data_2NTC
# 
_entry.id   2NTC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NTC         
NDB   PD0908       
RCSB  RCSB040276   
WWPDB D_1000040276 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1TBD 'NMR of same protein'                            unspecified 
PDB 2FUF 'high resolution open-ring form of same protein' unspecified 
# 
_pdbx_database_status.entry_id                        2NTC 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bohm, A.'      1 
'Meinke, G.'    2 
'Bullock, P.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'The Crystal Structure of the SV40 T-Antigen Origin Binding Domain in Complex with DNA' 
_citation.journal_abbrev            'Plos Biol.' 
_citation.journal_volume            5 
_citation.page_first                e23 
_citation.page_last                 e23 
_citation.year                      2007 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1544-9173 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17253903 
_citation.pdbx_database_id_DOI      10.1371/journal.pbio.0050023 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meinke, G.'     1 
primary 'Phelan, P.'     2 
primary 'Moine, S.'      3 
primary 'Bochkareva, E.' 4 
primary 'Bochkarev, A.'  5 
primary 'Bullock, P.A.'  6 
primary 'Bohm, A.'       7 
# 
_cell.entry_id           2NTC 
_cell.length_a           64.489 
_cell.length_b           68.341 
_cell.length_c           97.262 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NTC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn '21-nt PEN element of the SV40 DNA origin' 6415.134  1  ? ? ?                                          ? 
2 polymer syn '21-nt PEN element of the SV40 DNA origin' 6473.186  1  ? ? ?                                          ? 
3 polymer man 'large T antigen'                          15414.633 2  ? ? 'Origin binding domain (residues 131-259)' ? 
4 water   nat water                                      18.015    77 ? ? ?                                          ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DC)(DG)(DA)(DG)(DG)(DC)(DA)(DC)(DT)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DC)(DT)
(DG)
;
ACGAGGCACTTCTGGCCTCTG W   ? 
2 polydeoxyribonucleotide no no 
;(DT)(DC)(DA)(DG)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DA)(DG)(DT)(DG)(DC)(DC)(DT)(DC)
(DG)
;
TCAGAGGCCAGAAGTGCCTCG C   ? 
3 'polypeptide(L)'        no no 
;GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAI
NNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPESS
;
;GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAI
NNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPESS
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DG  n 
1 6   DG  n 
1 7   DC  n 
1 8   DA  n 
1 9   DC  n 
1 10  DT  n 
1 11  DT  n 
1 12  DC  n 
1 13  DT  n 
1 14  DG  n 
1 15  DG  n 
1 16  DC  n 
1 17  DC  n 
1 18  DT  n 
1 19  DC  n 
1 20  DT  n 
1 21  DG  n 
2 1   DT  n 
2 2   DC  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DC  n 
2 10  DA  n 
2 11  DG  n 
2 12  DA  n 
2 13  DA  n 
2 14  DG  n 
2 15  DT  n 
2 16  DG  n 
2 17  DC  n 
2 18  DC  n 
2 19  DT  n 
2 20  DC  n 
2 21  DG  n 
3 1   GLY n 
3 2   SER n 
3 3   LYS n 
3 4   VAL n 
3 5   GLU n 
3 6   ASP n 
3 7   PRO n 
3 8   LYS n 
3 9   ASP n 
3 10  PHE n 
3 11  PRO n 
3 12  SER n 
3 13  GLU n 
3 14  LEU n 
3 15  LEU n 
3 16  SER n 
3 17  PHE n 
3 18  LEU n 
3 19  SER n 
3 20  HIS n 
3 21  ALA n 
3 22  VAL n 
3 23  PHE n 
3 24  SER n 
3 25  ASN n 
3 26  ARG n 
3 27  THR n 
3 28  LEU n 
3 29  ALA n 
3 30  CYS n 
3 31  PHE n 
3 32  ALA n 
3 33  ILE n 
3 34  TYR n 
3 35  THR n 
3 36  THR n 
3 37  LYS n 
3 38  GLU n 
3 39  LYS n 
3 40  ALA n 
3 41  ALA n 
3 42  LEU n 
3 43  LEU n 
3 44  TYR n 
3 45  LYS n 
3 46  LYS n 
3 47  ILE n 
3 48  MET n 
3 49  GLU n 
3 50  LYS n 
3 51  TYR n 
3 52  SER n 
3 53  VAL n 
3 54  THR n 
3 55  PHE n 
3 56  ILE n 
3 57  SER n 
3 58  ARG n 
3 59  HIS n 
3 60  ASN n 
3 61  SER n 
3 62  TYR n 
3 63  ASN n 
3 64  HIS n 
3 65  ASN n 
3 66  ILE n 
3 67  LEU n 
3 68  PHE n 
3 69  PHE n 
3 70  LEU n 
3 71  THR n 
3 72  PRO n 
3 73  HIS n 
3 74  ARG n 
3 75  HIS n 
3 76  ARG n 
3 77  VAL n 
3 78  SER n 
3 79  ALA n 
3 80  ILE n 
3 81  ASN n 
3 82  ASN n 
3 83  TYR n 
3 84  ALA n 
3 85  GLN n 
3 86  LYS n 
3 87  LEU n 
3 88  CYS n 
3 89  THR n 
3 90  PHE n 
3 91  SER n 
3 92  PHE n 
3 93  LEU n 
3 94  ILE n 
3 95  CYS n 
3 96  LYS n 
3 97  GLY n 
3 98  VAL n 
3 99  ASN n 
3 100 LYS n 
3 101 GLU n 
3 102 TYR n 
3 103 LEU n 
3 104 MET n 
3 105 TYR n 
3 106 SER n 
3 107 ALA n 
3 108 LEU n 
3 109 THR n 
3 110 ARG n 
3 111 ASP n 
3 112 PRO n 
3 113 PHE n 
3 114 SER n 
3 115 VAL n 
3 116 ILE n 
3 117 GLU n 
3 118 GLU n 
3 119 SER n 
3 120 LEU n 
3 121 PRO n 
3 122 GLY n 
3 123 GLY n 
3 124 LEU n 
3 125 LYS n 
3 126 GLU n 
3 127 HIS n 
3 128 ASP n 
3 129 PHE n 
3 130 ASN n 
3 131 PRO n 
3 132 GLU n 
3 133 SER n 
3 134 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Polyomavirus 
_entity_src_gen.pdbx_gene_src_gene                 'large T antigen' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    776 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Simian virus 40' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10633 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-1lT 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP TALA_SV40 P03070 131 
;KVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINN
YAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPE
;
? 
2 1 PDB 2NTC      2NTC   ?   ? ? 
3 2 PDB 2NTC      2NTC   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2NTC A 3 ? 132 ? P03070 131 ? 260 ? 131 260 
2 1 2NTC B 3 ? 132 ? P03070 131 ? 260 ? 131 260 
3 2 2NTC W 1 ? 21  ? 2NTC   1   ? 21  ? 1   21  
4 3 2NTC C 1 ? 21  ? 2NTC   23  ? 43  ? 23  43  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2NTC GLY A 1   ? UNP P03070 ? ? 'CLONING ARTIFACT' 129 1 
1 2NTC SER A 2   ? UNP P03070 ? ? 'CLONING ARTIFACT' 130 2 
1 2NTC SER A 133 ? UNP P03070 ? ? 'CLONING ARTIFACT' 261 3 
1 2NTC SER A 134 ? UNP P03070 ? ? 'CLONING ARTIFACT' 262 4 
2 2NTC GLY B 1   ? UNP P03070 ? ? 'CLONING ARTIFACT' 129 5 
2 2NTC SER B 2   ? UNP P03070 ? ? 'CLONING ARTIFACT' 130 6 
2 2NTC SER B 133 ? UNP P03070 ? ? 'CLONING ARTIFACT' 261 7 
2 2NTC SER B 134 ? UNP P03070 ? ? 'CLONING ARTIFACT' 262 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2NTC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.18 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            273 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1 M sodium cacodylate pH 6.5, 0.1 M calcium acetate, 30 % v/v peg 8000, 20 % glycerol, VAPOR DIFFUSION, temperature 273K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'sodium cacodylate' ? ? ? 
1 2 1 'calcium acetate'   ? ? ? 
1 3 1 'peg 8000'          ? ? ? 
1 4 1 glycerol            ? ? ? 
1 5 2 'sodium cacodylate' ? ? ? 
1 6 2 'calcium acetate'   ? ? ? 
1 7 2 'peg 8000'          ? ? ? 
1 8 2 glycerol            ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-09-01 
_diffrn_detector.details                crystal 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     2NTC 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2.1 
_reflns.d_resolution_high            2.40 
_reflns.d_resolution_low             40 
_reflns.number_all                   15755 
_reflns.number_obs                   15314 
_reflns.percent_possible_obs         90.1 
_reflns.pdbx_Rmerge_I_obs            0.1 
_reflns.pdbx_Rsym_value              0.1 
_reflns.pdbx_netI_over_sigmaI        2.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2NTC 
_refine.ls_number_reflns_obs                     14921 
_refine.ls_number_reflns_all                     15755 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.84 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.24 
_refine.ls_R_factor_obs                          0.2088 
_refine.ls_R_factor_all                          0.2088 
_refine.ls_R_factor_R_work                       0.2049 
_refine.ls_R_factor_R_free                       0.28692 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  772 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               53.054 
_refine.aniso_B[1][1]                            -0.98 
_refine.aniso_B[2][2]                            -4.37 
_refine.aniso_B[3][3]                            5.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      't antigen origin binding domain and four base pairs duplex dna' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.523 
_refine.pdbx_overall_ESU_R_Free                  0.325 
_refine.overall_SU_ML                            0.261 
_refine.overall_SU_B                             13.329 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2063 
_refine_hist.pdbx_number_atoms_nucleic_acid   855 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               2995 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        38.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016  0.021  ? 3079 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.013  2.299  ? 4343 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   8.012  5.000  ? 251  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   34.099 23.200 ? 100  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   19.290 15.000 ? 361  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   24.621 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.108  0.200  ? 480  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007  0.020  ? 2041 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.239  0.200  ? 1239 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.314  0.200  ? 1969 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.208  0.200  ? 137  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.192  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.459  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.878  1.500  ? 1299 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.575  2.000  ? 2055 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.868  3.000  ? 2295 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.866  4.500  ? 2288 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_R_work             706 
_refine_ls_shell.R_factor_R_work                  0.297 
_refine_ls_shell.percent_reflns_obs               58.33 
_refine_ls_shell.R_factor_R_free                  0.413 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             29 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NTC 
_struct.title                     'Crystal Structure of sv40 large T antigen origin binding domain with DNA' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NTC 
_struct_keywords.pdbx_keywords   'DNA binding protein/DNA' 
_struct_keywords.text            'origin binding domain; protein-DNA complex; replication, DNA binding protein-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;the asymmetric unit contains two t-antigen origin binding domain molecules bound to a dna target that contains two high affinity binding sites
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 36  ? SER C 52  ? THR A 164 SER A 180 1 ? 17 
HELX_P HELX_P2 2 ARG C 76  ? LYS C 86  ? ARG A 204 LYS A 214 1 ? 11 
HELX_P HELX_P3 3 LYS C 100 ? ARG C 110 ? LYS A 228 ARG A 238 1 ? 11 
HELX_P HELX_P4 4 GLY C 122 ? GLU C 126 ? GLY A 250 GLU A 254 5 ? 5  
HELX_P HELX_P5 5 LEU D 14  ? LEU D 18  ? LEU B 142 LEU B 146 5 ? 5  
HELX_P HELX_P6 6 THR D 36  ? SER D 52  ? THR B 164 SER B 180 1 ? 17 
HELX_P HELX_P7 7 ARG D 76  ? LYS D 86  ? ARG B 204 LYS B 214 1 ? 11 
HELX_P HELX_P8 8 LYS D 100 ? ARG D 110 ? LYS B 228 ARG B 238 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 21 N1 ? ? W DC 2  C DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 21 O6 ? ? W DC 2  C DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 21 N2 ? ? W DC 2  C DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 20 N3 ? ? W DG 3  C DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 20 O2 ? ? W DG 3  C DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 20 N4 ? ? W DG 3  C DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 19 N3 ? ? W DA 4  C DT 41 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 19 O4 ? ? W DA 4  C DT 41 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9  hydrog ? ? A DG 5  N1 ? ? ? 1_555 B DC 18 N3 ? ? W DG 5  C DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B DC 18 O2 ? ? W DG 5  C DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B DC 18 N4 ? ? W DG 5  C DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 17 N3 ? ? W DG 6  C DC 39 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 17 O2 ? ? W DG 6  C DC 39 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 17 N4 ? ? W DG 6  C DC 39 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15 hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG 16 N1 ? ? W DC 7  C DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG 16 O6 ? ? W DC 7  C DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG 16 N2 ? ? W DC 7  C DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 15 N3 ? ? W DA 8  C DT 37 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 15 O4 ? ? W DA 8  C DT 37 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 14 N2 ? ? W DC 9  C DG 36 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog21 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 14 N1 ? ? W DC 9  C DG 36 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog22 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 13 N1 ? ? W DT 10 C DA 35 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 13 N6 ? ? W DT 10 C DA 35 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 12 N1 ? ? W DT 11 C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 12 N6 ? ? W DT 11 C DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 11 N1 ? ? W DC 12 C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 11 O6 ? ? W DC 12 C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 11 N2 ? ? W DC 12 C DG 33 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 10 N1 ? ? W DT 13 C DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 10 N6 ? ? W DT 13 C DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC 9  N3 ? ? W DG 14 C DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC 9  O2 ? ? W DG 14 C DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC 9  N4 ? ? W DG 14 C DC 31 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 8  N3 ? ? W DG 15 C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 8  O2 ? ? W DG 15 C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 8  N4 ? ? W DG 15 C DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 7  N1 ? ? W DC 16 C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 7  O6 ? ? W DC 16 C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 7  N2 ? ? W DC 16 C DG 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG 6  N1 ? ? W DC 17 C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG 6  O6 ? ? W DC 17 C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG 6  N2 ? ? W DC 17 C DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43 hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 5  N1 ? ? W DT 18 C DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44 hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 5  N6 ? ? W DT 18 C DA 27 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45 hydrog ? ? A DC 19 N3 ? ? ? 1_555 B DG 4  N1 ? ? W DC 19 C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46 hydrog ? ? A DC 19 N4 ? ? ? 1_555 B DG 4  O6 ? ? W DC 19 C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47 hydrog ? ? A DC 19 O2 ? ? ? 1_555 B DG 4  N2 ? ? W DC 19 C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 3  N1 ? ? W DT 20 C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49 hydrog ? ? A DT 20 O4 ? ? ? 1_555 B DA 3  N6 ? ? W DT 20 C DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50 hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC 2  N3 ? ? W DG 21 C DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51 hydrog ? ? A DG 21 N2 ? ? ? 1_555 B DC 2  O2 ? ? W DG 21 C DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52 hydrog ? ? A DG 21 O6 ? ? ? 1_555 B DC 2  N4 ? ? W DG 21 C DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 89  C . ? THR 217 A PHE 90  C ? PHE 218 A 1 13.32 
2 ASP 111 C . ? ASP 239 A PRO 112 C ? PRO 240 A 1 -3.32 
3 ASP 111 D . ? ASP 239 B PRO 112 D ? PRO 240 B 1 10.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 93  ? GLY C 97  ? LEU A 221 GLY A 225 
A 2 LEU C 28  ? THR C 35  ? LEU A 156 THR A 163 
A 3 HIS C 64  ? HIS C 75  ? HIS A 192 HIS A 203 
A 4 PHE C 55  ? SER C 61  ? PHE A 183 SER A 189 
A 5 SER C 114 ? GLU C 118 ? SER A 242 GLU A 246 
B 1 LEU D 93  ? GLY D 97  ? LEU B 221 GLY B 225 
B 2 LEU D 28  ? THR D 35  ? LEU B 156 THR B 163 
B 3 HIS D 64  ? HIS D 75  ? HIS B 192 HIS B 203 
B 4 PHE D 55  ? SER D 61  ? PHE B 183 SER B 189 
B 5 SER D 114 ? GLU D 118 ? SER B 242 GLU B 246 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE C 94 ? O ILE A 222 N TYR C 34  ? N TYR A 162 
A 2 3 N LEU C 28 ? N LEU A 156 O HIS C 75  ? O HIS A 203 
A 3 4 O HIS C 64 ? O HIS A 192 N SER C 61  ? N SER A 189 
A 4 5 N ASN C 60 ? N ASN A 188 O SER C 114 ? O SER A 242 
B 1 2 O ILE D 94 ? O ILE B 222 N TYR D 34  ? N TYR B 162 
B 2 3 N LEU D 28 ? N LEU B 156 O HIS D 75  ? O HIS B 203 
B 3 4 O PHE D 68 ? O PHE B 196 N SER D 57  ? N SER B 185 
B 4 5 N ARG D 58 ? N ARG B 186 O GLU D 117 ? O GLU B 245 
# 
_atom_sites.entry_id                    2NTC 
_atom_sites.fract_transf_matrix[1][1]   0.015507 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014633 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010282 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 17.758  31.200  -11.962 1.00 64.03 ? 1   DA  W "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 17.750  31.720  -10.623 1.00 61.62 ? 1   DA  W "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 16.307  31.926  -10.203 1.00 59.83 ? 1   DA  W "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 15.534  32.434  -11.327 1.00 56.77 ? 1   DA  W "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 15.588  30.650  -9.756  1.00 59.04 ? 1   DA  W "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 14.666  30.898  -8.668  1.00 61.08 ? 1   DA  W "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 14.847  30.242  -11.013 1.00 54.67 ? 1   DA  W "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 14.393  31.621  -11.454 1.00 52.05 ? 1   DA  W "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 13.936  31.635  -12.833 1.00 50.26 ? 1   DA  W N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 12.635  31.772  -13.214 1.00 49.78 ? 1   DA  W C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 12.459  31.748  -14.514 1.00 49.44 ? 1   DA  W N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 13.733  31.575  -14.971 1.00 47.05 ? 1   DA  W C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 14.163  31.480  -16.270 1.00 48.12 ? 1   DA  W C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 13.250  31.562  -17.214 1.00 49.80 ? 1   DA  W N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 15.476  31.309  -16.520 1.00 48.88 ? 1   DA  W N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 16.291  31.238  -15.440 1.00 50.13 ? 1   DA  W C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 15.994  31.325  -14.130 1.00 48.79 ? 1   DA  W N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 14.667  31.498  -13.977 1.00 47.91 ? 1   DA  W C4    1 
ATOM   19   P P     . DC  A 1 2   ? 14.269  29.709  -7.650  1.00 63.10 ? 2   DC  W P     1 
ATOM   20   O OP1   . DC  A 1 2   ? 13.598  30.296  -6.452  1.00 62.20 ? 2   DC  W OP1   1 
ATOM   21   O OP2   . DC  A 1 2   ? 15.404  28.761  -7.509  1.00 62.13 ? 2   DC  W OP2   1 
ATOM   22   O "O5'" . DC  A 1 2   ? 13.183  28.952  -8.557  1.00 63.82 ? 2   DC  W "O5'" 1 
ATOM   23   C "C5'" . DC  A 1 2   ? 11.784  29.302  -8.488  1.00 59.90 ? 2   DC  W "C5'" 1 
ATOM   24   C "C4'" . DC  A 1 2   ? 10.961  28.398  -9.401  1.00 57.23 ? 2   DC  W "C4'" 1 
ATOM   25   O "O4'" . DC  A 1 2   ? 11.284  28.701  -10.775 1.00 56.18 ? 2   DC  W "O4'" 1 
ATOM   26   C "C3'" . DC  A 1 2   ? 11.150  26.906  -9.270  1.00 56.81 ? 2   DC  W "C3'" 1 
ATOM   27   O "O3'" . DC  A 1 2   ? 9.834   26.402  -9.180  1.00 57.02 ? 2   DC  W "O3'" 1 
ATOM   28   C "C2'" . DC  A 1 2   ? 11.812  26.481  -10.595 1.00 56.79 ? 2   DC  W "C2'" 1 
ATOM   29   C "C1'" . DC  A 1 2   ? 11.305  27.552  -11.556 1.00 52.33 ? 2   DC  W "C1'" 1 
ATOM   30   N N1    . DC  A 1 2   ? 12.084  27.809  -12.856 1.00 50.00 ? 2   DC  W N1    1 
ATOM   31   C C2    . DC  A 1 2   ? 11.386  28.238  -14.006 1.00 50.39 ? 2   DC  W C2    1 
ATOM   32   O O2    . DC  A 1 2   ? 10.151  28.437  -13.983 1.00 48.28 ? 2   DC  W O2    1 
ATOM   33   N N3    . DC  A 1 2   ? 12.094  28.439  -15.150 1.00 48.26 ? 2   DC  W N3    1 
ATOM   34   C C4    . DC  A 1 2   ? 13.407  28.246  -15.184 1.00 47.95 ? 2   DC  W C4    1 
ATOM   35   N N4    . DC  A 1 2   ? 14.024  28.465  -16.337 1.00 47.66 ? 2   DC  W N4    1 
ATOM   36   C C5    . DC  A 1 2   ? 14.131  27.829  -14.035 1.00 47.55 ? 2   DC  W C5    1 
ATOM   37   C C6    . DC  A 1 2   ? 13.431  27.629  -12.912 1.00 48.08 ? 2   DC  W C6    1 
ATOM   38   P P     . DG  A 1 3   ? 9.330   25.156  -8.322  1.00 52.21 ? 3   DG  W P     1 
ATOM   39   O OP1   . DG  A 1 3   ? 8.930   25.737  -7.022  1.00 51.98 ? 3   DG  W OP1   1 
ATOM   40   O OP2   . DG  A 1 3   ? 10.216  23.990  -8.404  1.00 50.30 ? 3   DG  W OP2   1 
ATOM   41   O "O5'" . DG  A 1 3   ? 8.004   24.769  -9.160  1.00 55.00 ? 3   DG  W "O5'" 1 
ATOM   42   C "C5'" . DG  A 1 3   ? 6.971   25.770  -9.429  1.00 54.08 ? 3   DG  W "C5'" 1 
ATOM   43   C "C4'" . DG  A 1 3   ? 6.281   25.421  -10.740 1.00 55.06 ? 3   DG  W "C4'" 1 
ATOM   44   O "O4'" . DG  A 1 3   ? 7.139   25.740  -11.865 1.00 54.16 ? 3   DG  W "O4'" 1 
ATOM   45   C "C3'" . DG  A 1 3   ? 5.975   23.945  -10.935 1.00 56.03 ? 3   DG  W "C3'" 1 
ATOM   46   O "O3'" . DG  A 1 3   ? 4.805   23.792  -11.678 1.00 54.28 ? 3   DG  W "O3'" 1 
ATOM   47   C "C2'" . DG  A 1 3   ? 7.141   23.451  -11.782 1.00 55.05 ? 3   DG  W "C2'" 1 
ATOM   48   C "C1'" . DG  A 1 3   ? 7.297   24.642  -12.704 1.00 52.53 ? 3   DG  W "C1'" 1 
ATOM   49   N N9    . DG  A 1 3   ? 8.613   24.677  -13.316 1.00 53.71 ? 3   DG  W N9    1 
ATOM   50   C C8    . DG  A 1 3   ? 9.816   24.396  -12.699 1.00 53.82 ? 3   DG  W C8    1 
ATOM   51   N N7    . DG  A 1 3   ? 10.844  24.472  -13.495 1.00 53.97 ? 3   DG  W N7    1 
ATOM   52   C C5    . DG  A 1 3   ? 10.286  24.826  -14.714 1.00 53.71 ? 3   DG  W C5    1 
ATOM   53   C C6    . DG  A 1 3   ? 10.913  25.062  -15.951 1.00 53.49 ? 3   DG  W C6    1 
ATOM   54   O O6    . DG  A 1 3   ? 12.113  24.999  -16.150 1.00 53.05 ? 3   DG  W O6    1 
ATOM   55   N N1    . DG  A 1 3   ? 10.029  25.395  -16.991 1.00 53.23 ? 3   DG  W N1    1 
ATOM   56   C C2    . DG  A 1 3   ? 8.667   25.482  -16.805 1.00 53.20 ? 3   DG  W C2    1 
ATOM   57   N N2    . DG  A 1 3   ? 7.916   25.812  -17.864 1.00 53.21 ? 3   DG  W N2    1 
ATOM   58   N N3    . DG  A 1 3   ? 8.070   25.278  -15.635 1.00 53.62 ? 3   DG  W N3    1 
ATOM   59   C C4    . DG  A 1 3   ? 8.927   24.960  -14.632 1.00 53.15 ? 3   DG  W C4    1 
ATOM   60   P P     . DA  A 1 4   ? 4.060   22.391  -11.748 1.00 54.20 ? 4   DA  W P     1 
ATOM   61   O OP1   . DA  A 1 4   ? 2.690   22.722  -11.317 1.00 57.27 ? 4   DA  W OP1   1 
ATOM   62   O OP2   . DA  A 1 4   ? 4.778   21.294  -11.077 1.00 54.80 ? 4   DA  W OP2   1 
ATOM   63   O "O5'" . DA  A 1 4   ? 4.044   22.109  -13.319 1.00 53.28 ? 4   DA  W "O5'" 1 
ATOM   64   C "C5'" . DA  A 1 4   ? 3.431   23.073  -14.147 1.00 53.21 ? 4   DA  W "C5'" 1 
ATOM   65   C "C4'" . DA  A 1 4   ? 3.630   22.677  -15.594 1.00 52.02 ? 4   DA  W "C4'" 1 
ATOM   66   O "O4'" . DA  A 1 4   ? 4.956   23.054  -15.988 1.00 49.60 ? 4   DA  W "O4'" 1 
ATOM   67   C "C3'" . DA  A 1 4   ? 3.472   21.200  -15.941 1.00 52.70 ? 4   DA  W "C3'" 1 
ATOM   68   O "O3'" . DA  A 1 4   ? 2.785   21.170  -17.154 1.00 54.90 ? 4   DA  W "O3'" 1 
ATOM   69   C "C2'" . DA  A 1 4   ? 4.908   20.721  -16.161 1.00 50.95 ? 4   DA  W "C2'" 1 
ATOM   70   C "C1'" . DA  A 1 4   ? 5.588   21.971  -16.663 1.00 46.62 ? 4   DA  W "C1'" 1 
ATOM   71   N N9    . DA  A 1 4   ? 7.005   21.906  -16.353 1.00 46.80 ? 4   DA  W N9    1 
ATOM   72   C C8    . DA  A 1 4   ? 7.541   21.650  -15.115 1.00 46.20 ? 4   DA  W C8    1 
ATOM   73   N N7    . DA  A 1 4   ? 8.857   21.607  -15.093 1.00 46.25 ? 4   DA  W N7    1 
ATOM   74   C C5    . DA  A 1 4   ? 9.220   21.870  -16.419 1.00 46.40 ? 4   DA  W C5    1 
ATOM   75   C C6    . DA  A 1 4   ? 10.479  21.993  -17.046 1.00 45.21 ? 4   DA  W C6    1 
ATOM   76   N N6    . DA  A 1 4   ? 11.624  21.828  -16.377 1.00 44.04 ? 4   DA  W N6    1 
ATOM   77   N N1    . DA  A 1 4   ? 10.492  22.255  -18.386 1.00 45.69 ? 4   DA  W N1    1 
ATOM   78   C C2    . DA  A 1 4   ? 9.327   22.401  -19.052 1.00 44.51 ? 4   DA  W C2    1 
ATOM   79   N N3    . DA  A 1 4   ? 8.092   22.314  -18.574 1.00 44.14 ? 4   DA  W N3    1 
ATOM   80   C C4    . DA  A 1 4   ? 8.094   22.055  -17.230 1.00 47.41 ? 4   DA  W C4    1 
ATOM   81   P P     . DG  A 1 5   ? 2.035   19.928  -17.815 1.00 56.00 ? 5   DG  W P     1 
ATOM   82   O OP1   . DG  A 1 5   ? 1.096   20.691  -18.667 1.00 58.67 ? 5   DG  W OP1   1 
ATOM   83   O OP2   . DG  A 1 5   ? 1.600   18.935  -16.813 1.00 54.42 ? 5   DG  W OP2   1 
ATOM   84   O "O5'" . DG  A 1 5   ? 3.075   19.191  -18.766 1.00 56.43 ? 5   DG  W "O5'" 1 
ATOM   85   C "C5'" . DG  A 1 5   ? 3.576   19.891  -19.879 1.00 54.93 ? 5   DG  W "C5'" 1 
ATOM   86   C "C4'" . DG  A 1 5   ? 4.855   19.200  -20.314 1.00 53.15 ? 5   DG  W "C4'" 1 
ATOM   87   O "O4'" . DG  A 1 5   ? 5.935   19.614  -19.430 1.00 49.79 ? 5   DG  W "O4'" 1 
ATOM   88   C "C3'" . DG  A 1 5   ? 4.807   17.688  -20.287 1.00 52.92 ? 5   DG  W "C3'" 1 
ATOM   89   O "O3'" . DG  A 1 5   ? 5.391   17.198  -21.493 1.00 58.43 ? 5   DG  W "O3'" 1 
ATOM   90   C "C2'" . DG  A 1 5   ? 5.735   17.359  -19.137 1.00 51.95 ? 5   DG  W "C2'" 1 
ATOM   91   C "C1'" . DG  A 1 5   ? 6.733   18.487  -19.392 1.00 46.67 ? 5   DG  W "C1'" 1 
ATOM   92   N N9    . DG  A 1 5   ? 7.823   18.539  -18.429 1.00 45.26 ? 5   DG  W N9    1 
ATOM   93   C C8    . DG  A 1 5   ? 7.746   18.328  -17.080 1.00 44.02 ? 5   DG  W C8    1 
ATOM   94   N N7    . DG  A 1 5   ? 8.912   18.405  -16.521 1.00 43.91 ? 5   DG  W N7    1 
ATOM   95   C C5    . DG  A 1 5   ? 9.780   18.657  -17.564 1.00 43.18 ? 5   DG  W C5    1 
ATOM   96   C C6    . DG  A 1 5   ? 11.188  18.828  -17.534 1.00 44.99 ? 5   DG  W C6    1 
ATOM   97   O O6    . DG  A 1 5   ? 11.872  18.761  -16.492 1.00 43.79 ? 5   DG  W O6    1 
ATOM   98   N N1    . DG  A 1 5   ? 11.719  19.072  -18.827 1.00 42.26 ? 5   DG  W N1    1 
ATOM   99   C C2    . DG  A 1 5   ? 10.956  19.154  -19.976 1.00 43.00 ? 5   DG  W C2    1 
ATOM   100  N N2    . DG  A 1 5   ? 11.579  19.391  -21.142 1.00 42.67 ? 5   DG  W N2    1 
ATOM   101  N N3    . DG  A 1 5   ? 9.629   18.997  -19.986 1.00 43.03 ? 5   DG  W N3    1 
ATOM   102  C C4    . DG  A 1 5   ? 9.130   18.728  -18.756 1.00 42.02 ? 5   DG  W C4    1 
ATOM   103  P P     . DG  A 1 6   ? 4.510   16.366  -22.562 1.00 59.91 ? 6   DG  W P     1 
ATOM   104  O OP1   . DG  A 1 6   ? 3.473   17.379  -22.968 1.00 55.87 ? 6   DG  W OP1   1 
ATOM   105  O OP2   . DG  A 1 6   ? 4.174   15.075  -21.957 1.00 56.16 ? 6   DG  W OP2   1 
ATOM   106  O "O5'" . DG  A 1 6   ? 5.466   16.032  -23.810 1.00 57.16 ? 6   DG  W "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 6   ? 5.871   17.147  -24.653 1.00 53.93 ? 6   DG  W "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 6   ? 7.292   16.950  -25.134 1.00 53.15 ? 6   DG  W "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 6   ? 8.302   17.300  -24.123 1.00 50.46 ? 6   DG  W "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 6   ? 7.569   15.496  -25.522 1.00 53.92 ? 6   DG  W "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 6   ? 8.353   15.502  -26.675 1.00 53.85 ? 6   DG  W "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 6   ? 8.383   14.971  -24.354 1.00 52.45 ? 6   DG  W "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 6   ? 9.187   16.219  -23.947 1.00 49.56 ? 6   DG  W "C1'" 1 
ATOM   114  N N9    . DG  A 1 6   ? 9.518   16.066  -22.547 1.00 49.19 ? 6   DG  W N9    1 
ATOM   115  C C8    . DG  A 1 6   ? 8.589   15.860  -21.559 1.00 49.25 ? 6   DG  W C8    1 
ATOM   116  N N7    . DG  A 1 6   ? 9.114   15.691  -20.384 1.00 50.54 ? 6   DG  W N7    1 
ATOM   117  C C5    . DG  A 1 6   ? 10.484  15.790  -20.608 1.00 50.39 ? 6   DG  W C5    1 
ATOM   118  C C6    . DG  A 1 6   ? 11.554  15.731  -19.676 1.00 49.49 ? 6   DG  W C6    1 
ATOM   119  O O6    . DG  A 1 6   ? 11.464  15.546  -18.460 1.00 49.25 ? 6   DG  W O6    1 
ATOM   120  N N1    . DG  A 1 6   ? 12.804  15.889  -20.281 1.00 48.37 ? 6   DG  W N1    1 
ATOM   121  C C2    . DG  A 1 6   ? 12.995  16.071  -21.636 1.00 49.24 ? 6   DG  W C2    1 
ATOM   122  N N2    . DG  A 1 6   ? 14.266  16.190  -22.049 1.00 49.47 ? 6   DG  W N2    1 
ATOM   123  N N3    . DG  A 1 6   ? 12.000  16.160  -22.521 1.00 50.87 ? 6   DG  W N3    1 
ATOM   124  C C4    . DG  A 1 6   ? 10.761  16.005  -21.942 1.00 50.41 ? 6   DG  W C4    1 
ATOM   125  P P     . DC  A 1 7   ? 8.525   14.216  -27.577 1.00 58.95 ? 7   DC  W P     1 
ATOM   126  O OP1   . DC  A 1 7   ? 8.951   14.943  -28.814 1.00 56.80 ? 7   DC  W OP1   1 
ATOM   127  O OP2   . DC  A 1 7   ? 7.396   13.253  -27.535 1.00 54.51 ? 7   DC  W OP2   1 
ATOM   128  O "O5'" . DC  A 1 7   ? 9.731   13.408  -26.874 1.00 58.92 ? 7   DC  W "O5'" 1 
ATOM   129  C "C5'" . DC  A 1 7   ? 10.896  14.249  -26.635 1.00 58.77 ? 7   DC  W "C5'" 1 
ATOM   130  C "C4'" . DC  A 1 7   ? 12.005  13.466  -25.987 1.00 56.58 ? 7   DC  W "C4'" 1 
ATOM   131  O "O4'" . DC  A 1 7   ? 11.866  13.577  -24.565 1.00 53.54 ? 7   DC  W "O4'" 1 
ATOM   132  C "C3'" . DC  A 1 7   ? 11.971  11.990  -26.288 1.00 57.85 ? 7   DC  W "C3'" 1 
ATOM   133  O "O3'" . DC  A 1 7   ? 13.098  11.820  -27.075 1.00 63.44 ? 7   DC  W "O3'" 1 
ATOM   134  C "C2'" . DC  A 1 7   ? 12.121  11.314  -24.924 1.00 55.38 ? 7   DC  W "C2'" 1 
ATOM   135  C "C1'" . DC  A 1 7   ? 12.498  12.484  -24.013 1.00 49.57 ? 7   DC  W "C1'" 1 
ATOM   136  N N1    . DC  A 1 7   ? 11.956  12.408  -22.649 1.00 47.57 ? 7   DC  W N1    1 
ATOM   137  C C2    . DC  A 1 7   ? 12.842  12.475  -21.559 1.00 48.52 ? 7   DC  W C2    1 
ATOM   138  O O2    . DC  A 1 7   ? 14.078  12.622  -21.765 1.00 46.52 ? 7   DC  W O2    1 
ATOM   139  N N3    . DC  A 1 7   ? 12.286  12.406  -20.315 1.00 47.69 ? 7   DC  W N3    1 
ATOM   140  C C4    . DC  A 1 7   ? 10.948  12.292  -20.178 1.00 46.98 ? 7   DC  W C4    1 
ATOM   141  N N4    . DC  A 1 7   ? 10.428  12.211  -18.955 1.00 47.32 ? 7   DC  W N4    1 
ATOM   142  C C5    . DC  A 1 7   ? 10.070  12.207  -21.269 1.00 44.08 ? 7   DC  W C5    1 
ATOM   143  C C6    . DC  A 1 7   ? 10.617  12.277  -22.473 1.00 44.36 ? 7   DC  W C6    1 
ATOM   144  P P     . DA  A 1 8   ? 13.549  10.407  -27.664 1.00 68.57 ? 8   DA  W P     1 
ATOM   145  O OP1   . DA  A 1 8   ? 14.355  10.814  -28.849 1.00 69.07 ? 8   DA  W OP1   1 
ATOM   146  O OP2   . DA  A 1 8   ? 12.383  9.488   -27.755 1.00 68.85 ? 8   DA  W OP2   1 
ATOM   147  O "O5'" . DA  A 1 8   ? 14.524  9.764   -26.547 1.00 68.34 ? 8   DA  W "O5'" 1 
ATOM   148  C "C5'" . DA  A 1 8   ? 15.609  10.579  -26.055 1.00 67.35 ? 8   DA  W "C5'" 1 
ATOM   149  C "C4'" . DA  A 1 8   ? 16.387  9.806   -25.018 1.00 65.87 ? 8   DA  W "C4'" 1 
ATOM   150  O "O4'" . DA  A 1 8   ? 15.755  9.946   -23.716 1.00 62.87 ? 8   DA  W "O4'" 1 
ATOM   151  C "C3'" . DA  A 1 8   ? 16.461  8.322   -25.321 1.00 66.47 ? 8   DA  W "C3'" 1 
ATOM   152  O "O3'" . DA  A 1 8   ? 17.782  7.857   -25.006 1.00 70.89 ? 8   DA  W "O3'" 1 
ATOM   153  C "C2'" . DA  A 1 8   ? 15.375  7.770   -24.389 1.00 64.73 ? 8   DA  W "C2'" 1 
ATOM   154  C "C1'" . DA  A 1 8   ? 15.509  8.686   -23.170 1.00 60.55 ? 8   DA  W "C1'" 1 
ATOM   155  N N9    . DA  A 1 8   ? 14.295  8.771   -22.364 1.00 59.91 ? 8   DA  W N9    1 
ATOM   156  C C8    . DA  A 1 8   ? 13.009  8.784   -22.841 1.00 58.50 ? 8   DA  W C8    1 
ATOM   157  N N7    . DA  A 1 8   ? 12.093  8.858   -21.911 1.00 57.39 ? 8   DA  W N7    1 
ATOM   158  C C5    . DA  A 1 8   ? 12.826  8.894   -20.739 1.00 57.89 ? 8   DA  W C5    1 
ATOM   159  C C6    . DA  A 1 8   ? 12.419  8.976   -19.398 1.00 57.67 ? 8   DA  W C6    1 
ATOM   160  N N6    . DA  A 1 8   ? 11.127  9.029   -19.077 1.00 58.04 ? 8   DA  W N6    1 
ATOM   161  N N1    . DA  A 1 8   ? 13.379  8.999   -18.432 1.00 57.81 ? 8   DA  W N1    1 
ATOM   162  C C2    . DA  A 1 8   ? 14.680  8.952   -18.801 1.00 59.19 ? 8   DA  W C2    1 
ATOM   163  N N3    . DA  A 1 8   ? 15.188  8.863   -20.055 1.00 59.56 ? 8   DA  W N3    1 
ATOM   164  C C4    . DA  A 1 8   ? 14.193  8.838   -20.985 1.00 59.31 ? 8   DA  W C4    1 
ATOM   165  P P     . DC  A 1 9   ? 18.419  6.518   -25.658 1.00 75.40 ? 9   DC  W P     1 
ATOM   166  O OP1   . DC  A 1 9   ? 19.761  6.256   -25.075 1.00 75.46 ? 9   DC  W OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? 18.319  6.880   -27.091 1.00 75.29 ? 9   DC  W OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? 17.507  5.236   -25.300 1.00 70.86 ? 9   DC  W "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? 17.418  4.602   -23.985 1.00 71.00 ? 9   DC  W "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? 18.345  5.048   -22.829 1.00 69.66 ? 9   DC  W "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? 17.716  6.021   -21.950 1.00 67.32 ? 9   DC  W "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? 18.738  3.910   -21.874 1.00 69.09 ? 9   DC  W "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? 20.058  4.053   -21.311 1.00 71.06 ? 9   DC  W "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? 17.709  3.958   -20.757 1.00 66.35 ? 9   DC  W "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? 17.144  5.368   -20.815 1.00 63.72 ? 9   DC  W "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? 15.604  5.347   -20.800 1.00 62.35 ? 9   DC  W N1    1 
ATOM   177  C C2    . DC  A 1 9   ? 14.962  5.495   -19.563 1.00 60.80 ? 9   DC  W C2    1 
ATOM   178  O O2    . DC  A 1 9   ? 15.652  5.614   -18.556 1.00 60.37 ? 9   DC  W O2    1 
ATOM   179  N N3    . DC  A 1 9   ? 13.610  5.510   -19.480 1.00 60.37 ? 9   DC  W N3    1 
ATOM   180  C C4    . DC  A 1 9   ? 12.878  5.350   -20.592 1.00 61.89 ? 9   DC  W C4    1 
ATOM   181  N N4    . DC  A 1 9   ? 11.546  5.330   -20.460 1.00 59.88 ? 9   DC  W N4    1 
ATOM   182  C C5    . DC  A 1 9   ? 13.498  5.211   -21.885 1.00 61.08 ? 9   DC  W C5    1 
ATOM   183  C C6    . DC  A 1 9   ? 14.840  5.214   -21.941 1.00 61.37 ? 9   DC  W C6    1 
ATOM   184  P P     . DT  A 1 10  ? 20.997  2.753   -21.055 1.00 73.58 ? 10  DT  W P     1 
ATOM   185  O OP1   . DT  A 1 10  ? 22.359  3.345   -21.010 1.00 74.21 ? 10  DT  W OP1   1 
ATOM   186  O OP2   . DT  A 1 10  ? 20.675  1.652   -22.011 1.00 71.22 ? 10  DT  W OP2   1 
ATOM   187  O "O5'" . DT  A 1 10  ? 20.594  2.204   -19.590 1.00 72.11 ? 10  DT  W "O5'" 1 
ATOM   188  C "C5'" . DT  A 1 10  ? 20.463  3.084   -18.445 1.00 69.33 ? 10  DT  W "C5'" 1 
ATOM   189  C "C4'" . DT  A 1 10  ? 19.485  2.523   -17.411 1.00 66.53 ? 10  DT  W "C4'" 1 
ATOM   190  O "O4'" . DT  A 1 10  ? 18.109  2.852   -17.721 1.00 64.21 ? 10  DT  W "O4'" 1 
ATOM   191  C "C3'" . DT  A 1 10  ? 19.478  1.001   -17.240 1.00 66.38 ? 10  DT  W "C3'" 1 
ATOM   192  O "O3'" . DT  A 1 10  ? 19.533  0.765   -15.873 1.00 66.05 ? 10  DT  W "O3'" 1 
ATOM   193  C "C2'" . DT  A 1 10  ? 18.125  0.554   -17.778 1.00 63.58 ? 10  DT  W "C2'" 1 
ATOM   194  C "C1'" . DT  A 1 10  ? 17.292  1.753   -17.335 1.00 62.16 ? 10  DT  W "C1'" 1 
ATOM   195  N N1    . DT  A 1 10  ? 15.949  1.839   -18.007 1.00 59.56 ? 10  DT  W N1    1 
ATOM   196  C C2    . DT  A 1 10  ? 14.761  2.086   -17.310 1.00 58.29 ? 10  DT  W C2    1 
ATOM   197  O O2    . DT  A 1 10  ? 14.654  2.265   -16.111 1.00 59.44 ? 10  DT  W O2    1 
ATOM   198  N N3    . DT  A 1 10  ? 13.637  2.146   -18.093 1.00 56.46 ? 10  DT  W N3    1 
ATOM   199  C C4    . DT  A 1 10  ? 13.603  1.961   -19.456 1.00 58.19 ? 10  DT  W C4    1 
ATOM   200  O O4    . DT  A 1 10  ? 12.517  2.043   -19.985 1.00 58.80 ? 10  DT  W O4    1 
ATOM   201  C C5    . DT  A 1 10  ? 14.889  1.687   -20.140 1.00 58.65 ? 10  DT  W C5    1 
ATOM   202  C C7    . DT  A 1 10  ? 15.098  1.493   -21.621 1.00 54.89 ? 10  DT  W C7    1 
ATOM   203  C C6    . DT  A 1 10  ? 15.975  1.640   -19.377 1.00 57.67 ? 10  DT  W C6    1 
ATOM   204  P P     . DT  A 1 11  ? 20.089  -0.596  -15.259 1.00 69.88 ? 11  DT  W P     1 
ATOM   205  O OP1   . DT  A 1 11  ? 21.485  -0.204  -14.976 1.00 69.24 ? 11  DT  W OP1   1 
ATOM   206  O OP2   . DT  A 1 11  ? 19.769  -1.862  -16.048 1.00 65.86 ? 11  DT  W OP2   1 
ATOM   207  O "O5'" . DT  A 1 11  ? 19.240  -0.676  -13.877 1.00 65.82 ? 11  DT  W "O5'" 1 
ATOM   208  C "C5'" . DT  A 1 11  ? 18.391  0.410   -13.444 1.00 64.05 ? 11  DT  W "C5'" 1 
ATOM   209  C "C4'" . DT  A 1 11  ? 17.081  -0.074  -12.822 1.00 61.36 ? 11  DT  W "C4'" 1 
ATOM   210  O "O4'" . DT  A 1 11  ? 15.993  0.045   -13.766 1.00 57.36 ? 11  DT  W "O4'" 1 
ATOM   211  C "C3'" . DT  A 1 11  ? 17.088  -1.537  -12.388 1.00 61.85 ? 11  DT  W "C3'" 1 
ATOM   212  O "O3'" . DT  A 1 11  ? 16.541  -1.637  -11.045 1.00 62.97 ? 11  DT  W "O3'" 1 
ATOM   213  C "C2'" . DT  A 1 11  ? 16.332  -2.239  -13.527 1.00 57.36 ? 11  DT  W "C2'" 1 
ATOM   214  C "C1'" . DT  A 1 11  ? 15.293  -1.189  -13.861 1.00 56.45 ? 11  DT  W "C1'" 1 
ATOM   215  N N1    . DT  A 1 11  ? 14.620  -1.250  -15.222 1.00 54.94 ? 11  DT  W N1    1 
ATOM   216  C C2    . DT  A 1 11  ? 13.273  -0.975  -15.328 1.00 53.63 ? 11  DT  W C2    1 
ATOM   217  O O2    . DT  A 1 11  ? 12.541  -0.710  -14.400 1.00 55.34 ? 11  DT  W O2    1 
ATOM   218  N N3    . DT  A 1 11  ? 12.762  -0.998  -16.593 1.00 53.54 ? 11  DT  W N3    1 
ATOM   219  C C4    . DT  A 1 11  ? 13.452  -1.271  -17.750 1.00 54.68 ? 11  DT  W C4    1 
ATOM   220  O O4    . DT  A 1 11  ? 12.850  -1.297  -18.822 1.00 54.99 ? 11  DT  W O4    1 
ATOM   221  C C5    . DT  A 1 11  ? 14.877  -1.551  -17.585 1.00 54.82 ? 11  DT  W C5    1 
ATOM   222  C C7    . DT  A 1 11  ? 15.727  -2.006  -18.746 1.00 55.37 ? 11  DT  W C7    1 
ATOM   223  C C6    . DT  A 1 11  ? 15.387  -1.513  -16.348 1.00 53.93 ? 11  DT  W C6    1 
ATOM   224  P P     . DC  A 1 12  ? 16.108  -3.051  -10.416 1.00 66.74 ? 12  DC  W P     1 
ATOM   225  O OP1   . DC  A 1 12  ? 16.325  -2.982  -8.955  1.00 67.22 ? 12  DC  W OP1   1 
ATOM   226  O OP2   . DC  A 1 12  ? 16.659  -4.193  -11.204 1.00 65.68 ? 12  DC  W OP2   1 
ATOM   227  O "O5'" . DC  A 1 12  ? 14.545  -3.015  -10.720 1.00 65.03 ? 12  DC  W "O5'" 1 
ATOM   228  C "C5'" . DC  A 1 12  ? 13.702  -1.894  -10.384 1.00 59.97 ? 12  DC  W "C5'" 1 
ATOM   229  C "C4'" . DC  A 1 12  ? 12.285  -2.417  -10.523 1.00 55.01 ? 12  DC  W "C4'" 1 
ATOM   230  O "O4'" . DC  A 1 12  ? 11.979  -2.501  -11.919 1.00 51.62 ? 12  DC  W "O4'" 1 
ATOM   231  C "C3'" . DC  A 1 12  ? 12.045  -3.843  -10.000 1.00 53.22 ? 12  DC  W "C3'" 1 
ATOM   232  O "O3'" . DC  A 1 12  ? 10.836  -3.664  -9.315  1.00 55.48 ? 12  DC  W "O3'" 1 
ATOM   233  C "C2'" . DC  A 1 12  ? 11.922  -4.718  -11.255 1.00 51.24 ? 12  DC  W "C2'" 1 
ATOM   234  C "C1'" . DC  A 1 12  ? 11.307  -3.730  -12.233 1.00 49.59 ? 12  DC  W "C1'" 1 
ATOM   235  N N1    . DC  A 1 12  ? 11.533  -3.952  -13.705 1.00 47.54 ? 12  DC  W N1    1 
ATOM   236  C C2    . DC  A 1 12  ? 10.459  -3.872  -14.630 1.00 48.87 ? 12  DC  W C2    1 
ATOM   237  O O2    . DC  A 1 12  ? 9.286   -3.644  -14.265 1.00 48.12 ? 12  DC  W O2    1 
ATOM   238  N N3    . DC  A 1 12  ? 10.730  -4.023  -15.957 1.00 48.02 ? 12  DC  W N3    1 
ATOM   239  C C4    . DC  A 1 12  ? 11.992  -4.275  -16.324 1.00 48.16 ? 12  DC  W C4    1 
ATOM   240  N N4    . DC  A 1 12  ? 12.199  -4.463  -17.618 1.00 48.31 ? 12  DC  W N4    1 
ATOM   241  C C5    . DC  A 1 12  ? 13.087  -4.372  -15.413 1.00 47.06 ? 12  DC  W C5    1 
ATOM   242  C C6    . DC  A 1 12  ? 12.810  -4.196  -14.129 1.00 46.56 ? 12  DC  W C6    1 
ATOM   243  P P     . DT  A 1 13  ? 9.908   -4.743  -8.608  1.00 57.68 ? 13  DT  W P     1 
ATOM   244  O OP1   . DT  A 1 13  ? 9.105   -3.935  -7.692  1.00 59.80 ? 13  DT  W OP1   1 
ATOM   245  O OP2   . DT  A 1 13  ? 10.675  -5.901  -8.098  1.00 53.62 ? 13  DT  W OP2   1 
ATOM   246  O "O5'" . DT  A 1 13  ? 8.914   -5.160  -9.814  1.00 59.23 ? 13  DT  W "O5'" 1 
ATOM   247  C "C5'" . DT  A 1 13  ? 7.648   -4.515  -10.122 1.00 54.54 ? 13  DT  W "C5'" 1 
ATOM   248  C "C4'" . DT  A 1 13  ? 6.913   -5.385  -11.122 1.00 52.44 ? 13  DT  W "C4'" 1 
ATOM   249  O "O4'" . DT  A 1 13  ? 7.710   -5.525  -12.331 1.00 53.82 ? 13  DT  W "O4'" 1 
ATOM   250  C "C3'" . DT  A 1 13  ? 6.695   -6.831  -10.686 1.00 51.69 ? 13  DT  W "C3'" 1 
ATOM   251  O "O3'" . DT  A 1 13  ? 5.265   -6.963  -10.577 1.00 51.56 ? 13  DT  W "O3'" 1 
ATOM   252  C "C2'" . DT  A 1 13  ? 7.303   -7.692  -11.809 1.00 51.05 ? 13  DT  W "C2'" 1 
ATOM   253  C "C1'" . DT  A 1 13  ? 7.415   -6.723  -12.986 1.00 51.60 ? 13  DT  W "C1'" 1 
ATOM   254  N N1    . DT  A 1 13  ? 8.472   -6.983  -13.999 1.00 51.74 ? 13  DT  W N1    1 
ATOM   255  C C2    . DT  A 1 13  ? 8.143   -7.082  -15.385 1.00 52.67 ? 13  DT  W C2    1 
ATOM   256  O O2    . DT  A 1 13  ? 7.030   -6.956  -15.902 1.00 51.46 ? 13  DT  W O2    1 
ATOM   257  N N3    . DT  A 1 13  ? 9.204   -7.318  -16.235 1.00 49.28 ? 13  DT  W N3    1 
ATOM   258  C C4    . DT  A 1 13  ? 10.526  -7.497  -15.868 1.00 51.68 ? 13  DT  W C4    1 
ATOM   259  O O4    . DT  A 1 13  ? 11.388  -7.741  -16.737 1.00 53.18 ? 13  DT  W O4    1 
ATOM   260  C C5    . DT  A 1 13  ? 10.806  -7.421  -14.433 1.00 50.85 ? 13  DT  W C5    1 
ATOM   261  C C7    . DT  A 1 13  ? 12.076  -8.079  -13.941 1.00 52.98 ? 13  DT  W C7    1 
ATOM   262  C C6    . DT  A 1 13  ? 9.792   -7.158  -13.568 1.00 50.29 ? 13  DT  W C6    1 
ATOM   263  P P     . DG  A 1 14  ? 4.489   -8.105  -9.773  1.00 49.08 ? 14  DG  W P     1 
ATOM   264  O OP1   . DG  A 1 14  ? 3.242   -7.619  -9.233  1.00 44.50 ? 14  DG  W OP1   1 
ATOM   265  O OP2   . DG  A 1 14  ? 5.484   -8.767  -8.900  1.00 47.94 ? 14  DG  W OP2   1 
ATOM   266  O "O5'" . DG  A 1 14  ? 4.055   -9.083  -10.955 1.00 49.69 ? 14  DG  W "O5'" 1 
ATOM   267  C "C5'" . DG  A 1 14  ? 3.665   -8.548  -12.243 1.00 48.42 ? 14  DG  W "C5'" 1 
ATOM   268  C "C4'" . DG  A 1 14  ? 3.550   -9.617  -13.324 1.00 45.92 ? 14  DG  W "C4'" 1 
ATOM   269  O "O4'" . DG  A 1 14  ? 4.784   -9.522  -14.048 1.00 47.97 ? 14  DG  W "O4'" 1 
ATOM   270  C "C3'" . DG  A 1 14  ? 3.445   -11.061 -12.861 1.00 48.06 ? 14  DG  W "C3'" 1 
ATOM   271  O "O3'" . DG  A 1 14  ? 2.632   -11.826 -13.718 1.00 49.91 ? 14  DG  W "O3'" 1 
ATOM   272  C "C2'" . DG  A 1 14  ? 4.867   -11.581 -12.966 1.00 49.74 ? 14  DG  W "C2'" 1 
ATOM   273  C "C1'" . DG  A 1 14  ? 5.345   -10.801 -14.178 1.00 49.16 ? 14  DG  W "C1'" 1 
ATOM   274  N N9    . DG  A 1 14  ? 6.794   -10.745 -14.328 1.00 49.17 ? 14  DG  W N9    1 
ATOM   275  C C8    . DG  A 1 14  ? 7.780   -10.842 -13.365 1.00 49.52 ? 14  DG  W C8    1 
ATOM   276  N N7    . DG  A 1 14  ? 9.011   -10.780 -13.855 1.00 50.03 ? 14  DG  W N7    1 
ATOM   277  C C5    . DG  A 1 14  ? 8.778   -10.669 -15.230 1.00 49.47 ? 14  DG  W C5    1 
ATOM   278  C C6    . DG  A 1 14  ? 9.711   -10.573 -16.297 1.00 50.21 ? 14  DG  W C6    1 
ATOM   279  O O6    . DG  A 1 14  ? 10.962  -10.551 -16.183 1.00 50.72 ? 14  DG  W O6    1 
ATOM   280  N N1    . DG  A 1 14  ? 9.077   -10.457 -17.559 1.00 48.61 ? 14  DG  W N1    1 
ATOM   281  C C2    . DG  A 1 14  ? 7.707   -10.422 -17.747 1.00 49.94 ? 14  DG  W C2    1 
ATOM   282  N N2    . DG  A 1 14  ? 7.276   -10.298 -19.011 0.50 49.21 ? 14  DG  W N2    1 
ATOM   283  N N3    . DG  A 1 14  ? 6.822   -10.542 -16.746 1.00 50.26 ? 14  DG  W N3    1 
ATOM   284  C C4    . DG  A 1 14  ? 7.431   -10.644 -15.530 1.00 48.85 ? 14  DG  W C4    1 
ATOM   285  P P     . DG  A 1 15  ? 1.884   -13.103 -13.133 1.00 49.99 ? 15  DG  W P     1 
ATOM   286  O OP1   . DG  A 1 15  ? 0.706   -12.579 -12.440 1.00 49.64 ? 15  DG  W OP1   1 
ATOM   287  O OP2   . DG  A 1 15  ? 2.828   -13.898 -12.372 1.00 49.35 ? 15  DG  W OP2   1 
ATOM   288  O "O5'" . DG  A 1 15  ? 1.436   -13.985 -14.407 1.00 51.27 ? 15  DG  W "O5'" 1 
ATOM   289  C "C5'" . DG  A 1 15  ? 2.303   -14.842 -15.072 1.00 48.76 ? 15  DG  W "C5'" 1 
ATOM   290  C "C4'" . DG  A 1 15  ? 2.507   -14.461 -16.530 1.00 49.13 ? 15  DG  W "C4'" 1 
ATOM   291  O "O4'" . DG  A 1 15  ? 3.490   -13.410 -16.739 1.00 48.78 ? 15  DG  W "O4'" 1 
ATOM   292  C "C3'" . DG  A 1 15  ? 3.098   -15.626 -17.283 1.00 49.94 ? 15  DG  W "C3'" 1 
ATOM   293  O "O3'" . DG  A 1 15  ? 2.007   -16.494 -17.554 1.00 50.19 ? 15  DG  W "O3'" 1 
ATOM   294  C "C2'" . DG  A 1 15  ? 3.663   -14.917 -18.502 1.00 50.42 ? 15  DG  W "C2'" 1 
ATOM   295  C "C1'" . DG  A 1 15  ? 4.302   -13.703 -17.860 1.00 50.04 ? 15  DG  W "C1'" 1 
ATOM   296  N N9    . DG  A 1 15  ? 5.674   -13.861 -17.365 1.00 51.67 ? 15  DG  W N9    1 
ATOM   297  C C8    . DG  A 1 15  ? 6.011   -14.018 -16.043 1.00 50.80 ? 15  DG  W C8    1 
ATOM   298  N N7    . DG  A 1 15  ? 7.291   -14.101 -15.832 1.00 51.20 ? 15  DG  W N7    1 
ATOM   299  C C5    . DG  A 1 15  ? 7.871   -13.989 -17.079 1.00 51.23 ? 15  DG  W C5    1 
ATOM   300  C C6    . DG  A 1 15  ? 9.240   -13.998 -17.424 1.00 49.40 ? 15  DG  W C6    1 
ATOM   301  O O6    . DG  A 1 15  ? 10.155  -14.130 -16.630 1.00 50.63 ? 15  DG  W O6    1 
ATOM   302  N N1    . DG  A 1 15  ? 9.481   -13.854 -18.783 1.00 48.80 ? 15  DG  W N1    1 
ATOM   303  C C2    . DG  A 1 15  ? 8.450   -13.702 -19.705 1.00 51.22 ? 15  DG  W C2    1 
ATOM   304  N N2    . DG  A 1 15  ? 8.790   -13.598 -21.000 1.00 50.65 ? 15  DG  W N2    1 
ATOM   305  N N3    . DG  A 1 15  ? 7.144   -13.681 -19.396 1.00 52.85 ? 15  DG  W N3    1 
ATOM   306  C C4    . DG  A 1 15  ? 6.901   -13.834 -18.053 1.00 53.09 ? 15  DG  W C4    1 
ATOM   307  P P     . DC  A 1 16  ? 2.240   -17.905 -18.193 1.00 50.72 ? 16  DC  W P     1 
ATOM   308  O OP1   . DC  A 1 16  ? 1.017   -18.656 -18.462 1.00 49.19 ? 16  DC  W OP1   1 
ATOM   309  O OP2   . DC  A 1 16  ? 3.271   -18.603 -17.408 1.00 51.10 ? 16  DC  W OP2   1 
ATOM   310  O "O5'" . DC  A 1 16  ? 2.839   -17.274 -19.557 1.00 52.06 ? 16  DC  W "O5'" 1 
ATOM   311  C "C5'" . DC  A 1 16  ? 2.660   -17.900 -20.831 1.00 52.31 ? 16  DC  W "C5'" 1 
ATOM   312  C "C4'" . DC  A 1 16  ? 3.827   -17.610 -21.754 1.00 50.64 ? 16  DC  W "C4'" 1 
ATOM   313  O "O4'" . DC  A 1 16  ? 4.676   -16.619 -21.159 1.00 51.02 ? 16  DC  W "O4'" 1 
ATOM   314  C "C3'" . DC  A 1 16  ? 4.785   -18.769 -21.965 1.00 51.22 ? 16  DC  W "C3'" 1 
ATOM   315  O "O3'" . DC  A 1 16  ? 4.268   -19.653 -22.917 1.00 49.36 ? 16  DC  W "O3'" 1 
ATOM   316  C "C2'" . DC  A 1 16  ? 5.993   -18.015 -22.510 1.00 50.02 ? 16  DC  W "C2'" 1 
ATOM   317  C "C1'" . DC  A 1 16  ? 6.038   -16.888 -21.514 1.00 50.00 ? 16  DC  W "C1'" 1 
ATOM   318  N N1    . DC  A 1 16  ? 6.909   -17.076 -20.293 1.00 50.22 ? 16  DC  W N1    1 
ATOM   319  C C2    . DC  A 1 16  ? 8.318   -17.048 -20.380 1.00 51.22 ? 16  DC  W C2    1 
ATOM   320  O O2    . DC  A 1 16  ? 8.857   -16.900 -21.486 1.00 50.92 ? 16  DC  W O2    1 
ATOM   321  N N3    . DC  A 1 16  ? 9.062   -17.208 -19.238 1.00 49.66 ? 16  DC  W N3    1 
ATOM   322  C C4    . DC  A 1 16  ? 8.449   -17.342 -18.057 1.00 49.62 ? 16  DC  W C4    1 
ATOM   323  N N4    . DC  A 1 16  ? 9.198   -17.506 -16.968 1.00 50.12 ? 16  DC  W N4    1 
ATOM   324  C C5    . DC  A 1 16  ? 7.028   -17.367 -17.926 1.00 48.96 ? 16  DC  W C5    1 
ATOM   325  C C6    . DC  A 1 16  ? 6.322   -17.238 -19.060 1.00 50.03 ? 16  DC  W C6    1 
ATOM   326  P P     . DC  A 1 17  ? 4.260   -21.197 -22.616 1.00 52.15 ? 17  DC  W P     1 
ATOM   327  O OP1   . DC  A 1 17  ? 3.157   -21.872 -23.342 1.00 54.53 ? 17  DC  W OP1   1 
ATOM   328  O OP2   . DC  A 1 17  ? 4.375   -21.374 -21.162 1.00 53.78 ? 17  DC  W OP2   1 
ATOM   329  O "O5'" . DC  A 1 17  ? 5.609   -21.705 -23.303 1.00 52.90 ? 17  DC  W "O5'" 1 
ATOM   330  C "C5'" . DC  A 1 17  ? 6.157   -21.004 -24.426 1.00 52.18 ? 17  DC  W "C5'" 1 
ATOM   331  C "C4'" . DC  A 1 17  ? 7.656   -21.194 -24.464 1.00 52.80 ? 17  DC  W "C4'" 1 
ATOM   332  O "O4'" . DC  A 1 17  ? 8.230   -20.272 -23.506 1.00 52.64 ? 17  DC  W "O4'" 1 
ATOM   333  C "C3'" . DC  A 1 17  ? 8.121   -22.599 -24.077 1.00 53.63 ? 17  DC  W "C3'" 1 
ATOM   334  O "O3'" . DC  A 1 17  ? 8.322   -23.400 -25.244 1.00 54.00 ? 17  DC  W "O3'" 1 
ATOM   335  C "C2'" . DC  A 1 17  ? 9.407   -22.346 -23.305 1.00 53.70 ? 17  DC  W "C2'" 1 
ATOM   336  C "C1'" . DC  A 1 17  ? 9.315   -20.889 -22.855 1.00 53.61 ? 17  DC  W "C1'" 1 
ATOM   337  N N1    . DC  A 1 17  ? 9.219   -20.786 -21.376 1.00 53.23 ? 17  DC  W N1    1 
ATOM   338  C C2    . DC  A 1 17  ? 10.426  -20.666 -20.673 1.00 53.14 ? 17  DC  W C2    1 
ATOM   339  O O2    . DC  A 1 17  ? 11.481  -20.624 -21.309 1.00 51.50 ? 17  DC  W O2    1 
ATOM   340  N N3    . DC  A 1 17  ? 10.393  -20.594 -19.312 1.00 54.36 ? 17  DC  W N3    1 
ATOM   341  C C4    . DC  A 1 17  ? 9.215   -20.619 -18.659 1.00 54.99 ? 17  DC  W C4    1 
ATOM   342  N N4    . DC  A 1 17  ? 9.248   -20.535 -17.319 1.00 54.19 ? 17  DC  W N4    1 
ATOM   343  C C5    . DC  A 1 17  ? 7.968   -20.767 -19.360 1.00 53.78 ? 17  DC  W C5    1 
ATOM   344  C C6    . DC  A 1 17  ? 8.028   -20.849 -20.705 1.00 53.37 ? 17  DC  W C6    1 
ATOM   345  P P     . DT  A 1 18  ? 8.996   -24.832 -25.201 1.00 55.79 ? 18  DT  W P     1 
ATOM   346  O OP1   . DT  A 1 18  ? 8.973   -25.396 -26.547 1.00 57.91 ? 18  DT  W OP1   1 
ATOM   347  O OP2   . DT  A 1 18  ? 8.484   -25.619 -24.065 1.00 56.00 ? 18  DT  W OP2   1 
ATOM   348  O "O5'" . DT  A 1 18  ? 10.509  -24.455 -24.879 1.00 57.84 ? 18  DT  W "O5'" 1 
ATOM   349  C "C5'" . DT  A 1 18  ? 11.453  -23.986 -25.842 1.00 56.56 ? 18  DT  W "C5'" 1 
ATOM   350  C "C4'" . DT  A 1 18  ? 12.844  -24.207 -25.257 1.00 55.86 ? 18  DT  W "C4'" 1 
ATOM   351  O "O4'" . DT  A 1 18  ? 12.889  -23.645 -23.911 1.00 52.79 ? 18  DT  W "O4'" 1 
ATOM   352  C "C3'" . DT  A 1 18  ? 13.312  -25.669 -25.147 1.00 54.62 ? 18  DT  W "C3'" 1 
ATOM   353  O "O3'" . DT  A 1 18  ? 14.701  -25.684 -25.498 1.00 57.24 ? 18  DT  W "O3'" 1 
ATOM   354  C "C2'" . DT  A 1 18  ? 13.091  -25.987 -23.669 1.00 53.69 ? 18  DT  W "C2'" 1 
ATOM   355  C "C1'" . DT  A 1 18  ? 13.354  -24.619 -23.009 1.00 52.13 ? 18  DT  W "C1'" 1 
ATOM   356  N N1    . DT  A 1 18  ? 12.697  -24.357 -21.691 1.00 52.79 ? 18  DT  W N1    1 
ATOM   357  C C2    . DT  A 1 18  ? 13.443  -23.934 -20.595 1.00 52.73 ? 18  DT  W C2    1 
ATOM   358  O O2    . DT  A 1 18  ? 14.634  -23.738 -20.587 1.00 52.37 ? 18  DT  W O2    1 
ATOM   359  N N3    . DT  A 1 18  ? 12.728  -23.718 -19.450 1.00 52.51 ? 18  DT  W N3    1 
ATOM   360  C C4    . DT  A 1 18  ? 11.376  -23.880 -19.292 1.00 52.31 ? 18  DT  W C4    1 
ATOM   361  O O4    . DT  A 1 18  ? 10.853  -23.670 -18.221 1.00 53.65 ? 18  DT  W O4    1 
ATOM   362  C C5    . DT  A 1 18  ? 10.638  -24.315 -20.441 1.00 51.73 ? 18  DT  W C5    1 
ATOM   363  C C7    . DT  A 1 18  ? 9.187   -24.642 -20.316 1.00 50.84 ? 18  DT  W C7    1 
ATOM   364  C C6    . DT  A 1 18  ? 11.322  -24.519 -21.570 1.00 52.72 ? 18  DT  W C6    1 
ATOM   365  P P     . DC  A 1 19  ? 15.621  -27.002 -25.596 1.00 57.59 ? 19  DC  W P     1 
ATOM   366  O OP1   . DC  A 1 19  ? 16.528  -26.698 -26.725 1.00 60.14 ? 19  DC  W OP1   1 
ATOM   367  O OP2   . DC  A 1 19  ? 14.802  -28.225 -25.579 1.00 57.06 ? 19  DC  W OP2   1 
ATOM   368  O "O5'" . DC  A 1 19  ? 16.504  -27.010 -24.280 1.00 57.47 ? 19  DC  W "O5'" 1 
ATOM   369  C "C5'" . DC  A 1 19  ? 17.335  -25.894 -23.950 1.00 57.35 ? 19  DC  W "C5'" 1 
ATOM   370  C "C4'" . DC  A 1 19  ? 18.068  -26.161 -22.646 1.00 56.13 ? 19  DC  W "C4'" 1 
ATOM   371  O "O4'" . DC  A 1 19  ? 17.142  -25.892 -21.557 1.00 55.97 ? 19  DC  W "O4'" 1 
ATOM   372  C "C3'" . DC  A 1 19  ? 18.538  -27.590 -22.444 1.00 56.80 ? 19  DC  W "C3'" 1 
ATOM   373  O "O3'" . DC  A 1 19  ? 19.801  -27.576 -21.822 1.00 58.87 ? 19  DC  W "O3'" 1 
ATOM   374  C "C2'" . DC  A 1 19  ? 17.459  -28.213 -21.543 1.00 56.17 ? 19  DC  W "C2'" 1 
ATOM   375  C "C1'" . DC  A 1 19  ? 17.059  -27.002 -20.689 1.00 55.10 ? 19  DC  W "C1'" 1 
ATOM   376  N N1    . DC  A 1 19  ? 15.693  -27.022 -20.060 1.00 55.29 ? 19  DC  W N1    1 
ATOM   377  C C2    . DC  A 1 19  ? 15.558  -26.674 -18.697 1.00 55.16 ? 19  DC  W C2    1 
ATOM   378  O O2    . DC  A 1 19  ? 16.581  -26.368 -18.053 1.00 54.91 ? 19  DC  W O2    1 
ATOM   379  N N3    . DC  A 1 19  ? 14.314  -26.697 -18.123 1.00 53.86 ? 19  DC  W N3    1 
ATOM   380  C C4    . DC  A 1 19  ? 13.235  -27.048 -18.838 1.00 56.05 ? 19  DC  W C4    1 
ATOM   381  N N4    . DC  A 1 19  ? 12.036  -27.052 -18.233 1.00 54.17 ? 19  DC  W N4    1 
ATOM   382  C C5    . DC  A 1 19  ? 13.350  -27.406 -20.229 1.00 56.33 ? 19  DC  W C5    1 
ATOM   383  C C6    . DC  A 1 19  ? 14.576  -27.370 -20.789 1.00 56.02 ? 19  DC  W C6    1 
ATOM   384  P P     . DT  A 1 20  ? 20.815  -28.823 -22.008 1.00 63.62 ? 20  DT  W P     1 
ATOM   385  O OP1   . DT  A 1 20  ? 21.866  -28.241 -22.859 1.00 65.35 ? 20  DT  W OP1   1 
ATOM   386  O OP2   . DT  A 1 20  ? 20.129  -30.076 -22.410 1.00 60.48 ? 20  DT  W OP2   1 
ATOM   387  O "O5'" . DT  A 1 20  ? 21.421  -29.097 -20.540 1.00 64.14 ? 20  DT  W "O5'" 1 
ATOM   388  C "C5'" . DT  A 1 20  ? 20.946  -28.383 -19.378 1.00 64.26 ? 20  DT  W "C5'" 1 
ATOM   389  C "C4'" . DT  A 1 20  ? 20.651  -29.292 -18.192 1.00 62.50 ? 20  DT  W "C4'" 1 
ATOM   390  O "O4'" . DT  A 1 20  ? 19.278  -29.157 -17.735 1.00 59.75 ? 20  DT  W "O4'" 1 
ATOM   391  C "C3'" . DT  A 1 20  ? 20.840  -30.774 -18.425 1.00 63.64 ? 20  DT  W "C3'" 1 
ATOM   392  O "O3'" . DT  A 1 20  ? 21.385  -31.259 -17.250 1.00 67.70 ? 20  DT  W "O3'" 1 
ATOM   393  C "C2'" . DT  A 1 20  ? 19.424  -31.308 -18.573 1.00 61.68 ? 20  DT  W "C2'" 1 
ATOM   394  C "C1'" . DT  A 1 20  ? 18.687  -30.409 -17.571 1.00 57.99 ? 20  DT  W "C1'" 1 
ATOM   395  N N1    . DT  A 1 20  ? 17.217  -30.352 -17.815 1.00 55.25 ? 20  DT  W N1    1 
ATOM   396  C C2    . DT  A 1 20  ? 16.321  -29.986 -16.821 1.00 54.20 ? 20  DT  W C2    1 
ATOM   397  O O2    . DT  A 1 20  ? 16.663  -29.653 -15.701 1.00 53.37 ? 20  DT  W O2    1 
ATOM   398  N N3    . DT  A 1 20  ? 14.995  -30.008 -17.205 1.00 53.65 ? 20  DT  W N3    1 
ATOM   399  C C4    . DT  A 1 20  ? 14.515  -30.373 -18.471 1.00 55.92 ? 20  DT  W C4    1 
ATOM   400  O O4    . DT  A 1 20  ? 13.301  -30.376 -18.730 1.00 55.25 ? 20  DT  W O4    1 
ATOM   401  C C5    . DT  A 1 20  ? 15.543  -30.759 -19.446 1.00 54.15 ? 20  DT  W C5    1 
ATOM   402  C C7    . DT  A 1 20  ? 15.285  -30.978 -20.908 1.00 54.45 ? 20  DT  W C7    1 
ATOM   403  C C6    . DT  A 1 20  ? 16.803  -30.727 -19.064 1.00 53.43 ? 20  DT  W C6    1 
ATOM   404  P P     . DG  A 1 21  ? 22.313  -32.549 -17.335 1.00 74.44 ? 21  DG  W P     1 
ATOM   405  O OP1   . DG  A 1 21  ? 23.700  -32.023 -17.190 1.00 74.16 ? 21  DG  W OP1   1 
ATOM   406  O OP2   . DG  A 1 21  ? 21.914  -33.408 -18.498 1.00 73.00 ? 21  DG  W OP2   1 
ATOM   407  O "O5'" . DG  A 1 21  ? 21.871  -33.406 -16.044 1.00 73.46 ? 21  DG  W "O5'" 1 
ATOM   408  C "C5'" . DG  A 1 21  ? 22.076  -32.992 -14.673 1.00 71.46 ? 21  DG  W "C5'" 1 
ATOM   409  C "C4'" . DG  A 1 21  ? 21.003  -33.656 -13.814 1.00 68.62 ? 21  DG  W "C4'" 1 
ATOM   410  O "O4'" . DG  A 1 21  ? 19.751  -33.109 -14.313 1.00 65.61 ? 21  DG  W "O4'" 1 
ATOM   411  C "C3'" . DG  A 1 21  ? 20.941  -35.199 -13.900 1.00 67.84 ? 21  DG  W "C3'" 1 
ATOM   412  O "O3'" . DG  A 1 21  ? 20.548  -35.920 -12.694 1.00 68.56 ? 21  DG  W "O3'" 1 
ATOM   413  C "C2'" . DG  A 1 21  ? 19.865  -35.362 -14.952 1.00 66.09 ? 21  DG  W "C2'" 1 
ATOM   414  C "C1'" . DG  A 1 21  ? 18.936  -34.210 -14.546 1.00 61.32 ? 21  DG  W "C1'" 1 
ATOM   415  N N9    . DG  A 1 21  ? 17.956  -34.009 -15.587 1.00 60.45 ? 21  DG  W N9    1 
ATOM   416  C C8    . DG  A 1 21  ? 18.141  -34.205 -16.937 1.00 59.32 ? 21  DG  W C8    1 
ATOM   417  N N7    . DG  A 1 21  ? 17.067  -34.020 -17.635 1.00 58.94 ? 21  DG  W N7    1 
ATOM   418  C C5    . DG  A 1 21  ? 16.113  -33.716 -16.664 1.00 58.63 ? 21  DG  W C5    1 
ATOM   419  C C6    . DG  A 1 21  ? 14.762  -33.423 -16.826 1.00 57.64 ? 21  DG  W C6    1 
ATOM   420  O O6    . DG  A 1 21  ? 14.141  -33.375 -17.886 1.00 58.82 ? 21  DG  W O6    1 
ATOM   421  N N1    . DG  A 1 21  ? 14.154  -33.167 -15.611 1.00 58.58 ? 21  DG  W N1    1 
ATOM   422  C C2    . DG  A 1 21  ? 14.775  -33.200 -14.383 1.00 59.07 ? 21  DG  W C2    1 
ATOM   423  N N2    . DG  A 1 21  ? 14.006  -32.919 -13.314 1.00 59.51 ? 21  DG  W N2    1 
ATOM   424  N N3    . DG  A 1 21  ? 16.056  -33.465 -14.210 1.00 57.91 ? 21  DG  W N3    1 
ATOM   425  C C4    . DG  A 1 21  ? 16.642  -33.709 -15.397 1.00 58.93 ? 21  DG  W C4    1 
ATOM   426  O "O5'" . DT  B 2 1   ? 3.653   -36.458 -20.081 1.00 74.85 ? 23  DT  C "O5'" 1 
ATOM   427  C "C5'" . DT  B 2 1   ? 4.615   -35.587 -19.479 1.00 77.02 ? 23  DT  C "C5'" 1 
ATOM   428  C "C4'" . DT  B 2 1   ? 4.685   -35.891 -17.989 1.00 76.38 ? 23  DT  C "C4'" 1 
ATOM   429  O "O4'" . DT  B 2 1   ? 5.927   -36.539 -17.610 1.00 74.04 ? 23  DT  C "O4'" 1 
ATOM   430  C "C3'" . DT  B 2 1   ? 4.643   -34.681 -17.081 1.00 77.55 ? 23  DT  C "C3'" 1 
ATOM   431  O "O3'" . DT  B 2 1   ? 4.091   -35.152 -15.827 1.00 81.28 ? 23  DT  C "O3'" 1 
ATOM   432  C "C2'" . DT  B 2 1   ? 6.129   -34.324 -17.023 1.00 74.12 ? 23  DT  C "C2'" 1 
ATOM   433  C "C1'" . DT  B 2 1   ? 6.746   -35.703 -16.819 1.00 68.84 ? 23  DT  C "C1'" 1 
ATOM   434  N N1    . DT  B 2 1   ? 8.157   -35.793 -17.295 1.00 66.64 ? 23  DT  C N1    1 
ATOM   435  C C2    . DT  B 2 1   ? 9.218   -36.187 -16.455 1.00 65.81 ? 23  DT  C C2    1 
ATOM   436  O O2    . DT  B 2 1   ? 9.144   -36.517 -15.274 1.00 64.61 ? 23  DT  C O2    1 
ATOM   437  N N3    . DT  B 2 1   ? 10.445  -36.205 -17.071 1.00 65.73 ? 23  DT  C N3    1 
ATOM   438  C C4    . DT  B 2 1   ? 10.722  -35.860 -18.396 1.00 66.58 ? 23  DT  C C4    1 
ATOM   439  O O4    . DT  B 2 1   ? 11.865  -35.890 -18.849 1.00 66.91 ? 23  DT  C O4    1 
ATOM   440  C C5    . DT  B 2 1   ? 9.593   -35.454 -19.213 1.00 65.58 ? 23  DT  C C5    1 
ATOM   441  C C7    . DT  B 2 1   ? 9.807   -35.046 -20.653 1.00 64.50 ? 23  DT  C C7    1 
ATOM   442  C C6    . DT  B 2 1   ? 8.381   -35.449 -18.629 1.00 65.52 ? 23  DT  C C6    1 
ATOM   443  P P     . DC  B 2 2   ? 4.035   -34.259 -14.475 1.00 84.95 ? 24  DC  C P     1 
ATOM   444  O OP1   . DC  B 2 2   ? 2.729   -34.607 -13.809 1.00 82.90 ? 24  DC  C OP1   1 
ATOM   445  O OP2   . DC  B 2 2   ? 4.457   -32.826 -14.786 1.00 81.54 ? 24  DC  C OP2   1 
ATOM   446  O "O5'" . DC  B 2 2   ? 5.236   -34.925 -13.621 1.00 78.89 ? 24  DC  C "O5'" 1 
ATOM   447  C "C5'" . DC  B 2 2   ? 6.467   -34.223 -13.634 1.00 69.51 ? 24  DC  C "C5'" 1 
ATOM   448  C "C4'" . DC  B 2 2   ? 7.015   -33.923 -12.264 1.00 62.91 ? 24  DC  C "C4'" 1 
ATOM   449  O "O4'" . DC  B 2 2   ? 8.443   -33.978 -12.458 1.00 60.71 ? 24  DC  C "O4'" 1 
ATOM   450  C "C3'" . DC  B 2 2   ? 6.772   -32.514 -11.712 1.00 61.01 ? 24  DC  C "C3'" 1 
ATOM   451  O "O3'" . DC  B 2 2   ? 7.106   -32.522 -10.286 1.00 59.28 ? 24  DC  C "O3'" 1 
ATOM   452  C "C2'" . DC  B 2 2   ? 7.756   -31.682 -12.551 1.00 59.50 ? 24  DC  C "C2'" 1 
ATOM   453  C "C1'" . DC  B 2 2   ? 8.894   -32.696 -12.871 1.00 57.15 ? 24  DC  C "C1'" 1 
ATOM   454  N N1    . DC  B 2 2   ? 9.432   -32.723 -14.319 1.00 55.82 ? 24  DC  C N1    1 
ATOM   455  C C2    . DC  B 2 2   ? 10.782  -33.085 -14.469 1.00 55.25 ? 24  DC  C C2    1 
ATOM   456  O O2    . DC  B 2 2   ? 11.448  -33.387 -13.453 1.00 53.01 ? 24  DC  C O2    1 
ATOM   457  N N3    . DC  B 2 2   ? 11.321  -33.082 -15.727 1.00 54.27 ? 24  DC  C N3    1 
ATOM   458  C C4    . DC  B 2 2   ? 10.559  -32.741 -16.782 1.00 54.10 ? 24  DC  C C4    1 
ATOM   459  N N4    . DC  B 2 2   ? 11.185  -32.801 -17.956 1.00 55.20 ? 24  DC  C N4    1 
ATOM   460  C C5    . DC  B 2 2   ? 9.175   -32.346 -16.688 1.00 50.27 ? 24  DC  C C5    1 
ATOM   461  C C6    . DC  B 2 2   ? 8.678   -32.357 -15.440 1.00 53.62 ? 24  DC  C C6    1 
ATOM   462  P P     . DA  B 2 3   ? 6.798   -31.387 -9.176  1.00 56.43 ? 25  DA  C P     1 
ATOM   463  O OP1   . DA  B 2 3   ? 6.930   -32.112 -7.889  1.00 56.83 ? 25  DA  C OP1   1 
ATOM   464  O OP2   . DA  B 2 3   ? 5.543   -30.678 -9.488  1.00 56.89 ? 25  DA  C OP2   1 
ATOM   465  O "O5'" . DA  B 2 3   ? 8.017   -30.361 -9.303  1.00 53.49 ? 25  DA  C "O5'" 1 
ATOM   466  C "C5'" . DA  B 2 3   ? 9.235   -30.761 -8.669  1.00 51.55 ? 25  DA  C "C5'" 1 
ATOM   467  C "C4'" . DA  B 2 3   ? 10.393  -29.848 -8.991  1.00 48.68 ? 25  DA  C "C4'" 1 
ATOM   468  O "O4'" . DA  B 2 3   ? 10.735  -30.030 -10.361 1.00 47.31 ? 25  DA  C "O4'" 1 
ATOM   469  C "C3'" . DA  B 2 3   ? 10.105  -28.360 -8.840  1.00 49.91 ? 25  DA  C "C3'" 1 
ATOM   470  O "O3'" . DA  B 2 3   ? 11.216  -27.856 -8.166  1.00 48.11 ? 25  DA  C "O3'" 1 
ATOM   471  C "C2'" . DA  B 2 3   ? 9.967   -27.815 -10.267 1.00 48.03 ? 25  DA  C "C2'" 1 
ATOM   472  C "C1'" . DA  B 2 3   ? 10.883  -28.795 -10.976 1.00 48.01 ? 25  DA  C "C1'" 1 
ATOM   473  N N9    . DA  B 2 3   ? 10.648  -28.933 -12.390 1.00 46.96 ? 25  DA  C N9    1 
ATOM   474  C C8    . DA  B 2 3   ? 9.489   -28.761 -13.079 1.00 47.63 ? 25  DA  C C8    1 
ATOM   475  N N7    . DA  B 2 3   ? 9.606   -28.946 -14.367 1.00 46.27 ? 25  DA  C N7    1 
ATOM   476  C C5    . DA  B 2 3   ? 10.938  -29.237 -14.503 1.00 46.09 ? 25  DA  C C5    1 
ATOM   477  C C6    . DA  B 2 3   ? 11.689  -29.525 -15.639 1.00 48.71 ? 25  DA  C C6    1 
ATOM   478  N N6    . DA  B 2 3   ? 11.069  -29.537 -16.822 1.00 48.45 ? 25  DA  C N6    1 
ATOM   479  N N1    . DA  B 2 3   ? 13.028  -29.812 -15.499 1.00 49.72 ? 25  DA  C N1    1 
ATOM   480  C C2    . DA  B 2 3   ? 13.556  -29.772 -14.245 1.00 49.27 ? 25  DA  C C2    1 
ATOM   481  N N3    . DA  B 2 3   ? 12.910  -29.498 -13.088 1.00 47.99 ? 25  DA  C N3    1 
ATOM   482  C C4    . DA  B 2 3   ? 11.605  -29.240 -13.305 1.00 46.07 ? 25  DA  C C4    1 
ATOM   483  P P     . DG  B 2 4   ? 11.154  -26.600 -7.225  1.00 47.08 ? 26  DG  C P     1 
ATOM   484  O OP1   . DG  B 2 4   ? 11.202  -27.055 -5.832  1.00 48.02 ? 26  DG  C OP1   1 
ATOM   485  O OP2   . DG  B 2 4   ? 10.191  -25.570 -7.693  1.00 51.65 ? 26  DG  C OP2   1 
ATOM   486  O "O5'" . DG  B 2 4   ? 12.602  -26.011 -7.559  1.00 50.98 ? 26  DG  C "O5'" 1 
ATOM   487  C "C5'" . DG  B 2 4   ? 13.751  -26.872 -7.488  1.00 48.22 ? 26  DG  C "C5'" 1 
ATOM   488  C "C4'" . DG  B 2 4   ? 14.818  -26.284 -8.380  1.00 48.31 ? 26  DG  C "C4'" 1 
ATOM   489  O "O4'" . DG  B 2 4   ? 14.541  -26.556 -9.773  1.00 48.42 ? 26  DG  C "O4'" 1 
ATOM   490  C "C3'" . DG  B 2 4   ? 14.955  -24.789 -8.287  1.00 49.90 ? 26  DG  C "C3'" 1 
ATOM   491  O "O3'" . DG  B 2 4   ? 16.346  -24.524 -8.378  1.00 53.07 ? 26  DG  C "O3'" 1 
ATOM   492  C "C2'" . DG  B 2 4   ? 14.254  -24.287 -9.529  1.00 47.31 ? 26  DG  C "C2'" 1 
ATOM   493  C "C1'" . DG  B 2 4   ? 14.652  -25.355 -10.502 1.00 48.29 ? 26  DG  C "C1'" 1 
ATOM   494  N N9    . DG  B 2 4   ? 13.728  -25.526 -11.609 1.00 50.54 ? 26  DG  C N9    1 
ATOM   495  C C8    . DG  B 2 4   ? 12.335  -25.448 -11.650 1.00 49.08 ? 26  DG  C C8    1 
ATOM   496  N N7    . DG  B 2 4   ? 11.825  -25.692 -12.828 1.00 47.98 ? 26  DG  C N7    1 
ATOM   497  C C5    . DG  B 2 4   ? 12.941  -25.969 -13.599 1.00 49.81 ? 26  DG  C C5    1 
ATOM   498  C C6    . DG  B 2 4   ? 13.052  -26.292 -14.960 1.00 48.73 ? 26  DG  C C6    1 
ATOM   499  O O6    . DG  B 2 4   ? 12.153  -26.417 -15.773 1.00 48.89 ? 26  DG  C O6    1 
ATOM   500  N N1    . DG  B 2 4   ? 14.390  -26.479 -15.341 1.00 49.56 ? 26  DG  C N1    1 
ATOM   501  C C2    . DG  B 2 4   ? 15.504  -26.352 -14.525 1.00 47.99 ? 26  DG  C C2    1 
ATOM   502  N N2    . DG  B 2 4   ? 16.704  -26.523 -15.094 1.00 48.23 ? 26  DG  C N2    1 
ATOM   503  N N3    . DG  B 2 4   ? 15.420  -26.052 -13.236 1.00 48.59 ? 26  DG  C N3    1 
ATOM   504  C C4    . DG  B 2 4   ? 14.122  -25.878 -12.863 1.00 50.21 ? 26  DG  C C4    1 
ATOM   505  P P     . DA  B 2 5   ? 16.883  -23.042 -8.187  1.00 50.95 ? 27  DA  C P     1 
ATOM   506  O OP1   . DA  B 2 5   ? 17.831  -23.229 -7.060  1.00 53.04 ? 27  DA  C OP1   1 
ATOM   507  O OP2   . DA  B 2 5   ? 15.760  -22.111 -8.075  1.00 51.99 ? 27  DA  C OP2   1 
ATOM   508  O "O5'" . DA  B 2 5   ? 17.593  -22.702 -9.576  1.00 50.24 ? 27  DA  C "O5'" 1 
ATOM   509  C "C5'" . DA  B 2 5   ? 18.546  -23.605 -10.153 1.00 48.77 ? 27  DA  C "C5'" 1 
ATOM   510  C "C4'" . DA  B 2 5   ? 19.061  -23.049 -11.483 1.00 47.98 ? 27  DA  C "C4'" 1 
ATOM   511  O "O4'" . DA  B 2 5   ? 18.146  -23.437 -12.533 1.00 47.88 ? 27  DA  C "O4'" 1 
ATOM   512  C "C3'" . DA  B 2 5   ? 19.203  -21.537 -11.585 1.00 47.75 ? 27  DA  C "C3'" 1 
ATOM   513  O "O3'" . DA  B 2 5   ? 20.444  -21.218 -12.252 1.00 50.18 ? 27  DA  C "O3'" 1 
ATOM   514  C "C2'" . DA  B 2 5   ? 17.992  -21.089 -12.382 1.00 45.76 ? 27  DA  C "C2'" 1 
ATOM   515  C "C1'" . DA  B 2 5   ? 17.682  -22.308 -13.242 1.00 45.94 ? 27  DA  C "C1'" 1 
ATOM   516  N N9    . DA  B 2 5   ? 16.259  -22.480 -13.589 1.00 45.14 ? 27  DA  C N9    1 
ATOM   517  C C8    . DA  B 2 5   ? 15.196  -22.376 -12.749 1.00 44.64 ? 27  DA  C C8    1 
ATOM   518  N N7    . DA  B 2 5   ? 14.045  -22.593 -13.359 1.00 45.38 ? 27  DA  C N7    1 
ATOM   519  C C5    . DA  B 2 5   ? 14.377  -22.842 -14.674 1.00 42.91 ? 27  DA  C C5    1 
ATOM   520  C C6    . DA  B 2 5   ? 13.606  -23.108 -15.818 1.00 45.55 ? 27  DA  C C6    1 
ATOM   521  N N6    . DA  B 2 5   ? 12.258  -23.213 -15.820 1.00 46.66 ? 27  DA  C N6    1 
ATOM   522  N N1    . DA  B 2 5   ? 14.255  -23.290 -16.979 1.00 45.01 ? 27  DA  C N1    1 
ATOM   523  C C2    . DA  B 2 5   ? 15.586  -23.229 -17.002 1.00 43.91 ? 27  DA  C C2    1 
ATOM   524  N N3    . DA  B 2 5   ? 16.387  -22.962 -15.992 1.00 44.49 ? 27  DA  C N3    1 
ATOM   525  C C4    . DA  B 2 5   ? 15.727  -22.770 -14.840 1.00 43.19 ? 27  DA  C C4    1 
ATOM   526  P P     . DG  B 2 6   ? 21.039  -19.745 -12.421 1.00 48.62 ? 28  DG  C P     1 
ATOM   527  O OP1   . DG  B 2 6   ? 22.496  -19.996 -12.544 1.00 54.30 ? 28  DG  C OP1   1 
ATOM   528  O OP2   . DG  B 2 6   ? 20.573  -18.769 -11.422 1.00 49.12 ? 28  DG  C OP2   1 
ATOM   529  O "O5'" . DG  B 2 6   ? 20.472  -19.177 -13.801 1.00 49.35 ? 28  DG  C "O5'" 1 
ATOM   530  C "C5'" . DG  B 2 6   ? 20.629  -19.972 -14.984 1.00 49.40 ? 28  DG  C "C5'" 1 
ATOM   531  C "C4'" . DG  B 2 6   ? 19.647  -19.529 -16.052 1.00 49.08 ? 28  DG  C "C4'" 1 
ATOM   532  O "O4'" . DG  B 2 6   ? 18.348  -19.943 -15.626 1.00 49.82 ? 28  DG  C "O4'" 1 
ATOM   533  C "C3'" . DG  B 2 6   ? 19.465  -18.042 -16.281 1.00 51.27 ? 28  DG  C "C3'" 1 
ATOM   534  O "O3'" . DG  B 2 6   ? 19.752  -17.814 -17.646 1.00 55.19 ? 28  DG  C "O3'" 1 
ATOM   535  C "C2'" . DG  B 2 6   ? 17.976  -17.790 -16.045 1.00 48.55 ? 28  DG  C "C2'" 1 
ATOM   536  C "C1'" . DG  B 2 6   ? 17.461  -19.177 -16.357 1.00 49.22 ? 28  DG  C "C1'" 1 
ATOM   537  N N9    . DG  B 2 6   ? 16.096  -19.325 -15.894 1.00 49.57 ? 28  DG  C N9    1 
ATOM   538  C C8    . DG  B 2 6   ? 15.583  -19.119 -14.633 1.00 49.30 ? 28  DG  C C8    1 
ATOM   539  N N7    . DG  B 2 6   ? 14.300  -19.289 -14.574 1.00 48.91 ? 28  DG  C N7    1 
ATOM   540  C C5    . DG  B 2 6   ? 13.948  -19.623 -15.881 1.00 49.00 ? 28  DG  C C5    1 
ATOM   541  C C6    . DG  B 2 6   ? 12.687  -19.920 -16.464 1.00 50.03 ? 28  DG  C C6    1 
ATOM   542  O O6    . DG  B 2 6   ? 11.586  -19.931 -15.904 1.00 50.12 ? 28  DG  C O6    1 
ATOM   543  N N1    . DG  B 2 6   ? 12.788  -20.197 -17.837 1.00 49.76 ? 28  DG  C N1    1 
ATOM   544  C C2    . DG  B 2 6   ? 13.963  -20.202 -18.552 1.00 48.82 ? 28  DG  C C2    1 
ATOM   545  N N2    . DG  B 2 6   ? 13.918  -20.493 -19.850 1.00 48.94 ? 28  DG  C N2    1 
ATOM   546  N N3    . DG  B 2 6   ? 15.138  -19.931 -18.014 1.00 50.41 ? 28  DG  C N3    1 
ATOM   547  C C4    . DG  B 2 6   ? 15.048  -19.640 -16.695 1.00 48.93 ? 28  DG  C C4    1 
ATOM   548  P P     . DG  B 2 7   ? 20.488  -16.502 -18.150 1.00 53.70 ? 29  DG  C P     1 
ATOM   549  O OP1   . DG  B 2 7   ? 21.872  -16.993 -17.965 1.00 59.92 ? 29  DG  C OP1   1 
ATOM   550  O OP2   . DG  B 2 7   ? 19.996  -15.322 -17.444 1.00 55.28 ? 29  DG  C OP2   1 
ATOM   551  O "O5'" . DG  B 2 7   ? 20.180  -16.383 -19.720 1.00 54.04 ? 29  DG  C "O5'" 1 
ATOM   552  C "C5'" . DG  B 2 7   ? 20.169  -17.551 -20.591 1.00 54.37 ? 29  DG  C "C5'" 1 
ATOM   553  C "C4'" . DG  B 2 7   ? 19.130  -17.506 -21.727 1.00 54.22 ? 29  DG  C "C4'" 1 
ATOM   554  O "O4'" . DG  B 2 7   ? 17.796  -17.871 -21.273 1.00 51.49 ? 29  DG  C "O4'" 1 
ATOM   555  C "C3'" . DG  B 2 7   ? 18.941  -16.138 -22.361 1.00 56.43 ? 29  DG  C "C3'" 1 
ATOM   556  O "O3'" . DG  B 2 7   ? 18.811  -16.190 -23.806 1.00 58.05 ? 29  DG  C "O3'" 1 
ATOM   557  C "C2'" . DG  B 2 7   ? 17.715  -15.613 -21.611 1.00 53.17 ? 29  DG  C "C2'" 1 
ATOM   558  C "C1'" . DG  B 2 7   ? 16.863  -16.868 -21.499 1.00 50.28 ? 29  DG  C "C1'" 1 
ATOM   559  N N9    . DG  B 2 7   ? 15.905  -16.829 -20.387 1.00 51.66 ? 29  DG  C N9    1 
ATOM   560  C C8    . DG  B 2 7   ? 16.208  -16.571 -19.061 1.00 52.14 ? 29  DG  C C8    1 
ATOM   561  N N7    . DG  B 2 7   ? 15.203  -16.544 -18.247 1.00 51.05 ? 29  DG  C N7    1 
ATOM   562  C C5    . DG  B 2 7   ? 14.122  -16.808 -19.078 1.00 51.31 ? 29  DG  C C5    1 
ATOM   563  C C6    . DG  B 2 7   ? 12.744  -16.923 -18.729 1.00 50.29 ? 29  DG  C C6    1 
ATOM   564  O O6    . DG  B 2 7   ? 12.229  -16.790 -17.612 1.00 50.14 ? 29  DG  C O6    1 
ATOM   565  N N1    . DG  B 2 7   ? 11.946  -17.186 -19.843 1.00 50.25 ? 29  DG  C N1    1 
ATOM   566  C C2    . DG  B 2 7   ? 12.440  -17.317 -21.136 1.00 50.76 ? 29  DG  C C2    1 
ATOM   567  N N2    . DG  B 2 7   ? 11.508  -17.568 -22.053 1.00 50.90 ? 29  DG  C N2    1 
ATOM   568  N N3    . DG  B 2 7   ? 13.727  -17.232 -21.496 1.00 49.38 ? 29  DG  C N3    1 
ATOM   569  C C4    . DG  B 2 7   ? 14.523  -16.981 -20.408 1.00 51.53 ? 29  DG  C C4    1 
ATOM   570  P P     . DC  B 2 8   ? 18.947  -14.801 -24.602 1.00 63.09 ? 30  DC  C P     1 
ATOM   571  O OP1   . DC  B 2 8   ? 19.339  -15.129 -25.996 1.00 61.76 ? 30  DC  C OP1   1 
ATOM   572  O OP2   . DC  B 2 8   ? 19.705  -13.792 -23.802 1.00 63.27 ? 30  DC  C OP2   1 
ATOM   573  O "O5'" . DC  B 2 8   ? 17.427  -14.270 -24.582 1.00 62.35 ? 30  DC  C "O5'" 1 
ATOM   574  C "C5'" . DC  B 2 8   ? 16.418  -15.184 -25.080 1.00 60.93 ? 30  DC  C "C5'" 1 
ATOM   575  C "C4'" . DC  B 2 8   ? 15.021  -14.627 -24.944 1.00 58.58 ? 30  DC  C "C4'" 1 
ATOM   576  O "O4'" . DC  B 2 8   ? 14.588  -14.781 -23.577 1.00 57.78 ? 30  DC  C "O4'" 1 
ATOM   577  C "C3'" . DC  B 2 8   ? 14.936  -13.147 -25.239 1.00 59.11 ? 30  DC  C "C3'" 1 
ATOM   578  O "O3'" . DC  B 2 8   ? 13.894  -12.969 -26.144 1.00 61.54 ? 30  DC  C "O3'" 1 
ATOM   579  C "C2'" . DC  B 2 8   ? 14.607  -12.532 -23.885 1.00 58.44 ? 30  DC  C "C2'" 1 
ATOM   580  C "C1'" . DC  B 2 8   ? 13.788  -13.678 -23.303 1.00 56.91 ? 30  DC  C "C1'" 1 
ATOM   581  N N1    . DC  B 2 8   ? 13.521  -13.606 -21.857 1.00 56.83 ? 30  DC  C N1    1 
ATOM   582  C C2    . DC  B 2 8   ? 12.224  -13.849 -21.394 1.00 57.02 ? 30  DC  C C2    1 
ATOM   583  O O2    . DC  B 2 8   ? 11.337  -14.142 -22.229 1.00 56.68 ? 30  DC  C O2    1 
ATOM   584  N N3    . DC  B 2 8   ? 12.005  -13.778 -20.043 1.00 54.56 ? 30  DC  C N3    1 
ATOM   585  C C4    . DC  B 2 8   ? 13.003  -13.474 -19.219 1.00 54.36 ? 30  DC  C C4    1 
ATOM   586  N N4    . DC  B 2 8   ? 12.762  -13.388 -17.925 1.00 55.47 ? 30  DC  C N4    1 
ATOM   587  C C5    . DC  B 2 8   ? 14.323  -13.211 -19.673 1.00 56.74 ? 30  DC  C C5    1 
ATOM   588  C C6    . DC  B 2 8   ? 14.537  -13.295 -20.992 1.00 57.71 ? 30  DC  C C6    1 
ATOM   589  P P     . DC  B 2 9   ? 13.712  -11.575 -26.920 1.00 66.60 ? 31  DC  C P     1 
ATOM   590  O OP1   . DC  B 2 9   ? 14.036  -12.079 -28.297 1.00 65.31 ? 31  DC  C OP1   1 
ATOM   591  O OP2   . DC  B 2 9   ? 14.379  -10.388 -26.294 1.00 60.77 ? 31  DC  C OP2   1 
ATOM   592  O "O5'" . DC  B 2 9   ? 12.148  -11.207 -26.747 1.00 64.37 ? 31  DC  C "O5'" 1 
ATOM   593  C "C5'" . DC  B 2 9   ? 11.135  -12.151 -26.318 1.00 63.14 ? 31  DC  C "C5'" 1 
ATOM   594  C "C4'" . DC  B 2 9   ? 9.996   -11.374 -25.679 1.00 62.11 ? 31  DC  C "C4'" 1 
ATOM   595  O "O4'" . DC  B 2 9   ? 10.036  -11.456 -24.228 1.00 59.72 ? 31  DC  C "O4'" 1 
ATOM   596  C "C3'" . DC  B 2 9   ? 10.040  -9.901  -26.037 1.00 62.47 ? 31  DC  C "C3'" 1 
ATOM   597  O "O3'" . DC  B 2 9   ? 8.785   -9.575  -26.631 1.00 66.36 ? 31  DC  C "O3'" 1 
ATOM   598  C "C2'" . DC  B 2 9   ? 10.334  -9.176  -24.718 1.00 61.82 ? 31  DC  C "C2'" 1 
ATOM   599  C "C1'" . DC  B 2 9   ? 9.886   -10.175 -23.650 1.00 59.33 ? 31  DC  C "C1'" 1 
ATOM   600  N N1    . DC  B 2 9   ? 10.600  -10.200 -22.290 1.00 57.04 ? 31  DC  C N1    1 
ATOM   601  C C2    . DC  B 2 9   ? 9.801   -10.348 -21.137 1.00 55.50 ? 31  DC  C C2    1 
ATOM   602  O O2    . DC  B 2 9   ? 8.574   -10.437 -21.246 1.00 55.50 ? 31  DC  C O2    1 
ATOM   603  N N3    . DC  B 2 9   ? 10.380  -10.394 -19.914 1.00 53.82 ? 31  DC  C N3    1 
ATOM   604  C C4    . DC  B 2 9   ? 11.704  -10.289 -19.802 1.00 55.77 ? 31  DC  C C4    1 
ATOM   605  N N4    . DC  B 2 9   ? 12.194  -10.356 -18.556 1.00 56.41 ? 31  DC  C N4    1 
ATOM   606  C C5    . DC  B 2 9   ? 12.555  -10.119 -20.953 1.00 55.29 ? 31  DC  C C5    1 
ATOM   607  C C6    . DC  B 2 9   ? 11.967  -10.087 -22.171 1.00 55.86 ? 31  DC  C C6    1 
ATOM   608  P P     . DA  B 2 10  ? 8.481   -8.176  -27.389 1.00 68.50 ? 32  DA  C P     1 
ATOM   609  O OP1   . DA  B 2 10  ? 8.177   -8.570  -28.783 1.00 67.34 ? 32  DA  C OP1   1 
ATOM   610  O OP2   . DA  B 2 10  ? 9.460   -7.110  -27.022 1.00 66.44 ? 32  DA  C OP2   1 
ATOM   611  O "O5'" . DA  B 2 10  ? 7.107   -7.707  -26.712 1.00 69.46 ? 32  DA  C "O5'" 1 
ATOM   612  C "C5'" . DA  B 2 10  ? 6.320   -8.566  -25.869 1.00 69.78 ? 32  DA  C "C5'" 1 
ATOM   613  C "C4'" . DA  B 2 10  ? 5.567   -7.705  -24.871 1.00 69.06 ? 32  DA  C "C4'" 1 
ATOM   614  O "O4'" . DA  B 2 10  ? 6.257   -7.769  -23.609 1.00 69.23 ? 32  DA  C "O4'" 1 
ATOM   615  C "C3'" . DA  B 2 10  ? 5.514   -6.215  -25.193 1.00 71.43 ? 32  DA  C "C3'" 1 
ATOM   616  O "O3'" . DA  B 2 10  ? 4.332   -5.692  -24.628 1.00 73.07 ? 32  DA  C "O3'" 1 
ATOM   617  C "C2'" . DA  B 2 10  ? 6.738   -5.647  -24.468 1.00 70.21 ? 32  DA  C "C2'" 1 
ATOM   618  C "C1'" . DA  B 2 10  ? 6.655   -6.474  -23.195 1.00 67.23 ? 32  DA  C "C1'" 1 
ATOM   619  N N9    . DA  B 2 10  ? 7.923   -6.551  -22.493 1.00 67.00 ? 32  DA  C N9    1 
ATOM   620  C C8    . DA  B 2 10  ? 9.187   -6.455  -23.031 1.00 67.19 ? 32  DA  C C8    1 
ATOM   621  N N7    . DA  B 2 10  ? 10.162  -6.572  -22.154 1.00 66.56 ? 32  DA  C N7    1 
ATOM   622  C C5    . DA  B 2 10  ? 9.471   -6.742  -20.965 1.00 65.92 ? 32  DA  C C5    1 
ATOM   623  C C6    . DA  B 2 10  ? 9.933   -6.907  -19.657 1.00 66.01 ? 32  DA  C C6    1 
ATOM   624  N N6    . DA  B 2 10  ? 11.237  -6.923  -19.383 1.00 66.30 ? 32  DA  C N6    1 
ATOM   625  N N1    . DA  B 2 10  ? 9.010   -7.041  -18.675 1.00 66.68 ? 32  DA  C N1    1 
ATOM   626  C C2    . DA  B 2 10  ? 7.696   -7.030  -19.004 1.00 66.58 ? 32  DA  C C2    1 
ATOM   627  N N3    . DA  B 2 10  ? 7.138   -6.883  -20.209 1.00 65.13 ? 32  DA  C N3    1 
ATOM   628  C C4    . DA  B 2 10  ? 8.096   -6.741  -21.146 1.00 65.57 ? 32  DA  C C4    1 
ATOM   629  P P     . DG  B 2 11  ? 3.710   -4.292  -25.074 1.00 73.57 ? 33  DG  C P     1 
ATOM   630  O OP1   . DG  B 2 11  ? 2.819   -4.678  -26.193 1.00 73.48 ? 33  DG  C OP1   1 
ATOM   631  O OP2   . DG  B 2 11  ? 4.696   -3.183  -25.206 1.00 71.86 ? 33  DG  C OP2   1 
ATOM   632  O "O5'" . DG  B 2 11  ? 2.859   -3.946  -23.770 1.00 73.36 ? 33  DG  C "O5'" 1 
ATOM   633  C "C5'" . DG  B 2 11  ? 2.839   -4.882  -22.677 1.00 70.71 ? 33  DG  C "C5'" 1 
ATOM   634  C "C4'" . DG  B 2 11  ? 2.832   -4.125  -21.364 1.00 67.92 ? 33  DG  C "C4'" 1 
ATOM   635  O "O4'" . DG  B 2 11  ? 4.134   -4.248  -20.749 1.00 66.55 ? 33  DG  C "O4'" 1 
ATOM   636  C "C3'" . DG  B 2 11  ? 2.584   -2.629  -21.482 1.00 68.18 ? 33  DG  C "C3'" 1 
ATOM   637  O "O3'" . DG  B 2 11  ? 1.918   -2.191  -20.292 1.00 69.74 ? 33  DG  C "O3'" 1 
ATOM   638  C "C2'" . DG  B 2 11  ? 4.011   -2.111  -21.587 1.00 67.11 ? 33  DG  C "C2'" 1 
ATOM   639  C "C1'" . DG  B 2 11  ? 4.675   -2.977  -20.540 1.00 62.22 ? 33  DG  C "C1'" 1 
ATOM   640  N N9    . DG  B 2 11  ? 6.116   -3.085  -20.665 1.00 62.03 ? 33  DG  C N9    1 
ATOM   641  C C8    . DG  B 2 11  ? 6.909   -2.925  -21.793 1.00 62.07 ? 33  DG  C C8    1 
ATOM   642  N N7    . DG  B 2 11  ? 8.194   -3.094  -21.559 1.00 62.19 ? 33  DG  C N7    1 
ATOM   643  C C5    . DG  B 2 11  ? 8.238   -3.389  -20.204 1.00 60.34 ? 33  DG  C C5    1 
ATOM   644  C C6    . DG  B 2 11  ? 9.347   -3.665  -19.400 1.00 59.70 ? 33  DG  C C6    1 
ATOM   645  O O6    . DG  B 2 11  ? 10.516  -3.680  -19.750 1.00 58.90 ? 33  DG  C O6    1 
ATOM   646  N N1    . DG  B 2 11  ? 8.988   -3.896  -18.073 1.00 60.79 ? 33  DG  C N1    1 
ATOM   647  C C2    . DG  B 2 11  ? 7.679   -3.873  -17.609 1.00 61.57 ? 33  DG  C C2    1 
ATOM   648  N N2    . DG  B 2 11  ? 7.514   -4.128  -16.298 1.00 62.07 ? 33  DG  C N2    1 
ATOM   649  N N3    . DG  B 2 11  ? 6.605   -3.624  -18.354 1.00 58.53 ? 33  DG  C N3    1 
ATOM   650  C C4    . DG  B 2 11  ? 6.973   -3.386  -19.636 1.00 60.81 ? 33  DG  C C4    1 
ATOM   651  P P     . DA  B 2 12  ? 1.480   -0.678  -19.953 1.00 72.62 ? 34  DA  C P     1 
ATOM   652  O OP1   . DA  B 2 12  ? 0.005   -0.752  -19.839 1.00 72.41 ? 34  DA  C OP1   1 
ATOM   653  O OP2   . DA  B 2 12  ? 2.153   0.355   -20.813 1.00 69.40 ? 34  DA  C OP2   1 
ATOM   654  O "O5'" . DA  B 2 12  ? 2.102   -0.559  -18.471 1.00 70.26 ? 34  DA  C "O5'" 1 
ATOM   655  C "C5'" . DA  B 2 12  ? 2.328   -1.730  -17.647 1.00 65.34 ? 34  DA  C "C5'" 1 
ATOM   656  C "C4'" . DA  B 2 12  ? 3.028   -1.312  -16.362 1.00 62.21 ? 34  DA  C "C4'" 1 
ATOM   657  O "O4'" . DA  B 2 12  ? 4.467   -1.499  -16.483 1.00 61.36 ? 34  DA  C "O4'" 1 
ATOM   658  C "C3'" . DA  B 2 12  ? 2.859   0.147   -15.960 1.00 60.73 ? 34  DA  C "C3'" 1 
ATOM   659  O "O3'" . DA  B 2 12  ? 2.826   0.165   -14.516 1.00 61.44 ? 34  DA  C "O3'" 1 
ATOM   660  C "C2'" . DA  B 2 12  ? 4.107   0.788   -16.584 1.00 59.70 ? 34  DA  C "C2'" 1 
ATOM   661  C "C1'" . DA  B 2 12  ? 5.146   -0.278  -16.274 1.00 57.42 ? 34  DA  C "C1'" 1 
ATOM   662  N N9    . DA  B 2 12  ? 6.254   -0.242  -17.209 1.00 56.65 ? 34  DA  C N9    1 
ATOM   663  C C8    . DA  B 2 12  ? 6.123   0.002   -18.540 1.00 55.00 ? 34  DA  C C8    1 
ATOM   664  N N7    . DA  B 2 12  ? 7.262   -0.008  -19.190 1.00 55.73 ? 34  DA  C N7    1 
ATOM   665  C C5    . DA  B 2 12  ? 8.216   -0.266  -18.217 1.00 54.22 ? 34  DA  C C5    1 
ATOM   666  C C6    . DA  B 2 12  ? 9.607   -0.398  -18.302 1.00 53.99 ? 34  DA  C C6    1 
ATOM   667  N N6    . DA  B 2 12  ? 10.234  -0.265  -19.468 1.00 53.55 ? 34  DA  C N6    1 
ATOM   668  N N1    . DA  B 2 12  ? 10.302  -0.653  -17.145 1.00 55.89 ? 34  DA  C N1    1 
ATOM   669  C C2    . DA  B 2 12  ? 9.595   -0.777  -15.989 1.00 56.06 ? 34  DA  C C2    1 
ATOM   670  N N3    . DA  B 2 12  ? 8.257   -0.692  -15.805 1.00 54.97 ? 34  DA  C N3    1 
ATOM   671  C C4    . DA  B 2 12  ? 7.618   -0.419  -16.969 1.00 56.12 ? 34  DA  C C4    1 
ATOM   672  P P     . DA  B 2 13  ? 2.647   1.449   -13.556 1.00 63.33 ? 35  DA  C P     1 
ATOM   673  O OP1   . DA  B 2 13  ? 1.943   0.950   -12.359 1.00 64.59 ? 35  DA  C OP1   1 
ATOM   674  O OP2   . DA  B 2 13  ? 2.171   2.640   -14.305 1.00 60.74 ? 35  DA  C OP2   1 
ATOM   675  O "O5'" . DA  B 2 13  ? 4.155   1.731   -13.081 1.00 63.73 ? 35  DA  C "O5'" 1 
ATOM   676  C "C5'" . DA  B 2 13  ? 4.818   0.730   -12.281 1.00 61.51 ? 35  DA  C "C5'" 1 
ATOM   677  C "C4'" . DA  B 2 13  ? 6.232   1.176   -12.027 1.00 59.21 ? 35  DA  C "C4'" 1 
ATOM   678  O "O4'" . DA  B 2 13  ? 6.908   1.212   -13.296 1.00 60.19 ? 35  DA  C "O4'" 1 
ATOM   679  C "C3'" . DA  B 2 13  ? 6.407   2.583   -11.482 1.00 60.58 ? 35  DA  C "C3'" 1 
ATOM   680  O "O3'" . DA  B 2 13  ? 7.306   2.512   -10.375 1.00 60.84 ? 35  DA  C "O3'" 1 
ATOM   681  C "C2'" . DA  B 2 13  ? 6.957   3.432   -12.645 1.00 58.47 ? 35  DA  C "C2'" 1 
ATOM   682  C "C1'" . DA  B 2 13  ? 7.734   2.361   -13.388 1.00 56.87 ? 35  DA  C "C1'" 1 
ATOM   683  N N9    . DA  B 2 13  ? 8.078   2.596   -14.807 1.00 56.55 ? 35  DA  C N9    1 
ATOM   684  C C8    . DA  B 2 13  ? 7.270   2.972   -15.874 1.00 55.71 ? 35  DA  C C8    1 
ATOM   685  N N7    . DA  B 2 13  ? 7.884   3.074   -17.029 1.00 53.32 ? 35  DA  C N7    1 
ATOM   686  C C5    . DA  B 2 13  ? 9.203   2.755   -16.677 1.00 54.56 ? 35  DA  C C5    1 
ATOM   687  C C6    . DA  B 2 13  ? 10.388  2.677   -17.439 1.00 56.40 ? 35  DA  C C6    1 
ATOM   688  N N6    . DA  B 2 13  ? 10.376  2.930   -18.764 1.00 56.71 ? 35  DA  C N6    1 
ATOM   689  N N1    . DA  B 2 13  ? 11.561  2.337   -16.805 1.00 56.56 ? 35  DA  C N1    1 
ATOM   690  C C2    . DA  B 2 13  ? 11.532  2.078   -15.474 1.00 56.21 ? 35  DA  C C2    1 
ATOM   691  N N3    . DA  B 2 13  ? 10.470  2.113   -14.651 1.00 55.34 ? 35  DA  C N3    1 
ATOM   692  C C4    . DA  B 2 13  ? 9.343   2.448   -15.331 1.00 54.63 ? 35  DA  C C4    1 
ATOM   693  P P     . DG  B 2 14  ? 7.529   3.773   -9.407  1.00 63.43 ? 36  DG  C P     1 
ATOM   694  O OP1   . DG  B 2 14  ? 7.526   3.158   -8.073  1.00 64.02 ? 36  DG  C OP1   1 
ATOM   695  O OP2   . DG  B 2 14  ? 6.633   4.911   -9.743  1.00 62.24 ? 36  DG  C OP2   1 
ATOM   696  O "O5'" . DG  B 2 14  ? 9.034   4.210   -9.737  1.00 61.57 ? 36  DG  C "O5'" 1 
ATOM   697  C "C5'" . DG  B 2 14  ? 9.960   3.144   -9.928  1.00 59.54 ? 36  DG  C "C5'" 1 
ATOM   698  C "C4'" . DG  B 2 14  ? 11.329  3.641   -10.318 1.00 56.96 ? 36  DG  C "C4'" 1 
ATOM   699  O "O4'" . DG  B 2 14  ? 11.345  3.791   -11.758 1.00 56.54 ? 36  DG  C "O4'" 1 
ATOM   700  C "C3'" . DG  B 2 14  ? 11.670  4.991   -9.737  1.00 56.09 ? 36  DG  C "C3'" 1 
ATOM   701  O "O3'" . DG  B 2 14  ? 12.879  4.850   -8.930  1.00 54.67 ? 36  DG  C "O3'" 1 
ATOM   702  C "C2'" . DG  B 2 14  ? 11.731  5.929   -10.972 1.00 52.57 ? 36  DG  C "C2'" 1 
ATOM   703  C "C1'" . DG  B 2 14  ? 11.950  4.995   -12.144 1.00 52.51 ? 36  DG  C "C1'" 1 
ATOM   704  N N9    . DG  B 2 14  ? 11.264  5.314   -13.386 1.00 52.69 ? 36  DG  C N9    1 
ATOM   705  C C8    . DG  B 2 14  ? 9.897   5.529   -13.594 1.00 52.45 ? 36  DG  C C8    1 
ATOM   706  N N7    . DG  B 2 14  ? 9.574   5.801   -14.829 1.00 50.57 ? 36  DG  C N7    1 
ATOM   707  C C5    . DG  B 2 14  ? 10.804  5.700   -15.480 1.00 51.49 ? 36  DG  C C5    1 
ATOM   708  C C6    . DG  B 2 14  ? 11.119  5.883   -16.838 1.00 51.59 ? 36  DG  C C6    1 
ATOM   709  O O6    . DG  B 2 14  ? 10.354  6.152   -17.754 1.00 52.97 ? 36  DG  C O6    1 
ATOM   710  N N1    . DG  B 2 14  ? 12.473  5.743   -17.114 1.00 52.47 ? 36  DG  C N1    1 
ATOM   711  C C2    . DG  B 2 14  ? 13.412  5.450   -16.163 1.00 52.71 ? 36  DG  C C2    1 
ATOM   712  N N2    . DG  B 2 14  ? 14.655  5.315   -16.621 1.00 51.68 ? 36  DG  C N2    1 
ATOM   713  N N3    . DG  B 2 14  ? 13.145  5.290   -14.865 1.00 52.34 ? 36  DG  C N3    1 
ATOM   714  C C4    . DG  B 2 14  ? 11.837  5.423   -14.612 1.00 49.61 ? 36  DG  C C4    1 
ATOM   715  P P     . DT  B 2 15  ? 13.429  6.186   -8.285  1.00 55.50 ? 37  DT  C P     1 
ATOM   716  O OP1   . DT  B 2 15  ? 14.261  5.904   -7.092  1.00 55.11 ? 37  DT  C OP1   1 
ATOM   717  O OP2   . DT  B 2 15  ? 12.288  7.106   -8.136  1.00 55.27 ? 37  DT  C OP2   1 
ATOM   718  O "O5'" . DT  B 2 15  ? 14.274  6.763   -9.517  1.00 56.59 ? 37  DT  C "O5'" 1 
ATOM   719  C "C5'" . DT  B 2 15  ? 15.640  6.376   -9.782  1.00 56.24 ? 37  DT  C "C5'" 1 
ATOM   720  C "C4'" . DT  B 2 15  ? 16.262  7.279   -10.841 1.00 54.76 ? 37  DT  C "C4'" 1 
ATOM   721  O "O4'" . DT  B 2 15  ? 15.433  7.249   -12.036 1.00 55.39 ? 37  DT  C "O4'" 1 
ATOM   722  C "C3'" . DT  B 2 15  ? 16.308  8.744   -10.418 1.00 54.51 ? 37  DT  C "C3'" 1 
ATOM   723  O "O3'" . DT  B 2 15  ? 17.481  9.361   -10.895 1.00 52.82 ? 37  DT  C "O3'" 1 
ATOM   724  C "C2'" . DT  B 2 15  ? 15.045  9.334   -11.056 1.00 54.89 ? 37  DT  C "C2'" 1 
ATOM   725  C "C1'" . DT  B 2 15  ? 15.143  8.588   -12.379 1.00 52.82 ? 37  DT  C "C1'" 1 
ATOM   726  N N1    . DT  B 2 15  ? 13.978  8.769   -13.339 1.00 53.16 ? 37  DT  C N1    1 
ATOM   727  C C2    . DT  B 2 15  ? 14.309  8.830   -14.708 1.00 53.94 ? 37  DT  C C2    1 
ATOM   728  O O2    . DT  B 2 15  ? 15.429  8.745   -15.203 1.00 54.45 ? 37  DT  C O2    1 
ATOM   729  N N3    . DT  B 2 15  ? 13.267  8.992   -15.552 1.00 50.88 ? 37  DT  C N3    1 
ATOM   730  C C4    . DT  B 2 15  ? 11.972  9.114   -15.202 1.00 49.25 ? 37  DT  C C4    1 
ATOM   731  O O4    . DT  B 2 15  ? 11.199  9.273   -16.122 1.00 50.42 ? 37  DT  C O4    1 
ATOM   732  C C5    . DT  B 2 15  ? 11.655  9.042   -13.779 1.00 50.95 ? 37  DT  C C5    1 
ATOM   733  C C7    . DT  B 2 15  ? 10.206  8.926   -13.327 1.00 50.17 ? 37  DT  C C7    1 
ATOM   734  C C6    . DT  B 2 15  ? 12.673  8.899   -12.899 1.00 49.13 ? 37  DT  C C6    1 
ATOM   735  P P     . DG  B 2 16  ? 18.022  10.609  -10.087 1.00 54.82 ? 38  DG  C P     1 
ATOM   736  O OP1   . DG  B 2 16  ? 18.667  10.078  -8.863  1.00 57.23 ? 38  DG  C OP1   1 
ATOM   737  O OP2   . DG  B 2 16  ? 16.879  11.548  -10.019 1.00 55.96 ? 38  DG  C OP2   1 
ATOM   738  O "O5'" . DG  B 2 16  ? 19.229  11.310  -10.899 1.00 52.55 ? 38  DG  C "O5'" 1 
ATOM   739  C "C5'" . DG  B 2 16  ? 19.016  12.308  -11.858 1.00 51.93 ? 38  DG  C "C5'" 1 
ATOM   740  C "C4'" . DG  B 2 16  ? 19.315  11.867  -13.263 1.00 49.47 ? 38  DG  C "C4'" 1 
ATOM   741  O "O4'" . DG  B 2 16  ? 18.282  11.006  -13.747 1.00 51.85 ? 38  DG  C "O4'" 1 
ATOM   742  C "C3'" . DG  B 2 16  ? 19.245  13.025  -14.204 1.00 51.42 ? 38  DG  C "C3'" 1 
ATOM   743  O "O3'" . DG  B 2 16  ? 20.516  13.606  -14.162 1.00 51.83 ? 38  DG  C "O3'" 1 
ATOM   744  C "C2'" . DG  B 2 16  ? 18.988  12.338  -15.534 1.00 51.83 ? 38  DG  C "C2'" 1 
ATOM   745  C "C1'" . DG  B 2 16  ? 17.994  11.291  -15.096 1.00 52.50 ? 38  DG  C "C1'" 1 
ATOM   746  N N9    . DG  B 2 16  ? 16.580  11.646  -15.225 1.00 53.37 ? 38  DG  C N9    1 
ATOM   747  C C8    . DG  B 2 16  ? 15.667  11.782  -14.210 1.00 51.87 ? 38  DG  C C8    1 
ATOM   748  N N7    . DG  B 2 16  ? 14.463  12.094  -14.645 1.00 53.71 ? 38  DG  C N7    1 
ATOM   749  C C5    . DG  B 2 16  ? 14.563  12.154  -16.036 1.00 52.93 ? 38  DG  C C5    1 
ATOM   750  C C6    . DG  B 2 16  ? 13.590  12.428  -17.033 1.00 51.08 ? 38  DG  C C6    1 
ATOM   751  O O6    . DG  B 2 16  ? 12.385  12.658  -16.867 1.00 53.15 ? 38  DG  C O6    1 
ATOM   752  N N1    . DG  B 2 16  ? 14.098  12.385  -18.325 1.00 50.70 ? 38  DG  C N1    1 
ATOM   753  C C2    . DG  B 2 16  ? 15.418  12.124  -18.609 1.00 52.66 ? 38  DG  C C2    1 
ATOM   754  N N2    . DG  B 2 16  ? 15.770  12.150  -19.898 1.00 52.92 ? 38  DG  C N2    1 
ATOM   755  N N3    . DG  B 2 16  ? 16.356  11.867  -17.698 1.00 53.54 ? 38  DG  C N3    1 
ATOM   756  C C4    . DG  B 2 16  ? 15.872  11.884  -16.415 1.00 55.10 ? 38  DG  C C4    1 
ATOM   757  P P     . DC  B 2 17  ? 20.744  15.104  -14.527 1.00 52.69 ? 39  DC  C P     1 
ATOM   758  O OP1   . DC  B 2 17  ? 22.172  15.371  -14.268 1.00 55.48 ? 39  DC  C OP1   1 
ATOM   759  O OP2   . DC  B 2 17  ? 19.731  15.943  -13.841 1.00 57.47 ? 39  DC  C OP2   1 
ATOM   760  O "O5'" . DC  B 2 17  ? 20.452  15.155  -16.086 1.00 55.20 ? 39  DC  C "O5'" 1 
ATOM   761  C "C5'" . DC  B 2 17  ? 21.400  14.663  -17.057 1.00 56.53 ? 39  DC  C "C5'" 1 
ATOM   762  C "C4'" . DC  B 2 17  ? 20.840  14.824  -18.461 1.00 56.41 ? 39  DC  C "C4'" 1 
ATOM   763  O "O4'" . DC  B 2 17  ? 19.588  14.086  -18.573 1.00 55.44 ? 39  DC  C "O4'" 1 
ATOM   764  C "C3'" . DC  B 2 17  ? 20.464  16.249  -18.813 1.00 56.39 ? 39  DC  C "C3'" 1 
ATOM   765  O "O3'" . DC  B 2 17  ? 21.548  16.975  -19.337 1.00 60.41 ? 39  DC  C "O3'" 1 
ATOM   766  C "C2'" . DC  B 2 17  ? 19.435  16.021  -19.893 1.00 54.90 ? 39  DC  C "C2'" 1 
ATOM   767  C "C1'" . DC  B 2 17  ? 18.656  14.874  -19.298 1.00 52.40 ? 39  DC  C "C1'" 1 
ATOM   768  N N1    . DC  B 2 17  ? 17.408  15.161  -18.466 1.00 51.40 ? 39  DC  C N1    1 
ATOM   769  C C2    . DC  B 2 17  ? 16.219  15.388  -19.136 1.00 50.86 ? 39  DC  C C2    1 
ATOM   770  O O2    . DC  B 2 17  ? 16.270  15.398  -20.373 1.00 50.16 ? 39  DC  C O2    1 
ATOM   771  N N3    . DC  B 2 17  ? 15.068  15.590  -18.413 1.00 50.94 ? 39  DC  C N3    1 
ATOM   772  C C4    . DC  B 2 17  ? 15.088  15.566  -17.074 1.00 50.80 ? 39  DC  C C4    1 
ATOM   773  N N4    . DC  B 2 17  ? 13.954  15.777  -16.400 1.00 50.46 ? 39  DC  C N4    1 
ATOM   774  C C5    . DC  B 2 17  ? 16.302  15.339  -16.365 1.00 50.52 ? 39  DC  C C5    1 
ATOM   775  C C6    . DC  B 2 17  ? 17.408  15.137  -17.099 1.00 51.68 ? 39  DC  C C6    1 
ATOM   776  P P     . DC  B 2 18  ? 21.438  18.553  -19.242 1.00 65.41 ? 40  DC  C P     1 
ATOM   777  O OP1   . DC  B 2 18  ? 22.720  19.160  -19.650 1.00 66.67 ? 40  DC  C OP1   1 
ATOM   778  O OP2   . DC  B 2 18  ? 20.852  18.877  -17.919 1.00 64.07 ? 40  DC  C OP2   1 
ATOM   779  O "O5'" . DC  B 2 18  ? 20.321  18.926  -20.345 1.00 65.51 ? 40  DC  C "O5'" 1 
ATOM   780  C "C5'" . DC  B 2 18  ? 20.430  18.697  -21.767 1.00 60.70 ? 40  DC  C "C5'" 1 
ATOM   781  C "C4'" . DC  B 2 18  ? 19.098  19.034  -22.426 1.00 56.66 ? 40  DC  C "C4'" 1 
ATOM   782  O "O4'" . DC  B 2 18  ? 18.053  18.266  -21.808 1.00 52.04 ? 40  DC  C "O4'" 1 
ATOM   783  C "C3'" . DC  B 2 18  ? 18.651  20.471  -22.241 1.00 55.41 ? 40  DC  C "C3'" 1 
ATOM   784  O "O3'" . DC  B 2 18  ? 19.108  21.206  -23.314 1.00 56.23 ? 40  DC  C "O3'" 1 
ATOM   785  C "C2'" . DC  B 2 18  ? 17.144  20.363  -22.356 1.00 54.40 ? 40  DC  C "C2'" 1 
ATOM   786  C "C1'" . DC  B 2 18  ? 16.858  19.001  -21.790 1.00 51.05 ? 40  DC  C "C1'" 1 
ATOM   787  N N1    . DC  B 2 18  ? 16.317  19.049  -20.400 1.00 51.36 ? 40  DC  C N1    1 
ATOM   788  C C2    . DC  B 2 18  ? 14.920  19.067  -20.207 1.00 49.30 ? 40  DC  C C2    1 
ATOM   789  O O2    . DC  B 2 18  ? 14.187  19.060  -21.200 1.00 49.33 ? 40  DC  C O2    1 
ATOM   790  N N3    . DC  B 2 18  ? 14.421  19.083  -18.934 1.00 47.77 ? 40  DC  C N3    1 
ATOM   791  C C4    . DC  B 2 18  ? 15.260  19.073  -17.882 1.00 49.35 ? 40  DC  C C4    1 
ATOM   792  N N4    . DC  B 2 18  ? 14.755  19.091  -16.658 1.00 48.96 ? 40  DC  C N4    1 
ATOM   793  C C5    . DC  B 2 18  ? 16.684  19.073  -18.045 1.00 49.69 ? 40  DC  C C5    1 
ATOM   794  C C6    . DC  B 2 18  ? 17.164  19.047  -19.312 1.00 51.05 ? 40  DC  C C6    1 
ATOM   795  P P     . DT  B 2 19  ? 18.959  22.781  -23.344 1.00 60.05 ? 41  DT  C P     1 
ATOM   796  O OP1   . DT  B 2 19  ? 19.862  23.208  -24.424 1.00 60.33 ? 41  DT  C OP1   1 
ATOM   797  O OP2   . DT  B 2 19  ? 19.167  23.345  -21.976 1.00 58.54 ? 41  DT  C OP2   1 
ATOM   798  O "O5'" . DT  B 2 19  ? 17.449  23.006  -23.862 1.00 57.95 ? 41  DT  C "O5'" 1 
ATOM   799  C "C5'" . DT  B 2 19  ? 16.841  22.224  -24.927 1.00 56.58 ? 41  DT  C "C5'" 1 
ATOM   800  C "C4'" . DT  B 2 19  ? 15.401  22.667  -25.170 1.00 54.56 ? 41  DT  C "C4'" 1 
ATOM   801  O "O4'" . DT  B 2 19  ? 14.483  22.173  -24.149 1.00 55.08 ? 41  DT  C "O4'" 1 
ATOM   802  C "C3'" . DT  B 2 19  ? 15.224  24.173  -25.136 1.00 54.98 ? 41  DT  C "C3'" 1 
ATOM   803  O "O3'" . DT  B 2 19  ? 14.184  24.492  -26.032 1.00 56.35 ? 41  DT  C "O3'" 1 
ATOM   804  C "C2'" . DT  B 2 19  ? 14.891  24.455  -23.672 1.00 52.30 ? 41  DT  C "C2'" 1 
ATOM   805  C "C1'" . DT  B 2 19  ? 14.048  23.234  -23.312 1.00 51.99 ? 41  DT  C "C1'" 1 
ATOM   806  N N1    . DT  B 2 19  ? 14.029  22.921  -21.816 1.00 50.97 ? 41  DT  C N1    1 
ATOM   807  C C2    . DT  B 2 19  ? 12.814  22.677  -21.201 1.00 51.06 ? 41  DT  C C2    1 
ATOM   808  O O2    . DT  B 2 19  ? 11.746  22.641  -21.809 1.00 50.96 ? 41  DT  C O2    1 
ATOM   809  N N3    . DT  B 2 19  ? 12.894  22.459  -19.837 1.00 49.48 ? 41  DT  C N3    1 
ATOM   810  C C4    . DT  B 2 19  ? 14.030  22.474  -19.040 1.00 50.07 ? 41  DT  C C4    1 
ATOM   811  O O4    . DT  B 2 19  ? 14.010  22.249  -17.828 1.00 51.53 ? 41  DT  C O4    1 
ATOM   812  C C5    . DT  B 2 19  ? 15.257  22.770  -19.730 1.00 49.28 ? 41  DT  C C5    1 
ATOM   813  C C7    . DT  B 2 19  ? 16.518  22.984  -18.941 1.00 45.94 ? 41  DT  C C7    1 
ATOM   814  C C6    . DT  B 2 19  ? 15.191  22.989  -21.058 1.00 49.79 ? 41  DT  C C6    1 
ATOM   815  P P     . DC  B 2 20  ? 13.777  25.997  -26.398 1.00 57.39 ? 42  DC  C P     1 
ATOM   816  O OP1   . DC  B 2 20  ? 13.672  26.037  -27.872 1.00 58.82 ? 42  DC  C OP1   1 
ATOM   817  O OP2   . DC  B 2 20  ? 14.615  26.966  -25.652 1.00 57.70 ? 42  DC  C OP2   1 
ATOM   818  O "O5'" . DC  B 2 20  ? 12.306  26.102  -25.791 1.00 56.85 ? 42  DC  C "O5'" 1 
ATOM   819  C "C5'" . DC  B 2 20  ? 11.386  25.009  -25.914 1.00 55.39 ? 42  DC  C "C5'" 1 
ATOM   820  C "C4'" . DC  B 2 20  ? 10.109  25.344  -25.168 1.00 53.95 ? 42  DC  C "C4'" 1 
ATOM   821  O "O4'" . DC  B 2 20  ? 10.196  24.998  -23.761 1.00 53.49 ? 42  DC  C "O4'" 1 
ATOM   822  C "C3'" . DC  B 2 20  ? 9.733   26.814  -25.234 1.00 53.41 ? 42  DC  C "C3'" 1 
ATOM   823  O "O3'" . DC  B 2 20  ? 8.371   26.834  -25.634 1.00 54.78 ? 42  DC  C "O3'" 1 
ATOM   824  C "C2'" . DC  B 2 20  ? 10.003  27.368  -23.832 1.00 52.01 ? 42  DC  C "C2'" 1 
ATOM   825  C "C1'" . DC  B 2 20  ? 9.940   26.121  -22.950 1.00 51.48 ? 42  DC  C "C1'" 1 
ATOM   826  N N1    . DC  B 2 20  ? 10.898  26.077  -21.803 1.00 51.21 ? 42  DC  C N1    1 
ATOM   827  C C2    . DC  B 2 20  ? 10.336  25.877  -20.558 1.00 51.47 ? 42  DC  C C2    1 
ATOM   828  O O2    . DC  B 2 20  ? 9.106   25.753  -20.544 1.00 51.65 ? 42  DC  C O2    1 
ATOM   829  N N3    . DC  B 2 20  ? 11.139  25.836  -19.447 1.00 50.94 ? 42  DC  C N3    1 
ATOM   830  C C4    . DC  B 2 20  ? 12.465  25.966  -19.586 1.00 50.46 ? 42  DC  C C4    1 
ATOM   831  N N4    . DC  B 2 20  ? 13.201  25.913  -18.484 1.00 49.82 ? 42  DC  C N4    1 
ATOM   832  C C5    . DC  B 2 20  ? 13.080  26.178  -20.855 1.00 49.72 ? 42  DC  C C5    1 
ATOM   833  C C6    . DC  B 2 20  ? 12.261  26.220  -21.925 1.00 51.50 ? 42  DC  C C6    1 
ATOM   834  P P     . DG  B 2 21  ? 7.589   28.133  -26.177 1.00 56.63 ? 43  DG  C P     1 
ATOM   835  O OP1   . DG  B 2 21  ? 6.931   27.772  -27.465 1.00 56.53 ? 43  DG  C OP1   1 
ATOM   836  O OP2   . DG  B 2 21  ? 8.479   29.314  -26.144 1.00 51.72 ? 43  DG  C OP2   1 
ATOM   837  O "O5'" . DG  B 2 21  ? 6.510   28.181  -24.992 1.00 55.24 ? 43  DG  C "O5'" 1 
ATOM   838  C "C5'" . DG  B 2 21  ? 6.742   29.260  -24.121 1.00 56.17 ? 43  DG  C "C5'" 1 
ATOM   839  C "C4'" . DG  B 2 21  ? 6.024   29.187  -22.791 1.00 55.95 ? 43  DG  C "C4'" 1 
ATOM   840  O "O4'" . DG  B 2 21  ? 6.887   28.591  -21.780 1.00 54.77 ? 43  DG  C "O4'" 1 
ATOM   841  C "C3'" . DG  B 2 21  ? 5.746   30.617  -22.357 1.00 56.11 ? 43  DG  C "C3'" 1 
ATOM   842  O "O3'" . DG  B 2 21  ? 4.497   30.716  -21.662 1.00 57.19 ? 43  DG  C "O3'" 1 
ATOM   843  C "C2'" . DG  B 2 21  ? 6.985   30.977  -21.532 1.00 52.82 ? 43  DG  C "C2'" 1 
ATOM   844  C "C1'" . DG  B 2 21  ? 7.449   29.634  -20.981 1.00 49.68 ? 43  DG  C "C1'" 1 
ATOM   845  N N9    . DG  B 2 21  ? 8.922   29.588  -20.816 1.00 48.51 ? 43  DG  C N9    1 
ATOM   846  C C8    . DG  B 2 21  ? 9.961   29.803  -21.708 1.00 47.14 ? 43  DG  C C8    1 
ATOM   847  N N7    . DG  B 2 21  ? 11.157  29.691  -21.202 1.00 45.18 ? 43  DG  C N7    1 
ATOM   848  C C5    . DG  B 2 21  ? 10.884  29.409  -19.875 1.00 46.63 ? 43  DG  C C5    1 
ATOM   849  C C6    . DG  B 2 21  ? 11.762  29.188  -18.787 1.00 48.00 ? 43  DG  C C6    1 
ATOM   850  O O6    . DG  B 2 21  ? 12.985  29.210  -18.771 1.00 46.94 ? 43  DG  C O6    1 
ATOM   851  N N1    . DG  B 2 21  ? 11.083  28.906  -17.604 1.00 47.77 ? 43  DG  C N1    1 
ATOM   852  C C2    . DG  B 2 21  ? 9.715   28.865  -17.486 1.00 47.42 ? 43  DG  C C2    1 
ATOM   853  N N2    . DG  B 2 21  ? 9.275   28.582  -16.261 1.00 47.94 ? 43  DG  C N2    1 
ATOM   854  N N3    . DG  B 2 21  ? 8.854   29.077  -18.473 1.00 46.45 ? 43  DG  C N3    1 
ATOM   855  C C4    . DG  B 2 21  ? 9.527   29.330  -19.627 1.00 46.67 ? 43  DG  C C4    1 
ATOM   856  N N     . VAL C 3 4   ? 10.974  -11.892 15.078  1.00 78.29 ? 132 VAL A N     1 
ATOM   857  C CA    . VAL C 3 4   ? 11.573  -12.552 16.281  1.00 78.76 ? 132 VAL A CA    1 
ATOM   858  C C     . VAL C 3 4   ? 10.936  -13.935 16.540  1.00 78.51 ? 132 VAL A C     1 
ATOM   859  O O     . VAL C 3 4   ? 11.366  -14.913 15.927  1.00 78.96 ? 132 VAL A O     1 
ATOM   860  C CB    . VAL C 3 4   ? 11.543  -11.616 17.524  1.00 78.93 ? 132 VAL A CB    1 
ATOM   861  C CG1   . VAL C 3 4   ? 11.974  -12.362 18.807  1.00 80.13 ? 132 VAL A CG1   1 
ATOM   862  C CG2   . VAL C 3 4   ? 12.440  -10.389 17.288  1.00 79.46 ? 132 VAL A CG2   1 
ATOM   863  N N     . GLU C 3 5   ? 9.934   -14.027 17.427  1.00 77.86 ? 133 GLU A N     1 
ATOM   864  C CA    . GLU C 3 5   ? 9.181   -15.283 17.641  1.00 77.35 ? 133 GLU A CA    1 
ATOM   865  C C     . GLU C 3 5   ? 8.434   -15.770 16.376  1.00 75.98 ? 133 GLU A C     1 
ATOM   866  O O     . GLU C 3 5   ? 8.055   -16.951 16.268  1.00 75.74 ? 133 GLU A O     1 
ATOM   867  C CB    . GLU C 3 5   ? 8.170   -15.130 18.779  1.00 77.38 ? 133 GLU A CB    1 
ATOM   868  C CG    . GLU C 3 5   ? 8.709   -15.255 20.202  1.00 78.60 ? 133 GLU A CG    1 
ATOM   869  C CD    . GLU C 3 5   ? 7.617   -14.968 21.238  1.00 79.13 ? 133 GLU A CD    1 
ATOM   870  O OE1   . GLU C 3 5   ? 6.491   -15.532 21.086  1.00 81.25 ? 133 GLU A OE1   1 
ATOM   871  O OE2   . GLU C 3 5   ? 7.863   -14.176 22.189  1.00 79.09 ? 133 GLU A OE2   1 
ATOM   872  N N     . ASP C 3 6   ? 8.217   -14.851 15.433  1.00 74.31 ? 134 ASP A N     1 
ATOM   873  C CA    . ASP C 3 6   ? 7.652   -15.179 14.125  1.00 72.84 ? 134 ASP A CA    1 
ATOM   874  C C     . ASP C 3 6   ? 8.386   -16.301 13.407  1.00 71.83 ? 134 ASP A C     1 
ATOM   875  O O     . ASP C 3 6   ? 9.626   -16.294 13.343  1.00 72.26 ? 134 ASP A O     1 
ATOM   876  C CB    . ASP C 3 6   ? 7.671   -13.955 13.236  1.00 72.67 ? 134 ASP A CB    1 
ATOM   877  C CG    . ASP C 3 6   ? 6.678   -12.941 13.670  1.00 72.53 ? 134 ASP A CG    1 
ATOM   878  O OD1   . ASP C 3 6   ? 5.691   -13.349 14.339  1.00 71.96 ? 134 ASP A OD1   1 
ATOM   879  O OD2   . ASP C 3 6   ? 6.809   -11.727 13.404  1.00 71.63 ? 134 ASP A OD2   1 
ATOM   880  N N     . PRO C 3 7   ? 7.633   -17.250 12.849  1.00 70.31 ? 135 PRO A N     1 
ATOM   881  C CA    . PRO C 3 7   ? 8.228   -18.297 12.041  1.00 69.36 ? 135 PRO A CA    1 
ATOM   882  C C     . PRO C 3 7   ? 9.115   -17.746 10.907  1.00 68.64 ? 135 PRO A C     1 
ATOM   883  O O     . PRO C 3 7   ? 8.846   -16.663 10.347  1.00 68.61 ? 135 PRO A O     1 
ATOM   884  C CB    . PRO C 3 7   ? 7.006   -19.030 11.491  1.00 69.66 ? 135 PRO A CB    1 
ATOM   885  C CG    . PRO C 3 7   ? 5.972   -18.815 12.530  1.00 69.37 ? 135 PRO A CG    1 
ATOM   886  C CD    . PRO C 3 7   ? 6.171   -17.406 12.960  1.00 69.69 ? 135 PRO A CD    1 
ATOM   887  N N     . LYS C 3 8   ? 10.182  -18.479 10.599  1.00 67.29 ? 136 LYS A N     1 
ATOM   888  C CA    . LYS C 3 8   ? 11.055  -18.126 9.503   1.00 65.85 ? 136 LYS A CA    1 
ATOM   889  C C     . LYS C 3 8   ? 10.745  -18.975 8.258   1.00 65.01 ? 136 LYS A C     1 
ATOM   890  O O     . LYS C 3 8   ? 11.072  -18.575 7.135   1.00 65.42 ? 136 LYS A O     1 
ATOM   891  C CB    . LYS C 3 8   ? 12.524  -18.252 9.933   1.00 66.40 ? 136 LYS A CB    1 
ATOM   892  N N     . ASP C 3 9   ? 10.114  -20.135 8.452   1.00 63.27 ? 137 ASP A N     1 
ATOM   893  C CA    . ASP C 3 9   ? 9.544   -20.886 7.345   1.00 62.30 ? 137 ASP A CA    1 
ATOM   894  C C     . ASP C 3 9   ? 8.233   -21.557 7.738   1.00 61.09 ? 137 ASP A C     1 
ATOM   895  O O     . ASP C 3 9   ? 7.846   -21.574 8.903   1.00 61.42 ? 137 ASP A O     1 
ATOM   896  C CB    . ASP C 3 9   ? 10.543  -21.897 6.750   1.00 62.79 ? 137 ASP A CB    1 
ATOM   897  C CG    . ASP C 3 9   ? 10.214  -22.273 5.268   1.00 65.44 ? 137 ASP A CG    1 
ATOM   898  O OD1   . ASP C 3 9   ? 9.228   -21.715 4.697   1.00 66.22 ? 137 ASP A OD1   1 
ATOM   899  O OD2   . ASP C 3 9   ? 10.881  -23.116 4.592   1.00 64.96 ? 137 ASP A OD2   1 
ATOM   900  N N     . PHE C 3 10  ? 7.535   -22.077 6.744   1.00 59.30 ? 138 PHE A N     1 
ATOM   901  C CA    . PHE C 3 10  ? 6.403   -22.956 6.958   1.00 58.15 ? 138 PHE A CA    1 
ATOM   902  C C     . PHE C 3 10  ? 6.766   -24.060 7.971   1.00 58.68 ? 138 PHE A C     1 
ATOM   903  O O     . PHE C 3 10  ? 7.943   -24.333 8.196   1.00 59.14 ? 138 PHE A O     1 
ATOM   904  C CB    . PHE C 3 10  ? 5.989   -23.591 5.612   1.00 56.82 ? 138 PHE A CB    1 
ATOM   905  C CG    . PHE C 3 10  ? 5.092   -22.726 4.780   1.00 52.59 ? 138 PHE A CG    1 
ATOM   906  C CD1   . PHE C 3 10  ? 3.723   -22.981 4.717   1.00 51.29 ? 138 PHE A CD1   1 
ATOM   907  C CD2   . PHE C 3 10  ? 5.604   -21.660 4.058   1.00 48.79 ? 138 PHE A CD2   1 
ATOM   908  C CE1   . PHE C 3 10  ? 2.892   -22.183 3.946   1.00 48.29 ? 138 PHE A CE1   1 
ATOM   909  C CE2   . PHE C 3 10  ? 4.784   -20.859 3.286   1.00 48.82 ? 138 PHE A CE2   1 
ATOM   910  C CZ    . PHE C 3 10  ? 3.430   -21.109 3.240   1.00 50.91 ? 138 PHE A CZ    1 
ATOM   911  N N     . PRO C 3 11  ? 5.775   -24.707 8.583   1.00 58.87 ? 139 PRO A N     1 
ATOM   912  C CA    . PRO C 3 11  ? 6.056   -25.827 9.483   1.00 59.12 ? 139 PRO A CA    1 
ATOM   913  C C     . PRO C 3 11  ? 6.823   -26.976 8.809   1.00 59.04 ? 139 PRO A C     1 
ATOM   914  O O     . PRO C 3 11  ? 6.561   -27.300 7.636   1.00 58.80 ? 139 PRO A O     1 
ATOM   915  C CB    . PRO C 3 11  ? 4.662   -26.242 9.946   1.00 59.52 ? 139 PRO A CB    1 
ATOM   916  C CG    . PRO C 3 11  ? 3.911   -24.949 9.846   1.00 59.08 ? 139 PRO A CG    1 
ATOM   917  C CD    . PRO C 3 11  ? 4.335   -24.413 8.524   1.00 58.72 ? 139 PRO A CD    1 
ATOM   918  N N     . SER C 3 12  ? 7.768   -27.571 9.547   1.00 58.94 ? 140 SER A N     1 
ATOM   919  C CA    . SER C 3 12  ? 8.737   -28.506 8.956   1.00 59.22 ? 140 SER A CA    1 
ATOM   920  C C     . SER C 3 12  ? 8.067   -29.712 8.233   1.00 58.28 ? 140 SER A C     1 
ATOM   921  O O     . SER C 3 12  ? 8.645   -30.360 7.359   1.00 58.34 ? 140 SER A O     1 
ATOM   922  C CB    . SER C 3 12  ? 9.791   -28.936 9.999   1.00 59.40 ? 140 SER A CB    1 
ATOM   923  O OG    . SER C 3 12  ? 9.381   -30.066 10.764  1.00 60.92 ? 140 SER A OG    1 
ATOM   924  N N     . GLU C 3 13  ? 6.816   -29.936 8.588   1.00 57.30 ? 141 GLU A N     1 
ATOM   925  C CA    . GLU C 3 13  ? 6.001   -31.068 8.169   1.00 56.34 ? 141 GLU A CA    1 
ATOM   926  C C     . GLU C 3 13  ? 5.360   -30.853 6.814   1.00 54.92 ? 141 GLU A C     1 
ATOM   927  O O     . GLU C 3 13  ? 4.956   -31.802 6.172   1.00 54.88 ? 141 GLU A O     1 
ATOM   928  C CB    . GLU C 3 13  ? 4.916   -31.184 9.221   1.00 56.94 ? 141 GLU A CB    1 
ATOM   929  C CG    . GLU C 3 13  ? 5.260   -30.224 10.351  1.00 58.05 ? 141 GLU A CG    1 
ATOM   930  C CD    . GLU C 3 13  ? 4.346   -30.329 11.521  1.00 61.67 ? 141 GLU A CD    1 
ATOM   931  O OE1   . GLU C 3 13  ? 4.553   -29.543 12.480  1.00 63.11 ? 141 GLU A OE1   1 
ATOM   932  O OE2   . GLU C 3 13  ? 3.436   -31.189 11.476  1.00 62.87 ? 141 GLU A OE2   1 
ATOM   933  N N     . LEU C 3 14  ? 5.277   -29.599 6.393   1.00 53.85 ? 142 LEU A N     1 
ATOM   934  C CA    . LEU C 3 14  ? 4.772   -29.224 5.073   1.00 53.37 ? 142 LEU A CA    1 
ATOM   935  C C     . LEU C 3 14  ? 5.843   -29.065 3.989   1.00 52.56 ? 142 LEU A C     1 
ATOM   936  O O     . LEU C 3 14  ? 5.520   -29.058 2.807   1.00 52.07 ? 142 LEU A O     1 
ATOM   937  C CB    . LEU C 3 14  ? 3.934   -27.941 5.190   1.00 53.57 ? 142 LEU A CB    1 
ATOM   938  C CG    . LEU C 3 14  ? 2.761   -28.088 6.173   1.00 54.69 ? 142 LEU A CG    1 
ATOM   939  C CD1   . LEU C 3 14  ? 2.005   -26.765 6.395   1.00 55.88 ? 142 LEU A CD1   1 
ATOM   940  C CD2   . LEU C 3 14  ? 1.814   -29.243 5.758   1.00 53.69 ? 142 LEU A CD2   1 
ATOM   941  N N     . LEU C 3 15  ? 7.114   -28.974 4.395   1.00 52.14 ? 143 LEU A N     1 
ATOM   942  C CA    . LEU C 3 15  ? 8.212   -28.556 3.510   1.00 50.89 ? 143 LEU A CA    1 
ATOM   943  C C     . LEU C 3 15  ? 8.396   -29.396 2.236   1.00 50.32 ? 143 LEU A C     1 
ATOM   944  O O     . LEU C 3 15  ? 8.781   -28.845 1.171   1.00 50.14 ? 143 LEU A O     1 
ATOM   945  C CB    . LEU C 3 15  ? 9.532   -28.407 4.293   1.00 51.15 ? 143 LEU A CB    1 
ATOM   946  C CG    . LEU C 3 15  ? 9.649   -27.320 5.397   1.00 52.33 ? 143 LEU A CG    1 
ATOM   947  C CD1   . LEU C 3 15  ? 11.081  -27.147 5.858   1.00 52.86 ? 143 LEU A CD1   1 
ATOM   948  C CD2   . LEU C 3 15  ? 9.094   -25.957 4.999   1.00 51.30 ? 143 LEU A CD2   1 
ATOM   949  N N     . SER C 3 16  ? 8.123   -30.703 2.318   1.00 48.75 ? 144 SER A N     1 
ATOM   950  C CA    . SER C 3 16  ? 8.293   -31.560 1.147   1.00 48.31 ? 144 SER A CA    1 
ATOM   951  C C     . SER C 3 16  ? 7.263   -31.263 0.046   1.00 47.80 ? 144 SER A C     1 
ATOM   952  O O     . SER C 3 16  ? 7.506   -31.561 -1.116  1.00 47.91 ? 144 SER A O     1 
ATOM   953  C CB    . SER C 3 16  ? 8.275   -33.040 1.512   1.00 48.31 ? 144 SER A CB    1 
ATOM   954  O OG    . SER C 3 16  ? 6.940   -33.529 1.657   1.00 49.82 ? 144 SER A OG    1 
ATOM   955  N N     . PHE C 3 17  ? 6.133   -30.651 0.411   1.00 46.99 ? 145 PHE A N     1 
ATOM   956  C CA    . PHE C 3 17  ? 5.091   -30.288 -0.559  1.00 45.81 ? 145 PHE A CA    1 
ATOM   957  C C     . PHE C 3 17  ? 5.362   -28.947 -1.262  1.00 45.47 ? 145 PHE A C     1 
ATOM   958  O O     . PHE C 3 17  ? 4.989   -28.779 -2.404  1.00 46.25 ? 145 PHE A O     1 
ATOM   959  C CB    . PHE C 3 17  ? 3.667   -30.356 0.078   1.00 45.39 ? 145 PHE A CB    1 
ATOM   960  C CG    . PHE C 3 17  ? 3.469   -31.523 1.069   1.00 42.71 ? 145 PHE A CG    1 
ATOM   961  C CD1   . PHE C 3 17  ? 3.661   -32.847 0.668   1.00 43.80 ? 145 PHE A CD1   1 
ATOM   962  C CD2   . PHE C 3 17  ? 3.139   -31.280 2.389   1.00 40.21 ? 145 PHE A CD2   1 
ATOM   963  C CE1   . PHE C 3 17  ? 3.522   -33.917 1.568   1.00 42.94 ? 145 PHE A CE1   1 
ATOM   964  C CE2   . PHE C 3 17  ? 2.956   -32.331 3.292   1.00 43.47 ? 145 PHE A CE2   1 
ATOM   965  C CZ    . PHE C 3 17  ? 3.157   -33.654 2.896   1.00 43.05 ? 145 PHE A CZ    1 
ATOM   966  N N     . LEU C 3 18  ? 6.044   -28.016 -0.605  1.00 45.60 ? 146 LEU A N     1 
ATOM   967  C CA    . LEU C 3 18  ? 6.293   -26.662 -1.151  1.00 45.84 ? 146 LEU A CA    1 
ATOM   968  C C     . LEU C 3 18  ? 7.290   -26.538 -2.309  1.00 46.83 ? 146 LEU A C     1 
ATOM   969  O O     . LEU C 3 18  ? 8.157   -27.387 -2.492  1.00 47.75 ? 146 LEU A O     1 
ATOM   970  C CB    . LEU C 3 18  ? 6.784   -25.773 -0.035  1.00 44.94 ? 146 LEU A CB    1 
ATOM   971  C CG    . LEU C 3 18  ? 5.990   -25.764 1.254   1.00 45.34 ? 146 LEU A CG    1 
ATOM   972  C CD1   . LEU C 3 18  ? 6.705   -24.835 2.231   1.00 42.00 ? 146 LEU A CD1   1 
ATOM   973  C CD2   . LEU C 3 18  ? 4.534   -25.317 0.994   1.00 45.52 ? 146 LEU A CD2   1 
ATOM   974  N N     . SER C 3 19  ? 7.223   -25.461 -3.081  1.00 48.31 ? 147 SER A N     1 
ATOM   975  C CA    . SER C 3 19  ? 8.283   -25.233 -4.077  1.00 49.57 ? 147 SER A CA    1 
ATOM   976  C C     . SER C 3 19  ? 9.460   -24.654 -3.355  1.00 50.48 ? 147 SER A C     1 
ATOM   977  O O     . SER C 3 19  ? 9.306   -23.959 -2.353  1.00 50.90 ? 147 SER A O     1 
ATOM   978  C CB    . SER C 3 19  ? 7.876   -24.276 -5.190  1.00 49.98 ? 147 SER A CB    1 
ATOM   979  O OG    . SER C 3 19  ? 9.016   -23.819 -5.900  1.00 49.11 ? 147 SER A OG    1 
ATOM   980  N N     . HIS C 3 20  ? 10.644  -24.944 -3.873  1.00 51.38 ? 148 HIS A N     1 
ATOM   981  C CA    . HIS C 3 20  ? 11.866  -24.555 -3.202  1.00 51.83 ? 148 HIS A CA    1 
ATOM   982  C C     . HIS C 3 20  ? 12.804  -23.780 -4.130  1.00 51.32 ? 148 HIS A C     1 
ATOM   983  O O     . HIS C 3 20  ? 14.018  -23.741 -3.919  1.00 51.73 ? 148 HIS A O     1 
ATOM   984  C CB    . HIS C 3 20  ? 12.516  -25.794 -2.584  1.00 52.64 ? 148 HIS A CB    1 
ATOM   985  C CG    . HIS C 3 20  ? 11.943  -26.153 -1.243  1.00 53.50 ? 148 HIS A CG    1 
ATOM   986  N ND1   . HIS C 3 20  ? 11.610  -25.197 -0.296  1.00 54.14 ? 148 HIS A ND1   1 
ATOM   987  C CD2   . HIS C 3 20  ? 11.640  -27.357 -0.692  1.00 51.93 ? 148 HIS A CD2   1 
ATOM   988  C CE1   . HIS C 3 20  ? 11.126  -25.797 0.778   1.00 54.05 ? 148 HIS A CE1   1 
ATOM   989  N NE2   . HIS C 3 20  ? 11.131  -27.106 0.563   1.00 53.76 ? 148 HIS A NE2   1 
ATOM   990  N N     . ALA C 3 21  ? 12.205  -23.147 -5.140  1.00 49.61 ? 149 ALA A N     1 
ATOM   991  C CA    . ALA C 3 21  ? 12.931  -22.392 -6.126  1.00 48.80 ? 149 ALA A CA    1 
ATOM   992  C C     . ALA C 3 21  ? 13.375  -21.122 -5.426  1.00 48.81 ? 149 ALA A C     1 
ATOM   993  O O     . ALA C 3 21  ? 12.740  -20.685 -4.467  1.00 49.23 ? 149 ALA A O     1 
ATOM   994  C CB    . ALA C 3 21  ? 12.058  -22.078 -7.325  1.00 47.47 ? 149 ALA A CB    1 
ATOM   995  N N     . VAL C 3 22  ? 14.495  -20.571 -5.878  1.00 47.74 ? 150 VAL A N     1 
ATOM   996  C CA    . VAL C 3 22  ? 15.029  -19.344 -5.340  1.00 46.88 ? 150 VAL A CA    1 
ATOM   997  C C     . VAL C 3 22  ? 15.252  -18.461 -6.561  1.00 46.13 ? 150 VAL A C     1 
ATOM   998  O O     . VAL C 3 22  ? 15.111  -17.239 -6.462  1.00 46.03 ? 150 VAL A O     1 
ATOM   999  C CB    . VAL C 3 22  ? 16.377  -19.564 -4.561  1.00 47.25 ? 150 VAL A CB    1 
ATOM   1000 C CG1   . VAL C 3 22  ? 16.701  -18.370 -3.665  1.00 47.87 ? 150 VAL A CG1   1 
ATOM   1001 C CG2   . VAL C 3 22  ? 16.344  -20.823 -3.730  1.00 46.86 ? 150 VAL A CG2   1 
ATOM   1002 N N     . PHE C 3 23  ? 15.538  -19.105 -7.704  1.00 44.83 ? 151 PHE A N     1 
ATOM   1003 C CA    . PHE C 3 23  ? 16.032  -18.448 -8.926  1.00 44.41 ? 151 PHE A CA    1 
ATOM   1004 C C     . PHE C 3 23  ? 15.211  -18.840 -10.186 1.00 44.85 ? 151 PHE A C     1 
ATOM   1005 O O     . PHE C 3 23  ? 15.622  -18.554 -11.341 1.00 44.38 ? 151 PHE A O     1 
ATOM   1006 C CB    . PHE C 3 23  ? 17.499  -18.843 -9.224  1.00 44.20 ? 151 PHE A CB    1 
ATOM   1007 C CG    . PHE C 3 23  ? 18.496  -18.455 -8.169  1.00 42.66 ? 151 PHE A CG    1 
ATOM   1008 C CD1   . PHE C 3 23  ? 18.914  -17.125 -8.028  1.00 43.56 ? 151 PHE A CD1   1 
ATOM   1009 C CD2   . PHE C 3 23  ? 19.086  -19.443 -7.372  1.00 45.18 ? 151 PHE A CD2   1 
ATOM   1010 C CE1   . PHE C 3 23  ? 19.879  -16.761 -7.058  1.00 45.76 ? 151 PHE A CE1   1 
ATOM   1011 C CE2   . PHE C 3 23  ? 20.057  -19.127 -6.388  1.00 46.80 ? 151 PHE A CE2   1 
ATOM   1012 C CZ    . PHE C 3 23  ? 20.457  -17.772 -6.218  1.00 47.10 ? 151 PHE A CZ    1 
ATOM   1013 N N     . SER C 3 24  ? 14.074  -19.506 -9.971  1.00 44.07 ? 152 SER A N     1 
ATOM   1014 C CA    . SER C 3 24  ? 13.152  -19.837 -11.052 1.00 43.78 ? 152 SER A CA    1 
ATOM   1015 C C     . SER C 3 24  ? 12.274  -18.648 -11.510 1.00 43.70 ? 152 SER A C     1 
ATOM   1016 O O     . SER C 3 24  ? 11.744  -17.918 -10.681 1.00 41.95 ? 152 SER A O     1 
ATOM   1017 C CB    . SER C 3 24  ? 12.253  -21.012 -10.623 1.00 43.72 ? 152 SER A CB    1 
ATOM   1018 O OG    . SER C 3 24  ? 11.675  -21.590 -11.770 1.00 44.54 ? 152 SER A OG    1 
ATOM   1019 N N     . ASN C 3 25  ? 12.122  -18.471 -12.828 1.00 43.66 ? 153 ASN A N     1 
ATOM   1020 C CA    . ASN C 3 25  ? 11.004  -17.667 -13.366 1.00 44.25 ? 153 ASN A CA    1 
ATOM   1021 C C     . ASN C 3 25  ? 9.754   -18.510 -13.740 1.00 44.15 ? 153 ASN A C     1 
ATOM   1022 O O     . ASN C 3 25  ? 8.928   -18.062 -14.511 1.00 42.74 ? 153 ASN A O     1 
ATOM   1023 C CB    . ASN C 3 25  ? 11.441  -16.851 -14.600 1.00 44.07 ? 153 ASN A CB    1 
ATOM   1024 C CG    . ASN C 3 25  ? 12.744  -16.142 -14.395 1.00 43.66 ? 153 ASN A CG    1 
ATOM   1025 O OD1   . ASN C 3 25  ? 13.075  -15.776 -13.270 1.00 44.45 ? 153 ASN A OD1   1 
ATOM   1026 N ND2   . ASN C 3 25  ? 13.506  -15.956 -15.475 1.00 39.15 ? 153 ASN A ND2   1 
ATOM   1027 N N     . ARG C 3 26  ? 9.683   -19.746 -13.239 1.00 45.11 ? 154 ARG A N     1 
ATOM   1028 C CA    . ARG C 3 26  ? 8.555   -20.687 -13.452 1.00 46.36 ? 154 ARG A CA    1 
ATOM   1029 C C     . ARG C 3 26  ? 7.314   -20.164 -12.723 1.00 45.89 ? 154 ARG A C     1 
ATOM   1030 O O     . ARG C 3 26  ? 7.422   -19.584 -11.619 1.00 45.62 ? 154 ARG A O     1 
ATOM   1031 C CB    . ARG C 3 26  ? 8.984   -22.100 -12.985 1.00 46.02 ? 154 ARG A CB    1 
ATOM   1032 C CG    . ARG C 3 26  ? 7.947   -23.154 -12.510 1.00 48.61 ? 154 ARG A CG    1 
ATOM   1033 C CD    . ARG C 3 26  ? 8.508   -24.625 -12.618 1.00 48.05 ? 154 ARG A CD    1 
ATOM   1034 N NE    . ARG C 3 26  ? 8.971   -24.837 -13.998 1.00 52.63 ? 154 ARG A NE    1 
ATOM   1035 C CZ    . ARG C 3 26  ? 8.448   -25.699 -14.878 1.00 54.06 ? 154 ARG A CZ    1 
ATOM   1036 N NH1   . ARG C 3 26  ? 7.473   -26.519 -14.513 1.00 56.24 ? 154 ARG A NH1   1 
ATOM   1037 N NH2   . ARG C 3 26  ? 8.925   -25.772 -16.119 1.00 52.26 ? 154 ARG A NH2   1 
ATOM   1038 N N     . THR C 3 27  ? 6.156   -20.340 -13.359 1.00 45.64 ? 155 THR A N     1 
ATOM   1039 C CA    . THR C 3 27  ? 4.857   -19.937 -12.805 1.00 45.15 ? 155 THR A CA    1 
ATOM   1040 C C     . THR C 3 27  ? 4.067   -21.185 -12.430 1.00 45.54 ? 155 THR A C     1 
ATOM   1041 O O     . THR C 3 27  ? 4.193   -22.209 -13.074 1.00 45.59 ? 155 THR A O     1 
ATOM   1042 C CB    . THR C 3 27  ? 4.060   -19.140 -13.840 1.00 45.66 ? 155 THR A CB    1 
ATOM   1043 O OG1   . THR C 3 27  ? 4.109   -19.820 -15.112 1.00 44.81 ? 155 THR A OG1   1 
ATOM   1044 C CG2   . THR C 3 27  ? 4.700   -17.740 -14.126 1.00 44.40 ? 155 THR A CG2   1 
ATOM   1045 N N     . LEU C 3 28  ? 3.264   -21.116 -11.374 1.00 45.54 ? 156 LEU A N     1 
ATOM   1046 C CA    . LEU C 3 28  ? 2.442   -22.256 -11.014 1.00 44.93 ? 156 LEU A CA    1 
ATOM   1047 C C     . LEU C 3 28  ? 1.025   -21.815 -10.766 1.00 43.92 ? 156 LEU A C     1 
ATOM   1048 O O     . LEU C 3 28  ? 0.683   -20.669 -11.111 1.00 45.61 ? 156 LEU A O     1 
ATOM   1049 C CB    . LEU C 3 28  ? 3.036   -23.087 -9.856  1.00 45.75 ? 156 LEU A CB    1 
ATOM   1050 C CG    . LEU C 3 28  ? 3.837   -22.482 -8.701  1.00 46.81 ? 156 LEU A CG    1 
ATOM   1051 C CD1   . LEU C 3 28  ? 3.614   -23.329 -7.518  1.00 47.30 ? 156 LEU A CD1   1 
ATOM   1052 C CD2   . LEU C 3 28  ? 5.299   -22.497 -9.035  1.00 46.44 ? 156 LEU A CD2   1 
ATOM   1053 N N     . ALA C 3 29  ? 0.202   -22.732 -10.253 1.00 41.83 ? 157 ALA A N     1 
ATOM   1054 C CA    . ALA C 3 29  ? -1.210  -22.498 -9.987  1.00 41.10 ? 157 ALA A CA    1 
ATOM   1055 C C     . ALA C 3 29  ? -1.634  -22.957 -8.597  1.00 40.12 ? 157 ALA A C     1 
ATOM   1056 O O     . ALA C 3 29  ? -2.821  -23.099 -8.318  1.00 40.03 ? 157 ALA A O     1 
ATOM   1057 C CB    . ALA C 3 29  ? -2.107  -23.125 -11.076 1.00 40.42 ? 157 ALA A CB    1 
ATOM   1058 N N     . CYS C 3 30  ? -0.674  -23.180 -7.720  1.00 39.12 ? 158 CYS A N     1 
ATOM   1059 C CA    . CYS C 3 30  ? -0.999  -23.565 -6.361  1.00 38.63 ? 158 CYS A CA    1 
ATOM   1060 C C     . CYS C 3 30  ? -0.026  -22.888 -5.418  1.00 37.54 ? 158 CYS A C     1 
ATOM   1061 O O     . CYS C 3 30  ? 1.174   -23.003 -5.579  1.00 37.73 ? 158 CYS A O     1 
ATOM   1062 C CB    . CYS C 3 30  ? -1.034  -25.096 -6.183  1.00 38.15 ? 158 CYS A CB    1 
ATOM   1063 S SG    . CYS C 3 30  ? -1.610  -25.576 -4.539  1.00 39.75 ? 158 CYS A SG    1 
ATOM   1064 N N     . PHE C 3 31  ? -0.565  -22.144 -4.459  1.00 37.29 ? 159 PHE A N     1 
ATOM   1065 C CA    . PHE C 3 31  ? 0.241   -21.297 -3.594  1.00 36.77 ? 159 PHE A CA    1 
ATOM   1066 C C     . PHE C 3 31  ? -0.214  -21.502 -2.193  1.00 37.74 ? 159 PHE A C     1 
ATOM   1067 O O     . PHE C 3 31  ? -1.323  -22.005 -1.940  1.00 37.31 ? 159 PHE A O     1 
ATOM   1068 C CB    . PHE C 3 31  ? 0.173   -19.806 -4.009  1.00 36.21 ? 159 PHE A CB    1 
ATOM   1069 C CG    . PHE C 3 31  ? 0.549   -19.571 -5.457  1.00 32.81 ? 159 PHE A CG    1 
ATOM   1070 C CD1   . PHE C 3 31  ? 1.854   -19.365 -5.814  1.00 32.19 ? 159 PHE A CD1   1 
ATOM   1071 C CD2   . PHE C 3 31  ? -0.394  -19.578 -6.428  1.00 31.72 ? 159 PHE A CD2   1 
ATOM   1072 C CE1   . PHE C 3 31  ? 2.215   -19.192 -7.120  1.00 33.61 ? 159 PHE A CE1   1 
ATOM   1073 C CE2   . PHE C 3 31  ? -0.058  -19.457 -7.758  1.00 32.97 ? 159 PHE A CE2   1 
ATOM   1074 C CZ    . PHE C 3 31  ? 1.246   -19.251 -8.113  1.00 35.59 ? 159 PHE A CZ    1 
ATOM   1075 N N     . ALA C 3 32  ? 0.660   -21.109 -1.279  1.00 39.10 ? 160 ALA A N     1 
ATOM   1076 C CA    . ALA C 3 32  ? 0.428   -21.251 0.139   1.00 40.00 ? 160 ALA A CA    1 
ATOM   1077 C C     . ALA C 3 32  ? 0.971   -19.967 0.785   1.00 40.39 ? 160 ALA A C     1 
ATOM   1078 O O     . ALA C 3 32  ? 1.903   -19.378 0.243   1.00 41.35 ? 160 ALA A O     1 
ATOM   1079 C CB    . ALA C 3 32  ? 1.144   -22.496 0.651   1.00 40.73 ? 160 ALA A CB    1 
ATOM   1080 N N     . ILE C 3 33  ? 0.368   -19.525 1.895   1.00 39.54 ? 161 ILE A N     1 
ATOM   1081 C CA    . ILE C 3 33  ? 0.772   -18.311 2.599   1.00 40.15 ? 161 ILE A CA    1 
ATOM   1082 C C     . ILE C 3 33  ? 0.653   -18.575 4.067   1.00 40.84 ? 161 ILE A C     1 
ATOM   1083 O O     . ILE C 3 33  ? -0.337  -19.141 4.517   1.00 40.20 ? 161 ILE A O     1 
ATOM   1084 C CB    . ILE C 3 33  ? -0.112  -17.106 2.290   1.00 39.34 ? 161 ILE A CB    1 
ATOM   1085 C CG1   . ILE C 3 33  ? 0.206   -16.528 0.939   1.00 39.86 ? 161 ILE A CG1   1 
ATOM   1086 C CG2   . ILE C 3 33  ? 0.113   -16.058 3.293   1.00 38.21 ? 161 ILE A CG2   1 
ATOM   1087 C CD1   . ILE C 3 33  ? -0.746  -15.420 0.560   1.00 43.10 ? 161 ILE A CD1   1 
ATOM   1088 N N     . TYR C 3 34  ? 1.672   -18.143 4.805   1.00 41.58 ? 162 TYR A N     1 
ATOM   1089 C CA    . TYR C 3 34  ? 1.785   -18.448 6.209   1.00 42.46 ? 162 TYR A CA    1 
ATOM   1090 C C     . TYR C 3 34  ? 1.870   -17.094 6.853   1.00 43.36 ? 162 TYR A C     1 
ATOM   1091 O O     . TYR C 3 34  ? 2.806   -16.332 6.608   1.00 43.12 ? 162 TYR A O     1 
ATOM   1092 C CB    . TYR C 3 34  ? 3.032   -19.328 6.466   1.00 43.06 ? 162 TYR A CB    1 
ATOM   1093 C CG    . TYR C 3 34  ? 3.134   -19.896 7.864   1.00 43.91 ? 162 TYR A CG    1 
ATOM   1094 C CD1   . TYR C 3 34  ? 2.001   -20.296 8.544   1.00 44.75 ? 162 TYR A CD1   1 
ATOM   1095 C CD2   . TYR C 3 34  ? 4.351   -20.055 8.490   1.00 45.67 ? 162 TYR A CD2   1 
ATOM   1096 C CE1   . TYR C 3 34  ? 2.046   -20.820 9.813   1.00 45.53 ? 162 TYR A CE1   1 
ATOM   1097 C CE2   . TYR C 3 34  ? 4.413   -20.594 9.793   1.00 48.38 ? 162 TYR A CE2   1 
ATOM   1098 C CZ    . TYR C 3 34  ? 3.235   -20.973 10.452  1.00 46.55 ? 162 TYR A CZ    1 
ATOM   1099 O OH    . TYR C 3 34  ? 3.221   -21.511 11.738  1.00 45.05 ? 162 TYR A OH    1 
ATOM   1100 N N     . THR C 3 35  ? 0.847   -16.752 7.616   1.00 44.46 ? 163 THR A N     1 
ATOM   1101 C CA    . THR C 3 35  ? 0.829   -15.464 8.277   1.00 46.04 ? 163 THR A CA    1 
ATOM   1102 C C     . THR C 3 35  ? 0.097   -15.507 9.626   1.00 46.69 ? 163 THR A C     1 
ATOM   1103 O O     . THR C 3 35  ? -0.153  -16.582 10.150  1.00 46.76 ? 163 THR A O     1 
ATOM   1104 C CB    . THR C 3 35  ? 0.324   -14.377 7.292   1.00 46.42 ? 163 THR A CB    1 
ATOM   1105 O OG1   . THR C 3 35  ? 0.312   -13.081 7.926   1.00 46.44 ? 163 THR A OG1   1 
ATOM   1106 C CG2   . THR C 3 35  ? -1.135  -14.662 6.785   1.00 48.67 ? 163 THR A CG2   1 
ATOM   1107 N N     . THR C 3 36  ? -0.200  -14.354 10.197  1.00 48.81 ? 164 THR A N     1 
ATOM   1108 C CA    . THR C 3 36  ? -0.893  -14.263 11.482  1.00 50.96 ? 164 THR A CA    1 
ATOM   1109 C C     . THR C 3 36  ? -2.376  -14.598 11.341  1.00 52.72 ? 164 THR A C     1 
ATOM   1110 O O     . THR C 3 36  ? -2.919  -14.633 10.215  1.00 53.72 ? 164 THR A O     1 
ATOM   1111 C CB    . THR C 3 36  ? -0.782  -12.834 12.037  1.00 50.67 ? 164 THR A CB    1 
ATOM   1112 O OG1   . THR C 3 36  ? -0.967  -11.902 10.968  1.00 49.97 ? 164 THR A OG1   1 
ATOM   1113 C CG2   . THR C 3 36  ? 0.632   -12.557 12.551  1.00 50.43 ? 164 THR A CG2   1 
ATOM   1114 N N     . LYS C 3 37  ? -3.031  -14.814 12.480  1.00 54.34 ? 165 LYS A N     1 
ATOM   1115 C CA    . LYS C 3 37  ? -4.506  -14.876 12.544  1.00 56.29 ? 165 LYS A CA    1 
ATOM   1116 C C     . LYS C 3 37  ? -5.241  -13.649 11.933  1.00 57.07 ? 165 LYS A C     1 
ATOM   1117 O O     . LYS C 3 37  ? -6.241  -13.820 11.219  1.00 57.06 ? 165 LYS A O     1 
ATOM   1118 C CB    . LYS C 3 37  ? -4.960  -15.147 13.985  1.00 56.74 ? 165 LYS A CB    1 
ATOM   1119 C CG    . LYS C 3 37  ? -4.929  -16.632 14.337  1.00 57.11 ? 165 LYS A CG    1 
ATOM   1120 C CD    . LYS C 3 37  ? -4.596  -16.905 15.806  1.00 60.40 ? 165 LYS A CD    1 
ATOM   1121 C CE    . LYS C 3 37  ? -4.614  -18.443 16.106  1.00 59.75 ? 165 LYS A CE    1 
ATOM   1122 N NZ    . LYS C 3 37  ? -4.297  -18.844 17.525  1.00 58.55 ? 165 LYS A NZ    1 
ATOM   1123 N N     . GLU C 3 38  ? -4.717  -12.443 12.180  1.00 58.03 ? 166 GLU A N     1 
ATOM   1124 C CA    . GLU C 3 38  ? -5.332  -11.174 11.759  1.00 59.66 ? 166 GLU A CA    1 
ATOM   1125 C C     . GLU C 3 38  ? -5.357  -10.974 10.265  1.00 59.55 ? 166 GLU A C     1 
ATOM   1126 O O     . GLU C 3 38  ? -6.186  -10.254 9.720   1.00 60.85 ? 166 GLU A O     1 
ATOM   1127 C CB    . GLU C 3 38  ? -4.516  -10.003 12.295  1.00 60.58 ? 166 GLU A CB    1 
ATOM   1128 C CG    . GLU C 3 38  ? -4.883  -9.499  13.669  1.00 64.65 ? 166 GLU A CG    1 
ATOM   1129 C CD    . GLU C 3 38  ? -4.346  -10.371 14.789  1.00 69.70 ? 166 GLU A CD    1 
ATOM   1130 O OE1   . GLU C 3 38  ? -4.223  -11.620 14.611  1.00 69.85 ? 166 GLU A OE1   1 
ATOM   1131 O OE2   . GLU C 3 38  ? -4.059  -9.779  15.868  1.00 73.16 ? 166 GLU A OE2   1 
ATOM   1132 N N     . LYS C 3 39  ? -4.384  -11.548 9.598   1.00 58.93 ? 167 LYS A N     1 
ATOM   1133 C CA    . LYS C 3 39  ? -4.138  -11.161 8.234   1.00 57.88 ? 167 LYS A CA    1 
ATOM   1134 C C     . LYS C 3 39  ? -4.744  -12.206 7.359   1.00 56.94 ? 167 LYS A C     1 
ATOM   1135 O O     . LYS C 3 39  ? -5.085  -11.902 6.223   1.00 57.61 ? 167 LYS A O     1 
ATOM   1136 C CB    . LYS C 3 39  ? -2.625  -11.040 7.982   1.00 57.77 ? 167 LYS A CB    1 
ATOM   1137 C CG    . LYS C 3 39  ? -2.180  -9.861  7.101   1.00 58.76 ? 167 LYS A CG    1 
ATOM   1138 C CD    . LYS C 3 39  ? -2.733  -8.485  7.516   1.00 60.96 ? 167 LYS A CD    1 
ATOM   1139 C CE    . LYS C 3 39  ? -3.136  -8.376  9.017   1.00 64.34 ? 167 LYS A CE    1 
ATOM   1140 N NZ    . LYS C 3 39  ? -2.124  -8.878  10.033  1.00 66.66 ? 167 LYS A NZ    1 
ATOM   1141 N N     . ALA C 3 40  ? -4.867  -13.438 7.887   1.00 55.25 ? 168 ALA A N     1 
ATOM   1142 C CA    . ALA C 3 40  ? -5.401  -14.569 7.130   1.00 53.05 ? 168 ALA A CA    1 
ATOM   1143 C C     . ALA C 3 40  ? -6.833  -14.271 6.712   1.00 51.84 ? 168 ALA A C     1 
ATOM   1144 O O     . ALA C 3 40  ? -7.205  -14.541 5.558   1.00 50.29 ? 168 ALA A O     1 
ATOM   1145 C CB    . ALA C 3 40  ? -5.305  -15.879 7.924   1.00 52.98 ? 168 ALA A CB    1 
ATOM   1146 N N     . ALA C 3 41  ? -7.597  -13.679 7.642   1.00 50.72 ? 169 ALA A N     1 
ATOM   1147 C CA    . ALA C 3 41  ? -9.006  -13.261 7.406   1.00 50.98 ? 169 ALA A CA    1 
ATOM   1148 C C     . ALA C 3 41  ? -9.119  -12.292 6.251   1.00 50.84 ? 169 ALA A C     1 
ATOM   1149 O O     . ALA C 3 41  ? -9.785  -12.600 5.258   1.00 51.31 ? 169 ALA A O     1 
ATOM   1150 C CB    . ALA C 3 41  ? -9.638  -12.678 8.644   1.00 50.42 ? 169 ALA A CB    1 
ATOM   1151 N N     . LEU C 3 42  ? -8.434  -11.151 6.365   1.00 51.05 ? 170 LEU A N     1 
ATOM   1152 C CA    . LEU C 3 42  ? -8.370  -10.166 5.283   1.00 50.19 ? 170 LEU A CA    1 
ATOM   1153 C C     . LEU C 3 42  ? -7.813  -10.775 4.003   1.00 48.64 ? 170 LEU A C     1 
ATOM   1154 O O     . LEU C 3 42  ? -8.390  -10.612 2.937   1.00 48.93 ? 170 LEU A O     1 
ATOM   1155 C CB    . LEU C 3 42  ? -7.593  -8.904  5.710   1.00 50.72 ? 170 LEU A CB    1 
ATOM   1156 C CG    . LEU C 3 42  ? -7.138  -7.861  4.666   1.00 52.19 ? 170 LEU A CG    1 
ATOM   1157 C CD1   . LEU C 3 42  ? -8.301  -7.284  3.804   1.00 53.37 ? 170 LEU A CD1   1 
ATOM   1158 C CD2   . LEU C 3 42  ? -6.340  -6.719  5.327   1.00 52.21 ? 170 LEU A CD2   1 
ATOM   1159 N N     . LEU C 3 43  ? -6.731  -11.522 4.097   1.00 48.01 ? 171 LEU A N     1 
ATOM   1160 C CA    . LEU C 3 43  ? -6.063  -12.016 2.895   1.00 47.04 ? 171 LEU A CA    1 
ATOM   1161 C C     . LEU C 3 43  ? -6.924  -12.970 2.084   1.00 46.45 ? 171 LEU A C     1 
ATOM   1162 O O     . LEU C 3 43  ? -6.973  -12.877 0.876   1.00 47.31 ? 171 LEU A O     1 
ATOM   1163 C CB    . LEU C 3 43  ? -4.676  -12.593 3.217   1.00 47.06 ? 171 LEU A CB    1 
ATOM   1164 C CG    . LEU C 3 43  ? -3.498  -11.648 2.928   1.00 47.16 ? 171 LEU A CG    1 
ATOM   1165 C CD1   . LEU C 3 43  ? -2.220  -12.290 3.336   1.00 46.82 ? 171 LEU A CD1   1 
ATOM   1166 C CD2   . LEU C 3 43  ? -3.386  -11.245 1.443   1.00 44.80 ? 171 LEU A CD2   1 
ATOM   1167 N N     . TYR C 3 44  ? -7.646  -13.845 2.759   1.00 45.39 ? 172 TYR A N     1 
ATOM   1168 C CA    . TYR C 3 44  ? -8.532  -14.806 2.144   1.00 45.05 ? 172 TYR A CA    1 
ATOM   1169 C C     . TYR C 3 44  ? -9.472  -14.226 1.085   1.00 46.28 ? 172 TYR A C     1 
ATOM   1170 O O     . TYR C 3 44  ? -9.607  -14.782 -0.019  1.00 46.69 ? 172 TYR A O     1 
ATOM   1171 C CB    . TYR C 3 44  ? -9.319  -15.451 3.264   1.00 44.35 ? 172 TYR A CB    1 
ATOM   1172 C CG    . TYR C 3 44  ? -10.295 -16.534 2.925   1.00 42.57 ? 172 TYR A CG    1 
ATOM   1173 C CD1   . TYR C 3 44  ? -9.980  -17.860 3.173   1.00 40.57 ? 172 TYR A CD1   1 
ATOM   1174 C CD2   . TYR C 3 44  ? -11.574 -16.234 2.448   1.00 42.23 ? 172 TYR A CD2   1 
ATOM   1175 C CE1   . TYR C 3 44  ? -10.875 -18.879 2.914   1.00 39.88 ? 172 TYR A CE1   1 
ATOM   1176 C CE2   . TYR C 3 44  ? -12.504 -17.264 2.194   1.00 42.84 ? 172 TYR A CE2   1 
ATOM   1177 C CZ    . TYR C 3 44  ? -12.131 -18.578 2.443   1.00 40.73 ? 172 TYR A CZ    1 
ATOM   1178 O OH    . TYR C 3 44  ? -12.999 -19.592 2.206   1.00 42.85 ? 172 TYR A OH    1 
ATOM   1179 N N     . LYS C 3 45  ? -10.111 -13.111 1.409   1.00 47.08 ? 173 LYS A N     1 
ATOM   1180 C CA    . LYS C 3 45  ? -11.091 -12.515 0.530   1.00 48.03 ? 173 LYS A CA    1 
ATOM   1181 C C     . LYS C 3 45  ? -10.362 -11.817 -0.602  1.00 48.33 ? 173 LYS A C     1 
ATOM   1182 O O     . LYS C 3 45  ? -10.644 -12.030 -1.798  1.00 48.21 ? 173 LYS A O     1 
ATOM   1183 C CB    . LYS C 3 45  ? -11.917 -11.502 1.324   1.00 48.78 ? 173 LYS A CB    1 
ATOM   1184 C CG    . LYS C 3 45  ? -12.530 -12.054 2.638   1.00 52.18 ? 173 LYS A CG    1 
ATOM   1185 C CD    . LYS C 3 45  ? -12.243 -11.117 3.832   1.00 56.38 ? 173 LYS A CD    1 
ATOM   1186 C CE    . LYS C 3 45  ? -13.042 -9.803  3.767   1.00 58.88 ? 173 LYS A CE    1 
ATOM   1187 N NZ    . LYS C 3 45  ? -14.259 -9.872  4.606   1.00 59.78 ? 173 LYS A NZ    1 
ATOM   1188 N N     . LYS C 3 46  ? -9.415  -10.975 -0.209  1.00 48.88 ? 174 LYS A N     1 
ATOM   1189 C CA    . LYS C 3 46  ? -8.637  -10.173 -1.145  1.00 49.30 ? 174 LYS A CA    1 
ATOM   1190 C C     . LYS C 3 46  ? -8.034  -11.054 -2.232  1.00 49.40 ? 174 LYS A C     1 
ATOM   1191 O O     . LYS C 3 46  ? -8.273  -10.832 -3.438  1.00 50.35 ? 174 LYS A O     1 
ATOM   1192 C CB    . LYS C 3 46  ? -7.554  -9.418  -0.379  1.00 49.72 ? 174 LYS A CB    1 
ATOM   1193 C CG    . LYS C 3 46  ? -8.100  -8.468  0.648   1.00 49.61 ? 174 LYS A CG    1 
ATOM   1194 C CD    . LYS C 3 46  ? -8.933  -7.408  -0.034  1.00 53.16 ? 174 LYS A CD    1 
ATOM   1195 C CE    . LYS C 3 46  ? -8.393  -6.007  0.191   1.00 56.16 ? 174 LYS A CE    1 
ATOM   1196 N NZ    . LYS C 3 46  ? -9.407  -4.965  -0.297  1.00 55.41 ? 174 LYS A NZ    1 
ATOM   1197 N N     . ILE C 3 47  ? -7.277  -12.061 -1.782  1.00 48.65 ? 175 ILE A N     1 
ATOM   1198 C CA    . ILE C 3 47  ? -6.673  -13.072 -2.624  1.00 48.11 ? 175 ILE A CA    1 
ATOM   1199 C C     . ILE C 3 47  ? -7.690  -13.806 -3.487  1.00 48.97 ? 175 ILE A C     1 
ATOM   1200 O O     . ILE C 3 47  ? -7.479  -13.986 -4.694  1.00 47.99 ? 175 ILE A O     1 
ATOM   1201 C CB    . ILE C 3 47  ? -5.811  -14.021 -1.748  1.00 47.71 ? 175 ILE A CB    1 
ATOM   1202 C CG1   . ILE C 3 47  ? -4.438  -13.384 -1.566  1.00 47.45 ? 175 ILE A CG1   1 
ATOM   1203 C CG2   . ILE C 3 47  ? -5.640  -15.392 -2.381  1.00 46.15 ? 175 ILE A CG2   1 
ATOM   1204 C CD1   . ILE C 3 47  ? -3.483  -14.274 -0.950  1.00 48.71 ? 175 ILE A CD1   1 
ATOM   1205 N N     . MET C 3 48  ? -8.800  -14.211 -2.860  1.00 50.26 ? 176 MET A N     1 
ATOM   1206 C CA    . MET C 3 48  ? -9.931  -14.794 -3.576  1.00 52.04 ? 176 MET A CA    1 
ATOM   1207 C C     . MET C 3 48  ? -10.379 -13.934 -4.751  1.00 52.10 ? 176 MET A C     1 
ATOM   1208 O O     . MET C 3 48  ? -10.423 -14.412 -5.867  1.00 52.76 ? 176 MET A O     1 
ATOM   1209 C CB    . MET C 3 48  ? -11.107 -15.044 -2.637  1.00 51.77 ? 176 MET A CB    1 
ATOM   1210 C CG    . MET C 3 48  ? -12.276 -15.717 -3.327  1.00 52.89 ? 176 MET A CG    1 
ATOM   1211 S SD    . MET C 3 48  ? -13.659 -15.874 -2.212  1.00 53.82 ? 176 MET A SD    1 
ATOM   1212 C CE    . MET C 3 48  ? -14.329 -17.403 -2.839  1.00 52.82 ? 176 MET A CE    1 
ATOM   1213 N N     . GLU C 3 49  ? -10.698 -12.671 -4.490  1.00 53.10 ? 177 GLU A N     1 
ATOM   1214 C CA    . GLU C 3 49  ? -11.101 -11.743 -5.541  1.00 54.13 ? 177 GLU A CA    1 
ATOM   1215 C C     . GLU C 3 49  ? -9.996  -11.500 -6.564  1.00 53.70 ? 177 GLU A C     1 
ATOM   1216 O O     . GLU C 3 49  ? -10.234 -11.662 -7.767  1.00 53.71 ? 177 GLU A O     1 
ATOM   1217 C CB    . GLU C 3 49  ? -11.612 -10.415 -4.948  1.00 55.52 ? 177 GLU A CB    1 
ATOM   1218 C CG    . GLU C 3 49  ? -13.149 -10.275 -4.865  1.00 59.63 ? 177 GLU A CG    1 
ATOM   1219 C CD    . GLU C 3 49  ? -13.835 -11.352 -4.007  1.00 64.14 ? 177 GLU A CD    1 
ATOM   1220 O OE1   . GLU C 3 49  ? -13.880 -11.198 -2.739  1.00 67.05 ? 177 GLU A OE1   1 
ATOM   1221 O OE2   . GLU C 3 49  ? -14.334 -12.352 -4.601  1.00 62.56 ? 177 GLU A OE2   1 
ATOM   1222 N N     . LYS C 3 50  ? -8.783  -11.153 -6.109  1.00 53.00 ? 178 LYS A N     1 
ATOM   1223 C CA    . LYS C 3 50  ? -7.696  -10.836 -7.047  1.00 52.32 ? 178 LYS A CA    1 
ATOM   1224 C C     . LYS C 3 50  ? -7.387  -11.933 -8.068  1.00 51.31 ? 178 LYS A C     1 
ATOM   1225 O O     . LYS C 3 50  ? -7.152  -11.662 -9.248  1.00 50.44 ? 178 LYS A O     1 
ATOM   1226 C CB    . LYS C 3 50  ? -6.425  -10.516 -6.289  1.00 53.33 ? 178 LYS A CB    1 
ATOM   1227 C CG    . LYS C 3 50  ? -5.259  -10.102 -7.191  1.00 55.58 ? 178 LYS A CG    1 
ATOM   1228 C CD    . LYS C 3 50  ? -5.422  -8.642  -7.696  1.00 59.60 ? 178 LYS A CD    1 
ATOM   1229 C CE    . LYS C 3 50  ? -4.099  -8.061  -8.215  1.00 60.16 ? 178 LYS A CE    1 
ATOM   1230 N NZ    . LYS C 3 50  ? -3.536  -8.870  -9.348  1.00 60.96 ? 178 LYS A NZ    1 
ATOM   1231 N N     . TYR C 3 51  ? -7.378  -13.180 -7.609  1.00 50.11 ? 179 TYR A N     1 
ATOM   1232 C CA    . TYR C 3 51  ? -6.829  -14.237 -8.422  1.00 49.03 ? 179 TYR A CA    1 
ATOM   1233 C C     . TYR C 3 51  ? -7.892  -15.175 -8.914  1.00 49.91 ? 179 TYR A C     1 
ATOM   1234 O O     . TYR C 3 51  ? -7.581  -16.161 -9.616  1.00 49.95 ? 179 TYR A O     1 
ATOM   1235 C CB    . TYR C 3 51  ? -5.710  -14.943 -7.655  1.00 49.17 ? 179 TYR A CB    1 
ATOM   1236 C CG    . TYR C 3 51  ? -4.501  -14.048 -7.475  1.00 45.80 ? 179 TYR A CG    1 
ATOM   1237 C CD1   . TYR C 3 51  ? -3.794  -13.607 -8.587  1.00 43.52 ? 179 TYR A CD1   1 
ATOM   1238 C CD2   . TYR C 3 51  ? -4.113  -13.584 -6.206  1.00 45.74 ? 179 TYR A CD2   1 
ATOM   1239 C CE1   . TYR C 3 51  ? -2.689  -12.748 -8.450  1.00 46.71 ? 179 TYR A CE1   1 
ATOM   1240 C CE2   . TYR C 3 51  ? -2.978  -12.707 -6.046  1.00 45.23 ? 179 TYR A CE2   1 
ATOM   1241 C CZ    . TYR C 3 51  ? -2.278  -12.321 -7.191  1.00 45.91 ? 179 TYR A CZ    1 
ATOM   1242 O OH    . TYR C 3 51  ? -1.193  -11.501 -7.139  1.00 45.99 ? 179 TYR A OH    1 
ATOM   1243 N N     . SER C 3 52  ? -9.151  -14.835 -8.587  1.00 49.79 ? 180 SER A N     1 
ATOM   1244 C CA    . SER C 3 52  ? -10.316 -15.588 -9.036  1.00 50.01 ? 180 SER A CA    1 
ATOM   1245 C C     . SER C 3 52  ? -10.125 -17.080 -8.771  1.00 49.99 ? 180 SER A C     1 
ATOM   1246 O O     . SER C 3 52  ? -10.206 -17.914 -9.680  1.00 49.41 ? 180 SER A O     1 
ATOM   1247 C CB    . SER C 3 52  ? -10.563 -15.324 -10.523 1.00 50.14 ? 180 SER A CB    1 
ATOM   1248 O OG    . SER C 3 52  ? -10.735 -13.929 -10.765 1.00 51.62 ? 180 SER A OG    1 
ATOM   1249 N N     . VAL C 3 53  ? -9.858  -17.396 -7.509  1.00 49.90 ? 181 VAL A N     1 
ATOM   1250 C CA    . VAL C 3 53  ? -9.393  -18.720 -7.114  1.00 49.84 ? 181 VAL A CA    1 
ATOM   1251 C C     . VAL C 3 53  ? -10.377 -19.852 -7.476  1.00 49.95 ? 181 VAL A C     1 
ATOM   1252 O O     . VAL C 3 53  ? -11.578 -19.758 -7.218  1.00 50.49 ? 181 VAL A O     1 
ATOM   1253 C CB    . VAL C 3 53  ? -9.054  -18.745 -5.582  1.00 50.61 ? 181 VAL A CB    1 
ATOM   1254 C CG1   . VAL C 3 53  ? -7.880  -17.777 -5.232  1.00 48.67 ? 181 VAL A CG1   1 
ATOM   1255 C CG2   . VAL C 3 53  ? -10.300 -18.430 -4.713  1.00 50.29 ? 181 VAL A CG2   1 
ATOM   1256 N N     . THR C 3 54  ? -9.882  -20.927 -8.073  1.00 49.68 ? 182 THR A N     1 
ATOM   1257 C CA    . THR C 3 54  ? -10.720 -22.097 -8.221  1.00 49.44 ? 182 THR A CA    1 
ATOM   1258 C C     . THR C 3 54  ? -10.896 -22.756 -6.852  1.00 49.03 ? 182 THR A C     1 
ATOM   1259 O O     . THR C 3 54  ? -11.881 -23.471 -6.622  1.00 50.31 ? 182 THR A O     1 
ATOM   1260 C CB    . THR C 3 54  ? -10.193 -23.099 -9.272  1.00 49.57 ? 182 THR A CB    1 
ATOM   1261 O OG1   . THR C 3 54  ? -8.935  -23.620 -8.849  1.00 51.56 ? 182 THR A OG1   1 
ATOM   1262 C CG2   . THR C 3 54  ? -9.877  -22.408 -10.583 1.00 48.61 ? 182 THR A CG2   1 
ATOM   1263 N N     . PHE C 3 55  ? -9.981  -22.506 -5.924  1.00 47.63 ? 183 PHE A N     1 
ATOM   1264 C CA    . PHE C 3 55  ? -10.183 -22.990 -4.546  1.00 46.21 ? 183 PHE A CA    1 
ATOM   1265 C C     . PHE C 3 55  ? -9.396  -22.160 -3.529  1.00 45.13 ? 183 PHE A C     1 
ATOM   1266 O O     . PHE C 3 55  ? -8.355  -21.667 -3.858  1.00 45.99 ? 183 PHE A O     1 
ATOM   1267 C CB    . PHE C 3 55  ? -9.866  -24.510 -4.445  1.00 45.14 ? 183 PHE A CB    1 
ATOM   1268 C CG    . PHE C 3 55  ? -10.001 -25.056 -3.062  1.00 44.83 ? 183 PHE A CG    1 
ATOM   1269 C CD1   . PHE C 3 55  ? -11.262 -25.280 -2.504  1.00 44.83 ? 183 PHE A CD1   1 
ATOM   1270 C CD2   . PHE C 3 55  ? -8.875  -25.303 -2.285  1.00 43.78 ? 183 PHE A CD2   1 
ATOM   1271 C CE1   . PHE C 3 55  ? -11.391 -25.767 -1.207  1.00 41.84 ? 183 PHE A CE1   1 
ATOM   1272 C CE2   . PHE C 3 55  ? -8.994  -25.782 -1.001  1.00 42.39 ? 183 PHE A CE2   1 
ATOM   1273 C CZ    . PHE C 3 55  ? -10.263 -26.015 -0.461  1.00 45.11 ? 183 PHE A CZ    1 
ATOM   1274 N N     . ILE C 3 56  ? -9.927  -21.933 -2.336  1.00 44.61 ? 184 ILE A N     1 
ATOM   1275 C CA    . ILE C 3 56  ? -9.137  -21.373 -1.244  1.00 43.86 ? 184 ILE A CA    1 
ATOM   1276 C C     . ILE C 3 56  ? -9.598  -21.977 0.040   1.00 44.37 ? 184 ILE A C     1 
ATOM   1277 O O     . ILE C 3 56  ? -10.787 -22.169 0.223   1.00 45.37 ? 184 ILE A O     1 
ATOM   1278 C CB    . ILE C 3 56  ? -9.186  -19.801 -1.142  1.00 44.38 ? 184 ILE A CB    1 
ATOM   1279 C CG1   . ILE C 3 56  ? -8.055  -19.291 -0.218  1.00 42.22 ? 184 ILE A CG1   1 
ATOM   1280 C CG2   . ILE C 3 56  ? -10.514 -19.315 -0.604  1.00 43.63 ? 184 ILE A CG2   1 
ATOM   1281 C CD1   . ILE C 3 56  ? -7.615  -17.829 -0.445  1.00 42.33 ? 184 ILE A CD1   1 
ATOM   1282 N N     . SER C 3 57  ? -8.648  -22.294 0.915   1.00 44.77 ? 185 SER A N     1 
ATOM   1283 C CA    . SER C 3 57  ? -8.930  -22.699 2.291   1.00 44.70 ? 185 SER A CA    1 
ATOM   1284 C C     . SER C 3 57  ? -8.032  -21.950 3.262   1.00 44.20 ? 185 SER A C     1 
ATOM   1285 O O     . SER C 3 57  ? -6.949  -21.479 2.898   1.00 43.64 ? 185 SER A O     1 
ATOM   1286 C CB    . SER C 3 57  ? -8.742  -24.209 2.455   1.00 45.51 ? 185 SER A CB    1 
ATOM   1287 O OG    . SER C 3 57  ? -7.664  -24.707 1.661   1.00 47.09 ? 185 SER A OG    1 
ATOM   1288 N N     . ARG C 3 58  ? -8.512  -21.845 4.493   1.00 44.10 ? 186 ARG A N     1 
ATOM   1289 C CA    . ARG C 3 58  ? -7.833  -21.154 5.579   1.00 43.72 ? 186 ARG A CA    1 
ATOM   1290 C C     . ARG C 3 58  ? -7.621  -22.170 6.672   1.00 44.33 ? 186 ARG A C     1 
ATOM   1291 O O     . ARG C 3 58  ? -8.544  -22.893 7.007   1.00 44.46 ? 186 ARG A O     1 
ATOM   1292 C CB    . ARG C 3 58  ? -8.688  -20.039 6.123   1.00 44.00 ? 186 ARG A CB    1 
ATOM   1293 C CG    . ARG C 3 58  ? -7.969  -19.184 7.090   1.00 42.74 ? 186 ARG A CG    1 
ATOM   1294 C CD    . ARG C 3 58  ? -8.716  -17.958 7.438   1.00 42.45 ? 186 ARG A CD    1 
ATOM   1295 N NE    . ARG C 3 58  ? -8.345  -17.505 8.767   1.00 46.68 ? 186 ARG A NE    1 
ATOM   1296 C CZ    . ARG C 3 58  ? -9.055  -16.669 9.488   1.00 48.26 ? 186 ARG A CZ    1 
ATOM   1297 N NH1   . ARG C 3 58  ? -10.177 -16.185 8.996   1.00 51.84 ? 186 ARG A NH1   1 
ATOM   1298 N NH2   . ARG C 3 58  ? -8.657  -16.309 10.694  1.00 47.43 ? 186 ARG A NH2   1 
ATOM   1299 N N     . HIS C 3 59  ? -6.397  -22.262 7.201   1.00 44.68 ? 187 HIS A N     1 
ATOM   1300 C CA    . HIS C 3 59  ? -6.095  -23.310 8.149   1.00 44.91 ? 187 HIS A CA    1 
ATOM   1301 C C     . HIS C 3 59  ? -5.477  -22.858 9.469   1.00 46.41 ? 187 HIS A C     1 
ATOM   1302 O O     . HIS C 3 59  ? -4.855  -21.784 9.570   1.00 46.58 ? 187 HIS A O     1 
ATOM   1303 C CB    . HIS C 3 59  ? -5.229  -24.371 7.494   1.00 44.05 ? 187 HIS A CB    1 
ATOM   1304 C CG    . HIS C 3 59  ? -5.747  -24.838 6.176   1.00 41.05 ? 187 HIS A CG    1 
ATOM   1305 N ND1   . HIS C 3 59  ? -6.432  -26.023 6.025   1.00 38.67 ? 187 HIS A ND1   1 
ATOM   1306 C CD2   . HIS C 3 59  ? -5.648  -24.297 4.939   1.00 37.79 ? 187 HIS A CD2   1 
ATOM   1307 C CE1   . HIS C 3 59  ? -6.755  -26.174 4.749   1.00 36.33 ? 187 HIS A CE1   1 
ATOM   1308 N NE2   . HIS C 3 59  ? -6.306  -25.132 4.075   1.00 33.55 ? 187 HIS A NE2   1 
ATOM   1309 N N     . ASN C 3 60  ? -5.680  -23.679 10.491  1.00 47.88 ? 188 ASN A N     1 
ATOM   1310 C CA    . ASN C 3 60  ? -4.912  -23.554 11.713  1.00 50.30 ? 188 ASN A CA    1 
ATOM   1311 C C     . ASN C 3 60  ? -3.527  -24.158 11.663  1.00 50.88 ? 188 ASN A C     1 
ATOM   1312 O O     . ASN C 3 60  ? -3.343  -25.325 11.246  1.00 50.50 ? 188 ASN A O     1 
ATOM   1313 C CB    . ASN C 3 60  ? -5.657  -24.156 12.878  1.00 51.00 ? 188 ASN A CB    1 
ATOM   1314 C CG    . ASN C 3 60  ? -6.367  -23.118 13.658  1.00 53.97 ? 188 ASN A CG    1 
ATOM   1315 O OD1   . ASN C 3 60  ? -5.777  -22.069 14.002  1.00 56.38 ? 188 ASN A OD1   1 
ATOM   1316 N ND2   . ASN C 3 60  ? -7.662  -23.358 13.918  1.00 56.05 ? 188 ASN A ND2   1 
ATOM   1317 N N     . SER C 3 61  ? -2.565  -23.343 12.091  1.00 52.36 ? 189 SER A N     1 
ATOM   1318 C CA    . SER C 3 61  ? -1.172  -23.769 12.248  1.00 54.06 ? 189 SER A CA    1 
ATOM   1319 C C     . SER C 3 61  ? -0.480  -23.174 13.455  1.00 55.06 ? 189 SER A C     1 
ATOM   1320 O O     . SER C 3 61  ? -0.173  -21.999 13.452  1.00 56.11 ? 189 SER A O     1 
ATOM   1321 C CB    . SER C 3 61  ? -0.363  -23.369 11.048  1.00 53.49 ? 189 SER A CB    1 
ATOM   1322 O OG    . SER C 3 61  ? 0.522   -24.428 10.765  1.00 55.37 ? 189 SER A OG    1 
ATOM   1323 N N     . TYR C 3 62  ? -0.206  -23.983 14.469  1.00 56.24 ? 190 TYR A N     1 
ATOM   1324 C CA    . TYR C 3 62  ? 0.685   -23.576 15.550  1.00 57.41 ? 190 TYR A CA    1 
ATOM   1325 C C     . TYR C 3 62  ? 0.503   -22.120 15.885  1.00 58.59 ? 190 TYR A C     1 
ATOM   1326 O O     . TYR C 3 62  ? 1.444   -21.342 15.715  1.00 60.02 ? 190 TYR A O     1 
ATOM   1327 C CB    . TYR C 3 62  ? 2.169   -23.813 15.172  1.00 57.47 ? 190 TYR A CB    1 
ATOM   1328 C CG    . TYR C 3 62  ? 2.589   -25.283 15.074  1.00 57.03 ? 190 TYR A CG    1 
ATOM   1329 C CD1   . TYR C 3 62  ? 3.174   -25.937 16.164  1.00 55.29 ? 190 TYR A CD1   1 
ATOM   1330 C CD2   . TYR C 3 62  ? 2.397   -26.010 13.888  1.00 54.62 ? 190 TYR A CD2   1 
ATOM   1331 C CE1   . TYR C 3 62  ? 3.555   -27.281 16.074  1.00 55.59 ? 190 TYR A CE1   1 
ATOM   1332 C CE2   . TYR C 3 62  ? 2.757   -27.329 13.794  1.00 54.96 ? 190 TYR A CE2   1 
ATOM   1333 C CZ    . TYR C 3 62  ? 3.349   -27.974 14.885  1.00 56.53 ? 190 TYR A CZ    1 
ATOM   1334 O OH    . TYR C 3 62  ? 3.727   -29.313 14.785  1.00 55.62 ? 190 TYR A OH    1 
ATOM   1335 N N     . ASN C 3 63  ? -0.689  -21.738 16.346  1.00 59.70 ? 191 ASN A N     1 
ATOM   1336 C CA    . ASN C 3 63  ? -0.971  -20.334 16.750  1.00 60.57 ? 191 ASN A CA    1 
ATOM   1337 C C     . ASN C 3 63  ? -0.902  -19.263 15.659  1.00 59.58 ? 191 ASN A C     1 
ATOM   1338 O O     . ASN C 3 63  ? -0.985  -18.071 15.961  1.00 60.45 ? 191 ASN A O     1 
ATOM   1339 C CB    . ASN C 3 63  ? -0.108  -19.884 17.954  1.00 61.94 ? 191 ASN A CB    1 
ATOM   1340 C CG    . ASN C 3 63  ? -0.733  -20.251 19.320  1.00 64.37 ? 191 ASN A CG    1 
ATOM   1341 O OD1   . ASN C 3 63  ? -1.208  -19.370 20.060  1.00 64.79 ? 191 ASN A OD1   1 
ATOM   1342 N ND2   . ASN C 3 63  ? -0.722  -21.551 19.652  1.00 66.25 ? 191 ASN A ND2   1 
ATOM   1343 N N     . HIS C 3 64  ? -0.743  -19.681 14.412  1.00 58.05 ? 192 HIS A N     1 
ATOM   1344 C CA    . HIS C 3 64  ? -0.986  -18.813 13.261  1.00 57.03 ? 192 HIS A CA    1 
ATOM   1345 C C     . HIS C 3 64  ? -1.869  -19.554 12.210  1.00 55.14 ? 192 HIS A C     1 
ATOM   1346 O O     . HIS C 3 64  ? -2.471  -20.595 12.516  1.00 53.82 ? 192 HIS A O     1 
ATOM   1347 C CB    . HIS C 3 64  ? 0.342   -18.365 12.654  1.00 57.98 ? 192 HIS A CB    1 
ATOM   1348 C CG    . HIS C 3 64  ? 1.322   -17.799 13.646  1.00 62.13 ? 192 HIS A CG    1 
ATOM   1349 N ND1   . HIS C 3 64  ? 2.136   -18.592 14.437  1.00 63.93 ? 192 HIS A ND1   1 
ATOM   1350 C CD2   . HIS C 3 64  ? 1.656   -16.515 13.934  1.00 64.90 ? 192 HIS A CD2   1 
ATOM   1351 C CE1   . HIS C 3 64  ? 2.911   -17.817 15.178  1.00 65.72 ? 192 HIS A CE1   1 
ATOM   1352 N NE2   . HIS C 3 64  ? 2.641   -16.553 14.891  1.00 63.87 ? 192 HIS A NE2   1 
ATOM   1353 N N     . ASN C 3 65  ? -1.923  -19.033 10.981  1.00 53.64 ? 193 ASN A N     1 
ATOM   1354 C CA    . ASN C 3 65  ? -2.814  -19.538 9.943   1.00 52.67 ? 193 ASN A CA    1 
ATOM   1355 C C     . ASN C 3 65  ? -2.119  -19.706 8.610   1.00 52.23 ? 193 ASN A C     1 
ATOM   1356 O O     . ASN C 3 65  ? -1.178  -18.970 8.280   1.00 51.90 ? 193 ASN A O     1 
ATOM   1357 C CB    . ASN C 3 65  ? -4.000  -18.579 9.709   1.00 53.32 ? 193 ASN A CB    1 
ATOM   1358 C CG    . ASN C 3 65  ? -5.043  -18.588 10.826  1.00 54.47 ? 193 ASN A CG    1 
ATOM   1359 O OD1   . ASN C 3 65  ? -5.896  -17.711 10.859  1.00 57.51 ? 193 ASN A OD1   1 
ATOM   1360 N ND2   . ASN C 3 65  ? -4.992  -19.567 11.723  1.00 56.51 ? 193 ASN A ND2   1 
ATOM   1361 N N     . ILE C 3 66  ? -2.634  -20.656 7.823   1.00 51.33 ? 194 ILE A N     1 
ATOM   1362 C CA    . ILE C 3 66  ? -2.139  -20.950 6.490   1.00 49.92 ? 194 ILE A CA    1 
ATOM   1363 C C     . ILE C 3 66  ? -3.281  -20.837 5.469   1.00 49.16 ? 194 ILE A C     1 
ATOM   1364 O O     . ILE C 3 66  ? -4.384  -21.337 5.683   1.00 49.04 ? 194 ILE A O     1 
ATOM   1365 C CB    . ILE C 3 66  ? -1.491  -22.360 6.447   1.00 50.18 ? 194 ILE A CB    1 
ATOM   1366 C CG1   . ILE C 3 66  ? -0.298  -22.446 7.401   1.00 50.96 ? 194 ILE A CG1   1 
ATOM   1367 C CG2   . ILE C 3 66  ? -0.969  -22.678 5.087   1.00 49.43 ? 194 ILE A CG2   1 
ATOM   1368 C CD1   . ILE C 3 66  ? 0.131   -23.876 7.741   1.00 50.01 ? 194 ILE A CD1   1 
ATOM   1369 N N     . LEU C 3 67  ? -2.999  -20.164 4.362   1.00 47.40 ? 195 LEU A N     1 
ATOM   1370 C CA    . LEU C 3 67  ? -3.934  -20.042 3.288   1.00 46.08 ? 195 LEU A CA    1 
ATOM   1371 C C     . LEU C 3 67  ? -3.408  -20.877 2.141   1.00 45.36 ? 195 LEU A C     1 
ATOM   1372 O O     . LEU C 3 67  ? -2.292  -20.670 1.675   1.00 44.21 ? 195 LEU A O     1 
ATOM   1373 C CB    . LEU C 3 67  ? -4.072  -18.582 2.832   1.00 45.80 ? 195 LEU A CB    1 
ATOM   1374 C CG    . LEU C 3 67  ? -4.503  -17.565 3.877   1.00 44.78 ? 195 LEU A CG    1 
ATOM   1375 C CD1   . LEU C 3 67  ? -4.418  -16.174 3.299   1.00 42.00 ? 195 LEU A CD1   1 
ATOM   1376 C CD2   . LEU C 3 67  ? -5.945  -17.890 4.261   1.00 44.95 ? 195 LEU A CD2   1 
ATOM   1377 N N     . PHE C 3 68  ? -4.235  -21.813 1.684   1.00 43.95 ? 196 PHE A N     1 
ATOM   1378 C CA    . PHE C 3 68  ? -3.890  -22.636 0.558   1.00 43.34 ? 196 PHE A CA    1 
ATOM   1379 C C     . PHE C 3 68  ? -4.855  -22.248 -0.555  1.00 43.04 ? 196 PHE A C     1 
ATOM   1380 O O     . PHE C 3 68  ? -6.024  -21.984 -0.294  1.00 44.22 ? 196 PHE A O     1 
ATOM   1381 C CB    . PHE C 3 68  ? -4.013  -24.096 0.991   1.00 43.63 ? 196 PHE A CB    1 
ATOM   1382 C CG    . PHE C 3 68  ? -3.997  -25.077 -0.131  1.00 43.49 ? 196 PHE A CG    1 
ATOM   1383 C CD1   . PHE C 3 68  ? -2.847  -25.767 -0.437  1.00 43.68 ? 196 PHE A CD1   1 
ATOM   1384 C CD2   . PHE C 3 68  ? -5.150  -25.338 -0.864  1.00 43.12 ? 196 PHE A CD2   1 
ATOM   1385 C CE1   . PHE C 3 68  ? -2.843  -26.655 -1.492  1.00 44.19 ? 196 PHE A CE1   1 
ATOM   1386 C CE2   . PHE C 3 68  ? -5.138  -26.228 -1.907  1.00 38.66 ? 196 PHE A CE2   1 
ATOM   1387 C CZ    . PHE C 3 68  ? -4.021  -26.893 -2.200  1.00 41.50 ? 196 PHE A CZ    1 
ATOM   1388 N N     . PHE C 3 69  ? -4.387  -22.165 -1.787  1.00 42.03 ? 197 PHE A N     1 
ATOM   1389 C CA    . PHE C 3 69  ? -5.283  -21.763 -2.875  1.00 41.57 ? 197 PHE A CA    1 
ATOM   1390 C C     . PHE C 3 69  ? -4.782  -22.186 -4.233  1.00 42.49 ? 197 PHE A C     1 
ATOM   1391 O O     . PHE C 3 69  ? -3.554  -22.230 -4.459  1.00 42.20 ? 197 PHE A O     1 
ATOM   1392 C CB    . PHE C 3 69  ? -5.630  -20.243 -2.865  1.00 40.23 ? 197 PHE A CB    1 
ATOM   1393 C CG    . PHE C 3 69  ? -4.421  -19.281 -2.815  1.00 38.49 ? 197 PHE A CG    1 
ATOM   1394 C CD1   . PHE C 3 69  ? -3.889  -18.852 -1.580  1.00 36.63 ? 197 PHE A CD1   1 
ATOM   1395 C CD2   . PHE C 3 69  ? -3.880  -18.754 -3.987  1.00 32.14 ? 197 PHE A CD2   1 
ATOM   1396 C CE1   . PHE C 3 69  ? -2.818  -17.924 -1.511  1.00 34.56 ? 197 PHE A CE1   1 
ATOM   1397 C CE2   . PHE C 3 69  ? -2.833  -17.836 -3.945  1.00 32.13 ? 197 PHE A CE2   1 
ATOM   1398 C CZ    . PHE C 3 69  ? -2.280  -17.411 -2.696  1.00 33.98 ? 197 PHE A CZ    1 
ATOM   1399 N N     . LEU C 3 70  ? -5.750  -22.498 -5.113  1.00 42.92 ? 198 LEU A N     1 
ATOM   1400 C CA    . LEU C 3 70  ? -5.496  -22.811 -6.510  1.00 43.57 ? 198 LEU A CA    1 
ATOM   1401 C C     . LEU C 3 70  ? -6.028  -21.660 -7.317  1.00 43.85 ? 198 LEU A C     1 
ATOM   1402 O O     . LEU C 3 70  ? -6.923  -20.956 -6.846  1.00 43.79 ? 198 LEU A O     1 
ATOM   1403 C CB    . LEU C 3 70  ? -6.120  -24.160 -6.941  1.00 43.84 ? 198 LEU A CB    1 
ATOM   1404 C CG    . LEU C 3 70  ? -5.364  -25.443 -6.515  1.00 44.49 ? 198 LEU A CG    1 
ATOM   1405 C CD1   . LEU C 3 70  ? -5.554  -25.717 -5.049  1.00 44.69 ? 198 LEU A CD1   1 
ATOM   1406 C CD2   . LEU C 3 70  ? -5.815  -26.648 -7.314  1.00 44.56 ? 198 LEU A CD2   1 
ATOM   1407 N N     . THR C 3 71  ? -5.435  -21.447 -8.499  1.00 44.29 ? 199 THR A N     1 
ATOM   1408 C CA    . THR C 3 71  ? -5.715  -20.306 -9.378  1.00 45.24 ? 199 THR A CA    1 
ATOM   1409 C C     . THR C 3 71  ? -5.911  -20.883 -10.803 1.00 46.22 ? 199 THR A C     1 
ATOM   1410 O O     . THR C 3 71  ? -5.265  -21.868 -11.164 1.00 45.89 ? 199 THR A O     1 
ATOM   1411 C CB    . THR C 3 71  ? -4.576  -19.182 -9.324  1.00 45.51 ? 199 THR A CB    1 
ATOM   1412 O OG1   . THR C 3 71  ? -3.307  -19.720 -9.697  1.00 46.88 ? 199 THR A OG1   1 
ATOM   1413 C CG2   . THR C 3 71  ? -4.314  -18.658 -7.919  1.00 44.88 ? 199 THR A CG2   1 
ATOM   1414 N N     . PRO C 3 72  ? -6.869  -20.354 -11.579 1.00 47.23 ? 200 PRO A N     1 
ATOM   1415 C CA    . PRO C 3 72  ? -7.178  -20.950 -12.893 1.00 47.38 ? 200 PRO A CA    1 
ATOM   1416 C C     . PRO C 3 72  ? -6.104  -20.583 -13.898 1.00 48.24 ? 200 PRO A C     1 
ATOM   1417 O O     . PRO C 3 72  ? -5.986  -21.222 -14.926 1.00 48.98 ? 200 PRO A O     1 
ATOM   1418 C CB    . PRO C 3 72  ? -8.506  -20.300 -13.272 1.00 47.41 ? 200 PRO A CB    1 
ATOM   1419 C CG    . PRO C 3 72  ? -8.522  -18.969 -12.504 1.00 47.15 ? 200 PRO A CG    1 
ATOM   1420 C CD    . PRO C 3 72  ? -7.737  -19.192 -11.257 1.00 46.75 ? 200 PRO A CD    1 
ATOM   1421 N N     . HIS C 3 73  ? -5.340  -19.544 -13.569 1.00 48.84 ? 201 HIS A N     1 
ATOM   1422 C CA    . HIS C 3 73  ? -4.168  -19.078 -14.318 1.00 49.23 ? 201 HIS A CA    1 
ATOM   1423 C C     . HIS C 3 73  ? -2.825  -19.188 -13.554 1.00 48.66 ? 201 HIS A C     1 
ATOM   1424 O O     . HIS C 3 73  ? -2.809  -19.240 -12.307 1.00 47.74 ? 201 HIS A O     1 
ATOM   1425 C CB    . HIS C 3 73  ? -4.440  -17.656 -14.796 1.00 49.06 ? 201 HIS A CB    1 
ATOM   1426 C CG    . HIS C 3 73  ? -5.490  -17.603 -15.870 1.00 52.37 ? 201 HIS A CG    1 
ATOM   1427 N ND1   . HIS C 3 73  ? -6.653  -16.874 -15.751 1.00 53.87 ? 201 HIS A ND1   1 
ATOM   1428 C CD2   . HIS C 3 73  ? -5.580  -18.255 -17.056 1.00 53.83 ? 201 HIS A CD2   1 
ATOM   1429 C CE1   . HIS C 3 73  ? -7.395  -17.048 -16.830 1.00 53.68 ? 201 HIS A CE1   1 
ATOM   1430 N NE2   . HIS C 3 73  ? -6.761  -17.875 -17.641 1.00 54.27 ? 201 HIS A NE2   1 
ATOM   1431 N N     . ARG C 3 74  ? -1.718  -19.245 -14.313 1.00 49.02 ? 202 ARG A N     1 
ATOM   1432 C CA    . ARG C 3 74  ? -0.341  -19.354 -13.747 1.00 49.16 ? 202 ARG A CA    1 
ATOM   1433 C C     . ARG C 3 74  ? 0.220   -18.007 -13.299 1.00 48.73 ? 202 ARG A C     1 
ATOM   1434 O O     . ARG C 3 74  ? 0.151   -17.011 -14.039 1.00 48.76 ? 202 ARG A O     1 
ATOM   1435 C CB    . ARG C 3 74  ? 0.649   -19.990 -14.746 1.00 49.72 ? 202 ARG A CB    1 
ATOM   1436 C CG    . ARG C 3 74  ? 0.229   -21.344 -15.288 1.00 48.77 ? 202 ARG A CG    1 
ATOM   1437 C CD    . ARG C 3 74  ? 1.150   -21.925 -16.295 1.00 49.09 ? 202 ARG A CD    1 
ATOM   1438 N NE    . ARG C 3 74  ? 2.412   -22.332 -15.679 1.00 52.43 ? 202 ARG A NE    1 
ATOM   1439 C CZ    . ARG C 3 74  ? 3.148   -23.373 -16.038 1.00 50.84 ? 202 ARG A CZ    1 
ATOM   1440 N NH1   . ARG C 3 74  ? 2.743   -24.162 -17.008 1.00 53.01 ? 202 ARG A NH1   1 
ATOM   1441 N NH2   . ARG C 3 74  ? 4.287   -23.637 -15.408 1.00 51.03 ? 202 ARG A NH2   1 
ATOM   1442 N N     . HIS C 3 75  ? 0.770   -18.004 -12.085 1.00 48.01 ? 203 HIS A N     1 
ATOM   1443 C CA    . HIS C 3 75  ? 1.426   -16.834 -11.485 1.00 46.92 ? 203 HIS A CA    1 
ATOM   1444 C C     . HIS C 3 75  ? 2.813   -17.164 -10.961 1.00 45.78 ? 203 HIS A C     1 
ATOM   1445 O O     . HIS C 3 75  ? 3.148   -18.317 -10.652 1.00 45.46 ? 203 HIS A O     1 
ATOM   1446 C CB    . HIS C 3 75  ? 0.583   -16.248 -10.346 1.00 46.45 ? 203 HIS A CB    1 
ATOM   1447 C CG    . HIS C 3 75  ? -0.789  -15.829 -10.776 1.00 49.42 ? 203 HIS A CG    1 
ATOM   1448 N ND1   . HIS C 3 75  ? -1.010  -14.756 -11.618 1.00 51.00 ? 203 HIS A ND1   1 
ATOM   1449 C CD2   . HIS C 3 75  ? -2.012  -16.342 -10.494 1.00 48.87 ? 203 HIS A CD2   1 
ATOM   1450 C CE1   . HIS C 3 75  ? -2.305  -14.636 -11.843 1.00 49.59 ? 203 HIS A CE1   1 
ATOM   1451 N NE2   . HIS C 3 75  ? -2.934  -15.591 -11.184 1.00 49.17 ? 203 HIS A NE2   1 
ATOM   1452 N N     . ARG C 3 76  ? 3.601   -16.114 -10.829 1.00 44.40 ? 204 ARG A N     1 
ATOM   1453 C CA    . ARG C 3 76  ? 4.897   -16.184 -10.246 1.00 43.50 ? 204 ARG A CA    1 
ATOM   1454 C C     . ARG C 3 76  ? 4.676   -16.192 -8.741  1.00 43.53 ? 204 ARG A C     1 
ATOM   1455 O O     . ARG C 3 76  ? 3.795   -15.494 -8.235  1.00 43.66 ? 204 ARG A O     1 
ATOM   1456 C CB    . ARG C 3 76  ? 5.631   -14.918 -10.620 1.00 43.19 ? 204 ARG A CB    1 
ATOM   1457 C CG    . ARG C 3 76  ? 7.009   -15.092 -11.130 1.00 44.14 ? 204 ARG A CG    1 
ATOM   1458 C CD    . ARG C 3 76  ? 7.023   -15.159 -12.595 1.00 45.78 ? 204 ARG A CD    1 
ATOM   1459 N NE    . ARG C 3 76  ? 8.239   -14.623 -13.241 1.00 49.35 ? 204 ARG A NE    1 
ATOM   1460 C CZ    . ARG C 3 76  ? 9.382   -14.181 -12.696 1.00 43.64 ? 204 ARG A CZ    1 
ATOM   1461 N NH1   . ARG C 3 76  ? 9.608   -14.137 -11.397 1.00 40.42 ? 204 ARG A NH1   1 
ATOM   1462 N NH2   . ARG C 3 76  ? 10.325  -13.791 -13.527 1.00 43.21 ? 204 ARG A NH2   1 
ATOM   1463 N N     . VAL C 3 77  ? 5.463   -16.966 -8.010  1.00 43.13 ? 205 VAL A N     1 
ATOM   1464 C CA    . VAL C 3 77  ? 5.441   -16.868 -6.546  1.00 42.92 ? 205 VAL A CA    1 
ATOM   1465 C C     . VAL C 3 77  ? 5.656   -15.424 -6.100  1.00 43.24 ? 205 VAL A C     1 
ATOM   1466 O O     . VAL C 3 77  ? 4.909   -14.925 -5.295  1.00 44.83 ? 205 VAL A O     1 
ATOM   1467 C CB    . VAL C 3 77  ? 6.457   -17.836 -5.873  1.00 42.29 ? 205 VAL A CB    1 
ATOM   1468 C CG1   . VAL C 3 77  ? 6.399   -17.737 -4.299  1.00 42.43 ? 205 VAL A CG1   1 
ATOM   1469 C CG2   . VAL C 3 77  ? 6.187   -19.251 -6.322  1.00 42.44 ? 205 VAL A CG2   1 
ATOM   1470 N N     . SER C 3 78  ? 6.657   -14.730 -6.629  1.00 43.56 ? 206 SER A N     1 
ATOM   1471 C CA    . SER C 3 78  ? 6.881   -13.332 -6.208  1.00 42.88 ? 206 SER A CA    1 
ATOM   1472 C C     . SER C 3 78  ? 5.737   -12.383 -6.580  1.00 43.02 ? 206 SER A C     1 
ATOM   1473 O O     . SER C 3 78  ? 5.590   -11.315 -5.988  1.00 43.69 ? 206 SER A O     1 
ATOM   1474 C CB    . SER C 3 78  ? 8.201   -12.795 -6.751  1.00 42.30 ? 206 SER A CB    1 
ATOM   1475 O OG    . SER C 3 78  ? 8.233   -12.897 -8.165  1.00 41.39 ? 206 SER A OG    1 
ATOM   1476 N N     . ALA C 3 79  ? 4.933   -12.734 -7.578  1.00 42.90 ? 207 ALA A N     1 
ATOM   1477 C CA    . ALA C 3 79  ? 3.830   -11.873 -7.943  1.00 41.80 ? 207 ALA A CA    1 
ATOM   1478 C C     . ALA C 3 79  ? 2.783   -11.979 -6.862  1.00 42.30 ? 207 ALA A C     1 
ATOM   1479 O O     . ALA C 3 79  ? 2.305   -10.978 -6.394  1.00 41.51 ? 207 ALA A O     1 
ATOM   1480 C CB    . ALA C 3 79  ? 3.288   -12.247 -9.256  1.00 41.82 ? 207 ALA A CB    1 
ATOM   1481 N N     . ILE C 3 80  ? 2.431   -13.201 -6.454  1.00 43.80 ? 208 ILE A N     1 
ATOM   1482 C CA    . ILE C 3 80  ? 1.511   -13.391 -5.315  1.00 44.89 ? 208 ILE A CA    1 
ATOM   1483 C C     . ILE C 3 80  ? 2.102   -12.719 -4.070  1.00 45.63 ? 208 ILE A C     1 
ATOM   1484 O O     . ILE C 3 80  ? 1.411   -11.962 -3.421  1.00 45.62 ? 208 ILE A O     1 
ATOM   1485 C CB    . ILE C 3 80  ? 1.179   -14.925 -5.064  1.00 44.63 ? 208 ILE A CB    1 
ATOM   1486 C CG1   . ILE C 3 80  ? 0.147   -15.469 -6.041  1.00 44.35 ? 208 ILE A CG1   1 
ATOM   1487 C CG2   . ILE C 3 80  ? 0.577   -15.143 -3.709  1.00 43.25 ? 208 ILE A CG2   1 
ATOM   1488 C CD1   . ILE C 3 80  ? 0.462   -15.279 -7.456  1.00 46.14 ? 208 ILE A CD1   1 
ATOM   1489 N N     . ASN C 3 81  ? 3.376   -12.998 -3.761  1.00 47.82 ? 209 ASN A N     1 
ATOM   1490 C CA    . ASN C 3 81  ? 4.118   -12.365 -2.620  1.00 50.40 ? 209 ASN A CA    1 
ATOM   1491 C C     . ASN C 3 81  ? 4.056   -10.830 -2.557  1.00 51.42 ? 209 ASN A C     1 
ATOM   1492 O O     . ASN C 3 81  ? 3.779   -10.262 -1.514  1.00 52.26 ? 209 ASN A O     1 
ATOM   1493 C CB    . ASN C 3 81  ? 5.595   -12.818 -2.579  1.00 50.47 ? 209 ASN A CB    1 
ATOM   1494 C CG    . ASN C 3 81  ? 6.306   -12.414 -1.276  1.00 51.54 ? 209 ASN A CG    1 
ATOM   1495 O OD1   . ASN C 3 81  ? 6.057   -12.971 -0.208  1.00 53.75 ? 209 ASN A OD1   1 
ATOM   1496 N ND2   . ASN C 3 81  ? 7.207   -11.452 -1.373  1.00 52.40 ? 209 ASN A ND2   1 
ATOM   1497 N N     . ASN C 3 82  ? 4.319   -10.179 -3.675  1.00 53.23 ? 210 ASN A N     1 
ATOM   1498 C CA    . ASN C 3 82  ? 4.220   -8.726  -3.803  1.00 55.54 ? 210 ASN A CA    1 
ATOM   1499 C C     . ASN C 3 82  ? 2.818   -8.179  -3.585  1.00 56.91 ? 210 ASN A C     1 
ATOM   1500 O O     . ASN C 3 82  ? 2.636   -7.226  -2.810  1.00 57.32 ? 210 ASN A O     1 
ATOM   1501 C CB    . ASN C 3 82  ? 4.738   -8.263  -5.190  1.00 55.95 ? 210 ASN A CB    1 
ATOM   1502 C CG    . ASN C 3 82  ? 6.279   -8.137  -5.247  1.00 56.03 ? 210 ASN A CG    1 
ATOM   1503 O OD1   . ASN C 3 82  ? 6.939   -7.993  -4.204  1.00 58.85 ? 210 ASN A OD1   1 
ATOM   1504 N ND2   . ASN C 3 82  ? 6.847   -8.190  -6.460  1.00 51.58 ? 210 ASN A ND2   1 
ATOM   1505 N N     . TYR C 3 83  ? 1.829   -8.758  -4.274  1.00 58.19 ? 211 TYR A N     1 
ATOM   1506 C CA    . TYR C 3 83  ? 0.420   -8.435  -3.981  1.00 59.14 ? 211 TYR A CA    1 
ATOM   1507 C C     . TYR C 3 83  ? 0.097   -8.526  -2.486  1.00 59.07 ? 211 TYR A C     1 
ATOM   1508 O O     . TYR C 3 83  ? -0.476  -7.594  -1.949  1.00 59.17 ? 211 TYR A O     1 
ATOM   1509 C CB    . TYR C 3 83  ? -0.596  -9.249  -4.809  1.00 59.58 ? 211 TYR A CB    1 
ATOM   1510 C CG    . TYR C 3 83  ? -2.033  -8.985  -4.385  1.00 60.88 ? 211 TYR A CG    1 
ATOM   1511 C CD1   . TYR C 3 83  ? -2.771  -7.904  -4.913  1.00 61.81 ? 211 TYR A CD1   1 
ATOM   1512 C CD2   . TYR C 3 83  ? -2.647  -9.789  -3.419  1.00 60.88 ? 211 TYR A CD2   1 
ATOM   1513 C CE1   . TYR C 3 83  ? -4.090  -7.657  -4.486  1.00 61.18 ? 211 TYR A CE1   1 
ATOM   1514 C CE2   . TYR C 3 83  ? -3.948  -9.549  -2.994  1.00 61.20 ? 211 TYR A CE2   1 
ATOM   1515 C CZ    . TYR C 3 83  ? -4.661  -8.491  -3.521  1.00 61.42 ? 211 TYR A CZ    1 
ATOM   1516 O OH    . TYR C 3 83  ? -5.939  -8.305  -3.071  1.00 60.89 ? 211 TYR A OH    1 
ATOM   1517 N N     . ALA C 3 84  ? 0.475   -9.620  -1.827  1.00 59.70 ? 212 ALA A N     1 
ATOM   1518 C CA    . ALA C 3 84  ? 0.134   -9.843  -0.400  1.00 60.41 ? 212 ALA A CA    1 
ATOM   1519 C C     . ALA C 3 84  ? 0.942   -9.031  0.613   1.00 61.60 ? 212 ALA A C     1 
ATOM   1520 O O     . ALA C 3 84  ? 0.449   -8.733  1.692   1.00 61.69 ? 212 ALA A O     1 
ATOM   1521 C CB    . ALA C 3 84  ? 0.202   -11.335 -0.053  1.00 60.08 ? 212 ALA A CB    1 
ATOM   1522 N N     . GLN C 3 85  ? 2.183   -8.689  0.283   1.00 63.59 ? 213 GLN A N     1 
ATOM   1523 C CA    . GLN C 3 85  ? 3.025   -7.811  1.131   1.00 65.80 ? 213 GLN A CA    1 
ATOM   1524 C C     . GLN C 3 85  ? 2.527   -6.344  1.192   1.00 66.79 ? 213 GLN A C     1 
ATOM   1525 O O     . GLN C 3 85  ? 2.778   -5.616  2.164   1.00 66.69 ? 213 GLN A O     1 
ATOM   1526 C CB    . GLN C 3 85  ? 4.478   -7.847  0.627   1.00 65.87 ? 213 GLN A CB    1 
ATOM   1527 C CG    . GLN C 3 85  ? 5.531   -7.839  1.717   1.00 67.01 ? 213 GLN A CG    1 
ATOM   1528 C CD    . GLN C 3 85  ? 5.743   -9.214  2.373   1.00 68.87 ? 213 GLN A CD    1 
ATOM   1529 O OE1   . GLN C 3 85  ? 6.257   -10.148 1.742   1.00 67.92 ? 213 GLN A OE1   1 
ATOM   1530 N NE2   . GLN C 3 85  ? 5.377   -9.324  3.653   1.00 70.06 ? 213 GLN A NE2   1 
ATOM   1531 N N     . LYS C 3 86  ? 1.830   -5.928  0.138   1.00 68.56 ? 214 LYS A N     1 
ATOM   1532 C CA    . LYS C 3 86  ? 1.285   -4.584  0.003   1.00 70.50 ? 214 LYS A CA    1 
ATOM   1533 C C     . LYS C 3 86  ? -0.036  -4.398  0.755   1.00 72.05 ? 214 LYS A C     1 
ATOM   1534 O O     . LYS C 3 86  ? -0.591  -3.303  0.802   1.00 72.46 ? 214 LYS A O     1 
ATOM   1535 C CB    . LYS C 3 86  ? 1.121   -4.234  -1.475  1.00 70.70 ? 214 LYS A CB    1 
ATOM   1536 C CG    . LYS C 3 86  ? 2.448   -3.962  -2.187  1.00 71.81 ? 214 LYS A CG    1 
ATOM   1537 C CD    . LYS C 3 86  ? 2.262   -3.082  -3.409  1.00 74.82 ? 214 LYS A CD    1 
ATOM   1538 C CE    . LYS C 3 86  ? 1.887   -3.890  -4.667  1.00 76.69 ? 214 LYS A CE    1 
ATOM   1539 N NZ    . LYS C 3 86  ? 1.697   -3.014  -5.887  1.00 77.48 ? 214 LYS A NZ    1 
ATOM   1540 N N     . LEU C 3 87  ? -0.538  -5.477  1.337   1.00 74.24 ? 215 LEU A N     1 
ATOM   1541 C CA    . LEU C 3 87  ? -1.589  -5.405  2.346   1.00 76.18 ? 215 LEU A CA    1 
ATOM   1542 C C     . LEU C 3 87  ? -0.937  -5.131  3.712   1.00 78.06 ? 215 LEU A C     1 
ATOM   1543 O O     . LEU C 3 87  ? -1.208  -4.106  4.350   1.00 78.53 ? 215 LEU A O     1 
ATOM   1544 C CB    . LEU C 3 87  ? -2.404  -6.705  2.357   1.00 75.77 ? 215 LEU A CB    1 
ATOM   1545 C CG    . LEU C 3 87  ? -3.471  -6.810  1.257   1.00 75.72 ? 215 LEU A CG    1 
ATOM   1546 C CD1   . LEU C 3 87  ? -2.896  -7.003  -0.140  1.00 75.14 ? 215 LEU A CD1   1 
ATOM   1547 C CD2   . LEU C 3 87  ? -4.476  -7.905  1.564   1.00 76.11 ? 215 LEU A CD2   1 
ATOM   1548 N N     . CYS C 3 88  ? -0.036  -6.030  4.115   1.00 79.86 ? 216 CYS A N     1 
ATOM   1549 C CA    . CYS C 3 88  ? 0.716   -5.969  5.384   1.00 81.35 ? 216 CYS A CA    1 
ATOM   1550 C C     . CYS C 3 88  ? 1.605   -4.728  5.672   1.00 81.59 ? 216 CYS A C     1 
ATOM   1551 O O     . CYS C 3 88  ? 1.263   -3.585  5.320   1.00 81.57 ? 216 CYS A O     1 
ATOM   1552 C CB    . CYS C 3 88  ? 1.586   -7.233  5.500   1.00 81.43 ? 216 CYS A CB    1 
ATOM   1553 S SG    . CYS C 3 88  ? 0.721   -8.784  5.152   1.00 84.77 ? 216 CYS A SG    1 
ATOM   1554 N N     . THR C 3 89  ? 2.681   -5.004  6.431   1.00 81.99 ? 217 THR A N     1 
ATOM   1555 C CA    . THR C 3 89  ? 3.957   -4.248  6.541   1.00 82.08 ? 217 THR A CA    1 
ATOM   1556 C C     . THR C 3 89  ? 5.063   -4.915  7.438   1.00 81.65 ? 217 THR A C     1 
ATOM   1557 O O     . THR C 3 89  ? 6.048   -5.389  6.862   1.00 81.86 ? 217 THR A O     1 
ATOM   1558 C CB    . THR C 3 89  ? 3.851   -2.664  6.730   1.00 82.72 ? 217 THR A CB    1 
ATOM   1559 O OG1   . THR C 3 89  ? 2.615   -2.285  7.372   1.00 83.15 ? 217 THR A OG1   1 
ATOM   1560 C CG2   . THR C 3 89  ? 3.815   -1.929  5.348   1.00 83.50 ? 217 THR A CG2   1 
ATOM   1561 N N     . PHE C 3 90  ? 4.968   -5.038  8.778   1.00 80.58 ? 218 PHE A N     1 
ATOM   1562 C CA    . PHE C 3 90  ? 3.817   -4.869  9.704   1.00 79.36 ? 218 PHE A CA    1 
ATOM   1563 C C     . PHE C 3 90  ? 3.348   -6.163  10.379  1.00 77.68 ? 218 PHE A C     1 
ATOM   1564 O O     . PHE C 3 90  ? 2.724   -6.100  11.453  1.00 78.15 ? 218 PHE A O     1 
ATOM   1565 C CB    . PHE C 3 90  ? 2.699   -3.910  9.196   1.00 80.24 ? 218 PHE A CB    1 
ATOM   1566 C CG    . PHE C 3 90  ? 1.274   -4.488  9.132   1.00 81.58 ? 218 PHE A CG    1 
ATOM   1567 C CD1   . PHE C 3 90  ? 1.014   -5.819  8.777   1.00 81.85 ? 218 PHE A CD1   1 
ATOM   1568 C CD2   . PHE C 3 90  ? 0.174   -3.626  9.338   1.00 84.11 ? 218 PHE A CD2   1 
ATOM   1569 C CE1   . PHE C 3 90  ? -0.305  -6.302  8.696   1.00 82.45 ? 218 PHE A CE1   1 
ATOM   1570 C CE2   . PHE C 3 90  ? -1.162  -4.095  9.250   1.00 84.18 ? 218 PHE A CE2   1 
ATOM   1571 C CZ    . PHE C 3 90  ? -1.396  -5.439  8.926   1.00 83.30 ? 218 PHE A CZ    1 
ATOM   1572 N N     . SER C 3 91  ? 3.674   -7.321  9.771   1.00 74.72 ? 219 SER A N     1 
ATOM   1573 C CA    . SER C 3 91  ? 3.461   -8.670  10.371  1.00 71.40 ? 219 SER A CA    1 
ATOM   1574 C C     . SER C 3 91  ? 4.045   -9.728  9.458   1.00 68.28 ? 219 SER A C     1 
ATOM   1575 O O     . SER C 3 91  ? 4.197   -9.474  8.263   1.00 67.50 ? 219 SER A O     1 
ATOM   1576 C CB    . SER C 3 91  ? 1.978   -8.971  10.606  1.00 71.86 ? 219 SER A CB    1 
ATOM   1577 O OG    . SER C 3 91  ? 1.256   -8.841  9.385   1.00 74.44 ? 219 SER A OG    1 
ATOM   1578 N N     . PHE C 3 92  ? 4.360   -10.908 10.004  1.00 64.71 ? 220 PHE A N     1 
ATOM   1579 C CA    . PHE C 3 92  ? 5.042   -11.925 9.199   1.00 61.25 ? 220 PHE A CA    1 
ATOM   1580 C C     . PHE C 3 92  ? 4.186   -12.534 8.095   1.00 59.58 ? 220 PHE A C     1 
ATOM   1581 O O     . PHE C 3 92  ? 2.970   -12.659 8.239   1.00 58.50 ? 220 PHE A O     1 
ATOM   1582 C CB    . PHE C 3 92  ? 5.738   -12.998 10.046  1.00 60.71 ? 220 PHE A CB    1 
ATOM   1583 C CG    . PHE C 3 92  ? 4.917   -14.208 10.306  1.00 58.61 ? 220 PHE A CG    1 
ATOM   1584 C CD1   . PHE C 3 92  ? 3.997   -14.222 11.342  1.00 57.02 ? 220 PHE A CD1   1 
ATOM   1585 C CD2   . PHE C 3 92  ? 5.105   -15.356 9.556   1.00 56.88 ? 220 PHE A CD2   1 
ATOM   1586 C CE1   . PHE C 3 92  ? 3.241   -15.355 11.608  1.00 57.19 ? 220 PHE A CE1   1 
ATOM   1587 C CE2   . PHE C 3 92  ? 4.349   -16.480 9.793   1.00 56.98 ? 220 PHE A CE2   1 
ATOM   1588 C CZ    . PHE C 3 92  ? 3.402   -16.477 10.834  1.00 58.32 ? 220 PHE A CZ    1 
ATOM   1589 N N     . LEU C 3 93  ? 4.859   -12.908 7.001   1.00 57.32 ? 221 LEU A N     1 
ATOM   1590 C CA    . LEU C 3 93  ? 4.222   -13.486 5.841   1.00 55.42 ? 221 LEU A CA    1 
ATOM   1591 C C     . LEU C 3 93  ? 5.232   -14.278 5.036   1.00 54.27 ? 221 LEU A C     1 
ATOM   1592 O O     . LEU C 3 93  ? 6.183   -13.714 4.515   1.00 54.77 ? 221 LEU A O     1 
ATOM   1593 C CB    . LEU C 3 93  ? 3.584   -12.397 4.969   1.00 55.01 ? 221 LEU A CB    1 
ATOM   1594 C CG    . LEU C 3 93  ? 2.557   -12.895 3.940   1.00 54.34 ? 221 LEU A CG    1 
ATOM   1595 C CD1   . LEU C 3 93  ? 1.392   -11.975 3.959   1.00 53.96 ? 221 LEU A CD1   1 
ATOM   1596 C CD2   . LEU C 3 93  ? 3.094   -12.999 2.521   1.00 51.51 ? 221 LEU A CD2   1 
ATOM   1597 N N     . ILE C 3 94  ? 5.018   -15.584 4.943   1.00 52.37 ? 222 ILE A N     1 
ATOM   1598 C CA    . ILE C 3 94  ? 5.820   -16.432 4.109   1.00 50.61 ? 222 ILE A CA    1 
ATOM   1599 C C     . ILE C 3 94  ? 4.919   -16.941 2.986   1.00 50.34 ? 222 ILE A C     1 
ATOM   1600 O O     . ILE C 3 94  ? 3.888   -17.569 3.212   1.00 51.47 ? 222 ILE A O     1 
ATOM   1601 C CB    . ILE C 3 94  ? 6.455   -17.584 4.935   1.00 50.48 ? 222 ILE A CB    1 
ATOM   1602 C CG1   . ILE C 3 94  ? 7.428   -17.013 5.970   1.00 51.54 ? 222 ILE A CG1   1 
ATOM   1603 C CG2   . ILE C 3 94  ? 7.247   -18.526 4.053   1.00 48.55 ? 222 ILE A CG2   1 
ATOM   1604 C CD1   . ILE C 3 94  ? 7.378   -17.701 7.300   1.00 51.38 ? 222 ILE A CD1   1 
ATOM   1605 N N     . CYS C 3 95  ? 5.323   -16.672 1.764   1.00 48.99 ? 223 CYS A N     1 
ATOM   1606 C CA    . CYS C 3 95  ? 4.553   -17.038 0.626   1.00 47.94 ? 223 CYS A CA    1 
ATOM   1607 C C     . CYS C 3 95  ? 5.357   -17.938 -0.367  1.00 47.18 ? 223 CYS A C     1 
ATOM   1608 O O     . CYS C 3 95  ? 6.438   -17.564 -0.830  1.00 46.80 ? 223 CYS A O     1 
ATOM   1609 C CB    . CYS C 3 95  ? 4.013   -15.775 -0.020  1.00 47.47 ? 223 CYS A CB    1 
ATOM   1610 S SG    . CYS C 3 95  ? 3.344   -16.150 -1.632  1.00 49.15 ? 223 CYS A SG    1 
ATOM   1611 N N     . LYS C 3 96  ? 4.796   -19.105 -0.696  1.00 45.59 ? 224 LYS A N     1 
ATOM   1612 C CA    . LYS C 3 96  ? 5.494   -20.175 -1.433  1.00 45.38 ? 224 LYS A CA    1 
ATOM   1613 C C     . LYS C 3 96  ? 4.579   -20.878 -2.424  1.00 44.06 ? 224 LYS A C     1 
ATOM   1614 O O     . LYS C 3 96  ? 3.397   -20.974 -2.171  1.00 43.90 ? 224 LYS A O     1 
ATOM   1615 C CB    . LYS C 3 96  ? 6.065   -21.216 -0.452  1.00 45.72 ? 224 LYS A CB    1 
ATOM   1616 C CG    . LYS C 3 96  ? 7.582   -21.147 -0.340  1.00 48.43 ? 224 LYS A CG    1 
ATOM   1617 C CD    . LYS C 3 96  ? 8.112   -21.171 1.073   1.00 49.45 ? 224 LYS A CD    1 
ATOM   1618 C CE    . LYS C 3 96  ? 9.660   -21.174 1.006   1.00 49.51 ? 224 LYS A CE    1 
ATOM   1619 N NZ    . LYS C 3 96  ? 10.296  -21.843 2.163   1.00 46.24 ? 224 LYS A NZ    1 
ATOM   1620 N N     . GLY C 3 97  ? 5.123   -21.312 -3.559  1.00 42.54 ? 225 GLY A N     1 
ATOM   1621 C CA    . GLY C 3 97  ? 4.421   -22.186 -4.475  1.00 41.09 ? 225 GLY A CA    1 
ATOM   1622 C C     . GLY C 3 97  ? 4.325   -23.590 -3.883  1.00 41.39 ? 225 GLY A C     1 
ATOM   1623 O O     . GLY C 3 97  ? 5.171   -23.997 -3.076  1.00 41.01 ? 225 GLY A O     1 
ATOM   1624 N N     . VAL C 3 98  ? 3.290   -24.333 -4.279  1.00 41.08 ? 226 VAL A N     1 
ATOM   1625 C CA    . VAL C 3 98  ? 3.060   -25.704 -3.790  1.00 39.98 ? 226 VAL A CA    1 
ATOM   1626 C C     . VAL C 3 98  ? 3.234   -26.672 -4.944  1.00 40.45 ? 226 VAL A C     1 
ATOM   1627 O O     . VAL C 3 98  ? 2.589   -26.550 -5.986  1.00 40.62 ? 226 VAL A O     1 
ATOM   1628 C CB    . VAL C 3 98  ? 1.665   -25.856 -3.176  1.00 38.63 ? 226 VAL A CB    1 
ATOM   1629 C CG1   . VAL C 3 98  ? 1.346   -27.287 -2.916  1.00 36.75 ? 226 VAL A CG1   1 
ATOM   1630 C CG2   . VAL C 3 98  ? 1.560   -25.051 -1.930  1.00 38.14 ? 226 VAL A CG2   1 
ATOM   1631 N N     . ASN C 3 99  ? 4.123   -27.635 -4.749  1.00 41.32 ? 227 ASN A N     1 
ATOM   1632 C CA    . ASN C 3 99  ? 4.426   -28.621 -5.768  1.00 41.77 ? 227 ASN A CA    1 
ATOM   1633 C C     . ASN C 3 99  ? 3.464   -29.825 -5.661  1.00 43.02 ? 227 ASN A C     1 
ATOM   1634 O O     . ASN C 3 99  ? 3.021   -30.388 -6.678  1.00 43.12 ? 227 ASN A O     1 
ATOM   1635 C CB    . ASN C 3 99  ? 5.887   -29.065 -5.625  1.00 41.30 ? 227 ASN A CB    1 
ATOM   1636 C CG    . ASN C 3 99  ? 6.871   -28.136 -6.343  1.00 39.94 ? 227 ASN A CG    1 
ATOM   1637 O OD1   . ASN C 3 99  ? 6.484   -27.351 -7.195  1.00 34.16 ? 227 ASN A OD1   1 
ATOM   1638 N ND2   . ASN C 3 99  ? 8.161   -28.277 -6.027  1.00 38.14 ? 227 ASN A ND2   1 
ATOM   1639 N N     . LYS C 3 100 ? 3.125   -30.190 -4.431  1.00 43.82 ? 228 LYS A N     1 
ATOM   1640 C CA    . LYS C 3 100 ? 2.265   -31.346 -4.175  1.00 45.86 ? 228 LYS A CA    1 
ATOM   1641 C C     . LYS C 3 100 ? 0.911   -30.916 -3.594  1.00 45.90 ? 228 LYS A C     1 
ATOM   1642 O O     . LYS C 3 100 ? 0.707   -30.917 -2.367  1.00 45.99 ? 228 LYS A O     1 
ATOM   1643 C CB    . LYS C 3 100 ? 2.977   -32.302 -3.225  1.00 46.81 ? 228 LYS A CB    1 
ATOM   1644 C CG    . LYS C 3 100 ? 4.459   -32.550 -3.593  1.00 50.25 ? 228 LYS A CG    1 
ATOM   1645 C CD    . LYS C 3 100 ? 4.642   -33.541 -4.705  1.00 54.66 ? 228 LYS A CD    1 
ATOM   1646 C CE    . LYS C 3 100 ? 6.073   -34.136 -4.722  1.00 58.39 ? 228 LYS A CE    1 
ATOM   1647 N NZ    . LYS C 3 100 ? 6.412   -34.849 -3.441  1.00 59.34 ? 228 LYS A NZ    1 
ATOM   1648 N N     . GLU C 3 101 ? 0.004   -30.515 -4.485  1.00 45.75 ? 229 GLU A N     1 
ATOM   1649 C CA    . GLU C 3 101 ? -1.294  -29.951 -4.100  1.00 46.01 ? 229 GLU A CA    1 
ATOM   1650 C C     . GLU C 3 101 ? -2.179  -30.888 -3.259  1.00 46.56 ? 229 GLU A C     1 
ATOM   1651 O O     . GLU C 3 101 ? -2.646  -30.467 -2.185  1.00 46.60 ? 229 GLU A O     1 
ATOM   1652 C CB    . GLU C 3 101 ? -2.061  -29.479 -5.324  1.00 46.23 ? 229 GLU A CB    1 
ATOM   1653 C CG    . GLU C 3 101 ? -1.244  -28.694 -6.324  1.00 47.10 ? 229 GLU A CG    1 
ATOM   1654 C CD    . GLU C 3 101 ? -0.460  -29.539 -7.319  1.00 50.15 ? 229 GLU A CD    1 
ATOM   1655 O OE1   . GLU C 3 101 ? -0.089  -28.952 -8.350  1.00 53.63 ? 229 GLU A OE1   1 
ATOM   1656 O OE2   . GLU C 3 101 ? -0.193  -30.759 -7.117  1.00 49.02 ? 229 GLU A OE2   1 
ATOM   1657 N N     . TYR C 3 102 ? -2.412  -32.135 -3.710  1.00 46.98 ? 230 TYR A N     1 
ATOM   1658 C CA    . TYR C 3 102 ? -3.255  -33.043 -2.896  1.00 47.39 ? 230 TYR A CA    1 
ATOM   1659 C C     . TYR C 3 102 ? -2.611  -33.211 -1.535  1.00 46.56 ? 230 TYR A C     1 
ATOM   1660 O O     . TYR C 3 102 ? -3.277  -33.078 -0.515  1.00 47.02 ? 230 TYR A O     1 
ATOM   1661 C CB    . TYR C 3 102 ? -3.584  -34.436 -3.549  1.00 48.10 ? 230 TYR A CB    1 
ATOM   1662 C CG    . TYR C 3 102 ? -4.496  -35.318 -2.676  1.00 48.05 ? 230 TYR A CG    1 
ATOM   1663 C CD1   . TYR C 3 102 ? -5.885  -35.210 -2.748  1.00 51.26 ? 230 TYR A CD1   1 
ATOM   1664 C CD2   . TYR C 3 102 ? -3.961  -36.244 -1.747  1.00 50.30 ? 230 TYR A CD2   1 
ATOM   1665 C CE1   . TYR C 3 102 ? -6.732  -35.998 -1.916  1.00 50.29 ? 230 TYR A CE1   1 
ATOM   1666 C CE2   . TYR C 3 102 ? -4.789  -37.031 -0.911  1.00 48.41 ? 230 TYR A CE2   1 
ATOM   1667 C CZ    . TYR C 3 102 ? -6.181  -36.907 -1.005  1.00 50.33 ? 230 TYR A CZ    1 
ATOM   1668 O OH    . TYR C 3 102 ? -7.030  -37.686 -0.211  1.00 49.33 ? 230 TYR A OH    1 
ATOM   1669 N N     . LEU C 3 103 ? -1.309  -33.458 -1.529  1.00 45.81 ? 231 LEU A N     1 
ATOM   1670 C CA    . LEU C 3 103 ? -0.616  -33.805 -0.294  1.00 45.48 ? 231 LEU A CA    1 
ATOM   1671 C C     . LEU C 3 103 ? -0.607  -32.678 0.712   1.00 45.14 ? 231 LEU A C     1 
ATOM   1672 O O     . LEU C 3 103 ? -0.849  -32.891 1.898   1.00 45.61 ? 231 LEU A O     1 
ATOM   1673 C CB    . LEU C 3 103 ? 0.804   -34.356 -0.583  1.00 45.08 ? 231 LEU A CB    1 
ATOM   1674 C CG    . LEU C 3 103 ? 0.865   -35.690 -1.349  1.00 44.58 ? 231 LEU A CG    1 
ATOM   1675 C CD1   . LEU C 3 103 ? 2.293   -36.130 -1.479  1.00 42.33 ? 231 LEU A CD1   1 
ATOM   1676 C CD2   . LEU C 3 103 ? 0.009   -36.822 -0.686  1.00 39.97 ? 231 LEU A CD2   1 
ATOM   1677 N N     . MET C 3 104 ? -0.352  -31.470 0.215   1.00 45.31 ? 232 MET A N     1 
ATOM   1678 C CA    . MET C 3 104 ? -0.370  -30.257 0.996   1.00 44.98 ? 232 MET A CA    1 
ATOM   1679 C C     . MET C 3 104 ? -1.786  -30.010 1.538   1.00 45.29 ? 232 MET A C     1 
ATOM   1680 O O     . MET C 3 104 ? -1.976  -29.879 2.747   1.00 46.15 ? 232 MET A O     1 
ATOM   1681 C CB    . MET C 3 104 ? 0.149   -29.118 0.118   1.00 45.52 ? 232 MET A CB    1 
ATOM   1682 C CG    . MET C 3 104 ? 0.230   -27.735 0.754   1.00 45.52 ? 232 MET A CG    1 
ATOM   1683 S SD    . MET C 3 104 ? 1.369   -27.589 2.131   1.00 48.59 ? 232 MET A SD    1 
ATOM   1684 C CE    . MET C 3 104 ? 1.227   -25.830 2.451   1.00 41.34 ? 232 MET A CE    1 
ATOM   1685 N N     . TYR C 3 105 ? -2.788  -29.977 0.671   1.00 45.07 ? 233 TYR A N     1 
ATOM   1686 C CA    . TYR C 3 105 ? -4.183  -29.900 1.162   1.00 45.17 ? 233 TYR A CA    1 
ATOM   1687 C C     . TYR C 3 105 ? -4.521  -30.930 2.258   1.00 45.16 ? 233 TYR A C     1 
ATOM   1688 O O     . TYR C 3 105 ? -5.078  -30.572 3.330   1.00 45.17 ? 233 TYR A O     1 
ATOM   1689 C CB    . TYR C 3 105 ? -5.216  -30.060 0.062   1.00 44.42 ? 233 TYR A CB    1 
ATOM   1690 C CG    . TYR C 3 105 ? -6.611  -29.904 0.650   1.00 46.34 ? 233 TYR A CG    1 
ATOM   1691 C CD1   . TYR C 3 105 ? -7.039  -28.661 1.117   1.00 44.57 ? 233 TYR A CD1   1 
ATOM   1692 C CD2   . TYR C 3 105 ? -7.485  -30.997 0.782   1.00 46.33 ? 233 TYR A CD2   1 
ATOM   1693 C CE1   . TYR C 3 105 ? -8.270  -28.488 1.671   1.00 45.63 ? 233 TYR A CE1   1 
ATOM   1694 C CE2   . TYR C 3 105 ? -8.761  -30.819 1.351   1.00 47.47 ? 233 TYR A CE2   1 
ATOM   1695 C CZ    . TYR C 3 105 ? -9.141  -29.544 1.794   1.00 46.58 ? 233 TYR A CZ    1 
ATOM   1696 O OH    . TYR C 3 105 ? -10.367 -29.304 2.388   1.00 43.18 ? 233 TYR A OH    1 
ATOM   1697 N N     . SER C 3 106 ? -4.212  -32.203 2.014   1.00 44.17 ? 234 SER A N     1 
ATOM   1698 C CA    . SER C 3 106 ? -4.686  -33.195 2.975   1.00 43.98 ? 234 SER A CA    1 
ATOM   1699 C C     . SER C 3 106 ? -3.951  -33.158 4.323   1.00 43.57 ? 234 SER A C     1 
ATOM   1700 O O     . SER C 3 106 ? -4.575  -33.311 5.369   1.00 43.23 ? 234 SER A O     1 
ATOM   1701 C CB    . SER C 3 106 ? -4.836  -34.590 2.359   1.00 43.61 ? 234 SER A CB    1 
ATOM   1702 O OG    . SER C 3 106 ? -3.629  -35.288 2.314   1.00 44.87 ? 234 SER A OG    1 
ATOM   1703 N N     . ALA C 3 107 ? -2.646  -32.900 4.285   1.00 43.38 ? 235 ALA A N     1 
ATOM   1704 C CA    . ALA C 3 107 ? -1.869  -32.569 5.478   1.00 43.55 ? 235 ALA A CA    1 
ATOM   1705 C C     . ALA C 3 107 ? -2.483  -31.401 6.283   1.00 43.69 ? 235 ALA A C     1 
ATOM   1706 O O     . ALA C 3 107 ? -2.484  -31.422 7.511   1.00 44.48 ? 235 ALA A O     1 
ATOM   1707 C CB    . ALA C 3 107 ? -0.415  -32.272 5.103   1.00 42.60 ? 235 ALA A CB    1 
ATOM   1708 N N     . LEU C 3 108 ? -3.009  -30.393 5.595   1.00 43.83 ? 236 LEU A N     1 
ATOM   1709 C CA    . LEU C 3 108 ? -3.623  -29.220 6.268   1.00 43.41 ? 236 LEU A CA    1 
ATOM   1710 C C     . LEU C 3 108 ? -4.970  -29.510 6.915   1.00 44.20 ? 236 LEU A C     1 
ATOM   1711 O O     . LEU C 3 108 ? -5.385  -28.816 7.858   1.00 44.93 ? 236 LEU A O     1 
ATOM   1712 C CB    . LEU C 3 108 ? -3.761  -28.071 5.303   1.00 42.55 ? 236 LEU A CB    1 
ATOM   1713 C CG    . LEU C 3 108 ? -2.398  -27.559 4.832   1.00 41.92 ? 236 LEU A CG    1 
ATOM   1714 C CD1   . LEU C 3 108 ? -2.514  -26.734 3.538   1.00 42.30 ? 236 LEU A CD1   1 
ATOM   1715 C CD2   . LEU C 3 108 ? -1.735  -26.759 5.926   1.00 36.39 ? 236 LEU A CD2   1 
ATOM   1716 N N     . THR C 3 109 ? -5.645  -30.552 6.435   1.00 44.20 ? 237 THR A N     1 
ATOM   1717 C CA    . THR C 3 109 ? -6.882  -31.021 7.073   1.00 44.05 ? 237 THR A CA    1 
ATOM   1718 C C     . THR C 3 109 ? -6.667  -31.937 8.288   1.00 44.29 ? 237 THR A C     1 
ATOM   1719 O O     . THR C 3 109 ? -7.595  -32.127 9.047   1.00 44.27 ? 237 THR A O     1 
ATOM   1720 C CB    . THR C 3 109 ? -7.811  -31.708 6.056   1.00 43.51 ? 237 THR A CB    1 
ATOM   1721 O OG1   . THR C 3 109 ? -7.102  -32.771 5.426   1.00 44.36 ? 237 THR A OG1   1 
ATOM   1722 C CG2   . THR C 3 109 ? -8.118  -30.792 4.906   1.00 42.32 ? 237 THR A CG2   1 
ATOM   1723 N N     . ARG C 3 110 ? -5.466  -32.492 8.466   1.00 44.87 ? 238 ARG A N     1 
ATOM   1724 C CA    . ARG C 3 110 ? -5.162  -33.330 9.643   1.00 46.27 ? 238 ARG A CA    1 
ATOM   1725 C C     . ARG C 3 110 ? -4.232  -32.680 10.663  1.00 46.04 ? 238 ARG A C     1 
ATOM   1726 O O     . ARG C 3 110 ? -3.504  -31.741 10.339  1.00 46.09 ? 238 ARG A O     1 
ATOM   1727 C CB    . ARG C 3 110 ? -4.581  -34.691 9.236   1.00 45.82 ? 238 ARG A CB    1 
ATOM   1728 C CG    . ARG C 3 110 ? -5.634  -35.712 8.862   1.00 47.59 ? 238 ARG A CG    1 
ATOM   1729 C CD    . ARG C 3 110 ? -5.082  -37.087 8.526   1.00 48.83 ? 238 ARG A CD    1 
ATOM   1730 N NE    . ARG C 3 110 ? -4.045  -37.019 7.486   1.00 55.93 ? 238 ARG A NE    1 
ATOM   1731 C CZ    . ARG C 3 110 ? -4.262  -36.763 6.185   1.00 56.60 ? 238 ARG A CZ    1 
ATOM   1732 N NH1   . ARG C 3 110 ? -5.494  -36.537 5.722   1.00 55.96 ? 238 ARG A NH1   1 
ATOM   1733 N NH2   . ARG C 3 110 ? -3.226  -36.727 5.349   1.00 57.11 ? 238 ARG A NH2   1 
ATOM   1734 N N     . ASP C 3 111 ? -4.248  -33.219 11.883  1.00 46.13 ? 239 ASP A N     1 
ATOM   1735 C CA    . ASP C 3 111 ? -3.388  -32.763 12.988  1.00 46.60 ? 239 ASP A CA    1 
ATOM   1736 C C     . ASP C 3 111 ? -1.925  -32.515 12.579  1.00 46.82 ? 239 ASP A C     1 
ATOM   1737 O O     . ASP C 3 111 ? -1.402  -33.253 11.740  1.00 46.81 ? 239 ASP A O     1 
ATOM   1738 C CB    . ASP C 3 111 ? -3.449  -33.763 14.162  1.00 46.60 ? 239 ASP A CB    1 
ATOM   1739 C CG    . ASP C 3 111 ? -4.626  -33.493 15.099  1.00 46.88 ? 239 ASP A CG    1 
ATOM   1740 O OD1   . ASP C 3 111 ? -4.899  -32.299 15.410  1.00 45.95 ? 239 ASP A OD1   1 
ATOM   1741 O OD2   . ASP C 3 111 ? -5.337  -34.411 15.572  1.00 46.03 ? 239 ASP A OD2   1 
ATOM   1742 N N     . PRO C 3 112 ? -1.274  -31.479 13.133  1.00 46.94 ? 240 PRO A N     1 
ATOM   1743 C CA    . PRO C 3 112 ? -1.887  -30.519 14.056  1.00 47.21 ? 240 PRO A CA    1 
ATOM   1744 C C     . PRO C 3 112 ? -2.568  -29.321 13.363  1.00 46.99 ? 240 PRO A C     1 
ATOM   1745 O O     . PRO C 3 112 ? -2.804  -28.276 13.977  1.00 46.64 ? 240 PRO A O     1 
ATOM   1746 C CB    . PRO C 3 112 ? -0.687  -30.065 14.901  1.00 47.51 ? 240 PRO A CB    1 
ATOM   1747 C CG    . PRO C 3 112 ? 0.447   -30.107 13.954  1.00 47.03 ? 240 PRO A CG    1 
ATOM   1748 C CD    . PRO C 3 112 ? 0.146   -31.166 12.911  1.00 46.70 ? 240 PRO A CD    1 
ATOM   1749 N N     . PHE C 3 113 ? -2.882  -29.489 12.086  1.00 47.41 ? 241 PHE A N     1 
ATOM   1750 C CA    . PHE C 3 113 ? -3.562  -28.453 11.316  1.00 47.50 ? 241 PHE A CA    1 
ATOM   1751 C C     . PHE C 3 113 ? -5.058  -28.748 11.317  1.00 47.82 ? 241 PHE A C     1 
ATOM   1752 O O     . PHE C 3 113 ? -5.480  -29.854 11.708  1.00 47.38 ? 241 PHE A O     1 
ATOM   1753 C CB    . PHE C 3 113 ? -3.000  -28.390 9.890   1.00 47.45 ? 241 PHE A CB    1 
ATOM   1754 C CG    . PHE C 3 113 ? -1.497  -28.392 9.835   1.00 46.89 ? 241 PHE A CG    1 
ATOM   1755 C CD1   . PHE C 3 113 ? -0.771  -27.270 10.228  1.00 45.89 ? 241 PHE A CD1   1 
ATOM   1756 C CD2   . PHE C 3 113 ? -0.801  -29.532 9.419   1.00 48.76 ? 241 PHE A CD2   1 
ATOM   1757 C CE1   . PHE C 3 113 ? 0.598   -27.266 10.209  1.00 44.26 ? 241 PHE A CE1   1 
ATOM   1758 C CE2   . PHE C 3 113 ? 0.589   -29.538 9.384   1.00 48.15 ? 241 PHE A CE2   1 
ATOM   1759 C CZ    . PHE C 3 113 ? 1.285   -28.399 9.783   1.00 47.96 ? 241 PHE A CZ    1 
ATOM   1760 N N     . SER C 3 114 ? -5.850  -27.746 10.932  1.00 47.96 ? 242 SER A N     1 
ATOM   1761 C CA    . SER C 3 114 ? -7.316  -27.896 10.776  1.00 48.38 ? 242 SER A CA    1 
ATOM   1762 C C     . SER C 3 114 ? -7.875  -26.808 9.870   1.00 48.01 ? 242 SER A C     1 
ATOM   1763 O O     . SER C 3 114 ? -7.243  -25.774 9.691   1.00 48.88 ? 242 SER A O     1 
ATOM   1764 C CB    . SER C 3 114 ? -8.041  -27.903 12.130  1.00 48.17 ? 242 SER A CB    1 
ATOM   1765 O OG    . SER C 3 114 ? -7.951  -26.644 12.773  1.00 49.03 ? 242 SER A OG    1 
ATOM   1766 N N     . VAL C 3 115 ? -9.039  -27.062 9.283   1.00 47.79 ? 243 VAL A N     1 
ATOM   1767 C CA    . VAL C 3 115 ? -9.762  -26.080 8.460   1.00 46.93 ? 243 VAL A CA    1 
ATOM   1768 C C     . VAL C 3 115 ? -10.571 -25.112 9.349   1.00 46.63 ? 243 VAL A C     1 
ATOM   1769 O O     . VAL C 3 115 ? -11.386 -25.532 10.151  1.00 45.65 ? 243 VAL A O     1 
ATOM   1770 C CB    . VAL C 3 115 ? -10.727 -26.799 7.480   1.00 46.81 ? 243 VAL A CB    1 
ATOM   1771 C CG1   . VAL C 3 115 ? -11.526 -25.808 6.662   1.00 47.34 ? 243 VAL A CG1   1 
ATOM   1772 C CG2   . VAL C 3 115 ? -9.973  -27.738 6.567   1.00 45.94 ? 243 VAL A CG2   1 
ATOM   1773 N N     . ILE C 3 116 ? -10.317 -23.814 9.186   1.00 46.47 ? 244 ILE A N     1 
ATOM   1774 C CA    . ILE C 3 116 ? -11.133 -22.718 9.722   1.00 44.88 ? 244 ILE A CA    1 
ATOM   1775 C C     . ILE C 3 116 ? -12.344 -22.518 8.791   1.00 45.41 ? 244 ILE A C     1 
ATOM   1776 O O     . ILE C 3 116 ? -13.523 -22.519 9.230   1.00 45.45 ? 244 ILE A O     1 
ATOM   1777 C CB    . ILE C 3 116 ? -10.260 -21.407 9.779   1.00 44.41 ? 244 ILE A CB    1 
ATOM   1778 C CG1   . ILE C 3 116 ? -8.901  -21.674 10.462  1.00 44.98 ? 244 ILE A CG1   1 
ATOM   1779 C CG2   . ILE C 3 116 ? -11.028 -20.225 10.327  1.00 43.34 ? 244 ILE A CG2   1 
ATOM   1780 C CD1   . ILE C 3 116 ? -8.368  -20.581 11.444  1.00 47.10 ? 244 ILE A CD1   1 
ATOM   1781 N N     . GLU C 3 117 ? -12.047 -22.359 7.501   1.00 45.66 ? 245 GLU A N     1 
ATOM   1782 C CA    . GLU C 3 117 ? -13.044 -22.127 6.456   1.00 46.59 ? 245 GLU A CA    1 
ATOM   1783 C C     . GLU C 3 117 ? -12.435 -22.499 5.119   1.00 46.57 ? 245 GLU A C     1 
ATOM   1784 O O     . GLU C 3 117 ? -11.227 -22.424 4.954   1.00 47.50 ? 245 GLU A O     1 
ATOM   1785 C CB    . GLU C 3 117 ? -13.461 -20.650 6.447   1.00 47.05 ? 245 GLU A CB    1 
ATOM   1786 C CG    . GLU C 3 117 ? -14.859 -20.339 5.908   1.00 49.18 ? 245 GLU A CG    1 
ATOM   1787 C CD    . GLU C 3 117 ? -15.940 -21.130 6.605   1.00 51.16 ? 245 GLU A CD    1 
ATOM   1788 O OE1   . GLU C 3 117 ? -16.587 -20.558 7.517   1.00 52.58 ? 245 GLU A OE1   1 
ATOM   1789 O OE2   . GLU C 3 117 ? -16.124 -22.329 6.259   1.00 51.57 ? 245 GLU A OE2   1 
ATOM   1790 N N     . GLU C 3 118 ? -13.250 -22.924 4.164   1.00 47.19 ? 246 GLU A N     1 
ATOM   1791 C CA    . GLU C 3 118 ? -12.767 -23.200 2.804   1.00 48.07 ? 246 GLU A CA    1 
ATOM   1792 C C     . GLU C 3 118 ? -13.886 -22.957 1.795   1.00 47.90 ? 246 GLU A C     1 
ATOM   1793 O O     . GLU C 3 118 ? -15.022 -23.078 2.165   1.00 48.07 ? 246 GLU A O     1 
ATOM   1794 C CB    . GLU C 3 118 ? -12.200 -24.617 2.696   1.00 48.30 ? 246 GLU A CB    1 
ATOM   1795 C CG    . GLU C 3 118 ? -13.038 -25.710 3.373   1.00 48.67 ? 246 GLU A CG    1 
ATOM   1796 C CD    . GLU C 3 118 ? -12.525 -27.121 3.054   1.00 48.70 ? 246 GLU A CD    1 
ATOM   1797 O OE1   . GLU C 3 118 ? -11.338 -27.294 2.628   1.00 50.89 ? 246 GLU A OE1   1 
ATOM   1798 O OE2   . GLU C 3 118 ? -13.312 -28.069 3.217   1.00 47.58 ? 246 GLU A OE2   1 
ATOM   1799 N N     . SER C 3 119 ? -13.559 -22.627 0.544   1.00 48.11 ? 247 SER A N     1 
ATOM   1800 C CA    . SER C 3 119 ? -14.543 -22.122 -0.425  1.00 48.86 ? 247 SER A CA    1 
ATOM   1801 C C     . SER C 3 119 ? -15.414 -23.213 -1.065  1.00 49.10 ? 247 SER A C     1 
ATOM   1802 O O     . SER C 3 119 ? -16.537 -22.926 -1.519  1.00 49.20 ? 247 SER A O     1 
ATOM   1803 C CB    . SER C 3 119 ? -13.844 -21.375 -1.549  1.00 48.70 ? 247 SER A CB    1 
ATOM   1804 O OG    . SER C 3 119 ? -13.358 -22.332 -2.470  1.00 50.45 ? 247 SER A OG    1 
ATOM   1805 N N     . LEU C 3 120 ? -14.857 -24.426 -1.162  1.00 48.76 ? 248 LEU A N     1 
ATOM   1806 C CA    . LEU C 3 120 ? -15.589 -25.659 -1.487  1.00 48.56 ? 248 LEU A CA    1 
ATOM   1807 C C     . LEU C 3 120 ? -15.407 -26.628 -0.332  1.00 48.46 ? 248 LEU A C     1 
ATOM   1808 O O     . LEU C 3 120 ? -14.280 -26.828 0.117   1.00 48.38 ? 248 LEU A O     1 
ATOM   1809 C CB    . LEU C 3 120 ? -15.059 -26.326 -2.760  1.00 48.21 ? 248 LEU A CB    1 
ATOM   1810 C CG    . LEU C 3 120 ? -15.806 -26.225 -4.090  1.00 49.10 ? 248 LEU A CG    1 
ATOM   1811 C CD1   . LEU C 3 120 ? -17.363 -26.086 -3.969  1.00 48.48 ? 248 LEU A CD1   1 
ATOM   1812 C CD2   . LEU C 3 120 ? -15.235 -25.124 -4.940  1.00 49.15 ? 248 LEU A CD2   1 
ATOM   1813 N N     . PRO C 3 121 ? -16.494 -27.226 0.152   1.00 48.76 ? 249 PRO A N     1 
ATOM   1814 C CA    . PRO C 3 121 ? -16.423 -28.153 1.289   1.00 48.96 ? 249 PRO A CA    1 
ATOM   1815 C C     . PRO C 3 121 ? -15.764 -29.476 0.912   1.00 49.39 ? 249 PRO A C     1 
ATOM   1816 O O     . PRO C 3 121 ? -16.258 -30.179 0.029   1.00 50.43 ? 249 PRO A O     1 
ATOM   1817 C CB    . PRO C 3 121 ? -17.903 -28.409 1.619   1.00 49.03 ? 249 PRO A CB    1 
ATOM   1818 C CG    . PRO C 3 121 ? -18.620 -28.174 0.332   1.00 48.45 ? 249 PRO A CG    1 
ATOM   1819 C CD    . PRO C 3 121 ? -17.879 -27.072 -0.357  1.00 48.66 ? 249 PRO A CD    1 
ATOM   1820 N N     . GLY C 3 122 ? -14.670 -29.825 1.575   1.00 49.20 ? 250 GLY A N     1 
ATOM   1821 C CA    . GLY C 3 122 ? -13.999 -31.083 1.294   1.00 48.95 ? 250 GLY A CA    1 
ATOM   1822 C C     . GLY C 3 122 ? -12.786 -30.930 0.408   1.00 48.95 ? 250 GLY A C     1 
ATOM   1823 O O     . GLY C 3 122 ? -11.846 -31.727 0.493   1.00 49.52 ? 250 GLY A O     1 
ATOM   1824 N N     . GLY C 3 123 ? -12.826 -29.923 -0.458  1.00 48.71 ? 251 GLY A N     1 
ATOM   1825 C CA    . GLY C 3 123 ? -11.661 -29.458 -1.202  1.00 48.97 ? 251 GLY A CA    1 
ATOM   1826 C C     . GLY C 3 123 ? -11.175 -30.438 -2.238  1.00 48.88 ? 251 GLY A C     1 
ATOM   1827 O O     . GLY C 3 123 ? -11.964 -31.004 -2.979  1.00 48.89 ? 251 GLY A O     1 
ATOM   1828 N N     . LEU C 3 124 ? -9.866  -30.657 -2.248  1.00 48.76 ? 252 LEU A N     1 
ATOM   1829 C CA    . LEU C 3 124 ? -9.202  -31.488 -3.236  1.00 48.79 ? 252 LEU A CA    1 
ATOM   1830 C C     . LEU C 3 124 ? -9.446  -32.986 -3.025  1.00 49.26 ? 252 LEU A C     1 
ATOM   1831 O O     . LEU C 3 124 ? -9.110  -33.799 -3.896  1.00 49.24 ? 252 LEU A O     1 
ATOM   1832 C CB    . LEU C 3 124 ? -7.696  -31.174 -3.240  1.00 48.87 ? 252 LEU A CB    1 
ATOM   1833 C CG    . LEU C 3 124 ? -7.211  -29.848 -3.829  1.00 48.52 ? 252 LEU A CG    1 
ATOM   1834 C CD1   . LEU C 3 124 ? -7.528  -28.690 -2.896  1.00 46.98 ? 252 LEU A CD1   1 
ATOM   1835 C CD2   . LEU C 3 124 ? -5.714  -29.894 -4.125  1.00 48.67 ? 252 LEU A CD2   1 
ATOM   1836 N N     . LYS C 3 125 ? -10.001 -33.338 -1.862  1.00 49.86 ? 253 LYS A N     1 
ATOM   1837 C CA    . LYS C 3 125 ? -10.505 -34.697 -1.572  1.00 51.04 ? 253 LYS A CA    1 
ATOM   1838 C C     . LYS C 3 125 ? -11.843 -35.009 -2.245  1.00 50.81 ? 253 LYS A C     1 
ATOM   1839 O O     . LYS C 3 125 ? -12.150 -36.165 -2.514  1.00 50.84 ? 253 LYS A O     1 
ATOM   1840 C CB    . LYS C 3 125 ? -10.665 -34.912 -0.062  1.00 51.13 ? 253 LYS A CB    1 
ATOM   1841 C CG    . LYS C 3 125 ? -9.523  -34.338 0.791   1.00 52.26 ? 253 LYS A CG    1 
ATOM   1842 C CD    . LYS C 3 125 ? -9.711  -34.683 2.266   1.00 52.06 ? 253 LYS A CD    1 
ATOM   1843 C CE    . LYS C 3 125 ? -8.501  -34.276 3.094   1.00 53.57 ? 253 LYS A CE    1 
ATOM   1844 N NZ    . LYS C 3 125 ? -8.433  -35.082 4.380   1.00 53.88 ? 253 LYS A NZ    1 
ATOM   1845 N N     . GLU C 3 126 ? -12.636 -33.974 -2.510  1.00 51.44 ? 254 GLU A N     1 
ATOM   1846 C CA    . GLU C 3 126 ? -14.010 -34.154 -2.975  1.00 52.06 ? 254 GLU A CA    1 
ATOM   1847 C C     . GLU C 3 126 ? -14.232 -33.588 -4.378  1.00 52.59 ? 254 GLU A C     1 
ATOM   1848 O O     . GLU C 3 126 ? -15.283 -33.808 -5.020  1.00 52.38 ? 254 GLU A O     1 
ATOM   1849 C CB    . GLU C 3 126 ? -14.978 -33.568 -1.946  1.00 51.82 ? 254 GLU A CB    1 
ATOM   1850 C CG    . GLU C 3 126 ? -15.176 -34.514 -0.766  1.00 53.30 ? 254 GLU A CG    1 
ATOM   1851 C CD    . GLU C 3 126 ? -15.875 -33.892 0.426   1.00 54.36 ? 254 GLU A CD    1 
ATOM   1852 O OE1   . GLU C 3 126 ? -16.949 -33.276 0.243   1.00 56.15 ? 254 GLU A OE1   1 
ATOM   1853 O OE2   . GLU C 3 126 ? -15.361 -34.048 1.555   1.00 53.27 ? 254 GLU A OE2   1 
ATOM   1854 N N     . HIS C 3 127 ? -13.210 -32.889 -4.861  1.00 53.04 ? 255 HIS A N     1 
ATOM   1855 C CA    . HIS C 3 127 ? -13.287 -32.194 -6.129  1.00 53.90 ? 255 HIS A CA    1 
ATOM   1856 C C     . HIS C 3 127 ? -11.975 -32.341 -6.927  1.00 54.53 ? 255 HIS A C     1 
ATOM   1857 O O     . HIS C 3 127 ? -10.867 -32.154 -6.397  1.00 55.20 ? 255 HIS A O     1 
ATOM   1858 C CB    . HIS C 3 127 ? -13.671 -30.710 -5.893  1.00 53.50 ? 255 HIS A CB    1 
ATOM   1859 C CG    . HIS C 3 127 ? -14.841 -30.524 -4.964  1.00 53.77 ? 255 HIS A CG    1 
ATOM   1860 N ND1   . HIS C 3 127 ? -16.154 -30.530 -5.398  1.00 54.53 ? 255 HIS A ND1   1 
ATOM   1861 C CD2   . HIS C 3 127 ? -14.896 -30.354 -3.620  1.00 53.00 ? 255 HIS A CD2   1 
ATOM   1862 C CE1   . HIS C 3 127 ? -16.962 -30.369 -4.363  1.00 53.88 ? 255 HIS A CE1   1 
ATOM   1863 N NE2   . HIS C 3 127 ? -16.223 -30.255 -3.273  1.00 53.94 ? 255 HIS A NE2   1 
ATOM   1864 N N     . ASP C 3 128 ? -12.100 -32.710 -8.194  1.00 55.10 ? 256 ASP A N     1 
ATOM   1865 C CA    . ASP C 3 128 ? -11.026 -32.496 -9.135  1.00 56.06 ? 256 ASP A CA    1 
ATOM   1866 C C     . ASP C 3 128 ? -11.021 -30.999 -9.387  1.00 57.21 ? 256 ASP A C     1 
ATOM   1867 O O     . ASP C 3 128 ? -12.074 -30.355 -9.372  1.00 57.41 ? 256 ASP A O     1 
ATOM   1868 C CB    . ASP C 3 128 ? -11.296 -33.202 -10.462 1.00 56.02 ? 256 ASP A CB    1 
ATOM   1869 C CG    . ASP C 3 128 ? -11.697 -34.647 -10.291 1.00 55.38 ? 256 ASP A CG    1 
ATOM   1870 O OD1   . ASP C 3 128 ? -10.870 -35.461 -9.825  1.00 54.56 ? 256 ASP A OD1   1 
ATOM   1871 O OD2   . ASP C 3 128 ? -12.824 -35.060 -10.612 1.00 55.39 ? 256 ASP A OD2   1 
ATOM   1872 N N     . PHE C 3 129 ? -9.843  -30.432 -9.593  1.00 58.41 ? 257 PHE A N     1 
ATOM   1873 C CA    . PHE C 3 129 ? -9.780  -29.086 -10.133 1.00 59.45 ? 257 PHE A CA    1 
ATOM   1874 C C     . PHE C 3 129 ? -9.020  -29.130 -11.457 1.00 60.17 ? 257 PHE A C     1 
ATOM   1875 O O     . PHE C 3 129 ? -8.779  -28.097 -12.086 1.00 60.32 ? 257 PHE A O     1 
ATOM   1876 C CB    . PHE C 3 129 ? -9.219  -28.088 -9.105  1.00 59.40 ? 257 PHE A CB    1 
ATOM   1877 C CG    . PHE C 3 129 ? -10.140 -27.869 -7.908  1.00 59.61 ? 257 PHE A CG    1 
ATOM   1878 C CD1   . PHE C 3 129 ? -11.175 -26.939 -7.963  1.00 58.75 ? 257 PHE A CD1   1 
ATOM   1879 C CD2   . PHE C 3 129 ? -9.980  -28.614 -6.735  1.00 58.93 ? 257 PHE A CD2   1 
ATOM   1880 C CE1   . PHE C 3 129 ? -12.030 -26.759 -6.866  1.00 58.14 ? 257 PHE A CE1   1 
ATOM   1881 C CE2   . PHE C 3 129 ? -10.834 -28.430 -5.635  1.00 57.98 ? 257 PHE A CE2   1 
ATOM   1882 C CZ    . PHE C 3 129 ? -11.854 -27.510 -5.701  1.00 57.13 ? 257 PHE A CZ    1 
ATOM   1883 N N     . ASN C 3 130 ? -8.696  -30.360 -11.866 1.00 60.77 ? 258 ASN A N     1 
ATOM   1884 C CA    . ASN C 3 130 ? -8.045  -30.717 -13.141 1.00 61.42 ? 258 ASN A CA    1 
ATOM   1885 C C     . ASN C 3 130 ? -7.532  -29.570 -14.038 1.00 61.74 ? 258 ASN A C     1 
ATOM   1886 O O     . ASN C 3 130 ? -7.902  -29.469 -15.221 1.00 61.66 ? 258 ASN A O     1 
ATOM   1887 C CB    . ASN C 3 130 ? -8.965  -31.660 -13.946 1.00 61.66 ? 258 ASN A CB    1 
ATOM   1888 C CG    . ASN C 3 130 ? -8.190  -32.671 -14.771 1.00 61.97 ? 258 ASN A CG    1 
ATOM   1889 O OD1   . ASN C 3 130 ? -7.118  -32.371 -15.311 1.00 63.29 ? 258 ASN A OD1   1 
ATOM   1890 N ND2   . ASN C 3 130 ? -8.720  -33.881 -14.860 1.00 60.57 ? 258 ASN A ND2   1 
ATOM   1891 N N     . GLU D 3 5   ? 3.624   9.894   11.840  1.00 74.61 ? 133 GLU B N     1 
ATOM   1892 C CA    . GLU D 3 5   ? 2.269   10.389  11.434  1.00 73.88 ? 133 GLU B CA    1 
ATOM   1893 C C     . GLU D 3 5   ? 2.075   11.911  11.457  1.00 72.90 ? 133 GLU B C     1 
ATOM   1894 O O     . GLU D 3 5   ? 1.636   12.463  10.449  1.00 73.07 ? 133 GLU B O     1 
ATOM   1895 C CB    . GLU D 3 5   ? 1.191   9.761   12.308  1.00 74.63 ? 133 GLU B CB    1 
ATOM   1896 C CG    . GLU D 3 5   ? 1.340   8.272   12.553  1.00 77.30 ? 133 GLU B CG    1 
ATOM   1897 C CD    . GLU D 3 5   ? 0.375   7.810   13.619  1.00 81.11 ? 133 GLU B CD    1 
ATOM   1898 O OE1   . GLU D 3 5   ? -0.122  8.689   14.373  1.00 82.87 ? 133 GLU B OE1   1 
ATOM   1899 O OE2   . GLU D 3 5   ? 0.106   6.585   13.696  1.00 81.83 ? 133 GLU B OE2   1 
ATOM   1900 N N     . ASP D 3 6   ? 2.400   12.577  12.581  1.00 71.51 ? 134 ASP B N     1 
ATOM   1901 C CA    . ASP D 3 6   ? 1.861   13.941  12.927  1.00 70.04 ? 134 ASP B CA    1 
ATOM   1902 C C     . ASP D 3 6   ? 1.812   15.107  11.887  1.00 69.25 ? 134 ASP B C     1 
ATOM   1903 O O     . ASP D 3 6   ? 0.761   15.262  11.274  1.00 69.85 ? 134 ASP B O     1 
ATOM   1904 C CB    . ASP D 3 6   ? 2.348   14.429  14.317  1.00 70.59 ? 134 ASP B CB    1 
ATOM   1905 C CG    . ASP D 3 6   ? 1.878   15.858  14.648  1.00 71.19 ? 134 ASP B CG    1 
ATOM   1906 O OD1   . ASP D 3 6   ? 0.728   16.231  14.308  1.00 71.56 ? 134 ASP B OD1   1 
ATOM   1907 O OD2   . ASP D 3 6   ? 2.606   16.687  15.238  1.00 72.95 ? 134 ASP B OD2   1 
ATOM   1908 N N     . PRO D 3 7   ? 2.854   15.953  11.736  1.00 68.13 ? 135 PRO B N     1 
ATOM   1909 C CA    . PRO D 3 7   ? 2.798   17.139  10.822  1.00 67.66 ? 135 PRO B CA    1 
ATOM   1910 C C     . PRO D 3 7   ? 2.413   16.854  9.362   1.00 66.06 ? 135 PRO B C     1 
ATOM   1911 O O     . PRO D 3 7   ? 2.639   15.736  8.877   1.00 65.66 ? 135 PRO B O     1 
ATOM   1912 C CB    . PRO D 3 7   ? 4.227   17.707  10.903  1.00 67.35 ? 135 PRO B CB    1 
ATOM   1913 C CG    . PRO D 3 7   ? 4.696   17.304  12.270  1.00 66.93 ? 135 PRO B CG    1 
ATOM   1914 C CD    . PRO D 3 7   ? 4.159   15.909  12.425  1.00 67.96 ? 135 PRO B CD    1 
ATOM   1915 N N     . LYS D 3 8   ? 1.819   17.850  8.692   1.00 64.97 ? 136 LYS B N     1 
ATOM   1916 C CA    . LYS D 3 8   ? 1.234   17.668  7.328   1.00 64.52 ? 136 LYS B CA    1 
ATOM   1917 C C     . LYS D 3 8   ? 2.018   18.365  6.204   1.00 63.76 ? 136 LYS B C     1 
ATOM   1918 O O     . LYS D 3 8   ? 1.692   18.196  5.022   1.00 63.55 ? 136 LYS B O     1 
ATOM   1919 C CB    . LYS D 3 8   ? -0.254  18.123  7.251   1.00 64.93 ? 136 LYS B CB    1 
ATOM   1920 C CG    . LYS D 3 8   ? -1.240  17.454  8.241   1.00 65.33 ? 136 LYS B CG    1 
ATOM   1921 C CD    . LYS D 3 8   ? -1.534  15.984  7.914   1.00 65.39 ? 136 LYS B CD    1 
ATOM   1922 C CE    . LYS D 3 8   ? -2.336  15.359  9.060   1.00 65.87 ? 136 LYS B CE    1 
ATOM   1923 N NZ    . LYS D 3 8   ? -3.153  14.164  8.649   1.00 65.51 ? 136 LYS B NZ    1 
ATOM   1924 N N     . ASP D 3 9   ? 3.024   19.158  6.588   1.00 62.42 ? 137 ASP B N     1 
ATOM   1925 C CA    . ASP D 3 9   ? 3.921   19.845  5.677   1.00 60.89 ? 137 ASP B CA    1 
ATOM   1926 C C     . ASP D 3 9   ? 5.058   20.395  6.526   1.00 60.48 ? 137 ASP B C     1 
ATOM   1927 O O     . ASP D 3 9   ? 5.114   20.116  7.739   1.00 60.38 ? 137 ASP B O     1 
ATOM   1928 C CB    . ASP D 3 9   ? 3.184   21.010  5.029   1.00 61.09 ? 137 ASP B CB    1 
ATOM   1929 C CG    . ASP D 3 9   ? 3.789   21.438  3.699   1.00 60.85 ? 137 ASP B CG    1 
ATOM   1930 O OD1   . ASP D 3 9   ? 4.913   20.984  3.341   1.00 57.64 ? 137 ASP B OD1   1 
ATOM   1931 O OD2   . ASP D 3 9   ? 3.181   22.254  2.961   1.00 59.39 ? 137 ASP B OD2   1 
ATOM   1932 N N     . PHE D 3 10  ? 5.957   21.164  5.890   1.00 59.36 ? 138 PHE B N     1 
ATOM   1933 C CA    . PHE D 3 10  ? 7.062   21.867  6.564   1.00 58.45 ? 138 PHE B CA    1 
ATOM   1934 C C     . PHE D 3 10  ? 6.510   23.073  7.329   1.00 58.53 ? 138 PHE B C     1 
ATOM   1935 O O     . PHE D 3 10  ? 5.445   23.573  6.972   1.00 58.51 ? 138 PHE B O     1 
ATOM   1936 C CB    . PHE D 3 10  ? 8.126   22.321  5.543   1.00 57.78 ? 138 PHE B CB    1 
ATOM   1937 C CG    . PHE D 3 10  ? 9.099   21.226  5.141   1.00 55.93 ? 138 PHE B CG    1 
ATOM   1938 C CD1   . PHE D 3 10  ? 10.213  20.946  5.916   1.00 56.42 ? 138 PHE B CD1   1 
ATOM   1939 C CD2   . PHE D 3 10  ? 8.904   20.493  3.984   1.00 53.85 ? 138 PHE B CD2   1 
ATOM   1940 C CE1   . PHE D 3 10  ? 11.120  19.934  5.558   1.00 55.23 ? 138 PHE B CE1   1 
ATOM   1941 C CE2   . PHE D 3 10  ? 9.790   19.497  3.614   1.00 56.10 ? 138 PHE B CE2   1 
ATOM   1942 C CZ    . PHE D 3 10  ? 10.907  19.210  4.421   1.00 55.87 ? 138 PHE B CZ    1 
ATOM   1943 N N     . PRO D 3 11  ? 7.214   23.563  8.358   1.00 58.20 ? 139 PRO B N     1 
ATOM   1944 C CA    . PRO D 3 11  ? 6.743   24.739  9.066   1.00 57.78 ? 139 PRO B CA    1 
ATOM   1945 C C     . PRO D 3 11  ? 6.540   25.887  8.072   1.00 57.95 ? 139 PRO B C     1 
ATOM   1946 O O     . PRO D 3 11  ? 7.327   26.048  7.129   1.00 57.99 ? 139 PRO B O     1 
ATOM   1947 C CB    . PRO D 3 11  ? 7.874   25.029  10.047  1.00 57.15 ? 139 PRO B CB    1 
ATOM   1948 C CG    . PRO D 3 11  ? 8.481   23.740  10.280  1.00 56.91 ? 139 PRO B CG    1 
ATOM   1949 C CD    . PRO D 3 11  ? 8.486   23.082  8.925   1.00 57.70 ? 139 PRO B CD    1 
ATOM   1950 N N     . SER D 3 12  ? 5.476   26.663  8.287   1.00 58.23 ? 140 SER B N     1 
ATOM   1951 C CA    . SER D 3 12  ? 5.046   27.685  7.346   1.00 58.14 ? 140 SER B CA    1 
ATOM   1952 C C     . SER D 3 12  ? 6.116   28.722  7.065   1.00 57.56 ? 140 SER B C     1 
ATOM   1953 O O     . SER D 3 12  ? 6.169   29.277  5.960   1.00 58.12 ? 140 SER B O     1 
ATOM   1954 C CB    . SER D 3 12  ? 3.772   28.363  7.854   1.00 58.77 ? 140 SER B CB    1 
ATOM   1955 O OG    . SER D 3 12  ? 3.997   28.992  9.112   1.00 60.30 ? 140 SER B OG    1 
ATOM   1956 N N     . GLU D 3 13  ? 6.959   28.992  8.061   1.00 56.83 ? 141 GLU B N     1 
ATOM   1957 C CA    . GLU D 3 13  ? 8.033   29.984  7.925   1.00 56.29 ? 141 GLU B CA    1 
ATOM   1958 C C     . GLU D 3 13  ? 9.222   29.528  7.051   1.00 55.82 ? 141 GLU B C     1 
ATOM   1959 O O     . GLU D 3 13  ? 10.117  30.322  6.764   1.00 55.79 ? 141 GLU B O     1 
ATOM   1960 C CB    . GLU D 3 13  ? 8.508   30.474  9.301   1.00 56.68 ? 141 GLU B CB    1 
ATOM   1961 C CG    . GLU D 3 13  ? 9.184   29.438  10.188  1.00 58.07 ? 141 GLU B CG    1 
ATOM   1962 C CD    . GLU D 3 13  ? 8.218   28.657  11.071  1.00 60.73 ? 141 GLU B CD    1 
ATOM   1963 O OE1   . GLU D 3 13  ? 7.151   28.242  10.575  1.00 62.79 ? 141 GLU B OE1   1 
ATOM   1964 O OE2   . GLU D 3 13  ? 8.528   28.425  12.270  1.00 61.58 ? 141 GLU B OE2   1 
ATOM   1965 N N     . LEU D 3 14  ? 9.217   28.264  6.616   1.00 54.80 ? 142 LEU B N     1 
ATOM   1966 C CA    . LEU D 3 14  ? 10.274  27.759  5.752   1.00 53.73 ? 142 LEU B CA    1 
ATOM   1967 C C     . LEU D 3 14  ? 9.759   27.538  4.340   1.00 53.08 ? 142 LEU B C     1 
ATOM   1968 O O     . LEU D 3 14  ? 10.551  27.372  3.393   1.00 53.67 ? 142 LEU B O     1 
ATOM   1969 C CB    . LEU D 3 14  ? 10.885  26.475  6.320   1.00 53.69 ? 142 LEU B CB    1 
ATOM   1970 C CG    . LEU D 3 14  ? 11.397  26.568  7.766   1.00 53.76 ? 142 LEU B CG    1 
ATOM   1971 C CD1   . LEU D 3 14  ? 11.767  25.204  8.284   1.00 53.85 ? 142 LEU B CD1   1 
ATOM   1972 C CD2   . LEU D 3 14  ? 12.554  27.562  7.953   1.00 52.67 ? 142 LEU B CD2   1 
ATOM   1973 N N     . LEU D 3 15  ? 8.438   27.570  4.190   1.00 51.08 ? 143 LEU B N     1 
ATOM   1974 C CA    . LEU D 3 15  ? 7.784   27.283  2.915   1.00 49.06 ? 143 LEU B CA    1 
ATOM   1975 C C     . LEU D 3 15  ? 8.251   28.120  1.752   1.00 47.88 ? 143 LEU B C     1 
ATOM   1976 O O     . LEU D 3 15  ? 8.271   27.630  0.636   1.00 47.36 ? 143 LEU B O     1 
ATOM   1977 C CB    . LEU D 3 15  ? 6.265   27.409  3.034   1.00 48.98 ? 143 LEU B CB    1 
ATOM   1978 C CG    . LEU D 3 15  ? 5.452   26.308  3.718   1.00 49.92 ? 143 LEU B CG    1 
ATOM   1979 C CD1   . LEU D 3 15  ? 3.971   26.688  3.742   1.00 49.80 ? 143 LEU B CD1   1 
ATOM   1980 C CD2   . LEU D 3 15  ? 5.643   24.957  3.039   1.00 50.33 ? 143 LEU B CD2   1 
ATOM   1981 N N     . SER D 3 16  ? 8.588   29.390  1.985   1.00 47.41 ? 144 SER B N     1 
ATOM   1982 C CA    . SER D 3 16  ? 9.072   30.254  0.879   1.00 47.08 ? 144 SER B CA    1 
ATOM   1983 C C     . SER D 3 16  ? 10.362  29.712  0.178   1.00 46.38 ? 144 SER B C     1 
ATOM   1984 O O     . SER D 3 16  ? 10.680  30.130  -0.949  1.00 45.92 ? 144 SER B O     1 
ATOM   1985 C CB    . SER D 3 16  ? 9.279   31.701  1.339   1.00 46.73 ? 144 SER B CB    1 
ATOM   1986 O OG    . SER D 3 16  ? 9.807   31.771  2.669   1.00 49.18 ? 144 SER B OG    1 
ATOM   1987 N N     . PHE D 3 17  ? 11.057  28.760  0.826   1.00 45.60 ? 145 PHE B N     1 
ATOM   1988 C CA    . PHE D 3 17  ? 12.403  28.313  0.391   1.00 45.00 ? 145 PHE B CA    1 
ATOM   1989 C C     . PHE D 3 17  ? 12.378  27.085  -0.454  1.00 45.04 ? 145 PHE B C     1 
ATOM   1990 O O     . PHE D 3 17  ? 13.349  26.780  -1.158  1.00 45.64 ? 145 PHE B O     1 
ATOM   1991 C CB    . PHE D 3 17  ? 13.337  28.073  1.589   1.00 44.10 ? 145 PHE B CB    1 
ATOM   1992 C CG    . PHE D 3 17  ? 13.412  29.243  2.556   1.00 43.19 ? 145 PHE B CG    1 
ATOM   1993 C CD1   . PHE D 3 17  ? 13.575  30.558  2.091   1.00 41.89 ? 145 PHE B CD1   1 
ATOM   1994 C CD2   . PHE D 3 17  ? 13.325  29.023  3.912   1.00 41.53 ? 145 PHE B CD2   1 
ATOM   1995 C CE1   . PHE D 3 17  ? 13.637  31.624  2.962   1.00 42.30 ? 145 PHE B CE1   1 
ATOM   1996 C CE2   . PHE D 3 17  ? 13.392  30.076  4.795   1.00 43.60 ? 145 PHE B CE2   1 
ATOM   1997 C CZ    . PHE D 3 17  ? 13.552  31.380  4.334   1.00 42.93 ? 145 PHE B CZ    1 
ATOM   1998 N N     . LEU D 3 18  ? 11.252  26.387  -0.371  1.00 45.16 ? 146 LEU B N     1 
ATOM   1999 C CA    . LEU D 3 18  ? 11.090  25.049  -0.880  1.00 44.65 ? 146 LEU B CA    1 
ATOM   2000 C C     . LEU D 3 18  ? 10.508  25.084  -2.259  1.00 45.43 ? 146 LEU B C     1 
ATOM   2001 O O     . LEU D 3 18  ? 10.009  26.111  -2.721  1.00 45.23 ? 146 LEU B O     1 
ATOM   2002 C CB    . LEU D 3 18  ? 10.206  24.251  0.065   1.00 44.37 ? 146 LEU B CB    1 
ATOM   2003 C CG    . LEU D 3 18  ? 10.832  24.242  1.457   1.00 43.95 ? 146 LEU B CG    1 
ATOM   2004 C CD1   . LEU D 3 18  ? 9.905   23.607  2.440   1.00 42.82 ? 146 LEU B CD1   1 
ATOM   2005 C CD2   . LEU D 3 18  ? 12.161  23.492  1.414   1.00 45.78 ? 146 LEU B CD2   1 
ATOM   2006 N N     . SER D 3 19  ? 10.609  23.967  -2.950  1.00 46.30 ? 147 SER B N     1 
ATOM   2007 C CA    . SER D 3 19  ? 9.908   23.849  -4.218  1.00 46.92 ? 147 SER B CA    1 
ATOM   2008 C C     . SER D 3 19  ? 8.689   22.984  -3.983  1.00 47.97 ? 147 SER B C     1 
ATOM   2009 O O     . SER D 3 19  ? 8.776   21.983  -3.237  1.00 48.95 ? 147 SER B O     1 
ATOM   2010 C CB    . SER D 3 19  ? 10.803  23.208  -5.258  1.00 46.35 ? 147 SER B CB    1 
ATOM   2011 O OG    . SER D 3 19  ? 10.011  22.414  -6.095  1.00 42.73 ? 147 SER B OG    1 
ATOM   2012 N N     . HIS D 3 20  ? 7.579   23.366  -4.617  1.00 48.80 ? 148 HIS B N     1 
ATOM   2013 C CA    . HIS D 3 20  ? 6.255   22.730  -4.447  1.00 49.93 ? 148 HIS B CA    1 
ATOM   2014 C C     . HIS D 3 20  ? 5.782   22.072  -5.749  1.00 50.14 ? 148 HIS B C     1 
ATOM   2015 O O     . HIS D 3 20  ? 4.719   21.434  -5.806  1.00 51.47 ? 148 HIS B O     1 
ATOM   2016 C CB    . HIS D 3 20  ? 5.232   23.782  -3.968  1.00 50.72 ? 148 HIS B CB    1 
ATOM   2017 C CG    . HIS D 3 20  ? 5.731   24.623  -2.821  1.00 54.25 ? 148 HIS B CG    1 
ATOM   2018 N ND1   . HIS D 3 20  ? 5.962   24.104  -1.556  1.00 55.79 ? 148 HIS B ND1   1 
ATOM   2019 C CD2   . HIS D 3 20  ? 6.102   25.931  -2.767  1.00 57.07 ? 148 HIS B CD2   1 
ATOM   2020 C CE1   . HIS D 3 20  ? 6.422   25.065  -0.767  1.00 57.57 ? 148 HIS B CE1   1 
ATOM   2021 N NE2   . HIS D 3 20  ? 6.534   26.178  -1.480  1.00 57.74 ? 148 HIS B NE2   1 
ATOM   2022 N N     . ALA D 3 21  ? 6.567   22.240  -6.805  1.00 49.11 ? 149 ALA B N     1 
ATOM   2023 C CA    . ALA D 3 21  ? 6.381   21.527  -8.031  1.00 47.68 ? 149 ALA B CA    1 
ATOM   2024 C C     . ALA D 3 21  ? 5.809   20.146  -7.741  1.00 47.60 ? 149 ALA B C     1 
ATOM   2025 O O     . ALA D 3 21  ? 6.257   19.462  -6.794  1.00 46.95 ? 149 ALA B O     1 
ATOM   2026 C CB    . ALA D 3 21  ? 7.694   21.413  -8.746  1.00 47.22 ? 149 ALA B CB    1 
ATOM   2027 N N     . VAL D 3 22  ? 4.802   19.759  -8.541  1.00 46.81 ? 150 VAL B N     1 
ATOM   2028 C CA    . VAL D 3 22  ? 4.214   18.406  -8.509  1.00 45.90 ? 150 VAL B CA    1 
ATOM   2029 C C     . VAL D 3 22  ? 4.307   17.741  -9.888  1.00 45.59 ? 150 VAL B C     1 
ATOM   2030 O O     . VAL D 3 22  ? 4.257   16.511  -10.001 1.00 45.57 ? 150 VAL B O     1 
ATOM   2031 C CB    . VAL D 3 22  ? 2.717   18.447  -7.951  1.00 46.60 ? 150 VAL B CB    1 
ATOM   2032 C CG1   . VAL D 3 22  ? 1.779   19.306  -8.844  1.00 46.28 ? 150 VAL B CG1   1 
ATOM   2033 C CG2   . VAL D 3 22  ? 2.114   17.062  -7.709  1.00 44.71 ? 150 VAL B CG2   1 
ATOM   2034 N N     . PHE D 3 23  ? 4.457   18.551  -10.937 1.00 45.11 ? 151 PHE B N     1 
ATOM   2035 C CA    . PHE D 3 23  ? 4.441   18.031  -12.310 1.00 45.04 ? 151 PHE B CA    1 
ATOM   2036 C C     . PHE D 3 23  ? 5.738   18.260  -13.054 1.00 45.03 ? 151 PHE B C     1 
ATOM   2037 O O     . PHE D 3 23  ? 5.784   18.184  -14.308 1.00 44.93 ? 151 PHE B O     1 
ATOM   2038 C CB    . PHE D 3 23  ? 3.238   18.583  -13.120 1.00 45.43 ? 151 PHE B CB    1 
ATOM   2039 C CG    . PHE D 3 23  ? 1.890   18.146  -12.585 1.00 45.64 ? 151 PHE B CG    1 
ATOM   2040 C CD1   . PHE D 3 23  ? 1.352   16.888  -12.933 1.00 46.31 ? 151 PHE B CD1   1 
ATOM   2041 C CD2   . PHE D 3 23  ? 1.154   18.985  -11.735 1.00 44.72 ? 151 PHE B CD2   1 
ATOM   2042 C CE1   . PHE D 3 23  ? 0.083   16.457  -12.418 1.00 47.62 ? 151 PHE B CE1   1 
ATOM   2043 C CE2   . PHE D 3 23  ? -0.128  18.564  -11.221 1.00 47.49 ? 151 PHE B CE2   1 
ATOM   2044 C CZ    . PHE D 3 23  ? -0.661  17.290  -11.561 1.00 42.64 ? 151 PHE B CZ    1 
ATOM   2045 N N     . SER D 3 24  ? 6.798   18.523  -12.286 1.00 44.59 ? 152 SER B N     1 
ATOM   2046 C CA    . SER D 3 24  ? 8.094   18.791  -12.874 1.00 44.36 ? 152 SER B CA    1 
ATOM   2047 C C     . SER D 3 24  ? 9.015   17.576  -12.818 1.00 44.26 ? 152 SER B C     1 
ATOM   2048 O O     . SER D 3 24  ? 9.116   16.922  -11.795 1.00 43.76 ? 152 SER B O     1 
ATOM   2049 C CB    . SER D 3 24  ? 8.749   19.983  -12.196 1.00 44.36 ? 152 SER B CB    1 
ATOM   2050 O OG    . SER D 3 24  ? 9.861   20.396  -12.938 1.00 44.42 ? 152 SER B OG    1 
ATOM   2051 N N     . ASN D 3 25  ? 9.677   17.303  -13.932 1.00 43.70 ? 153 ASN B N     1 
ATOM   2052 C CA    . ASN D 3 25  ? 10.781  16.329  -14.029 1.00 43.47 ? 153 ASN B CA    1 
ATOM   2053 C C     . ASN D 3 25  ? 12.195  16.915  -13.760 1.00 43.33 ? 153 ASN B C     1 
ATOM   2054 O O     . ASN D 3 25  ? 13.210  16.244  -13.935 1.00 42.34 ? 153 ASN B O     1 
ATOM   2055 C CB    . ASN D 3 25  ? 10.719  15.665  -15.423 1.00 43.87 ? 153 ASN B CB    1 
ATOM   2056 C CG    . ASN D 3 25  ? 9.420   14.881  -15.641 1.00 41.88 ? 153 ASN B CG    1 
ATOM   2057 O OD1   . ASN D 3 25  ? 8.887   14.280  -14.694 1.00 39.32 ? 153 ASN B OD1   1 
ATOM   2058 N ND2   . ASN D 3 25  ? 8.912   14.878  -16.883 1.00 37.15 ? 153 ASN B ND2   1 
ATOM   2059 N N     . ARG D 3 26  ? 12.226  18.178  -13.333 1.00 43.87 ? 154 ARG B N     1 
ATOM   2060 C CA    . ARG D 3 26  ? 13.449  18.911  -12.968 1.00 44.67 ? 154 ARG B CA    1 
ATOM   2061 C C     . ARG D 3 26  ? 14.135  18.275  -11.775 1.00 44.22 ? 154 ARG B C     1 
ATOM   2062 O O     . ARG D 3 26  ? 13.473  17.724  -10.868 1.00 43.71 ? 154 ARG B O     1 
ATOM   2063 C CB    . ARG D 3 26  ? 13.132  20.363  -12.625 1.00 44.54 ? 154 ARG B CB    1 
ATOM   2064 C CG    . ARG D 3 26  ? 14.280  21.325  -12.944 1.00 47.95 ? 154 ARG B CG    1 
ATOM   2065 C CD    . ARG D 3 26  ? 14.059  22.806  -12.460 1.00 47.35 ? 154 ARG B CD    1 
ATOM   2066 N NE    . ARG D 3 26  ? 15.102  23.694  -12.992 1.00 55.12 ? 154 ARG B NE    1 
ATOM   2067 C CZ    . ARG D 3 26  ? 14.984  24.362  -14.136 1.00 56.12 ? 154 ARG B CZ    1 
ATOM   2068 N NH1   . ARG D 3 26  ? 13.868  24.264  -14.847 1.00 55.80 ? 154 ARG B NH1   1 
ATOM   2069 N NH2   . ARG D 3 26  ? 15.970  25.130  -14.569 1.00 57.62 ? 154 ARG B NH2   1 
ATOM   2070 N N     . THR D 3 27  ? 15.469  18.336  -11.804 1.00 43.62 ? 155 THR B N     1 
ATOM   2071 C CA    . THR D 3 27  ? 16.300  17.740  -10.791 1.00 42.48 ? 155 THR B CA    1 
ATOM   2072 C C     . THR D 3 27  ? 17.013  18.856  -10.010 1.00 42.30 ? 155 THR B C     1 
ATOM   2073 O O     . THR D 3 27  ? 17.257  19.976  -10.517 1.00 41.97 ? 155 THR B O     1 
ATOM   2074 C CB    . THR D 3 27  ? 17.296  16.729  -11.432 1.00 42.68 ? 155 THR B CB    1 
ATOM   2075 O OG1   . THR D 3 27  ? 18.077  17.375  -12.435 1.00 41.96 ? 155 THR B OG1   1 
ATOM   2076 C CG2   . THR D 3 27  ? 16.579  15.673  -12.264 1.00 42.78 ? 155 THR B CG2   1 
ATOM   2077 N N     . LEU D 3 28  ? 17.313  18.556  -8.757  1.00 41.71 ? 156 LEU B N     1 
ATOM   2078 C CA    . LEU D 3 28  ? 17.868  19.541  -7.860  1.00 41.61 ? 156 LEU B CA    1 
ATOM   2079 C C     . LEU D 3 28  ? 19.142  18.990  -7.184  1.00 41.55 ? 156 LEU B C     1 
ATOM   2080 O O     . LEU D 3 28  ? 19.458  17.815  -7.322  1.00 40.93 ? 156 LEU B O     1 
ATOM   2081 C CB    . LEU D 3 28  ? 16.798  19.904  -6.813  1.00 41.52 ? 156 LEU B CB    1 
ATOM   2082 C CG    . LEU D 3 28  ? 15.532  20.671  -7.200  1.00 41.19 ? 156 LEU B CG    1 
ATOM   2083 C CD1   . LEU D 3 28  ? 14.921  21.157  -5.937  1.00 41.64 ? 156 LEU B CD1   1 
ATOM   2084 C CD2   . LEU D 3 28  ? 15.841  21.872  -8.017  1.00 41.96 ? 156 LEU B CD2   1 
ATOM   2085 N N     . ALA D 3 29  ? 19.853  19.841  -6.443  1.00 42.42 ? 157 ALA B N     1 
ATOM   2086 C CA    . ALA D 3 29  ? 20.941  19.376  -5.545  1.00 42.61 ? 157 ALA B CA    1 
ATOM   2087 C C     . ALA D 3 29  ? 20.761  19.774  -4.067  1.00 42.76 ? 157 ALA B C     1 
ATOM   2088 O O     . ALA D 3 29  ? 21.691  19.624  -3.269  1.00 43.59 ? 157 ALA B O     1 
ATOM   2089 C CB    . ALA D 3 29  ? 22.306  19.840  -6.055  1.00 41.54 ? 157 ALA B CB    1 
ATOM   2090 N N     . CYS D 3 30  ? 19.598  20.316  -3.708  1.00 42.36 ? 158 CYS B N     1 
ATOM   2091 C CA    . CYS D 3 30  ? 19.333  20.647  -2.312  1.00 41.50 ? 158 CYS B CA    1 
ATOM   2092 C C     . CYS D 3 30  ? 17.946  20.145  -1.913  1.00 41.35 ? 158 CYS B C     1 
ATOM   2093 O O     . CYS D 3 30  ? 16.982  20.360  -2.631  1.00 40.09 ? 158 CYS B O     1 
ATOM   2094 C CB    . CYS D 3 30  ? 19.495  22.140  -2.048  1.00 40.92 ? 158 CYS B CB    1 
ATOM   2095 S SG    . CYS D 3 30  ? 19.601  22.510  -0.263  1.00 43.77 ? 158 CYS B SG    1 
ATOM   2096 N N     . PHE D 3 31  ? 17.872  19.435  -0.786  1.00 41.25 ? 159 PHE B N     1 
ATOM   2097 C CA    . PHE D 3 31  ? 16.631  18.837  -0.330  1.00 41.55 ? 159 PHE B CA    1 
ATOM   2098 C C     . PHE D 3 31  ? 16.535  18.973  1.179   1.00 42.08 ? 159 PHE B C     1 
ATOM   2099 O O     . PHE D 3 31  ? 17.532  19.130  1.884   1.00 41.87 ? 159 PHE B O     1 
ATOM   2100 C CB    . PHE D 3 31  ? 16.531  17.344  -0.760  1.00 42.18 ? 159 PHE B CB    1 
ATOM   2101 C CG    . PHE D 3 31  ? 16.936  17.073  -2.226  1.00 41.18 ? 159 PHE B CG    1 
ATOM   2102 C CD1   . PHE D 3 31  ? 15.977  17.072  -3.239  1.00 39.31 ? 159 PHE B CD1   1 
ATOM   2103 C CD2   . PHE D 3 31  ? 18.270  16.825  -2.564  1.00 39.37 ? 159 PHE B CD2   1 
ATOM   2104 C CE1   . PHE D 3 31  ? 16.333  16.840  -4.558  1.00 39.51 ? 159 PHE B CE1   1 
ATOM   2105 C CE2   . PHE D 3 31  ? 18.646  16.581  -3.883  1.00 40.24 ? 159 PHE B CE2   1 
ATOM   2106 C CZ    . PHE D 3 31  ? 17.679  16.590  -4.883  1.00 40.87 ? 159 PHE B CZ    1 
ATOM   2107 N N     . ALA D 3 32  ? 15.313  18.939  1.673   1.00 43.26 ? 160 ALA B N     1 
ATOM   2108 C CA    . ALA D 3 32  ? 15.049  18.880  3.106   1.00 44.07 ? 160 ALA B CA    1 
ATOM   2109 C C     . ALA D 3 32  ? 13.980  17.813  3.390   1.00 44.75 ? 160 ALA B C     1 
ATOM   2110 O O     . ALA D 3 32  ? 13.140  17.506  2.539   1.00 44.63 ? 160 ALA B O     1 
ATOM   2111 C CB    . ALA D 3 32  ? 14.635  20.240  3.647   1.00 43.68 ? 160 ALA B CB    1 
ATOM   2112 N N     . ILE D 3 33  ? 14.031  17.251  4.589   1.00 45.24 ? 161 ILE B N     1 
ATOM   2113 C CA    . ILE D 3 33  ? 13.180  16.154  4.941   1.00 45.82 ? 161 ILE B CA    1 
ATOM   2114 C C     . ILE D 3 33  ? 12.706  16.463  6.319   1.00 46.93 ? 161 ILE B C     1 
ATOM   2115 O O     . ILE D 3 33  ? 13.490  16.902  7.163   1.00 46.91 ? 161 ILE B O     1 
ATOM   2116 C CB    . ILE D 3 33  ? 13.966  14.818  4.963   1.00 46.18 ? 161 ILE B CB    1 
ATOM   2117 C CG1   . ILE D 3 33  ? 14.295  14.335  3.537   1.00 46.65 ? 161 ILE B CG1   1 
ATOM   2118 C CG2   . ILE D 3 33  ? 13.189  13.748  5.722   1.00 44.73 ? 161 ILE B CG2   1 
ATOM   2119 C CD1   . ILE D 3 33  ? 15.262  13.132  3.497   1.00 45.00 ? 161 ILE B CD1   1 
ATOM   2120 N N     . TYR D 3 34  ? 11.413  16.232  6.540   1.00 48.34 ? 162 TYR B N     1 
ATOM   2121 C CA    . TYR D 3 34  ? 10.780  16.434  7.833   1.00 49.19 ? 162 TYR B CA    1 
ATOM   2122 C C     . TYR D 3 34  ? 10.416  15.051  8.357   1.00 49.81 ? 162 TYR B C     1 
ATOM   2123 O O     . TYR D 3 34  ? 9.793   14.234  7.652   1.00 49.31 ? 162 TYR B O     1 
ATOM   2124 C CB    . TYR D 3 34  ? 9.544   17.320  7.648   1.00 49.69 ? 162 TYR B CB    1 
ATOM   2125 C CG    . TYR D 3 34  ? 9.099   18.123  8.845   1.00 49.48 ? 162 TYR B CG    1 
ATOM   2126 C CD1   . TYR D 3 34  ? 9.818   18.106  10.038  1.00 50.08 ? 162 TYR B CD1   1 
ATOM   2127 C CD2   . TYR D 3 34  ? 7.975   18.935  8.766   1.00 50.78 ? 162 TYR B CD2   1 
ATOM   2128 C CE1   . TYR D 3 34  ? 9.411   18.828  11.136  1.00 50.97 ? 162 TYR B CE1   1 
ATOM   2129 C CE2   . TYR D 3 34  ? 7.549   19.691  9.860   1.00 51.47 ? 162 TYR B CE2   1 
ATOM   2130 C CZ    . TYR D 3 34  ? 8.269   19.628  11.050  1.00 50.66 ? 162 TYR B CZ    1 
ATOM   2131 O OH    . TYR D 3 34  ? 7.878   20.368  12.135  1.00 48.33 ? 162 TYR B OH    1 
ATOM   2132 N N     . THR D 3 35  ? 10.847  14.762  9.570   1.00 50.51 ? 163 THR B N     1 
ATOM   2133 C CA    . THR D 3 35  ? 10.502  13.492  10.152  1.00 51.83 ? 163 THR B CA    1 
ATOM   2134 C C     . THR D 3 35  ? 10.765  13.427  11.682  1.00 53.09 ? 163 THR B C     1 
ATOM   2135 O O     . THR D 3 35  ? 11.129  14.447  12.321  1.00 51.76 ? 163 THR B O     1 
ATOM   2136 C CB    . THR D 3 35  ? 11.196  12.396  9.355   1.00 52.34 ? 163 THR B CB    1 
ATOM   2137 O OG1   . THR D 3 35  ? 10.676  11.102  9.706   1.00 53.17 ? 163 THR B OG1   1 
ATOM   2138 C CG2   . THR D 3 35  ? 12.725  12.358  9.642   1.00 53.09 ? 163 THR B CG2   1 
ATOM   2139 N N     . THR D 3 36  ? 10.532  12.248  12.267  1.00 54.29 ? 164 THR B N     1 
ATOM   2140 C CA    . THR D 3 36  ? 10.690  12.067  13.705  1.00 56.16 ? 164 THR B CA    1 
ATOM   2141 C C     . THR D 3 36  ? 12.164  12.138  14.062  1.00 57.13 ? 164 THR B C     1 
ATOM   2142 O O     . THR D 3 36  ? 13.009  12.067  13.191  1.00 56.80 ? 164 THR B O     1 
ATOM   2143 C CB    . THR D 3 36  ? 10.038  10.720  14.226  1.00 56.24 ? 164 THR B CB    1 
ATOM   2144 O OG1   . THR D 3 36  ? 10.649  9.586   13.586  1.00 58.33 ? 164 THR B OG1   1 
ATOM   2145 C CG2   . THR D 3 36  ? 8.555   10.615  13.843  1.00 54.69 ? 164 THR B CG2   1 
ATOM   2146 N N     . LYS D 3 37  ? 12.452  12.298  15.353  1.00 59.04 ? 165 LYS B N     1 
ATOM   2147 C CA    . LYS D 3 37  ? 13.795  12.187  15.899  1.00 60.46 ? 165 LYS B CA    1 
ATOM   2148 C C     . LYS D 3 37  ? 14.519  10.898  15.447  1.00 61.20 ? 165 LYS B C     1 
ATOM   2149 O O     . LYS D 3 37  ? 15.612  10.974  14.887  1.00 61.68 ? 165 LYS B O     1 
ATOM   2150 C CB    . LYS D 3 37  ? 13.713  12.302  17.414  1.00 60.31 ? 165 LYS B CB    1 
ATOM   2151 C CG    . LYS D 3 37  ? 14.838  11.615  18.177  1.00 63.09 ? 165 LYS B CG    1 
ATOM   2152 C CD    . LYS D 3 37  ? 14.349  11.008  19.527  1.00 66.02 ? 165 LYS B CD    1 
ATOM   2153 C CE    . LYS D 3 37  ? 14.124  12.021  20.644  1.00 66.19 ? 165 LYS B CE    1 
ATOM   2154 N NZ    . LYS D 3 37  ? 13.941  11.256  21.936  1.00 69.72 ? 165 LYS B NZ    1 
ATOM   2155 N N     . GLU D 3 38  ? 13.894  9.735   15.646  1.00 62.15 ? 166 GLU B N     1 
ATOM   2156 C CA    . GLU D 3 38  ? 14.536  8.422   15.378  1.00 62.76 ? 166 GLU B CA    1 
ATOM   2157 C C     . GLU D 3 38  ? 14.869  8.232   13.907  1.00 61.87 ? 166 GLU B C     1 
ATOM   2158 O O     . GLU D 3 38  ? 15.908  7.649   13.563  1.00 61.68 ? 166 GLU B O     1 
ATOM   2159 C CB    . GLU D 3 38  ? 13.659  7.235   15.862  1.00 63.53 ? 166 GLU B CB    1 
ATOM   2160 C CG    . GLU D 3 38  ? 13.529  7.070   17.386  1.00 66.34 ? 166 GLU B CG    1 
ATOM   2161 C CD    . GLU D 3 38  ? 12.758  8.202   18.081  1.00 69.63 ? 166 GLU B CD    1 
ATOM   2162 O OE1   . GLU D 3 38  ? 11.963  8.930   17.417  1.00 70.67 ? 166 GLU B OE1   1 
ATOM   2163 O OE2   . GLU D 3 38  ? 12.950  8.366   19.308  1.00 70.59 ? 166 GLU B OE2   1 
ATOM   2164 N N     . LYS D 3 39  ? 13.966  8.718   13.055  1.00 60.86 ? 167 LYS B N     1 
ATOM   2165 C CA    . LYS D 3 39  ? 14.102  8.587   11.596  1.00 59.82 ? 167 LYS B CA    1 
ATOM   2166 C C     . LYS D 3 39  ? 15.143  9.514   10.977  1.00 58.37 ? 167 LYS B C     1 
ATOM   2167 O O     . LYS D 3 39  ? 15.874  9.114   10.067  1.00 57.51 ? 167 LYS B O     1 
ATOM   2168 C CB    . LYS D 3 39  ? 12.753  8.783   10.907  1.00 60.29 ? 167 LYS B CB    1 
ATOM   2169 C CG    . LYS D 3 39  ? 11.654  7.859   11.386  1.00 60.54 ? 167 LYS B CG    1 
ATOM   2170 C CD    . LYS D 3 39  ? 12.131  6.437   11.522  1.00 62.21 ? 167 LYS B CD    1 
ATOM   2171 C CE    . LYS D 3 39  ? 12.636  5.868   10.221  1.00 62.12 ? 167 LYS B CE    1 
ATOM   2172 N NZ    . LYS D 3 39  ? 12.833  4.395   10.433  1.00 64.05 ? 167 LYS B NZ    1 
ATOM   2173 N N     . ALA D 3 40  ? 15.200  10.737  11.498  1.00 57.44 ? 168 ALA B N     1 
ATOM   2174 C CA    . ALA D 3 40  ? 16.200  11.745  11.127  1.00 57.08 ? 168 ALA B CA    1 
ATOM   2175 C C     . ALA D 3 40  ? 17.652  11.366  11.506  1.00 56.93 ? 168 ALA B C     1 
ATOM   2176 O O     . ALA D 3 40  ? 18.575  11.531  10.697  1.00 57.05 ? 168 ALA B O     1 
ATOM   2177 C CB    . ALA D 3 40  ? 15.828  13.094  11.717  1.00 56.58 ? 168 ALA B CB    1 
ATOM   2178 N N     . ALA D 3 41  ? 17.859  10.867  12.721  1.00 56.44 ? 169 ALA B N     1 
ATOM   2179 C CA    . ALA D 3 41  ? 19.180  10.374  13.121  1.00 55.88 ? 169 ALA B CA    1 
ATOM   2180 C C     . ALA D 3 41  ? 19.732  9.320   12.140  1.00 55.64 ? 169 ALA B C     1 
ATOM   2181 O O     . ALA D 3 41  ? 20.908  9.375   11.762  1.00 56.13 ? 169 ALA B O     1 
ATOM   2182 C CB    . ALA D 3 41  ? 19.144  9.836   14.548  1.00 55.46 ? 169 ALA B CB    1 
ATOM   2183 N N     . LEU D 3 42  ? 18.871  8.398   11.717  1.00 55.34 ? 170 LEU B N     1 
ATOM   2184 C CA    . LEU D 3 42  ? 19.196  7.297   10.790  1.00 54.95 ? 170 LEU B CA    1 
ATOM   2185 C C     . LEU D 3 42  ? 19.358  7.748   9.343   1.00 54.15 ? 170 LEU B C     1 
ATOM   2186 O O     . LEU D 3 42  ? 20.204  7.233   8.594   1.00 54.86 ? 170 LEU B O     1 
ATOM   2187 C CB    . LEU D 3 42  ? 18.055  6.259   10.849  1.00 55.62 ? 170 LEU B CB    1 
ATOM   2188 C CG    . LEU D 3 42  ? 18.025  4.832   10.245  1.00 56.95 ? 170 LEU B CG    1 
ATOM   2189 C CD1   . LEU D 3 42  ? 16.578  4.302   10.261  1.00 57.26 ? 170 LEU B CD1   1 
ATOM   2190 C CD2   . LEU D 3 42  ? 18.559  4.741   8.815   1.00 59.80 ? 170 LEU B CD2   1 
ATOM   2191 N N     . LEU D 3 43  ? 18.510  8.673   8.919   1.00 53.04 ? 171 LEU B N     1 
ATOM   2192 C CA    . LEU D 3 43  ? 18.550  9.141   7.537   1.00 51.50 ? 171 LEU B CA    1 
ATOM   2193 C C     . LEU D 3 43  ? 19.740  10.099  7.345   1.00 50.65 ? 171 LEU B C     1 
ATOM   2194 O O     . LEU D 3 43  ? 20.274  10.220  6.261   1.00 49.23 ? 171 LEU B O     1 
ATOM   2195 C CB    . LEU D 3 43  ? 17.210  9.767   7.143   1.00 50.98 ? 171 LEU B CB    1 
ATOM   2196 C CG    . LEU D 3 43  ? 16.024  8.850   6.857   1.00 50.15 ? 171 LEU B CG    1 
ATOM   2197 C CD1   . LEU D 3 43  ? 14.766  9.697   6.641   1.00 49.81 ? 171 LEU B CD1   1 
ATOM   2198 C CD2   . LEU D 3 43  ? 16.285  7.978   5.638   1.00 49.82 ? 171 LEU B CD2   1 
ATOM   2199 N N     . TYR D 3 44  ? 20.166  10.739  8.427   1.00 50.56 ? 172 TYR B N     1 
ATOM   2200 C CA    . TYR D 3 44  ? 21.429  11.453  8.448   1.00 51.24 ? 172 TYR B CA    1 
ATOM   2201 C C     . TYR D 3 44  ? 22.553  10.550  7.940   1.00 52.07 ? 172 TYR B C     1 
ATOM   2202 O O     . TYR D 3 44  ? 23.156  10.833  6.882   1.00 52.79 ? 172 TYR B O     1 
ATOM   2203 C CB    . TYR D 3 44  ? 21.734  11.893  9.868   1.00 51.15 ? 172 TYR B CB    1 
ATOM   2204 C CG    . TYR D 3 44  ? 22.976  12.735  9.988   1.00 52.64 ? 172 TYR B CG    1 
ATOM   2205 C CD1   . TYR D 3 44  ? 22.930  14.123  9.775   1.00 51.74 ? 172 TYR B CD1   1 
ATOM   2206 C CD2   . TYR D 3 44  ? 24.202  12.157  10.323  1.00 52.09 ? 172 TYR B CD2   1 
ATOM   2207 C CE1   . TYR D 3 44  ? 24.060  14.896  9.894   1.00 50.56 ? 172 TYR B CE1   1 
ATOM   2208 C CE2   . TYR D 3 44  ? 25.343  12.933  10.446  1.00 51.58 ? 172 TYR B CE2   1 
ATOM   2209 C CZ    . TYR D 3 44  ? 25.265  14.299  10.226  1.00 52.13 ? 172 TYR B CZ    1 
ATOM   2210 O OH    . TYR D 3 44  ? 26.406  15.068  10.347  1.00 53.28 ? 172 TYR B OH    1 
ATOM   2211 N N     . LYS D 3 45  ? 22.807  9.448   8.670   1.00 51.85 ? 173 LYS B N     1 
ATOM   2212 C CA    . LYS D 3 45  ? 23.802  8.444   8.273   1.00 51.56 ? 173 LYS B CA    1 
ATOM   2213 C C     . LYS D 3 45  ? 23.553  7.875   6.898   1.00 51.24 ? 173 LYS B C     1 
ATOM   2214 O O     . LYS D 3 45  ? 24.473  7.768   6.110   1.00 51.73 ? 173 LYS B O     1 
ATOM   2215 C CB    . LYS D 3 45  ? 23.900  7.302   9.306   1.00 51.97 ? 173 LYS B CB    1 
ATOM   2216 N N     . LYS D 3 46  ? 22.313  7.504   6.602   1.00 50.93 ? 174 LYS B N     1 
ATOM   2217 C CA    . LYS D 3 46  ? 22.069  6.691   5.412   1.00 50.57 ? 174 LYS B CA    1 
ATOM   2218 C C     . LYS D 3 46  ? 21.990  7.483   4.104   1.00 50.08 ? 174 LYS B C     1 
ATOM   2219 O O     . LYS D 3 46  ? 22.337  6.962   3.055   1.00 49.97 ? 174 LYS B O     1 
ATOM   2220 C CB    . LYS D 3 46  ? 20.865  5.771   5.616   1.00 50.66 ? 174 LYS B CB    1 
ATOM   2221 C CG    . LYS D 3 46  ? 21.159  4.518   6.483   1.00 52.73 ? 174 LYS B CG    1 
ATOM   2222 C CD    . LYS D 3 46  ? 21.267  3.224   5.671   1.00 54.32 ? 174 LYS B CD    1 
ATOM   2223 C CE    . LYS D 3 46  ? 21.278  2.019   6.581   1.00 56.73 ? 174 LYS B CE    1 
ATOM   2224 N NZ    . LYS D 3 46  ? 22.672  1.577   7.025   1.00 60.93 ? 174 LYS B NZ    1 
ATOM   2225 N N     . ILE D 3 47  ? 21.561  8.742   4.185   1.00 49.96 ? 175 ILE B N     1 
ATOM   2226 C CA    . ILE D 3 47  ? 21.468  9.630   3.026   1.00 49.91 ? 175 ILE B CA    1 
ATOM   2227 C C     . ILE D 3 47  ? 22.865  10.057  2.602   1.00 51.12 ? 175 ILE B C     1 
ATOM   2228 O O     . ILE D 3 47  ? 23.155  10.195  1.420   1.00 50.80 ? 175 ILE B O     1 
ATOM   2229 C CB    . ILE D 3 47  ? 20.592  10.894  3.355   1.00 49.36 ? 175 ILE B CB    1 
ATOM   2230 C CG1   . ILE D 3 47  ? 19.138  10.499  3.639   1.00 46.97 ? 175 ILE B CG1   1 
ATOM   2231 C CG2   . ILE D 3 47  ? 20.790  12.047  2.285   1.00 47.73 ? 175 ILE B CG2   1 
ATOM   2232 C CD1   . ILE D 3 47  ? 18.182  10.791  2.546   1.00 44.69 ? 175 ILE B CD1   1 
ATOM   2233 N N     . MET D 3 48  ? 23.710  10.265  3.595   1.00 52.74 ? 176 MET B N     1 
ATOM   2234 C CA    . MET D 3 48  ? 25.078  10.634  3.401   1.00 55.29 ? 176 MET B CA    1 
ATOM   2235 C C     . MET D 3 48  ? 25.895  9.532   2.735   1.00 55.23 ? 176 MET B C     1 
ATOM   2236 O O     . MET D 3 48  ? 26.650  9.843   1.817   1.00 55.20 ? 176 MET B O     1 
ATOM   2237 C CB    . MET D 3 48  ? 25.671  11.004  4.759   1.00 55.71 ? 176 MET B CB    1 
ATOM   2238 C CG    . MET D 3 48  ? 27.167  11.165  4.808   1.00 56.17 ? 176 MET B CG    1 
ATOM   2239 S SD    . MET D 3 48  ? 27.697  11.586  6.496   1.00 60.32 ? 176 MET B SD    1 
ATOM   2240 C CE    . MET D 3 48  ? 29.300  12.313  6.033   1.00 60.44 ? 176 MET B CE    1 
ATOM   2241 N N     . GLU D 3 49  ? 25.794  8.275   3.222   1.00 55.43 ? 177 GLU B N     1 
ATOM   2242 C CA    . GLU D 3 49  ? 26.447  7.129   2.571   1.00 55.65 ? 177 GLU B CA    1 
ATOM   2243 C C     . GLU D 3 49  ? 25.879  7.039   1.145   1.00 54.81 ? 177 GLU B C     1 
ATOM   2244 O O     . GLU D 3 49  ? 26.611  6.902   0.155   1.00 55.39 ? 177 GLU B O     1 
ATOM   2245 C CB    . GLU D 3 49  ? 26.159  5.788   3.289   1.00 55.63 ? 177 GLU B CB    1 
ATOM   2246 C CG    . GLU D 3 49  ? 26.782  5.535   4.679   1.00 57.85 ? 177 GLU B CG    1 
ATOM   2247 C CD    . GLU D 3 49  ? 26.067  4.418   5.506   1.00 58.67 ? 177 GLU B CD    1 
ATOM   2248 O OE1   . GLU D 3 49  ? 25.019  3.850   5.039   1.00 63.54 ? 177 GLU B OE1   1 
ATOM   2249 O OE2   . GLU D 3 49  ? 26.521  4.097   6.649   1.00 59.70 ? 177 GLU B OE2   1 
ATOM   2250 N N     . LYS D 3 50  ? 24.558  7.136   1.059   1.00 53.77 ? 178 LYS B N     1 
ATOM   2251 C CA    . LYS D 3 50  ? 23.823  6.875   -0.163  1.00 52.60 ? 178 LYS B CA    1 
ATOM   2252 C C     . LYS D 3 50  ? 24.138  7.871   -1.254  1.00 51.90 ? 178 LYS B C     1 
ATOM   2253 O O     . LYS D 3 50  ? 24.468  7.492   -2.370  1.00 51.67 ? 178 LYS B O     1 
ATOM   2254 C CB    . LYS D 3 50  ? 22.317  6.878   0.121   1.00 52.29 ? 178 LYS B CB    1 
ATOM   2255 C CG    . LYS D 3 50  ? 21.430  6.761   -1.107  1.00 52.25 ? 178 LYS B CG    1 
ATOM   2256 C CD    . LYS D 3 50  ? 21.683  5.487   -1.926  1.00 52.82 ? 178 LYS B CD    1 
ATOM   2257 C CE    . LYS D 3 50  ? 20.876  5.492   -3.210  1.00 51.77 ? 178 LYS B CE    1 
ATOM   2258 N NZ    . LYS D 3 50  ? 19.661  4.723   -2.944  1.00 53.60 ? 178 LYS B NZ    1 
ATOM   2259 N N     . TYR D 3 51  ? 23.994  9.147   -0.930  1.00 50.96 ? 179 TYR B N     1 
ATOM   2260 C CA    . TYR D 3 51  ? 24.074  10.194  -1.935  1.00 50.51 ? 179 TYR B CA    1 
ATOM   2261 C C     . TYR D 3 51  ? 25.453  10.865  -1.923  1.00 50.93 ? 179 TYR B C     1 
ATOM   2262 O O     . TYR D 3 51  ? 25.737  11.769  -2.740  1.00 51.57 ? 179 TYR B O     1 
ATOM   2263 C CB    . TYR D 3 51  ? 22.881  11.175  -1.783  1.00 49.77 ? 179 TYR B CB    1 
ATOM   2264 C CG    . TYR D 3 51  ? 21.605  10.519  -2.252  1.00 48.26 ? 179 TYR B CG    1 
ATOM   2265 C CD1   . TYR D 3 51  ? 21.450  10.180  -3.586  1.00 47.25 ? 179 TYR B CD1   1 
ATOM   2266 C CD2   . TYR D 3 51  ? 20.596  10.153  -1.369  1.00 47.67 ? 179 TYR B CD2   1 
ATOM   2267 C CE1   . TYR D 3 51  ? 20.313  9.533   -4.049  1.00 46.15 ? 179 TYR B CE1   1 
ATOM   2268 C CE2   . TYR D 3 51  ? 19.431  9.497   -1.831  1.00 46.28 ? 179 TYR B CE2   1 
ATOM   2269 C CZ    . TYR D 3 51  ? 19.320  9.204   -3.182  1.00 47.09 ? 179 TYR B CZ    1 
ATOM   2270 O OH    . TYR D 3 51  ? 18.221  8.585   -3.719  1.00 50.44 ? 179 TYR B OH    1 
ATOM   2271 N N     . SER D 3 52  ? 26.294  10.387  -1.003  1.00 49.74 ? 180 SER B N     1 
ATOM   2272 C CA    . SER D 3 52  ? 27.610  10.927  -0.737  1.00 49.83 ? 180 SER B CA    1 
ATOM   2273 C C     . SER D 3 52  ? 27.548  12.439  -0.745  1.00 49.35 ? 180 SER B C     1 
ATOM   2274 O O     . SER D 3 52  ? 28.244  13.128  -1.496  1.00 49.24 ? 180 SER B O     1 
ATOM   2275 C CB    . SER D 3 52  ? 28.651  10.363  -1.705  1.00 50.34 ? 180 SER B CB    1 
ATOM   2276 O OG    . SER D 3 52  ? 28.493  10.924  -2.981  1.00 51.15 ? 180 SER B OG    1 
ATOM   2277 N N     . VAL D 3 53  ? 26.656  12.931  0.100   1.00 48.72 ? 181 VAL B N     1 
ATOM   2278 C CA    . VAL D 3 53  ? 26.340  14.334  0.184   1.00 47.30 ? 181 VAL B CA    1 
ATOM   2279 C C     . VAL D 3 53  ? 27.597  15.170  0.397   1.00 48.18 ? 181 VAL B C     1 
ATOM   2280 O O     . VAL D 3 53  ? 28.511  14.808  1.146   1.00 48.67 ? 181 VAL B O     1 
ATOM   2281 C CB    . VAL D 3 53  ? 25.343  14.588  1.333   1.00 46.98 ? 181 VAL B CB    1 
ATOM   2282 C CG1   . VAL D 3 53  ? 24.042  13.817  1.089   1.00 43.91 ? 181 VAL B CG1   1 
ATOM   2283 C CG2   . VAL D 3 53  ? 25.965  14.254  2.699   1.00 44.02 ? 181 VAL B CG2   1 
ATOM   2284 N N     . THR D 3 54  ? 27.617  16.314  -0.250  1.00 47.99 ? 182 THR B N     1 
ATOM   2285 C CA    . THR D 3 54  ? 28.625  17.308  0.012   1.00 47.67 ? 182 THR B CA    1 
ATOM   2286 C C     . THR D 3 54  ? 28.463  18.027  1.396   1.00 46.53 ? 182 THR B C     1 
ATOM   2287 O O     . THR D 3 54  ? 29.426  18.622  1.908   1.00 45.32 ? 182 THR B O     1 
ATOM   2288 C CB    . THR D 3 54  ? 28.655  18.282  -1.186  1.00 47.44 ? 182 THR B CB    1 
ATOM   2289 O OG1   . THR D 3 54  ? 29.233  19.518  -0.768  1.00 52.82 ? 182 THR B OG1   1 
ATOM   2290 C CG2   . THR D 3 54  ? 27.303  18.732  -1.533  1.00 46.95 ? 182 THR B CG2   1 
ATOM   2291 N N     . PHE D 3 55  ? 27.248  17.971  1.965   1.00 45.16 ? 183 PHE B N     1 
ATOM   2292 C CA    . PHE D 3 55  ? 26.896  18.548  3.271   1.00 44.11 ? 183 PHE B CA    1 
ATOM   2293 C C     . PHE D 3 55  ? 25.531  17.999  3.653   1.00 43.59 ? 183 PHE B C     1 
ATOM   2294 O O     . PHE D 3 55  ? 24.719  17.790  2.792   1.00 41.73 ? 183 PHE B O     1 
ATOM   2295 C CB    . PHE D 3 55  ? 26.849  20.105  3.286   1.00 44.30 ? 183 PHE B CB    1 
ATOM   2296 C CG    . PHE D 3 55  ? 26.515  20.704  4.687   1.00 44.97 ? 183 PHE B CG    1 
ATOM   2297 C CD1   . PHE D 3 55  ? 27.502  20.823  5.670   1.00 39.45 ? 183 PHE B CD1   1 
ATOM   2298 C CD2   . PHE D 3 55  ? 25.188  21.106  5.013   1.00 45.22 ? 183 PHE B CD2   1 
ATOM   2299 C CE1   . PHE D 3 55  ? 27.210  21.338  6.945   1.00 40.73 ? 183 PHE B CE1   1 
ATOM   2300 C CE2   . PHE D 3 55  ? 24.867  21.620  6.299   1.00 44.34 ? 183 PHE B CE2   1 
ATOM   2301 C CZ    . PHE D 3 55  ? 25.901  21.747  7.277   1.00 43.30 ? 183 PHE B CZ    1 
ATOM   2302 N N     . ILE D 3 56  ? 25.318  17.772  4.957   1.00 43.97 ? 184 ILE B N     1 
ATOM   2303 C CA    . ILE D 3 56  ? 24.062  17.299  5.529   1.00 44.36 ? 184 ILE B CA    1 
ATOM   2304 C C     . ILE D 3 56  ? 23.946  17.764  6.962   1.00 45.75 ? 184 ILE B C     1 
ATOM   2305 O O     . ILE D 3 56  ? 24.890  17.598  7.731   1.00 45.64 ? 184 ILE B O     1 
ATOM   2306 C CB    . ILE D 3 56  ? 23.889  15.720  5.412   1.00 44.79 ? 184 ILE B CB    1 
ATOM   2307 C CG1   . ILE D 3 56  ? 22.517  15.253  5.901   1.00 42.81 ? 184 ILE B CG1   1 
ATOM   2308 C CG2   . ILE D 3 56  ? 25.035  14.928  6.087   1.00 45.53 ? 184 ILE B CG2   1 
ATOM   2309 C CD1   . ILE D 3 56  ? 22.101  13.917  5.312   1.00 43.38 ? 184 ILE B CD1   1 
ATOM   2310 N N     . SER D 3 57  ? 22.804  18.365  7.325   1.00 46.88 ? 185 SER B N     1 
ATOM   2311 C CA    . SER D 3 57  ? 22.593  18.705  8.711   1.00 48.46 ? 185 SER B CA    1 
ATOM   2312 C C     . SER D 3 57  ? 21.271  18.238  9.236   1.00 49.92 ? 185 SER B C     1 
ATOM   2313 O O     . SER D 3 57  ? 20.326  18.026  8.467   1.00 50.87 ? 185 SER B O     1 
ATOM   2314 C CB    . SER D 3 57  ? 22.816  20.205  8.977   1.00 48.88 ? 185 SER B CB    1 
ATOM   2315 O OG    . SER D 3 57  ? 21.832  21.032  8.404   1.00 49.37 ? 185 SER B OG    1 
ATOM   2316 N N     . ARG D 3 58  ? 21.205  18.088  10.557  1.00 50.89 ? 186 ARG B N     1 
ATOM   2317 C CA    . ARG D 3 58  ? 19.996  17.643  11.220  1.00 51.72 ? 186 ARG B CA    1 
ATOM   2318 C C     . ARG D 3 58  ? 19.604  18.647  12.301  1.00 52.42 ? 186 ARG B C     1 
ATOM   2319 O O     . ARG D 3 58  ? 20.440  19.038  13.127  1.00 52.46 ? 186 ARG B O     1 
ATOM   2320 C CB    . ARG D 3 58  ? 20.216  16.254  11.817  1.00 52.03 ? 186 ARG B CB    1 
ATOM   2321 C CG    . ARG D 3 58  ? 19.070  15.702  12.666  1.00 51.77 ? 186 ARG B CG    1 
ATOM   2322 C CD    . ARG D 3 58  ? 19.172  14.227  12.837  1.00 51.65 ? 186 ARG B CD    1 
ATOM   2323 N NE    . ARG D 3 58  ? 20.141  13.857  13.867  1.00 52.76 ? 186 ARG B NE    1 
ATOM   2324 C CZ    . ARG D 3 58  ? 19.795  13.590  15.128  1.00 54.52 ? 186 ARG B CZ    1 
ATOM   2325 N NH1   . ARG D 3 58  ? 18.525  13.675  15.504  1.00 53.72 ? 186 ARG B NH1   1 
ATOM   2326 N NH2   . ARG D 3 58  ? 20.701  13.235  16.018  1.00 53.49 ? 186 ARG B NH2   1 
ATOM   2327 N N     . HIS D 3 59  ? 18.326  19.042  12.298  1.00 52.58 ? 187 HIS B N     1 
ATOM   2328 C CA    . HIS D 3 59  ? 17.866  20.175  13.093  1.00 53.07 ? 187 HIS B CA    1 
ATOM   2329 C C     . HIS D 3 59  ? 16.601  19.877  13.870  1.00 54.47 ? 187 HIS B C     1 
ATOM   2330 O O     . HIS D 3 59  ? 15.753  19.091  13.432  1.00 54.66 ? 187 HIS B O     1 
ATOM   2331 C CB    . HIS D 3 59  ? 17.536  21.388  12.203  1.00 52.37 ? 187 HIS B CB    1 
ATOM   2332 C CG    . HIS D 3 59  ? 18.603  21.752  11.233  1.00 48.22 ? 187 HIS B CG    1 
ATOM   2333 N ND1   . HIS D 3 59  ? 19.476  22.787  11.459  1.00 45.06 ? 187 HIS B ND1   1 
ATOM   2334 C CD2   . HIS D 3 59  ? 18.927  21.236  10.025  1.00 47.33 ? 187 HIS B CD2   1 
ATOM   2335 C CE1   . HIS D 3 59  ? 20.307  22.887  10.436  1.00 47.94 ? 187 HIS B CE1   1 
ATOM   2336 N NE2   . HIS D 3 59  ? 19.998  21.957  9.552   1.00 47.40 ? 187 HIS B NE2   1 
ATOM   2337 N N     . ASN D 3 60  ? 16.484  20.564  15.000  1.00 55.59 ? 188 ASN B N     1 
ATOM   2338 C CA    . ASN D 3 60  ? 15.261  20.694  15.760  1.00 57.46 ? 188 ASN B CA    1 
ATOM   2339 C C     . ASN D 3 60  ? 14.177  21.538  15.081  1.00 57.95 ? 188 ASN B C     1 
ATOM   2340 O O     . ASN D 3 60  ? 14.428  22.682  14.696  1.00 58.62 ? 188 ASN B O     1 
ATOM   2341 C CB    . ASN D 3 60  ? 15.591  21.269  17.132  1.00 57.37 ? 188 ASN B CB    1 
ATOM   2342 C CG    . ASN D 3 60  ? 15.746  20.195  18.146  1.00 58.67 ? 188 ASN B CG    1 
ATOM   2343 O OD1   . ASN D 3 60  ? 15.075  19.153  18.041  1.00 61.30 ? 188 ASN B OD1   1 
ATOM   2344 N ND2   . ASN D 3 60  ? 16.634  20.397  19.122  1.00 56.90 ? 188 ASN B ND2   1 
ATOM   2345 N N     . SER D 3 61  ? 12.990  20.941  14.945  1.00 58.39 ? 189 SER B N     1 
ATOM   2346 C CA    . SER D 3 61  ? 11.800  21.577  14.380  1.00 58.69 ? 189 SER B CA    1 
ATOM   2347 C C     . SER D 3 61  ? 10.542  21.115  15.113  1.00 59.70 ? 189 SER B C     1 
ATOM   2348 O O     . SER D 3 61  ? 10.032  20.002  14.833  1.00 59.26 ? 189 SER B O     1 
ATOM   2349 C CB    . SER D 3 61  ? 11.650  21.194  12.911  1.00 58.60 ? 189 SER B CB    1 
ATOM   2350 O OG    . SER D 3 61  ? 10.353  21.521  12.430  1.00 57.33 ? 189 SER B OG    1 
ATOM   2351 N N     . TYR D 3 62  ? 10.061  21.942  16.055  1.00 60.32 ? 190 TYR B N     1 
ATOM   2352 C CA    . TYR D 3 62  ? 8.705   21.791  16.609  1.00 61.04 ? 190 TYR B CA    1 
ATOM   2353 C C     . TYR D 3 62  ? 8.348   20.348  16.918  1.00 61.55 ? 190 TYR B C     1 
ATOM   2354 O O     . TYR D 3 62  ? 7.645   19.729  16.105  1.00 62.31 ? 190 TYR B O     1 
ATOM   2355 C CB    . TYR D 3 62  ? 7.658   22.266  15.568  1.00 60.70 ? 190 TYR B CB    1 
ATOM   2356 C CG    . TYR D 3 62  ? 7.605   23.752  15.293  1.00 60.56 ? 190 TYR B CG    1 
ATOM   2357 C CD1   . TYR D 3 62  ? 7.071   24.635  16.232  1.00 61.30 ? 190 TYR B CD1   1 
ATOM   2358 C CD2   . TYR D 3 62  ? 8.035   24.272  14.081  1.00 60.20 ? 190 TYR B CD2   1 
ATOM   2359 C CE1   . TYR D 3 62  ? 6.993   26.004  15.992  1.00 60.40 ? 190 TYR B CE1   1 
ATOM   2360 C CE2   . TYR D 3 62  ? 7.958   25.641  13.831  1.00 61.40 ? 190 TYR B CE2   1 
ATOM   2361 C CZ    . TYR D 3 62  ? 7.431   26.503  14.799  1.00 60.78 ? 190 TYR B CZ    1 
ATOM   2362 O OH    . TYR D 3 62  ? 7.361   27.863  14.578  1.00 61.16 ? 190 TYR B OH    1 
ATOM   2363 N N     . ASN D 3 63  ? 8.803   19.792  18.043  1.00 61.86 ? 191 ASN B N     1 
ATOM   2364 C CA    . ASN D 3 63  ? 8.503   18.364  18.379  1.00 62.09 ? 191 ASN B CA    1 
ATOM   2365 C C     . ASN D 3 63  ? 9.288   17.335  17.548  1.00 61.45 ? 191 ASN B C     1 
ATOM   2366 O O     . ASN D 3 63  ? 9.433   16.198  17.964  1.00 61.86 ? 191 ASN B O     1 
ATOM   2367 C CB    . ASN D 3 63  ? 7.005   18.010  18.189  1.00 62.53 ? 191 ASN B CB    1 
ATOM   2368 C CG    . ASN D 3 63  ? 6.081   18.703  19.182  1.00 64.58 ? 191 ASN B CG    1 
ATOM   2369 O OD1   . ASN D 3 63  ? 6.261   18.591  20.400  1.00 64.91 ? 191 ASN B OD1   1 
ATOM   2370 N ND2   . ASN D 3 63  ? 5.050   19.398  18.655  1.00 65.48 ? 191 ASN B ND2   1 
ATOM   2371 N N     . HIS D 3 64  ? 9.742   17.713  16.353  1.00 60.41 ? 192 HIS B N     1 
ATOM   2372 C CA    . HIS D 3 64  ? 10.378  16.763  15.438  1.00 58.91 ? 192 HIS B CA    1 
ATOM   2373 C C     . HIS D 3 64  ? 11.732  17.262  14.903  1.00 57.07 ? 192 HIS B C     1 
ATOM   2374 O O     . HIS D 3 64  ? 12.370  18.111  15.520  1.00 56.59 ? 192 HIS B O     1 
ATOM   2375 C CB    . HIS D 3 64  ? 9.403   16.375  14.308  1.00 59.18 ? 192 HIS B CB    1 
ATOM   2376 C CG    . HIS D 3 64  ? 8.175   15.659  14.793  1.00 62.56 ? 192 HIS B CG    1 
ATOM   2377 N ND1   . HIS D 3 64  ? 6.896   16.157  14.615  1.00 64.14 ? 192 HIS B ND1   1 
ATOM   2378 C CD2   . HIS D 3 64  ? 8.033   14.500  15.484  1.00 64.19 ? 192 HIS B CD2   1 
ATOM   2379 C CE1   . HIS D 3 64  ? 6.022   15.323  15.157  1.00 64.55 ? 192 HIS B CE1   1 
ATOM   2380 N NE2   . HIS D 3 64  ? 6.686   14.311  15.690  1.00 65.08 ? 192 HIS B NE2   1 
ATOM   2381 N N     . ASN D 3 65  ? 12.143  16.737  13.752  1.00 55.54 ? 193 ASN B N     1 
ATOM   2382 C CA    . ASN D 3 65  ? 13.440  17.020  13.153  1.00 54.66 ? 193 ASN B CA    1 
ATOM   2383 C C     . ASN D 3 65  ? 13.318  17.351  11.667  1.00 53.81 ? 193 ASN B C     1 
ATOM   2384 O O     . ASN D 3 65  ? 12.489  16.785  10.974  1.00 53.58 ? 193 ASN B O     1 
ATOM   2385 C CB    . ASN D 3 65  ? 14.346  15.776  13.265  1.00 55.07 ? 193 ASN B CB    1 
ATOM   2386 C CG    . ASN D 3 65  ? 15.174  15.713  14.557  1.00 54.60 ? 193 ASN B CG    1 
ATOM   2387 O OD1   . ASN D 3 65  ? 16.120  14.943  14.627  1.00 58.59 ? 193 ASN B OD1   1 
ATOM   2388 N ND2   . ASN D 3 65  ? 14.818  16.488  15.567  1.00 52.66 ? 193 ASN B ND2   1 
ATOM   2389 N N     . ILE D 3 66  ? 14.171  18.247  11.177  1.00 53.05 ? 194 ILE B N     1 
ATOM   2390 C CA    . ILE D 3 66  ? 14.362  18.436  9.735   1.00 52.08 ? 194 ILE B CA    1 
ATOM   2391 C C     . ILE D 3 66  ? 15.806  18.058  9.370   1.00 51.79 ? 194 ILE B C     1 
ATOM   2392 O O     . ILE D 3 66  ? 16.730  18.316  10.140  1.00 51.53 ? 194 ILE B O     1 
ATOM   2393 C CB    . ILE D 3 66  ? 14.008  19.914  9.284   1.00 52.04 ? 194 ILE B CB    1 
ATOM   2394 C CG1   . ILE D 3 66  ? 12.495  20.126  9.267   1.00 51.28 ? 194 ILE B CG1   1 
ATOM   2395 C CG2   . ILE D 3 66  ? 14.540  20.243  7.870   1.00 50.74 ? 194 ILE B CG2   1 
ATOM   2396 C CD1   . ILE D 3 66  ? 12.085  21.559  9.129   1.00 52.19 ? 194 ILE B CD1   1 
ATOM   2397 N N     . LEU D 3 67  ? 15.965  17.421  8.208   1.00 50.98 ? 195 LEU B N     1 
ATOM   2398 C CA    . LEU D 3 67  ? 17.252  17.122  7.621   1.00 50.55 ? 195 LEU B CA    1 
ATOM   2399 C C     . LEU D 3 67  ? 17.403  17.939  6.360   1.00 50.62 ? 195 LEU B C     1 
ATOM   2400 O O     . LEU D 3 67  ? 16.557  17.822  5.458   1.00 51.17 ? 195 LEU B O     1 
ATOM   2401 C CB    . LEU D 3 67  ? 17.362  15.635  7.232   1.00 50.37 ? 195 LEU B CB    1 
ATOM   2402 C CG    . LEU D 3 67  ? 17.928  14.528  8.132   1.00 49.30 ? 195 LEU B CG    1 
ATOM   2403 C CD1   . LEU D 3 67  ? 17.815  13.220  7.408   1.00 47.93 ? 195 LEU B CD1   1 
ATOM   2404 C CD2   . LEU D 3 67  ? 19.351  14.774  8.486   1.00 47.45 ? 195 LEU B CD2   1 
ATOM   2405 N N     . PHE D 3 68  ? 18.492  18.720  6.290   1.00 49.53 ? 196 PHE B N     1 
ATOM   2406 C CA    . PHE D 3 68  ? 18.847  19.562  5.133   1.00 48.39 ? 196 PHE B CA    1 
ATOM   2407 C C     . PHE D 3 68  ? 20.174  19.041  4.561   1.00 47.58 ? 196 PHE B C     1 
ATOM   2408 O O     . PHE D 3 68  ? 21.069  18.686  5.335   1.00 47.69 ? 196 PHE B O     1 
ATOM   2409 C CB    . PHE D 3 68  ? 18.997  21.027  5.596   1.00 48.89 ? 196 PHE B CB    1 
ATOM   2410 C CG    . PHE D 3 68  ? 19.662  21.949  4.573   1.00 49.84 ? 196 PHE B CG    1 
ATOM   2411 C CD1   . PHE D 3 68  ? 18.890  22.663  3.648   1.00 47.67 ? 196 PHE B CD1   1 
ATOM   2412 C CD2   . PHE D 3 68  ? 21.063  22.111  4.549   1.00 50.06 ? 196 PHE B CD2   1 
ATOM   2413 C CE1   . PHE D 3 68  ? 19.487  23.510  2.712   1.00 46.55 ? 196 PHE B CE1   1 
ATOM   2414 C CE2   . PHE D 3 68  ? 21.667  22.952  3.608   1.00 48.79 ? 196 PHE B CE2   1 
ATOM   2415 C CZ    . PHE D 3 68  ? 20.859  23.658  2.689   1.00 48.56 ? 196 PHE B CZ    1 
ATOM   2416 N N     . PHE D 3 69  ? 20.302  18.970  3.232   1.00 45.72 ? 197 PHE B N     1 
ATOM   2417 C CA    . PHE D 3 69  ? 21.500  18.409  2.623   1.00 43.91 ? 197 PHE B CA    1 
ATOM   2418 C C     . PHE D 3 69  ? 21.644  18.738  1.138   1.00 44.12 ? 197 PHE B C     1 
ATOM   2419 O O     . PHE D 3 69  ? 20.674  18.938  0.450   1.00 43.37 ? 197 PHE B O     1 
ATOM   2420 C CB    . PHE D 3 69  ? 21.565  16.876  2.833   1.00 44.04 ? 197 PHE B CB    1 
ATOM   2421 C CG    . PHE D 3 69  ? 20.481  16.100  2.128   1.00 41.24 ? 197 PHE B CG    1 
ATOM   2422 C CD1   . PHE D 3 69  ? 19.304  15.807  2.774   1.00 37.44 ? 197 PHE B CD1   1 
ATOM   2423 C CD2   . PHE D 3 69  ? 20.651  15.687  0.799   1.00 42.46 ? 197 PHE B CD2   1 
ATOM   2424 C CE1   . PHE D 3 69  ? 18.306  15.117  2.140   1.00 39.27 ? 197 PHE B CE1   1 
ATOM   2425 C CE2   . PHE D 3 69  ? 19.665  14.981  0.131   1.00 42.60 ? 197 PHE B CE2   1 
ATOM   2426 C CZ    . PHE D 3 69  ? 18.472  14.702  0.807   1.00 43.29 ? 197 PHE B CZ    1 
ATOM   2427 N N     . LEU D 3 70  ? 22.885  18.756  0.669   1.00 44.35 ? 198 LEU B N     1 
ATOM   2428 C CA    . LEU D 3 70  ? 23.251  19.115  -0.675  1.00 44.78 ? 198 LEU B CA    1 
ATOM   2429 C C     . LEU D 3 70  ? 23.973  17.928  -1.256  1.00 46.53 ? 198 LEU B C     1 
ATOM   2430 O O     . LEU D 3 70  ? 24.831  17.320  -0.593  1.00 47.11 ? 198 LEU B O     1 
ATOM   2431 C CB    . LEU D 3 70  ? 24.209  20.296  -0.639  1.00 44.23 ? 198 LEU B CB    1 
ATOM   2432 C CG    . LEU D 3 70  ? 23.618  21.607  -0.125  1.00 43.82 ? 198 LEU B CG    1 
ATOM   2433 C CD1   . LEU D 3 70  ? 24.633  22.351  0.627   1.00 45.97 ? 198 LEU B CD1   1 
ATOM   2434 C CD2   . LEU D 3 70  ? 23.136  22.422  -1.295  1.00 42.27 ? 198 LEU B CD2   1 
ATOM   2435 N N     . THR D 3 71  ? 23.644  17.587  -2.493  1.00 46.87 ? 199 THR B N     1 
ATOM   2436 C CA    . THR D 3 71  ? 24.166  16.385  -3.087  1.00 47.05 ? 199 THR B CA    1 
ATOM   2437 C C     . THR D 3 71  ? 25.061  16.790  -4.239  1.00 47.89 ? 199 THR B C     1 
ATOM   2438 O O     . THR D 3 71  ? 24.696  17.725  -4.961  1.00 48.71 ? 199 THR B O     1 
ATOM   2439 C CB    . THR D 3 71  ? 23.019  15.453  -3.590  1.00 46.57 ? 199 THR B CB    1 
ATOM   2440 O OG1   . THR D 3 71  ? 22.292  16.105  -4.624  1.00 44.06 ? 199 THR B OG1   1 
ATOM   2441 C CG2   . THR D 3 71  ? 22.009  15.233  -2.514  1.00 46.77 ? 199 THR B CG2   1 
ATOM   2442 N N     . PRO D 3 72  ? 26.169  16.053  -4.462  1.00 48.02 ? 200 PRO B N     1 
ATOM   2443 C CA    . PRO D 3 72  ? 27.198  16.474  -5.417  1.00 48.06 ? 200 PRO B CA    1 
ATOM   2444 C C     . PRO D 3 72  ? 26.682  16.336  -6.855  1.00 48.11 ? 200 PRO B C     1 
ATOM   2445 O O     . PRO D 3 72  ? 27.193  17.024  -7.717  1.00 48.31 ? 200 PRO B O     1 
ATOM   2446 C CB    . PRO D 3 72  ? 28.339  15.468  -5.177  1.00 48.25 ? 200 PRO B CB    1 
ATOM   2447 C CG    . PRO D 3 72  ? 27.664  14.207  -4.636  1.00 47.66 ? 200 PRO B CG    1 
ATOM   2448 C CD    . PRO D 3 72  ? 26.459  14.717  -3.899  1.00 47.62 ? 200 PRO B CD    1 
ATOM   2449 N N     . HIS D 3 73  ? 25.713  15.435  -7.084  1.00 47.91 ? 201 HIS B N     1 
ATOM   2450 C CA    . HIS D 3 73  ? 24.947  15.332  -8.340  1.00 48.87 ? 201 HIS B CA    1 
ATOM   2451 C C     . HIS D 3 73  ? 23.446  15.675  -8.169  1.00 48.09 ? 201 HIS B C     1 
ATOM   2452 O O     . HIS D 3 73  ? 22.940  15.879  -7.058  1.00 46.46 ? 201 HIS B O     1 
ATOM   2453 C CB    . HIS D 3 73  ? 25.109  13.956  -9.027  1.00 49.45 ? 201 HIS B CB    1 
ATOM   2454 C CG    . HIS D 3 73  ? 26.539  13.510  -9.160  1.00 54.57 ? 201 HIS B CG    1 
ATOM   2455 N ND1   . HIS D 3 73  ? 27.539  14.330  -9.659  1.00 57.35 ? 201 HIS B ND1   1 
ATOM   2456 C CD2   . HIS D 3 73  ? 27.142  12.342  -8.832  1.00 56.18 ? 201 HIS B CD2   1 
ATOM   2457 C CE1   . HIS D 3 73  ? 28.689  13.682  -9.638  1.00 57.15 ? 201 HIS B CE1   1 
ATOM   2458 N NE2   . HIS D 3 73  ? 28.476  12.477  -9.136  1.00 59.52 ? 201 HIS B NE2   1 
ATOM   2459 N N     . ARG D 3 74  ? 22.768  15.746  -9.306  1.00 47.90 ? 202 ARG B N     1 
ATOM   2460 C CA    . ARG D 3 74  ? 21.389  16.170  -9.361  1.00 48.14 ? 202 ARG B CA    1 
ATOM   2461 C C     . ARG D 3 74  ? 20.406  14.991  -9.214  1.00 48.27 ? 202 ARG B C     1 
ATOM   2462 O O     . ARG D 3 74  ? 20.576  13.937  -9.833  1.00 48.87 ? 202 ARG B O     1 
ATOM   2463 C CB    . ARG D 3 74  ? 21.139  16.931  -10.659 1.00 47.98 ? 202 ARG B CB    1 
ATOM   2464 C CG    . ARG D 3 74  ? 21.606  18.371  -10.636 1.00 48.19 ? 202 ARG B CG    1 
ATOM   2465 C CD    . ARG D 3 74  ? 21.690  18.978  -12.018 1.00 51.01 ? 202 ARG B CD    1 
ATOM   2466 N NE    . ARG D 3 74  ? 20.374  19.354  -12.516 1.00 54.30 ? 202 ARG B NE    1 
ATOM   2467 C CZ    . ARG D 3 74  ? 20.070  20.541  -13.049 1.00 55.79 ? 202 ARG B CZ    1 
ATOM   2468 N NH1   . ARG D 3 74  ? 21.009  21.464  -13.172 1.00 58.35 ? 202 ARG B NH1   1 
ATOM   2469 N NH2   . ARG D 3 74  ? 18.829  20.816  -13.460 1.00 53.70 ? 202 ARG B NH2   1 
ATOM   2470 N N     . HIS D 3 75  ? 19.388  15.179  -8.379  1.00 47.42 ? 203 HIS B N     1 
ATOM   2471 C CA    . HIS D 3 75  ? 18.365  14.174  -8.197  1.00 47.02 ? 203 HIS B CA    1 
ATOM   2472 C C     . HIS D 3 75  ? 16.946  14.747  -8.359  1.00 45.88 ? 203 HIS B C     1 
ATOM   2473 O O     . HIS D 3 75  ? 16.742  15.950  -8.206  1.00 45.62 ? 203 HIS B O     1 
ATOM   2474 C CB    . HIS D 3 75  ? 18.564  13.519  -6.827  1.00 48.34 ? 203 HIS B CB    1 
ATOM   2475 C CG    . HIS D 3 75  ? 19.931  12.927  -6.637  1.00 49.28 ? 203 HIS B CG    1 
ATOM   2476 N ND1   . HIS D 3 75  ? 20.403  11.883  -7.405  1.00 52.31 ? 203 HIS B ND1   1 
ATOM   2477 C CD2   . HIS D 3 75  ? 20.915  13.217  -5.758  1.00 48.58 ? 203 HIS B CD2   1 
ATOM   2478 C CE1   . HIS D 3 75  ? 21.628  11.571  -7.021  1.00 50.07 ? 203 HIS B CE1   1 
ATOM   2479 N NE2   . HIS D 3 75  ? 21.957  12.358  -6.016  1.00 49.50 ? 203 HIS B NE2   1 
ATOM   2480 N N     . ARG D 3 76  ? 15.982  13.887  -8.689  1.00 44.06 ? 204 ARG B N     1 
ATOM   2481 C CA    . ARG D 3 76  ? 14.579  14.246  -8.660  1.00 42.56 ? 204 ARG B CA    1 
ATOM   2482 C C     . ARG D 3 76  ? 14.168  14.192  -7.214  1.00 42.59 ? 204 ARG B C     1 
ATOM   2483 O O     . ARG D 3 76  ? 14.597  13.286  -6.491  1.00 42.93 ? 204 ARG B O     1 
ATOM   2484 C CB    . ARG D 3 76  ? 13.770  13.175  -9.332  1.00 43.16 ? 204 ARG B CB    1 
ATOM   2485 C CG    . ARG D 3 76  ? 13.501  13.292  -10.784 1.00 43.96 ? 204 ARG B CG    1 
ATOM   2486 C CD    . ARG D 3 76  ? 12.335  12.399  -11.166 1.00 45.84 ? 204 ARG B CD    1 
ATOM   2487 N NE    . ARG D 3 76  ? 12.207  12.345  -12.615 1.00 48.34 ? 204 ARG B NE    1 
ATOM   2488 C CZ    . ARG D 3 76  ? 11.063  12.419  -13.277 1.00 48.36 ? 204 ARG B CZ    1 
ATOM   2489 N NH1   . ARG D 3 76  ? 9.894   12.576  -12.635 1.00 42.90 ? 204 ARG B NH1   1 
ATOM   2490 N NH2   . ARG D 3 76  ? 11.105  12.369  -14.607 1.00 50.74 ? 204 ARG B NH2   1 
ATOM   2491 N N     . VAL D 3 77  ? 13.320  15.113  -6.758  1.00 42.13 ? 205 VAL B N     1 
ATOM   2492 C CA    . VAL D 3 77  ? 12.757  14.990  -5.387  1.00 41.16 ? 205 VAL B CA    1 
ATOM   2493 C C     . VAL D 3 77  ? 12.119  13.607  -5.171  1.00 40.93 ? 205 VAL B C     1 
ATOM   2494 O O     . VAL D 3 77  ? 12.220  13.039  -4.100  1.00 40.70 ? 205 VAL B O     1 
ATOM   2495 C CB    . VAL D 3 77  ? 11.698  16.083  -5.113  1.00 40.78 ? 205 VAL B CB    1 
ATOM   2496 C CG1   . VAL D 3 77  ? 11.122  15.941  -3.691  1.00 40.66 ? 205 VAL B CG1   1 
ATOM   2497 C CG2   . VAL D 3 77  ? 12.325  17.460  -5.298  1.00 39.35 ? 205 VAL B CG2   1 
ATOM   2498 N N     . SER D 3 78  ? 11.490  13.059  -6.214  1.00 40.92 ? 206 SER B N     1 
ATOM   2499 C CA    . SER D 3 78  ? 10.803  11.798  -6.104  1.00 41.27 ? 206 SER B CA    1 
ATOM   2500 C C     . SER D 3 78  ? 11.763  10.661  -5.806  1.00 41.40 ? 206 SER B C     1 
ATOM   2501 O O     . SER D 3 78  ? 11.441  9.764   -4.992  1.00 41.88 ? 206 SER B O     1 
ATOM   2502 C CB    . SER D 3 78  ? 9.976   11.525  -7.338  1.00 41.16 ? 206 SER B CB    1 
ATOM   2503 O OG    . SER D 3 78  ? 10.670  11.879  -8.510  1.00 45.42 ? 206 SER B OG    1 
ATOM   2504 N N     . ALA D 3 79  ? 12.954  10.703  -6.418  1.00 41.20 ? 207 ALA B N     1 
ATOM   2505 C CA    . ALA D 3 79  ? 14.052  9.794   -6.008  1.00 40.46 ? 207 ALA B CA    1 
ATOM   2506 C C     . ALA D 3 79  ? 14.420  9.915   -4.513  1.00 40.60 ? 207 ALA B C     1 
ATOM   2507 O O     . ALA D 3 79  ? 14.457  8.939   -3.777  1.00 40.38 ? 207 ALA B O     1 
ATOM   2508 C CB    . ALA D 3 79  ? 15.270  9.998   -6.857  1.00 40.06 ? 207 ALA B CB    1 
ATOM   2509 N N     . ILE D 3 80  ? 14.738  11.111  -4.068  1.00 41.12 ? 208 ILE B N     1 
ATOM   2510 C CA    . ILE D 3 80  ? 15.138  11.266  -2.684  1.00 41.82 ? 208 ILE B CA    1 
ATOM   2511 C C     . ILE D 3 80  ? 14.008  10.676  -1.800  1.00 42.34 ? 208 ILE B C     1 
ATOM   2512 O O     . ILE D 3 80  ? 14.260  9.992   -0.781  1.00 43.05 ? 208 ILE B O     1 
ATOM   2513 C CB    . ILE D 3 80  ? 15.462  12.760  -2.395  1.00 40.60 ? 208 ILE B CB    1 
ATOM   2514 C CG1   . ILE D 3 80  ? 16.535  13.282  -3.370  1.00 40.55 ? 208 ILE B CG1   1 
ATOM   2515 C CG2   . ILE D 3 80  ? 15.794  12.990  -0.958  1.00 41.27 ? 208 ILE B CG2   1 
ATOM   2516 C CD1   . ILE D 3 80  ? 17.980  12.787  -3.203  1.00 40.01 ? 208 ILE B CD1   1 
ATOM   2517 N N     . ASN D 3 81  ? 12.774  10.888  -2.249  1.00 42.45 ? 209 ASN B N     1 
ATOM   2518 C CA    . ASN D 3 81  ? 11.557  10.430  -1.543  1.00 41.91 ? 209 ASN B CA    1 
ATOM   2519 C C     . ASN D 3 81  ? 11.348  8.907   -1.597  1.00 41.93 ? 209 ASN B C     1 
ATOM   2520 O O     . ASN D 3 81  ? 11.137  8.267   -0.580  1.00 41.34 ? 209 ASN B O     1 
ATOM   2521 C CB    . ASN D 3 81  ? 10.350  11.199  -2.110  1.00 41.64 ? 209 ASN B CB    1 
ATOM   2522 C CG    . ASN D 3 81  ? 9.148   11.067  -1.282  1.00 41.46 ? 209 ASN B CG    1 
ATOM   2523 O OD1   . ASN D 3 81  ? 9.050   11.670  -0.233  1.00 47.99 ? 209 ASN B OD1   1 
ATOM   2524 N ND2   . ASN D 3 81  ? 8.210   10.274  -1.734  1.00 41.35 ? 209 ASN B ND2   1 
ATOM   2525 N N     . ASN D 3 82  ? 11.413  8.312   -2.779  1.00 43.12 ? 210 ASN B N     1 
ATOM   2526 C CA    . ASN D 3 82  ? 11.386  6.860   -2.851  1.00 45.57 ? 210 ASN B CA    1 
ATOM   2527 C C     . ASN D 3 82  ? 12.486  6.181   -1.971  1.00 47.17 ? 210 ASN B C     1 
ATOM   2528 O O     . ASN D 3 82  ? 12.228  5.191   -1.297  1.00 47.02 ? 210 ASN B O     1 
ATOM   2529 C CB    . ASN D 3 82  ? 11.405  6.405   -4.308  1.00 45.69 ? 210 ASN B CB    1 
ATOM   2530 C CG    . ASN D 3 82  ? 10.129  6.813   -5.067  1.00 47.31 ? 210 ASN B CG    1 
ATOM   2531 O OD1   . ASN D 3 82  ? 9.067   7.038   -4.460  1.00 51.58 ? 210 ASN B OD1   1 
ATOM   2532 N ND2   . ASN D 3 82  ? 10.231  6.928   -6.391  1.00 46.71 ? 210 ASN B ND2   1 
ATOM   2533 N N     . TYR D 3 83  ? 13.685  6.757   -1.923  1.00 49.06 ? 211 TYR B N     1 
ATOM   2534 C CA    . TYR D 3 83  ? 14.712  6.246   -1.038  1.00 51.28 ? 211 TYR B CA    1 
ATOM   2535 C C     . TYR D 3 83  ? 14.353  6.404   0.438   1.00 52.98 ? 211 TYR B C     1 
ATOM   2536 O O     . TYR D 3 83  ? 14.426  5.434   1.178   1.00 53.64 ? 211 TYR B O     1 
ATOM   2537 C CB    . TYR D 3 83  ? 16.084  6.880   -1.300  1.00 50.90 ? 211 TYR B CB    1 
ATOM   2538 C CG    . TYR D 3 83  ? 17.116  6.332   -0.353  1.00 50.85 ? 211 TYR B CG    1 
ATOM   2539 C CD1   . TYR D 3 83  ? 17.638  5.043   -0.530  1.00 54.14 ? 211 TYR B CD1   1 
ATOM   2540 C CD2   . TYR D 3 83  ? 17.538  7.056   0.745   1.00 49.56 ? 211 TYR B CD2   1 
ATOM   2541 C CE1   . TYR D 3 83  ? 18.589  4.509   0.359   1.00 52.22 ? 211 TYR B CE1   1 
ATOM   2542 C CE2   . TYR D 3 83  ? 18.478  6.539   1.634   1.00 50.41 ? 211 TYR B CE2   1 
ATOM   2543 C CZ    . TYR D 3 83  ? 18.998  5.267   1.433   1.00 51.84 ? 211 TYR B CZ    1 
ATOM   2544 O OH    . TYR D 3 83  ? 19.921  4.746   2.315   1.00 52.72 ? 211 TYR B OH    1 
ATOM   2545 N N     . ALA D 3 84  ? 14.018  7.624   0.862   1.00 54.81 ? 212 ALA B N     1 
ATOM   2546 C CA    . ALA D 3 84  ? 13.703  7.925   2.256   1.00 56.73 ? 212 ALA B CA    1 
ATOM   2547 C C     . ALA D 3 84  ? 12.458  7.177   2.758   1.00 58.74 ? 212 ALA B C     1 
ATOM   2548 O O     . ALA D 3 84  ? 12.389  6.822   3.935   1.00 58.56 ? 212 ALA B O     1 
ATOM   2549 C CB    . ALA D 3 84  ? 13.553  9.428   2.447   1.00 56.01 ? 212 ALA B CB    1 
ATOM   2550 N N     . GLN D 3 85  ? 11.486  6.941   1.863   1.00 61.28 ? 213 GLN B N     1 
ATOM   2551 C CA    . GLN D 3 85  ? 10.275  6.147   2.178   1.00 63.53 ? 213 GLN B CA    1 
ATOM   2552 C C     . GLN D 3 85  ? 10.622  4.730   2.594   1.00 64.46 ? 213 GLN B C     1 
ATOM   2553 O O     . GLN D 3 85  ? 10.048  4.221   3.548   1.00 64.96 ? 213 GLN B O     1 
ATOM   2554 C CB    . GLN D 3 85  ? 9.243   6.111   1.012   1.00 63.57 ? 213 GLN B CB    1 
ATOM   2555 C CG    . GLN D 3 85  ? 8.485   7.419   0.763   1.00 65.02 ? 213 GLN B CG    1 
ATOM   2556 C CD    . GLN D 3 85  ? 8.140   8.143   2.061   1.00 66.75 ? 213 GLN B CD    1 
ATOM   2557 O OE1   . GLN D 3 85  ? 7.244   7.710   2.779   1.00 67.66 ? 213 GLN B OE1   1 
ATOM   2558 N NE2   . GLN D 3 85  ? 8.869   9.230   2.377   1.00 67.07 ? 213 GLN B NE2   1 
ATOM   2559 N N     . LYS D 3 86  ? 11.559  4.116   1.874   1.00 65.69 ? 214 LYS B N     1 
ATOM   2560 C CA    . LYS D 3 86  ? 12.024  2.742   2.129   1.00 67.25 ? 214 LYS B CA    1 
ATOM   2561 C C     . LYS D 3 86  ? 12.699  2.515   3.496   1.00 68.67 ? 214 LYS B C     1 
ATOM   2562 O O     . LYS D 3 86  ? 12.989  1.384   3.862   1.00 68.85 ? 214 LYS B O     1 
ATOM   2563 C CB    . LYS D 3 86  ? 12.972  2.282   0.999   1.00 67.09 ? 214 LYS B CB    1 
ATOM   2564 C CG    . LYS D 3 86  ? 12.265  1.882   -0.287  1.00 65.84 ? 214 LYS B CG    1 
ATOM   2565 C CD    . LYS D 3 86  ? 13.156  2.007   -1.486  1.00 64.87 ? 214 LYS B CD    1 
ATOM   2566 C CE    . LYS D 3 86  ? 12.372  1.681   -2.754  1.00 65.37 ? 214 LYS B CE    1 
ATOM   2567 N NZ    . LYS D 3 86  ? 12.976  2.247   -4.004  1.00 65.62 ? 214 LYS B NZ    1 
ATOM   2568 N N     . LEU D 3 87  ? 12.965  3.586   4.240   1.00 70.70 ? 215 LEU B N     1 
ATOM   2569 C CA    . LEU D 3 87  ? 13.516  3.462   5.603   1.00 72.36 ? 215 LEU B CA    1 
ATOM   2570 C C     . LEU D 3 87  ? 12.535  3.955   6.694   1.00 74.10 ? 215 LEU B C     1 
ATOM   2571 O O     . LEU D 3 87  ? 12.922  4.205   7.834   1.00 74.12 ? 215 LEU B O     1 
ATOM   2572 C CB    . LEU D 3 87  ? 14.919  4.102   5.709   1.00 72.28 ? 215 LEU B CB    1 
ATOM   2573 C CG    . LEU D 3 87  ? 16.050  3.350   4.989   1.00 71.43 ? 215 LEU B CG    1 
ATOM   2574 C CD1   . LEU D 3 87  ? 16.233  3.838   3.581   1.00 69.61 ? 215 LEU B CD1   1 
ATOM   2575 C CD2   . LEU D 3 87  ? 17.344  3.487   5.753   1.00 72.66 ? 215 LEU B CD2   1 
ATOM   2576 N N     . CYS D 3 88  ? 11.262  4.089   6.310   1.00 76.32 ? 216 CYS B N     1 
ATOM   2577 C CA    . CYS D 3 88  ? 10.102  4.098   7.229   1.00 78.25 ? 216 CYS B CA    1 
ATOM   2578 C C     . CYS D 3 88  ? 9.265   2.786   6.976   1.00 78.60 ? 216 CYS B C     1 
ATOM   2579 O O     . CYS D 3 88  ? 9.114   2.402   5.811   1.00 79.07 ? 216 CYS B O     1 
ATOM   2580 C CB    . CYS D 3 88  ? 9.312   5.385   7.003   1.00 78.51 ? 216 CYS B CB    1 
ATOM   2581 S SG    . CYS D 3 88  ? 10.385  6.850   6.930   1.00 82.97 ? 216 CYS B SG    1 
ATOM   2582 N N     . THR D 3 89  ? 8.674   2.101   7.970   1.00 78.91 ? 217 THR B N     1 
ATOM   2583 C CA    . THR D 3 89  ? 8.040   2.605   9.209   1.00 79.62 ? 217 THR B CA    1 
ATOM   2584 C C     . THR D 3 89  ? 6.962   3.650   8.878   1.00 79.49 ? 217 THR B C     1 
ATOM   2585 O O     . THR D 3 89  ? 7.264   4.764   8.435   1.00 79.91 ? 217 THR B O     1 
ATOM   2586 C CB    . THR D 3 89  ? 9.040   3.058   10.374  1.00 79.96 ? 217 THR B CB    1 
ATOM   2587 O OG1   . THR D 3 89  ? 9.668   4.314   10.063  1.00 80.33 ? 217 THR B OG1   1 
ATOM   2588 C CG2   . THR D 3 89  ? 10.206  2.059   10.577  1.00 80.45 ? 217 THR B CG2   1 
ATOM   2589 N N     . PHE D 3 90  ? 5.699   3.291   9.061   1.00 78.98 ? 218 PHE B N     1 
ATOM   2590 C CA    . PHE D 3 90  ? 4.643   4.249   8.744   1.00 78.43 ? 218 PHE B CA    1 
ATOM   2591 C C     . PHE D 3 90  ? 4.634   5.398   9.787   1.00 76.89 ? 218 PHE B C     1 
ATOM   2592 O O     . PHE D 3 90  ? 3.591   5.862   10.281  1.00 76.80 ? 218 PHE B O     1 
ATOM   2593 C CB    . PHE D 3 90  ? 3.294   3.547   8.429   1.00 79.72 ? 218 PHE B CB    1 
ATOM   2594 C CG    . PHE D 3 90  ? 3.176   3.060   6.968   1.00 81.38 ? 218 PHE B CG    1 
ATOM   2595 C CD1   . PHE D 3 90  ? 4.316   2.916   6.153   1.00 82.40 ? 218 PHE B CD1   1 
ATOM   2596 C CD2   . PHE D 3 90  ? 1.925   2.745   6.414   1.00 83.35 ? 218 PHE B CD2   1 
ATOM   2597 C CE1   . PHE D 3 90  ? 4.207   2.481   4.802   1.00 83.67 ? 218 PHE B CE1   1 
ATOM   2598 C CE2   . PHE D 3 90  ? 1.804   2.296   5.057   1.00 83.86 ? 218 PHE B CE2   1 
ATOM   2599 C CZ    . PHE D 3 90  ? 2.948   2.169   4.257   1.00 82.67 ? 218 PHE B CZ    1 
ATOM   2600 N N     . SER D 3 91  ? 5.873   5.791   10.110  1.00 74.58 ? 219 SER B N     1 
ATOM   2601 C CA    . SER D 3 91  ? 6.270   7.081   10.655  1.00 72.18 ? 219 SER B CA    1 
ATOM   2602 C C     . SER D 3 91  ? 6.189   8.120   9.519   1.00 69.98 ? 219 SER B C     1 
ATOM   2603 O O     . SER D 3 91  ? 6.319   7.751   8.342   1.00 70.18 ? 219 SER B O     1 
ATOM   2604 C CB    . SER D 3 91  ? 7.707   6.953   11.171  1.00 72.48 ? 219 SER B CB    1 
ATOM   2605 O OG    . SER D 3 91  ? 8.324   8.223   11.347  1.00 74.79 ? 219 SER B OG    1 
ATOM   2606 N N     . PHE D 3 92  ? 5.974   9.401   9.850   1.00 66.96 ? 220 PHE B N     1 
ATOM   2607 C CA    . PHE D 3 92  ? 5.758   10.437  8.804   1.00 63.72 ? 220 PHE B CA    1 
ATOM   2608 C C     . PHE D 3 92  ? 7.049   10.964  8.138   1.00 61.87 ? 220 PHE B C     1 
ATOM   2609 O O     . PHE D 3 92  ? 8.125   10.903  8.721   1.00 61.33 ? 220 PHE B O     1 
ATOM   2610 C CB    . PHE D 3 92  ? 4.905   11.614  9.323   1.00 62.54 ? 220 PHE B CB    1 
ATOM   2611 C CG    . PHE D 3 92  ? 5.702   12.678  10.003  1.00 60.12 ? 220 PHE B CG    1 
ATOM   2612 C CD1   . PHE D 3 92  ? 6.269   12.444  11.255  1.00 56.98 ? 220 PHE B CD1   1 
ATOM   2613 C CD2   . PHE D 3 92  ? 5.906   13.911  9.380   1.00 57.26 ? 220 PHE B CD2   1 
ATOM   2614 C CE1   . PHE D 3 92  ? 7.026   13.441  11.897  1.00 55.51 ? 220 PHE B CE1   1 
ATOM   2615 C CE2   . PHE D 3 92  ? 6.664   14.911  10.008  1.00 57.32 ? 220 PHE B CE2   1 
ATOM   2616 C CZ    . PHE D 3 92  ? 7.225   14.672  11.272  1.00 57.47 ? 220 PHE B CZ    1 
ATOM   2617 N N     . LEU D 3 93  ? 6.899   11.495  6.922   1.00 59.82 ? 221 LEU B N     1 
ATOM   2618 C CA    . LEU D 3 93  ? 8.005   12.000  6.135   1.00 57.78 ? 221 LEU B CA    1 
ATOM   2619 C C     . LEU D 3 93  ? 7.578   12.994  5.047   1.00 56.28 ? 221 LEU B C     1 
ATOM   2620 O O     . LEU D 3 93  ? 6.990   12.619  4.027   1.00 55.75 ? 221 LEU B O     1 
ATOM   2621 C CB    . LEU D 3 93  ? 8.791   10.824  5.524   1.00 57.70 ? 221 LEU B CB    1 
ATOM   2622 C CG    . LEU D 3 93  ? 10.312  10.984  5.359   1.00 57.80 ? 221 LEU B CG    1 
ATOM   2623 C CD1   . LEU D 3 93  ? 10.974  9.611   5.169   1.00 57.83 ? 221 LEU B CD1   1 
ATOM   2624 C CD2   . LEU D 3 93  ? 10.666  11.891  4.199   1.00 58.18 ? 221 LEU B CD2   1 
ATOM   2625 N N     . ILE D 3 94  ? 7.887   14.266  5.251   1.00 54.98 ? 222 ILE B N     1 
ATOM   2626 C CA    . ILE D 3 94  ? 7.744   15.242  4.161   1.00 54.08 ? 222 ILE B CA    1 
ATOM   2627 C C     . ILE D 3 94  ? 9.102   15.444  3.528   1.00 53.78 ? 222 ILE B C     1 
ATOM   2628 O O     . ILE D 3 94  ? 10.086  15.732  4.223   1.00 54.34 ? 222 ILE B O     1 
ATOM   2629 C CB    . ILE D 3 94  ? 7.172   16.591  4.643   1.00 53.81 ? 222 ILE B CB    1 
ATOM   2630 C CG1   . ILE D 3 94  ? 5.721   16.415  5.142   1.00 55.45 ? 222 ILE B CG1   1 
ATOM   2631 C CG2   . ILE D 3 94  ? 7.175   17.576  3.524   1.00 51.51 ? 222 ILE B CG2   1 
ATOM   2632 C CD1   . ILE D 3 94  ? 5.527   16.426  6.679   1.00 56.67 ? 222 ILE B CD1   1 
ATOM   2633 N N     . CYS D 3 95  ? 9.167   15.286  2.215   1.00 52.64 ? 223 CYS B N     1 
ATOM   2634 C CA    . CYS D 3 95  ? 10.423  15.417  1.529   1.00 50.88 ? 223 CYS B CA    1 
ATOM   2635 C C     . CYS D 3 95  ? 10.344  16.391  0.367   1.00 49.45 ? 223 CYS B C     1 
ATOM   2636 O O     . CYS D 3 95  ? 9.575   16.198  -0.560  1.00 49.10 ? 223 CYS B O     1 
ATOM   2637 C CB    . CYS D 3 95  ? 10.914  14.043  1.059   1.00 51.81 ? 223 CYS B CB    1 
ATOM   2638 S SG    . CYS D 3 95  ? 12.413  14.195  0.067   1.00 54.61 ? 223 CYS B SG    1 
ATOM   2639 N N     . LYS D 3 96  ? 11.161  17.430  0.405   1.00 48.49 ? 224 LYS B N     1 
ATOM   2640 C CA    . LYS D 3 96  ? 11.010  18.511  -0.572  1.00 47.96 ? 224 LYS B CA    1 
ATOM   2641 C C     . LYS D 3 96  ? 12.291  19.056  -1.120  1.00 46.79 ? 224 LYS B C     1 
ATOM   2642 O O     . LYS D 3 96  ? 13.298  19.048  -0.445  1.00 46.60 ? 224 LYS B O     1 
ATOM   2643 C CB    . LYS D 3 96  ? 10.142  19.649  -0.018  1.00 47.61 ? 224 LYS B CB    1 
ATOM   2644 C CG    . LYS D 3 96  ? 8.706   19.501  -0.453  1.00 49.80 ? 224 LYS B CG    1 
ATOM   2645 C CD    . LYS D 3 96  ? 7.760   20.293  0.408   1.00 53.16 ? 224 LYS B CD    1 
ATOM   2646 C CE    . LYS D 3 96  ? 6.339   20.045  -0.051  1.00 55.88 ? 224 LYS B CE    1 
ATOM   2647 N NZ    . LYS D 3 96  ? 5.577   21.325  0.024   1.00 59.68 ? 224 LYS B NZ    1 
ATOM   2648 N N     . GLY D 3 97  ? 12.232  19.540  -2.360  1.00 46.32 ? 225 GLY B N     1 
ATOM   2649 C CA    . GLY D 3 97  ? 13.352  20.236  -2.957  1.00 45.01 ? 225 GLY B CA    1 
ATOM   2650 C C     . GLY D 3 97  ? 13.549  21.606  -2.335  1.00 44.83 ? 225 GLY B C     1 
ATOM   2651 O O     . GLY D 3 97  ? 12.580  22.255  -1.929  1.00 45.17 ? 225 GLY B O     1 
ATOM   2652 N N     . VAL D 3 98  ? 14.801  22.058  -2.268  1.00 44.27 ? 226 VAL B N     1 
ATOM   2653 C CA    . VAL D 3 98  ? 15.097  23.382  -1.732  1.00 43.67 ? 226 VAL B CA    1 
ATOM   2654 C C     . VAL D 3 98  ? 15.614  24.276  -2.846  1.00 43.87 ? 226 VAL B C     1 
ATOM   2655 O O     . VAL D 3 98  ? 16.691  24.056  -3.398  1.00 43.48 ? 226 VAL B O     1 
ATOM   2656 C CB    . VAL D 3 98  ? 16.081  23.376  -0.522  1.00 42.76 ? 226 VAL B CB    1 
ATOM   2657 C CG1   . VAL D 3 98  ? 16.312  24.769  -0.057  1.00 42.53 ? 226 VAL B CG1   1 
ATOM   2658 C CG2   . VAL D 3 98  ? 15.565  22.521  0.636   1.00 41.14 ? 226 VAL B CG2   1 
ATOM   2659 N N     . ASN D 3 99  ? 14.809  25.283  -3.146  1.00 44.54 ? 227 ASN B N     1 
ATOM   2660 C CA    . ASN D 3 99  ? 15.135  26.384  -4.049  1.00 45.68 ? 227 ASN B CA    1 
ATOM   2661 C C     . ASN D 3 99  ? 16.139  27.416  -3.490  1.00 46.53 ? 227 ASN B C     1 
ATOM   2662 O O     . ASN D 3 99  ? 17.024  27.861  -4.229  1.00 47.47 ? 227 ASN B O     1 
ATOM   2663 C CB    . ASN D 3 99  ? 13.835  27.099  -4.467  1.00 45.25 ? 227 ASN B CB    1 
ATOM   2664 C CG    . ASN D 3 99  ? 12.989  26.279  -5.476  1.00 45.23 ? 227 ASN B CG    1 
ATOM   2665 O OD1   . ASN D 3 99  ? 13.432  25.278  -6.035  1.00 42.18 ? 227 ASN B OD1   1 
ATOM   2666 N ND2   . ASN D 3 99  ? 11.765  26.734  -5.710  1.00 46.05 ? 227 ASN B ND2   1 
ATOM   2667 N N     . LYS D 3 100 ? 16.007  27.788  -2.209  1.00 47.07 ? 228 LYS B N     1 
ATOM   2668 C CA    . LYS D 3 100 ? 16.783  28.890  -1.602  1.00 47.91 ? 228 LYS B CA    1 
ATOM   2669 C C     . LYS D 3 100 ? 17.633  28.289  -0.539  1.00 48.21 ? 228 LYS B C     1 
ATOM   2670 O O     . LYS D 3 100 ? 17.301  28.388  0.665   1.00 47.88 ? 228 LYS B O     1 
ATOM   2671 C CB    . LYS D 3 100 ? 15.901  29.955  -0.910  1.00 47.81 ? 228 LYS B CB    1 
ATOM   2672 C CG    . LYS D 3 100 ? 14.741  30.525  -1.687  1.00 52.11 ? 228 LYS B CG    1 
ATOM   2673 C CD    . LYS D 3 100 ? 15.189  31.576  -2.673  1.00 59.18 ? 228 LYS B CD    1 
ATOM   2674 C CE    . LYS D 3 100 ? 14.097  32.648  -2.876  1.00 64.13 ? 228 LYS B CE    1 
ATOM   2675 N NZ    . LYS D 3 100 ? 13.103  32.247  -3.927  1.00 69.02 ? 228 LYS B NZ    1 
ATOM   2676 N N     . GLU D 3 101 ? 18.738  27.683  -0.980  1.00 49.38 ? 229 GLU B N     1 
ATOM   2677 C CA    . GLU D 3 101 ? 19.579  26.825  -0.139  1.00 49.40 ? 229 GLU B CA    1 
ATOM   2678 C C     . GLU D 3 101 ? 20.129  27.501  1.084   1.00 50.02 ? 229 GLU B C     1 
ATOM   2679 O O     . GLU D 3 101 ? 20.003  26.967  2.179   1.00 50.06 ? 229 GLU B O     1 
ATOM   2680 C CB    . GLU D 3 101 ? 20.740  26.260  -0.923  1.00 49.47 ? 229 GLU B CB    1 
ATOM   2681 C CG    . GLU D 3 101 ? 20.338  25.378  -2.059  1.00 50.95 ? 229 GLU B CG    1 
ATOM   2682 C CD    . GLU D 3 101 ? 20.406  26.079  -3.388  1.00 53.53 ? 229 GLU B CD    1 
ATOM   2683 O OE1   . GLU D 3 101 ? 19.776  27.163  -3.538  1.00 54.66 ? 229 GLU B OE1   1 
ATOM   2684 O OE2   . GLU D 3 101 ? 21.083  25.509  -4.291  1.00 56.84 ? 229 GLU B OE2   1 
ATOM   2685 N N     . TYR D 3 102 ? 20.743  28.670  0.897   1.00 51.00 ? 230 TYR B N     1 
ATOM   2686 C CA    . TYR D 3 102 ? 21.367  29.380  2.002   1.00 52.04 ? 230 TYR B CA    1 
ATOM   2687 C C     . TYR D 3 102 ? 20.320  29.795  3.013   1.00 51.86 ? 230 TYR B C     1 
ATOM   2688 O O     . TYR D 3 102 ? 20.492  29.591  4.216   1.00 51.11 ? 230 TYR B O     1 
ATOM   2689 C CB    . TYR D 3 102 ? 22.179  30.626  1.556   1.00 54.14 ? 230 TYR B CB    1 
ATOM   2690 C CG    . TYR D 3 102 ? 22.571  31.415  2.793   1.00 56.43 ? 230 TYR B CG    1 
ATOM   2691 C CD1   . TYR D 3 102 ? 23.414  30.832  3.757   1.00 58.78 ? 230 TYR B CD1   1 
ATOM   2692 C CD2   . TYR D 3 102 ? 22.020  32.682  3.065   1.00 57.77 ? 230 TYR B CD2   1 
ATOM   2693 C CE1   . TYR D 3 102 ? 23.747  31.496  4.935   1.00 59.28 ? 230 TYR B CE1   1 
ATOM   2694 C CE2   . TYR D 3 102 ? 22.346  33.363  4.261   1.00 59.81 ? 230 TYR B CE2   1 
ATOM   2695 C CZ    . TYR D 3 102 ? 23.214  32.745  5.178   1.00 58.92 ? 230 TYR B CZ    1 
ATOM   2696 O OH    . TYR D 3 102 ? 23.559  33.344  6.356   1.00 59.83 ? 230 TYR B OH    1 
ATOM   2697 N N     . LEU D 3 103 ? 19.244  30.404  2.502   1.00 51.89 ? 231 LEU B N     1 
ATOM   2698 C CA    . LEU D 3 103 ? 18.182  30.970  3.332   1.00 51.20 ? 231 LEU B CA    1 
ATOM   2699 C C     . LEU D 3 103 ? 17.505  29.885  4.134   1.00 50.30 ? 231 LEU B C     1 
ATOM   2700 O O     . LEU D 3 103 ? 17.229  30.089  5.316   1.00 50.84 ? 231 LEU B O     1 
ATOM   2701 C CB    . LEU D 3 103 ? 17.178  31.745  2.477   1.00 50.99 ? 231 LEU B CB    1 
ATOM   2702 C CG    . LEU D 3 103 ? 17.770  33.040  1.909   1.00 53.00 ? 231 LEU B CG    1 
ATOM   2703 C CD1   . LEU D 3 103 ? 16.943  33.580  0.741   1.00 53.80 ? 231 LEU B CD1   1 
ATOM   2704 C CD2   . LEU D 3 103 ? 17.958  34.108  3.005   1.00 51.19 ? 231 LEU B CD2   1 
ATOM   2705 N N     . MET D 3 104 ? 17.265  28.736  3.502   1.00 48.71 ? 232 MET B N     1 
ATOM   2706 C CA    . MET D 3 104 ? 16.774  27.540  4.208   1.00 48.11 ? 232 MET B CA    1 
ATOM   2707 C C     . MET D 3 104 ? 17.752  27.106  5.321   1.00 47.61 ? 232 MET B C     1 
ATOM   2708 O O     . MET D 3 104 ? 17.369  27.042  6.478   1.00 47.63 ? 232 MET B O     1 
ATOM   2709 C CB    . MET D 3 104 ? 16.491  26.396  3.215   1.00 48.13 ? 232 MET B CB    1 
ATOM   2710 C CG    . MET D 3 104 ? 15.873  25.166  3.814   1.00 48.51 ? 232 MET B CG    1 
ATOM   2711 S SD    . MET D 3 104 ? 14.124  25.357  4.271   1.00 52.95 ? 232 MET B SD    1 
ATOM   2712 C CE    . MET D 3 104 ? 13.686  23.680  4.745   1.00 46.55 ? 232 MET B CE    1 
ATOM   2713 N N     . TYR D 3 105 ? 19.013  26.822  4.982   1.00 47.07 ? 233 TYR B N     1 
ATOM   2714 C CA    . TYR D 3 105 ? 19.982  26.432  6.005   1.00 46.42 ? 233 TYR B CA    1 
ATOM   2715 C C     . TYR D 3 105 ? 19.998  27.474  7.130   1.00 46.64 ? 233 TYR B C     1 
ATOM   2716 O O     . TYR D 3 105 ? 19.835  27.105  8.289   1.00 47.39 ? 233 TYR B O     1 
ATOM   2717 C CB    . TYR D 3 105 ? 21.384  26.175  5.428   1.00 46.10 ? 233 TYR B CB    1 
ATOM   2718 C CG    . TYR D 3 105 ? 22.446  25.894  6.499   1.00 46.63 ? 233 TYR B CG    1 
ATOM   2719 C CD1   . TYR D 3 105 ? 22.604  24.624  7.040   1.00 45.31 ? 233 TYR B CD1   1 
ATOM   2720 C CD2   . TYR D 3 105 ? 23.258  26.913  6.992   1.00 48.40 ? 233 TYR B CD2   1 
ATOM   2721 C CE1   . TYR D 3 105 ? 23.517  24.367  8.039   1.00 44.58 ? 233 TYR B CE1   1 
ATOM   2722 C CE2   . TYR D 3 105 ? 24.211  26.655  7.994   1.00 47.67 ? 233 TYR B CE2   1 
ATOM   2723 C CZ    . TYR D 3 105 ? 24.331  25.376  8.507   1.00 46.15 ? 233 TYR B CZ    1 
ATOM   2724 O OH    . TYR D 3 105 ? 25.253  25.109  9.501   1.00 44.80 ? 233 TYR B OH    1 
ATOM   2725 N N     . SER D 3 106 ? 20.142  28.766  6.795   1.00 46.04 ? 234 SER B N     1 
ATOM   2726 C CA    . SER D 3 106 ? 20.314  29.803  7.803   1.00 45.32 ? 234 SER B CA    1 
ATOM   2727 C C     . SER D 3 106 ? 19.122  29.924  8.750   1.00 45.24 ? 234 SER B C     1 
ATOM   2728 O O     . SER D 3 106 ? 19.312  30.064  9.953   1.00 45.24 ? 234 SER B O     1 
ATOM   2729 C CB    . SER D 3 106 ? 20.670  31.138  7.169   1.00 45.41 ? 234 SER B CB    1 
ATOM   2730 O OG    . SER D 3 106 ? 19.581  32.052  7.187   1.00 48.17 ? 234 SER B OG    1 
ATOM   2731 N N     . ALA D 3 107 ? 17.900  29.854  8.210   1.00 45.27 ? 235 ALA B N     1 
ATOM   2732 C CA    . ALA D 3 107 ? 16.675  29.805  9.012   1.00 44.70 ? 235 ALA B CA    1 
ATOM   2733 C C     . ALA D 3 107 ? 16.736  28.665  10.027  1.00 44.64 ? 235 ALA B C     1 
ATOM   2734 O O     . ALA D 3 107 ? 16.516  28.897  11.210  1.00 44.10 ? 235 ALA B O     1 
ATOM   2735 C CB    . ALA D 3 107 ? 15.452  29.680  8.114   1.00 44.37 ? 235 ALA B CB    1 
ATOM   2736 N N     . LEU D 3 108 ? 17.075  27.455  9.550   1.00 45.07 ? 236 LEU B N     1 
ATOM   2737 C CA    . LEU D 3 108 ? 17.195  26.207  10.372  1.00 45.36 ? 236 LEU B CA    1 
ATOM   2738 C C     . LEU D 3 108 ? 18.249  26.237  11.486  1.00 45.92 ? 236 LEU B C     1 
ATOM   2739 O O     . LEU D 3 108 ? 18.217  25.416  12.411  1.00 45.54 ? 236 LEU B O     1 
ATOM   2740 C CB    . LEU D 3 108 ? 17.475  24.985  9.491   1.00 44.26 ? 236 LEU B CB    1 
ATOM   2741 C CG    . LEU D 3 108 ? 16.359  24.447  8.618   1.00 43.04 ? 236 LEU B CG    1 
ATOM   2742 C CD1   . LEU D 3 108 ? 16.836  23.318  7.739   1.00 38.86 ? 236 LEU B CD1   1 
ATOM   2743 C CD2   . LEU D 3 108 ? 15.209  23.962  9.485   1.00 44.33 ? 236 LEU B CD2   1 
ATOM   2744 N N     . THR D 3 109 ? 19.181  27.179  11.363  1.00 46.60 ? 237 THR B N     1 
ATOM   2745 C CA    . THR D 3 109 ? 20.181  27.432  12.373  1.00 47.59 ? 237 THR B CA    1 
ATOM   2746 C C     . THR D 3 109 ? 19.803  28.428  13.488  1.00 47.78 ? 237 THR B C     1 
ATOM   2747 O O     . THR D 3 109 ? 20.495  28.489  14.507  1.00 47.85 ? 237 THR B O     1 
ATOM   2748 C CB    . THR D 3 109 ? 21.501  27.862  11.712  1.00 47.90 ? 237 THR B CB    1 
ATOM   2749 O OG1   . THR D 3 109 ? 22.468  27.999  12.744  1.00 49.70 ? 237 THR B OG1   1 
ATOM   2750 C CG2   . THR D 3 109 ? 21.437  29.288  11.182  1.00 47.22 ? 237 THR B CG2   1 
ATOM   2751 N N     . ARG D 3 110 ? 18.734  29.204  13.273  1.00 48.51 ? 238 ARG B N     1 
ATOM   2752 C CA    . ARG D 3 110 ? 18.197  30.210  14.217  1.00 48.86 ? 238 ARG B CA    1 
ATOM   2753 C C     . ARG D 3 110 ? 16.794  29.839  14.761  1.00 48.79 ? 238 ARG B C     1 
ATOM   2754 O O     . ARG D 3 110 ? 16.097  29.020  14.176  1.00 48.35 ? 238 ARG B O     1 
ATOM   2755 C CB    . ARG D 3 110 ? 18.100  31.582  13.534  1.00 48.93 ? 238 ARG B CB    1 
ATOM   2756 C CG    . ARG D 3 110 ? 19.416  32.161  13.026  1.00 50.07 ? 238 ARG B CG    1 
ATOM   2757 C CD    . ARG D 3 110 ? 19.261  33.455  12.236  1.00 49.82 ? 238 ARG B CD    1 
ATOM   2758 N NE    . ARG D 3 110 ? 18.982  33.255  10.810  1.00 53.01 ? 238 ARG B NE    1 
ATOM   2759 C CZ    . ARG D 3 110 ? 17.755  33.234  10.247  1.00 55.99 ? 238 ARG B CZ    1 
ATOM   2760 N NH1   . ARG D 3 110 ? 16.653  33.369  10.981  1.00 55.94 ? 238 ARG B NH1   1 
ATOM   2761 N NH2   . ARG D 3 110 ? 17.626  33.063  8.929   1.00 57.00 ? 238 ARG B NH2   1 
ATOM   2762 N N     . ASP D 3 111 ? 16.395  30.477  15.867  1.00 48.98 ? 239 ASP B N     1 
ATOM   2763 C CA    . ASP D 3 111 ? 15.096  30.270  16.538  1.00 49.00 ? 239 ASP B CA    1 
ATOM   2764 C C     . ASP D 3 111 ? 13.934  30.515  15.568  1.00 48.95 ? 239 ASP B C     1 
ATOM   2765 O O     . ASP D 3 111 ? 13.948  31.541  14.880  1.00 49.28 ? 239 ASP B O     1 
ATOM   2766 C CB    . ASP D 3 111 ? 14.995  31.235  17.721  1.00 48.98 ? 239 ASP B CB    1 
ATOM   2767 C CG    . ASP D 3 111 ? 13.997  30.792  18.765  1.00 48.81 ? 239 ASP B CG    1 
ATOM   2768 O OD1   . ASP D 3 111 ? 12.780  30.982  18.568  1.00 47.78 ? 239 ASP B OD1   1 
ATOM   2769 O OD2   . ASP D 3 111 ? 14.348  30.272  19.840  1.00 49.49 ? 239 ASP B OD2   1 
ATOM   2770 N N     . PRO D 3 112 ? 12.923  29.631  15.503  1.00 48.78 ? 240 PRO B N     1 
ATOM   2771 C CA    . PRO D 3 112 ? 12.705  28.520  16.452  1.00 48.65 ? 240 PRO B CA    1 
ATOM   2772 C C     . PRO D 3 112 ? 13.556  27.257  16.269  1.00 48.69 ? 240 PRO B C     1 
ATOM   2773 O O     . PRO D 3 112 ? 13.339  26.276  16.976  1.00 48.66 ? 240 PRO B O     1 
ATOM   2774 C CB    . PRO D 3 112 ? 11.236  28.155  16.214  1.00 48.43 ? 240 PRO B CB    1 
ATOM   2775 C CG    . PRO D 3 112 ? 10.973  28.517  14.772  1.00 48.21 ? 240 PRO B CG    1 
ATOM   2776 C CD    . PRO D 3 112 ? 11.877  29.671  14.456  1.00 48.50 ? 240 PRO B CD    1 
ATOM   2777 N N     . PHE D 3 113 ? 14.505  27.285  15.337  1.00 48.78 ? 241 PHE B N     1 
ATOM   2778 C CA    . PHE D 3 113 ? 15.247  26.111  14.952  1.00 48.43 ? 241 PHE B CA    1 
ATOM   2779 C C     . PHE D 3 113 ? 16.654  26.124  15.551  1.00 49.12 ? 241 PHE B C     1 
ATOM   2780 O O     . PHE D 3 113 ? 17.147  27.174  15.958  1.00 49.72 ? 241 PHE B O     1 
ATOM   2781 C CB    . PHE D 3 113 ? 15.338  26.051  13.429  1.00 48.45 ? 241 PHE B CB    1 
ATOM   2782 C CG    . PHE D 3 113 ? 14.020  26.192  12.729  1.00 48.24 ? 241 PHE B CG    1 
ATOM   2783 C CD1   . PHE D 3 113 ? 13.126  25.115  12.665  1.00 47.92 ? 241 PHE B CD1   1 
ATOM   2784 C CD2   . PHE D 3 113 ? 13.671  27.390  12.119  1.00 47.74 ? 241 PHE B CD2   1 
ATOM   2785 C CE1   . PHE D 3 113 ? 11.913  25.234  12.035  1.00 44.32 ? 241 PHE B CE1   1 
ATOM   2786 C CE2   . PHE D 3 113 ? 12.448  27.512  11.470  1.00 47.69 ? 241 PHE B CE2   1 
ATOM   2787 C CZ    . PHE D 3 113 ? 11.572  26.434  11.441  1.00 47.08 ? 241 PHE B CZ    1 
ATOM   2788 N N     . SER D 3 114 ? 17.293  24.951  15.592  1.00 49.49 ? 242 SER B N     1 
ATOM   2789 C CA    . SER D 3 114 ? 18.677  24.801  16.047  1.00 49.69 ? 242 SER B CA    1 
ATOM   2790 C C     . SER D 3 114 ? 19.333  23.591  15.379  1.00 49.94 ? 242 SER B C     1 
ATOM   2791 O O     . SER D 3 114 ? 18.643  22.662  14.943  1.00 50.06 ? 242 SER B O     1 
ATOM   2792 C CB    . SER D 3 114 ? 18.761  24.687  17.579  1.00 49.67 ? 242 SER B CB    1 
ATOM   2793 O OG    . SER D 3 114 ? 17.741  23.857  18.107  1.00 49.75 ? 242 SER B OG    1 
ATOM   2794 N N     . VAL D 3 115 ? 20.663  23.617  15.277  1.00 49.86 ? 243 VAL B N     1 
ATOM   2795 C CA    . VAL D 3 115 ? 21.418  22.489  14.721  1.00 49.55 ? 243 VAL B CA    1 
ATOM   2796 C C     . VAL D 3 115 ? 21.575  21.424  15.808  1.00 49.27 ? 243 VAL B C     1 
ATOM   2797 O O     . VAL D 3 115 ? 21.743  21.772  16.976  1.00 48.91 ? 243 VAL B O     1 
ATOM   2798 C CB    . VAL D 3 115 ? 22.810  22.917  14.225  1.00 49.60 ? 243 VAL B CB    1 
ATOM   2799 C CG1   . VAL D 3 115 ? 23.539  21.735  13.629  1.00 50.28 ? 243 VAL B CG1   1 
ATOM   2800 C CG2   . VAL D 3 115 ? 22.712  24.063  13.220  1.00 49.11 ? 243 VAL B CG2   1 
ATOM   2801 N N     . ILE D 3 116 ? 21.472  20.147  15.419  1.00 49.00 ? 244 ILE B N     1 
ATOM   2802 C CA    . ILE D 3 116 ? 21.796  19.012  16.285  1.00 48.42 ? 244 ILE B CA    1 
ATOM   2803 C C     . ILE D 3 116 ? 23.163  18.448  15.882  1.00 49.09 ? 244 ILE B C     1 
ATOM   2804 O O     . ILE D 3 116 ? 24.091  18.378  16.691  1.00 48.95 ? 244 ILE B O     1 
ATOM   2805 C CB    . ILE D 3 116 ? 20.704  17.904  16.230  1.00 48.30 ? 244 ILE B CB    1 
ATOM   2806 C CG1   . ILE D 3 116 ? 19.385  18.393  16.830  1.00 47.28 ? 244 ILE B CG1   1 
ATOM   2807 C CG2   . ILE D 3 116 ? 21.215  16.610  16.925  1.00 48.50 ? 244 ILE B CG2   1 
ATOM   2808 C CD1   . ILE D 3 116 ? 18.203  17.471  16.595  1.00 47.14 ? 244 ILE B CD1   1 
ATOM   2809 N N     . GLU D 3 117 ? 23.275  18.059  14.619  1.00 49.71 ? 245 GLU B N     1 
ATOM   2810 C CA    . GLU D 3 117 ? 24.541  17.626  14.048  1.00 50.68 ? 245 GLU B CA    1 
ATOM   2811 C C     . GLU D 3 117 ? 24.640  18.025  12.579  1.00 50.78 ? 245 GLU B C     1 
ATOM   2812 O O     . GLU D 3 117 ? 23.622  18.117  11.877  1.00 50.48 ? 245 GLU B O     1 
ATOM   2813 C CB    . GLU D 3 117 ? 24.690  16.112  14.186  1.00 50.99 ? 245 GLU B CB    1 
ATOM   2814 C CG    . GLU D 3 117 ? 23.454  15.337  13.751  1.00 52.00 ? 245 GLU B CG    1 
ATOM   2815 C CD    . GLU D 3 117 ? 23.648  13.836  13.849  1.00 54.67 ? 245 GLU B CD    1 
ATOM   2816 O OE1   . GLU D 3 117 ? 24.755  13.409  14.261  1.00 54.94 ? 245 GLU B OE1   1 
ATOM   2817 O OE2   . GLU D 3 117 ? 22.685  13.089  13.519  1.00 57.41 ? 245 GLU B OE2   1 
ATOM   2818 N N     . GLU D 3 118 ? 25.866  18.271  12.121  1.00 50.98 ? 246 GLU B N     1 
ATOM   2819 C CA    . GLU D 3 118 ? 26.100  18.541  10.704  1.00 51.32 ? 246 GLU B CA    1 
ATOM   2820 C C     . GLU D 3 118 ? 27.437  18.015  10.261  1.00 51.14 ? 246 GLU B C     1 
ATOM   2821 O O     . GLU D 3 118 ? 28.346  17.870  11.082  1.00 51.88 ? 246 GLU B O     1 
ATOM   2822 C CB    . GLU D 3 118 ? 26.020  20.020  10.429  1.00 51.34 ? 246 GLU B CB    1 
ATOM   2823 C CG    . GLU D 3 118 ? 26.897  20.806  11.362  1.00 52.26 ? 246 GLU B CG    1 
ATOM   2824 C CD    . GLU D 3 118 ? 26.416  22.212  11.454  1.00 52.57 ? 246 GLU B CD    1 
ATOM   2825 O OE1   . GLU D 3 118 ? 25.551  22.566  10.615  1.00 52.77 ? 246 GLU B OE1   1 
ATOM   2826 O OE2   . GLU D 3 118 ? 26.904  22.929  12.353  1.00 51.78 ? 246 GLU B OE2   1 
ATOM   2827 N N     . SER D 3 119 ? 27.558  17.756  8.960   1.00 51.12 ? 247 SER B N     1 
ATOM   2828 C CA    . SER D 3 119 ? 28.672  16.965  8.411   1.00 51.25 ? 247 SER B CA    1 
ATOM   2829 C C     . SER D 3 119 ? 29.956  17.775  8.181   1.00 50.99 ? 247 SER B C     1 
ATOM   2830 O O     . SER D 3 119 ? 30.998  17.230  7.786   1.00 51.16 ? 247 SER B O     1 
ATOM   2831 C CB    . SER D 3 119 ? 28.245  16.212  7.142   1.00 51.56 ? 247 SER B CB    1 
ATOM   2832 O OG    . SER D 3 119 ? 27.621  17.063  6.195   1.00 50.37 ? 247 SER B OG    1 
ATOM   2833 N N     . LEU D 3 120 ? 29.882  19.072  8.452   1.00 50.41 ? 248 LEU B N     1 
ATOM   2834 C CA    . LEU D 3 120 ? 31.067  19.916  8.441   1.00 49.50 ? 248 LEU B CA    1 
ATOM   2835 C C     . LEU D 3 120 ? 31.220  20.630  9.805   1.00 48.86 ? 248 LEU B C     1 
ATOM   2836 O O     . LEU D 3 120 ? 30.213  21.028  10.399  1.00 48.46 ? 248 LEU B O     1 
ATOM   2837 C CB    . LEU D 3 120 ? 31.005  20.876  7.257   1.00 49.85 ? 248 LEU B CB    1 
ATOM   2838 C CG    . LEU D 3 120 ? 31.152  20.308  5.830   1.00 50.40 ? 248 LEU B CG    1 
ATOM   2839 C CD1   . LEU D 3 120 ? 31.318  21.454  4.787   1.00 50.34 ? 248 LEU B CD1   1 
ATOM   2840 C CD2   . LEU D 3 120 ? 32.329  19.323  5.697   1.00 50.80 ? 248 LEU B CD2   1 
ATOM   2841 N N     . PRO D 3 121 ? 32.446  20.720  10.347  1.00 48.50 ? 249 PRO B N     1 
ATOM   2842 C CA    . PRO D 3 121 ? 32.654  21.447  11.608  1.00 48.16 ? 249 PRO B CA    1 
ATOM   2843 C C     . PRO D 3 121 ? 32.305  22.924  11.440  1.00 48.14 ? 249 PRO B C     1 
ATOM   2844 O O     . PRO D 3 121 ? 32.829  23.588  10.549  1.00 47.70 ? 249 PRO B O     1 
ATOM   2845 C CB    . PRO D 3 121 ? 34.141  21.219  11.919  1.00 47.71 ? 249 PRO B CB    1 
ATOM   2846 C CG    . PRO D 3 121 ? 34.774  20.801  10.639  1.00 47.17 ? 249 PRO B CG    1 
ATOM   2847 C CD    . PRO D 3 121 ? 33.703  20.116  9.852   1.00 48.40 ? 249 PRO B CD    1 
ATOM   2848 N N     . GLY D 3 122 ? 31.372  23.406  12.257  1.00 48.72 ? 250 GLY B N     1 
ATOM   2849 C CA    . GLY D 3 122 ? 30.909  24.793  12.176  1.00 48.94 ? 250 GLY B CA    1 
ATOM   2850 C C     . GLY D 3 122 ? 30.018  25.078  10.976  1.00 49.55 ? 250 GLY B C     1 
ATOM   2851 O O     . GLY D 3 122 ? 29.899  26.229  10.541  1.00 49.85 ? 250 GLY B O     1 
ATOM   2852 N N     . GLY D 3 123 ? 29.402  24.031  10.434  1.00 49.80 ? 251 GLY B N     1 
ATOM   2853 C CA    . GLY D 3 123 ? 28.353  24.151  9.421   1.00 49.90 ? 251 GLY B CA    1 
ATOM   2854 C C     . GLY D 3 123 ? 28.719  24.924  8.174   1.00 50.21 ? 251 GLY B C     1 
ATOM   2855 O O     . GLY D 3 123 ? 29.871  24.948  7.771   1.00 49.92 ? 251 GLY B O     1 
ATOM   2856 N N     . LEU D 3 124 ? 27.718  25.554  7.561   1.00 50.87 ? 252 LEU B N     1 
ATOM   2857 C CA    . LEU D 3 124 ? 27.920  26.327  6.339   1.00 51.08 ? 252 LEU B CA    1 
ATOM   2858 C C     . LEU D 3 124 ? 27.857  27.828  6.601   1.00 51.60 ? 252 LEU B C     1 
ATOM   2859 O O     . LEU D 3 124 ? 27.155  28.264  7.515   1.00 51.60 ? 252 LEU B O     1 
ATOM   2860 C CB    . LEU D 3 124 ? 26.904  25.906  5.267   1.00 50.46 ? 252 LEU B CB    1 
ATOM   2861 C CG    . LEU D 3 124 ? 27.164  24.530  4.651   1.00 49.90 ? 252 LEU B CG    1 
ATOM   2862 C CD1   . LEU D 3 124 ? 26.150  24.195  3.626   1.00 49.30 ? 252 LEU B CD1   1 
ATOM   2863 C CD2   . LEU D 3 124 ? 28.583  24.410  4.038   1.00 49.51 ? 252 LEU B CD2   1 
ATOM   2864 N N     . LYS D 3 125 ? 28.633  28.591  5.822   1.00 52.32 ? 253 LYS B N     1 
ATOM   2865 C CA    . LYS D 3 125 ? 28.559  30.060  5.762   1.00 52.80 ? 253 LYS B CA    1 
ATOM   2866 C C     . LYS D 3 125 ? 27.989  30.448  4.402   1.00 53.42 ? 253 LYS B C     1 
ATOM   2867 O O     . LYS D 3 125 ? 27.730  29.567  3.573   1.00 53.51 ? 253 LYS B O     1 
ATOM   2868 C CB    . LYS D 3 125 ? 29.939  30.693  5.943   1.00 52.75 ? 253 LYS B CB    1 
ATOM   2869 C CG    . LYS D 3 125 ? 30.267  31.134  7.353   1.00 52.96 ? 253 LYS B CG    1 
ATOM   2870 C CD    . LYS D 3 125 ? 31.739  31.491  7.451   1.00 53.98 ? 253 LYS B CD    1 
ATOM   2871 C CE    . LYS D 3 125 ? 32.157  31.747  8.887   1.00 54.52 ? 253 LYS B CE    1 
ATOM   2872 N NZ    . LYS D 3 125 ? 33.606  31.443  9.084   1.00 55.16 ? 253 LYS B NZ    1 
ATOM   2873 N N     . GLU D 3 126 ? 27.812  31.750  4.158   1.00 53.93 ? 254 GLU B N     1 
ATOM   2874 C CA    . GLU D 3 126 ? 27.134  32.203  2.944   1.00 54.54 ? 254 GLU B CA    1 
ATOM   2875 C C     . GLU D 3 126 ? 27.878  31.911  1.638   1.00 55.38 ? 254 GLU B C     1 
ATOM   2876 O O     . GLU D 3 126 ? 27.312  31.265  0.763   1.00 55.78 ? 254 GLU B O     1 
ATOM   2877 C CB    . GLU D 3 126 ? 26.701  33.658  3.031   1.00 54.52 ? 254 GLU B CB    1 
ATOM   2878 C CG    . GLU D 3 126 ? 25.330  33.865  2.415   1.00 53.73 ? 254 GLU B CG    1 
ATOM   2879 C CD    . GLU D 3 126 ? 24.959  35.317  2.244   1.00 52.09 ? 254 GLU B CD    1 
ATOM   2880 O OE1   . GLU D 3 126 ? 25.410  36.140  3.060   1.00 51.78 ? 254 GLU B OE1   1 
ATOM   2881 O OE2   . GLU D 3 126 ? 24.209  35.623  1.294   1.00 50.77 ? 254 GLU B OE2   1 
ATOM   2882 N N     . HIS D 3 127 ? 29.122  32.372  1.488   1.00 56.16 ? 255 HIS B N     1 
ATOM   2883 C CA    . HIS D 3 127 ? 29.960  31.840  0.418   1.00 57.05 ? 255 HIS B CA    1 
ATOM   2884 C C     . HIS D 3 127 ? 29.891  30.343  0.688   1.00 57.73 ? 255 HIS B C     1 
ATOM   2885 O O     . HIS D 3 127 ? 29.634  29.960  1.829   1.00 58.48 ? 255 HIS B O     1 
ATOM   2886 C CB    . HIS D 3 127 ? 31.388  32.394  0.497   1.00 57.46 ? 255 HIS B CB    1 
ATOM   2887 C CG    . HIS D 3 127 ? 32.307  31.602  1.378   1.00 57.51 ? 255 HIS B CG    1 
ATOM   2888 N ND1   . HIS D 3 127 ? 32.138  31.513  2.745   1.00 57.18 ? 255 HIS B ND1   1 
ATOM   2889 C CD2   . HIS D 3 127 ? 33.415  30.875  1.085   1.00 57.20 ? 255 HIS B CD2   1 
ATOM   2890 C CE1   . HIS D 3 127 ? 33.094  30.754  3.254   1.00 57.58 ? 255 HIS B CE1   1 
ATOM   2891 N NE2   . HIS D 3 127 ? 33.882  30.355  2.268   1.00 57.54 ? 255 HIS B NE2   1 
ATOM   2892 N N     . ASP D 3 128 ? 30.066  29.487  -0.315  1.00 58.10 ? 256 ASP B N     1 
ATOM   2893 C CA    . ASP D 3 128 ? 29.664  28.059  -0.185  1.00 58.18 ? 256 ASP B CA    1 
ATOM   2894 C C     . ASP D 3 128 ? 28.398  27.847  -1.016  1.00 58.56 ? 256 ASP B C     1 
ATOM   2895 O O     . ASP D 3 128 ? 28.222  26.811  -1.656  1.00 58.73 ? 256 ASP B O     1 
ATOM   2896 C CB    . ASP D 3 128 ? 29.361  27.627  1.279   1.00 57.83 ? 256 ASP B CB    1 
ATOM   2897 C CG    . ASP D 3 128 ? 30.623  27.450  2.156   1.00 57.69 ? 256 ASP B CG    1 
ATOM   2898 O OD1   . ASP D 3 128 ? 31.760  27.401  1.612   1.00 57.65 ? 256 ASP B OD1   1 
ATOM   2899 O OD2   . ASP D 3 128 ? 30.556  27.366  3.411   1.00 54.58 ? 256 ASP B OD2   1 
ATOM   2900 N N     . PHE D 3 129 ? 27.509  28.838  -0.985  1.00 59.04 ? 257 PHE B N     1 
ATOM   2901 C CA    . PHE D 3 129 ? 26.287  28.817  -1.782  1.00 59.14 ? 257 PHE B CA    1 
ATOM   2902 C C     . PHE D 3 129 ? 26.420  29.665  -3.044  1.00 59.78 ? 257 PHE B C     1 
ATOM   2903 O O     . PHE D 3 129 ? 26.855  30.825  -2.987  1.00 59.93 ? 257 PHE B O     1 
ATOM   2904 C CB    . PHE D 3 129 ? 25.091  29.282  -0.955  1.00 58.66 ? 257 PHE B CB    1 
ATOM   2905 C CG    . PHE D 3 129 ? 24.708  28.337  0.142   1.00 58.04 ? 257 PHE B CG    1 
ATOM   2906 C CD1   . PHE D 3 129 ? 23.981  27.183  -0.137  1.00 56.47 ? 257 PHE B CD1   1 
ATOM   2907 C CD2   . PHE D 3 129 ? 25.071  28.599  1.462   1.00 57.78 ? 257 PHE B CD2   1 
ATOM   2908 C CE1   . PHE D 3 129 ? 23.617  26.296  0.890   1.00 57.06 ? 257 PHE B CE1   1 
ATOM   2909 C CE2   . PHE D 3 129 ? 24.703  27.721  2.502   1.00 58.11 ? 257 PHE B CE2   1 
ATOM   2910 C CZ    . PHE D 3 129 ? 23.972  26.564  2.211   1.00 57.22 ? 257 PHE B CZ    1 
ATOM   2911 N N     . ASN D 3 130 ? 26.064  29.058  -4.179  1.00 60.55 ? 258 ASN B N     1 
ATOM   2912 C CA    . ASN D 3 130 ? 25.960  29.750  -5.473  1.00 61.14 ? 258 ASN B CA    1 
ATOM   2913 C C     . ASN D 3 130 ? 24.617  29.456  -6.159  1.00 61.51 ? 258 ASN B C     1 
ATOM   2914 O O     . ASN D 3 130 ? 23.926  30.361  -6.675  1.00 61.39 ? 258 ASN B O     1 
ATOM   2915 C CB    . ASN D 3 130 ? 27.118  29.364  -6.398  1.00 61.06 ? 258 ASN B CB    1 
ATOM   2916 C CG    . ASN D 3 130 ? 27.203  30.250  -7.627  1.00 60.96 ? 258 ASN B CG    1 
ATOM   2917 O OD1   . ASN D 3 130 ? 27.272  29.760  -8.750  1.00 61.03 ? 258 ASN B OD1   1 
ATOM   2918 N ND2   . ASN D 3 130 ? 27.192  31.561  -7.418  1.00 60.75 ? 258 ASN B ND2   1 
HETATM 2919 O O     . HOH E 4 .   ? 8.348   -1.650  -13.101 1.00 42.37 ? 22  HOH W O     1 
HETATM 2920 O O     . HOH E 4 .   ? 13.283  23.033  -9.873  1.00 39.79 ? 23  HOH W O     1 
HETATM 2921 O O     . HOH E 4 .   ? 13.225  -20.534 -23.791 1.00 37.05 ? 24  HOH W O     1 
HETATM 2922 O O     . HOH E 4 .   ? 9.949   -27.732 -21.455 1.00 49.56 ? 25  HOH W O     1 
HETATM 2923 O O     . HOH E 4 .   ? 6.540   -21.307 -16.437 1.00 31.84 ? 26  HOH W O     1 
HETATM 2924 O O     . HOH E 4 .   ? 13.224  -2.041  -21.458 1.00 49.89 ? 27  HOH W O     1 
HETATM 2925 O O     . HOH E 4 .   ? 15.716  27.353  -9.453  1.00 42.34 ? 28  HOH W O     1 
HETATM 2926 O O     . HOH E 4 .   ? 1.247   23.440  -19.145 1.00 50.33 ? 29  HOH W O     1 
HETATM 2927 O O     . HOH E 4 .   ? 4.646   -20.574 -18.412 1.00 36.96 ? 30  HOH W O     1 
HETATM 2928 O O     . HOH E 4 .   ? 5.338   -12.758 -21.328 1.00 51.79 ? 31  HOH W O     1 
HETATM 2929 O O     . HOH E 4 .   ? 6.112   -25.382 -22.782 1.00 42.31 ? 32  HOH W O     1 
HETATM 2930 O O     . HOH E 4 .   ? 14.152  -7.759  -16.299 1.00 53.31 ? 33  HOH W O     1 
HETATM 2931 O O     . HOH E 4 .   ? 5.705   20.902  -23.037 1.00 48.14 ? 34  HOH W O     1 
HETATM 2932 O O     . HOH E 4 .   ? 8.375   8.959   -20.721 1.00 41.45 ? 35  HOH W O     1 
HETATM 2933 O O     . HOH F 4 .   ? 9.370   0.272   -21.840 1.00 46.11 ? 44  HOH C O     1 
HETATM 2934 O O     . HOH F 4 .   ? 16.190  19.089  -14.575 1.00 36.21 ? 45  HOH C O     1 
HETATM 2935 O O     . HOH F 4 .   ? 7.025   0.203   -21.127 1.00 43.56 ? 46  HOH C O     1 
HETATM 2936 O O     . HOH F 4 .   ? 14.134  -29.129 -10.538 1.00 54.66 ? 47  HOH C O     1 
HETATM 2937 O O     . HOH F 4 .   ? 19.072  -22.998 -17.136 1.00 46.25 ? 48  HOH C O     1 
HETATM 2938 O O     . HOH F 4 .   ? 13.130  -34.603 -20.859 1.00 52.10 ? 49  HOH C O     1 
HETATM 2939 O O     . HOH F 4 .   ? 17.909  -27.585 -10.510 1.00 47.40 ? 50  HOH C O     1 
HETATM 2940 O O     . HOH F 4 .   ? 14.347  29.447  -22.073 1.00 59.91 ? 51  HOH C O     1 
HETATM 2941 O O     . HOH F 4 .   ? 7.609   4.101   -20.476 1.00 55.76 ? 52  HOH C O     1 
HETATM 2942 O O     . HOH F 4 .   ? 20.307  -23.066 -14.964 1.00 68.28 ? 53  HOH C O     1 
HETATM 2943 O O     . HOH F 4 .   ? 8.628   -31.934 -19.926 1.00 53.59 ? 54  HOH C O     1 
HETATM 2944 O O     . HOH G 4 .   ? 6.298   -35.292 5.387   1.00 54.39 ? 4   HOH A O     1 
HETATM 2945 O O     . HOH G 4 .   ? -1.438  -0.493  3.779   1.00 57.75 ? 8   HOH A O     1 
HETATM 2946 O O     . HOH G 4 .   ? 10.943  -21.137 -1.420  1.00 52.55 ? 14  HOH A O     1 
HETATM 2947 O O     . HOH G 4 .   ? 8.744   -16.416 -8.684  1.00 37.58 ? 16  HOH A O     1 
HETATM 2948 O O     . HOH G 4 .   ? -0.005  -34.237 -4.067  1.00 52.91 ? 17  HOH A O     1 
HETATM 2949 O O     . HOH G 4 .   ? -1.526  -15.493 -15.802 1.00 51.75 ? 20  HOH A O     1 
HETATM 2950 O O     . HOH G 4 .   ? 7.151   -18.975 -9.169  1.00 38.60 ? 26  HOH A O     1 
HETATM 2951 O O     . HOH G 4 .   ? -7.710  -14.619 -13.208 1.00 74.15 ? 27  HOH A O     1 
HETATM 2952 O O     . HOH G 4 .   ? -15.206 -34.608 -8.448  1.00 50.90 ? 28  HOH A O     1 
HETATM 2953 O O     . HOH G 4 .   ? 8.532   -14.603 1.998   1.00 70.51 ? 29  HOH A O     1 
HETATM 2954 O O     . HOH G 4 .   ? -13.888 -20.180 -4.743  1.00 52.98 ? 31  HOH A O     1 
HETATM 2955 O O     . HOH G 4 .   ? 2.874   -30.422 -9.077  1.00 52.15 ? 33  HOH A O     1 
HETATM 2956 O O     . HOH G 4 .   ? 9.012   -12.080 10.458  1.00 58.50 ? 39  HOH A O     1 
HETATM 2957 O O     . HOH G 4 .   ? 8.206   -21.420 -3.279  1.00 42.68 ? 40  HOH A O     1 
HETATM 2958 O O     . HOH G 4 .   ? -5.362  -24.180 -11.477 1.00 49.54 ? 46  HOH A O     1 
HETATM 2959 O O     . HOH G 4 .   ? 15.512  -14.852 -11.275 1.00 51.52 ? 56  HOH A O     1 
HETATM 2960 O O     . HOH G 4 .   ? -7.758  -33.053 -9.622  1.00 50.06 ? 57  HOH A O     1 
HETATM 2961 O O     . HOH G 4 .   ? 7.666   -11.931 6.955   1.00 54.91 ? 58  HOH A O     1 
HETATM 2962 O O     . HOH G 4 .   ? 9.340   -27.022 11.899  1.00 64.20 ? 60  HOH A O     1 
HETATM 2963 O O     . HOH G 4 .   ? -13.387 -13.817 -10.290 1.00 75.44 ? 64  HOH A O     1 
HETATM 2964 O O     . HOH G 4 .   ? -9.372  -38.200 -2.850  1.00 46.23 ? 66  HOH A O     1 
HETATM 2965 O O     . HOH G 4 .   ? -3.755  -15.454 18.803  1.00 61.65 ? 67  HOH A O     1 
HETATM 2966 O O     . HOH G 4 .   ? -0.678  -10.022 -8.941  1.00 51.50 ? 77  HOH A O     1 
HETATM 2967 O O     . HOH G 4 .   ? 7.133   -10.963 -9.657  1.00 35.66 ? 81  HOH A O     1 
HETATM 2968 O O     . HOH G 4 .   ? 7.137   -32.467 4.188   1.00 54.53 ? 84  HOH A O     1 
HETATM 2969 O O     . HOH G 4 .   ? -5.795  -16.502 -11.607 1.00 51.14 ? 86  HOH A O     1 
HETATM 2970 O O     . HOH G 4 .   ? 12.640  -12.257 -14.371 1.00 40.59 ? 87  HOH A O     1 
HETATM 2971 O O     . HOH H 4 .   ? 24.804  12.360  -5.091  1.00 36.91 ? 1   HOH B O     1 
HETATM 2972 O O     . HOH H 4 .   ? 6.998   13.991  0.829   1.00 49.46 ? 3   HOH B O     1 
HETATM 2973 O O     . HOH H 4 .   ? 4.630   27.292  11.041  1.00 53.78 ? 5   HOH B O     1 
HETATM 2974 O O     . HOH H 4 .   ? 9.533   19.718  -3.505  1.00 25.55 ? 6   HOH B O     1 
HETATM 2975 O O     . HOH H 4 .   ? 20.948  29.863  -1.519  1.00 63.88 ? 7   HOH B O     1 
HETATM 2976 O O     . HOH H 4 .   ? 15.615  15.792  18.609  1.00 58.98 ? 9   HOH B O     1 
HETATM 2977 O O     . HOH H 4 .   ? 6.778   13.558  -18.434 1.00 63.33 ? 10  HOH B O     1 
HETATM 2978 O O     . HOH H 4 .   ? 17.274  30.611  -4.989  1.00 65.30 ? 15  HOH B O     1 
HETATM 2979 O O     . HOH H 4 .   ? 24.510  -0.953  6.835   1.00 51.75 ? 22  HOH B O     1 
HETATM 2980 O O     . HOH H 4 .   ? 12.661  17.228  -8.043  1.00 42.04 ? 23  HOH B O     1 
HETATM 2981 O O     . HOH H 4 .   ? 22.327  12.270  -10.565 1.00 57.93 ? 24  HOH B O     1 
HETATM 2982 O O     . HOH H 4 .   ? 18.627  22.469  -15.907 1.00 46.01 ? 34  HOH B O     1 
HETATM 2983 O O     . HOH H 4 .   ? -0.518  19.305  10.024  1.00 56.94 ? 36  HOH B O     1 
HETATM 2984 O O     . HOH H 4 .   ? 4.100   22.084  9.986   1.00 48.21 ? 37  HOH B O     1 
HETATM 2985 O O     . HOH H 4 .   ? 15.769  3.588   -3.547  1.00 46.22 ? 38  HOH B O     1 
HETATM 2986 O O     . HOH H 4 .   ? 10.538  15.117  -8.760  1.00 44.80 ? 43  HOH B O     1 
HETATM 2987 O O     . HOH H 4 .   ? 10.552  13.468  16.823  1.00 54.06 ? 45  HOH B O     1 
HETATM 2988 O O     . HOH H 4 .   ? 25.595  25.829  12.865  1.00 50.67 ? 48  HOH B O     1 
HETATM 2989 O O     . HOH H 4 .   ? 6.168   14.563  -13.158 1.00 39.65 ? 54  HOH B O     1 
HETATM 2990 O O     . HOH H 4 .   ? 9.763   17.927  22.391  1.00 59.69 ? 59  HOH B O     1 
HETATM 2991 O O     . HOH H 4 .   ? 29.639  16.704  4.302   1.00 58.06 ? 65  HOH B O     1 
HETATM 2992 O O     . HOH H 4 .   ? 18.923  31.161  -0.669  1.00 63.36 ? 73  HOH B O     1 
HETATM 2993 O O     . HOH H 4 .   ? 2.919   11.493  14.689  1.00 61.98 ? 76  HOH B O     1 
HETATM 2994 O O     . HOH H 4 .   ? 29.042  31.418  -4.442  1.00 58.25 ? 78  HOH B O     1 
HETATM 2995 O O     . HOH H 4 .   ? 8.075   17.747  -9.326  1.00 48.64 ? 89  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   W . n 
A 1 2   DC  2   2   2   DC  C   W . n 
A 1 3   DG  3   3   3   DG  G   W . n 
A 1 4   DA  4   4   4   DA  A   W . n 
A 1 5   DG  5   5   5   DG  G   W . n 
A 1 6   DG  6   6   6   DG  G   W . n 
A 1 7   DC  7   7   7   DC  C   W . n 
A 1 8   DA  8   8   8   DA  A   W . n 
A 1 9   DC  9   9   9   DC  C   W . n 
A 1 10  DT  10  10  10  DT  T   W . n 
A 1 11  DT  11  11  11  DT  T   W . n 
A 1 12  DC  12  12  12  DC  C   W . n 
A 1 13  DT  13  13  13  DT  T   W . n 
A 1 14  DG  14  14  14  DG  G   W . n 
A 1 15  DG  15  15  15  DG  G   W . n 
A 1 16  DC  16  16  16  DC  C   W . n 
A 1 17  DC  17  17  17  DC  C   W . n 
A 1 18  DT  18  18  18  DT  T   W . n 
A 1 19  DC  19  19  19  DC  C   W . n 
A 1 20  DT  20  20  20  DT  T   W . n 
A 1 21  DG  21  21  21  DG  G   W . n 
B 2 1   DT  1   23  23  DT  T   C . n 
B 2 2   DC  2   24  24  DC  C   C . n 
B 2 3   DA  3   25  25  DA  A   C . n 
B 2 4   DG  4   26  26  DG  G   C . n 
B 2 5   DA  5   27  27  DA  A   C . n 
B 2 6   DG  6   28  28  DG  G   C . n 
B 2 7   DG  7   29  29  DG  G   C . n 
B 2 8   DC  8   30  30  DC  C   C . n 
B 2 9   DC  9   31  31  DC  C   C . n 
B 2 10  DA  10  32  32  DA  A   C . n 
B 2 11  DG  11  33  33  DG  G   C . n 
B 2 12  DA  12  34  34  DA  A   C . n 
B 2 13  DA  13  35  35  DA  A   C . n 
B 2 14  DG  14  36  36  DG  G   C . n 
B 2 15  DT  15  37  37  DT  T   C . n 
B 2 16  DG  16  38  38  DG  G   C . n 
B 2 17  DC  17  39  39  DC  C   C . n 
B 2 18  DC  18  40  40  DC  C   C . n 
B 2 19  DT  19  41  41  DT  T   C . n 
B 2 20  DC  20  42  42  DC  C   C . n 
B 2 21  DG  21  43  43  DG  G   C . n 
C 3 1   GLY 1   129 ?   ?   ?   A . n 
C 3 2   SER 2   130 ?   ?   ?   A . n 
C 3 3   LYS 3   131 ?   ?   ?   A . n 
C 3 4   VAL 4   132 132 VAL VAL A . n 
C 3 5   GLU 5   133 133 GLU GLU A . n 
C 3 6   ASP 6   134 134 ASP ASP A . n 
C 3 7   PRO 7   135 135 PRO PRO A . n 
C 3 8   LYS 8   136 136 LYS LYS A . n 
C 3 9   ASP 9   137 137 ASP ASP A . n 
C 3 10  PHE 10  138 138 PHE PHE A . n 
C 3 11  PRO 11  139 139 PRO PRO A . n 
C 3 12  SER 12  140 140 SER SER A . n 
C 3 13  GLU 13  141 141 GLU GLU A . n 
C 3 14  LEU 14  142 142 LEU LEU A . n 
C 3 15  LEU 15  143 143 LEU LEU A . n 
C 3 16  SER 16  144 144 SER SER A . n 
C 3 17  PHE 17  145 145 PHE PHE A . n 
C 3 18  LEU 18  146 146 LEU LEU A . n 
C 3 19  SER 19  147 147 SER SER A . n 
C 3 20  HIS 20  148 148 HIS HIS A . n 
C 3 21  ALA 21  149 149 ALA ALA A . n 
C 3 22  VAL 22  150 150 VAL VAL A . n 
C 3 23  PHE 23  151 151 PHE PHE A . n 
C 3 24  SER 24  152 152 SER SER A . n 
C 3 25  ASN 25  153 153 ASN ASN A . n 
C 3 26  ARG 26  154 154 ARG ARG A . n 
C 3 27  THR 27  155 155 THR THR A . n 
C 3 28  LEU 28  156 156 LEU LEU A . n 
C 3 29  ALA 29  157 157 ALA ALA A . n 
C 3 30  CYS 30  158 158 CYS CYS A . n 
C 3 31  PHE 31  159 159 PHE PHE A . n 
C 3 32  ALA 32  160 160 ALA ALA A . n 
C 3 33  ILE 33  161 161 ILE ILE A . n 
C 3 34  TYR 34  162 162 TYR TYR A . n 
C 3 35  THR 35  163 163 THR THR A . n 
C 3 36  THR 36  164 164 THR THR A . n 
C 3 37  LYS 37  165 165 LYS LYS A . n 
C 3 38  GLU 38  166 166 GLU GLU A . n 
C 3 39  LYS 39  167 167 LYS LYS A . n 
C 3 40  ALA 40  168 168 ALA ALA A . n 
C 3 41  ALA 41  169 169 ALA ALA A . n 
C 3 42  LEU 42  170 170 LEU LEU A . n 
C 3 43  LEU 43  171 171 LEU LEU A . n 
C 3 44  TYR 44  172 172 TYR TYR A . n 
C 3 45  LYS 45  173 173 LYS LYS A . n 
C 3 46  LYS 46  174 174 LYS LYS A . n 
C 3 47  ILE 47  175 175 ILE ILE A . n 
C 3 48  MET 48  176 176 MET MET A . n 
C 3 49  GLU 49  177 177 GLU GLU A . n 
C 3 50  LYS 50  178 178 LYS LYS A . n 
C 3 51  TYR 51  179 179 TYR TYR A . n 
C 3 52  SER 52  180 180 SER SER A . n 
C 3 53  VAL 53  181 181 VAL VAL A . n 
C 3 54  THR 54  182 182 THR THR A . n 
C 3 55  PHE 55  183 183 PHE PHE A . n 
C 3 56  ILE 56  184 184 ILE ILE A . n 
C 3 57  SER 57  185 185 SER SER A . n 
C 3 58  ARG 58  186 186 ARG ARG A . n 
C 3 59  HIS 59  187 187 HIS HIS A . n 
C 3 60  ASN 60  188 188 ASN ASN A . n 
C 3 61  SER 61  189 189 SER SER A . n 
C 3 62  TYR 62  190 190 TYR TYR A . n 
C 3 63  ASN 63  191 191 ASN ASN A . n 
C 3 64  HIS 64  192 192 HIS HIS A . n 
C 3 65  ASN 65  193 193 ASN ASN A . n 
C 3 66  ILE 66  194 194 ILE ILE A . n 
C 3 67  LEU 67  195 195 LEU LEU A . n 
C 3 68  PHE 68  196 196 PHE PHE A . n 
C 3 69  PHE 69  197 197 PHE PHE A . n 
C 3 70  LEU 70  198 198 LEU LEU A . n 
C 3 71  THR 71  199 199 THR THR A . n 
C 3 72  PRO 72  200 200 PRO PRO A . n 
C 3 73  HIS 73  201 201 HIS HIS A . n 
C 3 74  ARG 74  202 202 ARG ARG A . n 
C 3 75  HIS 75  203 203 HIS HIS A . n 
C 3 76  ARG 76  204 204 ARG ARG A . n 
C 3 77  VAL 77  205 205 VAL VAL A . n 
C 3 78  SER 78  206 206 SER SER A . n 
C 3 79  ALA 79  207 207 ALA ALA A . n 
C 3 80  ILE 80  208 208 ILE ILE A . n 
C 3 81  ASN 81  209 209 ASN ASN A . n 
C 3 82  ASN 82  210 210 ASN ASN A . n 
C 3 83  TYR 83  211 211 TYR TYR A . n 
C 3 84  ALA 84  212 212 ALA ALA A . n 
C 3 85  GLN 85  213 213 GLN GLN A . n 
C 3 86  LYS 86  214 214 LYS LYS A . n 
C 3 87  LEU 87  215 215 LEU LEU A . n 
C 3 88  CYS 88  216 216 CYS CYS A . n 
C 3 89  THR 89  217 217 THR THR A . n 
C 3 90  PHE 90  218 218 PHE PHE A . n 
C 3 91  SER 91  219 219 SER SER A . n 
C 3 92  PHE 92  220 220 PHE PHE A . n 
C 3 93  LEU 93  221 221 LEU LEU A . n 
C 3 94  ILE 94  222 222 ILE ILE A . n 
C 3 95  CYS 95  223 223 CYS CYS A . n 
C 3 96  LYS 96  224 224 LYS LYS A . n 
C 3 97  GLY 97  225 225 GLY GLY A . n 
C 3 98  VAL 98  226 226 VAL VAL A . n 
C 3 99  ASN 99  227 227 ASN ASN A . n 
C 3 100 LYS 100 228 228 LYS LYS A . n 
C 3 101 GLU 101 229 229 GLU GLU A . n 
C 3 102 TYR 102 230 230 TYR TYR A . n 
C 3 103 LEU 103 231 231 LEU LEU A . n 
C 3 104 MET 104 232 232 MET MET A . n 
C 3 105 TYR 105 233 233 TYR TYR A . n 
C 3 106 SER 106 234 234 SER SER A . n 
C 3 107 ALA 107 235 235 ALA ALA A . n 
C 3 108 LEU 108 236 236 LEU LEU A . n 
C 3 109 THR 109 237 237 THR THR A . n 
C 3 110 ARG 110 238 238 ARG ARG A . n 
C 3 111 ASP 111 239 239 ASP ASP A . n 
C 3 112 PRO 112 240 240 PRO PRO A . n 
C 3 113 PHE 113 241 241 PHE PHE A . n 
C 3 114 SER 114 242 242 SER SER A . n 
C 3 115 VAL 115 243 243 VAL VAL A . n 
C 3 116 ILE 116 244 244 ILE ILE A . n 
C 3 117 GLU 117 245 245 GLU GLU A . n 
C 3 118 GLU 118 246 246 GLU GLU A . n 
C 3 119 SER 119 247 247 SER SER A . n 
C 3 120 LEU 120 248 248 LEU LEU A . n 
C 3 121 PRO 121 249 249 PRO PRO A . n 
C 3 122 GLY 122 250 250 GLY GLY A . n 
C 3 123 GLY 123 251 251 GLY GLY A . n 
C 3 124 LEU 124 252 252 LEU LEU A . n 
C 3 125 LYS 125 253 253 LYS LYS A . n 
C 3 126 GLU 126 254 254 GLU GLU A . n 
C 3 127 HIS 127 255 255 HIS HIS A . n 
C 3 128 ASP 128 256 256 ASP ASP A . n 
C 3 129 PHE 129 257 257 PHE PHE A . n 
C 3 130 ASN 130 258 258 ASN ASN A . n 
C 3 131 PRO 131 259 ?   ?   ?   A . n 
C 3 132 GLU 132 260 ?   ?   ?   A . n 
C 3 133 SER 133 261 ?   ?   ?   A . n 
C 3 134 SER 134 262 ?   ?   ?   A . n 
D 3 1   GLY 1   129 ?   ?   ?   B . n 
D 3 2   SER 2   130 ?   ?   ?   B . n 
D 3 3   LYS 3   131 ?   ?   ?   B . n 
D 3 4   VAL 4   132 ?   ?   ?   B . n 
D 3 5   GLU 5   133 133 GLU GLU B . n 
D 3 6   ASP 6   134 134 ASP ASP B . n 
D 3 7   PRO 7   135 135 PRO PRO B . n 
D 3 8   LYS 8   136 136 LYS LYS B . n 
D 3 9   ASP 9   137 137 ASP ASP B . n 
D 3 10  PHE 10  138 138 PHE PHE B . n 
D 3 11  PRO 11  139 139 PRO PRO B . n 
D 3 12  SER 12  140 140 SER SER B . n 
D 3 13  GLU 13  141 141 GLU GLU B . n 
D 3 14  LEU 14  142 142 LEU LEU B . n 
D 3 15  LEU 15  143 143 LEU LEU B . n 
D 3 16  SER 16  144 144 SER SER B . n 
D 3 17  PHE 17  145 145 PHE PHE B . n 
D 3 18  LEU 18  146 146 LEU LEU B . n 
D 3 19  SER 19  147 147 SER SER B . n 
D 3 20  HIS 20  148 148 HIS HIS B . n 
D 3 21  ALA 21  149 149 ALA ALA B . n 
D 3 22  VAL 22  150 150 VAL VAL B . n 
D 3 23  PHE 23  151 151 PHE PHE B . n 
D 3 24  SER 24  152 152 SER SER B . n 
D 3 25  ASN 25  153 153 ASN ASN B . n 
D 3 26  ARG 26  154 154 ARG ARG B . n 
D 3 27  THR 27  155 155 THR THR B . n 
D 3 28  LEU 28  156 156 LEU LEU B . n 
D 3 29  ALA 29  157 157 ALA ALA B . n 
D 3 30  CYS 30  158 158 CYS CYS B . n 
D 3 31  PHE 31  159 159 PHE PHE B . n 
D 3 32  ALA 32  160 160 ALA ALA B . n 
D 3 33  ILE 33  161 161 ILE ILE B . n 
D 3 34  TYR 34  162 162 TYR TYR B . n 
D 3 35  THR 35  163 163 THR THR B . n 
D 3 36  THR 36  164 164 THR THR B . n 
D 3 37  LYS 37  165 165 LYS LYS B . n 
D 3 38  GLU 38  166 166 GLU GLU B . n 
D 3 39  LYS 39  167 167 LYS LYS B . n 
D 3 40  ALA 40  168 168 ALA ALA B . n 
D 3 41  ALA 41  169 169 ALA ALA B . n 
D 3 42  LEU 42  170 170 LEU LEU B . n 
D 3 43  LEU 43  171 171 LEU LEU B . n 
D 3 44  TYR 44  172 172 TYR TYR B . n 
D 3 45  LYS 45  173 173 LYS LYS B . n 
D 3 46  LYS 46  174 174 LYS LYS B . n 
D 3 47  ILE 47  175 175 ILE ILE B . n 
D 3 48  MET 48  176 176 MET MET B . n 
D 3 49  GLU 49  177 177 GLU GLU B . n 
D 3 50  LYS 50  178 178 LYS LYS B . n 
D 3 51  TYR 51  179 179 TYR TYR B . n 
D 3 52  SER 52  180 180 SER SER B . n 
D 3 53  VAL 53  181 181 VAL VAL B . n 
D 3 54  THR 54  182 182 THR THR B . n 
D 3 55  PHE 55  183 183 PHE PHE B . n 
D 3 56  ILE 56  184 184 ILE ILE B . n 
D 3 57  SER 57  185 185 SER SER B . n 
D 3 58  ARG 58  186 186 ARG ARG B . n 
D 3 59  HIS 59  187 187 HIS HIS B . n 
D 3 60  ASN 60  188 188 ASN ASN B . n 
D 3 61  SER 61  189 189 SER SER B . n 
D 3 62  TYR 62  190 190 TYR TYR B . n 
D 3 63  ASN 63  191 191 ASN ASN B . n 
D 3 64  HIS 64  192 192 HIS HIS B . n 
D 3 65  ASN 65  193 193 ASN ASN B . n 
D 3 66  ILE 66  194 194 ILE ILE B . n 
D 3 67  LEU 67  195 195 LEU LEU B . n 
D 3 68  PHE 68  196 196 PHE PHE B . n 
D 3 69  PHE 69  197 197 PHE PHE B . n 
D 3 70  LEU 70  198 198 LEU LEU B . n 
D 3 71  THR 71  199 199 THR THR B . n 
D 3 72  PRO 72  200 200 PRO PRO B . n 
D 3 73  HIS 73  201 201 HIS HIS B . n 
D 3 74  ARG 74  202 202 ARG ARG B . n 
D 3 75  HIS 75  203 203 HIS HIS B . n 
D 3 76  ARG 76  204 204 ARG ARG B . n 
D 3 77  VAL 77  205 205 VAL VAL B . n 
D 3 78  SER 78  206 206 SER SER B . n 
D 3 79  ALA 79  207 207 ALA ALA B . n 
D 3 80  ILE 80  208 208 ILE ILE B . n 
D 3 81  ASN 81  209 209 ASN ASN B . n 
D 3 82  ASN 82  210 210 ASN ASN B . n 
D 3 83  TYR 83  211 211 TYR TYR B . n 
D 3 84  ALA 84  212 212 ALA ALA B . n 
D 3 85  GLN 85  213 213 GLN GLN B . n 
D 3 86  LYS 86  214 214 LYS LYS B . n 
D 3 87  LEU 87  215 215 LEU LEU B . n 
D 3 88  CYS 88  216 216 CYS CYS B . n 
D 3 89  THR 89  217 217 THR THR B . n 
D 3 90  PHE 90  218 218 PHE PHE B . n 
D 3 91  SER 91  219 219 SER SER B . n 
D 3 92  PHE 92  220 220 PHE PHE B . n 
D 3 93  LEU 93  221 221 LEU LEU B . n 
D 3 94  ILE 94  222 222 ILE ILE B . n 
D 3 95  CYS 95  223 223 CYS CYS B . n 
D 3 96  LYS 96  224 224 LYS LYS B . n 
D 3 97  GLY 97  225 225 GLY GLY B . n 
D 3 98  VAL 98  226 226 VAL VAL B . n 
D 3 99  ASN 99  227 227 ASN ASN B . n 
D 3 100 LYS 100 228 228 LYS LYS B . n 
D 3 101 GLU 101 229 229 GLU GLU B . n 
D 3 102 TYR 102 230 230 TYR TYR B . n 
D 3 103 LEU 103 231 231 LEU LEU B . n 
D 3 104 MET 104 232 232 MET MET B . n 
D 3 105 TYR 105 233 233 TYR TYR B . n 
D 3 106 SER 106 234 234 SER SER B . n 
D 3 107 ALA 107 235 235 ALA ALA B . n 
D 3 108 LEU 108 236 236 LEU LEU B . n 
D 3 109 THR 109 237 237 THR THR B . n 
D 3 110 ARG 110 238 238 ARG ARG B . n 
D 3 111 ASP 111 239 239 ASP ASP B . n 
D 3 112 PRO 112 240 240 PRO PRO B . n 
D 3 113 PHE 113 241 241 PHE PHE B . n 
D 3 114 SER 114 242 242 SER SER B . n 
D 3 115 VAL 115 243 243 VAL VAL B . n 
D 3 116 ILE 116 244 244 ILE ILE B . n 
D 3 117 GLU 117 245 245 GLU GLU B . n 
D 3 118 GLU 118 246 246 GLU GLU B . n 
D 3 119 SER 119 247 247 SER SER B . n 
D 3 120 LEU 120 248 248 LEU LEU B . n 
D 3 121 PRO 121 249 249 PRO PRO B . n 
D 3 122 GLY 122 250 250 GLY GLY B . n 
D 3 123 GLY 123 251 251 GLY GLY B . n 
D 3 124 LEU 124 252 252 LEU LEU B . n 
D 3 125 LYS 125 253 253 LYS LYS B . n 
D 3 126 GLU 126 254 254 GLU GLU B . n 
D 3 127 HIS 127 255 255 HIS HIS B . n 
D 3 128 ASP 128 256 256 ASP ASP B . n 
D 3 129 PHE 129 257 257 PHE PHE B . n 
D 3 130 ASN 130 258 258 ASN ASN B . n 
D 3 131 PRO 131 259 ?   ?   ?   B . n 
D 3 132 GLU 132 260 ?   ?   ?   B . n 
D 3 133 SER 133 261 ?   ?   ?   B . n 
D 3 134 SER 134 262 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -9.2610 -29.1450 1.9760   -0.2066 0.0503  0.2779 -0.0508 0.0315  0.0774  8.3983 9.9159  9.7363 3.3512  5.6721 3.5961  
-0.0880 -0.2650 -0.9330 -0.1593 0.6771  0.9447  1.0058  -0.1001 -0.5891 'X-RAY DIFFRACTION' 
2 ? refined 22.9650 25.5320  9.5980   -0.0875 0.0495  0.5437 0.0462  -0.1449 -0.0010 6.8670 7.2487  2.1889 -4.0374 2.2804 1.3011  
-0.2292 -0.5219 1.0703  0.7454  -0.3025 -1.2936 -0.9327 0.1339  0.5317  'X-RAY DIFFRACTION' 
3 ? refined 11.7910 -2.9720  -17.8010 -0.0638 -0.2667 0.1124 -0.0026 0.0385  -0.0388 1.1212 10.3252 0.3335 -0.8682 0.0260 -0.0937 
0.0939  0.0082  -0.1424 -0.8168 -0.1762 -0.0307 -0.0025 0.0034  0.0823  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 233 C 105 A 258 C 130 ? 'X-RAY DIFFRACTION' ? 
2 2 B 233 D 105 B 258 D 130 ? 'X-RAY DIFFRACTION' ? 
3 3 W 2   A 2   W 21  A 21  ? 'X-RAY DIFFRACTION' ? 
4 3 C 23  B 1   C 43  B 21  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER    phasing          .   ? 1 
REFMAC    refinement       5.2 ? 2 
HKL-2000  'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N7 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   DA 
_pdbx_validate_close_contact.auth_seq_id_1    34 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    46 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.96 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    "O5'" 
_pdbx_validate_symm_contact.auth_asym_id_1    C 
_pdbx_validate_symm_contact.auth_comp_id_1    DT 
_pdbx_validate_symm_contact.auth_seq_id_1     23 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    "O3'" 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    DG 
_pdbx_validate_symm_contact.auth_seq_id_2     43 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_545 
_pdbx_validate_symm_contact.dist              2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N1    W DT 13 ? ? C2    W DT 13 ? ? 1.428 1.376 0.052  0.008 N 
2 1 "O3'" C DC 40 ? ? "C3'" C DC 40 ? ? 1.379 1.419 -0.040 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N1    W DA  1   ? ? C6    W DA  1   ? ? N6    W DA  1   ? ? 123.43 118.60 4.83  0.60 N 
2  1 C5    W DA  1   ? ? C6    W DA  1   ? ? N6    W DA  1   ? ? 117.23 123.70 -6.47 0.80 N 
3  1 "O4'" W DC  2   ? ? "C1'" W DC  2   ? ? N1    W DC  2   ? ? 110.17 108.30 1.87  0.30 N 
4  1 "C3'" W DC  2   ? ? "O3'" W DC  2   ? ? P     W DG  3   ? ? 127.43 119.70 7.73  1.20 Y 
5  1 "O4'" W DA  4   ? ? "C1'" W DA  4   ? ? N9    W DA  4   ? ? 111.47 108.30 3.17  0.30 N 
6  1 "C3'" W DA  4   ? ? "O3'" W DA  4   ? ? P     W DG  5   ? ? 127.53 119.70 7.83  1.20 Y 
7  1 "C1'" W DG  5   ? ? "O4'" W DG  5   ? ? "C4'" W DG  5   ? ? 102.31 110.10 -7.79 1.00 N 
8  1 "C3'" W DG  5   ? ? "C2'" W DG  5   ? ? "C1'" W DG  5   ? ? 96.50  102.40 -5.90 0.80 N 
9  1 "O4'" W DG  5   ? ? "C1'" W DG  5   ? ? N9    W DG  5   ? ? 114.94 108.30 6.64  0.30 N 
10 1 N1    W DG  5   ? ? C6    W DG  5   ? ? O6    W DG  5   ? ? 124.39 119.90 4.49  0.60 N 
11 1 C5    W DG  5   ? ? C6    W DG  5   ? ? O6    W DG  5   ? ? 123.71 128.60 -4.89 0.60 N 
12 1 "O4'" W DG  6   ? ? "C1'" W DG  6   ? ? N9    W DG  6   ? ? 110.24 108.30 1.94  0.30 N 
13 1 "O4'" W DC  9   ? ? "C1'" W DC  9   ? ? N1    W DC  9   ? ? 114.47 108.30 6.17  0.30 N 
14 1 "O4'" W DT  10  ? ? "C1'" W DT  10  ? ? N1    W DT  10  ? ? 110.32 108.30 2.02  0.30 N 
15 1 C4    W DT  10  ? ? C5    W DT  10  ? ? C7    W DT  10  ? ? 126.67 119.00 7.67  0.60 N 
16 1 C6    W DT  10  ? ? C5    W DT  10  ? ? C7    W DT  10  ? ? 116.51 122.90 -6.39 0.60 N 
17 1 "C3'" W DC  12  ? ? "O3'" W DC  12  ? ? P     W DT  13  ? ? 129.40 119.70 9.70  1.20 Y 
18 1 N3    W DT  13  ? ? C2    W DT  13  ? ? O2    W DT  13  ? ? 116.94 122.30 -5.36 0.60 N 
19 1 "O4'" W DG  14  ? ? "C1'" W DG  14  ? ? N9    W DG  14  ? ? 111.84 108.30 3.54  0.30 N 
20 1 N3    W DG  15  ? ? C4    W DG  15  ? ? C5    W DG  15  ? ? 125.24 128.60 -3.36 0.50 N 
21 1 C5    W DG  15  ? ? C6    W DG  15  ? ? O6    W DG  15  ? ? 124.72 128.60 -3.88 0.60 N 
22 1 "O4'" W DC  16  ? ? "C1'" W DC  16  ? ? N1    W DC  16  ? ? 111.77 108.30 3.47  0.30 N 
23 1 "O4'" W DC  17  ? ? "C1'" W DC  17  ? ? N1    W DC  17  ? ? 112.34 108.30 4.04  0.30 N 
24 1 "O4'" W DT  20  ? ? "C1'" W DT  20  ? ? N1    W DT  20  ? ? 111.37 108.30 3.07  0.30 N 
25 1 C4    W DT  20  ? ? C5    W DT  20  ? ? C7    W DT  20  ? ? 124.39 119.00 5.39  0.60 N 
26 1 C6    W DT  20  ? ? C5    W DT  20  ? ? C7    W DT  20  ? ? 116.78 122.90 -6.12 0.60 N 
27 1 "O4'" W DG  21  ? ? "C1'" W DG  21  ? ? N9    W DG  21  ? ? 114.12 108.30 5.82  0.30 N 
28 1 "O4'" C DC  24  ? ? "C1'" C DC  24  ? ? N1    C DC  24  ? ? 111.55 108.30 3.25  0.30 N 
29 1 "C3'" C DC  24  ? ? "O3'" C DC  24  ? ? P     C DA  25  ? ? 128.39 119.70 8.69  1.20 Y 
30 1 N1    C DA  25  ? ? C6    C DA  25  ? ? N6    C DA  25  ? ? 122.67 118.60 4.07  0.60 N 
31 1 C5    C DA  25  ? ? C6    C DA  25  ? ? N6    C DA  25  ? ? 118.31 123.70 -5.39 0.80 N 
32 1 "O4'" C DG  28  ? ? "C1'" C DG  28  ? ? "C2'" C DG  28  ? ? 100.42 105.90 -5.48 0.80 N 
33 1 "O4'" C DG  28  ? ? "C1'" C DG  28  ? ? N9    C DG  28  ? ? 112.28 108.30 3.98  0.30 N 
34 1 "C3'" C DA  34  ? ? "O3'" C DA  34  ? ? P     C DA  35  ? ? 127.40 119.70 7.70  1.20 Y 
35 1 "O4'" C DG  36  ? ? "C1'" C DG  36  ? ? N9    C DG  36  ? ? 102.71 108.00 -5.29 0.70 N 
36 1 "C3'" C DT  37  ? ? "C2'" C DT  37  ? ? "C1'" C DT  37  ? ? 96.90  102.40 -5.50 0.80 N 
37 1 "O4'" C DT  37  ? ? "C1'" C DT  37  ? ? N1    C DT  37  ? ? 115.06 108.30 6.76  0.30 N 
38 1 N3    C DT  37  ? ? C2    C DT  37  ? ? O2    C DT  37  ? ? 117.40 122.30 -4.90 0.60 N 
39 1 N3    C DT  37  ? ? C4    C DT  37  ? ? O4    C DT  37  ? ? 115.33 119.90 -4.57 0.60 N 
40 1 "O4'" C DC  39  ? ? "C1'" C DC  39  ? ? N1    C DC  39  ? ? 111.26 108.30 2.96  0.30 N 
41 1 "O4'" C DT  41  ? ? "C1'" C DT  41  ? ? N1    C DT  41  ? ? 115.33 108.30 7.03  0.30 N 
42 1 "O4'" C DG  43  ? ? "C1'" C DG  43  ? ? N9    C DG  43  ? ? 115.48 108.30 7.18  0.30 N 
43 1 NE    A ARG 204 ? ? CZ    A ARG 204 ? ? NH1   A ARG 204 ? ? 123.86 120.30 3.56  0.50 N 
44 1 NE    A ARG 204 ? ? CZ    A ARG 204 ? ? NH2   A ARG 204 ? ? 116.85 120.30 -3.45 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 138 ? ? -48.32  160.60  
2  1 TYR A 190 ? ? 37.14   62.91   
3  1 CYS A 216 ? ? -58.48  -149.42 
4  1 THR A 217 ? ? -175.10 -68.73  
5  1 PHE A 218 ? ? 112.51  -21.73  
6  1 ASP B 134 ? ? -46.03  -89.15  
7  1 ALA B 149 ? ? -31.83  135.53  
8  1 TYR B 190 ? ? 43.54   79.65   
9  1 ASN B 191 ? ? 73.78   -24.08  
10 1 HIS B 192 ? ? -129.53 -156.72 
11 1 THR B 217 ? ? 54.53   109.01  
12 1 PHE B 218 ? ? -71.02  40.99   
13 1 LYS B 228 ? ? -116.29 79.22   
14 1 ASP B 256 ? ? 106.45  -38.84  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   CYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    216 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    217 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            35.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 136 ? CG ? C LYS 8  CG 
2 1 Y 1 A LYS 136 ? CD ? C LYS 8  CD 
3 1 Y 1 A LYS 136 ? CE ? C LYS 8  CE 
4 1 Y 1 A LYS 136 ? NZ ? C LYS 8  NZ 
5 1 Y 1 B LYS 173 ? CG ? D LYS 45 CG 
6 1 Y 1 B LYS 173 ? CD ? D LYS 45 CD 
7 1 Y 1 B LYS 173 ? CE ? D LYS 45 CE 
8 1 Y 1 B LYS 173 ? NZ ? D LYS 45 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 129 ? C GLY 1   
2  1 Y 1 A SER 130 ? C SER 2   
3  1 Y 1 A LYS 131 ? C LYS 3   
4  1 Y 1 A PRO 259 ? C PRO 131 
5  1 Y 1 A GLU 260 ? C GLU 132 
6  1 Y 1 A SER 261 ? C SER 133 
7  1 Y 1 A SER 262 ? C SER 134 
8  1 Y 1 B GLY 129 ? D GLY 1   
9  1 Y 1 B SER 130 ? D SER 2   
10 1 Y 1 B LYS 131 ? D LYS 3   
11 1 Y 1 B VAL 132 ? D VAL 4   
12 1 Y 1 B PRO 259 ? D PRO 131 
13 1 Y 1 B GLU 260 ? D GLU 132 
14 1 Y 1 B SER 261 ? D SER 133 
15 1 Y 1 B SER 262 ? D SER 134 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2NTC 'double helix'        
2NTC 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 B DG 21 1_555 -0.348 -0.286 -0.215 6.197   -7.144  2.123  1  W_DC2:DG43_C  W 2  ? C 43 ? 19 1 
1 A DG 3  1_555 B DC 20 1_555 -0.080 -0.297 0.174  3.771   -12.588 -4.267 2  W_DG3:DC42_C  W 3  ? C 42 ? 19 1 
1 A DA 4  1_555 B DT 19 1_555 0.161  -0.170 -0.249 -5.760  -6.792  -4.198 3  W_DA4:DT41_C  W 4  ? C 41 ? 20 1 
1 A DG 5  1_555 B DC 18 1_555 -0.294 -0.307 0.046  9.578   -6.381  0.953  4  W_DG5:DC40_C  W 5  ? C 40 ? 19 1 
1 A DG 6  1_555 B DC 17 1_555 -0.538 -0.085 0.284  8.985   -12.371 4.136  5  W_DG6:DC39_C  W 6  ? C 39 ? 19 1 
1 A DC 7  1_555 B DG 16 1_555 0.291  -0.295 0.129  11.557  -13.887 0.959  6  W_DC7:DG38_C  W 7  ? C 38 ? 19 1 
1 A DA 8  1_555 B DT 15 1_555 0.568  -0.049 0.141  6.146   -5.088  -2.253 7  W_DA8:DT37_C  W 8  ? C 37 ? 20 1 
1 A DC 9  1_555 B DG 14 1_555 0.023  -0.255 0.236  9.594   -15.239 8.183  8  W_DC9:DG36_C  W 9  ? C 36 ? 22 1 
1 A DT 10 1_555 B DA 13 1_555 0.059  -0.490 -0.027 4.343   -18.469 -0.874 9  W_DT10:DA35_C W 10 ? C 35 ? 20 1 
1 A DT 11 1_555 B DA 12 1_555 -0.419 -0.346 0.040  3.136   -16.365 1.828  10 W_DT11:DA34_C W 11 ? C 34 ? 20 1 
1 A DC 12 1_555 B DG 11 1_555 -0.344 -0.230 0.064  -10.597 -13.918 -1.416 11 W_DC12:DG33_C W 12 ? C 33 ? 19 1 
1 A DT 13 1_555 B DA 10 1_555 -0.431 -0.441 0.496  -11.860 -11.528 0.795  12 W_DT13:DA32_C W 13 ? C 32 ? 20 1 
1 A DG 14 1_555 B DC 9  1_555 0.240  -0.280 -0.167 -1.413  -4.827  -0.776 13 W_DG14:DC31_C W 14 ? C 31 ? 19 1 
1 A DG 15 1_555 B DC 8  1_555 0.203  -0.129 -0.124 -7.701  -17.613 -1.006 14 W_DG15:DC30_C W 15 ? C 30 ? 19 1 
1 A DC 16 1_555 B DG 7  1_555 0.482  -0.081 0.115  -6.886  -15.761 2.792  15 W_DC16:DG29_C W 16 ? C 29 ? 19 1 
1 A DC 17 1_555 B DG 6  1_555 0.008  -0.160 0.092  -8.245  -4.647  -1.158 16 W_DC17:DG28_C W 17 ? C 28 ? 19 1 
1 A DT 18 1_555 B DA 5  1_555 -0.099 -0.084 -0.404 5.628   -2.397  -5.297 17 W_DT18:DA27_C W 18 ? C 27 ? 20 1 
1 A DC 19 1_555 B DG 4  1_555 0.406  -0.418 -0.351 -1.819  -11.816 -5.636 18 W_DC19:DG26_C W 19 ? C 26 ? 19 1 
1 A DT 20 1_555 B DA 3  1_555 -0.339 -0.296 -0.328 1.327   -13.491 3.869  19 W_DT20:DA25_C W 20 ? C 25 ? 20 1 
1 A DG 21 1_555 B DC 2  1_555 -0.437 -0.255 -0.498 -0.977  -12.656 5.743  20 W_DG21:DC24_C W 21 ? C 24 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 21 1_555 A DG 3  1_555 B DC 20 1_555 -0.875 0.714  3.459 -4.147 3.240  37.821 0.651  0.773  3.578 4.969  
6.360  38.172 1  WW_DC2DG3:DC42DG43_CC   W 2  ? C 43 ? W 3  ? C 42 ? 
1 A DG 3  1_555 B DC 20 1_555 A DA 4  1_555 B DT 19 1_555 0.032  -0.442 3.525 2.386  2.922  38.526 -1.052 0.266  3.479 4.416  
-3.606 38.704 2  WW_DG3DA4:DT41DC42_CC   W 3  ? C 42 ? W 4  ? C 41 ? 
1 A DA 4  1_555 B DT 19 1_555 A DG 5  1_555 B DC 18 1_555 0.879  -0.682 2.998 -3.077 5.635  21.661 -3.536 -3.225 2.590 14.586 
7.964  22.582 3  WW_DA4DG5:DC40DT41_CC   W 4  ? C 41 ? W 5  ? C 40 ? 
1 A DG 5  1_555 B DC 18 1_555 A DG 6  1_555 B DC 17 1_555 -0.836 -0.484 3.284 -7.108 -0.210 39.216 -0.685 0.383  3.381 -0.310 
10.486 39.831 4  WW_DG5DG6:DC39DC40_CC   W 5  ? C 40 ? W 6  ? C 39 ? 
1 A DG 6  1_555 B DC 17 1_555 A DC 7  1_555 B DG 16 1_555 0.494  -1.052 3.273 1.910  1.707  35.709 -1.957 -0.529 3.242 2.780  
-3.109 35.798 5  WW_DG6DC7:DG38DC39_CC   W 6  ? C 39 ? W 7  ? C 38 ? 
1 A DC 7  1_555 B DG 16 1_555 A DA 8  1_555 B DT 15 1_555 0.050  -0.393 3.435 1.651  0.677  35.977 -0.736 0.166  3.426 1.096  
-2.670 36.020 6  WW_DC7DA8:DT37DG38_CC   W 7  ? C 38 ? W 8  ? C 37 ? 
1 A DA 8  1_555 B DT 15 1_555 A DC 9  1_555 B DG 14 1_555 0.621  -0.327 3.338 -0.713 0.231  24.617 -0.838 -1.679 3.316 0.542  
1.672  24.628 7  WW_DA8DC9:DG36DT37_CC   W 8  ? C 37 ? W 9  ? C 36 ? 
1 A DC 9  1_555 B DG 14 1_555 A DT 10 1_555 B DA 13 1_555 -0.256 -0.340 3.341 3.747  4.024  38.221 -1.017 0.855  3.251 6.107  
-5.687 38.600 8  WW_DC9DT10:DA35DG36_CC  W 9  ? C 36 ? W 10 ? C 35 ? 
1 A DT 10 1_555 B DA 13 1_555 A DT 11 1_555 B DA 12 1_555 -0.079 -0.390 3.209 -0.610 0.124  31.976 -0.729 0.034  3.208 0.225  
1.107  31.982 9  WW_DT10DT11:DA34DA35_CC W 10 ? C 35 ? W 11 ? C 34 ? 
1 A DT 11 1_555 B DA 12 1_555 A DC 12 1_555 B DG 11 1_555 0.006  -0.599 3.516 -0.471 1.903  39.750 -1.117 -0.067 3.485 2.797  
0.692  39.797 10 WW_DT11DC12:DG33DA34_CC W 11 ? C 34 ? W 12 ? C 33 ? 
1 A DC 12 1_555 B DG 11 1_555 A DT 13 1_555 B DA 10 1_555 0.206  -0.241 3.338 -3.241 2.116  33.329 -0.770 -0.897 3.283 3.673  
5.627  33.547 11 WW_DC12DT13:DA32DG33_CC W 12 ? C 33 ? W 13 ? C 32 ? 
1 A DT 13 1_555 B DA 10 1_555 A DG 14 1_555 B DC 9  1_555 0.541  0.760  3.155 4.740  5.925  33.413 0.360  -0.174 3.282 10.144 
-8.115 34.240 12 WW_DT13DG14:DC31DA32_CC W 13 ? C 32 ? W 14 ? C 31 ? 
1 A DG 14 1_555 B DC 9  1_555 A DG 15 1_555 B DC 8  1_555 -0.330 -0.586 3.520 -1.050 4.724  34.472 -1.748 0.381  3.421 7.922  
1.762  34.800 13 WW_DG14DG15:DC30DC31_CC W 14 ? C 31 ? W 15 ? C 30 ? 
1 A DG 15 1_555 B DC 8  1_555 A DC 16 1_555 B DG 7  1_555 -0.199 -0.929 3.280 -2.109 1.127  30.816 -1.962 -0.035 3.251 2.117  
3.961  30.906 14 WW_DG15DC16:DG29DC30_CC W 15 ? C 30 ? W 16 ? C 29 ? 
1 A DC 16 1_555 B DG 7  1_555 A DC 17 1_555 B DG 6  1_555 0.893  -0.681 3.258 4.849  5.609  36.028 -1.843 -0.755 3.209 8.952  
-7.739 36.758 15 WW_DC16DC17:DG28DG29_CC W 16 ? C 29 ? W 17 ? C 28 ? 
1 A DC 17 1_555 B DG 6  1_555 A DT 18 1_555 B DA 5  1_555 -1.096 -0.626 3.036 4.516  3.310  26.355 -2.096 3.381  2.716 7.157  
-9.766 26.933 16 WW_DC17DT18:DA27DG28_CC W 17 ? C 28 ? W 18 ? C 27 ? 
1 A DT 18 1_555 B DA 5  1_555 A DC 19 1_555 B DG 4  1_555 0.061  -0.355 3.443 0.436  4.009  39.517 -1.011 -0.037 3.393 5.911  
-0.643 39.714 17 WW_DT18DC19:DG26DA27_CC W 18 ? C 27 ? W 19 ? C 26 ? 
1 A DC 19 1_555 B DG 4  1_555 A DT 20 1_555 B DA 3  1_555 0.876  0.410  3.159 3.440  9.609  31.227 -0.925 -0.961 3.217 17.282 
-6.187 32.813 18 WW_DC19DT20:DA25DG26_CC W 19 ? C 26 ? W 20 ? C 25 ? 
1 A DT 20 1_555 B DA 3  1_555 A DG 21 1_555 B DC 2  1_555 0.070  1.299  3.436 -0.074 14.160 29.360 -0.514 -0.139 3.662 26.111 
0.136  32.528 19 WW_DT20DG21:DC24DA25_CC W 20 ? C 25 ? W 21 ? C 24 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1  22 11 HOH HOH W . 
E 4 HOH 2  23 12 HOH HOH W . 
E 4 HOH 3  24 25 HOH HOH W . 
E 4 HOH 4  25 32 HOH HOH W . 
E 4 HOH 5  26 35 HOH HOH W . 
E 4 HOH 6  27 47 HOH HOH W . 
E 4 HOH 7  28 50 HOH HOH W . 
E 4 HOH 8  29 53 HOH HOH W . 
E 4 HOH 9  30 55 HOH HOH W . 
E 4 HOH 10 31 61 HOH HOH W . 
E 4 HOH 11 32 63 HOH HOH W . 
E 4 HOH 12 33 71 HOH HOH W . 
E 4 HOH 13 34 79 HOH HOH W . 
E 4 HOH 14 35 85 HOH HOH W . 
F 4 HOH 1  44 2  HOH HOH C . 
F 4 HOH 2  45 13 HOH HOH C . 
F 4 HOH 3  46 18 HOH HOH C . 
F 4 HOH 4  47 19 HOH HOH C . 
F 4 HOH 5  48 21 HOH HOH C . 
F 4 HOH 6  49 41 HOH HOH C . 
F 4 HOH 7  50 44 HOH HOH C . 
F 4 HOH 8  51 49 HOH HOH C . 
F 4 HOH 9  52 62 HOH HOH C . 
F 4 HOH 10 53 69 HOH HOH C . 
F 4 HOH 11 54 83 HOH HOH C . 
G 4 HOH 1  4  4  HOH HOH A . 
G 4 HOH 2  8  8  HOH HOH A . 
G 4 HOH 3  14 14 HOH HOH A . 
G 4 HOH 4  16 16 HOH HOH A . 
G 4 HOH 5  17 17 HOH HOH A . 
G 4 HOH 6  20 20 HOH HOH A . 
G 4 HOH 7  26 26 HOH HOH A . 
G 4 HOH 8  27 27 HOH HOH A . 
G 4 HOH 9  28 28 HOH HOH A . 
G 4 HOH 10 29 29 HOH HOH A . 
G 4 HOH 11 31 31 HOH HOH A . 
G 4 HOH 12 33 33 HOH HOH A . 
G 4 HOH 13 39 39 HOH HOH A . 
G 4 HOH 14 40 40 HOH HOH A . 
G 4 HOH 15 46 46 HOH HOH A . 
G 4 HOH 16 56 56 HOH HOH A . 
G 4 HOH 17 57 57 HOH HOH A . 
G 4 HOH 18 58 58 HOH HOH A . 
G 4 HOH 19 60 60 HOH HOH A . 
G 4 HOH 20 64 64 HOH HOH A . 
G 4 HOH 21 66 66 HOH HOH A . 
G 4 HOH 22 67 67 HOH HOH A . 
G 4 HOH 23 77 77 HOH HOH A . 
G 4 HOH 24 81 81 HOH HOH A . 
G 4 HOH 25 84 84 HOH HOH A . 
G 4 HOH 26 86 86 HOH HOH A . 
G 4 HOH 27 87 87 HOH HOH A . 
H 4 HOH 1  1  1  HOH HOH B . 
H 4 HOH 2  3  3  HOH HOH B . 
H 4 HOH 3  5  5  HOH HOH B . 
H 4 HOH 4  6  6  HOH HOH B . 
H 4 HOH 5  7  7  HOH HOH B . 
H 4 HOH 6  9  9  HOH HOH B . 
H 4 HOH 7  10 10 HOH HOH B . 
H 4 HOH 8  15 15 HOH HOH B . 
H 4 HOH 9  22 22 HOH HOH B . 
H 4 HOH 10 23 23 HOH HOH B . 
H 4 HOH 11 24 24 HOH HOH B . 
H 4 HOH 12 34 34 HOH HOH B . 
H 4 HOH 13 36 36 HOH HOH B . 
H 4 HOH 14 37 37 HOH HOH B . 
H 4 HOH 15 38 38 HOH HOH B . 
H 4 HOH 16 43 43 HOH HOH B . 
H 4 HOH 17 45 45 HOH HOH B . 
H 4 HOH 18 48 48 HOH HOH B . 
H 4 HOH 19 54 54 HOH HOH B . 
H 4 HOH 20 59 59 HOH HOH B . 
H 4 HOH 21 65 65 HOH HOH B . 
H 4 HOH 22 73 73 HOH HOH B . 
H 4 HOH 23 76 76 HOH HOH B . 
H 4 HOH 24 78 78 HOH HOH B . 
H 4 HOH 25 89 89 HOH HOH B . 
#