 43  ? 44.525  68.385  -11.599 1.00 145.81 ? 189  DA  J "O3'" 1 
ATOM   3855  C "C2'" . DA  B 1 43  ? 45.966  69.006  -13.426 1.00 145.85 ? 189  DA  J "C2'" 1 
ATOM   3856  C "C1'" . DA  B 1 43  ? 46.474  70.303  -12.824 1.00 145.54 ? 189  DA  J "C1'" 1 
ATOM   3857  N N9    . DA  B 1 43  ? 47.275  71.108  -13.747 1.00 121.81 ? 189  DA  J N9    1 
ATOM   3858  C C8    . DA  B 1 43  ? 48.224  70.667  -14.634 1.00 122.22 ? 189  DA  J C8    1 
ATOM   3859  N N7    . DA  B 1 43  ? 48.762  71.622  -15.352 1.00 122.42 ? 189  DA  J N7    1 
ATOM   3860  C C5    . DA  B 1 43  ? 48.127  72.772  -14.906 1.00 121.38 ? 189  DA  J C5    1 
ATOM   3861  C C6    . DA  B 1 43  ? 48.249  74.123  -15.275 1.00 120.93 ? 189  DA  J C6    1 
ATOM   3862  N N6    . DA  B 1 43  ? 49.087  74.559  -16.219 1.00 120.49 ? 189  DA  J N6    1 
ATOM   3863  N N1    . DA  B 1 43  ? 47.472  75.021  -14.635 1.00 120.43 ? 189  DA  J N1    1 
ATOM   3864  C C2    . DA  B 1 43  ? 46.632  74.582  -13.690 1.00 121.09 ? 189  DA  J C2    1 
ATOM   3865  N N3    . DA  B 1 43  ? 46.426  73.340  -13.255 1.00 121.49 ? 189  DA  J N3    1 
ATOM   3866  C C4    . DA  B 1 43  ? 47.213  72.472  -13.912 1.00 121.52 ? 189  DA  J C4    1 
ATOM   3867  P P     . DC  B 1 44  ? 43.190  67.844  -12.308 1.00 166.39 ? 190  DC  J P     1 
ATOM   3868  O OP1   . DC  B 1 44  ? 42.519  66.951  -11.328 1.00 104.36 ? 190  DC  J OP1   1 
ATOM   3869  O OP2   . DC  B 1 44  ? 43.519  67.332  -13.664 1.00 103.43 ? 190  DC  J OP2   1 
ATOM   3870  O "O5'" . DC  B 1 44  ? 42.314  69.161  -12.475 1.00 166.20 ? 190  DC  J "O5'" 1 
ATOM   3871  C "C5'" . DC  B 1 44  ? 42.079  70.018  -11.363 1.00 167.73 ? 190  DC  J "C5'" 1 
ATOM   3872  C "C4'" . DC  B 1 44  ? 41.458  71.315  -11.824 1.00 167.81 ? 190  DC  J "C4'" 1 
ATOM   3873  O "O4'" . DC  B 1 44  ? 42.445  72.125  -12.511 1.00 168.08 ? 190  DC  J "O4'" 1 
ATOM   3874  C "C3'" . DC  B 1 44  ? 40.294  71.143  -12.803 1.00 167.64 ? 190  DC  J "C3'" 1 
ATOM   3875  O "O3'" . DC  B 1 44  ? 39.257  72.079  -12.502 1.00 166.92 ? 190  DC  J "O3'" 1 
ATOM   3876  C "C2'" . DC  B 1 44  ? 40.917  71.472  -14.147 1.00 167.62 ? 190  DC  J "C2'" 1 
ATOM   3877  C "C1'" . DC  B 1 44  ? 41.917  72.542  -13.760 1.00 167.69 ? 190  DC  J "C1'" 1 
ATOM   3878  N N1    . DC  B 1 44  ? 43.033  72.719  -14.705 1.00 104.15 ? 190  DC  J N1    1 
ATOM   3879  C C2    . DC  B 1 44  ? 43.415  74.021  -15.057 1.00 103.44 ? 190  DC  J C2    1 
ATOM   3880  O O2    . DC  B 1 44  ? 42.822  74.983  -14.538 1.00 103.37 ? 190  DC  J O2    1 
ATOM   3881  N N3    . DC  B 1 44  ? 44.416  74.199  -15.949 1.00 102.25 ? 190  DC  J N3    1 
ATOM   3882  C C4    . DC  B 1 44  ? 45.031  73.141  -16.479 1.00 101.45 ? 190  DC  J C4    1 
ATOM   3883  N N4    . DC  B 1 44  ? 46.006  73.364  -17.363 1.00 99.49  ? 190  DC  J N4    1 
ATOM   3884  C C5    . DC  B 1 44  ? 44.673  71.805  -16.128 1.00 102.26 ? 190  DC  J C5    1 
ATOM   3885  C C6    . DC  B 1 44  ? 43.680  71.642  -15.244 1.00 103.60 ? 190  DC  J C6    1 
ATOM   3886  P P     . DT  B 1 45  ? 38.095  72.347  -13.576 1.00 159.01 ? 191  DT  J P     1 
ATOM   3887  O OP1   . DT  B 1 45  ? 36.896  72.852  -12.858 1.00 117.18 ? 191  DT  J OP1   1 
ATOM   3888  O OP2   . DT  B 1 45  ? 37.988  71.131  -14.422 1.00 117.22 ? 191  DT  J OP2   1 
ATOM   3889  O "O5'" . DT  B 1 45  ? 38.676  73.525  -14.475 1.00 157.81 ? 191  DT  J "O5'" 1 
ATOM   3890  C "C5'" . DT  B 1 45  ? 38.888  74.822  -13.923 1.00 158.22 ? 191  DT  J "C5'" 1 
ATOM   3891  C "C4'" . DT  B 1 45  ? 38.783  75.872  -15.003 1.00 157.78 ? 191  DT  J "C4'" 1 
ATOM   3892  O "O4'" . DT  B 1 45  ? 39.951  75.826  -15.857 1.00 158.00 ? 191  DT  J "O4'" 1 
ATOM   3893  C "C3'" . DT  B 1 45  ? 37.575  75.704  -15.926 1.00 157.60 ? 191  DT  J "C3'" 1 
ATOM   3894  O "O3'" . DT  B 1 45  ? 37.043  76.985  -16.269 1.00 156.77 ? 191  DT  J "O3'" 1 
ATOM   3895  C "C2'" . DT  B 1 45  ? 38.172  75.053  -17.160 1.00 157.84 ? 191  DT  J "C2'" 1 
ATOM   3896  C "C1'" . DT  B 1 45  ? 39.544  75.698  -17.209 1.00 157.80 ? 191  DT  J "C1'" 1 
ATOM   3897  N N1    . DT  B 1 45  ? 40.579  74.930  -17.927 1.00 115.30 ? 191  DT  J N1    1 
ATOM   3898  C C2    . DT  B 1 45  ? 41.579  75.639  -18.554 1.00 114.33 ? 191  DT  J C2    1 
ATOM   3899  O O2    . DT  B 1 45  ? 41.642  76.858  -18.538 1.00 113.45 ? 191  DT  J O2    1 
ATOM   3900  N N3    . DT  B 1 45  ? 42.507  74.862  -19.204 1.00 114.38 ? 191  DT  J N3    1 
ATOM   3901  C C4    . DT  B 1 45  ? 42.532  73.482  -19.288 1.00 114.54 ? 191  DT  J C4    1 
ATOM   3902  O O4    . DT  B 1 45  ? 43.434  72.922  -19.907 1.00 113.82 ? 191  DT  J O4    1 
ATOM   3903  C C5    . DT  B 1 45  ? 41.451  72.804  -18.609 1.00 114.82 ? 191  DT  J C5    1 
ATOM   3904  C C7    . DT  B 1 45  ? 41.392  71.310  -18.650 1.00 115.09 ? 191  DT  J C7    1 
ATOM   3905  C C6    . DT  B 1 45  ? 40.542  73.552  -17.970 1.00 115.07 ? 191  DT  J C6    1 
ATOM   3906  P P     . DG  B 1 46  ? 35.459  77.237  -16.192 1.00 153.13 ? 192  DG  J P     1 
ATOM   3907  O OP1   . DG  B 1 46  ? 35.126  77.626  -14.799 1.00 112.25 ? 192  DG  J OP1   1 
ATOM   3908  O OP2   . DG  B 1 46  ? 34.776  76.072  -16.816 1.00 112.41 ? 192  DG  J OP2   1 
ATOM   3909  O "O5'" . DG  B 1 46  ? 35.245  78.510  -17.121 1.00 151.06 ? 192  DG  J "O5'" 1 
ATOM   3910  C "C5'" . DG  B 1 46  ? 35.933  79.726  -16.848 1.00 149.04 ? 192  DG  J "C5'" 1 
ATOM   3911  C "C4'" . DG  B 1 46  ? 36.392  80.366  -18.136 1.00 146.82 ? 192  DG  J "C4'" 1 
ATOM   3912  O "O4'" . DG  B 1 46  ? 37.419  79.554  -18.757 1.00 146.62 ? 192  DG  J "O4'" 1 
ATOM   3913  C "C3'" . DG  B 1 46  ? 35.298  80.538  -19.188 1.00 145.58 ? 192  DG  J "C3'" 1 
ATOM   3914  O "O3'" . DG  B 1 46  ? 35.496  81.782  -19.862 1.00 144.18 ? 192  DG  J "O3'" 1 
ATOM   3915  C "C2'" . DG  B 1 46  ? 35.534  79.373  -20.134 1.00 145.31 ? 192  DG  J "C2'" 1 
ATOM   3916  C "C1'" . DG  B 1 46  ? 37.046  79.242  -20.092 1.00 145.72 ? 192  DG  J "C1'" 1 
ATOM   3917  N N9    . DG  B 1 46  ? 37.567  77.914  -20.406 1.00 103.90 ? 192  DG  J N9    1 
ATOM   3918  C C8    . DG  B 1 46  ? 37.064  76.703  -19.994 1.00 104.06 ? 192  DG  J C8    1 
ATOM   3919  N N7    . DG  B 1 46  ? 37.766  75.685  -20.418 1.00 103.35 ? 192  DG  J N7    1 
ATOM   3920  C C5    . DG  B 1 46  ? 38.792  76.257  -21.159 1.00 101.96 ? 192  DG  J C5    1 
ATOM   3921  C C6    . DG  B 1 46  ? 39.874  75.651  -21.859 1.00 100.93 ? 192  DG  J C6    1 
ATOM   3922  O O6    . DG  B 1 46  ? 40.154  74.451  -21.959 1.00 99.19  ? 192  DG  J O6    1 
ATOM   3923  N N1    . DG  B 1 46  ? 40.678  76.602  -22.479 1.00 100.22 ? 192  DG  J N1    1 
ATOM   3924  C C2    . DG  B 1 46  ? 40.474  77.960  -22.432 1.00 100.55 ? 192  DG  J C2    1 
ATOM   3925  N N2    . DG  B 1 46  ? 41.361  78.713  -23.100 1.00 99.90  ? 192  DG  J N2    1 
ATOM   3926  N N3    . DG  B 1 46  ? 39.476  78.538  -21.780 1.00 101.65 ? 192  DG  J N3    1 
ATOM   3927  C C4    . DG  B 1 46  ? 38.680  77.632  -21.170 1.00 102.72 ? 192  DG  J C4    1 
ATOM   3928  P P     . DC  B 1 47  ? 34.357  82.350  -20.839 1.00 139.62 ? 193  DC  J P     1 
ATOM   3929  O OP1   . DC  B 1 47  ? 34.242  83.814  -20.605 1.00 105.50 ? 193  DC  J OP1   1 
ATOM   3930  O OP2   . DC  B 1 47  ? 33.160  81.481  -20.690 1.00 105.56 ? 193  DC  J OP2   1 
ATOM   3931  O "O5'" . DC  B 1 47  ? 34.969  82.127  -22.292 1.00 137.44 ? 193  DC  J "O5'" 1 
ATOM   3932  C "C5'" . DC  B 1 47  ? 36.123  82.852  -22.711 1.00 134.63 ? 193  DC  J "C5'" 1 
ATOM   3933  C "C4'" . DC  B 1 47  ? 36.540  82.418  -24.097 1.00 132.07 ? 193  DC  J "C4'" 1 
ATOM   3934  O "O4'" . DC  B 1 47  ? 37.098  81.083  -24.062 1.00 131.64 ? 193  DC  J "O4'" 1 
ATOM   3935  C "C3'" . DC  B 1 47  ? 35.401  82.371  -25.117 1.00 130.88 ? 193  DC  J "C3'" 1 
ATOM   3936  O "O3'" . DC  B 1 47  ? 35.913  82.739  -26.397 1.00 129.37 ? 193  DC  J "O3'" 1 
ATOM   3937  C "C2'" . DC  B 1 47  ? 35.056  80.894  -25.160 1.00 130.27 ? 193  DC  J "C2'" 1 
ATOM   3938  C "C1'" . DC  B 1 47  ? 36.443  80.296  -25.040 1.00 130.87 ? 193  DC  J "C1'" 1 
ATOM   3939  N N1    . DC  B 1 47  ? 36.518  78.885  -24.631 1.00 96.20  ? 193  DC  J N1    1 
ATOM   3940  C C2    . DC  B 1 47  ? 37.604  78.116  -25.080 1.00 95.55  ? 193  DC  J C2    1 
ATOM   3941  O O2    . DC  B 1 47  ? 38.466  78.654  -25.798 1.00 94.83  ? 193  DC  J O2    1 
ATOM   3942  N N3    . DC  B 1 47  ? 37.686  76.815  -24.722 1.00 94.61  ? 193  DC  J N3    1 
ATOM   3943  C C4    . DC  B 1 47  ? 36.741  76.277  -23.947 1.00 94.18  ? 193  DC  J C4    1 
ATOM   3944  N N4    . DC  B 1 47  ? 36.864  74.990  -23.618 1.00 92.87  ? 193  DC  J N4    1 
ATOM   3945  C C5    . DC  B 1 47  ? 35.629  77.036  -23.474 1.00 94.83  ? 193  DC  J C5    1 
ATOM   3946  C C6    . DC  B 1 47  ? 35.558  78.324  -23.837 1.00 95.67  ? 193  DC  J C6    1 
ATOM   3947  P P     . DT  B 1 48  ? 35.920  84.279  -26.845 1.00 120.94 ? 194  DT  J P     1 
ATOM   3948  O OP1   . DT  B 1 48  ? 36.257  85.091  -25.646 1.00 106.75 ? 194  DT  J OP1   1 
ATOM   3949  O OP2   . DT  B 1 48  ? 34.675  84.566  -27.603 1.00 106.58 ? 194  DT  J OP2   1 
ATOM   3950  O "O5'" . DT  B 1 48  ? 37.154  84.355  -27.848 1.00 119.10 ? 194  DT  J "O5'" 1 
ATOM   3951  C "C5'" . DT  B 1 48  ? 38.488  84.431  -27.349 1.00 115.65 ? 194  DT  J "C5'" 1 
ATOM   3952  C "C4'" . DT  B 1 48  ? 39.426  83.602  -28.199 1.00 112.39 ? 194  DT  J "C4'" 1 
ATOM   3953  O "O4'" . DT  B 1 48  ? 39.249  82.187  -27.946 1.00 111.76 ? 194  DT  J "O4'" 1 
ATOM   3954  C "C3'" . DT  B 1 48  ? 39.290  83.784  -29.712 1.00 110.43 ? 194  DT  J "C3'" 1 
ATOM   3955  O "O3'" . DT  B 1 48  ? 40.594  83.861  -30.293 1.00 107.19 ? 194  DT  J "O3'" 1 
ATOM   3956  C "C2'" . DT  B 1 48  ? 38.596  82.508  -30.158 1.00 110.64 ? 194  DT  J "C2'" 1 
ATOM   3957  C "C1'" . DT  B 1 48  ? 39.181  81.505  -29.187 1.00 111.51 ? 194  DT  J "C1'" 1 
ATOM   3958  N N1    . DT  B 1 48  ? 38.414  80.259  -28.991 1.00 98.37  ? 194  DT  J N1    1 
ATOM   3959  C C2    . DT  B 1 48  ? 39.070  79.066  -29.216 1.00 99.06  ? 194  DT  J C2    1 
ATOM   3960  O O2    . DT  B 1 48  ? 40.230  79.004  -29.597 1.00 99.87  ? 194  DT  J O2    1 
ATOM   3961  N N3    . DT  B 1 48  ? 38.314  77.941  -28.980 1.00 98.94  ? 194  DT  J N3    1 
ATOM   3962  C C4    . DT  B 1 48  ? 36.999  77.892  -28.558 1.00 98.79  ? 194  DT  J C4    1 
ATOM   3963  O O4    . DT  B 1 48  ? 36.456  76.807  -28.372 1.00 98.60  ? 194  DT  J O4    1 
ATOM   3964  C C5    . DT  B 1 48  ? 36.367  79.178  -28.365 1.00 98.81  ? 194  DT  J C5    1 
ATOM   3965  C C7    . DT  B 1 48  ? 34.936  79.220  -27.934 1.00 98.61  ? 194  DT  J C7    1 
ATOM   3966  C C6    . DT  B 1 48  ? 37.097  80.283  -28.586 1.00 98.84  ? 194  DT  J C6    1 
ATOM   3967  P P     . DC  B 1 49  ? 40.749  84.144  -31.866 1.00 96.40  ? 195  DC  J P     1 
ATOM   3968  O OP1   . DC  B 1 49  ? 42.105  84.702  -32.107 1.00 92.05  ? 195  DC  J OP1   1 
ATOM   3969  O OP2   . DC  B 1 49  ? 39.554  84.908  -32.311 1.00 92.85  ? 195  DC  J OP2   1 
ATOM   3970  O "O5'" . DC  B 1 49  ? 40.670  82.688  -32.507 1.00 92.81  ? 195  DC  J "O5'" 1 
ATOM   3971  C "C5'" . DC  B 1 49  ? 41.742  81.760  -32.354 1.00 86.27  ? 195  DC  J "C5'" 1 
ATOM   3972  C "C4'" . DC  B 1 49  ? 41.516  80.561  -33.243 1.00 81.97  ? 195  DC  J "C4'" 1 
ATOM   3973  O "O4'" . DC  B 1 49  ? 40.472  79.726  -32.692 1.00 81.43  ? 195  DC  J "O4'" 1 
ATOM   3974  C "C3'" . DC  B 1 49  ? 41.067  80.915  -34.664 1.00 79.20  ? 195  DC  J "C3'" 1 
ATOM   3975  O "O3'" . DC  B 1 49  ? 41.551  79.934  -35.575 1.00 74.80  ? 195  DC  J "O3'" 1 
ATOM   3976  C "C2'" . DC  B 1 49  ? 39.563  80.743  -34.587 1.00 80.76  ? 195  DC  J "C2'" 1 
ATOM   3977  C "C1'" . DC  B 1 49  ? 39.479  79.525  -33.686 1.00 81.66  ? 195  DC  J "C1'" 1 
ATOM   3978  N N1    . DC  B 1 49  ? 38.186  79.295  -33.018 1.00 77.85  ? 195  DC  J N1    1 
ATOM   3979  C C2    . DC  B 1 49  ? 37.936  78.032  -32.477 1.00 77.64  ? 195  DC  J C2    1 
ATOM   3980  O O2    . DC  B 1 49  ? 38.813  77.160  -32.571 1.00 76.73  ? 195  DC  J O2    1 
ATOM   3981  N N3    . DC  B 1 49  ? 36.751  77.794  -31.867 1.00 77.91  ? 195  DC  J N3    1 
ATOM   3982  C C4    . DC  B 1 49  ? 35.837  78.763  -31.786 1.00 78.21  ? 195  DC  J C4    1 
ATOM   3983  N N4    . DC  B 1 49  ? 34.680  78.482  -31.181 1.00 78.94  ? 195  DC  J N4    1 
ATOM   3984  C C5    . DC  B 1 49  ? 36.067  80.064  -32.325 1.00 78.09  ? 195  DC  J C5    1 
ATOM   3985  C C6    . DC  B 1 49  ? 37.244  80.284  -32.926 1.00 78.21  ? 195  DC  J C6    1 
ATOM   3986  P P     . DC  B 1 50  ? 43.037  80.050  -36.165 1.00 63.48  ? 196  DC  J P     1 
ATOM   3987  O OP1   . DC  B 1 50  ? 43.941  80.450  -35.048 1.00 66.26  ? 196  DC  J OP1   1 
ATOM   3988  O OP2   . DC  B 1 50  ? 42.998  80.853  -37.418 1.00 67.79  ? 196  DC  J OP2   1 
ATOM   3989  O "O5'" . DC  B 1 50  ? 43.373  78.542  -36.540 1.00 60.46  ? 196  DC  J "O5'" 1 
ATOM   3990  C "C5'" . DC  B 1 50  ? 43.743  77.612  -35.528 1.00 55.94  ? 196  DC  J "C5'" 1 
ATOM   3991  C "C4'" . DC  B 1 50  ? 43.126  76.265  -35.817 1.00 55.67  ? 196  DC  J "C4'" 1 
ATOM   3992  O "O4'" . DC  B 1 50  ? 41.767  76.193  -35.311 1.00 55.47  ? 196  DC  J "O4'" 1 
ATOM   3993  C "C3'" . DC  B 1 50  ? 43.058  75.910  -37.304 1.00 53.27  ? 196  DC  J "C3'" 1 
ATOM   3994  O "O3'" . DC  B 1 50  ? 43.471  74.565  -37.500 1.00 49.72  ? 196  DC  J "O3'" 1 
ATOM   3995  C "C2'" . DC  B 1 50  ? 41.583  76.056  -37.639 1.00 54.46  ? 196  DC  J "C2'" 1 
ATOM   3996  C "C1'" . DC  B 1 50  ? 40.911  75.689  -36.324 1.00 54.56  ? 196  DC  J "C1'" 1 
ATOM   3997  N N1    . DC  B 1 50  ? 39.579  76.287  -36.128 1.00 59.79  ? 196  DC  J N1    1 
ATOM   3998  C C2    . DC  B 1 50  ? 38.550  75.490  -35.595 1.00 58.59  ? 196  DC  J C2    1 
ATOM   3999  O O2    . DC  B 1 50  ? 38.792  74.308  -35.313 1.00 56.31  ? 196  DC  J O2    1 
ATOM   4000  N N3    . DC  B 1 50  ? 37.324  76.033  -35.405 1.00 57.00  ? 196  DC  J N3    1 
ATOM   4001  C C4    . DC  B 1 50  ? 37.102  77.312  -35.727 1.00 58.75  ? 196  DC  J C4    1 
ATOM   4002  N N4    . DC  B 1 50  ? 35.879  77.809  -35.520 1.00 59.47  ? 196  DC  J N4    1 
ATOM   4003  C C5    . DC  B 1 50  ? 38.127  78.142  -36.278 1.00 59.26  ? 196  DC  J C5    1 
ATOM   4004  C C6    . DC  B 1 50  ? 39.338  77.594  -36.458 1.00 58.97  ? 196  DC  J C6    1 
ATOM   4005  P P     . DA  B 1 51  ? 43.660  74.002  -38.985 1.00 50.64  ? 197  DA  J P     1 
ATOM   4006  O OP1   . DA  B 1 51  ? 45.033  73.464  -39.130 1.00 55.34  ? 197  DA  J OP1   1 
ATOM   4007  O OP2   . DA  B 1 51  ? 43.168  75.036  -39.935 1.00 57.41  ? 197  DA  J OP2   1 
ATOM   4008  O "O5'" . DA  B 1 51  ? 42.652  72.771  -39.033 1.00 53.44  ? 197  DA  J "O5'" 1 
ATOM   4009  C "C5'" . DA  B 1 51  ? 42.649  71.793  -37.994 1.00 57.49  ? 197  DA  J "C5'" 1 
ATOM   4010  C "C4'" . DA  B 1 51  ? 41.504  70.827  -38.192 1.00 61.02  ? 197  DA  J "C4'" 1 
ATOM   4011  O "O4'" . DA  B 1 51  ? 40.244  71.467  -37.875 1.00 60.67  ? 197  DA  J "O4'" 1 
ATOM   4012  C "C3'" . DA  B 1 51  ? 41.367  70.313  -39.622 1.00 63.69  ? 197  DA  J "C3'" 1 
ATOM   4013  O "O3'" . DA  B 1 51  ? 41.004  68.931  -39.607 1.00 69.24  ? 197  DA  J "O3'" 1 
ATOM   4014  C "C2'" . DA  B 1 51  ? 40.272  71.185  -40.212 1.00 61.56  ? 197  DA  J "C2'" 1 
ATOM   4015  C "C1'" . DA  B 1 51  ? 39.392  71.478  -39.012 1.00 61.61  ? 197  DA  J "C1'" 1 
ATOM   4016  N N9    . DA  B 1 51  ? 38.735  72.784  -39.054 1.00 68.44  ? 197  DA  J N9    1 
ATOM   4017  C C8    . DA  B 1 51  ? 39.252  73.976  -39.499 1.00 68.50  ? 197  DA  J C8    1 
ATOM   4018  N N7    . DA  B 1 51  ? 38.424  74.986  -39.392 1.00 67.60  ? 197  DA  J N7    1 
ATOM   4019  C C5    . DA  B 1 51  ? 37.283  74.424  -38.842 1.00 67.88  ? 197  DA  J C5    1 
ATOM   4020  C C6    . DA  B 1 51  ? 36.040  74.972  -38.484 1.00 67.54  ? 197  DA  J C6    1 
ATOM   4021  N N6    . DA  B 1 51  ? 35.734  76.262  -38.622 1.00 66.52  ? 197  DA  J N6    1 
ATOM   4022  N N1    . DA  B 1 51  ? 35.111  74.137  -37.971 1.00 67.80  ? 197  DA  J N1    1 
ATOM   4023  C C2    . DA  B 1 51  ? 35.422  72.841  -37.828 1.00 69.47  ? 197  DA  J C2    1 
ATOM   4024  N N3    . DA  B 1 51  ? 36.557  72.207  -38.124 1.00 68.84  ? 197  DA  J N3    1 
ATOM   4025  C C4    . DA  B 1 51  ? 37.457  73.066  -38.634 1.00 68.83  ? 197  DA  J C4    1 
ATOM   4026  P P     . DT  B 1 52  ? 40.645  68.190  -40.985 1.00 73.23  ? 198  DT  J P     1 
ATOM   4027  O OP1   . DT  B 1 52  ? 40.762  66.730  -40.744 1.00 80.26  ? 198  DT  J OP1   1 
ATOM   4028  O OP2   . DT  B 1 52  ? 41.415  68.812  -42.091 1.00 78.45  ? 198  DT  J OP2   1 
ATOM   4029  O "O5'" . DT  B 1 52  ? 39.109  68.554  -41.180 1.00 74.65  ? 198  DT  J "O5'" 1 
ATOM   4030  C "C5'" . DT  B 1 52  ? 38.165  68.267  -40.153 1.00 77.57  ? 198  DT  J "C5'" 1 
ATOM   4031  C "C4'" . DT  B 1 52  ? 36.762  68.404  -40.692 1.00 79.83  ? 198  DT  J "C4'" 1 
ATOM   4032  O "O4'" . DT  B 1 52  ? 36.228  69.729  -40.452 1.00 78.23  ? 198  DT  J "O4'" 1 
ATOM   4033  C "C3'" . DT  B 1 52  ? 36.660  68.161  -42.199 1.00 82.41  ? 198  DT  J "C3'" 1 
ATOM   4034  O "O3'" . DT  B 1 52  ? 35.523  67.358  -42.485 1.00 88.22  ? 198  DT  J "O3'" 1 
ATOM   4035  C "C2'" . DT  B 1 52  ? 36.441  69.552  -42.764 1.00 80.82  ? 198  DT  J "C2'" 1 
ATOM   4036  C "C1'" . DT  B 1 52  ? 35.649  70.210  -41.652 1.00 78.58  ? 198  DT  J "C1'" 1 
ATOM   4037  N N1    . DT  B 1 52  ? 35.699  71.685  -41.640 1.00 83.34  ? 198  DT  J N1    1 
ATOM   4038  C C2    . DT  B 1 52  ? 34.626  72.362  -41.106 1.00 82.86  ? 198  DT  J C2    1 
ATOM   4039  O O2    . DT  B 1 52  ? 33.669  71.800  -40.600 1.00 82.22  ? 198  DT  J O2    1 
ATOM   4040  N N3    . DT  B 1 52  ? 34.715  73.730  -41.183 1.00 82.28  ? 198  DT  J N3    1 
ATOM   4041  C C4    . DT  B 1 52  ? 35.751  74.470  -41.717 1.00 82.22  ? 198  DT  J C4    1 
ATOM   4042  O O4    . DT  B 1 52  ? 35.683  75.696  -41.730 1.00 81.82  ? 198  DT  J O4    1 
ATOM   4043  C C5    . DT  B 1 52  ? 36.859  73.696  -42.232 1.00 82.74  ? 198  DT  J C5    1 
ATOM   4044  C C7    . DT  B 1 52  ? 38.039  74.413  -42.808 1.00 81.50  ? 198  DT  J C7    1 
ATOM   4045  C C6    . DT  B 1 52  ? 36.779  72.361  -42.169 1.00 83.10  ? 198  DT  J C6    1 
ATOM   4046  P P     . DC  B 1 53  ? 35.502  66.448  -43.805 1.00 112.00 ? 199  DC  J P     1 
ATOM   4047  O OP1   . DC  B 1 53  ? 36.033  65.104  -43.458 1.00 84.50  ? 199  DC  J OP1   1 
ATOM   4048  O OP2   . DC  B 1 53  ? 36.115  67.213  -44.925 1.00 85.78  ? 199  DC  J OP2   1 
ATOM   4049  O "O5'" . DC  B 1 53  ? 33.944  66.322  -44.087 1.00 113.63 ? 199  DC  J "O5'" 1 
ATOM   4050  C "C5'" . DC  B 1 53  ? 33.027  66.205  -43.003 1.00 116.00 ? 199  DC  J "C5'" 1 
ATOM   4051  C "C4'" . DC  B 1 53  ? 31.768  66.984  -43.298 1.00 117.34 ? 199  DC  J "C4'" 1 
ATOM   4052  O "O4'" . DC  B 1 53  ? 31.933  68.394  -42.996 1.00 116.61 ? 199  DC  J "O4'" 1 
ATOM   4053  C "C3'" . DC  B 1 53  ? 31.317  66.909  -44.759 1.00 118.56 ? 199  DC  J "C3'" 1 
ATOM   4054  O "O3'" . DC  B 1 53  ? 29.907  66.704  -44.827 1.00 120.67 ? 199  DC  J "O3'" 1 
ATOM   4055  C "C2'" . DC  B 1 53  ? 31.663  68.284  -45.301 1.00 118.05 ? 199  DC  J "C2'" 1 
ATOM   4056  C "C1'" . DC  B 1 53  ? 31.411  69.143  -44.079 1.00 117.59 ? 199  DC  J "C1'" 1 
ATOM   4057  N N1    . DC  B 1 53  ? 32.058  70.467  -44.103 1.00 90.89  ? 199  DC  J N1    1 
ATOM   4058  C C2    . DC  B 1 53  ? 31.394  71.550  -43.513 1.00 90.60  ? 199  DC  J C2    1 
ATOM   4059  O O2    . DC  B 1 53  ? 30.307  71.354  -42.949 1.00 90.73  ? 199  DC  J O2    1 
ATOM   4060  N N3    . DC  B 1 53  ? 31.954  72.779  -43.571 1.00 89.83  ? 199  DC  J N3    1 
ATOM   4061  C C4    . DC  B 1 53  ? 33.131  72.947  -44.177 1.00 89.18  ? 199  DC  J C4    1 
ATOM   4062  N N4    . DC  B 1 53  ? 33.641  74.177  -44.220 1.00 88.57  ? 199  DC  J N4    1 
ATOM   4063  C C5    . DC  B 1 53  ? 33.837  71.860  -44.767 1.00 89.47  ? 199  DC  J C5    1 
ATOM   4064  C C6    . DC  B 1 53  ? 33.271  70.649  -44.706 1.00 90.56  ? 199  DC  J C6    1 
ATOM   4065  P P     . DA  B 1 54  ? 29.117  67.069  -46.175 1.00 127.78 ? 200  DA  J P     1 
ATOM   4066  O OP1   . DA  B 1 54  ? 27.816  66.353  -46.147 1.00 96.35  ? 200  DA  J OP1   1 
ATOM   4067  O OP2   . DA  B 1 54  ? 30.042  66.873  -47.327 1.00 95.20  ? 200  DA  J OP2   1 
ATOM   4068  O "O5'" . DA  B 1 54  ? 28.819  68.624  -46.015 1.00 126.68 ? 200  DA  J "O5'" 1 
ATOM   4069  C "C5'" . DA  B 1 54  ? 27.780  69.073  -45.150 1.00 126.36 ? 200  DA  J "C5'" 1 
ATOM   4070  C "C4'" . DA  B 1 54  ? 26.925  70.091  -45.863 1.00 126.03 ? 200  DA  J "C4'" 1 
ATOM   4071  O "O4'" . DA  B 1 54  ? 27.568  71.388  -45.836 1.00 125.27 ? 200  DA  J "O4'" 1 
ATOM   4072  C "C3'" . DA  B 1 54  ? 26.706  69.752  -47.335 1.00 126.60 ? 200  DA  J "C3'" 1 
ATOM   4073  O "O3'" . DA  B 1 54  ? 25.368  70.055  -47.722 1.00 128.47 ? 200  DA  J "O3'" 1 
ATOM   4074  C "C2'" . DA  B 1 54  ? 27.708  70.636  -48.058 1.00 125.41 ? 200  DA  J "C2'" 1 
ATOM   4075  C "C1'" . DA  B 1 54  ? 27.792  71.858  -47.157 1.00 124.26 ? 200  DA  J "C1'" 1 
ATOM   4076  N N9    . DA  B 1 54  ? 29.090  72.535  -47.171 1.00 90.51  ? 200  DA  J N9    1 
ATOM   4077  C C8    . DA  B 1 54  ? 30.338  71.964  -47.219 1.00 89.79  ? 200  DA  J C8    1 
ATOM   4078  N N7    . DA  B 1 54  ? 31.318  72.835  -47.203 1.00 89.14  ? 200  DA  J N7    1 
ATOM   4079  C C5    . DA  B 1 54  ? 30.673  74.063  -47.143 1.00 88.66  ? 200  DA  J C5    1 
ATOM   4080  C C6    . DA  B 1 54  ? 31.155  75.385  -47.099 1.00 88.26  ? 200  DA  J C6    1 
ATOM   4081  N N6    . DA  B 1 54  ? 32.449  75.703  -47.108 1.00 87.60  ? 200  DA  J N6    1 
ATOM   4082  N N1    . DA  B 1 54  ? 30.246  76.383  -47.046 1.00 88.49  ? 200  DA  J N1    1 
ATOM   4083  C C2    . DA  B 1 54  ? 28.945  76.064  -47.037 1.00 88.72  ? 200  DA  J C2    1 
ATOM   4084  N N3    . DA  B 1 54  ? 28.371  74.862  -47.074 1.00 89.04  ? 200  DA  J N3    1 
ATOM   4085  C C4    . DA  B 1 54  ? 29.301  73.893  -47.126 1.00 89.35  ? 200  DA  J C4    1 
ATOM   4086  P P     . DA  B 1 55  ? 24.817  69.539  -49.137 1.00 113.68 ? 201  DA  J P     1 
ATOM   4087  O OP1   . DA  B 1 55  ? 23.422  69.066  -48.953 1.00 106.71 ? 201  DA  J OP1   1 
ATOM   4088  O OP2   . DA  B 1 55  ? 25.832  68.622  -49.718 1.00 106.71 ? 201  DA  J OP2   1 
ATOM   4089  O "O5'" . DA  B 1 55  ? 24.792  70.864  -50.011 1.00 112.96 ? 201  DA  J "O5'" 1 
ATOM   4090  C "C5'" . DA  B 1 55  ? 24.120  72.025  -49.538 1.00 112.78 ? 201  DA  J "C5'" 1 
ATOM   4091  C "C4'" . DA  B 1 55  ? 24.358  73.178  -50.481 1.00 112.87 ? 201  DA  J "C4'" 1 
ATOM   4092  O "O4'" . DA  B 1 55  ? 25.680  73.737  -50.284 1.00 113.04 ? 201  DA  J "O4'" 1 
ATOM   4093  C "C3'" . DA  B 1 55  ? 24.284  72.777  -51.952 1.00 112.88 ? 201  DA  J "C3'" 1 
ATOM   4094  O "O3'" . DA  B 1 55  ? 23.661  73.818  -52.690 1.00 112.72 ? 201  DA  J "O3'" 1 
ATOM   4095  C "C2'" . DA  B 1 55  ? 25.741  72.672  -52.360 1.00 113.40 ? 201  DA  J "C2'" 1 
ATOM   4096  C "C1'" . DA  B 1 55  ? 26.362  73.776  -51.528 1.00 113.15 ? 201  DA  J "C1'" 1 
ATOM   4097  N N9    . DA  B 1 55  ? 27.793  73.621  -51.270 1.00 105.81 ? 201  DA  J N9    1 
ATOM   4098  C C8    . DA  B 1 55  ? 28.541  72.469  -51.302 1.00 105.77 ? 201  DA  J C8    1 
ATOM   4099  N N7    . DA  B 1 55  ? 29.812  72.657  -51.043 1.00 105.55 ? 201  DA  J N7    1 
ATOM   4100  C C5    . DA  B 1 55  ? 29.908  74.024  -50.822 1.00 104.96 ? 201  DA  J C5    1 
ATOM   4101  C C6    . DA  B 1 55  ? 30.995  74.856  -50.503 1.00 104.26 ? 201  DA  J C6    1 
ATOM   4102  N N6    . DA  B 1 55  ? 32.243  74.411  -50.346 1.00 103.80 ? 201  DA  J N6    1 
ATOM   4103  N N1    . DA  B 1 55  ? 30.752  76.176  -50.347 1.00 103.48 ? 201  DA  J N1    1 
ATOM   4104  C C2    . DA  B 1 55  ? 29.500  76.619  -50.504 1.00 103.40 ? 201  DA  J C2    1 
ATOM   4105  N N3    . DA  B 1 55  ? 28.396  75.937  -50.804 1.00 104.15 ? 201  DA  J N3    1 
ATOM   4106  C C4    . DA  B 1 55  ? 28.672  74.629  -50.953 1.00 104.97 ? 201  DA  J C4    1 
ATOM   4107  P P     . DA  B 1 56  ? 23.096  73.522  -54.159 1.00 139.85 ? 202  DA  J P     1 
ATOM   4108  O OP1   . DA  B 1 56  ? 21.637  73.276  -54.045 1.00 92.31  ? 202  DA  J OP1   1 
ATOM   4109  O OP2   . DA  B 1 56  ? 23.967  72.508  -54.810 1.00 92.22  ? 202  DA  J OP2   1 
ATOM   4110  O "O5'" . DA  B 1 56  ? 23.318  74.912  -54.892 1.00 137.91 ? 202  DA  J "O5'" 1 
ATOM   4111  C "C5'" . DA  B 1 56  ? 23.214  76.132  -54.167 1.00 135.45 ? 202  DA  J "C5'" 1 
ATOM   4112  C "C4'" . DA  B 1 56  ? 24.126  77.167  -54.775 1.00 133.38 ? 202  DA  J "C4'" 1 
ATOM   4113  O "O4'" . DA  B 1 56  ? 25.497  76.967  -54.351 1.00 133.10 ? 202  DA  J "O4'" 1 
ATOM   4114  C "C3'" . DA  B 1 56  ? 24.140  77.119  -56.300 1.00 132.26 ? 202  DA  J "C3'" 1 
ATOM   4115  O "O3'" . DA  B 1 56  ? 24.123  78.441  -56.819 1.00 131.57 ? 202  DA  J "O3'" 1 
ATOM   4116  C "C2'" . DA  B 1 56  ? 25.454  76.429  -56.625 1.00 131.18 ? 202  DA  J "C2'" 1 
ATOM   4117  C "C1'" . DA  B 1 56  ? 26.343  76.902  -55.490 1.00 130.54 ? 202  DA  J "C1'" 1 
ATOM   4118  N N9    . DA  B 1 56  ? 27.473  76.027  -55.166 1.00 80.29  ? 202  DA  J N9    1 
ATOM   4119  C C8    . DA  B 1 56  ? 27.531  74.653  -55.207 1.00 79.63  ? 202  DA  J C8    1 
ATOM   4120  N N7    . DA  B 1 56  ? 28.689  74.160  -54.833 1.00 77.44  ? 202  DA  J N7    1 
ATOM   4121  C C5    . DA  B 1 56  ? 29.447  75.284  -54.528 1.00 76.03  ? 202  DA  J C5    1 
ATOM   4122  C C6    . DA  B 1 56  ? 30.770  75.441  -54.069 1.00 73.49  ? 202  DA  J C6    1 
ATOM   4123  N N6    . DA  B 1 56  ? 31.594  74.424  -53.817 1.00 71.19  ? 202  DA  J N6    1 
ATOM   4124  N N1    . DA  B 1 56  ? 31.221  76.698  -53.872 1.00 72.77  ? 202  DA  J N1    1 
ATOM   4125  C C2    . DA  B 1 56  ? 30.395  77.722  -54.119 1.00 73.79  ? 202  DA  J C2    1 
ATOM   4126  N N3    . DA  B 1 56  ? 29.135  77.705  -54.549 1.00 76.18  ? 202  DA  J N3    1 
ATOM   4127  C C4    . DA  B 1 56  ? 28.714  76.441  -54.736 1.00 77.73  ? 202  DA  J C4    1 
ATOM   4128  P P     . DA  B 1 57  ? 23.674  78.682  -58.334 1.00 117.03 ? 203  DA  J P     1 
ATOM   4129  O OP1   . DA  B 1 57  ? 22.562  79.664  -58.344 1.00 94.61  ? 203  DA  J OP1   1 
ATOM   4130  O OP2   . DA  B 1 57  ? 23.487  77.345  -58.953 1.00 94.64  ? 203  DA  J OP2   1 
ATOM   4131  O "O5'" . DA  B 1 57  ? 24.958  79.350  -58.986 1.00 116.48 ? 203  DA  J "O5'" 1 
ATOM   4132  C "C5'" . DA  B 1 57  ? 25.603  80.450  -58.354 1.00 115.27 ? 203  DA  J "C5'" 1 
ATOM   4133  C "C4'" . DA  B 1 57  ? 26.985  80.633  -58.932 1.00 114.01 ? 203  DA  J "C4'" 1 
ATOM   4134  O "O4'" . DA  B 1 57  ? 27.913  79.667  -58.379 1.00 113.92 ? 203  DA  J "O4'" 1 
ATOM   4135  C "C3'" . DA  B 1 57  ? 27.029  80.444  -60.449 1.00 112.99 ? 203  DA  J "C3'" 1 
ATOM   4136  O "O3'" . DA  B 1 57  ? 27.930  81.385  -61.012 1.00 112.01 ? 203  DA  J "O3'" 1 
ATOM   4137  C "C2'" . DA  B 1 57  ? 27.611  79.052  -60.606 1.00 113.26 ? 203  DA  J "C2'" 1 
ATOM   4138  C "C1'" . DA  B 1 57  ? 28.587  79.027  -59.449 1.00 113.38 ? 203  DA  J "C1'" 1 
ATOM   4139  N N9    . DA  B 1 57  ? 29.005  77.698  -59.008 1.00 90.64  ? 203  DA  J N9    1 
ATOM   4140  C C8    . DA  B 1 57  ? 28.385  76.488  -59.205 1.00 91.06  ? 203  DA  J C8    1 
ATOM   4141  N N7    . DA  B 1 57  ? 29.048  75.469  -58.714 1.00 90.49  ? 203  DA  J N7    1 
ATOM   4142  C C5    . DA  B 1 57  ? 30.177  76.048  -58.149 1.00 89.94  ? 203  DA  J C5    1 
ATOM   4143  C C6    . DA  B 1 57  ? 31.287  75.504  -57.477 1.00 89.23  ? 203  DA  J C6    1 
ATOM   4144  N N6    . DA  B 1 57  ? 31.457  74.198  -57.261 1.00 88.65  ? 203  DA  J N6    1 
ATOM   4145  N N1    . DA  B 1 57  ? 32.233  76.360  -57.034 1.00 88.70  ? 203  DA  J N1    1 
ATOM   4146  C C2    . DA  B 1 57  ? 32.072  77.669  -57.264 1.00 88.89  ? 203  DA  J C2    1 
ATOM   4147  N N3    . DA  B 1 57  ? 31.081  78.299  -57.890 1.00 89.34  ? 203  DA  J N3    1 
ATOM   4148  C C4    . DA  B 1 57  ? 30.156  77.421  -58.313 1.00 90.05  ? 203  DA  J C4    1 
ATOM   4149  P P     . DG  B 1 58  ? 27.366  82.576  -61.915 1.00 97.84  ? 204  DG  J P     1 
ATOM   4150  O OP1   . DG  B 1 58  ? 26.452  83.401  -61.084 1.00 93.21  ? 204  DG  J OP1   1 
ATOM   4151  O OP2   . DG  B 1 58  ? 26.877  81.977  -63.186 1.00 92.85  ? 204  DG  J OP2   1 
ATOM   4152  O "O5'" . DG  B 1 58  ? 28.665  83.436  -62.226 1.00 96.45  ? 204  DG  J "O5'" 1 
ATOM   4153  C "C5'" . DG  B 1 58  ? 29.532  83.851  -61.173 1.00 92.13  ? 204  DG  J "C5'" 1 
ATOM   4154  C "C4'" . DG  B 1 58  ? 30.942  83.389  -61.454 1.00 89.37  ? 204  DG  J "C4'" 1 
ATOM   4155  O "O4'" . DG  B 1 58  ? 31.099  81.981  -61.140 1.00 88.29  ? 204  DG  J "O4'" 1 
ATOM   4156  C "C3'" . DG  B 1 58  ? 31.374  83.550  -62.916 1.00 87.51  ? 204  DG  J "C3'" 1 
ATOM   4157  O "O3'" . DG  B 1 58  ? 32.743  83.941  -62.959 1.00 84.08  ? 204  DG  J "O3'" 1 
ATOM   4158  C "C2'" . DG  B 1 58  ? 31.272  82.136  -63.456 1.00 87.63  ? 204  DG  J "C2'" 1 
ATOM   4159  C "C1'" . DG  B 1 58  ? 31.718  81.345  -62.242 1.00 87.58  ? 204  DG  J "C1'" 1 
ATOM   4160  N N9    . DG  B 1 58  ? 31.350  79.934  -62.232 1.00 83.04  ? 204  DG  J N9    1 
ATOM   4161  C C8    . DG  B 1 58  ? 30.245  79.354  -62.806 1.00 83.32  ? 204  DG  J C8    1 
ATOM   4162  N N7    . DG  B 1 58  ? 30.219  78.054  -62.669 1.00 84.00  ? 204  DG  J N7    1 
ATOM   4163  C C5    . DG  B 1 58  ? 31.374  77.760  -61.956 1.00 82.99  ? 204  DG  J C5    1 
ATOM   4164  C C6    . DG  B 1 58  ? 31.895  76.511  -61.516 1.00 82.58  ? 204  DG  J C6    1 
ATOM   4165  O O6    . DG  B 1 58  ? 31.432  75.376  -61.688 1.00 81.45  ? 204  DG  J O6    1 
ATOM   4166  N N1    . DG  B 1 58  ? 33.084  76.675  -60.811 1.00 82.46  ? 204  DG  J N1    1 
ATOM   4167  C C2    . DG  B 1 58  ? 33.695  77.879  -60.562 1.00 82.51  ? 204  DG  J C2    1 
ATOM   4168  N N2    . DG  B 1 58  ? 34.828  77.830  -59.847 1.00 82.41  ? 204  DG  J N2    1 
ATOM   4169  N N3    . DG  B 1 58  ? 33.229  79.046  -60.978 1.00 82.57  ? 204  DG  J N3    1 
ATOM   4170  C C4    . DG  B 1 58  ? 32.074  78.912  -61.664 1.00 83.11  ? 204  DG  J C4    1 
ATOM   4171  P P     . DG  B 1 59  ? 33.130  85.482  -63.157 1.00 72.16  ? 205  DG  J P     1 
ATOM   4172  O OP1   . DG  B 1 59  ? 32.272  86.309  -62.267 1.00 77.78  ? 205  DG  J OP1   1 
ATOM   4173  O OP2   . DG  B 1 59  ? 33.166  85.758  -64.616 1.00 76.59  ? 205  DG  J OP2   1 
ATOM   4174  O "O5'" . DG  B 1 59  ? 34.617  85.542  -62.588 1.00 70.42  ? 205  DG  J "O5'" 1 
ATOM   4175  C "C5'" . DG  B 1 59  ? 34.869  85.354  -61.197 1.00 66.10  ? 205  DG  J "C5'" 1 
ATOM   4176  C "C4'" . DG  B 1 59  ? 36.040  84.421  -60.995 1.00 62.84  ? 205  DG  J "C4'" 1 
ATOM   4177  O "O4'" . DG  B 1 59  ? 35.677  83.052  -61.305 1.00 60.97  ? 205  DG  J "O4'" 1 
ATOM   4178  C "C3'" . DG  B 1 59  ? 37.269  84.738  -61.843 1.00 60.83  ? 205  DG  J "C3'" 1 
ATOM   4179  O "O3'" . DG  B 1 59  ? 38.431  84.534  -61.041 1.00 57.55  ? 205  DG  J "O3'" 1 
ATOM   4180  C "C2'" . DG  B 1 59  ? 37.187  83.732  -62.979 1.00 60.26  ? 205  DG  J "C2'" 1 
ATOM   4181  C "C1'" . DG  B 1 59  ? 36.529  82.526  -62.318 1.00 61.06  ? 205  DG  J "C1'" 1 
ATOM   4182  N N9    . DG  B 1 59  ? 35.699  81.713  -63.207 1.00 66.36  ? 205  DG  J N9    1 
ATOM   4183  C C8    . DG  B 1 59  ? 34.817  82.169  -64.158 1.00 67.00  ? 205  DG  J C8    1 
ATOM   4184  N N7    . DG  B 1 59  ? 34.170  81.208  -64.763 1.00 67.57  ? 205  DG  J N7    1 
ATOM   4185  C C5    . DG  B 1 59  ? 34.659  80.045  -64.184 1.00 67.90  ? 205  DG  J C5    1 
ATOM   4186  C C6    . DG  B 1 59  ? 34.315  78.681  -64.417 1.00 67.59  ? 205  DG  J C6    1 
ATOM   4187  O O6    . DG  B 1 59  ? 33.463  78.219  -65.181 1.00 68.59  ? 205  DG  J O6    1 
ATOM   4188  N N1    . DG  B 1 59  ? 35.074  77.821  -63.631 1.00 67.50  ? 205  DG  J N1    1 
ATOM   4189  C C2    . DG  B 1 59  ? 36.028  78.216  -62.725 1.00 67.04  ? 205  DG  J C2    1 
ATOM   4190  N N2    . DG  B 1 59  ? 36.672  77.233  -62.084 1.00 66.14  ? 205  DG  J N2    1 
ATOM   4191  N N3    . DG  B 1 59  ? 36.334  79.482  -62.473 1.00 67.30  ? 205  DG  J N3    1 
ATOM   4192  C C4    . DG  B 1 59  ? 35.620  80.337  -63.236 1.00 66.81  ? 205  DG  J C4    1 
ATOM   4193  P P     . DC  B 1 60  ? 39.882  84.870  -61.630 1.00 60.92  ? 206  DC  J P     1 
ATOM   4194  O OP1   . DC  B 1 60  ? 40.686  85.375  -60.483 1.00 59.21  ? 206  DC  J OP1   1 
ATOM   4195  O OP2   . DC  B 1 60  ? 39.726  85.697  -62.855 1.00 61.98  ? 206  DC  J OP2   1 
ATOM   4196  O "O5'" . DC  B 1 60  ? 40.434  83.446  -62.072 1.00 56.85  ? 206  DC  J "O5'" 1 
ATOM   4197  C "C5'" . DC  B 1 60  ? 40.380  82.364  -61.159 1.00 54.07  ? 206  DC  J "C5'" 1 
ATOM   4198  C "C4'" . DC  B 1 60  ? 40.761  81.077  -61.845 1.00 53.05  ? 206  DC  J "C4'" 1 
ATOM   4199  O "O4'" . DC  B 1 60  ? 39.694  80.584  -62.694 1.00 53.20  ? 206  DC  J "O4'" 1 
ATOM   4200  C "C3'" . DC  B 1 60  ? 42.012  81.154  -62.719 1.00 51.94  ? 206  DC  J "C3'" 1 
ATOM   4201  O "O3'" . DC  B 1 60  ? 42.774  79.989  -62.430 1.00 49.04  ? 206  DC  J "O3'" 1 
ATOM   4202  C "C2'" . DC  B 1 60  ? 41.456  81.102  -64.136 1.00 51.32  ? 206  DC  J "C2'" 1 
ATOM   4203  C "C1'" . DC  B 1 60  ? 40.231  80.219  -63.956 1.00 52.68  ? 206  DC  J "C1'" 1 
ATOM   4204  N N1    . DC  B 1 60  ? 39.165  80.369  -64.966 1.00 55.30  ? 206  DC  J N1    1 
ATOM   4205  C C2    . DC  B 1 60  ? 38.462  79.226  -65.382 1.00 54.07  ? 206  DC  J C2    1 
ATOM   4206  O O2    . DC  B 1 60  ? 38.761  78.129  -64.902 1.00 53.04  ? 206  DC  J O2    1 
ATOM   4207  N N3    . DC  B 1 60  ? 37.479  79.350  -66.298 1.00 55.28  ? 206  DC  J N3    1 
ATOM   4208  C C4    . DC  B 1 60  ? 37.185  80.550  -66.804 1.00 57.36  ? 206  DC  J C4    1 
ATOM   4209  N N4    . DC  B 1 60  ? 36.199  80.623  -67.714 1.00 57.72  ? 206  DC  J N4    1 
ATOM   4210  C C5    . DC  B 1 60  ? 37.885  81.729  -66.406 1.00 55.48  ? 206  DC  J C5    1 
ATOM   4211  C C6    . DC  B 1 60  ? 38.858  81.594  -65.493 1.00 55.76  ? 206  DC  J C6    1 
ATOM   4212  P P     . DA  B 1 61  ? 44.292  79.866  -62.918 1.00 43.01  ? 207  DA  J P     1 
ATOM   4213  O OP1   . DA  B 1 61  ? 45.134  80.031  -61.705 1.00 47.45  ? 207  DA  J OP1   1 
ATOM   4214  O OP2   . DA  B 1 61  ? 44.525  80.723  -64.105 1.00 49.42  ? 207  DA  J OP2   1 
ATOM   4215  O "O5'" . DA  B 1 61  ? 44.344  78.334  -63.336 1.00 42.11  ? 207  DA  J "O5'" 1 
ATOM   4216  C "C5'" . DA  B 1 61  ? 43.850  77.355  -62.421 1.00 43.12  ? 207  DA  J "C5'" 1 
ATOM   4217  C "C4'" . DA  B 1 61  ? 43.576  76.051  -63.126 1.00 43.46  ? 207  DA  J "C4'" 1 
ATOM   4218  O "O4'" . DA  B 1 61  ? 42.426  76.189  -63.996 1.00 46.46  ? 207  DA  J "O4'" 1 
ATOM   4219  C "C3'" . DA  B 1 61  ? 44.722  75.553  -63.996 1.00 43.86  ? 207  DA  J "C3'" 1 
ATOM   4220  O "O3'" . DA  B 1 61  ? 44.885  74.155  -63.770 1.00 42.87  ? 207  DA  J "O3'" 1 
ATOM   4221  C "C2'" . DA  B 1 61  ? 44.279  75.885  -65.415 1.00 44.16  ? 207  DA  J "C2'" 1 
ATOM   4222  C "C1'" . DA  B 1 61  ? 42.761  75.855  -65.335 1.00 44.60  ? 207  DA  J "C1'" 1 
ATOM   4223  N N9    . DA  B 1 61  ? 42.083  76.821  -66.201 1.00 53.13  ? 207  DA  J N9    1 
ATOM   4224  C C8    . DA  B 1 61  ? 42.266  78.181  -66.245 1.00 52.43  ? 207  DA  J C8    1 
ATOM   4225  N N7    . DA  B 1 61  ? 41.486  78.793  -67.100 1.00 53.00  ? 207  DA  J N7    1 
ATOM   4226  C C5    . DA  B 1 61  ? 40.743  77.768  -67.667 1.00 54.21  ? 207  DA  J C5    1 
ATOM   4227  C C6    . DA  B 1 61  ? 39.726  77.762  -68.643 1.00 55.10  ? 207  DA  J C6    1 
ATOM   4228  N N6    . DA  B 1 61  ? 39.267  78.862  -69.245 1.00 51.69  ? 207  DA  J N6    1 
ATOM   4229  N N1    . DA  B 1 61  ? 39.188  76.567  -68.979 1.00 56.18  ? 207  DA  J N1    1 
ATOM   4230  C C2    . DA  B 1 61  ? 39.646  75.464  -68.370 1.00 55.10  ? 207  DA  J C2    1 
ATOM   4231  N N3    . DA  B 1 61  ? 40.593  75.344  -67.441 1.00 54.15  ? 207  DA  J N3    1 
ATOM   4232  C C4    . DA  B 1 61  ? 41.106  76.546  -67.129 1.00 53.97  ? 207  DA  J C4    1 
ATOM   4233  P P     . DT  B 1 62  ? 46.058  73.358  -64.502 1.00 44.03  ? 208  DT  J P     1 
ATOM   4234  O OP1   . DT  B 1 62  ? 46.441  72.248  -63.584 1.00 49.38  ? 208  DT  J OP1   1 
ATOM   4235  O OP2   . DT  B 1 62  ? 47.090  74.305  -64.989 1.00 50.54  ? 208  DT  J OP2   1 
ATOM   4236  O "O5'" . DT  B 1 62  ? 45.304  72.749  -65.764 1.00 48.23  ? 208  DT  J "O5'" 1 
ATOM   4237  C "C5'" . DT  B 1 62  ? 44.028  72.131  -65.585 1.00 49.44  ? 208  DT  J "C5'" 1 
ATOM   4238  C "C4'" . DT  B 1 62  ? 43.528  71.562  -66.889 1.00 52.45  ? 208  DT  J "C4'" 1 
ATOM   4239  O "O4'" . DT  B 1 62  ? 42.818  72.561  -67.658 1.00 52.80  ? 208  DT  J "O4'" 1 
ATOM   4240  C "C3'" . DT  B 1 62  ? 44.617  70.994  -67.798 1.00 53.96  ? 208  DT  J "C3'" 1 
ATOM   4241  O "O3'" . DT  B 1 62  ? 44.198  69.705  -68.259 1.00 57.00  ? 208  DT  J "O3'" 1 
ATOM   4242  C "C2'" . DT  B 1 62  ? 44.714  72.020  -68.922 1.00 52.08  ? 208  DT  J "C2'" 1 
ATOM   4243  C "C1'" . DT  B 1 62  ? 43.298  72.574  -68.992 1.00 52.36  ? 208  DT  J "C1'" 1 
ATOM   4244  N N1    . DT  B 1 62  ? 43.132  73.956  -69.508 1.00 56.99  ? 208  DT  J N1    1 
ATOM   4245  C C2    . DT  B 1 62  ? 42.084  74.196  -70.377 1.00 57.76  ? 208  DT  J C2    1 
ATOM   4246  O O2    . DT  B 1 62  ? 41.339  73.324  -70.788 1.00 58.41  ? 208  DT  J O2    1 
ATOM   4247  N N3    . DT  B 1 62  ? 41.937  75.508  -70.750 1.00 59.22  ? 208  DT  J N3    1 
ATOM   4248  C C4    . DT  B 1 62  ? 42.714  76.579  -70.364 1.00 58.32  ? 208  DT  J C4    1 
ATOM   4249  O O4    . DT  B 1 62  ? 42.425  77.713  -70.749 1.00 58.90  ? 208  DT  J O4    1 
ATOM   4250  C C5    . DT  B 1 62  ? 43.828  76.252  -69.497 1.00 57.10  ? 208  DT  J C5    1 
ATOM   4251  C C7    . DT  B 1 62  ? 44.761  77.346  -69.075 1.00 54.79  ? 208  DT  J C7    1 
ATOM   4252  C C6    . DT  B 1 62  ? 43.976  74.974  -69.113 1.00 54.78  ? 208  DT  J C6    1 
ATOM   4253  P P     . DG  B 1 63  ? 45.258  68.706  -68.934 1.00 55.47  ? 209  DG  J P     1 
ATOM   4254  O OP1   . DG  B 1 63  ? 44.878  67.325  -68.531 1.00 66.45  ? 209  DG  J OP1   1 
ATOM   4255  O OP2   . DG  B 1 63  ? 46.638  69.188  -68.682 1.00 63.33  ? 209  DG  J OP2   1 
ATOM   4256  O "O5'" . DG  B 1 63  ? 44.947  68.877  -70.487 1.00 55.86  ? 209  DG  J "O5'" 1 
ATOM   4257  C "C5'" . DG  B 1 63  ? 43.617  68.717  -70.970 1.00 55.77  ? 209  DG  J "C5'" 1 
ATOM   4258  C "C4'" . DG  B 1 63  ? 43.513  69.164  -72.411 1.00 57.63  ? 209  DG  J "C4'" 1 
ATOM   4259  O "O4'" . DG  B 1 63  ? 43.317  70.598  -72.499 1.00 56.40  ? 209  DG  J "O4'" 1 
ATOM   4260  C "C3'" . DG  B 1 63  ? 44.719  68.830  -73.295 1.00 57.50  ? 209  DG  J "C3'" 1 
ATOM   4261  O "O3'" . DG  B 1 63  ? 44.280  68.215  -74.505 1.00 57.86  ? 209  DG  J "O3'" 1 
ATOM   4262  C "C2'" . DG  B 1 63  ? 45.346  70.187  -73.580 1.00 57.22  ? 209  DG  J "C2'" 1 
ATOM   4263  C "C1'" . DG  B 1 63  ? 44.151  71.122  -73.517 1.00 56.85  ? 209  DG  J "C1'" 1 
ATOM   4264  N N9    . DG  B 1 63  ? 44.463  72.504  -73.165 1.00 65.90  ? 209  DG  J N9    1 
ATOM   4265  C C8    . DG  B 1 63  ? 45.380  72.938  -72.237 1.00 65.24  ? 209  DG  J C8    1 
ATOM   4266  N N7    . DG  B 1 63  ? 45.415  74.236  -72.117 1.00 62.82  ? 209  DG  J N7    1 
ATOM   4267  C C5    . DG  B 1 63  ? 44.469  74.689  -73.024 1.00 63.86  ? 209  DG  J C5    1 
ATOM   4268  C C6    . DG  B 1 63  ? 44.060  76.003  -73.328 1.00 63.81  ? 209  DG  J C6    1 
ATOM   4269  O O6    . DG  B 1 63  ? 44.451  77.056  -72.830 1.00 63.33  ? 209  DG  J O6    1 
ATOM   4270  N N1    . DG  B 1 63  ? 43.079  76.021  -74.316 1.00 65.56  ? 209  DG  J N1    1 
ATOM   4271  C C2    . DG  B 1 63  ? 42.549  74.907  -74.922 1.00 65.45  ? 209  DG  J C2    1 
ATOM   4272  N N2    . DG  B 1 63  ? 41.601  75.134  -75.843 1.00 64.09  ? 209  DG  J N2    1 
ATOM   4273  N N3    . DG  B 1 63  ? 42.920  73.667  -74.641 1.00 64.26  ? 209  DG  J N3    1 
ATOM   4274  C C4    . DG  B 1 63  ? 43.879  73.634  -73.688 1.00 64.76  ? 209  DG  J C4    1 
ATOM   4275  P P     . DT  B 1 64  ? 45.353  67.779  -75.617 1.00 64.73  ? 210  DT  J P     1 
ATOM   4276  O OP1   . DT  B 1 64  ? 45.113  66.361  -75.971 1.00 64.09  ? 210  DT  J OP1   1 
ATOM   4277  O OP2   . DT  B 1 64  ? 46.702  68.198  -75.172 1.00 62.85  ? 210  DT  J OP2   1 
ATOM   4278  O "O5'" . DT  B 1 64  ? 44.917  68.681  -76.850 1.00 66.27  ? 210  DT  J "O5'" 1 
ATOM   4279  C "C5'" . DT  B 1 64  ? 43.531  68.928  -77.085 1.00 67.42  ? 210  DT  J "C5'" 1 
ATOM   4280  C "C4'" . DT  B 1 64  ? 43.352  69.919  -78.210 1.00 68.06  ? 210  DT  J "C4'" 1 
ATOM   4281  O "O4'" . DT  B 1 64  ? 43.418  71.288  -77.732 1.00 68.25  ? 210  DT  J "O4'" 1 
ATOM   4282  C "C3'" . DT  B 1 64  ? 44.382  69.793  -79.330 1.00 68.31  ? 210  DT  J "C3'" 1 
ATOM   4283  O "O3'" . DT  B 1 64  ? 43.718  69.793  -80.589 1.00 71.47  ? 210  DT  J "O3'" 1 
ATOM   4284  C "C2'" . DT  B 1 64  ? 45.253  71.029  -79.164 1.00 67.20  ? 210  DT  J "C2'" 1 
ATOM   4285  C "C1'" . DT  B 1 64  ? 44.307  72.046  -78.539 1.00 65.39  ? 210  DT  J "C1'" 1 
ATOM   4286  N N1    . DT  B 1 64  ? 44.972  73.047  -77.667 1.00 61.94  ? 210  DT  J N1    1 
ATOM   4287  C C2    . DT  B 1 64  ? 44.603  74.380  -77.764 1.00 60.18  ? 210  DT  J C2    1 
ATOM   4288  O O2    . DT  B 1 64  ? 43.747  74.789  -78.525 1.00 60.90  ? 210  DT  J O2    1 
ATOM   4289  N N3    . DT  B 1 64  ? 45.284  75.225  -76.926 1.00 59.10  ? 210  DT  J N3    1 
ATOM   4290  C C4    . DT  B 1 64  ? 46.274  74.893  -76.029 1.00 57.53  ? 210  DT  J C4    1 
ATOM   4291  O O4    . DT  B 1 64  ? 46.800  75.773  -75.353 1.00 53.95  ? 210  DT  J O4    1 
ATOM   4292  C C5    . DT  B 1 64  ? 46.608  73.482  -75.972 1.00 58.15  ? 210  DT  J C5    1 
ATOM   4293  C C7    . DT  B 1 64  ? 47.672  73.022  -75.024 1.00 58.87  ? 210  DT  J C7    1 
ATOM   4294  C C6    . DT  B 1 64  ? 45.946  72.645  -76.779 1.00 58.90  ? 210  DT  J C6    1 
ATOM   4295  P P     . DT  B 1 65  ? 44.558  69.550  -81.930 1.00 80.58  ? 211  DT  J P     1 
ATOM   4296  O OP1   . DT  B 1 65  ? 43.757  68.677  -82.823 1.00 66.86  ? 211  DT  J OP1   1 
ATOM   4297  O OP2   . DT  B 1 65  ? 45.938  69.156  -81.557 1.00 66.90  ? 211  DT  J OP2   1 
ATOM   4298  O "O5'" . DT  B 1 65  ? 44.610  71.003  -82.563 1.00 79.31  ? 211  DT  J "O5'" 1 
ATOM   4299  C "C5'" . DT  B 1 65  ? 43.424  71.780  -82.647 1.00 76.07  ? 211  DT  J "C5'" 1 
ATOM   4300  C "C4'" . DT  B 1 65  ? 43.729  73.112  -83.281 1.00 73.74  ? 211  DT  J "C4'" 1 
ATOM   4301  O "O4'" . DT  B 1 65  ? 44.326  74.013  -82.317 1.00 72.88  ? 211  DT  J "O4'" 1 
ATOM   4302  C "C3'" . DT  B 1 65  ? 44.710  73.012  -84.444 1.00 72.64  ? 211  DT  J "C3'" 1 
ATOM   4303  O "O3'" . DT  B 1 65  ? 44.262  73.867  -85.490 1.00 74.27  ? 211  DT  J "O3'" 1 
ATOM   4304  C "C2'" . DT  B 1 65  ? 46.024  73.492  -83.848 1.00 69.92  ? 211  DT  J "C2'" 1 
ATOM   4305  C "C1'" . DT  B 1 65  ? 45.564  74.505  -82.811 1.00 69.68  ? 211  DT  J "C1'" 1 
ATOM   4306  N N1    . DT  B 1 65  ? 46.469  74.690  -81.653 1.00 52.52  ? 211  DT  J N1    1 
ATOM   4307  C C2    . DT  B 1 65  ? 46.636  75.968  -81.154 1.00 49.78  ? 211  DT  J C2    1 
ATOM   4308  O O2    . DT  B 1 65  ? 46.111  76.948  -81.645 1.00 47.05  ? 211  DT  J O2    1 
ATOM   4309  N N3    . DT  B 1 65  ? 47.450  76.054  -80.048 1.00 50.10  ? 211  DT  J N3    1 
ATOM   4310  C C4    . DT  B 1 65  ? 48.105  75.020  -79.413 1.00 49.59  ? 211  DT  J C4    1 
ATOM   4311  O O4    . DT  B 1 65  ? 48.776  75.250  -78.412 1.00 50.36  ? 211  DT  J O4    1 
ATOM   4312  C C5    . DT  B 1 65  ? 47.917  73.706  -80.013 1.00 50.39  ? 211  DT  J C5    1 
ATOM   4313  C C7    . DT  B 1 65  ? 48.623  72.525  -79.423 1.00 48.03  ? 211  DT  J C7    1 
ATOM   4314  C C6    . DT  B 1 65  ? 47.114  73.611  -81.083 1.00 50.38  ? 211  DT  J C6    1 
ATOM   4315  P P     . DC  B 1 66  ? 44.905  73.748  -86.952 1.00 68.69  ? 212  DC  J P     1 
ATOM   4316  O OP1   . DC  B 1 66  ? 43.773  73.830  -87.910 1.00 64.52  ? 212  DC  J OP1   1 
ATOM   4317  O OP2   . DC  B 1 66  ? 45.851  72.604  -87.022 1.00 62.01  ? 212  DC  J OP2   1 
ATOM   4318  O "O5'" . DC  B 1 66  ? 45.754  75.084  -87.050 1.00 67.53  ? 212  DC  J "O5'" 1 
ATOM   4319  C "C5'" . DC  B 1 66  ? 45.162  76.322  -86.682 1.00 67.25  ? 212  DC  J "C5'" 1 
ATOM   4320  C "C4'" . DC  B 1 66  ? 46.223  77.385  -86.554 1.00 67.05  ? 212  DC  J "C4'" 1 
ATOM   4321  O "O4'" . DC  B 1 66  ? 46.891  77.320  -85.267 1.00 66.62  ? 212  DC  J "O4'" 1 
ATOM   4322  C "C3'" . DC  B 1 66  ? 47.318  77.292  -87.614 1.00 65.92  ? 212  DC  J "C3'" 1 
ATOM   4323  O "O3'" . DC  B 1 66  ? 47.523  78.580  -88.182 1.00 66.76  ? 212  DC  J "O3'" 1 
ATOM   4324  C "C2'" . DC  B 1 66  ? 48.542  76.840  -86.830 1.00 65.51  ? 212  DC  J "C2'" 1 
ATOM   4325  C "C1'" . DC  B 1 66  ? 48.284  77.462  -85.469 1.00 64.15  ? 212  DC  J "C1'" 1 
ATOM   4326  N N1    . DC  B 1 66  ? 48.981  76.860  -84.316 1.00 57.47  ? 212  DC  J N1    1 
ATOM   4327  C C2    . DC  B 1 66  ? 49.440  77.711  -83.281 1.00 56.37  ? 212  DC  J C2    1 
ATOM   4328  O O2    . DC  B 1 66  ? 49.244  78.932  -83.368 1.00 54.32  ? 212  DC  J O2    1 
ATOM   4329  N N3    . DC  B 1 66  ? 50.078  77.176  -82.218 1.00 54.19  ? 212  DC  J N3    1 
ATOM   4330  C C4    . DC  B 1 66  ? 50.269  75.859  -82.149 1.00 55.88  ? 212  DC  J C4    1 
ATOM   4331  N N4    . DC  B 1 66  ? 50.908  75.382  -81.079 1.00 52.77  ? 212  DC  J N4    1 
ATOM   4332  C C5    . DC  B 1 66  ? 49.815  74.970  -83.178 1.00 56.23  ? 212  DC  J C5    1 
ATOM   4333  C C6    . DC  B 1 66  ? 49.182  75.511  -84.234 1.00 56.61  ? 212  DC  J C6    1 
ATOM   4334  P P     . DA  B 1 67  ? 48.324  78.718  -89.559 1.00 64.30  ? 213  DA  J P     1 
ATOM   4335  O OP1   . DA  B 1 67  ? 47.462  79.456  -90.515 1.00 66.76  ? 213  DA  J OP1   1 
ATOM   4336  O OP2   . DA  B 1 67  ? 48.870  77.386  -89.927 1.00 64.40  ? 213  DA  J OP2   1 
ATOM   4337  O "O5'" . DA  B 1 67  ? 49.550  79.654  -89.165 1.00 65.59  ? 213  DA  J "O5'" 1 
ATOM   4338  C "C5'" . DA  B 1 67  ? 49.328  80.860  -88.435 1.00 65.41  ? 213  DA  J "C5'" 1 
ATOM   4339  C "C4'" . DA  B 1 67  ? 50.616  81.334  -87.807 1.00 65.14  ? 213  DA  J "C4'" 1 
ATOM   4340  O "O4'" . DA  B 1 67  ? 50.979  80.489  -86.691 1.00 63.96  ? 213  DA  J "O4'" 1 
ATOM   4341  C "C3'" . DA  B 1 67  ? 51.817  81.319  -88.752 1.00 65.02  ? 213  DA  J "C3'" 1 
ATOM   4342  O "O3'" . DA  B 1 67  ? 52.664  82.408  -88.414 1.00 65.32  ? 213  DA  J "O3'" 1 
ATOM   4343  C "C2'" . DA  B 1 67  ? 52.529  80.039  -88.367 1.00 65.56  ? 213  DA  J "C2'" 1 
ATOM   4344  C "C1'" . DA  B 1 67  ? 52.315  80.062  -86.869 1.00 66.62  ? 213  DA  J "C1'" 1 
ATOM   4345  N N9    . DA  B 1 67  ? 52.482  78.785  -86.185 1.00 70.73  ? 213  DA  J N9    1 
ATOM   4346  C C8    . DA  B 1 67  ? 52.297  77.517  -86.673 1.00 70.73  ? 213  DA  J C8    1 
ATOM   4347  N N7    . DA  B 1 67  ? 52.554  76.574  -85.801 1.00 72.06  ? 213  DA  J N7    1 
ATOM   4348  C C5    . DA  B 1 67  ? 52.929  77.269  -84.660 1.00 72.47  ? 213  DA  J C5    1 
ATOM   4349  C C6    . DA  B 1 67  ? 53.324  76.844  -83.386 1.00 73.56  ? 213  DA  J C6    1 
ATOM   4350  N N6    . DA  B 1 67  ? 53.416  75.562  -83.037 1.00 74.27  ? 213  DA  J N6    1 
ATOM   4351  N N1    . DA  B 1 67  ? 53.626  77.792  -82.469 1.00 73.75  ? 213  DA  J N1    1 
ATOM   4352  C C2    . DA  B 1 67  ? 53.532  79.079  -82.826 1.00 73.62  ? 213  DA  J C2    1 
ATOM   4353  N N3    . DA  B 1 67  ? 53.173  79.603  -83.996 1.00 71.70  ? 213  DA  J N3    1 
ATOM   4354  C C4    . DA  B 1 67  ? 52.883  78.632  -84.880 1.00 71.81  ? 213  DA  J C4    1 
ATOM   4355  P P     . DG  B 1 68  ? 52.581  83.774  -89.246 1.00 61.04  ? 214  DG  J P     1 
ATOM   4356  O OP1   . DG  B 1 68  ? 51.147  84.100  -89.461 1.00 61.37  ? 214  DG  J OP1   1 
ATOM   4357  O OP2   . DG  B 1 68  ? 53.495  83.629  -90.408 1.00 63.20  ? 214  DG  J OP2   1 
ATOM   4358  O "O5'" . DG  B 1 68  ? 53.204  84.842  -88.242 1.00 59.13  ? 214  DG  J "O5'" 1 
ATOM   4359  C "C5'" . DG  B 1 68  ? 52.501  85.230  -87.062 1.00 56.76  ? 214  DG  J "C5'" 1 
ATOM   4360  C "C4'" . DG  B 1 68  ? 53.473  85.468  -85.929 1.00 56.59  ? 214  DG  J "C4'" 1 
ATOM   4361  O "O4'" . DG  B 1 68  ? 53.973  84.211  -85.411 1.00 55.33  ? 214  DG  J "O4'" 1 
ATOM   4362  C "C3'" . DG  B 1 68  ? 54.703  86.289  -86.302 1.00 55.89  ? 214  DG  J "C3'" 1 
ATOM   4363  O "O3'" . DG  B 1 68  ? 55.011  87.168  -85.217 1.00 57.76  ? 214  DG  J "O3'" 1 
ATOM   4364  C "C2'" . DG  B 1 68  ? 55.782  85.237  -86.515 1.00 54.58  ? 214  DG  J "C2'" 1 
ATOM   4365  C "C1'" . DG  B 1 68  ? 55.389  84.148  -85.529 1.00 54.55  ? 214  DG  J "C1'" 1 
ATOM   4366  N N9    . DG  B 1 68  ? 55.717  82.780  -85.920 1.00 57.02  ? 214  DG  J N9    1 
ATOM   4367  C C8    . DG  B 1 68  ? 55.595  82.218  -87.168 1.00 57.29  ? 214  DG  J C8    1 
ATOM   4368  N N7    . DG  B 1 68  ? 55.849  80.935  -87.180 1.00 55.94  ? 214  DG  J N7    1 
ATOM   4369  C C5    . DG  B 1 68  ? 56.183  80.637  -85.866 1.00 54.93  ? 214  DG  J C5    1 
ATOM   4370  C C6    . DG  B 1 68  ? 56.521  79.402  -85.262 1.00 55.11  ? 214  DG  J C6    1 
ATOM   4371  O O6    . DG  B 1 68  ? 56.555  78.275  -85.772 1.00 53.48  ? 214  DG  J O6    1 
ATOM   4372  N N1    . DG  B 1 68  ? 56.816  79.558  -83.913 1.00 55.09  ? 214  DG  J N1    1 
ATOM   4373  C C2    . DG  B 1 68  ? 56.774  80.743  -83.226 1.00 54.75  ? 214  DG  J C2    1 
ATOM   4374  N N2    . DG  B 1 68  ? 57.123  80.687  -81.938 1.00 54.45  ? 214  DG  J N2    1 
ATOM   4375  N N3    . DG  B 1 68  ? 56.423  81.896  -83.766 1.00 56.31  ? 214  DG  J N3    1 
ATOM   4376  C C4    . DG  B 1 68  ? 56.145  81.772  -85.082 1.00 56.48  ? 214  DG  J C4    1 
ATOM   4377  P P     . DC  B 1 69  ? 56.117  88.319  -85.403 1.00 64.24  ? 215  DC  J P     1 
ATOM   4378  O OP1   . DC  B 1 69  ? 55.680  89.468  -84.568 1.00 61.40  ? 215  DC  J OP1   1 
ATOM   4379  O OP2   . DC  B 1 69  ? 56.385  88.519  -86.854 1.00 62.16  ? 215  DC  J OP2   1 
ATOM   4380  O "O5'" . DC  B 1 69  ? 57.425  87.669  -84.765 1.00 64.13  ? 215  DC  J "O5'" 1 
ATOM   4381  C "C5'" . DC  B 1 69  ? 57.384  87.062  -83.473 1.00 62.17  ? 215  DC  J "C5'" 1 
ATOM   4382  C "C4'" . DC  B 1 69  ? 58.639  86.256  -83.230 1.00 61.58  ? 215  DC  J "C4'" 1 
ATOM   4383  O "O4'" . DC  B 1 69  ? 58.590  85.000  -83.945 1.00 60.41  ? 215  DC  J "O4'" 1 
ATOM   4384  C "C3'" . DC  B 1 69  ? 59.943  86.940  -83.656 1.00 61.76  ? 215  DC  J "C3'" 1 
ATOM   4385  O "O3'" . DC  B 1 69  ? 60.945  86.710  -82.666 1.00 61.04  ? 215  DC  J "O3'" 1 
ATOM   4386  C "C2'" . DC  B 1 69  ? 60.320  86.206  -84.933 1.00 60.24  ? 215  DC  J "C2'" 1 
ATOM   4387  C "C1'" . DC  B 1 69  ? 59.824  84.809  -84.612 1.00 62.42  ? 215  DC  J "C1'" 1 
ATOM   4388  N N1    . DC  B 1 69  ? 59.601  83.907  -85.753 1.00 62.44  ? 215  DC  J N1    1 
ATOM   4389  C C2    . DC  B 1 69  ? 59.720  82.529  -85.543 1.00 63.63  ? 215  DC  J C2    1 
ATOM   4390  O O2    . DC  B 1 69  ? 59.974  82.117  -84.400 1.00 62.31  ? 215  DC  J O2    1 
ATOM   4391  N N3    . DC  B 1 69  ? 59.549  81.683  -86.584 1.00 64.47  ? 215  DC  J N3    1 
ATOM   4392  C C4    . DC  B 1 69  ? 59.263  82.167  -87.794 1.00 65.60  ? 215  DC  J C4    1 
ATOM   4393  N N4    . DC  B 1 69  ? 59.113  81.295  -88.799 1.00 66.31  ? 215  DC  J N4    1 
ATOM   4394  C C5    . DC  B 1 69  ? 59.119  83.565  -88.032 1.00 65.20  ? 215  DC  J C5    1 
ATOM   4395  C C6    . DC  B 1 69  ? 59.295  84.391  -86.993 1.00 64.13  ? 215  DC  J C6    1 
ATOM   4396  P P     . DG  B 1 70  ? 61.295  87.862  -81.601 1.00 58.04  ? 216  DG  J P     1 
ATOM   4397  O OP1   . DG  B 1 70  ? 60.021  88.409  -81.073 1.00 56.47  ? 216  DG  J OP1   1 
ATOM   4398  O OP2   . DG  B 1 70  ? 62.309  88.776  -82.196 1.00 56.28  ? 216  DG  J OP2   1 
ATOM   4399  O "O5'" . DG  B 1 70  ? 62.000  87.057  -80.425 1.00 54.36  ? 216  DG  J "O5'" 1 
ATOM   4400  C "C5'" . DG  B 1 70  ? 61.256  86.134  -79.639 1.00 49.92  ? 216  DG  J "C5'" 1 
ATOM   4401  C "C4'" . DG  B 1 70  ? 62.052  84.868  -79.442 1.00 51.12  ? 216  DG  J "C4'" 1 
ATOM   4402  O "O4'" . DG  B 1 70  ? 61.990  84.024  -80.616 1.00 52.26  ? 216  DG  J "O4'" 1 
ATOM   4403  C "C3'" . DG  B 1 70  ? 63.536  85.089  -79.146 1.00 48.62  ? 216  DG  J "C3'" 1 
ATOM   4404  O "O3'" . DG  B 1 70  ? 63.910  84.216  -78.090 1.00 45.92  ? 216  DG  J "O3'" 1 
ATOM   4405  C "C2'" . DG  B 1 70  ? 64.230  84.708  -80.442 1.00 49.06  ? 216  DG  J "C2'" 1 
ATOM   4406  C "C1'" . DG  B 1 70  ? 63.297  83.661  -81.036 1.00 51.46  ? 216  DG  J "C1'" 1 
ATOM   4407  N N9    . DG  B 1 70  ? 63.293  83.643  -82.495 1.00 53.96  ? 216  DG  J N9    1 
ATOM   4408  C C8    . DG  B 1 70  ? 63.253  84.737  -83.328 1.00 54.37  ? 216  DG  J C8    1 
ATOM   4409  N N7    . DG  B 1 70  ? 63.239  84.417  -84.594 1.00 56.48  ? 216  DG  J N7    1 
ATOM   4410  C C5    . DG  B 1 70  ? 63.277  83.029  -84.600 1.00 56.21  ? 216  DG  J C5    1 
ATOM   4411  C C6    . DG  B 1 70  ? 63.276  82.116  -85.689 1.00 57.20  ? 216  DG  J C6    1 
ATOM   4412  O O6    . DG  B 1 70  ? 63.232  82.364  -86.903 1.00 60.34  ? 216  DG  J O6    1 
ATOM   4413  N N1    . DG  B 1 70  ? 63.331  80.795  -85.251 1.00 55.73  ? 216  DG  J N1    1 
ATOM   4414  C C2    . DG  B 1 70  ? 63.377  80.402  -83.934 1.00 55.71  ? 216  DG  J C2    1 
ATOM   4415  N N2    . DG  B 1 70  ? 63.439  79.075  -83.717 1.00 52.48  ? 216  DG  J N2    1 
ATOM   4416  N N3    . DG  B 1 70  ? 63.368  81.245  -82.907 1.00 53.94  ? 216  DG  J N3    1 
ATOM   4417  C C4    . DG  B 1 70  ? 63.319  82.533  -83.312 1.00 54.79  ? 216  DG  J C4    1 
ATOM   4418  P P     . DG  B 1 71  ? 65.343  84.366  -77.380 1.00 41.91  ? 217  DG  J P     1 
ATOM   4419  O OP1   . DG  B 1 71  ? 65.051  84.340  -75.914 1.00 43.95  ? 217  DG  J OP1   1 
ATOM   4420  O OP2   . DG  B 1 71  ? 66.138  85.470  -77.944 1.00 45.54  ? 217  DG  J OP2   1 
ATOM   4421  O "O5'" . DG  B 1 71  ? 66.010  82.978  -77.755 1.00 43.03  ? 217  DG  J "O5'" 1 
ATOM   4422  C "C5'" . DG  B 1 71  ? 65.277  81.789  -77.510 1.00 45.02  ? 217  DG  J "C5'" 1 
ATOM   4423  C "C4'" . DG  B 1 71  ? 65.947  80.611  -78.165 1.00 51.99  ? 217  DG  J "C4'" 1 
ATOM   4424  O "O4'" . DG  B 1 71  ? 65.841  80.685  -79.606 1.00 51.49  ? 217  DG  J "O4'" 1 
ATOM   4425  C "C3'" . DG  B 1 71  ? 67.427  80.460  -77.845 1.00 54.01  ? 217  DG  J "C3'" 1 
ATOM   4426  O "O3'" . DG  B 1 71  ? 67.661  79.067  -77.652 1.00 59.58  ? 217  DG  J "O3'" 1 
ATOM   4427  C "C2'" . DG  B 1 71  ? 68.115  81.010  -79.088 1.00 52.98  ? 217  DG  J "C2'" 1 
ATOM   4428  C "C1'" . DG  B 1 71  ? 67.127  80.668  -80.201 1.00 51.88  ? 217  DG  J "C1'" 1 
ATOM   4429  N N9    . DG  B 1 71  ? 67.093  81.592  -81.335 1.00 52.71  ? 217  DG  J N9    1 
ATOM   4430  C C8    . DG  B 1 71  ? 67.193  82.958  -81.301 1.00 50.93  ? 217  DG  J C8    1 
ATOM   4431  N N7    . DG  B 1 71  ? 67.093  83.509  -82.483 1.00 51.33  ? 217  DG  J N7    1 
ATOM   4432  C C5    . DG  B 1 71  ? 66.919  82.439  -83.349 1.00 50.52  ? 217  DG  J C5    1 
ATOM   4433  C C6    . DG  B 1 71  ? 66.746  82.414  -84.767 1.00 51.93  ? 217  DG  J C6    1 
ATOM   4434  O O6    . DG  B 1 71  ? 66.693  83.372  -85.556 1.00 50.20  ? 217  DG  J O6    1 
ATOM   4435  N N1    . DG  B 1 71  ? 66.624  81.113  -85.245 1.00 48.88  ? 217  DG  J N1    1 
ATOM   4436  C C2    . DG  B 1 71  ? 66.656  79.982  -84.464 1.00 52.42  ? 217  DG  J C2    1 
ATOM   4437  N N2    . DG  B 1 71  ? 66.537  78.810  -85.108 1.00 51.92  ? 217  DG  J N2    1 
ATOM   4438  N N3    . DG  B 1 71  ? 66.800  79.994  -83.142 1.00 53.18  ? 217  DG  J N3    1 
ATOM   4439  C C4    . DG  B 1 71  ? 66.928  81.248  -82.660 1.00 51.74  ? 217  DG  J C4    1 
ATOM   4440  P P     . DA  B 1 72  ? 69.025  78.566  -76.990 1.00 67.98  ? 218  DA  J P     1 
ATOM   4441  O OP1   . DA  B 1 72  ? 68.691  77.396  -76.134 1.00 60.86  ? 218  DA  J OP1   1 
ATOM   4442  O OP2   . DA  B 1 72  ? 69.723  79.737  -76.406 1.00 62.18  ? 218  DA  J OP2   1 
ATOM   4443  O "O5'" . DA  B 1 72  ? 69.849  78.052  -78.248 1.00 69.85  ? 218  DA  J "O5'" 1 
ATOM   4444  C "C5'" . DA  B 1 72  ? 69.281  77.077  -79.116 1.00 71.72  ? 218  DA  J "C5'" 1 
ATOM   4445  C "C4'" . DA  B 1 72  ? 70.065  76.996  -80.402 1.00 73.90  ? 218  DA  J "C4'" 1 
ATOM   4446  O "O4'" . DA  B 1 72  ? 69.761  78.101  -81.290 1.00 73.07  ? 218  DA  J "O4'" 1 
ATOM   4447  C "C3'" . DA  B 1 72  ? 71.584  76.993  -80.227 1.00 75.05  ? 218  DA  J "C3'" 1 
ATOM   4448  O "O3'" . DA  B 1 72  ? 72.128  76.030  -81.120 1.00 79.13  ? 218  DA  J "O3'" 1 
ATOM   4449  C "C2'" . DA  B 1 72  ? 71.985  78.384  -80.687 1.00 73.61  ? 218  DA  J "C2'" 1 
ATOM   4450  C "C1'" . DA  B 1 72  ? 70.980  78.602  -81.798 1.00 72.25  ? 218  DA  J "C1'" 1 
ATOM   4451  N N9    . DA  B 1 72  ? 70.775  79.980  -82.246 1.00 65.03  ? 218  DA  J N9    1 
ATOM   4452  C C8    . DA  B 1 72  ? 70.891  81.153  -81.545 1.00 64.71  ? 218  DA  J C8    1 
ATOM   4453  N N7    . DA  B 1 72  ? 70.667  82.227  -82.268 1.00 63.51  ? 218  DA  J N7    1 
ATOM   4454  C C5    . DA  B 1 72  ? 70.376  81.723  -83.530 1.00 63.64  ? 218  DA  J C5    1 
ATOM   4455  C C6    . DA  B 1 72  ? 70.045  82.348  -84.751 1.00 62.60  ? 218  DA  J C6    1 
ATOM   4456  N N6    . DA  B 1 72  ? 69.942  83.671  -84.908 1.00 60.45  ? 218  DA  J N6    1 
ATOM   4457  N N1    . DA  B 1 72  ? 69.818  81.555  -85.818 1.00 63.60  ? 218  DA  J N1    1 
ATOM   4458  C C2    . DA  B 1 72  ? 69.913  80.227  -85.665 1.00 65.05  ? 218  DA  J C2    1 
ATOM   4459  N N3    . DA  B 1 72  ? 70.208  79.524  -84.574 1.00 64.93  ? 218  DA  J N3    1 
ATOM   4460  C C4    . DA  B 1 72  ? 70.433  80.342  -83.529 1.00 64.56  ? 218  DA  J C4    1 
ATOM   4461  P P     . DA  B 1 73  ? 73.486  75.266  -80.750 1.00 79.59  ? 219  DA  J P     1 
ATOM   4462  O OP1   . DA  B 1 73  ? 73.141  74.034  -79.992 1.00 71.94  ? 219  DA  J OP1   1 
ATOM   4463  O OP2   . DA  B 1 73  ? 74.438  76.256  -80.179 1.00 72.78  ? 219  DA  J OP2   1 
ATOM   4464  O "O5'" . DA  B 1 73  ? 74.023  74.824  -82.176 1.00 78.22  ? 219  DA  J "O5'" 1 
ATOM   4465  C "C5'" . DA  B 1 73  ? 73.141  74.214  -83.106 1.00 77.44  ? 219  DA  J "C5'" 1 
ATOM   4466  C "C4'" . DA  B 1 73  ? 73.521  74.604  -84.512 1.00 77.02  ? 219  DA  J "C4'" 1 
ATOM   4467  O "O4'" . DA  B 1 73  ? 73.071  75.948  -84.810 1.00 74.82  ? 219  DA  J "O4'" 1 
ATOM   4468  C "C3'" . DA  B 1 73  ? 75.026  74.586  -84.761 1.00 78.06  ? 219  DA  J "C3'" 1 
ATOM   4469  O "O3'" . DA  B 1 73  ? 75.314  73.897  -85.976 1.00 82.02  ? 219  DA  J "O3'" 1 
ATOM   4470  C "C2'" . DA  B 1 73  ? 75.401  76.057  -84.844 1.00 74.41  ? 219  DA  J "C2'" 1 
ATOM   4471  C "C1'" . DA  B 1 73  ? 74.132  76.696  -85.376 1.00 72.79  ? 219  DA  J "C1'" 1 
ATOM   4472  N N9    . DA  B 1 73  ? 73.954  78.096  -84.984 1.00 64.21  ? 219  DA  J N9    1 
ATOM   4473  C C8    . DA  B 1 73  ? 74.054  78.632  -83.721 1.00 63.54  ? 219  DA  J C8    1 
ATOM   4474  N N7    . DA  B 1 73  ? 73.873  79.931  -83.680 1.00 61.22  ? 219  DA  J N7    1 
ATOM   4475  C C5    . DA  B 1 73  ? 73.630  80.276  -85.000 1.00 60.40  ? 219  DA  J C5    1 
ATOM   4476  C C6    . DA  B 1 73  ? 73.373  81.515  -85.624 1.00 59.84  ? 219  DA  J C6    1 
ATOM   4477  N N6    . DA  B 1 73  ? 73.325  82.680  -84.972 1.00 55.62  ? 219  DA  J N6    1 
ATOM   4478  N N1    . DA  B 1 73  ? 73.170  81.514  -86.963 1.00 60.07  ? 219  DA  J N1    1 
ATOM   4479  C C2    . DA  B 1 73  ? 73.227  80.346  -87.618 1.00 61.19  ? 219  DA  J C2    1 
ATOM   4480  N N3    . DA  B 1 73  ? 73.467  79.119  -87.144 1.00 62.51  ? 219  DA  J N3    1 
ATOM   4481  C C4    . DA  B 1 73  ? 73.665  79.154  -85.815 1.00 62.47  ? 219  DA  J C4    1 
ATOM   4482  P P     . DT  B 1 74  ? 76.836  73.724  -86.442 1.00 79.69  ? 220  DT  J P     1 
ATOM   4483  O OP1   . DT  B 1 74  ? 76.930  72.500  -87.276 1.00 86.24  ? 220  DT  J OP1   1 
ATOM   4484  O OP2   . DT  B 1 74  ? 77.707  73.871  -85.248 1.00 84.18  ? 220  DT  J OP2   1 
ATOM   4485  O "O5'" . DT  B 1 74  ? 77.043  74.981  -87.384 1.00 79.09  ? 220  DT  J "O5'" 1 
ATOM   4486  C "C5'" . DT  B 1 74  ? 76.168  75.187  -88.481 1.00 79.90  ? 220  DT  J "C5'" 1 
ATOM   4487  C "C4'" . DT  B 1 74  ? 76.713  76.271  -89.372 1.00 81.00  ? 220  DT  J "C4'" 1 
ATOM   4488  O "O4'" . DT  B 1 74  ? 76.304  77.575  -88.892 1.00 80.20  ? 220  DT  J "O4'" 1 
ATOM   4489  C "C3'" . DT  B 1 74  ? 78.241  76.291  -89.443 1.00 82.05  ? 220  DT  J "C3'" 1 
ATOM   4490  O "O3'" . DT  B 1 74  ? 78.652  76.462  -90.800 1.00 85.13  ? 220  DT  J "O3'" 1 
ATOM   4491  C "C2'" . DT  B 1 74  ? 78.615  77.507  -88.611 1.00 81.12  ? 220  DT  J "C2'" 1 
ATOM   4492  C "C1'" . DT  B 1 74  ? 77.433  78.426  -88.862 1.00 80.32  ? 220  DT  J "C1'" 1 
ATOM   4493  N N1    . DT  B 1 74  ? 77.200  79.469  -87.843 1.00 83.87  ? 220  DT  J N1    1 
ATOM   4494  C C2    . DT  B 1 74  ? 76.906  80.740  -88.287 1.00 83.46  ? 220  DT  J C2    1 
ATOM   4495  O O2    . DT  B 1 74  ? 76.823  81.027  -89.468 1.00 83.94  ? 220  DT  J O2    1 
ATOM   4496  N N3    . DT  B 1 74  ? 76.711  81.666  -87.292 1.00 83.09  ? 220  DT  J N3    1 
ATOM   4497  C C4    . DT  B 1 74  ? 76.782  81.453  -85.929 1.00 83.24  ? 220  DT  J C4    1 
ATOM   4498  O O4    . DT  B 1 74  ? 76.583  82.383  -85.153 1.00 83.18  ? 220  DT  J O4    1 
ATOM   4499  C C5    . DT  B 1 74  ? 77.096  80.098  -85.533 1.00 83.73  ? 220  DT  J C5    1 
ATOM   4500  C C7    . DT  B 1 74  ? 77.204  79.776  -84.076 1.00 83.74  ? 220  DT  J C7    1 
ATOM   4501  C C6    . DT  B 1 74  ? 77.282  79.185  -86.497 1.00 83.56  ? 220  DT  J C6    1 
ATOM   4502  P P     . DT  B 1 75  ? 80.193  76.254  -91.207 1.00 89.16  ? 221  DT  J P     1 
ATOM   4503  O OP1   . DT  B 1 75  ? 80.230  75.235  -92.288 1.00 82.34  ? 221  DT  J OP1   1 
ATOM   4504  O OP2   . DT  B 1 75  ? 81.020  76.063  -89.985 1.00 82.25  ? 221  DT  J OP2   1 
ATOM   4505  O "O5'" . DT  B 1 75  ? 80.557  77.661  -91.839 1.00 87.40  ? 221  DT  J "O5'" 1 
ATOM   4506  C "C5'" . DT  B 1 75  ? 79.628  78.300  -92.700 1.00 86.92  ? 221  DT  J "C5'" 1 
ATOM   4507  C "C4'" . DT  B 1 75  ? 79.967  79.762  -92.836 1.00 87.30  ? 221  DT  J "C4'" 1 
ATOM   4508  O "O4'" . DT  B 1 75  ? 79.579  80.490  -91.646 1.00 85.41  ? 221  DT  J "O4'" 1 
ATOM   4509  C "C3'" . DT  B 1 75  ? 81.456  80.029  -93.038 1.00 88.23  ? 221  DT  J "C3'" 1 
ATOM   4510  O "O3'" . DT  B 1 75  ? 81.630  80.981  -94.085 1.00 90.84  ? 221  DT  J "O3'" 1 
ATOM   4511  C "C2'" . DT  B 1 75  ? 81.906  80.588  -91.697 1.00 86.50  ? 221  DT  J "C2'" 1 
ATOM   4512  C "C1'" . DT  B 1 75  ? 80.658  81.304  -91.222 1.00 84.13  ? 221  DT  J "C1'" 1 
ATOM   4513  N N1    . DT  B 1 75  ? 80.536  81.499  -89.762 1.00 74.71  ? 221  DT  J N1    1 
ATOM   4514  C C2    . DT  B 1 75  ? 80.186  82.754  -89.314 1.00 73.29  ? 221  DT  J C2    1 
ATOM   4515  O O2    . DT  B 1 75  ? 80.010  83.702  -90.059 1.00 73.40  ? 221  DT  J O2    1 
ATOM   4516  N N3    . DT  B 1 75  ? 80.049  82.861  -87.953 1.00 73.21  ? 221  DT  J N3    1 
ATOM   4517  C C4    . DT  B 1 75  ? 80.227  81.864  -87.015 1.00 73.54  ? 221  DT  J C4    1 
ATOM   4518  O O4    . DT  B 1 75  ? 80.042  82.104  -85.824 1.00 73.05  ? 221  DT  J O4    1 
ATOM   4519  C C5    . DT  B 1 75  ? 80.619  80.580  -87.550 1.00 73.40  ? 221  DT  J C5    1 
ATOM   4520  C C7    . DT  B 1 75  ? 80.859  79.449  -86.602 1.00 73.95  ? 221  DT  J C7    1 
ATOM   4521  C C6    . DT  B 1 75  ? 80.751  80.461  -88.879 1.00 73.74  ? 221  DT  J C6    1 
ATOM   4522  P P     . DC  B 1 76  ? 83.103  81.468  -94.471 1.00 116.32 ? 222  DC  J P     1 
ATOM   4523  O OP1   . DC  B 1 76  ? 83.136  81.802  -95.921 1.00 80.56  ? 222  DC  J OP1   1 
ATOM   4524  O OP2   . DC  B 1 76  ? 84.054  80.471  -93.920 1.00 78.47  ? 222  DC  J OP2   1 
ATOM   4525  O "O5'" . DC  B 1 76  ? 83.250  82.809  -93.635 1.00 116.64 ? 222  DC  J "O5'" 1 
ATOM   4526  C "C5'" . DC  B 1 76  ? 82.318  83.873  -93.805 1.00 118.46 ? 222  DC  J "C5'" 1 
ATOM   4527  C "C4'" . DC  B 1 76  ? 82.852  85.121  -93.150 1.00 118.68 ? 222  DC  J "C4'" 1 
ATOM   4528  O "O4'" . DC  B 1 76  ? 82.576  85.110  -91.729 1.00 118.40 ? 222  DC  J "O4'" 1 
ATOM   4529  C "C3'" . DC  B 1 76  ? 84.367  85.230  -93.289 1.00 119.53 ? 222  DC  J "C3'" 1 
ATOM   4530  O "O3'" . DC  B 1 76  ? 84.740  86.578  -93.521 1.00 121.08 ? 222  DC  J "O3'" 1 
ATOM   4531  C "C2'" . DC  B 1 76  ? 84.881  84.776  -91.936 1.00 118.65 ? 222  DC  J "C2'" 1 
ATOM   4532  C "C1'" . DC  B 1 76  ? 83.789  85.277  -91.011 1.00 117.53 ? 222  DC  J "C1'" 1 
ATOM   4533  N N1    . DC  B 1 76  ? 83.668  84.556  -89.734 1.00 79.50  ? 222  DC  J N1    1 
ATOM   4534  C C2    . DC  B 1 76  ? 83.192  85.251  -88.622 1.00 78.21  ? 222  DC  J C2    1 
ATOM   4535  O O2    . DC  B 1 76  ? 82.883  86.445  -88.756 1.00 78.22  ? 222  DC  J O2    1 
ATOM   4536  N N3    . DC  B 1 76  ? 83.078  84.608  -87.434 1.00 76.46  ? 222  DC  J N3    1 
ATOM   4537  C C4    . DC  B 1 76  ? 83.415  83.320  -87.339 1.00 76.01  ? 222  DC  J C4    1 
ATOM   4538  N N4    . DC  B 1 76  ? 83.278  82.721  -86.154 1.00 72.67  ? 222  DC  J N4    1 
ATOM   4539  C C5    . DC  B 1 76  ? 83.905  82.585  -88.460 1.00 76.82  ? 222  DC  J C5    1 
ATOM   4540  C C6    . DC  B 1 76  ? 84.014  83.236  -89.627 1.00 78.35  ? 222  DC  J C6    1 
ATOM   4541  P P     . DC  B 1 77  ? 86.102  86.894  -94.299 1.00 120.25 ? 223  DC  J P     1 
ATOM   4542  O OP1   . DC  B 1 77  ? 85.773  87.107  -95.732 1.00 82.08  ? 223  DC  J OP1   1 
ATOM   4543  O OP2   . DC  B 1 77  ? 87.090  85.849  -93.911 1.00 82.04  ? 223  DC  J OP2   1 
ATOM   4544  O "O5'" . DC  B 1 77  ? 86.546  88.282  -93.667 1.00 118.86 ? 223  DC  J "O5'" 1 
ATOM   4545  C "C5'" . DC  B 1 77  ? 85.568  89.261  -93.338 1.00 118.42 ? 223  DC  J "C5'" 1 
ATOM   4546  C "C4'" . DC  B 1 77  ? 85.901  89.900  -92.013 1.00 117.40 ? 223  DC  J "C4'" 1 
ATOM   4547  O "O4'" . DC  B 1 77  ? 85.597  89.011  -90.908 1.00 116.53 ? 223  DC  J "O4'" 1 
ATOM   4548  C "C3'" . DC  B 1 77  ? 87.377  90.266  -91.869 1.00 117.99 ? 223  DC  J "C3'" 1 
ATOM   4549  O "O3'" . DC  B 1 77  ? 87.480  91.535  -91.235 1.00 119.70 ? 223  DC  J "O3'" 1 
ATOM   4550  C "C2'" . DC  B 1 77  ? 87.914  89.192  -90.940 1.00 116.56 ? 223  DC  J "C2'" 1 
ATOM   4551  C "C1'" . DC  B 1 77  ? 86.717  88.968  -90.042 1.00 114.71 ? 223  DC  J "C1'" 1 
ATOM   4552  N N1    . DC  B 1 77  ? 86.696  87.693  -89.305 1.00 74.87  ? 223  DC  J N1    1 
ATOM   4553  C C2    . DC  B 1 77  ? 86.313  87.711  -87.955 1.00 73.35  ? 223  DC  J C2    1 
ATOM   4554  O O2    . DC  B 1 77  ? 85.973  88.791  -87.444 1.00 72.84  ? 223  DC  J O2    1 
ATOM   4555  N N3    . DC  B 1 77  ? 86.318  86.556  -87.247 1.00 71.14  ? 223  DC  J N3    1 
ATOM   4556  C C4    . DC  B 1 77  ? 86.676  85.415  -87.836 1.00 71.59  ? 223  DC  J C4    1 
ATOM   4557  N N4    . DC  B 1 77  ? 86.677  84.304  -87.094 1.00 68.89  ? 223  DC  J N4    1 
ATOM   4558  C C5    . DC  B 1 77  ? 87.053  85.363  -89.216 1.00 72.41  ? 223  DC  J C5    1 
ATOM   4559  C C6    . DC  B 1 77  ? 87.050  86.516  -89.904 1.00 73.96  ? 223  DC  J C6    1 
ATOM   4560  P P     . DG  B 1 78  ? 88.173  92.754  -92.010 1.00 110.75 ? 224  DG  J P     1 
ATOM   4561  O OP1   . DG  B 1 78  ? 87.331  93.105  -93.183 1.00 93.47  ? 224  DG  J OP1   1 
ATOM   4562  O OP2   . DG  B 1 78  ? 89.604  92.401  -92.203 1.00 94.06  ? 224  DG  J OP2   1 
ATOM   4563  O "O5'" . DG  B 1 78  ? 88.072  93.941  -90.958 1.00 109.31 ? 224  DG  J "O5'" 1 
ATOM   4564  C "C5'" . DG  B 1 78  ? 86.817  94.277  -90.378 1.00 108.59 ? 224  DG  J "C5'" 1 
ATOM   4565  C "C4'" . DG  B 1 78  ? 86.954  94.412  -88.880 1.00 107.42 ? 224  DG  J "C4'" 1 
ATOM   4566  O "O4'" . DG  B 1 78  ? 87.114  93.115  -88.256 1.00 106.77 ? 224  DG  J "O4'" 1 
ATOM   4567  C "C3'" . DG  B 1 78  ? 88.148  95.247  -88.433 1.00 106.62 ? 224  DG  J "C3'" 1 
ATOM   4568  O "O3'" . DG  B 1 78  ? 87.755  96.089  -87.355 1.00 106.03 ? 224  DG  J "O3'" 1 
ATOM   4569  C "C2'" . DG  B 1 78  ? 89.165  94.211  -87.983 1.00 105.61 ? 224  DG  J "C2'" 1 
ATOM   4570  C "C1'" . DG  B 1 78  ? 88.285  93.093  -87.455 1.00 105.77 ? 224  DG  J "C1'" 1 
ATOM   4571  N N9    . DG  B 1 78  ? 88.863  91.757  -87.566 1.00 89.50  ? 224  DG  J N9    1 
ATOM   4572  C C8    . DG  B 1 78  ? 89.529  91.235  -88.649 1.00 89.25  ? 224  DG  J C8    1 
ATOM   4573  N N7    . DG  B 1 78  ? 89.894  89.994  -88.478 1.00 89.01  ? 224  DG  J N7    1 
ATOM   4574  C C5    . DG  B 1 78  ? 89.452  89.676  -87.201 1.00 89.02  ? 224  DG  J C5    1 
ATOM   4575  C C6    . DG  B 1 78  ? 89.551  88.461  -86.469 1.00 88.78  ? 224  DG  J C6    1 
ATOM   4576  O O6    . DG  B 1 78  ? 90.047  87.387  -86.822 1.00 88.55  ? 224  DG  J O6    1 
ATOM   4577  N N1    . DG  B 1 78  ? 88.985  88.578  -85.205 1.00 88.22  ? 224  DG  J N1    1 
ATOM   4578  C C2    . DG  B 1 78  ? 88.393  89.710  -84.708 1.00 88.50  ? 224  DG  J C2    1 
ATOM   4579  N N2    . DG  B 1 78  ? 87.919  89.620  -83.457 1.00 87.92  ? 224  DG  J N2    1 
ATOM   4580  N N3    . DG  B 1 78  ? 88.277  90.847  -85.384 1.00 88.74  ? 224  DG  J N3    1 
ATOM   4581  C C4    . DG  B 1 78  ? 88.827  90.758  -86.616 1.00 89.22  ? 224  DG  J C4    1 
ATOM   4582  P P     . DC  B 1 79  ? 88.780  97.177  -86.792 1.00 100.90 ? 225  DC  J P     1 
ATOM   4583  O OP1   . DC  B 1 79  ? 88.039  98.436  -86.523 1.00 98.05  ? 225  DC  J OP1   1 
ATOM   4584  O OP2   . DC  B 1 79  ? 89.949  97.193  -87.705 1.00 98.58  ? 225  DC  J OP2   1 
ATOM   4585  O "O5'" . DC  B 1 79  ? 89.246  96.540  -85.411 1.00 100.89 ? 225  DC  J "O5'" 1 
ATOM   4586  C "C5'" . DC  B 1 79  ? 88.288  96.060  -84.472 1.00 99.15  ? 225  DC  J "C5'" 1 
ATOM   4587  C "C4'" . DC  B 1 79  ? 88.990  95.362  -83.334 1.00 98.37  ? 225  DC  J "C4'" 1 
ATOM   4588  O "O4'" . DC  B 1 79  ? 89.476  94.064  -83.752 1.00 98.79  ? 225  DC  J "O4'" 1 
ATOM   4589  C "C3'" . DC  B 1 79  ? 90.212  96.117  -82.811 1.00 97.74  ? 225  DC  J "C3'" 1 
ATOM   4590  O "O3'" . DC  B 1 79  ? 90.300  95.937  -81.405 1.00 95.54  ? 225  DC  J "O3'" 1 
ATOM   4591  C "C2'" . DC  B 1 79  ? 91.370  95.381  -83.456 1.00 98.58  ? 225  DC  J "C2'" 1 
ATOM   4592  C "C1'" . DC  B 1 79  ? 90.849  93.961  -83.417 1.00 98.93  ? 225  DC  J "C1'" 1 
ATOM   4593  N N1    . DC  B 1 79  ? 91.485  93.025  -84.353 1.00 96.50  ? 225  DC  J N1    1 
ATOM   4594  C C2    . DC  B 1 79  ? 91.554  91.674  -83.998 1.00 96.73  ? 225  DC  J C2    1 
ATOM   4595  O O2    . DC  B 1 79  ? 91.084  91.317  -82.904 1.00 95.45  ? 225  DC  J O2    1 
ATOM   4596  N N3    . DC  B 1 79  ? 92.130  90.795  -84.849 1.00 97.06  ? 225  DC  J N3    1 
ATOM   4597  C C4    . DC  B 1 79  ? 92.625  91.222  -86.013 1.00 97.25  ? 225  DC  J C4    1 
ATOM   4598  N N4    . DC  B 1 79  ? 93.175  90.317  -86.827 1.00 97.58  ? 225  DC  J N4    1 
ATOM   4599  C C5    . DC  B 1 79  ? 92.575  92.595  -86.397 1.00 97.07  ? 225  DC  J C5    1 
ATOM   4600  C C6    . DC  B 1 79  ? 92.001  93.454  -85.545 1.00 96.51  ? 225  DC  J C6    1 
ATOM   4601  P P     . DT  B 1 80  ? 90.110  97.189  -80.424 1.00 94.56  ? 226  DT  J P     1 
ATOM   4602  O OP1   . DT  B 1 80  ? 88.954  98.000  -80.890 1.00 87.45  ? 226  DT  J OP1   1 
ATOM   4603  O OP2   . DT  B 1 80  ? 91.443  97.827  -80.253 1.00 86.44  ? 226  DT  J OP2   1 
ATOM   4604  O "O5'" . DT  B 1 80  ? 89.696  96.481  -79.063 1.00 90.54  ? 226  DT  J "O5'" 1 
ATOM   4605  C "C5'" . DT  B 1 80  ? 88.780  95.391  -79.074 1.00 84.17  ? 226  DT  J "C5'" 1 
ATOM   4606  C "C4'" . DT  B 1 80  ? 89.415  94.165  -78.458 1.00 81.00  ? 226  DT  J "C4'" 1 
ATOM   4607  O "O4'" . DT  B 1 80  ? 90.293  93.466  -79.375 1.00 79.71  ? 226  DT  J "O4'" 1 
ATOM   4608  C "C3'" . DT  B 1 80  ? 90.243  94.427  -77.203 1.00 78.93  ? 226  DT  J "C3'" 1 
ATOM   4609  O "O3'" . DT  B 1 80  ? 89.989  93.372  -76.292 1.00 77.05  ? 226  DT  J "O3'" 1 
ATOM   4610  C "C2'" . DT  B 1 80  ? 91.674  94.299  -77.697 1.00 78.58  ? 226  DT  J "C2'" 1 
ATOM   4611  C "C1'" . DT  B 1 80  ? 91.521  93.191  -78.717 1.00 78.41  ? 226  DT  J "C1'" 1 
ATOM   4612  N N1    . DT  B 1 80  ? 92.576  93.101  -79.743 1.00 71.12  ? 226  DT  J N1    1 
ATOM   4613  C C2    . DT  B 1 80  ? 93.065  91.852  -80.058 1.00 70.15  ? 226  DT  J C2    1 
ATOM   4614  O O2    . DT  B 1 80  ? 92.720  90.836  -79.481 1.00 68.51  ? 226  DT  J O2    1 
ATOM   4615  N N3    . DT  B 1 80  ? 93.981  91.837  -81.078 1.00 70.89  ? 226  DT  J N3    1 
ATOM   4616  C C4    . DT  B 1 80  ? 94.456  92.920  -81.790 1.00 72.43  ? 226  DT  J C4    1 
ATOM   4617  O O4    . DT  B 1 80  ? 95.255  92.747  -82.708 1.00 73.78  ? 226  DT  J O4    1 
ATOM   4618  C C5    . DT  B 1 80  ? 93.935  94.205  -81.374 1.00 72.73  ? 226  DT  J C5    1 
ATOM   4619  C C7    . DT  B 1 80  ? 94.419  95.444  -82.060 1.00 73.27  ? 226  DT  J C7    1 
ATOM   4620  C C6    . DT  B 1 80  ? 93.034  94.229  -80.384 1.00 72.09  ? 226  DT  J C6    1 
ATOM   4621  P P     . DG  B 1 81  ? 89.672  93.699  -74.760 1.00 68.63  ? 227  DG  J P     1 
ATOM   4622  O OP1   . DG  B 1 81  ? 88.205  93.782  -74.548 1.00 66.64  ? 227  DG  J OP1   1 
ATOM   4623  O OP2   . DG  B 1 81  ? 90.555  94.807  -74.319 1.00 64.29  ? 227  DG  J OP2   1 
ATOM   4624  O "O5'" . DG  B 1 81  ? 90.194  92.395  -74.051 1.00 66.50  ? 227  DG  J "O5'" 1 
ATOM   4625  C "C5'" . DG  B 1 81  ? 91.520  92.345  -73.622 1.00 61.99  ? 227  DG  J "C5'" 1 
ATOM   4626  C "C4'" . DG  B 1 81  ? 92.116  91.004  -73.950 1.00 60.13  ? 227  DG  J "C4'" 1 
ATOM   4627  O "O4'" . DG  B 1 81  ? 92.693  91.009  -75.280 1.00 60.20  ? 227  DG  J "O4'" 1 
ATOM   4628  C "C3'" . DG  B 1 81  ? 93.272  90.763  -73.004 1.00 57.17  ? 227  DG  J "C3'" 1 
ATOM   4629  O "O3'" . DG  B 1 81  ? 93.347  89.401  -72.693 1.00 52.35  ? 227  DG  J "O3'" 1 
ATOM   4630  C "C2'" . DG  B 1 81  ? 94.486  91.219  -73.777 1.00 58.51  ? 227  DG  J "C2'" 1 
ATOM   4631  C "C1'" . DG  B 1 81  ? 94.109  90.876  -75.199 1.00 58.94  ? 227  DG  J "C1'" 1 
ATOM   4632  N N9    . DG  B 1 81  ? 94.706  91.806  -76.146 1.00 56.91  ? 227  DG  J N9    1 
ATOM   4633  C C8    . DG  B 1 81  ? 94.597  93.175  -76.147 1.00 57.02  ? 227  DG  J C8    1 
ATOM   4634  N N7    . DG  B 1 81  ? 95.246  93.739  -77.128 1.00 57.98  ? 227  DG  J N7    1 
ATOM   4635  C C5    . DG  B 1 81  ? 95.814  92.676  -77.815 1.00 58.77  ? 227  DG  J C5    1 
ATOM   4636  C C6    . DG  B 1 81  ? 96.618  92.664  -78.977 1.00 59.96  ? 227  DG  J C6    1 
ATOM   4637  O O6    . DG  B 1 81  ? 96.986  93.623  -79.667 1.00 62.44  ? 227  DG  J O6    1 
ATOM   4638  N N1    . DG  B 1 81  ? 96.992  91.369  -79.325 1.00 60.08  ? 227  DG  J N1    1 
ATOM   4639  C C2    . DG  B 1 81  ? 96.628  90.231  -78.642 1.00 59.72  ? 227  DG  J C2    1 
ATOM   4640  N N2    . DG  B 1 81  ? 97.102  89.071  -79.121 1.00 60.33  ? 227  DG  J N2    1 
ATOM   4641  N N3    . DG  B 1 81  ? 95.862  90.231  -77.568 1.00 57.00  ? 227  DG  J N3    1 
ATOM   4642  C C4    . DG  B 1 81  ? 95.497  91.478  -77.212 1.00 57.50  ? 227  DG  J C4    1 
ATOM   4643  P P     . DA  B 1 82  ? 94.277  88.955  -71.495 1.00 45.38  ? 228  DA  J P     1 
ATOM   4644  O OP1   . DA  B 1 82  ? 93.423  88.198  -70.532 1.00 49.03  ? 228  DA  J OP1   1 
ATOM   4645  O OP2   . DA  B 1 82  ? 94.997  90.170  -71.052 1.00 43.94  ? 228  DA  J OP2   1 
ATOM   4646  O "O5'" . DA  B 1 82  ? 95.322  87.993  -72.202 1.00 44.12  ? 228  DA  J "O5'" 1 
ATOM   4647  C "C5'" . DA  B 1 82  ? 94.888  86.921  -73.026 1.00 44.95  ? 228  DA  J "C5'" 1 
ATOM   4648  C "C4'" . DA  B 1 82  ? 96.089  86.156  -73.532 1.00 46.01  ? 228  DA  J "C4'" 1 
ATOM   4649  O "O4'" . DA  B 1 82  ? 96.738  86.914  -74.578 1.00 46.62  ? 228  DA  J "O4'" 1 
ATOM   4650  C "C3'" . DA  B 1 82  ? 97.156  85.914  -72.467 1.00 45.69  ? 228  DA  J "C3'" 1 
ATOM   4651  O "O3'" . DA  B 1 82  ? 97.757  84.644  -72.687 1.00 47.41  ? 228  DA  J "O3'" 1 
ATOM   4652  C "C2'" . DA  B 1 82  ? 98.137  87.052  -72.682 1.00 45.16  ? 228  DA  J "C2'" 1 
ATOM   4653  C "C1'" . DA  B 1 82  ? 98.035  87.322  -74.178 1.00 46.81  ? 228  DA  J "C1'" 1 
ATOM   4654  N N9    . DA  B 1 82  ? 98.176  88.727  -74.554 1.00 51.99  ? 228  DA  J N9    1 
ATOM   4655  C C8    . DA  B 1 82  ? 97.698  89.828  -73.886 1.00 52.03  ? 228  DA  J C8    1 
ATOM   4656  N N7    . DA  B 1 82  ? 97.962  90.965  -74.483 1.00 51.95  ? 228  DA  J N7    1 
ATOM   4657  C C5    . DA  B 1 82  ? 98.666  90.590  -75.618 1.00 53.90  ? 228  DA  J C5    1 
ATOM   4658  C C6    . DA  B 1 82  ? 99.230  91.336  -76.671 1.00 53.92  ? 228  DA  J C6    1 
ATOM   4659  N N6    . DA  B 1 82  ? 99.160  92.668  -76.751 1.00 51.07  ? 228  DA  J N6    1 
ATOM   4660  N N1    . DA  B 1 82  ? 99.872  90.660  -77.647 1.00 55.00  ? 228  DA  J N1    1 
ATOM   4661  C C2    . DA  B 1 82  ? 99.937  89.322  -77.566 1.00 55.83  ? 228  DA  J C2    1 
ATOM   4662  N N3    . DA  B 1 82  ? 99.443  88.508  -76.630 1.00 56.54  ? 228  DA  J N3    1 
ATOM   4663  C C4    . DA  B 1 82  ? 98.811  89.214  -75.673 1.00 54.25  ? 228  DA  J C4    1 
ATOM   4664  P P     . DA  B 1 83  ? 98.909  84.124  -71.706 1.00 47.92  ? 229  DA  J P     1 
ATOM   4665  O OP1   . DA  B 1 83  ? 98.755  82.657  -71.606 1.00 52.71  ? 229  DA  J OP1   1 
ATOM   4666  O OP2   . DA  B 1 83  ? 98.909  84.956  -70.477 1.00 54.34  ? 229  DA  J OP2   1 
ATOM   4667  O "O5'" . DA  B 1 83  ? 100.244 84.445  -72.513 1.00 50.24  ? 229  DA  J "O5'" 1 
ATOM   4668  C "C5'" . DA  B 1 83  ? 100.450 83.883  -73.808 1.00 51.41  ? 229  DA  J "C5'" 1 
ATOM   4669  C "C4'" . DA  B 1 83  ? 101.774 84.332  -74.378 1.00 53.21  ? 229  DA  J "C4'" 1 
ATOM   4670  O "O4'" . DA  B 1 83  ? 101.693 85.705  -74.831 1.00 50.98  ? 229  DA  J "O4'" 1 
ATOM   4671  C "C3'" . DA  B 1 83  ? 102.962 84.253  -73.413 1.00 54.49  ? 229  DA  J "C3'" 1 
ATOM   4672  O "O3'" . DA  B 1 83  ? 104.065 83.608  -74.058 1.00 60.85  ? 229  DA  J "O3'" 1 
ATOM   4673  C "C2'" . DA  B 1 83  ? 103.280 85.706  -73.107 1.00 52.11  ? 229  DA  J "C2'" 1 
ATOM   4674  C "C1'" . DA  B 1 83  ? 102.810 86.433  -74.356 1.00 51.36  ? 229  DA  J "C1'" 1 
ATOM   4675  N N9    . DA  B 1 83  ? 102.379 87.809  -74.113 1.00 56.92  ? 229  DA  J N9    1 
ATOM   4676  C C8    . DA  B 1 83  ? 101.717 88.302  -73.014 1.00 56.76  ? 229  DA  J C8    1 
ATOM   4677  N N7    . DA  B 1 83  ? 101.491 89.594  -73.066 1.00 56.62  ? 229  DA  J N7    1 
ATOM   4678  C C5    . DA  B 1 83  ? 102.030 89.978  -74.285 1.00 57.29  ? 229  DA  J C5    1 
ATOM   4679  C C6    . DA  B 1 83  ? 102.121 91.224  -74.929 1.00 57.76  ? 229  DA  J C6    1 
ATOM   4680  N N6    . DA  B 1 83  ? 101.638 92.364  -74.418 1.00 56.43  ? 229  DA  J N6    1 
ATOM   4681  N N1    . DA  B 1 83  ? 102.732 91.263  -76.134 1.00 57.50  ? 229  DA  J N1    1 
ATOM   4682  C C2    . DA  B 1 83  ? 103.212 90.126  -76.646 1.00 56.75  ? 229  DA  J C2    1 
ATOM   4683  N N3    . DA  B 1 83  ? 103.187 88.894  -76.140 1.00 58.42  ? 229  DA  J N3    1 
ATOM   4684  C C4    . DA  B 1 83  ? 102.576 88.887  -74.944 1.00 57.91  ? 229  DA  J C4    1 
ATOM   4685  P P     . DC  B 1 84  ? 105.417 83.306  -73.241 1.00 60.36  ? 230  DC  J P     1 
ATOM   4686  O OP1   . DC  B 1 84  ? 106.049 82.130  -73.896 1.00 61.06  ? 230  DC  J OP1   1 
ATOM   4687  O OP2   . DC  B 1 84  ? 105.131 83.266  -71.782 1.00 61.96  ? 230  DC  J OP2   1 
ATOM   4688  O "O5'" . DC  B 1 84  ? 106.295 84.600  -73.541 1.00 63.35  ? 230  DC  J "O5'" 1 
ATOM   4689  C "C5'" . DC  B 1 84  ? 106.590 84.972  -74.889 1.00 68.91  ? 230  DC  J "C5'" 1 
ATOM   4690  C "C4'" . DC  B 1 84  ? 107.470 86.198  -74.917 1.00 73.93  ? 230  DC  J "C4'" 1 
ATOM   4691  O "O4'" . DC  B 1 84  ? 106.681 87.413  -74.838 1.00 72.60  ? 230  DC  J "O4'" 1 
ATOM   4692  C "C3'" . DC  B 1 84  ? 108.491 86.266  -73.776 1.00 78.34  ? 230  DC  J "C3'" 1 
ATOM   4693  O "O3'" . DC  B 1 84  ? 109.786 86.626  -74.266 1.00 86.84  ? 230  DC  J "O3'" 1 
ATOM   4694  C "C2'" . DC  B 1 84  ? 107.959 87.382  -72.896 1.00 76.42  ? 230  DC  J "C2'" 1 
ATOM   4695  C "C1'" . DC  B 1 84  ? 107.310 88.291  -73.923 1.00 73.28  ? 230  DC  J "C1'" 1 
ATOM   4696  N N1    . DC  B 1 84  ? 106.306 89.231  -73.389 1.00 73.17  ? 230  DC  J N1    1 
ATOM   4697  C C2    . DC  B 1 84  ? 106.106 90.452  -74.050 1.00 72.80  ? 230  DC  J C2    1 
ATOM   4698  O O2    . DC  B 1 84  ? 106.722 90.675  -75.099 1.00 74.27  ? 230  DC  J O2    1 
ATOM   4699  N N3    . DC  B 1 84  ? 105.245 91.354  -73.532 1.00 72.14  ? 230  DC  J N3    1 
ATOM   4700  C C4    . DC  B 1 84  ? 104.583 91.073  -72.409 1.00 71.67  ? 230  DC  J C4    1 
ATOM   4701  N N4    . DC  B 1 84  ? 103.760 92.007  -71.923 1.00 70.01  ? 230  DC  J N4    1 
ATOM   4702  C C5    . DC  B 1 84  ? 104.739 89.826  -71.732 1.00 71.27  ? 230  DC  J C5    1 
ATOM   4703  C C6    . DC  B 1 84  ? 105.599 88.940  -72.254 1.00 72.17  ? 230  DC  J C6    1 
ATOM   4704  P P     . DA  B 1 85  ? 111.098 86.049  -73.540 1.00 106.76 ? 231  DA  J P     1 
ATOM   4705  O OP1   . DA  B 1 85  ? 111.400 84.729  -74.148 1.00 95.64  ? 231  DA  J OP1   1 
ATOM   4706  O OP2   . DA  B 1 85  ? 110.929 86.158  -72.067 1.00 95.15  ? 231  DA  J OP2   1 
ATOM   4707  O "O5'" . DA  B 1 85  ? 112.234 87.069  -73.980 1.00 112.92 ? 231  DA  J "O5'" 1 
ATOM   4708  C "C5'" . DA  B 1 85  ? 112.307 87.545  -75.319 1.00 123.68 ? 231  DA  J "C5'" 1 
ATOM   4709  C "C4'" . DA  B 1 85  ? 112.733 88.993  -75.325 1.00 131.68 ? 231  DA  J "C4'" 1 
ATOM   4710  O "O4'" . DA  B 1 85  ? 111.657 89.807  -74.797 1.00 133.60 ? 231  DA  J "O4'" 1 
ATOM   4711  C "C3'" . DA  B 1 85  ? 113.951 89.277  -74.443 1.00 136.02 ? 231  DA  J "C3'" 1 
ATOM   4712  O "O3'" . DA  B 1 85  ? 114.795 90.258  -75.049 1.00 141.28 ? 231  DA  J "O3'" 1 
ATOM   4713  C "C2'" . DA  B 1 85  ? 113.340 89.813  -73.163 1.00 136.62 ? 231  DA  J "C2'" 1 
ATOM   4714  C "C1'" . DA  B 1 85  ? 112.115 90.548  -73.675 1.00 136.45 ? 231  DA  J "C1'" 1 
ATOM   4715  N N9    . DA  B 1 85  ? 111.025 90.622  -72.703 1.00 127.71 ? 231  DA  J N9    1 
ATOM   4716  C C8    . DA  B 1 85  ? 110.744 89.744  -71.684 1.00 128.56 ? 231  DA  J C8    1 
ATOM   4717  N N7    . DA  B 1 85  ? 109.713 90.094  -70.954 1.00 129.14 ? 231  DA  J N7    1 
ATOM   4718  C C5    . DA  B 1 85  ? 109.281 91.279  -71.534 1.00 129.07 ? 231  DA  J C5    1 
ATOM   4719  C C6    . DA  B 1 85  ? 108.228 92.156  -71.221 1.00 129.31 ? 231  DA  J C6    1 
ATOM   4720  N N6    . DA  B 1 85  ? 107.384 91.968  -70.203 1.00 129.22 ? 231  DA  J N6    1 
ATOM   4721  N N1    . DA  B 1 85  ? 108.069 93.248  -72.001 1.00 129.40 ? 231  DA  J N1    1 
ATOM   4722  C C2    . DA  B 1 85  ? 108.916 93.437  -73.020 1.00 128.86 ? 231  DA  J C2    1 
ATOM   4723  N N3    . DA  B 1 85  ? 109.944 92.688  -73.412 1.00 128.65 ? 231  DA  J N3    1 
ATOM   4724  C C4    . DA  B 1 85  ? 110.075 91.612  -72.617 1.00 128.47 ? 231  DA  J C4    1 
ATOM   4725  P P     . DT  B 1 86  ? 115.920 90.991  -74.167 1.00 159.42 ? 232  DT  J P     1 
ATOM   4726  O OP1   . DT  B 1 86  ? 117.012 91.400  -75.087 1.00 132.47 ? 232  DT  J OP1   1 
ATOM   4727  O OP2   . DT  B 1 86  ? 116.232 90.142  -72.986 1.00 132.40 ? 232  DT  J OP2   1 
ATOM   4728  O "O5'" . DT  B 1 86  ? 115.182 92.304  -73.651 1.00 162.36 ? 232  DT  J "O5'" 1 
ATOM   4729  C "C5'" . DT  B 1 86  ? 114.588 93.213  -74.575 1.00 168.33 ? 232  DT  J "C5'" 1 
ATOM   4730  C "C4'" . DT  B 1 86  ? 114.429 94.572  -73.936 1.00 171.75 ? 232  DT  J "C4'" 1 
ATOM   4731  O "O4'" . DT  B 1 86  ? 113.367 94.527  -72.952 1.00 173.76 ? 232  DT  J "O4'" 1 
ATOM   4732  C "C3'" . DT  B 1 86  ? 115.676 95.055  -73.196 1.00 173.34 ? 232  DT  J "C3'" 1 
ATOM   4733  O "O3'" . DT  B 1 86  ? 115.861 96.459  -73.389 1.00 173.87 ? 232  DT  J "O3'" 1 
ATOM   4734  C "C2'" . DT  B 1 86  ? 115.361 94.753  -71.742 1.00 174.25 ? 232  DT  J "C2'" 1 
ATOM   4735  C "C1'" . DT  B 1 86  ? 113.856 94.951  -71.689 1.00 175.49 ? 232  DT  J "C1'" 1 
ATOM   4736  N N1    . DT  B 1 86  ? 113.160 94.169  -70.644 1.00 150.18 ? 232  DT  J N1    1 
ATOM   4737  C C2    . DT  B 1 86  ? 111.794 94.304  -70.537 1.00 150.96 ? 232  DT  J C2    1 
ATOM   4738  O O2    . DT  B 1 86  ? 111.139 95.033  -71.262 1.00 151.21 ? 232  DT  J O2    1 
ATOM   4739  N N3    . DT  B 1 86  ? 111.220 93.552  -69.541 1.00 150.64 ? 232  DT  J N3    1 
ATOM   4740  C C4    . DT  B 1 86  ? 111.863 92.702  -68.659 1.00 150.50 ? 232  DT  J C4    1 
ATOM   4741  O O4    . DT  B 1 86  ? 111.213 92.093  -67.813 1.00 149.27 ? 232  DT  J O4    1 
ATOM   4742  C C5    . DT  B 1 86  ? 113.297 92.610  -68.827 1.00 150.53 ? 232  DT  J C5    1 
ATOM   4743  C C7    . DT  B 1 86  ? 114.081 91.721  -67.914 1.00 150.65 ? 232  DT  J C7    1 
ATOM   4744  C C6    . DT  B 1 86  ? 113.864 93.334  -69.800 1.00 150.79 ? 232  DT  J C6    1 
ATOM   4745  P P     . DG  B 1 87  ? 117.171 97.175  -72.798 1.00 154.02 ? 233  DG  J P     1 
ATOM   4746  O OP1   . DG  B 1 87  ? 117.707 98.076  -73.850 1.00 159.93 ? 233  DG  J OP1   1 
ATOM   4747  O OP2   . DG  B 1 87  ? 118.048 96.132  -72.205 1.00 159.62 ? 233  DG  J OP2   1 
ATOM   4748  O "O5'" . DG  B 1 87  ? 116.601 98.079  -71.618 1.00 154.42 ? 233  DG  J "O5'" 1 
ATOM   4749  C "C5'" . DG  B 1 87  ? 115.692 99.142  -71.891 1.00 154.40 ? 233  DG  J "C5'" 1 
ATOM   4750  C "C4'" . DG  B 1 87  ? 115.313 99.844  -70.608 1.00 154.21 ? 233  DG  J "C4'" 1 
ATOM   4751  O "O4'" . DG  B 1 87  ? 114.451 98.988  -69.816 1.00 155.70 ? 233  DG  J "O4'" 1 
ATOM   4752  C "C3'" . DG  B 1 87  ? 116.504 100.194 -69.714 1.00 152.98 ? 233  DG  J "C3'" 1 
ATOM   4753  O "O3'" . DG  B 1 87  ? 116.322 101.488 -69.132 1.00 148.80 ? 233  DG  J "O3'" 1 
ATOM   4754  C "C2'" . DG  B 1 87  ? 116.477 99.111  -68.652 1.00 155.17 ? 233  DG  J "C2'" 1 
ATOM   4755  C "C1'" . DG  B 1 87  ? 114.993 98.835  -68.513 1.00 157.19 ? 233  DG  J "C1'" 1 
ATOM   4756  N N9    . DG  B 1 87  ? 114.685 97.488  -68.042 1.00 165.35 ? 233  DG  J N9    1 
ATOM   4757  C C8    . DG  B 1 87  ? 115.362 96.329  -68.340 1.00 166.10 ? 233  DG  J C8    1 
ATOM   4758  N N7    . DG  B 1 87  ? 114.870 95.279  -67.741 1.00 166.76 ? 233  DG  J N7    1 
ATOM   4759  C C5    . DG  B 1 87  ? 113.797 95.772  -67.011 1.00 166.99 ? 233  DG  J C5    1 
ATOM   4760  C C6    . DG  B 1 87  ? 112.884 95.104  -66.156 1.00 167.39 ? 233  DG  J C6    1 
ATOM   4761  O O6    . DG  B 1 87  ? 112.837 93.902  -65.865 1.00 167.40 ? 233  DG  J O6    1 
ATOM   4762  N N1    . DG  B 1 87  ? 111.954 95.986  -65.614 1.00 167.43 ? 233  DG  J N1    1 
ATOM   4763  C C2    . DG  B 1 87  ? 111.908 97.336  -65.860 1.00 167.24 ? 233  DG  J C2    1 
ATOM   4764  N N2    . DG  B 1 87  ? 110.936 98.018  -65.239 1.00 167.27 ? 233  DG  J N2    1 
ATOM   4765  N N3    . DG  B 1 87  ? 112.753 97.971  -66.655 1.00 166.77 ? 233  DG  J N3    1 
ATOM   4766  C C4    . DG  B 1 87  ? 113.665 97.133  -67.192 1.00 166.50 ? 233  DG  J C4    1 
ATOM   4767  P P     . DC  B 1 88  ? 117.133 101.887 -67.803 1.00 142.41 ? 234  DC  J P     1 
ATOM   4768  O OP1   . DC  B 1 88  ? 117.321 103.359 -67.827 1.00 142.87 ? 234  DC  J OP1   1 
ATOM   4769  O OP2   . DC  B 1 88  ? 118.313 100.997 -67.659 1.00 142.70 ? 234  DC  J OP2   1 
ATOM   4770  O "O5'" . DC  B 1 88  ? 116.105 101.543 -66.638 1.00 139.97 ? 234  DC  J "O5'" 1 
ATOM   4771  C "C5'" . DC  B 1 88  ? 114.750 101.977 -66.722 1.00 134.45 ? 234  DC  J "C5'" 1 
ATOM   4772  C "C4'" . DC  B 1 88  ? 114.095 101.916 -65.363 1.00 130.06 ? 234  DC  J "C4'" 1 
ATOM   4773  O "O4'" . DC  B 1 88  ? 113.867 100.538 -64.987 1.00 128.79 ? 234  DC  J "O4'" 1 
ATOM   4774  C "C3'" . DC  B 1 88  ? 114.923 102.539 -64.241 1.00 127.77 ? 234  DC  J "C3'" 1 
ATOM   4775  O "O3'" . DC  B 1 88  ? 114.061 103.250 -63.351 1.00 124.76 ? 234  DC  J "O3'" 1 
ATOM   4776  C "C2'" . DC  B 1 88  ? 115.550 101.336 -63.556 1.00 127.21 ? 234  DC  J "C2'" 1 
ATOM   4777  C "C1'" . DC  B 1 88  ? 114.498 100.254 -63.749 1.00 127.50 ? 234  DC  J "C1'" 1 
ATOM   4778  N N1    . DC  B 1 88  ? 115.023 98.881  -63.828 1.00 126.47 ? 234  DC  J N1    1 
ATOM   4779  C C2    . DC  B 1 88  ? 114.814 98.013  -62.752 1.00 126.07 ? 234  DC  J C2    1 
ATOM   4780  O O2    . DC  B 1 88  ? 114.216 98.433  -61.752 1.00 125.29 ? 234  DC  J O2    1 
ATOM   4781  N N3    . DC  B 1 88  ? 115.270 96.741  -62.829 1.00 125.75 ? 234  DC  J N3    1 
ATOM   4782  C C4    . DC  B 1 88  ? 115.917 96.329  -63.923 1.00 125.25 ? 234  DC  J C4    1 
ATOM   4783  N N4    . DC  B 1 88  ? 116.340 95.063  -63.961 1.00 124.69 ? 234  DC  J N4    1 
ATOM   4784  C C5    . DC  B 1 88  ? 116.156 97.197  -65.027 1.00 125.35 ? 234  DC  J C5    1 
ATOM   4785  C C6    . DC  B 1 88  ? 115.696 98.452  -64.938 1.00 126.03 ? 234  DC  J C6    1 
ATOM   4786  P P     . DC  B 1 89  ? 113.905 104.844 -63.501 1.00 115.46 ? 235  DC  J P     1 
ATOM   4787  O OP1   . DC  B 1 89  ? 113.647 105.137 -64.934 1.00 127.69 ? 235  DC  J OP1   1 
ATOM   4788  O OP2   . DC  B 1 89  ? 115.047 105.495 -62.811 1.00 128.14 ? 235  DC  J OP2   1 
ATOM   4789  O "O5'" . DC  B 1 89  ? 112.578 105.171 -62.684 1.00 113.48 ? 235  DC  J "O5'" 1 
ATOM   4790  C "C5'" . DC  B 1 89  ? 111.309 104.700 -63.135 1.00 108.80 ? 235  DC  J "C5'" 1 
ATOM   4791  C "C4'" . DC  B 1 89  ? 110.576 104.001 -62.013 1.00 106.02 ? 235  DC  J "C4'" 1 
ATOM   4792  O "O4'" . DC  B 1 89  ? 111.216 102.736 -61.703 1.00 104.60 ? 235  DC  J "O4'" 1 
ATOM   4793  C "C3'" . DC  B 1 89  ? 110.513 104.778 -60.695 1.00 104.74 ? 235  DC  J "C3'" 1 
ATOM   4794  O "O3'" . DC  B 1 89  ? 109.219 104.623 -60.106 1.00 103.29 ? 235  DC  J "O3'" 1 
ATOM   4795  C "C2'" . DC  B 1 89  ? 111.556 104.090 -59.833 1.00 104.27 ? 235  DC  J "C2'" 1 
ATOM   4796  C "C1'" . DC  B 1 89  ? 111.451 102.655 -60.306 1.00 104.42 ? 235  DC  J "C1'" 1 
ATOM   4797  N N1    . DC  B 1 89  ? 112.658 101.844 -60.085 1.00 117.55 ? 235  DC  J N1    1 
ATOM   4798  C C2    . DC  B 1 89  ? 112.509 100.497 -59.749 1.00 118.10 ? 235  DC  J C2    1 
ATOM   4799  O O2    . DC  B 1 89  ? 111.369 100.022 -59.668 1.00 117.70 ? 235  DC  J O2    1 
ATOM   4800  N N3    . DC  B 1 89  ? 113.610 99.746  -59.522 1.00 119.39 ? 235  DC  J N3    1 
ATOM   4801  C C4    . DC  B 1 89  ? 114.823 100.292 -59.627 1.00 119.92 ? 235  DC  J C4    1 
ATOM   4802  N N4    . DC  B 1 89  ? 115.882 99.513  -59.391 1.00 120.80 ? 235  DC  J N4    1 
ATOM   4803  C C5    . DC  B 1 89  ? 115.005 101.661 -59.977 1.00 119.40 ? 235  DC  J C5    1 
ATOM   4804  C C6    . DC  B 1 89  ? 113.906 102.393 -60.196 1.00 118.50 ? 235  DC  J C6    1 
ATOM   4805  P P     . DT  B 1 90  ? 108.864 105.385 -58.736 1.00 111.96 ? 236  DT  J P     1 
ATOM   4806  O OP1   . DT  B 1 90  ? 107.852 106.431 -59.031 1.00 128.78 ? 236  DT  J OP1   1 
ATOM   4807  O OP2   . DT  B 1 90  ? 110.130 105.757 -58.054 1.00 129.39 ? 236  DT  J OP2   1 
ATOM   4808  O "O5'" . DT  B 1 90  ? 108.170 104.249 -57.869 1.00 109.98 ? 236  DT  J "O5'" 1 
ATOM   4809  C "C5'" . DT  B 1 90  ? 107.345 103.273 -58.493 1.00 106.16 ? 236  DT  J "C5'" 1 
ATOM   4810  C "C4'" . DT  B 1 90  ? 107.221 102.053 -57.612 1.00 103.84 ? 236  DT  J "C4'" 1 
ATOM   4811  O "O4'" . DT  B 1 90  ? 108.473 101.324 -57.578 1.00 104.70 ? 236  DT  J "O4'" 1 
ATOM   4812  C "C3'" . DT  B 1 90  ? 106.862 102.351 -56.156 1.00 101.53 ? 236  DT  J "C3'" 1 
ATOM   4813  O "O3'" . DT  B 1 90  ? 105.909 101.389 -55.704 1.00 96.30  ? 236  DT  J "O3'" 1 
ATOM   4814  C "C2'" . DT  B 1 90  ? 108.184 102.186 -55.426 1.00 103.04 ? 236  DT  J "C2'" 1 
ATOM   4815  C "C1'" . DT  B 1 90  ? 108.854 101.090 -56.232 1.00 105.29 ? 236  DT  J "C1'" 1 
ATOM   4816  N N1    . DT  B 1 90  ? 110.329 101.081 -56.167 1.00 124.81 ? 236  DT  J N1    1 
ATOM   4817  C C2    . DT  B 1 90  ? 110.948 99.961  -55.654 1.00 125.87 ? 236  DT  J C2    1 
ATOM   4818  O O2    . DT  B 1 90  ? 110.335 98.987  -55.252 1.00 125.70 ? 236  DT  J O2    1 
ATOM   4819  N N3    . DT  B 1 90  ? 112.318 100.025 -55.628 1.00 126.87 ? 236  DT  J N3    1 
ATOM   4820  C C4    . DT  B 1 90  ? 113.113 101.071 -56.056 1.00 128.07 ? 236  DT  J C4    1 
ATOM   4821  O O4    . DT  B 1 90  ? 114.337 100.984 -55.974 1.00 129.21 ? 236  DT  J O4    1 
ATOM   4822  C C5    . DT  B 1 90  ? 112.399 102.213 -56.581 1.00 127.40 ? 236  DT  J C5    1 
ATOM   4823  C C7    . DT  B 1 90  ? 113.179 103.393 -57.066 1.00 128.09 ? 236  DT  J C7    1 
ATOM   4824  C C6    . DT  B 1 90  ? 111.061 102.162 -56.610 1.00 126.26 ? 236  DT  J C6    1 
ATOM   4825  P P     . DT  B 1 91  ? 105.265 101.525 -54.241 1.00 71.28  ? 237  DT  J P     1 
ATOM   4826  O OP1   . DT  B 1 91  ? 103.803 101.711 -54.393 1.00 95.91  ? 237  DT  J OP1   1 
ATOM   4827  O OP2   . DT  B 1 91  ? 106.055 102.522 -53.473 1.00 95.98  ? 237  DT  J OP2   1 
ATOM   4828  O "O5'" . DT  B 1 91  ? 105.523 100.084 -53.620 1.00 69.16  ? 237  DT  J "O5'" 1 
ATOM   4829  C "C5'" . DT  B 1 91  ? 105.429 98.925  -54.439 1.00 63.67  ? 237  DT  J "C5'" 1 
ATOM   4830  C "C4'" . DT  B 1 91  ? 106.186 97.778  -53.814 1.00 61.21  ? 237  DT  J "C4'" 1 
ATOM   4831  O "O4'" . DT  B 1 91  ? 107.610 98.051  -53.844 1.00 61.27  ? 237  DT  J "O4'" 1 
ATOM   4832  C "C3'" . DT  B 1 91  ? 105.834 97.500  -52.351 1.00 59.60  ? 237  DT  J "C3'" 1 
ATOM   4833  O "O3'" . DT  B 1 91  ? 105.757 96.090  -52.137 1.00 56.35  ? 237  DT  J "O3'" 1 
ATOM   4834  C "C2'" . DT  B 1 91  ? 107.001 98.095  -51.582 1.00 60.70  ? 237  DT  J "C2'" 1 
ATOM   4835  C "C1'" . DT  B 1 91  ? 108.160 97.883  -52.541 1.00 61.93  ? 237  DT  J "C1'" 1 
ATOM   4836  N N1    . DT  B 1 91  ? 109.278 98.844  -52.383 1.00 86.37  ? 237  DT  J N1    1 
ATOM   4837  C C2    . DT  B 1 91  ? 110.551 98.343  -52.183 1.00 86.67  ? 237  DT  J C2    1 
ATOM   4838  O O2    . DT  B 1 91  ? 110.801 97.150  -52.118 1.00 87.24  ? 237  DT  J O2    1 
ATOM   4839  N N3    . DT  B 1 91  ? 111.526 99.299  -52.058 1.00 86.91  ? 237  DT  J N3    1 
ATOM   4840  C C4    . DT  B 1 91  ? 111.365 100.670 -52.109 1.00 87.37  ? 237  DT  J C4    1 
ATOM   4841  O O4    . DT  B 1 91  ? 112.341 101.404 -51.988 1.00 87.51  ? 237  DT  J O4    1 
ATOM   4842  C C5    . DT  B 1 91  ? 110.008 101.125 -52.311 1.00 87.18  ? 237  DT  J C5    1 
ATOM   4843  C C7    . DT  B 1 91  ? 109.738 102.595 -52.370 1.00 87.22  ? 237  DT  J C7    1 
ATOM   4844  C C6    . DT  B 1 91  ? 109.046 100.202 -52.438 1.00 86.26  ? 237  DT  J C6    1 
ATOM   4845  P P     . DT  B 1 92  ? 105.488 95.522  -50.663 1.00 62.23  ? 238  DT  J P     1 
ATOM   4846  O OP1   . DT  B 1 92  ? 104.650 94.302  -50.785 1.00 75.68  ? 238  DT  J OP1   1 
ATOM   4847  O OP2   . DT  B 1 92  ? 105.048 96.634  -49.781 1.00 72.61  ? 238  DT  J OP2   1 
ATOM   4848  O "O5'" . DT  B 1 92  ? 106.935 95.043  -50.208 1.00 67.39  ? 238  DT  J "O5'" 1 
ATOM   4849  C "C5'" . DT  B 1 92  ? 107.669 94.117  -51.004 1.00 71.64  ? 238  DT  J "C5'" 1 
ATOM   4850  C "C4'" . DT  B 1 92  ? 108.955 93.737  -50.307 1.00 75.73  ? 238  DT  J "C4'" 1 
ATOM   4851  O "O4'" . DT  B 1 92  ? 109.882 94.849  -50.348 1.00 76.26  ? 238  DT  J "O4'" 1 
ATOM   4852  C "C3'" . DT  B 1 92  ? 108.787 93.374  -48.831 1.00 77.76  ? 238  DT  J "C3'" 1 
ATOM   4853  O "O3'" . DT  B 1 92  ? 109.604 92.246  -48.513 1.00 81.14  ? 238  DT  J "O3'" 1 
ATOM   4854  C "C2'" . DT  B 1 92  ? 109.257 94.623  -48.102 1.00 77.55  ? 238  DT  J "C2'" 1 
ATOM   4855  C "C1'" . DT  B 1 92  ? 110.326 95.157  -49.038 1.00 77.40  ? 238  DT  J "C1'" 1 
ATOM   4856  N N1    . DT  B 1 92  ? 110.569 96.615  -48.973 1.00 91.03  ? 238  DT  J N1    1 
ATOM   4857  C C2    . DT  B 1 92  ? 111.881 97.043  -48.919 1.00 92.03  ? 238  DT  J C2    1 
ATOM   4858  O O2    . DT  B 1 92  ? 112.834 96.277  -48.895 1.00 92.30  ? 238  DT  J O2    1 
ATOM   4859  N N3    . DT  B 1 92  ? 112.036 98.409  -48.893 1.00 91.72  ? 238  DT  J N3    1 
ATOM   4860  C C4    . DT  B 1 92  ? 111.037 99.365  -48.906 1.00 91.85  ? 238  DT  J C4    1 
ATOM   4861  O O4    . DT  B 1 92  ? 111.329 100.558 -48.895 1.00 92.65  ? 238  DT  J O4    1 
ATOM   4862  C C5    . DT  B 1 92  ? 109.689 98.847  -48.939 1.00 91.15  ? 238  DT  J C5    1 
ATOM   4863  C C7    . DT  B 1 92  ? 108.546 99.813  -48.927 1.00 90.38  ? 238  DT  J C7    1 
ATOM   4864  C C6    . DT  B 1 92  ? 109.523 97.515  -48.975 1.00 90.96  ? 238  DT  J C6    1 
ATOM   4865  P P     . DT  B 1 93  ? 109.584 91.642  -47.025 1.00 92.60  ? 239  DT  J P     1 
ATOM   4866  O OP1   . DT  B 1 93  ? 109.753 90.172  -47.126 1.00 92.96  ? 239  DT  J OP1   1 
ATOM   4867  O OP2   . DT  B 1 93  ? 108.405 92.197  -46.313 1.00 93.21  ? 239  DT  J OP2   1 
ATOM   4868  O "O5'" . DT  B 1 93  ? 110.895 92.259  -46.364 1.00 96.66  ? 239  DT  J "O5'" 1 
ATOM   4869  C "C5'" . DT  B 1 93  ? 112.187 91.946  -46.885 1.00 102.45 ? 239  DT  J "C5'" 1 
ATOM   4870  C "C4'" . DT  B 1 93  ? 113.263 92.603  -46.053 1.00 106.51 ? 239  DT  J "C4'" 1 
ATOM   4871  O "O4'" . DT  B 1 93  ? 113.299 94.027  -46.316 1.00 106.30 ? 239  DT  J "O4'" 1 
ATOM   4872  C "C3'" . DT  B 1 93  ? 113.076 92.454  -44.541 1.00 110.00 ? 239  DT  J "C3'" 1 
ATOM   4873  O "O3'" . DT  B 1 93  ? 114.342 92.244  -43.904 1.00 116.27 ? 239  DT  J "O3'" 1 
ATOM   4874  C "C2'" . DT  B 1 93  ? 112.516 93.803  -44.131 1.00 108.81 ? 239  DT  J "C2'" 1 
ATOM   4875  C "C1'" . DT  B 1 93  ? 113.253 94.725  -45.083 1.00 107.30 ? 239  DT  J "C1'" 1 
ATOM   4876  N N1    . DT  B 1 93  ? 112.624 96.039  -45.315 1.00 107.59 ? 239  DT  J N1    1 
ATOM   4877  C C2    . DT  B 1 93  ? 113.454 97.130  -45.431 1.00 107.67 ? 239  DT  J C2    1 
ATOM   4878  O O2    . DT  B 1 93  ? 114.669 97.053  -45.357 1.00 108.61 ? 239  DT  J O2    1 
ATOM   4879  N N3    . DT  B 1 93  ? 112.807 98.322  -45.636 1.00 107.03 ? 239  DT  J N3    1 
ATOM   4880  C C4    . DT  B 1 93  ? 111.446 98.527  -45.731 1.00 106.82 ? 239  DT  J C4    1 
ATOM   4881  O O4    . DT  B 1 93  ? 111.012 99.660  -45.911 1.00 106.27 ? 239  DT  J O4    1 
ATOM   4882  C C5    . DT  B 1 93  ? 110.634 97.339  -45.602 1.00 106.93 ? 239  DT  J C5    1 
ATOM   4883  C C7    . DT  B 1 93  ? 109.146 97.464  -45.690 1.00 106.65 ? 239  DT  J C7    1 
ATOM   4884  C C6    . DT  B 1 93  ? 111.256 96.169  -45.405 1.00 107.46 ? 239  DT  J C6    1 
ATOM   4885  P P     . DG  B 1 94  ? 114.397 91.632  -42.416 1.00 135.55 ? 240  DG  J P     1 
ATOM   4886  O OP1   . DG  B 1 94  ? 115.277 90.438  -42.473 1.00 127.54 ? 240  DG  J OP1   1 
ATOM   4887  O OP2   . DG  B 1 94  ? 113.011 91.496  -41.899 1.00 127.31 ? 240  DG  J OP2   1 
ATOM   4888  O "O5'" . DG  B 1 94  ? 115.137 92.762  -41.570 1.00 138.16 ? 240  DG  J "O5'" 1 
ATOM   4889  C "C5'" . DG  B 1 94  ? 116.475 93.146  -41.878 1.00 144.00 ? 240  DG  J "C5'" 1 
ATOM   4890  C "C4'" . DG  B 1 94  ? 116.800 94.480  -41.248 1.00 148.30 ? 240  DG  J "C4'" 1 
ATOM   4891  O "O4'" . DG  B 1 94  ? 115.991 95.517  -41.856 1.00 149.40 ? 240  DG  J "O4'" 1 
ATOM   4892  C "C3'" . DG  B 1 94  ? 116.536 94.570  -39.743 1.00 150.63 ? 240  DG  J "C3'" 1 
ATOM   4893  O "O3'" . DG  B 1 94  ? 117.535 95.387  -39.125 1.00 153.75 ? 240  DG  J "O3'" 1 
ATOM   4894  C "C2'" . DG  B 1 94  ? 115.196 95.276  -39.672 1.00 150.79 ? 240  DG  J "C2'" 1 
ATOM   4895  C "C1'" . DG  B 1 94  ? 115.305 96.234  -40.842 1.00 150.73 ? 240  DG  J "C1'" 1 
ATOM   4896  N N9    . DG  B 1 94  ? 114.026 96.678  -41.383 1.00 143.66 ? 240  DG  J N9    1 
ATOM   4897  C C8    . DG  B 1 94  ? 112.999 95.892  -41.844 1.00 143.97 ? 240  DG  J C8    1 
ATOM   4898  N N7    . DG  B 1 94  ? 111.973 96.581  -42.261 1.00 144.09 ? 240  DG  J N7    1 
ATOM   4899  C C5    . DG  B 1 94  ? 112.344 97.903  -42.062 1.00 144.28 ? 240  DG  J C5    1 
ATOM   4900  C C6    . DG  B 1 94  ? 111.637 99.107  -42.322 1.00 144.48 ? 240  DG  J C6    1 
ATOM   4901  O O6    . DG  B 1 94  ? 110.504 99.250  -42.798 1.00 144.03 ? 240  DG  J O6    1 
ATOM   4902  N N1    . DG  B 1 94  ? 112.386 100.225 -41.967 1.00 144.73 ? 240  DG  J N1    1 
ATOM   4903  C C2    . DG  B 1 94  ? 113.651 100.192 -41.432 1.00 144.78 ? 240  DG  J C2    1 
ATOM   4904  N N2    . DG  B 1 94  ? 114.207 101.380 -41.151 1.00 144.83 ? 240  DG  J N2    1 
ATOM   4905  N N3    . DG  B 1 94  ? 114.320 99.078  -41.187 1.00 144.70 ? 240  DG  J N3    1 
ATOM   4906  C C4    . DG  B 1 94  ? 113.611 97.979  -41.523 1.00 144.21 ? 240  DG  J C4    1 
ATOM   4907  P P     . DA  B 1 95  ? 117.683 95.396  -37.525 1.00 155.11 ? 241  DA  J P     1 
ATOM   4908  O OP1   . DA  B 1 95  ? 118.987 94.765  -37.206 1.00 147.41 ? 241  DA  J OP1   1 
ATOM   4909  O OP2   . DA  B 1 95  ? 116.437 94.848  -36.928 1.00 147.19 ? 241  DA  J OP2   1 
ATOM   4910  O "O5'" . DA  B 1 95  ? 117.777 96.945  -37.159 1.00 156.37 ? 241  DA  J "O5'" 1 
ATOM   4911  C "C5'" . DA  B 1 95  ? 118.849 97.750  -37.652 1.00 159.32 ? 241  DA  J "C5'" 1 
ATOM   4912  C "C4'" . DA  B 1 95  ? 118.589 99.209  -37.355 1.00 161.02 ? 241  DA  J "C4'" 1 
ATOM   4913  O "O4'" . DA  B 1 95  ? 117.399 99.627  -38.069 1.00 162.62 ? 241  DA  J "O4'" 1 
ATOM   4914  C "C3'" . DA  B 1 95  ? 118.330 99.531  -35.881 1.00 161.09 ? 241  DA  J "C3'" 1 
ATOM   4915  O "O3'" . DA  B 1 95  ? 118.878 100.810 -35.543 1.00 158.92 ? 241  DA  J "O3'" 1 
ATOM   4916  C "C2'" . DA  B 1 95  ? 116.817 99.583  -35.799 1.00 162.76 ? 241  DA  J "C2'" 1 
ATOM   4917  C "C1'" . DA  B 1 95  ? 116.452 100.159 -37.154 1.00 164.23 ? 241  DA  J "C1'" 1 
ATOM   4918  N N9    . DA  B 1 95  ? 115.116 99.790  -37.617 1.00 158.19 ? 241  DA  J N9    1 
ATOM   4919  C C8    . DA  B 1 95  ? 114.660 98.550  -37.991 1.00 158.96 ? 241  DA  J C8    1 
ATOM   4920  N N7    . DA  B 1 95  ? 113.399 98.537  -38.348 1.00 159.54 ? 241  DA  J N7    1 
ATOM   4921  C C5    . DA  B 1 95  ? 112.997 99.858  -38.203 1.00 159.36 ? 241  DA  J C5    1 
ATOM   4922  C C6    . DA  B 1 95  ? 111.767 100.504 -38.423 1.00 159.48 ? 241  DA  J C6    1 
ATOM   4923  N N6    . DA  B 1 95  ? 110.669 99.880  -38.854 1.00 159.33 ? 241  DA  J N6    1 
ATOM   4924  N N1    . DA  B 1 95  ? 111.703 101.832 -38.183 1.00 159.29 ? 241  DA  J N1    1 
ATOM   4925  C C2    . DA  B 1 95  ? 112.805 102.458 -37.751 1.00 159.34 ? 241  DA  J C2    1 
ATOM   4926  N N3    . DA  B 1 95  ? 114.016 101.962 -37.507 1.00 159.24 ? 241  DA  J N3    1 
ATOM   4927  C C4    . DA  B 1 95  ? 114.046 100.641 -37.756 1.00 159.09 ? 241  DA  J C4    1 
ATOM   4928  P P     . DT  B 1 96  ? 118.860 101.305 -34.013 1.00 154.43 ? 242  DT  J P     1 
ATOM   4929  O OP1   . DT  B 1 96  ? 120.148 101.998 -33.761 1.00 143.59 ? 242  DT  J OP1   1 
ATOM   4930  O OP2   . DT  B 1 96  ? 118.467 100.154 -33.160 1.00 143.29 ? 242  DT  J OP2   1 
ATOM   4931  O "O5'" . DT  B 1 96  ? 117.697 102.395 -33.961 1.00 152.93 ? 242  DT  J "O5'" 1 
ATOM   4932  C "C5'" . DT  B 1 96  ? 117.845 103.649 -34.628 1.00 150.55 ? 242  DT  J "C5'" 1 
ATOM   4933  C "C4'" . DT  B 1 96  ? 116.699 104.579 -34.290 1.00 148.40 ? 242  DT  J "C4'" 1 
ATOM   4934  O "O4'" . DT  B 1 96  ? 115.454 104.049 -34.808 1.00 148.41 ? 242  DT  J "O4'" 1 
ATOM   4935  C "C3'" . DT  B 1 96  ? 116.455 104.851 -32.801 1.00 146.60 ? 242  DT  J "C3'" 1 
ATOM   4936  O "O3'" . DT  B 1 96  ? 116.087 106.226 -32.622 1.00 142.82 ? 242  DT  J "O3'" 1 
ATOM   4937  C "C2'" . DT  B 1 96  ? 115.259 103.973 -32.482 1.00 147.18 ? 242  DT  J "C2'" 1 
ATOM   4938  C "C1'" . DT  B 1 96  ? 114.477 104.058 -33.779 1.00 148.01 ? 242  DT  J "C1'" 1 
ATOM   4939  N N1    . DT  B 1 96  ? 113.541 102.947 -34.025 1.00 136.92 ? 242  DT  J N1    1 
ATOM   4940  C C2    . DT  B 1 96  ? 112.242 103.265 -34.349 1.00 136.72 ? 242  DT  J C2    1 
ATOM   4941  O O2    . DT  B 1 96  ? 111.843 104.415 -34.448 1.00 136.08 ? 242  DT  J O2    1 
ATOM   4942  N N3    . DT  B 1 96  ? 111.423 102.182 -34.557 1.00 136.61 ? 242  DT  J N3    1 
ATOM   4943  C C4    . DT  B 1 96  ? 111.767 100.845 -34.477 1.00 136.57 ? 242  DT  J C4    1 
ATOM   4944  O O4    . DT  B 1 96  ? 110.919 99.980  -34.688 1.00 135.87 ? 242  DT  J O4    1 
ATOM   4945  C C5    . DT  B 1 96  ? 113.148 100.584 -34.139 1.00 136.74 ? 242  DT  J C5    1 
ATOM   4946  C C7    . DT  B 1 96  ? 113.614 99.165  -34.036 1.00 136.63 ? 242  DT  J C7    1 
ATOM   4947  C C6    . DT  B 1 96  ? 113.955 101.634 -33.931 1.00 137.01 ? 242  DT  J C6    1 
ATOM   4948  P P     . DG  B 1 97  ? 116.496 106.997 -31.270 1.00 132.92 ? 243  DG  J P     1 
ATOM   4949  O OP1   . DG  B 1 97  ? 117.978 107.092 -31.263 1.00 118.81 ? 243  DG  J OP1   1 
ATOM   4950  O OP2   . DG  B 1 97  ? 115.794 106.359 -30.126 1.00 118.23 ? 243  DG  J OP2   1 
ATOM   4951  O "O5'" . DG  B 1 97  ? 115.904 108.464 -31.471 1.00 129.96 ? 243  DG  J "O5'" 1 
ATOM   4952  C "C5'" . DG  B 1 97  ? 115.118 109.092 -30.454 1.00 124.88 ? 243  DG  J "C5'" 1 
ATOM   4953  C "C4'" . DG  B 1 97  ? 113.830 109.623 -31.043 1.00 121.17 ? 243  DG  J "C4'" 1 
ATOM   4954  O "O4'" . DG  B 1 97  ? 113.115 108.532 -31.673 1.00 119.95 ? 243  DG  J "O4'" 1 
ATOM   4955  C "C3'" . DG  B 1 97  ? 112.856 110.223 -30.028 1.00 118.90 ? 243  DG  J "C3'" 1 
ATOM   4956  O "O3'" . DG  B 1 97  ? 112.132 111.308 -30.622 1.00 115.82 ? 243  DG  J "O3'" 1 
ATOM   4957  C "C2'" . DG  B 1 97  ? 111.922 109.069 -29.719 1.00 118.50 ? 243  DG  J "C2'" 1 
ATOM   4958  C "C1'" . DG  B 1 97  ? 111.850 108.347 -31.052 1.00 118.31 ? 243  DG  J "C1'" 1 
ATOM   4959  N N9    . DG  B 1 97  ? 111.613 106.910 -30.946 1.00 102.64 ? 243  DG  J N9    1 
ATOM   4960  C C8    . DG  B 1 97  ? 112.372 105.984 -30.267 1.00 102.57 ? 243  DG  J C8    1 
ATOM   4961  N N7    . DG  B 1 97  ? 111.912 104.767 -30.373 1.00 101.66 ? 243  DG  J N7    1 
ATOM   4962  C C5    . DG  B 1 97  ? 110.779 104.897 -31.167 1.00 101.38 ? 243  DG  J C5    1 
ATOM   4963  C C6    . DG  B 1 97  ? 109.862 103.918 -31.633 1.00 100.46 ? 243  DG  J C6    1 
ATOM   4964  O O6    . DG  B 1 97  ? 109.870 102.697 -31.434 1.00 99.20  ? 243  DG  J O6    1 
ATOM   4965  N N1    . DG  B 1 97  ? 108.857 104.490 -32.408 1.00 100.00 ? 243  DG  J N1    1 
ATOM   4966  C C2    . DG  B 1 97  ? 108.748 105.829 -32.700 1.00 99.89  ? 243  DG  J C2    1 
ATOM   4967  N N2    . DG  B 1 97  ? 107.709 106.190 -33.463 1.00 99.15  ? 243  DG  J N2    1 
ATOM   4968  N N3    . DG  B 1 97  ? 109.596 106.748 -32.277 1.00 100.79 ? 243  DG  J N3    1 
ATOM   4969  C C4    . DG  B 1 97  ? 110.580 106.216 -31.521 1.00 101.80 ? 243  DG  J C4    1 
ATOM   4970  P P     . DG  B 1 98  ? 111.217 112.258 -29.699 1.00 116.14 ? 244  DG  J P     1 
ATOM   4971  O OP1   . DG  B 1 98  ? 111.112 113.590 -30.350 1.00 108.73 ? 244  DG  J OP1   1 
ATOM   4972  O OP2   . DG  B 1 98  ? 111.716 112.160 -28.304 1.00 109.68 ? 244  DG  J OP2   1 
ATOM   4973  O "O5'" . DG  B 1 98  ? 109.782 111.567 -29.737 1.00 114.27 ? 244  DG  J "O5'" 1 
ATOM   4974  C "C5'" . DG  B 1 98  ? 108.950 111.665 -30.893 1.00 109.49 ? 244  DG  J "C5'" 1 
ATOM   4975  C "C4'" . DG  B 1 98  ? 107.634 110.963 -30.652 1.00 105.76 ? 244  DG  J "C4'" 1 
ATOM   4976  O "O4'" . DG  B 1 98  ? 107.842 109.533 -30.544 1.00 104.90 ? 244  DG  J "O4'" 1 
ATOM   4977  C "C3'" . DG  B 1 98  ? 106.903 111.378 -29.373 1.00 103.71 ? 244  DG  J "C3'" 1 
ATOM   4978  O "O3'" . DG  B 1 98  ? 105.496 111.332 -29.610 1.00 100.95 ? 244  DG  J "O3'" 1 
ATOM   4979  C "C2'" . DG  B 1 98  ? 107.261 110.263 -28.406 1.00 103.47 ? 244  DG  J "C2'" 1 
ATOM   4980  C "C1'" . DG  B 1 98  ? 107.255 109.068 -29.340 1.00 104.11 ? 244  DG  J "C1'" 1 
ATOM   4981  N N9    . DG  B 1 98  ? 108.001 107.898 -28.891 1.00 97.64  ? 244  DG  J N9    1 
ATOM   4982  C C8    . DG  B 1 98  ? 109.149 107.874 -28.135 1.00 97.71  ? 244  DG  J C8    1 
ATOM   4983  N N7    . DG  B 1 98  ? 109.581 106.664 -27.898 1.00 97.87  ? 244  DG  J N7    1 
ATOM   4984  C C5    . DG  B 1 98  ? 108.662 105.839 -28.535 1.00 96.91  ? 244  DG  J C5    1 
ATOM   4985  C C6    . DG  B 1 98  ? 108.606 104.421 -28.630 1.00 96.12  ? 244  DG  J C6    1 
ATOM   4986  O O6    . DG  B 1 98  ? 109.386 103.585 -28.164 1.00 95.35  ? 244  DG  J O6    1 
ATOM   4987  N N1    . DG  B 1 98  ? 107.502 104.003 -29.365 1.00 96.01  ? 244  DG  J N1    1 
ATOM   4988  C C2    . DG  B 1 98  ? 106.574 104.835 -29.940 1.00 96.31  ? 244  DG  J C2    1 
ATOM   4989  N N2    . DG  B 1 98  ? 105.578 104.236 -30.611 1.00 96.67  ? 244  DG  J N2    1 
ATOM   4990  N N3    . DG  B 1 98  ? 106.617 106.156 -29.863 1.00 96.08  ? 244  DG  J N3    1 
ATOM   4991  C C4    . DG  B 1 98  ? 107.680 106.585 -29.151 1.00 97.15  ? 244  DG  J C4    1 
ATOM   4992  P P     . DA  B 1 99  ? 104.650 112.692 -29.725 1.00 97.16  ? 245  DA  J P     1 
ATOM   4993  O OP1   . DA  B 1 99  ? 105.240 113.543 -30.790 1.00 88.24  ? 245  DA  J OP1   1 
ATOM   4994  O OP2   . DA  B 1 99  ? 104.463 113.241 -28.359 1.00 88.48  ? 245  DA  J OP2   1 
ATOM   4995  O "O5'" . DA  B 1 99  ? 103.239 112.181 -30.249 1.00 95.79  ? 245  DA  J "O5'" 1 
ATOM   4996  C "C5'" . DA  B 1 99  ? 103.126 111.575 -31.536 1.00 92.99  ? 245  DA  J "C5'" 1 
ATOM   4997  C "C4'" . DA  B 1 99  ? 102.218 110.368 -31.474 1.00 90.69  ? 245  DA  J "C4'" 1 
ATOM   4998  O "O4'" . DA  B 1 99  ? 102.866 109.271 -30.785 1.00 89.48  ? 245  DA  J "O4'" 1 
ATOM   4999  C "C3'" . DA  B 1 99  ? 100.894 110.599 -30.751 1.00 89.30  ? 245  DA  J "C3'" 1 
ATOM   5000  O "O3'" . DA  B 1 99  ? 99.854  109.927 -31.458 1.00 88.16  ? 245  DA  J "O3'" 1 
ATOM   5001  C "C2'" . DA  B 1 99  ? 101.124 109.981 -29.382 1.00 88.38  ? 245  DA  J "C2'" 1 
ATOM   5002  C "C1'" . DA  B 1 99  ? 102.066 108.832 -29.696 1.00 88.78  ? 245  DA  J "C1'" 1 
ATOM   5003  N N9    . DA  B 1 99  ? 102.976 108.462 -28.611 1.00 80.28  ? 245  DA  J N9    1 
ATOM   5004  C C8    . DA  B 1 99  ? 103.626 109.296 -27.733 1.00 80.17  ? 245  DA  J C8    1 
ATOM   5005  N N7    . DA  B 1 99  ? 104.432 108.671 -26.908 1.00 79.95  ? 245  DA  J N7    1 
ATOM   5006  C C5    . DA  B 1 99  ? 104.292 107.334 -27.256 1.00 79.60  ? 245  DA  J C5    1 
ATOM   5007  C C6    . DA  B 1 99  ? 104.892 106.161 -26.764 1.00 79.36  ? 245  DA  J C6    1 
ATOM   5008  N N6    . DA  B 1 99  ? 105.804 106.150 -25.788 1.00 79.88  ? 245  DA  J N6    1 
ATOM   5009  N N1    . DA  B 1 99  ? 104.525 104.985 -27.322 1.00 78.86  ? 245  DA  J N1    1 
ATOM   5010  C C2    . DA  B 1 99  ? 103.624 105.000 -28.313 1.00 78.30  ? 245  DA  J C2    1 
ATOM   5011  N N3    . DA  B 1 99  ? 103.000 106.037 -28.870 1.00 78.45  ? 245  DA  J N3    1 
ATOM   5012  C C4    . DA  B 1 99  ? 103.383 107.189 -28.290 1.00 79.69  ? 245  DA  J C4    1 
ATOM   5013  P P     . DG  B 1 100 ? 98.330  110.129 -31.008 1.00 79.75  ? 246  DG  J P     1 
ATOM   5014  O OP1   . DG  B 1 100 ? 97.478  110.064 -32.225 1.00 95.54  ? 246  DG  J OP1   1 
ATOM   5015  O OP2   . DG  B 1 100 ? 98.264  111.323 -30.125 1.00 95.13  ? 246  DG  J OP2   1 
ATOM   5016  O "O5'" . DG  B 1 100 ? 98.049  108.847 -30.111 1.00 78.11  ? 246  DG  J "O5'" 1 
ATOM   5017  C "C5'" . DG  B 1 100 ? 98.349  107.545 -30.598 1.00 75.37  ? 246  DG  J "C5'" 1 
ATOM   5018  C "C4'" . DG  B 1 100 ? 98.194  106.529 -29.493 1.00 73.94  ? 246  DG  J "C4'" 1 
ATOM   5019  O "O4'" . DG  B 1 100 ? 99.314  106.588 -28.577 1.00 74.35  ? 246  DG  J "O4'" 1 
ATOM   5020  C "C3'" . DG  B 1 100 ? 96.939  106.723 -28.640 1.00 71.79  ? 246  DG  J "C3'" 1 
ATOM   5021  O "O3'" . DG  B 1 100 ? 96.421  105.450 -28.288 1.00 68.31  ? 246  DG  J "O3'" 1 
ATOM   5022  C "C2'" . DG  B 1 100 ? 97.476  107.375 -27.382 1.00 73.13  ? 246  DG  J "C2'" 1 
ATOM   5023  C "C1'" . DG  B 1 100 ? 98.815  106.676 -27.253 1.00 75.57  ? 246  DG  J "C1'" 1 
ATOM   5024  N N9    . DG  B 1 100 ? 99.802  107.377 -26.440 1.00 93.08  ? 246  DG  J N9    1 
ATOM   5025  C C8    . DG  B 1 100 ? 99.879  108.729 -26.210 1.00 93.87  ? 246  DG  J C8    1 
ATOM   5026  N N7    . DG  B 1 100 ? 100.868 109.058 -25.428 1.00 94.47  ? 246  DG  J N7    1 
ATOM   5027  C C5    . DG  B 1 100 ? 101.482 107.853 -25.125 1.00 94.62  ? 246  DG  J C5    1 
ATOM   5028  C C6    . DG  B 1 100 ? 102.610 107.580 -24.315 1.00 94.98  ? 246  DG  J C6    1 
ATOM   5029  O O6    . DG  B 1 100 ? 103.311 108.376 -23.677 1.00 95.29  ? 246  DG  J O6    1 
ATOM   5030  N N1    . DG  B 1 100 ? 102.897 106.218 -24.283 1.00 94.65  ? 246  DG  J N1    1 
ATOM   5031  C C2    . DG  B 1 100 ? 102.185 105.244 -24.944 1.00 95.38  ? 246  DG  J C2    1 
ATOM   5032  N N2    . DG  B 1 100 ? 102.617 103.984 -24.791 1.00 95.52  ? 246  DG  J N2    1 
ATOM   5033  N N3    . DG  B 1 100 ? 101.128 105.489 -25.700 1.00 94.01  ? 246  DG  J N3    1 
ATOM   5034  C C4    . DG  B 1 100 ? 100.837 106.806 -25.745 1.00 93.85  ? 246  DG  J C4    1 
ATOM   5035  P P     . DC  B 1 101 ? 94.906  105.081 -28.645 1.00 61.75  ? 247  DC  J P     1 
ATOM   5036  O OP1   . DC  B 1 101 ? 94.713  105.419 -30.072 1.00 65.63  ? 247  DC  J OP1   1 
ATOM   5037  O OP2   . DC  B 1 101 ? 93.983  105.636 -27.627 1.00 65.36  ? 247  DC  J OP2   1 
ATOM   5038  O "O5'" . DC  B 1 101 ? 94.914  103.505 -28.482 1.00 64.38  ? 247  DC  J "O5'" 1 
ATOM   5039  C "C5'" . DC  B 1 101 ? 95.967  102.735 -29.049 1.00 67.00  ? 247  DC  J "C5'" 1 
ATOM   5040  C "C4'" . DC  B 1 101 ? 96.470  101.727 -28.044 1.00 69.00  ? 247  DC  J "C4'" 1 
ATOM   5041  O "O4'" . DC  B 1 101 ? 97.359  102.349 -27.082 1.00 68.52  ? 247  DC  J "O4'" 1 
ATOM   5042  C "C3'" . DC  B 1 101 ? 95.355  101.067 -27.238 1.00 70.05  ? 247  DC  J "C3'" 1 
ATOM   5043  O "O3'" . DC  B 1 101 ? 95.624  99.671  -27.127 1.00 73.18  ? 247  DC  J "O3'" 1 
ATOM   5044  C "C2'" . DC  B 1 101 ? 95.410  101.777 -25.895 1.00 68.87  ? 247  DC  J "C2'" 1 
ATOM   5045  C "C1'" . DC  B 1 101 ? 96.884  102.140 -25.759 1.00 67.79  ? 247  DC  J "C1'" 1 
ATOM   5046  N N1    . DC  B 1 101 ? 97.150  103.373 -24.996 1.00 68.86  ? 247  DC  J N1    1 
ATOM   5047  C C2    . DC  B 1 101 ? 98.096  103.341 -23.956 1.00 68.06  ? 247  DC  J C2    1 
ATOM   5048  O O2    . DC  B 1 101 ? 98.641  102.264 -23.670 1.00 66.12  ? 247  DC  J O2    1 
ATOM   5049  N N3    . DC  B 1 101 ? 98.386  104.487 -23.291 1.00 67.08  ? 247  DC  J N3    1 
ATOM   5050  C C4    . DC  B 1 101 ? 97.768  105.625 -23.622 1.00 66.68  ? 247  DC  J C4    1 
ATOM   5051  N N4    . DC  B 1 101 ? 98.104  106.732 -22.962 1.00 66.28  ? 247  DC  J N4    1 
ATOM   5052  C C5    . DC  B 1 101 ? 96.781  105.676 -24.651 1.00 67.09  ? 247  DC  J C5    1 
ATOM   5053  C C6    . DC  B 1 101 ? 96.506  104.538 -25.305 1.00 67.81  ? 247  DC  J C6    1 
ATOM   5054  P P     . DA  B 1 102 ? 94.598  98.722  -26.344 1.00 82.75  ? 248  DA  J P     1 
ATOM   5055  O OP1   . DA  B 1 102 ? 94.535  97.418  -27.047 1.00 80.87  ? 248  DA  J OP1   1 
ATOM   5056  O OP2   . DA  B 1 102 ? 93.350  99.489  -26.095 1.00 79.66  ? 248  DA  J OP2   1 
ATOM   5057  O "O5'" . DA  B 1 102 ? 95.338  98.486  -24.962 1.00 86.04  ? 248  DA  J "O5'" 1 
ATOM   5058  C "C5'" . DA  B 1 102 ? 94.601  98.254  -23.784 1.00 90.04  ? 248  DA  J "C5'" 1 
ATOM   5059  C "C4'" . DA  B 1 102 ? 95.532  98.232  -22.599 1.00 92.80  ? 248  DA  J "C4'" 1 
ATOM   5060  O "O4'" . DA  B 1 102 ? 96.201  99.513  -22.475 1.00 91.65  ? 248  DA  J "O4'" 1 
ATOM   5061  C "C3'" . DA  B 1 102 ? 94.788  98.010  -21.291 1.00 95.31  ? 248  DA  J "C3'" 1 
ATOM   5062  O "O3'" . DA  B 1 102 ? 95.513  97.113  -20.463 1.00 100.25 ? 248  DA  J "O3'" 1 
ATOM   5063  C "C2'" . DA  B 1 102 ? 94.697  99.395  -20.681 1.00 93.89  ? 248  DA  J "C2'" 1 
ATOM   5064  C "C1'" . DA  B 1 102 ? 95.948  100.076 -21.198 1.00 91.75  ? 248  DA  J "C1'" 1 
ATOM   5065  N N9    . DA  B 1 102 ? 95.782  101.519 -21.363 1.00 87.90  ? 248  DA  J N9    1 
ATOM   5066  C C8    . DA  B 1 102 ? 94.828  102.177 -22.096 1.00 87.78  ? 248  DA  J C8    1 
ATOM   5067  N N7    . DA  B 1 102 ? 94.910  103.483 -22.021 1.00 87.74  ? 248  DA  J N7    1 
ATOM   5068  C C5    . DA  B 1 102 ? 95.998  103.700 -21.187 1.00 87.17  ? 248  DA  J C5    1 
ATOM   5069  C C6    . DA  B 1 102 ? 96.602  104.876 -20.705 1.00 87.00  ? 248  DA  J C6    1 
ATOM   5070  N N6    . DA  B 1 102 ? 96.165  106.106 -20.991 1.00 86.56  ? 248  DA  J N6    1 
ATOM   5071  N N1    . DA  B 1 102 ? 97.678  104.743 -19.901 1.00 86.52  ? 248  DA  J N1    1 
ATOM   5072  C C2    . DA  B 1 102 ? 98.103  103.512 -19.599 1.00 86.76  ? 248  DA  J C2    1 
ATOM   5073  N N3    . DA  B 1 102 ? 97.615  102.334 -19.980 1.00 87.05  ? 248  DA  J N3    1 
ATOM   5074  C C4    . DA  B 1 102 ? 96.551  102.500 -20.784 1.00 87.40  ? 248  DA  J C4    1 
ATOM   5075  P P     . DG  B 1 103 ? 94.735  96.309  -19.321 1.00 118.97 ? 249  DG  J P     1 
ATOM   5076  O OP1   . DG  B 1 103 ? 95.216  94.900  -19.348 1.00 98.79  ? 249  DG  J OP1   1 
ATOM   5077  O OP2   . DG  B 1 103 ? 93.285  96.595  -19.472 1.00 97.40  ? 249  DG  J OP2   1 
ATOM   5078  O "O5'" . DG  B 1 103 ? 95.246  97.008  -17.990 1.00 119.87 ? 249  DG  J "O5'" 1 
ATOM   5079  C "C5'" . DG  B 1 103 ? 96.613  96.926  -17.610 1.00 123.61 ? 249  DG  J "C5'" 1 
ATOM   5080  C "C4'" . DG  B 1 103 ? 96.848  97.759  -16.375 1.00 126.13 ? 249  DG  J "C4'" 1 
ATOM   5081  O "O4'" . DG  B 1 103 ? 96.861  99.160  -16.744 1.00 126.68 ? 249  DG  J "O4'" 1 
ATOM   5082  C "C3'" . DG  B 1 103 ? 95.747  97.600  -15.327 1.00 128.01 ? 249  DG  J "C3'" 1 
ATOM   5083  O "O3'" . DG  B 1 103 ? 96.310  97.532  -14.013 1.00 130.06 ? 249  DG  J "O3'" 1 
ATOM   5084  C "C2'" . DG  B 1 103 ? 94.891  98.840  -15.521 1.00 127.72 ? 249  DG  J "C2'" 1 
ATOM   5085  C "C1'" . DG  B 1 103 ? 95.902  99.874  -15.983 1.00 127.13 ? 249  DG  J "C1'" 1 
ATOM   5086  N N9    . DG  B 1 103 ? 95.339  100.915 -16.835 1.00 106.77 ? 249  DG  J N9    1 
ATOM   5087  C C8    . DG  B 1 103 ? 94.422  100.750 -17.844 1.00 106.98 ? 249  DG  J C8    1 
ATOM   5088  N N7    . DG  B 1 103 ? 94.089  101.870 -18.424 1.00 106.75 ? 249  DG  J N7    1 
ATOM   5089  C C5    . DG  B 1 103 ? 94.832  102.836 -17.761 1.00 106.56 ? 249  DG  J C5    1 
ATOM   5090  C C6    . DG  B 1 103 ? 94.886  104.241 -17.946 1.00 106.57 ? 249  DG  J C6    1 
ATOM   5091  O O6    . DG  B 1 103 ? 94.265  104.936 -18.757 1.00 106.23 ? 249  DG  J O6    1 
ATOM   5092  N N1    . DG  B 1 103 ? 95.775  104.840 -17.062 1.00 106.86 ? 249  DG  J N1    1 
ATOM   5093  C C2    . DG  B 1 103 ? 96.515  104.176 -16.116 1.00 107.00 ? 249  DG  J C2    1 
ATOM   5094  N N2    . DG  B 1 103 ? 97.319  104.936 -15.358 1.00 107.03 ? 249  DG  J N2    1 
ATOM   5095  N N3    . DG  B 1 103 ? 96.471  102.866 -15.927 1.00 106.84 ? 249  DG  J N3    1 
ATOM   5096  C C4    . DG  B 1 103 ? 95.614  102.263 -16.780 1.00 106.90 ? 249  DG  J C4    1 
ATOM   5097  P P     . DT  B 1 104 ? 95.478  98.093  -12.759 1.00 111.81 ? 250  DT  J P     1 
ATOM   5098  O OP1   . DT  B 1 104 ? 96.136  97.587  -11.527 1.00 110.22 ? 250  DT  J OP1   1 
ATOM   5099  O OP2   . DT  B 1 104 ? 94.025  97.854  -12.966 1.00 109.64 ? 250  DT  J OP2   1 
ATOM   5100  O "O5'" . DT  B 1 104 ? 95.745  99.657  -12.842 1.00 112.49 ? 250  DT  J "O5'" 1 
ATOM   5101  C "C5'" . DT  B 1 104 ? 97.048  100.177 -12.609 1.00 114.02 ? 250  DT  J "C5'" 1 
ATOM   5102  C "C4'" . DT  B 1 104 ? 96.952  101.369 -11.692 1.00 115.29 ? 250  DT  J "C4'" 1 
ATOM   5103  O "O4'" . DT  B 1 104 ? 96.424  102.491 -12.436 1.00 115.25 ? 250  DT  J "O4'" 1 
ATOM   5104  C "C3'" . DT  B 1 104 ? 95.972  101.118 -10.551 1.00 116.12 ? 250  DT  J "C3'" 1 
ATOM   5105  O "O3'" . DT  B 1 104 ? 96.414  101.761 -9.362  1.00 118.27 ? 250  DT  J "O3'" 1 
ATOM   5106  C "C2'" . DT  B 1 104 ? 94.678  101.726 -11.059 1.00 116.21 ? 250  DT  J "C2'" 1 
ATOM   5107  C "C1'" . DT  B 1 104 ? 95.158  102.879 -11.926 1.00 115.37 ? 250  DT  J "C1'" 1 
ATOM   5108  N N1    . DT  B 1 104 ? 94.286  103.179 -13.080 1.00 112.81 ? 250  DT  J N1    1 
ATOM   5109  C C2    . DT  B 1 104 ? 94.151  104.493 -13.470 1.00 112.55 ? 250  DT  J C2    1 
ATOM   5110  O O2    . DT  B 1 104 ? 94.709  105.417 -12.903 1.00 112.67 ? 250  DT  J O2    1 
ATOM   5111  N N3    . DT  B 1 104 ? 93.334  104.686 -14.555 1.00 112.10 ? 250  DT  J N3    1 
ATOM   5112  C C4    . DT  B 1 104 ? 92.652  103.721 -15.270 1.00 111.65 ? 250  DT  J C4    1 
ATOM   5113  O O4    . DT  B 1 104 ? 91.962  104.047 -16.231 1.00 110.57 ? 250  DT  J O4    1 
ATOM   5114  C C5    . DT  B 1 104 ? 92.830  102.365 -14.801 1.00 111.77 ? 250  DT  J C5    1 
ATOM   5115  C C7    . DT  B 1 104 ? 92.118  101.254 -15.504 1.00 111.43 ? 250  DT  J C7    1 
ATOM   5116  C C6    . DT  B 1 104 ? 93.630  102.165 -13.746 1.00 112.21 ? 250  DT  J C6    1 
ATOM   5117  P P     . DT  B 1 105 ? 95.599  101.543 -8.001  1.00 142.08 ? 251  DT  J P     1 
ATOM   5118  O OP1   . DT  B 1 105 ? 96.541  101.043 -6.969  1.00 121.66 ? 251  DT  J OP1   1 
ATOM   5119  O OP2   . DT  B 1 105 ? 94.374  100.763 -8.320  1.00 120.92 ? 251  DT  J OP2   1 
ATOM   5120  O "O5'" . DT  B 1 105 ? 95.156  103.018 -7.608  1.00 142.66 ? 251  DT  J "O5'" 1 
ATOM   5121  C "C5'" . DT  B 1 105 ? 96.115  104.067 -7.540  1.00 144.95 ? 251  DT  J "C5'" 1 
ATOM   5122  C "C4'" . DT  B 1 105 ? 95.420  105.379 -7.271  1.00 146.03 ? 251  DT  J "C4'" 1 
ATOM   5123  O "O4'" . DT  B 1 105 ? 94.727  105.824 -8.463  1.00 146.94 ? 251  DT  J "O4'" 1 
ATOM   5124  C "C3'" . DT  B 1 105 ? 94.360  105.281 -6.177  1.00 146.31 ? 251  DT  J "C3'" 1 
ATOM   5125  O "O3'" . DT  B 1 105 ? 94.375  106.460 -5.376  1.00 145.49 ? 251  DT  J "O3'" 1 
ATOM   5126  C "C2'" . DT  B 1 105 ? 93.060  105.174 -6.955  1.00 146.95 ? 251  DT  J "C2'" 1 
ATOM   5127  C "C1'" . DT  B 1 105 ? 93.354  106.034 -8.169  1.00 147.42 ? 251  DT  J "C1'" 1 
ATOM   5128  N N1    . DT  B 1 105 ? 92.569  105.700 -9.375  1.00 126.89 ? 251  DT  J N1    1 
ATOM   5129  C C2    . DT  B 1 105 ? 92.020  106.740 -10.089 1.00 126.97 ? 251  DT  J C2    1 
ATOM   5130  O O2    . DT  B 1 105 ? 92.147  107.910 -9.766  1.00 127.51 ? 251  DT  J O2    1 
ATOM   5131  N N3    . DT  B 1 105 ? 91.310  106.359 -11.201 1.00 126.45 ? 251  DT  J N3    1 
ATOM   5132  C C4    . DT  B 1 105 ? 91.096  105.074 -11.654 1.00 126.16 ? 251  DT  J C4    1 
ATOM   5133  O O4    . DT  B 1 105 ? 90.439  104.886 -12.671 1.00 125.24 ? 251  DT  J O4    1 
ATOM   5134  C C5    . DT  B 1 105 ? 91.691  104.031 -10.853 1.00 126.42 ? 251  DT  J C5    1 
ATOM   5135  C C7    . DT  B 1 105 ? 91.497  102.605 -11.261 1.00 126.82 ? 251  DT  J C7    1 
ATOM   5136  C C6    . DT  B 1 105 ? 92.393  104.391 -9.769  1.00 126.69 ? 251  DT  J C6    1 
ATOM   5137  P P     . DT  B 1 106 ? 93.149  106.760 -4.391  1.00 133.90 ? 252  DT  J P     1 
ATOM   5138  O OP1   . DT  B 1 106 ? 93.652  107.608 -3.282  1.00 115.20 ? 252  DT  J OP1   1 
ATOM   5139  O OP2   . DT  B 1 106 ? 92.484  105.465 -4.087  1.00 114.56 ? 252  DT  J OP2   1 
ATOM   5140  O "O5'" . DT  B 1 106 ? 92.162  107.626 -5.291  1.00 133.63 ? 252  DT  J "O5'" 1 
ATOM   5141  C "C5'" . DT  B 1 106 ? 92.619  108.815 -5.932  1.00 132.32 ? 252  DT  J "C5'" 1 
ATOM   5142  C "C4'" . DT  B 1 106 ? 91.445  109.630 -6.421  1.00 130.92 ? 252  DT  J "C4'" 1 
ATOM   5143  O "O4'" . DT  B 1 106 ? 90.871  109.026 -7.604  1.00 129.59 ? 252  DT  J "O4'" 1 
ATOM   5144  C "C3'" . DT  B 1 106 ? 90.307  109.752 -5.410  1.00 130.32 ? 252  DT  J "C3'" 1 
ATOM   5145  O "O3'" . DT  B 1 106 ? 89.764  111.070 -5.447  1.00 130.27 ? 252  DT  J "O3'" 1 
ATOM   5146  C "C2'" . DT  B 1 106 ? 89.288  108.738 -5.900  1.00 130.12 ? 252  DT  J "C2'" 1 
ATOM   5147  C "C1'" . DT  B 1 106 ? 89.485  108.788 -7.406  1.00 129.15 ? 252  DT  J "C1'" 1 
ATOM   5148  N N1    . DT  B 1 106 ? 89.136  107.547 -8.127  1.00 108.57 ? 252  DT  J N1    1 
ATOM   5149  C C2    . DT  B 1 106 ? 88.538  107.663 -9.364  1.00 107.76 ? 252  DT  J C2    1 
ATOM   5150  O O2    . DT  B 1 106 ? 88.254  108.736 -9.869  1.00 107.44 ? 252  DT  J O2    1 
ATOM   5151  N N3    . DT  B 1 106 ? 88.281  106.469 -9.991  1.00 107.33 ? 252  DT  J N3    1 
ATOM   5152  C C4    . DT  B 1 106 ? 88.546  105.200 -9.512  1.00 107.59 ? 252  DT  J C4    1 
ATOM   5153  O O4    . DT  B 1 106 ? 88.270  104.216 -10.198 1.00 106.56 ? 252  DT  J O4    1 
ATOM   5154  C C5    . DT  B 1 106 ? 89.152  105.152 -8.197  1.00 107.67 ? 252  DT  J C5    1 
ATOM   5155  C C7    . DT  B 1 106 ? 89.458  103.822 -7.585  1.00 107.88 ? 252  DT  J C7    1 
ATOM   5156  C C6    . DT  B 1 106 ? 89.413  106.312 -7.581  1.00 108.11 ? 252  DT  J C6    1 
ATOM   5157  P P     . DC  B 1 107 ? 89.055  111.671 -4.140  1.00 171.36 ? 253  DC  J P     1 
ATOM   5158  O OP1   . DC  B 1 107 ? 89.614  113.031 -3.918  1.00 104.48 ? 253  DC  J OP1   1 
ATOM   5159  O OP2   . DC  B 1 107 ? 89.137  110.655 -3.057  1.00 104.41 ? 253  DC  J OP2   1 
ATOM   5160  O "O5'" . DC  B 1 107 ? 87.531  111.815 -4.576  1.00 170.30 ? 253  DC  J "O5'" 1 
ATOM   5161  C "C5'" . DC  B 1 107 ? 87.153  112.707 -5.621  1.00 170.20 ? 253  DC  J "C5'" 1 
ATOM   5162  C "C4'" . DC  B 1 107 ? 85.740  112.415 -6.069  1.00 169.11 ? 253  DC  J "C4'" 1 
ATOM   5163  O "O4'" . DC  B 1 107 ? 85.696  111.185 -6.832  1.00 170.02 ? 253  DC  J "O4'" 1 
ATOM   5164  C "C3'" . DC  B 1 107 ? 84.733  112.246 -4.930  1.00 168.33 ? 253  DC  J "C3'" 1 
ATOM   5165  O "O3'" . DC  B 1 107 ? 83.489  112.832 -5.309  1.00 165.61 ? 253  DC  J "O3'" 1 
ATOM   5166  C "C2'" . DC  B 1 107 ? 84.572  110.740 -4.833  1.00 168.43 ? 253  DC  J "C2'" 1 
ATOM   5167  C "C1'" . DC  B 1 107 ? 84.703  110.331 -6.289  1.00 169.65 ? 253  DC  J "C1'" 1 
ATOM   5168  N N1    . DC  B 1 107 ? 85.117  108.939 -6.527  1.00 102.65 ? 253  DC  J N1    1 
ATOM   5169  C C2    . DC  B 1 107 ? 84.843  108.367 -7.772  1.00 102.04 ? 253  DC  J C2    1 
ATOM   5170  O O2    . DC  B 1 107 ? 84.275  109.054 -8.633  1.00 101.29 ? 253  DC  J O2    1 
ATOM   5171  N N3    . DC  B 1 107 ? 85.204  107.085 -8.007  1.00 101.45 ? 253  DC  J N3    1 
ATOM   5172  C C4    . DC  B 1 107 ? 85.817  106.380 -7.055  1.00 101.25 ? 253  DC  J C4    1 
ATOM   5173  N N4    . DC  B 1 107 ? 86.150  105.115 -7.329  1.00 99.64  ? 253  DC  J N4    1 
ATOM   5174  C C5    . DC  B 1 107 ? 86.116  106.940 -5.777  1.00 102.09 ? 253  DC  J C5    1 
ATOM   5175  C C6    . DC  B 1 107 ? 85.752  108.211 -5.559  1.00 103.10 ? 253  DC  J C6    1 
ATOM   5176  P P     . DC  B 1 108 ? 83.151  114.335 -4.861  1.00 124.47 ? 254  DC  J P     1 
ATOM   5177  O OP1   . DC  B 1 108 ? 84.373  115.148 -5.095  1.00 107.26 ? 254  DC  J OP1   1 
ATOM   5178  O OP2   . DC  B 1 108 ? 82.526  114.308 -3.512  1.00 107.03 ? 254  DC  J OP2   1 
ATOM   5179  O "O5'" . DC  B 1 108 ? 82.055  114.796 -5.914  1.00 122.05 ? 254  DC  J "O5'" 1 
ATOM   5180  C "C5'" . DC  B 1 108 ? 82.403  115.013 -7.278  1.00 118.26 ? 254  DC  J "C5'" 1 
ATOM   5181  C "C4'" . DC  B 1 108 ? 81.394  114.344 -8.181  1.00 115.53 ? 254  DC  J "C4'" 1 
ATOM   5182  O "O4'" . DC  B 1 108 ? 81.643  112.919 -8.266  1.00 114.60 ? 254  DC  J "O4'" 1 
ATOM   5183  C "C3'" . DC  B 1 108 ? 79.948  114.493 -7.706  1.00 114.22 ? 254  DC  J "C3'" 1 
ATOM   5184  O "O3'" . DC  B 1 108 ? 79.099  114.675 -8.833  1.00 112.11 ? 254  DC  J "O3'" 1 
ATOM   5185  C "C2'" . DC  B 1 108 ? 79.653  113.148 -7.069  1.00 114.13 ? 254  DC  J "C2'" 1 
ATOM   5186  C "C1'" . DC  B 1 108 ? 80.444  112.222 -7.971  1.00 114.42 ? 254  DC  J "C1'" 1 
ATOM   5187  N N1    . DC  B 1 108 ? 80.801  110.916 -7.396  1.00 97.41  ? 254  DC  J N1    1 
ATOM   5188  C C2    . DC  B 1 108 ? 80.870  109.811 -8.250  1.00 97.23  ? 254  DC  J C2    1 
ATOM   5189  O O2    . DC  B 1 108 ? 80.628  109.971 -9.456  1.00 96.59  ? 254  DC  J O2    1 
ATOM   5190  N N3    . DC  B 1 108 ? 81.197  108.600 -7.745  1.00 97.16  ? 254  DC  J N3    1 
ATOM   5191  C C4    . DC  B 1 108 ? 81.451  108.470 -6.441  1.00 97.10  ? 254  DC  J C4    1 
ATOM   5192  N N4    . DC  B 1 108 ? 81.777  107.257 -5.988  1.00 96.68  ? 254  DC  J N4    1 
ATOM   5193  C C5    . DC  B 1 108 ? 81.385  109.580 -5.545  1.00 97.07  ? 254  DC  J C5    1 
ATOM   5194  C C6    . DC  B 1 108 ? 81.059  110.773 -6.061  1.00 97.32  ? 254  DC  J C6    1 
ATOM   5195  P P     . DA  B 1 109 ? 78.073  115.905 -8.863  1.00 111.69 ? 255  DA  J P     1 
ATOM   5196  O OP1   . DA  B 1 109 ? 78.884  117.147 -8.931  1.00 101.46 ? 255  DA  J OP1   1 
ATOM   5197  O OP2   . DA  B 1 109 ? 77.087  115.724 -7.764  1.00 100.43 ? 255  DA  J OP2   1 
ATOM   5198  O "O5'" . DA  B 1 109 ? 77.335  115.721 -10.260 1.00 109.80 ? 255  DA  J "O5'" 1 
ATOM   5199  C "C5'" . DA  B 1 109 ? 78.088  115.459 -11.444 1.00 106.12 ? 255  DA  J "C5'" 1 
ATOM   5200  C "C4'" . DA  B 1 109 ? 77.523  114.259 -12.170 1.00 103.24 ? 255  DA  J "C4'" 1 
ATOM   5201  O "O4'" . DA  B 1 109 ? 77.725  113.061 -11.379 1.00 101.70 ? 255  DA  J "O4'" 1 
ATOM   5202  C "C3'" . DA  B 1 109 ? 76.023  114.336 -12.447 1.00 101.59 ? 255  DA  J "C3'" 1 
ATOM   5203  O "O3'" . DA  B 1 109 ? 75.745  113.799 -13.741 1.00 99.29  ? 255  DA  J "O3'" 1 
ATOM   5204  C "C2'" . DA  B 1 109 ? 75.414  113.481 -11.350 1.00 100.48 ? 255  DA  J "C2'" 1 
ATOM   5205  C "C1'" . DA  B 1 109 ? 76.481  112.427 -11.116 1.00 100.67 ? 255  DA  J "C1'" 1 
ATOM   5206  N N9    . DA  B 1 109 ? 76.525  111.916 -9.747  1.00 89.95  ? 255  DA  J N9    1 
ATOM   5207  C C8    . DA  B 1 109 ? 76.210  112.579 -8.585  1.00 89.67  ? 255  DA  J C8    1 
ATOM   5208  N N7    . DA  B 1 109 ? 76.368  111.855 -7.504  1.00 89.38  ? 255  DA  J N7    1 
ATOM   5209  C C5    . DA  B 1 109 ? 76.817  110.632 -7.984  1.00 89.82  ? 255  DA  J C5    1 
ATOM   5210  C C6    . DA  B 1 109 ? 77.177  109.434 -7.339  1.00 89.89  ? 255  DA  J C6    1 
ATOM   5211  N N6    . DA  B 1 109 ? 77.153  109.267 -6.016  1.00 89.70  ? 255  DA  J N6    1 
ATOM   5212  N N1    . DA  B 1 109 ? 77.572  108.399 -8.112  1.00 89.38  ? 255  DA  J N1    1 
ATOM   5213  C C2    . DA  B 1 109 ? 77.605  108.569 -9.439  1.00 89.17  ? 255  DA  J C2    1 
ATOM   5214  N N3    . DA  B 1 109 ? 77.298  109.644 -10.161 1.00 89.22  ? 255  DA  J N3    1 
ATOM   5215  C C4    . DA  B 1 109 ? 76.908  110.653 -9.365  1.00 89.81  ? 255  DA  J C4    1 
ATOM   5216  P P     . DA  B 1 110 ? 74.224  113.660 -14.237 1.00 88.42  ? 256  DA  J P     1 
ATOM   5217  O OP1   . DA  B 1 110 ? 74.176  114.043 -15.672 1.00 97.01  ? 256  DA  J OP1   1 
ATOM   5218  O OP2   . DA  B 1 110 ? 73.342  114.353 -13.261 1.00 96.39  ? 256  DA  J OP2   1 
ATOM   5219  O "O5'" . DA  B 1 110 ? 73.952  112.097 -14.112 1.00 86.92  ? 256  DA  J "O5'" 1 
ATOM   5220  C "C5'" . DA  B 1 110 ? 74.907  111.156 -14.598 1.00 83.00  ? 256  DA  J "C5'" 1 
ATOM   5221  C "C4'" . DA  B 1 110 ? 74.488  109.751 -14.236 1.00 81.19  ? 256  DA  J "C4'" 1 
ATOM   5222  O "O4'" . DA  B 1 110 ? 74.800  109.444 -12.854 1.00 80.68  ? 256  DA  J "O4'" 1 
ATOM   5223  C "C3'" . DA  B 1 110 ? 72.991  109.485 -14.404 1.00 79.64  ? 256  DA  J "C3'" 1 
ATOM   5224  O "O3'" . DA  B 1 110 ? 72.808  108.183 -14.948 1.00 77.24  ? 256  DA  J "O3'" 1 
ATOM   5225  C "C2'" . DA  B 1 110 ? 72.475  109.505 -12.978 1.00 79.91  ? 256  DA  J "C2'" 1 
ATOM   5226  C "C1'" . DA  B 1 110 ? 73.647  108.896 -12.237 1.00 81.21  ? 256  DA  J "C1'" 1 
ATOM   5227  N N9    . DA  B 1 110 ? 73.691  109.214 -10.812 1.00 91.29  ? 256  DA  J N9    1 
ATOM   5228  C C8    . DA  B 1 110 ? 73.419  110.412 -10.201 1.00 92.18  ? 256  DA  J C8    1 
ATOM   5229  N N7    . DA  B 1 110 ? 73.522  110.373 -8.895  1.00 92.22  ? 256  DA  J N7    1 
ATOM   5230  C C5    . DA  B 1 110 ? 73.893  109.064 -8.630  1.00 92.59  ? 256  DA  J C5    1 
ATOM   5231  C C6    . DA  B 1 110 ? 74.161  108.385 -7.432  1.00 93.12  ? 256  DA  J C6    1 
ATOM   5232  N N6    . DA  B 1 110 ? 74.096  108.956 -6.229  1.00 93.81  ? 256  DA  J N6    1 
ATOM   5233  N N1    . DA  B 1 110 ? 74.505  107.081 -7.512  1.00 93.63  ? 256  DA  J N1    1 
ATOM   5234  C C2    . DA  B 1 110 ? 74.575  106.511 -8.723  1.00 93.45  ? 256  DA  J C2    1 
ATOM   5235  N N3    . DA  B 1 110 ? 74.347  107.047 -9.920  1.00 92.60  ? 256  DA  J N3    1 
ATOM   5236  C C4    . DA  B 1 110 ? 74.006  108.340 -9.802  1.00 91.99  ? 256  DA  J C4    1 
ATOM   5237  P P     . DA  B 1 111 ? 71.363  107.735 -15.484 1.00 69.82  ? 257  DA  J P     1 
ATOM   5238  O OP1   . DA  B 1 111 ? 71.333  107.916 -16.959 1.00 75.11  ? 257  DA  J OP1   1 
ATOM   5239  O OP2   . DA  B 1 111 ? 70.303  108.348 -14.645 1.00 72.88  ? 257  DA  J OP2   1 
ATOM   5240  O "O5'" . DA  B 1 111 ? 71.374  106.178 -15.188 1.00 71.62  ? 257  DA  J "O5'" 1 
ATOM   5241  C "C5'" . DA  B 1 111 ? 72.601  105.458 -15.162 1.00 72.49  ? 257  DA  J "C5'" 1 
ATOM   5242  C "C4'" . DA  B 1 111 ? 72.468  104.283 -14.229 1.00 73.58  ? 257  DA  J "C4'" 1 
ATOM   5243  O "O4'" . DA  B 1 111 ? 72.665  104.713 -12.859 1.00 73.32  ? 257  DA  J "O4'" 1 
ATOM   5244  C "C3'" . DA  B 1 111 ? 71.065  103.693 -14.298 1.00 73.96  ? 257  DA  J "C3'" 1 
ATOM   5245  O "O3'" . DA  B 1 111 ? 71.090  102.274 -14.308 1.00 75.64  ? 257  DA  J "O3'" 1 
ATOM   5246  C "C2'" . DA  B 1 111 ? 70.386  104.216 -13.048 1.00 74.14  ? 257  DA  J "C2'" 1 
ATOM   5247  C "C1'" . DA  B 1 111 ? 71.534  104.378 -12.072 1.00 73.81  ? 257  DA  J "C1'" 1 
ATOM   5248  N N9    . DA  B 1 111 ? 71.314  105.466 -11.120 1.00 78.63  ? 257  DA  J N9    1 
ATOM   5249  C C8    . DA  B 1 111 ? 70.873  106.739 -11.394 1.00 78.33  ? 257  DA  J C8    1 
ATOM   5250  N N7    . DA  B 1 111 ? 70.736  107.493 -10.331 1.00 78.22  ? 257  DA  J N7    1 
ATOM   5251  C C5    . DA  B 1 111 ? 71.119  106.665 -9.285  1.00 79.09  ? 257  DA  J C5    1 
ATOM   5252  C C6    . DA  B 1 111 ? 71.191  106.869 -7.895  1.00 79.48  ? 257  DA  J C6    1 
ATOM   5253  N N6    . DA  B 1 111 ? 70.861  108.019 -7.303  1.00 79.42  ? 257  DA  J N6    1 
ATOM   5254  N N1    . DA  B 1 111 ? 71.616  105.839 -7.126  1.00 79.23  ? 257  DA  J N1    1 
ATOM   5255  C C2    . DA  B 1 111 ? 71.942  104.688 -7.725  1.00 79.74  ? 257  DA  J C2    1 
ATOM   5256  N N3    . DA  B 1 111 ? 71.915  104.373 -9.025  1.00 80.17  ? 257  DA  J N3    1 
ATOM   5257  C C4    . DA  B 1 111 ? 71.488  105.416 -9.757  1.00 78.90  ? 257  DA  J C4    1 
ATOM   5258  P P     . DT  B 1 112 ? 69.707  101.473 -14.269 1.00 70.46  ? 258  DT  J P     1 
ATOM   5259  O OP1   . DT  B 1 112 ? 69.845  100.194 -15.011 1.00 83.47  ? 258  DT  J OP1   1 
ATOM   5260  O OP2   . DT  B 1 112 ? 68.628  102.421 -14.637 1.00 83.67  ? 258  DT  J OP2   1 
ATOM   5261  O "O5'" . DT  B 1 112 ? 69.556  101.169 -12.725 1.00 74.97  ? 258  DT  J "O5'" 1 
ATOM   5262  C "C5'" . DT  B 1 112 ? 68.798  100.072 -12.277 1.00 81.24  ? 258  DT  J "C5'" 1 
ATOM   5263  C "C4'" . DT  B 1 112 ? 69.490  99.438  -11.100 1.00 85.24  ? 258  DT  J "C4'" 1 
ATOM   5264  O "O4'" . DT  B 1 112 ? 70.006  100.486 -10.250 1.00 85.01  ? 258  DT  J "O4'" 1 
ATOM   5265  C "C3'" . DT  B 1 112 ? 68.540  98.621  -10.242 1.00 88.33  ? 258  DT  J "C3'" 1 
ATOM   5266  O "O3'" . DT  B 1 112 ? 69.203  97.482  -9.705  1.00 93.40  ? 258  DT  J "O3'" 1 
ATOM   5267  C "C2'" . DT  B 1 112 ? 68.100  99.603  -9.172  1.00 87.71  ? 258  DT  J "C2'" 1 
ATOM   5268  C "C1'" . DT  B 1 112 ? 69.285  100.546 -9.029  1.00 85.79  ? 258  DT  J "C1'" 1 
ATOM   5269  N N1    . DT  B 1 112 ? 68.902  101.956 -8.814  1.00 96.95  ? 258  DT  J N1    1 
ATOM   5270  C C2    . DT  B 1 112 ? 68.981  102.473 -7.540  1.00 96.37  ? 258  DT  J C2    1 
ATOM   5271  O O2    . DT  B 1 112 ? 69.329  101.816 -6.575  1.00 97.17  ? 258  DT  J O2    1 
ATOM   5272  N N3    . DT  B 1 112 ? 68.635  103.797 -7.436  1.00 95.55  ? 258  DT  J N3    1 
ATOM   5273  C C4    . DT  B 1 112 ? 68.225  104.634 -8.453  1.00 95.30  ? 258  DT  J C4    1 
ATOM   5274  O O4    . DT  B 1 112 ? 67.962  105.807 -8.209  1.00 94.19  ? 258  DT  J O4    1 
ATOM   5275  C C5    . DT  B 1 112 ? 68.148  104.023 -9.762  1.00 95.66  ? 258  DT  J C5    1 
ATOM   5276  C C7    . DT  B 1 112 ? 67.704  104.853 -10.925 1.00 95.74  ? 258  DT  J C7    1 
ATOM   5277  C C6    . DT  B 1 112 ? 68.484  102.732 -9.875  1.00 95.80  ? 258  DT  J C6    1 
ATOM   5278  P P     . DA  B 1 113 ? 68.335  96.214  -9.264  1.00 124.15 ? 259  DA  J P     1 
ATOM   5279  O OP1   . DA  B 1 113 ? 69.270  95.104  -8.941  1.00 107.45 ? 259  DA  J OP1   1 
ATOM   5280  O OP2   . DA  B 1 113 ? 67.281  96.012  -10.290 1.00 106.42 ? 259  DA  J OP2   1 
ATOM   5281  O "O5'" . DA  B 1 113 ? 67.652  96.714  -7.917  1.00 126.86 ? 259  DA  J "O5'" 1 
ATOM   5282  C "C5'" . DA  B 1 113 ? 68.436  96.918  -6.743  1.00 133.01 ? 259  DA  J "C5'" 1 
ATOM   5283  C "C4'" . DA  B 1 113 ? 67.548  97.320  -5.589  1.00 137.00 ? 259  DA  J "C4'" 1 
ATOM   5284  O "O4'" . DA  B 1 113 ? 67.289  98.745  -5.611  1.00 138.03 ? 259  DA  J "O4'" 1 
ATOM   5285  C "C3'" . DA  B 1 113 ? 66.182  96.635  -5.597  1.00 138.98 ? 259  DA  J "C3'" 1 
ATOM   5286  O "O3'" . DA  B 1 113 ? 65.818  96.244  -4.274  1.00 141.02 ? 259  DA  J "O3'" 1 
ATOM   5287  C "C2'" . DA  B 1 113 ? 65.250  97.717  -6.110  1.00 139.61 ? 259  DA  J "C2'" 1 
ATOM   5288  C "C1'" . DA  B 1 113 ? 65.890  98.976  -5.555  1.00 139.61 ? 259  DA  J "C1'" 1 
ATOM   5289  N N9    . DA  B 1 113 ? 65.603  100.189 -6.319  1.00 124.21 ? 259  DA  J N9    1 
ATOM   5290  C C8    . DA  B 1 113 ? 65.388  100.299 -7.670  1.00 124.89 ? 259  DA  J C8    1 
ATOM   5291  N N7    . DA  B 1 113 ? 65.166  101.526 -8.073  1.00 125.61 ? 259  DA  J N7    1 
ATOM   5292  C C5    . DA  B 1 113 ? 65.234  102.276 -6.907  1.00 125.09 ? 259  DA  J C5    1 
ATOM   5293  C C6    . DA  B 1 113 ? 65.086  103.652 -6.658  1.00 125.27 ? 259  DA  J C6    1 
ATOM   5294  N N6    . DA  B 1 113 ? 64.839  104.553 -7.611  1.00 125.37 ? 259  DA  J N6    1 
ATOM   5295  N N1    . DA  B 1 113 ? 65.203  104.075 -5.381  1.00 124.80 ? 259  DA  J N1    1 
ATOM   5296  C C2    . DA  B 1 113 ? 65.457  103.171 -4.429  1.00 124.64 ? 259  DA  J C2    1 
ATOM   5297  N N3    . DA  B 1 113 ? 65.623  101.854 -4.538  1.00 124.71 ? 259  DA  J N3    1 
ATOM   5298  C C4    . DA  B 1 113 ? 65.497  101.465 -5.819  1.00 124.68 ? 259  DA  J C4    1 
ATOM   5299  P P     . DC  B 1 114 ? 64.331  95.719  -3.985  1.00 139.32 ? 260  DC  J P     1 
ATOM   5300  O OP1   . DC  B 1 114 ? 64.406  94.876  -2.765  1.00 107.78 ? 260  DC  J OP1   1 
ATOM   5301  O OP2   . DC  B 1 114 ? 63.773  95.150  -5.240  1.00 106.72 ? 260  DC  J OP2   1 
ATOM   5302  O "O5'" . DC  B 1 114 ? 63.544  97.057  -3.627  1.00 140.06 ? 260  DC  J "O5'" 1 
ATOM   5303  C "C5'" . DC  B 1 114 ? 63.948  97.852  -2.515  1.00 143.08 ? 260  DC  J "C5'" 1 
ATOM   5304  C "C4'" . DC  B 1 114 ? 62.866  98.841  -2.151  1.00 144.98 ? 260  DC  J "C4'" 1 
ATOM   5305  O "O4'" . DC  B 1 114 ? 62.914  100.005 -3.012  1.00 144.77 ? 260  DC  J "O4'" 1 
ATOM   5306  C "C3'" . DC  B 1 114 ? 61.439  98.297  -2.245  1.00 146.56 ? 260  DC  J "C3'" 1 
ATOM   5307  O "O3'" . DC  B 1 114 ? 60.664  98.780  -1.146  1.00 149.27 ? 260  DC  J "O3'" 1 
ATOM   5308  C "C2'" . DC  B 1 114 ? 60.918  98.923  -3.525  1.00 145.53 ? 260  DC  J "C2'" 1 
ATOM   5309  C "C1'" . DC  B 1 114 ? 61.604  100.274 -3.477  1.00 145.00 ? 260  DC  J "C1'" 1 
ATOM   5310  N N1    . DC  B 1 114 ? 61.701  100.995 -4.755  1.00 112.11 ? 260  DC  J N1    1 
ATOM   5311  C C2    . DC  B 1 114 ? 62.071  102.345 -4.735  1.00 111.77 ? 260  DC  J C2    1 
ATOM   5312  O O2    . DC  B 1 114 ? 62.338  102.878 -3.646  1.00 111.32 ? 260  DC  J O2    1 
ATOM   5313  N N3    . DC  B 1 114 ? 62.130  103.032 -5.898  1.00 111.30 ? 260  DC  J N3    1 
ATOM   5314  C C4    . DC  B 1 114 ? 61.846  102.419 -7.049  1.00 111.06 ? 260  DC  J C4    1 
ATOM   5315  N N4    . DC  B 1 114 ? 61.911  103.137 -8.172  1.00 110.21 ? 260  DC  J N4    1 
ATOM   5316  C C5    . DC  B 1 114 ? 61.481  101.041 -7.100  1.00 111.42 ? 260  DC  J C5    1 
ATOM   5317  C C6    . DC  B 1 114 ? 61.424  100.374 -5.941  1.00 112.09 ? 260  DC  J C6    1 
ATOM   5318  P P     . DA  B 1 115 ? 59.395  97.938  -0.635  1.00 151.05 ? 261  DA  J P     1 
ATOM   5319  O OP1   . DA  B 1 115 ? 59.835  97.097  0.507   1.00 141.06 ? 261  DA  J OP1   1 
ATOM   5320  O OP2   . DA  B 1 115 ? 58.760  97.299  -1.815  1.00 140.68 ? 261  DA  J OP2   1 
ATOM   5321  O "O5'" . DA  B 1 115 ? 58.403  99.056  -0.088  1.00 152.65 ? 261  DA  J "O5'" 1 
ATOM   5322  C "C5'" . DA  B 1 115 ? 58.871  100.096 0.769   1.00 156.18 ? 261  DA  J "C5'" 1 
ATOM   5323  C "C4'" . DA  B 1 115 ? 57.985  101.312 0.634   1.00 158.43 ? 261  DA  J "C4'" 1 
ATOM   5324  O "O4'" . DA  B 1 115 ? 58.162  101.894 -0.681  1.00 160.31 ? 261  DA  J "O4'" 1 
ATOM   5325  C "C3'" . DA  B 1 115 ? 56.495  100.995 0.750   1.00 159.03 ? 261  DA  J "C3'" 1 
ATOM   5326  O "O3'" . DA  B 1 115 ? 55.812  102.090 1.373   1.00 157.85 ? 261  DA  J "O3'" 1 
ATOM   5327  C "C2'" . DA  B 1 115 ? 56.069  100.845 -0.698  1.00 160.78 ? 261  DA  J "C2'" 1 
ATOM   5328  C "C1'" . DA  B 1 115 ? 56.921  101.903 -1.372  1.00 162.26 ? 261  DA  J "C1'" 1 
ATOM   5329  N N9    . DA  B 1 115 ? 57.190  101.668 -2.791  1.00 154.51 ? 261  DA  J N9    1 
ATOM   5330  C C8    . DA  B 1 115 ? 57.310  100.467 -3.446  1.00 155.26 ? 261  DA  J C8    1 
ATOM   5331  N N7    . DA  B 1 115 ? 57.562  100.588 -4.727  1.00 156.08 ? 261  DA  J N7    1 
ATOM   5332  C C5    . DA  B 1 115 ? 57.611  101.960 -4.930  1.00 156.22 ? 261  DA  J C5    1 
ATOM   5333  C C6    . DA  B 1 115 ? 57.844  102.740 -6.077  1.00 156.84 ? 261  DA  J C6    1 
ATOM   5334  N N6    . DA  B 1 115 ? 58.087  102.227 -7.285  1.00 156.87 ? 261  DA  J N6    1 
ATOM   5335  N N1    . DA  B 1 115 ? 57.820  104.085 -5.938  1.00 156.85 ? 261  DA  J N1    1 
ATOM   5336  C C2    . DA  B 1 115 ? 57.580  104.599 -4.725  1.00 156.46 ? 261  DA  J C2    1 
ATOM   5337  N N3    . DA  B 1 115 ? 57.350  103.971 -3.574  1.00 156.15 ? 261  DA  J N3    1 
ATOM   5338  C C4    . DA  B 1 115 ? 57.380  102.637 -3.747  1.00 155.73 ? 261  DA  J C4    1 
ATOM   5339  P P     . DC  B 1 116 ? 54.346  101.868 1.996   1.00 157.04 ? 262  DC  J P     1 
ATOM   5340  O OP1   . DC  B 1 116 ? 54.275  102.593 3.290   1.00 138.39 ? 262  DC  J OP1   1 
ATOM   5341  O OP2   . DC  B 1 116 ? 54.053  100.412 1.951   1.00 138.32 ? 262  DC  J OP2   1 
ATOM   5342  O "O5'" . DC  B 1 116 ? 53.382  102.596 0.961   1.00 155.16 ? 262  DC  J "O5'" 1 
ATOM   5343  C "C5'" . DC  B 1 116 ? 53.748  102.699 -0.408  1.00 152.53 ? 262  DC  J "C5'" 1 
ATOM   5344  C "C4'" . DC  B 1 116 ? 53.446  104.083 -0.927  1.00 149.78 ? 262  DC  J "C4'" 1 
ATOM   5345  O "O4'" . DC  B 1 116 ? 54.111  104.260 -2.198  1.00 150.28 ? 262  DC  J "O4'" 1 
ATOM   5346  C "C3'" . DC  B 1 116 ? 51.963  104.330 -1.181  1.00 147.67 ? 262  DC  J "C3'" 1 
ATOM   5347  O "O3'" . DC  B 1 116 ? 51.623  105.677 -0.860  1.00 143.06 ? 262  DC  J "O3'" 1 
ATOM   5348  C "C2'" . DC  B 1 116 ? 51.809  104.055 -2.666  1.00 148.90 ? 262  DC  J "C2'" 1 
ATOM   5349  C "C1'" . DC  B 1 116 ? 53.166  104.443 -3.241  1.00 149.94 ? 262  DC  J "C1'" 1 
ATOM   5350  N N1    . DC  B 1 116 ? 53.595  103.607 -4.376  1.00 130.52 ? 262  DC  J N1    1 
ATOM   5351  C C2    . DC  B 1 116 ? 54.279  104.208 -5.438  1.00 129.85 ? 262  DC  J C2    1 
ATOM   5352  O O2    . DC  B 1 116 ? 54.519  105.424 -5.388  1.00 129.02 ? 262  DC  J O2    1 
ATOM   5353  N N3    . DC  B 1 116 ? 54.664  103.445 -6.490  1.00 129.51 ? 262  DC  J N3    1 
ATOM   5354  C C4    . DC  B 1 116 ? 54.393  102.136 -6.502  1.00 129.28 ? 262  DC  J C4    1 
ATOM   5355  N N4    . DC  B 1 116 ? 54.786  101.424 -7.560  1.00 128.00 ? 262  DC  J N4    1 
ATOM   5356  C C5    . DC  B 1 116 ? 53.705  101.500 -5.429  1.00 129.60 ? 262  DC  J C5    1 
ATOM   5357  C C6    . DC  B 1 116 ? 53.328  102.265 -4.397  1.00 130.48 ? 262  DC  J C6    1 
ATOM   5358  P P     . DT  B 1 117 ? 50.099  106.157 -0.983  1.00 133.26 ? 263  DT  J P     1 
ATOM   5359  O OP1   . DT  B 1 117 ? 49.803  107.032 0.181   1.00 111.89 ? 263  DT  J OP1   1 
ATOM   5360  O OP2   . DT  B 1 117 ? 49.252  104.964 -1.247  1.00 111.46 ? 263  DT  J OP2   1 
ATOM   5361  O "O5'" . DT  B 1 117 ? 50.110  107.070 -2.284  1.00 130.62 ? 263  DT  J "O5'" 1 
ATOM   5362  C "C5'" . DT  B 1 117 ? 50.978  108.196 -2.364  1.00 126.68 ? 263  DT  J "C5'" 1 
ATOM   5363  C "C4'" . DT  B 1 117 ? 50.817  108.883 -3.697  1.00 123.43 ? 263  DT  J "C4'" 1 
ATOM   5364  O "O4'" . DT  B 1 117 ? 51.398  108.073 -4.749  1.00 122.03 ? 263  DT  J "O4'" 1 
ATOM   5365  C "C3'" . DT  B 1 117 ? 49.363  109.123 -4.097  1.00 122.08 ? 263  DT  J "C3'" 1 
ATOM   5366  O "O3'" . DT  B 1 117 ? 49.236  110.417 -4.683  1.00 120.56 ? 263  DT  J "O3'" 1 
ATOM   5367  C "C2'" . DT  B 1 117 ? 49.085  108.026 -5.110  1.00 120.97 ? 263  DT  J "C2'" 1 
ATOM   5368  C "C1'" . DT  B 1 117 ? 50.439  107.846 -5.770  1.00 120.88 ? 263  DT  J "C1'" 1 
ATOM   5369  N N1    . DT  B 1 117 ? 50.678  106.501 -6.333  1.00 98.08  ? 263  DT  J N1    1 
ATOM   5370  C C2    . DT  B 1 117 ? 51.227  106.418 -7.594  1.00 97.50  ? 263  DT  J C2    1 
ATOM   5371  O O2    . DT  B 1 117 ? 51.527  107.398 -8.257  1.00 97.68  ? 263  DT  J O2    1 
ATOM   5372  N N3    . DT  B 1 117 ? 51.412  105.138 -8.055  1.00 96.72  ? 263  DT  J N3    1 
ATOM   5373  C C4    . DT  B 1 117 ? 51.106  103.961 -7.400  1.00 96.12  ? 263  DT  J C4    1 
ATOM   5374  O O4    . DT  B 1 117 ? 51.329  102.883 -7.943  1.00 94.89  ? 263  DT  J O4    1 
ATOM   5375  C C5    . DT  B 1 117 ? 50.532  104.121 -6.083  1.00 96.41  ? 263  DT  J C5    1 
ATOM   5376  C C7    . DT  B 1 117 ? 50.158  102.899 -5.303  1.00 95.94  ? 263  DT  J C7    1 
ATOM   5377  C C6    . DT  B 1 117 ? 50.355  105.366 -5.619  1.00 97.19  ? 263  DT  J C6    1 
ATOM   5378  P P     . DT  B 1 118 ? 47.872  110.827 -5.418  1.00 128.95 ? 264  DT  J P     1 
ATOM   5379  O OP1   . DT  B 1 118 ? 47.638  112.270 -5.149  1.00 107.99 ? 264  DT  J OP1   1 
ATOM   5380  O OP2   . DT  B 1 118 ? 46.817  109.833 -5.085  1.00 108.00 ? 264  DT  J OP2   1 
ATOM   5381  O "O5'" . DT  B 1 118 ? 48.244  110.663 -6.953  1.00 127.61 ? 264  DT  J "O5'" 1 
ATOM   5382  C "C5'" . DT  B 1 118 ? 49.410  111.289 -7.478  1.00 125.65 ? 264  DT  J "C5'" 1 
ATOM   5383  C "C4'" . DT  B 1 118 ? 49.417  111.186 -8.983  1.00 124.05 ? 264  DT  J "C4'" 1 
ATOM   5384  O "O4'" . DT  B 1 118 ? 49.734  109.830 -9.376  1.00 123.50 ? 264  DT  J "O4'" 1 
ATOM   5385  C "C3'" . DT  B 1 118 ? 48.068  111.512 -9.620  1.00 123.47 ? 264  DT  J "C3'" 1 
ATOM   5386  O "O3'" . DT  B 1 118 ? 48.270  112.259 -10.817 1.00 121.72 ? 264  DT  J "O3'" 1 
ATOM   5387  C "C2'" . DT  B 1 118 ? 47.474  110.145 -9.913  1.00 122.71 ? 264  DT  J "C2'" 1 
ATOM   5388  C "C1'" . DT  B 1 118 ? 48.703  109.305 -10.197 1.00 123.47 ? 264  DT  J "C1'" 1 
ATOM   5389  N N1    . DT  B 1 118 ? 48.557  107.878 -9.870  1.00 103.24 ? 264  DT  J N1    1 
ATOM   5390  C C2    . DT  B 1 118 ? 48.940  106.961 -10.819 1.00 103.26 ? 264  DT  J C2    1 
ATOM   5391  O O2    . DT  B 1 118 ? 49.376  107.280 -11.912 1.00 103.31 ? 264  DT  J O2    1 
ATOM   5392  N N3    . DT  B 1 118 ? 48.794  105.651 -10.441 1.00 103.15 ? 264  DT  J N3    1 
ATOM   5393  C C4    . DT  B 1 118 ? 48.310  105.178 -9.239  1.00 103.25 ? 264  DT  J C4    1 
ATOM   5394  O O4    . DT  B 1 118 ? 48.245  103.969 -9.041  1.00 103.02 ? 264  DT  J O4    1 
ATOM   5395  C C5    . DT  B 1 118 ? 47.913  106.196 -8.292  1.00 103.75 ? 264  DT  J C5    1 
ATOM   5396  C C7    . DT  B 1 118 ? 47.360  105.780 -6.965  1.00 104.10 ? 264  DT  J C7    1 
ATOM   5397  C C6    . DT  B 1 118 ? 48.057  107.479 -8.650  1.00 103.75 ? 264  DT  J C6    1 
ATOM   5398  P P     . DT  B 1 119 ? 47.012  112.674 -11.721 1.00 95.15  ? 265  DT  J P     1 
ATOM   5399  O OP1   . DT  B 1 119 ? 47.054  114.148 -11.897 1.00 112.13 ? 265  DT  J OP1   1 
ATOM   5400  O OP2   . DT  B 1 119 ? 45.783  112.031 -11.191 1.00 112.62 ? 265  DT  J OP2   1 
ATOM   5401  O "O5'" . DT  B 1 119 ? 47.366  111.995 -13.111 1.00 94.27  ? 265  DT  J "O5'" 1 
ATOM   5402  C "C5'" . DT  B 1 119 ? 48.716  111.949 -13.554 1.00 90.55  ? 265  DT  J "C5'" 1 
ATOM   5403  C "C4'" . DT  B 1 119 ? 48.838  111.055 -14.762 1.00 87.92  ? 265  DT  J "C4'" 1 
ATOM   5404  O "O4'" . DT  B 1 119 ? 48.717  109.666 -14.370 1.00 87.40  ? 265  DT  J "O4'" 1 
ATOM   5405  C "C3'" . DT  B 1 119 ? 47.777  111.297 -15.832 1.00 86.09  ? 265  DT  J "C3'" 1 
ATOM   5406  O "O3'" . DT  B 1 119 ? 48.397  111.324 -17.115 1.00 83.90  ? 265  DT  J "O3'" 1 
ATOM   5407  C "C2'" . DT  B 1 119 ? 46.836  110.112 -15.686 1.00 86.55  ? 265  DT  J "C2'" 1 
ATOM   5408  C "C1'" . DT  B 1 119 ? 47.751  109.015 -15.178 1.00 87.30  ? 265  DT  J "C1'" 1 
ATOM   5409  N N1    . DT  B 1 119 ? 47.086  107.993 -14.347 1.00 105.99 ? 265  DT  J N1    1 
ATOM   5410  C C2    . DT  B 1 119 ? 47.061  106.696 -14.807 1.00 106.97 ? 265  DT  J C2    1 
ATOM   5411  O O2    . DT  B 1 119 ? 47.556  106.356 -15.866 1.00 108.73 ? 265  DT  J O2    1 
ATOM   5412  N N3    . DT  B 1 119 ? 46.432  105.803 -13.976 1.00 107.00 ? 265  DT  J N3    1 
ATOM   5413  C C4    . DT  B 1 119 ? 45.841  106.072 -12.758 1.00 107.34 ? 265  DT  J C4    1 
ATOM   5414  O O4    . DT  B 1 119 ? 45.317  105.165 -12.121 1.00 107.34 ? 265  DT  J O4    1 
ATOM   5415  C C5    . DT  B 1 119 ? 45.903  107.454 -12.334 1.00 107.49 ? 265  DT  J C5    1 
ATOM   5416  C C7    . DT  B 1 119 ? 45.292  107.839 -11.024 1.00 107.33 ? 265  DT  J C7    1 
ATOM   5417  C C6    . DT  B 1 119 ? 46.512  108.333 -13.141 1.00 107.28 ? 265  DT  J C6    1 
ATOM   5418  P P     . DT  B 1 120 ? 47.501  111.223 -18.435 1.00 88.75  ? 266  DT  J P     1 
ATOM   5419  O OP1   . DT  B 1 120 ? 48.158  112.057 -19.470 1.00 96.07  ? 266  DT  J OP1   1 
ATOM   5420  O OP2   . DT  B 1 120 ? 46.075  111.459 -18.095 1.00 95.68  ? 266  DT  J OP2   1 
ATOM   5421  O "O5'" . DT  B 1 120 ? 47.671  109.699 -18.840 1.00 88.31  ? 266  DT  J "O5'" 1 
ATOM   5422  C "C5'" . DT  B 1 120 ? 48.958  109.096 -18.834 1.00 85.60  ? 266  DT  J "C5'" 1 
ATOM   5423  C "C4'" . DT  B 1 120 ? 48.903  107.767 -19.544 1.00 84.42  ? 266  DT  J "C4'" 1 
ATOM   5424  O "O4'" . DT  B 1 120 ? 48.214  106.799 -18.717 1.00 84.47  ? 266  DT  J "O4'" 1 
ATOM   5425  C "C3'" . DT  B 1 120 ? 48.135  107.826 -20.861 1.00 83.47  ? 266  DT  J "C3'" 1 
ATOM   5426  O "O3'" . DT  B 1 120 ? 48.788  107.020 -21.831 1.00 81.74  ? 266  DT  J "O3'" 1 
ATOM   5427  C "C2'" . DT  B 1 120 ? 46.777  107.242 -20.512 1.00 83.77  ? 266  DT  J "C2'" 1 
ATOM   5428  C "C1'" . DT  B 1 120 ? 47.112  106.244 -19.419 1.00 83.95  ? 266  DT  J "C1'" 1 
ATOM   5429  N N1    . DT  B 1 120 ? 46.025  106.028 -18.445 1.00 90.41  ? 266  DT  J N1    1 
ATOM   5430  C C2    . DT  B 1 120 ? 45.656  104.735 -18.136 1.00 90.20  ? 266  DT  J C2    1 
ATOM   5431  O O2    . DT  B 1 120 ? 46.184  103.752 -18.625 1.00 88.36  ? 266  DT  J O2    1 
ATOM   5432  N N3    . DT  B 1 120 ? 44.640  104.637 -17.221 1.00 91.34  ? 266  DT  J N3    1 
ATOM   5433  C C4    . DT  B 1 120 ? 43.975  105.674 -16.595 1.00 92.07  ? 266  DT  J C4    1 
ATOM   5434  O O4    . DT  B 1 120 ? 43.085  105.430 -15.786 1.00 92.65  ? 266  DT  J O4    1 
ATOM   5435  C C5    . DT  B 1 120 ? 44.413  106.998 -16.964 1.00 91.82  ? 266  DT  J C5    1 
ATOM   5436  C C7    . DT  B 1 120 ? 43.754  108.183 -16.333 1.00 92.54  ? 266  DT  J C7    1 
ATOM   5437  C C6    . DT  B 1 120 ? 45.400  107.107 -17.860 1.00 91.37  ? 266  DT  J C6    1 
ATOM   5438  P P     . DG  B 1 121 ? 48.509  107.270 -23.389 1.00 82.28  ? 267  DG  J P     1 
ATOM   5439  O OP1   . DG  B 1 121 ? 49.607  108.109 -23.927 1.00 89.88  ? 267  DG  J OP1   1 
ATOM   5440  O OP2   . DG  B 1 121 ? 47.098  107.713 -23.555 1.00 89.33  ? 267  DG  J OP2   1 
ATOM   5441  O "O5'" . DG  B 1 121 ? 48.640  105.805 -23.994 1.00 78.50  ? 267  DG  J "O5'" 1 
ATOM   5442  C "C5'" . DG  B 1 121 ? 49.535  104.867 -23.412 1.00 72.13  ? 267  DG  J "C5'" 1 
ATOM   5443  C "C4'" . DG  B 1 121 ? 48.937  103.482 -23.449 1.00 69.17  ? 267  DG  J "C4'" 1 
ATOM   5444  O "O4'" . DG  B 1 121 ? 47.828  103.380 -22.530 1.00 68.47  ? 267  DG  J "O4'" 1 
ATOM   5445  C "C3'" . DG  B 1 121 ? 48.400  103.044 -24.805 1.00 67.08  ? 267  DG  J "C3'" 1 
ATOM   5446  O "O3'" . DG  B 1 121 ? 48.675  101.655 -24.950 1.00 64.95  ? 267  DG  J "O3'" 1 
ATOM   5447  C "C2'" . DG  B 1 121 ? 46.909  103.314 -24.695 1.00 66.70  ? 267  DG  J "C2'" 1 
ATOM   5448  C "C1'" . DG  B 1 121 ? 46.629  103.067 -23.222 1.00 68.22  ? 267  DG  J "C1'" 1 
ATOM   5449  N N9    . DG  B 1 121 ? 45.574  103.900 -22.649 1.00 78.09  ? 267  DG  J N9    1 
ATOM   5450  C C8    . DG  B 1 121 ? 45.299  105.216 -22.942 1.00 78.02  ? 267  DG  J C8    1 
ATOM   5451  N N7    . DG  B 1 121 ? 44.325  105.708 -22.225 1.00 77.82  ? 267  DG  J N7    1 
ATOM   5452  C C5    . DG  B 1 121 ? 43.925  104.651 -21.419 1.00 78.29  ? 267  DG  J C5    1 
ATOM   5453  C C6    . DG  B 1 121 ? 42.912  104.582 -20.425 1.00 78.15  ? 267  DG  J C6    1 
ATOM   5454  O O6    . DG  B 1 121 ? 42.138  105.471 -20.049 1.00 79.41  ? 267  DG  J O6    1 
ATOM   5455  N N1    . DG  B 1 121 ? 42.850  103.318 -19.848 1.00 77.80  ? 267  DG  J N1    1 
ATOM   5456  C C2    . DG  B 1 121 ? 43.653  102.255 -20.186 1.00 77.70  ? 267  DG  J C2    1 
ATOM   5457  N N2    . DG  B 1 121 ? 43.445  101.114 -19.520 1.00 77.28  ? 267  DG  J N2    1 
ATOM   5458  N N3    . DG  B 1 121 ? 44.595  102.305 -21.110 1.00 77.68  ? 267  DG  J N3    1 
ATOM   5459  C C4    . DG  B 1 121 ? 44.678  103.524 -21.679 1.00 77.95  ? 267  DG  J C4    1 
ATOM   5460  P P     . DG  B 1 122 ? 48.448  100.930 -26.359 1.00 58.24  ? 268  DG  J P     1 
ATOM   5461  O OP1   . DG  B 1 122 ? 49.739  100.317 -26.774 1.00 71.12  ? 268  DG  J OP1   1 
ATOM   5462  O OP2   . DG  B 1 122 ? 47.746  101.871 -27.270 1.00 70.11  ? 268  DG  J OP2   1 
ATOM   5463  O "O5'" . DG  B 1 122 ? 47.457  99.754  -25.964 1.00 60.23  ? 268  DG  J "O5'" 1 
ATOM   5464  C "C5'" . DG  B 1 122 ? 46.625  99.907  -24.828 1.00 64.77  ? 268  DG  J "C5'" 1 
ATOM   5465  C "C4'" . DG  B 1 122 ? 45.861  98.640  -24.550 1.00 67.33  ? 268  DG  J "C4'" 1 
ATOM   5466  O "O4'" . DG  B 1 122 ? 44.803  99.021  -23.644 1.00 68.98  ? 268  DG  J "O4'" 1 
ATOM   5467  C "C3'" . DG  B 1 122 ? 45.158  98.068  -25.775 1.00 68.31  ? 268  DG  J "C3'" 1 
ATOM   5468  O "O3'" . DG  B 1 122 ? 44.983  96.661  -25.613 1.00 68.84  ? 268  DG  J "O3'" 1 
ATOM   5469  C "C2'" . DG  B 1 122 ? 43.833  98.804  -25.791 1.00 69.89  ? 268  DG  J "C2'" 1 
ATOM   5470  C "C1'" . DG  B 1 122 ? 43.552  99.056  -24.318 1.00 70.56  ? 268  DG  J "C1'" 1 
ATOM   5471  N N9    . DG  B 1 122 ? 42.944  100.357 -24.053 1.00 84.53  ? 268  DG  J N9    1 
ATOM   5472  C C8    . DG  B 1 122 ? 43.099  101.514 -24.780 1.00 84.99  ? 268  DG  J C8    1 
ATOM   5473  N N7    . DG  B 1 122 ? 42.413  102.516 -24.300 1.00 84.90  ? 268  DG  J N7    1 
ATOM   5474  C C5    . DG  B 1 122 ? 41.769  101.991 -23.189 1.00 86.35  ? 268  DG  J C5    1 
ATOM   5475  C C6    . DG  B 1 122 ? 40.874  102.602 -22.261 1.00 87.54  ? 268  DG  J C6    1 
ATOM   5476  O O6    . DG  B 1 122 ? 40.457  103.772 -22.237 1.00 87.77  ? 268  DG  J O6    1 
ATOM   5477  N N1    . DG  B 1 122 ? 40.458  101.699 -21.287 1.00 87.96  ? 268  DG  J N1    1 
ATOM   5478  C C2    . DG  B 1 122 ? 40.842  100.381 -21.213 1.00 88.04  ? 268  DG  J C2    1 
ATOM   5479  N N2    . DG  B 1 122 ? 40.325  99.668  -20.201 1.00 88.94  ? 268  DG  J N2    1 
ATOM   5480  N N3    . DG  B 1 122 ? 41.671  99.802  -22.068 1.00 86.80  ? 268  DG  J N3    1 
ATOM   5481  C C4    . DG  B 1 122 ? 42.091  100.659 -23.022 1.00 85.62  ? 268  DG  J C4    1 
ATOM   5482  P P     . DT  B 1 123 ? 44.241  95.813  -26.756 1.00 66.24  ? 269  DT  J P     1 
ATOM   5483  O OP1   . DT  B 1 123 ? 44.776  94.425  -26.699 1.00 67.44  ? 269  DT  J OP1   1 
ATOM   5484  O OP2   . DT  B 1 123 ? 44.313  96.580  -28.025 1.00 68.65  ? 269  DT  J OP2   1 
ATOM   5485  O "O5'" . DT  B 1 123 ? 42.716  95.806  -26.297 1.00 71.11  ? 269  DT  J "O5'" 1 
ATOM   5486  C "C5'" . DT  B 1 123 ? 42.346  95.358  -24.993 1.00 76.99  ? 269  DT  J "C5'" 1 
ATOM   5487  C "C4'" . DT  B 1 123 ? 40.855  95.498  -24.794 1.00 82.03  ? 269  DT  J "C4'" 1 
ATOM   5488  O "O4'" . DT  B 1 123 ? 40.505  96.867  -24.470 1.00 81.20  ? 269  DT  J "O4'" 1 
ATOM   5489  C "C3'" . DT  B 1 123 ? 40.027  95.120  -26.023 1.00 86.17  ? 269  DT  J "C3'" 1 
ATOM   5490  O "O3'" . DT  B 1 123 ? 38.882  94.358  -25.641 1.00 95.12  ? 269  DT  J "O3'" 1 
ATOM   5491  C "C2'" . DT  B 1 123 ? 39.592  96.463  -26.579 1.00 84.74  ? 269  DT  J "C2'" 1 
ATOM   5492  C "C1'" . DT  B 1 123 ? 39.443  97.285  -25.314 1.00 82.23  ? 269  DT  J "C1'" 1 
ATOM   5493  N N1    . DT  B 1 123 ? 39.543  98.749  -25.503 1.00 83.64  ? 269  DT  J N1    1 
ATOM   5494  C C2    . DT  B 1 123 ? 39.019  99.571  -24.523 1.00 83.31  ? 269  DT  J C2    1 
ATOM   5495  O O2    . DT  B 1 123 ? 38.497  99.150  -23.502 1.00 83.17  ? 269  DT  J O2    1 
ATOM   5496  N N3    . DT  B 1 123 ? 39.133  100.914 -24.783 1.00 82.76  ? 269  DT  J N3    1 
ATOM   5497  C C4    . DT  B 1 123 ? 39.709  101.506 -25.889 1.00 83.23  ? 269  DT  J C4    1 
ATOM   5498  O O4    . DT  B 1 123 ? 39.742  102.731 -25.979 1.00 82.29  ? 269  DT  J O4    1 
ATOM   5499  C C5    . DT  B 1 123 ? 40.242  100.588 -26.871 1.00 83.50  ? 269  DT  J C5    1 
ATOM   5500  C C7    . DT  B 1 123 ? 40.886  101.141 -28.104 1.00 84.90  ? 269  DT  J C7    1 
ATOM   5501  C C6    . DT  B 1 123 ? 40.135  99.274  -26.633 1.00 83.29  ? 269  DT  J C6    1 
ATOM   5502  P P     . DA  B 1 124 ? 38.449  93.081  -26.515 1.00 153.66 ? 270  DA  J P     1 
ATOM   5503  O OP1   . DA  B 1 124 ? 39.413  91.978  -26.266 1.00 107.53 ? 270  DA  J OP1   1 
ATOM   5504  O OP2   . DA  B 1 124 ? 38.223  93.555  -27.903 1.00 107.52 ? 270  DA  J OP2   1 
ATOM   5505  O "O5'" . DA  B 1 124 ? 37.038  92.676  -25.900 1.00 159.22 ? 270  DA  J "O5'" 1 
ATOM   5506  C "C5'" . DA  B 1 124 ? 36.863  92.541  -24.488 1.00 171.61 ? 270  DA  J "C5'" 1 
ATOM   5507  C "C4'" . DA  B 1 124 ? 35.558  93.174  -24.070 1.00 179.58 ? 270  DA  J "C4'" 1 
ATOM   5508  O "O4'" . DA  B 1 124 ? 35.688  94.619  -24.094 1.00 181.73 ? 270  DA  J "O4'" 1 
ATOM   5509  C "C3'" . DA  B 1 124 ? 34.420  92.832  -25.030 1.00 184.61 ? 270  DA  J "C3'" 1 
ATOM   5510  O "O3'" . DA  B 1 124 ? 33.202  92.577  -24.331 1.00 190.89 ? 270  DA  J "O3'" 1 
ATOM   5511  C "C2'" . DA  B 1 124 ? 34.319  94.061  -25.916 1.00 183.96 ? 270  DA  J "C2'" 1 
ATOM   5512  C "C1'" . DA  B 1 124 ? 34.721  95.178  -24.969 1.00 183.67 ? 270  DA  J "C1'" 1 
ATOM   5513  N N9    . DA  B 1 124 ? 35.320  96.339  -25.628 1.00 138.26 ? 270  DA  J N9    1 
ATOM   5514  C C8    . DA  B 1 124 ? 36.178  96.364  -26.703 1.00 139.46 ? 270  DA  J C8    1 
ATOM   5515  N N7    . DA  B 1 124 ? 36.515  97.573  -27.079 1.00 139.45 ? 270  DA  J N7    1 
ATOM   5516  C C5    . DA  B 1 124 ? 35.843  98.396  -26.186 1.00 138.41 ? 270  DA  J C5    1 
ATOM   5517  C C6    . DA  B 1 124 ? 35.785  99.782  -26.056 1.00 137.98 ? 270  DA  J C6    1 
ATOM   5518  N N6    . DA  B 1 124 ? 36.455  100.608 -26.858 1.00 137.16 ? 270  DA  J N6    1 
ATOM   5519  N N1    . DA  B 1 124 ? 35.013  100.296 -25.067 1.00 137.49 ? 270  DA  J N1    1 
ATOM   5520  C C2    . DA  B 1 124 ? 34.358  99.449  -24.264 1.00 137.59 ? 270  DA  J C2    1 
ATOM   5521  N N3    . DA  B 1 124 ? 34.341  98.120  -24.285 1.00 138.21 ? 270  DA  J N3    1 
ATOM   5522  C C4    . DA  B 1 124 ? 35.110  97.652  -25.284 1.00 138.44 ? 270  DA  J C4    1 
ATOM   5523  P P     . DG  B 1 125 ? 31.900  92.144  -25.158 1.00 167.94 ? 271  DG  J P     1 
ATOM   5524  O OP1   . DG  B 1 125 ? 30.838  91.851  -24.163 1.00 154.59 ? 271  DG  J OP1   1 
ATOM   5525  O OP2   . DG  B 1 125 ? 32.287  91.099  -26.147 1.00 154.21 ? 271  DG  J OP2   1 
ATOM   5526  O "O5'" . DG  B 1 125 ? 31.512  93.481  -25.934 1.00 171.71 ? 271  DG  J "O5'" 1 
ATOM   5527  C "C5'" . DG  B 1 125 ? 30.896  94.568  -25.242 1.00 178.51 ? 271  DG  J "C5'" 1 
ATOM   5528  C "C4'" . DG  B 1 125 ? 30.290  95.538  -26.227 1.00 183.23 ? 271  DG  J "C4'" 1 
ATOM   5529  O "O4'" . DG  B 1 125 ? 31.310  96.409  -26.774 1.00 183.85 ? 271  DG  J "O4'" 1 
ATOM   5530  C "C3'" . DG  B 1 125 ? 29.617  94.860  -27.421 1.00 186.51 ? 271  DG  J "C3'" 1 
ATOM   5531  O "O3'" . DG  B 1 125 ? 28.389  95.516  -27.737 1.00 191.49 ? 271  DG  J "O3'" 1 
ATOM   5532  C "C2'" . DG  B 1 125 ? 30.623  95.052  -28.542 1.00 185.93 ? 271  DG  J "C2'" 1 
ATOM   5533  C "C1'" . DG  B 1 125 ? 31.220  96.400  -28.187 1.00 185.09 ? 271  DG  J "C1'" 1 
ATOM   5534  N N9    . DG  B 1 125 ? 32.549  96.663  -28.732 1.00 171.85 ? 271  DG  J N9    1 
ATOM   5535  C C8    . DG  B 1 125 ? 33.401  95.763  -29.327 1.00 172.04 ? 271  DG  J C8    1 
ATOM   5536  N N7    . DG  B 1 125 ? 34.512  96.308  -29.744 1.00 171.76 ? 271  DG  J N7    1 
ATOM   5537  C C5    . DG  B 1 125 ? 34.389  97.647  -29.399 1.00 171.52 ? 271  DG  J C5    1 
ATOM   5538  C C6    . DG  B 1 125 ? 35.280  98.733  -29.599 1.00 171.18 ? 271  DG  J C6    1 
ATOM   5539  O O6    . DG  B 1 125 ? 36.390  98.729  -30.143 1.00 170.57 ? 271  DG  J O6    1 
ATOM   5540  N N1    . DG  B 1 125 ? 34.763  99.920  -29.089 1.00 171.05 ? 271  DG  J N1    1 
ATOM   5541  C C2    . DG  B 1 125 ? 33.546  100.049 -28.467 1.00 171.11 ? 271  DG  J C2    1 
ATOM   5542  N N2    . DG  B 1 125 ? 33.226  101.278 -28.041 1.00 170.93 ? 271  DG  J N2    1 
ATOM   5543  N N3    . DG  B 1 125 ? 32.704  99.045  -28.277 1.00 171.38 ? 271  DG  J N3    1 
ATOM   5544  C C4    . DG  B 1 125 ? 33.187  97.882  -28.765 1.00 171.70 ? 271  DG  J C4    1 
ATOM   5545  P P     . DA  B 1 126 ? 27.081  94.641  -28.066 1.00 199.95 ? 272  DA  J P     1 
ATOM   5546  O OP1   . DA  B 1 126 ? 26.737  93.827  -26.871 1.00 189.18 ? 272  DA  J OP1   1 
ATOM   5547  O OP2   . DA  B 1 126 ? 27.309  93.967  -29.370 1.00 189.14 ? 272  DA  J OP2   1 
ATOM   5548  O "O5'" . DA  B 1 126 ? 25.947  95.740  -28.265 1.00 200.00 ? 272  DA  J "O5'" 1 
ATOM   5549  C "C5'" . DA  B 1 126 ? 25.459  96.495  -27.157 1.00 200.00 ? 272  DA  J "C5'" 1 
ATOM   5550  C "C4'" . DA  B 1 126 ? 25.227  97.931  -27.565 1.00 200.00 ? 272  DA  J "C4'" 1 
ATOM   5551  O "O4'" . DA  B 1 126 ? 26.502  98.590  -27.769 1.00 200.00 ? 272  DA  J "O4'" 1 
ATOM   5552  C "C3'" . DA  B 1 126 ? 24.452  98.094  -28.873 1.00 200.00 ? 272  DA  J "C3'" 1 
ATOM   5553  O "O3'" . DA  B 1 126 ? 23.558  99.207  -28.794 1.00 200.00 ? 272  DA  J "O3'" 1 
ATOM   5554  C "C2'" . DA  B 1 126 ? 25.541  98.370  -29.892 1.00 200.00 ? 272  DA  J "C2'" 1 
ATOM   5555  C "C1'" . DA  B 1 126 ? 26.547  99.153  -29.072 1.00 200.00 ? 272  DA  J "C1'" 1 
ATOM   5556  N N9    . DA  B 1 126 ? 27.919  99.049  -29.568 1.00 199.71 ? 272  DA  J N9    1 
ATOM   5557  C C8    . DA  B 1 126 ? 28.557  97.932  -30.047 1.00 200.00 ? 272  DA  J C8    1 
ATOM   5558  N N7    . DA  B 1 126 ? 29.782  98.156  -30.454 1.00 200.00 ? 272  DA  J N7    1 
ATOM   5559  C C5    . DA  B 1 126 ? 29.968  99.512  -30.222 1.00 200.00 ? 272  DA  J C5    1 
ATOM   5560  C C6    . DA  B 1 126 ? 31.059  100.370 -30.446 1.00 200.00 ? 272  DA  J C6    1 
ATOM   5561  N N6    . DA  B 1 126 ? 32.214  99.973  -30.989 1.00 200.00 ? 272  DA  J N6    1 
ATOM   5562  N N1    . DA  B 1 126 ? 30.921  101.667 -30.097 1.00 200.00 ? 272  DA  J N1    1 
ATOM   5563  C C2    . DA  B 1 126 ? 29.758  102.067 -29.566 1.00 200.00 ? 272  DA  J C2    1 
ATOM   5564  N N3    . DA  B 1 126 ? 28.659  101.359 -29.313 1.00 200.00 ? 272  DA  J N3    1 
ATOM   5565  C C4    . DA  B 1 126 ? 28.831  100.073 -29.668 1.00 200.00 ? 272  DA  J C4    1 
ATOM   5566  P P     . DA  B 1 127 ? 22.905  99.799  -30.138 1.00 200.00 ? 273  DA  J P     1 
ATOM   5567  O OP1   . DA  B 1 127 ? 21.664  100.528 -29.774 1.00 198.36 ? 273  DA  J OP1   1 
ATOM   5568  O OP2   . DA  B 1 127 ? 22.845  98.698  -31.133 1.00 198.06 ? 273  DA  J OP2   1 
ATOM   5569  O "O5'" . DA  B 1 127 ? 23.980  100.863 -30.638 1.00 200.00 ? 273  DA  J "O5'" 1 
ATOM   5570  C "C5'" . DA  B 1 127 ? 24.246  102.037 -29.874 1.00 200.00 ? 273  DA  J "C5'" 1 
ATOM   5571  C "C4'" . DA  B 1 127 ? 24.811  103.124 -30.758 1.00 200.00 ? 273  DA  J "C4'" 1 
ATOM   5572  O "O4'" . DA  B 1 127 ? 26.218  102.893 -31.024 1.00 200.00 ? 273  DA  J "O4'" 1 
ATOM   5573  C "C3'" . DA  B 1 127 ? 24.132  103.257 -32.123 1.00 200.00 ? 273  DA  J "C3'" 1 
ATOM   5574  O "O3'" . DA  B 1 127 ? 23.948  104.637 -32.443 1.00 198.61 ? 273  DA  J "O3'" 1 
ATOM   5575  C "C2'" . DA  B 1 127 ? 25.135  102.629 -33.074 1.00 200.00 ? 273  DA  J "C2'" 1 
ATOM   5576  C "C1'" . DA  B 1 127 ? 26.453  102.999 -32.420 1.00 200.00 ? 273  DA  J "C1'" 1 
ATOM   5577  N N9    . DA  B 1 127 ? 27.581  102.130 -32.768 1.00 200.00 ? 273  DA  J N9    1 
ATOM   5578  C C8    . DA  B 1 127 ? 27.554  100.790 -33.072 1.00 200.00 ? 273  DA  J C8    1 
ATOM   5579  N N7    . DA  B 1 127 ? 28.731  100.291 -33.371 1.00 200.00 ? 273  DA  J N7    1 
ATOM   5580  C C5    . DA  B 1 127 ? 29.593  101.373 -33.251 1.00 200.00 ? 273  DA  J C5    1 
ATOM   5581  C C6    . DA  B 1 127 ? 30.984  101.503 -33.437 1.00 200.00 ? 273  DA  J C6    1 
ATOM   5582  N N6    . DA  B 1 127 ? 31.781  100.496 -33.802 1.00 200.00 ? 273  DA  J N6    1 
ATOM   5583  N N1    . DA  B 1 127 ? 31.534  102.719 -33.233 1.00 200.00 ? 273  DA  J N1    1 
ATOM   5584  C C2    . DA  B 1 127 ? 30.735  103.729 -32.868 1.00 200.00 ? 273  DA  J C2    1 
ATOM   5585  N N3    . DA  B 1 127 ? 29.418  103.734 -32.663 1.00 200.00 ? 273  DA  J N3    1 
ATOM   5586  C C4    . DA  B 1 127 ? 28.900  102.511 -32.874 1.00 200.00 ? 273  DA  J C4    1 
ATOM   5587  P P     . DT  B 1 128 ? 23.275  105.052 -33.842 1.00 200.00 ? 274  DT  J P     1 
ATOM   5588  O OP1   . DT  B 1 128 ? 22.132  105.949 -33.533 1.00 186.23 ? 274  DT  J OP1   1 
ATOM   5589  O OP2   . DT  B 1 128 ? 23.048  103.828 -34.655 1.00 186.11 ? 274  DT  J OP2   1 
ATOM   5590  O "O5'" . DT  B 1 128 ? 24.410  105.926 -34.540 1.00 200.00 ? 274  DT  J "O5'" 1 
ATOM   5591  C "C5'" . DT  B 1 128 ? 25.048  106.979 -33.820 1.00 200.00 ? 274  DT  J "C5'" 1 
ATOM   5592  C "C4'" . DT  B 1 128 ? 26.213  107.537 -34.606 1.00 200.00 ? 274  DT  J "C4'" 1 
ATOM   5593  O "O4'" . DT  B 1 128 ? 27.312  106.592 -34.636 1.00 200.00 ? 274  DT  J "O4'" 1 
ATOM   5594  C "C3'" . DT  B 1 128 ? 25.912  107.890 -36.064 1.00 197.56 ? 274  DT  J "C3'" 1 
ATOM   5595  O "O3'" . DT  B 1 128 ? 26.522  109.142 -36.388 1.00 191.75 ? 274  DT  J "O3'" 1 
ATOM   5596  C "C2'" . DT  B 1 128 ? 26.566  106.761 -36.842 1.00 198.81 ? 274  DT  J "C2'" 1 
ATOM   5597  C "C1'" . DT  B 1 128 ? 27.767  106.439 -35.971 1.00 200.00 ? 274  DT  J "C1'" 1 
ATOM   5598  N N1    . DT  B 1 128 ? 28.310  105.071 -36.127 1.00 173.85 ? 274  DT  J N1    1 
ATOM   5599  C C2    . DT  B 1 128 ? 29.677  104.907 -36.046 1.00 173.75 ? 274  DT  J C2    1 
ATOM   5600  O O2    . DT  B 1 128 ? 30.449  105.830 -35.843 1.00 173.96 ? 274  DT  J O2    1 
ATOM   5601  N N3    . DT  B 1 128 ? 30.110  103.615 -36.215 1.00 173.03 ? 274  DT  J N3    1 
ATOM   5602  C C4    . DT  B 1 128 ? 29.332  102.497 -36.451 1.00 172.54 ? 274  DT  J C4    1 
ATOM   5603  O O4    . DT  B 1 128 ? 29.866  101.399 -36.585 1.00 171.29 ? 274  DT  J O4    1 
ATOM   5604  C C5    . DT  B 1 128 ? 27.908  102.740 -36.520 1.00 172.58 ? 274  DT  J C5    1 
ATOM   5605  C C7    . DT  B 1 128 ? 26.988  101.588 -36.774 1.00 172.49 ? 274  DT  J C7    1 
ATOM   5606  C C6    . DT  B 1 128 ? 27.474  103.997 -36.353 1.00 173.25 ? 274  DT  J C6    1 
ATOM   5607  P P     . DC  B 1 129 ? 26.540  109.651 -37.911 1.00 188.72 ? 275  DC  J P     1 
ATOM   5608  O OP1   . DC  B 1 129 ? 26.437  111.134 -37.887 1.00 154.16 ? 275  DC  J OP1   1 
ATOM   5609  O OP2   . DC  B 1 129 ? 25.553  108.857 -38.692 1.00 154.16 ? 275  DC  J OP2   1 
ATOM   5610  O "O5'" . DC  B 1 129 ? 28.006  109.268 -38.404 1.00 184.53 ? 275  DC  J "O5'" 1 
ATOM   5611  C "C5'" . DC  B 1 129 ? 29.153  109.676 -37.656 1.00 178.36 ? 275  DC  J "C5'" 1 
ATOM   5612  C "C4'" . DC  B 1 129 ? 30.418  109.374 -38.426 1.00 172.53 ? 275  DC  J "C4'" 1 
ATOM   5613  O "O4'" . DC  B 1 129 ? 30.670  107.948 -38.435 1.00 173.03 ? 275  DC  J "O4'" 1 
ATOM   5614  C "C3'" . DC  B 1 129 ? 30.384  109.810 -39.889 1.00 168.42 ? 275  DC  J "C3'" 1 
ATOM   5615  O "O3'" . DC  B 1 129 ? 31.649  110.350 -40.273 1.00 160.11 ? 275  DC  J "O3'" 1 
ATOM   5616  C "C2'" . DC  B 1 129 ? 30.104  108.519 -40.637 1.00 169.55 ? 275  DC  J "C2'" 1 
ATOM   5617  C "C1'" . DC  B 1 129 ? 30.801  107.485 -39.771 1.00 172.39 ? 275  DC  J "C1'" 1 
ATOM   5618  N N1    . DC  B 1 129 ? 30.216  106.136 -39.841 1.00 138.63 ? 275  DC  J N1    1 
ATOM   5619  C C2    . DC  B 1 129 ? 31.000  105.082 -40.326 1.00 138.86 ? 275  DC  J C2    1 
ATOM   5620  O O2    . DC  B 1 129 ? 32.163  105.315 -40.685 1.00 138.89 ? 275  DC  J O2    1 
ATOM   5621  N N3    . DC  B 1 129 ? 30.471  103.839 -40.390 1.00 138.58 ? 275  DC  J N3    1 
ATOM   5622  C C4    . DC  B 1 129 ? 29.214  103.629 -39.992 1.00 138.47 ? 275  DC  J C4    1 
ATOM   5623  N N4    . DC  B 1 129 ? 28.734  102.385 -40.067 1.00 137.68 ? 275  DC  J N4    1 
ATOM   5624  C C5    . DC  B 1 129 ? 28.393  104.684 -39.499 1.00 138.94 ? 275  DC  J C5    1 
ATOM   5625  C C6    . DC  B 1 129 ? 28.929  105.909 -39.440 1.00 139.17 ? 275  DC  J C6    1 
ATOM   5626  P P     . DT  B 1 130 ? 31.798  111.085 -41.693 1.00 117.03 ? 276  DT  J P     1 
ATOM   5627  O OP1   . DT  B 1 130 ? 32.811  112.162 -41.541 1.00 133.38 ? 276  DT  J OP1   1 
ATOM   5628  O OP2   . DT  B 1 130 ? 30.443  111.415 -42.200 1.00 133.80 ? 276  DT  J OP2   1 
ATOM   5629  O "O5'" . DT  B 1 130 ? 32.408  109.956 -42.635 1.00 112.24 ? 276  DT  J "O5'" 1 
ATOM   5630  C "C5'" . DT  B 1 130 ? 33.751  109.510 -42.464 1.00 101.92 ? 276  DT  J "C5'" 1 
ATOM   5631  C "C4'" . DT  B 1 130 ? 34.143  108.587 -43.594 1.00 94.71  ? 276  DT  J "C4'" 1 
ATOM   5632  O "O4'" . DT  B 1 130 ? 33.454  107.320 -43.463 1.00 93.42  ? 276  DT  J "O4'" 1 
ATOM   5633  C "C3'" . DT  B 1 130 ? 33.812  109.107 -44.995 1.00 90.14  ? 276  DT  J "C3'" 1 
ATOM   5634  O "O3'" . DT  B 1 130 ? 34.861  108.738 -45.889 1.00 83.10  ? 276  DT  J "O3'" 1 
ATOM   5635  C "C2'" . DT  B 1 130 ? 32.557  108.332 -45.361 1.00 90.79  ? 276  DT  J "C2'" 1 
ATOM   5636  C "C1'" . DT  B 1 130 ? 32.835  106.998 -44.696 1.00 92.13  ? 276  DT  J "C1'" 1 
ATOM   5637  N N1    . DT  B 1 130 ? 31.658  106.160 -44.409 1.00 109.28 ? 276  DT  J N1    1 
ATOM   5638  C C2    . DT  B 1 130 ? 31.669  104.861 -44.864 1.00 109.70 ? 276  DT  J C2    1 
ATOM   5639  O O2    . DT  B 1 130 ? 32.593  104.387 -45.503 1.00 109.19 ? 276  DT  J O2    1 
ATOM   5640  N N3    . DT  B 1 130 ? 30.553  104.132 -44.543 1.00 110.65 ? 276  DT  J N3    1 
ATOM   5641  C C4    . DT  B 1 130 ? 29.450  104.563 -43.832 1.00 110.86 ? 276  DT  J C4    1 
ATOM   5642  O O4    . DT  B 1 130 ? 28.523  103.787 -43.615 1.00 111.08 ? 276  DT  J O4    1 
ATOM   5643  C C5    . DT  B 1 130 ? 29.499  105.941 -43.394 1.00 110.82 ? 276  DT  J C5    1 
ATOM   5644  C C7    . DT  B 1 130 ? 28.344  106.500 -42.625 1.00 110.66 ? 276  DT  J C7    1 
ATOM   5645  C C6    . DT  B 1 130 ? 30.587  106.661 -43.701 1.00 110.52 ? 276  DT  J C6    1 
ATOM   5646  P P     . DG  B 1 131 ? 35.784  109.869 -46.553 1.00 73.50  ? 277  DG  J P     1 
ATOM   5647  O OP1   . DG  B 1 131 ? 36.390  110.655 -45.449 1.00 100.90 ? 277  DG  J OP1   1 
ATOM   5648  O OP2   . DG  B 1 131 ? 35.002  110.563 -47.608 1.00 101.45 ? 277  DG  J OP2   1 
ATOM   5649  O "O5'" . DG  B 1 131 ? 36.941  109.019 -47.246 1.00 70.84  ? 277  DG  J "O5'" 1 
ATOM   5650  C "C5'" . DG  B 1 131 ? 37.867  108.272 -46.454 1.00 63.74  ? 277  DG  J "C5'" 1 
ATOM   5651  C "C4'" . DG  B 1 131 ? 38.196  106.955 -47.118 1.00 59.46  ? 277  DG  J "C4'" 1 
ATOM   5652  O "O4'" . DG  B 1 131 ? 37.035  106.091 -47.113 1.00 59.66  ? 277  DG  J "O4'" 1 
ATOM   5653  C "C3'" . DG  B 1 131 ? 38.647  107.049 -48.574 1.00 56.40  ? 277  DG  J "C3'" 1 
ATOM   5654  O "O3'" . DG  B 1 131 ? 39.668  106.073 -48.803 1.00 50.18  ? 277  DG  J "O3'" 1 
ATOM   5655  C "C2'" . DG  B 1 131 ? 37.383  106.738 -49.360 1.00 57.85  ? 277  DG  J "C2'" 1 
ATOM   5656  C "C1'" . DG  B 1 131 ? 36.635  105.775 -48.445 1.00 61.25  ? 277  DG  J "C1'" 1 
ATOM   5657  N N9    . DG  B 1 131 ? 35.182  105.908 -48.504 1.00 91.32  ? 277  DG  J N9    1 
ATOM   5658  C C8    . DG  B 1 131 ? 34.467  107.079 -48.578 1.00 92.59  ? 277  DG  J C8    1 
ATOM   5659  N N7    . DG  B 1 131 ? 33.175  106.892 -48.582 1.00 93.63  ? 277  DG  J N7    1 
ATOM   5660  C C5    . DG  B 1 131 ? 33.025  105.514 -48.515 1.00 94.93  ? 277  DG  J C5    1 
ATOM   5661  C C6    . DG  B 1 131 ? 31.850  104.721 -48.481 1.00 96.61  ? 277  DG  J C6    1 
ATOM   5662  O O6    . DG  B 1 131 ? 30.669  105.090 -48.503 1.00 99.75  ? 277  DG  J O6    1 
ATOM   5663  N N1    . DG  B 1 131 ? 32.151  103.365 -48.412 1.00 96.90  ? 277  DG  J N1    1 
ATOM   5664  C C2    . DG  B 1 131 ? 33.416  102.838 -48.380 1.00 95.91  ? 277  DG  J C2    1 
ATOM   5665  N N2    . DG  B 1 131 ? 33.493  101.501 -48.318 1.00 95.95  ? 277  DG  J N2    1 
ATOM   5666  N N3    . DG  B 1 131 ? 34.523  103.566 -48.409 1.00 95.25  ? 277  DG  J N3    1 
ATOM   5667  C C4    . DG  B 1 131 ? 34.254  104.889 -48.475 1.00 93.96  ? 277  DG  J C4    1 
ATOM   5668  P P     . DC  B 1 132 ? 40.366  105.965 -50.241 1.00 50.63  ? 278  DC  J P     1 
ATOM   5669  O OP1   . DC  B 1 132 ? 41.755  105.484 -50.027 1.00 66.91  ? 278  DC  J OP1   1 
ATOM   5670  O OP2   . DC  B 1 132 ? 40.139  107.235 -50.975 1.00 68.28  ? 278  DC  J OP2   1 
ATOM   5671  O "O5'" . DC  B 1 132 ? 39.520  104.814 -50.945 1.00 54.45  ? 278  DC  J "O5'" 1 
ATOM   5672  C "C5'" . DC  B 1 132 ? 39.328  103.554 -50.295 1.00 55.46  ? 278  DC  J "C5'" 1 
ATOM   5673  C "C4'" . DC  B 1 132 ? 38.425  102.662 -51.117 1.00 57.48  ? 278  DC  J "C4'" 1 
ATOM   5674  O "O4'" . DC  B 1 132 ? 37.038  103.045 -50.971 1.00 57.55  ? 278  DC  J "O4'" 1 
ATOM   5675  C "C3'" . DC  B 1 132 ? 38.704  102.658 -52.620 1.00 58.40  ? 278  DC  J "C3'" 1 
ATOM   5676  O "O3'" . DC  B 1 132 ? 38.460  101.346 -53.124 1.00 61.41  ? 278  DC  J "O3'" 1 
ATOM   5677  C "C2'" . DC  B 1 132 ? 37.643  103.594 -53.164 1.00 58.16  ? 278  DC  J "C2'" 1 
ATOM   5678  C "C1'" . DC  B 1 132 ? 36.472  103.250 -52.258 1.00 58.41  ? 278  DC  J "C1'" 1 
ATOM   5679  N N1    . DC  B 1 132 ? 35.410  104.267 -52.135 1.00 72.77  ? 278  DC  J N1    1 
ATOM   5680  C C2    . DC  B 1 132 ? 34.107  103.839 -51.840 1.00 73.61  ? 278  DC  J C2    1 
ATOM   5681  O O2    . DC  B 1 132 ? 33.887  102.624 -51.717 1.00 73.18  ? 278  DC  J O2    1 
ATOM   5682  N N3    . DC  B 1 132 ? 33.124  104.755 -51.699 1.00 74.62  ? 278  DC  J N3    1 
ATOM   5683  C C4    . DC  B 1 132 ? 33.396  106.053 -51.849 1.00 75.86  ? 278  DC  J C4    1 
ATOM   5684  N N4    . DC  B 1 132 ? 32.392  106.923 -51.694 1.00 76.60  ? 278  DC  J N4    1 
ATOM   5685  C C5    . DC  B 1 132 ? 34.711  106.519 -52.164 1.00 74.63  ? 278  DC  J C5    1 
ATOM   5686  C C6    . DC  B 1 132 ? 35.678  105.599 -52.295 1.00 73.91  ? 278  DC  J C6    1 
ATOM   5687  P P     . DA  B 1 133 ? 39.682  100.463 -53.672 1.00 71.86  ? 279  DA  J P     1 
ATOM   5688  O OP1   . DA  B 1 133 ? 40.670  100.428 -52.564 1.00 64.56  ? 279  DA  J OP1   1 
ATOM   5689  O OP2   . DA  B 1 133 ? 40.090  100.961 -55.013 1.00 61.45  ? 279  DA  J OP2   1 
ATOM   5690  O "O5'" . DA  B 1 133 ? 39.055  99.007  -53.838 1.00 73.48  ? 279  DA  J "O5'" 1 
ATOM   5691  C "C5'" . DA  B 1 133 ? 38.558  98.291  -52.709 1.00 77.62  ? 279  DA  J "C5'" 1 
ATOM   5692  C "C4'" . DA  B 1 133 ? 37.253  97.609  -53.054 1.00 81.00  ? 279  DA  J "C4'" 1 
ATOM   5693  O "O4'" . DA  B 1 133 ? 36.185  98.578  -53.169 1.00 80.64  ? 279  DA  J "O4'" 1 
ATOM   5694  C "C3'" . DA  B 1 133 ? 37.264  96.847  -54.374 1.00 83.10  ? 279  DA  J "C3'" 1 
ATOM   5695  O "O3'" . DA  B 1 133 ? 36.451  95.679  -54.249 1.00 89.76  ? 279  DA  J "O3'" 1 
ATOM   5696  C "C2'" . DA  B 1 133 ? 36.651  97.833  -55.352 1.00 80.99  ? 279  DA  J "C2'" 1 
ATOM   5697  C "C1'" . DA  B 1 133 ? 35.647  98.576  -54.487 1.00 79.31  ? 279  DA  J "C1'" 1 
ATOM   5698  N N9    . DA  B 1 133 ? 35.435  99.973  -54.868 1.00 69.86  ? 279  DA  J N9    1 
ATOM   5699  C C8    . DA  B 1 133 ? 36.359  100.851 -55.372 1.00 68.66  ? 279  DA  J C8    1 
ATOM   5700  N N7    . DA  B 1 133 ? 35.896  102.063 -55.549 1.00 67.73  ? 279  DA  J N7    1 
ATOM   5701  C C5    . DA  B 1 133 ? 34.572  101.975 -55.150 1.00 68.27  ? 279  DA  J C5    1 
ATOM   5702  C C6    . DA  B 1 133 ? 33.537  102.928 -55.086 1.00 68.02  ? 279  DA  J C6    1 
ATOM   5703  N N6    . DA  B 1 133 ? 33.689  104.207 -55.426 1.00 67.18  ? 279  DA  J N6    1 
ATOM   5704  N N1    . DA  B 1 133 ? 32.330  102.515 -54.649 1.00 68.39  ? 279  DA  J N1    1 
ATOM   5705  C C2    . DA  B 1 133 ? 32.181  101.229 -54.303 1.00 69.18  ? 279  DA  J C2    1 
ATOM   5706  N N3    . DA  B 1 133 ? 33.076  100.243 -54.315 1.00 69.60  ? 279  DA  J N3    1 
ATOM   5707  C C4    . DA  B 1 133 ? 34.267  100.688 -54.750 1.00 68.82  ? 279  DA  J C4    1 
ATOM   5708  P P     . DG  B 1 134 ? 36.508  94.546  -55.384 1.00 117.33 ? 280  DG  J P     1 
ATOM   5709  O OP1   . DG  B 1 134 ? 36.172  93.260  -54.726 1.00 89.31  ? 280  DG  J OP1   1 
ATOM   5710  O OP2   . DG  B 1 134 ? 37.784  94.678  -56.136 1.00 89.11  ? 280  DG  J OP2   1 
ATOM   5711  O "O5'" . DG  B 1 134 ? 35.318  94.947  -56.360 1.00 118.80 ? 280  DG  J "O5'" 1 
ATOM   5712  C "C5'" . DG  B 1 134 ? 33.975  94.983  -55.893 1.00 123.09 ? 280  DG  J "C5'" 1 
ATOM   5713  C "C4'" . DG  B 1 134 ? 33.072  95.539  -56.967 1.00 126.24 ? 280  DG  J "C4'" 1 
ATOM   5714  O "O4'" . DG  B 1 134 ? 33.184  96.983  -57.032 1.00 127.31 ? 280  DG  J "O4'" 1 
ATOM   5715  C "C3'" . DG  B 1 134 ? 33.396  95.022  -58.370 1.00 128.31 ? 280  DG  J "C3'" 1 
ATOM   5716  O "O3'" . DG  B 1 134 ? 32.184  94.802  -59.087 1.00 131.59 ? 280  DG  J "O3'" 1 
ATOM   5717  C "C2'" . DG  B 1 134 ? 34.140  96.183  -59.001 1.00 127.87 ? 280  DG  J "C2'" 1 
ATOM   5718  C "C1'" . DG  B 1 134 ? 33.416  97.360  -58.378 1.00 128.06 ? 280  DG  J "C1'" 1 
ATOM   5719  N N9    . DG  B 1 134 ? 34.148  98.625  -58.391 1.00 100.38 ? 280  DG  J N9    1 
ATOM   5720  C C8    . DG  B 1 134 ? 35.499  98.802  -58.569 1.00 100.64 ? 280  DG  J C8    1 
ATOM   5721  N N7    . DG  B 1 134 ? 35.852  100.059 -58.589 1.00 100.23 ? 280  DG  J N7    1 
ATOM   5722  C C5    . DG  B 1 134 ? 34.665  100.753 -58.402 1.00 99.64  ? 280  DG  J C5    1 
ATOM   5723  C C6    . DG  B 1 134 ? 34.417  102.150 -58.343 1.00 99.25  ? 280  DG  J C6    1 
ATOM   5724  O O6    . DG  B 1 134 ? 35.225  103.082 -58.459 1.00 98.48  ? 280  DG  J O6    1 
ATOM   5725  N N1    . DG  B 1 134 ? 33.069  102.421 -58.128 1.00 98.44  ? 280  DG  J N1    1 
ATOM   5726  C C2    . DG  B 1 134 ? 32.084  101.472 -57.991 1.00 98.65  ? 280  DG  J C2    1 
ATOM   5727  N N2    . DG  B 1 134 ? 30.843  101.934 -57.776 1.00 98.15  ? 280  DG  J N2    1 
ATOM   5728  N N3    . DG  B 1 134 ? 32.301  100.167 -58.056 1.00 98.91  ? 280  DG  J N3    1 
ATOM   5729  C C4    . DG  B 1 134 ? 33.605  99.882  -58.262 1.00 99.62  ? 280  DG  J C4    1 
ATOM   5730  P P     . DG  B 1 135 ? 32.082  93.595  -60.139 1.00 122.59 ? 281  DG  J P     1 
ATOM   5731  O OP1   . DG  B 1 135 ? 31.813  92.356  -59.369 1.00 100.32 ? 281  DG  J OP1   1 
ATOM   5732  O OP2   . DG  B 1 135 ? 33.237  93.646  -61.073 1.00 99.55  ? 281  DG  J OP2   1 
ATOM   5733  O "O5'" . DG  B 1 135 ? 30.765  93.959  -60.947 1.00 124.31 ? 281  DG  J "O5'" 1 
ATOM   5734  C "C5'" . DG  B 1 135 ? 29.567  94.304  -60.258 1.00 127.40 ? 281  DG  J "C5'" 1 
ATOM   5735  C "C4'" . DG  B 1 135 ? 28.814  95.357  -61.033 1.00 129.42 ? 281  DG  J "C4'" 1 
ATOM   5736  O "O4'" . DG  B 1 135 ? 29.319  96.683  -60.724 1.00 129.49 ? 281  DG  J "O4'" 1 
ATOM   5737  C "C3'" . DG  B 1 135 ? 28.942  95.187  -62.547 1.00 130.60 ? 281  DG  J "C3'" 1 
ATOM   5738  O "O3'" . DG  B 1 135 ? 27.676  95.341  -63.187 1.00 132.68 ? 281  DG  J "O3'" 1 
ATOM   5739  C "C2'" . DG  B 1 135 ? 29.896  96.298  -62.953 1.00 130.48 ? 281  DG  J "C2'" 1 
ATOM   5740  C "C1'" . DG  B 1 135 ? 29.593  97.379  -61.932 1.00 129.86 ? 281  DG  J "C1'" 1 
ATOM   5741  N N9    . DG  B 1 135 ? 30.702  98.301  -61.696 1.00 106.83 ? 281  DG  J N9    1 
ATOM   5742  C C8    . DG  B 1 135 ? 32.009  97.971  -61.431 1.00 106.91 ? 281  DG  J C8    1 
ATOM   5743  N N7    . DG  B 1 135 ? 32.790  99.012  -61.309 1.00 106.24 ? 281  DG  J N7    1 
ATOM   5744  C C5    . DG  B 1 135 ? 31.948  100.099 -61.496 1.00 105.57 ? 281  DG  J C5    1 
ATOM   5745  C C6    . DG  B 1 135 ? 32.230  101.496 -61.492 1.00 104.99 ? 281  DG  J C6    1 
ATOM   5746  O O6    . DG  B 1 135 ? 33.319  102.064 -61.332 1.00 102.97 ? 281  DG  J O6    1 
ATOM   5747  N N1    . DG  B 1 135 ? 31.081  102.250 -61.715 1.00 104.96 ? 281  DG  J N1    1 
ATOM   5748  C C2    . DG  B 1 135 ? 29.825  101.733 -61.924 1.00 105.61 ? 281  DG  J C2    1 
ATOM   5749  N N2    . DG  B 1 135 ? 28.843  102.629 -62.118 1.00 105.34 ? 281  DG  J N2    1 
ATOM   5750  N N3    . DG  B 1 135 ? 29.550  100.434 -61.942 1.00 106.18 ? 281  DG  J N3    1 
ATOM   5751  C C4    . DG  B 1 135 ? 30.651  99.680  -61.722 1.00 106.33 ? 281  DG  J C4    1 
ATOM   5752  P P     . DT  B 1 136 ? 27.617  95.598  -64.770 1.00 145.22 ? 282  DT  J P     1 
ATOM   5753  O OP1   . DT  B 1 136 ? 26.231  95.336  -65.236 1.00 99.84  ? 282  DT  J OP1   1 
ATOM   5754  O OP2   . DT  B 1 136 ? 28.754  94.877  -65.400 1.00 99.23  ? 282  DT  J OP2   1 
ATOM   5755  O "O5'" . DT  B 1 136 ? 27.889  97.161  -64.875 1.00 145.06 ? 282  DT  J "O5'" 1 
ATOM   5756  C "C5'" . DT  B 1 136 ? 26.911  98.090  -64.422 1.00 147.05 ? 282  DT  J "C5'" 1 
ATOM   5757  C "C4'" . DT  B 1 136 ? 26.812  99.238  -65.394 1.00 147.91 ? 282  DT  J "C4'" 1 
ATOM   5758  O "O4'" . DT  B 1 136 ? 27.795  100.249 -65.068 1.00 147.25 ? 282  DT  J "O4'" 1 
ATOM   5759  C "C3'" . DT  B 1 136 ? 27.087  98.812  -66.835 1.00 149.19 ? 282  DT  J "C3'" 1 
ATOM   5760  O "O3'" . DT  B 1 136 ? 26.177  99.436  -67.738 1.00 151.87 ? 282  DT  J "O3'" 1 
ATOM   5761  C "C2'" . DT  B 1 136 ? 28.506  99.290  -67.083 1.00 147.86 ? 282  DT  J "C2'" 1 
ATOM   5762  C "C1'" . DT  B 1 136 ? 28.599  100.523 -66.201 1.00 146.57 ? 282  DT  J "C1'" 1 
ATOM   5763  N N1    . DT  B 1 136 ? 29.964  100.826 -65.728 1.00 99.22  ? 282  DT  J N1    1 
ATOM   5764  C C2    . DT  B 1 136 ? 30.284  102.138 -65.460 1.00 97.87  ? 282  DT  J C2    1 
ATOM   5765  O O2    . DT  B 1 136 ? 29.487  103.054 -65.577 1.00 98.26  ? 282  DT  J O2    1 
ATOM   5766  N N3    . DT  B 1 136 ? 31.579  102.338 -65.048 1.00 96.56  ? 282  DT  J N3    1 
ATOM   5767  C C4    . DT  B 1 136 ? 32.560  101.377 -64.883 1.00 96.07  ? 282  DT  J C4    1 
ATOM   5768  O O4    . DT  B 1 136 ? 33.683  101.706 -64.514 1.00 94.94  ? 282  DT  J O4    1 
ATOM   5769  C C5    . DT  B 1 136 ? 32.152  100.023 -65.174 1.00 96.47  ? 282  DT  J C5    1 
ATOM   5770  C C7    . DT  B 1 136 ? 33.146  98.916  -65.024 1.00 96.22  ? 282  DT  J C7    1 
ATOM   5771  C C6    . DT  B 1 136 ? 30.891  99.818  -65.572 1.00 97.96  ? 282  DT  J C6    1 
ATOM   5772  P P     . DG  B 1 137 ? 26.326  99.179  -69.315 1.00 148.10 ? 283  DG  J P     1 
ATOM   5773  O OP1   . DG  B 1 137 ? 24.962  98.975  -69.868 1.00 117.46 ? 283  DG  J OP1   1 
ATOM   5774  O OP2   . DG  B 1 137 ? 27.368  98.139  -69.529 1.00 117.98 ? 283  DG  J OP2   1 
ATOM   5775  O "O5'" . DG  B 1 137 ? 26.888  100.570 -69.842 1.00 148.66 ? 283  DG  J "O5'" 1 
ATOM   5776  C "C5'" . DG  B 1 137 ? 26.364  101.796 -69.340 1.00 151.30 ? 283  DG  J "C5'" 1 
ATOM   5777  C "C4'" . DG  B 1 137 ? 27.195  102.956 -69.832 1.00 153.27 ? 283  DG  J "C4'" 1 
ATOM   5778  O "O4'" . DG  B 1 137 ? 28.481  102.955 -69.165 1.00 153.43 ? 283  DG  J "O4'" 1 
ATOM   5779  C "C3'" . DG  B 1 137 ? 27.493  102.897 -71.330 1.00 154.16 ? 283  DG  J "C3'" 1 
ATOM   5780  O "O3'" . DG  B 1 137 ? 27.466  104.211 -71.890 1.00 155.67 ? 283  DG  J "O3'" 1 
ATOM   5781  C "C2'" . DG  B 1 137 ? 28.902  102.338 -71.381 1.00 154.75 ? 283  DG  J "C2'" 1 
ATOM   5782  C "C1'" . DG  B 1 137 ? 29.517  102.944 -70.134 1.00 154.06 ? 283  DG  J "C1'" 1 
ATOM   5783  N N9    . DG  B 1 137 ? 30.644  102.193 -69.588 1.00 123.18 ? 283  DG  J N9    1 
ATOM   5784  C C8    . DG  B 1 137 ? 30.791  100.826 -69.543 1.00 123.14 ? 283  DG  J C8    1 
ATOM   5785  N N7    . DG  B 1 137 ? 31.920  100.450 -69.006 1.00 122.73 ? 283  DG  J N7    1 
ATOM   5786  C C5    . DG  B 1 137 ? 32.556  101.639 -68.672 1.00 121.91 ? 283  DG  J C5    1 
ATOM   5787  C C6    . DG  B 1 137 ? 33.817  101.868 -68.061 1.00 121.25 ? 283  DG  J C6    1 
ATOM   5788  O O6    . DG  B 1 137 ? 34.651  101.039 -67.679 1.00 120.64 ? 283  DG  J O6    1 
ATOM   5789  N N1    . DG  B 1 137 ? 34.073  103.228 -67.908 1.00 120.33 ? 283  DG  J N1    1 
ATOM   5790  C C2    . DG  B 1 137 ? 33.230  104.239 -68.294 1.00 120.21 ? 283  DG  J C2    1 
ATOM   5791  N N2    . DG  B 1 137 ? 33.664  105.487 -68.065 1.00 119.13 ? 283  DG  J N2    1 
ATOM   5792  N N3    . DG  B 1 137 ? 32.050  104.040 -68.863 1.00 120.96 ? 283  DG  J N3    1 
ATOM   5793  C C4    . DG  B 1 137 ? 31.780  102.725 -69.022 1.00 122.23 ? 283  DG  J C4    1 
ATOM   5794  P P     . DG  B 1 138 ? 27.182  104.399 -73.459 1.00 173.07 ? 284  DG  J P     1 
ATOM   5795  O OP1   . DG  B 1 138 ? 25.770  104.821 -73.635 1.00 109.07 ? 284  DG  J OP1   1 
ATOM   5796  O OP2   . DG  B 1 138 ? 27.673  103.176 -74.143 1.00 109.18 ? 284  DG  J OP2   1 
ATOM   5797  O "O5'" . DG  B 1 138 ? 28.125  105.617 -73.860 1.00 172.27 ? 284  DG  J "O5'" 1 
ATOM   5798  C "C5'" . DG  B 1 138 ? 28.176  106.791 -73.054 1.00 173.12 ? 284  DG  J "C5'" 1 
ATOM   5799  C "C4'" . DG  B 1 138 ? 29.583  107.340 -73.015 1.00 173.17 ? 284  DG  J "C4'" 1 
ATOM   5800  O "O4'" . DG  B 1 138 ? 30.455  106.416 -72.316 1.00 173.25 ? 284  DG  J "O4'" 1 
ATOM   5801  C "C3'" . DG  B 1 138 ? 30.222  107.563 -74.387 1.00 172.99 ? 284  DG  J "C3'" 1 
ATOM   5802  O "O3'" . DG  B 1 138 ? 31.030  108.741 -74.356 1.00 172.78 ? 284  DG  J "O3'" 1 
ATOM   5803  C "C2'" . DG  B 1 138 ? 31.114  106.347 -74.555 1.00 172.68 ? 284  DG  J "C2'" 1 
ATOM   5804  C "C1'" . DG  B 1 138 ? 31.582  106.129 -73.131 1.00 172.24 ? 284  DG  J "C1'" 1 
ATOM   5805  N N9    . DG  B 1 138 ? 32.039  104.775 -72.825 1.00 105.65 ? 284  DG  J N9    1 
ATOM   5806  C C8    . DG  B 1 138 ? 31.410  103.590 -73.128 1.00 105.42 ? 284  DG  J C8    1 
ATOM   5807  N N7    . DG  B 1 138 ? 32.073  102.540 -72.722 1.00 104.31 ? 284  DG  J N7    1 
ATOM   5808  C C5    . DG  B 1 138 ? 33.207  103.064 -72.116 1.00 102.92 ? 284  DG  J C5    1 
ATOM   5809  C C6    . DG  B 1 138 ? 34.301  102.410 -71.487 1.00 101.80 ? 284  DG  J C6    1 
ATOM   5810  O O6    . DG  B 1 138 ? 34.488  101.195 -71.329 1.00 99.31  ? 284  DG  J O6    1 
ATOM   5811  N N1    . DG  B 1 138 ? 35.237  103.325 -71.011 1.00 101.35 ? 284  DG  J N1    1 
ATOM   5812  C C2    . DG  B 1 138 ? 35.135  104.692 -71.120 1.00 101.49 ? 284  DG  J C2    1 
ATOM   5813  N N2    . DG  B 1 138 ? 36.143  105.406 -70.595 1.00 100.76 ? 284  DG  J N2    1 
ATOM   5814  N N3    . DG  B 1 138 ? 34.120  105.312 -71.699 1.00 102.43 ? 284  DG  J N3    1 
ATOM   5815  C C4    . DG  B 1 138 ? 33.201  104.443 -72.171 1.00 103.79 ? 284  DG  J C4    1 
ATOM   5816  P P     . DA  B 1 139 ? 31.409  109.480 -75.728 1.00 182.50 ? 285  DA  J P     1 
ATOM   5817  O OP1   . DA  B 1 139 ? 30.544  110.680 -75.860 1.00 112.42 ? 285  DA  J OP1   1 
ATOM   5818  O OP2   . DA  B 1 139 ? 31.407  108.452 -76.801 1.00 112.24 ? 285  DA  J OP2   1 
ATOM   5819  O "O5'" . DA  B 1 139 ? 32.907  109.965 -75.498 1.00 181.19 ? 285  DA  J "O5'" 1 
ATOM   5820  C "C5'" . DA  B 1 139 ? 33.222  110.903 -74.471 1.00 181.60 ? 285  DA  J "C5'" 1 
ATOM   5821  C "C4'" . DA  B 1 139 ? 34.718  110.975 -74.275 1.00 180.98 ? 285  DA  J "C4'" 1 
ATOM   5822  O "O4'" . DA  B 1 139 ? 35.190  109.718 -73.730 1.00 182.00 ? 285  DA  J "O4'" 1 
ATOM   5823  C "C3'" . DA  B 1 139 ? 35.512  111.204 -75.561 1.00 179.96 ? 285  DA  J "C3'" 1 
ATOM   5824  O "O3'" . DA  B 1 139 ? 36.622  112.073 -75.312 1.00 176.98 ? 285  DA  J "O3'" 1 
ATOM   5825  C "C2'" . DA  B 1 139 ? 35.988  109.813 -75.935 1.00 180.96 ? 285  DA  J "C2'" 1 
ATOM   5826  C "C1'" . DA  B 1 139 ? 36.181  109.155 -74.580 1.00 181.69 ? 285  DA  J "C1'" 1 
ATOM   5827  N N9    . DA  B 1 139 ? 35.992  107.704 -74.596 1.00 110.55 ? 285  DA  J N9    1 
ATOM   5828  C C8    . DA  B 1 139 ? 34.919  107.003 -75.092 1.00 111.17 ? 285  DA  J C8    1 
ATOM   5829  N N7    . DA  B 1 139 ? 35.038  105.703 -74.979 1.00 110.57 ? 285  DA  J N7    1 
ATOM   5830  C C5    . DA  B 1 139 ? 36.270  105.533 -74.364 1.00 108.60 ? 285  DA  J C5    1 
ATOM   5831  C C6    . DA  B 1 139 ? 36.978  104.385 -73.969 1.00 107.45 ? 285  DA  J C6    1 
ATOM   5832  N N6    . DA  B 1 139 ? 36.528  103.139 -74.143 1.00 105.11 ? 285  DA  J N6    1 
ATOM   5833  N N1    . DA  B 1 139 ? 38.181  104.562 -73.382 1.00 106.80 ? 285  DA  J N1    1 
ATOM   5834  C C2    . DA  B 1 139 ? 38.632  105.811 -73.209 1.00 107.42 ? 285  DA  J C2    1 
ATOM   5835  N N3    . DA  B 1 139 ? 38.060  106.968 -73.538 1.00 108.36 ? 285  DA  J N3    1 
ATOM   5836  C C4    . DA  B 1 139 ? 36.867  106.757 -74.119 1.00 109.33 ? 285  DA  J C4    1 
ATOM   5837  P P     . DT  B 1 140 ? 37.756  112.257 -76.436 1.00 167.73 ? 286  DT  J P     1 
ATOM   5838  O OP1   . DT  B 1 140 ? 38.421  113.569 -76.205 1.00 99.42  ? 286  DT  J OP1   1 
ATOM   5839  O OP2   . DT  B 1 140 ? 37.156  111.957 -77.767 1.00 99.14  ? 286  DT  J OP2   1 
ATOM   5840  O "O5'" . DT  B 1 140 ? 38.812  111.118 -76.081 1.00 164.08 ? 286  DT  J "O5'" 1 
ATOM   5841  C "C5'" . DT  B 1 140 ? 39.571  111.187 -74.874 1.00 159.56 ? 286  DT  J "C5'" 1 
ATOM   5842  C "C4'" . DT  B 1 140 ? 40.814  110.338 -74.988 1.00 154.85 ? 286  DT  J "C4'" 1 
ATOM   5843  O "O4'" . DT  B 1 140 ? 40.452  108.936 -74.956 1.00 153.37 ? 286  DT  J "O4'" 1 
ATOM   5844  C "C3'" . DT  B 1 140 ? 41.603  110.543 -76.282 1.00 152.44 ? 286  DT  J "C3'" 1 
ATOM   5845  O "O3'" . DT  B 1 140 ? 43.008  110.500 -76.022 1.00 149.22 ? 286  DT  J "O3'" 1 
ATOM   5846  C "C2'" . DT  B 1 140 ? 41.188  109.359 -77.136 1.00 150.83 ? 286  DT  J "C2'" 1 
ATOM   5847  C "C1'" . DT  B 1 140 ? 40.988  108.279 -76.091 1.00 150.49 ? 286  DT  J "C1'" 1 
ATOM   5848  N N1    . DT  B 1 140 ? 40.059  107.203 -76.482 1.00 79.09  ? 286  DT  J N1    1 
ATOM   5849  C C2    . DT  B 1 140 ? 40.361  105.920 -76.077 1.00 77.10  ? 286  DT  J C2    1 
ATOM   5850  O O2    . DT  B 1 140 ? 41.338  105.649 -75.393 1.00 77.30  ? 286  DT  J O2    1 
ATOM   5851  N N3    . DT  B 1 140 ? 39.475  104.961 -76.503 1.00 75.03  ? 286  DT  J N3    1 
ATOM   5852  C C4    . DT  B 1 140 ? 38.344  105.152 -77.271 1.00 74.05  ? 286  DT  J C4    1 
ATOM   5853  O O4    . DT  B 1 140 ? 37.654  104.187 -77.591 1.00 71.15  ? 286  DT  J O4    1 
ATOM   5854  C C5    . DT  B 1 140 ? 38.076  106.525 -77.644 1.00 74.97  ? 286  DT  J C5    1 
ATOM   5855  C C7    . DT  B 1 140 ? 36.862  106.829 -78.464 1.00 74.96  ? 286  DT  J C7    1 
ATOM   5856  C C6    . DT  B 1 140 ? 38.935  107.470 -77.236 1.00 76.78  ? 286  DT  J C6    1 
ATOM   5857  P P     . DA  B 1 141 ? 44.046  110.710 -77.231 1.00 130.84 ? 287  DA  J P     1 
ATOM   5858  O OP1   . DA  B 1 141 ? 45.420  110.767 -76.668 1.00 98.00  ? 287  DA  J OP1   1 
ATOM   5859  O OP2   . DA  B 1 141 ? 43.554  111.827 -78.078 1.00 99.00  ? 287  DA  J OP2   1 
ATOM   5860  O "O5'" . DA  B 1 141 ? 43.903  109.371 -78.078 1.00 127.48 ? 287  DA  J "O5'" 1 
ATOM   5861  C "C5'" . DA  B 1 141 ? 45.037  108.555 -78.342 1.00 122.01 ? 287  DA  J "C5'" 1 
ATOM   5862  C "C4'" . DA  B 1 141 ? 45.252  107.583 -77.206 1.00 117.17 ? 287  DA  J "C4'" 1 
ATOM   5863  O "O4'" . DA  B 1 141 ? 44.048  106.821 -76.969 1.00 114.96 ? 287  DA  J "O4'" 1 
ATOM   5864  C "C3'" . DA  B 1 141 ? 46.342  106.558 -77.485 1.00 114.92 ? 287  DA  J "C3'" 1 
ATOM   5865  O "O3'" . DA  B 1 141 ? 47.032  106.238 -76.282 1.00 112.76 ? 287  DA  J "O3'" 1 
ATOM   5866  C "C2'" . DA  B 1 141 ? 45.575  105.364 -78.017 1.00 113.42 ? 287  DA  J "C2'" 1 
ATOM   5867  C "C1'" . DA  B 1 141 ? 44.245  105.452 -77.293 1.00 111.87 ? 287  DA  J "C1'" 1 
ATOM   5868  N N9    . DA  B 1 141 ? 43.110  105.036 -78.113 1.00 77.40  ? 287  DA  J N9    1 
ATOM   5869  C C8    . DA  B 1 141 ? 42.229  105.852 -78.778 1.00 76.68  ? 287  DA  J C8    1 
ATOM   5870  N N7    . DA  B 1 141 ? 41.281  105.205 -79.408 1.00 75.55  ? 287  DA  J N7    1 
ATOM   5871  C C5    . DA  B 1 141 ? 41.560  103.871 -79.151 1.00 74.71  ? 287  DA  J C5    1 
ATOM   5872  C C6    . DA  B 1 141 ? 40.920  102.683 -79.533 1.00 74.30  ? 287  DA  J C6    1 
ATOM   5873  N N6    . DA  B 1 141 ? 39.815  102.644 -80.283 1.00 73.85  ? 287  DA  J N6    1 
ATOM   5874  N N1    . DA  B 1 141 ? 41.456  101.519 -79.113 1.00 73.56  ? 287  DA  J N1    1 
ATOM   5875  C C2    . DA  B 1 141 ? 42.561  101.559 -78.360 1.00 73.36  ? 287  DA  J C2    1 
ATOM   5876  N N3    . DA  B 1 141 ? 43.250  102.611 -77.931 1.00 74.16  ? 287  DA  J N3    1 
ATOM   5877  C C4    . DA  B 1 141 ? 42.691  103.751 -78.364 1.00 75.53  ? 287  DA  J C4    1 
ATOM   5878  P P     . DT  B 1 142 ? 48.537  105.695 -76.362 1.00 99.09  ? 288  DT  J P     1 
ATOM   5879  O OP1   . DT  B 1 142 ? 49.075  105.633 -74.974 1.00 95.54  ? 288  DT  J OP1   1 
ATOM   5880  O OP2   . DT  B 1 142 ? 49.259  106.482 -77.400 1.00 94.43  ? 288  DT  J OP2   1 
ATOM   5881  O "O5'" . DT  B 1 142 ? 48.362  104.209 -76.908 1.00 94.91  ? 288  DT  J "O5'" 1 
ATOM   5882  C "C5'" . DT  B 1 142 ? 47.905  103.171 -76.048 1.00 87.60  ? 288  DT  J "C5'" 1 
ATOM   5883  C "C4'" . DT  B 1 142 ? 47.931  101.847 -76.771 1.00 82.77  ? 288  DT  J "C4'" 1 
ATOM   5884  O "O4'" . DT  B 1 142 ? 46.764  101.699 -77.613 1.00 81.01  ? 288  DT  J "O4'" 1 
ATOM   5885  C "C3'" . DT  B 1 142 ? 49.148  101.635 -77.674 1.00 80.29  ? 288  DT  J "C3'" 1 
ATOM   5886  O "O3'" . DT  B 1 142 ? 49.640  100.305 -77.486 1.00 75.95  ? 288  DT  J "O3'" 1 
ATOM   5887  C "C2'" . DT  B 1 142 ? 48.584  101.830 -79.074 1.00 79.79  ? 288  DT  J "C2'" 1 
ATOM   5888  C "C1'" . DT  B 1 142 ? 47.162  101.319 -78.922 1.00 79.82  ? 288  DT  J "C1'" 1 
ATOM   5889  N N1    . DT  B 1 142 ? 46.166  101.867 -79.872 1.00 76.13  ? 288  DT  J N1    1 
ATOM   5890  C C2    . DT  B 1 142 ? 45.163  101.028 -80.308 1.00 75.43  ? 288  DT  J C2    1 
ATOM   5891  O O2    . DT  B 1 142 ? 45.095  99.852  -79.999 1.00 75.64  ? 288  DT  J O2    1 
ATOM   5892  N N3    . DT  B 1 142 ? 44.236  101.619 -81.128 1.00 76.14  ? 288  DT  J N3    1 
ATOM   5893  C C4    . DT  B 1 142 ? 44.217  102.931 -81.557 1.00 76.62  ? 288  DT  J C4    1 
ATOM   5894  O O4    . DT  B 1 142 ? 43.299  103.324 -82.272 1.00 77.79  ? 288  DT  J O4    1 
ATOM   5895  C C5    . DT  B 1 142 ? 45.318  103.746 -81.096 1.00 75.55  ? 288  DT  J C5    1 
ATOM   5896  C C7    . DT  B 1 142 ? 45.398  105.172 -81.537 1.00 75.53  ? 288  DT  J C7    1 
ATOM   5897  C C6    . DT  B 1 142 ? 46.225  103.181 -80.288 1.00 75.48  ? 288  DT  J C6    1 
ATOM   5898  P P     . DT  B 1 143 ? 51.049  99.863  -78.124 1.00 67.26  ? 289  DT  J P     1 
ATOM   5899  O OP1   . DT  B 1 143 ? 51.896  99.316  -77.034 1.00 74.93  ? 289  DT  J OP1   1 
ATOM   5900  O OP2   . DT  B 1 143 ? 51.578  100.942 -78.998 1.00 72.10  ? 289  DT  J OP2   1 
ATOM   5901  O "O5'" . DT  B 1 143 ? 50.608  98.675  -79.077 1.00 64.03  ? 289  DT  J "O5'" 1 
ATOM   5902  C "C5'" . DT  B 1 143 ? 49.418  98.813  -79.819 1.00 58.64  ? 289  DT  J "C5'" 1 
ATOM   5903  C "C4'" . DT  B 1 143 ? 48.881  97.469  -80.233 1.00 54.07  ? 289  DT  J "C4'" 1 
ATOM   5904  O "O4'" . DT  B 1 143 ? 47.621  97.746  -80.877 1.00 53.36  ? 289  DT  J "O4'" 1 
ATOM   5905  C "C3'" . DT  B 1 143 ? 49.736  96.765  -81.280 1.00 50.94  ? 289  DT  J "C3'" 1 
ATOM   5906  O "O3'" . DT  B 1 143 ? 49.574  95.342  -81.175 1.00 45.94  ? 289  DT  J "O3'" 1 
ATOM   5907  C "C2'" . DT  B 1 143 ? 49.217  97.341  -82.587 1.00 51.07  ? 289  DT  J "C2'" 1 
ATOM   5908  C "C1'" . DT  B 1 143 ? 47.757  97.681  -82.286 1.00 53.00  ? 289  DT  J "C1'" 1 
ATOM   5909  N N1    . DT  B 1 143 ? 47.304  98.982  -82.821 1.00 58.00  ? 289  DT  J N1    1 
ATOM   5910  C C2    . DT  B 1 143 ? 46.106  99.019  -83.490 1.00 56.54  ? 289  DT  J C2    1 
ATOM   5911  O O2    . DT  B 1 143 ? 45.408  98.036  -83.648 1.00 54.39  ? 289  DT  J O2    1 
ATOM   5912  N N3    . DT  B 1 143 ? 45.751  100.260 -83.964 1.00 58.12  ? 289  DT  J N3    1 
ATOM   5913  C C4    . DT  B 1 143 ? 46.460  101.441 -83.830 1.00 57.89  ? 289  DT  J C4    1 
ATOM   5914  O O4    . DT  B 1 143 ? 46.017  102.479 -84.310 1.00 61.03  ? 289  DT  J O4    1 
ATOM   5915  C C5    . DT  B 1 143 ? 47.705  101.332 -83.107 1.00 58.34  ? 289  DT  J C5    1 
ATOM   5916  C C7    . DT  B 1 143 ? 48.532  102.563 -82.905 1.00 56.85  ? 289  DT  J C7    1 
ATOM   5917  C C6    . DT  B 1 143 ? 48.062  100.124 -82.646 1.00 57.56  ? 289  DT  J C6    1 
ATOM   5918  P P     . DG  B 1 144 ? 50.541  94.363  -82.008 1.00 44.09  ? 290  DG  J P     1 
ATOM   5919  O OP1   . DG  B 1 144 ? 50.536  93.013  -81.380 1.00 51.53  ? 290  DG  J OP1   1 
ATOM   5920  O OP2   . DG  B 1 144 ? 51.826  95.055  -82.231 1.00 49.45  ? 290  DG  J OP2   1 
ATOM   5921  O "O5'" . DG  B 1 144 ? 49.796  94.228  -83.409 1.00 48.47  ? 290  DG  J "O5'" 1 
ATOM   5922  C "C5'" . DG  B 1 144 ? 48.540  93.555  -83.498 1.00 52.35  ? 290  DG  J "C5'" 1 
ATOM   5923  C "C4'" . DG  B 1 144 ? 48.020  93.601  -84.917 1.00 55.45  ? 290  DG  J "C4'" 1 
ATOM   5924  O "O4'" . DG  B 1 144 ? 47.559  94.927  -85.259 1.00 55.42  ? 290  DG  J "O4'" 1 
ATOM   5925  C "C3'" . DG  B 1 144 ? 49.048  93.235  -85.987 1.00 57.76  ? 290  DG  J "C3'" 1 
ATOM   5926  O "O3'" . DG  B 1 144 ? 48.367  92.536  -87.019 1.00 61.90  ? 290  DG  J "O3'" 1 
ATOM   5927  C "C2'" . DG  B 1 144 ? 49.504  94.586  -86.507 1.00 55.50  ? 290  DG  J "C2'" 1 
ATOM   5928  C "C1'" . DG  B 1 144 ? 48.197  95.343  -86.458 1.00 56.26  ? 290  DG  J "C1'" 1 
ATOM   5929  N N9    . DG  B 1 144 ? 48.288  96.798  -86.439 1.00 61.39  ? 290  DG  J N9    1 
ATOM   5930  C C8    . DG  B 1 144 ? 49.312  97.578  -85.964 1.00 61.70  ? 290  DG  J C8    1 
ATOM   5931  N N7    . DG  B 1 144 ? 49.076  98.858  -86.082 1.00 62.40  ? 290  DG  J N7    1 
ATOM   5932  C C5    . DG  B 1 144 ? 47.821  98.921  -86.673 1.00 62.26  ? 290  DG  J C5    1 
ATOM   5933  C C6    . DG  B 1 144 ? 47.030  100.042 -87.045 1.00 63.04  ? 290  DG  J C6    1 
ATOM   5934  O O6    . DG  B 1 144 ? 47.288  101.247 -86.919 1.00 65.66  ? 290  DG  J O6    1 
ATOM   5935  N N1    . DG  B 1 144 ? 45.827  99.649  -87.618 1.00 61.45  ? 290  DG  J N1    1 
ATOM   5936  C C2    . DG  B 1 144 ? 45.432  98.350  -87.817 1.00 62.71  ? 290  DG  J C2    1 
ATOM   5937  N N2    . DG  B 1 144 ? 44.244  98.173  -88.409 1.00 62.24  ? 290  DG  J N2    1 
ATOM   5938  N N3    . DG  B 1 144 ? 46.153  97.299  -87.468 1.00 62.03  ? 290  DG  J N3    1 
ATOM   5939  C C4    . DG  B 1 144 ? 47.327  97.658  -86.905 1.00 62.26  ? 290  DG  J C4    1 
ATOM   5940  P P     . DA  B 1 145 ? 49.196  91.838  -88.191 1.00 74.28  ? 291  DA  J P     1 
ATOM   5941  O OP1   . DA  B 1 145 ? 49.462  90.438  -87.785 1.00 64.66  ? 291  DA  J OP1   1 
ATOM   5942  O OP2   . DA  B 1 145 ? 50.327  92.724  -88.548 1.00 62.45  ? 291  DA  J OP2   1 
ATOM   5943  O "O5'" . DA  B 1 145 ? 48.159  91.840  -89.396 1.00 76.99  ? 291  DA  J "O5'" 1 
ATOM   5944  C "C5'" . DA  B 1 145 ? 46.764  91.664  -89.157 1.00 77.91  ? 291  DA  J "C5'" 1 
ATOM   5945  C "C4'" . DA  B 1 145 ? 45.962  92.333  -90.249 1.00 80.55  ? 291  DA  J "C4'" 1 
ATOM   5946  O "O4'" . DA  B 1 145 ? 45.912  93.768  -90.048 1.00 79.18  ? 291  DA  J "O4'" 1 
ATOM   5947  C "C3'" . DA  B 1 145 ? 46.524  92.115  -91.655 1.00 81.96  ? 291  DA  J "C3'" 1 
ATOM   5948  O "O3'" . DA  B 1 145 ? 45.465  91.879  -92.582 1.00 86.69  ? 291  DA  J "O3'" 1 
ATOM   5949  C "C2'" . DA  B 1 145 ? 47.222  93.427  -91.968 1.00 80.19  ? 291  DA  J "C2'" 1 
ATOM   5950  C "C1'" . DA  B 1 145 ? 46.381  94.442  -91.211 1.00 78.14  ? 291  DA  J "C1'" 1 
ATOM   5951  N N9    . DA  B 1 145 ? 47.143  95.614  -90.778 1.00 64.59  ? 291  DA  J N9    1 
ATOM   5952  C C8    . DA  B 1 145 ? 48.341  95.626  -90.110 1.00 63.97  ? 291  DA  J C8    1 
ATOM   5953  N N7    . DA  B 1 145 ? 48.803  96.829  -89.872 1.00 63.07  ? 291  DA  J N7    1 
ATOM   5954  C C5    . DA  B 1 145 ? 47.843  97.667  -90.419 1.00 62.37  ? 291  DA  J C5    1 
ATOM   5955  C C6    . DA  B 1 145 ? 47.751  99.066  -90.504 1.00 61.43  ? 291  DA  J C6    1 
ATOM   5956  N N6    . DA  B 1 145 ? 48.678  99.897  -90.031 1.00 61.08  ? 291  DA  J N6    1 
ATOM   5957  N N1    . DA  B 1 145 ? 46.662  99.587  -91.103 1.00 60.90  ? 291  DA  J N1    1 
ATOM   5958  C C2    . DA  B 1 145 ? 45.736  98.751  -91.587 1.00 62.18  ? 291  DA  J C2    1 
ATOM   5959  N N3    . DA  B 1 145 ? 45.713  97.420  -91.574 1.00 63.00  ? 291  DA  J N3    1 
ATOM   5960  C C4    . DA  B 1 145 ? 46.810  96.933  -90.970 1.00 63.35  ? 291  DA  J C4    1 
ATOM   5961  P P     . DT  B 1 146 ? 45.808  91.550  -94.117 1.00 94.23  ? 292  DT  J P     1 
ATOM   5962  O OP1   . DT  B 1 146 ? 44.653  90.788  -94.659 1.00 70.49  ? 292  DT  J OP1   1 
ATOM   5963  O OP2   . DT  B 1 146 ? 47.173  90.957  -94.170 1.00 68.32  ? 292  DT  J OP2   1 
ATOM   5964  O "O5'" . DT  B 1 146 ? 45.833  92.989  -94.805 1.00 92.62  ? 292  DT  J "O5'" 1 
ATOM   5965  C "C5'" . DT  B 1 146 ? 44.658  93.801  -94.805 1.00 93.14  ? 292  DT  J "C5'" 1 
ATOM   5966  C "C4'" . DT  B 1 146 ? 44.896  95.098  -95.546 1.00 93.23  ? 292  DT  J "C4'" 1 
ATOM   5967  O "O4'" . DT  B 1 146 ? 45.626  96.052  -94.734 1.00 92.28  ? 292  DT  J "O4'" 1 
ATOM   5968  C "C3'" . DT  B 1 146 ? 45.660  94.983  -96.868 1.00 93.62  ? 292  DT  J "C3'" 1 
ATOM   5969  O "O3'" . DT  B 1 146 ? 45.103  95.886  -97.824 1.00 95.20  ? 292  DT  J "O3'" 1 
ATOM   5970  C "C2'" . DT  B 1 146 ? 47.025  95.549  -96.524 1.00 92.72  ? 292  DT  J "C2'" 1 
ATOM   5971  C "C1'" . DT  B 1 146 ? 46.642  96.630  -95.531 1.00 91.56  ? 292  DT  J "C1'" 1 
ATOM   5972  N N1    . DT  B 1 146 ? 47.729  97.094  -94.651 1.00 68.21  ? 292  DT  J N1    1 
ATOM   5973  C C2    . DT  B 1 146 ? 47.831  98.447  -94.427 1.00 68.09  ? 292  DT  J C2    1 
ATOM   5974  O O2    . DT  B 1 146 ? 47.040  99.257  -94.878 1.00 68.35  ? 292  DT  J O2    1 
ATOM   5975  N N3    . DT  B 1 146 ? 48.899  98.822  -93.649 1.00 67.94  ? 292  DT  J N3    1 
ATOM   5976  C C4    . DT  B 1 146 ? 49.850  97.994  -93.083 1.00 67.94  ? 292  DT  J C4    1 
ATOM   5977  O O4    . DT  B 1 146 ? 50.768  98.479  -92.421 1.00 67.92  ? 292  DT  J O4    1 
ATOM   5978  C C5    . DT  B 1 146 ? 49.667  96.581  -93.339 1.00 67.56  ? 292  DT  J C5    1 
ATOM   5979  C C7    . DT  B 1 146 ? 50.642  95.606  -92.758 1.00 67.02  ? 292  DT  J C7    1 
ATOM   5980  C C6    . DT  B 1 146 ? 48.626  96.207  -94.094 1.00 67.97  ? 292  DT  J C6    1 
ATOM   5981  N N     . PRO C 2 38  ? 113.632 80.327  -80.355 1.00 128.52 ? 438  PRO A N     1 
ATOM   5982  C CA    . PRO C 2 38  ? 112.513 81.300  -80.325 1.00 127.97 ? 438  PRO A CA    1 
ATOM   5983  C C     . PRO C 2 38  ? 111.209 80.622  -79.899 1.00 126.94 ? 438  PRO A C     1 
ATOM   5984  O O     . PRO C 2 38  ? 110.290 80.459  -80.703 1.00 126.95 ? 438  PRO A O     1 
ATOM   5985  C CB    . PRO C 2 38  ? 112.394 81.873  -81.731 1.00 119.33 ? 438  PRO A CB    1 
ATOM   5986  C CG    . PRO C 2 38  ? 112.925 80.708  -82.566 1.00 120.22 ? 438  PRO A CG    1 
ATOM   5987  C CD    . PRO C 2 38  ? 114.096 80.138  -81.741 1.00 120.04 ? 438  PRO A CD    1 
ATOM   5988  N N     . HIS C 2 39  ? 111.135 80.232  -78.630 1.00 133.74 ? 439  HIS A N     1 
ATOM   5989  C CA    . HIS C 2 39  ? 109.953 79.562  -78.097 1.00 129.76 ? 439  HIS A CA    1 
ATOM   5990  C C     . HIS C 2 39  ? 108.864 80.553  -77.706 1.00 125.46 ? 439  HIS A C     1 
ATOM   5991  O O     . HIS C 2 39  ? 109.151 81.707  -77.390 1.00 126.45 ? 439  HIS A O     1 
ATOM   5992  C CB    . HIS C 2 39  ? 110.335 78.710  -76.884 1.00 110.44 ? 439  HIS A CB    1 
ATOM   5993  C CG    . HIS C 2 39  ? 109.178 77.989  -76.266 1.00 112.72 ? 439  HIS A CG    1 
ATOM   5994  N ND1   . HIS C 2 39  ? 108.198 78.635  -75.545 1.00 113.25 ? 439  HIS A ND1   1 
ATOM   5995  C CD2   . HIS C 2 39  ? 108.834 76.680  -76.281 1.00 113.35 ? 439  HIS A CD2   1 
ATOM   5996  C CE1   . HIS C 2 39  ? 107.299 77.755  -75.143 1.00 114.16 ? 439  HIS A CE1   1 
ATOM   5997  N NE2   . HIS C 2 39  ? 107.661 76.561  -75.576 1.00 114.17 ? 439  HIS A NE2   1 
ATOM   5998  N N     . ARG C 2 40  ? 107.615 80.094  -77.719 1.00 87.71  ? 440  ARG A N     1 
ATOM   5999  C CA    . ARG C 2 40  ? 106.490 80.958  -77.375 1.00 80.21  ? 440  ARG A CA    1 
ATOM   6000  C C     . ARG C 2 40  ? 105.218 80.162  -77.049 1.00 75.67  ? 440  ARG A C     1 
ATOM   6001  O O     . ARG C 2 40  ? 104.739 79.374  -77.874 1.00 74.87  ? 440  ARG A O     1 
ATOM   6002  C CB    . ARG C 2 40  ? 106.223 81.915  -78.539 1.00 73.92  ? 440  ARG A CB    1 
ATOM   6003  C CG    . ARG C 2 40  ? 105.329 83.074  -78.200 1.00 71.03  ? 440  ARG A CG    1 
ATOM   6004  C CD    . ARG C 2 40  ? 105.125 83.973  -79.404 1.00 68.79  ? 440  ARG A CD    1 
ATOM   6005  N NE    . ARG C 2 40  ? 104.253 85.095  -79.076 1.00 67.86  ? 440  ARG A NE    1 
ATOM   6006  C CZ    . ARG C 2 40  ? 104.631 86.155  -78.372 1.00 67.03  ? 440  ARG A CZ    1 
ATOM   6007  N NH1   . ARG C 2 40  ? 105.877 86.247  -77.927 1.00 66.68  ? 440  ARG A NH1   1 
ATOM   6008  N NH2   . ARG C 2 40  ? 103.757 87.114  -78.097 1.00 65.66  ? 440  ARG A NH2   1 
ATOM   6009  N N     . TYR C 2 41  ? 104.678 80.365  -75.845 1.00 59.74  ? 441  TYR A N     1 
ATOM   6010  C CA    . TYR C 2 41  ? 103.459 79.670  -75.428 1.00 54.01  ? 441  TYR A CA    1 
ATOM   6011  C C     . TYR C 2 41  ? 102.218 80.314  -76.051 1.00 50.82  ? 441  TYR A C     1 
ATOM   6012  O O     . TYR C 2 41  ? 102.141 81.533  -76.168 1.00 49.28  ? 441  TYR A O     1 
ATOM   6013  C CB    . TYR C 2 41  ? 103.333 79.674  -73.901 1.00 55.88  ? 441  TYR A CB    1 
ATOM   6014  C CG    . TYR C 2 41  ? 104.249 78.692  -73.214 1.00 52.66  ? 441  TYR A CG    1 
ATOM   6015  C CD1   . TYR C 2 41  ? 105.311 79.131  -72.421 1.00 51.70  ? 441  TYR A CD1   1 
ATOM   6016  C CD2   . TYR C 2 41  ? 104.075 77.319  -73.383 1.00 52.06  ? 441  TYR A CD2   1 
ATOM   6017  C CE1   . TYR C 2 41  ? 106.175 78.227  -71.815 1.00 51.36  ? 441  TYR A CE1   1 
ATOM   6018  C CE2   . TYR C 2 41  ? 104.935 76.405  -72.785 1.00 52.27  ? 441  TYR A CE2   1 
ATOM   6019  C CZ    . TYR C 2 41  ? 105.983 76.866  -72.000 1.00 52.80  ? 441  TYR A CZ    1 
ATOM   6020  O OH    . TYR C 2 41  ? 106.830 75.959  -71.395 1.00 54.82  ? 441  TYR A OH    1 
ATOM   6021  N N     . ARG C 2 42  ? 101.248 79.505  -76.458 1.00 54.04  ? 442  ARG A N     1 
ATOM   6022  C CA    . ARG C 2 42  ? 100.044 80.065  -77.063 1.00 54.87  ? 442  ARG A CA    1 
ATOM   6023  C C     . ARG C 2 42  ? 99.124  80.756  -76.045 1.00 52.84  ? 442  ARG A C     1 
ATOM   6024  O O     . ARG C 2 42  ? 99.097  80.394  -74.862 1.00 50.78  ? 442  ARG A O     1 
ATOM   6025  C CB    . ARG C 2 42  ? 99.279  78.978  -77.821 1.00 79.92  ? 442  ARG A CB    1 
ATOM   6026  C CG    . ARG C 2 42  ? 100.054 78.438  -79.008 1.00 86.51  ? 442  ARG A CG    1 
ATOM   6027  C CD    . ARG C 2 42  ? 99.146  77.741  -79.994 1.00 90.78  ? 442  ARG A CD    1 
ATOM   6028  N NE    . ARG C 2 42  ? 98.482  76.588  -79.401 1.00 95.84  ? 442  ARG A NE    1 
ATOM   6029  C CZ    . ARG C 2 42  ? 97.562  75.859  -80.026 1.00 98.27  ? 442  ARG A CZ    1 
ATOM   6030  N NH1   . ARG C 2 42  ? 97.198  76.169  -81.263 1.00 99.12  ? 442  ARG A NH1   1 
ATOM   6031  N NH2   . ARG C 2 42  ? 97.010  74.818  -79.416 1.00 99.87  ? 442  ARG A NH2   1 
ATOM   6032  N N     . PRO C 2 43  ? 98.363  81.771  -76.499 1.00 57.23  ? 443  PRO A N     1 
ATOM   6033  C CA    . PRO C 2 43  ? 97.444  82.512  -75.628 1.00 55.25  ? 443  PRO A CA    1 
ATOM   6034  C C     . PRO C 2 43  ? 96.563  81.571  -74.825 1.00 53.85  ? 443  PRO A C     1 
ATOM   6035  O O     . PRO C 2 43  ? 95.933  80.672  -75.388 1.00 51.24  ? 443  PRO A O     1 
ATOM   6036  C CB    . PRO C 2 43  ? 96.636  83.351  -76.611 1.00 54.96  ? 443  PRO A CB    1 
ATOM   6037  C CG    . PRO C 2 43  ? 97.632  83.631  -77.694 1.00 56.80  ? 443  PRO A CG    1 
ATOM   6038  C CD    . PRO C 2 43  ? 98.284  82.273  -77.883 1.00 56.85  ? 443  PRO A CD    1 
ATOM   6039  N N     . GLY C 2 44  ? 96.542  81.772  -73.509 1.00 51.72  ? 444  GLY A N     1 
ATOM   6040  C CA    . GLY C 2 44  ? 95.730  80.941  -72.640 1.00 50.14  ? 444  GLY A CA    1 
ATOM   6041  C C     . GLY C 2 44  ? 96.521  79.915  -71.857 1.00 49.93  ? 444  GLY A C     1 
ATOM   6042  O O     . GLY C 2 44  ? 96.187  79.606  -70.712 1.00 50.39  ? 444  GLY A O     1 
ATOM   6043  N N     . THR C 2 45  ? 97.571  79.383  -72.474 1.00 49.89  ? 445  THR A N     1 
ATOM   6044  C CA    . THR C 2 45  ? 98.410  78.379  -71.837 1.00 48.44  ? 445  THR A CA    1 
ATOM   6045  C C     . THR C 2 45  ? 99.044  78.887  -70.545 1.00 47.73  ? 445  THR A C     1 
ATOM   6046  O O     . THR C 2 45  ? 99.037  78.194  -69.535 1.00 48.24  ? 445  THR A O     1 
ATOM   6047  C CB    . THR C 2 45  ? 99.524  77.896  -72.802 1.00 47.37  ? 445  THR A CB    1 
ATOM   6048  O OG1   . THR C 2 45  ? 98.921  77.281  -73.946 1.00 48.83  ? 445  THR A OG1   1 
ATOM   6049  C CG2   . THR C 2 45  ? 100.436 76.870  -72.121 1.00 46.49  ? 445  THR A CG2   1 
ATOM   6050  N N     . VAL C 2 46  ? 99.592  80.094  -70.575 1.00 45.36  ? 446  VAL A N     1 
ATOM   6051  C CA    . VAL C 2 46  ? 100.219 80.659  -69.391 1.00 46.96  ? 446  VAL A CA    1 
ATOM   6052  C C     . VAL C 2 46  ? 99.177  81.143  -68.384 1.00 46.64  ? 446  VAL A C     1 
ATOM   6053  O O     . VAL C 2 46  ? 99.408  81.101  -67.173 1.00 46.87  ? 446  VAL A O     1 
ATOM   6054  C CB    . VAL C 2 46  ? 101.143 81.834  -69.756 1.00 57.85  ? 446  VAL A CB    1 
ATOM   6055  C CG1   . VAL C 2 46  ? 101.802 82.388  -68.492 1.00 57.24  ? 446  VAL A CG1   1 
ATOM   6056  C CG2   . VAL C 2 46  ? 102.198 81.367  -70.749 1.00 58.86  ? 446  VAL A CG2   1 
ATOM   6057  N N     . ALA C 2 47  ? 98.037  81.613  -68.882 1.00 52.82  ? 447  ALA A N     1 
ATOM   6058  C CA    . ALA C 2 47  ? 96.972  82.082  -68.001 1.00 52.00  ? 447  ALA A CA    1 
ATOM   6059  C C     . ALA C 2 47  ? 96.486  80.883  -67.195 1.00 50.98  ? 447  ALA A C     1 
ATOM   6060  O O     . ALA C 2 47  ? 96.289  80.971  -65.985 1.00 48.97  ? 447  ALA A O     1 
ATOM   6061  C CB    . ALA C 2 47  ? 95.833  82.666  -68.818 1.00 43.16  ? 447  ALA A CB    1 
ATOM   6062  N N     . LEU C 2 48  ? 96.319  79.756  -67.881 1.00 42.89  ? 448  LEU A N     1 
ATOM   6063  C CA    . LEU C 2 48  ? 95.872  78.523  -67.251 1.00 43.69  ? 448  LEU A CA    1 
ATOM   6064  C C     . LEU C 2 48  ? 96.890  78.075  -66.192 1.00 43.85  ? 448  LEU A C     1 
ATOM   6065  O O     . LEU C 2 48  ? 96.527  77.562  -65.128 1.00 41.84  ? 448  LEU A O     1 
ATOM   6066  C CB    . LEU C 2 48  ? 95.703  77.446  -68.319 1.00 47.46  ? 448  LEU A CB    1 
ATOM   6067  C CG    . LEU C 2 48  ? 94.357  76.731  -68.448 1.00 49.23  ? 448  LEU A CG    1 
ATOM   6068  C CD1   . LEU C 2 48  ? 93.202  77.631  -68.039 1.00 50.10  ? 448  LEU A CD1   1 
ATOM   6069  C CD2   . LEU C 2 48  ? 94.199  76.288  -69.894 1.00 50.13  ? 448  LEU A CD2   1 
ATOM   6070  N N     . ARG C 2 49  ? 98.168  78.269  -66.498 1.00 46.02  ? 449  ARG A N     1 
ATOM   6071  C CA    . ARG C 2 49  ? 99.232  77.909  -65.577 1.00 48.23  ? 449  ARG A CA    1 
ATOM   6072  C C     . ARG C 2 49  ? 99.167  78.819  -64.339 1.00 47.49  ? 449  ARG A C     1 
ATOM   6073  O O     . ARG C 2 49  ? 99.389  78.369  -63.210 1.00 46.24  ? 449  ARG A O     1 
ATOM   6074  C CB    . ARG C 2 49  ? 100.596 78.022  -66.283 1.00 59.99  ? 449  ARG A CB    1 
ATOM   6075  C CG    . ARG C 2 49  ? 101.767 78.300  -65.350 1.00 64.68  ? 449  ARG A CG    1 
ATOM   6076  C CD    . ARG C 2 49  ? 103.112 77.794  -65.886 1.00 67.16  ? 449  ARG A CD    1 
ATOM   6077  N NE    . ARG C 2 49  ? 103.538 78.410  -67.143 1.00 69.85  ? 449  ARG A NE    1 
ATOM   6078  C CZ    . ARG C 2 49  ? 103.426 77.837  -68.338 1.00 70.57  ? 449  ARG A CZ    1 
ATOM   6079  N NH1   . ARG C 2 49  ? 102.895 76.624  -68.455 1.00 72.02  ? 449  ARG A NH1   1 
ATOM   6080  N NH2   . ARG C 2 49  ? 103.860 78.472  -69.414 1.00 68.03  ? 449  ARG A NH2   1 
ATOM   6081  N N     . GLU C 2 50  ? 98.848  80.091  -64.562 1.00 47.00  ? 450  GLU A N     1 
ATOM   6082  C CA    . GLU C 2 50  ? 98.739  81.058  -63.475 1.00 47.88  ? 450  GLU A CA    1 
ATOM   6083  C C     . GLU C 2 50  ? 97.565  80.702  -62.559 1.00 46.54  ? 450  GLU A C     1 
ATOM   6084  O O     . GLU C 2 50  ? 97.664  80.812  -61.339 1.00 45.58  ? 450  GLU A O     1 
ATOM   6085  C CB    . GLU C 2 50  ? 98.541  82.469  -64.030 1.00 56.52  ? 450  GLU A CB    1 
ATOM   6086  C CG    . GLU C 2 50  ? 99.779  83.112  -64.622 1.00 61.44  ? 450  GLU A CG    1 
ATOM   6087  C CD    . GLU C 2 50  ? 99.477  84.481  -65.215 1.00 65.53  ? 450  GLU A CD    1 
ATOM   6088  O OE1   . GLU C 2 50  ? 98.857  85.311  -64.518 1.00 68.19  ? 450  GLU A OE1   1 
ATOM   6089  O OE2   . GLU C 2 50  ? 99.855  84.732  -66.380 1.00 70.24  ? 450  GLU A OE2   1 
ATOM   6090  N N     . ILE C 2 51  ? 96.454  80.282  -63.157 1.00 41.34  ? 451  ILE A N     1 
ATOM   6091  C CA    . ILE C 2 51  ? 95.279  79.909  -62.386 1.00 40.26  ? 451  ILE A CA    1 
ATOM   6092  C C     . ILE C 2 51  ? 95.639  78.769  -61.448 1.00 41.27  ? 451  ILE A C     1 
ATOM   6093  O O     . ILE C 2 51  ? 95.281  78.793  -60.272 1.00 39.59  ? 451  ILE A O     1 
ATOM   6094  C CB    . ILE C 2 51  ? 94.117  79.447  -63.300 1.00 39.55  ? 451  ILE A CB    1 
ATOM   6095  C CG1   . ILE C 2 51  ? 93.575  80.635  -64.094 1.00 36.69  ? 451  ILE A CG1   1 
ATOM   6096  C CG2   . ILE C 2 51  ? 93.016  78.785  -62.466 1.00 36.03  ? 451  ILE A CG2   1 
ATOM   6097  C CD1   . ILE C 2 51  ? 92.565  80.248  -65.139 1.00 38.72  ? 451  ILE A CD1   1 
ATOM   6098  N N     . ARG C 2 52  ? 96.353  77.774  -61.966 1.00 42.01  ? 452  ARG A N     1 
ATOM   6099  C CA    . ARG C 2 52  ? 96.741  76.633  -61.143 1.00 43.87  ? 452  ARG A CA    1 
ATOM   6100  C C     . ARG C 2 52  ? 97.685  77.051  -60.029 1.00 42.87  ? 452  ARG A C     1 
ATOM   6101  O O     . ARG C 2 52  ? 97.577  76.587  -58.894 1.00 42.16  ? 452  ARG A O     1 
ATOM   6102  C CB    . ARG C 2 52  ? 97.396  75.550  -62.000 1.00 49.31  ? 452  ARG A CB    1 
ATOM   6103  C CG    . ARG C 2 52  ? 96.454  74.977  -63.029 1.00 54.12  ? 452  ARG A CG    1 
ATOM   6104  C CD    . ARG C 2 52  ? 96.941  73.640  -63.563 1.00 59.44  ? 452  ARG A CD    1 
ATOM   6105  N NE    . ARG C 2 52  ? 95.880  72.951  -64.298 1.00 64.29  ? 452  ARG A NE    1 
ATOM   6106  C CZ    . ARG C 2 52  ? 95.555  73.201  -65.564 1.00 66.07  ? 452  ARG A CZ    1 
ATOM   6107  N NH1   . ARG C 2 52  ? 96.214  74.124  -66.252 1.00 67.11  ? 452  ARG A NH1   1 
ATOM   6108  N NH2   . ARG C 2 52  ? 94.560  72.533  -66.138 1.00 66.25  ? 452  ARG A NH2   1 
ATOM   6109  N N     . ARG C 2 53  ? 98.600  77.949  -60.360 1.00 44.68  ? 453  ARG A N     1 
ATOM   6110  C CA    . ARG C 2 53  ? 99.565  78.432  -59.396 1.00 46.07  ? 453  ARG A CA    1 
ATOM   6111  C C     . ARG C 2 53  ? 98.920  79.229  -58.264 1.00 45.93  ? 453  ARG A C     1 
ATOM   6112  O O     . ARG C 2 53  ? 99.192  78.987  -57.086 1.00 45.16  ? 453  ARG A O     1 
ATOM   6113  C CB    . ARG C 2 53  ? 100.607 79.308  -60.094 1.00 64.71  ? 453  ARG A CB    1 
ATOM   6114  C CG    . ARG C 2 53  ? 101.569 79.970  -59.133 1.00 70.17  ? 453  ARG A CG    1 
ATOM   6115  C CD    . ARG C 2 53  ? 102.561 80.870  -59.840 1.00 75.93  ? 453  ARG A CD    1 
ATOM   6116  N NE    . ARG C 2 53  ? 103.519 81.422  -58.887 1.00 82.95  ? 453  ARG A NE    1 
ATOM   6117  C CZ    . ARG C 2 53  ? 104.475 82.295  -59.194 1.00 85.60  ? 453  ARG A CZ    1 
ATOM   6118  N NH1   . ARG C 2 53  ? 104.611 82.730  -60.441 1.00 87.69  ? 453  ARG A NH1   1 
ATOM   6119  N NH2   . ARG C 2 53  ? 105.299 82.731  -58.249 1.00 85.46  ? 453  ARG A NH2   1 
ATOM   6120  N N     . TYR C 2 54  ? 98.062  80.178  -58.616 1.00 43.62  ? 454  TYR A N     1 
ATOM   6121  C CA    . TYR C 2 54  ? 97.452  81.008  -57.596 1.00 43.17  ? 454  TYR A CA    1 
ATOM   6122  C C     . TYR C 2 54  ? 96.345  80.351  -56.795 1.00 41.92  ? 454  TYR A C     1 
ATOM   6123  O O     . TYR C 2 54  ? 96.068  80.775  -55.676 1.00 41.43  ? 454  TYR A O     1 
ATOM   6124  C CB    . TYR C 2 54  ? 96.998  82.330  -58.211 1.00 44.81  ? 454  TYR A CB    1 
ATOM   6125  C CG    . TYR C 2 54  ? 98.179  83.158  -58.642 1.00 46.31  ? 454  TYR A CG    1 
ATOM   6126  C CD1   . TYR C 2 54  ? 98.465  83.361  -59.988 1.00 46.28  ? 454  TYR A CD1   1 
ATOM   6127  C CD2   . TYR C 2 54  ? 99.054  83.695  -57.695 1.00 47.31  ? 454  TYR A CD2   1 
ATOM   6128  C CE1   . TYR C 2 54  ? 99.594  84.076  -60.384 1.00 46.80  ? 454  TYR A CE1   1 
ATOM   6129  C CE2   . TYR C 2 54  ? 100.186 84.408  -58.080 1.00 46.73  ? 454  TYR A CE2   1 
ATOM   6130  C CZ    . TYR C 2 54  ? 100.450 84.594  -59.423 1.00 47.44  ? 454  TYR A CZ    1 
ATOM   6131  O OH    . TYR C 2 54  ? 101.570 85.293  -59.804 1.00 49.41  ? 454  TYR A OH    1 
ATOM   6132  N N     . GLN C 2 55  ? 95.730  79.309  -57.345 1.00 39.03  ? 455  GLN A N     1 
ATOM   6133  C CA    . GLN C 2 55  ? 94.684  78.607  -56.619 1.00 39.12  ? 455  GLN A CA    1 
ATOM   6134  C C     . GLN C 2 55  ? 95.311  77.652  -55.622 1.00 41.16  ? 455  GLN A C     1 
ATOM   6135  O O     . GLN C 2 55  ? 94.634  77.150  -54.728 1.00 42.71  ? 455  GLN A O     1 
ATOM   6136  C CB    . GLN C 2 55  ? 93.772  77.827  -57.567 1.00 38.93  ? 455  GLN A CB    1 
ATOM   6137  C CG    . GLN C 2 55  ? 92.976  78.714  -58.503 1.00 38.32  ? 455  GLN A CG    1 
ATOM   6138  C CD    . GLN C 2 55  ? 91.727  78.043  -59.017 1.00 39.49  ? 455  GLN A CD    1 
ATOM   6139  O OE1   . GLN C 2 55  ? 91.721  76.839  -59.290 1.00 39.67  ? 455  GLN A OE1   1 
ATOM   6140  N NE2   . GLN C 2 55  ? 90.655  78.819  -59.162 1.00 38.84  ? 455  GLN A NE2   1 
ATOM   6141  N N     . LYS C 2 56  ? 96.601  77.385  -55.785 1.00 51.62  ? 456  LYS A N     1 
ATOM   6142  C CA    . LYS C 2 56  ? 97.307  76.498  -54.870 1.00 54.22  ? 456  LYS A CA    1 
ATOM   6143  C C     . LYS C 2 56  ? 97.808  77.283  -53.668 1.00 54.05  ? 456  LYS A C     1 
ATOM   6144  O O     . LYS C 2 56  ? 97.742  76.811  -52.535 1.00 53.88  ? 456  LYS A O     1 
ATOM   6145  C CB    . LYS C 2 56  ? 98.507  75.843  -55.556 1.00 71.17  ? 456  LYS A CB    1 
ATOM   6146  C CG    . LYS C 2 56  ? 98.186  74.581  -56.320 1.00 77.04  ? 456  LYS A CG    1 
ATOM   6147  C CD    . LYS C 2 56  ? 99.453  73.935  -56.858 1.00 79.89  ? 456  LYS A CD    1 
ATOM   6148  C CE    . LYS C 2 56  ? 99.138  72.631  -57.579 1.00 83.80  ? 456  LYS A CE    1 
ATOM   6149  N NZ    . LYS C 2 56  ? 100.360 71.975  -58.123 1.00 86.77  ? 456  LYS A NZ    1 
ATOM   6150  N N     . SER C 2 57  ? 98.295  78.492  -53.932 1.00 48.70  ? 457  SER A N     1 
ATOM   6151  C CA    . SER C 2 57  ? 98.857  79.358  -52.898 1.00 49.62  ? 457  SER A CA    1 
ATOM   6152  C C     . SER C 2 57  ? 97.838  80.141  -52.074 1.00 48.79  ? 457  SER A C     1 
ATOM   6153  O O     . SER C 2 57  ? 96.658  80.193  -52.400 1.00 50.14  ? 457  SER A O     1 
ATOM   6154  C CB    . SER C 2 57  ? 99.847  80.333  -53.535 1.00 54.17  ? 457  SER A CB    1 
ATOM   6155  O OG    . SER C 2 57  ? 99.211  81.106  -54.535 1.00 58.27  ? 457  SER A OG    1 
ATOM   6156  N N     . THR C 2 58  ? 98.313  80.773  -51.008 1.00 46.31  ? 458  THR A N     1 
ATOM   6157  C CA    . THR C 2 58  ? 97.435  81.533  -50.138 1.00 44.75  ? 458  THR A CA    1 
ATOM   6158  C C     . THR C 2 58  ? 97.970  82.914  -49.833 1.00 44.57  ? 458  THR A C     1 
ATOM   6159  O O     . THR C 2 58  ? 97.342  83.673  -49.101 1.00 44.48  ? 458  THR A O     1 
ATOM   6160  C CB    . THR C 2 58  ? 97.231  80.805  -48.807 1.00 49.55  ? 458  THR A CB    1 
ATOM   6161  O OG1   . THR C 2 58  ? 98.486  80.716  -48.126 1.00 50.04  ? 458  THR A OG1   1 
ATOM   6162  C CG2   . THR C 2 58  ? 96.693  79.398  -49.049 1.00 47.52  ? 458  THR A CG2   1 
ATOM   6163  N N     . GLU C 2 59  ? 99.130  83.248  -50.385 1.00 45.38  ? 459  GLU A N     1 
ATOM   6164  C CA    . GLU C 2 59  ? 99.709  84.562  -50.129 1.00 48.03  ? 459  GLU A CA    1 
ATOM   6165  C C     . GLU C 2 59  ? 98.852  85.692  -50.685 1.00 46.16  ? 459  GLU A C     1 
ATOM   6166  O O     . GLU C 2 59  ? 98.081  85.494  -51.621 1.00 44.82  ? 459  GLU A O     1 
ATOM   6167  C CB    . GLU C 2 59  ? 101.131 84.647  -50.707 1.00 82.13  ? 459  GLU A CB    1 
ATOM   6168  C CG    . GLU C 2 59  ? 101.445 83.657  -51.823 1.00 90.41  ? 459  GLU A CG    1 
ATOM   6169  C CD    . GLU C 2 59  ? 100.795 84.012  -53.144 1.00 93.49  ? 459  GLU A CD    1 
ATOM   6170  O OE1   . GLU C 2 59  ? 101.120 85.079  -53.701 1.00 96.63  ? 459  GLU A OE1   1 
ATOM   6171  O OE2   . GLU C 2 59  ? 99.964  83.222  -53.631 1.00 95.28  ? 459  GLU A OE2   1 
ATOM   6172  N N     . LEU C 2 60  ? 98.973  86.871  -50.084 1.00 49.90  ? 460  LEU A N     1 
ATOM   6173  C CA    . LEU C 2 60  ? 98.231  88.039  -50.535 1.00 50.09  ? 460  LEU A CA    1 
ATOM   6174  C C     . LEU C 2 60  ? 98.761  88.400  -51.920 1.00 49.54  ? 460  LEU A C     1 
ATOM   6175  O O     . LEU C 2 60  ? 99.956  88.279  -52.178 1.00 49.04  ? 460  LEU A O     1 
ATOM   6176  C CB    . LEU C 2 60  ? 98.424  89.195  -49.554 1.00 49.12  ? 460  LEU A CB    1 
ATOM   6177  C CG    . LEU C 2 60  ? 97.784  88.945  -48.183 1.00 52.32  ? 460  LEU A CG    1 
ATOM   6178  C CD1   . LEU C 2 60  ? 98.256  90.004  -47.192 1.00 53.44  ? 460  LEU A CD1   1 
ATOM   6179  C CD2   . LEU C 2 60  ? 96.256  88.955  -48.311 1.00 51.25  ? 460  LEU A CD2   1 
ATOM   6180  N N     . LEU C 2 61  ? 97.872  88.845  -52.804 1.00 47.64  ? 461  LEU A N     1 
ATOM   6181  C CA    . LEU C 2 61  ? 98.255  89.157  -54.178 1.00 46.12  ? 461  LEU A CA    1 
ATOM   6182  C C     . LEU C 2 61  ? 98.407  90.634  -54.525 1.00 45.79  ? 461  LEU A C     1 
ATOM   6183  O O     . LEU C 2 61  ? 98.876  90.975  -55.609 1.00 47.08  ? 461  LEU A O     1 
ATOM   6184  C CB    . LEU C 2 61  ? 97.262  88.481  -55.126 1.00 42.88  ? 461  LEU A CB    1 
ATOM   6185  C CG    . LEU C 2 61  ? 97.068  87.002  -54.779 1.00 41.34  ? 461  LEU A CG    1 
ATOM   6186  C CD1   . LEU C 2 61  ? 95.982  86.402  -55.645 1.00 41.76  ? 461  LEU A CD1   1 
ATOM   6187  C CD2   . LEU C 2 61  ? 98.380  86.259  -54.968 1.00 41.87  ? 461  LEU A CD2   1 
ATOM   6188  N N     . ILE C 2 62  ? 97.989  91.511  -53.622 1.00 45.23  ? 462  ILE A N     1 
ATOM   6189  C CA    . ILE C 2 62  ? 98.150  92.943  -53.839 1.00 44.73  ? 462  ILE A CA    1 
ATOM   6190  C C     . ILE C 2 62  ? 99.366  93.282  -52.978 1.00 45.62  ? 462  ILE A C     1 
ATOM   6191  O O     . ILE C 2 62  ? 99.567  92.661  -51.932 1.00 45.94  ? 462  ILE A O     1 
ATOM   6192  C CB    . ILE C 2 62  ? 96.930  93.748  -53.328 1.00 40.60  ? 462  ILE A CB    1 
ATOM   6193  C CG1   . ILE C 2 62  ? 95.674  93.333  -54.086 1.00 41.04  ? 462  ILE A CG1   1 
ATOM   6194  C CG2   . ILE C 2 62  ? 97.177  95.251  -53.504 1.00 40.38  ? 462  ILE A CG2   1 
ATOM   6195  C CD1   . ILE C 2 62  ? 94.411  94.066  -53.633 1.00 39.04  ? 462  ILE A CD1   1 
ATOM   6196  N N     . ARG C 2 63  ? 100.174 94.252  -53.401 1.00 47.06  ? 463  ARG A N     1 
ATOM   6197  C CA    . ARG C 2 63  ? 101.363 94.627  -52.627 1.00 48.67  ? 463  ARG A CA    1 
ATOM   6198  C C     . ARG C 2 63  ? 100.979 95.422  -51.375 1.00 47.69  ? 463  ARG A C     1 
ATOM   6199  O O     . ARG C 2 63  ? 100.083 96.260  -51.412 1.00 46.90  ? 463  ARG A O     1 
ATOM   6200  C CB    . ARG C 2 63  ? 102.327 95.406  -53.523 1.00 66.21  ? 463  ARG A CB    1 
ATOM   6201  C CG    . ARG C 2 63  ? 102.699 94.608  -54.766 1.00 71.59  ? 463  ARG A CG    1 
ATOM   6202  C CD    . ARG C 2 63  ? 103.641 95.336  -55.706 1.00 77.35  ? 463  ARG A CD    1 
ATOM   6203  N NE    . ARG C 2 63  ? 104.978 95.519  -55.143 1.00 83.59  ? 463  ARG A NE    1 
ATOM   6204  C CZ    . ARG C 2 63  ? 105.723 94.544  -54.628 1.00 85.70  ? 463  ARG A CZ    1 
ATOM   6205  N NH1   . ARG C 2 63  ? 105.271 93.295  -54.593 1.00 87.11  ? 463  ARG A NH1   1 
ATOM   6206  N NH2   . ARG C 2 63  ? 106.931 94.819  -54.154 1.00 87.22  ? 463  ARG A NH2   1 
ATOM   6207  N N     . LYS C 2 64  ? 101.664 95.143  -50.268 1.00 44.17  ? 464  LYS A N     1 
ATOM   6208  C CA    . LYS C 2 64  ? 101.384 95.774  -48.975 1.00 44.94  ? 464  LYS A CA    1 
ATOM   6209  C C     . LYS C 2 64  ? 101.334 97.298  -48.904 1.00 43.57  ? 464  LYS A C     1 
ATOM   6210  O O     . LYS C 2 64  ? 100.290 97.879  -48.599 1.00 41.84  ? 464  LYS A O     1 
ATOM   6211  C CB    . LYS C 2 64  ? 102.375 95.264  -47.922 1.00 63.14  ? 464  LYS A CB    1 
ATOM   6212  C CG    . LYS C 2 64  ? 102.421 93.752  -47.776 1.00 68.29  ? 464  LYS A CG    1 
ATOM   6213  C CD    . LYS C 2 64  ? 101.052 93.176  -47.452 1.00 71.38  ? 464  LYS A CD    1 
ATOM   6214  C CE    . LYS C 2 64  ? 101.105 91.659  -47.298 1.00 75.14  ? 464  LYS A CE    1 
ATOM   6215  N NZ    . LYS C 2 64  ? 101.903 91.225  -46.112 1.00 77.38  ? 464  LYS A NZ    1 
ATOM   6216  N N     . LEU C 2 65  ? 102.465 97.949  -49.164 1.00 51.75  ? 465  LEU A N     1 
ATOM   6217  C CA    . LEU C 2 65  ? 102.534 99.409  -49.096 1.00 50.66  ? 465  LEU A CA    1 
ATOM   6218  C C     . LEU C 2 65  ? 101.417 100.102 -49.880 1.00 49.03  ? 465  LEU A C     1 
ATOM   6219  O O     . LEU C 2 65  ? 100.706 100.950 -49.340 1.00 48.27  ? 465  LEU A O     1 
ATOM   6220  C CB    . LEU C 2 65  ? 103.909 99.895  -49.581 1.00 61.15  ? 465  LEU A CB    1 
ATOM   6221  C CG    . LEU C 2 65  ? 104.157 101.410 -49.650 1.00 63.03  ? 465  LEU A CG    1 
ATOM   6222  C CD1   . LEU C 2 65  ? 103.899 102.061 -48.298 1.00 60.89  ? 465  LEU A CD1   1 
ATOM   6223  C CD2   . LEU C 2 65  ? 105.593 101.661 -50.108 1.00 64.64  ? 465  LEU A CD2   1 
ATOM   6224  N N     . PRO C 2 66  ? 101.246 99.750  -51.166 1.00 46.88  ? 466  PRO A N     1 
ATOM   6225  C CA    . PRO C 2 66  ? 100.190 100.381 -51.964 1.00 46.26  ? 466  PRO A CA    1 
ATOM   6226  C C     . PRO C 2 66  ? 98.822  100.209 -51.300 1.00 46.19  ? 466  PRO A C     1 
ATOM   6227  O O     . PRO C 2 66  ? 98.017  101.132 -51.273 1.00 46.27  ? 466  PRO A O     1 
ATOM   6228  C CB    . PRO C 2 66  ? 100.272 99.641  -53.296 1.00 44.64  ? 466  PRO A CB    1 
ATOM   6229  C CG    . PRO C 2 66  ? 101.712 99.235  -53.369 1.00 44.96  ? 466  PRO A CG    1 
ATOM   6230  C CD    . PRO C 2 66  ? 101.978 98.756  -51.967 1.00 44.81  ? 466  PRO A CD    1 
ATOM   6231  N N     . PHE C 2 67  ? 98.565  99.022  -50.761 1.00 45.44  ? 467  PHE A N     1 
ATOM   6232  C CA    . PHE C 2 67  ? 97.288  98.777  -50.112 1.00 45.62  ? 467  PHE A CA    1 
ATOM   6233  C C     . PHE C 2 67  ? 97.186  99.645  -48.864 1.00 45.36  ? 467  PHE A C     1 
ATOM   6234  O O     . PHE C 2 67  ? 96.147  100.246 -48.590 1.00 43.61  ? 467  PHE A O     1 
ATOM   6235  C CB    . PHE C 2 67  ? 97.144  97.302  -49.724 1.00 43.29  ? 467  PHE A CB    1 
ATOM   6236  C CG    . PHE C 2 67  ? 95.762  96.946  -49.243 1.00 43.22  ? 467  PHE A CG    1 
ATOM   6237  C CD1   . PHE C 2 67  ? 94.724  96.758  -50.153 1.00 42.88  ? 467  PHE A CD1   1 
ATOM   6238  C CD2   . PHE C 2 67  ? 95.479  96.870  -47.885 1.00 40.61  ? 467  PHE A CD2   1 
ATOM   6239  C CE1   . PHE C 2 67  ? 93.425  96.501  -49.711 1.00 41.56  ? 467  PHE A CE1   1 
ATOM   6240  C CE2   . PHE C 2 67  ? 94.181  96.614  -47.438 1.00 40.59  ? 467  PHE A CE2   1 
ATOM   6241  C CZ    . PHE C 2 67  ? 93.158  96.433  -48.351 1.00 39.36  ? 467  PHE A CZ    1 
ATOM   6242  N N     . GLN C 2 68  ? 98.278  99.708  -48.114 1.00 47.43  ? 468  GLN A N     1 
ATOM   6243  C CA    . GLN C 2 68  ? 98.325  100.505 -46.896 1.00 49.47  ? 468  GLN A CA    1 
ATOM   6244  C C     . GLN C 2 68  ? 97.982  101.966 -47.188 1.00 48.50  ? 468  GLN A C     1 
ATOM   6245  O O     . GLN C 2 68  ? 97.173  102.579 -46.482 1.00 47.98  ? 468  GLN A O     1 
ATOM   6246  C CB    . GLN C 2 68  ? 99.715  100.408 -46.266 1.00 63.37  ? 468  GLN A CB    1 
ATOM   6247  C CG    . GLN C 2 68  ? 99.848  101.137 -44.947 1.00 69.06  ? 468  GLN A CG    1 
ATOM   6248  C CD    . GLN C 2 68  ? 100.304 100.225 -43.832 1.00 73.62  ? 468  GLN A CD    1 
ATOM   6249  O OE1   . GLN C 2 68  ? 100.495 100.660 -42.696 1.00 77.09  ? 468  GLN A OE1   1 
ATOM   6250  N NE2   . GLN C 2 68  ? 100.482 98.948  -44.148 1.00 75.12  ? 468  GLN A NE2   1 
ATOM   6251  N N     . ARG C 2 69  ? 98.587  102.520 -48.234 1.00 41.52  ? 469  ARG A N     1 
ATOM   6252  C CA    . ARG C 2 69  ? 98.329  103.913 -48.609 1.00 42.62  ? 469  ARG A CA    1 
ATOM   6253  C C     . ARG C 2 69  ? 96.862  104.147 -48.951 1.00 41.31  ? 469  ARG A C     1 
ATOM   6254  O O     . ARG C 2 69  ? 96.271  105.171 -48.590 1.00 40.22  ? 469  ARG A O     1 
ATOM   6255  C CB    . ARG C 2 69  ? 99.174  104.316 -49.824 1.00 60.39  ? 469  ARG A CB    1 
ATOM   6256  C CG    . ARG C 2 69  ? 100.671 104.410 -49.572 1.00 64.31  ? 469  ARG A CG    1 
ATOM   6257  C CD    . ARG C 2 69  ? 101.335 105.261 -50.652 1.00 67.02  ? 469  ARG A CD    1 
ATOM   6258  N NE    . ARG C 2 69  ? 101.137 104.708 -51.988 1.00 68.35  ? 469  ARG A NE    1 
ATOM   6259  C CZ    . ARG C 2 69  ? 102.007 103.919 -52.609 1.00 70.33  ? 469  ARG A CZ    1 
ATOM   6260  N NH1   . ARG C 2 69  ? 103.150 103.587 -52.021 1.00 71.26  ? 469  ARG A NH1   1 
ATOM   6261  N NH2   . ARG C 2 69  ? 101.728 103.455 -53.818 1.00 71.52  ? 469  ARG A NH2   1 
ATOM   6262  N N     . LEU C 2 70  ? 96.281  103.196 -49.671 1.00 42.28  ? 470  LEU A N     1 
ATOM   6263  C CA    . LEU C 2 70  ? 94.890  103.292 -50.071 1.00 41.42  ? 470  LEU A CA    1 
ATOM   6264  C C     . LEU C 2 70  ? 93.982  103.296 -48.848 1.00 40.41  ? 470  LEU A C     1 
ATOM   6265  O O     . LEU C 2 70  ? 93.088  104.131 -48.725 1.00 39.26  ? 470  LEU A O     1 
ATOM   6266  C CB    . LEU C 2 70  ? 94.545  102.118 -50.979 1.00 46.19  ? 470  LEU A CB    1 
ATOM   6267  C CG    . LEU C 2 70  ? 93.130  102.099 -51.526 1.00 45.91  ? 470  LEU A CG    1 
ATOM   6268  C CD1   . LEU C 2 70  ? 92.860  103.364 -52.349 1.00 43.45  ? 470  LEU A CD1   1 
ATOM   6269  C CD2   . LEU C 2 70  ? 92.975  100.844 -52.366 1.00 46.00  ? 470  LEU A CD2   1 
ATOM   6270  N N     . VAL C 2 71  ? 94.223  102.363 -47.937 1.00 40.22  ? 471  VAL A N     1 
ATOM   6271  C CA    . VAL C 2 71  ? 93.425  102.264 -46.727 1.00 41.01  ? 471  VAL A CA    1 
ATOM   6272  C C     . VAL C 2 71  ? 93.490  103.551 -45.906 1.00 42.56  ? 471  VAL A C     1 
ATOM   6273  O O     . VAL C 2 71  ? 92.467  104.044 -45.419 1.00 42.27  ? 471  VAL A O     1 
ATOM   6274  C CB    . VAL C 2 71  ? 93.914  101.077 -45.868 1.00 45.22  ? 471  VAL A CB    1 
ATOM   6275  C CG1   . VAL C 2 71  ? 93.403  101.200 -44.438 1.00 44.31  ? 471  VAL A CG1   1 
ATOM   6276  C CG2   . VAL C 2 71  ? 93.453  99.773  -46.499 1.00 45.08  ? 471  VAL A CG2   1 
ATOM   6277  N N     . ARG C 2 72  ? 94.697  104.093 -45.755 1.00 45.60  ? 472  ARG A N     1 
ATOM   6278  C CA    . ARG C 2 72  ? 94.884  105.315 -44.982 1.00 46.90  ? 472  ARG A CA    1 
ATOM   6279  C C     . ARG C 2 72  ? 94.198  106.496 -45.641 1.00 46.82  ? 472  ARG A C     1 
ATOM   6280  O O     . ARG C 2 72  ? 93.605  107.327 -44.961 1.00 45.91  ? 472  ARG A O     1 
ATOM   6281  C CB    . ARG C 2 72  ? 96.374  105.605 -44.797 1.00 48.43  ? 472  ARG A CB    1 
ATOM   6282  C CG    . ARG C 2 72  ? 97.064  104.590 -43.912 1.00 49.07  ? 472  ARG A CG    1 
ATOM   6283  C CD    . ARG C 2 72  ? 98.552  104.809 -43.876 1.00 51.27  ? 472  ARG A CD    1 
ATOM   6284  N NE    . ARG C 2 72  ? 99.208  103.767 -43.098 1.00 53.15  ? 472  ARG A NE    1 
ATOM   6285  C CZ    . ARG C 2 72  ? 99.168  103.681 -41.775 1.00 51.88  ? 472  ARG A CZ    1 
ATOM   6286  N NH1   . ARG C 2 72  ? 98.509  104.585 -41.066 1.00 52.25  ? 472  ARG A NH1   1 
ATOM   6287  N NH2   . ARG C 2 72  ? 99.772  102.675 -41.167 1.00 52.07  ? 472  ARG A NH2   1 
ATOM   6288  N N     . GLU C 2 73  ? 94.267  106.561 -46.968 1.00 46.86  ? 473  GLU A N     1 
ATOM   6289  C CA    . GLU C 2 73  ? 93.631  107.646 -47.707 1.00 47.34  ? 473  GLU A CA    1 
ATOM   6290  C C     . GLU C 2 73  ? 92.127  107.641 -47.436 1.00 45.64  ? 473  GLU A C     1 
ATOM   6291  O O     . GLU C 2 73  ? 91.556  108.650 -47.036 1.00 46.70  ? 473  GLU A O     1 
ATOM   6292  C CB    . GLU C 2 73  ? 93.894  107.486 -49.201 1.00 68.20  ? 473  GLU A CB    1 
ATOM   6293  C CG    . GLU C 2 73  ? 93.089  108.428 -50.068 1.00 75.75  ? 473  GLU A CG    1 
ATOM   6294  C CD    . GLU C 2 73  ? 93.154  108.069 -51.541 1.00 81.19  ? 473  GLU A CD    1 
ATOM   6295  O OE1   . GLU C 2 73  ? 94.221  108.265 -52.161 1.00 82.56  ? 473  GLU A OE1   1 
ATOM   6296  O OE2   . GLU C 2 73  ? 92.133  107.583 -52.077 1.00 84.71  ? 473  GLU A OE2   1 
ATOM   6297  N N     . ILE C 2 74  ? 91.488  106.494 -47.641 1.00 46.97  ? 474  ILE A N     1 
ATOM   6298  C CA    . ILE C 2 74  ? 90.048  106.361 -47.419 1.00 44.42  ? 474  ILE A CA    1 
ATOM   6299  C C     . ILE C 2 74  ? 89.671  106.677 -45.977 1.00 44.89  ? 474  ILE A C     1 
ATOM   6300  O O     . ILE C 2 74  ? 88.685  107.363 -45.724 1.00 45.40  ? 474  ILE A O     1 
ATOM   6301  C CB    . ILE C 2 74  ? 89.576  104.925 -47.746 1.00 41.62  ? 474  ILE A CB    1 
ATOM   6302  C CG1   . ILE C 2 74  ? 89.701  104.674 -49.251 1.00 41.24  ? 474  ILE A CG1   1 
ATOM   6303  C CG2   . ILE C 2 74  ? 88.156  104.705 -47.246 1.00 38.14  ? 474  ILE A CG2   1 
ATOM   6304  C CD1   . ILE C 2 74  ? 89.692  103.204 -49.622 1.00 40.11  ? 474  ILE A CD1   1 
ATOM   6305  N N     . ALA C 2 75  ? 90.454  106.177 -45.029 1.00 41.97  ? 475  ALA A N     1 
ATOM   6306  C CA    . ALA C 2 75  ? 90.155  106.422 -43.623 1.00 43.29  ? 475  ALA A CA    1 
ATOM   6307  C C     . ALA C 2 75  ? 90.258  107.910 -43.294 1.00 44.67  ? 475  ALA A C     1 
ATOM   6308  O O     . ALA C 2 75  ? 89.501  108.426 -42.468 1.00 43.89  ? 475  ALA A O     1 
ATOM   6309  C CB    . ALA C 2 75  ? 91.112  105.610 -42.724 1.00 33.54  ? 475  ALA A CB    1 
ATOM   6310  N N     . GLN C 2 76  ? 91.188  108.588 -43.957 1.00 51.81  ? 476  GLN A N     1 
ATOM   6311  C CA    . GLN C 2 76  ? 91.421  110.008 -43.735 1.00 55.53  ? 476  GLN A CA    1 
ATOM   6312  C C     . GLN C 2 76  ? 90.160  110.815 -44.007 1.00 56.69  ? 476  GLN A C     1 
ATOM   6313  O O     . GLN C 2 76  ? 89.967  111.875 -43.418 1.00 57.12  ? 476  GLN A O     1 
ATOM   6314  C CB    . GLN C 2 76  ? 92.574  110.494 -44.626 1.00 63.34  ? 476  GLN A CB    1 
ATOM   6315  C CG    . GLN C 2 76  ? 93.006  111.958 -44.434 1.00 66.04  ? 476  GLN A CG    1 
ATOM   6316  C CD    . GLN C 2 76  ? 93.613  112.246 -43.061 1.00 69.11  ? 476  GLN A CD    1 
ATOM   6317  O OE1   . GLN C 2 76  ? 94.088  111.341 -42.368 1.00 69.55  ? 476  GLN A OE1   1 
ATOM   6318  N NE2   . GLN C 2 76  ? 93.615  113.517 -42.676 1.00 68.34  ? 476  GLN A NE2   1 
ATOM   6319  N N     . ASP C 2 77  ? 89.290  110.307 -44.877 1.00 49.31  ? 477  ASP A N     1 
ATOM   6320  C CA    . ASP C 2 77  ? 88.050  111.014 -45.196 1.00 50.19  ? 477  ASP A CA    1 
ATOM   6321  C C     . ASP C 2 77  ? 86.980  110.872 -44.115 1.00 49.79  ? 477  ASP A C     1 
ATOM   6322  O O     . ASP C 2 77  ? 86.003  111.612 -44.113 1.00 50.04  ? 477  ASP A O     1 
ATOM   6323  C CB    . ASP C 2 77  ? 87.491  110.526 -46.534 1.00 86.71  ? 477  ASP A CB    1 
ATOM   6324  C CG    . ASP C 2 77  ? 88.339  110.961 -47.713 1.00 91.73  ? 477  ASP A CG    1 
ATOM   6325  O OD1   . ASP C 2 77  ? 88.078  110.490 -48.840 1.00 94.96  ? 477  ASP A OD1   1 
ATOM   6326  O OD2   . ASP C 2 77  ? 89.262  111.780 -47.516 1.00 94.81  ? 477  ASP A OD2   1 
ATOM   6327  N N     . PHE C 2 78  ? 87.156  109.936 -43.188 1.00 50.29  ? 478  PHE A N     1 
ATOM   6328  C CA    . PHE C 2 78  ? 86.162  109.744 -42.131 1.00 50.62  ? 478  PHE A CA    1 
ATOM   6329  C C     . PHE C 2 78  ? 86.617  110.372 -40.823 1.00 50.21  ? 478  PHE A C     1 
ATOM   6330  O O     . PHE C 2 78  ? 85.812  110.872 -40.044 1.00 50.26  ? 478  PHE A O     1 
ATOM   6331  C CB    . PHE C 2 78  ? 85.879  108.247 -41.932 1.00 53.10  ? 478  PHE A CB    1 
ATOM   6332  C CG    . PHE C 2 78  ? 85.321  107.569 -43.156 1.00 53.74  ? 478  PHE A CG    1 
ATOM   6333  C CD1   . PHE C 2 78  ? 86.019  106.541 -43.780 1.00 53.58  ? 478  PHE A CD1   1 
ATOM   6334  C CD2   . PHE C 2 78  ? 84.105  107.977 -43.702 1.00 54.30  ? 478  PHE A CD2   1 
ATOM   6335  C CE1   . PHE C 2 78  ? 85.516  105.929 -44.932 1.00 53.13  ? 478  PHE A CE1   1 
ATOM   6336  C CE2   . PHE C 2 78  ? 83.592  107.367 -44.858 1.00 53.62  ? 478  PHE A CE2   1 
ATOM   6337  C CZ    . PHE C 2 78  ? 84.302  106.344 -45.471 1.00 52.71  ? 478  PHE A CZ    1 
ATOM   6338  N N     . LYS C 2 79  ? 87.919  110.330 -40.582 1.00 48.61  ? 479  LYS A N     1 
ATOM   6339  C CA    . LYS C 2 79  ? 88.498  110.921 -39.387 1.00 49.56  ? 479  LYS A CA    1 
ATOM   6340  C C     . LYS C 2 79  ? 89.977  111.109 -39.672 1.00 48.74  ? 479  LYS A C     1 
ATOM   6341  O O     . LYS C 2 79  ? 90.656  110.185 -40.129 1.00 47.66  ? 479  LYS A O     1 
ATOM   6342  C CB    . LYS C 2 79  ? 88.306  110.022 -38.165 1.00 67.21  ? 479  LYS A CB    1 
ATOM   6343  C CG    . LYS C 2 79  ? 88.771  110.696 -36.885 1.00 71.03  ? 479  LYS A CG    1 
ATOM   6344  C CD    . LYS C 2 79  ? 88.439  109.897 -35.639 1.00 76.36  ? 479  LYS A CD    1 
ATOM   6345  C CE    . LYS C 2 79  ? 88.822  110.679 -34.380 1.00 78.83  ? 479  LYS A CE    1 
ATOM   6346  N NZ    . LYS C 2 79  ? 88.528  109.927 -33.126 1.00 81.98  ? 479  LYS A NZ    1 
ATOM   6347  N N     . THR C 2 80  ? 90.477  112.308 -39.402 1.00 48.90  ? 480  THR A N     1 
ATOM   6348  C CA    . THR C 2 80  ? 91.876  112.625 -39.673 1.00 49.41  ? 480  THR A CA    1 
ATOM   6349  C C     . THR C 2 80  ? 92.829  112.236 -38.547 1.00 48.51  ? 480  THR A C     1 
ATOM   6350  O O     . THR C 2 80  ? 92.419  112.053 -37.398 1.00 46.97  ? 480  THR A O     1 
ATOM   6351  C CB    . THR C 2 80  ? 92.044  114.130 -39.936 1.00 55.89  ? 480  THR A CB    1 
ATOM   6352  O OG1   . THR C 2 80  ? 91.705  114.853 -38.749 1.00 56.02  ? 480  THR A OG1   1 
ATOM   6353  C CG2   . THR C 2 80  ? 91.131  114.582 -41.062 1.00 55.09  ? 480  THR A CG2   1 
ATOM   6354  N N     . ASP C 2 81  ? 94.103  112.105 -38.906 1.00 57.33  ? 481  ASP A N     1 
ATOM   6355  C CA    . ASP C 2 81  ? 95.170  111.776 -37.965 1.00 58.94  ? 481  ASP A CA    1 
ATOM   6356  C C     . ASP C 2 81  ? 94.984  110.415 -37.302 1.00 57.76  ? 481  ASP A C     1 
ATOM   6357  O O     . ASP C 2 81  ? 95.170  110.260 -36.097 1.00 57.88  ? 481  ASP A O     1 
ATOM   6358  C CB    . ASP C 2 81  ? 95.270  112.895 -36.912 1.00 70.59  ? 481  ASP A CB    1 
ATOM   6359  C CG    . ASP C 2 81  ? 96.502  112.774 -36.030 1.00 75.97  ? 481  ASP A CG    1 
ATOM   6360  O OD1   . ASP C 2 81  ? 97.567  112.343 -36.535 1.00 77.32  ? 481  ASP A OD1   1 
ATOM   6361  O OD2   . ASP C 2 81  ? 96.404  113.129 -34.831 1.00 79.33  ? 481  ASP A OD2   1 
ATOM   6362  N N     . LEU C 2 82  ? 94.632  109.417 -38.100 1.00 55.32  ? 482  LEU A N     1 
ATOM   6363  C CA    . LEU C 2 82  ? 94.428  108.081 -37.566 1.00 54.30  ? 482  LEU A CA    1 
ATOM   6364  C C     . LEU C 2 82  ? 95.662  107.198 -37.651 1.00 52.73  ? 482  LEU A C     1 
ATOM   6365  O O     . LEU C 2 82  ? 96.485  107.335 -38.553 1.00 52.51  ? 482  LEU A O     1 
ATOM   6366  C CB    . LEU C 2 82  ? 93.285  107.379 -38.302 1.00 56.22  ? 482  LEU A CB    1 
ATOM   6367  C CG    . LEU C 2 82  ? 91.842  107.695 -37.924 1.00 55.69  ? 482  LEU A CG    1 
ATOM   6368  C CD1   . LEU C 2 82  ? 90.903  106.959 -38.874 1.00 55.96  ? 482  LEU A CD1   1 
ATOM   6369  C CD2   . LEU C 2 82  ? 91.587  107.270 -36.494 1.00 55.05  ? 482  LEU A CD2   1 
ATOM   6370  N N     . ARG C 2 83  ? 95.777  106.295 -36.686 1.00 42.92  ? 483  ARG A N     1 
ATOM   6371  C CA    . ARG C 2 83  ? 96.857  105.311 -36.645 1.00 42.99  ? 483  ARG A CA    1 
ATOM   6372  C C     . ARG C 2 83  ? 96.190  103.950 -36.865 1.00 40.60  ? 483  ARG A C     1 
ATOM   6373  O O     . ARG C 2 83  ? 95.004  103.795 -36.585 1.00 37.40  ? 483  ARG A O     1 
ATOM   6374  C CB    . ARG C 2 83  ? 97.553  105.329 -35.282 1.00 65.91  ? 483  ARG A CB    1 
ATOM   6375  C CG    . ARG C 2 83  ? 98.629  106.384 -35.160 1.00 71.18  ? 483  ARG A CG    1 
ATOM   6376  C CD    . ARG C 2 83  ? 99.123  106.521 -33.734 1.00 75.36  ? 483  ARG A CD    1 
ATOM   6377  N NE    . ARG C 2 83  ? 100.253 107.441 -33.672 1.00 81.24  ? 483  ARG A NE    1 
ATOM   6378  C CZ    . ARG C 2 83  ? 101.503 107.110 -33.983 1.00 83.53  ? 483  ARG A CZ    1 
ATOM   6379  N NH1   . ARG C 2 83  ? 101.789 105.873 -34.368 1.00 86.10  ? 483  ARG A NH1   1 
ATOM   6380  N NH2   . ARG C 2 83  ? 102.466 108.020 -33.937 1.00 84.58  ? 483  ARG A NH2   1 
ATOM   6381  N N     . PHE C 2 84  ? 96.949  102.974 -37.357 1.00 49.50  ? 484  PHE A N     1 
ATOM   6382  C CA    . PHE C 2 84  ? 96.420  101.633 -37.594 1.00 49.88  ? 484  PHE A CA    1 
ATOM   6383  C C     . PHE C 2 84  ? 97.322  100.555 -36.995 1.00 48.79  ? 484  PHE A C     1 
ATOM   6384  O O     . PHE C 2 84  ? 98.532  100.585 -37.198 1.00 47.78  ? 484  PHE A O     1 
ATOM   6385  C CB    . PHE C 2 84  ? 96.306  101.335 -39.107 1.00 51.58  ? 484  PHE A CB    1 
ATOM   6386  C CG    . PHE C 2 84  ? 95.119  101.970 -39.786 1.00 52.81  ? 484  PHE A CG    1 
ATOM   6387  C CD1   . PHE C 2 84  ? 95.095  103.336 -40.062 1.00 52.23  ? 484  PHE A CD1   1 
ATOM   6388  C CD2   . PHE C 2 84  ? 94.026  101.193 -40.173 1.00 53.84  ? 484  PHE A CD2   1 
ATOM   6389  C CE1   . PHE C 2 84  ? 94.001  103.922 -40.713 1.00 51.04  ? 484  PHE A CE1   1 
ATOM   6390  C CE2   . PHE C 2 84  ? 92.925  101.772 -40.825 1.00 52.77  ? 484  PHE A CE2   1 
ATOM   6391  C CZ    . PHE C 2 84  ? 92.915  103.136 -41.094 1.00 51.88  ? 484  PHE A CZ    1 
ATOM   6392  N N     . GLN C 2 85  ? 96.755  99.607  -36.253 1.00 45.14  ? 485  GLN A N     1 
ATOM   6393  C CA    . GLN C 2 85  ? 97.589  98.511  -35.774 1.00 45.95  ? 485  GLN A CA    1 
ATOM   6394  C C     . GLN C 2 85  ? 97.927  97.835  -37.095 1.00 46.08  ? 485  GLN A C     1 
ATOM   6395  O O     . GLN C 2 85  ? 97.135  97.905  -38.034 1.00 46.65  ? 485  GLN A O     1 
ATOM   6396  C CB    . GLN C 2 85  ? 96.808  97.533  -34.905 1.00 49.13  ? 485  GLN A CB    1 
ATOM   6397  C CG    . GLN C 2 85  ? 96.322  98.113  -33.612 1.00 50.54  ? 485  GLN A CG    1 
ATOM   6398  C CD    . GLN C 2 85  ? 95.759  97.051  -32.705 1.00 53.91  ? 485  GLN A CD    1 
ATOM   6399  O OE1   . GLN C 2 85  ? 95.019  96.167  -33.153 1.00 54.63  ? 485  GLN A OE1   1 
ATOM   6400  N NE2   . GLN C 2 85  ? 96.093  97.130  -31.414 1.00 54.41  ? 485  GLN A NE2   1 
ATOM   6401  N N     . SER C 2 86  ? 99.083  97.192  -37.193 1.00 45.31  ? 486  SER A N     1 
ATOM   6402  C CA    . SER C 2 86  ? 99.436  96.555  -38.449 1.00 44.39  ? 486  SER A CA    1 
ATOM   6403  C C     . SER C 2 86  ? 98.472  95.405  -38.725 1.00 44.18  ? 486  SER A C     1 
ATOM   6404  O O     . SER C 2 86  ? 98.174  95.104  -39.880 1.00 43.90  ? 486  SER A O     1 
ATOM   6405  C CB    . SER C 2 86  ? 100.879 96.044  -38.410 1.00 50.93  ? 486  SER A CB    1 
ATOM   6406  O OG    . SER C 2 86  ? 101.025 95.016  -37.452 1.00 54.83  ? 486  SER A OG    1 
ATOM   6407  N N     . SER C 2 87  ? 97.980  94.764  -37.669 1.00 46.07  ? 487  SER A N     1 
ATOM   6408  C CA    . SER C 2 87  ? 97.047  93.655  -37.844 1.00 46.71  ? 487  SER A CA    1 
ATOM   6409  C C     . SER C 2 87  ? 95.716  94.153  -38.437 1.00 45.05  ? 487  SER A C     1 
ATOM   6410  O O     . SER C 2 87  ? 95.025  93.407  -39.129 1.00 43.77  ? 487  SER A O     1 
ATOM   6411  C CB    . SER C 2 87  ? 96.822  92.938  -36.514 1.00 48.58  ? 487  SER A CB    1 
ATOM   6412  O OG    . SER C 2 87  ? 96.511  93.864  -35.492 1.00 54.11  ? 487  SER A OG    1 
ATOM   6413  N N     . ALA C 2 88  ? 95.376  95.416  -38.174 1.00 39.39  ? 488  ALA A N     1 
ATOM   6414  C CA    . ALA C 2 88  ? 94.163  96.018  -38.720 1.00 38.34  ? 488  ALA A CA    1 
ATOM   6415  C C     . ALA C 2 88  ? 94.278  96.099  -40.247 1.00 38.12  ? 488  ALA A C     1 
ATOM   6416  O O     . ALA C 2 88  ? 93.349  95.746  -40.973 1.00 37.34  ? 488  ALA A O     1 
ATOM   6417  C CB    . ALA C 2 88  ? 93.956  97.413  -38.154 1.00 36.97  ? 488  ALA A CB    1 
ATOM   6418  N N     . VAL C 2 89  ? 95.415  96.579  -40.734 1.00 38.92  ? 489  VAL A N     1 
ATOM   6419  C CA    . VAL C 2 89  ? 95.611  96.677  -42.169 1.00 40.16  ? 489  VAL A CA    1 
ATOM   6420  C C     . VAL C 2 89  ? 95.606  95.285  -42.794 1.00 41.31  ? 489  VAL A C     1 
ATOM   6421  O O     . VAL C 2 89  ? 95.111  95.107  -43.900 1.00 40.22  ? 489  VAL A O     1 
ATOM   6422  C CB    . VAL C 2 89  ? 96.943  97.397  -42.521 1.00 40.18  ? 489  VAL A CB    1 
ATOM   6423  C CG1   . VAL C 2 89  ? 97.165  97.385  -44.037 1.00 36.90  ? 489  VAL A CG1   1 
ATOM   6424  C CG2   . VAL C 2 89  ? 96.891  98.824  -42.036 1.00 38.27  ? 489  VAL A CG2   1 
ATOM   6425  N N     . MET C 2 90  ? 96.144  94.298  -42.081 1.00 43.39  ? 490  MET A N     1 
ATOM   6426  C CA    . MET C 2 90  ? 96.174  92.936  -42.603 1.00 45.39  ? 490  MET A CA    1 
ATOM   6427  C C     . MET C 2 90  ? 94.786  92.296  -42.673 1.00 43.02  ? 490  MET A C     1 
ATOM   6428  O O     . MET C 2 90  ? 94.469  91.611  -43.640 1.00 40.88  ? 490  MET A O     1 
ATOM   6429  C CB    . MET C 2 90  ? 97.121  92.062  -41.778 1.00 79.94  ? 490  MET A CB    1 
ATOM   6430  C CG    . MET C 2 90  ? 98.585  92.396  -42.000 1.00 88.23  ? 490  MET A CG    1 
ATOM   6431  S SD    . MET C 2 90  ? 99.024  92.455  -43.762 1.00 101.66 ? 490  MET A SD    1 
ATOM   6432  C CE    . MET C 2 90  ? 99.610  90.783  -44.031 1.00 98.30  ? 490  MET A CE    1 
ATOM   6433  N N     . ALA C 2 91  ? 93.961  92.506  -41.651 1.00 44.32  ? 491  ALA A N     1 
ATOM   6434  C CA    . ALA C 2 91  ? 92.617  91.951  -41.669 1.00 43.81  ? 491  ALA A CA    1 
ATOM   6435  C C     . ALA C 2 91  ? 91.914  92.555  -42.888 1.00 44.27  ? 491  ALA A C     1 
ATOM   6436  O O     . ALA C 2 91  ? 91.243  91.864  -43.655 1.00 45.18  ? 491  ALA A O     1 
ATOM   6437  C CB    . ALA C 2 91  ? 91.874  92.321  -40.388 1.00 26.63  ? 491  ALA A CB    1 
ATOM   6438  N N     . LEU C 2 92  ? 92.112  93.852  -43.073 1.00 40.22  ? 492  LEU A N     1 
ATOM   6439  C CA    . LEU C 2 92  ? 91.511  94.573  -44.177 1.00 41.77  ? 492  LEU A CA    1 
ATOM   6440  C C     . LEU C 2 92  ? 91.969  94.023  -45.538 1.00 40.80  ? 492  LEU A C     1 
ATOM   6441  O O     . LEU C 2 92  ? 91.174  93.927  -46.470 1.00 40.19  ? 492  LEU A O     1 
ATOM   6442  C CB    . LEU C 2 92  ? 91.859  96.058  -44.041 1.00 46.03  ? 492  LEU A CB    1 
ATOM   6443  C CG    . LEU C 2 92  ? 90.806  97.179  -43.958 1.00 48.08  ? 492  LEU A CG    1 
ATOM   6444  C CD1   . LEU C 2 92  ? 89.521  96.741  -43.289 1.00 47.66  ? 492  LEU A CD1   1 
ATOM   6445  C CD2   . LEU C 2 92  ? 91.433  98.338  -43.191 1.00 46.01  ? 492  LEU A CD2   1 
ATOM   6446  N N     . GLN C 2 93  ? 93.235  93.642  -45.659 1.00 40.92  ? 493  GLN A N     1 
ATOM   6447  C CA    . GLN C 2 93  ? 93.702  93.138  -46.937 1.00 42.66  ? 493  GLN A CA    1 
ATOM   6448  C C     . GLN C 2 93  ? 93.239  91.709  -47.200 1.00 41.97  ? 493  GLN A C     1 
ATOM   6449  O O     . GLN C 2 93  ? 92.990  91.338  -48.349 1.00 41.92  ? 493  GLN A O     1 
ATOM   6450  C CB    . GLN C 2 93  ? 95.224  93.221  -47.045 1.00 44.33  ? 493  GLN A CB    1 
ATOM   6451  C CG    . GLN C 2 93  ? 95.692  93.426  -48.488 1.00 47.52  ? 493  GLN A CG    1 
ATOM   6452  C CD    . GLN C 2 93  ? 97.199  93.414  -48.631 1.00 50.10  ? 493  GLN A CD    1 
ATOM   6453  O OE1   . GLN C 2 93  ? 97.917  93.945  -47.779 1.00 53.08  ? 493  GLN A OE1   1 
ATOM   6454  N NE2   . GLN C 2 93  ? 97.688  92.822  -49.715 1.00 46.56  ? 493  GLN A NE2   1 
ATOM   6455  N N     . GLU C 2 94  ? 93.125  90.911  -46.145 1.00 41.92  ? 494  GLU A N     1 
ATOM   6456  C CA    . GLU C 2 94  ? 92.656  89.534  -46.291 1.00 43.10  ? 494  GLU A CA    1 
ATOM   6457  C C     . GLU C 2 94  ? 91.174  89.550  -46.695 1.00 41.19  ? 494  GLU A C     1 
ATOM   6458  O O     . GLU C 2 94  ? 90.760  88.811  -47.592 1.00 39.21  ? 494  GLU A O     1 
ATOM   6459  C CB    . GLU C 2 94  ? 92.811  88.764  -44.975 1.00 48.40  ? 494  GLU A CB    1 
ATOM   6460  C CG    . GLU C 2 94  ? 94.245  88.418  -44.605 1.00 54.76  ? 494  GLU A CG    1 
ATOM   6461  C CD    . GLU C 2 94  ? 94.778  87.187  -45.327 1.00 58.46  ? 494  GLU A CD    1 
ATOM   6462  O OE1   . GLU C 2 94  ? 96.005  86.964  -45.258 1.00 61.21  ? 494  GLU A OE1   1 
ATOM   6463  O OE2   . GLU C 2 94  ? 93.983  86.438  -45.947 1.00 59.05  ? 494  GLU A OE2   1 
ATOM   6464  N N     . ALA C 2 95  ? 90.385  90.396  -46.033 1.00 38.90  ? 495  ALA A N     1 
ATOM   6465  C CA    . ALA C 2 95  ? 88.958  90.497  -46.340 1.00 38.62  ? 495  ALA A CA    1 
ATOM   6466  C C     . ALA C 2 95  ? 88.724  91.016  -47.757 1.00 37.91  ? 495  ALA A C     1 
ATOM   6467  O O     . ALA C 2 95  ? 87.884  90.474  -48.487 1.00 37.83  ? 495  ALA A O     1 
ATOM   6468  C CB    . ALA C 2 95  ? 88.256  91.404  -45.327 1.00 26.53  ? 495  ALA A CB    1 
ATOM   6469  N N     . SER C 2 96  ? 89.470  92.058  -48.134 1.00 38.96  ? 496  SER A N     1 
ATOM   6470  C CA    . SER C 2 96  ? 89.367  92.669  -49.464 1.00 40.74  ? 496  SER A CA    1 
ATOM   6471  C C     . SER C 2 96  ? 89.724  91.668  -50.552 1.00 40.02  ? 496  SER A C     1 
ATOM   6472  O O     . SER C 2 96  ? 88.997  91.515  -51.523 1.00 40.98  ? 496  SER A O     1 
ATOM   6473  C CB    . SER C 2 96  ? 90.314  93.873  -49.603 1.00 36.77  ? 496  SER A CB    1 
ATOM   6474  O OG    . SER C 2 96  ? 89.958  94.932  -48.730 1.00 37.66  ? 496  SER A OG    1 
ATOM   6475  N N     . GLU C 2 97  ? 90.851  90.990  -50.387 1.00 37.25  ? 497  GLU A N     1 
ATOM   6476  C CA    . GLU C 2 97  ? 91.271  90.032  -51.394 1.00 39.42  ? 497  GLU A CA    1 
ATOM   6477  C C     . GLU C 2 97  ? 90.321  88.842  -51.501 1.00 38.06  ? 497  GLU A C     1 
ATOM   6478  O O     . GLU C 2 97  ? 90.050  88.358  -52.603 1.00 35.45  ? 497  GLU A O     1 
ATOM   6479  C CB    . GLU C 2 97  ? 92.712  89.577  -51.120 1.00 50.66  ? 497  GLU A CB    1 
ATOM   6480  C CG    . GLU C 2 97  ? 93.736  90.655  -51.486 1.00 56.78  ? 497  GLU A CG    1 
ATOM   6481  C CD    . GLU C 2 97  ? 95.177  90.149  -51.525 1.00 61.33  ? 497  GLU A CD    1 
ATOM   6482  O OE1   . GLU C 2 97  ? 95.406  89.011  -52.011 1.00 61.88  ? 497  GLU A OE1   1 
ATOM   6483  O OE2   . GLU C 2 97  ? 96.081  90.903  -51.088 1.00 62.32  ? 497  GLU A OE2   1 
ATOM   6484  N N     . ALA C 2 98  ? 89.797  88.386  -50.363 1.00 34.84  ? 498  ALA A N     1 
ATOM   6485  C CA    . ALA C 2 98  ? 88.865  87.263  -50.376 1.00 33.82  ? 498  ALA A CA    1 
ATOM   6486  C C     . ALA C 2 98  ? 87.585  87.711  -51.072 1.00 33.33  ? 498  ALA A C     1 
ATOM   6487  O O     . ALA C 2 98  ? 86.956  86.948  -51.787 1.00 33.02  ? 498  ALA A O     1 
ATOM   6488  C CB    . ALA C 2 98  ? 88.559  86.803  -48.943 1.00 26.90  ? 498  ALA A CB    1 
ATOM   6489  N N     . TYR C 2 99  ? 87.207  88.963  -50.850 1.00 34.91  ? 499  TYR A N     1 
ATOM   6490  C CA    . TYR C 2 99  ? 86.010  89.509  -51.459 1.00 33.96  ? 499  TYR A CA    1 
ATOM   6491  C C     . TYR C 2 99  ? 86.163  89.603  -52.975 1.00 34.77  ? 499  TYR A C     1 
ATOM   6492  O O     . TYR C 2 99  ? 85.273  89.190  -53.709 1.00 34.51  ? 499  TYR A O     1 
ATOM   6493  C CB    . TYR C 2 99  ? 85.708  90.902  -50.889 1.00 33.50  ? 499  TYR A CB    1 
ATOM   6494  C CG    . TYR C 2 99  ? 84.671  91.671  -51.682 1.00 32.46  ? 499  TYR A CG    1 
ATOM   6495  C CD1   . TYR C 2 99  ? 83.312  91.355  -51.601 1.00 33.70  ? 499  TYR A CD1   1 
ATOM   6496  C CD2   . TYR C 2 99  ? 85.055  92.675  -52.559 1.00 32.95  ? 499  TYR A CD2   1 
ATOM   6497  C CE1   . TYR C 2 99  ? 82.365  92.022  -52.382 1.00 33.40  ? 499  TYR A CE1   1 
ATOM   6498  C CE2   . TYR C 2 99  ? 84.122  93.345  -53.345 1.00 34.37  ? 499  TYR A CE2   1 
ATOM   6499  C CZ    . TYR C 2 99  ? 82.785  93.018  -53.255 1.00 35.09  ? 499  TYR A CZ    1 
ATOM   6500  O OH    . TYR C 2 99  ? 81.882  93.701  -54.045 1.00 36.31  ? 499  TYR A OH    1 
ATOM   6501  N N     . LEU C 2 100 ? 87.285  90.148  -53.444 1.00 32.04  ? 500  LEU A N     1 
ATOM   6502  C CA    . LEU C 2 100 ? 87.491  90.292  -54.881 1.00 33.28  ? 500  LEU A CA    1 
ATOM   6503  C C     . LEU C 2 100 ? 87.605  88.953  -55.586 1.00 32.94  ? 500  LEU A C     1 
ATOM   6504  O O     . LEU C 2 100 ? 87.092  88.801  -56.697 1.00 31.58  ? 500  LEU A O     1 
ATOM   6505  C CB    . LEU C 2 100 ? 88.727  91.145  -55.177 1.00 36.48  ? 500  LEU A CB    1 
ATOM   6506  C CG    . LEU C 2 100 ? 88.562  92.628  -54.834 1.00 41.07  ? 500  LEU A CG    1 
ATOM   6507  C CD1   . LEU C 2 100 ? 89.882  93.354  -55.055 1.00 39.63  ? 500  LEU A CD1   1 
ATOM   6508  C CD2   . LEU C 2 100 ? 87.456  93.238  -55.692 1.00 39.28  ? 500  LEU A CD2   1 
ATOM   6509  N N     . VAL C 2 101 ? 88.277  87.991  -54.954 1.00 36.00  ? 501  VAL A N     1 
ATOM   6510  C CA    . VAL C 2 101 ? 88.421  86.657  -55.537 1.00 39.24  ? 501  VAL A CA    1 
ATOM   6511  C C     . VAL C 2 101 ? 87.042  86.008  -55.692 1.00 39.30  ? 501  VAL A C     1 
ATOM   6512  O O     . VAL C 2 101 ? 86.741  85.423  -56.736 1.00 40.24  ? 501  VAL A O     1 
ATOM   6513  C CB    . VAL C 2 101 ? 89.313  85.746  -54.663 1.00 38.70  ? 501  VAL A CB    1 
ATOM   6514  C CG1   . VAL C 2 101 ? 89.177  84.285  -55.097 1.00 39.01  ? 501  VAL A CG1   1 
ATOM   6515  C CG2   . VAL C 2 101 ? 90.758  86.179  -54.795 1.00 40.30  ? 501  VAL A CG2   1 
ATOM   6516  N N     . GLY C 2 102 ? 86.218  86.109  -54.647 1.00 37.91  ? 502  GLY A N     1 
ATOM   6517  C CA    . GLY C 2 102 ? 84.875  85.554  -54.687 1.00 35.88  ? 502  GLY A CA    1 
ATOM   6518  C C     . GLY C 2 102 ? 84.046  86.222  -55.775 1.00 36.06  ? 502  GLY A C     1 
ATOM   6519  O O     . GLY C 2 102 ? 83.253  85.564  -56.451 1.00 36.14  ? 502  GLY A O     1 
ATOM   6520  N N     . LEU C 2 103 ? 84.219  87.531  -55.940 1.00 30.84  ? 503  LEU A N     1 
ATOM   6521  C CA    . LEU C 2 103 ? 83.497  88.265  -56.975 1.00 31.79  ? 503  LEU A CA    1 
ATOM   6522  C C     . LEU C 2 103 ? 83.977  87.844  -58.379 1.00 31.82  ? 503  LEU A C     1 
ATOM   6523  O O     . LEU C 2 103 ? 83.165  87.698  -59.303 1.00 32.37  ? 503  LEU A O     1 
ATOM   6524  C CB    . LEU C 2 103 ? 83.695  89.772  -56.806 1.00 28.89  ? 503  LEU A CB    1 
ATOM   6525  C CG    . LEU C 2 103 ? 82.958  90.675  -57.809 1.00 29.11  ? 503  LEU A CG    1 
ATOM   6526  C CD1   . LEU C 2 103 ? 81.464  90.420  -57.710 1.00 29.16  ? 503  LEU A CD1   1 
ATOM   6527  C CD2   . LEU C 2 103 ? 83.267  92.158  -57.515 1.00 28.13  ? 503  LEU A CD2   1 
ATOM   6528  N N     . PHE C 2 104 ? 85.291  87.671  -58.535 1.00 26.03  ? 504  PHE A N     1 
ATOM   6529  C CA    . PHE C 2 104 ? 85.841  87.257  -59.812 1.00 30.74  ? 504  PHE A CA    1 
ATOM   6530  C C     . PHE C 2 104 ? 85.292  85.879  -60.178 1.00 33.59  ? 504  PHE A C     1 
ATOM   6531  O O     . PHE C 2 104 ? 85.090  85.588  -61.353 1.00 33.04  ? 504  PHE A O     1 
ATOM   6532  C CB    . PHE C 2 104 ? 87.376  87.263  -59.773 1.00 33.48  ? 504  PHE A CB    1 
ATOM   6533  C CG    . PHE C 2 104 ? 87.977  88.606  -60.116 1.00 33.31  ? 504  PHE A CG    1 
ATOM   6534  C CD1   . PHE C 2 104 ? 88.986  89.155  -59.341 1.00 32.45  ? 504  PHE A CD1   1 
ATOM   6535  C CD2   . PHE C 2 104 ? 87.503  89.334  -61.211 1.00 34.55  ? 504  PHE A CD2   1 
ATOM   6536  C CE1   . PHE C 2 104 ? 89.524  90.424  -59.641 1.00 34.44  ? 504  PHE A CE1   1 
ATOM   6537  C CE2   . PHE C 2 104 ? 88.027  90.597  -61.522 1.00 35.56  ? 504  PHE A CE2   1 
ATOM   6538  C CZ    . PHE C 2 104 ? 89.040  91.144  -60.733 1.00 35.71  ? 504  PHE A CZ    1 
ATOM   6539  N N     . GLU C 2 105 ? 85.010  85.052  -59.173 1.00 40.13  ? 505  GLU A N     1 
ATOM   6540  C CA    . GLU C 2 105 ? 84.439  83.730  -59.419 1.00 43.07  ? 505  GLU A CA    1 
ATOM   6541  C C     . GLU C 2 105 ? 83.038  83.872  -60.021 1.00 42.91  ? 505  GLU A C     1 
ATOM   6542  O O     . GLU C 2 105 ? 82.724  83.247  -61.034 1.00 43.00  ? 505  GLU A O     1 
ATOM   6543  C CB    . GLU C 2 105 ? 84.338  82.930  -58.116 1.00 49.71  ? 505  GLU A CB    1 
ATOM   6544  C CG    . GLU C 2 105 ? 85.654  82.398  -57.595 1.00 57.51  ? 505  GLU A CG    1 
ATOM   6545  C CD    . GLU C 2 105 ? 85.548  81.812  -56.191 1.00 60.64  ? 505  GLU A CD    1 
ATOM   6546  O OE1   . GLU C 2 105 ? 84.441  81.373  -55.807 1.00 64.20  ? 505  GLU A OE1   1 
ATOM   6547  O OE2   . GLU C 2 105 ? 86.575  81.779  -55.477 1.00 60.92  ? 505  GLU A OE2   1 
ATOM   6548  N N     . ASP C 2 106 ? 82.194  84.683  -59.385 1.00 40.84  ? 506  ASP A N     1 
ATOM   6549  C CA    . ASP C 2 106 ? 80.819  84.900  -59.865 1.00 41.87  ? 506  ASP A CA    1 
ATOM   6550  C C     . ASP C 2 106 ? 80.802  85.595  -61.225 1.00 39.50  ? 506  ASP A C     1 
ATOM   6551  O O     . ASP C 2 106 ? 79.948  85.322  -62.072 1.00 39.09  ? 506  ASP A O     1 
ATOM   6552  C CB    . ASP C 2 106 ? 80.021  85.742  -58.863 1.00 51.33  ? 506  ASP A CB    1 
ATOM   6553  C CG    . ASP C 2 106 ? 79.751  85.007  -57.564 1.00 56.29  ? 506  ASP A CG    1 
ATOM   6554  O OD1   . ASP C 2 106 ? 79.818  83.754  -57.558 1.00 60.46  ? 506  ASP A OD1   1 
ATOM   6555  O OD2   . ASP C 2 106 ? 79.453  85.680  -56.551 1.00 58.08  ? 506  ASP A OD2   1 
ATOM   6556  N N     . THR C 2 107 ? 81.742  86.512  -61.412 1.00 34.28  ? 507  THR A N     1 
ATOM   6557  C CA    . THR C 2 107 ? 81.874  87.244  -62.660 1.00 33.65  ? 507  THR A CA    1 
ATOM   6558  C C     . THR C 2 107 ? 82.190  86.245  -63.790 1.00 33.97  ? 507  THR A C     1 
ATOM   6559  O O     . THR C 2 107 ? 81.627  86.325  -64.891 1.00 30.12  ? 507  THR A O     1 
ATOM   6560  C CB    . THR C 2 107 ? 83.011  88.273  -62.527 1.00 39.62  ? 507  THR A CB    1 
ATOM   6561  O OG1   . THR C 2 107 ? 82.666  89.221  -61.504 1.00 37.65  ? 507  THR A OG1   1 
ATOM   6562  C CG2   . THR C 2 107 ? 83.271  88.983  -63.855 1.00 37.85  ? 507  THR A CG2   1 
ATOM   6563  N N     . ASN C 2 108 ? 83.073  85.294  -63.492 1.00 33.93  ? 508  ASN A N     1 
ATOM   6564  C CA    . ASN C 2 108 ? 83.465  84.287  -64.463 1.00 35.79  ? 508  ASN A CA    1 
ATOM   6565  C C     . ASN C 2 108 ? 82.260  83.453  -64.900 1.00 35.59  ? 508  ASN A C     1 
ATOM   6566  O O     . ASN C 2 108 ? 82.129  83.109  -66.079 1.00 35.72  ? 508  ASN A O     1 
ATOM   6567  C CB    . ASN C 2 108 ? 84.551  83.382  -63.871 1.00 42.44  ? 508  ASN A CB    1 
ATOM   6568  C CG    . ASN C 2 108 ? 85.395  82.717  -64.938 1.00 44.40  ? 508  ASN A CG    1 
ATOM   6569  O OD1   . ASN C 2 108 ? 85.690  83.322  -65.962 1.00 47.15  ? 508  ASN A OD1   1 
ATOM   6570  N ND2   . ASN C 2 108 ? 85.801  81.476  -64.697 1.00 45.82  ? 508  ASN A ND2   1 
ATOM   6571  N N     . LEU C 2 109 ? 81.378  83.136  -63.955 1.00 33.48  ? 509  LEU A N     1 
ATOM   6572  C CA    . LEU C 2 109 ? 80.182  82.364  -64.272 1.00 34.67  ? 509  LEU A CA    1 
ATOM   6573  C C     . LEU C 2 109 ? 79.229  83.158  -65.180 1.00 36.39  ? 509  LEU A C     1 
ATOM   6574  O O     . LEU C 2 109 ? 78.543  82.575  -66.023 1.00 37.10  ? 509  LEU A O     1 
ATOM   6575  C CB    . LEU C 2 109 ? 79.451  81.946  -62.985 1.00 30.09  ? 509  LEU A CB    1 
ATOM   6576  C CG    . LEU C 2 109 ? 80.175  80.904  -62.124 1.00 33.38  ? 509  LEU A CG    1 
ATOM   6577  C CD1   . LEU C 2 109 ? 79.450  80.719  -60.800 1.00 33.80  ? 509  LEU A CD1   1 
ATOM   6578  C CD2   . LEU C 2 109 ? 80.256  79.579  -62.867 1.00 32.93  ? 509  LEU A CD2   1 
ATOM   6579  N N     . CYS C 2 110 ? 79.183  84.478  -65.003 1.00 33.97  ? 510  CYS A N     1 
ATOM   6580  C CA    . CYS C 2 110 ? 78.315  85.323  -65.813 1.00 35.08  ? 510  CYS A CA    1 
ATOM   6581  C C     . CYS C 2 110 ? 78.843  85.434  -67.244 1.00 35.76  ? 510  CYS A C     1 
ATOM   6582  O O     . CYS C 2 110 ? 78.067  85.423  -68.192 1.00 35.72  ? 510  CYS A O     1 
ATOM   6583  C CB    . CYS C 2 110 ? 78.185  86.718  -65.192 1.00 33.60  ? 510  CYS A CB    1 
ATOM   6584  S SG    . CYS C 2 110 ? 77.358  86.722  -63.563 1.00 36.73  ? 510  CYS A SG    1 
ATOM   6585  N N     . ALA C 2 111 ? 80.156  85.562  -67.395 1.00 37.69  ? 511  ALA A N     1 
ATOM   6586  C CA    . ALA C 2 111 ? 80.763  85.636  -68.722 1.00 38.83  ? 511  ALA A CA    1 
ATOM   6587  C C     . ALA C 2 111 ? 80.514  84.298  -69.431 1.00 37.93  ? 511  ALA A C     1 
ATOM   6588  O O     . ALA C 2 111 ? 80.077  84.262  -70.581 1.00 38.12  ? 511  ALA A O     1 
ATOM   6589  C CB    . ALA C 2 111 ? 82.253  85.891  -68.601 1.00 41.90  ? 511  ALA A CB    1 
ATOM   6590  N N     . ILE C 2 112 ? 80.775  83.201  -68.731 1.00 33.11  ? 512  ILE A N     1 
ATOM   6591  C CA    . ILE C 2 112 ? 80.558  81.879  -69.299 1.00 34.67  ? 512  ILE A CA    1 
ATOM   6592  C C     . ILE C 2 112 ? 79.084  81.663  -69.659 1.00 36.39  ? 512  ILE A C     1 
ATOM   6593  O O     . ILE C 2 112 ? 78.766  81.002  -70.661 1.00 36.53  ? 512  ILE A O     1 
ATOM   6594  C CB    . ILE C 2 112 ? 81.023  80.787  -68.325 1.00 36.06  ? 512  ILE A CB    1 
ATOM   6595  C CG1   . ILE C 2 112 ? 82.553  80.793  -68.256 1.00 35.50  ? 512  ILE A CG1   1 
ATOM   6596  C CG2   . ILE C 2 112 ? 80.481  79.423  -68.766 1.00 36.06  ? 512  ILE A CG2   1 
ATOM   6597  C CD1   . ILE C 2 112 ? 83.138  79.893  -67.171 1.00 36.25  ? 512  ILE A CD1   1 
ATOM   6598  N N     . HIS C 2 113 ? 78.187  82.227  -68.853 1.00 37.71  ? 513  HIS A N     1 
ATOM   6599  C CA    . HIS C 2 113 ? 76.758  82.102  -69.106 1.00 36.57  ? 513  HIS A CA    1 
ATOM   6600  C C     . HIS C 2 113 ? 76.455  82.740  -70.467 1.00 38.63  ? 513  HIS A C     1 
ATOM   6601  O O     . HIS C 2 113 ? 75.617  82.246  -71.226 1.00 39.08  ? 513  HIS A O     1 
ATOM   6602  C CB    . HIS C 2 113 ? 75.961  82.813  -68.005 1.00 35.05  ? 513  HIS A CB    1 
ATOM   6603  C CG    . HIS C 2 113 ? 74.474  82.666  -68.135 1.00 35.14  ? 513  HIS A CG    1 
ATOM   6604  N ND1   . HIS C 2 113 ? 73.824  81.460  -67.968 1.00 35.25  ? 513  HIS A ND1   1 
ATOM   6605  C CD2   . HIS C 2 113 ? 73.507  83.581  -68.385 1.00 35.33  ? 513  HIS A CD2   1 
ATOM   6606  C CE1   . HIS C 2 113 ? 72.522  81.640  -68.103 1.00 34.62  ? 513  HIS A CE1   1 
ATOM   6607  N NE2   . HIS C 2 113 ? 72.302  82.918  -68.356 1.00 34.02  ? 513  HIS A NE2   1 
ATOM   6608  N N     . ALA C 2 114 ? 77.134  83.846  -70.761 1.00 36.80  ? 514  ALA A N     1 
ATOM   6609  C CA    . ALA C 2 114 ? 76.948  84.537  -72.030 1.00 38.44  ? 514  ALA A CA    1 
ATOM   6610  C C     . ALA C 2 114 ? 77.819  83.918  -73.133 1.00 39.32  ? 514  ALA A C     1 
ATOM   6611  O O     . ALA C 2 114 ? 78.044  84.537  -74.161 1.00 41.42  ? 514  ALA A O     1 
ATOM   6612  C CB    . ALA C 2 114 ? 77.281  86.004  -71.873 1.00 24.63  ? 514  ALA A CB    1 
ATOM   6613  N N     . LYS C 2 115 ? 78.312  82.705  -72.905 1.00 41.59  ? 515  LYS A N     1 
ATOM   6614  C CA    . LYS C 2 115 ? 79.134  81.996  -73.883 1.00 45.13  ? 515  LYS A CA    1 
ATOM   6615  C C     . LYS C 2 115 ? 80.443  82.698  -74.235 1.00 44.69  ? 515  LYS A C     1 
ATOM   6616  O O     . LYS C 2 115 ? 80.884  82.696  -75.390 1.00 43.78  ? 515  LYS A O     1 
ATOM   6617  C CB    . LYS C 2 115 ? 78.317  81.740  -75.150 1.00 71.98  ? 515  LYS A CB    1 
ATOM   6618  C CG    . LYS C 2 115 ? 77.062  80.922  -74.888 1.00 77.73  ? 515  LYS A CG    1 
ATOM   6619  C CD    . LYS C 2 115 ? 76.181  80.824  -76.119 1.00 81.27  ? 515  LYS A CD    1 
ATOM   6620  C CE    . LYS C 2 115 ? 74.928  80.011  -75.829 1.00 84.00  ? 515  LYS A CE    1 
ATOM   6621  N NZ    . LYS C 2 115 ? 74.023  79.937  -77.015 1.00 86.88  ? 515  LYS A NZ    1 
ATOM   6622  N N     . ARG C 2 116 ? 81.052  83.312  -73.229 1.00 40.44  ? 516  ARG A N     1 
ATOM   6623  C CA    . ARG C 2 116 ? 82.323  83.990  -73.371 1.00 39.12  ? 516  ARG A CA    1 
ATOM   6624  C C     . ARG C 2 116 ? 83.309  83.366  -72.419 1.00 40.13  ? 516  ARG A C     1 
ATOM   6625  O O     . ARG C 2 116 ? 82.923  82.594  -71.539 1.00 38.03  ? 516  ARG A O     1 
ATOM   6626  C CB    . ARG C 2 116 ? 82.189  85.491  -73.111 1.00 39.65  ? 516  ARG A CB    1 
ATOM   6627  C CG    . ARG C 2 116 ? 81.510  86.300  -74.200 1.00 40.40  ? 516  ARG A CG    1 
ATOM   6628  C CD    . ARG C 2 116 ? 81.563  87.807  -73.938 1.00 38.94  ? 516  ARG A CD    1 
ATOM   6629  N NE    . ARG C 2 116 ? 80.506  88.233  -73.019 1.00 39.19  ? 516  ARG A NE    1 
ATOM   6630  C CZ    . ARG C 2 116 ? 80.667  88.482  -71.717 1.00 38.99  ? 516  ARG A CZ    1 
ATOM   6631  N NH1   . ARG C 2 116 ? 81.850  88.320  -71.138 1.00 36.03  ? 516  ARG A NH1   1 
ATOM   6632  N NH2   . ARG C 2 116 ? 79.637  88.895  -70.995 1.00 39.06  ? 516  ARG A NH2   1 
ATOM   6633  N N     . VAL C 2 117 ? 84.584  83.692  -72.585 1.00 40.61  ? 517  VAL A N     1 
ATOM   6634  C CA    . VAL C 2 117 ? 85.627  83.196  -71.705 1.00 43.39  ? 517  VAL A CA    1 
ATOM   6635  C C     . VAL C 2 117 ? 86.394  84.408  -71.208 1.00 42.08  ? 517  VAL A C     1 
ATOM   6636  O O     . VAL C 2 117 ? 87.357  84.293  -70.463 1.00 45.03  ? 517  VAL A O     1 
ATOM   6637  C CB    . VAL C 2 117 ? 86.522  82.165  -72.416 1.00 57.25  ? 517  VAL A CB    1 
ATOM   6638  C CG1   . VAL C 2 117 ? 85.711  80.942  -72.815 1.00 57.52  ? 517  VAL A CG1   1 
ATOM   6639  C CG2   . VAL C 2 117 ? 87.192  82.789  -73.630 1.00 53.17  ? 517  VAL A CG2   1 
ATOM   6640  N N     . THR C 2 118 ? 85.941  85.580  -71.632 1.00 42.23  ? 518  THR A N     1 
ATOM   6641  C CA    . THR C 2 118 ? 86.555  86.836  -71.237 1.00 41.99  ? 518  THR A CA    1 
ATOM   6642  C C     . THR C 2 118 ? 85.586  87.592  -70.344 1.00 40.89  ? 518  THR A C     1 
ATOM   6643  O O     . THR C 2 118 ? 84.467  87.884  -70.765 1.00 41.53  ? 518  THR A O     1 
ATOM   6644  C CB    . THR C 2 118 ? 86.849  87.730  -72.467 1.00 45.14  ? 518  THR A CB    1 
ATOM   6645  O OG1   . THR C 2 118 ? 87.526  86.963  -73.466 1.00 46.20  ? 518  THR A OG1   1 
ATOM   6646  C CG2   . THR C 2 118 ? 87.722  88.917  -72.071 1.00 43.68  ? 518  THR A CG2   1 
ATOM   6647  N N     . ILE C 2 119 ? 86.010  87.914  -69.121 1.00 37.99  ? 519  ILE A N     1 
ATOM   6648  C CA    . ILE C 2 119 ? 85.145  88.663  -68.208 1.00 37.41  ? 519  ILE A CA    1 
ATOM   6649  C C     . ILE C 2 119 ? 85.145  90.137  -68.588 1.00 39.02  ? 519  ILE A C     1 
ATOM   6650  O O     . ILE C 2 119 ? 86.176  90.689  -68.975 1.00 39.12  ? 519  ILE A O     1 
ATOM   6651  C CB    . ILE C 2 119 ? 85.592  88.546  -66.733 1.00 33.86  ? 519  ILE A CB    1 
ATOM   6652  C CG1   . ILE C 2 119 ? 87.046  88.979  -66.578 1.00 31.28  ? 519  ILE A CG1   1 
ATOM   6653  C CG2   . ILE C 2 119 ? 85.391  87.124  -66.245 1.00 29.85  ? 519  ILE A CG2   1 
ATOM   6654  C CD1   . ILE C 2 119 ? 87.487  89.120  -65.137 1.00 31.57  ? 519  ILE A CD1   1 
ATOM   6655  N N     . MET C 2 120 ? 83.985  90.771  -68.482 1.00 39.37  ? 520  MET A N     1 
ATOM   6656  C CA    . MET C 2 120 ? 83.858  92.182  -68.813 1.00 40.93  ? 520  MET A CA    1 
ATOM   6657  C C     . MET C 2 120 ? 83.160  92.923  -67.686 1.00 42.10  ? 520  MET A C     1 
ATOM   6658  O O     . MET C 2 120 ? 82.628  92.310  -66.760 1.00 40.39  ? 520  MET A O     1 
ATOM   6659  C CB    . MET C 2 120 ? 83.071  92.344  -70.107 1.00 49.10  ? 520  MET A CB    1 
ATOM   6660  C CG    . MET C 2 120 ? 83.646  91.532  -71.245 1.00 52.18  ? 520  MET A CG    1 
ATOM   6661  S SD    . MET C 2 120 ? 82.632  91.575  -72.710 1.00 57.44  ? 520  MET A SD    1 
ATOM   6662  C CE    . MET C 2 120 ? 83.915  91.238  -73.994 1.00 58.55  ? 520  MET A CE    1 
ATOM   6663  N N     . PRO C 2 121 ? 83.162  94.263  -67.744 1.00 48.03  ? 521  PRO A N     1 
ATOM   6664  C CA    . PRO C 2 121 ? 82.511  95.044  -66.690 1.00 47.97  ? 521  PRO A CA    1 
ATOM   6665  C C     . PRO C 2 121 ? 81.052  94.649  -66.482 1.00 46.73  ? 521  PRO A C     1 
ATOM   6666  O O     . PRO C 2 121 ? 80.571  94.585  -65.350 1.00 45.37  ? 521  PRO A O     1 
ATOM   6667  C CB    . PRO C 2 121 ? 82.668  96.483  -67.183 1.00 48.45  ? 521  PRO A CB    1 
ATOM   6668  C CG    . PRO C 2 121 ? 83.992  96.433  -67.904 1.00 48.62  ? 521  PRO A CG    1 
ATOM   6669  C CD    . PRO C 2 121 ? 83.879  95.142  -68.688 1.00 49.08  ? 521  PRO A CD    1 
ATOM   6670  N N     . LYS C 2 122 ? 80.348  94.379  -67.574 1.00 40.87  ? 522  LYS A N     1 
ATOM   6671  C CA    . LYS C 2 122 ? 78.947  94.001  -67.459 1.00 40.77  ? 522  LYS A CA    1 
ATOM   6672  C C     . LYS C 2 122 ? 78.778  92.682  -66.696 1.00 39.06  ? 522  LYS A C     1 
ATOM   6673  O O     . LYS C 2 122 ? 77.701  92.402  -66.167 1.00 38.40  ? 522  LYS A O     1 
ATOM   6674  C CB    . LYS C 2 122 ? 78.300  93.913  -68.842 1.00 45.95  ? 522  LYS A CB    1 
ATOM   6675  C CG    . LYS C 2 122 ? 78.962  92.922  -69.770 1.00 52.24  ? 522  LYS A CG    1 
ATOM   6676  C CD    . LYS C 2 122 ? 78.190  92.805  -71.068 1.00 56.52  ? 522  LYS A CD    1 
ATOM   6677  C CE    . LYS C 2 122 ? 78.907  91.889  -72.044 1.00 60.18  ? 522  LYS A CE    1 
ATOM   6678  N NZ    . LYS C 2 122 ? 78.239  91.911  -73.386 1.00 64.93  ? 522  LYS A NZ    1 
ATOM   6679  N N     . ASP C 2 123 ? 79.828  91.867  -66.646 1.00 36.58  ? 523  ASP A N     1 
ATOM   6680  C CA    . ASP C 2 123 ? 79.755  90.608  -65.900 1.00 35.76  ? 523  ASP A CA    1 
ATOM   6681  C C     . ASP C 2 123 ? 79.853  90.927  -64.414 1.00 35.58  ? 523  ASP A C     1 
ATOM   6682  O O     . ASP C 2 123 ? 79.111  90.375  -63.606 1.00 34.79  ? 523  ASP A O     1 
ATOM   6683  C CB    . ASP C 2 123 ? 80.901  89.667  -66.280 1.00 39.31  ? 523  ASP A CB    1 
ATOM   6684  C CG    . ASP C 2 123 ? 80.837  89.225  -67.726 1.00 40.99  ? 523  ASP A CG    1 
ATOM   6685  O OD1   . ASP C 2 123 ? 79.723  88.905  -68.183 1.00 42.31  ? 523  ASP A OD1   1 
ATOM   6686  O OD2   . ASP C 2 123 ? 81.896  89.184  -68.396 1.00 38.87  ? 523  ASP A OD2   1 
ATOM   6687  N N     . ILE C 2 124 ? 80.778  91.816  -64.060 1.00 35.82  ? 524  ILE A N     1 
ATOM   6688  C CA    . ILE C 2 124 ? 80.970  92.217  -62.670 1.00 37.17  ? 524  ILE A CA    1 
ATOM   6689  C C     . ILE C 2 124 ? 79.685  92.866  -62.175 1.00 36.72  ? 524  ILE A C     1 
ATOM   6690  O O     . ILE C 2 124 ? 79.252  92.616  -61.052 1.00 36.79  ? 524  ILE A O     1 
ATOM   6691  C CB    . ILE C 2 124 ? 82.161  93.225  -62.517 1.00 37.70  ? 524  ILE A CB    1 
ATOM   6692  C CG1   . ILE C 2 124 ? 83.488  92.515  -62.805 1.00 40.98  ? 524  ILE A CG1   1 
ATOM   6693  C CG2   . ILE C 2 124 ? 82.195  93.805  -61.115 1.00 39.04  ? 524  ILE A CG2   1 
ATOM   6694  C CD1   . ILE C 2 124 ? 84.725  93.407  -62.701 1.00 42.98  ? 524  ILE A CD1   1 
ATOM   6695  N N     . GLN C 2 125 ? 79.077  93.683  -63.027 1.00 35.05  ? 525  GLN A N     1 
ATOM   6696  C CA    . GLN C 2 125 ? 77.832  94.380  -62.703 1.00 37.12  ? 525  GLN A CA    1 
ATOM   6697  C C     . GLN C 2 125 ? 76.673  93.419  -62.484 1.00 36.10  ? 525  GLN A C     1 
ATOM   6698  O O     . GLN C 2 125 ? 75.905  93.575  -61.541 1.00 37.83  ? 525  GLN A O     1 
ATOM   6699  C CB    . GLN C 2 125 ? 77.483  95.370  -63.817 1.00 48.42  ? 525  GLN A CB    1 
ATOM   6700  C CG    . GLN C 2 125 ? 78.383  96.604  -63.839 1.00 54.27  ? 525  GLN A CG    1 
ATOM   6701  C CD    . GLN C 2 125 ? 78.507  97.225  -65.223 1.00 57.74  ? 525  GLN A CD    1 
ATOM   6702  O OE1   . GLN C 2 125 ? 77.585  97.153  -66.038 1.00 60.40  ? 525  GLN A OE1   1 
ATOM   6703  N NE2   . GLN C 2 125 ? 79.649  97.854  -65.486 1.00 61.39  ? 525  GLN A NE2   1 
ATOM   6704  N N     . LEU C 2 126 ? 76.529  92.429  -63.357 1.00 35.44  ? 526  LEU A N     1 
ATOM   6705  C CA    . LEU C 2 126 ? 75.462  91.462  -63.173 1.00 33.59  ? 526  LEU A CA    1 
ATOM   6706  C C     . LEU C 2 126 ? 75.646  90.773  -61.820 1.00 33.30  ? 526  LEU A C     1 
ATOM   6707  O O     . LEU C 2 126 ? 74.729  90.737  -61.010 1.00 30.73  ? 526  LEU A O     1 
ATOM   6708  C CB    . LEU C 2 126 ? 75.486  90.404  -64.271 1.00 32.09  ? 526  LEU A CB    1 
ATOM   6709  C CG    . LEU C 2 126 ? 74.382  89.351  -64.129 1.00 34.72  ? 526  LEU A CG    1 
ATOM   6710  C CD1   . LEU C 2 126 ? 73.019  90.032  -64.175 1.00 33.92  ? 526  LEU A CD1   1 
ATOM   6711  C CD2   . LEU C 2 126 ? 74.504  88.309  -65.243 1.00 33.84  ? 526  LEU A CD2   1 
ATOM   6712  N N     . ALA C 2 127 ? 76.835  90.222  -61.588 1.00 31.67  ? 527  ALA A N     1 
ATOM   6713  C CA    . ALA C 2 127 ? 77.117  89.529  -60.336 1.00 33.61  ? 527  ALA A CA    1 
ATOM   6714  C C     . ALA C 2 127 ? 76.821  90.409  -59.108 1.00 34.81  ? 527  ALA A C     1 
ATOM   6715  O O     . ALA C 2 127 ? 76.197  89.955  -58.158 1.00 35.79  ? 527  ALA A O     1 
ATOM   6716  C CB    . ALA C 2 127 ? 78.582  89.043  -60.320 1.00 29.18  ? 527  ALA A CB    1 
ATOM   6717  N N     . ARG C 2 128 ? 77.240  91.667  -59.130 1.00 39.09  ? 528  ARG A N     1 
ATOM   6718  C CA    . ARG C 2 128 ? 76.979  92.553  -57.999 1.00 40.73  ? 528  ARG A CA    1 
ATOM   6719  C C     . ARG C 2 128 ? 75.494  92.860  -57.847 1.00 41.75  ? 528  ARG A C     1 
ATOM   6720  O O     . ARG C 2 128 ? 74.968  92.917  -56.726 1.00 41.45  ? 528  ARG A O     1 
ATOM   6721  C CB    . ARG C 2 128 ? 77.788  93.854  -58.134 1.00 32.85  ? 528  ARG A CB    1 
ATOM   6722  C CG    . ARG C 2 128 ? 79.287  93.617  -57.963 1.00 33.81  ? 528  ARG A CG    1 
ATOM   6723  C CD    . ARG C 2 128 ? 80.074  94.924  -57.817 1.00 37.44  ? 528  ARG A CD    1 
ATOM   6724  N NE    . ARG C 2 128 ? 79.809  95.607  -56.552 1.00 36.98  ? 528  ARG A NE    1 
ATOM   6725  C CZ    . ARG C 2 128 ? 79.359  96.857  -56.468 1.00 38.89  ? 528  ARG A CZ    1 
ATOM   6726  N NH1   . ARG C 2 128 ? 79.128  97.548  -57.571 1.00 38.97  ? 528  ARG A NH1   1 
ATOM   6727  N NH2   . ARG C 2 128 ? 79.139  97.416  -55.287 1.00 38.37  ? 528  ARG A NH2   1 
ATOM   6728  N N     . ARG C 2 129 ? 74.812  93.062  -58.968 1.00 34.28  ? 529  ARG A N     1 
ATOM   6729  C CA    . ARG C 2 129 ? 73.388  93.328  -58.909 1.00 36.30  ? 529  ARG A CA    1 
ATOM   6730  C C     . ARG C 2 129 ? 72.670  92.127  -58.271 1.00 35.71  ? 529  ARG A C     1 
ATOM   6731  O O     . ARG C 2 129 ? 71.858  92.277  -57.357 1.00 34.10  ? 529  ARG A O     1 
ATOM   6732  C CB    . ARG C 2 129 ? 72.853  93.596  -60.314 1.00 47.41  ? 529  ARG A CB    1 
ATOM   6733  C CG    . ARG C 2 129 ? 71.357  93.420  -60.465 1.00 53.57  ? 529  ARG A CG    1 
ATOM   6734  C CD    . ARG C 2 129 ? 70.558  94.416  -59.645 1.00 57.79  ? 529  ARG A CD    1 
ATOM   6735  N NE    . ARG C 2 129 ? 69.118  94.208  -59.811 1.00 59.58  ? 529  ARG A NE    1 
ATOM   6736  C CZ    . ARG C 2 129 ? 68.457  93.130  -59.387 1.00 61.90  ? 529  ARG A CZ    1 
ATOM   6737  N NH1   . ARG C 2 129 ? 69.100  92.149  -58.759 1.00 60.07  ? 529  ARG A NH1   1 
ATOM   6738  N NH2   . ARG C 2 129 ? 67.148  93.023  -59.606 1.00 61.94  ? 529  ARG A NH2   1 
ATOM   6739  N N     . ILE C 2 130 ? 72.993  90.927  -58.729 1.00 38.02  ? 530  ILE A N     1 
ATOM   6740  C CA    . ILE C 2 130 ? 72.345  89.749  -58.190 1.00 39.55  ? 530  ILE A CA    1 
ATOM   6741  C C     . ILE C 2 130 ? 72.732  89.486  -56.736 1.00 41.31  ? 530  ILE A C     1 
ATOM   6742  O O     . ILE C 2 130 ? 71.944  88.943  -55.974 1.00 40.77  ? 530  ILE A O     1 
ATOM   6743  C CB    . ILE C 2 130 ? 72.639  88.537  -59.064 1.00 39.81  ? 530  ILE A CB    1 
ATOM   6744  C CG1   . ILE C 2 130 ? 71.964  88.742  -60.420 1.00 41.02  ? 530  ILE A CG1   1 
ATOM   6745  C CG2   . ILE C 2 130 ? 72.139  87.261  -58.400 1.00 38.91  ? 530  ILE A CG2   1 
ATOM   6746  C CD1   . ILE C 2 130 ? 72.226  87.625  -61.397 1.00 44.25  ? 530  ILE A CD1   1 
ATOM   6747  N N     . ARG C 2 131 ? 73.939  89.874  -56.345 1.00 42.84  ? 531  ARG A N     1 
ATOM   6748  C CA    . ARG C 2 131 ? 74.347  89.697  -54.959 1.00 45.39  ? 531  ARG A CA    1 
ATOM   6749  C C     . ARG C 2 131 ? 73.599  90.684  -54.058 1.00 48.31  ? 531  ARG A C     1 
ATOM   6750  O O     . ARG C 2 131 ? 73.561  90.520  -52.838 1.00 48.82  ? 531  ARG A O     1 
ATOM   6751  C CB    . ARG C 2 131 ? 75.839  89.948  -54.803 1.00 41.15  ? 531  ARG A CB    1 
ATOM   6752  C CG    . ARG C 2 131 ? 76.724  88.778  -55.143 1.00 38.95  ? 531  ARG A CG    1 
ATOM   6753  C CD    . ARG C 2 131 ? 78.142  89.213  -54.938 1.00 38.33  ? 531  ARG A CD    1 
ATOM   6754  N NE    . ARG C 2 131 ? 79.073  88.112  -55.082 1.00 39.02  ? 531  ARG A NE    1 
ATOM   6755  C CZ    . ARG C 2 131 ? 80.277  88.100  -54.533 1.00 38.25  ? 531  ARG A CZ    1 
ATOM   6756  N NH1   . ARG C 2 131 ? 80.677  89.141  -53.808 1.00 37.42  ? 531  ARG A NH1   1 
ATOM   6757  N NH2   . ARG C 2 131 ? 81.066  87.046  -54.693 1.00 34.98  ? 531  ARG A NH2   1 
ATOM   6758  N N     . GLY C 2 132 ? 73.023  91.716  -54.662 1.00 45.65  ? 532  GLY A N     1 
ATOM   6759  C CA    . GLY C 2 132 ? 72.308  92.711  -53.886 1.00 51.18  ? 532  GLY A CA    1 
ATOM   6760  C C     . GLY C 2 132 ? 73.229  93.817  -53.407 1.00 55.70  ? 532  GLY A C     1 
ATOM   6761  O O     . GLY C 2 132 ? 72.892  94.577  -52.499 1.00 56.69  ? 532  GLY A O     1 
ATOM   6762  N N     . GLU C 2 133 ? 74.403  93.910  -54.017 1.00 48.86  ? 533  GLU A N     1 
ATOM   6763  C CA    . GLU C 2 133 ? 75.370  94.934  -53.641 1.00 55.15  ? 533  GLU A CA    1 
ATOM   6764  C C     . GLU C 2 133 ? 75.104  96.166  -54.485 1.00 61.54  ? 533  GLU A C     1 
ATOM   6765  O O     . GLU C 2 133 ? 75.473  97.280  -54.116 1.00 63.30  ? 533  GLU A O     1 
ATOM   6766  C CB    . GLU C 2 133 ? 76.804  94.454  -53.905 1.00 53.89  ? 533  GLU A CB    1 
ATOM   6767  C CG    . GLU C 2 133 ? 77.167  93.123  -53.268 1.00 50.62  ? 533  GLU A CG    1 
ATOM   6768  C CD    . GLU C 2 133 ? 78.631  92.747  -53.473 1.00 50.04  ? 533  GLU A CD    1 
ATOM   6769  O OE1   . GLU C 2 133 ? 79.357  93.483  -54.186 1.00 48.75  ? 533  GLU A OE1   1 
ATOM   6770  O OE2   . GLU C 2 133 ? 79.056  91.708  -52.919 1.00 49.23  ? 533  GLU A OE2   1 
ATOM   6771  N N     . ARG C 2 134 ? 74.458  95.950  -55.623 1.00 101.04 ? 534  ARG A N     1 
ATOM   6772  C CA    . ARG C 2 134 ? 74.152  97.020  -56.563 1.00 109.54 ? 534  ARG A CA    1 
ATOM   6773  C C     . ARG C 2 134 ? 72.697  97.443  -56.408 1.00 113.00 ? 534  ARG A C     1 
ATOM   6774  O O     . ARG C 2 134 ? 72.387  98.635  -56.370 1.00 113.51 ? 534  ARG A O     1 
ATOM   6775  C CB    . ARG C 2 134 ? 74.410  96.521  -57.990 1.00 113.13 ? 534  ARG A CB    1 
ATOM   6776  C CG    . ARG C 2 134 ? 74.750  97.593  -59.010 1.00 118.80 ? 534  ARG A CG    1 
ATOM   6777  C CD    . ARG C 2 134 ? 75.007  96.960  -60.379 1.00 122.95 ? 534  ARG A CD    1 
ATOM   6778  N NE    . ARG C 2 134 ? 75.448  97.941  -61.368 1.00 127.79 ? 534  ARG A NE    1 
ATOM   6779  C CZ    . ARG C 2 134 ? 76.721  98.241  -61.621 1.00 129.91 ? 534  ARG A CZ    1 
ATOM   6780  N NH1   . ARG C 2 134 ? 77.698  97.629  -60.961 1.00 130.78 ? 534  ARG A NH1   1 
ATOM   6781  N NH2   . ARG C 2 134 ? 77.016  99.163  -62.529 1.00 130.50 ? 534  ARG A NH2   1 
ATOM   6782  N N     . ALA C 2 135 ? 71.812  96.455  -56.315 1.00 119.30 ? 535  ALA A N     1 
ATOM   6783  C CA    . ALA C 2 135 ? 70.383  96.706  -56.161 1.00 121.75 ? 535  ALA A CA    1 
ATOM   6784  C C     . ALA C 2 135 ? 69.623  95.394  -55.968 1.00 122.38 ? 535  ALA A C     1 
ATOM   6785  O O     . ALA C 2 135 ? 68.615  95.179  -56.677 1.00 122.92 ? 535  ALA A O     1 
ATOM   6786  C CB    . ALA C 2 135 ? 69.848  97.449  -57.388 1.00 117.27 ? 535  ALA A CB    1 
ATOM   6787  O OXT   . ALA C 2 135 ? 70.040  94.600  -55.099 1.00 120.25 ? 535  ALA A OXT   1 
ATOM   6788  N N     . LEU D 3 23  ? 102.947 111.535 -61.421 1.00 136.64 ? 22   LEU B N     1 
ATOM   6789  C CA    . LEU D 3 23  ? 103.596 110.738 -60.344 1.00 136.75 ? 22   LEU B CA    1 
ATOM   6790  C C     . LEU D 3 23  ? 102.749 109.545 -59.900 1.00 134.90 ? 22   LEU B C     1 
ATOM   6791  O O     . LEU D 3 23  ? 103.160 108.402 -60.100 1.00 134.55 ? 22   LEU B O     1 
ATOM   6792  C CB    . LEU D 3 23  ? 103.935 111.636 -59.146 1.00 142.47 ? 22   LEU B CB    1 
ATOM   6793  C CG    . LEU D 3 23  ? 102.941 112.708 -58.687 1.00 143.81 ? 22   LEU B CG    1 
ATOM   6794  C CD1   . LEU D 3 23  ? 103.496 113.402 -57.452 1.00 144.40 ? 22   LEU B CD1   1 
ATOM   6795  C CD2   . LEU D 3 23  ? 102.710 113.728 -59.795 1.00 144.39 ? 22   LEU B CD2   1 
ATOM   6796  N N     . ARG D 3 24  ? 101.578 109.798 -59.310 1.00 153.29 ? 23   ARG B N     1 
ATOM   6797  C CA    . ARG D 3 24  ? 100.699 108.710 -58.863 1.00 150.00 ? 23   ARG B CA    1 
ATOM   6798  C C     . ARG D 3 24  ? 99.393  109.083 -58.159 1.00 143.76 ? 23   ARG B C     1 
ATOM   6799  O O     . ARG D 3 24  ? 99.127  110.247 -57.858 1.00 144.78 ? 23   ARG B O     1 
ATOM   6800  C CB    . ARG D 3 24  ? 101.461 107.750 -57.943 1.00 155.58 ? 23   ARG B CB    1 
ATOM   6801  C CG    . ARG D 3 24  ? 101.923 106.472 -58.617 1.00 161.82 ? 23   ARG B CG    1 
ATOM   6802  C CD    . ARG D 3 24  ? 102.494 105.496 -57.609 1.00 166.94 ? 23   ARG B CD    1 
ATOM   6803  N NE    . ARG D 3 24  ? 103.030 104.303 -58.255 1.00 170.85 ? 23   ARG B NE    1 
ATOM   6804  C CZ    . ARG D 3 24  ? 103.489 103.244 -57.598 1.00 172.68 ? 23   ARG B CZ    1 
ATOM   6805  N NH1   . ARG D 3 24  ? 103.472 103.232 -56.274 1.00 173.56 ? 23   ARG B NH1   1 
ATOM   6806  N NH2   . ARG D 3 24  ? 103.966 102.200 -58.262 1.00 173.95 ? 23   ARG B NH2   1 
ATOM   6807  N N     . ASP D 3 25  ? 98.591  108.048 -57.911 1.00 88.71  ? 24   ASP B N     1 
ATOM   6808  C CA    . ASP D 3 25  ? 97.302  108.122 -57.220 1.00 81.58  ? 24   ASP B CA    1 
ATOM   6809  C C     . ASP D 3 25  ? 97.187  106.801 -56.468 1.00 74.36  ? 24   ASP B C     1 
ATOM   6810  O O     . ASP D 3 25  ? 97.522  105.748 -57.013 1.00 74.05  ? 24   ASP B O     1 
ATOM   6811  C CB    . ASP D 3 25  ? 96.133  108.247 -58.202 1.00 144.21 ? 24   ASP B CB    1 
ATOM   6812  C CG    . ASP D 3 25  ? 95.925  109.666 -58.689 1.00 145.12 ? 24   ASP B CG    1 
ATOM   6813  O OD1   . ASP D 3 25  ? 96.331  110.608 -57.975 1.00 146.56 ? 24   ASP B OD1   1 
ATOM   6814  O OD2   . ASP D 3 25  ? 95.339  109.838 -59.778 1.00 146.63 ? 24   ASP B OD2   1 
ATOM   6815  N N     . ASN D 3 26  ? 96.705  106.856 -55.230 1.00 72.39  ? 25   ASN B N     1 
ATOM   6816  C CA    . ASN D 3 26  ? 96.604  105.663 -54.395 1.00 64.19  ? 25   ASN B CA    1 
ATOM   6817  C C     . ASN D 3 26  ? 95.850  104.451 -54.942 1.00 58.19  ? 25   ASN B C     1 
ATOM   6818  O O     . ASN D 3 26  ? 96.386  103.338 -54.936 1.00 55.20  ? 25   ASN B O     1 
ATOM   6819  C CB    . ASN D 3 26  ? 96.064  106.046 -53.019 1.00 60.26  ? 25   ASN B CB    1 
ATOM   6820  C CG    . ASN D 3 26  ? 97.066  106.859 -52.221 1.00 58.87  ? 25   ASN B CG    1 
ATOM   6821  O OD1   . ASN D 3 26  ? 98.257  106.523 -52.177 1.00 57.61  ? 25   ASN B OD1   1 
ATOM   6822  N ND2   . ASN D 3 26  ? 96.597  107.928 -51.585 1.00 57.69  ? 25   ASN B ND2   1 
ATOM   6823  N N     . ILE D 3 27  ? 94.624  104.651 -55.414 1.00 57.48  ? 26   ILE B N     1 
ATOM   6824  C CA    . ILE D 3 27  ? 93.857  103.537 -55.950 1.00 53.21  ? 26   ILE B CA    1 
ATOM   6825  C C     . ILE D 3 27  ? 94.585  102.908 -57.145 1.00 50.97  ? 26   ILE B C     1 
ATOM   6826  O O     . ILE D 3 27  ? 94.433  101.715 -57.417 1.00 48.48  ? 26   ILE B O     1 
ATOM   6827  C CB    . ILE D 3 27  ? 92.441  103.978 -56.377 1.00 58.00  ? 26   ILE B CB    1 
ATOM   6828  C CG1   . ILE D 3 27  ? 91.595  102.753 -56.739 1.00 56.25  ? 26   ILE B CG1   1 
ATOM   6829  C CG2   . ILE D 3 27  ? 92.531  104.918 -57.569 1.00 57.76  ? 26   ILE B CG2   1 
ATOM   6830  C CD1   . ILE D 3 27  ? 91.466  101.741 -55.631 1.00 53.77  ? 26   ILE B CD1   1 
ATOM   6831  N N     . GLN D 3 28  ? 95.381  103.703 -57.854 1.00 62.80  ? 27   GLN B N     1 
ATOM   6832  C CA    . GLN D 3 28  ? 96.127  103.182 -58.994 1.00 60.82  ? 27   GLN B CA    1 
ATOM   6833  C C     . GLN D 3 28  ? 97.290  102.329 -58.498 1.00 61.22  ? 27   GLN B C     1 
ATOM   6834  O O     . GLN D 3 28  ? 97.996  101.686 -59.284 1.00 62.07  ? 27   GLN B O     1 
ATOM   6835  C CB    . GLN D 3 28  ? 96.637  104.323 -59.867 1.00 60.89  ? 27   GLN B CB    1 
ATOM   6836  C CG    . GLN D 3 28  ? 95.534  105.094 -60.592 1.00 61.02  ? 27   GLN B CG    1 
ATOM   6837  C CD    . GLN D 3 28  ? 94.689  104.207 -61.509 1.00 61.39  ? 27   GLN B CD    1 
ATOM   6838  O OE1   . GLN D 3 28  ? 95.218  103.381 -62.260 1.00 60.30  ? 27   GLN B OE1   1 
ATOM   6839  N NE2   . GLN D 3 28  ? 93.373  104.387 -61.457 1.00 60.03  ? 27   GLN B NE2   1 
ATOM   6840  N N     . GLY D 3 29  ? 97.482  102.324 -57.181 1.00 63.33  ? 28   GLY B N     1 
ATOM   6841  C CA    . GLY D 3 29  ? 98.538  101.520 -56.596 1.00 60.83  ? 28   GLY B CA    1 
ATOM   6842  C C     . GLY D 3 29  ? 98.163  100.057 -56.739 1.00 59.74  ? 28   GLY B C     1 
ATOM   6843  O O     . GLY D 3 29  ? 99.025  99.174  -56.714 1.00 59.99  ? 28   GLY B O     1 
ATOM   6844  N N     . ILE D 3 30  ? 96.862  99.798  -56.866 1.00 50.29  ? 29   ILE B N     1 
ATOM   6845  C CA    . ILE D 3 30  ? 96.376  98.440  -57.050 1.00 48.15  ? 29   ILE B CA    1 
ATOM   6846  C C     . ILE D 3 30  ? 96.600  98.247  -58.539 1.00 47.78  ? 29   ILE B C     1 
ATOM   6847  O O     . ILE D 3 30  ? 95.784  98.649  -59.369 1.00 46.17  ? 29   ILE B O     1 
ATOM   6848  C CB    . ILE D 3 30  ? 94.872  98.317  -56.713 1.00 49.61  ? 29   ILE B CB    1 
ATOM   6849  C CG1   . ILE D 3 30  ? 94.579  98.991  -55.373 1.00 47.96  ? 29   ILE B CG1   1 
ATOM   6850  C CG2   . ILE D 3 30  ? 94.483  96.846  -56.622 1.00 47.66  ? 29   ILE B CG2   1 
ATOM   6851  C CD1   . ILE D 3 30  ? 95.375  98.422  -54.203 1.00 47.91  ? 29   ILE B CD1   1 
ATOM   6852  N N     . THR D 3 31  ? 97.729  97.637  -58.865 1.00 50.01  ? 30   THR B N     1 
ATOM   6853  C CA    . THR D 3 31  ? 98.131  97.449  -60.247 1.00 49.07  ? 30   THR B CA    1 
ATOM   6854  C C     . THR D 3 31  ? 97.429  96.372  -61.057 1.00 49.72  ? 30   THR B C     1 
ATOM   6855  O O     . THR D 3 31  ? 96.877  95.403  -60.520 1.00 48.01  ? 30   THR B O     1 
ATOM   6856  C CB    . THR D 3 31  ? 99.640  97.192  -60.310 1.00 47.96  ? 30   THR B CB    1 
ATOM   6857  O OG1   . THR D 3 31  ? 99.935  95.944  -59.667 1.00 47.51  ? 30   THR B OG1   1 
ATOM   6858  C CG2   . THR D 3 31  ? 100.392 98.313  -59.597 1.00 43.91  ? 30   THR B CG2   1 
ATOM   6859  N N     . LYS D 3 32  ? 97.478  96.559  -62.372 1.00 45.03  ? 31   LYS B N     1 
ATOM   6860  C CA    . LYS D 3 32  ? 96.885  95.630  -63.306 1.00 45.84  ? 31   LYS B CA    1 
ATOM   6861  C C     . LYS D 3 32  ? 97.327  94.200  -62.994 1.00 44.89  ? 31   LYS B C     1 
ATOM   6862  O O     . LYS D 3 32  ? 96.509  93.286  -62.960 1.00 45.30  ? 31   LYS B O     1 
ATOM   6863  C CB    . LYS D 3 32  ? 97.280  96.020  -64.735 1.00 58.25  ? 31   LYS B CB    1 
ATOM   6864  C CG    . LYS D 3 32  ? 96.932  94.991  -65.792 1.00 62.29  ? 31   LYS B CG    1 
ATOM   6865  C CD    . LYS D 3 32  ? 97.287  95.499  -67.176 1.00 66.70  ? 31   LYS B CD    1 
ATOM   6866  C CE    . LYS D 3 32  ? 97.019  94.456  -68.243 1.00 67.83  ? 31   LYS B CE    1 
ATOM   6867  N NZ    . LYS D 3 32  ? 97.271  95.011  -69.603 1.00 71.18  ? 31   LYS B NZ    1 
ATOM   6868  N N     . PRO D 3 33  ? 98.630  93.982  -62.770 1.00 50.59  ? 32   PRO B N     1 
ATOM   6869  C CA    . PRO D 3 33  ? 99.103  92.625  -62.465 1.00 48.30  ? 32   PRO B CA    1 
ATOM   6870  C C     . PRO D 3 33  ? 98.533  92.057  -61.171 1.00 47.29  ? 32   PRO B C     1 
ATOM   6871  O O     . PRO D 3 33  ? 98.286  90.860  -61.070 1.00 47.81  ? 32   PRO B O     1 
ATOM   6872  C CB    . PRO D 3 33  ? 100.620 92.796  -62.391 1.00 47.29  ? 32   PRO B CB    1 
ATOM   6873  C CG    . PRO D 3 33  ? 100.874 93.924  -63.360 1.00 48.80  ? 32   PRO B CG    1 
ATOM   6874  C CD    . PRO D 3 33  ? 99.766  94.889  -63.030 1.00 48.40  ? 32   PRO B CD    1 
ATOM   6875  N N     . ALA D 3 34  ? 98.341  92.912  -60.174 1.00 42.22  ? 33   ALA B N     1 
ATOM   6876  C CA    . ALA D 3 34  ? 97.804  92.460  -58.898 1.00 40.37  ? 33   ALA B CA    1 
ATOM   6877  C C     . ALA D 3 34  ? 96.355  92.049  -59.097 1.00 40.17  ? 33   ALA B C     1 
ATOM   6878  O O     . ALA D 3 34  ? 95.883  91.048  -58.524 1.00 40.65  ? 33   ALA B O     1 
ATOM   6879  C CB    . ALA D 3 34  ? 97.897  93.571  -57.860 1.00 43.35  ? 33   ALA B CB    1 
ATOM   6880  N N     . ILE D 3 35  ? 95.646  92.823  -59.913 1.00 40.17  ? 34   ILE B N     1 
ATOM   6881  C CA    . ILE D 3 35  ? 94.246  92.536  -60.202 1.00 40.96  ? 34   ILE B CA    1 
ATOM   6882  C C     . ILE D 3 35  ? 94.159  91.226  -60.991 1.00 42.29  ? 34   ILE B C     1 
ATOM   6883  O O     . ILE D 3 35  ? 93.293  90.389  -60.733 1.00 41.91  ? 34   ILE B O     1 
ATOM   6884  C CB    . ILE D 3 35  ? 93.603  93.693  -60.990 1.00 34.43  ? 34   ILE B CB    1 
ATOM   6885  C CG1   . ILE D 3 35  ? 93.485  94.921  -60.075 1.00 33.85  ? 34   ILE B CG1   1 
ATOM   6886  C CG2   . ILE D 3 35  ? 92.238  93.285  -61.506 1.00 33.88  ? 34   ILE B CG2   1 
ATOM   6887  C CD1   . ILE D 3 35  ? 92.947  96.161  -60.748 1.00 33.43  ? 34   ILE B CD1   1 
ATOM   6888  N N     . ARG D 3 36  ? 95.076  91.050  -61.937 1.00 38.86  ? 35   ARG B N     1 
ATOM   6889  C CA    . ARG D 3 36  ? 95.119  89.846  -62.747 1.00 40.11  ? 35   ARG B CA    1 
ATOM   6890  C C     . ARG D 3 36  ? 95.331  88.646  -61.841 1.00 40.12  ? 35   ARG B C     1 
ATOM   6891  O O     . ARG D 3 36  ? 94.705  87.603  -62.033 1.00 39.41  ? 35   ARG B O     1 
ATOM   6892  C CB    . ARG D 3 36  ? 96.268  89.930  -63.741 1.00 52.78  ? 35   ARG B CB    1 
ATOM   6893  C CG    . ARG D 3 36  ? 96.500  88.676  -64.539 1.00 58.81  ? 35   ARG B CG    1 
ATOM   6894  C CD    . ARG D 3 36  ? 97.484  88.927  -65.684 1.00 62.07  ? 35   ARG B CD    1 
ATOM   6895  N NE    . ARG D 3 36  ? 96.937  89.902  -66.624 1.00 64.57  ? 35   ARG B NE    1 
ATOM   6896  C CZ    . ARG D 3 36  ? 96.522  89.626  -67.859 1.00 67.67  ? 35   ARG B CZ    1 
ATOM   6897  N NH1   . ARG D 3 36  ? 96.594  88.393  -68.344 1.00 68.14  ? 35   ARG B NH1   1 
ATOM   6898  N NH2   . ARG D 3 36  ? 95.998  90.588  -68.603 1.00 70.53  ? 35   ARG B NH2   1 
ATOM   6899  N N     . ARG D 3 37  ? 96.235  88.784  -60.873 1.00 37.49  ? 36   ARG B N     1 
ATOM   6900  C CA    . ARG D 3 37  ? 96.496  87.688  -59.954 1.00 39.38  ? 36   ARG B CA    1 
ATOM   6901  C C     . ARG D 3 37  ? 95.227  87.295  -59.189 1.00 37.68  ? 36   ARG B C     1 
ATOM   6902  O O     . ARG D 3 37  ? 94.935  86.108  -59.036 1.00 37.43  ? 36   ARG B O     1 
ATOM   6903  C CB    . ARG D 3 37  ? 97.624  88.042  -58.973 1.00 42.42  ? 36   ARG B CB    1 
ATOM   6904  C CG    . ARG D 3 37  ? 99.012  88.003  -59.590 1.00 44.76  ? 36   ARG B CG    1 
ATOM   6905  C CD    . ARG D 3 37  ? 100.099 88.032  -58.517 1.00 47.74  ? 36   ARG B CD    1 
ATOM   6906  N NE    . ARG D 3 37  ? 100.188 89.318  -57.831 1.00 46.77  ? 36   ARG B NE    1 
ATOM   6907  C CZ    . ARG D 3 37  ? 100.873 90.369  -58.280 1.00 49.41  ? 36   ARG B CZ    1 
ATOM   6908  N NH1   . ARG D 3 37  ? 101.545 90.302  -59.425 1.00 48.40  ? 36   ARG B NH1   1 
ATOM   6909  N NH2   . ARG D 3 37  ? 100.888 91.497  -57.580 1.00 46.82  ? 36   ARG B NH2   1 
ATOM   6910  N N     . LEU D 3 38  ? 94.474  88.283  -58.709 1.00 37.00  ? 37   LEU B N     1 
ATOM   6911  C CA    . LEU D 3 38  ? 93.239  88.000  -57.977 1.00 36.52  ? 37   LEU B CA    1 
ATOM   6912  C C     . LEU D 3 38  ? 92.263  87.230  -58.866 1.00 36.59  ? 37   LEU B C     1 
ATOM   6913  O O     . LEU D 3 38  ? 91.675  86.236  -58.449 1.00 35.39  ? 37   LEU B O     1 
ATOM   6914  C CB    . LEU D 3 38  ? 92.576  89.298  -57.523 1.00 34.38  ? 37   LEU B CB    1 
ATOM   6915  C CG    . LEU D 3 38  ? 93.283  90.091  -56.429 1.00 34.49  ? 37   LEU B CG    1 
ATOM   6916  C CD1   . LEU D 3 38  ? 92.836  91.532  -56.498 1.00 34.04  ? 37   LEU B CD1   1 
ATOM   6917  C CD2   . LEU D 3 38  ? 92.986  89.492  -55.069 1.00 33.32  ? 37   LEU B CD2   1 
ATOM   6918  N N     . ALA D 3 39  ? 92.097  87.702  -60.098 1.00 37.37  ? 38   ALA B N     1 
ATOM   6919  C CA    . ALA D 3 39  ? 91.209  87.058  -61.053 1.00 36.80  ? 38   ALA B CA    1 
ATOM   6920  C C     . ALA D 3 39  ? 91.658  85.616  -61.289 1.00 37.07  ? 38   ALA B C     1 
ATOM   6921  O O     . ALA D 3 39  ? 90.836  84.696  -61.385 1.00 35.22  ? 38   ALA B O     1 
ATOM   6922  C CB    . ALA D 3 39  ? 91.204  87.851  -62.380 1.00 25.97  ? 38   ALA B CB    1 
ATOM   6923  N N     . ARG D 3 40  ? 92.970  85.418  -61.378 1.00 35.06  ? 39   ARG B N     1 
ATOM   6924  C CA    . ARG D 3 40  ? 93.506  84.088  -61.597 1.00 35.95  ? 39   ARG B CA    1 
ATOM   6925  C C     . ARG D 3 40  ? 93.102  83.168  -60.452 1.00 36.89  ? 39   ARG B C     1 
ATOM   6926  O O     . ARG D 3 40  ? 92.629  82.051  -60.688 1.00 37.20  ? 39   ARG B O     1 
ATOM   6927  C CB    . ARG D 3 40  ? 95.028  84.152  -61.728 1.00 43.01  ? 39   ARG B CB    1 
ATOM   6928  C CG    . ARG D 3 40  ? 95.514  84.830  -63.001 1.00 44.60  ? 39   ARG B CG    1 
ATOM   6929  C CD    . ARG D 3 40  ? 95.355  83.933  -64.224 1.00 47.71  ? 39   ARG B CD    1 
ATOM   6930  N NE    . ARG D 3 40  ? 95.950  84.566  -65.394 1.00 50.60  ? 39   ARG B NE    1 
ATOM   6931  C CZ    . ARG D 3 40  ? 95.270  85.259  -66.300 1.00 51.24  ? 39   ARG B CZ    1 
ATOM   6932  N NH1   . ARG D 3 40  ? 93.958  85.399  -66.190 1.00 50.01  ? 39   ARG B NH1   1 
ATOM   6933  N NH2   . ARG D 3 40  ? 95.913  85.852  -67.292 1.00 50.69  ? 39   ARG B NH2   1 
ATOM   6934  N N     . ARG D 3 41  ? 93.289  83.621  -59.210 1.00 36.36  ? 40   ARG B N     1 
ATOM   6935  C CA    . ARG D 3 41  ? 92.897  82.803  -58.067 1.00 35.67  ? 40   ARG B CA    1 
ATOM   6936  C C     . ARG D 3 41  ? 91.386  82.575  -58.148 1.00 36.09  ? 40   ARG B C     1 
ATOM   6937  O O     . ARG D 3 41  ? 90.858  81.593  -57.616 1.00 35.79  ? 40   ARG B O     1 
ATOM   6938  C CB    . ARG D 3 41  ? 93.256  83.495  -56.749 1.00 37.81  ? 40   ARG B CB    1 
ATOM   6939  C CG    . ARG D 3 41  ? 92.777  82.734  -55.511 1.00 39.77  ? 40   ARG B CG    1 
ATOM   6940  C CD    . ARG D 3 41  ? 93.461  83.228  -54.241 1.00 41.00  ? 40   ARG B CD    1 
ATOM   6941  N NE    . ARG D 3 41  ? 94.908  83.037  -54.302 1.00 44.00  ? 40   ARG B NE    1 
ATOM   6942  C CZ    . ARG D 3 41  ? 95.775  83.544  -53.428 1.00 44.60  ? 40   ARG B CZ    1 
ATOM   6943  N NH1   . ARG D 3 41  ? 95.351  84.279  -52.409 1.00 44.37  ? 40   ARG B NH1   1 
ATOM   6944  N NH2   . ARG D 3 41  ? 97.072  83.327  -53.584 1.00 42.29  ? 40   ARG B NH2   1 
ATOM   6945  N N     . GLY D 3 42  ? 90.698  83.493  -58.826 1.00 35.49  ? 41   GLY B N     1 
ATOM   6946  C CA    . GLY D 3 42  ? 89.261  83.380  -58.997 1.00 35.93  ? 41   GLY B CA    1 
ATOM   6947  C C     . GLY D 3 42  ? 88.891  82.504  -60.186 1.00 36.38  ? 41   GLY B C     1 
ATOM   6948  O O     . GLY D 3 42  ? 87.720  82.382  -60.536 1.00 36.57  ? 41   GLY B O     1 
ATOM   6949  N N     . GLY D 3 43  ? 89.894  81.906  -60.821 1.00 37.46  ? 42   GLY B N     1 
ATOM   6950  C CA    . GLY D 3 43  ? 89.647  81.033  -61.956 1.00 36.87  ? 42   GLY B CA    1 
ATOM   6951  C C     . GLY D 3 43  ? 89.394  81.699  -63.298 1.00 37.14  ? 42   GLY B C     1 
ATOM   6952  O O     . GLY D 3 43  ? 88.944  81.046  -64.230 1.00 38.03  ? 42   GLY B O     1 
ATOM   6953  N N     . VAL D 3 44  ? 89.687  82.987  -63.415 1.00 34.42  ? 43   VAL B N     1 
ATOM   6954  C CA    . VAL D 3 44  ? 89.454  83.698  -64.666 1.00 36.27  ? 43   VAL B CA    1 
ATOM   6955  C C     . VAL D 3 44  ? 90.601  83.533  -65.666 1.00 38.63  ? 43   VAL B C     1 
ATOM   6956  O O     . VAL D 3 44  ? 91.765  83.716  -65.317 1.00 37.98  ? 43   VAL B O     1 
ATOM   6957  C CB    . VAL D 3 44  ? 89.241  85.184  -64.400 1.00 35.47  ? 43   VAL B CB    1 
ATOM   6958  C CG1   . VAL D 3 44  ? 89.150  85.940  -65.718 1.00 35.06  ? 43   VAL B CG1   1 
ATOM   6959  C CG2   . VAL D 3 44  ? 87.983  85.373  -63.548 1.00 35.17  ? 43   VAL B CG2   1 
ATOM   6960  N N     . LYS D 3 45  ? 90.262  83.220  -66.915 1.00 41.49  ? 44   LYS B N     1 
ATOM   6961  C CA    . LYS D 3 45  ? 91.267  82.990  -67.955 1.00 44.34  ? 44   LYS B CA    1 
ATOM   6962  C C     . LYS D 3 45  ? 91.588  84.164  -68.900 1.00 45.60  ? 44   LYS B C     1 
ATOM   6963  O O     . LYS D 3 45  ? 92.744  84.362  -69.263 1.00 45.65  ? 44   LYS B O     1 
ATOM   6964  C CB    . LYS D 3 45  ? 90.855  81.773  -68.781 1.00 50.02  ? 44   LYS B CB    1 
ATOM   6965  C CG    . LYS D 3 45  ? 91.858  81.375  -69.845 1.00 53.78  ? 44   LYS B CG    1 
ATOM   6966  C CD    . LYS D 3 45  ? 91.389  80.141  -70.593 1.00 55.45  ? 44   LYS B CD    1 
ATOM   6967  C CE    . LYS D 3 45  ? 92.359  79.764  -71.700 1.00 57.48  ? 44   LYS B CE    1 
ATOM   6968  N NZ    . LYS D 3 45  ? 91.873  78.579  -72.459 1.00 57.30  ? 44   LYS B NZ    1 
ATOM   6969  N N     . ARG D 3 46  ? 90.573  84.920  -69.310 1.00 43.15  ? 45   ARG B N     1 
ATOM   6970  C CA    . ARG D 3 46  ? 90.753  86.066  -70.214 1.00 43.62  ? 45   ARG B CA    1 
ATOM   6971  C C     . ARG D 3 46  ? 90.126  87.296  -69.577 1.00 41.52  ? 45   ARG B C     1 
ATOM   6972  O O     . ARG D 3 46  ? 88.991  87.231  -69.100 1.00 39.61  ? 45   ARG B O     1 
ATOM   6973  C CB    . ARG D 3 46  ? 90.063  85.821  -71.562 1.00 53.72  ? 45   ARG B CB    1 
ATOM   6974  C CG    . ARG D 3 46  ? 90.785  84.910  -72.518 1.00 60.37  ? 45   ARG B CG    1 
ATOM   6975  C CD    . ARG D 3 46  ? 91.284  85.694  -73.725 1.00 63.30  ? 45   ARG B CD    1 
ATOM   6976  N NE    . ARG D 3 46  ? 90.227  86.514  -74.298 1.00 65.15  ? 45   ARG B NE    1 
ATOM   6977  C CZ    . ARG D 3 46  ? 90.386  87.335  -75.330 1.00 64.46  ? 45   ARG B CZ    1 
ATOM   6978  N NH1   . ARG D 3 46  ? 91.568  87.446  -75.917 1.00 66.20  ? 45   ARG B NH1   1 
ATOM   6979  N NH2   . ARG D 3 46  ? 89.364  88.061  -75.756 1.00 64.03  ? 45   ARG B NH2   1 
ATOM   6980  N N     . ILE D 3 47  ? 90.842  88.417  -69.624 1.00 44.78  ? 46   ILE B N     1 
ATOM   6981  C CA    . ILE D 3 47  ? 90.376  89.654  -69.005 1.00 44.62  ? 46   ILE B CA    1 
ATOM   6982  C C     . ILE D 3 47  ? 90.323  90.854  -69.953 1.00 45.47  ? 46   ILE B C     1 
ATOM   6983  O O     . ILE D 3 47  ? 91.308  91.164  -70.625 1.00 46.84  ? 46   ILE B O     1 
ATOM   6984  C CB    . ILE D 3 47  ? 91.294  89.993  -67.818 1.00 39.61  ? 46   ILE B CB    1 
ATOM   6985  C CG1   . ILE D 3 47  ? 91.400  88.769  -66.898 1.00 38.38  ? 46   ILE B CG1   1 
ATOM   6986  C CG2   . ILE D 3 47  ? 90.767  91.202  -67.062 1.00 36.54  ? 46   ILE B CG2   1 
ATOM   6987  C CD1   . ILE D 3 47  ? 92.428  88.932  -65.794 1.00 39.89  ? 46   ILE B CD1   1 
ATOM   6988  N N     . SER D 3 48  ? 89.187  91.540  -70.011 1.00 40.68  ? 47   SER B N     1 
ATOM   6989  C CA    . SER D 3 48  ? 89.095  92.698  -70.901 1.00 41.88  ? 47   SER B CA    1 
ATOM   6990  C C     . SER D 3 48  ? 89.779  93.890  -70.222 1.00 42.47  ? 47   SER B C     1 
ATOM   6991  O O     . SER D 3 48  ? 89.848  93.965  -68.984 1.00 40.06  ? 47   SER B O     1 
ATOM   6992  C CB    . SER D 3 48  ? 87.636  93.024  -71.242 1.00 46.00  ? 47   SER B CB    1 
ATOM   6993  O OG    . SER D 3 48  ? 87.076  93.945  -70.328 1.00 54.05  ? 47   SER B OG    1 
ATOM   6994  N N     . GLY D 3 49  ? 90.296  94.808  -71.032 1.00 44.72  ? 48   GLY B N     1 
ATOM   6995  C CA    . GLY D 3 49  ? 91.001  95.956  -70.496 1.00 45.24  ? 48   GLY B CA    1 
ATOM   6996  C C     . GLY D 3 49  ? 90.234  96.840  -69.537 1.00 47.35  ? 48   GLY B C     1 
ATOM   6997  O O     . GLY D 3 49  ? 90.832  97.453  -68.646 1.00 49.69  ? 48   GLY B O     1 
ATOM   6998  N N     . LEU D 3 50  ? 88.917  96.915  -69.707 1.00 41.84  ? 49   LEU B N     1 
ATOM   6999  C CA    . LEU D 3 50  ? 88.087  97.758  -68.853 1.00 41.65  ? 49   LEU B CA    1 
ATOM   7000  C C     . LEU D 3 50  ? 87.866  97.191  -67.448 1.00 40.79  ? 49   LEU B C     1 
ATOM   7001  O O     . LEU D 3 50  ? 87.377  97.883  -66.561 1.00 40.30  ? 49   LEU B O     1 
ATOM   7002  C CB    . LEU D 3 50  ? 86.739  98.002  -69.533 1.00 54.30  ? 49   LEU B CB    1 
ATOM   7003  C CG    . LEU D 3 50  ? 86.790  98.752  -70.870 1.00 57.72  ? 49   LEU B CG    1 
ATOM   7004  C CD1   . LEU D 3 50  ? 85.447  98.638  -71.577 1.00 58.15  ? 49   LEU B CD1   1 
ATOM   7005  C CD2   . LEU D 3 50  ? 87.153  100.207 -70.626 1.00 55.24  ? 49   LEU B CD2   1 
ATOM   7006  N N     . ILE D 3 51  ? 88.243  95.937  -67.246 1.00 41.42  ? 50   ILE B N     1 
ATOM   7007  C CA    . ILE D 3 51  ? 88.078  95.291  -65.953 1.00 40.83  ? 50   ILE B CA    1 
ATOM   7008  C C     . ILE D 3 51  ? 88.852  95.990  -64.837 1.00 42.11  ? 50   ILE B C     1 
ATOM   7009  O O     . ILE D 3 51  ? 88.331  96.194  -63.738 1.00 40.36  ? 50   ILE B O     1 
ATOM   7010  C CB    . ILE D 3 51  ? 88.538  93.811  -66.024 1.00 41.70  ? 50   ILE B CB    1 
ATOM   7011  C CG1   . ILE D 3 51  ? 87.451  92.960  -66.700 1.00 41.34  ? 50   ILE B CG1   1 
ATOM   7012  C CG2   . ILE D 3 51  ? 88.914  93.304  -64.636 1.00 37.66  ? 50   ILE B CG2   1 
ATOM   7013  C CD1   . ILE D 3 51  ? 86.123  92.974  -65.970 1.00 41.39  ? 50   ILE B CD1   1 
ATOM   7014  N N     . TYR D 3 52  ? 90.090  96.372  -65.128 1.00 44.78  ? 51   TYR B N     1 
ATOM   7015  C CA    . TYR D 3 52  ? 90.946  96.999  -64.129 1.00 46.61  ? 51   TYR B CA    1 
ATOM   7016  C C     . TYR D 3 52  ? 90.351  98.211  -63.419 1.00 47.85  ? 51   TYR B C     1 
ATOM   7017  O O     . TYR D 3 52  ? 90.399  98.298  -62.187 1.00 47.33  ? 51   TYR B O     1 
ATOM   7018  C CB    . TYR D 3 52  ? 92.294  97.334  -64.774 1.00 44.39  ? 51   TYR B CB    1 
ATOM   7019  C CG    . TYR D 3 52  ? 92.875  96.113  -65.453 1.00 44.59  ? 51   TYR B CG    1 
ATOM   7020  C CD1   . TYR D 3 52  ? 93.250  94.997  -64.708 1.00 43.15  ? 51   TYR B CD1   1 
ATOM   7021  C CD2   . TYR D 3 52  ? 92.937  96.025  -66.850 1.00 45.41  ? 51   TYR B CD2   1 
ATOM   7022  C CE1   . TYR D 3 52  ? 93.662  93.818  -65.332 1.00 44.60  ? 51   TYR B CE1   1 
ATOM   7023  C CE2   . TYR D 3 52  ? 93.348  94.846  -67.486 1.00 42.88  ? 51   TYR B CE2   1 
ATOM   7024  C CZ    . TYR D 3 52  ? 93.705  93.749  -66.718 1.00 44.99  ? 51   TYR B CZ    1 
ATOM   7025  O OH    . TYR D 3 52  ? 94.083  92.568  -67.322 1.00 45.87  ? 51   TYR B OH    1 
ATOM   7026  N N     . GLU D 3 53  ? 89.789  99.141  -64.182 1.00 48.84  ? 52   GLU B N     1 
ATOM   7027  C CA    . GLU D 3 53  ? 89.186  100.323 -63.582 1.00 50.97  ? 52   GLU B CA    1 
ATOM   7028  C C     . GLU D 3 53  ? 87.874  99.966  -62.881 1.00 49.55  ? 52   GLU B C     1 
ATOM   7029  O O     . GLU D 3 53  ? 87.523  100.564 -61.869 1.00 49.24  ? 52   GLU B O     1 
ATOM   7030  C CB    . GLU D 3 53  ? 88.951  101.405 -64.642 1.00 59.32  ? 52   GLU B CB    1 
ATOM   7031  C CG    . GLU D 3 53  ? 90.229  102.115 -65.074 1.00 64.70  ? 52   GLU B CG    1 
ATOM   7032  C CD    . GLU D 3 53  ? 90.879  102.901 -63.941 1.00 68.27  ? 52   GLU B CD    1 
ATOM   7033  O OE1   . GLU D 3 53  ? 90.298  103.919 -63.506 1.00 70.84  ? 52   GLU B OE1   1 
ATOM   7034  O OE2   . GLU D 3 53  ? 91.970  102.501 -63.480 1.00 70.56  ? 52   GLU B OE2   1 
ATOM   7035  N N     . GLU D 3 54  ? 87.156  98.988  -63.421 1.00 44.96  ? 53   GLU B N     1 
ATOM   7036  C CA    . GLU D 3 54  ? 85.900  98.552  -62.824 1.00 44.97  ? 53   GLU B CA    1 
ATOM   7037  C C     . GLU D 3 54  ? 86.217  97.933  -61.444 1.00 43.23  ? 53   GLU B C     1 
ATOM   7038  O O     . GLU D 3 54  ? 85.527  98.190  -60.453 1.00 40.06  ? 53   GLU B O     1 
ATOM   7039  C CB    . GLU D 3 54  ? 85.236  97.511  -63.734 1.00 67.46  ? 53   GLU B CB    1 
ATOM   7040  C CG    . GLU D 3 54  ? 83.797  97.139  -63.377 1.00 74.12  ? 53   GLU B CG    1 
ATOM   7041  C CD    . GLU D 3 54  ? 82.806  98.271  -63.625 1.00 78.34  ? 53   GLU B CD    1 
ATOM   7042  O OE1   . GLU D 3 54  ? 82.926  98.956  -64.665 1.00 80.50  ? 53   GLU B OE1   1 
ATOM   7043  O OE2   . GLU D 3 54  ? 81.897  98.466  -62.788 1.00 81.88  ? 53   GLU B OE2   1 
ATOM   7044  N N     . THR D 3 55  ? 87.283  97.136  -61.393 1.00 40.05  ? 54   THR B N     1 
ATOM   7045  C CA    . THR D 3 55  ? 87.695  96.479  -60.161 1.00 40.25  ? 54   THR B CA    1 
ATOM   7046  C C     . THR D 3 55  ? 88.114  97.471  -59.077 1.00 40.34  ? 54   THR B C     1 
ATOM   7047  O O     . THR D 3 55  ? 87.725  97.332  -57.910 1.00 39.68  ? 54   THR B O     1 
ATOM   7048  C CB    . THR D 3 55  ? 88.859  95.517  -60.418 1.00 42.80  ? 54   THR B CB    1 
ATOM   7049  O OG1   . THR D 3 55  ? 88.458  94.531  -61.380 1.00 45.51  ? 54   THR B OG1   1 
ATOM   7050  C CG2   . THR D 3 55  ? 89.267  94.822  -59.122 1.00 45.27  ? 54   THR B CG2   1 
ATOM   7051  N N     . ARG D 3 56  ? 88.911  98.463  -59.464 1.00 42.95  ? 55   ARG B N     1 
ATOM   7052  C CA    . ARG D 3 56  ? 89.373  99.475  -58.520 1.00 42.86  ? 55   ARG B CA    1 
ATOM   7053  C C     . ARG D 3 56  ? 88.175  100.171 -57.894 1.00 41.35  ? 55   ARG B C     1 
ATOM   7054  O O     . ARG D 3 56  ? 88.142  100.408 -56.685 1.00 42.12  ? 55   ARG B O     1 
ATOM   7055  C CB    . ARG D 3 56  ? 90.275  100.507 -59.221 1.00 44.59  ? 55   ARG B CB    1 
ATOM   7056  C CG    . ARG D 3 56  ? 91.590  99.936  -59.743 1.00 43.27  ? 55   ARG B CG    1 
ATOM   7057  C CD    . ARG D 3 56  ? 92.616  101.030 -60.064 1.00 44.60  ? 55   ARG B CD    1 
ATOM   7058  N NE    . ARG D 3 56  ? 93.887  100.448 -60.497 1.00 46.78  ? 55   ARG B NE    1 
ATOM   7059  C CZ    . ARG D 3 56  ? 94.164  100.097 -61.751 1.00 46.04  ? 55   ARG B CZ    1 
ATOM   7060  N NH1   . ARG D 3 56  ? 93.271  100.280 -62.713 1.00 45.32  ? 55   ARG B NH1   1 
ATOM   7061  N NH2   . ARG D 3 56  ? 95.324  99.529  -62.037 1.00 45.88  ? 55   ARG B NH2   1 
ATOM   7062  N N     . GLY D 3 57  ? 87.182  100.487 -58.714 1.00 38.55  ? 56   GLY B N     1 
ATOM   7063  C CA    . GLY D 3 57  ? 86.000  101.147 -58.190 1.00 38.48  ? 56   GLY B CA    1 
ATOM   7064  C C     . GLY D 3 57  ? 85.256  100.247 -57.214 1.00 37.82  ? 56   GLY B C     1 
ATOM   7065  O O     . GLY D 3 57  ? 84.720  100.702 -56.210 1.00 38.04  ? 56   GLY B O     1 
ATOM   7066  N N     . VAL D 3 58  ? 85.215  98.957  -57.519 1.00 38.57  ? 57   VAL B N     1 
ATOM   7067  C CA    . VAL D 3 58  ? 84.534  98.001  -56.656 1.00 36.89  ? 57   VAL B CA    1 
ATOM   7068  C C     . VAL D 3 58  ? 85.314  97.871  -55.352 1.00 36.34  ? 57   VAL B C     1 
ATOM   7069  O O     . VAL D 3 58  ? 84.723  97.855  -54.282 1.00 33.68  ? 57   VAL B O     1 
ATOM   7070  C CB    . VAL D 3 58  ? 84.408  96.621  -57.367 1.00 41.02  ? 57   VAL B CB    1 
ATOM   7071  C CG1   . VAL D 3 58  ? 84.025  95.534  -56.382 1.00 39.02  ? 57   VAL B CG1   1 
ATOM   7072  C CG2   . VAL D 3 58  ? 83.377  96.723  -58.472 1.00 40.27  ? 57   VAL B CG2   1 
ATOM   7073  N N     . LEU D 3 59  ? 86.643  97.797  -55.437 1.00 38.58  ? 58   LEU B N     1 
ATOM   7074  C CA    . LEU D 3 59  ? 87.453  97.679  -54.231 1.00 37.51  ? 58   LEU B CA    1 
ATOM   7075  C C     . LEU D 3 59  ? 87.317  98.925  -53.366 1.00 38.96  ? 58   LEU B C     1 
ATOM   7076  O O     . LEU D 3 59  ? 87.254  98.837  -52.141 1.00 38.27  ? 58   LEU B O     1 
ATOM   7077  C CB    . LEU D 3 59  ? 88.924  97.455  -54.578 1.00 38.00  ? 58   LEU B CB    1 
ATOM   7078  C CG    . LEU D 3 59  ? 89.864  97.465  -53.361 1.00 38.37  ? 58   LEU B CG    1 
ATOM   7079  C CD1   . LEU D 3 59  ? 89.400  96.454  -52.301 1.00 36.55  ? 58   LEU B CD1   1 
ATOM   7080  C CD2   . LEU D 3 59  ? 91.271  97.146  -53.823 1.00 40.54  ? 58   LEU B CD2   1 
ATOM   7081  N N     . LYS D 3 60  ? 87.259  100.087 -54.006 1.00 38.00  ? 59   LYS B N     1 
ATOM   7082  C CA    . LYS D 3 60  ? 87.112  101.339 -53.272 1.00 39.39  ? 59   LYS B CA    1 
ATOM   7083  C C     . LYS D 3 60  ? 85.805  101.368 -52.477 1.00 38.28  ? 59   LYS B C     1 
ATOM   7084  O O     . LYS D 3 60  ? 85.788  101.789 -51.327 1.00 35.74  ? 59   LYS B O     1 
ATOM   7085  C CB    . LYS D 3 60  ? 87.156  102.532 -54.226 1.00 58.94  ? 59   LYS B CB    1 
ATOM   7086  C CG    . LYS D 3 60  ? 87.175  103.876 -53.519 1.00 64.43  ? 59   LYS B CG    1 
ATOM   7087  C CD    . LYS D 3 60  ? 87.272  105.025 -54.514 1.00 70.37  ? 59   LYS B CD    1 
ATOM   7088  C CE    . LYS D 3 60  ? 87.214  106.375 -53.811 1.00 74.58  ? 59   LYS B CE    1 
ATOM   7089  N NZ    . LYS D 3 60  ? 87.164  107.508 -54.778 1.00 78.22  ? 59   LYS B NZ    1 
ATOM   7090  N N     . VAL D 3 61  ? 84.709  100.923 -53.091 1.00 39.26  ? 60   VAL B N     1 
ATOM   7091  C CA    . VAL D 3 61  ? 83.416  100.889 -52.412 1.00 36.48  ? 60   VAL B CA    1 
ATOM   7092  C C     . VAL D 3 61  ? 83.457  99.900  -51.243 1.00 37.00  ? 60   VAL B C     1 
ATOM   7093  O O     . VAL D 3 61  ? 82.964  100.189 -50.160 1.00 37.42  ? 60   VAL B O     1 
ATOM   7094  C CB    . VAL D 3 61  ? 82.301  100.496 -53.400 1.00 43.99  ? 60   VAL B CB    1 
ATOM   7095  C CG1   . VAL D 3 61  ? 81.028  100.153 -52.657 1.00 41.19  ? 60   VAL B CG1   1 
ATOM   7096  C CG2   . VAL D 3 61  ? 82.049  101.651 -54.365 1.00 42.14  ? 60   VAL B CG2   1 
ATOM   7097  N N     . PHE D 3 62  ? 84.058  98.734  -51.459 1.00 34.92  ? 61   PHE B N     1 
ATOM   7098  C CA    . PHE D 3 62  ? 84.166  97.738  -50.399 1.00 34.05  ? 61   PHE B CA    1 
ATOM   7099  C C     . PHE D 3 62  ? 84.936  98.341  -49.193 1.00 35.25  ? 61   PHE B C     1 
ATOM   7100  O O     . PHE D 3 62  ? 84.497  98.251  -48.045 1.00 31.70  ? 61   PHE B O     1 
ATOM   7101  C CB    . PHE D 3 62  ? 84.897  96.486  -50.924 1.00 31.15  ? 61   PHE B CB    1 
ATOM   7102  C CG    . PHE D 3 62  ? 85.020  95.372  -49.905 1.00 32.50  ? 61   PHE B CG    1 
ATOM   7103  C CD1   . PHE D 3 62  ? 83.992  94.436  -49.730 1.00 34.00  ? 61   PHE B CD1   1 
ATOM   7104  C CD2   . PHE D 3 62  ? 86.144  95.286  -49.084 1.00 33.35  ? 61   PHE B CD2   1 
ATOM   7105  C CE1   . PHE D 3 62  ? 84.090  93.426  -48.738 1.00 33.56  ? 61   PHE B CE1   1 
ATOM   7106  C CE2   . PHE D 3 62  ? 86.253  94.289  -48.093 1.00 33.05  ? 61   PHE B CE2   1 
ATOM   7107  C CZ    . PHE D 3 62  ? 85.230  93.362  -47.922 1.00 33.19  ? 61   PHE B CZ    1 
ATOM   7108  N N     . LEU D 3 63  ? 86.080  98.964  -49.455 1.00 38.41  ? 62   LEU B N     1 
ATOM   7109  C CA    . LEU D 3 63  ? 86.861  99.533  -48.360 1.00 40.74  ? 62   LEU B CA    1 
ATOM   7110  C C     . LEU D 3 63  ? 86.171  100.707 -47.668 1.00 40.81  ? 62   LEU B C     1 
ATOM   7111  O O     . LEU D 3 63  ? 86.176  100.793 -46.439 1.00 41.00  ? 62   LEU B O     1 
ATOM   7112  C CB    . LEU D 3 63  ? 88.254  99.928  -48.853 1.00 40.32  ? 62   LEU B CB    1 
ATOM   7113  C CG    . LEU D 3 63  ? 89.112  98.703  -49.207 1.00 41.16  ? 62   LEU B CG    1 
ATOM   7114  C CD1   . LEU D 3 63  ? 90.366  99.145  -49.913 1.00 39.79  ? 62   LEU B CD1   1 
ATOM   7115  C CD2   . LEU D 3 63  ? 89.459  97.916  -47.939 1.00 40.61  ? 62   LEU B CD2   1 
ATOM   7116  N N     . GLU D 3 64  ? 85.566  101.603 -48.438 1.00 38.41  ? 63   GLU B N     1 
ATOM   7117  C CA    . GLU D 3 64  ? 84.870  102.723 -47.827 1.00 40.66  ? 63   GLU B CA    1 
ATOM   7118  C C     . GLU D 3 64  ? 83.841  102.201 -46.823 1.00 40.32  ? 63   GLU B C     1 
ATOM   7119  O O     . GLU D 3 64  ? 83.796  102.656 -45.678 1.00 39.60  ? 63   GLU B O     1 
ATOM   7120  C CB    . GLU D 3 64  ? 84.167  103.569 -48.887 1.00 49.19  ? 63   GLU B CB    1 
ATOM   7121  C CG    . GLU D 3 64  ? 85.110  104.172 -49.915 1.00 55.39  ? 63   GLU B CG    1 
ATOM   7122  C CD    . GLU D 3 64  ? 84.377  104.999 -50.959 1.00 60.10  ? 63   GLU B CD    1 
ATOM   7123  O OE1   . GLU D 3 64  ? 83.329  104.535 -51.461 1.00 60.11  ? 63   GLU B OE1   1 
ATOM   7124  O OE2   . GLU D 3 64  ? 84.852  106.113 -51.280 1.00 63.01  ? 63   GLU B OE2   1 
ATOM   7125  N N     . ASN D 3 65  ? 83.032  101.228 -47.241 1.00 39.39  ? 64   ASN B N     1 
ATOM   7126  C CA    . ASN D 3 65  ? 82.008  100.683 -46.356 1.00 39.01  ? 64   ASN B CA    1 
ATOM   7127  C C     . ASN D 3 65  ? 82.528  100.027 -45.086 1.00 37.14  ? 64   ASN B C     1 
ATOM   7128  O O     . ASN D 3 65  ? 81.971  100.229 -44.016 1.00 37.45  ? 64   ASN B O     1 
ATOM   7129  C CB    . ASN D 3 65  ? 81.116  99.691  -47.106 1.00 46.80  ? 64   ASN B CB    1 
ATOM   7130  C CG    . ASN D 3 65  ? 80.254  100.371 -48.152 1.00 51.38  ? 64   ASN B CG    1 
ATOM   7131  O OD1   . ASN D 3 65  ? 79.928  101.554 -48.026 1.00 54.49  ? 64   ASN B OD1   1 
ATOM   7132  N ND2   . ASN D 3 65  ? 79.869  99.628  -49.181 1.00 51.48  ? 64   ASN B ND2   1 
ATOM   7133  N N     . VAL D 3 66  ? 83.585  99.233  -45.197 1.00 36.47  ? 65   VAL B N     1 
ATOM   7134  C CA    . VAL D 3 66  ? 84.133  98.561  -44.029 1.00 35.61  ? 65   VAL B CA    1 
ATOM   7135  C C     . VAL D 3 66  ? 84.901  99.540  -43.136 1.00 35.50  ? 65   VAL B C     1 
ATOM   7136  O O     . VAL D 3 66  ? 84.771  99.518  -41.901 1.00 31.09  ? 65   VAL B O     1 
ATOM   7137  C CB    . VAL D 3 66  ? 85.076  97.416  -44.451 1.00 43.25  ? 65   VAL B CB    1 
ATOM   7138  C CG1   . VAL D 3 66  ? 85.624  96.708  -43.214 1.00 40.06  ? 65   VAL B CG1   1 
ATOM   7139  C CG2   . VAL D 3 66  ? 84.321  96.429  -45.345 1.00 45.23  ? 65   VAL B CG2   1 
ATOM   7140  N N     . ILE D 3 67  ? 85.690  100.405 -43.765 1.00 33.31  ? 66   ILE B N     1 
ATOM   7141  C CA    . ILE D 3 67  ? 86.490  101.369 -43.015 1.00 35.31  ? 66   ILE B CA    1 
ATOM   7142  C C     . ILE D 3 67  ? 85.618  102.370 -42.277 1.00 35.87  ? 66   ILE B C     1 
ATOM   7143  O O     . ILE D 3 67  ? 85.899  102.720 -41.132 1.00 35.08  ? 66   ILE B O     1 
ATOM   7144  C CB    . ILE D 3 67  ? 87.493  102.082 -43.946 1.00 36.57  ? 66   ILE B CB    1 
ATOM   7145  C CG1   . ILE D 3 67  ? 88.509  101.054 -44.451 1.00 35.17  ? 66   ILE B CG1   1 
ATOM   7146  C CG2   . ILE D 3 67  ? 88.223  103.190 -43.202 1.00 37.90  ? 66   ILE B CG2   1 
ATOM   7147  C CD1   . ILE D 3 67  ? 89.528  101.605 -45.403 1.00 38.60  ? 66   ILE B CD1   1 
ATOM   7148  N N     . ARG D 3 68  ? 84.548  102.815 -42.927 1.00 34.19  ? 67   ARG B N     1 
ATOM   7149  C CA    . ARG D 3 68  ? 83.633  103.745 -42.303 1.00 34.94  ? 67   ARG B CA    1 
ATOM   7150  C C     . ARG D 3 68  ? 83.166  103.110 -40.991 1.00 35.25  ? 67   ARG B C     1 
ATOM   7151  O O     . ARG D 3 68  ? 83.197  103.742 -39.940 1.00 32.57  ? 67   ARG B O     1 
ATOM   7152  C CB    . ARG D 3 68  ? 82.433  103.994 -43.215 1.00 50.34  ? 67   ARG B CB    1 
ATOM   7153  C CG    . ARG D 3 68  ? 81.442  105.032 -42.694 1.00 56.00  ? 67   ARG B CG    1 
ATOM   7154  C CD    . ARG D 3 68  ? 80.258  105.173 -43.650 1.00 60.74  ? 67   ARG B CD    1 
ATOM   7155  N NE    . ARG D 3 68  ? 80.692  105.593 -44.983 1.00 65.87  ? 67   ARG B NE    1 
ATOM   7156  C CZ    . ARG D 3 68  ? 80.381  104.958 -46.110 1.00 67.74  ? 67   ARG B CZ    1 
ATOM   7157  N NH1   . ARG D 3 68  ? 79.625  103.867 -46.073 1.00 66.79  ? 67   ARG B NH1   1 
ATOM   7158  N NH2   . ARG D 3 68  ? 80.837  105.407 -47.274 1.00 67.85  ? 67   ARG B NH2   1 
ATOM   7159  N N     . ASP D 3 69  ? 82.733  101.855 -41.053 1.00 36.99  ? 68   ASP B N     1 
ATOM   7160  C CA    . ASP D 3 69  ? 82.269  101.167 -39.846 1.00 38.08  ? 68   ASP B CA    1 
ATOM   7161  C C     . ASP D 3 69  ? 83.403  100.939 -38.839 1.00 36.41  ? 68   ASP B C     1 
ATOM   7162  O O     . ASP D 3 69  ? 83.210  101.111 -37.640 1.00 35.03  ? 68   ASP B O     1 
ATOM   7163  C CB    . ASP D 3 69  ? 81.610  99.832  -40.216 1.00 42.33  ? 68   ASP B CB    1 
ATOM   7164  C CG    . ASP D 3 69  ? 80.153  99.994  -40.638 1.00 46.04  ? 68   ASP B CG    1 
ATOM   7165  O OD1   . ASP D 3 69  ? 79.740  101.124 -40.966 1.00 45.45  ? 68   ASP B OD1   1 
ATOM   7166  O OD2   . ASP D 3 69  ? 79.413  98.987  -40.651 1.00 51.08  ? 68   ASP B OD2   1 
ATOM   7167  N N     . ALA D 3 70  ? 84.581  100.553 -39.320 1.00 36.50  ? 69   ALA B N     1 
ATOM   7168  C CA    . ALA D 3 70  ? 85.718  100.328 -38.426 1.00 37.72  ? 69   ALA B CA    1 
ATOM   7169  C C     . ALA D 3 70  ? 86.059  101.627 -37.666 1.00 37.32  ? 69   ALA B C     1 
ATOM   7170  O O     . ALA D 3 70  ? 86.258  101.620 -36.446 1.00 37.21  ? 69   ALA B O     1 
ATOM   7171  C CB    . ALA D 3 70  ? 86.945  99.849  -39.227 1.00 30.09  ? 69   ALA B CB    1 
ATOM   7172  N N     . VAL D 3 71  ? 86.121  102.734 -38.396 1.00 35.55  ? 70   VAL B N     1 
ATOM   7173  C CA    . VAL D 3 71  ? 86.432  104.024 -37.795 1.00 36.87  ? 70   VAL B CA    1 
ATOM   7174  C C     . VAL D 3 71  ? 85.350  104.438 -36.810 1.00 37.50  ? 70   VAL B C     1 
ATOM   7175  O O     . VAL D 3 71  ? 85.631  105.045 -35.779 1.00 40.40  ? 70   VAL B O     1 
ATOM   7176  C CB    . VAL D 3 71  ? 86.588  105.109 -38.860 1.00 35.16  ? 70   VAL B CB    1 
ATOM   7177  C CG1   . VAL D 3 71  ? 86.642  106.484 -38.204 1.00 37.01  ? 70   VAL B CG1   1 
ATOM   7178  C CG2   . VAL D 3 71  ? 87.848  104.851 -39.649 1.00 33.49  ? 70   VAL B CG2   1 
ATOM   7179  N N     . THR D 3 72  ? 84.107  104.105 -37.116 1.00 33.98  ? 71   THR B N     1 
ATOM   7180  C CA    . THR D 3 72  ? 83.028  104.441 -36.213 1.00 32.58  ? 71   THR B CA    1 
ATOM   7181  C C     . THR D 3 72  ? 83.196  103.709 -34.880 1.00 33.36  ? 71   THR B C     1 
ATOM   7182  O O     . THR D 3 72  ? 82.887  104.254 -33.818 1.00 33.24  ? 71   THR B O     1 
ATOM   7183  C CB    . THR D 3 72  ? 81.708  104.126 -36.864 1.00 35.49  ? 71   THR B CB    1 
ATOM   7184  O OG1   . THR D 3 72  ? 81.568  104.981 -38.003 1.00 37.26  ? 71   THR B OG1   1 
ATOM   7185  C CG2   . THR D 3 72  ? 80.542  104.370 -35.910 1.00 34.33  ? 71   THR B CG2   1 
ATOM   7186  N N     . TYR D 3 73  ? 83.709  102.488 -34.919 1.00 35.69  ? 72   TYR B N     1 
ATOM   7187  C CA    . TYR D 3 73  ? 83.928  101.756 -33.677 1.00 38.02  ? 72   TYR B CA    1 
ATOM   7188  C C     . TYR D 3 73  ? 85.109  102.398 -32.949 1.00 39.48  ? 72   TYR B C     1 
ATOM   7189  O O     . TYR D 3 73  ? 85.123  102.472 -31.723 1.00 37.94  ? 72   TYR B O     1 
ATOM   7190  C CB    . TYR D 3 73  ? 84.243  100.280 -33.944 1.00 35.43  ? 72   TYR B CB    1 
ATOM   7191  C CG    . TYR D 3 73  ? 83.030  99.415  -34.222 1.00 36.85  ? 72   TYR B CG    1 
ATOM   7192  C CD1   . TYR D 3 73  ? 82.888  98.745  -35.441 1.00 33.87  ? 72   TYR B CD1   1 
ATOM   7193  C CD2   . TYR D 3 73  ? 82.039  99.241  -33.254 1.00 35.06  ? 72   TYR B CD2   1 
ATOM   7194  C CE1   . TYR D 3 73  ? 81.791  97.930  -35.684 1.00 35.85  ? 72   TYR B CE1   1 
ATOM   7195  C CE2   . TYR D 3 73  ? 80.940  98.431  -33.489 1.00 35.17  ? 72   TYR B CE2   1 
ATOM   7196  C CZ    . TYR D 3 73  ? 80.820  97.780  -34.708 1.00 35.54  ? 72   TYR B CZ    1 
ATOM   7197  O OH    . TYR D 3 73  ? 79.713  97.006  -34.960 1.00 38.22  ? 72   TYR B OH    1 
ATOM   7198  N N     . THR D 3 74  ? 86.099  102.853 -33.716 1.00 48.04  ? 73   THR B N     1 
ATOM   7199  C CA    . THR D 3 74  ? 87.284  103.495 -33.144 1.00 49.30  ? 73   THR B CA    1 
ATOM   7200  C C     . THR D 3 74  ? 86.861  104.728 -32.347 1.00 50.68  ? 73   THR B C     1 
ATOM   7201  O O     . THR D 3 74  ? 87.147  104.834 -31.153 1.00 50.29  ? 73   THR B O     1 
ATOM   7202  C CB    . THR D 3 74  ? 88.276  103.932 -34.248 1.00 41.55  ? 73   THR B CB    1 
ATOM   7203  O OG1   . THR D 3 74  ? 88.633  102.792 -35.039 1.00 39.66  ? 73   THR B OG1   1 
ATOM   7204  C CG2   . THR D 3 74  ? 89.545  104.524 -33.630 1.00 40.19  ? 73   THR B CG2   1 
ATOM   7205  N N     . GLU D 3 75  ? 86.165  105.644 -33.016 1.00 45.06  ? 74   GLU B N     1 
ATOM   7206  C CA    . GLU D 3 75  ? 85.698  106.867 -32.379 1.00 48.16  ? 74   GLU B CA    1 
ATOM   7207  C C     . GLU D 3 75  ? 84.858  106.563 -31.152 1.00 46.98  ? 74   GLU B C     1 
ATOM   7208  O O     . GLU D 3 75  ? 84.986  107.220 -30.116 1.00 47.11  ? 74   GLU B O     1 
ATOM   7209  C CB    . GLU D 3 75  ? 84.856  107.701 -33.344 1.00 85.08  ? 74   GLU B CB    1 
ATOM   7210  C CG    . GLU D 3 75  ? 85.593  108.208 -34.555 1.00 93.61  ? 74   GLU B CG    1 
ATOM   7211  C CD    . GLU D 3 75  ? 84.855  109.347 -35.230 1.00 101.04 ? 74   GLU B CD    1 
ATOM   7212  O OE1   . GLU D 3 75  ? 84.723  110.422 -34.599 1.00 103.91 ? 74   GLU B OE1   1 
ATOM   7213  O OE2   . GLU D 3 75  ? 84.402  109.167 -36.383 1.00 103.85 ? 74   GLU B OE2   1 
ATOM   7214  N N     . HIS D 3 76  ? 83.984  105.573 -31.260 1.00 42.91  ? 75   HIS B N     1 
ATOM   7215  C CA    . HIS D 3 76  ? 83.156  105.265 -30.121 1.00 41.42  ? 75   HIS B CA    1 
ATOM   7216  C C     . HIS D 3 76  ? 83.996  104.888 -28.906 1.00 43.18  ? 75   HIS B C     1 
ATOM   7217  O O     . HIS D 3 76  ? 83.624  105.188 -27.771 1.00 42.91  ? 75   HIS B O     1 
ATOM   7218  C CB    . HIS D 3 76  ? 82.194  104.123 -30.411 1.00 38.59  ? 75   HIS B CB    1 
ATOM   7219  C CG    . HIS D 3 76  ? 81.280  103.850 -29.268 1.00 37.20  ? 75   HIS B CG    1 
ATOM   7220  N ND1   . HIS D 3 76  ? 80.226  104.682 -28.955 1.00 37.88  ? 75   HIS B ND1   1 
ATOM   7221  C CD2   . HIS D 3 76  ? 81.342  102.929 -28.279 1.00 36.79  ? 75   HIS B CD2   1 
ATOM   7222  C CE1   . HIS D 3 76  ? 79.679  104.288 -27.819 1.00 36.83  ? 75   HIS B CE1   1 
ATOM   7223  N NE2   . HIS D 3 76  ? 80.338  103.227 -27.387 1.00 39.08  ? 75   HIS B NE2   1 
ATOM   7224  N N     . ALA D 3 77  ? 85.117  104.218 -29.139 1.00 45.34  ? 76   ALA B N     1 
ATOM   7225  C CA    . ALA D 3 77  ? 85.979  103.809 -28.042 1.00 48.01  ? 76   ALA B CA    1 
ATOM   7226  C C     . ALA D 3 77  ? 86.970  104.910 -27.679 1.00 48.98  ? 76   ALA B C     1 
ATOM   7227  O O     . ALA D 3 77  ? 87.884  104.691 -26.883 1.00 48.51  ? 76   ALA B O     1 
ATOM   7228  C CB    . ALA D 3 77  ? 86.725  102.525 -28.403 1.00 39.65  ? 76   ALA B CB    1 
ATOM   7229  N N     . LYS D 3 78  ? 86.794  106.088 -28.274 1.00 51.30  ? 77   LYS B N     1 
ATOM   7230  C CA    . LYS D 3 78  ? 87.668  107.225 -27.991 1.00 53.48  ? 77   LYS B CA    1 
ATOM   7231  C C     . LYS D 3 78  ? 89.146  106.941 -28.279 1.00 52.78  ? 77   LYS B C     1 
ATOM   7232  O O     . LYS D 3 78  ? 90.025  107.359 -27.525 1.00 52.57  ? 77   LYS B O     1 
ATOM   7233  C CB    . LYS D 3 78  ? 87.503  107.648 -26.530 1.00 64.38  ? 77   LYS B CB    1 
ATOM   7234  C CG    . LYS D 3 78  ? 86.078  108.024 -26.158 1.00 69.64  ? 77   LYS B CG    1 
ATOM   7235  C CD    . LYS D 3 78  ? 85.951  108.328 -24.670 1.00 73.75  ? 77   LYS B CD    1 
ATOM   7236  C CE    . LYS D 3 78  ? 84.525  108.715 -24.302 1.00 76.21  ? 77   LYS B CE    1 
ATOM   7237  N NZ    . LYS D 3 78  ? 84.355  108.900 -22.832 1.00 78.18  ? 77   LYS B NZ    1 
ATOM   7238  N N     . ARG D 3 79  ? 89.419  106.227 -29.367 1.00 44.85  ? 78   ARG B N     1 
ATOM   7239  C CA    . ARG D 3 79  ? 90.795  105.922 -29.734 1.00 43.32  ? 78   ARG B CA    1 
ATOM   7240  C C     . ARG D 3 79  ? 91.163  106.689 -30.993 1.00 42.85  ? 78   ARG B C     1 
ATOM   7241  O O     . ARG D 3 79  ? 90.305  107.298 -31.635 1.00 43.62  ? 78   ARG B O     1 
ATOM   7242  C CB    . ARG D 3 79  ? 90.973  104.410 -29.962 1.00 46.56  ? 78   ARG B CB    1 
ATOM   7243  C CG    . ARG D 3 79  ? 90.975  103.579 -28.678 1.00 47.05  ? 78   ARG B CG    1 
ATOM   7244  C CD    . ARG D 3 79  ? 91.400  102.113 -28.900 1.00 48.12  ? 78   ARG B CD    1 
ATOM   7245  N NE    . ARG D 3 79  ? 90.272  101.212 -29.137 1.00 47.74  ? 78   ARG B NE    1 
ATOM   7246  C CZ    . ARG D 3 79  ? 89.745  100.958 -30.333 1.00 48.93  ? 78   ARG B CZ    1 
ATOM   7247  N NH1   . ARG D 3 79  ? 90.247  101.530 -31.426 1.00 47.66  ? 78   ARG B NH1   1 
ATOM   7248  N NH2   . ARG D 3 79  ? 88.703  100.141 -30.437 1.00 43.96  ? 78   ARG B NH2   1 
ATOM   7249  N N     . LYS D 3 80  ? 92.448  106.685 -31.325 1.00 47.40  ? 79   LYS B N     1 
ATOM   7250  C CA    . LYS D 3 80  ? 92.940  107.345 -32.529 1.00 48.05  ? 79   LYS B CA    1 
ATOM   7251  C C     . LYS D 3 80  ? 93.609  106.266 -33.369 1.00 46.20  ? 79   LYS B C     1 
ATOM   7252  O O     . LYS D 3 80  ? 94.191  106.543 -34.418 1.00 47.46  ? 79   LYS B O     1 
ATOM   7253  C CB    . LYS D 3 80  ? 93.963  108.428 -32.182 1.00 81.30  ? 79   LYS B CB    1 
ATOM   7254  C CG    . LYS D 3 80  ? 93.396  109.599 -31.413 1.00 86.02  ? 79   LYS B CG    1 
ATOM   7255  C CD    . LYS D 3 80  ? 94.410  110.721 -31.317 1.00 90.36  ? 79   LYS B CD    1 
ATOM   7256  C CE    . LYS D 3 80  ? 93.881  111.872 -30.476 1.00 95.06  ? 79   LYS B CE    1 
ATOM   7257  N NZ    . LYS D 3 80  ? 93.589  111.454 -29.071 1.00 96.23  ? 79   LYS B NZ    1 
ATOM   7258  N N     . THR D 3 81  ? 93.520  105.033 -32.884 1.00 40.98  ? 80   THR B N     1 
ATOM   7259  C CA    . THR D 3 81  ? 94.119  103.890 -33.557 1.00 41.94  ? 80   THR B CA    1 
ATOM   7260  C C     . THR D 3 81  ? 93.068  102.835 -33.923 1.00 40.05  ? 80   THR B C     1 
ATOM   7261  O O     . THR D 3 81  ? 92.327  102.353 -33.058 1.00 38.04  ? 80   THR B O     1 
ATOM   7262  C CB    . THR D 3 81  ? 95.161  103.207 -32.650 1.00 51.50  ? 80   THR B CB    1 
ATOM   7263  O OG1   . THR D 3 81  ? 95.974  104.204 -32.023 1.00 55.01  ? 80   THR B OG1   1 
ATOM   7264  C CG2   . THR D 3 81  ? 96.043  102.270 -33.461 1.00 50.20  ? 80   THR B CG2   1 
ATOM   7265  N N     . VAL D 3 82  ? 93.015  102.484 -35.201 1.00 37.38  ? 81   VAL B N     1 
ATOM   7266  C CA    . VAL D 3 82  ? 92.086  101.473 -35.678 1.00 35.39  ? 81   VAL B CA    1 
ATOM   7267  C C     . VAL D 3 82  ? 92.641  100.098 -35.329 1.00 34.61  ? 81   VAL B C     1 
ATOM   7268  O O     . VAL D 3 82  ? 93.710  99.715  -35.810 1.00 34.75  ? 81   VAL B O     1 
ATOM   7269  C CB    . VAL D 3 82  ? 91.915  101.564 -37.207 1.00 42.51  ? 81   VAL B CB    1 
ATOM   7270  C CG1   . VAL D 3 82  ? 90.935  100.494 -37.691 1.00 43.13  ? 81   VAL B CG1   1 
ATOM   7271  C CG2   . VAL D 3 82  ? 91.421  102.953 -37.586 1.00 42.42  ? 81   VAL B CG2   1 
ATOM   7272  N N     . THR D 3 83  ? 91.933  99.350  -34.489 1.00 35.23  ? 82   THR B N     1 
ATOM   7273  C CA    . THR D 3 83  ? 92.405  98.010  -34.114 1.00 36.45  ? 82   THR B CA    1 
ATOM   7274  C C     . THR D 3 83  ? 91.885  96.922  -35.052 1.00 36.68  ? 82   THR B C     1 
ATOM   7275  O O     . THR D 3 83  ? 90.953  97.141  -35.818 1.00 36.68  ? 82   THR B O     1 
ATOM   7276  C CB    . THR D 3 83  ? 91.959  97.637  -32.696 1.00 35.08  ? 82   THR B CB    1 
ATOM   7277  O OG1   . THR D 3 83  ? 90.530  97.677  -32.632 1.00 36.29  ? 82   THR B OG1   1 
ATOM   7278  C CG2   . THR D 3 83  ? 92.533  98.619  -31.676 1.00 34.94  ? 82   THR B CG2   1 
ATOM   7279  N N     . ALA D 3 84  ? 92.496  95.744  -34.986 1.00 39.70  ? 83   ALA B N     1 
ATOM   7280  C CA    . ALA D 3 84  ? 92.071  94.630  -35.807 1.00 38.96  ? 83   ALA B CA    1 
ATOM   7281  C C     . ALA D 3 84  ? 90.631  94.303  -35.432 1.00 38.94  ? 83   ALA B C     1 
ATOM   7282  O O     . ALA D 3 84  ? 89.816  93.993  -36.301 1.00 40.15  ? 83   ALA B O     1 
ATOM   7283  C CB    . ALA D 3 84  ? 92.969  93.416  -35.566 1.00 34.85  ? 83   ALA B CB    1 
ATOM   7284  N N     . MET D 3 85  ? 90.314  94.379  -34.143 1.00 34.51  ? 84   MET B N     1 
ATOM   7285  C CA    . MET D 3 85  ? 88.960  94.083  -33.694 1.00 35.22  ? 84   MET B CA    1 
ATOM   7286  C C     . MET D 3 85  ? 87.948  95.055  -34.288 1.00 35.55  ? 84   MET B C     1 
ATOM   7287  O O     . MET D 3 85  ? 86.829  94.652  -34.625 1.00 34.16  ? 84   MET B O     1 
ATOM   7288  C CB    . MET D 3 85  ? 88.865  94.099  -32.166 1.00 44.86  ? 84   MET B CB    1 
ATOM   7289  C CG    . MET D 3 85  ? 89.403  92.838  -31.486 1.00 50.14  ? 84   MET B CG    1 
ATOM   7290  S SD    . MET D 3 85  ? 88.917  91.265  -32.289 1.00 57.34  ? 84   MET B SD    1 
ATOM   7291  C CE    . MET D 3 85  ? 87.156  91.196  -31.927 1.00 52.51  ? 84   MET B CE    1 
ATOM   7292  N N     . ASP D 3 86  ? 88.320  96.328  -34.411 1.00 37.09  ? 85   ASP B N     1 
ATOM   7293  C CA    . ASP D 3 86  ? 87.413  97.301  -35.018 1.00 37.30  ? 85   ASP B CA    1 
ATOM   7294  C C     . ASP D 3 86  ? 87.085  96.808  -36.432 1.00 36.91  ? 85   ASP B C     1 
ATOM   7295  O O     . ASP D 3 86  ? 85.940  96.856  -36.857 1.00 37.30  ? 85   ASP B O     1 
ATOM   7296  C CB    . ASP D 3 86  ? 88.053  98.694  -35.131 1.00 39.61  ? 85   ASP B CB    1 
ATOM   7297  C CG    . ASP D 3 86  ? 88.301  99.351  -33.773 1.00 43.07  ? 85   ASP B CG    1 
ATOM   7298  O OD1   . ASP D 3 86  ? 87.501  99.122  -32.836 1.00 44.08  ? 85   ASP B OD1   1 
ATOM   7299  O OD2   . ASP D 3 86  ? 89.290  100.115 -33.658 1.00 43.88  ? 85   ASP B OD2   1 
ATOM   7300  N N     . VAL D 3 87  ? 88.099  96.340  -37.151 1.00 34.31  ? 86   VAL B N     1 
ATOM   7301  C CA    . VAL D 3 87  ? 87.914  95.841  -38.513 1.00 35.87  ? 86   VAL B CA    1 
ATOM   7302  C C     . VAL D 3 87  ? 87.065  94.557  -38.530 1.00 35.74  ? 86   VAL B C     1 
ATOM   7303  O O     . VAL D 3 87  ? 86.143  94.414  -39.338 1.00 36.31  ? 86   VAL B O     1 
ATOM   7304  C CB    . VAL D 3 87  ? 89.295  95.593  -39.183 1.00 34.88  ? 86   VAL B CB    1 
ATOM   7305  C CG1   . VAL D 3 87  ? 89.112  94.977  -40.572 1.00 35.24  ? 86   VAL B CG1   1 
ATOM   7306  C CG2   . VAL D 3 87  ? 90.055  96.928  -39.298 1.00 33.72  ? 86   VAL B CG2   1 
ATOM   7307  N N     . VAL D 3 88  ? 87.377  93.639  -37.622 1.00 33.77  ? 87   VAL B N     1 
ATOM   7308  C CA    . VAL D 3 88  ? 86.651  92.386  -37.488 1.00 33.63  ? 87   VAL B CA    1 
ATOM   7309  C C     . VAL D 3 88  ? 85.172  92.641  -37.178 1.00 33.04  ? 87   VAL B C     1 
ATOM   7310  O O     . VAL D 3 88  ? 84.300  92.008  -37.762 1.00 32.40  ? 87   VAL B O     1 
ATOM   7311  C CB    . VAL D 3 88  ? 87.282  91.510  -36.367 1.00 36.99  ? 87   VAL B CB    1 
ATOM   7312  C CG1   . VAL D 3 88  ? 86.349  90.336  -35.979 1.00 34.76  ? 87   VAL B CG1   1 
ATOM   7313  C CG2   . VAL D 3 88  ? 88.602  90.976  -36.855 1.00 35.04  ? 87   VAL B CG2   1 
ATOM   7314  N N     . TYR D 3 89  ? 84.891  93.565  -36.262 1.00 36.75  ? 88   TYR B N     1 
ATOM   7315  C CA    . TYR D 3 89  ? 83.506  93.880  -35.917 1.00 37.93  ? 88   TYR B CA    1 
ATOM   7316  C C     . TYR D 3 89  ? 82.799  94.525  -37.110 1.00 38.25  ? 88   TYR B C     1 
ATOM   7317  O O     . TYR D 3 89  ? 81.626  94.257  -37.367 1.00 40.37  ? 88   TYR B O     1 
ATOM   7318  C CB    . TYR D 3 89  ? 83.448  94.835  -34.722 1.00 41.98  ? 88   TYR B CB    1 
ATOM   7319  C CG    . TYR D 3 89  ? 83.901  94.232  -33.406 1.00 45.67  ? 88   TYR B CG    1 
ATOM   7320  C CD1   . TYR D 3 89  ? 84.582  95.006  -32.461 1.00 47.10  ? 88   TYR B CD1   1 
ATOM   7321  C CD2   . TYR D 3 89  ? 83.640  92.897  -33.098 1.00 47.69  ? 88   TYR B CD2   1 
ATOM   7322  C CE1   . TYR D 3 89  ? 84.994  94.464  -31.243 1.00 48.91  ? 88   TYR B CE1   1 
ATOM   7323  C CE2   . TYR D 3 89  ? 84.041  92.342  -31.881 1.00 49.59  ? 88   TYR B CE2   1 
ATOM   7324  C CZ    . TYR D 3 89  ? 84.717  93.130  -30.960 1.00 52.37  ? 88   TYR B CZ    1 
ATOM   7325  O OH    . TYR D 3 89  ? 85.122  92.579  -29.762 1.00 56.79  ? 88   TYR B OH    1 
ATOM   7326  N N     . ALA D 3 90  ? 83.516  95.364  -37.850 1.00 33.12  ? 89   ALA B N     1 
ATOM   7327  C CA    . ALA D 3 90  ? 82.923  96.035  -39.001 1.00 34.00  ? 89   ALA B CA    1 
ATOM   7328  C C     . ALA D 3 90  ? 82.617  95.027  -40.104 1.00 33.58  ? 89   ALA B C     1 
ATOM   7329  O O     . ALA D 3 90  ? 81.586  95.115  -40.752 1.00 34.62  ? 89   ALA B O     1 
ATOM   7330  C CB    . ALA D 3 90  ? 83.864  97.152  -39.531 1.00 19.00  ? 89   ALA B CB    1 
ATOM   7331  N N     . LEU D 3 91  ? 83.511  94.068  -40.303 1.00 34.89  ? 90   LEU B N     1 
ATOM   7332  C CA    . LEU D 3 91  ? 83.318  93.052  -41.327 1.00 37.48  ? 90   LEU B CA    1 
ATOM   7333  C C     . LEU D 3 91  ? 82.161  92.143  -40.948 1.00 39.07  ? 90   LEU B C     1 
ATOM   7334  O O     . LEU D 3 91  ? 81.367  91.738  -41.806 1.00 37.97  ? 90   LEU B O     1 
ATOM   7335  C CB    . LEU D 3 91  ? 84.591  92.226  -41.508 1.00 32.53  ? 90   LEU B CB    1 
ATOM   7336  C CG    . LEU D 3 91  ? 85.770  92.912  -42.212 1.00 33.66  ? 90   LEU B CG    1 
ATOM   7337  C CD1   . LEU D 3 91  ? 87.044  92.113  -42.012 1.00 31.06  ? 90   LEU B CD1   1 
ATOM   7338  C CD2   . LEU D 3 91  ? 85.471  93.057  -43.705 1.00 30.89  ? 90   LEU B CD2   1 
ATOM   7339  N N     . LYS D 3 92  ? 82.054  91.836  -39.660 1.00 40.26  ? 91   LYS B N     1 
ATOM   7340  C CA    . LYS D 3 92  ? 80.980  90.966  -39.198 1.00 42.36  ? 91   LYS B CA    1 
ATOM   7341  C C     . LYS D 3 92  ? 79.617  91.589  -39.423 1.00 41.88  ? 91   LYS B C     1 
ATOM   7342  O O     . LYS D 3 92  ? 78.688  90.901  -39.848 1.00 41.16  ? 91   LYS B O     1 
ATOM   7343  C CB    . LYS D 3 92  ? 81.145  90.620  -37.716 1.00 54.86  ? 91   LYS B CB    1 
ATOM   7344  C CG    . LYS D 3 92  ? 80.016  89.757  -37.176 1.00 59.45  ? 91   LYS B CG    1 
ATOM   7345  C CD    . LYS D 3 92  ? 80.503  88.736  -36.153 1.00 67.02  ? 91   LYS B CD    1 
ATOM   7346  C CE    . LYS D 3 92  ? 81.121  89.400  -34.931 1.00 71.30  ? 91   LYS B CE    1 
ATOM   7347  N NZ    . LYS D 3 92  ? 81.600  88.402  -33.930 1.00 75.46  ? 91   LYS B NZ    1 
ATOM   7348  N N     . ARG D 3 93  ? 79.480  92.882  -39.146 1.00 43.35  ? 92   ARG B N     1 
ATOM   7349  C CA    . ARG D 3 93  ? 78.183  93.510  -39.355 1.00 45.23  ? 92   ARG B CA    1 
ATOM   7350  C C     . ARG D 3 93  ? 77.903  93.762  -40.842 1.00 45.50  ? 92   ARG B C     1 
ATOM   7351  O O     . ARG D 3 93  ? 76.756  93.993  -41.224 1.00 44.61  ? 92   ARG B O     1 
ATOM   7352  C CB    . ARG D 3 93  ? 78.049  94.804  -38.539 1.00 42.67  ? 92   ARG B CB    1 
ATOM   7353  C CG    . ARG D 3 93  ? 78.897  95.975  -38.989 1.00 46.60  ? 92   ARG B CG    1 
ATOM   7354  C CD    . ARG D 3 93  ? 78.616  97.153  -38.066 1.00 47.58  ? 92   ARG B CD    1 
ATOM   7355  N NE    . ARG D 3 93  ? 77.179  97.357  -37.933 1.00 47.34  ? 92   ARG B NE    1 
ATOM   7356  C CZ    . ARG D 3 93  ? 76.431  97.962  -38.847 1.00 49.36  ? 92   ARG B CZ    1 
ATOM   7357  N NH1   . ARG D 3 93  ? 76.994  98.436  -39.951 1.00 49.83  ? 92   ARG B NH1   1 
ATOM   7358  N NH2   . ARG D 3 93  ? 75.120  98.072  -38.674 1.00 49.41  ? 92   ARG B NH2   1 
ATOM   7359  N N     . GLN D 3 94  ? 78.940  93.716  -41.679 1.00 39.39  ? 93   GLN B N     1 
ATOM   7360  C CA    . GLN D 3 94  ? 78.748  93.889  -43.125 1.00 40.80  ? 93   GLN B CA    1 
ATOM   7361  C C     . GLN D 3 94  ? 78.464  92.491  -43.685 1.00 41.16  ? 93   GLN B C     1 
ATOM   7362  O O     . GLN D 3 94  ? 78.338  92.314  -44.895 1.00 41.28  ? 93   GLN B O     1 
ATOM   7363  C CB    . GLN D 3 94  ? 80.021  94.405  -43.811 1.00 55.99  ? 93   GLN B CB    1 
ATOM   7364  C CG    . GLN D 3 94  ? 80.428  95.845  -43.527 1.00 61.53  ? 93   GLN B CG    1 
ATOM   7365  C CD    . GLN D 3 94  ? 79.471  96.853  -44.114 1.00 65.13  ? 93   GLN B CD    1 
ATOM   7366  O OE1   . GLN D 3 94  ? 79.134  96.792  -45.297 1.00 67.42  ? 93   GLN B OE1   1 
ATOM   7367  N NE2   . GLN D 3 94  ? 79.031  97.796  -43.292 1.00 67.09  ? 93   GLN B NE2   1 
ATOM   7368  N N     . GLY D 3 95  ? 78.413  91.499  -42.800 1.00 46.62  ? 94   GLY B N     1 
ATOM   7369  C CA    . GLY D 3 95  ? 78.178  90.128  -43.211 1.00 44.70  ? 94   GLY B CA    1 
ATOM   7370  C C     . GLY D 3 95  ? 79.395  89.441  -43.820 1.00 46.17  ? 94   GLY B C     1 
ATOM   7371  O O     . GLY D 3 95  ? 79.245  88.460  -44.550 1.00 48.38  ? 94   GLY B O     1 
ATOM   7372  N N     . ARG D 3 96  ? 80.594  89.942  -43.525 1.00 41.05  ? 95   ARG B N     1 
ATOM   7373  C CA    . ARG D 3 96  ? 81.838  89.375  -44.054 1.00 39.50  ? 95   ARG B CA    1 
ATOM   7374  C C     . ARG D 3 96  ? 82.731  88.844  -42.923 1.00 40.08  ? 95   ARG B C     1 
ATOM   7375  O O     . ARG D 3 96  ? 83.903  89.216  -42.843 1.00 40.88  ? 95   ARG B O     1 
ATOM   7376  C CB    . ARG D 3 96  ? 82.647  90.432  -44.814 1.00 41.32  ? 95   ARG B CB    1 
ATOM   7377  C CG    . ARG D 3 96  ? 81.945  91.131  -45.961 1.00 44.22  ? 95   ARG B CG    1 
ATOM   7378  C CD    . ARG D 3 96  ? 81.618  90.204  -47.124 1.00 44.50  ? 95   ARG B CD    1 
ATOM   7379  N NE    . ARG D 3 96  ? 82.776  89.431  -47.537 1.00 48.49  ? 95   ARG B NE    1 
ATOM   7380  C CZ    . ARG D 3 96  ? 82.807  88.621  -48.592 1.00 48.85  ? 95   ARG B CZ    1 
ATOM   7381  N NH1   . ARG D 3 96  ? 81.734  88.482  -49.362 1.00 49.12  ? 95   ARG B NH1   1 
ATOM   7382  N NH2   . ARG D 3 96  ? 83.905  87.923  -48.863 1.00 47.23  ? 95   ARG B NH2   1 
ATOM   7383  N N     . THR D 3 97  ? 82.187  87.992  -42.059 1.00 38.90  ? 96   THR B N     1 
ATOM   7384  C CA    . THR D 3 97  ? 82.941  87.421  -40.939 1.00 37.16  ? 96   THR B CA    1 
ATOM   7385  C C     . THR D 3 97  ? 84.346  86.949  -41.310 1.00 36.93  ? 96   THR B C     1 
ATOM   7386  O O     . THR D 3 97  ? 84.524  86.153  -42.231 1.00 37.47  ? 96   THR B O     1 
ATOM   7387  C CB    . THR D 3 97  ? 82.195  86.226  -40.307 1.00 37.98  ? 96   THR B CB    1 
ATOM   7388  O OG1   . THR D 3 97  ? 80.919  86.666  -39.831 1.00 38.99  ? 96   THR B OG1   1 
ATOM   7389  C CG2   . THR D 3 97  ? 82.995  85.641  -39.123 1.00 38.24  ? 96   THR B CG2   1 
ATOM   7390  N N     . LEU D 3 98  ? 85.341  87.444  -40.580 1.00 32.03  ? 97   LEU B N     1 
ATOM   7391  C CA    . LEU D 3 98  ? 86.730  87.092  -40.830 1.00 33.31  ? 97   LEU B CA    1 
ATOM   7392  C C     . LEU D 3 98  ? 87.340  86.393  -39.615 1.00 34.13  ? 97   LEU B C     1 
ATOM   7393  O O     . LEU D 3 98  ? 87.295  86.932  -38.510 1.00 33.21  ? 97   LEU B O     1 
ATOM   7394  C CB    . LEU D 3 98  ? 87.521  88.359  -41.135 1.00 39.11  ? 97   LEU B CB    1 
ATOM   7395  C CG    . LEU D 3 98  ? 89.030  88.226  -41.312 1.00 40.65  ? 97   LEU B CG    1 
ATOM   7396  C CD1   . LEU D 3 98  ? 89.346  87.545  -42.630 1.00 40.00  ? 97   LEU B CD1   1 
ATOM   7397  C CD2   . LEU D 3 98  ? 89.655  89.618  -41.262 1.00 42.42  ? 97   LEU B CD2   1 
ATOM   7398  N N     . TYR D 3 99  ? 87.887  85.191  -39.817 1.00 33.51  ? 98   TYR B N     1 
ATOM   7399  C CA    . TYR D 3 99  ? 88.520  84.439  -38.732 1.00 34.14  ? 98   TYR B CA    1 
ATOM   7400  C C     . TYR D 3 99  ? 90.026  84.653  -38.792 1.00 36.54  ? 98   TYR B C     1 
ATOM   7401  O O     . TYR D 3 99  ? 90.590  84.804  -39.879 1.00 36.04  ? 98   TYR B O     1 
ATOM   7402  C CB    . TYR D 3 99  ? 88.299  82.927  -38.866 1.00 33.58  ? 98   TYR B CB    1 
ATOM   7403  C CG    . TYR D 3 99  ? 86.923  82.385  -38.549 1.00 33.41  ? 98   TYR B CG    1 
ATOM   7404  C CD1   . TYR D 3 99  ? 85.901  83.198  -38.056 1.00 31.93  ? 98   TYR B CD1   1 
ATOM   7405  C CD2   . TYR D 3 99  ? 86.660  81.028  -38.717 1.00 33.67  ? 98   TYR B CD2   1 
ATOM   7406  C CE1   . TYR D 3 99  ? 84.645  82.657  -37.734 1.00 32.61  ? 98   TYR B CE1   1 
ATOM   7407  C CE2   . TYR D 3 99  ? 85.425  80.486  -38.402 1.00 34.56  ? 98   TYR B CE2   1 
ATOM   7408  C CZ    . TYR D 3 99  ? 84.421  81.298  -37.910 1.00 33.56  ? 98   TYR B CZ    1 
ATOM   7409  O OH    . TYR D 3 99  ? 83.207  80.715  -37.591 1.00 36.23  ? 98   TYR B OH    1 
ATOM   7410  N N     . GLY D 3 100 ? 90.664  84.642  -37.623 1.00 48.56  ? 99   GLY B N     1 
ATOM   7411  C CA    . GLY D 3 100 ? 92.104  84.781  -37.556 1.00 52.34  ? 99   GLY B CA    1 
ATOM   7412  C C     . GLY D 3 100 ? 92.683  86.087  -37.055 1.00 53.42  ? 99   GLY B C     1 
ATOM   7413  O O     . GLY D 3 100 ? 93.896  86.267  -37.087 1.00 54.95  ? 99   GLY B O     1 
ATOM   7414  N N     . PHE D 3 101 ? 91.843  86.999  -36.588 1.00 43.90  ? 100  PHE B N     1 
ATOM   7415  C CA    . PHE D 3 101 ? 92.358  88.273  -36.116 1.00 45.34  ? 100  PHE B CA    1 
ATOM   7416  C C     . PHE D 3 101 ? 91.722  88.725  -34.817 1.00 47.48  ? 100  PHE B C     1 
ATOM   7417  O O     . PHE D 3 101 ? 91.656  89.918  -34.530 1.00 46.83  ? 100  PHE B O     1 
ATOM   7418  C CB    . PHE D 3 101 ? 92.170  89.349  -37.189 1.00 40.95  ? 100  PHE B CB    1 
ATOM   7419  C CG    . PHE D 3 101 ? 93.043  89.155  -38.396 1.00 40.78  ? 100  PHE B CG    1 
ATOM   7420  C CD1   . PHE D 3 101 ? 92.599  88.411  -39.484 1.00 40.25  ? 100  PHE B CD1   1 
ATOM   7421  C CD2   . PHE D 3 101 ? 94.318  89.718  -38.444 1.00 40.14  ? 100  PHE B CD2   1 
ATOM   7422  C CE1   . PHE D 3 101 ? 93.413  88.231  -40.612 1.00 40.55  ? 100  PHE B CE1   1 
ATOM   7423  C CE2   . PHE D 3 101 ? 95.143  89.546  -39.560 1.00 41.30  ? 100  PHE B CE2   1 
ATOM   7424  C CZ    . PHE D 3 101 ? 94.686  88.799  -40.653 1.00 41.48  ? 100  PHE B CZ    1 
ATOM   7425  N N     . GLY D 3 102 ? 91.268  87.765  -34.023 1.00 52.52  ? 101  GLY B N     1 
ATOM   7426  C CA    . GLY D 3 102 ? 90.642  88.103  -32.762 1.00 57.32  ? 101  GLY B CA    1 
ATOM   7427  C C     . GLY D 3 102 ? 89.163  87.825  -32.866 1.00 60.77  ? 101  GLY B C     1 
ATOM   7428  O O     . GLY D 3 102 ? 88.640  87.644  -33.973 1.00 63.60  ? 101  GLY B O     1 
ATOM   7429  N N     . GLY D 3 103 ? 88.487  87.786  -31.724 1.00 75.60  ? 102  GLY B N     1 
ATOM   7430  C CA    . GLY D 3 103 ? 87.060  87.514  -31.719 1.00 79.70  ? 102  GLY B CA    1 
ATOM   7431  C C     . GLY D 3 103 ? 86.748  86.171  -32.356 1.00 83.26  ? 102  GLY B C     1 
ATOM   7432  O O     . GLY D 3 103 ? 86.438  85.222  -31.606 1.00 83.89  ? 102  GLY B O     1 
ATOM   7433  O OXT   . GLY D 3 103 ? 86.830  86.059  -33.605 1.00 95.41  ? 102  GLY B OXT   1 
ATOM   7434  N N     . ALA E 4 13  ? 53.094  117.266 -12.783 1.00 93.00  ? 814  ALA C N     1 
ATOM   7435  C CA    . ALA E 4 13  ? 54.009  116.143 -13.144 1.00 93.66  ? 814  ALA C CA    1 
ATOM   7436  C C     . ALA E 4 13  ? 53.955  115.893 -14.647 1.00 93.22  ? 814  ALA C C     1 
ATOM   7437  O O     . ALA E 4 13  ? 52.886  115.630 -15.196 1.00 94.15  ? 814  ALA C O     1 
ATOM   7438  C CB    . ALA E 4 13  ? 53.606  114.876 -12.387 1.00 71.49  ? 814  ALA C CB    1 
ATOM   7439  N N     . LYS E 4 14  ? 55.104  115.969 -15.311 1.00 75.71  ? 815  LYS C N     1 
ATOM   7440  C CA    . LYS E 4 14  ? 55.147  115.751 -16.754 1.00 74.16  ? 815  LYS C CA    1 
ATOM   7441  C C     . LYS E 4 14  ? 55.651  114.382 -17.204 1.00 70.25  ? 815  LYS C C     1 
ATOM   7442  O O     . LYS E 4 14  ? 56.475  113.750 -16.541 1.00 69.53  ? 815  LYS C O     1 
ATOM   7443  C CB    . LYS E 4 14  ? 55.979  116.841 -17.434 1.00 92.44  ? 815  LYS C CB    1 
ATOM   7444  C CG    . LYS E 4 14  ? 55.267  118.173 -17.521 1.00 94.94  ? 815  LYS C CG    1 
ATOM   7445  C CD    . LYS E 4 14  ? 55.937  119.092 -18.519 1.00 98.13  ? 815  LYS C CD    1 
ATOM   7446  C CE    . LYS E 4 14  ? 55.148  120.381 -18.692 1.00 100.93 ? 815  LYS C CE    1 
ATOM   7447  N NZ    . LYS E 4 14  ? 55.673  121.226 -19.808 1.00 103.13 ? 815  LYS C NZ    1 
ATOM   7448  N N     . SER E 4 15  ? 55.133  113.929 -18.341 1.00 58.73  ? 816  SER C N     1 
ATOM   7449  C CA    . SER E 4 15  ? 55.535  112.649 -18.902 1.00 54.37  ? 816  SER C CA    1 
ATOM   7450  C C     . SER E 4 15  ? 56.916  112.848 -19.499 1.00 50.74  ? 816  SER C C     1 
ATOM   7451  O O     . SER E 4 15  ? 57.273  113.954 -19.912 1.00 48.31  ? 816  SER C O     1 
ATOM   7452  C CB    . SER E 4 15  ? 54.566  112.206 -20.005 1.00 58.53  ? 816  SER C CB    1 
ATOM   7453  O OG    . SER E 4 15  ? 54.815  112.890 -21.225 1.00 56.58  ? 816  SER C OG    1 
ATOM   7454  N N     . ARG E 4 16  ? 57.705  111.784 -19.535 1.00 52.05  ? 817  ARG C N     1 
ATOM   7455  C CA    . ARG E 4 16  ? 59.036  111.892 -20.104 1.00 49.03  ? 817  ARG C CA    1 
ATOM   7456  C C     . ARG E 4 16  ? 58.952  112.188 -21.601 1.00 45.58  ? 817  ARG C C     1 
ATOM   7457  O O     . ARG E 4 16  ? 59.813  112.866 -22.154 1.00 42.80  ? 817  ARG C O     1 
ATOM   7458  C CB    . ARG E 4 16  ? 59.828  110.616 -19.845 1.00 57.91  ? 817  ARG C CB    1 
ATOM   7459  C CG    . ARG E 4 16  ? 60.207  110.458 -18.389 1.00 60.83  ? 817  ARG C CG    1 
ATOM   7460  C CD    . ARG E 4 16  ? 61.372  109.510 -18.243 1.00 62.07  ? 817  ARG C CD    1 
ATOM   7461  N NE    . ARG E 4 16  ? 60.933  108.133 -18.075 1.00 62.98  ? 817  ARG C NE    1 
ATOM   7462  C CZ    . ARG E 4 16  ? 61.704  107.080 -18.314 1.00 61.70  ? 817  ARG C CZ    1 
ATOM   7463  N NH1   . ARG E 4 16  ? 62.944  107.257 -18.744 1.00 60.23  ? 817  ARG C NH1   1 
ATOM   7464  N NH2   . ARG E 4 16  ? 61.243  105.857 -18.094 1.00 61.65  ? 817  ARG C NH2   1 
ATOM   7465  N N     . SER E 4 17  ? 57.910  111.698 -22.260 1.00 39.99  ? 818  SER C N     1 
ATOM   7466  C CA    . SER E 4 17  ? 57.785  111.968 -23.685 1.00 41.29  ? 818  SER C CA    1 
ATOM   7467  C C     . SER E 4 17  ? 57.590  113.467 -23.887 1.00 41.10  ? 818  SER C C     1 
ATOM   7468  O O     . SER E 4 17  ? 58.214  114.070 -24.755 1.00 39.72  ? 818  SER C O     1 
ATOM   7469  C CB    . SER E 4 17  ? 56.617  111.189 -24.276 1.00 41.04  ? 818  SER C CB    1 
ATOM   7470  O OG    . SER E 4 17  ? 56.934  109.813 -24.316 1.00 42.01  ? 818  SER C OG    1 
ATOM   7471  N N     . ASN E 4 18  ? 56.739  114.060 -23.054 1.00 49.63  ? 819  ASN C N     1 
ATOM   7472  C CA    . ASN E 4 18  ? 56.456  115.489 -23.122 1.00 53.40  ? 819  ASN C CA    1 
ATOM   7473  C C     . ASN E 4 18  ? 57.729  116.301 -22.870 1.00 50.50  ? 819  ASN C C     1 
ATOM   7474  O O     . ASN E 4 18  ? 58.055  117.212 -23.626 1.00 49.63  ? 819  ASN C O     1 
ATOM   7475  C CB    . ASN E 4 18  ? 55.387  115.858 -22.089 1.00 98.01  ? 819  ASN C CB    1 
ATOM   7476  C CG    . ASN E 4 18  ? 54.715  117.177 -22.398 1.00 102.70 ? 819  ASN C CG    1 
ATOM   7477  O OD1   . ASN E 4 18  ? 54.068  117.326 -23.436 1.00 106.22 ? 819  ASN C OD1   1 
ATOM   7478  N ND2   . ASN E 4 18  ? 54.865  118.146 -21.500 1.00 104.00 ? 819  ASN C ND2   1 
ATOM   7479  N N     . ARG E 4 19  ? 58.452  115.958 -21.810 1.00 45.41  ? 820  ARG C N     1 
ATOM   7480  C CA    . ARG E 4 19  ? 59.686  116.657 -21.484 1.00 44.89  ? 820  ARG C CA    1 
ATOM   7481  C C     . ARG E 4 19  ? 60.667  116.552 -22.641 1.00 45.14  ? 820  ARG C C     1 
ATOM   7482  O O     . ARG E 4 19  ? 61.472  117.458 -22.877 1.00 45.66  ? 820  ARG C O     1 
ATOM   7483  C CB    . ARG E 4 19  ? 60.314  116.057 -20.229 1.00 51.92  ? 820  ARG C CB    1 
ATOM   7484  C CG    . ARG E 4 19  ? 59.468  116.210 -18.969 1.00 56.28  ? 820  ARG C CG    1 
ATOM   7485  C CD    . ARG E 4 19  ? 60.082  115.432 -17.821 1.00 56.79  ? 820  ARG C CD    1 
ATOM   7486  N NE    . ARG E 4 19  ? 61.495  115.761 -17.672 1.00 61.08  ? 820  ARG C NE    1 
ATOM   7487  C CZ    . ARG E 4 19  ? 62.371  115.010 -17.014 1.00 63.23  ? 820  ARG C CZ    1 
ATOM   7488  N NH1   . ARG E 4 19  ? 61.975  113.879 -16.440 1.00 63.66  ? 820  ARG C NH1   1 
ATOM   7489  N NH2   . ARG E 4 19  ? 63.643  115.382 -16.939 1.00 63.59  ? 820  ARG C NH2   1 
ATOM   7490  N N     . ALA E 4 20  ? 60.604  115.446 -23.373 1.00 43.39  ? 821  ALA C N     1 
ATOM   7491  C CA    . ALA E 4 20  ? 61.506  115.257 -24.504 1.00 43.51  ? 821  ALA C CA    1 
ATOM   7492  C C     . ALA E 4 20  ? 60.989  115.936 -25.775 1.00 42.74  ? 821  ALA C C     1 
ATOM   7493  O O     . ALA E 4 20  ? 61.745  116.138 -26.723 1.00 41.47  ? 821  ALA C O     1 
ATOM   7494  C CB    . ALA E 4 20  ? 61.721  113.754 -24.761 1.00 48.30  ? 821  ALA C CB    1 
ATOM   7495  N N     . GLY E 4 21  ? 59.706  116.291 -25.786 1.00 45.37  ? 822  GLY C N     1 
ATOM   7496  C CA    . GLY E 4 21  ? 59.113  116.917 -26.960 1.00 44.52  ? 822  GLY C CA    1 
ATOM   7497  C C     . GLY E 4 21  ? 58.836  115.851 -28.007 1.00 45.50  ? 822  GLY C C     1 
ATOM   7498  O O     . GLY E 4 21  ? 59.007  116.078 -29.211 1.00 44.19  ? 822  GLY C O     1 
ATOM   7499  N N     . LEU E 4 22  ? 58.397  114.681 -27.544 1.00 44.01  ? 823  LEU C N     1 
ATOM   7500  C CA    . LEU E 4 22  ? 58.120  113.552 -28.434 1.00 44.37  ? 823  LEU C CA    1 
ATOM   7501  C C     . LEU E 4 22  ? 56.720  112.975 -28.318 1.00 44.33  ? 823  LEU C C     1 
ATOM   7502  O O     . LEU E 4 22  ? 56.064  113.111 -27.289 1.00 44.98  ? 823  LEU C O     1 
ATOM   7503  C CB    . LEU E 4 22  ? 59.124  112.429 -28.167 1.00 42.97  ? 823  LEU C CB    1 
ATOM   7504  C CG    . LEU E 4 22  ? 60.593  112.730 -28.465 1.00 42.28  ? 823  LEU C CG    1 
ATOM   7505  C CD1   . LEU E 4 22  ? 61.459  111.575 -27.975 1.00 40.87  ? 823  LEU C CD1   1 
ATOM   7506  C CD2   . LEU E 4 22  ? 60.773  112.957 -29.974 1.00 39.41  ? 823  LEU C CD2   1 
ATOM   7507  N N     . GLN E 4 23  ? 56.271  112.329 -29.389 1.00 45.28  ? 824  GLN C N     1 
ATOM   7508  C CA    . GLN E 4 23  ? 54.970  111.680 -29.415 1.00 46.28  ? 824  GLN C CA    1 
ATOM   7509  C C     . GLN E 4 23  ? 55.167  110.232 -28.981 1.00 47.13  ? 824  GLN C C     1 
ATOM   7510  O O     . GLN E 4 23  ? 54.339  109.681 -28.251 1.00 47.98  ? 824  GLN C O     1 
ATOM   7511  C CB    . GLN E 4 23  ? 54.369  111.710 -30.824 1.00 53.23  ? 824  GLN C CB    1 
ATOM   7512  C CG    . GLN E 4 23  ? 54.019  113.105 -31.332 1.00 54.83  ? 824  GLN C CG    1 
ATOM   7513  C CD    . GLN E 4 23  ? 53.206  113.898 -30.320 1.00 54.85  ? 824  GLN C CD    1 
ATOM   7514  O OE1   . GLN E 4 23  ? 52.191  113.425 -29.804 1.00 53.93  ? 824  GLN C OE1   1 
ATOM   7515  N NE2   . GLN E 4 23  ? 53.658  115.108 -30.028 1.00 53.78  ? 824  GLN C NE2   1 
ATOM   7516  N N     . PHE E 4 24  ? 56.261  109.617 -29.436 1.00 46.18  ? 825  PHE C N     1 
ATOM   7517  C CA    . PHE E 4 24  ? 56.568  108.230 -29.084 1.00 46.85  ? 825  PHE C CA    1 
ATOM   7518  C C     . PHE E 4 24  ? 56.865  108.111 -27.584 1.00 47.04  ? 825  PHE C C     1 
ATOM   7519  O O     . PHE E 4 24  ? 57.556  108.953 -27.017 1.00 47.32  ? 825  PHE C O     1 
ATOM   7520  C CB    . PHE E 4 24  ? 57.734  107.718 -29.936 1.00 45.11  ? 825  PHE C CB    1 
ATOM   7521  C CG    . PHE E 4 24  ? 57.297  107.110 -31.245 1.00 47.26  ? 825  PHE C CG    1 
ATOM   7522  C CD1   . PHE E 4 24  ? 56.414  107.786 -32.083 1.00 44.96  ? 825  PHE C CD1   1 
ATOM   7523  C CD2   . PHE E 4 24  ? 57.745  105.847 -31.627 1.00 48.44  ? 825  PHE C CD2   1 
ATOM   7524  C CE1   . PHE E 4 24  ? 55.979  107.215 -33.279 1.00 47.00  ? 825  PHE C CE1   1 
ATOM   7525  C CE2   . PHE E 4 24  ? 57.319  105.261 -32.823 1.00 47.47  ? 825  PHE C CE2   1 
ATOM   7526  C CZ    . PHE E 4 24  ? 56.433  105.945 -33.652 1.00 47.84  ? 825  PHE C CZ    1 
ATOM   7527  N N     . PRO E 4 25  ? 56.346  107.050 -26.932 1.00 48.78  ? 826  PRO C N     1 
ATOM   7528  C CA    . PRO E 4 25  ? 56.459  106.715 -25.504 1.00 47.27  ? 826  PRO C CA    1 
ATOM   7529  C C     . PRO E 4 25  ? 57.825  106.397 -24.916 1.00 48.05  ? 826  PRO C C     1 
ATOM   7530  O O     . PRO E 4 25  ? 58.259  105.241 -24.920 1.00 46.79  ? 826  PRO C O     1 
ATOM   7531  C CB    . PRO E 4 25  ? 55.500  105.545 -25.362 1.00 43.94  ? 826  PRO C CB    1 
ATOM   7532  C CG    . PRO E 4 25  ? 55.703  104.821 -26.647 1.00 45.56  ? 826  PRO C CG    1 
ATOM   7533  C CD    . PRO E 4 25  ? 55.722  105.934 -27.670 1.00 46.18  ? 826  PRO C CD    1 
ATOM   7534  N N     . VAL E 4 26  ? 58.489  107.419 -24.381 1.00 44.71  ? 827  VAL C N     1 
ATOM   7535  C CA    . VAL E 4 26  ? 59.799  107.226 -23.779 1.00 42.71  ? 827  VAL C CA    1 
ATOM   7536  C C     . VAL E 4 26  ? 59.762  106.175 -22.667 1.00 42.92  ? 827  VAL C C     1 
ATOM   7537  O O     . VAL E 4 26  ? 60.618  105.289 -22.618 1.00 42.62  ? 827  VAL C O     1 
ATOM   7538  C CB    . VAL E 4 26  ? 60.350  108.550 -23.207 1.00 40.68  ? 827  VAL C CB    1 
ATOM   7539  C CG1   . VAL E 4 26  ? 61.574  108.283 -22.326 1.00 39.27  ? 827  VAL C CG1   1 
ATOM   7540  C CG2   . VAL E 4 26  ? 60.730  109.477 -24.346 1.00 39.88  ? 827  VAL C CG2   1 
ATOM   7541  N N     . GLY E 4 27  ? 58.764  106.264 -21.791 1.00 42.66  ? 828  GLY C N     1 
ATOM   7542  C CA    . GLY E 4 27  ? 58.664  105.325 -20.682 1.00 42.54  ? 828  GLY C CA    1 
ATOM   7543  C C     . GLY E 4 27  ? 58.568  103.876 -21.112 1.00 42.52  ? 828  GLY C C     1 
ATOM   7544  O O     . GLY E 4 27  ? 59.208  102.990 -20.539 1.00 41.73  ? 828  GLY C O     1 
ATOM   7545  N N     . ARG E 4 28  ? 57.757  103.631 -22.131 1.00 46.01  ? 829  ARG C N     1 
ATOM   7546  C CA    . ARG E 4 28  ? 57.576  102.285 -22.640 1.00 46.43  ? 829  ARG C CA    1 
ATOM   7547  C C     . ARG E 4 28  ? 58.870  101.770 -23.255 1.00 46.45  ? 829  ARG C C     1 
ATOM   7548  O O     . ARG E 4 28  ? 59.270  100.619 -23.038 1.00 45.63  ? 829  ARG C O     1 
ATOM   7549  C CB    . ARG E 4 28  ? 56.480  102.267 -23.696 1.00 50.64  ? 829  ARG C CB    1 
ATOM   7550  C CG    . ARG E 4 28  ? 56.237  100.893 -24.280 1.00 52.49  ? 829  ARG C CG    1 
ATOM   7551  C CD    . ARG E 4 28  ? 54.763  100.604 -24.287 1.00 54.93  ? 829  ARG C CD    1 
ATOM   7552  N NE    . ARG E 4 28  ? 54.162  100.863 -25.582 1.00 55.86  ? 829  ARG C NE    1 
ATOM   7553  C CZ    . ARG E 4 28  ? 52.855  100.971 -25.787 1.00 57.62  ? 829  ARG C CZ    1 
ATOM   7554  N NH1   . ARG E 4 28  ? 52.005  100.856 -24.776 1.00 55.42  ? 829  ARG C NH1   1 
ATOM   7555  N NH2   . ARG E 4 28  ? 52.399  101.167 -27.014 1.00 59.46  ? 829  ARG C NH2   1 
ATOM   7556  N N     . ILE E 4 29  ? 59.523  102.631 -24.022 1.00 41.45  ? 830  ILE C N     1 
ATOM   7557  C CA    . ILE E 4 29  ? 60.756  102.259 -24.668 1.00 41.87  ? 830  ILE C CA    1 
ATOM   7558  C C     . ILE E 4 29  ? 61.857  102.005 -23.631 1.00 42.63  ? 830  ILE C C     1 
ATOM   7559  O O     . ILE E 4 29  ? 62.663  101.098 -23.800 1.00 41.68  ? 830  ILE C O     1 
ATOM   7560  C CB    . ILE E 4 29  ? 61.159  103.330 -25.706 1.00 36.33  ? 830  ILE C CB    1 
ATOM   7561  C CG1   . ILE E 4 29  ? 60.242  103.205 -26.921 1.00 36.16  ? 830  ILE C CG1   1 
ATOM   7562  C CG2   . ILE E 4 29  ? 62.615  103.149 -26.138 1.00 35.67  ? 830  ILE C CG2   1 
ATOM   7563  C CD1   . ILE E 4 29  ? 60.395  104.327 -27.930 1.00 36.05  ? 830  ILE C CD1   1 
ATOM   7564  N N     . HIS E 4 30  ? 61.874  102.783 -22.552 1.00 43.35  ? 831  HIS C N     1 
ATOM   7565  C CA    . HIS E 4 30  ? 62.867  102.586 -21.500 1.00 45.17  ? 831  HIS C CA    1 
ATOM   7566  C C     . HIS E 4 30  ? 62.649  101.192 -20.915 1.00 45.37  ? 831  HIS C C     1 
ATOM   7567  O O     . HIS E 4 30  ? 63.591  100.444 -20.660 1.00 45.57  ? 831  HIS C O     1 
ATOM   7568  C CB    . HIS E 4 30  ? 62.688  103.618 -20.382 1.00 52.42  ? 831  HIS C CB    1 
ATOM   7569  C CG    . HIS E 4 30  ? 63.873  103.737 -19.473 1.00 54.38  ? 831  HIS C CG    1 
ATOM   7570  N ND1   . HIS E 4 30  ? 64.787  102.720 -19.302 1.00 56.50  ? 831  HIS C ND1   1 
ATOM   7571  C CD2   . HIS E 4 30  ? 64.302  104.760 -18.696 1.00 55.31  ? 831  HIS C CD2   1 
ATOM   7572  C CE1   . HIS E 4 30  ? 65.731  103.113 -18.465 1.00 55.71  ? 831  HIS C CE1   1 
ATOM   7573  N NE2   . HIS E 4 30  ? 65.460  104.347 -18.082 1.00 54.69  ? 831  HIS C NE2   1 
ATOM   7574  N N     . ARG E 4 31  ? 61.388  100.850 -20.711 1.00 47.23  ? 832  ARG C N     1 
ATOM   7575  C CA    . ARG E 4 31  ? 61.033  99.560  -20.147 1.00 49.79  ? 832  ARG C CA    1 
ATOM   7576  C C     . ARG E 4 31  ? 61.371  98.405  -21.087 1.00 49.78  ? 832  ARG C C     1 
ATOM   7577  O O     . ARG E 4 31  ? 61.757  97.331  -20.638 1.00 49.79  ? 832  ARG C O     1 
ATOM   7578  C CB    . ARG E 4 31  ? 59.543  99.532  -19.821 1.00 62.39  ? 832  ARG C CB    1 
ATOM   7579  C CG    . ARG E 4 31  ? 59.108  98.319  -19.038 1.00 67.01  ? 832  ARG C CG    1 
ATOM   7580  C CD    . ARG E 4 31  ? 57.611  98.159  -19.134 1.00 71.67  ? 832  ARG C CD    1 
ATOM   7581  N NE    . ARG E 4 31  ? 57.209  97.691  -20.457 1.00 74.85  ? 832  ARG C NE    1 
ATOM   7582  C CZ    . ARG E 4 31  ? 56.141  98.134  -21.112 1.00 77.20  ? 832  ARG C CZ    1 
ATOM   7583  N NH1   . ARG E 4 31  ? 55.366  99.066  -20.572 1.00 77.62  ? 832  ARG C NH1   1 
ATOM   7584  N NH2   . ARG E 4 31  ? 55.840  97.639  -22.303 1.00 78.12  ? 832  ARG C NH2   1 
ATOM   7585  N N     . LEU E 4 32  ? 61.210  98.621  -22.386 1.00 54.55  ? 833  LEU C N     1 
ATOM   7586  C CA    . LEU E 4 32  ? 61.510  97.582  -23.362 1.00 52.48  ? 833  LEU C CA    1 
ATOM   7587  C C     . LEU E 4 32  ? 63.007  97.343  -23.423 1.00 51.95  ? 833  LEU C C     1 
ATOM   7588  O O     . LEU E 4 32  ? 63.447  96.213  -23.622 1.00 52.97  ? 833  LEU C O     1 
ATOM   7589  C CB    . LEU E 4 32  ? 60.970  97.967  -24.738 1.00 48.39  ? 833  LEU C CB    1 
ATOM   7590  C CG    . LEU E 4 32  ? 59.451  97.790  -24.822 1.00 50.24  ? 833  LEU C CG    1 
ATOM   7591  C CD1   . LEU E 4 32  ? 58.908  98.411  -26.095 1.00 49.49  ? 833  LEU C CD1   1 
ATOM   7592  C CD2   . LEU E 4 32  ? 59.117  96.303  -24.759 1.00 49.03  ? 833  LEU C CD2   1 
ATOM   7593  N N     . LEU E 4 33  ? 63.790  98.403  -23.246 1.00 40.43  ? 834  LEU C N     1 
ATOM   7594  C CA    . LEU E 4 33  ? 65.240  98.273  -23.258 1.00 41.16  ? 834  LEU C CA    1 
ATOM   7595  C C     . LEU E 4 33  ? 65.727  97.503  -22.014 1.00 44.10  ? 834  LEU C C     1 
ATOM   7596  O O     . LEU E 4 33  ? 66.612  96.652  -22.112 1.00 45.41  ? 834  LEU C O     1 
ATOM   7597  C CB    . LEU E 4 33  ? 65.896  99.651  -23.302 1.00 41.91  ? 834  LEU C CB    1 
ATOM   7598  C CG    . LEU E 4 33  ? 65.831  100.471 -24.592 1.00 41.55  ? 834  LEU C CG    1 
ATOM   7599  C CD1   . LEU E 4 33  ? 66.482  101.840 -24.349 1.00 40.33  ? 834  LEU C CD1   1 
ATOM   7600  C CD2   . LEU E 4 33  ? 66.552  99.724  -25.720 1.00 39.42  ? 834  LEU C CD2   1 
ATOM   7601  N N     . ARG E 4 34  ? 65.141  97.797  -20.855 1.00 49.11  ? 835  ARG C N     1 
ATOM   7602  C CA    . ARG E 4 34  ? 65.513  97.136  -19.603 1.00 52.79  ? 835  ARG C CA    1 
ATOM   7603  C C     . ARG E 4 34  ? 65.189  95.649  -19.606 1.00 53.48  ? 835  ARG C C     1 
ATOM   7604  O O     . ARG E 4 34  ? 65.945  94.844  -19.069 1.00 54.96  ? 835  ARG C O     1 
ATOM   7605  C CB    . ARG E 4 34  ? 64.771  97.744  -18.412 1.00 64.71  ? 835  ARG C CB    1 
ATOM   7606  C CG    . ARG E 4 34  ? 65.171  99.133  -17.994 1.00 69.00  ? 835  ARG C CG    1 
ATOM   7607  C CD    . ARG E 4 34  ? 64.306  99.547  -16.809 1.00 73.32  ? 835  ARG C CD    1 
ATOM   7608  N NE    . ARG E 4 34  ? 64.591  100.894 -16.332 1.00 78.07  ? 835  ARG C NE    1 
ATOM   7609  C CZ    . ARG E 4 34  ? 65.797  101.324 -15.972 1.00 80.43  ? 835  ARG C CZ    1 
ATOM   7610  N NH1   . ARG E 4 34  ? 66.847  100.512 -16.039 1.00 81.28  ? 835  ARG C NH1   1 
ATOM   7611  N NH2   . ARG E 4 34  ? 65.952  102.567 -15.534 1.00 81.79  ? 835  ARG C NH2   1 
ATOM   7612  N N     . LYS E 4 35  ? 64.056  95.295  -20.202 1.00 56.09  ? 836  LYS C N     1 
ATOM   7613  C CA    . LYS E 4 35  ? 63.604  93.911  -20.238 1.00 58.19  ? 836  LYS C CA    1 
ATOM   7614  C C     . LYS E 4 35  ? 64.166  93.078  -21.374 1.00 57.05  ? 836  LYS C C     1 
ATOM   7615  O O     . LYS E 4 35  ? 64.110  91.850  -21.322 1.00 57.41  ? 836  LYS C O     1 
ATOM   7616  C CB    . LYS E 4 35  ? 62.077  93.865  -20.330 1.00 105.01 ? 836  LYS C CB    1 
ATOM   7617  C CG    . LYS E 4 35  ? 61.539  94.498  -21.610 1.00 110.71 ? 836  LYS C CG    1 
ATOM   7618  C CD    . LYS E 4 35  ? 60.039  94.294  -21.795 1.00 113.02 ? 836  LYS C CD    1 
ATOM   7619  C CE    . LYS E 4 35  ? 59.718  92.889  -22.272 1.00 115.47 ? 836  LYS C CE    1 
ATOM   7620  N NZ    . LYS E 4 35  ? 58.271  92.748  -22.584 1.00 118.36 ? 836  LYS C NZ    1 
ATOM   7621  N N     . GLY E 4 36  ? 64.701  93.737  -22.399 1.00 54.50  ? 837  GLY C N     1 
ATOM   7622  C CA    . GLY E 4 36  ? 65.209  93.017  -23.553 1.00 51.43  ? 837  GLY C CA    1 
ATOM   7623  C C     . GLY E 4 36  ? 66.600  92.414  -23.488 1.00 50.59  ? 837  GLY C C     1 
ATOM   7624  O O     . GLY E 4 36  ? 67.119  91.975  -24.517 1.00 50.64  ? 837  GLY C O     1 
ATOM   7625  N N     . ASN E 4 37  ? 67.211  92.387  -22.309 1.00 51.17  ? 838  ASN C N     1 
ATOM   7626  C CA    . ASN E 4 37  ? 68.547  91.813  -22.163 1.00 50.73  ? 838  ASN C CA    1 
ATOM   7627  C C     . ASN E 4 37  ? 69.549  92.422  -23.126 1.00 49.70  ? 838  ASN C C     1 
ATOM   7628  O O     . ASN E 4 37  ? 70.184  91.708  -23.908 1.00 49.42  ? 838  ASN C O     1 
ATOM   7629  C CB    . ASN E 4 37  ? 68.525  90.299  -22.401 1.00 57.05  ? 838  ASN C CB    1 
ATOM   7630  C CG    . ASN E 4 37  ? 67.762  89.552  -21.333 1.00 59.98  ? 838  ASN C CG    1 
ATOM   7631  O OD1   . ASN E 4 37  ? 66.570  89.280  -21.480 1.00 60.03  ? 838  ASN C OD1   1 
ATOM   7632  N ND2   . ASN E 4 37  ? 68.445  89.227  -20.236 1.00 61.16  ? 838  ASN C ND2   1 
ATOM   7633  N N     . TYR E 4 38  ? 69.689  93.739  -23.081 1.00 46.29  ? 839  TYR C N     1 
ATOM   7634  C CA    . TYR E 4 38  ? 70.634  94.398  -23.960 1.00 42.43  ? 839  TYR C CA    1 
ATOM   7635  C C     . TYR E 4 38  ? 71.863  94.798  -23.176 1.00 40.86  ? 839  TYR C C     1 
ATOM   7636  O O     . TYR E 4 38  ? 72.976  94.787  -23.704 1.00 41.22  ? 839  TYR C O     1 
ATOM   7637  C CB    . TYR E 4 38  ? 69.976  95.605  -24.625 1.00 39.36  ? 839  TYR C CB    1 
ATOM   7638  C CG    . TYR E 4 38  ? 68.804  95.216  -25.507 1.00 38.16  ? 839  TYR C CG    1 
ATOM   7639  C CD1   . TYR E 4 38  ? 67.497  95.507  -25.124 1.00 36.65  ? 839  TYR C CD1   1 
ATOM   7640  C CD2   . TYR E 4 38  ? 69.006  94.556  -26.731 1.00 36.76  ? 839  TYR C CD2   1 
ATOM   7641  C CE1   . TYR E 4 38  ? 66.414  95.159  -25.928 1.00 34.88  ? 839  TYR C CE1   1 
ATOM   7642  C CE2   . TYR E 4 38  ? 67.924  94.200  -27.551 1.00 37.39  ? 839  TYR C CE2   1 
ATOM   7643  C CZ    . TYR E 4 38  ? 66.629  94.510  -27.134 1.00 38.28  ? 839  TYR C CZ    1 
ATOM   7644  O OH    . TYR E 4 38  ? 65.540  94.172  -27.906 1.00 40.32  ? 839  TYR C OH    1 
ATOM   7645  N N     . ALA E 4 39  ? 71.668  95.126  -21.904 1.00 35.73  ? 840  ALA C N     1 
ATOM   7646  C CA    . ALA E 4 39  ? 72.784  95.512  -21.050 1.00 38.01  ? 840  ALA C CA    1 
ATOM   7647  C C     . ALA E 4 39  ? 72.371  95.438  -19.583 1.00 38.54  ? 840  ALA C C     1 
ATOM   7648  O O     . ALA E 4 39  ? 71.191  95.383  -19.262 1.00 38.59  ? 840  ALA C O     1 
ATOM   7649  C CB    . ALA E 4 39  ? 73.259  96.942  -21.403 1.00 31.62  ? 840  ALA C CB    1 
ATOM   7650  N N     . GLU E 4 40  ? 73.336  95.427  -18.679 1.00 44.71  ? 841  GLU C N     1 
ATOM   7651  C CA    . GLU E 4 40  ? 72.957  95.373  -17.283 1.00 48.52  ? 841  GLU C CA    1 
ATOM   7652  C C     . GLU E 4 40  ? 72.259  96.674  -16.912 1.00 47.30  ? 841  GLU C C     1 
ATOM   7653  O O     . GLU E 4 40  ? 71.341  96.687  -16.101 1.00 47.02  ? 841  GLU C O     1 
ATOM   7654  C CB    . GLU E 4 40  ? 74.184  95.165  -16.391 1.00 91.50  ? 841  GLU C CB    1 
ATOM   7655  C CG    . GLU E 4 40  ? 74.841  93.800  -16.555 1.00 99.91  ? 841  GLU C CG    1 
ATOM   7656  C CD    . GLU E 4 40  ? 73.833  92.655  -16.546 1.00 104.13 ? 841  GLU C CD    1 
ATOM   7657  O OE1   . GLU E 4 40  ? 72.981  92.607  -15.632 1.00 105.96 ? 841  GLU C OE1   1 
ATOM   7658  O OE2   . GLU E 4 40  ? 73.896  91.798  -17.455 1.00 106.12 ? 841  GLU C OE2   1 
ATOM   7659  N N     . ARG E 4 41  ? 72.676  97.768  -17.535 1.00 41.19  ? 842  ARG C N     1 
ATOM   7660  C CA    . ARG E 4 41  ? 72.099  99.062  -17.209 1.00 41.75  ? 842  ARG C CA    1 
ATOM   7661  C C     . ARG E 4 41  ? 71.725  99.875  -18.435 1.00 40.71  ? 842  ARG C C     1 
ATOM   7662  O O     . ARG E 4 41  ? 72.399  99.822  -19.473 1.00 38.86  ? 842  ARG C O     1 
ATOM   7663  C CB    . ARG E 4 41  ? 73.098  99.862  -16.360 1.00 55.41  ? 842  ARG C CB    1 
ATOM   7664  C CG    . ARG E 4 41  ? 73.533  99.151  -15.081 1.00 57.84  ? 842  ARG C CG    1 
ATOM   7665  C CD    . ARG E 4 41  ? 74.946  99.551  -14.665 1.00 61.62  ? 842  ARG C CD    1 
ATOM   7666  N NE    . ARG E 4 41  ? 75.020  100.836 -13.973 1.00 66.02  ? 842  ARG C NE    1 
ATOM   7667  C CZ    . ARG E 4 41  ? 74.844  100.997 -12.662 1.00 67.45  ? 842  ARG C CZ    1 
ATOM   7668  N NH1   . ARG E 4 41  ? 74.580  99.950  -11.889 1.00 67.57  ? 842  ARG C NH1   1 
ATOM   7669  N NH2   . ARG E 4 41  ? 74.953  102.206 -12.120 1.00 66.21  ? 842  ARG C NH2   1 
ATOM   7670  N N     . VAL E 4 42  ? 70.649  100.636 -18.301 1.00 48.52  ? 843  VAL C N     1 
ATOM   7671  C CA    . VAL E 4 42  ? 70.189  101.502 -19.372 1.00 47.31  ? 843  VAL C CA    1 
ATOM   7672  C C     . VAL E 4 42  ? 70.027  102.902 -18.803 1.00 47.04  ? 843  VAL C C     1 
ATOM   7673  O O     . VAL E 4 42  ? 69.245  103.115 -17.888 1.00 47.90  ? 843  VAL C O     1 
ATOM   7674  C CB    . VAL E 4 42  ? 68.845  101.029 -19.953 1.00 37.88  ? 843  VAL C CB    1 
ATOM   7675  C CG1   . VAL E 4 42  ? 68.398  101.985 -21.065 1.00 34.34  ? 843  VAL C CG1   1 
ATOM   7676  C CG2   . VAL E 4 42  ? 68.988  99.610  -20.484 1.00 36.24  ? 843  VAL C CG2   1 
ATOM   7677  N N     . GLY E 4 43  ? 70.787  103.849 -19.338 1.00 45.45  ? 844  GLY C N     1 
ATOM   7678  C CA    . GLY E 4 43  ? 70.700  105.215 -18.864 1.00 46.26  ? 844  GLY C CA    1 
ATOM   7679  C C     . GLY E 4 43  ? 69.411  105.908 -19.277 1.00 46.45  ? 844  GLY C C     1 
ATOM   7680  O O     . GLY E 4 43  ? 68.745  105.501 -20.235 1.00 46.12  ? 844  GLY C O     1 
ATOM   7681  N N     . ALA E 4 44  ? 69.087  106.989 -18.574 1.00 42.49  ? 845  ALA C N     1 
ATOM   7682  C CA    . ALA E 4 44  ? 67.871  107.765 -18.828 1.00 41.90  ? 845  ALA C CA    1 
ATOM   7683  C C     . ALA E 4 44  ? 67.792  108.384 -20.230 1.00 40.70  ? 845  ALA C C     1 
ATOM   7684  O O     . ALA E 4 44  ? 66.712  108.521 -20.788 1.00 41.29  ? 845  ALA C O     1 
ATOM   7685  C CB    . ALA E 4 44  ? 67.736  108.861 -17.765 1.00 41.38  ? 845  ALA C CB    1 
ATOM   7686  N N     . GLY E 4 45  ? 68.930  108.764 -20.790 1.00 38.11  ? 846  GLY C N     1 
ATOM   7687  C CA    . GLY E 4 45  ? 68.934  109.351 -22.116 1.00 40.44  ? 846  GLY C CA    1 
ATOM   7688  C C     . GLY E 4 45  ? 68.772  108.370 -23.269 1.00 40.17  ? 846  GLY C C     1 
ATOM   7689  O O     . GLY E 4 45  ? 68.291  108.749 -24.338 1.00 41.37  ? 846  GLY C O     1 
ATOM   7690  N N     . ALA E 4 46  ? 69.159  107.111 -23.068 1.00 42.08  ? 847  ALA C N     1 
ATOM   7691  C CA    . ALA E 4 46  ? 69.053  106.105 -24.123 1.00 40.23  ? 847  ALA C CA    1 
ATOM   7692  C C     . ALA E 4 46  ? 67.658  105.988 -24.706 1.00 39.11  ? 847  ALA C C     1 
ATOM   7693  O O     . ALA E 4 46  ? 67.489  106.059 -25.917 1.00 41.12  ? 847  ALA C O     1 
ATOM   7694  C CB    . ALA E 4 46  ? 69.506  104.745 -23.613 1.00 39.75  ? 847  ALA C CB    1 
ATOM   7695  N N     . PRO E 4 47  ? 66.636  105.809 -23.855 1.00 34.96  ? 848  PRO C N     1 
ATOM   7696  C CA    . PRO E 4 47  ? 65.277  105.686 -24.392 1.00 35.32  ? 848  PRO C CA    1 
ATOM   7697  C C     . PRO E 4 47  ? 64.720  106.950 -25.064 1.00 34.39  ? 848  PRO C C     1 
ATOM   7698  O O     . PRO E 4 47  ? 63.867  106.867 -25.948 1.00 34.59  ? 848  PRO C O     1 
ATOM   7699  C CB    . PRO E 4 47  ? 64.460  105.235 -23.171 1.00 30.85  ? 848  PRO C CB    1 
ATOM   7700  C CG    . PRO E 4 47  ? 65.203  105.836 -22.012 1.00 31.69  ? 848  PRO C CG    1 
ATOM   7701  C CD    . PRO E 4 47  ? 66.655  105.621 -22.389 1.00 31.90  ? 848  PRO C CD    1 
ATOM   7702  N N     . VAL E 4 48  ? 65.211  108.109 -24.643 1.00 35.69  ? 849  VAL C N     1 
ATOM   7703  C CA    . VAL E 4 48  ? 64.783  109.382 -25.202 1.00 36.13  ? 849  VAL C CA    1 
ATOM   7704  C C     . VAL E 4 48  ? 65.310  109.474 -26.621 1.00 35.97  ? 849  VAL C C     1 
ATOM   7705  O O     . VAL E 4 48  ? 64.584  109.797 -27.550 1.00 37.16  ? 849  VAL C O     1 
ATOM   7706  C CB    . VAL E 4 48  ? 65.350  110.578 -24.379 1.00 35.47  ? 849  VAL C CB    1 
ATOM   7707  C CG1   . VAL E 4 48  ? 65.141  111.887 -25.135 1.00 33.11  ? 849  VAL C CG1   1 
ATOM   7708  C CG2   . VAL E 4 48  ? 64.666  110.637 -23.014 1.00 35.56  ? 849  VAL C CG2   1 
ATOM   7709  N N     . TYR E 4 49  ? 66.592  109.196 -26.771 1.00 40.66  ? 850  TYR C N     1 
ATOM   7710  C CA    . TYR E 4 49  ? 67.240  109.249 -28.067 1.00 40.55  ? 850  TYR C CA    1 
ATOM   7711  C C     . TYR E 4 49  ? 66.614  108.218 -29.010 1.00 40.47  ? 850  TYR C C     1 
ATOM   7712  O O     . TYR E 4 49  ? 66.299  108.532 -30.159 1.00 41.70  ? 850  TYR C O     1 
ATOM   7713  C CB    . TYR E 4 49  ? 68.734  108.965 -27.889 1.00 33.87  ? 850  TYR C CB    1 
ATOM   7714  C CG    . TYR E 4 49  ? 69.617  109.450 -29.018 1.00 34.35  ? 850  TYR C CG    1 
ATOM   7715  C CD1   . TYR E 4 49  ? 70.560  110.464 -28.801 1.00 30.91  ? 850  TYR C CD1   1 
ATOM   7716  C CD2   . TYR E 4 49  ? 69.534  108.880 -30.295 1.00 34.14  ? 850  TYR C CD2   1 
ATOM   7717  C CE1   . TYR E 4 49  ? 71.395  110.896 -29.811 1.00 33.11  ? 850  TYR C CE1   1 
ATOM   7718  C CE2   . TYR E 4 49  ? 70.375  109.303 -31.322 1.00 34.12  ? 850  TYR C CE2   1 
ATOM   7719  C CZ    . TYR E 4 49  ? 71.304  110.308 -31.068 1.00 35.81  ? 850  TYR C CZ    1 
ATOM   7720  O OH    . TYR E 4 49  ? 72.182  110.689 -32.049 1.00 36.89  ? 850  TYR C OH    1 
ATOM   7721  N N     . LEU E 4 50  ? 66.418  106.996 -28.514 1.00 34.16  ? 851  LEU C N     1 
ATOM   7722  C CA    . LEU E 4 50  ? 65.853  105.924 -29.329 1.00 33.50  ? 851  LEU C CA    1 
ATOM   7723  C C     . LEU E 4 50  ? 64.429  106.223 -29.797 1.00 33.49  ? 851  LEU C C     1 
ATOM   7724  O O     . LEU E 4 50  ? 64.094  105.972 -30.958 1.00 32.90  ? 851  LEU C O     1 
ATOM   7725  C CB    . LEU E 4 50  ? 65.896  104.577 -28.572 1.00 34.46  ? 851  LEU C CB    1 
ATOM   7726  C CG    . LEU E 4 50  ? 65.486  103.316 -29.364 1.00 35.93  ? 851  LEU C CG    1 
ATOM   7727  C CD1   . LEU E 4 50  ? 66.276  103.216 -30.671 1.00 31.09  ? 851  LEU C CD1   1 
ATOM   7728  C CD2   . LEU E 4 50  ? 65.732  102.059 -28.511 1.00 34.83  ? 851  LEU C CD2   1 
ATOM   7729  N N     . ALA E 4 51  ? 63.597  106.756 -28.901 1.00 35.98  ? 852  ALA C N     1 
ATOM   7730  C CA    . ALA E 4 51  ? 62.220  107.105 -29.246 1.00 36.17  ? 852  ALA C CA    1 
ATOM   7731  C C     . ALA E 4 51  ? 62.189  108.214 -30.312 1.00 36.26  ? 852  ALA C C     1 
ATOM   7732  O O     . ALA E 4 51  ? 61.343  108.216 -31.204 1.00 36.61  ? 852  ALA C O     1 
ATOM   7733  C CB    . ALA E 4 51  ? 61.455  107.570 -27.984 1.00 30.10  ? 852  ALA C CB    1 
ATOM   7734  N N     . ALA E 4 52  ? 63.112  109.160 -30.204 1.00 33.21  ? 853  ALA C N     1 
ATOM   7735  C CA    . ALA E 4 52  ? 63.185  110.258 -31.153 1.00 33.04  ? 853  ALA C CA    1 
ATOM   7736  C C     . ALA E 4 52  ? 63.557  109.718 -32.527 1.00 34.28  ? 853  ALA C C     1 
ATOM   7737  O O     . ALA E 4 52  ? 62.996  110.130 -33.541 1.00 34.95  ? 853  ALA C O     1 
ATOM   7738  C CB    . ALA E 4 52  ? 64.217  111.273 -30.698 1.00 22.40  ? 853  ALA C CB    1 
ATOM   7739  N N     . VAL E 4 53  ? 64.506  108.791 -32.566 1.00 34.43  ? 854  VAL C N     1 
ATOM   7740  C CA    . VAL E 4 53  ? 64.921  108.217 -33.843 1.00 35.46  ? 854  VAL C CA    1 
ATOM   7741  C C     . VAL E 4 53  ? 63.775  107.402 -34.449 1.00 34.97  ? 854  VAL C C     1 
ATOM   7742  O O     . VAL E 4 53  ? 63.489  107.509 -35.638 1.00 32.31  ? 854  VAL C O     1 
ATOM   7743  C CB    . VAL E 4 53  ? 66.179  107.329 -33.663 1.00 41.23  ? 854  VAL C CB    1 
ATOM   7744  C CG1   . VAL E 4 53  ? 66.461  106.531 -34.935 1.00 39.00  ? 854  VAL C CG1   1 
ATOM   7745  C CG2   . VAL E 4 53  ? 67.370  108.212 -33.311 1.00 40.80  ? 854  VAL C CG2   1 
ATOM   7746  N N     . MET E 4 54  ? 63.112  106.604 -33.617 1.00 37.79  ? 855  MET C N     1 
ATOM   7747  C CA    . MET E 4 54  ? 61.999  105.779 -34.071 1.00 38.26  ? 855  MET C CA    1 
ATOM   7748  C C     . MET E 4 54  ? 60.902  106.664 -34.630 1.00 39.53  ? 855  MET C C     1 
ATOM   7749  O O     . MET E 4 54  ? 60.322  106.368 -35.675 1.00 39.09  ? 855  MET C O     1 
ATOM   7750  C CB    . MET E 4 54  ? 61.439  104.945 -32.909 1.00 38.24  ? 855  MET C CB    1 
ATOM   7751  C CG    . MET E 4 54  ? 62.275  103.707 -32.566 1.00 40.54  ? 855  MET C CG    1 
ATOM   7752  S SD    . MET E 4 54  ? 61.924  103.054 -30.906 1.00 43.50  ? 855  MET C SD    1 
ATOM   7753  C CE    . MET E 4 54  ? 60.361  102.286 -31.138 1.00 39.12  ? 855  MET C CE    1 
ATOM   7754  N N     . GLU E 4 55  ? 60.608  107.745 -33.914 1.00 37.77  ? 856  GLU C N     1 
ATOM   7755  C CA    . GLU E 4 55  ? 59.577  108.678 -34.342 1.00 37.90  ? 856  GLU C CA    1 
ATOM   7756  C C     . GLU E 4 55  ? 59.971  109.350 -35.660 1.00 34.37  ? 856  GLU C C     1 
ATOM   7757  O O     . GLU E 4 55  ? 59.151  109.498 -36.544 1.00 32.48  ? 856  GLU C O     1 
ATOM   7758  C CB    . GLU E 4 55  ? 59.339  109.737 -33.262 1.00 45.60  ? 856  GLU C CB    1 
ATOM   7759  C CG    . GLU E 4 55  ? 58.195  110.690 -33.576 1.00 50.46  ? 856  GLU C CG    1 
ATOM   7760  C CD    . GLU E 4 55  ? 57.957  111.704 -32.460 1.00 55.73  ? 856  GLU C CD    1 
ATOM   7761  O OE1   . GLU E 4 55  ? 57.701  111.274 -31.307 1.00 55.74  ? 856  GLU C OE1   1 
ATOM   7762  O OE2   . GLU E 4 55  ? 58.031  112.928 -32.738 1.00 54.93  ? 856  GLU C OE2   1 
ATOM   7763  N N     . TYR E 4 56  ? 61.232  109.741 -35.787 1.00 32.89  ? 857  TYR C N     1 
ATOM   7764  C CA    . TYR E 4 56  ? 61.708  110.385 -37.005 1.00 34.10  ? 857  TYR C CA    1 
ATOM   7765  C C     . TYR E 4 56  ? 61.631  109.445 -38.216 1.00 33.75  ? 857  TYR C C     1 
ATOM   7766  O O     . TYR E 4 56  ? 61.272  109.863 -39.325 1.00 32.29  ? 857  TYR C O     1 
ATOM   7767  C CB    . TYR E 4 56  ? 63.154  110.853 -36.821 1.00 44.62  ? 857  TYR C CB    1 
ATOM   7768  C CG    . TYR E 4 56  ? 63.847  111.161 -38.132 1.00 49.65  ? 857  TYR C CG    1 
ATOM   7769  C CD1   . TYR E 4 56  ? 63.453  112.250 -38.920 1.00 52.71  ? 857  TYR C CD1   1 
ATOM   7770  C CD2   . TYR E 4 56  ? 64.838  110.318 -38.626 1.00 50.09  ? 857  TYR C CD2   1 
ATOM   7771  C CE1   . TYR E 4 56  ? 64.030  112.480 -40.175 1.00 54.57  ? 857  TYR C CE1   1 
ATOM   7772  C CE2   . TYR E 4 56  ? 65.417  110.535 -39.872 1.00 53.81  ? 857  TYR C CE2   1 
ATOM   7773  C CZ    . TYR E 4 56  ? 65.009  111.615 -40.642 1.00 55.82  ? 857  TYR C CZ    1 
ATOM   7774  O OH    . TYR E 4 56  ? 65.581  111.813 -41.881 1.00 59.45  ? 857  TYR C OH    1 
ATOM   7775  N N     . LEU E 4 57  ? 61.978  108.179 -38.012 1.00 34.00  ? 858  LEU C N     1 
ATOM   7776  C CA    . LEU E 4 57  ? 61.935  107.223 -39.111 1.00 35.27  ? 858  LEU C CA    1 
ATOM   7777  C C     . LEU E 4 57  ? 60.495  106.931 -39.509 1.00 34.25  ? 858  LEU C C     1 
ATOM   7778  O O     . LEU E 4 57  ? 60.190  106.767 -40.696 1.00 34.24  ? 858  LEU C O     1 
ATOM   7779  C CB    . LEU E 4 57  ? 62.669  105.935 -38.729 1.00 33.69  ? 858  LEU C CB    1 
ATOM   7780  C CG    . LEU E 4 57  ? 64.181  106.163 -38.662 1.00 36.68  ? 858  LEU C CG    1 
ATOM   7781  C CD1   . LEU E 4 57  ? 64.894  104.879 -38.213 1.00 37.05  ? 858  LEU C CD1   1 
ATOM   7782  C CD2   . LEU E 4 57  ? 64.684  106.615 -40.051 1.00 35.13  ? 858  LEU C CD2   1 
ATOM   7783  N N     . ALA E 4 58  ? 59.602  106.880 -38.526 1.00 29.70  ? 859  ALA C N     1 
ATOM   7784  C CA    . ALA E 4 58  ? 58.203  106.630 -38.835 1.00 31.36  ? 859  ALA C CA    1 
ATOM   7785  C C     . ALA E 4 58  ? 57.643  107.823 -39.629 1.00 32.43  ? 859  ALA C C     1 
ATOM   7786  O O     . ALA E 4 58  ? 56.904  107.639 -40.596 1.00 32.17  ? 859  ALA C O     1 
ATOM   7787  C CB    . ALA E 4 58  ? 57.413  106.426 -37.552 1.00 30.91  ? 859  ALA C CB    1 
ATOM   7788  N N     . ALA E 4 59  ? 58.010  109.040 -39.222 1.00 33.89  ? 860  ALA C N     1 
ATOM   7789  C CA    . ALA E 4 59  ? 57.549  110.260 -39.899 1.00 35.62  ? 860  ALA C CA    1 
ATOM   7790  C C     . ALA E 4 59  ? 57.982  110.279 -41.365 1.00 35.24  ? 860  ALA C C     1 
ATOM   7791  O O     . ALA E 4 59  ? 57.194  110.593 -42.247 1.00 34.66  ? 860  ALA C O     1 
ATOM   7792  C CB    . ALA E 4 59  ? 58.097  111.516 -39.174 1.00 31.42  ? 860  ALA C CB    1 
ATOM   7793  N N     . GLU E 4 60  ? 59.240  109.933 -41.605 1.00 33.34  ? 861  GLU C N     1 
ATOM   7794  C CA    . GLU E 4 60  ? 59.805  109.902 -42.944 1.00 34.75  ? 861  GLU C CA    1 
ATOM   7795  C C     . GLU E 4 60  ? 59.072  108.899 -43.848 1.00 34.69  ? 861  GLU C C     1 
ATOM   7796  O O     . GLU E 4 60  ? 58.790  109.185 -45.018 1.00 34.07  ? 861  GLU C O     1 
ATOM   7797  C CB    . GLU E 4 60  ? 61.288  109.540 -42.856 1.00 49.85  ? 861  GLU C CB    1 
ATOM   7798  C CG    . GLU E 4 60  ? 62.016  109.577 -44.186 1.00 62.37  ? 861  GLU C CG    1 
ATOM   7799  C CD    . GLU E 4 60  ? 61.992  110.958 -44.823 1.00 66.96  ? 861  GLU C CD    1 
ATOM   7800  O OE1   . GLU E 4 60  ? 62.392  111.926 -44.141 1.00 69.75  ? 861  GLU C OE1   1 
ATOM   7801  O OE2   . GLU E 4 60  ? 61.580  111.071 -46.000 1.00 68.94  ? 861  GLU C OE2   1 
ATOM   7802  N N     . VAL E 4 61  ? 58.769  107.724 -43.304 1.00 30.42  ? 862  VAL C N     1 
ATOM   7803  C CA    . VAL E 4 61  ? 58.057  106.720 -44.070 1.00 30.60  ? 862  VAL C CA    1 
ATOM   7804  C C     . VAL E 4 61  ? 56.616  107.155 -44.331 1.00 28.87  ? 862  VAL C C     1 
ATOM   7805  O O     . VAL E 4 61  ? 56.117  107.004 -45.451 1.00 26.34  ? 862  VAL C O     1 
ATOM   7806  C CB    . VAL E 4 61  ? 58.025  105.344 -43.337 1.00 38.00  ? 862  VAL C CB    1 
ATOM   7807  C CG1   . VAL E 4 61  ? 57.088  104.399 -44.053 1.00 34.07  ? 862  VAL C CG1   1 
ATOM   7808  C CG2   . VAL E 4 61  ? 59.426  104.746 -43.279 1.00 39.34  ? 862  VAL C CG2   1 
ATOM   7809  N N     . LEU E 4 62  ? 55.949  107.684 -43.300 1.00 30.64  ? 863  LEU C N     1 
ATOM   7810  C CA    . LEU E 4 62  ? 54.559  108.114 -43.447 1.00 31.55  ? 863  LEU C CA    1 
ATOM   7811  C C     . LEU E 4 62  ? 54.430  109.300 -44.399 1.00 32.78  ? 863  LEU C C     1 
ATOM   7812  O O     . LEU E 4 62  ? 53.429  109.437 -45.111 1.00 33.14  ? 863  LEU C O     1 
ATOM   7813  C CB    . LEU E 4 62  ? 53.960  108.474 -42.090 1.00 33.84  ? 863  LEU C CB    1 
ATOM   7814  C CG    . LEU E 4 62  ? 53.803  107.289 -41.134 1.00 37.41  ? 863  LEU C CG    1 
ATOM   7815  C CD1   . LEU E 4 62  ? 53.448  107.795 -39.734 1.00 35.97  ? 863  LEU C CD1   1 
ATOM   7816  C CD2   . LEU E 4 62  ? 52.722  106.344 -41.675 1.00 36.47  ? 863  LEU C CD2   1 
ATOM   7817  N N     . GLU E 4 63  ? 55.442  110.155 -44.416 1.00 31.62  ? 864  GLU C N     1 
ATOM   7818  C CA    . GLU E 4 63  ? 55.412  111.308 -45.301 1.00 32.98  ? 864  GLU C CA    1 
ATOM   7819  C C     . GLU E 4 63  ? 55.419  110.782 -46.736 1.00 32.71  ? 864  GLU C C     1 
ATOM   7820  O O     . GLU E 4 63  ? 54.589  111.167 -47.555 1.00 31.35  ? 864  GLU C O     1 
ATOM   7821  C CB    . GLU E 4 63  ? 56.637  112.199 -45.064 1.00 38.84  ? 864  GLU C CB    1 
ATOM   7822  C CG    . GLU E 4 63  ? 56.762  113.361 -46.034 1.00 48.62  ? 864  GLU C CG    1 
ATOM   7823  C CD    . GLU E 4 63  ? 55.687  114.432 -45.829 1.00 53.27  ? 864  GLU C CD    1 
ATOM   7824  O OE1   . GLU E 4 63  ? 55.668  115.418 -46.598 1.00 58.46  ? 864  GLU C OE1   1 
ATOM   7825  O OE2   . GLU E 4 63  ? 54.862  114.288 -44.899 1.00 56.75  ? 864  GLU C OE2   1 
ATOM   7826  N N     . LEU E 4 64  ? 56.350  109.875 -47.022 1.00 31.68  ? 865  LEU C N     1 
ATOM   7827  C CA    . LEU E 4 64  ? 56.474  109.301 -48.365 1.00 31.74  ? 865  LEU C CA    1 
ATOM   7828  C C     . LEU E 4 64  ? 55.282  108.440 -48.775 1.00 30.59  ? 865  LEU C C     1 
ATOM   7829  O O     . LEU E 4 64  ? 54.843  108.495 -49.920 1.00 31.61  ? 865  LEU C O     1 
ATOM   7830  C CB    . LEU E 4 64  ? 57.767  108.496 -48.468 1.00 37.74  ? 865  LEU C CB    1 
ATOM   7831  C CG    . LEU E 4 64  ? 59.035  109.349 -48.437 1.00 40.24  ? 865  LEU C CG    1 
ATOM   7832  C CD1   . LEU E 4 64  ? 60.258  108.454 -48.295 1.00 38.91  ? 865  LEU C CD1   1 
ATOM   7833  C CD2   . LEU E 4 64  ? 59.110  110.202 -49.723 1.00 41.18  ? 865  LEU C CD2   1 
ATOM   7834  N N     . ALA E 4 65  ? 54.744  107.662 -47.843 1.00 33.88  ? 866  ALA C N     1 
ATOM   7835  C CA    . ALA E 4 65  ? 53.603  106.807 -48.158 1.00 33.88  ? 866  ALA C CA    1 
ATOM   7836  C C     . ALA E 4 65  ? 52.357  107.647 -48.447 1.00 34.08  ? 866  ALA C C     1 
ATOM   7837  O O     . ALA E 4 65  ? 51.576  107.343 -49.364 1.00 33.81  ? 866  ALA C O     1 
ATOM   7838  C CB    . ALA E 4 65  ? 53.343  105.850 -47.010 1.00 28.24  ? 866  ALA C CB    1 
ATOM   7839  N N     . GLY E 4 66  ? 52.165  108.696 -47.655 1.00 32.42  ? 867  GLY C N     1 
ATOM   7840  C CA    . GLY E 4 66  ? 51.029  109.570 -47.873 1.00 32.41  ? 867  GLY C CA    1 
ATOM   7841  C C     . GLY E 4 66  ? 51.121  110.215 -49.243 1.00 33.76  ? 867  GLY C C     1 
ATOM   7842  O O     . GLY E 4 66  ? 50.108  110.399 -49.912 1.00 35.17  ? 867  GLY C O     1 
ATOM   7843  N N     . ASN E 4 67  ? 52.327  110.575 -49.672 1.00 31.87  ? 868  ASN C N     1 
ATOM   7844  C CA    . ASN E 4 67  ? 52.479  111.166 -50.995 1.00 34.34  ? 868  ASN C CA    1 
ATOM   7845  C C     . ASN E 4 67  ? 52.136  110.115 -52.058 1.00 37.07  ? 868  ASN C C     1 
ATOM   7846  O O     . ASN E 4 67  ? 51.535  110.426 -53.093 1.00 35.32  ? 868  ASN C O     1 
ATOM   7847  C CB    . ASN E 4 67  ? 53.913  111.653 -51.223 1.00 36.16  ? 868  ASN C CB    1 
ATOM   7848  C CG    . ASN E 4 67  ? 54.278  112.850 -50.355 1.00 40.01  ? 868  ASN C CG    1 
ATOM   7849  O OD1   . ASN E 4 67  ? 53.412  113.521 -49.798 1.00 40.10  ? 868  ASN C OD1   1 
ATOM   7850  N ND2   . ASN E 4 67  ? 55.569  113.128 -50.252 1.00 39.56  ? 868  ASN C ND2   1 
ATOM   7851  N N     . ALA E 4 68  ? 52.537  108.869 -51.813 1.00 34.14  ? 869  ALA C N     1 
ATOM   7852  C CA    . ALA E 4 68  ? 52.252  107.805 -52.769 1.00 35.08  ? 869  ALA C CA    1 
ATOM   7853  C C     . ALA E 4 68  ? 50.745  107.598 -52.844 1.00 34.92  ? 869  ALA C C     1 
ATOM   7854  O O     . ALA E 4 68  ? 50.197  107.343 -53.909 1.00 34.91  ? 869  ALA C O     1 
ATOM   7855  C CB    . ALA E 4 68  ? 52.953  106.502 -52.348 1.00 37.43  ? 869  ALA C CB    1 
ATOM   7856  N N     . ALA E 4 69  ? 50.071  107.723 -51.711 1.00 34.60  ? 870  ALA C N     1 
ATOM   7857  C CA    . ALA E 4 69  ? 48.633  107.543 -51.691 1.00 38.40  ? 870  ALA C CA    1 
ATOM   7858  C C     . ALA E 4 69  ? 47.965  108.674 -52.474 1.00 41.51  ? 870  ALA C C     1 
ATOM   7859  O O     . ALA E 4 69  ? 47.037  108.441 -53.255 1.00 41.19  ? 870  ALA C O     1 
ATOM   7860  C CB    . ALA E 4 69  ? 48.125  107.512 -50.251 1.00 29.08  ? 870  ALA C CB    1 
ATOM   7861  N N     . ARG E 4 70  ? 48.437  109.898 -52.273 1.00 45.44  ? 871  ARG C N     1 
ATOM   7862  C CA    . ARG E 4 70  ? 47.869  111.035 -52.992 1.00 49.92  ? 871  ARG C CA    1 
ATOM   7863  C C     . ARG E 4 70  ? 48.051  110.836 -54.488 1.00 49.35  ? 871  ARG C C     1 
ATOM   7864  O O     . ARG E 4 70  ? 47.125  111.063 -55.258 1.00 49.91  ? 871  ARG C O     1 
ATOM   7865  C CB    . ARG E 4 70  ? 48.532  112.345 -52.558 1.00 79.08  ? 871  ARG C CB    1 
ATOM   7866  C CG    . ARG E 4 70  ? 47.906  113.582 -53.183 1.00 86.31  ? 871  ARG C CG    1 
ATOM   7867  C CD    . ARG E 4 70  ? 48.252  114.831 -52.390 1.00 94.10  ? 871  ARG C CD    1 
ATOM   7868  N NE    . ARG E 4 70  ? 47.850  114.698 -50.990 1.00 101.35 ? 871  ARG C NE    1 
ATOM   7869  C CZ    . ARG E 4 70  ? 48.014  115.638 -50.062 1.00 104.99 ? 871  ARG C CZ    1 
ATOM   7870  N NH1   . ARG E 4 70  ? 48.576  116.800 -50.377 1.00 106.43 ? 871  ARG C NH1   1 
ATOM   7871  N NH2   . ARG E 4 70  ? 47.625  115.410 -48.814 1.00 106.30 ? 871  ARG C NH2   1 
ATOM   7872  N N     . ASP E 4 71  ? 49.238  110.401 -54.899 1.00 51.08  ? 872  ASP C N     1 
ATOM   7873  C CA    . ASP E 4 71  ? 49.507  110.170 -56.318 1.00 54.24  ? 872  ASP C CA    1 
ATOM   7874  C C     . ASP E 4 71  ? 48.534  109.145 -56.923 1.00 54.14  ? 872  ASP C C     1 
ATOM   7875  O O     . ASP E 4 71  ? 48.258  109.185 -58.120 1.00 55.29  ? 872  ASP C O     1 
ATOM   7876  C CB    . ASP E 4 71  ? 50.949  109.687 -56.528 1.00 72.75  ? 872  ASP C CB    1 
ATOM   7877  C CG    . ASP E 4 71  ? 51.988  110.709 -56.078 1.00 77.52  ? 872  ASP C CG    1 
ATOM   7878  O OD1   . ASP E 4 71  ? 51.755  111.928 -56.256 1.00 78.12  ? 872  ASP C OD1   1 
ATOM   7879  O OD2   . ASP E 4 71  ? 53.049  110.291 -55.560 1.00 78.52  ? 872  ASP C OD2   1 
ATOM   7880  N N     . ASN E 4 72  ? 48.023  108.229 -56.102 1.00 51.26  ? 873  ASN C N     1 
ATOM   7881  C CA    . ASN E 4 72  ? 47.077  107.216 -56.580 1.00 52.41  ? 873  ASN C CA    1 
ATOM   7882  C C     . ASN E 4 72  ? 45.648  107.667 -56.310 1.00 50.20  ? 873  ASN C C     1 
ATOM   7883  O O     . ASN E 4 72  ? 44.697  106.882 -56.400 1.00 48.18  ? 873  ASN C O     1 
ATOM   7884  C CB    . ASN E 4 72  ? 47.330  105.868 -55.896 1.00 78.00  ? 873  ASN C CB    1 
ATOM   7885  C CG    . ASN E 4 72  ? 48.619  105.221 -56.348 1.00 81.49  ? 873  ASN C CG    1 
ATOM   7886  O OD1   . ASN E 4 72  ? 48.792  104.911 -57.525 1.00 84.86  ? 873  ASN C OD1   1 
ATOM   7887  N ND2   . ASN E 4 72  ? 49.536  105.016 -55.414 1.00 83.68  ? 873  ASN C ND2   1 
ATOM   7888  N N     . LYS E 4 73  ? 45.513  108.942 -55.965 1.00 48.56  ? 874  LYS C N     1 
ATOM   7889  C CA    . LYS E 4 73  ? 44.214  109.535 -55.695 1.00 49.58  ? 874  LYS C CA    1 
ATOM   7890  C C     . LYS E 4 73  ? 43.466  108.820 -54.582 1.00 47.96  ? 874  LYS C C     1 
ATOM   7891  O O     . LYS E 4 73  ? 42.249  108.637 -54.657 1.00 47.59  ? 874  LYS C O     1 
ATOM   7892  C CB    . LYS E 4 73  ? 43.373  109.542 -56.975 1.00 94.79  ? 874  LYS C CB    1 
ATOM   7893  C CG    . LYS E 4 73  ? 44.031  110.291 -58.124 1.00 98.87  ? 874  LYS C CG    1 
ATOM   7894  C CD    . LYS E 4 73  ? 43.137  110.363 -59.348 1.00 103.77 ? 874  LYS C CD    1 
ATOM   7895  C CE    . LYS E 4 73  ? 43.818  111.139 -60.465 1.00 105.67 ? 874  LYS C CE    1 
ATOM   7896  N NZ    . LYS E 4 73  ? 42.940  111.295 -61.656 1.00 108.69 ? 874  LYS C NZ    1 
ATOM   7897  N N     . LYS E 4 74  ? 44.201  108.427 -53.546 1.00 45.65  ? 875  LYS C N     1 
ATOM   7898  C CA    . LYS E 4 74  ? 43.617  107.745 -52.404 1.00 44.26  ? 875  LYS C CA    1 
ATOM   7899  C C     . LYS E 4 74  ? 43.818  108.593 -51.162 1.00 43.15  ? 875  LYS C C     1 
ATOM   7900  O O     . LYS E 4 74  ? 44.773  109.360 -51.069 1.00 42.77  ? 875  LYS C O     1 
ATOM   7901  C CB    . LYS E 4 74  ? 44.282  106.384 -52.188 1.00 53.77  ? 875  LYS C CB    1 
ATOM   7902  C CG    . LYS E 4 74  ? 44.140  105.409 -53.346 1.00 55.27  ? 875  LYS C CG    1 
ATOM   7903  C CD    . LYS E 4 74  ? 42.697  105.021 -53.578 1.00 57.78  ? 875  LYS C CD    1 
ATOM   7904  C CE    . LYS E 4 74  ? 42.607  103.791 -54.477 1.00 60.39  ? 875  LYS C CE    1 
ATOM   7905  N NZ    . LYS E 4 74  ? 43.366  103.958 -55.746 1.00 61.99  ? 875  LYS C NZ    1 
ATOM   7906  N N     . THR E 4 75  ? 42.920  108.439 -50.204 1.00 45.41  ? 876  THR C N     1 
ATOM   7907  C CA    . THR E 4 75  ? 42.990  109.181 -48.962 1.00 46.17  ? 876  THR C CA    1 
ATOM   7908  C C     . THR E 4 75  ? 43.560  108.294 -47.861 1.00 44.90  ? 876  THR C C     1 
ATOM   7909  O O     . THR E 4 75  ? 44.127  108.784 -46.875 1.00 44.19  ? 876  THR C O     1 
ATOM   7910  C CB    . THR E 4 75  ? 41.577  109.662 -48.550 1.00 59.99  ? 876  THR C CB    1 
ATOM   7911  O OG1   . THR E 4 75  ? 41.214  110.791 -49.351 1.00 64.89  ? 876  THR C OG1   1 
ATOM   7912  C CG2   . THR E 4 75  ? 41.528  110.038 -47.082 1.00 61.71  ? 876  THR C CG2   1 
ATOM   7913  N N     . ARG E 4 76  ? 43.404  106.986 -48.034 1.00 38.06  ? 877  ARG C N     1 
ATOM   7914  C CA    . ARG E 4 76  ? 43.885  106.033 -47.045 1.00 37.75  ? 877  ARG C CA    1 
ATOM   7915  C C     . ARG E 4 76  ? 45.153  105.274 -47.461 1.00 34.60  ? 877  ARG C C     1 
ATOM   7916  O O     . ARG E 4 76  ? 45.203  104.621 -48.505 1.00 33.49  ? 877  ARG C O     1 
ATOM   7917  C CB    . ARG E 4 76  ? 42.773  105.033 -46.721 1.00 44.29  ? 877  ARG C CB    1 
ATOM   7918  C CG    . ARG E 4 76  ? 43.166  103.963 -45.710 1.00 48.14  ? 877  ARG C CG    1 
ATOM   7919  C CD    . ARG E 4 76  ? 42.020  102.995 -45.458 1.00 47.54  ? 877  ARG C CD    1 
ATOM   7920  N NE    . ARG E 4 76  ? 40.858  103.685 -44.926 1.00 50.30  ? 877  ARG C NE    1 
ATOM   7921  C CZ    . ARG E 4 76  ? 39.643  103.651 -45.470 1.00 52.93  ? 877  ARG C CZ    1 
ATOM   7922  N NH1   . ARG E 4 76  ? 39.426  102.951 -46.577 1.00 52.15  ? 877  ARG C NH1   1 
ATOM   7923  N NH2   . ARG E 4 76  ? 38.646  104.330 -44.906 1.00 51.19  ? 877  ARG C NH2   1 
ATOM   7924  N N     . ILE E 4 77  ? 46.181  105.360 -46.632 1.00 38.97  ? 878  ILE C N     1 
ATOM   7925  C CA    . ILE E 4 77  ? 47.422  104.654 -46.908 1.00 39.05  ? 878  ILE C CA    1 
ATOM   7926  C C     . ILE E 4 77  ? 47.196  103.141 -46.768 1.00 37.92  ? 878  ILE C C     1 
ATOM   7927  O O     . ILE E 4 77  ? 46.629  102.679 -45.771 1.00 37.26  ? 878  ILE C O     1 
ATOM   7928  C CB    . ILE E 4 77  ? 48.528  105.086 -45.916 1.00 30.18  ? 878  ILE C CB    1 
ATOM   7929  C CG1   . ILE E 4 77  ? 49.039  106.480 -46.285 1.00 27.29  ? 878  ILE C CG1   1 
ATOM   7930  C CG2   . ILE E 4 77  ? 49.667  104.077 -45.928 1.00 26.77  ? 878  ILE C CG2   1 
ATOM   7931  C CD1   . ILE E 4 77  ? 49.955  107.105 -45.214 1.00 23.76  ? 878  ILE C CD1   1 
ATOM   7932  N N     . ILE E 4 78  ? 47.618  102.382 -47.779 1.00 36.04  ? 879  ILE C N     1 
ATOM   7933  C CA    . ILE E 4 78  ? 47.516  100.915 -47.758 1.00 35.48  ? 879  ILE C CA    1 
ATOM   7934  C C     . ILE E 4 78  ? 48.933  100.330 -47.947 1.00 34.87  ? 879  ILE C C     1 
ATOM   7935  O O     . ILE E 4 78  ? 49.872  101.065 -48.283 1.00 32.91  ? 879  ILE C O     1 
ATOM   7936  C CB    . ILE E 4 78  ? 46.564  100.370 -48.877 1.00 33.94  ? 879  ILE C CB    1 
ATOM   7937  C CG1   . ILE E 4 78  ? 47.120  100.703 -50.260 1.00 33.42  ? 879  ILE C CG1   1 
ATOM   7938  C CG2   . ILE E 4 78  ? 45.149  100.924 -48.678 1.00 31.99  ? 879  ILE C CG2   1 
ATOM   7939  C CD1   . ILE E 4 78  ? 46.328  100.063 -51.408 1.00 33.75  ? 879  ILE C CD1   1 
ATOM   7940  N N     . PRO E 4 79  ? 49.110  99.004  -47.734 1.00 34.81  ? 880  PRO C N     1 
ATOM   7941  C CA    . PRO E 4 79  ? 50.441  98.403  -47.893 1.00 31.44  ? 880  PRO C CA    1 
ATOM   7942  C C     . PRO E 4 79  ? 51.157  98.791  -49.171 1.00 31.49  ? 880  PRO C C     1 
ATOM   7943  O O     . PRO E 4 79  ? 52.347  99.071  -49.145 1.00 31.63  ? 880  PRO C O     1 
ATOM   7944  C CB    . PRO E 4 79  ? 50.158  96.901  -47.809 1.00 30.72  ? 880  PRO C CB    1 
ATOM   7945  C CG    . PRO E 4 79  ? 49.031  96.861  -46.805 1.00 31.47  ? 880  PRO C CG    1 
ATOM   7946  C CD    . PRO E 4 79  ? 48.129  97.985  -47.305 1.00 31.31  ? 880  PRO C CD    1 
ATOM   7947  N N     . ARG E 4 80  ? 50.445  98.809  -50.292 1.00 28.32  ? 881  ARG C N     1 
ATOM   7948  C CA    . ARG E 4 80  ? 51.066  99.186  -51.554 1.00 29.53  ? 881  ARG C CA    1 
ATOM   7949  C C     . ARG E 4 80  ? 51.715  100.565 -51.502 1.00 29.62  ? 881  ARG C C     1 
ATOM   7950  O O     . ARG E 4 80  ? 52.776  100.771 -52.104 1.00 30.25  ? 881  ARG C O     1 
ATOM   7951  C CB    . ARG E 4 80  ? 50.045  99.145  -52.698 1.00 34.87  ? 881  ARG C CB    1 
ATOM   7952  C CG    . ARG E 4 80  ? 50.370  100.115 -53.812 1.00 39.84  ? 881  ARG C CG    1 
ATOM   7953  C CD    . ARG E 4 80  ? 50.686  99.475  -55.154 1.00 41.35  ? 881  ARG C CD    1 
ATOM   7954  N NE    . ARG E 4 80  ? 51.911  98.700  -55.160 1.00 45.54  ? 881  ARG C NE    1 
ATOM   7955  C CZ    . ARG E 4 80  ? 52.561  98.354  -56.270 1.00 46.62  ? 881  ARG C CZ    1 
ATOM   7956  N NH1   . ARG E 4 80  ? 52.098  98.726  -57.448 1.00 44.54  ? 881  ARG C NH1   1 
ATOM   7957  N NH2   . ARG E 4 80  ? 53.668  97.628  -56.204 1.00 45.92  ? 881  ARG C NH2   1 
ATOM   7958  N N     . HIS E 4 81  ? 51.078  101.512 -50.803 1.00 30.87  ? 882  HIS C N     1 
ATOM   7959  C CA    . HIS E 4 81  ? 51.621  102.868 -50.688 1.00 31.73  ? 882  HIS C CA    1 
ATOM   7960  C C     . HIS E 4 81  ? 52.909  102.873 -49.884 1.00 30.71  ? 882  HIS C C     1 
ATOM   7961  O O     . HIS E 4 81  ? 53.839  103.602 -50.217 1.00 31.57  ? 882  HIS C O     1 
ATOM   7962  C CB    . HIS E 4 81  ? 50.588  103.822 -50.061 1.00 28.96  ? 882  HIS C CB    1 
ATOM   7963  C CG    . HIS E 4 81  ? 49.327  103.926 -50.857 1.00 30.33  ? 882  HIS C CG    1 
ATOM   7964  N ND1   . HIS E 4 81  ? 48.089  104.095 -50.276 1.00 30.82  ? 882  HIS C ND1   1 
ATOM   7965  C CD2   . HIS E 4 81  ? 49.105  103.810 -52.189 1.00 30.63  ? 882  HIS C CD2   1 
ATOM   7966  C CE1   . HIS E 4 81  ? 47.159  104.070 -51.214 1.00 31.43  ? 882  HIS C CE1   1 
ATOM   7967  N NE2   . HIS E 4 81  ? 47.750  103.895 -52.384 1.00 32.48  ? 882  HIS C NE2   1 
ATOM   7968  N N     . LEU E 4 82  ? 52.966  102.054 -48.834 1.00 27.14  ? 883  LEU C N     1 
ATOM   7969  C CA    . LEU E 4 82  ? 54.166  101.946 -48.015 1.00 26.20  ? 883  LEU C CA    1 
ATOM   7970  C C     . LEU E 4 82  ? 55.275  101.346 -48.869 1.00 28.12  ? 883  LEU C C     1 
ATOM   7971  O O     . LEU E 4 82  ? 56.426  101.777 -48.811 1.00 30.01  ? 883  LEU C O     1 
ATOM   7972  C CB    . LEU E 4 82  ? 53.919  101.048 -46.803 1.00 28.24  ? 883  LEU C CB    1 
ATOM   7973  C CG    . LEU E 4 82  ? 52.941  101.574 -45.750 1.00 31.38  ? 883  LEU C CG    1 
ATOM   7974  C CD1   . LEU E 4 82  ? 52.722  100.524 -44.679 1.00 28.66  ? 883  LEU C CD1   1 
ATOM   7975  C CD2   . LEU E 4 82  ? 53.485  102.861 -45.134 1.00 28.10  ? 883  LEU C CD2   1 
ATOM   7976  N N     . GLN E 4 83  ? 54.922  100.362 -49.685 1.00 30.23  ? 884  GLN C N     1 
ATOM   7977  C CA    . GLN E 4 83  ? 55.900  99.710  -50.548 1.00 32.52  ? 884  GLN C CA    1 
ATOM   7978  C C     . GLN E 4 83  ? 56.477  100.670 -51.590 1.00 32.87  ? 884  GLN C C     1 
ATOM   7979  O O     . GLN E 4 83  ? 57.683  100.683 -51.827 1.00 34.29  ? 884  GLN C O     1 
ATOM   7980  C CB    . GLN E 4 83  ? 55.267  98.494  -51.243 1.00 33.43  ? 884  GLN C CB    1 
ATOM   7981  C CG    . GLN E 4 83  ? 56.138  97.907  -52.342 1.00 35.41  ? 884  GLN C CG    1 
ATOM   7982  C CD    . GLN E 4 83  ? 57.286  97.075  -51.796 1.00 38.58  ? 884  GLN C CD    1 
ATOM   7983  O OE1   . GLN E 4 83  ? 57.818  97.361  -50.721 1.00 36.58  ? 884  GLN C OE1   1 
ATOM   7984  N NE2   . GLN E 4 83  ? 57.691  96.045  -52.554 1.00 36.57  ? 884  GLN C NE2   1 
ATOM   7985  N N     . LEU E 4 84  ? 55.624  101.466 -52.224 1.00 33.24  ? 885  LEU C N     1 
ATOM   7986  C CA    . LEU E 4 84  ? 56.096  102.436 -53.223 1.00 35.32  ? 885  LEU C CA    1 
ATOM   7987  C C     . LEU E 4 84  ? 56.965  103.514 -52.571 1.00 35.00  ? 885  LEU C C     1 
ATOM   7988  O O     . LEU E 4 84  ? 57.976  103.938 -53.128 1.00 36.26  ? 885  LEU C O     1 
ATOM   7989  C CB    . LEU E 4 84  ? 54.909  103.103 -53.923 1.00 43.23  ? 885  LEU C CB    1 
ATOM   7990  C CG    . LEU E 4 84  ? 54.037  102.186 -54.784 1.00 47.06  ? 885  LEU C CG    1 
ATOM   7991  C CD1   . LEU E 4 84  ? 52.704  102.858 -55.096 1.00 45.55  ? 885  LEU C CD1   1 
ATOM   7992  C CD2   . LEU E 4 84  ? 54.795  101.838 -56.057 1.00 47.61  ? 885  LEU C CD2   1 
ATOM   7993  N N     . ALA E 4 85  ? 56.571  103.958 -51.385 1.00 38.29  ? 886  ALA C N     1 
ATOM   7994  C CA    . ALA E 4 85  ? 57.335  104.984 -50.685 1.00 37.04  ? 886  ALA C CA    1 
ATOM   7995  C C     . ALA E 4 85  ? 58.740  104.478 -50.401 1.00 36.03  ? 886  ALA C C     1 
ATOM   7996  O O     . ALA E 4 85  ? 59.725  105.163 -50.651 1.00 36.20  ? 886  ALA C O     1 
ATOM   7997  C CB    . ALA E 4 85  ? 56.636  105.358 -49.371 1.00 34.39  ? 886  ALA C CB    1 
ATOM   7998  N N     . ILE E 4 86  ? 58.822  103.261 -49.881 1.00 33.18  ? 887  ILE C N     1 
ATOM   7999  C CA    . ILE E 4 86  ? 60.104  102.671 -49.546 1.00 33.04  ? 887  ILE C CA    1 
ATOM   8000  C C     . ILE E 4 86  ? 60.986  102.322 -50.751 1.00 32.08  ? 887  ILE C C     1 
ATOM   8001  O O     . ILE E 4 86  ? 62.158  102.671 -50.772 1.00 30.77  ? 887  ILE C O     1 
ATOM   8002  C CB    . ILE E 4 86  ? 59.905  101.417 -48.676 1.00 34.87  ? 887  ILE C CB    1 
ATOM   8003  C CG1   . ILE E 4 86  ? 59.341  101.835 -47.315 1.00 38.43  ? 887  ILE C CG1   1 
ATOM   8004  C CG2   . ILE E 4 86  ? 61.218  100.651 -48.532 1.00 34.07  ? 887  ILE C CG2   1 
ATOM   8005  C CD1   . ILE E 4 86  ? 58.893  100.664 -46.446 1.00 39.30  ? 887  ILE C CD1   1 
ATOM   8006  N N     . ARG E 4 87  ? 60.435  101.661 -51.760 1.00 32.35  ? 888  ARG C N     1 
ATOM   8007  C CA    . ARG E 4 87  ? 61.274  101.295 -52.894 1.00 34.51  ? 888  ARG C CA    1 
ATOM   8008  C C     . ARG E 4 87  ? 61.677  102.465 -53.775 1.00 34.97  ? 888  ARG C C     1 
ATOM   8009  O O     . ARG E 4 87  ? 62.690  102.392 -54.451 1.00 35.64  ? 888  ARG C O     1 
ATOM   8010  C CB    . ARG E 4 87  ? 60.615  100.186 -53.733 1.00 32.54  ? 888  ARG C CB    1 
ATOM   8011  C CG    . ARG E 4 87  ? 60.319  98.932  -52.923 1.00 31.65  ? 888  ARG C CG    1 
ATOM   8012  C CD    . ARG E 4 87  ? 61.553  98.473  -52.133 1.00 33.45  ? 888  ARG C CD    1 
ATOM   8013  N NE    . ARG E 4 87  ? 61.226  97.521  -51.065 1.00 33.00  ? 888  ARG C NE    1 
ATOM   8014  C CZ    . ARG E 4 87  ? 62.057  97.183  -50.078 1.00 34.51  ? 888  ARG C CZ    1 
ATOM   8015  N NH1   . ARG E 4 87  ? 63.284  97.706  -50.008 1.00 31.94  ? 888  ARG C NH1   1 
ATOM   8016  N NH2   . ARG E 4 87  ? 61.653  96.347  -49.134 1.00 33.38  ? 888  ARG C NH2   1 
ATOM   8017  N N     . ASN E 4 88  ? 60.913  103.550 -53.768 1.00 35.91  ? 889  ASN C N     1 
ATOM   8018  C CA    . ASN E 4 88  ? 61.305  104.697 -54.584 1.00 38.24  ? 889  ASN C CA    1 
ATOM   8019  C C     . ASN E 4 88  ? 62.265  105.619 -53.838 1.00 40.81  ? 889  ASN C C     1 
ATOM   8020  O O     . ASN E 4 88  ? 62.728  106.604 -54.407 1.00 40.16  ? 889  ASN C O     1 
ATOM   8021  C CB    . ASN E 4 88  ? 60.091  105.502 -55.054 1.00 33.24  ? 889  ASN C CB    1 
ATOM   8022  C CG    . ASN E 4 88  ? 59.419  104.873 -56.259 1.00 34.58  ? 889  ASN C CG    1 
ATOM   8023  O OD1   . ASN E 4 88  ? 60.074  104.587 -57.265 1.00 34.84  ? 889  ASN C OD1   1 
ATOM   8024  N ND2   . ASN E 4 88  ? 58.116  104.649 -56.167 1.00 31.67  ? 889  ASN C ND2   1 
ATOM   8025  N N     . ASP E 4 89  ? 62.551  105.308 -52.568 1.00 39.35  ? 890  ASP C N     1 
ATOM   8026  C CA    . ASP E 4 89  ? 63.479  106.125 -51.786 1.00 40.43  ? 890  ASP C CA    1 
ATOM   8027  C C     . ASP E 4 89  ? 64.760  105.359 -51.575 1.00 40.43  ? 890  ASP C C     1 
ATOM   8028  O O     . ASP E 4 89  ? 64.785  104.347 -50.872 1.00 40.72  ? 890  ASP C O     1 
ATOM   8029  C CB    . ASP E 4 89  ? 62.930  106.500 -50.409 1.00 53.38  ? 890  ASP C CB    1 
ATOM   8030  C CG    . ASP E 4 89  ? 63.878  107.439 -49.654 1.00 57.52  ? 890  ASP C CG    1 
ATOM   8031  O OD1   . ASP E 4 89  ? 63.873  108.652 -49.958 1.00 62.02  ? 890  ASP C OD1   1 
ATOM   8032  O OD2   . ASP E 4 89  ? 64.648  106.969 -48.784 1.00 57.46  ? 890  ASP C OD2   1 
ATOM   8033  N N     . GLU E 4 90  ? 65.827  105.872 -52.166 1.00 37.89  ? 891  GLU C N     1 
ATOM   8034  C CA    . GLU E 4 90  ? 67.138  105.254 -52.099 1.00 39.18  ? 891  GLU C CA    1 
ATOM   8035  C C     . GLU E 4 90  ? 67.563  104.815 -50.699 1.00 36.62  ? 891  GLU C C     1 
ATOM   8036  O O     . GLU E 4 90  ? 67.930  103.662 -50.498 1.00 36.71  ? 891  GLU C O     1 
ATOM   8037  C CB    . GLU E 4 90  ? 68.183  106.208 -52.685 1.00 64.17  ? 891  GLU C CB    1 
ATOM   8038  C CG    . GLU E 4 90  ? 69.254  105.522 -53.517 1.00 73.88  ? 891  GLU C CG    1 
ATOM   8039  C CD    . GLU E 4 90  ? 70.380  106.463 -53.935 1.00 80.22  ? 891  GLU C CD    1 
ATOM   8040  O OE1   . GLU E 4 90  ? 71.193  106.066 -54.797 1.00 82.66  ? 891  GLU C OE1   1 
ATOM   8041  O OE2   . GLU E 4 90  ? 70.461  107.593 -53.398 1.00 83.30  ? 891  GLU C OE2   1 
ATOM   8042  N N     . GLU E 4 91  ? 67.512  105.714 -49.724 1.00 36.65  ? 892  GLU C N     1 
ATOM   8043  C CA    . GLU E 4 91  ? 67.944  105.344 -48.372 1.00 37.62  ? 892  GLU C CA    1 
ATOM   8044  C C     . GLU E 4 91  ? 67.012  104.366 -47.645 1.00 35.15  ? 892  GLU C C     1 
ATOM   8045  O O     . GLU E 4 91  ? 67.477  103.434 -46.982 1.00 32.04  ? 892  GLU C O     1 
ATOM   8046  C CB    . GLU E 4 91  ? 68.177  106.604 -47.539 1.00 54.03  ? 892  GLU C CB    1 
ATOM   8047  C CG    . GLU E 4 91  ? 69.098  107.577 -48.254 1.00 61.81  ? 892  GLU C CG    1 
ATOM   8048  C CD    . GLU E 4 91  ? 69.965  108.389 -47.318 1.00 66.19  ? 892  GLU C CD    1 
ATOM   8049  O OE1   . GLU E 4 91  ? 69.422  108.928 -46.334 1.00 69.54  ? 892  GLU C OE1   1 
ATOM   8050  O OE2   . GLU E 4 91  ? 71.188  108.496 -47.577 1.00 68.78  ? 892  GLU C OE2   1 
ATOM   8051  N N     . LEU E 4 92  ? 65.705  104.567 -47.764 1.00 33.80  ? 893  LEU C N     1 
ATOM   8052  C CA    . LEU E 4 92  ? 64.775  103.653 -47.122 1.00 34.84  ? 893  LEU C CA    1 
ATOM   8053  C C     . LEU E 4 92  ? 64.891  102.302 -47.816 1.00 33.68  ? 893  LEU C C     1 
ATOM   8054  O O     . LEU E 4 92  ? 64.839  101.266 -47.177 1.00 32.18  ? 893  LEU C O     1 
ATOM   8055  C CB    . LEU E 4 92  ? 63.344  104.185 -47.213 1.00 38.36  ? 893  LEU C CB    1 
ATOM   8056  C CG    . LEU E 4 92  ? 63.044  105.363 -46.279 1.00 39.01  ? 893  LEU C CG    1 
ATOM   8057  C CD1   . LEU E 4 92  ? 61.616  105.839 -46.481 1.00 40.37  ? 893  LEU C CD1   1 
ATOM   8058  C CD2   . LEU E 4 92  ? 63.242  104.914 -44.831 1.00 39.61  ? 893  LEU C CD2   1 
ATOM   8059  N N     . ASN E 4 93  ? 65.086  102.317 -49.128 1.00 36.85  ? 894  ASN C N     1 
ATOM   8060  C CA    . ASN E 4 93  ? 65.214  101.072 -49.854 1.00 36.56  ? 894  ASN C CA    1 
ATOM   8061  C C     . ASN E 4 93  ? 66.418  100.285 -49.347 1.00 37.41  ? 894  ASN C C     1 
ATOM   8062  O O     . ASN E 4 93  ? 66.353  99.062  -49.198 1.00 37.80  ? 894  ASN C O     1 
ATOM   8063  C CB    . ASN E 4 93  ? 65.350  101.323 -51.346 1.00 34.79  ? 894  ASN C CB    1 
ATOM   8064  C CG    . ASN E 4 93  ? 65.345  100.039 -52.134 1.00 36.12  ? 894  ASN C CG    1 
ATOM   8065  O OD1   . ASN E 4 93  ? 64.424  99.228  -52.005 1.00 40.16  ? 894  ASN C OD1   1 
ATOM   8066  N ND2   . ASN E 4 93  ? 66.371  99.835  -52.950 1.00 34.25  ? 894  ASN C ND2   1 
ATOM   8067  N N     . LYS E 4 94  ? 67.516  100.977 -49.068 1.00 36.00  ? 895  LYS C N     1 
ATOM   8068  C CA    . LYS E 4 94  ? 68.678  100.285 -48.553 1.00 39.61  ? 895  LYS C CA    1 
ATOM   8069  C C     . LYS E 4 94  ? 68.454  99.842  -47.107 1.00 38.27  ? 895  LYS C C     1 
ATOM   8070  O O     . LYS E 4 94  ? 68.740  98.700  -46.751 1.00 39.67  ? 895  LYS C O     1 
ATOM   8071  C CB    . LYS E 4 94  ? 69.936  101.156 -48.624 1.00 67.80  ? 895  LYS C CB    1 
ATOM   8072  C CG    . LYS E 4 94  ? 71.164  100.414 -48.107 1.00 72.88  ? 895  LYS C CG    1 
ATOM   8073  C CD    . LYS E 4 94  ? 72.463  101.159 -48.358 1.00 81.08  ? 895  LYS C CD    1 
ATOM   8074  C CE    . LYS E 4 94  ? 73.659  100.326 -47.892 1.00 85.26  ? 895  LYS C CE    1 
ATOM   8075  N NZ    . LYS E 4 94  ? 74.973  100.964 -48.199 1.00 86.98  ? 895  LYS C NZ    1 
ATOM   8076  N N     . LEU E 4 95  ? 67.951  100.740 -46.268 1.00 33.18  ? 896  LEU C N     1 
ATOM   8077  C CA    . LEU E 4 95  ? 67.713  100.378 -44.872 1.00 31.49  ? 896  LEU C CA    1 
ATOM   8078  C C     . LEU E 4 95  ? 66.814  99.148  -44.779 1.00 31.56  ? 896  LEU C C     1 
ATOM   8079  O O     . LEU E 4 95  ? 67.031  98.269  -43.947 1.00 31.03  ? 896  LEU C O     1 
ATOM   8080  C CB    . LEU E 4 95  ? 67.056  101.533 -44.122 1.00 29.78  ? 896  LEU C CB    1 
ATOM   8081  C CG    . LEU E 4 95  ? 66.596  101.229 -42.689 1.00 33.30  ? 896  LEU C CG    1 
ATOM   8082  C CD1   . LEU E 4 95  ? 67.816  100.937 -41.786 1.00 31.93  ? 896  LEU C CD1   1 
ATOM   8083  C CD2   . LEU E 4 95  ? 65.788  102.417 -42.151 1.00 30.61  ? 896  LEU C CD2   1 
ATOM   8084  N N     . LEU E 4 96  ? 65.814  99.082  -45.651 1.00 36.37  ? 897  LEU C N     1 
ATOM   8085  C CA    . LEU E 4 96  ? 64.870  97.979  -45.634 1.00 37.49  ? 897  LEU C CA    1 
ATOM   8086  C C     . LEU E 4 96  ? 65.056  96.966  -46.768 1.00 37.82  ? 897  LEU C C     1 
ATOM   8087  O O     . LEU E 4 96  ? 64.084  96.353  -47.225 1.00 37.08  ? 897  LEU C O     1 
ATOM   8088  C CB    . LEU E 4 96  ? 63.446  98.544  -45.654 1.00 36.72  ? 897  LEU C CB    1 
ATOM   8089  C CG    . LEU E 4 96  ? 63.093  99.505  -44.500 1.00 39.34  ? 897  LEU C CG    1 
ATOM   8090  C CD1   . LEU E 4 96  ? 61.648  99.955  -44.644 1.00 39.93  ? 897  LEU C CD1   1 
ATOM   8091  C CD2   . LEU E 4 96  ? 63.291  98.811  -43.144 1.00 38.33  ? 897  LEU C CD2   1 
ATOM   8092  N N     . SER E 4 97  ? 66.299  96.769  -47.202 1.00 34.68  ? 898  SER C N     1 
ATOM   8093  C CA    . SER E 4 97  ? 66.570  95.842  -48.305 1.00 37.35  ? 898  SER C CA    1 
ATOM   8094  C C     . SER E 4 97  ? 66.223  94.377  -48.020 1.00 37.00  ? 898  SER C C     1 
ATOM   8095  O O     . SER E 4 97  ? 65.897  93.630  -48.938 1.00 39.49  ? 898  SER C O     1 
ATOM   8096  C CB    . SER E 4 97  ? 68.036  95.941  -48.745 1.00 40.21  ? 898  SER C CB    1 
ATOM   8097  O OG    . SER E 4 97  ? 68.898  95.601  -47.679 1.00 43.69  ? 898  SER C OG    1 
ATOM   8098  N N     . GLY E 4 98  ? 66.298  93.959  -46.763 1.00 37.82  ? 899  GLY C N     1 
ATOM   8099  C CA    . GLY E 4 98  ? 65.954  92.587  -46.436 1.00 36.11  ? 899  GLY C CA    1 
ATOM   8100  C C     . GLY E 4 98  ? 64.492  92.441  -46.034 1.00 37.61  ? 899  GLY C C     1 
ATOM   8101  O O     . GLY E 4 98  ? 64.072  91.392  -45.547 1.00 38.38  ? 899  GLY C O     1 
ATOM   8102  N N     . VAL E 4 99  ? 63.692  93.477  -46.264 1.00 34.22  ? 900  VAL C N     1 
ATOM   8103  C CA    . VAL E 4 99  ? 62.298  93.427  -45.847 1.00 31.98  ? 900  VAL C CA    1 
ATOM   8104  C C     . VAL E 4 99  ? 61.297  93.153  -46.947 1.00 32.59  ? 900  VAL C C     1 
ATOM   8105  O O     . VAL E 4 99  ? 61.452  93.603  -48.074 1.00 33.87  ? 900  VAL C O     1 
ATOM   8106  C CB    . VAL E 4 99  ? 61.895  94.754  -45.126 1.00 35.19  ? 900  VAL C CB    1 
ATOM   8107  C CG1   . VAL E 4 99  ? 60.384  94.806  -44.862 1.00 33.54  ? 900  VAL C CG1   1 
ATOM   8108  C CG2   . VAL E 4 99  ? 62.632  94.856  -43.810 1.00 32.89  ? 900  VAL C CG2   1 
ATOM   8109  N N     . THR E 4 100 ? 60.261  92.399  -46.599 1.00 30.56  ? 901  THR C N     1 
ATOM   8110  C CA    . THR E 4 100 ? 59.190  92.087  -47.522 1.00 29.02  ? 901  THR C CA    1 
ATOM   8111  C C     . THR E 4 100 ? 57.933  92.674  -46.895 1.00 29.76  ? 901  THR C C     1 
ATOM   8112  O O     . THR E 4 100 ? 57.622  92.406  -45.733 1.00 28.70  ? 901  THR C O     1 
ATOM   8113  C CB    . THR E 4 100 ? 58.984  90.553  -47.686 1.00 41.49  ? 901  THR C CB    1 
ATOM   8114  O OG1   . THR E 4 100 ? 60.136  89.971  -48.304 1.00 43.59  ? 901  THR C OG1   1 
ATOM   8115  C CG2   . THR E 4 100 ? 57.766  90.272  -48.544 1.00 37.81  ? 901  THR C CG2   1 
ATOM   8116  N N     . ILE E 4 101 ? 57.216  93.480  -47.663 1.00 32.02  ? 902  ILE C N     1 
ATOM   8117  C CA    . ILE E 4 101 ? 55.988  94.089  -47.187 1.00 31.21  ? 902  ILE C CA    1 
ATOM   8118  C C     . ILE E 4 101 ? 54.804  93.335  -47.781 1.00 32.55  ? 902  ILE C C     1 
ATOM   8119  O O     . ILE E 4 101 ? 54.609  93.335  -48.998 1.00 34.97  ? 902  ILE C O     1 
ATOM   8120  C CB    . ILE E 4 101 ? 55.924  95.578  -47.598 1.00 35.66  ? 902  ILE C CB    1 
ATOM   8121  C CG1   . ILE E 4 101 ? 57.018  96.350  -46.853 1.00 36.76  ? 902  ILE C CG1   1 
ATOM   8122  C CG2   . ILE E 4 101 ? 54.540  96.150  -47.311 1.00 30.90  ? 902  ILE C CG2   1 
ATOM   8123  C CD1   . ILE E 4 101 ? 57.128  97.771  -47.248 1.00 42.45  ? 902  ILE C CD1   1 
ATOM   8124  N N     . ALA E 4 102 ? 54.016  92.693  -46.927 1.00 30.34  ? 903  ALA C N     1 
ATOM   8125  C CA    . ALA E 4 102 ? 52.861  91.937  -47.402 1.00 34.16  ? 903  ALA C CA    1 
ATOM   8126  C C     . ALA E 4 102 ? 51.896  92.839  -48.168 1.00 35.53  ? 903  ALA C C     1 
ATOM   8127  O O     . ALA E 4 102 ? 51.614  93.947  -47.732 1.00 35.89  ? 903  ALA C O     1 
ATOM   8128  C CB    . ALA E 4 102 ? 52.132  91.290  -46.222 1.00 30.10  ? 903  ALA C CB    1 
ATOM   8129  N N     . GLN E 4 103 ? 51.391  92.345  -49.295 1.00 37.60  ? 904  GLN C N     1 
ATOM   8130  C CA    . GLN E 4 103 ? 50.451  93.074  -50.135 1.00 37.92  ? 904  GLN C CA    1 
ATOM   8131  C C     . GLN E 4 103 ? 51.016  94.387  -50.661 1.00 36.58  ? 904  GLN C C     1 
ATOM   8132  O O     . GLN E 4 103 ? 50.285  95.344  -50.956 1.00 34.72  ? 904  GLN C O     1 
ATOM   8133  C CB    . GLN E 4 103 ? 49.134  93.299  -49.384 1.00 44.42  ? 904  GLN C CB    1 
ATOM   8134  C CG    . GLN E 4 103 ? 48.243  92.039  -49.342 1.00 52.61  ? 904  GLN C CG    1 
ATOM   8135  C CD    . GLN E 4 103 ? 47.837  91.556  -50.747 1.00 58.15  ? 904  GLN C CD    1 
ATOM   8136  O OE1   . GLN E 4 103 ? 47.067  92.223  -51.453 1.00 59.70  ? 904  GLN C OE1   1 
ATOM   8137  N NE2   . GLN E 4 103 ? 48.365  90.403  -51.157 1.00 57.32  ? 904  GLN C NE2   1 
ATOM   8138  N N     . GLY E 4 104 ? 52.331  94.409  -50.809 1.00 36.67  ? 905  GLY C N     1 
ATOM   8139  C CA    . GLY E 4 104 ? 52.986  95.595  -51.305 1.00 37.44  ? 905  GLY C CA    1 
ATOM   8140  C C     . GLY E 4 104 ? 53.279  95.565  -52.790 1.00 34.78  ? 905  GLY C C     1 
ATOM   8141  O O     . GLY E 4 104 ? 53.397  96.624  -53.402 1.00 35.20  ? 905  GLY C O     1 
ATOM   8142  N N     . GLY E 4 105 ? 53.388  94.365  -53.368 1.00 29.09  ? 906  GLY C N     1 
ATOM   8143  C CA    . GLY E 4 105 ? 53.688  94.236  -54.790 1.00 26.90  ? 906  GLY C CA    1 
ATOM   8144  C C     . GLY E 4 105 ? 55.088  94.729  -55.106 1.00 28.48  ? 906  GLY C C     1 
ATOM   8145  O O     . GLY E 4 105 ? 55.945  94.767  -54.228 1.00 29.02  ? 906  GLY C O     1 
ATOM   8146  N N     . VAL E 4 106 ? 55.329  95.128  -56.351 1.00 28.58  ? 907  VAL C N     1 
ATOM   8147  C CA    . VAL E 4 106 ? 56.649  95.606  -56.754 1.00 30.09  ? 907  VAL C CA    1 
ATOM   8148  C C     . VAL E 4 106 ? 56.529  96.896  -57.563 1.00 31.74  ? 907  VAL C C     1 
ATOM   8149  O O     . VAL E 4 106 ? 55.432  97.305  -57.931 1.00 30.35  ? 907  VAL C O     1 
ATOM   8150  C CB    . VAL E 4 106 ? 57.366  94.550  -57.636 1.00 34.16  ? 907  VAL C CB    1 
ATOM   8151  C CG1   . VAL E 4 106 ? 57.550  93.246  -56.849 1.00 33.74  ? 907  VAL C CG1   1 
ATOM   8152  C CG2   . VAL E 4 106 ? 56.557  94.301  -58.926 1.00 30.39  ? 907  VAL C CG2   1 
ATOM   8153  N N     . LEU E 4 107 ? 57.658  97.526  -57.853 1.00 29.98  ? 908  LEU C N     1 
ATOM   8154  C CA    . LEU E 4 107 ? 57.653  98.749  -58.651 1.00 34.50  ? 908  LEU C CA    1 
ATOM   8155  C C     . LEU E 4 107 ? 57.506  98.419  -60.132 1.00 36.14  ? 908  LEU C C     1 
ATOM   8156  O O     . LEU E 4 107 ? 58.082  97.448  -60.614 1.00 36.52  ? 908  LEU C O     1 
ATOM   8157  C CB    . LEU E 4 107 ? 58.969  99.510  -58.479 1.00 40.84  ? 908  LEU C CB    1 
ATOM   8158  C CG    . LEU E 4 107 ? 59.368  100.057 -57.113 1.00 43.58  ? 908  LEU C CG    1 
ATOM   8159  C CD1   . LEU E 4 107 ? 60.671  100.854 -57.245 1.00 42.11  ? 908  LEU C CD1   1 
ATOM   8160  C CD2   . LEU E 4 107 ? 58.248  100.938 -56.583 1.00 41.89  ? 908  LEU C CD2   1 
ATOM   8161  N N     . PRO E 4 108 ? 56.707  99.196  -60.872 1.00 40.56  ? 909  PRO C N     1 
ATOM   8162  C CA    . PRO E 4 108 ? 56.592  98.880  -62.301 1.00 41.74  ? 909  PRO C CA    1 
ATOM   8163  C C     . PRO E 4 108 ? 57.985  99.052  -62.896 1.00 43.43  ? 909  PRO C C     1 
ATOM   8164  O O     . PRO E 4 108 ? 58.636  100.075 -62.693 1.00 43.59  ? 909  PRO C O     1 
ATOM   8165  C CB    . PRO E 4 108 ? 55.608  99.930  -62.804 1.00 45.66  ? 909  PRO C CB    1 
ATOM   8166  C CG    . PRO E 4 108 ? 54.674  100.061 -61.626 1.00 45.55  ? 909  PRO C CG    1 
ATOM   8167  C CD    . PRO E 4 108 ? 55.659  100.145 -60.460 1.00 44.37  ? 909  PRO C CD    1 
ATOM   8168  N N     . ASN E 4 109 ? 58.463  98.049  -63.610 1.00 46.46  ? 910  ASN C N     1 
ATOM   8169  C CA    . ASN E 4 109 ? 59.795  98.142  -64.169 1.00 48.65  ? 910  ASN C CA    1 
ATOM   8170  C C     . ASN E 4 109 ? 59.959  97.077  -65.234 1.00 48.40  ? 910  ASN C C     1 
ATOM   8171  O O     . ASN E 4 109 ? 59.928  95.880  -64.943 1.00 48.10  ? 910  ASN C O     1 
ATOM   8172  C CB    . ASN E 4 109 ? 60.826  97.955  -63.050 1.00 61.42  ? 910  ASN C CB    1 
ATOM   8173  C CG    . ASN E 4 109 ? 62.243  98.273  -63.493 1.00 65.66  ? 910  ASN C CG    1 
ATOM   8174  O OD1   . ASN E 4 109 ? 62.490  99.288  -64.145 1.00 71.02  ? 910  ASN C OD1   1 
ATOM   8175  N ND2   . ASN E 4 109 ? 63.185  97.414  -63.127 1.00 67.06  ? 910  ASN C ND2   1 
ATOM   8176  N N     . ILE E 4 110 ? 60.111  97.525  -66.475 1.00 45.77  ? 911  ILE C N     1 
ATOM   8177  C CA    . ILE E 4 110 ? 60.274  96.621  -67.599 1.00 42.98  ? 911  ILE C CA    1 
ATOM   8178  C C     . ILE E 4 110 ? 61.610  96.887  -68.282 1.00 43.63  ? 911  ILE C C     1 
ATOM   8179  O O     . ILE E 4 110 ? 61.869  97.997  -68.749 1.00 45.33  ? 911  ILE C O     1 
ATOM   8180  C CB    . ILE E 4 110 ? 59.144  96.810  -68.618 1.00 41.88  ? 911  ILE C CB    1 
ATOM   8181  C CG1   . ILE E 4 110 ? 57.793  96.762  -67.915 1.00 41.15  ? 911  ILE C CG1   1 
ATOM   8182  C CG2   . ILE E 4 110 ? 59.195  95.703  -69.658 1.00 44.01  ? 911  ILE C CG2   1 
ATOM   8183  C CD1   . ILE E 4 110 ? 56.611  96.932  -68.863 1.00 43.36  ? 911  ILE C CD1   1 
ATOM   8184  N N     . GLN E 4 111 ? 62.469  95.876  -68.324 1.00 39.40  ? 912  GLN C N     1 
ATOM   8185  C CA    . GLN E 4 111 ? 63.768  96.012  -68.970 1.00 38.71  ? 912  GLN C CA    1 
ATOM   8186  C C     . GLN E 4 111 ? 63.560  96.564  -70.376 1.00 38.63  ? 912  GLN C C     1 
ATOM   8187  O O     . GLN E 4 111 ? 62.695  96.082  -71.120 1.00 36.23  ? 912  GLN C O     1 
ATOM   8188  C CB    . GLN E 4 111 ? 64.458  94.654  -69.020 1.00 47.20  ? 912  GLN C CB    1 
ATOM   8189  C CG    . GLN E 4 111 ? 64.773  94.106  -67.636 1.00 50.38  ? 912  GLN C CG    1 
ATOM   8190  C CD    . GLN E 4 111 ? 65.645  95.055  -66.830 1.00 52.48  ? 912  GLN C CD    1 
ATOM   8191  O OE1   . GLN E 4 111 ? 66.776  95.352  -67.214 1.00 54.58  ? 912  GLN C OE1   1 
ATOM   8192  N NE2   . GLN E 4 111 ? 65.118  95.541  -65.714 1.00 53.14  ? 912  GLN C NE2   1 
ATOM   8193  N N     . ALA E 4 112 ? 64.350  97.575  -70.729 1.00 43.74  ? 913  ALA C N     1 
ATOM   8194  C CA    . ALA E 4 112 ? 64.248  98.235  -72.033 1.00 45.88  ? 913  ALA C CA    1 
ATOM   8195  C C     . ALA E 4 112 ? 64.261  97.300  -73.242 1.00 46.44  ? 913  ALA C C     1 
ATOM   8196  O O     . ALA E 4 112 ? 63.448  97.459  -74.150 1.00 45.98  ? 913  ALA C O     1 
ATOM   8197  C CB    . ALA E 4 112 ? 65.358  99.299  -72.179 1.00 36.43  ? 913  ALA C CB    1 
ATOM   8198  N N     . VAL E 4 113 ? 65.171  96.327  -73.256 1.00 44.09  ? 914  VAL C N     1 
ATOM   8199  C CA    . VAL E 4 113 ? 65.267  95.395  -74.378 1.00 46.00  ? 914  VAL C CA    1 
ATOM   8200  C C     . VAL E 4 113 ? 63.975  94.627  -74.651 1.00 46.84  ? 914  VAL C C     1 
ATOM   8201  O O     . VAL E 4 113 ? 63.783  94.118  -75.755 1.00 46.37  ? 914  VAL C O     1 
ATOM   8202  C CB    . VAL E 4 113 ? 66.388  94.354  -74.167 1.00 57.29  ? 914  VAL C CB    1 
ATOM   8203  C CG1   . VAL E 4 113 ? 67.712  95.061  -73.910 1.00 59.95  ? 914  VAL C CG1   1 
ATOM   8204  C CG2   . VAL E 4 113 ? 66.027  93.424  -73.014 1.00 56.63  ? 914  VAL C CG2   1 
ATOM   8205  N N     . LEU E 4 114 ? 63.097  94.547  -73.651 1.00 42.81  ? 915  LEU C N     1 
ATOM   8206  C CA    . LEU E 4 114 ? 61.832  93.818  -73.786 1.00 43.37  ? 915  LEU C CA    1 
ATOM   8207  C C     . LEU E 4 114 ? 60.747  94.547  -74.585 1.00 45.13  ? 915  LEU C C     1 
ATOM   8208  O O     . LEU E 4 114 ? 59.827  93.914  -75.111 1.00 41.63  ? 915  LEU C O     1 
ATOM   8209  C CB    . LEU E 4 114 ? 61.288  93.444  -72.397 1.00 39.40  ? 915  LEU C CB    1 
ATOM   8210  C CG    . LEU E 4 114 ? 62.252  92.611  -71.545 1.00 40.03  ? 915  LEU C CG    1 
ATOM   8211  C CD1   . LEU E 4 114 ? 61.528  92.097  -70.300 1.00 38.02  ? 915  LEU C CD1   1 
ATOM   8212  C CD2   . LEU E 4 114 ? 62.790  91.440  -72.369 1.00 37.08  ? 915  LEU C CD2   1 
ATOM   8213  N N     . LEU E 4 115 ? 60.854  95.871  -74.671 1.00 40.30  ? 916  LEU C N     1 
ATOM   8214  C CA    . LEU E 4 115 ? 59.879  96.672  -75.417 1.00 47.16  ? 916  LEU C CA    1 
ATOM   8215  C C     . LEU E 4 115 ? 59.955  96.395  -76.917 1.00 53.11  ? 916  LEU C C     1 
ATOM   8216  O O     . LEU E 4 115 ? 61.015  96.083  -77.453 1.00 51.16  ? 916  LEU C O     1 
ATOM   8217  C CB    . LEU E 4 115 ? 60.103  98.162  -75.157 1.00 51.23  ? 916  LEU C CB    1 
ATOM   8218  C CG    . LEU E 4 115 ? 60.014  98.559  -73.682 1.00 51.97  ? 916  LEU C CG    1 
ATOM   8219  C CD1   . LEU E 4 115 ? 60.436  100.020 -73.524 1.00 51.82  ? 916  LEU C CD1   1 
ATOM   8220  C CD2   . LEU E 4 115 ? 58.602  98.333  -73.160 1.00 49.68  ? 916  LEU C CD2   1 
ATOM   8221  N N     . PRO E 4 116 ? 58.818  96.514  -77.614 1.00 58.51  ? 917  PRO C N     1 
ATOM   8222  C CA    . PRO E 4 116 ? 58.713  96.280  -79.061 1.00 66.74  ? 917  PRO C CA    1 
ATOM   8223  C C     . PRO E 4 116 ? 59.382  97.338  -79.946 1.00 75.37  ? 917  PRO C C     1 
ATOM   8224  O O     . PRO E 4 116 ? 60.043  98.250  -79.451 1.00 75.12  ? 917  PRO C O     1 
ATOM   8225  C CB    . PRO E 4 116 ? 57.209  96.218  -79.280 1.00 52.93  ? 917  PRO C CB    1 
ATOM   8226  C CG    . PRO E 4 116 ? 56.706  97.240  -78.273 1.00 50.63  ? 917  PRO C CG    1 
ATOM   8227  C CD    . PRO E 4 116 ? 57.514  96.908  -77.043 1.00 48.46  ? 917  PRO C CD    1 
ATOM   8228  N N     . LYS E 4 117 ? 59.183  97.200  -81.257 1.00 127.11 ? 918  LYS C N     1 
ATOM   8229  C CA    . LYS E 4 117 ? 59.734  98.101  -82.275 1.00 136.76 ? 918  LYS C CA    1 
ATOM   8230  C C     . LYS E 4 117 ? 61.185  98.509  -82.034 1.00 142.91 ? 918  LYS C C     1 
ATOM   8231  O O     . LYS E 4 117 ? 61.952  97.782  -81.402 1.00 143.15 ? 918  LYS C O     1 
ATOM   8232  C CB    . LYS E 4 117 ? 58.865  99.361  -82.415 1.00 127.84 ? 918  LYS C CB    1 
ATOM   8233  C CG    . LYS E 4 117 ? 58.849  100.277 -81.194 1.00 132.03 ? 918  LYS C CG    1 
ATOM   8234  C CD    . LYS E 4 117 ? 58.054  101.559 -81.443 1.00 133.57 ? 918  LYS C CD    1 
ATOM   8235  C CE    . LYS E 4 117 ? 58.786  102.526 -82.370 1.00 134.26 ? 918  LYS C CE    1 
ATOM   8236  N NZ    . LYS E 4 117 ? 59.019  101.973 -83.734 1.00 134.13 ? 918  LYS C NZ    1 
ATOM   8237  N N     . LYS E 4 118 ? 61.551  99.677  -82.555 1.00 148.72 ? 919  LYS C N     1 
ATOM   8238  C CA    . LYS E 4 118 ? 62.904  100.200 -82.417 1.00 153.92 ? 919  LYS C CA    1 
ATOM   8239  C C     . LYS E 4 118 ? 62.895  101.726 -82.398 1.00 155.26 ? 919  LYS C C     1 
ATOM   8240  O O     . LYS E 4 118 ? 61.796  102.307 -82.525 1.00 156.93 ? 919  LYS C O     1 
ATOM   8241  C CB    . LYS E 4 118 ? 63.788  99.705  -83.571 1.00 138.42 ? 919  LYS C CB    1 
ATOM   8242  C CG    . LYS E 4 118 ? 63.272  100.047 -84.967 1.00 143.70 ? 919  LYS C CG    1 
ATOM   8243  C CD    . LYS E 4 118 ? 62.007  99.272  -85.298 1.00 147.54 ? 919  LYS C CD    1 
ATOM   8244  C CE    . LYS E 4 118 ? 61.475  99.629  -86.672 1.00 150.38 ? 919  LYS C CE    1 
ATOM   8245  N NZ    . LYS E 4 118 ? 60.211  98.899  -86.961 1.00 152.83 ? 919  LYS C NZ    1 
ATOM   8246  N N     . ARG F 5 29  ? 40.159  90.167  -19.155 1.00 132.35 ? 1228 ARG D N     1 
ATOM   8247  C CA    . ARG F 5 29  ? 40.904  91.179  -19.957 1.00 132.27 ? 1228 ARG D CA    1 
ATOM   8248  C C     . ARG F 5 29  ? 41.970  90.558  -20.848 1.00 131.85 ? 1228 ARG D C     1 
ATOM   8249  O O     . ARG F 5 29  ? 42.487  89.479  -20.563 1.00 132.17 ? 1228 ARG D O     1 
ATOM   8250  C CB    . ARG F 5 29  ? 41.571  92.206  -19.040 1.00 100.51 ? 1228 ARG D CB    1 
ATOM   8251  C CG    . ARG F 5 29  ? 40.729  93.430  -18.746 1.00 101.70 ? 1228 ARG D CG    1 
ATOM   8252  C CD    . ARG F 5 29  ? 41.572  94.505  -18.083 1.00 103.08 ? 1228 ARG D CD    1 
ATOM   8253  N NE    . ARG F 5 29  ? 40.950  95.819  -18.192 1.00 104.27 ? 1228 ARG D NE    1 
ATOM   8254  C CZ    . ARG F 5 29  ? 41.515  96.950  -17.785 1.00 105.02 ? 1228 ARG D CZ    1 
ATOM   8255  N NH1   . ARG F 5 29  ? 42.721  96.934  -17.235 1.00 105.69 ? 1228 ARG D NH1   1 
ATOM   8256  N NH2   . ARG F 5 29  ? 40.876  98.099  -17.936 1.00 105.36 ? 1228 ARG D NH2   1 
ATOM   8257  N N     . LYS F 5 30  ? 42.287  91.259  -21.932 1.00 131.82 ? 1229 LYS D N     1 
ATOM   8258  C CA    . LYS F 5 30  ? 43.302  90.835  -22.889 1.00 129.65 ? 1229 LYS D CA    1 
ATOM   8259  C C     . LYS F 5 30  ? 43.928  92.086  -23.486 1.00 127.43 ? 1229 LYS D C     1 
ATOM   8260  O O     . LYS F 5 30  ? 43.301  92.780  -24.284 1.00 128.02 ? 1229 LYS D O     1 
ATOM   8261  C CB    . LYS F 5 30  ? 42.684  89.971  -23.989 1.00 107.01 ? 1229 LYS D CB    1 
ATOM   8262  C CG    . LYS F 5 30  ? 42.276  88.589  -23.518 1.00 109.64 ? 1229 LYS D CG    1 
ATOM   8263  C CD    . LYS F 5 30  ? 42.269  87.599  -24.667 1.00 111.13 ? 1229 LYS D CD    1 
ATOM   8264  C CE    . LYS F 5 30  ? 42.101  86.174  -24.167 1.00 112.11 ? 1229 LYS D CE    1 
ATOM   8265  N NZ    . LYS F 5 30  ? 42.335  85.178  -25.249 1.00 111.46 ? 1229 LYS D NZ    1 
ATOM   8266  N N     . ARG F 5 31  ? 45.172  92.361  -23.099 1.00 120.68 ? 1230 ARG D N     1 
ATOM   8267  C CA    . ARG F 5 31  ? 45.878  93.554  -23.553 1.00 115.74 ? 1230 ARG D CA    1 
ATOM   8268  C C     . ARG F 5 31  ? 47.228  93.337  -24.247 1.00 110.80 ? 1230 ARG D C     1 
ATOM   8269  O O     . ARG F 5 31  ? 48.126  92.704  -23.694 1.00 111.68 ? 1230 ARG D O     1 
ATOM   8270  C CB    . ARG F 5 31  ? 46.077  94.485  -22.357 1.00 88.90  ? 1230 ARG D CB    1 
ATOM   8271  C CG    . ARG F 5 31  ? 47.228  95.447  -22.509 1.00 91.53  ? 1230 ARG D CG    1 
ATOM   8272  C CD    . ARG F 5 31  ? 47.422  96.288  -21.270 1.00 93.35  ? 1230 ARG D CD    1 
ATOM   8273  N NE    . ARG F 5 31  ? 48.605  97.131  -21.397 1.00 96.12  ? 1230 ARG D NE    1 
ATOM   8274  C CZ    . ARG F 5 31  ? 48.902  98.130  -20.575 1.00 98.38  ? 1230 ARG D CZ    1 
ATOM   8275  N NH1   . ARG F 5 31  ? 48.097  98.417  -19.560 1.00 100.23 ? 1230 ARG D NH1   1 
ATOM   8276  N NH2   . ARG F 5 31  ? 50.004  98.843  -20.768 1.00 99.21  ? 1230 ARG D NH2   1 
ATOM   8277  N N     . LYS F 5 32  ? 47.363  93.882  -25.455 1.00 70.61  ? 1231 LYS D N     1 
ATOM   8278  C CA    . LYS F 5 32  ? 48.605  93.795  -26.227 1.00 63.86  ? 1231 LYS D CA    1 
ATOM   8279  C C     . LYS F 5 32  ? 48.994  95.202  -26.690 1.00 57.72  ? 1231 LYS D C     1 
ATOM   8280  O O     . LYS F 5 32  ? 48.223  95.880  -27.373 1.00 56.53  ? 1231 LYS D O     1 
ATOM   8281  C CB    . LYS F 5 32  ? 48.436  92.865  -27.435 1.00 94.11  ? 1231 LYS D CB    1 
ATOM   8282  C CG    . LYS F 5 32  ? 47.435  93.338  -28.473 1.00 96.62  ? 1231 LYS D CG    1 
ATOM   8283  C CD    . LYS F 5 32  ? 47.417  92.404  -29.678 1.00 99.61  ? 1231 LYS D CD    1 
ATOM   8284  C CE    . LYS F 5 32  ? 46.435  92.881  -30.743 1.00 101.58 ? 1231 LYS D CE    1 
ATOM   8285  N NZ    . LYS F 5 32  ? 46.442  92.003  -31.950 1.00 102.71 ? 1231 LYS D NZ    1 
ATOM   8286  N N     . GLU F 5 33  ? 50.186  95.642  -26.308 1.00 62.14  ? 1232 GLU D N     1 
ATOM   8287  C CA    . GLU F 5 33  ? 50.652  96.975  -26.666 1.00 57.39  ? 1232 GLU D CA    1 
ATOM   8288  C C     . GLU F 5 33  ? 51.104  97.106  -28.120 1.00 52.32  ? 1232 GLU D C     1 
ATOM   8289  O O     . GLU F 5 33  ? 51.405  96.117  -28.785 1.00 50.57  ? 1232 GLU D O     1 
ATOM   8290  C CB    . GLU F 5 33  ? 51.817  97.384  -25.766 1.00 68.39  ? 1232 GLU D CB    1 
ATOM   8291  C CG    . GLU F 5 33  ? 51.550  97.263  -24.286 1.00 72.08  ? 1232 GLU D CG    1 
ATOM   8292  C CD    . GLU F 5 33  ? 52.759  97.651  -23.458 1.00 75.17  ? 1232 GLU D CD    1 
ATOM   8293  O OE1   . GLU F 5 33  ? 53.865  97.162  -23.768 1.00 76.05  ? 1232 GLU D OE1   1 
ATOM   8294  O OE2   . GLU F 5 33  ? 52.605  98.439  -22.498 1.00 77.59  ? 1232 GLU D OE2   1 
ATOM   8295  N N     . SER F 5 34  ? 51.143  98.342  -28.606 1.00 50.57  ? 1233 SER D N     1 
ATOM   8296  C CA    . SER F 5 34  ? 51.608  98.610  -29.957 1.00 45.91  ? 1233 SER D CA    1 
ATOM   8297  C C     . SER F 5 34  ? 51.845  100.101 -30.114 1.00 42.15  ? 1233 SER D C     1 
ATOM   8298  O O     . SER F 5 34  ? 51.404  100.903 -29.299 1.00 40.10  ? 1233 SER D O     1 
ATOM   8299  C CB    . SER F 5 34  ? 50.603  98.102  -30.998 1.00 45.44  ? 1233 SER D CB    1 
ATOM   8300  O OG    . SER F 5 34  ? 49.737  99.123  -31.437 1.00 44.65  ? 1233 SER D OG    1 
ATOM   8301  N N     . TYR F 5 35  ? 52.558  100.475 -31.161 1.00 40.25  ? 1234 TYR D N     1 
ATOM   8302  C CA    . TYR F 5 35  ? 52.842  101.875 -31.393 1.00 38.89  ? 1234 TYR D CA    1 
ATOM   8303  C C     . TYR F 5 35  ? 51.777  102.554 -32.234 1.00 37.96  ? 1234 TYR D C     1 
ATOM   8304  O O     . TYR F 5 35  ? 51.916  103.720 -32.580 1.00 37.57  ? 1234 TYR D O     1 
ATOM   8305  C CB    . TYR F 5 35  ? 54.200  102.017 -32.070 1.00 38.94  ? 1234 TYR D CB    1 
ATOM   8306  C CG    . TYR F 5 35  ? 55.337  101.529 -31.213 1.00 38.47  ? 1234 TYR D CG    1 
ATOM   8307  C CD1   . TYR F 5 35  ? 55.922  100.289 -31.438 1.00 38.99  ? 1234 TYR D CD1   1 
ATOM   8308  C CD2   . TYR F 5 35  ? 55.826  102.310 -30.166 1.00 41.77  ? 1234 TYR D CD2   1 
ATOM   8309  C CE1   . TYR F 5 35  ? 56.972  99.836  -30.647 1.00 38.85  ? 1234 TYR D CE1   1 
ATOM   8310  C CE2   . TYR F 5 35  ? 56.877  101.865 -29.361 1.00 41.15  ? 1234 TYR D CE2   1 
ATOM   8311  C CZ    . TYR F 5 35  ? 57.441  100.629 -29.611 1.00 40.40  ? 1234 TYR D CZ    1 
ATOM   8312  O OH    . TYR F 5 35  ? 58.474  100.187 -28.826 1.00 41.23  ? 1234 TYR D OH    1 
ATOM   8313  N N     . ALA F 5 36  ? 50.710  101.826 -32.543 1.00 39.97  ? 1235 ALA D N     1 
ATOM   8314  C CA    . ALA F 5 36  ? 49.634  102.340 -33.379 1.00 42.10  ? 1235 ALA D CA    1 
ATOM   8315  C C     . ALA F 5 36  ? 49.132  103.767 -33.100 1.00 42.77  ? 1235 ALA D C     1 
ATOM   8316  O O     . ALA F 5 36  ? 49.046  104.583 -34.028 1.00 43.75  ? 1235 ALA D O     1 
ATOM   8317  C CB    . ALA F 5 36  ? 48.462  101.358 -33.364 1.00 34.22  ? 1235 ALA D CB    1 
ATOM   8318  N N     . ILE F 5 37  ? 48.803  104.084 -31.849 1.00 41.38  ? 1236 ILE D N     1 
ATOM   8319  C CA    . ILE F 5 37  ? 48.307  105.432 -31.557 1.00 41.57  ? 1236 ILE D CA    1 
ATOM   8320  C C     . ILE F 5 37  ? 49.377  106.506 -31.769 1.00 40.97  ? 1236 ILE D C     1 
ATOM   8321  O O     . ILE F 5 37  ? 49.066  107.633 -32.152 1.00 41.37  ? 1236 ILE D O     1 
ATOM   8322  C CB    . ILE F 5 37  ? 47.736  105.551 -30.111 1.00 41.18  ? 1236 ILE D CB    1 
ATOM   8323  C CG1   . ILE F 5 37  ? 48.824  105.262 -29.083 1.00 43.19  ? 1236 ILE D CG1   1 
ATOM   8324  C CG2   . ILE F 5 37  ? 46.561  104.589 -29.929 1.00 39.46  ? 1236 ILE D CG2   1 
ATOM   8325  C CD1   . ILE F 5 37  ? 48.376  105.536 -27.643 1.00 45.33  ? 1236 ILE D CD1   1 
ATOM   8326  N N     . TYR F 5 38  ? 50.636  106.162 -31.523 1.00 38.90  ? 1237 TYR D N     1 
ATOM   8327  C CA    . TYR F 5 38  ? 51.698  107.126 -31.727 1.00 39.76  ? 1237 TYR D CA    1 
ATOM   8328  C C     . TYR F 5 38  ? 51.953  107.264 -33.222 1.00 39.50  ? 1237 TYR D C     1 
ATOM   8329  O O     . TYR F 5 38  ? 52.226  108.361 -33.708 1.00 39.43  ? 1237 TYR D O     1 
ATOM   8330  C CB    . TYR F 5 38  ? 52.966  106.692 -31.007 1.00 40.07  ? 1237 TYR D CB    1 
ATOM   8331  C CG    . TYR F 5 38  ? 52.712  106.289 -29.583 1.00 43.39  ? 1237 TYR D CG    1 
ATOM   8332  C CD1   . TYR F 5 38  ? 52.632  104.938 -29.228 1.00 45.59  ? 1237 TYR D CD1   1 
ATOM   8333  C CD2   . TYR F 5 38  ? 52.493  107.249 -28.593 1.00 41.72  ? 1237 TYR D CD2   1 
ATOM   8334  C CE1   . TYR F 5 38  ? 52.337  104.550 -27.924 1.00 46.37  ? 1237 TYR D CE1   1 
ATOM   8335  C CE2   . TYR F 5 38  ? 52.194  106.872 -27.286 1.00 43.72  ? 1237 TYR D CE2   1 
ATOM   8336  C CZ    . TYR F 5 38  ? 52.115  105.523 -26.960 1.00 46.70  ? 1237 TYR D CZ    1 
ATOM   8337  O OH    . TYR F 5 38  ? 51.791  105.136 -25.682 1.00 48.88  ? 1237 TYR D OH    1 
ATOM   8338  N N     . ILE F 5 39  ? 51.855  106.158 -33.955 1.00 36.48  ? 1238 ILE D N     1 
ATOM   8339  C CA    . ILE F 5 39  ? 52.060  106.209 -35.394 1.00 35.83  ? 1238 ILE D CA    1 
ATOM   8340  C C     . ILE F 5 39  ? 50.950  107.089 -35.971 1.00 35.51  ? 1238 ILE D C     1 
ATOM   8341  O O     . ILE F 5 39  ? 51.197  107.950 -36.811 1.00 33.26  ? 1238 ILE D O     1 
ATOM   8342  C CB    . ILE F 5 39  ? 52.004  104.780 -36.024 1.00 34.69  ? 1238 ILE D CB    1 
ATOM   8343  C CG1   . ILE F 5 39  ? 53.235  103.964 -35.592 1.00 33.80  ? 1238 ILE D CG1   1 
ATOM   8344  C CG2   . ILE F 5 39  ? 51.962  104.872 -37.545 1.00 31.23  ? 1238 ILE D CG2   1 
ATOM   8345  C CD1   . ILE F 5 39  ? 53.078  102.445 -35.790 1.00 33.92  ? 1238 ILE D CD1   1 
ATOM   8346  N N     . TYR F 5 40  ? 49.727  106.883 -35.495 1.00 35.84  ? 1239 TYR D N     1 
ATOM   8347  C CA    . TYR F 5 40  ? 48.589  107.658 -35.975 1.00 38.33  ? 1239 TYR D CA    1 
ATOM   8348  C C     . TYR F 5 40  ? 48.773  109.165 -35.745 1.00 39.65  ? 1239 TYR D C     1 
ATOM   8349  O O     . TYR F 5 40  ? 48.484  109.969 -36.632 1.00 37.95  ? 1239 TYR D O     1 
ATOM   8350  C CB    . TYR F 5 40  ? 47.298  107.144 -35.303 1.00 49.61  ? 1239 TYR D CB    1 
ATOM   8351  C CG    . TYR F 5 40  ? 46.062  107.639 -36.027 1.00 54.11  ? 1239 TYR D CG    1 
ATOM   8352  C CD1   . TYR F 5 40  ? 45.714  107.094 -37.261 1.00 56.93  ? 1239 TYR D CD1   1 
ATOM   8353  C CD2   . TYR F 5 40  ? 45.289  108.689 -35.526 1.00 56.29  ? 1239 TYR D CD2   1 
ATOM   8354  C CE1   . TYR F 5 40  ? 44.627  107.588 -37.993 1.00 62.12  ? 1239 TYR D CE1   1 
ATOM   8355  C CE2   . TYR F 5 40  ? 44.200  109.193 -36.245 1.00 62.16  ? 1239 TYR D CE2   1 
ATOM   8356  C CZ    . TYR F 5 40  ? 43.876  108.639 -37.480 1.00 63.92  ? 1239 TYR D CZ    1 
ATOM   8357  O OH    . TYR F 5 40  ? 42.814  109.143 -38.201 1.00 68.17  ? 1239 TYR D OH    1 
ATOM   8358  N N     . THR F 5 41  ? 49.258  109.547 -34.563 1.00 44.53  ? 1240 THR D N     1 
ATOM   8359  C CA    . THR F 5 41  ? 49.483  110.959 -34.268 1.00 45.91  ? 1240 THR D CA    1 
ATOM   8360  C C     . THR F 5 41  ? 50.496  111.532 -35.253 1.00 44.41  ? 1240 THR D C     1 
ATOM   8361  O O     . THR F 5 41  ? 50.289  112.603 -35.833 1.00 44.60  ? 1240 THR D O     1 
ATOM   8362  C CB    . THR F 5 41  ? 49.977  111.160 -32.835 1.00 72.25  ? 1240 THR D CB    1 
ATOM   8363  O OG1   . THR F 5 41  ? 49.001  110.657 -31.916 1.00 41.07  ? 1240 THR D OG1   1 
ATOM   8364  C CG2   . THR F 5 41  ? 50.234  112.637 -32.583 1.00 41.07  ? 1240 THR D CG2   1 
ATOM   8365  N N     . VAL F 5 42  ? 51.601  110.822 -35.445 1.00 39.69  ? 1241 VAL D N     1 
ATOM   8366  C CA    . VAL F 5 42  ? 52.614  111.308 -36.371 1.00 38.59  ? 1241 VAL D CA    1 
ATOM   8367  C C     . VAL F 5 42  ? 52.065  111.391 -37.795 1.00 37.55  ? 1241 VAL D C     1 
ATOM   8368  O O     . VAL F 5 42  ? 52.401  112.314 -38.540 1.00 39.14  ? 1241 VAL D O     1 
ATOM   8369  C CB    . VAL F 5 42  ? 53.890  110.429 -36.318 1.00 38.55  ? 1241 VAL D CB    1 
ATOM   8370  C CG1   . VAL F 5 42  ? 54.892  110.909 -37.354 1.00 37.54  ? 1241 VAL D CG1   1 
ATOM   8371  C CG2   . VAL F 5 42  ? 54.495  110.457 -34.932 1.00 36.23  ? 1241 VAL D CG2   1 
ATOM   8372  N N     . LEU F 5 43  ? 51.207  110.450 -38.180 1.00 35.16  ? 1242 LEU D N     1 
ATOM   8373  C CA    . LEU F 5 43  ? 50.641  110.500 -39.525 1.00 34.42  ? 1242 LEU D CA    1 
ATOM   8374  C C     . LEU F 5 43  ? 49.851  111.811 -39.693 1.00 35.78  ? 1242 LEU D C     1 
ATOM   8375  O O     . LEU F 5 43  ? 49.983  112.503 -40.713 1.00 33.56  ? 1242 LEU D O     1 
ATOM   8376  C CB    . LEU F 5 43  ? 49.712  109.315 -39.772 1.00 29.78  ? 1242 LEU D CB    1 
ATOM   8377  C CG    . LEU F 5 43  ? 48.900  109.478 -41.062 1.00 32.24  ? 1242 LEU D CG    1 
ATOM   8378  C CD1   . LEU F 5 43  ? 49.833  109.574 -42.302 1.00 28.39  ? 1242 LEU D CD1   1 
ATOM   8379  C CD2   . LEU F 5 43  ? 47.939  108.309 -41.186 1.00 32.30  ? 1242 LEU D CD2   1 
ATOM   8380  N N     . LYS F 5 44  ? 49.038  112.151 -38.692 1.00 39.18  ? 1243 LYS D N     1 
ATOM   8381  C CA    . LYS F 5 44  ? 48.249  113.378 -38.756 1.00 42.17  ? 1243 LYS D CA    1 
ATOM   8382  C C     . LYS F 5 44  ? 49.100  114.639 -38.798 1.00 41.10  ? 1243 LYS D C     1 
ATOM   8383  O O     . LYS F 5 44  ? 48.656  115.655 -39.311 1.00 42.81  ? 1243 LYS D O     1 
ATOM   8384  C CB    . LYS F 5 44  ? 47.255  113.456 -37.593 1.00 46.95  ? 1243 LYS D CB    1 
ATOM   8385  C CG    . LYS F 5 44  ? 46.123  112.433 -37.719 1.00 51.81  ? 1243 LYS D CG    1 
ATOM   8386  C CD    . LYS F 5 44  ? 45.510  112.499 -39.114 1.00 54.34  ? 1243 LYS D CD    1 
ATOM   8387  C CE    . LYS F 5 44  ? 44.394  111.497 -39.288 1.00 57.64  ? 1243 LYS D CE    1 
ATOM   8388  N NZ    . LYS F 5 44  ? 43.805  111.591 -40.647 1.00 59.41  ? 1243 LYS D NZ    1 
ATOM   8389  N N     . GLN F 5 45  ? 50.322  114.575 -38.279 1.00 34.64  ? 1244 GLN D N     1 
ATOM   8390  C CA    . GLN F 5 45  ? 51.198  115.738 -38.314 1.00 34.09  ? 1244 GLN D CA    1 
ATOM   8391  C C     . GLN F 5 45  ? 51.757  115.975 -39.713 1.00 32.71  ? 1244 GLN D C     1 
ATOM   8392  O O     . GLN F 5 45  ? 51.964  117.126 -40.116 1.00 32.43  ? 1244 GLN D O     1 
ATOM   8393  C CB    . GLN F 5 45  ? 52.371  115.580 -37.351 1.00 42.09  ? 1244 GLN D CB    1 
ATOM   8394  C CG    . GLN F 5 45  ? 52.009  115.485 -35.882 1.00 47.23  ? 1244 GLN D CG    1 
ATOM   8395  C CD    . GLN F 5 45  ? 53.245  115.487 -35.000 1.00 51.02  ? 1244 GLN D CD    1 
ATOM   8396  O OE1   . GLN F 5 45  ? 54.241  114.826 -35.310 1.00 53.06  ? 1244 GLN D OE1   1 
ATOM   8397  N NE2   . GLN F 5 45  ? 53.188  116.226 -33.895 1.00 51.93  ? 1244 GLN D NE2   1 
ATOM   8398  N N     . VAL F 5 46  ? 52.015  114.896 -40.455 1.00 29.67  ? 1245 VAL D N     1 
ATOM   8399  C CA    . VAL F 5 46  ? 52.573  115.033 -41.803 1.00 28.88  ? 1245 VAL D CA    1 
ATOM   8400  C C     . VAL F 5 46  ? 51.499  115.080 -42.873 1.00 30.88  ? 1245 VAL D C     1 
ATOM   8401  O O     . VAL F 5 46  ? 51.673  115.721 -43.896 1.00 30.82  ? 1245 VAL D O     1 
ATOM   8402  C CB    . VAL F 5 46  ? 53.579  113.890 -42.124 1.00 35.36  ? 1245 VAL D CB    1 
ATOM   8403  C CG1   . VAL F 5 46  ? 54.722  113.928 -41.117 1.00 35.17  ? 1245 VAL D CG1   1 
ATOM   8404  C CG2   . VAL F 5 46  ? 52.875  112.509 -42.096 1.00 31.09  ? 1245 VAL D CG2   1 
ATOM   8405  N N     . HIS F 5 47  ? 50.381  114.410 -42.638 1.00 35.59  ? 1246 HIS D N     1 
ATOM   8406  C CA    . HIS F 5 47  ? 49.289  114.398 -43.605 1.00 37.77  ? 1246 HIS D CA    1 
ATOM   8407  C C     . HIS F 5 47  ? 47.977  114.470 -42.835 1.00 40.82  ? 1246 HIS D C     1 
ATOM   8408  O O     . HIS F 5 47  ? 47.326  113.451 -42.586 1.00 41.28  ? 1246 HIS D O     1 
ATOM   8409  C CB    . HIS F 5 47  ? 49.341  113.129 -44.453 1.00 37.80  ? 1246 HIS D CB    1 
ATOM   8410  C CG    . HIS F 5 47  ? 50.465  113.118 -45.436 1.00 38.87  ? 1246 HIS D CG    1 
ATOM   8411  N ND1   . HIS F 5 47  ? 50.639  114.114 -46.372 1.00 39.29  ? 1246 HIS D ND1   1 
ATOM   8412  C CD2   . HIS F 5 47  ? 51.469  112.231 -45.637 1.00 40.22  ? 1246 HIS D CD2   1 
ATOM   8413  C CE1   . HIS F 5 47  ? 51.702  113.843 -47.109 1.00 40.54  ? 1246 HIS D CE1   1 
ATOM   8414  N NE2   . HIS F 5 47  ? 52.224  112.706 -46.684 1.00 42.72  ? 1246 HIS D NE2   1 
ATOM   8415  N N     . PRO F 5 48  ? 47.568  115.695 -42.466 1.00 40.19  ? 1247 PRO D N     1 
ATOM   8416  C CA    . PRO F 5 48  ? 46.335  115.929 -41.707 1.00 40.57  ? 1247 PRO D CA    1 
ATOM   8417  C C     . PRO F 5 48  ? 45.079  115.238 -42.224 1.00 40.41  ? 1247 PRO D C     1 
ATOM   8418  O O     . PRO F 5 48  ? 44.264  114.789 -41.429 1.00 42.34  ? 1247 PRO D O     1 
ATOM   8419  C CB    . PRO F 5 48  ? 46.203  117.464 -41.697 1.00 35.63  ? 1247 PRO D CB    1 
ATOM   8420  C CG    . PRO F 5 48  ? 47.642  117.945 -41.893 1.00 37.51  ? 1247 PRO D CG    1 
ATOM   8421  C CD    . PRO F 5 48  ? 48.163  116.967 -42.926 1.00 34.37  ? 1247 PRO D CD    1 
ATOM   8422  N N     . ASP F 5 49  ? 44.917  115.133 -43.539 1.00 40.86  ? 1248 ASP D N     1 
ATOM   8423  C CA    . ASP F 5 49  ? 43.711  114.500 -44.070 1.00 43.63  ? 1248 ASP D CA    1 
ATOM   8424  C C     . ASP F 5 49  ? 43.898  113.119 -44.715 1.00 44.17  ? 1248 ASP D C     1 
ATOM   8425  O O     . ASP F 5 49  ? 43.159  112.739 -45.629 1.00 44.51  ? 1248 ASP D O     1 
ATOM   8426  C CB    . ASP F 5 49  ? 43.032  115.446 -45.063 1.00 63.12  ? 1248 ASP D CB    1 
ATOM   8427  C CG    . ASP F 5 49  ? 42.627  116.768 -44.426 1.00 68.75  ? 1248 ASP D CG    1 
ATOM   8428  O OD1   . ASP F 5 49  ? 41.896  116.752 -43.412 1.00 70.71  ? 1248 ASP D OD1   1 
ATOM   8429  O OD2   . ASP F 5 49  ? 43.037  117.826 -44.943 1.00 71.90  ? 1248 ASP D OD2   1 
ATOM   8430  N N     . THR F 5 50  ? 44.874  112.360 -44.234 1.00 39.26  ? 1249 THR D N     1 
ATOM   8431  C CA    . THR F 5 50  ? 45.113  111.034 -44.785 1.00 38.78  ? 1249 THR D CA    1 
ATOM   8432  C C     . THR F 5 50  ? 44.864  109.987 -43.706 1.00 36.42  ? 1249 THR D C     1 
ATOM   8433  O O     . THR F 5 50  ? 45.203  110.198 -42.546 1.00 37.58  ? 1249 THR D O     1 
ATOM   8434  C CB    . THR F 5 50  ? 46.573  110.916 -45.291 1.00 44.53  ? 1249 THR D CB    1 
ATOM   8435  O OG1   . THR F 5 50  ? 46.804  111.914 -46.287 1.00 45.46  ? 1249 THR D OG1   1 
ATOM   8436  C CG2   . THR F 5 50  ? 46.846  109.532 -45.883 1.00 45.35  ? 1249 THR D CG2   1 
ATOM   8437  N N     . GLY F 5 51  ? 44.255  108.869 -44.071 1.00 37.14  ? 1250 GLY D N     1 
ATOM   8438  C CA    . GLY F 5 51  ? 44.026  107.819 -43.086 1.00 36.75  ? 1250 GLY D CA    1 
ATOM   8439  C C     . GLY F 5 51  ? 45.006  106.665 -43.295 1.00 37.16  ? 1250 GLY D C     1 
ATOM   8440  O O     . GLY F 5 51  ? 45.972  106.782 -44.048 1.00 36.60  ? 1250 GLY D O     1 
ATOM   8441  N N     . ILE F 5 52  ? 44.775  105.543 -42.632 1.00 39.71  ? 1251 ILE D N     1 
ATOM   8442  C CA    . ILE F 5 52  ? 45.652  104.395 -42.803 1.00 39.80  ? 1251 ILE D CA    1 
ATOM   8443  C C     . ILE F 5 52  ? 44.858  103.121 -42.510 1.00 38.81  ? 1251 ILE D C     1 
ATOM   8444  O O     . ILE F 5 52  ? 44.129  103.049 -41.530 1.00 38.88  ? 1251 ILE D O     1 
ATOM   8445  C CB    . ILE F 5 52  ? 46.905  104.520 -41.887 1.00 37.88  ? 1251 ILE D CB    1 
ATOM   8446  C CG1   . ILE F 5 52  ? 47.868  103.357 -42.141 1.00 37.24  ? 1251 ILE D CG1   1 
ATOM   8447  C CG2   . ILE F 5 52  ? 46.480  104.592 -40.420 1.00 35.77  ? 1251 ILE D CG2   1 
ATOM   8448  C CD1   . ILE F 5 52  ? 49.225  103.559 -41.490 1.00 38.65  ? 1251 ILE D CD1   1 
ATOM   8449  N N     . SER F 5 53  ? 44.969  102.130 -43.385 1.00 34.97  ? 1252 SER D N     1 
ATOM   8450  C CA    . SER F 5 53  ? 44.233  100.892 -43.190 1.00 35.67  ? 1252 SER D CA    1 
ATOM   8451  C C     . SER F 5 53  ? 44.898  100.131 -42.056 1.00 36.24  ? 1252 SER D C     1 
ATOM   8452  O O     . SER F 5 53  ? 46.050  100.392 -41.742 1.00 37.51  ? 1252 SER D O     1 
ATOM   8453  C CB    . SER F 5 53  ? 44.242  100.054 -44.472 1.00 37.54  ? 1252 SER D CB    1 
ATOM   8454  O OG    . SER F 5 53  ? 45.486  99.419  -44.663 1.00 38.08  ? 1252 SER D OG    1 
ATOM   8455  N N     . SER F 5 54  ? 44.181  99.200  -41.439 1.00 37.68  ? 1253 SER D N     1 
ATOM   8456  C CA    . SER F 5 54  ? 44.743  98.440  -40.328 1.00 40.48  ? 1253 SER D CA    1 
ATOM   8457  C C     . SER F 5 54  ? 45.961  97.631  -40.766 1.00 39.61  ? 1253 SER D C     1 
ATOM   8458  O O     . SER F 5 54  ? 46.918  97.491  -40.003 1.00 40.25  ? 1253 SER D O     1 
ATOM   8459  C CB    . SER F 5 54  ? 43.696  97.502  -39.732 1.00 45.50  ? 1253 SER D CB    1 
ATOM   8460  O OG    . SER F 5 54  ? 43.324  96.539  -40.692 1.00 52.05  ? 1253 SER D OG    1 
ATOM   8461  N N     . LYS F 5 55  ? 45.931  97.103  -41.989 1.00 37.16  ? 1254 LYS D N     1 
ATOM   8462  C CA    . LYS F 5 55  ? 47.060  96.326  -42.486 1.00 37.20  ? 1254 LYS D CA    1 
ATOM   8463  C C     . LYS F 5 55  ? 48.311  97.194  -42.616 1.00 36.35  ? 1254 LYS D C     1 
ATOM   8464  O O     . LYS F 5 55  ? 49.400  96.775  -42.203 1.00 34.51  ? 1254 LYS D O     1 
ATOM   8465  C CB    . LYS F 5 55  ? 46.717  95.671  -43.823 1.00 72.40  ? 1254 LYS D CB    1 
ATOM   8466  C CG    . LYS F 5 55  ? 45.807  94.464  -43.677 1.00 78.81  ? 1254 LYS D CG    1 
ATOM   8467  C CD    . LYS F 5 55  ? 45.662  93.715  -44.990 1.00 85.34  ? 1254 LYS D CD    1 
ATOM   8468  C CE    . LYS F 5 55  ? 44.932  92.394  -44.798 1.00 86.14  ? 1254 LYS D CE    1 
ATOM   8469  N NZ    . LYS F 5 55  ? 44.847  91.633  -46.076 1.00 88.81  ? 1254 LYS D NZ    1 
ATOM   8470  N N     . ALA F 5 56  ? 48.160  98.404  -43.174 1.00 31.53  ? 1255 ALA D N     1 
ATOM   8471  C CA    . ALA F 5 56  ? 49.297  99.317  -43.299 1.00 26.98  ? 1255 ALA D CA    1 
ATOM   8472  C C     . ALA F 5 56  ? 49.778  99.687  -41.897 1.00 25.93  ? 1255 ALA D C     1 
ATOM   8473  O O     . ALA F 5 56  ? 50.971  99.769  -41.643 1.00 27.98  ? 1255 ALA D O     1 
ATOM   8474  C CB    . ALA F 5 56  ? 48.893  100.576 -44.072 1.00 29.83  ? 1255 ALA D CB    1 
ATOM   8475  N N     . MET F 5 57  ? 48.857  99.894  -40.968 1.00 30.97  ? 1256 MET D N     1 
ATOM   8476  C CA    . MET F 5 57  ? 49.253  100.228 -39.600 1.00 31.39  ? 1256 MET D CA    1 
ATOM   8477  C C     . MET F 5 57  ? 50.039  99.056  -39.005 1.00 32.97  ? 1256 MET D C     1 
ATOM   8478  O O     . MET F 5 57  ? 51.017  99.247  -38.275 1.00 34.84  ? 1256 MET D O     1 
ATOM   8479  C CB    . MET F 5 57  ? 48.020  100.523 -38.733 1.00 28.79  ? 1256 MET D CB    1 
ATOM   8480  C CG    . MET F 5 57  ? 48.364  100.857 -37.286 1.00 32.82  ? 1256 MET D CG    1 
ATOM   8481  S SD    . MET F 5 57  ? 49.481  102.294 -37.158 1.00 41.56  ? 1256 MET D SD    1 
ATOM   8482  C CE    . MET F 5 57  ? 48.261  103.665 -37.019 1.00 36.98  ? 1256 MET D CE    1 
ATOM   8483  N N     . SER F 5 58  ? 49.622  97.839  -39.326 1.00 31.26  ? 1257 SER D N     1 
ATOM   8484  C CA    . SER F 5 58  ? 50.325  96.665  -38.825 1.00 34.57  ? 1257 SER D CA    1 
ATOM   8485  C C     . SER F 5 58  ? 51.755  96.655  -39.384 1.00 33.37  ? 1257 SER D C     1 
ATOM   8486  O O     . SER F 5 58  ? 52.713  96.355  -38.664 1.00 32.91  ? 1257 SER D O     1 
ATOM   8487  C CB    . SER F 5 58  ? 49.573  95.395  -39.222 1.00 35.96  ? 1257 SER D CB    1 
ATOM   8488  O OG    . SER F 5 58  ? 50.324  94.259  -38.866 1.00 39.03  ? 1257 SER D OG    1 
ATOM   8489  N N     . ILE F 5 59  ? 51.900  96.985  -40.666 1.00 33.67  ? 1258 ILE D N     1 
ATOM   8490  C CA    . ILE F 5 59  ? 53.231  97.076  -41.268 1.00 33.88  ? 1258 ILE D CA    1 
ATOM   8491  C C     . ILE F 5 59  ? 54.061  98.200  -40.593 1.00 34.43  ? 1258 ILE D C     1 
ATOM   8492  O O     . ILE F 5 59  ? 55.266  98.042  -40.369 1.00 35.24  ? 1258 ILE D O     1 
ATOM   8493  C CB    . ILE F 5 59  ? 53.145  97.347  -42.790 1.00 27.06  ? 1258 ILE D CB    1 
ATOM   8494  C CG1   . ILE F 5 59  ? 52.614  96.091  -43.484 1.00 30.75  ? 1258 ILE D CG1   1 
ATOM   8495  C CG2   . ILE F 5 59  ? 54.535  97.737  -43.350 1.00 21.73  ? 1258 ILE D CG2   1 
ATOM   8496  C CD1   . ILE F 5 59  ? 52.205  96.304  -44.914 1.00 32.32  ? 1258 ILE D CD1   1 
ATOM   8497  N N     . MET F 5 60  ? 53.429  99.327  -40.264 1.00 32.60  ? 1259 MET D N     1 
ATOM   8498  C CA    . MET F 5 60  ? 54.160  100.421 -39.606 1.00 32.28  ? 1259 MET D CA    1 
ATOM   8499  C C     . MET F 5 60  ? 54.587  99.994  -38.197 1.00 32.89  ? 1259 MET D C     1 
ATOM   8500  O O     . MET F 5 60  ? 55.656  100.373 -37.716 1.00 30.20  ? 1259 MET D O     1 
ATOM   8501  C CB    . MET F 5 60  ? 53.286  101.679 -39.500 1.00 32.52  ? 1259 MET D CB    1 
ATOM   8502  C CG    . MET F 5 60  ? 53.094  102.437 -40.804 1.00 31.30  ? 1259 MET D CG    1 
ATOM   8503  S SD    . MET F 5 60  ? 54.666  102.937 -41.471 1.00 35.08  ? 1259 MET D SD    1 
ATOM   8504  C CE    . MET F 5 60  ? 55.391  103.915 -40.065 1.00 30.65  ? 1259 MET D CE    1 
ATOM   8505  N N     . ASN F 5 61  ? 53.735  99.221  -37.531 1.00 30.61  ? 1260 ASN D N     1 
ATOM   8506  C CA    . ASN F 5 61  ? 54.056  98.752  -36.192 1.00 31.77  ? 1260 ASN D CA    1 
ATOM   8507  C C     . ASN F 5 61  ? 55.249  97.784  -36.246 1.00 33.13  ? 1260 ASN D C     1 
ATOM   8508  O O     . ASN F 5 61  ? 56.151  97.859  -35.409 1.00 33.88  ? 1260 ASN D O     1 
ATOM   8509  C CB    . ASN F 5 61  ? 52.840  98.087  -35.554 1.00 40.46  ? 1260 ASN D CB    1 
ATOM   8510  C CG    . ASN F 5 61  ? 53.000  97.924  -34.052 1.00 45.24  ? 1260 ASN D CG    1 
ATOM   8511  O OD1   . ASN F 5 61  ? 53.264  98.890  -33.343 1.00 45.55  ? 1260 ASN D OD1   1 
ATOM   8512  N ND2   . ASN F 5 61  ? 52.849  96.699  -33.565 1.00 45.68  ? 1260 ASN D ND2   1 
ATOM   8513  N N     . SER F 5 62  ? 55.260  96.891  -37.235 1.00 32.26  ? 1261 SER D N     1 
ATOM   8514  C CA    . SER F 5 62  ? 56.384  95.969  -37.417 1.00 34.28  ? 1261 SER D CA    1 
ATOM   8515  C C     . SER F 5 62  ? 57.671  96.752  -37.726 1.00 34.30  ? 1261 SER D C     1 
ATOM   8516  O O     . SER F 5 62  ? 58.755  96.381  -37.271 1.00 33.96  ? 1261 SER D O     1 
ATOM   8517  C CB    . SER F 5 62  ? 56.128  95.006  -38.589 1.00 36.55  ? 1261 SER D CB    1 
ATOM   8518  O OG    . SER F 5 62  ? 55.194  93.993  -38.256 1.00 40.56  ? 1261 SER D OG    1 
ATOM   8519  N N     . PHE F 5 63  ? 57.551  97.816  -38.523 1.00 36.05  ? 1262 PHE D N     1 
ATOM   8520  C CA    . PHE F 5 63  ? 58.707  98.640  -38.896 1.00 34.96  ? 1262 PHE D CA    1 
ATOM   8521  C C     . PHE F 5 63  ? 59.342  99.320  -37.671 1.00 34.78  ? 1262 PHE D C     1 
ATOM   8522  O O     . PHE F 5 63  ? 60.558  99.284  -37.488 1.00 34.36  ? 1262 PHE D O     1 
ATOM   8523  C CB    . PHE F 5 63  ? 58.287  99.708  -39.933 1.00 30.12  ? 1262 PHE D CB    1 
ATOM   8524  C CG    . PHE F 5 63  ? 59.335  100.776 -40.180 1.00 30.84  ? 1262 PHE D CG    1 
ATOM   8525  C CD1   . PHE F 5 63  ? 60.567  100.455 -40.750 1.00 30.60  ? 1262 PHE D CD1   1 
ATOM   8526  C CD2   . PHE F 5 63  ? 59.074  102.109 -39.865 1.00 30.35  ? 1262 PHE D CD2   1 
ATOM   8527  C CE1   . PHE F 5 63  ? 61.531  101.459 -41.009 1.00 32.11  ? 1262 PHE D CE1   1 
ATOM   8528  C CE2   . PHE F 5 63  ? 60.021  103.115 -40.116 1.00 31.52  ? 1262 PHE D CE2   1 
ATOM   8529  C CZ    . PHE F 5 63  ? 61.249  102.794 -40.688 1.00 31.14  ? 1262 PHE D CZ    1 
ATOM   8530  N N     . VAL F 5 64  ? 58.519  99.946  -36.840 1.00 34.68  ? 1263 VAL D N     1 
ATOM   8531  C CA    . VAL F 5 64  ? 59.016  100.618 -35.638 1.00 37.10  ? 1263 VAL D CA    1 
ATOM   8532  C C     . VAL F 5 64  ? 59.699  99.605  -34.710 1.00 37.20  ? 1263 VAL D C     1 
ATOM   8533  O O     . VAL F 5 64  ? 60.756  99.882  -34.153 1.00 37.88  ? 1263 VAL D O     1 
ATOM   8534  C CB    . VAL F 5 64  ? 57.850  101.328 -34.884 1.00 36.54  ? 1263 VAL D CB    1 
ATOM   8535  C CG1   . VAL F 5 64  ? 58.360  102.007 -33.637 1.00 38.38  ? 1263 VAL D CG1   1 
ATOM   8536  C CG2   . VAL F 5 64  ? 57.208  102.372 -35.793 1.00 38.62  ? 1263 VAL D CG2   1 
ATOM   8537  N N     . ASN F 5 65  ? 59.101  98.428  -34.552 1.00 34.08  ? 1264 ASN D N     1 
ATOM   8538  C CA    . ASN F 5 65  ? 59.678  97.384  -33.699 1.00 33.59  ? 1264 ASN D CA    1 
ATOM   8539  C C     . ASN F 5 65  ? 60.984  96.869  -34.275 1.00 31.34  ? 1264 ASN D C     1 
ATOM   8540  O O     . ASN F 5 65  ? 61.926  96.561  -33.538 1.00 28.36  ? 1264 ASN D O     1 
ATOM   8541  C CB    . ASN F 5 65  ? 58.709  96.210  -33.551 1.00 45.34  ? 1264 ASN D CB    1 
ATOM   8542  C CG    . ASN F 5 65  ? 57.636  96.470  -32.518 1.00 49.66  ? 1264 ASN D CG    1 
ATOM   8543  O OD1   . ASN F 5 65  ? 57.936  96.816  -31.378 1.00 54.10  ? 1264 ASN D OD1   1 
ATOM   8544  N ND2   . ASN F 5 65  ? 56.377  96.297  -32.906 1.00 52.49  ? 1264 ASN D ND2   1 
ATOM   8545  N N     . ASP F 5 66  ? 61.041  96.777  -35.598 1.00 31.36  ? 1265 ASP D N     1 
ATOM   8546  C CA    . ASP F 5 66  ? 62.242  96.292  -36.267 1.00 31.18  ? 1265 ASP D CA    1 
ATOM   8547  C C     . ASP F 5 66  ? 63.382  97.284  -36.008 1.00 30.02  ? 1265 ASP D C     1 
ATOM   8548  O O     . ASP F 5 66  ? 64.495  96.893  -35.662 1.00 30.14  ? 1265 ASP D O     1 
ATOM   8549  C CB    . ASP F 5 66  ? 61.954  96.116  -37.775 1.00 33.95  ? 1265 ASP D CB    1 
ATOM   8550  C CG    . ASP F 5 66  ? 63.129  95.516  -38.547 1.00 39.32  ? 1265 ASP D CG    1 
ATOM   8551  O OD1   . ASP F 5 66  ? 64.172  95.192  -37.928 1.00 40.71  ? 1265 ASP D OD1   1 
ATOM   8552  O OD2   . ASP F 5 66  ? 63.012  95.370  -39.790 1.00 41.11  ? 1265 ASP D OD2   1 
ATOM   8553  N N     . ILE F 5 67  ? 63.091  98.571  -36.145 1.00 34.55  ? 1266 ILE D N     1 
ATOM   8554  C CA    . ILE F 5 67  ? 64.084  99.628  -35.911 1.00 33.23  ? 1266 ILE D CA    1 
ATOM   8555  C C     . ILE F 5 67  ? 64.582  99.587  -34.465 1.00 34.54  ? 1266 ILE D C     1 
ATOM   8556  O O     . ILE F 5 67  ? 65.787  99.666  -34.206 1.00 34.13  ? 1266 ILE D O     1 
ATOM   8557  C CB    . ILE F 5 67  ? 63.480  101.035 -36.200 1.00 36.17  ? 1266 ILE D CB    1 
ATOM   8558  C CG1   . ILE F 5 67  ? 63.139  101.149 -37.688 1.00 35.34  ? 1266 ILE D CG1   1 
ATOM   8559  C CG2   . ILE F 5 67  ? 64.446  102.135 -35.759 1.00 34.30  ? 1266 ILE D CG2   1 
ATOM   8560  C CD1   . ILE F 5 67  ? 64.306  100.814 -38.608 1.00 36.67  ? 1266 ILE D CD1   1 
ATOM   8561  N N     . PHE F 5 68  ? 63.645  99.481  -33.530 1.00 30.34  ? 1267 PHE D N     1 
ATOM   8562  C CA    . PHE F 5 68  ? 63.985  99.405  -32.107 1.00 33.14  ? 1267 PHE D CA    1 
ATOM   8563  C C     . PHE F 5 68  ? 64.989  98.270  -31.853 1.00 33.20  ? 1267 PHE D C     1 
ATOM   8564  O O     . PHE F 5 68  ? 66.048  98.482  -31.241 1.00 31.86  ? 1267 PHE D O     1 
ATOM   8565  C CB    . PHE F 5 68  ? 62.712  99.154  -31.277 1.00 41.73  ? 1267 PHE D CB    1 
ATOM   8566  C CG    . PHE F 5 68  ? 62.979  98.768  -29.838 1.00 44.13  ? 1267 PHE D CG    1 
ATOM   8567  C CD1   . PHE F 5 68  ? 63.183  99.740  -28.867 1.00 45.39  ? 1267 PHE D CD1   1 
ATOM   8568  C CD2   . PHE F 5 68  ? 63.073  97.423  -29.470 1.00 45.01  ? 1267 PHE D CD2   1 
ATOM   8569  C CE1   . PHE F 5 68  ? 63.483  99.385  -27.543 1.00 48.37  ? 1267 PHE D CE1   1 
ATOM   8570  C CE2   . PHE F 5 68  ? 63.372  97.053  -28.160 1.00 47.47  ? 1267 PHE D CE2   1 
ATOM   8571  C CZ    . PHE F 5 68  ? 63.581  98.039  -27.187 1.00 49.04  ? 1267 PHE D CZ    1 
ATOM   8572  N N     . GLU F 5 69  ? 64.650  97.067  -32.317 1.00 35.22  ? 1268 GLU D N     1 
ATOM   8573  C CA    . GLU F 5 69  ? 65.505  95.883  -32.133 1.00 36.38  ? 1268 GLU D CA    1 
ATOM   8574  C C     . GLU F 5 69  ? 66.882  96.036  -32.770 1.00 35.13  ? 1268 GLU D C     1 
ATOM   8575  O O     . GLU F 5 69  ? 67.894  95.695  -32.164 1.00 34.73  ? 1268 GLU D O     1 
ATOM   8576  C CB    . GLU F 5 69  ? 64.841  94.636  -32.728 1.00 81.62  ? 1268 GLU D CB    1 
ATOM   8577  C CG    . GLU F 5 69  ? 63.502  94.255  -32.130 1.00 92.27  ? 1268 GLU D CG    1 
ATOM   8578  C CD    . GLU F 5 69  ? 62.800  93.161  -32.931 1.00 100.45 ? 1268 GLU D CD    1 
ATOM   8579  O OE1   . GLU F 5 69  ? 61.690  92.749  -32.529 1.00 103.82 ? 1268 GLU D OE1   1 
ATOM   8580  O OE2   . GLU F 5 69  ? 63.352  92.715  -33.963 1.00 103.18 ? 1268 GLU D OE2   1 
ATOM   8581  N N     . ARG F 5 70  ? 66.932  96.525  -34.005 1.00 32.70  ? 1269 ARG D N     1 
ATOM   8582  C CA    . ARG F 5 70  ? 68.227  96.689  -34.643 1.00 32.96  ? 1269 ARG D CA    1 
ATOM   8583  C C     . ARG F 5 70  ? 69.113  97.662  -33.868 1.00 33.66  ? 1269 ARG D C     1 
ATOM   8584  O O     . ARG F 5 70  ? 70.293  97.389  -33.635 1.00 33.33  ? 1269 ARG D O     1 
ATOM   8585  C CB    . ARG F 5 70  ? 68.083  97.193  -36.081 1.00 34.76  ? 1269 ARG D CB    1 
ATOM   8586  C CG    . ARG F 5 70  ? 67.373  96.242  -37.028 1.00 37.81  ? 1269 ARG D CG    1 
ATOM   8587  C CD    . ARG F 5 70  ? 67.545  96.707  -38.481 1.00 38.19  ? 1269 ARG D CD    1 
ATOM   8588  N NE    . ARG F 5 70  ? 66.500  96.185  -39.352 1.00 36.69  ? 1269 ARG D NE    1 
ATOM   8589  C CZ    . ARG F 5 70  ? 66.428  96.431  -40.656 1.00 40.89  ? 1269 ARG D CZ    1 
ATOM   8590  N NH1   . ARG F 5 70  ? 67.353  97.187  -41.244 1.00 38.78  ? 1269 ARG D NH1   1 
ATOM   8591  N NH2   . ARG F 5 70  ? 65.415  95.944  -41.370 1.00 39.83  ? 1269 ARG D NH2   1 
ATOM   8592  N N     . ILE F 5 71  ? 68.560  98.811  -33.486 1.00 31.73  ? 1270 ILE D N     1 
ATOM   8593  C CA    . ILE F 5 71  ? 69.358  99.789  -32.768 1.00 30.94  ? 1270 ILE D CA    1 
ATOM   8594  C C     . ILE F 5 71  ? 69.754  99.251  -31.391 1.00 30.98  ? 1270 ILE D C     1 
ATOM   8595  O O     . ILE F 5 71  ? 70.916  99.338  -31.006 1.00 29.41  ? 1270 ILE D O     1 
ATOM   8596  C CB    . ILE F 5 71  ? 68.603  101.137 -32.641 1.00 32.95  ? 1270 ILE D CB    1 
ATOM   8597  C CG1   . ILE F 5 71  ? 68.462  101.776 -34.028 1.00 32.92  ? 1270 ILE D CG1   1 
ATOM   8598  C CG2   . ILE F 5 71  ? 69.360  102.078 -31.711 1.00 33.80  ? 1270 ILE D CG2   1 
ATOM   8599  C CD1   . ILE F 5 71  ? 67.458  102.912 -34.097 1.00 37.75  ? 1270 ILE D CD1   1 
ATOM   8600  N N     . ALA F 5 72  ? 68.805  98.658  -30.670 1.00 33.89  ? 1271 ALA D N     1 
ATOM   8601  C CA    . ALA F 5 72  ? 69.118  98.124  -29.343 1.00 34.80  ? 1271 ALA D CA    1 
ATOM   8602  C C     . ALA F 5 72  ? 70.186  97.027  -29.392 1.00 34.37  ? 1271 ALA D C     1 
ATOM   8603  O O     . ALA F 5 72  ? 71.116  97.022  -28.576 1.00 33.47  ? 1271 ALA D O     1 
ATOM   8604  C CB    . ALA F 5 72  ? 67.846  97.591  -28.659 1.00 29.36  ? 1271 ALA D CB    1 
ATOM   8605  N N     . ALA F 5 73  ? 70.064  96.106  -30.347 1.00 34.11  ? 1272 ALA D N     1 
ATOM   8606  C CA    . ALA F 5 73  ? 71.036  95.015  -30.446 1.00 35.05  ? 1272 ALA D CA    1 
ATOM   8607  C C     . ALA F 5 73  ? 72.404  95.579  -30.779 1.00 36.22  ? 1272 ALA D C     1 
ATOM   8608  O O     . ALA F 5 73  ? 73.413  95.149  -30.216 1.00 38.32  ? 1272 ALA D O     1 
ATOM   8609  C CB    . ALA F 5 73  ? 70.595  93.967  -31.510 1.00 21.25  ? 1272 ALA D CB    1 
ATOM   8610  N N     . GLU F 5 74  ? 72.439  96.550  -31.687 1.00 35.54  ? 1273 GLU D N     1 
ATOM   8611  C CA    . GLU F 5 74  ? 73.697  97.195  -32.061 1.00 37.85  ? 1273 GLU D CA    1 
ATOM   8612  C C     . GLU F 5 74  ? 74.305  97.927  -30.852 1.00 37.58  ? 1273 GLU D C     1 
ATOM   8613  O O     . GLU F 5 74  ? 75.521  97.911  -30.653 1.00 38.44  ? 1273 GLU D O     1 
ATOM   8614  C CB    . GLU F 5 74  ? 73.465  98.205  -33.189 1.00 45.83  ? 1273 GLU D CB    1 
ATOM   8615  C CG    . GLU F 5 74  ? 74.081  97.837  -34.523 1.00 56.48  ? 1273 GLU D CG    1 
ATOM   8616  C CD    . GLU F 5 74  ? 75.583  97.651  -34.448 1.00 60.38  ? 1273 GLU D CD    1 
ATOM   8617  O OE1   . GLU F 5 74  ? 76.256  98.504  -33.837 1.00 63.59  ? 1273 GLU D OE1   1 
ATOM   8618  O OE2   . GLU F 5 74  ? 76.092  96.657  -35.004 1.00 63.50  ? 1273 GLU D OE2   1 
ATOM   8619  N N     . ALA F 5 75  ? 73.464  98.580  -30.053 1.00 36.06  ? 1274 ALA D N     1 
ATOM   8620  C CA    . ALA F 5 75  ? 73.952  99.302  -28.876 1.00 37.27  ? 1274 ALA D CA    1 
ATOM   8621  C C     . ALA F 5 75  ? 74.514  98.291  -27.872 1.00 36.75  ? 1274 ALA D C     1 
ATOM   8622  O O     . ALA F 5 75  ? 75.557  98.519  -27.248 1.00 36.83  ? 1274 ALA D O     1 
ATOM   8623  C CB    . ALA F 5 75  ? 72.810  100.110 -28.237 1.00 32.33  ? 1274 ALA D CB    1 
ATOM   8624  N N     . SER F 5 76  ? 73.810  97.174  -27.730 1.00 36.68  ? 1275 SER D N     1 
ATOM   8625  C CA    . SER F 5 76  ? 74.217  96.087  -26.838 1.00 38.25  ? 1275 SER D CA    1 
ATOM   8626  C C     . SER F 5 76  ? 75.633  95.587  -27.171 1.00 39.43  ? 1275 SER D C     1 
ATOM   8627  O O     . SER F 5 76  ? 76.488  95.512  -26.289 1.00 38.07  ? 1275 SER D O     1 
ATOM   8628  C CB    . SER F 5 76  ? 73.219  94.932  -26.957 1.00 39.78  ? 1275 SER D CB    1 
ATOM   8629  O OG    . SER F 5 76  ? 73.529  93.891  -26.054 1.00 42.96  ? 1275 SER D OG    1 
ATOM   8630  N N     . ARG F 5 77  ? 75.877  95.252  -28.440 1.00 41.23  ? 1276 ARG D N     1 
ATOM   8631  C CA    . ARG F 5 77  ? 77.191  94.775  -28.879 1.00 43.70  ? 1276 ARG D CA    1 
ATOM   8632  C C     . ARG F 5 77  ? 78.211  95.861  -28.602 1.00 43.48  ? 1276 ARG D C     1 
ATOM   8633  O O     . ARG F 5 77  ? 79.300  95.603  -28.102 1.00 43.58  ? 1276 ARG D O     1 
ATOM   8634  C CB    . ARG F 5 77  ? 77.210  94.478  -30.387 1.00 47.41  ? 1276 ARG D CB    1 
ATOM   8635  C CG    . ARG F 5 77  ? 76.280  93.378  -30.845 1.00 51.50  ? 1276 ARG D CG    1 
ATOM   8636  C CD    . ARG F 5 77  ? 76.330  93.207  -32.378 1.00 54.80  ? 1276 ARG D CD    1 
ATOM   8637  N NE    . ARG F 5 77  ? 75.108  92.567  -32.866 1.00 57.25  ? 1276 ARG D NE    1 
ATOM   8638  C CZ    . ARG F 5 77  ? 74.178  93.181  -33.589 1.00 57.76  ? 1276 ARG D CZ    1 
ATOM   8639  N NH1   . ARG F 5 77  ? 74.327  94.455  -33.930 1.00 58.87  ? 1276 ARG D NH1   1 
ATOM   8640  N NH2   . ARG F 5 77  ? 73.080  92.527  -33.945 1.00 60.82  ? 1276 ARG D NH2   1 
ATOM   8641  N N     . LEU F 5 78  ? 77.838  97.084  -28.948 1.00 41.80  ? 1277 LEU D N     1 
ATOM   8642  C CA    . LEU F 5 78  ? 78.690  98.249  -28.746 1.00 42.27  ? 1277 LEU D CA    1 
ATOM   8643  C C     . LEU F 5 78  ? 79.183  98.327  -27.292 1.00 40.12  ? 1277 LEU D C     1 
ATOM   8644  O O     . LEU F 5 78  ? 80.379  98.464  -27.044 1.00 37.64  ? 1277 LEU D O     1 
ATOM   8645  C CB    . LEU F 5 78  ? 77.902  99.501  -29.107 1.00 52.95  ? 1277 LEU D CB    1 
ATOM   8646  C CG    . LEU F 5 78  ? 78.628  100.696 -29.705 1.00 59.07  ? 1277 LEU D CG    1 
ATOM   8647  C CD1   . LEU F 5 78  ? 79.700  100.256 -30.705 1.00 57.98  ? 1277 LEU D CD1   1 
ATOM   8648  C CD2   . LEU F 5 78  ? 77.573  101.572 -30.380 1.00 60.51  ? 1277 LEU D CD2   1 
ATOM   8649  N N     . ALA F 5 79  ? 78.263  98.245  -26.338 1.00 40.76  ? 1278 ALA D N     1 
ATOM   8650  C CA    . ALA F 5 79  ? 78.629  98.295  -24.922 1.00 43.21  ? 1278 ALA D CA    1 
ATOM   8651  C C     . ALA F 5 79  ? 79.511  97.101  -24.541 1.00 44.20  ? 1278 ALA D C     1 
ATOM   8652  O O     . ALA F 5 79  ? 80.462  97.238  -23.778 1.00 44.53  ? 1278 ALA D O     1 
ATOM   8653  C CB    . ALA F 5 79  ? 77.354  98.315  -24.038 1.00 28.03  ? 1278 ALA D CB    1 
ATOM   8654  N N     . HIS F 5 80  ? 79.196  95.931  -25.082 1.00 43.26  ? 1279 HIS D N     1 
ATOM   8655  C CA    . HIS F 5 80  ? 79.962  94.725  -24.775 1.00 45.75  ? 1279 HIS D CA    1 
ATOM   8656  C C     . HIS F 5 80  ? 81.392  94.812  -25.291 1.00 44.48  ? 1279 HIS D C     1 
ATOM   8657  O O     . HIS F 5 80  ? 82.334  94.474  -24.578 1.00 44.91  ? 1279 HIS D O     1 
ATOM   8658  C CB    . HIS F 5 80  ? 79.251  93.498  -25.354 1.00 66.63  ? 1279 HIS D CB    1 
ATOM   8659  C CG    . HIS F 5 80  ? 79.892  92.194  -24.991 1.00 72.75  ? 1279 HIS D CG    1 
ATOM   8660  N ND1   . HIS F 5 80  ? 80.791  91.550  -25.815 1.00 73.94  ? 1279 HIS D ND1   1 
ATOM   8661  C CD2   . HIS F 5 80  ? 79.769  91.417  -23.889 1.00 74.88  ? 1279 HIS D CD2   1 
ATOM   8662  C CE1   . HIS F 5 80  ? 81.192  90.432  -25.237 1.00 75.82  ? 1279 HIS D CE1   1 
ATOM   8663  N NE2   . HIS F 5 80  ? 80.588  90.328  -24.067 1.00 76.02  ? 1279 HIS D NE2   1 
ATOM   8664  N N     . TYR F 5 81  ? 81.563  95.281  -26.523 1.00 42.45  ? 1280 TYR D N     1 
ATOM   8665  C CA    . TYR F 5 81  ? 82.897  95.412  -27.108 1.00 43.41  ? 1280 TYR D CA    1 
ATOM   8666  C C     . TYR F 5 81  ? 83.775  96.351  -26.285 1.00 43.01  ? 1280 TYR D C     1 
ATOM   8667  O O     . TYR F 5 81  ? 84.989  96.183  -26.232 1.00 42.44  ? 1280 TYR D O     1 
ATOM   8668  C CB    . TYR F 5 81  ? 82.821  95.973  -28.531 1.00 59.40  ? 1280 TYR D CB    1 
ATOM   8669  C CG    . TYR F 5 81  ? 82.086  95.114  -29.534 1.00 63.68  ? 1280 TYR D CG    1 
ATOM   8670  C CD1   . TYR F 5 81  ? 81.687  95.646  -30.760 1.00 63.61  ? 1280 TYR D CD1   1 
ATOM   8671  C CD2   . TYR F 5 81  ? 81.803  93.770  -29.272 1.00 64.22  ? 1280 TYR D CD2   1 
ATOM   8672  C CE1   . TYR F 5 81  ? 81.029  94.867  -31.703 1.00 65.93  ? 1280 TYR D CE1   1 
ATOM   8673  C CE2   . TYR F 5 81  ? 81.142  92.981  -30.211 1.00 66.37  ? 1280 TYR D CE2   1 
ATOM   8674  C CZ    . TYR F 5 81  ? 80.759  93.539  -31.426 1.00 67.14  ? 1280 TYR D CZ    1 
ATOM   8675  O OH    . TYR F 5 81  ? 80.113  92.774  -32.373 1.00 70.15  ? 1280 TYR D OH    1 
ATOM   8676  N N     . ASN F 5 82  ? 83.166  97.352  -25.663 1.00 47.93  ? 1281 ASN D N     1 
ATOM   8677  C CA    . ASN F 5 82  ? 83.926  98.320  -24.880 1.00 49.38  ? 1281 ASN D CA    1 
ATOM   8678  C C     . ASN F 5 82  ? 83.851  98.083  -23.380 1.00 51.27  ? 1281 ASN D C     1 
ATOM   8679  O O     . ASN F 5 82  ? 84.127  98.985  -22.589 1.00 51.50  ? 1281 ASN D O     1 
ATOM   8680  C CB    . ASN F 5 82  ? 83.452  99.736  -25.214 1.00 46.79  ? 1281 ASN D CB    1 
ATOM   8681  C CG    . ASN F 5 82  ? 83.904  100.184 -26.591 1.00 47.64  ? 1281 ASN D CG    1 
ATOM   8682  O OD1   . ASN F 5 82  ? 85.062  100.550 -26.788 1.00 48.50  ? 1281 ASN D OD1   1 
ATOM   8683  N ND2   . ASN F 5 82  ? 82.995  100.144 -27.556 1.00 45.87  ? 1281 ASN D ND2   1 
ATOM   8684  N N     . LYS F 5 83  ? 83.474  96.869  -22.996 1.00 55.00  ? 1282 LYS D N     1 
ATOM   8685  C CA    . LYS F 5 83  ? 83.376  96.495  -21.589 1.00 57.22  ? 1282 LYS D CA    1 
ATOM   8686  C C     . LYS F 5 83  ? 82.558  97.476  -20.762 1.00 56.67  ? 1282 LYS D C     1 
ATOM   8687  O O     . LYS F 5 83  ? 82.863  97.727  -19.605 1.00 57.62  ? 1282 LYS D O     1 
ATOM   8688  C CB    . LYS F 5 83  ? 84.772  96.354  -20.987 1.00 61.24  ? 1282 LYS D CB    1 
ATOM   8689  C CG    . LYS F 5 83  ? 85.615  95.286  -21.650 1.00 65.83  ? 1282 LYS D CG    1 
ATOM   8690  C CD    . LYS F 5 83  ? 87.047  95.347  -21.140 1.00 72.18  ? 1282 LYS D CD    1 
ATOM   8691  C CE    . LYS F 5 83  ? 87.948  94.341  -21.845 1.00 74.74  ? 1282 LYS D CE    1 
ATOM   8692  N NZ    . LYS F 5 83  ? 89.380  94.517  -21.449 1.00 77.77  ? 1282 LYS D NZ    1 
ATOM   8693  N N     . ARG F 5 84  ? 81.523  98.037  -21.367 1.00 52.85  ? 1283 ARG D N     1 
ATOM   8694  C CA    . ARG F 5 84  ? 80.648  98.963  -20.670 1.00 53.05  ? 1283 ARG D CA    1 
ATOM   8695  C C     . ARG F 5 84  ? 79.400  98.169  -20.305 1.00 50.67  ? 1283 ARG D C     1 
ATOM   8696  O O     . ARG F 5 84  ? 78.931  97.351  -21.089 1.00 50.31  ? 1283 ARG D O     1 
ATOM   8697  C CB    . ARG F 5 84  ? 80.272  100.138 -21.578 1.00 85.32  ? 1283 ARG D CB    1 
ATOM   8698  C CG    . ARG F 5 84  ? 81.430  101.059 -21.945 1.00 92.88  ? 1283 ARG D CG    1 
ATOM   8699  C CD    . ARG F 5 84  ? 82.040  101.719 -20.712 1.00 99.20  ? 1283 ARG D CD    1 
ATOM   8700  N NE    . ARG F 5 84  ? 82.918  102.840 -21.050 1.00 105.94 ? 1283 ARG D NE    1 
ATOM   8701  C CZ    . ARG F 5 84  ? 84.054  102.734 -21.736 1.00 108.52 ? 1283 ARG D CZ    1 
ATOM   8702  N NH1   . ARG F 5 84  ? 84.469  101.550 -22.167 1.00 110.07 ? 1283 ARG D NH1   1 
ATOM   8703  N NH2   . ARG F 5 84  ? 84.775  103.816 -21.998 1.00 109.84 ? 1283 ARG D NH2   1 
ATOM   8704  N N     . SER F 5 85  ? 78.865  98.401  -19.114 1.00 47.40  ? 1284 SER D N     1 
ATOM   8705  C CA    . SER F 5 85  ? 77.669  97.682  -18.683 1.00 45.73  ? 1284 SER D CA    1 
ATOM   8706  C C     . SER F 5 85  ? 76.413  98.544  -18.828 1.00 43.82  ? 1284 SER D C     1 
ATOM   8707  O O     . SER F 5 85  ? 75.299  98.084  -18.594 1.00 41.88  ? 1284 SER D O     1 
ATOM   8708  C CB    . SER F 5 85  ? 77.835  97.240  -17.226 1.00 48.42  ? 1284 SER D CB    1 
ATOM   8709  O OG    . SER F 5 85  ? 78.163  98.344  -16.406 1.00 45.90  ? 1284 SER D OG    1 
ATOM   8710  N N     . THR F 5 86  ? 76.600  99.793  -19.231 1.00 43.71  ? 1285 THR D N     1 
ATOM   8711  C CA    . THR F 5 86  ? 75.479  100.712 -19.388 1.00 45.18  ? 1285 THR D CA    1 
ATOM   8712  C C     . THR F 5 86  ? 75.267  101.135 -20.839 1.00 43.74  ? 1285 THR D C     1 
ATOM   8713  O O     . THR F 5 86  ? 76.221  101.479 -21.536 1.00 43.77  ? 1285 THR D O     1 
ATOM   8714  C CB    . THR F 5 86  ? 75.704  102.015 -18.569 1.00 51.65  ? 1285 THR D CB    1 
ATOM   8715  O OG1   . THR F 5 86  ? 76.067  101.686 -17.225 1.00 54.08  ? 1285 THR D OG1   1 
ATOM   8716  C CG2   . THR F 5 86  ? 74.435  102.863 -18.557 1.00 50.50  ? 1285 THR D CG2   1 
ATOM   8717  N N     . ILE F 5 87  ? 74.018  101.095 -21.292 1.00 45.50  ? 1286 ILE D N     1 
ATOM   8718  C CA    . ILE F 5 87  ? 73.693  101.548 -22.637 1.00 44.57  ? 1286 ILE D CA    1 
ATOM   8719  C C     . ILE F 5 87  ? 73.180  102.974 -22.445 1.00 45.39  ? 1286 ILE D C     1 
ATOM   8720  O O     . ILE F 5 87  ? 72.156  103.189 -21.794 1.00 44.35  ? 1286 ILE D O     1 
ATOM   8721  C CB    . ILE F 5 87  ? 72.578  100.690 -23.306 1.00 39.25  ? 1286 ILE D CB    1 
ATOM   8722  C CG1   . ILE F 5 87  ? 73.167  99.381  -23.842 1.00 37.38  ? 1286 ILE D CG1   1 
ATOM   8723  C CG2   . ILE F 5 87  ? 71.950  101.458 -24.474 1.00 37.80  ? 1286 ILE D CG2   1 
ATOM   8724  C CD1   . ILE F 5 87  ? 72.121  98.421  -24.331 1.00 35.30  ? 1286 ILE D CD1   1 
ATOM   8725  N N     . THR F 5 88  ? 73.908  103.940 -22.989 1.00 41.94  ? 1287 THR D N     1 
ATOM   8726  C CA    . THR F 5 88  ? 73.520  105.340 -22.874 1.00 41.78  ? 1287 THR D CA    1 
ATOM   8727  C C     . THR F 5 88  ? 73.160  105.919 -24.245 1.00 41.34  ? 1287 THR D C     1 
ATOM   8728  O O     . THR F 5 88  ? 73.199  105.217 -25.269 1.00 39.94  ? 1287 THR D O     1 
ATOM   8729  C CB    . THR F 5 88  ? 74.664  106.193 -22.271 1.00 48.51  ? 1287 THR D CB    1 
ATOM   8730  O OG1   . THR F 5 88  ? 75.718  106.328 -23.236 1.00 47.91  ? 1287 THR D OG1   1 
ATOM   8731  C CG2   . THR F 5 88  ? 75.225  105.533 -20.997 1.00 47.47  ? 1287 THR D CG2   1 
ATOM   8732  N N     . SER F 5 89  ? 72.820  107.205 -24.265 1.00 42.00  ? 1288 SER D N     1 
ATOM   8733  C CA    . SER F 5 89  ? 72.456  107.862 -25.511 1.00 41.03  ? 1288 SER D CA    1 
ATOM   8734  C C     . SER F 5 89  ? 73.626  107.814 -26.479 1.00 40.09  ? 1288 SER D C     1 
ATOM   8735  O O     . SER F 5 89  ? 73.435  107.829 -27.689 1.00 41.06  ? 1288 SER D O     1 
ATOM   8736  C CB    . SER F 5 89  ? 72.038  109.307 -25.248 1.00 39.23  ? 1288 SER D CB    1 
ATOM   8737  O OG    . SER F 5 89  ? 73.090  110.012 -24.630 1.00 41.66  ? 1288 SER D OG    1 
ATOM   8738  N N     . ARG F 5 90  ? 74.840  107.736 -25.946 1.00 39.37  ? 1289 ARG D N     1 
ATOM   8739  C CA    . ARG F 5 90  ? 76.026  107.671 -26.790 1.00 40.55  ? 1289 ARG D CA    1 
ATOM   8740  C C     . ARG F 5 90  ? 76.122  106.345 -27.572 1.00 40.46  ? 1289 ARG D C     1 
ATOM   8741  O O     . ARG F 5 90  ? 76.569  106.337 -28.724 1.00 38.16  ? 1289 ARG D O     1 
ATOM   8742  C CB    . ARG F 5 90  ? 77.284  107.876 -25.944 1.00 48.55  ? 1289 ARG D CB    1 
ATOM   8743  C CG    . ARG F 5 90  ? 78.547  108.051 -26.767 1.00 52.12  ? 1289 ARG D CG    1 
ATOM   8744  C CD    . ARG F 5 90  ? 79.644  108.748 -25.962 1.00 54.69  ? 1289 ARG D CD    1 
ATOM   8745  N NE    . ARG F 5 90  ? 80.860  108.919 -26.756 1.00 55.32  ? 1289 ARG D NE    1 
ATOM   8746  C CZ    . ARG F 5 90  ? 81.696  107.932 -27.060 1.00 54.51  ? 1289 ARG D CZ    1 
ATOM   8747  N NH1   . ARG F 5 90  ? 81.453  106.704 -26.628 1.00 53.02  ? 1289 ARG D NH1   1 
ATOM   8748  N NH2   . ARG F 5 90  ? 82.763  108.172 -27.810 1.00 53.86  ? 1289 ARG D NH2   1 
ATOM   8749  N N     . GLU F 5 91  ? 75.712  105.230 -26.959 1.00 42.62  ? 1290 GLU D N     1 
ATOM   8750  C CA    . GLU F 5 91  ? 75.757  103.949 -27.666 1.00 42.55  ? 1290 GLU D CA    1 
ATOM   8751  C C     . GLU F 5 91  ? 74.632  103.961 -28.702 1.00 41.55  ? 1290 GLU D C     1 
ATOM   8752  O O     . GLU F 5 91  ? 74.814  103.488 -29.829 1.00 39.04  ? 1290 GLU D O     1 
ATOM   8753  C CB    . GLU F 5 91  ? 75.564  102.738 -26.733 1.00 42.74  ? 1290 GLU D CB    1 
ATOM   8754  C CG    . GLU F 5 91  ? 75.923  102.920 -25.246 1.00 52.26  ? 1290 GLU D CG    1 
ATOM   8755  C CD    . GLU F 5 91  ? 77.309  103.476 -24.989 1.00 53.15  ? 1290 GLU D CD    1 
ATOM   8756  O OE1   . GLU F 5 91  ? 78.306  102.913 -25.477 1.00 57.86  ? 1290 GLU D OE1   1 
ATOM   8757  O OE2   . GLU F 5 91  ? 77.398  104.489 -24.274 1.00 58.67  ? 1290 GLU D OE2   1 
ATOM   8758  N N     . ILE F 5 92  ? 73.474  104.511 -28.324 1.00 38.29  ? 1291 ILE D N     1 
ATOM   8759  C CA    . ILE F 5 92  ? 72.347  104.575 -29.249 1.00 36.96  ? 1291 ILE D CA    1 
ATOM   8760  C C     . ILE F 5 92  ? 72.754  105.392 -30.474 1.00 36.59  ? 1291 ILE D C     1 
ATOM   8761  O O     . ILE F 5 92  ? 72.419  105.040 -31.607 1.00 34.24  ? 1291 ILE D O     1 
ATOM   8762  C CB    . ILE F 5 92  ? 71.105  105.240 -28.604 1.00 36.21  ? 1291 ILE D CB    1 
ATOM   8763  C CG1   . ILE F 5 92  ? 70.662  104.455 -27.362 1.00 36.60  ? 1291 ILE D CG1   1 
ATOM   8764  C CG2   . ILE F 5 92  ? 69.974  105.338 -29.627 1.00 31.95  ? 1291 ILE D CG2   1 
ATOM   8765  C CD1   . ILE F 5 92  ? 70.187  103.030 -27.622 1.00 35.27  ? 1291 ILE D CD1   1 
ATOM   8766  N N     . GLN F 5 93  ? 73.502  106.471 -30.242 1.00 36.36  ? 1292 GLN D N     1 
ATOM   8767  C CA    . GLN F 5 93  ? 73.944  107.343 -31.332 1.00 36.90  ? 1292 GLN D CA    1 
ATOM   8768  C C     . GLN F 5 93  ? 74.904  106.653 -32.298 1.00 35.33  ? 1292 GLN D C     1 
ATOM   8769  O O     . GLN F 5 93  ? 74.773  106.778 -33.515 1.00 34.43  ? 1292 GLN D O     1 
ATOM   8770  C CB    . GLN F 5 93  ? 74.603  108.613 -30.786 1.00 37.69  ? 1292 GLN D CB    1 
ATOM   8771  C CG    . GLN F 5 93  ? 75.083  109.550 -31.892 1.00 41.52  ? 1292 GLN D CG    1 
ATOM   8772  C CD    . GLN F 5 93  ? 75.358  110.975 -31.404 1.00 44.01  ? 1292 GLN D CD    1 
ATOM   8773  O OE1   . GLN F 5 93  ? 76.483  111.322 -31.051 1.00 46.36  ? 1292 GLN D OE1   1 
ATOM   8774  N NE2   . GLN F 5 93  ? 74.324  111.794 -31.382 1.00 40.92  ? 1292 GLN D NE2   1 
ATOM   8775  N N     . THR F 5 94  ? 75.883  105.945 -31.756 1.00 34.53  ? 1293 THR D N     1 
ATOM   8776  C CA    . THR F 5 94  ? 76.832  105.238 -32.596 1.00 34.85  ? 1293 THR D CA    1 
ATOM   8777  C C     . THR F 5 94  ? 76.087  104.153 -33.379 1.00 33.70  ? 1293 THR D C     1 
ATOM   8778  O O     . THR F 5 94  ? 76.337  103.954 -34.562 1.00 33.49  ? 1293 THR D O     1 
ATOM   8779  C CB    . THR F 5 94  ? 77.928  104.584 -31.745 1.00 44.31  ? 1293 THR D CB    1 
ATOM   8780  O OG1   . THR F 5 94  ? 78.673  105.602 -31.065 1.00 44.00  ? 1293 THR D OG1   1 
ATOM   8781  C CG2   . THR F 5 94  ? 78.875  103.756 -32.624 1.00 43.00  ? 1293 THR D CG2   1 
ATOM   8782  N N     . ALA F 5 95  ? 75.167  103.460 -32.711 1.00 34.06  ? 1294 ALA D N     1 
ATOM   8783  C CA    . ALA F 5 95  ? 74.397  102.403 -33.351 1.00 36.48  ? 1294 ALA D CA    1 
ATOM   8784  C C     . ALA F 5 95  ? 73.622  102.977 -34.534 1.00 39.30  ? 1294 ALA D C     1 
ATOM   8785  O O     . ALA F 5 95  ? 73.581  102.374 -35.613 1.00 38.96  ? 1294 ALA D O     1 
ATOM   8786  C CB    . ALA F 5 95  ? 73.438  101.760 -32.348 1.00 24.88  ? 1294 ALA D CB    1 
ATOM   8787  N N     . VAL F 5 96  ? 73.016  104.148 -34.335 1.00 36.91  ? 1295 VAL D N     1 
ATOM   8788  C CA    . VAL F 5 96  ? 72.258  104.798 -35.404 1.00 36.42  ? 1295 VAL D CA    1 
ATOM   8789  C C     . VAL F 5 96  ? 73.161  105.106 -36.594 1.00 36.22  ? 1295 VAL D C     1 
ATOM   8790  O O     . VAL F 5 96  ? 72.751  104.984 -37.746 1.00 35.47  ? 1295 VAL D O     1 
ATOM   8791  C CB    . VAL F 5 96  ? 71.612  106.107 -34.910 1.00 42.55  ? 1295 VAL D CB    1 
ATOM   8792  C CG1   . VAL F 5 96  ? 71.109  106.919 -36.094 1.00 42.00  ? 1295 VAL D CG1   1 
ATOM   8793  C CG2   . VAL F 5 96  ? 70.473  105.792 -33.952 1.00 40.31  ? 1295 VAL D CG2   1 
ATOM   8794  N N     . ARG F 5 97  ? 74.399  105.488 -36.315 1.00 38.00  ? 1296 ARG D N     1 
ATOM   8795  C CA    . ARG F 5 97  ? 75.347  105.805 -37.375 1.00 41.32  ? 1296 ARG D CA    1 
ATOM   8796  C C     . ARG F 5 97  ? 75.781  104.575 -38.175 1.00 40.26  ? 1296 ARG D C     1 
ATOM   8797  O O     . ARG F 5 97  ? 76.021  104.675 -39.384 1.00 38.30  ? 1296 ARG D O     1 
ATOM   8798  C CB    . ARG F 5 97  ? 76.568  106.515 -36.791 1.00 46.68  ? 1296 ARG D CB    1 
ATOM   8799  C CG    . ARG F 5 97  ? 76.335  108.002 -36.583 1.00 54.17  ? 1296 ARG D CG    1 
ATOM   8800  C CD    . ARG F 5 97  ? 77.463  108.639 -35.802 1.00 59.09  ? 1296 ARG D CD    1 
ATOM   8801  N NE    . ARG F 5 97  ? 77.299  110.083 -35.674 1.00 64.21  ? 1296 ARG D NE    1 
ATOM   8802  C CZ    . ARG F 5 97  ? 77.868  110.817 -34.720 1.00 67.99  ? 1296 ARG D CZ    1 
ATOM   8803  N NH1   . ARG F 5 97  ? 78.645  110.247 -33.800 1.00 68.01  ? 1296 ARG D NH1   1 
ATOM   8804  N NH2   . ARG F 5 97  ? 77.657  112.127 -34.679 1.00 69.77  ? 1296 ARG D NH2   1 
ATOM   8805  N N     . LEU F 5 98  ? 75.875  103.430 -37.494 1.00 39.91  ? 1297 LEU D N     1 
ATOM   8806  C CA    . LEU F 5 98  ? 76.251  102.163 -38.125 1.00 40.48  ? 1297 LEU D CA    1 
ATOM   8807  C C     . LEU F 5 98  ? 75.079  101.568 -38.887 1.00 40.36  ? 1297 LEU D C     1 
ATOM   8808  O O     . LEU F 5 98  ? 75.274  100.882 -39.885 1.00 41.10  ? 1297 LEU D O     1 
ATOM   8809  C CB    . LEU F 5 98  ? 76.686  101.129 -37.079 1.00 34.20  ? 1297 LEU D CB    1 
ATOM   8810  C CG    . LEU F 5 98  ? 77.962  101.397 -36.283 1.00 34.66  ? 1297 LEU D CG    1 
ATOM   8811  C CD1   . LEU F 5 98  ? 77.966  100.529 -35.034 1.00 33.64  ? 1297 LEU D CD1   1 
ATOM   8812  C CD2   . LEU F 5 98  ? 79.182  101.116 -37.147 1.00 30.97  ? 1297 LEU D CD2   1 
ATOM   8813  N N     . LEU F 5 99  ? 73.864  101.833 -38.412 1.00 39.70  ? 1298 LEU D N     1 
ATOM   8814  C CA    . LEU F 5 99  ? 72.660  101.274 -39.022 1.00 39.70  ? 1298 LEU D CA    1 
ATOM   8815  C C     . LEU F 5 99  ? 72.003  102.041 -40.175 1.00 40.22  ? 1298 LEU D C     1 
ATOM   8816  O O     . LEU F 5 99  ? 71.568  101.432 -41.148 1.00 41.02  ? 1298 LEU D O     1 
ATOM   8817  C CB    . LEU F 5 99  ? 71.604  101.039 -37.940 1.00 39.53  ? 1298 LEU D CB    1 
ATOM   8818  C CG    . LEU F 5 99  ? 71.365  99.649  -37.329 1.00 44.88  ? 1298 LEU D CG    1 
ATOM   8819  C CD1   . LEU F 5 99  ? 72.259  98.596  -37.976 1.00 42.38  ? 1298 LEU D CD1   1 
ATOM   8820  C CD2   . LEU F 5 99  ? 71.599  99.720  -35.816 1.00 42.14  ? 1298 LEU D CD2   1 
ATOM   8821  N N     . LEU F 5 100 ? 71.918  103.365 -40.075 1.00 36.86  ? 1299 LEU D N     1 
ATOM   8822  C CA    . LEU F 5 100 ? 71.254  104.129 -41.113 1.00 36.94  ? 1299 LEU D CA    1 
ATOM   8823  C C     . LEU F 5 100 ? 72.153  104.656 -42.211 1.00 38.19  ? 1299 LEU D C     1 
ATOM   8824  O O     . LEU F 5 100 ? 73.330  104.930 -41.995 1.00 39.75  ? 1299 LEU D O     1 
ATOM   8825  C CB    . LEU F 5 100 ? 70.476  105.298 -40.501 1.00 33.43  ? 1299 LEU D CB    1 
ATOM   8826  C CG    . LEU F 5 100 ? 69.570  104.987 -39.305 1.00 37.03  ? 1299 LEU D CG    1 
ATOM   8827  C CD1   . LEU F 5 100 ? 68.745  106.220 -38.959 1.00 35.21  ? 1299 LEU D CD1   1 
ATOM   8828  C CD2   . LEU F 5 100 ? 68.651  103.826 -39.617 1.00 36.66  ? 1299 LEU D CD2   1 
ATOM   8829  N N     . PRO F 5 101 ? 71.602  104.785 -43.424 1.00 46.48  ? 1300 PRO D N     1 
ATOM   8830  C CA    . PRO F 5 101 ? 72.287  105.284 -44.622 1.00 47.66  ? 1300 PRO D CA    1 
ATOM   8831  C C     . PRO F 5 101 ? 72.455  106.808 -44.549 1.00 49.17  ? 1300 PRO D C     1 
ATOM   8832  O O     . PRO F 5 101 ? 71.535  107.521 -44.151 1.00 51.13  ? 1300 PRO D O     1 
ATOM   8833  C CB    . PRO F 5 101 ? 71.340  104.898 -45.755 1.00 38.86  ? 1300 PRO D CB    1 
ATOM   8834  C CG    . PRO F 5 101 ? 70.564  103.748 -45.208 1.00 40.88  ? 1300 PRO D CG    1 
ATOM   8835  C CD    . PRO F 5 101 ? 70.324  104.151 -43.783 1.00 39.92  ? 1300 PRO D CD    1 
ATOM   8836  N N     . GLY F 5 102 ? 73.628  107.283 -44.947 1.00 48.57  ? 1301 GLY D N     1 
ATOM   8837  C CA    . GLY F 5 102 ? 73.949  108.703 -44.953 1.00 48.02  ? 1301 GLY D CA    1 
ATOM   8838  C C     . GLY F 5 102 ? 73.000  109.769 -44.432 1.00 48.11  ? 1301 GLY D C     1 
ATOM   8839  O O     . GLY F 5 102 ? 73.112  110.197 -43.282 1.00 48.46  ? 1301 GLY D O     1 
ATOM   8840  N N     . GLU F 5 103 ? 72.081  110.220 -45.280 1.00 44.84  ? 1302 GLU D N     1 
ATOM   8841  C CA    . GLU F 5 103 ? 71.140  111.274 -44.917 1.00 45.71  ? 1302 GLU D CA    1 
ATOM   8842  C C     . GLU F 5 103 ? 70.209  110.967 -43.735 1.00 45.10  ? 1302 GLU D C     1 
ATOM   8843  O O     . GLU F 5 103 ? 69.987  111.831 -42.884 1.00 46.37  ? 1302 GLU D O     1 
ATOM   8844  C CB    . GLU F 5 103 ? 70.316  111.665 -46.141 1.00 70.14  ? 1302 GLU D CB    1 
ATOM   8845  C CG    . GLU F 5 103 ? 69.859  113.105 -46.134 1.00 78.14  ? 1302 GLU D CG    1 
ATOM   8846  C CD    . GLU F 5 103 ? 71.017  114.075 -45.940 1.00 84.52  ? 1302 GLU D CD    1 
ATOM   8847  O OE1   . GLU F 5 103 ? 72.033  113.948 -46.659 1.00 86.25  ? 1302 GLU D OE1   1 
ATOM   8848  O OE2   . GLU F 5 103 ? 70.910  114.969 -45.071 1.00 87.41  ? 1302 GLU D OE2   1 
ATOM   8849  N N     . LEU F 5 104 ? 69.652  109.760 -43.682 1.00 41.01  ? 1303 LEU D N     1 
ATOM   8850  C CA    . LEU F 5 104 ? 68.764  109.388 -42.583 1.00 38.60  ? 1303 LEU D CA    1 
ATOM   8851  C C     . LEU F 5 104 ? 69.513  109.452 -41.265 1.00 38.85  ? 1303 LEU D C     1 
ATOM   8852  O O     . LEU F 5 104 ? 68.977  109.921 -40.260 1.00 38.48  ? 1303 LEU D O     1 
ATOM   8853  C CB    . LEU F 5 104 ? 68.215  107.964 -42.760 1.00 35.30  ? 1303 LEU D CB    1 
ATOM   8854  C CG    . LEU F 5 104 ? 67.122  107.733 -43.805 1.00 34.47  ? 1303 LEU D CG    1 
ATOM   8855  C CD1   . LEU F 5 104 ? 66.781  106.226 -43.903 1.00 30.75  ? 1303 LEU D CD1   1 
ATOM   8856  C CD2   . LEU F 5 104 ? 65.896  108.549 -43.414 1.00 31.06  ? 1303 LEU D CD2   1 
ATOM   8857  N N     . ALA F 5 105 ? 70.752  108.973 -41.271 1.00 41.03  ? 1304 ALA D N     1 
ATOM   8858  C CA    . ALA F 5 105 ? 71.558  108.967 -40.063 1.00 43.60  ? 1304 ALA D CA    1 
ATOM   8859  C C     . ALA F 5 105 ? 71.699  110.386 -39.517 1.00 45.43  ? 1304 ALA D C     1 
ATOM   8860  O O     . ALA F 5 105 ? 71.371  110.642 -38.348 1.00 45.49  ? 1304 ALA D O     1 
ATOM   8861  C CB    . ALA F 5 105 ? 72.940  108.350 -40.352 1.00 31.61  ? 1304 ALA D CB    1 
ATOM   8862  N N     . LYS F 5 106 ? 72.162  111.304 -40.368 1.00 45.73  ? 1305 LYS D N     1 
ATOM   8863  C CA    . LYS F 5 106 ? 72.345  112.708 -39.977 1.00 47.33  ? 1305 LYS D CA    1 
ATOM   8864  C C     . LYS F 5 106 ? 71.110  113.301 -39.308 1.00 46.47  ? 1305 LYS D C     1 
ATOM   8865  O O     . LYS F 5 106 ? 71.202  113.903 -38.242 1.00 46.80  ? 1305 LYS D O     1 
ATOM   8866  C CB    . LYS F 5 106 ? 72.728  113.567 -41.190 1.00 74.35  ? 1305 LYS D CB    1 
ATOM   8867  C CG    . LYS F 5 106 ? 74.135  113.296 -41.707 1.00 81.50  ? 1305 LYS D CG    1 
ATOM   8868  C CD    . LYS F 5 106 ? 74.630  114.378 -42.673 1.00 86.26  ? 1305 LYS D CD    1 
ATOM   8869  C CE    . LYS F 5 106 ? 73.832  114.416 -43.973 1.00 90.07  ? 1305 LYS D CE    1 
ATOM   8870  N NZ    . LYS F 5 106 ? 74.443  115.333 -44.987 1.00 90.88  ? 1305 LYS D NZ    1 
ATOM   8871  N N     . HIS F 5 107 ? 69.953  113.125 -39.931 1.00 43.26  ? 1306 HIS D N     1 
ATOM   8872  C CA    . HIS F 5 107 ? 68.722  113.650 -39.369 1.00 43.38  ? 1306 HIS D CA    1 
ATOM   8873  C C     . HIS F 5 107 ? 68.295  112.904 -38.100 1.00 42.29  ? 1306 HIS D C     1 
ATOM   8874  O O     . HIS F 5 107 ? 67.740  113.515 -37.176 1.00 39.71  ? 1306 HIS D O     1 
ATOM   8875  C CB    . HIS F 5 107 ? 67.615  113.603 -40.422 1.00 58.97  ? 1306 HIS D CB    1 
ATOM   8876  C CG    . HIS F 5 107 ? 67.797  114.595 -41.530 1.00 65.52  ? 1306 HIS D CG    1 
ATOM   8877  N ND1   . HIS F 5 107 ? 67.356  114.367 -42.817 1.00 67.83  ? 1306 HIS D ND1   1 
ATOM   8878  C CD2   . HIS F 5 107 ? 68.354  115.830 -41.537 1.00 66.43  ? 1306 HIS D CD2   1 
ATOM   8879  C CE1   . HIS F 5 107 ? 67.635  115.417 -43.569 1.00 67.48  ? 1306 HIS D CE1   1 
ATOM   8880  N NE2   . HIS F 5 107 ? 68.240  116.319 -42.816 1.00 68.94  ? 1306 HIS D NE2   1 
ATOM   8881  N N     . ALA F 5 108 ? 68.545  111.592 -38.049 1.00 39.90  ? 1307 ALA D N     1 
ATOM   8882  C CA    . ALA F 5 108 ? 68.183  110.830 -36.855 1.00 40.02  ? 1307 ALA D CA    1 
ATOM   8883  C C     . ALA F 5 108 ? 69.045  111.352 -35.710 1.00 38.89  ? 1307 ALA D C     1 
ATOM   8884  O O     . ALA F 5 108 ? 68.546  111.600 -34.626 1.00 38.71  ? 1307 ALA D O     1 
ATOM   8885  C CB    . ALA F 5 108 ? 68.414  109.298 -37.056 1.00 24.64  ? 1307 ALA D CB    1 
ATOM   8886  N N     . VAL F 5 109 ? 70.337  111.524 -35.964 1.00 43.34  ? 1308 VAL D N     1 
ATOM   8887  C CA    . VAL F 5 109 ? 71.256  112.028 -34.950 1.00 46.24  ? 1308 VAL D CA    1 
ATOM   8888  C C     . VAL F 5 109 ? 70.808  113.379 -34.390 1.00 47.66  ? 1308 VAL D C     1 
ATOM   8889  O O     . VAL F 5 109 ? 70.890  113.608 -33.182 1.00 48.76  ? 1308 VAL D O     1 
ATOM   8890  C CB    . VAL F 5 109 ? 72.681  112.163 -35.518 1.00 45.43  ? 1308 VAL D CB    1 
ATOM   8891  C CG1   . VAL F 5 109 ? 73.593  112.893 -34.516 1.00 42.81  ? 1308 VAL D CG1   1 
ATOM   8892  C CG2   . VAL F 5 109 ? 73.230  110.779 -35.815 1.00 43.18  ? 1308 VAL D CG2   1 
ATOM   8893  N N     . SER F 5 110 ? 70.330  114.262 -35.265 1.00 44.65  ? 1309 SER D N     1 
ATOM   8894  C CA    . SER F 5 110 ? 69.849  115.578 -34.842 1.00 46.41  ? 1309 SER D CA    1 
ATOM   8895  C C     . SER F 5 110 ? 68.602  115.478 -33.975 1.00 45.43  ? 1309 SER D C     1 
ATOM   8896  O O     . SER F 5 110 ? 68.530  116.097 -32.918 1.00 47.08  ? 1309 SER D O     1 
ATOM   8897  C CB    . SER F 5 110 ? 69.533  116.459 -36.056 1.00 47.59  ? 1309 SER D CB    1 
ATOM   8898  O OG    . SER F 5 110 ? 70.723  116.766 -36.749 1.00 52.36  ? 1309 SER D OG    1 
ATOM   8899  N N     . GLU F 5 111 ? 67.608  114.726 -34.434 1.00 38.93  ? 1310 GLU D N     1 
ATOM   8900  C CA    . GLU F 5 111 ? 66.383  114.560 -33.662 1.00 40.04  ? 1310 GLU D CA    1 
ATOM   8901  C C     . GLU F 5 111 ? 66.747  113.943 -32.307 1.00 39.70  ? 1310 GLU D C     1 
ATOM   8902  O O     . GLU F 5 111 ? 66.215  114.341 -31.264 1.00 38.62  ? 1310 GLU D O     1 
ATOM   8903  C CB    . GLU F 5 111 ? 65.405  113.635 -34.391 1.00 54.22  ? 1310 GLU D CB    1 
ATOM   8904  C CG    . GLU F 5 111 ? 64.869  114.162 -35.721 1.00 61.13  ? 1310 GLU D CG    1 
ATOM   8905  C CD    . GLU F 5 111 ? 63.591  114.983 -35.573 1.00 65.76  ? 1310 GLU D CD    1 
ATOM   8906  O OE1   . GLU F 5 111 ? 63.662  116.131 -35.077 1.00 67.56  ? 1310 GLU D OE1   1 
ATOM   8907  O OE2   . GLU F 5 111 ? 62.511  114.471 -35.952 1.00 66.64  ? 1310 GLU D OE2   1 
ATOM   8908  N N     . GLY F 5 112 ? 67.648  112.965 -32.331 1.00 40.55  ? 1311 GLY D N     1 
ATOM   8909  C CA    . GLY F 5 112 ? 68.056  112.308 -31.104 1.00 42.34  ? 1311 GLY D CA    1 
ATOM   8910  C C     . GLY F 5 112 ? 68.738  113.239 -30.113 1.00 41.45  ? 1311 GLY D C     1 
ATOM   8911  O O     . GLY F 5 112 ? 68.333  113.324 -28.957 1.00 40.83  ? 1311 GLY D O     1 
ATOM   8912  N N     . THR F 5 113 ? 69.785  113.920 -30.563 1.00 46.41  ? 1312 THR D N     1 
ATOM   8913  C CA    . THR F 5 113 ? 70.527  114.852 -29.723 1.00 47.31  ? 1312 THR D CA    1 
ATOM   8914  C C     . THR F 5 113 ? 69.574  115.924 -29.186 1.00 47.64  ? 1312 THR D C     1 
ATOM   8915  O O     . THR F 5 113 ? 69.618  116.291 -28.016 1.00 47.15  ? 1312 THR D O     1 
ATOM   8916  C CB    . THR F 5 113 ? 71.645  115.545 -30.529 1.00 43.90  ? 1312 THR D CB    1 
ATOM   8917  O OG1   . THR F 5 113 ? 72.522  114.554 -31.090 1.00 43.64  ? 1312 THR D OG1   1 
ATOM   8918  C CG2   . THR F 5 113 ? 72.443  116.485 -29.627 1.00 41.34  ? 1312 THR D CG2   1 
ATOM   8919  N N     . LYS F 5 114 ? 68.700  116.400 -30.062 1.00 46.18  ? 1313 LYS D N     1 
ATOM   8920  C CA    . LYS F 5 114 ? 67.728  117.423 -29.718 1.00 46.93  ? 1313 LYS D CA    1 
ATOM   8921  C C     . LYS F 5 114 ? 66.783  116.955 -28.608 1.00 45.65  ? 1313 LYS D C     1 
ATOM   8922  O O     . LYS F 5 114 ? 66.528  117.687 -27.646 1.00 45.24  ? 1313 LYS D O     1 
ATOM   8923  C CB    . LYS F 5 114 ? 66.937  117.792 -30.975 1.00 63.40  ? 1313 LYS D CB    1 
ATOM   8924  C CG    . LYS F 5 114 ? 65.941  118.914 -30.836 1.00 68.21  ? 1313 LYS D CG    1 
ATOM   8925  C CD    . LYS F 5 114 ? 65.286  119.177 -32.192 1.00 74.32  ? 1313 LYS D CD    1 
ATOM   8926  C CE    . LYS F 5 114 ? 64.211  120.249 -32.117 1.00 78.65  ? 1313 LYS D CE    1 
ATOM   8927  N NZ    . LYS F 5 114 ? 63.065  119.855 -31.249 1.00 83.04  ? 1313 LYS D NZ    1 
ATOM   8928  N N     . ALA F 5 115 ? 66.258  115.740 -28.732 1.00 39.41  ? 1314 ALA D N     1 
ATOM   8929  C CA    . ALA F 5 115 ? 65.345  115.245 -27.714 1.00 37.52  ? 1314 ALA D CA    1 
ATOM   8930  C C     . ALA F 5 115 ? 66.060  115.064 -26.365 1.00 37.86  ? 1314 ALA D C     1 
ATOM   8931  O O     . ALA F 5 115 ? 65.453  115.251 -25.316 1.00 36.63  ? 1314 ALA D O     1 
ATOM   8932  C CB    . ALA F 5 115 ? 64.717  113.932 -28.162 1.00 34.07  ? 1314 ALA D CB    1 
ATOM   8933  N N     . VAL F 5 116 ? 67.344  114.717 -26.387 1.00 37.23  ? 1315 VAL D N     1 
ATOM   8934  C CA    . VAL F 5 116 ? 68.072  114.507 -25.140 1.00 40.62  ? 1315 VAL D CA    1 
ATOM   8935  C C     . VAL F 5 116 ? 68.438  115.847 -24.492 1.00 42.70  ? 1315 VAL D C     1 
ATOM   8936  O O     . VAL F 5 116 ? 68.281  116.020 -23.286 1.00 41.94  ? 1315 VAL D O     1 
ATOM   8937  C CB    . VAL F 5 116 ? 69.358  113.651 -25.359 1.00 40.85  ? 1315 VAL D CB    1 
ATOM   8938  C CG1   . VAL F 5 116 ? 70.123  113.499 -24.041 1.00 38.31  ? 1315 VAL D CG1   1 
ATOM   8939  C CG2   . VAL F 5 116 ? 68.976  112.260 -25.895 1.00 40.40  ? 1315 VAL D CG2   1 
ATOM   8940  N N     . THR F 5 117 ? 68.918  116.786 -25.293 1.00 46.22  ? 1316 THR D N     1 
ATOM   8941  C CA    . THR F 5 117 ? 69.255  118.104 -24.779 1.00 49.91  ? 1316 THR D CA    1 
ATOM   8942  C C     . THR F 5 117 ? 68.018  118.711 -24.106 1.00 49.48  ? 1316 THR D C     1 
ATOM   8943  O O     . THR F 5 117 ? 68.098  119.229 -22.997 1.00 50.67  ? 1316 THR D O     1 
ATOM   8944  C CB    . THR F 5 117 ? 69.722  119.043 -25.903 1.00 52.67  ? 1316 THR D CB    1 
ATOM   8945  O OG1   . THR F 5 117 ? 70.881  118.484 -26.537 1.00 54.66  ? 1316 THR D OG1   1 
ATOM   8946  C CG2   . THR F 5 117 ? 70.081  120.409 -25.335 1.00 54.70  ? 1316 THR D CG2   1 
ATOM   8947  N N     . LYS F 5 118 ? 66.870  118.622 -24.767 1.00 45.86  ? 1317 LYS D N     1 
ATOM   8948  C CA    . LYS F 5 118 ? 65.642  119.163 -24.206 1.00 46.74  ? 1317 LYS D CA    1 
ATOM   8949  C C     . LYS F 5 118 ? 65.169  118.381 -22.985 1.00 47.97  ? 1317 LYS D C     1 
ATOM   8950  O O     . LYS F 5 118 ? 64.678  118.963 -22.012 1.00 47.83  ? 1317 LYS D O     1 
ATOM   8951  C CB    . LYS F 5 118 ? 64.526  119.182 -25.254 1.00 52.85  ? 1317 LYS D CB    1 
ATOM   8952  C CG    . LYS F 5 118 ? 63.186  119.593 -24.665 1.00 55.21  ? 1317 LYS D CG    1 
ATOM   8953  C CD    . LYS F 5 118 ? 62.086  119.809 -25.694 1.00 57.33  ? 1317 LYS D CD    1 
ATOM   8954  C CE    . LYS F 5 118 ? 60.786  120.161 -24.969 1.00 59.74  ? 1317 LYS D CE    1 
ATOM   8955  N NZ    . LYS F 5 118 ? 59.648  120.455 -25.878 1.00 64.21  ? 1317 LYS D NZ    1 
ATOM   8956  N N     . TYR F 5 119 ? 65.294  117.059 -23.041 1.00 44.55  ? 1318 TYR D N     1 
ATOM   8957  C CA    . TYR F 5 119 ? 64.871  116.222 -21.927 1.00 45.80  ? 1318 TYR D CA    1 
ATOM   8958  C C     . TYR F 5 119 ? 65.685  116.586 -20.682 1.00 47.40  ? 1318 TYR D C     1 
ATOM   8959  O O     . TYR F 5 119 ? 65.164  116.627 -19.571 1.00 45.10  ? 1318 TYR D O     1 
ATOM   8960  C CB    . TYR F 5 119 ? 65.090  114.749 -22.269 1.00 52.91  ? 1318 TYR D CB    1 
ATOM   8961  C CG    . TYR F 5 119 ? 64.840  113.811 -21.117 1.00 52.09  ? 1318 TYR D CG    1 
ATOM   8962  C CD1   . TYR F 5 119 ? 63.544  113.468 -20.738 1.00 51.28  ? 1318 TYR D CD1   1 
ATOM   8963  C CD2   . TYR F 5 119 ? 65.907  113.278 -20.389 1.00 52.10  ? 1318 TYR D CD2   1 
ATOM   8964  C CE1   . TYR F 5 119 ? 63.315  112.617 -19.662 1.00 52.27  ? 1318 TYR D CE1   1 
ATOM   8965  C CE2   . TYR F 5 119 ? 65.689  112.431 -19.313 1.00 53.56  ? 1318 TYR D CE2   1 
ATOM   8966  C CZ    . TYR F 5 119 ? 64.393  112.105 -18.955 1.00 54.46  ? 1318 TYR D CZ    1 
ATOM   8967  O OH    . TYR F 5 119 ? 64.178  111.271 -17.884 1.00 58.20  ? 1318 TYR D OH    1 
ATOM   8968  N N     . THR F 5 120 ? 66.969  116.850 -20.892 1.00 51.00  ? 1319 THR D N     1 
ATOM   8969  C CA    . THR F 5 120 ? 67.877  117.201 -19.818 1.00 57.20  ? 1319 THR D CA    1 
ATOM   8970  C C     . THR F 5 120 ? 67.654  118.599 -19.238 1.00 59.00  ? 1319 THR D C     1 
ATOM   8971  O O     . THR F 5 120 ? 67.991  118.844 -18.078 1.00 59.32  ? 1319 THR D O     1 
ATOM   8972  C CB    . THR F 5 120 ? 69.332  117.093 -20.299 1.00 82.28  ? 1319 THR D CB    1 
ATOM   8973  O OG1   . THR F 5 120 ? 69.604  115.736 -20.669 1.00 86.26  ? 1319 THR D OG1   1 
ATOM   8974  C CG2   . THR F 5 120 ? 70.297  117.517 -19.205 1.00 84.66  ? 1319 THR D CG2   1 
ATOM   8975  N N     . SER F 5 121 ? 67.087  119.506 -20.032 1.00 49.53  ? 1320 SER D N     1 
ATOM   8976  C CA    . SER F 5 121 ? 66.844  120.875 -19.578 1.00 52.59  ? 1320 SER D CA    1 
ATOM   8977  C C     . SER F 5 121 ? 65.674  120.976 -18.604 1.00 55.30  ? 1320 SER D C     1 
ATOM   8978  O O     . SER F 5 121 ? 65.503  121.997 -17.938 1.00 56.70  ? 1320 SER D O     1 
ATOM   8979  C CB    . SER F 5 121 ? 66.579  121.799 -20.771 1.00 58.67  ? 1320 SER D CB    1 
ATOM   8980  O OG    . SER F 5 121 ? 65.311  121.529 -21.352 1.00 55.83  ? 1320 SER D OG    1 
ATOM   8981  N N     . SER F 5 122 ? 64.875  119.918 -18.509 1.00 55.10  ? 1321 SER D N     1 
ATOM   8982  C CA    . SER F 5 122 ? 63.717  119.932 -17.617 1.00 61.14  ? 1321 SER D CA    1 
ATOM   8983  C C     . SER F 5 122 ? 63.920  119.182 -16.293 1.00 66.01  ? 1321 SER D C     1 
ATOM   8984  O O     . SER F 5 122 ? 64.773  118.300 -16.186 1.00 63.64  ? 1321 SER D O     1 
ATOM   8985  C CB    . SER F 5 122 ? 62.499  119.365 -18.351 1.00 61.42  ? 1321 SER D CB    1 
ATOM   8986  O OG    . SER F 5 122 ? 62.763  118.056 -18.827 1.00 61.81  ? 1321 SER D OG    1 
ATOM   8987  N N     . LYS F 5 123 ? 63.126  119.554 -15.292 1.00 135.37 ? 1322 LYS D N     1 
ATOM   8988  C CA    . LYS F 5 123 ? 63.184  118.946 -13.965 1.00 139.72 ? 1322 LYS D CA    1 
ATOM   8989  C C     . LYS F 5 123 ? 64.565  119.093 -13.320 1.00 141.03 ? 1322 LYS D C     1 
ATOM   8990  O O     . LYS F 5 123 ? 65.218  118.057 -13.061 1.00 141.41 ? 1322 LYS D O     1 
ATOM   8991  C CB    . LYS F 5 123 ? 62.794  117.465 -14.048 1.00 99.92  ? 1322 LYS D CB    1 
ATOM   8992  C CG    . LYS F 5 123 ? 62.650  116.776 -12.698 1.00 106.28 ? 1322 LYS D CG    1 
ATOM   8993  C CD    . LYS F 5 123 ? 62.172  115.342 -12.860 1.00 107.97 ? 1322 LYS D CD    1 
ATOM   8994  C CE    . LYS F 5 123 ? 61.964  114.675 -11.511 1.00 109.51 ? 1322 LYS D CE    1 
ATOM   8995  N NZ    . LYS F 5 123 ? 61.395  113.305 -11.649 1.00 111.38 ? 1322 LYS D NZ    1 
ATOM   8996  O OXT   . LYS F 5 123 ? 64.981  120.248 -13.078 1.00 100.79 ? 1322 LYS D OXT   1 
ATOM   8997  N N     . PRO G 2 38  ? 39.194  87.871  -88.184 1.00 119.89 ? 638  PRO E N     1 
ATOM   8998  C CA    . PRO G 2 38  ? 39.815  87.375  -86.932 1.00 118.17 ? 638  PRO E CA    1 
ATOM   8999  C C     . PRO G 2 38  ? 41.020  88.229  -86.541 1.00 115.90 ? 638  PRO E C     1 
ATOM   9000  O O     . PRO G 2 38  ? 41.990  88.329  -87.291 1.00 116.41 ? 638  PRO E O     1 
ATOM   9001  C CB    . PRO G 2 38  ? 40.234  85.934  -87.188 1.00 107.78 ? 638  PRO E CB    1 
ATOM   9002  C CG    . PRO G 2 38  ? 39.259  85.528  -88.295 1.00 108.50 ? 638  PRO E CG    1 
ATOM   9003  C CD    . PRO G 2 38  ? 39.125  86.781  -89.174 1.00 108.62 ? 638  PRO E CD    1 
ATOM   9004  N N     . HIS G 2 39  ? 40.949  88.844  -85.366 1.00 82.27  ? 639  HIS E N     1 
ATOM   9005  C CA    . HIS G 2 39  ? 42.033  89.693  -84.876 1.00 78.42  ? 639  HIS E CA    1 
ATOM   9006  C C     . HIS G 2 39  ? 42.984  88.921  -83.964 1.00 74.24  ? 639  HIS E C     1 
ATOM   9007  O O     . HIS G 2 39  ? 42.557  88.071  -83.176 1.00 73.63  ? 639  HIS E O     1 
ATOM   9008  C CB    . HIS G 2 39  ? 41.462  90.901  -84.132 1.00 78.68  ? 639  HIS E CB    1 
ATOM   9009  C CG    . HIS G 2 39  ? 42.495  91.713  -83.416 1.00 81.20  ? 639  HIS E CG    1 
ATOM   9010  N ND1   . HIS G 2 39  ? 43.113  91.280  -82.261 1.00 81.32  ? 639  HIS E ND1   1 
ATOM   9011  C CD2   . HIS G 2 39  ? 43.026  92.926  -83.696 1.00 82.04  ? 639  HIS E CD2   1 
ATOM   9012  C CE1   . HIS G 2 39  ? 43.979  92.193  -81.861 1.00 82.41  ? 639  HIS E CE1   1 
ATOM   9013  N NE2   . HIS G 2 39  ? 43.946  93.202  -82.714 1.00 83.02  ? 639  HIS E NE2   1 
ATOM   9014  N N     . ARG G 2 40  ? 44.273  89.226  -84.071 1.00 65.05  ? 640  ARG E N     1 
ATOM   9015  C CA    . ARG G 2 40  ? 45.277  88.543  -83.267 1.00 59.35  ? 640  ARG E CA    1 
ATOM   9016  C C     . ARG G 2 40  ? 46.461  89.438  -82.903 1.00 55.16  ? 640  ARG E C     1 
ATOM   9017  O O     . ARG G 2 40  ? 47.078  90.058  -83.778 1.00 53.40  ? 640  ARG E O     1 
ATOM   9018  C CB    . ARG G 2 40  ? 45.763  87.299  -84.024 1.00 57.48  ? 640  ARG E CB    1 
ATOM   9019  C CG    . ARG G 2 40  ? 46.917  86.560  -83.381 1.00 58.83  ? 640  ARG E CG    1 
ATOM   9020  C CD    . ARG G 2 40  ? 47.198  85.237  -84.101 1.00 57.45  ? 640  ARG E CD    1 
ATOM   9021  N NE    . ARG G 2 40  ? 46.196  84.222  -83.789 1.00 56.26  ? 640  ARG E NE    1 
ATOM   9022  C CZ    . ARG G 2 40  ? 46.283  83.348  -82.785 1.00 55.54  ? 640  ARG E CZ    1 
ATOM   9023  N NH1   . ARG G 2 40  ? 47.333  83.337  -81.972 1.00 53.34  ? 640  ARG E NH1   1 
ATOM   9024  N NH2   . ARG G 2 40  ? 45.305  82.478  -82.593 1.00 55.78  ? 640  ARG E NH2   1 
ATOM   9025  N N     . TYR G 2 41  ? 46.765  89.528  -81.608 1.00 45.38  ? 641  TYR E N     1 
ATOM   9026  C CA    . TYR G 2 41  ? 47.912  90.324  -81.182 1.00 41.68  ? 641  TYR E CA    1 
ATOM   9027  C C     . TYR G 2 41  ? 49.170  89.534  -81.498 1.00 39.18  ? 641  TYR E C     1 
ATOM   9028  O O     . TYR G 2 41  ? 49.161  88.308  -81.477 1.00 38.18  ? 641  TYR E O     1 
ATOM   9029  C CB    . TYR G 2 41  ? 47.853  90.635  -79.677 1.00 40.37  ? 641  TYR E CB    1 
ATOM   9030  C CG    . TYR G 2 41  ? 46.839  91.697  -79.342 1.00 36.34  ? 641  TYR E CG    1 
ATOM   9031  C CD1   . TYR G 2 41  ? 45.646  91.376  -78.701 1.00 36.53  ? 641  TYR E CD1   1 
ATOM   9032  C CD2   . TYR G 2 41  ? 47.047  93.020  -79.727 1.00 36.11  ? 641  TYR E CD2   1 
ATOM   9033  C CE1   . TYR G 2 41  ? 44.680  92.350  -78.453 1.00 37.65  ? 641  TYR E CE1   1 
ATOM   9034  C CE2   . TYR G 2 41  ? 46.093  94.000  -79.492 1.00 35.46  ? 641  TYR E CE2   1 
ATOM   9035  C CZ    . TYR G 2 41  ? 44.918  93.664  -78.858 1.00 38.07  ? 641  TYR E CZ    1 
ATOM   9036  O OH    . TYR G 2 41  ? 43.975  94.642  -78.631 1.00 41.56  ? 641  TYR E OH    1 
ATOM   9037  N N     . ARG G 2 42  ? 50.249  90.229  -81.815 1.00 41.26  ? 642  ARG E N     1 
ATOM   9038  C CA    . ARG G 2 42  ? 51.500  89.550  -82.109 1.00 42.50  ? 642  ARG E CA    1 
ATOM   9039  C C     . ARG G 2 42  ? 52.106  88.980  -80.809 1.00 42.24  ? 642  ARG E C     1 
ATOM   9040  O O     . ARG G 2 42  ? 51.908  89.528  -79.717 1.00 39.71  ? 642  ARG E O     1 
ATOM   9041  C CB    . ARG G 2 42  ? 52.462  90.536  -82.767 1.00 64.29  ? 642  ARG E CB    1 
ATOM   9042  C CG    . ARG G 2 42  ? 51.906  91.137  -84.050 1.00 69.58  ? 642  ARG E CG    1 
ATOM   9043  C CD    . ARG G 2 42  ? 52.773  92.273  -84.550 1.00 75.46  ? 642  ARG E CD    1 
ATOM   9044  N NE    . ARG G 2 42  ? 54.129  91.830  -84.866 1.00 81.37  ? 642  ARG E NE    1 
ATOM   9045  C CZ    . ARG G 2 42  ? 55.127  92.645  -85.197 1.00 83.65  ? 642  ARG E CZ    1 
ATOM   9046  N NH1   . ARG G 2 42  ? 54.928  93.957  -85.257 1.00 84.98  ? 642  ARG E NH1   1 
ATOM   9047  N NH2   . ARG G 2 42  ? 56.328  92.149  -85.468 1.00 85.27  ? 642  ARG E NH2   1 
ATOM   9048  N N     . PRO G 2 43  ? 52.837  87.860  -80.909 1.00 52.16  ? 643  PRO E N     1 
ATOM   9049  C CA    . PRO G 2 43  ? 53.438  87.278  -79.704 1.00 49.83  ? 643  PRO E CA    1 
ATOM   9050  C C     . PRO G 2 43  ? 54.321  88.277  -78.962 1.00 49.44  ? 643  PRO E C     1 
ATOM   9051  O O     . PRO G 2 43  ? 55.201  88.902  -79.555 1.00 49.53  ? 643  PRO E O     1 
ATOM   9052  C CB    . PRO G 2 43  ? 54.226  86.078  -80.250 1.00 41.25  ? 643  PRO E CB    1 
ATOM   9053  C CG    . PRO G 2 43  ? 54.511  86.464  -81.677 1.00 44.31  ? 643  PRO E CG    1 
ATOM   9054  C CD    . PRO G 2 43  ? 53.210  87.091  -82.109 1.00 43.12  ? 643  PRO E CD    1 
ATOM   9055  N N     . GLY G 2 44  ? 54.077  88.427  -77.662 1.00 40.75  ? 644  GLY E N     1 
ATOM   9056  C CA    . GLY G 2 44  ? 54.860  89.358  -76.869 1.00 38.83  ? 644  GLY E CA    1 
ATOM   9057  C C     . GLY G 2 44  ? 54.076  90.595  -76.470 1.00 39.15  ? 644  GLY E C     1 
ATOM   9058  O O     . GLY G 2 44  ? 54.409  91.257  -75.486 1.00 40.63  ? 644  GLY E O     1 
ATOM   9059  N N     . THR G 2 45  ? 53.031  90.909  -77.228 1.00 39.51  ? 645  THR E N     1 
ATOM   9060  C CA    . THR G 2 45  ? 52.200  92.078  -76.953 1.00 38.02  ? 645  THR E CA    1 
ATOM   9061  C C     . THR G 2 45  ? 51.339  91.878  -75.718 1.00 37.50  ? 645  THR E C     1 
ATOM   9062  O O     . THR G 2 45  ? 51.212  92.778  -74.885 1.00 36.80  ? 645  THR E O     1 
ATOM   9063  C CB    . THR G 2 45  ? 51.265  92.409  -78.162 1.00 41.08  ? 645  THR E CB    1 
ATOM   9064  O OG1   . THR G 2 45  ? 52.054  92.838  -79.277 1.00 42.24  ? 645  THR E OG1   1 
ATOM   9065  C CG2   . THR G 2 45  ? 50.288  93.524  -77.810 1.00 38.00  ? 645  THR E CG2   1 
ATOM   9066  N N     . VAL G 2 46  ? 50.733  90.701  -75.605 1.00 37.10  ? 646  VAL E N     1 
ATOM   9067  C CA    . VAL G 2 46  ? 49.872  90.409  -74.466 1.00 37.95  ? 646  VAL E CA    1 
ATOM   9068  C C     . VAL G 2 46  ? 50.734  90.165  -73.227 1.00 38.55  ? 646  VAL E C     1 
ATOM   9069  O O     . VAL G 2 46  ? 50.354  90.530  -72.112 1.00 38.80  ? 646  VAL E O     1 
ATOM   9070  C CB    . VAL G 2 46  ? 48.975  89.181  -74.768 1.00 34.12  ? 646  VAL E CB    1 
ATOM   9071  C CG1   . VAL G 2 46  ? 47.992  88.918  -73.614 1.00 30.55  ? 646  VAL E CG1   1 
ATOM   9072  C CG2   . VAL G 2 46  ? 48.220  89.430  -76.064 1.00 33.05  ? 646  VAL E CG2   1 
ATOM   9073  N N     . ALA G 2 47  ? 51.904  89.566  -73.427 1.00 34.37  ? 647  ALA E N     1 
ATOM   9074  C CA    . ALA G 2 47  ? 52.819  89.313  -72.325 1.00 34.84  ? 647  ALA E CA    1 
ATOM   9075  C C     . ALA G 2 47  ? 53.192  90.654  -71.661 1.00 34.23  ? 647  ALA E C     1 
ATOM   9076  O O     . ALA G 2 47  ? 53.188  90.759  -70.432 1.00 33.02  ? 647  ALA E O     1 
ATOM   9077  C CB    . ALA G 2 47  ? 54.056  88.610  -72.841 1.00 33.94  ? 647  ALA E CB    1 
ATOM   9078  N N     . LEU G 2 48  ? 53.500  91.669  -72.478 1.00 37.91  ? 648  LEU E N     1 
ATOM   9079  C CA    . LEU G 2 48  ? 53.845  93.007  -71.978 1.00 39.11  ? 648  LEU E CA    1 
ATOM   9080  C C     . LEU G 2 48  ? 52.666  93.614  -71.240 1.00 37.40  ? 648  LEU E C     1 
ATOM   9081  O O     . LEU G 2 48  ? 52.829  94.241  -70.191 1.00 38.69  ? 648  LEU E O     1 
ATOM   9082  C CB    . LEU G 2 48  ? 54.258  93.933  -73.125 1.00 39.10  ? 648  LEU E CB    1 
ATOM   9083  C CG    . LEU G 2 48  ? 55.634  93.604  -73.697 1.00 43.99  ? 648  LEU E CG    1 
ATOM   9084  C CD1   . LEU G 2 48  ? 55.894  94.429  -74.958 1.00 44.20  ? 648  LEU E CD1   1 
ATOM   9085  C CD2   . LEU G 2 48  ? 56.697  93.863  -72.632 1.00 42.71  ? 648  LEU E CD2   1 
ATOM   9086  N N     . ARG G 2 49  ? 51.475  93.433  -71.795 1.00 31.43  ? 649  ARG E N     1 
ATOM   9087  C CA    . ARG G 2 49  ? 50.265  93.934  -71.151 1.00 32.79  ? 649  ARG E CA    1 
ATOM   9088  C C     . ARG G 2 49  ? 50.124  93.233  -69.781 1.00 33.93  ? 649  ARG E C     1 
ATOM   9089  O O     . ARG G 2 49  ? 49.652  93.835  -68.803 1.00 31.26  ? 649  ARG E O     1 
ATOM   9090  C CB    . ARG G 2 49  ? 49.051  93.608  -72.023 1.00 37.32  ? 649  ARG E CB    1 
ATOM   9091  C CG    . ARG G 2 49  ? 47.730  94.185  -71.550 1.00 43.14  ? 649  ARG E CG    1 
ATOM   9092  C CD    . ARG G 2 49  ? 46.584  93.699  -72.438 1.00 45.93  ? 649  ARG E CD    1 
ATOM   9093  N NE    . ARG G 2 49  ? 46.893  93.868  -73.860 1.00 48.29  ? 649  ARG E NE    1 
ATOM   9094  C CZ    . ARG G 2 49  ? 46.321  93.161  -74.832 1.00 49.97  ? 649  ARG E CZ    1 
ATOM   9095  N NH1   . ARG G 2 49  ? 45.414  92.244  -74.532 1.00 49.07  ? 649  ARG E NH1   1 
ATOM   9096  N NH2   . ARG G 2 49  ? 46.662  93.360  -76.098 1.00 49.34  ? 649  ARG E NH2   1 
ATOM   9097  N N     . GLU G 2 50  ? 50.528  91.957  -69.723 1.00 33.88  ? 650  GLU E N     1 
ATOM   9098  C CA    . GLU G 2 50  ? 50.437  91.175  -68.482 1.00 34.98  ? 650  GLU E CA    1 
ATOM   9099  C C     . GLU G 2 50  ? 51.457  91.645  -67.444 1.00 32.36  ? 650  GLU E C     1 
ATOM   9100  O O     . GLU G 2 50  ? 51.157  91.729  -66.252 1.00 32.76  ? 650  GLU E O     1 
ATOM   9101  C CB    . GLU G 2 50  ? 50.608  89.671  -68.776 1.00 39.06  ? 650  GLU E CB    1 
ATOM   9102  C CG    . GLU G 2 50  ? 49.349  89.024  -69.341 1.00 43.74  ? 650  GLU E CG    1 
ATOM   9103  C CD    . GLU G 2 50  ? 49.488  87.522  -69.599 1.00 50.73  ? 650  GLU E CD    1 
ATOM   9104  O OE1   . GLU G 2 50  ? 48.484  86.906  -70.036 1.00 53.88  ? 650  GLU E OE1   1 
ATOM   9105  O OE2   . GLU G 2 50  ? 50.586  86.954  -69.372 1.00 51.26  ? 650  GLU E OE2   1 
ATOM   9106  N N     . ILE G 2 51  ? 52.664  91.939  -67.896 1.00 30.85  ? 651  ILE E N     1 
ATOM   9107  C CA    . ILE G 2 51  ? 53.683  92.459  -66.999 1.00 32.59  ? 651  ILE E CA    1 
ATOM   9108  C C     . ILE G 2 51  ? 53.175  93.778  -66.366 1.00 33.75  ? 651  ILE E C     1 
ATOM   9109  O O     . ILE G 2 51  ? 53.248  93.957  -65.146 1.00 33.82  ? 651  ILE E O     1 
ATOM   9110  C CB    . ILE G 2 51  ? 54.990  92.748  -67.763 1.00 30.10  ? 651  ILE E CB    1 
ATOM   9111  C CG1   . ILE G 2 51  ? 55.593  91.434  -68.263 1.00 27.14  ? 651  ILE E CG1   1 
ATOM   9112  C CG2   . ILE G 2 51  ? 55.959  93.526  -66.870 1.00 28.79  ? 651  ILE E CG2   1 
ATOM   9113  C CD1   . ILE G 2 51  ? 56.858  91.630  -69.110 1.00 28.54  ? 651  ILE E CD1   1 
ATOM   9114  N N     . ARG G 2 52  ? 52.625  94.682  -67.177 1.00 33.66  ? 652  ARG E N     1 
ATOM   9115  C CA    . ARG G 2 52  ? 52.141  95.958  -66.633 1.00 35.91  ? 652  ARG E CA    1 
ATOM   9116  C C     . ARG G 2 52  ? 50.983  95.752  -65.684 1.00 35.59  ? 652  ARG E C     1 
ATOM   9117  O O     . ARG G 2 52  ? 50.872  96.435  -64.662 1.00 37.41  ? 652  ARG E O     1 
ATOM   9118  C CB    . ARG G 2 52  ? 51.726  96.929  -67.747 1.00 39.15  ? 652  ARG E CB    1 
ATOM   9119  C CG    . ARG G 2 52  ? 52.849  97.283  -68.725 1.00 45.43  ? 652  ARG E CG    1 
ATOM   9120  C CD    . ARG G 2 52  ? 52.428  98.406  -69.698 1.00 48.42  ? 652  ARG E CD    1 
ATOM   9121  N NE    . ARG G 2 52  ? 52.766  98.097  -71.088 1.00 53.07  ? 652  ARG E NE    1 
ATOM   9122  C CZ    . ARG G 2 52  ? 53.958  98.288  -71.648 1.00 55.80  ? 652  ARG E CZ    1 
ATOM   9123  N NH1   . ARG G 2 52  ? 54.960  98.802  -70.945 1.00 59.36  ? 652  ARG E NH1   1 
ATOM   9124  N NH2   . ARG G 2 52  ? 54.151  97.954  -72.918 1.00 56.99  ? 652  ARG E NH2   1 
ATOM   9125  N N     . ARG G 2 53  ? 50.115  94.806  -66.011 1.00 31.91  ? 653  ARG E N     1 
ATOM   9126  C CA    . ARG G 2 53  ? 48.983  94.532  -65.143 1.00 33.64  ? 653  ARG E CA    1 
ATOM   9127  C C     . ARG G 2 53  ? 49.419  93.961  -63.776 1.00 34.40  ? 653  ARG E C     1 
ATOM   9128  O O     . ARG G 2 53  ? 49.009  94.455  -62.723 1.00 33.69  ? 653  ARG E O     1 
ATOM   9129  C CB    . ARG G 2 53  ? 48.022  93.543  -65.802 1.00 44.17  ? 653  ARG E CB    1 
ATOM   9130  C CG    . ARG G 2 53  ? 46.979  93.025  -64.820 1.00 50.87  ? 653  ARG E CG    1 
ATOM   9131  C CD    . ARG G 2 53  ? 46.149  91.857  -65.346 1.00 57.82  ? 653  ARG E CD    1 
ATOM   9132  N NE    . ARG G 2 53  ? 45.211  91.412  -64.314 1.00 62.80  ? 653  ARG E NE    1 
ATOM   9133  C CZ    . ARG G 2 53  ? 44.367  90.391  -64.433 1.00 65.31  ? 653  ARG E CZ    1 
ATOM   9134  N NH1   . ARG G 2 53  ? 44.323  89.679  -65.553 1.00 64.62  ? 653  ARG E NH1   1 
ATOM   9135  N NH2   . ARG G 2 53  ? 43.567  90.081  -63.419 1.00 66.36  ? 653  ARG E NH2   1 
ATOM   9136  N N     . TYR G 2 54  ? 50.246  92.922  -63.786 1.00 34.61  ? 654  TYR E N     1 
ATOM   9137  C CA    . TYR G 2 54  ? 50.660  92.321  -62.522 1.00 35.16  ? 654  TYR E CA    1 
ATOM   9138  C C     . TYR G 2 54  ? 51.618  93.165  -61.689 1.00 34.69  ? 654  TYR E C     1 
ATOM   9139  O O     . TYR G 2 54  ? 51.610  93.076  -60.460 1.00 34.09  ? 654  TYR E O     1 
ATOM   9140  C CB    . TYR G 2 54  ? 51.200  90.916  -62.786 1.00 33.93  ? 654  TYR E CB    1 
ATOM   9141  C CG    . TYR G 2 54  ? 50.064  90.014  -63.236 1.00 35.50  ? 654  TYR E CG    1 
ATOM   9142  C CD1   . TYR G 2 54  ? 50.035  89.469  -64.521 1.00 35.08  ? 654  TYR E CD1   1 
ATOM   9143  C CD2   . TYR G 2 54  ? 48.973  89.775  -62.391 1.00 34.29  ? 654  TYR E CD2   1 
ATOM   9144  C CE1   . TYR G 2 54  ? 48.937  88.702  -64.961 1.00 34.10  ? 654  TYR E CE1   1 
ATOM   9145  C CE2   . TYR G 2 54  ? 47.877  89.019  -62.814 1.00 35.49  ? 654  TYR E CE2   1 
ATOM   9146  C CZ    . TYR G 2 54  ? 47.868  88.489  -64.096 1.00 36.69  ? 654  TYR E CZ    1 
ATOM   9147  O OH    . TYR G 2 54  ? 46.780  87.769  -64.507 1.00 39.36  ? 654  TYR E OH    1 
ATOM   9148  N N     . GLN G 2 55  ? 52.416  94.001  -62.345 1.00 33.47  ? 655  GLN E N     1 
ATOM   9149  C CA    . GLN G 2 55  ? 53.331  94.871  -61.607 1.00 36.46  ? 655  GLN E CA    1 
ATOM   9150  C C     . GLN G 2 55  ? 52.558  96.001  -60.947 1.00 37.78  ? 655  GLN E C     1 
ATOM   9151  O O     . GLN G 2 55  ? 53.051  96.650  -60.036 1.00 38.44  ? 655  GLN E O     1 
ATOM   9152  C CB    . GLN G 2 55  ? 54.402  95.447  -62.526 1.00 31.23  ? 655  GLN E CB    1 
ATOM   9153  C CG    . GLN G 2 55  ? 55.399  94.403  -62.960 1.00 33.84  ? 655  GLN E CG    1 
ATOM   9154  C CD    . GLN G 2 55  ? 56.647  95.007  -63.533 1.00 34.99  ? 655  GLN E CD    1 
ATOM   9155  O OE1   . GLN G 2 55  ? 56.619  96.116  -64.054 1.00 35.78  ? 655  GLN E OE1   1 
ATOM   9156  N NE2   . GLN G 2 55  ? 57.757  94.277  -63.450 1.00 34.47  ? 655  GLN E NE2   1 
ATOM   9157  N N     . LYS G 2 56  ? 51.329  96.199  -61.399 1.00 41.40  ? 656  LYS E N     1 
ATOM   9158  C CA    . LYS G 2 56  ? 50.466  97.244  -60.876 1.00 44.00  ? 656  LYS E CA    1 
ATOM   9159  C C     . LYS G 2 56  ? 49.637  96.741  -59.694 1.00 43.97  ? 656  LYS E C     1 
ATOM   9160  O O     . LYS G 2 56  ? 49.232  97.522  -58.830 1.00 43.34  ? 656  LYS E O     1 
ATOM   9161  C CB    . LYS G 2 56  ? 49.543  97.723  -61.996 1.00 64.11  ? 656  LYS E CB    1 
ATOM   9162  C CG    . LYS G 2 56  ? 48.682  98.910  -61.667 1.00 69.11  ? 656  LYS E CG    1 
ATOM   9163  C CD    . LYS G 2 56  ? 47.927  99.357  -62.914 1.00 74.57  ? 656  LYS E CD    1 
ATOM   9164  C CE    . LYS G 2 56  ? 47.027  100.555 -62.637 1.00 78.16  ? 656  LYS E CE    1 
ATOM   9165  N NZ    . LYS G 2 56  ? 46.293  100.982 -63.864 1.00 79.87  ? 656  LYS E NZ    1 
ATOM   9166  N N     . SER G 2 57  ? 49.398  95.433  -59.641 1.00 38.45  ? 657  SER E N     1 
ATOM   9167  C CA    . SER G 2 57  ? 48.582  94.880  -58.560 1.00 37.57  ? 657  SER E CA    1 
ATOM   9168  C C     . SER G 2 57  ? 49.392  94.259  -57.428 1.00 35.69  ? 657  SER E C     1 
ATOM   9169  O O     . SER G 2 57  ? 50.608  94.063  -57.541 1.00 34.44  ? 657  SER E O     1 
ATOM   9170  C CB    . SER G 2 57  ? 47.600  93.847  -59.130 1.00 42.84  ? 657  SER E CB    1 
ATOM   9171  O OG    . SER G 2 57  ? 48.294  92.805  -59.794 1.00 45.71  ? 657  SER E OG    1 
ATOM   9172  N N     . THR G 2 58  ? 48.705  93.928  -56.343 1.00 38.13  ? 658  THR E N     1 
ATOM   9173  C CA    . THR G 2 58  ? 49.366  93.350  -55.187 1.00 40.17  ? 658  THR E CA    1 
ATOM   9174  C C     . THR G 2 58  ? 48.769  92.031  -54.705 1.00 38.74  ? 658  THR E C     1 
ATOM   9175  O O     . THR G 2 58  ? 49.278  91.445  -53.765 1.00 40.58  ? 658  THR E O     1 
ATOM   9176  C CB    . THR G 2 58  ? 49.323  94.318  -54.003 1.00 39.96  ? 658  THR E CB    1 
ATOM   9177  O OG1   . THR G 2 58  ? 47.968  94.442  -53.549 1.00 40.89  ? 658  THR E OG1   1 
ATOM   9178  C CG2   . THR G 2 58  ? 49.834  95.685  -54.424 1.00 40.97  ? 658  THR E CG2   1 
ATOM   9179  N N     . GLU G 2 59  ? 47.701  91.560  -55.330 1.00 36.75  ? 659  GLU E N     1 
ATOM   9180  C CA    . GLU G 2 59  ? 47.095  90.322  -54.871 1.00 37.05  ? 659  GLU E CA    1 
ATOM   9181  C C     . GLU G 2 59  ? 48.013  89.120  -55.103 1.00 35.60  ? 659  GLU E C     1 
ATOM   9182  O O     . GLU G 2 59  ? 48.911  89.155  -55.957 1.00 33.55  ? 659  GLU E O     1 
ATOM   9183  C CB    . GLU G 2 59  ? 45.757  90.077  -55.572 1.00 49.02  ? 659  GLU E CB    1 
ATOM   9184  C CG    . GLU G 2 59  ? 45.865  89.344  -56.906 1.00 56.63  ? 659  GLU E CG    1 
ATOM   9185  C CD    . GLU G 2 59  ? 46.199  90.261  -58.065 1.00 61.66  ? 659  GLU E CD    1 
ATOM   9186  O OE1   . GLU G 2 59  ? 47.091  91.127  -57.909 1.00 65.91  ? 659  GLU E OE1   1 
ATOM   9187  O OE2   . GLU G 2 59  ? 45.574  90.109  -59.136 1.00 62.50  ? 659  GLU E OE2   1 
ATOM   9188  N N     . LEU G 2 60  ? 47.786  88.074  -54.317 1.00 37.46  ? 660  LEU E N     1 
ATOM   9189  C CA    . LEU G 2 60  ? 48.525  86.818  -54.433 1.00 39.31  ? 660  LEU E CA    1 
ATOM   9190  C C     . LEU G 2 60  ? 48.194  86.204  -55.798 1.00 38.20  ? 660  LEU E C     1 
ATOM   9191  O O     . LEU G 2 60  ? 47.045  86.248  -56.239 1.00 38.28  ? 660  LEU E O     1 
ATOM   9192  C CB    . LEU G 2 60  ? 48.107  85.870  -53.310 1.00 41.23  ? 660  LEU E CB    1 
ATOM   9193  C CG    . LEU G 2 60  ? 48.549  86.345  -51.923 1.00 43.88  ? 660  LEU E CG    1 
ATOM   9194  C CD1   . LEU G 2 60  ? 47.941  85.453  -50.856 1.00 45.68  ? 660  LEU E CD1   1 
ATOM   9195  C CD2   . LEU G 2 60  ? 50.071  86.330  -51.836 1.00 42.09  ? 660  LEU E CD2   1 
ATOM   9196  N N     . LEU G 2 61  ? 49.198  85.645  -56.461 1.00 36.28  ? 661  LEU E N     1 
ATOM   9197  C CA    . LEU G 2 61  ? 49.022  85.067  -57.792 1.00 36.17  ? 661  LEU E CA    1 
ATOM   9198  C C     . LEU G 2 61  ? 48.837  83.548  -57.812 1.00 36.48  ? 661  LEU E C     1 
ATOM   9199  O O     . LEU G 2 61  ? 48.431  82.978  -58.834 1.00 34.63  ? 661  LEU E O     1 
ATOM   9200  C CB    . LEU G 2 61  ? 50.214  85.472  -58.671 1.00 34.97  ? 661  LEU E CB    1 
ATOM   9201  C CG    . LEU G 2 61  ? 50.400  86.995  -58.643 1.00 34.73  ? 661  LEU E CG    1 
ATOM   9202  C CD1   . LEU G 2 61  ? 51.687  87.417  -59.334 1.00 31.67  ? 661  LEU E CD1   1 
ATOM   9203  C CD2   . LEU G 2 61  ? 49.185  87.633  -59.297 1.00 34.49  ? 661  LEU E CD2   1 
ATOM   9204  N N     . ILE G 2 62  ? 49.141  82.893  -56.691 1.00 32.21  ? 662  ILE E N     1 
ATOM   9205  C CA    . ILE G 2 62  ? 48.963  81.449  -56.602 1.00 32.71  ? 662  ILE E CA    1 
ATOM   9206  C C     . ILE G 2 62  ? 47.600  81.217  -55.947 1.00 31.88  ? 662  ILE E C     1 
ATOM   9207  O O     . ILE G 2 62  ? 47.260  81.931  -55.022 1.00 30.91  ? 662  ILE E O     1 
ATOM   9208  C CB    . ILE G 2 62  ? 50.079  80.799  -55.737 1.00 36.51  ? 662  ILE E CB    1 
ATOM   9209  C CG1   . ILE G 2 62  ? 51.440  80.960  -56.426 1.00 37.14  ? 662  ILE E CG1   1 
ATOM   9210  C CG2   . ILE G 2 62  ? 49.785  79.312  -55.517 1.00 37.23  ? 662  ILE E CG2   1 
ATOM   9211  C CD1   . ILE G 2 62  ? 52.617  80.402  -55.609 1.00 35.90  ? 662  ILE E CD1   1 
ATOM   9212  N N     . ARG G 2 63  ? 46.824  80.243  -56.429 1.00 36.01  ? 663  ARG E N     1 
ATOM   9213  C CA    . ARG G 2 63  ? 45.505  79.929  -55.847 1.00 38.69  ? 663  ARG E CA    1 
ATOM   9214  C C     . ARG G 2 63  ? 45.687  79.593  -54.366 1.00 38.53  ? 663  ARG E C     1 
ATOM   9215  O O     . ARG G 2 63  ? 46.640  78.910  -54.007 1.00 37.18  ? 663  ARG E O     1 
ATOM   9216  C CB    . ARG G 2 63  ? 44.883  78.718  -56.552 1.00 57.20  ? 663  ARG E CB    1 
ATOM   9217  C CG    . ARG G 2 63  ? 44.588  78.899  -58.040 1.00 62.58  ? 663  ARG E CG    1 
ATOM   9218  C CD    . ARG G 2 63  ? 43.316  79.697  -58.255 1.00 69.09  ? 663  ARG E CD    1 
ATOM   9219  N NE    . ARG G 2 63  ? 43.445  81.056  -57.744 1.00 76.60  ? 663  ARG E NE    1 
ATOM   9220  C CZ    . ARG G 2 63  ? 42.427  81.889  -57.555 1.00 80.72  ? 663  ARG E CZ    1 
ATOM   9221  N NH1   . ARG G 2 63  ? 41.188  81.497  -57.832 1.00 82.85  ? 663  ARG E NH1   1 
ATOM   9222  N NH2   . ARG G 2 63  ? 42.651  83.117  -57.096 1.00 81.73  ? 663  ARG E NH2   1 
ATOM   9223  N N     . LYS G 2 64  ? 44.769  80.049  -53.518 1.00 35.92  ? 664  LYS E N     1 
ATOM   9224  C CA    . LYS G 2 64  ? 44.872  79.821  -52.077 1.00 37.65  ? 664  LYS E CA    1 
ATOM   9225  C C     . LYS G 2 64  ? 44.776  78.386  -51.564 1.00 36.73  ? 664  LYS E C     1 
ATOM   9226  O O     . LYS G 2 64  ? 45.670  77.921  -50.866 1.00 34.76  ? 664  LYS E O     1 
ATOM   9227  C CB    . LYS G 2 64  ? 43.840  80.662  -51.328 1.00 51.56  ? 664  LYS E CB    1 
ATOM   9228  C CG    . LYS G 2 64  ? 44.023  82.155  -51.501 1.00 60.48  ? 664  LYS E CG    1 
ATOM   9229  C CD    . LYS G 2 64  ? 43.168  82.936  -50.508 1.00 65.19  ? 664  LYS E CD    1 
ATOM   9230  C CE    . LYS G 2 64  ? 43.264  84.433  -50.761 1.00 66.68  ? 664  LYS E CE    1 
ATOM   9231  N NZ    . LYS G 2 64  ? 44.683  84.877  -50.836 1.00 71.52  ? 664  LYS E NZ    1 
ATOM   9232  N N     . LEU G 2 65  ? 43.691  77.685  -51.883 1.00 42.00  ? 665  LEU E N     1 
ATOM   9233  C CA    . LEU G 2 65  ? 43.531  76.321  -51.389 1.00 40.17  ? 665  LEU E CA    1 
ATOM   9234  C C     . LEU G 2 65  ? 44.691  75.421  -51.802 1.00 39.31  ? 665  LEU E C     1 
ATOM   9235  O O     . LEU G 2 65  ? 45.217  74.673  -50.986 1.00 41.16  ? 665  LEU E O     1 
ATOM   9236  C CB    . LEU G 2 65  ? 42.195  75.743  -51.856 1.00 47.48  ? 665  LEU E CB    1 
ATOM   9237  C CG    . LEU G 2 65  ? 41.837  74.319  -51.425 1.00 49.34  ? 665  LEU E CG    1 
ATOM   9238  C CD1   . LEU G 2 65  ? 42.070  74.123  -49.929 1.00 50.03  ? 665  LEU E CD1   1 
ATOM   9239  C CD2   . LEU G 2 65  ? 40.391  74.069  -51.781 1.00 49.22  ? 665  LEU E CD2   1 
ATOM   9240  N N     . PRO G 2 66  ? 45.109  75.477  -53.076 1.00 36.14  ? 666  PRO E N     1 
ATOM   9241  C CA    . PRO G 2 66  ? 46.227  74.623  -53.490 1.00 34.72  ? 666  PRO E CA    1 
ATOM   9242  C C     . PRO G 2 66  ? 47.514  74.937  -52.719 1.00 35.19  ? 666  PRO E C     1 
ATOM   9243  O O     . PRO G 2 66  ? 48.272  74.027  -52.355 1.00 33.71  ? 666  PRO E O     1 
ATOM   9244  C CB    . PRO G 2 66  ? 46.368  74.934  -54.976 1.00 34.00  ? 666  PRO E CB    1 
ATOM   9245  C CG    . PRO G 2 66  ? 44.954  75.244  -55.385 1.00 33.13  ? 666  PRO E CG    1 
ATOM   9246  C CD    . PRO G 2 66  ? 44.464  76.106  -54.244 1.00 33.16  ? 666  PRO E CD    1 
ATOM   9247  N N     . PHE G 2 67  ? 47.779  76.221  -52.474 1.00 33.00  ? 667  PHE E N     1 
ATOM   9248  C CA    . PHE G 2 67  ? 48.996  76.562  -51.744 1.00 32.38  ? 667  PHE E CA    1 
ATOM   9249  C C     . PHE G 2 67  ? 48.898  75.986  -50.322 1.00 31.53  ? 667  PHE E C     1 
ATOM   9250  O O     . PHE G 2 67  ? 49.857  75.408  -49.805 1.00 29.60  ? 667  PHE E O     1 
ATOM   9251  C CB    . PHE G 2 67  ? 49.212  78.085  -51.679 1.00 31.86  ? 667  PHE E CB    1 
ATOM   9252  C CG    . PHE G 2 67  ? 50.511  78.475  -51.005 1.00 30.79  ? 667  PHE E CG    1 
ATOM   9253  C CD1   . PHE G 2 67  ? 51.721  78.418  -51.707 1.00 30.22  ? 667  PHE E CD1   1 
ATOM   9254  C CD2   . PHE G 2 67  ? 50.531  78.854  -49.665 1.00 26.38  ? 667  PHE E CD2   1 
ATOM   9255  C CE1   . PHE G 2 67  ? 52.946  78.742  -51.075 1.00 29.50  ? 667  PHE E CE1   1 
ATOM   9256  C CE2   . PHE G 2 67  ? 51.751  79.181  -49.021 1.00 27.17  ? 667  PHE E CE2   1 
ATOM   9257  C CZ    . PHE G 2 67  ? 52.952  79.124  -49.727 1.00 26.28  ? 667  PHE E CZ    1 
ATOM   9258  N N     . GLN G 2 68  ? 47.736  76.137  -49.702 1.00 30.14  ? 668  GLN E N     1 
ATOM   9259  C CA    . GLN G 2 68  ? 47.529  75.619  -48.353 1.00 35.28  ? 668  GLN E CA    1 
ATOM   9260  C C     . GLN G 2 68  ? 47.765  74.096  -48.250 1.00 36.50  ? 668  GLN E C     1 
ATOM   9261  O O     . GLN G 2 68  ? 48.323  73.623  -47.256 1.00 36.59  ? 668  GLN E O     1 
ATOM   9262  C CB    . GLN G 2 68  ? 46.121  75.948  -47.866 1.00 44.66  ? 668  GLN E CB    1 
ATOM   9263  C CG    . GLN G 2 68  ? 45.928  75.625  -46.399 1.00 54.65  ? 668  GLN E CG    1 
ATOM   9264  C CD    . GLN G 2 68  ? 44.686  76.261  -45.817 1.00 59.65  ? 668  GLN E CD    1 
ATOM   9265  O OE1   . GLN G 2 68  ? 43.572  75.802  -46.052 1.00 63.96  ? 668  GLN E OE1   1 
ATOM   9266  N NE2   . GLN G 2 68  ? 44.874  77.336  -45.058 1.00 62.33  ? 668  GLN E NE2   1 
ATOM   9267  N N     . ARG G 2 69  ? 47.334  73.334  -49.258 1.00 36.63  ? 669  ARG E N     1 
ATOM   9268  C CA    . ARG G 2 69  ? 47.535  71.878  -49.249 1.00 37.74  ? 669  ARG E CA    1 
ATOM   9269  C C     . ARG G 2 69  ? 49.012  71.569  -49.325 1.00 36.95  ? 669  ARG E C     1 
ATOM   9270  O O     . ARG G 2 69  ? 49.492  70.639  -48.679 1.00 37.24  ? 669  ARG E O     1 
ATOM   9271  C CB    . ARG G 2 69  ? 46.894  71.207  -50.455 1.00 41.62  ? 669  ARG E CB    1 
ATOM   9272  C CG    . ARG G 2 69  ? 45.421  70.971  -50.378 1.00 43.70  ? 669  ARG E CG    1 
ATOM   9273  C CD    . ARG G 2 69  ? 45.022  70.204  -51.632 1.00 48.53  ? 669  ARG E CD    1 
ATOM   9274  N NE    . ARG G 2 69  ? 43.647  70.496  -51.990 1.00 52.91  ? 669  ARG E NE    1 
ATOM   9275  C CZ    . ARG G 2 69  ? 43.278  71.050  -53.137 1.00 52.66  ? 669  ARG E CZ    1 
ATOM   9276  N NH1   . ARG G 2 69  ? 44.183  71.368  -54.058 1.00 49.68  ? 669  ARG E NH1   1 
ATOM   9277  N NH2   . ARG G 2 69  ? 41.997  71.313  -53.340 1.00 54.96  ? 669  ARG E NH2   1 
ATOM   9278  N N     . LEU G 2 70  ? 49.720  72.332  -50.158 1.00 32.34  ? 670  LEU E N     1 
ATOM   9279  C CA    . LEU G 2 70  ? 51.149  72.136  -50.322 1.00 31.52  ? 670  LEU E CA    1 
ATOM   9280  C C     . LEU G 2 70  ? 51.872  72.357  -48.985 1.00 31.07  ? 670  LEU E C     1 
ATOM   9281  O O     . LEU G 2 70  ? 52.722  71.553  -48.582 1.00 29.46  ? 670  LEU E O     1 
ATOM   9282  C CB    . LEU G 2 70  ? 51.682  73.078  -51.409 1.00 31.67  ? 670  LEU E CB    1 
ATOM   9283  C CG    . LEU G 2 70  ? 53.203  73.071  -51.586 1.00 32.10  ? 670  LEU E CG    1 
ATOM   9284  C CD1   . LEU G 2 70  ? 53.664  71.677  -52.047 1.00 30.69  ? 670  LEU E CD1   1 
ATOM   9285  C CD2   . LEU G 2 70  ? 53.605  74.165  -52.573 1.00 28.40  ? 670  LEU E CD2   1 
ATOM   9286  N N     . VAL G 2 71  ? 51.511  73.429  -48.289 1.00 29.25  ? 671  VAL E N     1 
ATOM   9287  C CA    . VAL G 2 71  ? 52.101  73.732  -46.988 1.00 29.33  ? 671  VAL E CA    1 
ATOM   9288  C C     . VAL G 2 71  ? 51.791  72.627  -45.975 1.00 31.45  ? 671  VAL E C     1 
ATOM   9289  O O     . VAL G 2 71  ? 52.658  72.222  -45.196 1.00 28.31  ? 671  VAL E O     1 
ATOM   9290  C CB    . VAL G 2 71  ? 51.569  75.067  -46.432 1.00 28.15  ? 671  VAL E CB    1 
ATOM   9291  C CG1   . VAL G 2 71  ? 51.954  75.220  -44.942 1.00 27.34  ? 671  VAL E CG1   1 
ATOM   9292  C CG2   . VAL G 2 71  ? 52.137  76.219  -47.248 1.00 28.47  ? 671  VAL E CG2   1 
ATOM   9293  N N     . ARG G 2 72  ? 50.551  72.152  -45.968 1.00 33.89  ? 672  ARG E N     1 
ATOM   9294  C CA    . ARG G 2 72  ? 50.173  71.098  -45.036 1.00 37.85  ? 672  ARG E CA    1 
ATOM   9295  C C     . ARG G 2 72  ? 50.875  69.781  -45.339 1.00 37.10  ? 672  ARG E C     1 
ATOM   9296  O O     . ARG G 2 72  ? 51.259  69.055  -44.420 1.00 38.03  ? 672  ARG E O     1 
ATOM   9297  C CB    . ARG G 2 72  ? 48.654  70.900  -45.033 1.00 43.65  ? 672  ARG E CB    1 
ATOM   9298  C CG    . ARG G 2 72  ? 47.916  72.006  -44.295 1.00 47.17  ? 672  ARG E CG    1 
ATOM   9299  C CD    . ARG G 2 72  ? 46.416  71.886  -44.471 1.00 50.80  ? 672  ARG E CD    1 
ATOM   9300  N NE    . ARG G 2 72  ? 45.708  73.049  -43.940 1.00 52.82  ? 672  ARG E NE    1 
ATOM   9301  C CZ    . ARG G 2 72  ? 45.607  73.346  -42.649 1.00 53.51  ? 672  ARG E CZ    1 
ATOM   9302  N NH1   . ARG G 2 72  ? 46.168  72.560  -41.734 1.00 51.54  ? 672  ARG E NH1   1 
ATOM   9303  N NH2   . ARG G 2 72  ? 44.947  74.441  -42.277 1.00 53.77  ? 672  ARG E NH2   1 
ATOM   9304  N N     . GLU G 2 73  ? 51.054  69.491  -46.626 1.00 32.22  ? 673  GLU E N     1 
ATOM   9305  C CA    . GLU G 2 73  ? 51.713  68.270  -47.069 1.00 31.57  ? 673  GLU E CA    1 
ATOM   9306  C C     . GLU G 2 73  ? 53.171  68.298  -46.638 1.00 33.84  ? 673  GLU E C     1 
ATOM   9307  O O     . GLU G 2 73  ? 53.687  67.350  -46.021 1.00 33.91  ? 673  GLU E O     1 
ATOM   9308  C CB    . GLU G 2 73  ? 51.633  68.146  -48.591 1.00 35.11  ? 673  GLU E CB    1 
ATOM   9309  C CG    . GLU G 2 73  ? 52.379  66.942  -49.166 1.00 40.21  ? 673  GLU E CG    1 
ATOM   9310  C CD    . GLU G 2 73  ? 52.397  66.909  -50.699 1.00 46.42  ? 673  GLU E CD    1 
ATOM   9311  O OE1   . GLU G 2 73  ? 51.305  66.981  -51.326 1.00 45.02  ? 673  GLU E OE1   1 
ATOM   9312  O OE2   . GLU G 2 73  ? 53.510  66.800  -51.275 1.00 46.99  ? 673  GLU E OE2   1 
ATOM   9313  N N     . ILE G 2 74  ? 53.853  69.384  -46.967 1.00 32.96  ? 674  ILE E N     1 
ATOM   9314  C CA    . ILE G 2 74  ? 55.256  69.512  -46.585 1.00 31.24  ? 674  ILE E CA    1 
ATOM   9315  C C     . ILE G 2 74  ? 55.402  69.479  -45.062 1.00 31.05  ? 674  ILE E C     1 
ATOM   9316  O O     . ILE G 2 74  ? 56.219  68.744  -44.525 1.00 30.84  ? 674  ILE E O     1 
ATOM   9317  C CB    . ILE G 2 74  ? 55.853  70.833  -47.136 1.00 36.17  ? 674  ILE E CB    1 
ATOM   9318  C CG1   . ILE G 2 74  ? 55.963  70.740  -48.660 1.00 37.08  ? 674  ILE E CG1   1 
ATOM   9319  C CG2   . ILE G 2 74  ? 57.184  71.136  -46.473 1.00 32.17  ? 674  ILE E CG2   1 
ATOM   9320  C CD1   . ILE G 2 74  ? 56.480  71.995  -49.332 1.00 40.98  ? 674  ILE E CD1   1 
ATOM   9321  N N     . ALA G 2 75  ? 54.596  70.257  -44.358 1.00 33.68  ? 675  ALA E N     1 
ATOM   9322  C CA    . ALA G 2 75  ? 54.707  70.291  -42.904 1.00 34.86  ? 675  ALA E CA    1 
ATOM   9323  C C     . ALA G 2 75  ? 54.462  68.911  -42.304 1.00 36.65  ? 675  ALA E C     1 
ATOM   9324  O O     . ALA G 2 75  ? 55.152  68.492  -41.380 1.00 35.73  ? 675  ALA E O     1 
ATOM   9325  C CB    . ALA G 2 75  ? 53.719  71.310  -42.322 1.00 25.78  ? 675  ALA E CB    1 
ATOM   9326  N N     . GLN G 2 76  ? 53.483  68.206  -42.851 1.00 46.06  ? 676  GLN E N     1 
ATOM   9327  C CA    . GLN G 2 76  ? 53.130  66.882  -42.372 1.00 47.75  ? 676  GLN E CA    1 
ATOM   9328  C C     . GLN G 2 76  ? 54.318  65.940  -42.484 1.00 47.94  ? 676  GLN E C     1 
ATOM   9329  O O     . GLN G 2 76  ? 54.562  65.125  -41.589 1.00 48.05  ? 676  GLN E O     1 
ATOM   9330  C CB    . GLN G 2 76  ? 51.947  66.354  -43.176 1.00 42.85  ? 676  GLN E CB    1 
ATOM   9331  C CG    . GLN G 2 76  ? 51.466  64.978  -42.771 1.00 45.58  ? 676  GLN E CG    1 
ATOM   9332  C CD    . GLN G 2 76  ? 50.192  64.603  -43.497 1.00 45.83  ? 676  GLN E CD    1 
ATOM   9333  O OE1   . GLN G 2 76  ? 50.146  64.587  -44.730 1.00 44.20  ? 676  GLN E OE1   1 
ATOM   9334  N NE2   . GLN G 2 76  ? 49.142  64.313  -42.736 1.00 47.79  ? 676  GLN E NE2   1 
ATOM   9335  N N     . ASP G 2 77  ? 55.068  66.056  -43.574 1.00 41.12  ? 677  ASP E N     1 
ATOM   9336  C CA    . ASP G 2 77  ? 56.235  65.210  -43.749 1.00 41.21  ? 677  ASP E CA    1 
ATOM   9337  C C     . ASP G 2 77  ? 57.313  65.494  -42.702 1.00 42.96  ? 677  ASP E C     1 
ATOM   9338  O O     . ASP G 2 77  ? 58.127  64.632  -42.391 1.00 43.14  ? 677  ASP E O     1 
ATOM   9339  C CB    . ASP G 2 77  ? 56.816  65.365  -45.150 1.00 39.37  ? 677  ASP E CB    1 
ATOM   9340  C CG    . ASP G 2 77  ? 55.964  64.685  -46.203 1.00 42.32  ? 677  ASP E CG    1 
ATOM   9341  O OD1   . ASP G 2 77  ? 55.339  63.644  -45.869 1.00 40.79  ? 677  ASP E OD1   1 
ATOM   9342  O OD2   . ASP G 2 77  ? 55.925  65.170  -47.359 1.00 37.57  ? 677  ASP E OD2   1 
ATOM   9343  N N     . PHE G 2 78  ? 57.323  66.697  -42.145 1.00 41.26  ? 678  PHE E N     1 
ATOM   9344  C CA    . PHE G 2 78  ? 58.323  67.021  -41.139 1.00 43.33  ? 678  PHE E CA    1 
ATOM   9345  C C     . PHE G 2 78  ? 57.775  66.628  -39.762 1.00 43.27  ? 678  PHE E C     1 
ATOM   9346  O O     . PHE G 2 78  ? 58.491  66.079  -38.923 1.00 43.04  ? 678  PHE E O     1 
ATOM   9347  C CB    . PHE G 2 78  ? 58.644  68.524  -41.171 1.00 55.74  ? 678  PHE E CB    1 
ATOM   9348  C CG    . PHE G 2 78  ? 59.722  68.933  -40.209 1.00 59.65  ? 678  PHE E CG    1 
ATOM   9349  C CD1   . PHE G 2 78  ? 61.064  68.694  -40.500 1.00 61.83  ? 678  PHE E CD1   1 
ATOM   9350  C CD2   . PHE G 2 78  ? 59.400  69.542  -38.999 1.00 61.35  ? 678  PHE E CD2   1 
ATOM   9351  C CE1   . PHE G 2 78  ? 62.074  69.060  -39.592 1.00 61.75  ? 678  PHE E CE1   1 
ATOM   9352  C CE2   . PHE G 2 78  ? 60.403  69.911  -38.086 1.00 62.24  ? 678  PHE E CE2   1 
ATOM   9353  C CZ    . PHE G 2 78  ? 61.739  69.669  -38.385 1.00 61.24  ? 678  PHE E CZ    1 
ATOM   9354  N N     . LYS G 2 79  ? 56.490  66.884  -39.548 1.00 41.04  ? 679  LYS E N     1 
ATOM   9355  C CA    . LYS G 2 79  ? 55.868  66.586  -38.268 1.00 42.85  ? 679  LYS E CA    1 
ATOM   9356  C C     . LYS G 2 79  ? 54.365  66.346  -38.435 1.00 43.11  ? 679  LYS E C     1 
ATOM   9357  O O     . LYS G 2 79  ? 53.653  67.154  -39.048 1.00 41.24  ? 679  LYS E O     1 
ATOM   9358  C CB    . LYS G 2 79  ? 56.109  67.761  -37.318 1.00 60.84  ? 679  LYS E CB    1 
ATOM   9359  C CG    . LYS G 2 79  ? 56.511  67.380  -35.911 1.00 65.47  ? 679  LYS E CG    1 
ATOM   9360  C CD    . LYS G 2 79  ? 55.349  66.797  -35.142 1.00 70.57  ? 679  LYS E CD    1 
ATOM   9361  C CE    . LYS G 2 79  ? 55.719  66.559  -33.690 1.00 71.08  ? 679  LYS E CE    1 
ATOM   9362  N NZ    . LYS G 2 79  ? 54.580  65.953  -32.953 1.00 75.05  ? 679  LYS E NZ    1 
ATOM   9363  N N     . THR G 2 80  ? 53.877  65.244  -37.869 1.00 45.61  ? 680  THR E N     1 
ATOM   9364  C CA    . THR G 2 80  ? 52.457  64.901  -37.966 1.00 47.44  ? 680  THR E CA    1 
ATOM   9365  C C     . THR G 2 80  ? 51.588  65.597  -36.922 1.00 47.60  ? 680  THR E C     1 
ATOM   9366  O O     . THR G 2 80  ? 52.077  66.055  -35.887 1.00 49.30  ? 680  THR E O     1 
ATOM   9367  C CB    . THR G 2 80  ? 52.234  63.372  -37.815 1.00 59.96  ? 680  THR E CB    1 
ATOM   9368  O OG1   . THR G 2 80  ? 52.738  62.936  -36.542 1.00 57.84  ? 680  THR E OG1   1 
ATOM   9369  C CG2   . THR G 2 80  ? 52.940  62.609  -38.940 1.00 59.73  ? 680  THR E CG2   1 
ATOM   9370  N N     . ASP G 2 81  ? 50.295  65.681  -37.213 1.00 46.89  ? 681  ASP E N     1 
ATOM   9371  C CA    . ASP G 2 81  ? 49.323  66.273  -36.304 1.00 50.71  ? 681  ASP E CA    1 
ATOM   9372  C C     . ASP G 2 81  ? 49.401  67.790  -36.117 1.00 49.70  ? 681  ASP E C     1 
ATOM   9373  O O     . ASP G 2 81  ? 48.828  68.331  -35.164 1.00 48.71  ? 681  ASP E O     1 
ATOM   9374  C CB    . ASP G 2 81  ? 49.411  65.600  -34.924 1.00 115.13 ? 681  ASP E CB    1 
ATOM   9375  C CG    . ASP G 2 81  ? 49.231  64.091  -34.990 1.00 120.76 ? 681  ASP E CG    1 
ATOM   9376  O OD1   . ASP G 2 81  ? 50.141  63.398  -35.493 1.00 123.47 ? 681  ASP E OD1   1 
ATOM   9377  O OD2   . ASP G 2 81  ? 48.175  63.597  -34.540 1.00 125.02 ? 681  ASP E OD2   1 
ATOM   9378  N N     . LEU G 2 82  ? 50.094  68.479  -37.015 1.00 51.28  ? 682  LEU E N     1 
ATOM   9379  C CA    . LEU G 2 82  ? 50.196  69.926  -36.906 1.00 50.68  ? 682  LEU E CA    1 
ATOM   9380  C C     . LEU G 2 82  ? 48.934  70.637  -37.385 1.00 49.43  ? 682  LEU E C     1 
ATOM   9381  O O     . LEU G 2 82  ? 48.250  70.182  -38.302 1.00 50.63  ? 682  LEU E O     1 
ATOM   9382  C CB    . LEU G 2 82  ? 51.391  70.445  -37.715 1.00 49.10  ? 682  LEU E CB    1 
ATOM   9383  C CG    . LEU G 2 82  ? 52.777  70.056  -37.207 1.00 49.56  ? 682  LEU E CG    1 
ATOM   9384  C CD1   . LEU G 2 82  ? 53.831  70.499  -38.206 1.00 48.61  ? 682  LEU E CD1   1 
ATOM   9385  C CD2   . LEU G 2 82  ? 53.012  70.679  -35.834 1.00 48.07  ? 682  LEU E CD2   1 
ATOM   9386  N N     . ARG G 2 83  ? 48.636  71.754  -36.740 1.00 47.85  ? 683  ARG E N     1 
ATOM   9387  C CA    . ARG G 2 83  ? 47.510  72.602  -37.105 1.00 47.93  ? 683  ARG E CA    1 
ATOM   9388  C C     . ARG G 2 83  ? 48.140  73.924  -37.579 1.00 45.10  ? 683  ARG E C     1 
ATOM   9389  O O     . ARG G 2 83  ? 49.321  74.161  -37.343 1.00 44.39  ? 683  ARG E O     1 
ATOM   9390  C CB    . ARG G 2 83  ? 46.619  72.856  -35.893 1.00 64.20  ? 683  ARG E CB    1 
ATOM   9391  C CG    . ARG G 2 83  ? 45.939  71.615  -35.380 1.00 70.06  ? 683  ARG E CG    1 
ATOM   9392  C CD    . ARG G 2 83  ? 44.826  71.976  -34.436 1.00 73.48  ? 683  ARG E CD    1 
ATOM   9393  N NE    . ARG G 2 83  ? 43.825  70.922  -34.412 1.00 78.84  ? 683  ARG E NE    1 
ATOM   9394  C CZ    . ARG G 2 83  ? 42.529  71.135  -34.223 1.00 81.42  ? 683  ARG E CZ    1 
ATOM   9395  N NH1   . ARG G 2 83  ? 42.078  72.369  -34.038 1.00 81.96  ? 683  ARG E NH1   1 
ATOM   9396  N NH2   . ARG G 2 83  ? 41.685  70.114  -34.231 1.00 82.99  ? 683  ARG E NH2   1 
ATOM   9397  N N     . PHE G 2 84  ? 47.353  74.779  -38.224 1.00 40.55  ? 684  PHE E N     1 
ATOM   9398  C CA    . PHE G 2 84  ? 47.848  76.058  -38.729 1.00 39.40  ? 684  PHE E CA    1 
ATOM   9399  C C     . PHE G 2 84  ? 46.873  77.197  -38.553 1.00 37.66  ? 684  PHE E C     1 
ATOM   9400  O O     . PHE G 2 84  ? 45.712  77.062  -38.910 1.00 38.52  ? 684  PHE E O     1 
ATOM   9401  C CB    . PHE G 2 84  ? 48.133  75.980  -40.232 1.00 45.11  ? 684  PHE E CB    1 
ATOM   9402  C CG    . PHE G 2 84  ? 49.438  75.339  -40.582 1.00 45.12  ? 684  PHE E CG    1 
ATOM   9403  C CD1   . PHE G 2 84  ? 49.548  73.956  -40.671 1.00 45.46  ? 684  PHE E CD1   1 
ATOM   9404  C CD2   . PHE G 2 84  ? 50.557  76.122  -40.836 1.00 45.17  ? 684  PHE E CD2   1 
ATOM   9405  C CE1   . PHE G 2 84  ? 50.760  73.359  -41.018 1.00 46.83  ? 684  PHE E CE1   1 
ATOM   9406  C CE2   . PHE G 2 84  ? 51.778  75.539  -41.184 1.00 46.81  ? 684  PHE E CE2   1 
ATOM   9407  C CZ    . PHE G 2 84  ? 51.881  74.155  -41.274 1.00 47.99  ? 684  PHE E CZ    1 
ATOM   9408  N N     . GLN G 2 85  ? 47.327  78.320  -38.005 1.00 38.15  ? 685  GLN E N     1 
ATOM   9409  C CA    . GLN G 2 85  ? 46.455  79.491  -37.923 1.00 37.89  ? 685  GLN E CA    1 
ATOM   9410  C C     . GLN G 2 85  ? 46.327  79.880  -39.400 1.00 36.36  ? 685  GLN E C     1 
ATOM   9411  O O     . GLN G 2 85  ? 47.255  79.648  -40.191 1.00 32.76  ? 685  GLN E O     1 
ATOM   9412  C CB    . GLN G 2 85  ? 47.126  80.653  -37.178 1.00 47.96  ? 685  GLN E CB    1 
ATOM   9413  C CG    . GLN G 2 85  ? 47.393  80.412  -35.710 1.00 50.41  ? 685  GLN E CG    1 
ATOM   9414  C CD    . GLN G 2 85  ? 47.928  81.650  -35.015 1.00 54.15  ? 685  GLN E CD    1 
ATOM   9415  O OE1   . GLN G 2 85  ? 48.770  82.368  -35.561 1.00 56.06  ? 685  GLN E OE1   1 
ATOM   9416  N NE2   . GLN G 2 85  ? 47.456  81.900  -33.796 1.00 54.45  ? 685  GLN E NE2   1 
ATOM   9417  N N     . SER G 2 86  ? 45.201  80.451  -39.794 1.00 46.83  ? 686  SER E N     1 
ATOM   9418  C CA    . SER G 2 86  ? 45.050  80.833  -41.196 1.00 48.46  ? 686  SER E CA    1 
ATOM   9419  C C     . SER G 2 86  ? 46.106  81.885  -41.596 1.00 47.53  ? 686  SER E C     1 
ATOM   9420  O O     . SER G 2 86  ? 46.614  81.871  -42.716 1.00 49.22  ? 686  SER E O     1 
ATOM   9421  C CB    . SER G 2 86  ? 43.639  81.376  -41.451 1.00 44.09  ? 686  SER E CB    1 
ATOM   9422  O OG    . SER G 2 86  ? 43.434  82.611  -40.772 1.00 50.94  ? 686  SER E OG    1 
ATOM   9423  N N     . SER G 2 87  ? 46.447  82.786  -40.680 1.00 33.59  ? 687  SER E N     1 
ATOM   9424  C CA    . SER G 2 87  ? 47.440  83.821  -40.981 1.00 34.81  ? 687  SER E CA    1 
ATOM   9425  C C     . SER G 2 87  ? 48.855  83.241  -41.172 1.00 32.24  ? 687  SER E C     1 
ATOM   9426  O O     . SER G 2 87  ? 49.681  83.834  -41.862 1.00 29.33  ? 687  SER E O     1 
ATOM   9427  C CB    . SER G 2 87  ? 47.448  84.895  -39.884 1.00 45.15  ? 687  SER E CB    1 
ATOM   9428  O OG    . SER G 2 87  ? 47.737  84.321  -38.618 1.00 53.03  ? 687  SER E OG    1 
ATOM   9429  N N     . ALA G 2 88  ? 49.131  82.092  -40.560 1.00 34.79  ? 688  ALA E N     1 
ATOM   9430  C CA    . ALA G 2 88  ? 50.427  81.439  -40.717 1.00 32.68  ? 688  ALA E CA    1 
ATOM   9431  C C     . ALA G 2 88  ? 50.569  80.993  -42.174 1.00 33.46  ? 688  ALA E C     1 
ATOM   9432  O O     . ALA G 2 88  ? 51.634  81.124  -42.788 1.00 32.80  ? 688  ALA E O     1 
ATOM   9433  C CB    . ALA G 2 88  ? 50.521  80.225  -39.807 1.00 28.06  ? 688  ALA E CB    1 
ATOM   9434  N N     . VAL G 2 89  ? 49.491  80.447  -42.723 1.00 31.86  ? 689  VAL E N     1 
ATOM   9435  C CA    . VAL G 2 89  ? 49.509  79.996  -44.107 1.00 33.68  ? 689  VAL E CA    1 
ATOM   9436  C C     . VAL G 2 89  ? 49.647  81.194  -45.055 1.00 33.35  ? 689  VAL E C     1 
ATOM   9437  O O     . VAL G 2 89  ? 50.341  81.111  -46.064 1.00 31.51  ? 689  VAL E O     1 
ATOM   9438  C CB    . VAL G 2 89  ? 48.223  79.216  -44.462 1.00 30.28  ? 689  VAL E CB    1 
ATOM   9439  C CG1   . VAL G 2 89  ? 48.258  78.781  -45.919 1.00 26.80  ? 689  VAL E CG1   1 
ATOM   9440  C CG2   . VAL G 2 89  ? 48.097  77.986  -43.551 1.00 34.31  ? 689  VAL E CG2   1 
ATOM   9441  N N     . MET G 2 90  ? 48.979  82.296  -44.726 1.00 38.58  ? 690  MET E N     1 
ATOM   9442  C CA    . MET G 2 90  ? 49.045  83.500  -45.547 1.00 40.45  ? 690  MET E CA    1 
ATOM   9443  C C     . MET G 2 90  ? 50.432  84.123  -45.466 1.00 38.81  ? 690  MET E C     1 
ATOM   9444  O O     . MET G 2 90  ? 50.958  84.603  -46.476 1.00 38.83  ? 690  MET E O     1 
ATOM   9445  C CB    . MET G 2 90  ? 47.977  84.513  -45.119 1.00 50.58  ? 690  MET E CB    1 
ATOM   9446  C CG    . MET G 2 90  ? 46.579  84.154  -45.600 1.00 60.29  ? 690  MET E CG    1 
ATOM   9447  S SD    . MET G 2 90  ? 46.485  83.839  -47.411 1.00 72.78  ? 690  MET E SD    1 
ATOM   9448  C CE    . MET G 2 90  ? 45.968  85.449  -48.004 1.00 69.38  ? 690  MET E CE    1 
ATOM   9449  N N     . ALA G 2 91  ? 51.032  84.105  -44.275 1.00 33.88  ? 691  ALA E N     1 
ATOM   9450  C CA    . ALA G 2 91  ? 52.376  84.643  -44.125 1.00 33.23  ? 691  ALA E CA    1 
ATOM   9451  C C     . ALA G 2 91  ? 53.318  83.869  -45.050 1.00 32.74  ? 691  ALA E C     1 
ATOM   9452  O O     . ALA G 2 91  ? 54.143  84.460  -45.748 1.00 33.98  ? 691  ALA E O     1 
ATOM   9453  C CB    . ALA G 2 91  ? 52.843  84.531  -42.672 1.00 22.69  ? 691  ALA E CB    1 
ATOM   9454  N N     . LEU G 2 92  ? 53.180  82.544  -45.071 1.00 30.44  ? 692  LEU E N     1 
ATOM   9455  C CA    . LEU G 2 92  ? 54.024  81.694  -45.915 1.00 30.86  ? 692  LEU E CA    1 
ATOM   9456  C C     . LEU G 2 92  ? 53.807  81.977  -47.394 1.00 30.12  ? 692  LEU E C     1 
ATOM   9457  O O     . LEU G 2 92  ? 54.751  81.951  -48.195 1.00 32.04  ? 692  LEU E O     1 
ATOM   9458  C CB    . LEU G 2 92  ? 53.749  80.199  -45.625 1.00 31.51  ? 692  LEU E CB    1 
ATOM   9459  C CG    . LEU G 2 92  ? 54.295  79.615  -44.314 1.00 33.23  ? 692  LEU E CG    1 
ATOM   9460  C CD1   . LEU G 2 92  ? 53.577  78.321  -43.954 1.00 34.41  ? 692  LEU E CD1   1 
ATOM   9461  C CD2   . LEU G 2 92  ? 55.790  79.378  -44.451 1.00 31.14  ? 692  LEU E CD2   1 
ATOM   9462  N N     . GLN G 2 93  ? 52.565  82.247  -47.768 1.00 26.38  ? 693  GLN E N     1 
ATOM   9463  C CA    . GLN G 2 93  ? 52.278  82.511  -49.169 1.00 29.10  ? 693  GLN E CA    1 
ATOM   9464  C C     . GLN G 2 93  ? 52.798  83.874  -49.621 1.00 29.39  ? 693  GLN E C     1 
ATOM   9465  O O     . GLN G 2 93  ? 53.294  84.001  -50.746 1.00 29.97  ? 693  GLN E O     1 
ATOM   9466  C CB    . GLN G 2 93  ? 50.778  82.420  -49.465 1.00 34.14  ? 693  GLN E CB    1 
ATOM   9467  C CG    . GLN G 2 93  ? 50.532  82.110  -50.935 1.00 37.52  ? 693  GLN E CG    1 
ATOM   9468  C CD    . GLN G 2 93  ? 49.080  82.008  -51.291 1.00 41.76  ? 693  GLN E CD    1 
ATOM   9469  O OE1   . GLN G 2 93  ? 48.234  81.733  -50.438 1.00 41.71  ? 693  GLN E OE1   1 
ATOM   9470  N NE2   . GLN G 2 93  ? 48.774  82.219  -52.570 1.00 43.47  ? 693  GLN E NE2   1 
ATOM   9471  N N     . GLU G 2 94  ? 52.676  84.887  -48.765 1.00 33.28  ? 694  GLU E N     1 
ATOM   9472  C CA    . GLU G 2 94  ? 53.176  86.219  -49.098 1.00 34.04  ? 694  GLU E CA    1 
ATOM   9473  C C     . GLU G 2 94  ? 54.698  86.142  -49.276 1.00 32.55  ? 694  GLU E C     1 
ATOM   9474  O O     . GLU G 2 94  ? 55.242  86.699  -50.236 1.00 31.20  ? 694  GLU E O     1 
ATOM   9475  C CB    . GLU G 2 94  ? 52.845  87.224  -47.987 1.00 34.80  ? 694  GLU E CB    1 
ATOM   9476  C CG    . GLU G 2 94  ? 51.364  87.562  -47.847 1.00 40.54  ? 694  GLU E CG    1 
ATOM   9477  C CD    . GLU G 2 94  ? 50.865  88.601  -48.864 1.00 44.75  ? 694  GLU E CD    1 
ATOM   9478  O OE1   . GLU G 2 94  ? 51.693  89.224  -49.577 1.00 40.63  ? 694  GLU E OE1   1 
ATOM   9479  O OE2   . GLU G 2 94  ? 49.623  88.804  -48.926 1.00 47.99  ? 694  GLU E OE2   1 
ATOM   9480  N N     . ALA G 2 95  ? 55.373  85.430  -48.364 1.00 26.62  ? 695  ALA E N     1 
ATOM   9481  C CA    . ALA G 2 95  ? 56.834  85.285  -48.426 1.00 28.35  ? 695  ALA E CA    1 
ATOM   9482  C C     . ALA G 2 95  ? 57.302  84.473  -49.621 1.00 27.78  ? 695  ALA E C     1 
ATOM   9483  O O     . ALA G 2 95  ? 58.301  84.814  -50.250 1.00 26.95  ? 695  ALA E O     1 
ATOM   9484  C CB    . ALA G 2 95  ? 57.363  84.630  -47.154 1.00 24.46  ? 695  ALA E CB    1 
ATOM   9485  N N     . SER G 2 96  ? 56.597  83.380  -49.909 1.00 25.92  ? 696  SER E N     1 
ATOM   9486  C CA    . SER G 2 96  ? 56.956  82.514  -51.029 1.00 28.10  ? 696  SER E CA    1 
ATOM   9487  C C     . SER G 2 96  ? 56.790  83.259  -52.329 1.00 25.07  ? 696  SER E C     1 
ATOM   9488  O O     . SER G 2 96  ? 57.627  83.145  -53.219 1.00 23.13  ? 696  SER E O     1 
ATOM   9489  C CB    . SER G 2 96  ? 56.066  81.260  -51.084 1.00 27.44  ? 696  SER E CB    1 
ATOM   9490  O OG    . SER G 2 96  ? 56.277  80.448  -49.955 1.00 31.09  ? 696  SER E OG    1 
ATOM   9491  N N     . GLU G 2 97  ? 55.697  84.002  -52.452 1.00 29.76  ? 697  GLU E N     1 
ATOM   9492  C CA    . GLU G 2 97  ? 55.477  84.744  -53.681 1.00 33.53  ? 697  GLU E CA    1 
ATOM   9493  C C     . GLU G 2 97  ? 56.484  85.883  -53.850 1.00 33.14  ? 697  GLU E C     1 
ATOM   9494  O O     . GLU G 2 97  ? 56.969  86.102  -54.966 1.00 33.66  ? 697  GLU E O     1 
ATOM   9495  C CB    . GLU G 2 97  ? 54.021  85.249  -53.770 1.00 36.57  ? 697  GLU E CB    1 
ATOM   9496  C CG    . GLU G 2 97  ? 53.032  84.104  -54.133 1.00 42.92  ? 697  GLU E CG    1 
ATOM   9497  C CD    . GLU G 2 97  ? 51.641  84.588  -54.560 1.00 49.10  ? 697  GLU E CD    1 
ATOM   9498  O OE1   . GLU G 2 97  ? 51.535  85.683  -55.179 1.00 52.36  ? 697  GLU E OE1   1 
ATOM   9499  O OE2   . GLU G 2 97  ? 50.650  83.862  -54.295 1.00 48.38  ? 697  GLU E OE2   1 
ATOM   9500  N N     . ALA G 2 98  ? 56.837  86.581  -52.764 1.00 28.06  ? 698  ALA E N     1 
ATOM   9501  C CA    . ALA G 2 98  ? 57.801  87.673  -52.893 1.00 27.54  ? 698  ALA E CA    1 
ATOM   9502  C C     . ALA G 2 98  ? 59.130  87.061  -53.277 1.00 28.91  ? 698  ALA E C     1 
ATOM   9503  O O     . ALA G 2 98  ? 59.858  87.619  -54.093 1.00 29.52  ? 698  ALA E O     1 
ATOM   9504  C CB    . ALA G 2 98  ? 57.945  88.449  -51.581 1.00 26.37  ? 698  ALA E CB    1 
ATOM   9505  N N     . TYR G 2 99  ? 59.442  85.909  -52.684 1.00 27.87  ? 699  TYR E N     1 
ATOM   9506  C CA    . TYR G 2 99  ? 60.680  85.198  -52.997 1.00 28.61  ? 699  TYR E CA    1 
ATOM   9507  C C     . TYR G 2 99  ? 60.750  84.843  -54.496 1.00 29.25  ? 699  TYR E C     1 
ATOM   9508  O O     . TYR G 2 99  ? 61.739  85.133  -55.165 1.00 29.03  ? 699  TYR E O     1 
ATOM   9509  C CB    . TYR G 2 99  ? 60.773  83.903  -52.174 1.00 29.87  ? 699  TYR E CB    1 
ATOM   9510  C CG    . TYR G 2 99  ? 61.913  83.007  -52.604 1.00 31.09  ? 699  TYR E CG    1 
ATOM   9511  C CD1   . TYR G 2 99  ? 63.244  83.358  -52.343 1.00 30.83  ? 699  TYR E CD1   1 
ATOM   9512  C CD2   . TYR G 2 99  ? 61.668  81.849  -53.345 1.00 30.28  ? 699  TYR E CD2   1 
ATOM   9513  C CE1   . TYR G 2 99  ? 64.304  82.579  -52.829 1.00 33.85  ? 699  TYR E CE1   1 
ATOM   9514  C CE2   . TYR G 2 99  ? 62.714  81.064  -53.830 1.00 33.32  ? 699  TYR E CE2   1 
ATOM   9515  C CZ    . TYR G 2 99  ? 64.025  81.429  -53.579 1.00 34.48  ? 699  TYR E CZ    1 
ATOM   9516  O OH    . TYR G 2 99  ? 65.047  80.662  -54.099 1.00 34.94  ? 699  TYR E OH    1 
ATOM   9517  N N     . LEU G 2 100 ? 59.696  84.218  -55.015 1.00 30.43  ? 700  LEU E N     1 
ATOM   9518  C CA    . LEU G 2 100 ? 59.667  83.814  -56.419 1.00 31.11  ? 700  LEU E CA    1 
ATOM   9519  C C     . LEU G 2 100 ? 59.730  85.006  -57.380 1.00 31.47  ? 700  LEU E C     1 
ATOM   9520  O O     . LEU G 2 100 ? 60.452  84.966  -58.384 1.00 32.85  ? 700  LEU E O     1 
ATOM   9521  C CB    . LEU G 2 100 ? 58.424  82.943  -56.698 1.00 26.49  ? 700  LEU E CB    1 
ATOM   9522  C CG    . LEU G 2 100 ? 58.448  81.511  -56.108 1.00 29.61  ? 700  LEU E CG    1 
ATOM   9523  C CD1   . LEU G 2 100 ? 57.189  80.729  -56.498 1.00 27.54  ? 700  LEU E CD1   1 
ATOM   9524  C CD2   . LEU G 2 100 ? 59.664  80.763  -56.618 1.00 28.71  ? 700  LEU E CD2   1 
ATOM   9525  N N     . VAL G 2 101 ? 58.985  86.068  -57.083 1.00 30.11  ? 701  VAL E N     1 
ATOM   9526  C CA    . VAL G 2 101 ? 59.010  87.254  -57.940 1.00 31.13  ? 701  VAL E CA    1 
ATOM   9527  C C     . VAL G 2 101 ? 60.434  87.836  -58.005 1.00 29.76  ? 701  VAL E C     1 
ATOM   9528  O O     . VAL G 2 101 ? 60.940  88.150  -59.096 1.00 27.89  ? 701  VAL E O     1 
ATOM   9529  C CB    . VAL G 2 101 ? 57.997  88.323  -57.427 1.00 30.40  ? 701  VAL E CB    1 
ATOM   9530  C CG1   . VAL G 2 101 ? 58.150  89.630  -58.197 1.00 30.22  ? 701  VAL E CG1   1 
ATOM   9531  C CG2   . VAL G 2 101 ? 56.579  87.789  -57.596 1.00 30.33  ? 701  VAL E CG2   1 
ATOM   9532  N N     . GLY G 2 102 ? 61.073  87.960  -56.840 1.00 33.37  ? 702  GLY E N     1 
ATOM   9533  C CA    . GLY G 2 102 ? 62.434  88.473  -56.769 1.00 31.83  ? 702  GLY E CA    1 
ATOM   9534  C C     . GLY G 2 102 ? 63.402  87.557  -57.511 1.00 33.73  ? 702  GLY E C     1 
ATOM   9535  O O     . GLY G 2 102 ? 64.376  88.014  -58.122 1.00 34.55  ? 702  GLY E O     1 
ATOM   9536  N N     . LEU G 2 103 ? 63.151  86.251  -57.461 1.00 28.39  ? 703  LEU E N     1 
ATOM   9537  C CA    . LEU G 2 103 ? 64.010  85.298  -58.167 1.00 27.76  ? 703  LEU E CA    1 
ATOM   9538  C C     . LEU G 2 103 ? 63.822  85.475  -59.687 1.00 25.61  ? 703  LEU E C     1 
ATOM   9539  O O     . LEU G 2 103 ? 64.794  85.506  -60.445 1.00 24.80  ? 703  LEU E O     1 
ATOM   9540  C CB    . LEU G 2 103 ? 63.664  83.863  -57.759 1.00 30.35  ? 703  LEU E CB    1 
ATOM   9541  C CG    . LEU G 2 103 ? 64.532  82.783  -58.405 1.00 35.09  ? 703  LEU E CG    1 
ATOM   9542  C CD1   . LEU G 2 103 ? 65.999  83.094  -58.169 1.00 36.18  ? 703  LEU E CD1   1 
ATOM   9543  C CD2   . LEU G 2 103 ? 64.175  81.409  -57.830 1.00 36.05  ? 703  LEU E CD2   1 
ATOM   9544  N N     . PHE G 2 104 ? 62.577  85.604  -60.136 1.00 24.19  ? 704  PHE E N     1 
ATOM   9545  C CA    . PHE G 2 104 ? 62.328  85.797  -61.566 1.00 28.62  ? 704  PHE E CA    1 
ATOM   9546  C C     . PHE G 2 104 ? 62.952  87.101  -62.087 1.00 29.61  ? 704  PHE E C     1 
ATOM   9547  O O     . PHE G 2 104 ? 63.389  87.153  -63.234 1.00 28.64  ? 704  PHE E O     1 
ATOM   9548  C CB    . PHE G 2 104 ? 60.822  85.764  -61.871 1.00 28.43  ? 704  PHE E CB    1 
ATOM   9549  C CG    . PHE G 2 104 ? 60.258  84.373  -61.973 1.00 27.60  ? 704  PHE E CG    1 
ATOM   9550  C CD1   . PHE G 2 104 ? 59.153  83.996  -61.211 1.00 29.42  ? 704  PHE E CD1   1 
ATOM   9551  C CD2   . PHE G 2 104 ? 60.831  83.440  -62.837 1.00 29.46  ? 704  PHE E CD2   1 
ATOM   9552  C CE1   . PHE G 2 104 ? 58.616  82.706  -61.308 1.00 28.62  ? 704  PHE E CE1   1 
ATOM   9553  C CE2   . PHE G 2 104 ? 60.305  82.137  -62.950 1.00 27.89  ? 704  PHE E CE2   1 
ATOM   9554  C CZ    . PHE G 2 104 ? 59.195  81.770  -62.182 1.00 30.02  ? 704  PHE E CZ    1 
ATOM   9555  N N     . GLU G 2 105 ? 63.023  88.143  -61.257 1.00 31.18  ? 705  GLU E N     1 
ATOM   9556  C CA    . GLU G 2 105 ? 63.643  89.385  -61.727 1.00 34.57  ? 705  GLU E CA    1 
ATOM   9557  C C     . GLU G 2 105 ? 65.114  89.107  -62.002 1.00 35.03  ? 705  GLU E C     1 
ATOM   9558  O O     . GLU G 2 105 ? 65.644  89.521  -63.035 1.00 34.07  ? 705  GLU E O     1 
ATOM   9559  C CB    . GLU G 2 105 ? 63.544  90.512  -60.687 1.00 37.26  ? 705  GLU E CB    1 
ATOM   9560  C CG    . GLU G 2 105 ? 62.147  90.747  -60.164 1.00 46.90  ? 705  GLU E CG    1 
ATOM   9561  C CD    . GLU G 2 105 ? 62.113  91.738  -59.007 1.00 53.15  ? 705  GLU E CD    1 
ATOM   9562  O OE1   . GLU G 2 105 ? 63.090  91.783  -58.216 1.00 55.79  ? 705  GLU E OE1   1 
ATOM   9563  O OE2   . GLU G 2 105 ? 61.098  92.458  -58.878 1.00 55.99  ? 705  GLU E OE2   1 
ATOM   9564  N N     . ASP G 2 106 ? 65.779  88.407  -61.079 1.00 34.74  ? 706  ASP E N     1 
ATOM   9565  C CA    . ASP G 2 106 ? 67.206  88.094  -61.260 1.00 34.97  ? 706  ASP E CA    1 
ATOM   9566  C C     . ASP G 2 106 ? 67.435  87.155  -62.436 1.00 32.28  ? 706  ASP E C     1 
ATOM   9567  O O     . ASP G 2 106 ? 68.408  87.289  -63.169 1.00 32.29  ? 706  ASP E O     1 
ATOM   9568  C CB    . ASP G 2 106 ? 67.783  87.466  -59.997 1.00 41.64  ? 706  ASP E CB    1 
ATOM   9569  C CG    . ASP G 2 106 ? 67.840  88.441  -58.842 1.00 47.38  ? 706  ASP E CG    1 
ATOM   9570  O OD1   . ASP G 2 106 ? 67.742  89.665  -59.094 1.00 50.23  ? 706  ASP E OD1   1 
ATOM   9571  O OD2   . ASP G 2 106 ? 67.999  87.986  -57.685 1.00 50.56  ? 706  ASP E OD2   1 
ATOM   9572  N N     . THR G 2 107 ? 66.524  86.201  -62.593 1.00 27.73  ? 707  THR E N     1 
ATOM   9573  C CA    . THR G 2 107 ? 66.583  85.226  -63.668 1.00 27.05  ? 707  THR E CA    1 
ATOM   9574  C C     . THR G 2 107 ? 66.451  85.969  -64.992 1.00 26.36  ? 707  THR E C     1 
ATOM   9575  O O     . THR G 2 107 ? 67.121  85.640  -65.961 1.00 24.56  ? 707  THR E O     1 
ATOM   9576  C CB    . THR G 2 107 ? 65.422  84.210  -63.503 1.00 32.53  ? 707  THR E CB    1 
ATOM   9577  O OG1   . THR G 2 107 ? 65.618  83.487  -62.279 1.00 34.44  ? 707  THR E OG1   1 
ATOM   9578  C CG2   . THR G 2 107 ? 65.346  83.236  -64.677 1.00 32.57  ? 707  THR E CG2   1 
ATOM   9579  N N     . ASN G 2 108 ? 65.593  86.983  -65.013 1.00 29.53  ? 708  ASN E N     1 
ATOM   9580  C CA    . ASN G 2 108 ? 65.353  87.773  -66.214 1.00 30.59  ? 708  ASN E CA    1 
ATOM   9581  C C     . ASN G 2 108 ? 66.621  88.528  -66.634 1.00 33.32  ? 708  ASN E C     1 
ATOM   9582  O O     . ASN G 2 108 ? 66.910  88.665  -67.831 1.00 32.12  ? 708  ASN E O     1 
ATOM   9583  C CB    . ASN G 2 108 ? 64.202  88.754  -65.956 1.00 29.97  ? 708  ASN E CB    1 
ATOM   9584  C CG    . ASN G 2 108 ? 63.508  89.199  -67.240 1.00 33.12  ? 708  ASN E CG    1 
ATOM   9585  O OD1   . ASN G 2 108 ? 63.493  88.472  -68.234 1.00 32.16  ? 708  ASN E OD1   1 
ATOM   9586  N ND2   . ASN G 2 108 ? 62.912  90.384  -67.212 1.00 30.33  ? 708  ASN E ND2   1 
ATOM   9587  N N     . LEU G 2 109 ? 67.372  89.025  -65.650 1.00 32.94  ? 709  LEU E N     1 
ATOM   9588  C CA    . LEU G 2 109 ? 68.612  89.736  -65.948 1.00 33.40  ? 709  LEU E CA    1 
ATOM   9589  C C     . LEU G 2 109 ? 69.653  88.757  -66.503 1.00 32.37  ? 709  LEU E C     1 
ATOM   9590  O O     . LEU G 2 109 ? 70.454  89.115  -67.362 1.00 31.20  ? 709  LEU E O     1 
ATOM   9591  C CB    . LEU G 2 109 ? 69.145  90.440  -64.696 1.00 35.65  ? 709  LEU E CB    1 
ATOM   9592  C CG    . LEU G 2 109 ? 68.334  91.677  -64.287 1.00 40.33  ? 709  LEU E CG    1 
ATOM   9593  C CD1   . LEU G 2 109 ? 68.888  92.261  -63.001 1.00 38.71  ? 709  LEU E CD1   1 
ATOM   9594  C CD2   . LEU G 2 109 ? 68.390  92.719  -65.412 1.00 38.86  ? 709  LEU E CD2   1 
ATOM   9595  N N     . CYS G 2 110 ? 69.638  87.521  -66.011 1.00 29.96  ? 710  CYS E N     1 
ATOM   9596  C CA    . CYS G 2 110 ? 70.573  86.518  -66.508 1.00 31.78  ? 710  CYS E CA    1 
ATOM   9597  C C     . CYS G 2 110 ? 70.254  86.143  -67.964 1.00 31.41  ? 710  CYS E C     1 
ATOM   9598  O O     . CYS G 2 110 ? 71.160  85.984  -68.777 1.00 30.16  ? 710  CYS E O     1 
ATOM   9599  C CB    . CYS G 2 110 ? 70.545  85.275  -65.605 1.00 33.59  ? 710  CYS E CB    1 
ATOM   9600  S SG    . CYS G 2 110 ? 71.263  85.592  -63.949 1.00 36.31  ? 710  CYS E SG    1 
ATOM   9601  N N     . ALA G 2 111 ? 68.976  85.999  -68.294 1.00 32.05  ? 711  ALA E N     1 
ATOM   9602  C CA    . ALA G 2 111 ? 68.592  85.674  -69.668 1.00 34.60  ? 711  ALA E CA    1 
ATOM   9603  C C     . ALA G 2 111 ? 69.030  86.828  -70.572 1.00 34.60  ? 711  ALA E C     1 
ATOM   9604  O O     . ALA G 2 111 ? 69.676  86.618  -71.598 1.00 34.53  ? 711  ALA E O     1 
ATOM   9605  C CB    . ALA G 2 111 ? 67.087  85.482  -69.767 1.00 32.42  ? 711  ALA E CB    1 
ATOM   9606  N N     . ILE G 2 112 ? 68.696  88.049  -70.166 1.00 33.98  ? 712  ILE E N     1 
ATOM   9607  C CA    . ILE G 2 112 ? 69.044  89.242  -70.937 1.00 36.05  ? 712  ILE E CA    1 
ATOM   9608  C C     . ILE G 2 112 ? 70.555  89.363  -71.133 1.00 36.99  ? 712  ILE E C     1 
ATOM   9609  O O     . ILE G 2 112 ? 71.018  89.767  -72.202 1.00 39.16  ? 712  ILE E O     1 
ATOM   9610  C CB    . ILE G 2 112 ? 68.498  90.526  -70.251 1.00 35.60  ? 712  ILE E CB    1 
ATOM   9611  C CG1   . ILE G 2 112 ? 66.972  90.560  -70.365 1.00 37.18  ? 712  ILE E CG1   1 
ATOM   9612  C CG2   . ILE G 2 112 ? 69.102  91.782  -70.892 1.00 36.54  ? 712  ILE E CG2   1 
ATOM   9613  C CD1   . ILE G 2 112 ? 66.316  91.673  -69.533 1.00 36.96  ? 712  ILE E CD1   1 
ATOM   9614  N N     . HIS G 2 113 ? 71.314  89.003  -70.102 1.00 39.03  ? 713  HIS E N     1 
ATOM   9615  C CA    . HIS G 2 113 ? 72.776  89.061  -70.144 1.00 38.89  ? 713  HIS E CA    1 
ATOM   9616  C C     . HIS G 2 113 ? 73.313  88.163  -71.264 1.00 39.98  ? 713  HIS E C     1 
ATOM   9617  O O     . HIS G 2 113 ? 74.337  88.470  -71.882 1.00 40.27  ? 713  HIS E O     1 
ATOM   9618  C CB    . HIS G 2 113 ? 73.351  88.589  -68.804 1.00 33.78  ? 713  HIS E CB    1 
ATOM   9619  C CG    . HIS G 2 113 ? 74.850  88.597  -68.739 1.00 33.82  ? 713  HIS E CG    1 
ATOM   9620  N ND1   . HIS G 2 113 ? 75.589  89.760  -68.648 1.00 33.87  ? 713  HIS E ND1   1 
ATOM   9621  C CD2   . HIS G 2 113 ? 75.746  87.581  -68.705 1.00 33.49  ? 713  HIS E CD2   1 
ATOM   9622  C CE1   . HIS G 2 113 ? 76.873  89.461  -68.553 1.00 32.47  ? 713  HIS E CE1   1 
ATOM   9623  N NE2   . HIS G 2 113 ? 76.997  88.144  -68.585 1.00 34.05  ? 713  HIS E NE2   1 
ATOM   9624  N N     . ALA G 2 114 ? 72.632  87.041  -71.486 1.00 36.34  ? 714  ALA E N     1 
ATOM   9625  C CA    . ALA G 2 114 ? 73.014  86.090  -72.520 1.00 39.15  ? 714  ALA E CA    1 
ATOM   9626  C C     . ALA G 2 114 ? 72.375  86.458  -73.855 1.00 40.06  ? 714  ALA E C     1 
ATOM   9627  O O     . ALA G 2 114 ? 72.371  85.650  -74.773 1.00 39.92  ? 714  ALA E O     1 
ATOM   9628  C CB    . ALA G 2 114 ? 72.583  84.678  -72.126 1.00 25.82  ? 714  ALA E CB    1 
ATOM   9629  N N     . LYS G 2 115 ? 71.819  87.666  -73.940 1.00 42.25  ? 715  LYS E N     1 
ATOM   9630  C CA    . LYS G 2 115 ? 71.174  88.150  -75.155 1.00 45.20  ? 715  LYS E CA    1 
ATOM   9631  C C     . LYS G 2 115 ? 69.909  87.386  -75.570 1.00 45.06  ? 715  LYS E C     1 
ATOM   9632  O O     . LYS G 2 115 ? 69.660  87.166  -76.754 1.00 45.52  ? 715  LYS E O     1 
ATOM   9633  C CB    . LYS G 2 115 ? 72.183  88.155  -76.299 1.00 58.40  ? 715  LYS E CB    1 
ATOM   9634  C CG    . LYS G 2 115 ? 73.385  89.039  -76.025 1.00 63.76  ? 715  LYS E CG    1 
ATOM   9635  C CD    . LYS G 2 115 ? 74.424  88.876  -77.107 1.00 69.47  ? 715  LYS E CD    1 
ATOM   9636  C CE    . LYS G 2 115 ? 75.626  89.764  -76.865 1.00 71.79  ? 715  LYS E CE    1 
ATOM   9637  N NZ    . LYS G 2 115 ? 76.690  89.453  -77.863 1.00 74.70  ? 715  LYS E NZ    1 
ATOM   9638  N N     . ARG G 2 116 ? 69.108  86.997  -74.584 1.00 40.93  ? 716  ARG E N     1 
ATOM   9639  C CA    . ARG G 2 116 ? 67.854  86.295  -74.823 1.00 37.50  ? 716  ARG E CA    1 
ATOM   9640  C C     . ARG G 2 116 ? 66.750  87.094  -74.141 1.00 36.45  ? 716  ARG E C     1 
ATOM   9641  O O     . ARG G 2 116 ? 67.034  88.017  -73.393 1.00 35.67  ? 716  ARG E O     1 
ATOM   9642  C CB    . ARG G 2 116 ? 67.870  84.853  -74.250 1.00 37.75  ? 716  ARG E CB    1 
ATOM   9643  C CG    . ARG G 2 116 ? 68.812  83.877  -74.935 1.00 39.28  ? 716  ARG E CG    1 
ATOM   9644  C CD    . ARG G 2 116 ? 68.616  82.472  -74.384 1.00 39.16  ? 716  ARG E CD    1 
ATOM   9645  N NE    . ARG G 2 116 ? 69.534  82.199  -73.271 1.00 38.64  ? 716  ARG E NE    1 
ATOM   9646  C CZ    . ARG G 2 116 ? 69.175  82.236  -71.984 1.00 37.57  ? 716  ARG E CZ    1 
ATOM   9647  N NH1   . ARG G 2 116 ? 67.926  82.538  -71.658 1.00 31.98  ? 716  ARG E NH1   1 
ATOM   9648  N NH2   . ARG G 2 116 ? 70.076  81.981  -71.047 1.00 35.09  ? 716  ARG E NH2   1 
ATOM   9649  N N     . VAL G 2 117 ? 65.493  86.737  -74.383 1.00 35.00  ? 717  VAL E N     1 
ATOM   9650  C CA    . VAL G 2 117 ? 64.387  87.405  -73.701 1.00 34.28  ? 717  VAL E CA    1 
ATOM   9651  C C     . VAL G 2 117 ? 63.517  86.310  -73.080 1.00 34.23  ? 717  VAL E C     1 
ATOM   9652  O O     . VAL G 2 117 ? 62.485  86.571  -72.467 1.00 34.22  ? 717  VAL E O     1 
ATOM   9653  C CB    . VAL G 2 117 ? 63.606  88.322  -74.658 1.00 39.62  ? 717  VAL E CB    1 
ATOM   9654  C CG1   . VAL G 2 117 ? 64.500  89.439  -75.174 1.00 38.80  ? 717  VAL E CG1   1 
ATOM   9655  C CG2   . VAL G 2 117 ? 63.026  87.518  -75.812 1.00 37.61  ? 717  VAL E CG2   1 
ATOM   9656  N N     . THR G 2 118 ? 63.970  85.076  -73.238 1.00 34.22  ? 718  THR E N     1 
ATOM   9657  C CA    . THR G 2 118 ? 63.278  83.899  -72.723 1.00 35.99  ? 718  THR E CA    1 
ATOM   9658  C C     . THR G 2 118 ? 64.081  83.336  -71.563 1.00 34.72  ? 718  THR E C     1 
ATOM   9659  O O     . THR G 2 118 ? 65.244  82.970  -71.745 1.00 35.02  ? 718  THR E O     1 
ATOM   9660  C CB    . THR G 2 118 ? 63.214  82.784  -73.790 1.00 42.57  ? 718  THR E CB    1 
ATOM   9661  O OG1   . THR G 2 118 ? 62.825  83.348  -75.047 1.00 43.49  ? 718  THR E OG1   1 
ATOM   9662  C CG2   . THR G 2 118 ? 62.229  81.685  -73.375 1.00 39.28  ? 718  THR E CG2   1 
ATOM   9663  N N     . ILE G 2 119 ? 63.484  83.258  -70.381 1.00 28.59  ? 719  ILE E N     1 
ATOM   9664  C CA    . ILE G 2 119 ? 64.214  82.696  -69.260 1.00 29.55  ? 719  ILE E CA    1 
ATOM   9665  C C     . ILE G 2 119 ? 64.211  81.168  -69.375 1.00 30.38  ? 719  ILE E C     1 
ATOM   9666  O O     . ILE G 2 119 ? 63.224  80.555  -69.801 1.00 26.87  ? 719  ILE E O     1 
ATOM   9667  C CB    . ILE G 2 119 ? 63.608  83.118  -67.904 1.00 29.12  ? 719  ILE E CB    1 
ATOM   9668  C CG1   . ILE G 2 119 ? 62.152  82.685  -67.808 1.00 28.72  ? 719  ILE E CG1   1 
ATOM   9669  C CG2   . ILE G 2 119 ? 63.730  84.627  -67.746 1.00 27.33  ? 719  ILE E CG2   1 
ATOM   9670  C CD1   . ILE G 2 119 ? 61.576  82.754  -66.391 1.00 30.69  ? 719  ILE E CD1   1 
ATOM   9671  N N     . MET G 2 120 ? 65.333  80.571  -68.998 1.00 36.98  ? 720  MET E N     1 
ATOM   9672  C CA    . MET G 2 120 ? 65.527  79.132  -69.054 1.00 39.19  ? 720  MET E CA    1 
ATOM   9673  C C     . MET G 2 120 ? 66.043  78.632  -67.711 1.00 38.09  ? 720  MET E C     1 
ATOM   9674  O O     . MET G 2 120 ? 66.544  79.415  -66.894 1.00 37.30  ? 720  MET E O     1 
ATOM   9675  C CB    . MET G 2 120 ? 66.539  78.792  -70.157 1.00 44.52  ? 720  MET E CB    1 
ATOM   9676  C CG    . MET G 2 120 ? 66.059  79.157  -71.572 1.00 48.55  ? 720  MET E CG    1 
ATOM   9677  S SD    . MET G 2 120 ? 67.374  79.112  -72.814 1.00 55.90  ? 720  MET E SD    1 
ATOM   9678  C CE    . MET G 2 120 ? 67.284  77.366  -73.347 1.00 56.78  ? 720  MET E CE    1 
ATOM   9679  N N     . PRO G 2 121 ? 65.909  77.321  -67.457 1.00 38.53  ? 721  PRO E N     1 
ATOM   9680  C CA    . PRO G 2 121 ? 66.374  76.731  -66.197 1.00 38.38  ? 721  PRO E CA    1 
ATOM   9681  C C     . PRO G 2 121 ? 67.777  77.189  -65.824 1.00 37.16  ? 721  PRO E C     1 
ATOM   9682  O O     . PRO G 2 121 ? 68.045  77.488  -64.661 1.00 37.91  ? 721  PRO E O     1 
ATOM   9683  C CB    . PRO G 2 121 ? 66.300  75.224  -66.472 1.00 34.30  ? 721  PRO E CB    1 
ATOM   9684  C CG    . PRO G 2 121 ? 65.035  75.140  -67.302 1.00 36.28  ? 721  PRO E CG    1 
ATOM   9685  C CD    . PRO G 2 121 ? 65.251  76.303  -68.300 1.00 36.04  ? 721  PRO E CD    1 
ATOM   9686  N N     . LYS G 2 122 ? 68.671  77.267  -66.803 1.00 31.12  ? 722  LYS E N     1 
ATOM   9687  C CA    . LYS G 2 122 ? 70.033  77.694  -66.497 1.00 33.91  ? 722  LYS E CA    1 
ATOM   9688  C C     . LYS G 2 122 ? 70.154  79.142  -65.986 1.00 32.53  ? 722  LYS E C     1 
ATOM   9689  O O     . LYS G 2 122 ? 71.116  79.472  -65.317 1.00 32.96  ? 722  LYS E O     1 
ATOM   9690  C CB    . LYS G 2 122 ? 70.956  77.488  -67.707 1.00 40.59  ? 722  LYS E CB    1 
ATOM   9691  C CG    . LYS G 2 122 ? 70.665  78.376  -68.897 1.00 46.74  ? 722  LYS E CG    1 
ATOM   9692  C CD    . LYS G 2 122 ? 71.547  77.973  -70.064 1.00 50.26  ? 722  LYS E CD    1 
ATOM   9693  C CE    . LYS G 2 122 ? 71.074  78.602  -71.344 1.00 54.39  ? 722  LYS E CE    1 
ATOM   9694  N NZ    . LYS G 2 122 ? 71.780  78.029  -72.521 1.00 61.49  ? 722  LYS E NZ    1 
ATOM   9695  N N     . ASP G 2 123 ? 69.198  80.005  -66.314 1.00 31.44  ? 723  ASP E N     1 
ATOM   9696  C CA    . ASP G 2 123 ? 69.228  81.387  -65.828 1.00 31.39  ? 723  ASP E CA    1 
ATOM   9697  C C     . ASP G 2 123 ? 68.881  81.371  -64.344 1.00 31.80  ? 723  ASP E C     1 
ATOM   9698  O O     . ASP G 2 123 ? 69.461  82.109  -63.559 1.00 31.30  ? 723  ASP E O     1 
ATOM   9699  C CB    . ASP G 2 123 ? 68.205  82.252  -66.579 1.00 35.70  ? 723  ASP E CB    1 
ATOM   9700  C CG    . ASP G 2 123 ? 68.533  82.397  -68.051 1.00 37.13  ? 723  ASP E CG    1 
ATOM   9701  O OD1   . ASP G 2 123 ? 69.712  82.657  -68.363 1.00 36.54  ? 723  ASP E OD1   1 
ATOM   9702  O OD2   . ASP G 2 123 ? 67.617  82.263  -68.894 1.00 37.62  ? 723  ASP E OD2   1 
ATOM   9703  N N     . ILE G 2 124 ? 67.922  80.528  -63.970 1.00 32.90  ? 724  ILE E N     1 
ATOM   9704  C CA    . ILE G 2 124 ? 67.504  80.403  -62.578 1.00 35.55  ? 724  ILE E CA    1 
ATOM   9705  C C     . ILE G 2 124 ? 68.649  79.824  -61.751 1.00 35.34  ? 724  ILE E C     1 
ATOM   9706  O O     . ILE G 2 124 ? 68.878  80.236  -60.614 1.00 34.65  ? 724  ILE E O     1 
ATOM   9707  C CB    . ILE G 2 124 ? 66.279  79.455  -62.428 1.00 39.00  ? 724  ILE E CB    1 
ATOM   9708  C CG1   . ILE G 2 124 ? 65.050  80.086  -63.085 1.00 39.01  ? 724  ILE E CG1   1 
ATOM   9709  C CG2   . ILE G 2 124 ? 66.022  79.149  -60.942 1.00 36.51  ? 724  ILE E CG2   1 
ATOM   9710  C CD1   . ILE G 2 124 ? 63.761  79.277  -62.924 1.00 41.75  ? 724  ILE E CD1   1 
ATOM   9711  N N     . GLN G 2 125 ? 69.363  78.873  -62.337 1.00 38.42  ? 725  GLN E N     1 
ATOM   9712  C CA    . GLN G 2 125 ? 70.480  78.221  -61.672 1.00 38.37  ? 725  GLN E CA    1 
ATOM   9713  C C     . GLN G 2 125 ? 71.623  79.206  -61.468 1.00 37.31  ? 725  GLN E C     1 
ATOM   9714  O O     . GLN G 2 125 ? 72.241  79.227  -60.412 1.00 39.05  ? 725  GLN E O     1 
ATOM   9715  C CB    . GLN G 2 125 ? 70.934  76.995  -62.485 1.00 36.33  ? 725  GLN E CB    1 
ATOM   9716  C CG    . GLN G 2 125 ? 69.937  75.819  -62.415 1.00 42.91  ? 725  GLN E CG    1 
ATOM   9717  C CD    . GLN G 2 125 ? 69.989  74.876  -63.625 1.00 46.76  ? 725  GLN E CD    1 
ATOM   9718  O OE1   . GLN G 2 125 ? 71.031  74.690  -64.255 1.00 51.16  ? 725  GLN E OE1   1 
ATOM   9719  N NE2   . GLN G 2 125 ? 68.857  74.267  -63.937 1.00 50.42  ? 725  GLN E NE2   1 
ATOM   9720  N N     . LEU G 2 126 ? 71.894  80.042  -62.465 1.00 31.13  ? 726  LEU E N     1 
ATOM   9721  C CA    . LEU G 2 126 ? 72.957  81.016  -62.321 1.00 30.26  ? 726  LEU E CA    1 
ATOM   9722  C C     . LEU G 2 126 ? 72.607  82.008  -61.209 1.00 31.53  ? 726  LEU E C     1 
ATOM   9723  O O     . LEU G 2 126 ? 73.448  82.342  -60.367 1.00 29.08  ? 726  LEU E O     1 
ATOM   9724  C CB    . LEU G 2 126 ? 73.167  81.790  -63.619 1.00 27.42  ? 726  LEU E CB    1 
ATOM   9725  C CG    . LEU G 2 126 ? 74.206  82.916  -63.490 1.00 29.96  ? 726  LEU E CG    1 
ATOM   9726  C CD1   . LEU G 2 126 ? 75.576  82.286  -63.248 1.00 29.43  ? 726  LEU E CD1   1 
ATOM   9727  C CD2   . LEU G 2 126 ? 74.235  83.787  -64.762 1.00 27.39  ? 726  LEU E CD2   1 
ATOM   9728  N N     . ALA G 2 127 ? 71.361  82.472  -61.218 1.00 29.49  ? 727  ALA E N     1 
ATOM   9729  C CA    . ALA G 2 127 ? 70.914  83.443  -60.240 1.00 32.31  ? 727  ALA E CA    1 
ATOM   9730  C C     . ALA G 2 127 ? 70.980  82.861  -58.827 1.00 33.42  ? 727  ALA E C     1 
ATOM   9731  O O     . ALA G 2 127 ? 71.472  83.512  -57.905 1.00 32.38  ? 727  ALA E O     1 
ATOM   9732  C CB    . ALA G 2 127 ? 69.470  83.914  -60.578 1.00 23.73  ? 727  ALA E CB    1 
ATOM   9733  N N     . ARG G 2 128 ? 70.503  81.633  -58.658 1.00 36.52  ? 728  ARG E N     1 
ATOM   9734  C CA    . ARG G 2 128 ? 70.525  81.010  -57.346 1.00 39.47  ? 728  ARG E CA    1 
ATOM   9735  C C     . ARG G 2 128 ? 71.955  80.797  -56.877 1.00 39.36  ? 728  ARG E C     1 
ATOM   9736  O O     . ARG G 2 128 ? 72.252  80.909  -55.684 1.00 37.44  ? 728  ARG E O     1 
ATOM   9737  C CB    . ARG G 2 128 ? 69.767  79.681  -57.363 1.00 35.77  ? 728  ARG E CB    1 
ATOM   9738  C CG    . ARG G 2 128 ? 68.262  79.845  -57.554 1.00 40.27  ? 728  ARG E CG    1 
ATOM   9739  C CD    . ARG G 2 128 ? 67.493  79.077  -56.494 1.00 43.24  ? 728  ARG E CD    1 
ATOM   9740  N NE    . ARG G 2 128 ? 67.881  77.683  -56.524 1.00 52.56  ? 728  ARG E NE    1 
ATOM   9741  C CZ    . ARG G 2 128 ? 67.800  76.858  -55.493 1.00 53.55  ? 728  ARG E CZ    1 
ATOM   9742  N NH1   . ARG G 2 128 ? 67.342  77.285  -54.324 1.00 53.13  ? 728  ARG E NH1   1 
ATOM   9743  N NH2   . ARG G 2 128 ? 68.179  75.600  -55.647 1.00 57.66  ? 728  ARG E NH2   1 
ATOM   9744  N N     . ARG G 2 129 ? 72.842  80.498  -57.818 1.00 34.52  ? 729  ARG E N     1 
ATOM   9745  C CA    . ARG G 2 129 ? 74.237  80.281  -57.479 1.00 38.02  ? 729  ARG E CA    1 
ATOM   9746  C C     . ARG G 2 129 ? 74.922  81.581  -57.040 1.00 37.38  ? 729  ARG E C     1 
ATOM   9747  O O     . ARG G 2 129 ? 75.701  81.577  -56.094 1.00 37.45  ? 729  ARG E O     1 
ATOM   9748  C CB    . ARG G 2 129 ? 74.986  79.655  -58.662 1.00 46.38  ? 729  ARG E CB    1 
ATOM   9749  C CG    . ARG G 2 129 ? 76.449  79.343  -58.367 1.00 52.98  ? 729  ARG E CG    1 
ATOM   9750  C CD    . ARG G 2 129 ? 77.003  78.304  -59.345 1.00 58.38  ? 729  ARG E CD    1 
ATOM   9751  N NE    . ARG G 2 129 ? 78.419  78.009  -59.116 1.00 63.51  ? 729  ARG E NE    1 
ATOM   9752  C CZ    . ARG G 2 129 ? 79.124  77.125  -59.820 1.00 64.15  ? 729  ARG E CZ    1 
ATOM   9753  N NH1   . ARG G 2 129 ? 78.546  76.442  -60.801 1.00 65.10  ? 729  ARG E NH1   1 
ATOM   9754  N NH2   . ARG G 2 129 ? 80.408  76.927  -59.551 1.00 63.78  ? 729  ARG E NH2   1 
ATOM   9755  N N     . ILE G 2 130 ? 74.630  82.693  -57.707 1.00 39.49  ? 730  ILE E N     1 
ATOM   9756  C CA    . ILE G 2 130 ? 75.260  83.952  -57.328 1.00 40.72  ? 730  ILE E CA    1 
ATOM   9757  C C     . ILE G 2 130 ? 74.710  84.389  -55.968 1.00 42.59  ? 730  ILE E C     1 
ATOM   9758  O O     . ILE G 2 130 ? 75.442  84.893  -55.122 1.00 42.33  ? 730  ILE E O     1 
ATOM   9759  C CB    . ILE G 2 130 ? 74.981  85.068  -58.356 1.00 43.51  ? 730  ILE E CB    1 
ATOM   9760  C CG1   . ILE G 2 130 ? 75.356  84.600  -59.774 1.00 46.05  ? 730  ILE E CG1   1 
ATOM   9761  C CG2   . ILE G 2 130 ? 75.773  86.325  -57.986 1.00 37.99  ? 730  ILE E CG2   1 
ATOM   9762  C CD1   . ILE G 2 130 ? 76.819  84.294  -59.970 1.00 48.42  ? 730  ILE E CD1   1 
ATOM   9763  N N     . ARG G 2 131 ? 73.410  84.195  -55.775 1.00 40.81  ? 731  ARG E N     1 
ATOM   9764  C CA    . ARG G 2 131 ? 72.749  84.543  -54.530 1.00 43.24  ? 731  ARG E CA    1 
ATOM   9765  C C     . ARG G 2 131 ? 73.279  83.739  -53.350 1.00 46.42  ? 731  ARG E C     1 
ATOM   9766  O O     . ARG G 2 131 ? 73.061  84.113  -52.200 1.00 46.84  ? 731  ARG E O     1 
ATOM   9767  C CB    . ARG G 2 131 ? 71.259  84.276  -54.635 1.00 41.28  ? 731  ARG E CB    1 
ATOM   9768  C CG    . ARG G 2 131 ? 70.478  85.242  -55.472 1.00 36.97  ? 731  ARG E CG    1 
ATOM   9769  C CD    . ARG G 2 131 ? 69.044  84.769  -55.480 1.00 34.02  ? 731  ARG E CD    1 
ATOM   9770  N NE    . ARG G 2 131 ? 68.138  85.801  -55.931 1.00 34.31  ? 731  ARG E NE    1 
ATOM   9771  C CZ    . ARG G 2 131 ? 66.882  85.904  -55.518 1.00 34.11  ? 731  ARG E CZ    1 
ATOM   9772  N NH1   . ARG G 2 131 ? 66.393  85.027  -54.644 1.00 33.06  ? 731  ARG E NH1   1 
ATOM   9773  N NH2   . ARG G 2 131 ? 66.128  86.899  -55.960 1.00 31.30  ? 731  ARG E NH2   1 
ATOM   9774  N N     . GLY G 2 132 ? 73.953  82.626  -53.628 1.00 41.56  ? 732  GLY E N     1 
ATOM   9775  C CA    . GLY G 2 132 ? 74.474  81.805  -52.546 1.00 48.22  ? 732  GLY E CA    1 
ATOM   9776  C C     . GLY G 2 132 ? 73.498  80.730  -52.093 1.00 53.26  ? 732  GLY E C     1 
ATOM   9777  O O     . GLY G 2 132 ? 73.640  80.156  -51.014 1.00 53.03  ? 732  GLY E O     1 
ATOM   9778  N N     . GLU G 2 133 ? 72.494  80.460  -52.917 1.00 50.11  ? 733  GLU E N     1 
ATOM   9779  C CA    . GLU G 2 133 ? 71.503  79.436  -52.612 1.00 57.33  ? 733  GLU E CA    1 
ATOM   9780  C C     . GLU G 2 133 ? 72.022  78.089  -53.124 1.00 64.76  ? 733  GLU E C     1 
ATOM   9781  O O     . GLU G 2 133 ? 71.342  77.064  -53.033 1.00 65.72  ? 733  GLU E O     1 
ATOM   9782  C CB    . GLU G 2 133 ? 70.160  79.802  -53.261 1.00 55.68  ? 733  GLU E CB    1 
ATOM   9783  C CG    . GLU G 2 133 ? 69.462  80.954  -52.540 1.00 51.45  ? 733  GLU E CG    1 
ATOM   9784  C CD    . GLU G 2 133 ? 68.231  81.488  -53.261 1.00 50.01  ? 733  GLU E CD    1 
ATOM   9785  O OE1   . GLU G 2 133 ? 67.412  80.688  -53.782 1.00 46.76  ? 733  GLU E OE1   1 
ATOM   9786  O OE2   . GLU G 2 133 ? 68.073  82.729  -53.285 1.00 49.39  ? 733  GLU E OE2   1 
ATOM   9787  N N     . ARG G 2 134 ? 73.249  78.111  -53.640 1.00 114.01 ? 734  ARG E N     1 
ATOM   9788  C CA    . ARG G 2 134 ? 73.912  76.925  -54.175 1.00 123.56 ? 734  ARG E CA    1 
ATOM   9789  C C     . ARG G 2 134 ? 75.325  77.295  -54.643 1.00 127.69 ? 734  ARG E C     1 
ATOM   9790  O O     . ARG G 2 134 ? 75.959  76.544  -55.388 1.00 128.37 ? 734  ARG E O     1 
ATOM   9791  C CB    . ARG G 2 134 ? 73.115  76.365  -55.355 1.00 120.57 ? 734  ARG E CB    1 
ATOM   9792  C CG    . ARG G 2 134 ? 72.974  77.350  -56.503 1.00 127.19 ? 734  ARG E CG    1 
ATOM   9793  C CD    . ARG G 2 134 ? 72.175  76.771  -57.655 1.00 132.21 ? 734  ARG E CD    1 
ATOM   9794  N NE    . ARG G 2 134 ? 72.820  75.600  -58.241 1.00 136.59 ? 734  ARG E NE    1 
ATOM   9795  C CZ    . ARG G 2 134 ? 72.323  74.912  -59.264 1.00 138.90 ? 734  ARG E CZ    1 
ATOM   9796  N NH1   . ARG G 2 134 ? 71.175  75.278  -59.814 1.00 140.14 ? 734  ARG E NH1   1 
ATOM   9797  N NH2   . ARG G 2 134 ? 72.971  73.856  -59.735 1.00 140.03 ? 734  ARG E NH2   1 
ATOM   9798  N N     . ALA G 2 135 ? 75.806  78.455  -54.197 1.00 124.81 ? 735  ALA E N     1 
ATOM   9799  C CA    . ALA G 2 135 ? 77.131  78.961  -54.566 1.00 127.45 ? 735  ALA E CA    1 
ATOM   9800  C C     . ALA G 2 135 ? 78.284  78.040  -54.170 1.00 128.92 ? 735  ALA E C     1 
ATOM   9801  O O     . ALA G 2 135 ? 79.029  77.610  -55.080 1.00 129.79 ? 735  ALA E O     1 
ATOM   9802  C CB    . ALA G 2 135 ? 77.343  80.340  -53.953 1.00 125.65 ? 735  ALA E CB    1 
ATOM   9803  O OXT   . ALA G 2 135 ? 78.439  77.770  -52.958 1.00 130.09 ? 735  ALA E OXT   1 
ATOM   9804  N N     . ARG H 3 18  ? 37.057  59.156  -40.641 1.00 114.36 ? 217  ARG F N     1 
ATOM   9805  C CA    . ARG H 3 18  ? 37.480  59.554  -39.268 1.00 113.98 ? 217  ARG F CA    1 
ATOM   9806  C C     . ARG H 3 18  ? 38.805  60.300  -39.341 1.00 112.70 ? 217  ARG F C     1 
ATOM   9807  O O     . ARG H 3 18  ? 39.240  60.904  -38.360 1.00 113.06 ? 217  ARG F O     1 
ATOM   9808  C CB    . ARG H 3 18  ? 37.656  58.315  -38.381 1.00 124.49 ? 217  ARG F CB    1 
ATOM   9809  C CG    . ARG H 3 18  ? 38.898  57.493  -38.718 1.00 126.18 ? 217  ARG F CG    1 
ATOM   9810  C CD    . ARG H 3 18  ? 39.029  56.244  -37.855 1.00 127.29 ? 217  ARG F CD    1 
ATOM   9811  N NE    . ARG H 3 18  ? 40.288  55.545  -38.115 1.00 128.02 ? 217  ARG F NE    1 
ATOM   9812  C CZ    . ARG H 3 18  ? 40.631  54.379  -37.574 1.00 127.79 ? 217  ARG F CZ    1 
ATOM   9813  N NH1   . ARG H 3 18  ? 39.811  53.761  -36.734 1.00 127.78 ? 217  ARG F NH1   1 
ATOM   9814  N NH2   . ARG H 3 18  ? 41.802  53.831  -37.868 1.00 127.18 ? 217  ARG F NH2   1 
ATOM   9815  N N     . HIS H 3 19  ? 39.447  60.258  -40.504 1.00 84.41  ? 218  HIS F N     1 
ATOM   9816  C CA    . HIS H 3 19  ? 40.733  60.919  -40.650 1.00 83.05  ? 218  HIS F CA    1 
ATOM   9817  C C     . HIS H 3 19  ? 41.172  61.290  -42.064 1.00 81.17  ? 218  HIS F C     1 
ATOM   9818  O O     . HIS H 3 19  ? 40.507  61.005  -43.062 1.00 81.36  ? 218  HIS F O     1 
ATOM   9819  C CB    . HIS H 3 19  ? 41.833  60.047  -40.042 1.00 123.22 ? 218  HIS F CB    1 
ATOM   9820  C CG    . HIS H 3 19  ? 42.142  58.817  -40.845 1.00 122.98 ? 218  HIS F CG    1 
ATOM   9821  N ND1   . HIS H 3 19  ? 41.365  57.679  -40.800 1.00 123.05 ? 218  HIS F ND1   1 
ATOM   9822  C CD2   . HIS H 3 19  ? 43.126  58.561  -41.740 1.00 122.47 ? 218  HIS F CD2   1 
ATOM   9823  C CE1   . HIS H 3 19  ? 41.857  56.777  -41.631 1.00 122.64 ? 218  HIS F CE1   1 
ATOM   9824  N NE2   . HIS H 3 19  ? 42.925  57.287  -42.214 1.00 122.07 ? 218  HIS F NE2   1 
ATOM   9825  N N     . ARG H 3 20  ? 42.333  61.935  -42.091 1.00 129.96 ? 219  ARG F N     1 
ATOM   9826  C CA    . ARG H 3 20  ? 43.038  62.397  -43.280 1.00 127.86 ? 219  ARG F CA    1 
ATOM   9827  C C     . ARG H 3 20  ? 42.307  62.552  -44.602 1.00 121.29 ? 219  ARG F C     1 
ATOM   9828  O O     . ARG H 3 20  ? 41.180  63.036  -44.700 1.00 121.71 ? 219  ARG F O     1 
ATOM   9829  C CB    . ARG H 3 20  ? 44.231  61.481  -43.550 1.00 166.00 ? 219  ARG F CB    1 
ATOM   9830  C CG    . ARG H 3 20  ? 45.117  61.197  -42.366 1.00 174.91 ? 219  ARG F CG    1 
ATOM   9831  C CD    . ARG H 3 20  ? 46.106  60.112  -42.735 1.00 182.18 ? 219  ARG F CD    1 
ATOM   9832  N NE    . ARG H 3 20  ? 46.773  59.566  -41.562 1.00 189.01 ? 219  ARG F NE    1 
ATOM   9833  C CZ    . ARG H 3 20  ? 47.556  58.493  -41.587 1.00 192.77 ? 219  ARG F CZ    1 
ATOM   9834  N NH1   . ARG H 3 20  ? 47.769  57.852  -42.730 1.00 195.16 ? 219  ARG F NH1   1 
ATOM   9835  N NH2   . ARG H 3 20  ? 48.115  58.055  -40.467 1.00 195.15 ? 219  ARG F NH2   1 
ATOM   9836  N N     . LYS H 3 21  ? 43.048  62.120  -45.614 1.00 94.17  ? 220  LYS F N     1 
ATOM   9837  C CA    . LYS H 3 21  ? 42.724  62.118  -47.027 1.00 86.05  ? 220  LYS F CA    1 
ATOM   9838  C C     . LYS H 3 21  ? 44.123  62.419  -47.547 1.00 78.82  ? 220  LYS F C     1 
ATOM   9839  O O     . LYS H 3 21  ? 44.427  63.543  -47.937 1.00 79.38  ? 220  LYS F O     1 
ATOM   9840  C CB    . LYS H 3 21  ? 41.768  63.250  -47.412 1.00 94.60  ? 220  LYS F CB    1 
ATOM   9841  C CG    . LYS H 3 21  ? 41.093  63.033  -48.771 1.00 94.71  ? 220  LYS F CG    1 
ATOM   9842  C CD    . LYS H 3 21  ? 42.101  62.681  -49.861 1.00 94.65  ? 220  LYS F CD    1 
ATOM   9843  C CE    . LYS H 3 21  ? 41.425  62.428  -51.196 1.00 95.24  ? 220  LYS F CE    1 
ATOM   9844  N NZ    . LYS H 3 21  ? 42.427  62.144  -52.262 1.00 95.80  ? 220  LYS F NZ    1 
ATOM   9845  N N     . VAL H 3 22  ? 44.974  61.402  -47.499 1.00 55.66  ? 221  VAL F N     1 
ATOM   9846  C CA    . VAL H 3 22  ? 46.358  61.501  -47.916 1.00 47.63  ? 221  VAL F CA    1 
ATOM   9847  C C     . VAL H 3 22  ? 46.666  62.702  -48.812 1.00 42.92  ? 221  VAL F C     1 
ATOM   9848  O O     . VAL H 3 22  ? 46.038  62.903  -49.861 1.00 38.67  ? 221  VAL F O     1 
ATOM   9849  C CB    . VAL H 3 22  ? 46.816  60.209  -48.630 1.00 51.94  ? 221  VAL F CB    1 
ATOM   9850  C CG1   . VAL H 3 22  ? 48.294  60.297  -48.967 1.00 50.87  ? 221  VAL F CG1   1 
ATOM   9851  C CG2   . VAL H 3 22  ? 46.572  59.009  -47.731 1.00 52.47  ? 221  VAL F CG2   1 
ATOM   9852  N N     . LEU H 3 23  ? 47.636  63.498  -48.373 1.00 47.89  ? 222  LEU F N     1 
ATOM   9853  C CA    . LEU H 3 23  ? 48.075  64.664  -49.119 1.00 44.14  ? 222  LEU F CA    1 
ATOM   9854  C C     . LEU H 3 23  ? 49.206  64.190  -50.008 1.00 40.21  ? 222  LEU F C     1 
ATOM   9855  O O     . LEU H 3 23  ? 50.241  63.761  -49.507 1.00 38.15  ? 222  LEU F O     1 
ATOM   9856  C CB    . LEU H 3 23  ? 48.579  65.736  -48.163 1.00 57.33  ? 222  LEU F CB    1 
ATOM   9857  C CG    . LEU H 3 23  ? 47.481  66.329  -47.290 1.00 60.09  ? 222  LEU F CG    1 
ATOM   9858  C CD1   . LEU H 3 23  ? 48.084  67.304  -46.284 1.00 60.35  ? 222  LEU F CD1   1 
ATOM   9859  C CD2   . LEU H 3 23  ? 46.460  67.024  -48.186 1.00 60.08  ? 222  LEU F CD2   1 
ATOM   9860  N N     . ARG H 3 24  ? 49.000  64.246  -51.320 1.00 41.09  ? 223  ARG F N     1 
ATOM   9861  C CA    . ARG H 3 24  ? 50.007  63.796  -52.277 1.00 41.63  ? 223  ARG F CA    1 
ATOM   9862  C C     . ARG H 3 24  ? 50.188  64.776  -53.415 1.00 40.59  ? 223  ARG F C     1 
ATOM   9863  O O     . ARG H 3 24  ? 49.236  65.422  -53.840 1.00 41.52  ? 223  ARG F O     1 
ATOM   9864  C CB    . ARG H 3 24  ? 49.607  62.482  -52.955 1.00 41.87  ? 223  ARG F CB    1 
ATOM   9865  C CG    . ARG H 3 24  ? 49.670  61.226  -52.157 1.00 45.03  ? 223  ARG F CG    1 
ATOM   9866  C CD    . ARG H 3 24  ? 49.620  60.036  -53.132 1.00 42.69  ? 223  ARG F CD    1 
ATOM   9867  N NE    . ARG H 3 24  ? 48.339  59.908  -53.821 1.00 42.73  ? 223  ARG F NE    1 
ATOM   9868  C CZ    . ARG H 3 24  ? 48.198  59.472  -55.076 1.00 43.00  ? 223  ARG F CZ    1 
ATOM   9869  N NH1   . ARG H 3 24  ? 49.256  59.129  -55.795 1.00 38.45  ? 223  ARG F NH1   1 
ATOM   9870  N NH2   . ARG H 3 24  ? 46.989  59.352  -55.608 1.00 42.14  ? 223  ARG F NH2   1 
ATOM   9871  N N     . ASP H 3 25  ? 51.413  64.835  -53.926 1.00 40.51  ? 224  ASP F N     1 
ATOM   9872  C CA    . ASP H 3 25  ? 51.772  65.660  -55.076 1.00 42.82  ? 224  ASP F CA    1 
ATOM   9873  C C     . ASP H 3 25  ? 51.084  67.028  -55.167 1.00 39.37  ? 224  ASP F C     1 
ATOM   9874  O O     . ASP H 3 25  ? 50.655  67.463  -56.236 1.00 36.32  ? 224  ASP F O     1 
ATOM   9875  C CB    . ASP H 3 25  ? 51.502  64.848  -56.350 1.00 91.27  ? 224  ASP F CB    1 
ATOM   9876  C CG    . ASP H 3 25  ? 52.351  65.293  -57.520 1.00 99.42  ? 224  ASP F CG    1 
ATOM   9877  O OD1   . ASP H 3 25  ? 52.143  66.420  -58.004 1.00 106.69 ? 224  ASP F OD1   1 
ATOM   9878  O OD2   . ASP H 3 25  ? 53.232  64.517  -57.952 1.00 103.93 ? 224  ASP F OD2   1 
ATOM   9879  N N     . ASN H 3 26  ? 51.001  67.727  -54.053 1.00 40.16  ? 225  ASN F N     1 
ATOM   9880  C CA    . ASN H 3 26  ? 50.363  69.023  -54.087 1.00 41.89  ? 225  ASN F CA    1 
ATOM   9881  C C     . ASN H 3 26  ? 51.204  70.103  -54.775 1.00 40.14  ? 225  ASN F C     1 
ATOM   9882  O O     . ASN H 3 26  ? 50.691  71.170  -55.088 1.00 40.54  ? 225  ASN F O     1 
ATOM   9883  C CB    . ASN H 3 26  ? 49.974  69.431  -52.671 1.00 43.09  ? 225  ASN F CB    1 
ATOM   9884  C CG    . ASN H 3 26  ? 48.796  68.632  -52.165 1.00 47.74  ? 225  ASN F CG    1 
ATOM   9885  O OD1   . ASN H 3 26  ? 47.659  68.862  -52.579 1.00 49.35  ? 225  ASN F OD1   1 
ATOM   9886  N ND2   . ASN H 3 26  ? 49.060  67.662  -51.294 1.00 45.86  ? 225  ASN F ND2   1 
ATOM   9887  N N     . ILE H 3 27  ? 52.476  69.820  -55.031 1.00 37.26  ? 226  ILE F N     1 
ATOM   9888  C CA    . ILE H 3 27  ? 53.334  70.798  -55.694 1.00 39.33  ? 226  ILE F CA    1 
ATOM   9889  C C     . ILE H 3 27  ? 52.787  71.124  -57.092 1.00 41.77  ? 226  ILE F C     1 
ATOM   9890  O O     . ILE H 3 27  ? 53.144  72.144  -57.672 1.00 41.92  ? 226  ILE F O     1 
ATOM   9891  C CB    . ILE H 3 27  ? 54.810  70.290  -55.804 1.00 39.79  ? 226  ILE F CB    1 
ATOM   9892  C CG1   . ILE H 3 27  ? 55.724  71.415  -56.303 1.00 38.44  ? 226  ILE F CG1   1 
ATOM   9893  C CG2   . ILE H 3 27  ? 54.895  69.102  -56.763 1.00 38.32  ? 226  ILE F CG2   1 
ATOM   9894  C CD1   . ILE H 3 27  ? 55.792  72.630  -55.391 1.00 38.60  ? 226  ILE F CD1   1 
ATOM   9895  N N     . GLN H 3 28  ? 51.917  70.267  -57.625 1.00 47.74  ? 227  GLN F N     1 
ATOM   9896  C CA    . GLN H 3 28  ? 51.330  70.502  -58.946 1.00 50.20  ? 227  GLN F CA    1 
ATOM   9897  C C     . GLN H 3 28  ? 50.194  71.514  -58.851 1.00 50.77  ? 227  GLN F C     1 
ATOM   9898  O O     . GLN H 3 28  ? 49.644  71.941  -59.864 1.00 53.33  ? 227  GLN F O     1 
ATOM   9899  C CB    . GLN H 3 28  ? 50.811  69.198  -59.560 1.00 55.13  ? 227  GLN F CB    1 
ATOM   9900  C CG    . GLN H 3 28  ? 51.905  68.221  -59.998 1.00 58.21  ? 227  GLN F CG    1 
ATOM   9901  C CD    . GLN H 3 28  ? 52.788  68.769  -61.111 1.00 62.32  ? 227  GLN F CD    1 
ATOM   9902  O OE1   . GLN H 3 28  ? 52.287  69.234  -62.140 1.00 65.70  ? 227  GLN F OE1   1 
ATOM   9903  N NE2   . GLN H 3 28  ? 54.106  68.705  -60.918 1.00 59.22  ? 227  GLN F NE2   1 
ATOM   9904  N N     . GLY H 3 29  ? 49.844  71.888  -57.624 1.00 51.60  ? 228  GLY F N     1 
ATOM   9905  C CA    . GLY H 3 29  ? 48.801  72.871  -57.410 1.00 49.63  ? 228  GLY F CA    1 
ATOM   9906  C C     . GLY H 3 29  ? 49.340  74.221  -57.839 1.00 51.04  ? 228  GLY F C     1 
ATOM   9907  O O     . GLY H 3 29  ? 48.585  75.157  -58.099 1.00 53.36  ? 228  GLY F O     1 
ATOM   9908  N N     . ILE H 3 30  ? 50.663  74.332  -57.881 1.00 44.64  ? 229  ILE F N     1 
ATOM   9909  C CA    . ILE H 3 30  ? 51.300  75.556  -58.332 1.00 42.44  ? 229  ILE F CA    1 
ATOM   9910  C C     . ILE H 3 30  ? 51.291  75.378  -59.844 1.00 38.99  ? 229  ILE F C     1 
ATOM   9911  O O     . ILE H 3 30  ? 52.237  74.851  -60.428 1.00 38.01  ? 229  ILE F O     1 
ATOM   9912  C CB    . ILE H 3 30  ? 52.758  75.662  -57.851 1.00 45.15  ? 229  ILE F CB    1 
ATOM   9913  C CG1   . ILE H 3 30  ? 52.851  75.349  -56.354 1.00 44.81  ? 229  ILE F CG1   1 
ATOM   9914  C CG2   . ILE H 3 30  ? 53.285  77.041  -58.158 1.00 45.52  ? 229  ILE F CG2   1 
ATOM   9915  C CD1   . ILE H 3 30  ? 51.881  76.142  -55.480 1.00 45.75  ? 229  ILE F CD1   1 
ATOM   9916  N N     . THR H 3 31  ? 50.206  75.817  -60.462 1.00 36.62  ? 230  THR F N     1 
ATOM   9917  C CA    . THR H 3 31  ? 50.007  75.668  -61.895 1.00 36.33  ? 230  THR F CA    1 
ATOM   9918  C C     . THR H 3 31  ? 50.882  76.499  -62.816 1.00 35.85  ? 230  THR F C     1 
ATOM   9919  O O     . THR H 3 31  ? 51.522  77.465  -62.403 1.00 33.17  ? 230  THR F O     1 
ATOM   9920  C CB    . THR H 3 31  ? 48.553  75.959  -62.256 1.00 40.89  ? 230  THR F CB    1 
ATOM   9921  O OG1   . THR H 3 31  ? 48.309  77.359  -62.097 1.00 40.95  ? 230  THR F OG1   1 
ATOM   9922  C CG2   . THR H 3 31  ? 47.598  75.160  -61.335 1.00 37.00  ? 230  THR F CG2   1 
ATOM   9923  N N     . LYS H 3 32  ? 50.913  76.092  -64.079 1.00 33.59  ? 231  LYS F N     1 
ATOM   9924  C CA    . LYS H 3 32  ? 51.677  76.801  -65.083 1.00 35.12  ? 231  LYS F CA    1 
ATOM   9925  C C     . LYS H 3 32  ? 51.217  78.276  -65.133 1.00 34.43  ? 231  LYS F C     1 
ATOM   9926  O O     . LYS H 3 32  ? 52.038  79.185  -65.189 1.00 33.01  ? 231  LYS F O     1 
ATOM   9927  C CB    . LYS H 3 32  ? 51.485  76.125  -66.442 1.00 49.38  ? 231  LYS F CB    1 
ATOM   9928  C CG    . LYS H 3 32  ? 52.056  76.890  -67.609 1.00 54.29  ? 231  LYS F CG    1 
ATOM   9929  C CD    . LYS H 3 32  ? 51.768  76.174  -68.922 1.00 57.11  ? 231  LYS F CD    1 
ATOM   9930  C CE    . LYS H 3 32  ? 52.221  77.019  -70.100 1.00 60.26  ? 231  LYS F CE    1 
ATOM   9931  N NZ    . LYS H 3 32  ? 51.812  76.418  -71.407 1.00 64.39  ? 231  LYS F NZ    1 
ATOM   9932  N N     . PRO H 3 33  ? 49.899  78.522  -65.109 1.00 39.45  ? 232  PRO F N     1 
ATOM   9933  C CA    . PRO H 3 33  ? 49.392  79.905  -65.150 1.00 37.92  ? 232  PRO F CA    1 
ATOM   9934  C C     . PRO H 3 33  ? 49.817  80.727  -63.923 1.00 38.13  ? 232  PRO F C     1 
ATOM   9935  O O     . PRO H 3 33  ? 50.136  81.919  -64.044 1.00 34.74  ? 232  PRO F O     1 
ATOM   9936  C CB    . PRO H 3 33  ? 47.878  79.720  -65.210 1.00 36.91  ? 232  PRO F CB    1 
ATOM   9937  C CG    . PRO H 3 33  ? 47.724  78.387  -65.928 1.00 37.86  ? 232  PRO F CG    1 
ATOM   9938  C CD    . PRO H 3 33  ? 48.801  77.548  -65.287 1.00 36.83  ? 232  PRO F CD    1 
ATOM   9939  N N     . ALA H 3 34  ? 49.807  80.104  -62.745 1.00 33.05  ? 233  ALA F N     1 
ATOM   9940  C CA    . ALA H 3 34  ? 50.217  80.816  -61.544 1.00 33.16  ? 233  ALA F CA    1 
ATOM   9941  C C     . ALA H 3 34  ? 51.690  81.184  -61.672 1.00 33.11  ? 233  ALA F C     1 
ATOM   9942  O O     . ALA H 3 34  ? 52.099  82.288  -61.314 1.00 33.88  ? 233  ALA F O     1 
ATOM   9943  C CB    . ALA H 3 34  ? 49.999  79.962  -60.313 1.00 30.57  ? 233  ALA F CB    1 
ATOM   9944  N N     . ILE H 3 35  ? 52.489  80.266  -62.202 1.00 28.68  ? 234  ILE F N     1 
ATOM   9945  C CA    . ILE H 3 35  ? 53.897  80.541  -62.357 1.00 29.42  ? 234  ILE F CA    1 
ATOM   9946  C C     . ILE H 3 35  ? 54.144  81.643  -63.388 1.00 31.97  ? 234  ILE F C     1 
ATOM   9947  O O     . ILE H 3 35  ? 55.040  82.469  -63.192 1.00 30.05  ? 234  ILE F O     1 
ATOM   9948  C CB    . ILE H 3 35  ? 54.671  79.271  -62.738 1.00 27.07  ? 234  ILE F CB    1 
ATOM   9949  C CG1   . ILE H 3 35  ? 54.562  78.243  -61.598 1.00 29.11  ? 234  ILE F CG1   1 
ATOM   9950  C CG2   . ILE H 3 35  ? 56.126  79.611  -62.996 1.00 21.87  ? 234  ILE F CG2   1 
ATOM   9951  C CD1   . ILE H 3 35  ? 55.113  76.857  -61.946 1.00 28.08  ? 234  ILE F CD1   1 
ATOM   9952  N N     . ARG H 3 36  ? 53.355  81.656  -64.472 1.00 30.35  ? 235  ARG F N     1 
ATOM   9953  C CA    . ARG H 3 36  ? 53.491  82.679  -65.512 1.00 31.29  ? 235  ARG F CA    1 
ATOM   9954  C C     . ARG H 3 36  ? 53.214  84.035  -64.867 1.00 29.89  ? 235  ARG F C     1 
ATOM   9955  O O     . ARG H 3 36  ? 53.957  84.986  -65.074 1.00 28.25  ? 235  ARG F O     1 
ATOM   9956  C CB    . ARG H 3 36  ? 52.481  82.475  -66.650 1.00 47.61  ? 235  ARG F CB    1 
ATOM   9957  C CG    . ARG H 3 36  ? 52.478  81.101  -67.273 1.00 58.03  ? 235  ARG F CG    1 
ATOM   9958  C CD    . ARG H 3 36  ? 53.064  81.098  -68.677 1.00 65.37  ? 235  ARG F CD    1 
ATOM   9959  N NE    . ARG H 3 36  ? 52.241  81.798  -69.663 1.00 68.19  ? 235  ARG F NE    1 
ATOM   9960  C CZ    . ARG H 3 36  ? 52.633  82.010  -70.918 1.00 73.35  ? 235  ARG F CZ    1 
ATOM   9961  N NH1   . ARG H 3 36  ? 53.827  81.578  -71.314 1.00 73.88  ? 235  ARG F NH1   1 
ATOM   9962  N NH2   . ARG H 3 36  ? 51.841  82.642  -71.780 1.00 74.05  ? 235  ARG F NH2   1 
ATOM   9963  N N     . ARG H 3 37  ? 52.140  84.113  -64.086 1.00 27.31  ? 236  ARG F N     1 
ATOM   9964  C CA    . ARG H 3 37  ? 51.784  85.353  -63.418 1.00 29.81  ? 236  ARG F CA    1 
ATOM   9965  C C     . ARG H 3 37  ? 52.907  85.880  -62.527 1.00 29.83  ? 236  ARG F C     1 
ATOM   9966  O O     . ARG H 3 37  ? 53.204  87.075  -62.546 1.00 33.10  ? 236  ARG F O     1 
ATOM   9967  C CB    . ARG H 3 37  ? 50.501  85.182  -62.578 1.00 32.10  ? 236  ARG F CB    1 
ATOM   9968  C CG    . ARG H 3 37  ? 49.213  85.036  -63.393 1.00 31.75  ? 236  ARG F CG    1 
ATOM   9969  C CD    . ARG H 3 37  ? 47.957  85.177  -62.520 1.00 32.63  ? 236  ARG F CD    1 
ATOM   9970  N NE    . ARG H 3 37  ? 47.729  84.063  -61.596 1.00 33.81  ? 236  ARG F NE    1 
ATOM   9971  C CZ    . ARG H 3 37  ? 47.085  82.930  -61.906 1.00 35.77  ? 236  ARG F CZ    1 
ATOM   9972  N NH1   . ARG H 3 37  ? 46.595  82.739  -63.133 1.00 29.39  ? 236  ARG F NH1   1 
ATOM   9973  N NH2   . ARG H 3 37  ? 46.917  81.990  -60.976 1.00 30.96  ? 236  ARG F NH2   1 
ATOM   9974  N N     . LEU H 3 38  ? 53.520  85.001  -61.740 1.00 33.08  ? 237  LEU F N     1 
ATOM   9975  C CA    . LEU H 3 38  ? 54.609  85.406  -60.856 1.00 32.03  ? 237  LEU F CA    1 
ATOM   9976  C C     . LEU H 3 38  ? 55.788  85.927  -61.684 1.00 33.46  ? 237  LEU F C     1 
ATOM   9977  O O     . LEU H 3 38  ? 56.464  86.876  -61.290 1.00 32.37  ? 237  LEU F O     1 
ATOM   9978  C CB    . LEU H 3 38  ? 55.085  84.220  -60.000 1.00 23.98  ? 237  LEU F CB    1 
ATOM   9979  C CG    . LEU H 3 38  ? 54.174  83.740  -58.893 1.00 26.15  ? 237  LEU F CG    1 
ATOM   9980  C CD1   . LEU H 3 38  ? 54.609  82.348  -58.439 1.00 26.48  ? 237  LEU F CD1   1 
ATOM   9981  C CD2   . LEU H 3 38  ? 54.230  84.740  -57.741 1.00 29.10  ? 237  LEU F CD2   1 
ATOM   9982  N N     . ALA H 3 39  ? 56.046  85.279  -62.817 1.00 24.41  ? 238  ALA F N     1 
ATOM   9983  C CA    . ALA H 3 39  ? 57.135  85.695  -63.690 1.00 24.76  ? 238  ALA F CA    1 
ATOM   9984  C C     . ALA H 3 39  ? 56.792  87.069  -64.302 1.00 26.53  ? 238  ALA F C     1 
ATOM   9985  O O     . ALA H 3 39  ? 57.674  87.899  -64.492 1.00 26.93  ? 238  ALA F O     1 
ATOM   9986  C CB    . ALA H 3 39  ? 57.365  84.645  -64.802 1.00 24.60  ? 238  ALA F CB    1 
ATOM   9987  N N     . ARG H 3 40  ? 55.519  87.296  -64.621 1.00 27.24  ? 239  ARG F N     1 
ATOM   9988  C CA    . ARG H 3 40  ? 55.096  88.575  -65.180 1.00 28.70  ? 239  ARG F CA    1 
ATOM   9989  C C     . ARG H 3 40  ? 55.366  89.686  -64.178 1.00 30.83  ? 239  ARG F C     1 
ATOM   9990  O O     . ARG H 3 40  ? 55.941  90.717  -64.537 1.00 29.14  ? 239  ARG F O     1 
ATOM   9991  C CB    . ARG H 3 40  ? 53.609  88.569  -65.510 1.00 29.56  ? 239  ARG F CB    1 
ATOM   9992  C CG    . ARG H 3 40  ? 53.225  87.675  -66.673 1.00 30.72  ? 239  ARG F CG    1 
ATOM   9993  C CD    . ARG H 3 40  ? 53.776  88.147  -68.003 1.00 30.79  ? 239  ARG F CD    1 
ATOM   9994  N NE    . ARG H 3 40  ? 53.314  87.250  -69.067 1.00 34.74  ? 239  ARG F NE    1 
ATOM   9995  C CZ    . ARG H 3 40  ? 54.103  86.460  -69.782 1.00 34.81  ? 239  ARG F CZ    1 
ATOM   9996  N NH1   . ARG H 3 40  ? 55.413  86.448  -69.571 1.00 36.58  ? 239  ARG F NH1   1 
ATOM   9997  N NH2   . ARG H 3 40  ? 53.579  85.654  -70.687 1.00 34.54  ? 239  ARG F NH2   1 
ATOM   9998  N N     . ARG H 3 41  ? 54.952  89.476  -62.920 1.00 30.81  ? 240  ARG F N     1 
ATOM   9999  C CA    . ARG H 3 41  ? 55.180  90.478  -61.894 1.00 28.70  ? 240  ARG F CA    1 
ATOM   10000 C C     . ARG H 3 41  ? 56.681  90.709  -61.757 1.00 29.62  ? 240  ARG F C     1 
ATOM   10001 O O     . ARG H 3 41  ? 57.118  91.798  -61.399 1.00 30.68  ? 240  ARG F O     1 
ATOM   10002 C CB    . ARG H 3 41  ? 54.592  90.037  -60.557 1.00 27.36  ? 240  ARG F CB    1 
ATOM   10003 C CG    . ARG H 3 41  ? 54.735  91.108  -59.467 1.00 26.92  ? 240  ARG F CG    1 
ATOM   10004 C CD    . ARG H 3 41  ? 53.833  90.838  -58.283 1.00 27.36  ? 240  ARG F CD    1 
ATOM   10005 N NE    . ARG H 3 41  ? 52.426  91.112  -58.575 1.00 28.43  ? 240  ARG F NE    1 
ATOM   10006 C CZ    . ARG H 3 41  ? 51.416  90.717  -57.800 1.00 27.96  ? 240  ARG F CZ    1 
ATOM   10007 N NH1   . ARG H 3 41  ? 51.665  90.034  -56.702 1.00 26.53  ? 240  ARG F NH1   1 
ATOM   10008 N NH2   . ARG H 3 41  ? 50.160  91.000  -58.117 1.00 26.01  ? 240  ARG F NH2   1 
ATOM   10009 N N     . GLY H 3 42  ? 57.461  89.677  -62.061 1.00 28.27  ? 241  GLY F N     1 
ATOM   10010 C CA    . GLY H 3 42  ? 58.909  89.769  -61.985 1.00 27.41  ? 241  GLY F CA    1 
ATOM   10011 C C     . GLY H 3 42  ? 59.506  90.363  -63.245 1.00 28.06  ? 241  GLY F C     1 
ATOM   10012 O O     . GLY H 3 42  ? 60.737  90.414  -63.403 1.00 29.24  ? 241  GLY F O     1 
ATOM   10013 N N     . GLY H 3 43  ? 58.630  90.801  -64.146 1.00 28.50  ? 242  GLY F N     1 
ATOM   10014 C CA    . GLY H 3 43  ? 59.052  91.428  -65.388 1.00 28.25  ? 242  GLY F CA    1 
ATOM   10015 C C     . GLY H 3 43  ? 59.496  90.531  -66.527 1.00 28.94  ? 242  GLY F C     1 
ATOM   10016 O O     . GLY H 3 43  ? 60.155  90.997  -67.467 1.00 25.15  ? 242  GLY F O     1 
ATOM   10017 N N     . VAL H 3 44  ? 59.127  89.253  -66.474 1.00 26.92  ? 243  VAL F N     1 
ATOM   10018 C CA    . VAL H 3 44  ? 59.542  88.316  -67.521 1.00 26.55  ? 243  VAL F CA    1 
ATOM   10019 C C     . VAL H 3 44  ? 58.587  88.288  -68.696 1.00 27.04  ? 243  VAL F C     1 
ATOM   10020 O O     . VAL H 3 44  ? 57.386  88.149  -68.530 1.00 27.30  ? 243  VAL F O     1 
ATOM   10021 C CB    . VAL H 3 44  ? 59.697  86.892  -66.947 1.00 31.18  ? 243  VAL F CB    1 
ATOM   10022 C CG1   . VAL H 3 44  ? 60.035  85.904  -68.068 1.00 25.33  ? 243  VAL F CG1   1 
ATOM   10023 C CG2   . VAL H 3 44  ? 60.793  86.893  -65.879 1.00 27.42  ? 243  VAL F CG2   1 
ATOM   10024 N N     . LYS H 3 45  ? 59.138  88.386  -69.895 1.00 33.92  ? 244  LYS F N     1 
ATOM   10025 C CA    . LYS H 3 45  ? 58.331  88.429  -71.105 1.00 36.31  ? 244  LYS F CA    1 
ATOM   10026 C C     . LYS H 3 45  ? 58.127  87.092  -71.822 1.00 37.12  ? 244  LYS F C     1 
ATOM   10027 O O     . LYS H 3 45  ? 57.082  86.861  -72.419 1.00 37.15  ? 244  LYS F O     1 
ATOM   10028 C CB    . LYS H 3 45  ? 58.953  89.428  -72.074 1.00 38.34  ? 244  LYS F CB    1 
ATOM   10029 C CG    . LYS H 3 45  ? 58.130  89.682  -73.307 1.00 42.30  ? 244  LYS F CG    1 
ATOM   10030 C CD    . LYS H 3 45  ? 58.850  90.621  -74.236 1.00 45.96  ? 244  LYS F CD    1 
ATOM   10031 C CE    . LYS H 3 45  ? 58.045  90.870  -75.492 1.00 45.85  ? 244  LYS F CE    1 
ATOM   10032 N NZ    . LYS H 3 45  ? 58.850  91.702  -76.409 1.00 48.62  ? 244  LYS F NZ    1 
ATOM   10033 N N     . ARG H 3 46  ? 59.120  86.216  -71.758 1.00 36.68  ? 245  ARG F N     1 
ATOM   10034 C CA    . ARG H 3 46  ? 59.037  84.927  -72.431 1.00 38.04  ? 245  ARG F CA    1 
ATOM   10035 C C     . ARG H 3 46  ? 59.589  83.812  -71.523 1.00 36.05  ? 245  ARG F C     1 
ATOM   10036 O O     . ARG H 3 46  ? 60.665  83.945  -70.932 1.00 34.21  ? 245  ARG F O     1 
ATOM   10037 C CB    . ARG H 3 46  ? 59.799  85.023  -73.754 1.00 38.86  ? 245  ARG F CB    1 
ATOM   10038 C CG    . ARG H 3 46  ? 59.468  83.958  -74.751 1.00 42.10  ? 245  ARG F CG    1 
ATOM   10039 C CD    . ARG H 3 46  ? 59.896  84.393  -76.139 1.00 43.20  ? 245  ARG F CD    1 
ATOM   10040 N NE    . ARG H 3 46  ? 59.421  83.465  -77.155 1.00 45.90  ? 245  ARG F NE    1 
ATOM   10041 C CZ    . ARG H 3 46  ? 60.050  82.353  -77.521 1.00 45.01  ? 245  ARG F CZ    1 
ATOM   10042 N NH1   . ARG H 3 46  ? 61.200  82.007  -76.960 1.00 41.05  ? 245  ARG F NH1   1 
ATOM   10043 N NH2   . ARG H 3 46  ? 59.520  81.589  -78.464 1.00 46.52  ? 245  ARG F NH2   1 
ATOM   10044 N N     . ILE H 3 47  ? 58.838  82.716  -71.444 1.00 39.36  ? 246  ILE F N     1 
ATOM   10045 C CA    . ILE H 3 47  ? 59.147  81.585  -70.572 1.00 39.24  ? 246  ILE F CA    1 
ATOM   10046 C C     . ILE H 3 47  ? 59.296  80.247  -71.303 1.00 41.18  ? 246  ILE F C     1 
ATOM   10047 O O     . ILE H 3 47  ? 58.352  79.785  -71.963 1.00 41.78  ? 246  ILE F O     1 
ATOM   10048 C CB    . ILE H 3 47  ? 58.008  81.429  -69.540 1.00 30.89  ? 246  ILE F CB    1 
ATOM   10049 C CG1   . ILE H 3 47  ? 57.717  82.784  -68.884 1.00 29.00  ? 246  ILE F CG1   1 
ATOM   10050 C CG2   . ILE H 3 47  ? 58.369  80.377  -68.505 1.00 28.18  ? 246  ILE F CG2   1 
ATOM   10051 C CD1   . ILE H 3 47  ? 56.430  82.785  -68.047 1.00 30.88  ? 246  ILE F CD1   1 
ATOM   10052 N N     . SER H 3 48  ? 60.457  79.604  -71.178 1.00 35.69  ? 247  SER F N     1 
ATOM   10053 C CA    . SER H 3 48  ? 60.647  78.314  -71.854 1.00 36.48  ? 247  SER F CA    1 
ATOM   10054 C C     . SER H 3 48  ? 59.893  77.217  -71.097 1.00 36.48  ? 247  SER F C     1 
ATOM   10055 O O     . SER H 3 48  ? 59.694  77.300  -69.869 1.00 33.22  ? 247  SER F O     1 
ATOM   10056 C CB    . SER H 3 48  ? 62.125  77.953  -71.953 1.00 41.35  ? 247  SER F CB    1 
ATOM   10057 O OG    . SER H 3 48  ? 62.574  77.375  -70.752 1.00 47.69  ? 247  SER F OG    1 
ATOM   10058 N N     . GLY H 3 49  ? 59.463  76.203  -71.844 1.00 34.95  ? 248  GLY F N     1 
ATOM   10059 C CA    . GLY H 3 49  ? 58.697  75.105  -71.271 1.00 34.43  ? 248  GLY F CA    1 
ATOM   10060 C C     . GLY H 3 49  ? 59.221  74.425  -70.017 1.00 34.13  ? 248  GLY F C     1 
ATOM   10061 O O     . GLY H 3 49  ? 58.434  73.943  -69.202 1.00 35.18  ? 248  GLY F O     1 
ATOM   10062 N N     . LEU H 3 50  ? 60.534  74.384  -69.839 1.00 33.75  ? 249  LEU F N     1 
ATOM   10063 C CA    . LEU H 3 50  ? 61.098  73.723  -68.663 1.00 35.11  ? 249  LEU F CA    1 
ATOM   10064 C C     . LEU H 3 50  ? 61.126  74.586  -67.402 1.00 36.06  ? 249  LEU F C     1 
ATOM   10065 O O     . LEU H 3 50  ? 61.498  74.116  -66.323 1.00 35.80  ? 249  LEU F O     1 
ATOM   10066 C CB    . LEU H 3 50  ? 62.508  73.229  -68.985 1.00 41.23  ? 249  LEU F CB    1 
ATOM   10067 C CG    . LEU H 3 50  ? 62.579  72.184  -70.106 1.00 47.43  ? 249  LEU F CG    1 
ATOM   10068 C CD1   . LEU H 3 50  ? 64.033  71.849  -70.417 1.00 47.96  ? 249  LEU F CD1   1 
ATOM   10069 C CD2   . LEU H 3 50  ? 61.816  70.933  -69.681 1.00 48.68  ? 249  LEU F CD2   1 
ATOM   10070 N N     . ILE H 3 51  ? 60.724  75.845  -67.522 1.00 34.12  ? 250  ILE F N     1 
ATOM   10071 C CA    . ILE H 3 51  ? 60.736  76.745  -66.363 1.00 33.75  ? 250  ILE F CA    1 
ATOM   10072 C C     . ILE H 3 51  ? 59.775  76.343  -65.248 1.00 34.39  ? 250  ILE F C     1 
ATOM   10073 O O     . ILE H 3 51  ? 60.066  76.537  -64.064 1.00 32.06  ? 250  ILE F O     1 
ATOM   10074 C CB    . ILE H 3 51  ? 60.393  78.217  -66.795 1.00 34.97  ? 250  ILE F CB    1 
ATOM   10075 C CG1   . ILE H 3 51  ? 61.627  78.874  -67.414 1.00 34.96  ? 250  ILE F CG1   1 
ATOM   10076 C CG2   . ILE H 3 51  ? 59.916  79.043  -65.590 1.00 31.23  ? 250  ILE F CG2   1 
ATOM   10077 C CD1   . ILE H 3 51  ? 62.750  79.074  -66.422 1.00 35.84  ? 250  ILE F CD1   1 
ATOM   10078 N N     . TYR H 3 52  ? 58.622  75.800  -65.622 1.00 33.51  ? 251  TYR F N     1 
ATOM   10079 C CA    . TYR H 3 52  ? 57.613  75.448  -64.628 1.00 35.20  ? 251  TYR F CA    1 
ATOM   10080 C C     . TYR H 3 52  ? 58.051  74.382  -63.634 1.00 35.53  ? 251  TYR F C     1 
ATOM   10081 O O     . TYR H 3 52  ? 57.827  74.529  -62.432 1.00 33.35  ? 251  TYR F O     1 
ATOM   10082 C CB    . TYR H 3 52  ? 56.307  75.042  -65.330 1.00 35.86  ? 251  TYR F CB    1 
ATOM   10083 C CG    . TYR H 3 52  ? 55.908  76.047  -66.383 1.00 39.73  ? 251  TYR F CG    1 
ATOM   10084 C CD1   . TYR H 3 52  ? 56.066  75.763  -67.742 1.00 41.64  ? 251  TYR F CD1   1 
ATOM   10085 C CD2   . TYR H 3 52  ? 55.454  77.316  -66.021 1.00 38.50  ? 251  TYR F CD2   1 
ATOM   10086 C CE1   . TYR H 3 52  ? 55.786  76.720  -68.718 1.00 44.08  ? 251  TYR F CE1   1 
ATOM   10087 C CE2   . TYR H 3 52  ? 55.173  78.278  -66.977 1.00 43.02  ? 251  TYR F CE2   1 
ATOM   10088 C CZ    . TYR H 3 52  ? 55.343  77.975  -68.327 1.00 44.87  ? 251  TYR F CZ    1 
ATOM   10089 O OH    . TYR H 3 52  ? 55.087  78.929  -69.277 1.00 44.76  ? 251  TYR F OH    1 
ATOM   10090 N N     . GLU H 3 53  ? 58.668  73.316  -64.128 1.00 38.74  ? 252  GLU F N     1 
ATOM   10091 C CA    . GLU H 3 53  ? 59.128  72.248  -63.249 1.00 41.52  ? 252  GLU F CA    1 
ATOM   10092 C C     . GLU H 3 53  ? 60.320  72.710  -62.397 1.00 38.97  ? 252  GLU F C     1 
ATOM   10093 O O     . GLU H 3 53  ? 60.447  72.330  -61.235 1.00 37.46  ? 252  GLU F O     1 
ATOM   10094 C CB    . GLU H 3 53  ? 59.500  71.013  -64.075 1.00 58.25  ? 252  GLU F CB    1 
ATOM   10095 C CG    . GLU H 3 53  ? 59.035  69.696  -63.452 1.00 69.17  ? 252  GLU F CG    1 
ATOM   10096 C CD    . GLU H 3 53  ? 57.554  69.709  -63.043 1.00 72.75  ? 252  GLU F CD    1 
ATOM   10097 O OE1   . GLU H 3 53  ? 57.221  70.325  -62.013 1.00 78.23  ? 252  GLU F OE1   1 
ATOM   10098 O OE2   . GLU H 3 53  ? 56.719  69.108  -63.752 1.00 75.29  ? 252  GLU F OE2   1 
ATOM   10099 N N     . GLU H 3 54  ? 61.192  73.531  -62.969 1.00 34.33  ? 253  GLU F N     1 
ATOM   10100 C CA    . GLU H 3 54  ? 62.327  74.030  -62.205 1.00 36.23  ? 253  GLU F CA    1 
ATOM   10101 C C     . GLU H 3 54  ? 61.807  74.949  -61.068 1.00 34.69  ? 253  GLU F C     1 
ATOM   10102 O O     . GLU H 3 54  ? 62.324  74.927  -59.949 1.00 33.94  ? 253  GLU F O     1 
ATOM   10103 C CB    . GLU H 3 54  ? 63.269  74.811  -63.126 1.00 43.66  ? 253  GLU F CB    1 
ATOM   10104 C CG    . GLU H 3 54  ? 64.576  75.222  -62.489 1.00 51.82  ? 253  GLU F CG    1 
ATOM   10105 C CD    . GLU H 3 54  ? 65.635  74.129  -62.531 1.00 57.40  ? 253  GLU F CD    1 
ATOM   10106 O OE1   . GLU H 3 54  ? 65.295  72.953  -62.803 1.00 60.48  ? 253  GLU F OE1   1 
ATOM   10107 O OE2   . GLU H 3 54  ? 66.816  74.451  -62.282 1.00 59.35  ? 253  GLU F OE2   1 
ATOM   10108 N N     . THR H 3 55  ? 60.772  75.735  -61.360 1.00 29.05  ? 254  THR F N     1 
ATOM   10109 C CA    . THR H 3 55  ? 60.194  76.658  -60.381 1.00 29.65  ? 254  THR F CA    1 
ATOM   10110 C C     . THR H 3 55  ? 59.544  75.916  -59.213 1.00 31.75  ? 254  THR F C     1 
ATOM   10111 O O     . THR H 3 55  ? 59.642  76.349  -58.050 1.00 29.68  ? 254  THR F O     1 
ATOM   10112 C CB    . THR H 3 55  ? 59.135  77.598  -61.047 1.00 33.43  ? 254  THR F CB    1 
ATOM   10113 O OG1   . THR H 3 55  ? 59.770  78.365  -62.080 1.00 32.84  ? 254  THR F OG1   1 
ATOM   10114 C CG2   . THR H 3 55  ? 58.522  78.563  -60.010 1.00 33.40  ? 254  THR F CG2   1 
ATOM   10115 N N     . ARG H 3 56  ? 58.868  74.813  -59.520 1.00 36.35  ? 255  ARG F N     1 
ATOM   10116 C CA    . ARG H 3 56  ? 58.233  74.018  -58.479 1.00 38.30  ? 255  ARG F CA    1 
ATOM   10117 C C     . ARG H 3 56  ? 59.306  73.479  -57.540 1.00 37.79  ? 255  ARG F C     1 
ATOM   10118 O O     . ARG H 3 56  ? 59.150  73.504  -56.318 1.00 39.35  ? 255  ARG F O     1 
ATOM   10119 C CB    . ARG H 3 56  ? 57.448  72.860  -59.096 1.00 35.74  ? 255  ARG F CB    1 
ATOM   10120 C CG    . ARG H 3 56  ? 56.226  73.326  -59.846 1.00 38.05  ? 255  ARG F CG    1 
ATOM   10121 C CD    . ARG H 3 56  ? 55.377  72.171  -60.373 1.00 38.62  ? 255  ARG F CD    1 
ATOM   10122 N NE    . ARG H 3 56  ? 54.251  72.713  -61.117 1.00 37.92  ? 255  ARG F NE    1 
ATOM   10123 C CZ    . ARG H 3 56  ? 54.153  72.692  -62.441 1.00 36.81  ? 255  ARG F CZ    1 
ATOM   10124 N NH1   . ARG H 3 56  ? 55.104  72.131  -63.172 1.00 32.55  ? 255  ARG F NH1   1 
ATOM   10125 N NH2   . ARG H 3 56  ? 53.140  73.306  -63.032 1.00 37.37  ? 255  ARG F NH2   1 
ATOM   10126 N N     . GLY H 3 57  ? 60.401  72.999  -58.118 1.00 31.87  ? 256  GLY F N     1 
ATOM   10127 C CA    . GLY H 3 57  ? 61.483  72.478  -57.306 1.00 33.36  ? 256  GLY F CA    1 
ATOM   10128 C C     . GLY H 3 57  ? 62.060  73.552  -56.384 1.00 34.52  ? 256  GLY F C     1 
ATOM   10129 O O     . GLY H 3 57  ? 62.382  73.285  -55.221 1.00 34.75  ? 256  GLY F O     1 
ATOM   10130 N N     . VAL H 3 58  ? 62.190  74.768  -56.905 1.00 34.15  ? 257  VAL F N     1 
ATOM   10131 C CA    . VAL H 3 58  ? 62.742  75.882  -56.140 1.00 33.05  ? 257  VAL F CA    1 
ATOM   10132 C C     . VAL H 3 58  ? 61.776  76.304  -55.049 1.00 31.41  ? 257  VAL F C     1 
ATOM   10133 O O     . VAL H 3 58  ? 62.176  76.615  -53.922 1.00 32.07  ? 257  VAL F O     1 
ATOM   10134 C CB    . VAL H 3 58  ? 63.046  77.092  -57.076 1.00 38.93  ? 257  VAL F CB    1 
ATOM   10135 C CG1   . VAL H 3 58  ? 63.321  78.340  -56.257 1.00 40.85  ? 257  VAL F CG1   1 
ATOM   10136 C CG2   . VAL H 3 58  ? 64.246  76.768  -57.957 1.00 35.68  ? 257  VAL F CG2   1 
ATOM   10137 N N     . LEU H 3 59  ? 60.492  76.299  -55.367 1.00 28.32  ? 258  LEU F N     1 
ATOM   10138 C CA    . LEU H 3 59  ? 59.524  76.692  -54.362 1.00 31.34  ? 258  LEU F CA    1 
ATOM   10139 C C     . LEU H 3 59  ? 59.522  75.665  -53.234 1.00 33.25  ? 258  LEU F C     1 
ATOM   10140 O O     . LEU H 3 59  ? 59.494  76.022  -52.053 1.00 31.28  ? 258  LEU F O     1 
ATOM   10141 C CB    . LEU H 3 59  ? 58.126  76.835  -54.974 1.00 32.20  ? 258  LEU F CB    1 
ATOM   10142 C CG    . LEU H 3 59  ? 56.969  77.049  -53.985 1.00 36.33  ? 258  LEU F CG    1 
ATOM   10143 C CD1   . LEU H 3 59  ? 57.277  78.233  -53.047 1.00 34.66  ? 258  LEU F CD1   1 
ATOM   10144 C CD2   . LEU H 3 59  ? 55.665  77.282  -54.762 1.00 36.03  ? 258  LEU F CD2   1 
ATOM   10145 N N     . LYS H 3 60  ? 59.583  74.389  -53.594 1.00 36.11  ? 259  LYS F N     1 
ATOM   10146 C CA    . LYS H 3 60  ? 59.568  73.345  -52.583 1.00 36.88  ? 259  LYS F CA    1 
ATOM   10147 C C     . LYS H 3 60  ? 60.721  73.470  -51.599 1.00 34.86  ? 259  LYS F C     1 
ATOM   10148 O O     . LYS H 3 60  ? 60.531  73.352  -50.388 1.00 32.52  ? 259  LYS F O     1 
ATOM   10149 C CB    . LYS H 3 60  ? 59.581  71.962  -53.242 1.00 54.69  ? 259  LYS F CB    1 
ATOM   10150 C CG    . LYS H 3 60  ? 59.176  70.865  -52.285 1.00 59.70  ? 259  LYS F CG    1 
ATOM   10151 C CD    . LYS H 3 60  ? 58.876  69.565  -52.992 1.00 67.38  ? 259  LYS F CD    1 
ATOM   10152 C CE    . LYS H 3 60  ? 58.510  68.486  -51.980 1.00 71.52  ? 259  LYS F CE    1 
ATOM   10153 N NZ    . LYS H 3 60  ? 58.156  67.182  -52.616 1.00 74.99  ? 259  LYS F NZ    1 
ATOM   10154 N N     . VAL H 3 61  ? 61.920  73.712  -52.114 1.00 35.12  ? 260  VAL F N     1 
ATOM   10155 C CA    . VAL H 3 61  ? 63.082  73.867  -51.258 1.00 33.60  ? 260  VAL F CA    1 
ATOM   10156 C C     . VAL H 3 61  ? 62.897  75.057  -50.319 1.00 33.49  ? 260  VAL F C     1 
ATOM   10157 O O     . VAL H 3 61  ? 63.186  74.971  -49.128 1.00 35.52  ? 260  VAL F O     1 
ATOM   10158 C CB    . VAL H 3 61  ? 64.364  74.070  -52.109 1.00 42.11  ? 260  VAL F CB    1 
ATOM   10159 C CG1   . VAL H 3 61  ? 65.536  74.545  -51.224 1.00 40.33  ? 260  VAL F CG1   1 
ATOM   10160 C CG2   . VAL H 3 61  ? 64.729  72.753  -52.803 1.00 39.91  ? 260  VAL F CG2   1 
ATOM   10161 N N     . PHE H 3 62  ? 62.410  76.171  -50.858 1.00 30.31  ? 261  PHE F N     1 
ATOM   10162 C CA    . PHE H 3 62  ? 62.202  77.370  -50.059 1.00 29.25  ? 261  PHE F CA    1 
ATOM   10163 C C     . PHE H 3 62  ? 61.188  77.080  -48.950 1.00 27.62  ? 261  PHE F C     1 
ATOM   10164 O O     . PHE H 3 62  ? 61.400  77.401  -47.785 1.00 25.04  ? 261  PHE F O     1 
ATOM   10165 C CB    . PHE H 3 62  ? 61.683  78.515  -50.950 1.00 29.18  ? 261  PHE F CB    1 
ATOM   10166 C CG    . PHE H 3 62  ? 61.371  79.788  -50.189 1.00 29.84  ? 261  PHE F CG    1 
ATOM   10167 C CD1   . PHE H 3 62  ? 62.363  80.732  -49.945 1.00 27.80  ? 261  PHE F CD1   1 
ATOM   10168 C CD2   . PHE H 3 62  ? 60.092  80.018  -49.686 1.00 28.65  ? 261  PHE F CD2   1 
ATOM   10169 C CE1   . PHE H 3 62  ? 62.086  81.884  -49.206 1.00 27.87  ? 261  PHE F CE1   1 
ATOM   10170 C CE2   . PHE H 3 62  ? 59.802  81.168  -48.942 1.00 29.48  ? 261  PHE F CE2   1 
ATOM   10171 C CZ    . PHE H 3 62  ? 60.797  82.100  -48.704 1.00 28.87  ? 261  PHE F CZ    1 
ATOM   10172 N N     . LEU H 3 63  ? 60.073  76.475  -49.323 1.00 29.22  ? 262  LEU F N     1 
ATOM   10173 C CA    . LEU H 3 63  ? 59.042  76.161  -48.350 1.00 30.74  ? 262  LEU F CA    1 
ATOM   10174 C C     . LEU H 3 63  ? 59.492  75.162  -47.293 1.00 31.68  ? 262  LEU F C     1 
ATOM   10175 O O     . LEU H 3 63  ? 59.189  75.341  -46.119 1.00 31.90  ? 262  LEU F O     1 
ATOM   10176 C CB    . LEU H 3 63  ? 57.788  75.638  -49.055 1.00 37.78  ? 262  LEU F CB    1 
ATOM   10177 C CG    . LEU H 3 63  ? 56.775  76.703  -49.478 1.00 41.95  ? 262  LEU F CG    1 
ATOM   10178 C CD1   . LEU H 3 63  ? 55.593  76.027  -50.170 1.00 41.44  ? 262  LEU F CD1   1 
ATOM   10179 C CD2   . LEU H 3 63  ? 56.304  77.492  -48.257 1.00 40.11  ? 262  LEU F CD2   1 
ATOM   10180 N N     . GLU H 3 64  ? 60.212  74.115  -47.700 1.00 32.59  ? 263  GLU F N     1 
ATOM   10181 C CA    . GLU H 3 64  ? 60.663  73.113  -46.739 1.00 35.37  ? 263  GLU F CA    1 
ATOM   10182 C C     . GLU H 3 64  ? 61.570  73.757  -45.700 1.00 33.97  ? 263  GLU F C     1 
ATOM   10183 O O     . GLU H 3 64  ? 61.440  73.478  -44.506 1.00 32.64  ? 263  GLU F O     1 
ATOM   10184 C CB    . GLU H 3 64  ? 61.424  71.973  -47.426 1.00 51.88  ? 263  GLU F CB    1 
ATOM   10185 C CG    . GLU H 3 64  ? 60.657  71.293  -48.536 1.00 62.02  ? 263  GLU F CG    1 
ATOM   10186 C CD    . GLU H 3 64  ? 61.496  70.272  -49.300 1.00 67.72  ? 263  GLU F CD    1 
ATOM   10187 O OE1   . GLU H 3 64  ? 62.655  70.594  -49.663 1.00 68.35  ? 263  GLU F OE1   1 
ATOM   10188 O OE2   . GLU H 3 64  ? 60.989  69.151  -49.546 1.00 70.09  ? 263  GLU F OE2   1 
ATOM   10189 N N     . ASN H 3 65  ? 62.482  74.617  -46.152 1.00 32.17  ? 264  ASN F N     1 
ATOM   10190 C CA    . ASN H 3 65  ? 63.404  75.281  -45.237 1.00 31.72  ? 264  ASN F CA    1 
ATOM   10191 C C     . ASN H 3 65  ? 62.690  76.193  -44.242 1.00 31.29  ? 264  ASN F C     1 
ATOM   10192 O O     . ASN H 3 65  ? 62.992  76.160  -43.056 1.00 30.93  ? 264  ASN F O     1 
ATOM   10193 C CB    . ASN H 3 65  ? 64.459  76.093  -46.003 1.00 39.38  ? 264  ASN F CB    1 
ATOM   10194 C CG    . ASN H 3 65  ? 65.447  75.208  -46.773 1.00 44.14  ? 264  ASN F CG    1 
ATOM   10195 O OD1   . ASN H 3 65  ? 65.686  74.053  -46.412 1.00 46.98  ? 264  ASN F OD1   1 
ATOM   10196 N ND2   . ASN H 3 65  ? 66.040  75.762  -47.825 1.00 44.46  ? 264  ASN F ND2   1 
ATOM   10197 N N     . VAL H 3 66  ? 61.742  76.999  -44.707 1.00 30.61  ? 265  VAL F N     1 
ATOM   10198 C CA    . VAL H 3 66  ? 61.047  77.894  -43.787 1.00 32.32  ? 265  VAL F CA    1 
ATOM   10199 C C     . VAL H 3 66  ? 60.099  77.123  -42.865 1.00 32.32  ? 265  VAL F C     1 
ATOM   10200 O O     . VAL H 3 66  ? 60.015  77.406  -41.669 1.00 28.41  ? 265  VAL F O     1 
ATOM   10201 C CB    . VAL H 3 66  ? 60.225  78.972  -44.545 1.00 31.90  ? 265  VAL F CB    1 
ATOM   10202 C CG1   . VAL H 3 66  ? 59.492  79.863  -43.537 1.00 28.52  ? 265  VAL F CG1   1 
ATOM   10203 C CG2   . VAL H 3 66  ? 61.156  79.800  -45.451 1.00 32.89  ? 265  VAL F CG2   1 
ATOM   10204 N N     . ILE H 3 67  ? 59.365  76.165  -43.433 1.00 31.80  ? 266  ILE F N     1 
ATOM   10205 C CA    . ILE H 3 67  ? 58.437  75.375  -42.634 1.00 33.00  ? 266  ILE F CA    1 
ATOM   10206 C C     . ILE H 3 67  ? 59.181  74.589  -41.560 1.00 33.41  ? 266  ILE F C     1 
ATOM   10207 O O     . ILE H 3 67  ? 58.764  74.562  -40.400 1.00 33.54  ? 266  ILE F O     1 
ATOM   10208 C CB    . ILE H 3 67  ? 57.616  74.418  -43.527 1.00 34.21  ? 266  ILE F CB    1 
ATOM   10209 C CG1   . ILE H 3 67  ? 56.524  75.217  -44.254 1.00 32.10  ? 266  ILE F CG1   1 
ATOM   10210 C CG2   . ILE H 3 67  ? 56.991  73.301  -42.675 1.00 33.95  ? 266  ILE F CG2   1 
ATOM   10211 C CD1   . ILE H 3 67  ? 55.884  74.486  -45.420 1.00 34.65  ? 266  ILE F CD1   1 
ATOM   10212 N N     . ARG H 3 68  ? 60.297  73.972  -41.940 1.00 32.66  ? 267  ARG F N     1 
ATOM   10213 C CA    . ARG H 3 68  ? 61.098  73.208  -40.990 1.00 34.94  ? 267  ARG F CA    1 
ATOM   10214 C C     . ARG H 3 68  ? 61.413  74.069  -39.765 1.00 34.92  ? 267  ARG F C     1 
ATOM   10215 O O     . ARG H 3 68  ? 61.238  73.636  -38.625 1.00 32.95  ? 267  ARG F O     1 
ATOM   10216 C CB    . ARG H 3 68  ? 62.404  72.755  -41.638 1.00 49.90  ? 267  ARG F CB    1 
ATOM   10217 C CG    . ARG H 3 68  ? 63.382  72.124  -40.662 1.00 57.33  ? 267  ARG F CG    1 
ATOM   10218 C CD    . ARG H 3 68  ? 64.703  71.805  -41.343 1.00 63.29  ? 267  ARG F CD    1 
ATOM   10219 N NE    . ARG H 3 68  ? 64.502  70.933  -42.499 1.00 70.18  ? 267  ARG F NE    1 
ATOM   10220 C CZ    . ARG H 3 68  ? 64.901  71.217  -43.737 1.00 71.73  ? 267  ARG F CZ    1 
ATOM   10221 N NH1   . ARG H 3 68  ? 65.533  72.360  -43.993 1.00 72.43  ? 267  ARG F NH1   1 
ATOM   10222 N NH2   . ARG H 3 68  ? 64.660  70.359  -44.721 1.00 70.36  ? 267  ARG F NH2   1 
ATOM   10223 N N     . ASP H 3 69  ? 61.880  75.293  -40.010 1.00 35.97  ? 268  ASP F N     1 
ATOM   10224 C CA    . ASP H 3 69  ? 62.214  76.207  -38.928 1.00 35.67  ? 268  ASP F CA    1 
ATOM   10225 C C     . ASP H 3 69  ? 60.974  76.658  -38.190 1.00 34.12  ? 268  ASP F C     1 
ATOM   10226 O O     . ASP H 3 69  ? 60.969  76.728  -36.955 1.00 31.24  ? 268  ASP F O     1 
ATOM   10227 C CB    . ASP H 3 69  ? 62.965  77.425  -39.461 1.00 47.55  ? 268  ASP F CB    1 
ATOM   10228 C CG    . ASP H 3 69  ? 64.406  77.109  -39.817 1.00 54.48  ? 268  ASP F CG    1 
ATOM   10229 O OD1   . ASP H 3 69  ? 64.831  75.937  -39.649 1.00 57.45  ? 268  ASP F OD1   1 
ATOM   10230 O OD2   . ASP H 3 69  ? 65.120  78.036  -40.261 1.00 57.55  ? 268  ASP F OD2   1 
ATOM   10231 N N     . ALA H 3 70  ? 59.916  76.971  -38.932 1.00 31.75  ? 269  ALA F N     1 
ATOM   10232 C CA    . ALA H 3 70  ? 58.690  77.406  -38.279 1.00 32.40  ? 269  ALA F CA    1 
ATOM   10233 C C     . ALA H 3 70  ? 58.182  76.307  -37.323 1.00 32.52  ? 269  ALA F C     1 
ATOM   10234 O O     . ALA H 3 70  ? 57.803  76.582  -36.175 1.00 32.58  ? 269  ALA F O     1 
ATOM   10235 C CB    . ALA H 3 70  ? 57.630  77.731  -39.309 1.00 22.52  ? 269  ALA F CB    1 
ATOM   10236 N N     . VAL H 3 71  ? 58.174  75.068  -37.799 1.00 34.34  ? 270  VAL F N     1 
ATOM   10237 C CA    . VAL H 3 71  ? 57.716  73.959  -36.975 1.00 35.68  ? 270  VAL F CA    1 
ATOM   10238 C C     . VAL H 3 71  ? 58.654  73.744  -35.789 1.00 34.12  ? 270  VAL F C     1 
ATOM   10239 O O     . VAL H 3 71  ? 58.223  73.339  -34.717 1.00 37.30  ? 270  VAL F O     1 
ATOM   10240 C CB    . VAL H 3 71  ? 57.595  72.671  -37.804 1.00 32.79  ? 270  VAL F CB    1 
ATOM   10241 C CG1   . VAL H 3 71  ? 57.411  71.455  -36.874 1.00 34.06  ? 270  VAL F CG1   1 
ATOM   10242 C CG2   . VAL H 3 71  ? 56.406  72.801  -38.754 1.00 29.27  ? 270  VAL F CG2   1 
ATOM   10243 N N     . THR H 3 72  ? 59.933  74.040  -35.965 1.00 33.87  ? 271  THR F N     1 
ATOM   10244 C CA    . THR H 3 72  ? 60.862  73.874  -34.861 1.00 33.82  ? 271  THR F CA    1 
ATOM   10245 C C     . THR H 3 72  ? 60.518  74.844  -33.720 1.00 36.29  ? 271  THR F C     1 
ATOM   10246 O O     . THR H 3 72  ? 60.570  74.448  -32.549 1.00 34.55  ? 271  THR F O     1 
ATOM   10247 C CB    . THR H 3 72  ? 62.306  74.053  -35.336 1.00 29.68  ? 271  THR F CB    1 
ATOM   10248 O OG1   . THR H 3 72  ? 62.592  73.029  -36.292 1.00 29.71  ? 271  THR F OG1   1 
ATOM   10249 C CG2   . THR H 3 72  ? 63.309  73.937  -34.167 1.00 26.39  ? 271  THR F CG2   1 
ATOM   10250 N N     . TYR H 3 73  ? 60.153  76.092  -34.052 1.00 36.40  ? 272  TYR F N     1 
ATOM   10251 C CA    . TYR H 3 73  ? 59.767  77.076  -33.025 1.00 38.62  ? 272  TYR F CA    1 
ATOM   10252 C C     . TYR H 3 73  ? 58.472  76.635  -32.337 1.00 39.89  ? 272  TYR F C     1 
ATOM   10253 O O     . TYR H 3 73  ? 58.288  76.839  -31.141 1.00 39.29  ? 272  TYR F O     1 
ATOM   10254 C CB    . TYR H 3 73  ? 59.537  78.477  -33.625 1.00 38.95  ? 272  TYR F CB    1 
ATOM   10255 C CG    . TYR H 3 73  ? 60.806  79.251  -33.912 1.00 40.20  ? 272  TYR F CG    1 
ATOM   10256 C CD1   . TYR H 3 73  ? 61.188  79.552  -35.220 1.00 40.25  ? 272  TYR F CD1   1 
ATOM   10257 C CD2   . TYR H 3 73  ? 61.640  79.664  -32.873 1.00 39.92  ? 272  TYR F CD2   1 
ATOM   10258 C CE1   . TYR H 3 73  ? 62.370  80.244  -35.480 1.00 40.71  ? 272  TYR F CE1   1 
ATOM   10259 C CE2   . TYR H 3 73  ? 62.820  80.347  -33.124 1.00 39.91  ? 272  TYR F CE2   1 
ATOM   10260 C CZ    . TYR H 3 73  ? 63.179  80.633  -34.422 1.00 39.76  ? 272  TYR F CZ    1 
ATOM   10261 O OH    . TYR H 3 73  ? 64.352  81.298  -34.656 1.00 41.21  ? 272  TYR F OH    1 
ATOM   10262 N N     . THR H 3 74  ? 57.568  76.051  -33.111 1.00 40.85  ? 273  THR F N     1 
ATOM   10263 C CA    . THR H 3 74  ? 56.296  75.583  -32.571 1.00 40.98  ? 273  THR F CA    1 
ATOM   10264 C C     . THR H 3 74  ? 56.565  74.516  -31.515 1.00 41.97  ? 273  THR F C     1 
ATOM   10265 O O     . THR H 3 74  ? 56.118  74.634  -30.374 1.00 39.52  ? 273  THR F O     1 
ATOM   10266 C CB    . THR H 3 74  ? 55.413  74.980  -33.679 1.00 42.22  ? 273  THR F CB    1 
ATOM   10267 O OG1   . THR H 3 74  ? 55.172  75.974  -34.681 1.00 43.57  ? 273  THR F OG1   1 
ATOM   10268 C CG2   . THR H 3 74  ? 54.072  74.505  -33.111 1.00 40.22  ? 273  THR F CG2   1 
ATOM   10269 N N     . GLU H 3 75  ? 57.302  73.482  -31.903 1.00 43.90  ? 274