data_2NUE
# 
_entry.id   2NUE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NUE         
NDB   PR0239       
RCSB  RCSB040313   
WWPDB D_1000040313 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RC7 
;Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with ds-RNA (5'-GGCGCGCGCC-3')
;
unspecified 
PDB 2EZ6 'Crystal structure of RNase III mutant D44N from Aquifex aeolicus complexed with products at 2.05-Angstrom Resolution' 
unspecified 
PDB 1YZ9 
;Crystal structure of RNase III mutant E110Q from Aquifex aeolicus complexed with ds-RNA (5'-CGAACUUCGCG-3') at 2.1-Angstrom Resolution
;
unspecified 
PDB 1YYO 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-CGCGAAUUCGCG-3') at 2.5-Angstrom Resolution
;
unspecified 
PDB 1YYW 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-AAAUAUAUAUUU-3') at 2.8-Angstrom Resolution
;
unspecified 
PDB 2NUF . unspecified 
PDB 2NUG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NUE 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.H.'    1 
'Shaw, G.'     2 
'Tropea, J.E.' 3 
'Waugh, D.S.'  4 
'Court, D.L.'  5 
'Ji, X.'       6 
# 
_citation.id                        primary 
_citation.title                     'A stepwise model for double-stranded RNA processing by ribonuclease III.' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            67 
_citation.page_first                143 
_citation.page_last                 154 
_citation.year                      2007 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18047582 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2007.06032.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gan, J.'      1 
primary 'Shaw, G.'     2 
primary 'Tropea, J.E.' 3 
primary 'Waugh, D.S.'  4 
primary 'Court, D.L.'  5 
primary 'Ji, X.'       6 
# 
_cell.entry_id           2NUE 
_cell.length_a           101.596 
_cell.length_b           101.657 
_cell.length_c           67.082 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.69 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NUE 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 46-MER             14818.836 1  ?        ? ? ? 
2 polymer man 'Ribonuclease III' 26147.381 2  3.1.26.3 ? ? ? 
3 water   nat water              18.015    28 ?        ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'RNase III' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGGACAAGCGCAAGGUCAUUCGCAAGAGUGGCCUUGCGCUUGUCCC GGGACAAGCGCAAGGUCAUUCGCAAGAGUGGCCUUGCGCUUGUCCC C   ? 
2 'polypeptide(L)'   no no 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   G   n 
1 3   G   n 
1 4   A   n 
1 5   C   n 
1 6   A   n 
1 7   A   n 
1 8   G   n 
1 9   C   n 
1 10  G   n 
1 11  C   n 
1 12  A   n 
1 13  A   n 
1 14  G   n 
1 15  G   n 
1 16  U   n 
1 17  C   n 
1 18  A   n 
1 19  U   n 
1 20  U   n 
1 21  C   n 
1 22  G   n 
1 23  C   n 
1 24  A   n 
1 25  A   n 
1 26  G   n 
1 27  A   n 
1 28  G   n 
1 29  U   n 
1 30  G   n 
1 31  G   n 
1 32  C   n 
1 33  C   n 
1 34  U   n 
1 35  U   n 
1 36  G   n 
1 37  C   n 
1 38  G   n 
1 39  C   n 
1 40  U   n 
1 41  U   n 
1 42  G   n 
1 43  U   n 
1 44  C   n 
1 45  C   n 
1 46  C   n 
2 1   MET n 
2 2   LYS n 
2 3   MET n 
2 4   LEU n 
2 5   GLU n 
2 6   GLN n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  LYS n 
2 11  LEU n 
2 12  GLY n 
2 13  TYR n 
2 14  THR n 
2 15  PHE n 
2 16  LYS n 
2 17  ASP n 
2 18  LYS n 
2 19  SER n 
2 20  LEU n 
2 21  LEU n 
2 22  GLU n 
2 23  LYS n 
2 24  ALA n 
2 25  LEU n 
2 26  THR n 
2 27  HIS n 
2 28  VAL n 
2 29  SER n 
2 30  TYR n 
2 31  SER n 
2 32  LYS n 
2 33  LYS n 
2 34  GLU n 
2 35  HIS n 
2 36  TYR n 
2 37  GLU n 
2 38  THR n 
2 39  LEU n 
2 40  GLU n 
2 41  PHE n 
2 42  LEU n 
2 43  GLY n 
2 44  ASP n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  ASN n 
2 49  PHE n 
2 50  PHE n 
2 51  ILE n 
2 52  VAL n 
2 53  ASP n 
2 54  LEU n 
2 55  LEU n 
2 56  VAL n 
2 57  GLN n 
2 58  TYR n 
2 59  SER n 
2 60  PRO n 
2 61  ASN n 
2 62  LYS n 
2 63  ARG n 
2 64  GLU n 
2 65  GLY n 
2 66  PHE n 
2 67  LEU n 
2 68  SER n 
2 69  PRO n 
2 70  LEU n 
2 71  LYS n 
2 72  ALA n 
2 73  TYR n 
2 74  LEU n 
2 75  ILE n 
2 76  SER n 
2 77  GLU n 
2 78  GLU n 
2 79  PHE n 
2 80  PHE n 
2 81  ASN n 
2 82  LEU n 
2 83  LEU n 
2 84  ALA n 
2 85  GLN n 
2 86  LYS n 
2 87  LEU n 
2 88  GLU n 
2 89  LEU n 
2 90  HIS n 
2 91  LYS n 
2 92  PHE n 
2 93  ILE n 
2 94  ARG n 
2 95  ILE n 
2 96  LYS n 
2 97  ARG n 
2 98  GLY n 
2 99  LYS n 
2 100 ILE n 
2 101 ASN n 
2 102 GLU n 
2 103 THR n 
2 104 ILE n 
2 105 ILE n 
2 106 GLY n 
2 107 ASP n 
2 108 VAL n 
2 109 PHE n 
2 110 GLU n 
2 111 ALA n 
2 112 LEU n 
2 113 TRP n 
2 114 ALA n 
2 115 ALA n 
2 116 VAL n 
2 117 TYR n 
2 118 ILE n 
2 119 ASP n 
2 120 SER n 
2 121 GLY n 
2 122 ARG n 
2 123 ASP n 
2 124 ALA n 
2 125 ASN n 
2 126 PHE n 
2 127 THR n 
2 128 ARG n 
2 129 GLU n 
2 130 LEU n 
2 131 PHE n 
2 132 TYR n 
2 133 LYS n 
2 134 LEU n 
2 135 PHE n 
2 136 LYS n 
2 137 GLU n 
2 138 ASP n 
2 139 ILE n 
2 140 LEU n 
2 141 SER n 
2 142 ALA n 
2 143 ILE n 
2 144 LYS n 
2 145 GLU n 
2 146 GLY n 
2 147 ARG n 
2 148 VAL n 
2 149 LYS n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 LYS n 
2 154 THR n 
2 155 ILE n 
2 156 LEU n 
2 157 GLN n 
2 158 GLU n 
2 159 ILE n 
2 160 THR n 
2 161 GLN n 
2 162 LYS n 
2 163 ARG n 
2 164 TRP n 
2 165 LYS n 
2 166 GLU n 
2 167 ARG n 
2 168 PRO n 
2 169 GLU n 
2 170 TYR n 
2 171 ARG n 
2 172 LEU n 
2 173 ILE n 
2 174 SER n 
2 175 VAL n 
2 176 GLU n 
2 177 GLY n 
2 178 PRO n 
2 179 HIS n 
2 180 HIS n 
2 181 LYS n 
2 182 LYS n 
2 183 LYS n 
2 184 PHE n 
2 185 ILE n 
2 186 VAL n 
2 187 GLU n 
2 188 ALA n 
2 189 LYS n 
2 190 ILE n 
2 191 LYS n 
2 192 GLU n 
2 193 TYR n 
2 194 ARG n 
2 195 THR n 
2 196 LEU n 
2 197 GLY n 
2 198 GLU n 
2 199 GLY n 
2 200 LYS n 
2 201 SER n 
2 202 LYS n 
2 203 LYS n 
2 204 GLU n 
2 205 ALA n 
2 206 GLU n 
2 207 GLN n 
2 208 ARG n 
2 209 ALA n 
2 210 ALA n 
2 211 GLU n 
2 212 GLU n 
2 213 LEU n 
2 214 ILE n 
2 215 LYS n 
2 216 LEU n 
2 217 LEU n 
2 218 GLU n 
2 219 GLU n 
2 220 SER n 
2 221 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 rnc 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHPK1409 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RNC_AQUAE O67082 2 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
1 ? 
2 PDB 2NUE      2NUE   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2NUE A 1 ? 221 ? O67082 1 ? 221 ? 1 221 
2 1 2NUE B 1 ? 221 ? O67082 1 ? 221 ? 1 221 
3 2 2NUE C 1 ? 46  ? 2NUE   1 ? 46  ? 1 46  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2NUE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   50.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.2 M NaCl + 16% PEG3350 in 0.1 M Tris-Cl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 NaCl    ? ? ? 
1 2 1 PEG3350 ? ? ? 
1 3 1 Tris-Cl ? ? ? 
1 4 1 H2O     ? ? ? 
1 5 2 NaCl    ? ? ? 
1 6 2 PEG3350 ? ? ? 
1 7 2 H2O     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-01-18 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2NUE 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   13199 
_reflns.number_all                   13199 
_reflns.percent_possible_obs         89.1 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.3 
_reflns.B_iso_Wilson_estimate        72.4 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.00 
_reflns_shell.percent_possible_all   53.4 
_reflns_shell.Rmerge_I_obs           0.16 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NUE 
_refine.ls_number_reflns_obs                     13142 
_refine.ls_number_reflns_all                     13142 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               935262.42 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.11 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    89.1 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.238 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  669 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               98.4 
_refine.aniso_B[1][1]                            21.63 
_refine.aniso_B[2][2]                            -0.29 
_refine.aniso_B[3][3]                            -21.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            5.75 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.302101 
_refine.solvent_model_param_bsol                 35.1746 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1RC7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2NUE 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.34 
_refine_analyze.Luzzati_d_res_low_obs           30.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.36 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3677 
_refine_hist.pdbx_number_atoms_nucleic_acid   980 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             28 
_refine_hist.number_atoms_total               4685 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        29.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.004 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             0.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      16.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.86  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.04  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.85  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             5.52  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            8.18  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             1427 
_refine_ls_shell.R_factor_R_work                  0.347 
_refine_ls_shell.percent_reflns_obs               61.8 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            0.041 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             79 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
5 tris.par          tris.top    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NUE 
_struct.title                     
'Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA at 2.9-Angstrom Resolution' 
_struct.pdbx_descriptor           'Ribonuclease III(E.C.3.1.26.3)/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NUE 
_struct_keywords.pdbx_keywords   hydrolase/RNA 
_struct_keywords.text            'Ribonuclease III, dsRNA, RNA interference, endonucleolytic cleavage, hydrolase-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU B 5   ? GLY B 12  ? GLU A 5   GLY A 12  1 ? 8  
HELX_P HELX_P2  2  LYS B 18  ? ALA B 24  ? LYS A 18  ALA A 24  1 ? 7  
HELX_P HELX_P3  3  TYR B 36  ? VAL B 56  ? TYR A 36  VAL A 56  1 ? 21 
HELX_P HELX_P4  4  ARG B 63  ? ILE B 75  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER B 76  ? LYS B 86  ? SER A 76  LYS A 86  1 ? 11 
HELX_P HELX_P6  6  LEU B 87  ? PHE B 92  ? LEU A 87  PHE A 92  5 ? 6  
HELX_P HELX_P7  7  ASN B 101 ? SER B 120 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP B 123 ? GLY B 146 ? ASP A 123 GLY A 146 1 ? 24 
HELX_P HELX_P9  9  ASP B 151 ? LYS B 165 ? ASP A 151 LYS A 165 1 ? 15 
HELX_P HELX_P10 10 PRO B 178 ? LYS B 182 ? PRO A 178 LYS A 182 5 ? 5  
HELX_P HELX_P11 11 SER B 201 ? GLU B 218 ? SER A 201 GLU A 218 1 ? 18 
HELX_P HELX_P12 12 GLU C 5   ? GLY C 12  ? GLU B 5   GLY B 12  1 ? 8  
HELX_P HELX_P13 13 ASP C 17  ? ALA C 24  ? ASP B 17  ALA B 24  1 ? 8  
HELX_P HELX_P14 14 TYR C 36  ? TYR C 58  ? TYR B 36  TYR B 58  1 ? 23 
HELX_P HELX_P15 15 ARG C 63  ? ILE C 75  ? ARG B 63  ILE B 75  1 ? 13 
HELX_P HELX_P16 16 SER C 76  ? GLN C 85  ? SER B 76  GLN B 85  1 ? 10 
HELX_P HELX_P17 17 GLU C 88  ? ILE C 93  ? GLU B 88  ILE B 93  1 ? 6  
HELX_P HELX_P18 18 ASN C 101 ? SER C 120 ? ASN B 101 SER B 120 1 ? 20 
HELX_P HELX_P19 19 ASP C 123 ? LYS C 133 ? ASP B 123 LYS B 133 1 ? 11 
HELX_P HELX_P20 20 PHE C 135 ? GLY C 146 ? PHE B 135 GLY B 146 1 ? 12 
HELX_P HELX_P21 21 ASP C 151 ? LYS C 165 ? ASP B 151 LYS B 165 1 ? 15 
HELX_P HELX_P22 22 SER C 201 ? GLU C 218 ? SER B 201 GLU B 218 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A G 1  N1 ? ? ? 1_555 A C 46 N3 ? ? C G 1  C C 46 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog2  hydrog ? ? A G 1  N2 ? ? ? 1_555 A C 46 O2 ? ? C G 1  C C 46 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog3  hydrog ? ? A G 1  O6 ? ? ? 1_555 A C 46 N4 ? ? C G 1  C C 46 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog4  hydrog ? ? A G 2  N1 ? ? ? 1_555 A C 45 N3 ? ? C G 2  C C 45 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog5  hydrog ? ? A G 2  N2 ? ? ? 1_555 A C 45 O2 ? ? C G 2  C C 45 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog6  hydrog ? ? A G 2  O6 ? ? ? 1_555 A C 45 N4 ? ? C G 2  C C 45 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog7  hydrog ? ? A G 3  N1 ? ? ? 1_555 A C 44 N3 ? ? C G 3  C C 44 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog8  hydrog ? ? A G 3  N2 ? ? ? 1_555 A C 44 O2 ? ? C G 3  C C 44 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog9  hydrog ? ? A G 3  O6 ? ? ? 1_555 A C 44 N4 ? ? C G 3  C C 44 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog10 hydrog ? ? A A 4  N1 ? ? ? 1_555 A U 43 N3 ? ? C A 4  C U 43 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog11 hydrog ? ? A A 4  N6 ? ? ? 1_555 A U 43 O4 ? ? C A 4  C U 43 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog12 hydrog ? ? A C 5  N3 ? ? ? 1_555 A G 42 N1 ? ? C C 5  C G 42 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog13 hydrog ? ? A C 5  N4 ? ? ? 1_555 A G 42 O6 ? ? C C 5  C G 42 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog14 hydrog ? ? A C 5  O2 ? ? ? 1_555 A G 42 N2 ? ? C C 5  C G 42 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog15 hydrog ? ? A A 6  N1 ? ? ? 1_555 A U 41 N3 ? ? C A 6  C U 41 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog16 hydrog ? ? A A 6  N6 ? ? ? 1_555 A U 41 O4 ? ? C A 6  C U 41 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog17 hydrog ? ? A A 7  N1 ? ? ? 1_555 A U 40 N3 ? ? C A 7  C U 40 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog18 hydrog ? ? A A 7  N6 ? ? ? 1_555 A U 40 O4 ? ? C A 7  C U 40 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog19 hydrog ? ? A G 8  N1 ? ? ? 1_555 A C 39 N3 ? ? C G 8  C C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog20 hydrog ? ? A G 8  N2 ? ? ? 1_555 A C 39 O2 ? ? C G 8  C C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog21 hydrog ? ? A G 8  O6 ? ? ? 1_555 A C 39 N4 ? ? C G 8  C C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog22 hydrog ? ? A C 9  N3 ? ? ? 1_555 A G 38 N1 ? ? C C 9  C G 38 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog23 hydrog ? ? A C 9  N4 ? ? ? 1_555 A G 38 O6 ? ? C C 9  C G 38 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog24 hydrog ? ? A C 9  O2 ? ? ? 1_555 A G 38 N2 ? ? C C 9  C G 38 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog25 hydrog ? ? A G 10 N1 ? ? ? 1_555 A C 37 N3 ? ? C G 10 C C 37 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog26 hydrog ? ? A G 10 N2 ? ? ? 1_555 A C 37 O2 ? ? C G 10 C C 37 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog27 hydrog ? ? A G 10 O6 ? ? ? 1_555 A C 37 N4 ? ? C G 10 C C 37 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog28 hydrog ? ? A C 11 N3 ? ? ? 1_555 A G 36 N1 ? ? C C 11 C G 36 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog29 hydrog ? ? A C 11 N4 ? ? ? 1_555 A G 36 O6 ? ? C C 11 C G 36 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog30 hydrog ? ? A C 11 O2 ? ? ? 1_555 A G 36 N2 ? ? C C 11 C G 36 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog31 hydrog ? ? A A 12 N1 ? ? ? 1_555 A U 35 N3 ? ? C A 12 C U 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog32 hydrog ? ? A A 12 N6 ? ? ? 1_555 A U 35 O4 ? ? C A 12 C U 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog33 hydrog ? ? A A 13 N1 ? ? ? 1_555 A U 34 N3 ? ? C A 13 C U 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog34 hydrog ? ? A A 13 N6 ? ? ? 1_555 A U 34 O4 ? ? C A 13 C U 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog35 hydrog ? ? A G 14 N1 ? ? ? 1_555 A C 33 N3 ? ? C G 14 C C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog36 hydrog ? ? A G 14 N2 ? ? ? 1_555 A C 33 O2 ? ? C G 14 C C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog37 hydrog ? ? A G 14 O6 ? ? ? 1_555 A C 33 N4 ? ? C G 14 C C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog38 hydrog ? ? A G 15 N1 ? ? ? 1_555 A C 32 N3 ? ? C G 15 C C 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog39 hydrog ? ? A G 15 N2 ? ? ? 1_555 A C 32 O2 ? ? C G 15 C C 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog40 hydrog ? ? A G 15 O6 ? ? ? 1_555 A C 32 N4 ? ? C G 15 C C 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog41 hydrog ? ? A U 16 N3 ? ? ? 1_555 A G 31 O6 ? ? C U 16 C G 31 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog42 hydrog ? ? A U 16 O2 ? ? ? 1_555 A G 31 N1 ? ? C U 16 C G 31 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog43 hydrog ? ? A C 17 N3 ? ? ? 1_555 A G 30 N1 ? ? C C 17 C G 30 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog44 hydrog ? ? A C 17 N4 ? ? ? 1_555 A G 30 O6 ? ? C C 17 C G 30 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog45 hydrog ? ? A C 17 O2 ? ? ? 1_555 A G 30 N2 ? ? C C 17 C G 30 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog46 hydrog ? ? A A 18 N1 ? ? ? 1_555 A U 29 N3 ? ? C A 18 C U 29 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog47 hydrog ? ? A A 18 N6 ? ? ? 1_555 A U 29 O4 ? ? C A 18 C U 29 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog48 hydrog ? ? A U 19 N3 ? ? ? 1_555 A G 28 O6 ? ? C U 19 C G 28 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog49 hydrog ? ? A U 19 O2 ? ? ? 1_555 A G 28 N1 ? ? C U 19 C G 28 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog50 hydrog ? ? A U 20 N3 ? ? ? 1_555 A A 27 N1 ? ? C U 20 C A 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog51 hydrog ? ? A U 20 O4 ? ? ? 1_555 A A 27 N6 ? ? C U 20 C A 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog52 hydrog ? ? A C 21 N3 ? ? ? 1_555 A G 26 N1 ? ? C C 21 C G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog53 hydrog ? ? A C 21 N4 ? ? ? 1_555 A G 26 O6 ? ? C C 21 C G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog54 hydrog ? ? A C 21 O2 ? ? ? 1_555 A G 26 N2 ? ? C C 21 C G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog55 hydrog ? ? A G 22 N3 ? ? ? 1_555 A A 25 N6 ? ? C G 22 C A 25 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU B 169 ? GLU B 176 ? GLU A 169 GLU A 176 
A 2 LYS B 183 ? ILE B 190 ? LYS A 183 ILE A 190 
A 3 TYR B 193 ? GLY B 199 ? TYR A 193 GLY A 199 
B 1 GLU C 169 ? GLU C 176 ? GLU B 169 GLU B 176 
B 2 LYS C 183 ? ILE C 190 ? LYS B 183 ILE B 190 
B 3 TYR C 193 ? GLY C 199 ? TYR B 193 GLY B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE B 173 ? N ILE A 173 O ILE B 185 ? O ILE A 185 
A 2 3 N PHE B 184 ? N PHE A 184 O GLY B 199 ? O GLY A 199 
B 1 2 N ILE C 173 ? N ILE B 173 O ILE C 185 ? O ILE B 185 
B 2 3 N PHE C 184 ? N PHE B 184 O GLY C 199 ? O GLY B 199 
# 
_database_PDB_matrix.entry_id          2NUE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NUE 
_atom_sites.fract_transf_matrix[1][1]   0.009843 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002398 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009837 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015343 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . G   A 1 1   ? -0.405  38.841  30.756 1.00 119.30 ? 1   G   C "O5'" 1 
ATOM   2    C "C5'" . G   A 1 1   ? -0.914  39.031  32.079 1.00 109.92 ? 1   G   C "C5'" 1 
ATOM   3    C "C4'" . G   A 1 1   ? -1.704  40.312  32.202 1.00 106.11 ? 1   G   C "C4'" 1 
ATOM   4    O "O4'" . G   A 1 1   ? -2.998  40.143  31.562 1.00 105.70 ? 1   G   C "O4'" 1 
ATOM   5    C "C3'" . G   A 1 1   ? -2.046  40.724  33.623 1.00 106.51 ? 1   G   C "C3'" 1 
ATOM   6    O "O3'" . G   A 1 1   ? -0.969  41.440  34.212 1.00 108.14 ? 1   G   C "O3'" 1 
ATOM   7    C "C2'" . G   A 1 1   ? -3.276  41.596  33.413 1.00 100.29 ? 1   G   C "C2'" 1 
ATOM   8    O "O2'" . G   A 1 1   ? -2.961  42.893  32.952 1.00 100.50 ? 1   G   C "O2'" 1 
ATOM   9    C "C1'" . G   A 1 1   ? -3.995  40.825  32.307 1.00 95.24  ? 1   G   C "C1'" 1 
ATOM   10   N N9    . G   A 1 1   ? -4.921  39.831  32.838 1.00 83.81  ? 1   G   C N9    1 
ATOM   11   C C8    . G   A 1 1   ? -4.778  38.465  32.807 1.00 78.48  ? 1   G   C C8    1 
ATOM   12   N N7    . G   A 1 1   ? -5.767  37.833  33.378 1.00 74.12  ? 1   G   C N7    1 
ATOM   13   C C5    . G   A 1 1   ? -6.617  38.844  33.808 1.00 71.42  ? 1   G   C C5    1 
ATOM   14   C C6    . G   A 1 1   ? -7.855  38.772  34.496 1.00 71.75  ? 1   G   C C6    1 
ATOM   15   O O6    . G   A 1 1   ? -8.473  37.768  34.868 1.00 74.16  ? 1   G   C O6    1 
ATOM   16   N N1    . G   A 1 1   ? -8.375  40.038  34.747 1.00 68.34  ? 1   G   C N1    1 
ATOM   17   C C2    . G   A 1 1   ? -7.782  41.220  34.382 1.00 75.26  ? 1   G   C C2    1 
ATOM   18   N N2    . G   A 1 1   ? -8.434  42.340  34.730 1.00 69.77  ? 1   G   C N2    1 
ATOM   19   N N3    . G   A 1 1   ? -6.633  41.301  33.730 1.00 74.31  ? 1   G   C N3    1 
ATOM   20   C C4    . G   A 1 1   ? -6.109  40.083  33.480 1.00 75.21  ? 1   G   C C4    1 
ATOM   21   P P     . G   A 1 2   ? -0.703  41.319  35.791 1.00 103.34 ? 2   G   C P     1 
ATOM   22   O OP1   . G   A 1 2   ? 0.513   42.117  36.082 1.00 103.61 ? 2   G   C OP1   1 
ATOM   23   O OP2   . G   A 1 2   ? -0.749  39.884  36.170 1.00 96.71  ? 2   G   C OP2   1 
ATOM   24   O "O5'" . G   A 1 2   ? -1.955  42.056  36.442 1.00 97.38  ? 2   G   C "O5'" 1 
ATOM   25   C "C5'" . G   A 1 2   ? -2.128  43.459  36.287 1.00 89.03  ? 2   G   C "C5'" 1 
ATOM   26   C "C4'" . G   A 1 2   ? -3.343  43.924  37.047 1.00 89.13  ? 2   G   C "C4'" 1 
ATOM   27   O "O4'" . G   A 1 2   ? -4.548  43.410  36.420 1.00 88.82  ? 2   G   C "O4'" 1 
ATOM   28   C "C3'" . G   A 1 2   ? -3.448  43.427  38.476 1.00 93.00  ? 2   G   C "C3'" 1 
ATOM   29   O "O3'" . G   A 1 2   ? -2.630  44.188  39.357 1.00 101.47 ? 2   G   C "O3'" 1 
ATOM   30   C "C2'" . G   A 1 2   ? -4.937  43.597  38.756 1.00 88.00  ? 2   G   C "C2'" 1 
ATOM   31   O "O2'" . G   A 1 2   ? -5.292  44.932  39.051 1.00 81.60  ? 2   G   C "O2'" 1 
ATOM   32   C "C1'" . G   A 1 2   ? -5.544  43.188  37.411 1.00 82.75  ? 2   G   C "C1'" 1 
ATOM   33   N N9    . G   A 1 2   ? -5.930  41.780  37.367 1.00 72.32  ? 2   G   C N9    1 
ATOM   34   C C8    . G   A 1 2   ? -5.202  40.743  36.836 1.00 64.04  ? 2   G   C C8    1 
ATOM   35   N N7    . G   A 1 2   ? -5.789  39.585  36.968 1.00 65.38  ? 2   G   C N7    1 
ATOM   36   C C5    . G   A 1 2   ? -6.979  39.872  37.621 1.00 60.51  ? 2   G   C C5    1 
ATOM   37   C C6    . G   A 1 2   ? -8.025  39.009  38.048 1.00 67.33  ? 2   G   C C6    1 
ATOM   38   O O6    . G   A 1 2   ? -8.104  37.781  37.937 1.00 74.72  ? 2   G   C O6    1 
ATOM   39   N N1    . G   A 1 2   ? -9.052  39.715  38.667 1.00 63.57  ? 2   G   C N1    1 
ATOM   40   C C2    . G   A 1 2   ? -9.072  41.074  38.854 1.00 69.26  ? 2   G   C C2    1 
ATOM   41   N N2    . G   A 1 2   ? -10.162 41.562  39.467 1.00 61.78  ? 2   G   C N2    1 
ATOM   42   N N3    . G   A 1 2   ? -8.098  41.892  38.469 1.00 63.29  ? 2   G   C N3    1 
ATOM   43   C C4    . G   A 1 2   ? -7.090  41.225  37.865 1.00 60.03  ? 2   G   C C4    1 
ATOM   44   P P     . G   A 1 3   ? -2.335  43.635  40.838 1.00 106.04 ? 3   G   C P     1 
ATOM   45   O OP1   . G   A 1 3   ? -1.301  44.505  41.455 1.00 103.78 ? 3   G   C OP1   1 
ATOM   46   O OP2   . G   A 1 3   ? -2.113  42.167  40.766 1.00 101.53 ? 3   G   C OP2   1 
ATOM   47   O "O5'" . G   A 1 3   ? -3.711  43.885  41.595 1.00 96.38  ? 3   G   C "O5'" 1 
ATOM   48   C "C5'" . G   A 1 3   ? -4.093  43.085  42.700 1.00 90.54  ? 3   G   C "C5'" 1 
ATOM   49   C "C4'" . G   A 1 3   ? -5.594  43.041  42.800 1.00 88.92  ? 3   G   C "C4'" 1 
ATOM   50   O "O4'" . G   A 1 3   ? -6.138  42.394  41.622 1.00 86.06  ? 3   G   C "O4'" 1 
ATOM   51   C "C3'" . G   A 1 3   ? -6.129  42.222  43.957 1.00 94.21  ? 3   G   C "C3'" 1 
ATOM   52   O "O3'" . G   A 1 3   ? -6.144  43.024  45.132 1.00 98.06  ? 3   G   C "O3'" 1 
ATOM   53   C "C2'" . G   A 1 3   ? -7.531  41.861  43.476 1.00 89.62  ? 3   G   C "C2'" 1 
ATOM   54   O "O2'" . G   A 1 3   ? -8.457  42.913  43.667 1.00 88.49  ? 3   G   C "O2'" 1 
ATOM   55   C "C1'" . G   A 1 3   ? -7.295  41.654  41.977 1.00 84.10  ? 3   G   C "C1'" 1 
ATOM   56   N N9    . G   A 1 3   ? -7.092  40.264  41.575 1.00 78.94  ? 3   G   C N9    1 
ATOM   57   C C8    . G   A 1 3   ? -6.000  39.746  40.918 1.00 76.60  ? 3   G   C C8    1 
ATOM   58   N N7    . G   A 1 3   ? -6.108  38.469  40.670 1.00 67.72  ? 3   G   C N7    1 
ATOM   59   C C5    . G   A 1 3   ? -7.343  38.119  41.198 1.00 64.39  ? 3   G   C C5    1 
ATOM   60   C C6    . G   A 1 3   ? -8.008  36.865  41.223 1.00 67.99  ? 3   G   C C6    1 
ATOM   61   O O6    . G   A 1 3   ? -7.627  35.780  40.762 1.00 70.93  ? 3   G   C O6    1 
ATOM   62   N N1    . G   A 1 3   ? -9.243  36.953  41.862 1.00 57.39  ? 3   G   C N1    1 
ATOM   63   C C2    . G   A 1 3   ? -9.772  38.100  42.400 1.00 69.66  ? 3   G   C C2    1 
ATOM   64   N N2    . G   A 1 3   ? -10.976 37.981  42.983 1.00 57.84  ? 3   G   C N2    1 
ATOM   65   N N3    . G   A 1 3   ? -9.166  39.279  42.374 1.00 73.06  ? 3   G   C N3    1 
ATOM   66   C C4    . G   A 1 3   ? -7.963  39.214  41.764 1.00 69.76  ? 3   G   C C4    1 
ATOM   67   P P     . A   A 1 4   ? -5.716  42.380  46.537 1.00 96.78  ? 4   A   C P     1 
ATOM   68   O OP1   . A   A 1 4   ? -5.638  43.484  47.528 1.00 93.32  ? 4   A   C OP1   1 
ATOM   69   O OP2   . A   A 1 4   ? -4.530  41.512  46.308 1.00 86.34  ? 4   A   C OP2   1 
ATOM   70   O "O5'" . A   A 1 4   ? -6.968  41.474  46.918 1.00 87.07  ? 4   A   C "O5'" 1 
ATOM   71   C "C5'" . A   A 1 4   ? -8.175  42.073  47.370 1.00 87.91  ? 4   A   C "C5'" 1 
ATOM   72   C "C4'" . A   A 1 4   ? -9.147  41.014  47.821 1.00 90.42  ? 4   A   C "C4'" 1 
ATOM   73   O "O4'" . A   A 1 4   ? -9.718  40.340  46.669 1.00 85.75  ? 4   A   C "O4'" 1 
ATOM   74   C "C3'" . A   A 1 4   ? -8.541  39.884  48.631 1.00 92.93  ? 4   A   C "C3'" 1 
ATOM   75   O "O3'" . A   A 1 4   ? -8.332  40.239  49.990 1.00 95.53  ? 4   A   C "O3'" 1 
ATOM   76   C "C2'" . A   A 1 4   ? -9.588  38.795  48.459 1.00 86.19  ? 4   A   C "C2'" 1 
ATOM   77   O "O2'" . A   A 1 4   ? -10.725 39.014  49.268 1.00 88.83  ? 4   A   C "O2'" 1 
ATOM   78   C "C1'" . A   A 1 4   ? -9.946  38.973  46.982 1.00 77.09  ? 4   A   C "C1'" 1 
ATOM   79   N N9    . A   A 1 4   ? -9.094  38.164  46.112 1.00 65.87  ? 4   A   C N9    1 
ATOM   80   C C8    . A   A 1 4   ? -7.983  38.574  45.418 1.00 61.68  ? 4   A   C C8    1 
ATOM   81   N N7    . A   A 1 4   ? -7.401  37.615  44.737 1.00 57.89  ? 4   A   C N7    1 
ATOM   82   C C5    . A   A 1 4   ? -8.184  36.501  44.994 1.00 46.16  ? 4   A   C C5    1 
ATOM   83   C C6    . A   A 1 4   ? -8.095  35.170  44.566 1.00 59.26  ? 4   A   C C6    1 
ATOM   84   N N6    . A   A 1 4   ? -7.131  34.716  43.758 1.00 59.16  ? 4   A   C N6    1 
ATOM   85   N N1    . A   A 1 4   ? -9.038  34.305  45.002 1.00 58.98  ? 4   A   C N1    1 
ATOM   86   C C2    . A   A 1 4   ? -10.001 34.764  45.811 1.00 53.04  ? 4   A   C C2    1 
ATOM   87   N N3    . A   A 1 4   ? -10.191 35.993  46.282 1.00 53.72  ? 4   A   C N3    1 
ATOM   88   C C4    . A   A 1 4   ? -9.235  36.825  45.833 1.00 54.41  ? 4   A   C C4    1 
ATOM   89   P P     . C   A 1 5   ? -7.115  39.570  50.797 1.00 102.80 ? 5   C   C P     1 
ATOM   90   O OP1   . C   A 1 5   ? -7.008  40.263  52.105 1.00 103.70 ? 5   C   C OP1   1 
ATOM   91   O OP2   . C   A 1 5   ? -5.937  39.522  49.892 1.00 93.67  ? 5   C   C OP2   1 
ATOM   92   O "O5'" . C   A 1 5   ? -7.616  38.079  51.055 1.00 96.85  ? 5   C   C "O5'" 1 
ATOM   93   C "C5'" . C   A 1 5   ? -8.879  37.839  51.673 1.00 97.33  ? 5   C   C "C5'" 1 
ATOM   94   C "C4'" . C   A 1 5   ? -9.284  36.389  51.523 1.00 96.03  ? 5   C   C "C4'" 1 
ATOM   95   O "O4'" . C   A 1 5   ? -9.536  36.074  50.124 1.00 90.86  ? 5   C   C "O4'" 1 
ATOM   96   C "C3'" . C   A 1 5   ? -8.251  35.358  51.938 1.00 93.73  ? 5   C   C "C3'" 1 
ATOM   97   O "O3'" . C   A 1 5   ? -8.233  35.165  53.345 1.00 92.02  ? 5   C   C "O3'" 1 
ATOM   98   C "C2'" . C   A 1 5   ? -8.744  34.120  51.205 1.00 85.37  ? 5   C   C "C2'" 1 
ATOM   99   O "O2'" . C   A 1 5   ? -9.854  33.524  51.846 1.00 80.57  ? 5   C   C "O2'" 1 
ATOM   100  C "C1'" . C   A 1 5   ? -9.173  34.724  49.867 1.00 77.04  ? 5   C   C "C1'" 1 
ATOM   101  N N1    . C   A 1 5   ? -8.069  34.717  48.895 1.00 68.45  ? 5   C   C N1    1 
ATOM   102  C C2    . C   A 1 5   ? -7.785  33.534  48.204 1.00 67.08  ? 5   C   C C2    1 
ATOM   103  O O2    . C   A 1 5   ? -8.490  32.536  48.411 1.00 65.33  ? 5   C   C O2    1 
ATOM   104  N N3    . C   A 1 5   ? -6.751  33.510  47.330 1.00 63.25  ? 5   C   C N3    1 
ATOM   105  C C4    . C   A 1 5   ? -6.018  34.610  47.135 1.00 60.74  ? 5   C   C C4    1 
ATOM   106  N N4    . C   A 1 5   ? -4.999  34.540  46.273 1.00 60.82  ? 5   C   C N4    1 
ATOM   107  C C5    . C   A 1 5   ? -6.293  35.831  47.815 1.00 57.94  ? 5   C   C C5    1 
ATOM   108  C C6    . C   A 1 5   ? -7.320  35.840  48.677 1.00 66.30  ? 5   C   C C6    1 
ATOM   109  P P     . A   A 1 6   ? -6.856  34.765  54.066 1.00 91.98  ? 6   A   C P     1 
ATOM   110  O OP1   . A   A 1 6   ? -7.144  34.660  55.518 1.00 96.11  ? 6   A   C OP1   1 
ATOM   111  O OP2   . A   A 1 6   ? -5.790  35.681  53.588 1.00 88.74  ? 6   A   C OP2   1 
ATOM   112  O "O5'" . A   A 1 6   ? -6.534  33.308  53.505 1.00 87.01  ? 6   A   C "O5'" 1 
ATOM   113  C "C5'" . A   A 1 6   ? -7.417  32.224  53.760 1.00 79.91  ? 6   A   C "C5'" 1 
ATOM   114  C "C4'" . A   A 1 6   ? -7.018  31.012  52.951 1.00 77.72  ? 6   A   C "C4'" 1 
ATOM   115  O "O4'" . A   A 1 6   ? -7.117  31.298  51.532 1.00 77.23  ? 6   A   C "O4'" 1 
ATOM   116  C "C3'" . A   A 1 6   ? -5.587  30.529  53.094 1.00 77.56  ? 6   A   C "C3'" 1 
ATOM   117  O "O3'" . A   A 1 6   ? -5.421  29.759  54.272 1.00 80.95  ? 6   A   C "O3'" 1 
ATOM   118  C "C2'" . A   A 1 6   ? -5.435  29.651  51.859 1.00 71.01  ? 6   A   C "C2'" 1 
ATOM   119  O "O2'" . A   A 1 6   ? -6.034  28.383  52.034 1.00 70.55  ? 6   A   C "O2'" 1 
ATOM   120  C "C1'" . A   A 1 6   ? -6.232  30.444  50.823 1.00 68.80  ? 6   A   C "C1'" 1 
ATOM   121  N N9    . A   A 1 6   ? -5.377  31.253  49.958 1.00 58.07  ? 6   A   C N9    1 
ATOM   122  C C8    . A   A 1 6   ? -5.177  32.608  49.976 1.00 53.57  ? 6   A   C C8    1 
ATOM   123  N N7    . A   A 1 6   ? -4.334  33.028  49.064 1.00 54.77  ? 6   A   C N7    1 
ATOM   124  C C5    . A   A 1 6   ? -3.956  31.869  48.400 1.00 45.76  ? 6   A   C C5    1 
ATOM   125  C C6    . A   A 1 6   ? -3.078  31.636  47.330 1.00 49.50  ? 6   A   C C6    1 
ATOM   126  N N6    . A   A 1 6   ? -2.394  32.598  46.715 1.00 60.37  ? 6   A   C N6    1 
ATOM   127  N N1    . A   A 1 6   ? -2.925  30.363  46.908 1.00 49.85  ? 6   A   C N1    1 
ATOM   128  C C2    . A   A 1 6   ? -3.612  29.398  47.529 1.00 55.67  ? 6   A   C C2    1 
ATOM   129  N N3    . A   A 1 6   ? -4.464  29.492  48.547 1.00 51.79  ? 6   A   C N3    1 
ATOM   130  C C4    . A   A 1 6   ? -4.593  30.770  48.939 1.00 50.16  ? 6   A   C C4    1 
ATOM   131  P P     . A   A 1 7   ? -3.942  29.481  54.833 1.00 83.31  ? 7   A   C P     1 
ATOM   132  O OP1   . A   A 1 7   ? -4.108  28.843  56.165 1.00 73.91  ? 7   A   C OP1   1 
ATOM   133  O OP2   . A   A 1 7   ? -3.159  30.739  54.704 1.00 69.08  ? 7   A   C OP2   1 
ATOM   134  O "O5'" . A   A 1 7   ? -3.325  28.413  53.822 1.00 73.83  ? 7   A   C "O5'" 1 
ATOM   135  C "C5'" . A   A 1 7   ? -3.873  27.102  53.714 1.00 63.50  ? 7   A   C "C5'" 1 
ATOM   136  C "C4'" . A   A 1 7   ? -3.142  26.311  52.654 1.00 64.89  ? 7   A   C "C4'" 1 
ATOM   137  O "O4'" . A   A 1 7   ? -3.336  26.926  51.352 1.00 63.05  ? 7   A   C "O4'" 1 
ATOM   138  C "C3'" . A   A 1 7   ? -1.634  26.272  52.798 1.00 77.48  ? 7   A   C "C3'" 1 
ATOM   139  O "O3'" . A   A 1 7   ? -1.234  25.305  53.759 1.00 77.09  ? 7   A   C "O3'" 1 
ATOM   140  C "C2'" . A   A 1 7   ? -1.191  25.908  51.386 1.00 71.80  ? 7   A   C "C2'" 1 
ATOM   141  O "O2'" . A   A 1 7   ? -1.337  24.531  51.109 1.00 80.03  ? 7   A   C "O2'" 1 
ATOM   142  C "C1'" . A   A 1 7   ? -2.190  26.704  50.544 1.00 66.09  ? 7   A   C "C1'" 1 
ATOM   143  N N9    . A   A 1 7   ? -1.668  27.999  50.109 1.00 66.19  ? 7   A   C N9    1 
ATOM   144  C C8    . A   A 1 7   ? -1.896  29.233  50.667 1.00 71.90  ? 7   A   C C8    1 
ATOM   145  N N7    . A   A 1 7   ? -1.275  30.214  50.055 1.00 68.15  ? 7   A   C N7    1 
ATOM   146  C C5    . A   A 1 7   ? -0.594  29.585  49.022 1.00 55.29  ? 7   A   C C5    1 
ATOM   147  C C6    . A   A 1 7   ? 0.249   30.073  48.010 1.00 57.04  ? 7   A   C C6    1 
ATOM   148  N N6    . A   A 1 7   ? 0.564   31.359  47.870 1.00 58.59  ? 7   A   C N6    1 
ATOM   149  N N1    . A   A 1 7   ? 0.765   29.182  47.135 1.00 55.56  ? 7   A   C N1    1 
ATOM   150  C C2    . A   A 1 7   ? 0.449   27.891  47.277 1.00 61.13  ? 7   A   C C2    1 
ATOM   151  N N3    . A   A 1 7   ? -0.333  27.309  48.188 1.00 70.13  ? 7   A   C N3    1 
ATOM   152  C C4    . A   A 1 7   ? -0.829  28.222  49.041 1.00 63.13  ? 7   A   C C4    1 
ATOM   153  P P     . G   A 1 8   ? 0.164   25.486  54.525 1.00 74.43  ? 8   G   C P     1 
ATOM   154  O OP1   . G   A 1 8   ? 0.192   24.482  55.618 1.00 70.14  ? 8   G   C OP1   1 
ATOM   155  O OP2   . G   A 1 8   ? 0.343   26.922  54.840 1.00 69.53  ? 8   G   C OP2   1 
ATOM   156  O "O5'" . G   A 1 8   ? 1.252   25.085  53.436 1.00 66.60  ? 8   G   C "O5'" 1 
ATOM   157  C "C5'" . G   A 1 8   ? 1.294   23.766  52.907 1.00 64.53  ? 8   G   C "C5'" 1 
ATOM   158  C "C4'" . G   A 1 8   ? 2.270   23.694  51.761 1.00 67.17  ? 8   G   C "C4'" 1 
ATOM   159  O "O4'" . G   A 1 8   ? 1.791   24.512  50.660 1.00 71.80  ? 8   G   C "O4'" 1 
ATOM   160  C "C3'" . G   A 1 8   ? 3.643   24.267  52.052 1.00 71.52  ? 8   G   C "C3'" 1 
ATOM   161  O "O3'" . G   A 1 8   ? 4.464   23.345  52.750 1.00 77.72  ? 8   G   C "O3'" 1 
ATOM   162  C "C2'" . G   A 1 8   ? 4.165   24.559  50.655 1.00 64.29  ? 8   G   C "C2'" 1 
ATOM   163  O "O2'" . G   A 1 8   ? 4.639   23.401  50.001 1.00 66.97  ? 8   G   C "O2'" 1 
ATOM   164  C "C1'" . G   A 1 8   ? 2.899   25.070  49.967 1.00 68.57  ? 8   G   C "C1'" 1 
ATOM   165  N N9    . G   A 1 8   ? 2.797   26.525  50.025 1.00 65.02  ? 8   G   C N9    1 
ATOM   166  C C8    . G   A 1 8   ? 2.099   27.282  50.938 1.00 62.95  ? 8   G   C C8    1 
ATOM   167  N N7    . G   A 1 8   ? 2.220   28.566  50.734 1.00 54.66  ? 8   G   C N7    1 
ATOM   168  C C5    . G   A 1 8   ? 3.042   28.662  49.619 1.00 48.39  ? 8   G   C C5    1 
ATOM   169  C C6    . G   A 1 8   ? 3.527   29.801  48.930 1.00 53.56  ? 8   G   C C6    1 
ATOM   170  O O6    . G   A 1 8   ? 3.319   30.993  49.174 1.00 61.37  ? 8   G   C O6    1 
ATOM   171  N N1    . G   A 1 8   ? 4.331   29.445  47.854 1.00 49.22  ? 8   G   C N1    1 
ATOM   172  C C2    . G   A 1 8   ? 4.627   28.157  47.484 1.00 60.09  ? 8   G   C C2    1 
ATOM   173  N N2    . G   A 1 8   ? 5.417   28.015  46.408 1.00 59.98  ? 8   G   C N2    1 
ATOM   174  N N3    . G   A 1 8   ? 4.183   27.086  48.119 1.00 54.66  ? 8   G   C N3    1 
ATOM   175  C C4    . G   A 1 8   ? 3.403   27.411  49.169 1.00 53.06  ? 8   G   C C4    1 
ATOM   176  P P     . C   A 1 9   ? 5.578   23.897  53.767 1.00 81.01  ? 9   C   C P     1 
ATOM   177  O OP1   . C   A 1 9   ? 6.126   22.725  54.492 1.00 77.24  ? 9   C   C OP1   1 
ATOM   178  O OP2   . C   A 1 9   ? 4.984   25.023  54.531 1.00 72.94  ? 9   C   C OP2   1 
ATOM   179  O "O5'" . C   A 1 9   ? 6.715   24.470  52.809 1.00 63.78  ? 9   C   C "O5'" 1 
ATOM   180  C "C5'" . C   A 1 9   ? 7.381   23.609  51.900 1.00 60.29  ? 9   C   C "C5'" 1 
ATOM   181  C "C4'" . C   A 1 9   ? 8.066   24.403  50.816 1.00 66.05  ? 9   C   C "C4'" 1 
ATOM   182  O "O4'" . C   A 1 9   ? 7.086   25.176  50.073 1.00 75.62  ? 9   C   C "O4'" 1 
ATOM   183  C "C3'" . C   A 1 9   ? 9.056   25.457  51.269 1.00 75.44  ? 9   C   C "C3'" 1 
ATOM   184  O "O3'" . C   A 1 9   ? 10.299  24.877  51.635 1.00 86.49  ? 9   C   C "O3'" 1 
ATOM   185  C "C2'" . C   A 1 9   ? 9.153   26.315  50.015 1.00 69.05  ? 9   C   C "C2'" 1 
ATOM   186  O "O2'" . C   A 1 9   ? 9.882   25.687  48.979 1.00 62.51  ? 9   C   C "O2'" 1 
ATOM   187  C "C1'" . C   A 1 9   ? 7.685   26.376  49.604 1.00 62.68  ? 9   C   C "C1'" 1 
ATOM   188  N N1    . C   A 1 9   ? 6.996   27.511  50.231 1.00 51.52  ? 9   C   C N1    1 
ATOM   189  C C2    . C   A 1 9   ? 7.198   28.786  49.706 1.00 52.62  ? 9   C   C C2    1 
ATOM   190  O O2    . C   A 1 9   ? 7.945   28.914  48.721 1.00 47.27  ? 9   C   C O2    1 
ATOM   191  N N3    . C   A 1 9   ? 6.580   29.844  50.283 1.00 39.49  ? 9   C   C N3    1 
ATOM   192  C C4    . C   A 1 9   ? 5.793   29.657  51.347 1.00 42.88  ? 9   C   C C4    1 
ATOM   193  N N4    . C   A 1 9   ? 5.218   30.726  51.896 1.00 47.70  ? 9   C   C N4    1 
ATOM   194  C C5    . C   A 1 9   ? 5.565   28.364  51.897 1.00 43.54  ? 9   C   C C5    1 
ATOM   195  C C6    . C   A 1 9   ? 6.179   27.329  51.312 1.00 50.99  ? 9   C   C C6    1 
ATOM   196  P P     . G   A 1 10  ? 11.140  25.511  52.846 1.00 86.70  ? 10  G   C P     1 
ATOM   197  O OP1   . G   A 1 10  ? 12.231  24.552  53.148 1.00 85.03  ? 10  G   C OP1   1 
ATOM   198  O OP2   . G   A 1 10  ? 10.198  25.914  53.920 1.00 69.13  ? 10  G   C OP2   1 
ATOM   199  O "O5'" . G   A 1 10  ? 11.779  26.827  52.212 1.00 82.00  ? 10  G   C "O5'" 1 
ATOM   200  C "C5'" . G   A 1 10  ? 12.605  26.737  51.055 1.00 82.02  ? 10  G   C "C5'" 1 
ATOM   201  C "C4'" . G   A 1 10  ? 12.844  28.106  50.459 1.00 82.73  ? 10  G   C "C4'" 1 
ATOM   202  O "O4'" . G   A 1 10  ? 11.578  28.694  50.057 1.00 79.70  ? 10  G   C "O4'" 1 
ATOM   203  C "C3'" . G   A 1 10  ? 13.434  29.158  51.380 1.00 88.01  ? 10  G   C "C3'" 1 
ATOM   204  O "O3'" . G   A 1 10  ? 14.842  29.002  51.525 1.00 90.45  ? 10  G   C "O3'" 1 
ATOM   205  C "C2'" . G   A 1 10  ? 13.073  30.440  50.641 1.00 79.28  ? 10  G   C "C2'" 1 
ATOM   206  O "O2'" . G   A 1 10  ? 13.900  30.667  49.518 1.00 76.46  ? 10  G   C "O2'" 1 
ATOM   207  C "C1'" . G   A 1 10  ? 11.664  30.109  50.150 1.00 73.17  ? 10  G   C "C1'" 1 
ATOM   208  N N9    . G   A 1 10  ? 10.619  30.586  51.050 1.00 61.72  ? 10  G   C N9    1 
ATOM   209  C C8    . G   A 1 10  ? 9.846   29.837  51.907 1.00 57.99  ? 10  G   C C8    1 
ATOM   210  N N7    . G   A 1 10  ? 8.981   30.554  52.577 1.00 42.80  ? 10  G   C N7    1 
ATOM   211  C C5    . G   A 1 10  ? 9.197   31.853  52.136 1.00 42.25  ? 10  G   C C5    1 
ATOM   212  C C6    . G   A 1 10  ? 8.551   33.064  52.496 1.00 44.86  ? 10  G   C C6    1 
ATOM   213  O O6    . G   A 1 10  ? 7.628   33.230  53.302 1.00 44.40  ? 10  G   C O6    1 
ATOM   214  N N1    . G   A 1 10  ? 9.082   34.155  51.805 1.00 27.42  ? 10  G   C N1    1 
ATOM   215  C C2    . G   A 1 10  ? 10.104  34.085  50.884 1.00 44.98  ? 10  G   C C2    1 
ATOM   216  N N2    . G   A 1 10  ? 10.485  35.244  50.323 1.00 35.86  ? 10  G   C N2    1 
ATOM   217  N N3    . G   A 1 10  ? 10.709  32.958  50.538 1.00 50.56  ? 10  G   C N3    1 
ATOM   218  C C4    . G   A 1 10  ? 10.209  31.891  51.198 1.00 52.83  ? 10  G   C C4    1 
ATOM   219  P P     . C   A 1 11  ? 15.545  29.403  52.916 1.00 89.47  ? 11  C   C P     1 
ATOM   220  O OP1   . C   A 1 11  ? 16.979  29.040  52.787 1.00 85.56  ? 11  C   C OP1   1 
ATOM   221  O OP2   . C   A 1 11  ? 14.749  28.851  54.044 1.00 74.10  ? 11  C   C OP2   1 
ATOM   222  O "O5'" . C   A 1 11  ? 15.443  30.992  52.940 1.00 75.24  ? 11  C   C "O5'" 1 
ATOM   223  C "C5'" . C   A 1 11  ? 16.212  31.771  52.031 1.00 80.47  ? 11  C   C "C5'" 1 
ATOM   224  C "C4'" . C   A 1 11  ? 15.949  33.243  52.238 1.00 81.06  ? 11  C   C "C4'" 1 
ATOM   225  O "O4'" . C   A 1 11  ? 14.588  33.563  51.844 1.00 79.13  ? 11  C   C "O4'" 1 
ATOM   226  C "C3'" . C   A 1 11  ? 16.033  33.747  53.668 1.00 85.75  ? 11  C   C "C3'" 1 
ATOM   227  O "O3'" . C   A 1 11  ? 17.378  33.964  54.084 1.00 86.97  ? 11  C   C "O3'" 1 
ATOM   228  C "C2'" . C   A 1 11  ? 15.245  35.046  53.575 1.00 80.31  ? 11  C   C "C2'" 1 
ATOM   229  O "O2'" . C   A 1 11  ? 16.003  36.096  53.008 1.00 76.93  ? 11  C   C "O2'" 1 
ATOM   230  C "C1'" . C   A 1 11  ? 14.106  34.639  52.634 1.00 68.51  ? 11  C   C "C1'" 1 
ATOM   231  N N1    . C   A 1 11  ? 12.928  34.178  53.385 1.00 58.94  ? 11  C   C N1    1 
ATOM   232  C C2    . C   A 1 11  ? 11.996  35.127  53.814 1.00 61.96  ? 11  C   C C2    1 
ATOM   233  O O2    . C   A 1 11  ? 12.152  36.310  53.481 1.00 67.94  ? 11  C   C O2    1 
ATOM   234  N N3    . C   A 1 11  ? 10.948  34.731  54.572 1.00 57.21  ? 11  C   C N3    1 
ATOM   235  C C4    . C   A 1 11  ? 10.805  33.442  54.889 1.00 54.44  ? 11  C   C C4    1 
ATOM   236  N N4    . C   A 1 11  ? 9.775   33.102  55.667 1.00 51.81  ? 11  C   C N4    1 
ATOM   237  C C5    . C   A 1 11  ? 11.716  32.446  54.429 1.00 43.85  ? 11  C   C C5    1 
ATOM   238  C C6    . C   A 1 11  ? 12.754  32.855  53.685 1.00 54.59  ? 11  C   C C6    1 
ATOM   239  P P     . A   A 1 12  ? 17.753  33.858  55.647 1.00 99.61  ? 12  A   C P     1 
ATOM   240  O OP1   . A   A 1 12  ? 19.211  34.118  55.750 1.00 102.06 ? 12  A   C OP1   1 
ATOM   241  O OP2   . A   A 1 12  ? 17.192  32.601  56.207 1.00 85.47  ? 12  A   C OP2   1 
ATOM   242  O "O5'" . A   A 1 12  ? 16.979  35.085  56.315 1.00 99.26  ? 12  A   C "O5'" 1 
ATOM   243  C "C5'" . A   A 1 12  ? 17.317  36.425  55.967 1.00 95.54  ? 12  A   C "C5'" 1 
ATOM   244  C "C4'" . A   A 1 12  ? 16.279  37.401  56.481 1.00 87.36  ? 12  A   C "C4'" 1 
ATOM   245  O "O4'" . A   A 1 12  ? 14.975  37.098  55.914 1.00 84.19  ? 12  A   C "O4'" 1 
ATOM   246  C "C3'" . A   A 1 12  ? 16.002  37.434  57.973 1.00 83.13  ? 12  A   C "C3'" 1 
ATOM   247  O "O3'" . A   A 1 12  ? 17.030  38.145  58.664 1.00 82.76  ? 12  A   C "O3'" 1 
ATOM   248  C "C2'" . A   A 1 12  ? 14.669  38.182  58.001 1.00 82.84  ? 12  A   C "C2'" 1 
ATOM   249  O "O2'" . A   A 1 12  ? 14.813  39.575  57.804 1.00 77.04  ? 12  A   C "O2'" 1 
ATOM   250  C "C1'" . A   A 1 12  ? 13.961  37.591  56.778 1.00 72.87  ? 12  A   C "C1'" 1 
ATOM   251  N N9    . A   A 1 12  ? 13.076  36.488  57.150 1.00 63.95  ? 12  A   C N9    1 
ATOM   252  C C8    . A   A 1 12  ? 13.318  35.140  57.062 1.00 63.49  ? 12  A   C C8    1 
ATOM   253  N N7    . A   A 1 12  ? 12.359  34.398  57.566 1.00 57.76  ? 12  A   C N7    1 
ATOM   254  C C5    . A   A 1 12  ? 11.415  35.319  57.995 1.00 34.82  ? 12  A   C C5    1 
ATOM   255  C C6    . A   A 1 12  ? 10.184  35.170  58.637 1.00 37.63  ? 12  A   C C6    1 
ATOM   256  N N6    . A   A 1 12  ? 9.675   33.987  58.977 1.00 52.92  ? 12  A   C N6    1 
ATOM   257  N N1    . A   A 1 12  ? 9.482   36.290  58.930 1.00 33.81  ? 12  A   C N1    1 
ATOM   258  C C2    . A   A 1 12  ? 9.999   37.472  58.591 1.00 31.61  ? 12  A   C C2    1 
ATOM   259  N N3    . A   A 1 12  ? 11.154  37.742  57.986 1.00 34.42  ? 12  A   C N3    1 
ATOM   260  C C4    . A   A 1 12  ? 11.827  36.608  57.718 1.00 46.40  ? 12  A   C C4    1 
ATOM   261  P P     . A   A 1 13  ? 17.206  37.969  60.259 1.00 77.72  ? 13  A   C P     1 
ATOM   262  O OP1   . A   A 1 13  ? 18.431  38.726  60.618 1.00 74.15  ? 13  A   C OP1   1 
ATOM   263  O OP2   . A   A 1 13  ? 17.088  36.538  60.639 1.00 73.65  ? 13  A   C OP2   1 
ATOM   264  O "O5'" . A   A 1 13  ? 15.964  38.746  60.879 1.00 65.39  ? 13  A   C "O5'" 1 
ATOM   265  C "C5'" . A   A 1 13  ? 15.828  40.149  60.696 1.00 65.71  ? 13  A   C "C5'" 1 
ATOM   266  C "C4'" . A   A 1 13  ? 14.522  40.622  61.272 1.00 65.38  ? 13  A   C "C4'" 1 
ATOM   267  O "O4'" . A   A 1 13  ? 13.425  40.025  60.531 1.00 64.66  ? 13  A   C "O4'" 1 
ATOM   268  C "C3'" . A   A 1 13  ? 14.262  40.181  62.699 1.00 75.10  ? 13  A   C "C3'" 1 
ATOM   269  O "O3'" . A   A 1 13  ? 14.934  41.015  63.631 1.00 70.03  ? 13  A   C "O3'" 1 
ATOM   270  C "C2'" . A   A 1 13  ? 12.747  40.296  62.789 1.00 71.90  ? 13  A   C "C2'" 1 
ATOM   271  O "O2'" . A   A 1 13  ? 12.304  41.627  62.948 1.00 80.25  ? 13  A   C "O2'" 1 
ATOM   272  C "C1'" . A   A 1 13  ? 12.334  39.790  61.407 1.00 68.34  ? 13  A   C "C1'" 1 
ATOM   273  N N9    . A   A 1 13  ? 12.036  38.359  61.408 1.00 64.84  ? 13  A   C N9    1 
ATOM   274  C C8    . A   A 1 13  ? 12.805  37.317  60.947 1.00 60.60  ? 13  A   C C8    1 
ATOM   275  N N7    . A   A 1 13  ? 12.244  36.141  61.102 1.00 61.96  ? 13  A   C N7    1 
ATOM   276  C C5    . A   A 1 13  ? 11.024  36.430  61.703 1.00 49.81  ? 13  A   C C5    1 
ATOM   277  C C6    . A   A 1 13  ? 9.957   35.617  62.124 1.00 48.10  ? 13  A   C C6    1 
ATOM   278  N N6    . A   A 1 13  ? 9.933   34.294  61.977 1.00 54.77  ? 13  A   C N6    1 
ATOM   279  N N1    . A   A 1 13  ? 8.896   36.219  62.700 1.00 51.83  ? 13  A   C N1    1 
ATOM   280  C C2    . A   A 1 13  ? 8.905   37.549  62.822 1.00 57.71  ? 13  A   C C2    1 
ATOM   281  N N3    . A   A 1 13  ? 9.839   38.423  62.452 1.00 58.39  ? 13  A   C N3    1 
ATOM   282  C C4    . A   A 1 13  ? 10.885  37.790  61.897 1.00 51.35  ? 13  A   C C4    1 
ATOM   283  P P     . G   A 1 14  ? 15.411  40.403  65.037 1.00 71.24  ? 14  G   C P     1 
ATOM   284  O OP1   . G   A 1 14  ? 16.409  41.352  65.595 1.00 75.51  ? 14  G   C OP1   1 
ATOM   285  O OP2   . G   A 1 14  ? 15.778  38.979  64.848 1.00 66.57  ? 14  G   C OP2   1 
ATOM   286  O "O5'" . G   A 1 14  ? 14.095  40.438  65.932 1.00 58.20  ? 14  G   C "O5'" 1 
ATOM   287  C "C5'" . G   A 1 14  ? 13.411  41.661  66.162 1.00 59.84  ? 14  G   C "C5'" 1 
ATOM   288  C "C4'" . G   A 1 14  ? 12.051  41.392  66.748 1.00 59.29  ? 14  G   C "C4'" 1 
ATOM   289  O "O4'" . G   A 1 14  ? 11.218  40.721  65.766 1.00 60.35  ? 14  G   C "O4'" 1 
ATOM   290  C "C3'" . G   A 1 14  ? 12.036  40.450  67.936 1.00 67.30  ? 14  G   C "C3'" 1 
ATOM   291  O "O3'" . G   A 1 14  ? 12.372  41.131  69.138 1.00 78.45  ? 14  G   C "O3'" 1 
ATOM   292  C "C2'" . G   A 1 14  ? 10.594  39.964  67.921 1.00 60.35  ? 14  G   C "C2'" 1 
ATOM   293  O "O2'" . G   A 1 14  ? 9.693   40.923  68.437 1.00 56.85  ? 14  G   C "O2'" 1 
ATOM   294  C "C1'" . G   A 1 14  ? 10.363  39.796  66.419 1.00 55.67  ? 14  G   C "C1'" 1 
ATOM   295  N N9    . G   A 1 14  ? 10.716  38.458  65.959 1.00 52.63  ? 14  G   C N9    1 
ATOM   296  C C8    . G   A 1 14  ? 11.865  38.086  65.307 1.00 48.64  ? 14  G   C C8    1 
ATOM   297  N N7    . G   A 1 14  ? 11.909  36.809  65.038 1.00 50.80  ? 14  G   C N7    1 
ATOM   298  C C5    . G   A 1 14  ? 10.713  36.311  65.536 1.00 38.66  ? 14  G   C C5    1 
ATOM   299  C C6    . G   A 1 14  ? 10.196  34.993  65.532 1.00 42.17  ? 14  G   C C6    1 
ATOM   300  O O6    . G   A 1 14  ? 10.701  33.967  65.062 1.00 57.38  ? 14  G   C O6    1 
ATOM   301  N N1    . G   A 1 14  ? 8.956   34.929  66.153 1.00 37.54  ? 14  G   C N1    1 
ATOM   302  C C2    . G   A 1 14  ? 8.293   35.993  66.701 1.00 40.12  ? 14  G   C C2    1 
ATOM   303  N N2    . G   A 1 14  ? 7.115   35.715  67.279 1.00 36.50  ? 14  G   C N2    1 
ATOM   304  N N3    . G   A 1 14  ? 8.753   37.234  66.693 1.00 40.05  ? 14  G   C N3    1 
ATOM   305  C C4    . G   A 1 14  ? 9.964   37.316  66.105 1.00 41.32  ? 14  G   C C4    1 
ATOM   306  P P     . G   A 1 15  ? 13.172  40.354  70.293 1.00 71.84  ? 15  G   C P     1 
ATOM   307  O OP1   . G   A 1 15  ? 13.560  41.374  71.299 1.00 79.65  ? 15  G   C OP1   1 
ATOM   308  O OP2   . G   A 1 15  ? 14.214  39.509  69.656 1.00 61.31  ? 15  G   C OP2   1 
ATOM   309  O "O5'" . G   A 1 15  ? 12.079  39.405  70.954 1.00 64.98  ? 15  G   C "O5'" 1 
ATOM   310  C "C5'" . G   A 1 15  ? 10.911  39.963  71.538 1.00 68.52  ? 15  G   C "C5'" 1 
ATOM   311  C "C4'" . G   A 1 15  ? 9.842   38.911  71.691 1.00 72.72  ? 15  G   C "C4'" 1 
ATOM   312  O "O4'" . G   A 1 15  ? 9.553   38.303  70.402 1.00 72.93  ? 15  G   C "O4'" 1 
ATOM   313  C "C3'" . G   A 1 15  ? 10.210  37.711  72.537 1.00 80.85  ? 15  G   C "C3'" 1 
ATOM   314  O "O3'" . G   A 1 15  ? 10.149  38.011  73.920 1.00 88.51  ? 15  G   C "O3'" 1 
ATOM   315  C "C2'" . G   A 1 15  ? 9.151   36.705  72.104 1.00 74.66  ? 15  G   C "C2'" 1 
ATOM   316  O "O2'" . G   A 1 15  ? 7.873   36.985  72.647 1.00 65.38  ? 15  G   C "O2'" 1 
ATOM   317  C "C1'" . G   A 1 15  ? 9.116   36.964  70.598 1.00 67.80  ? 15  G   C "C1'" 1 
ATOM   318  N N9    . G   A 1 15  ? 9.987   36.067  69.842 1.00 56.59  ? 15  G   C N9    1 
ATOM   319  C C8    . G   A 1 15  ? 11.144  36.393  69.178 1.00 53.16  ? 15  G   C C8    1 
ATOM   320  N N7    . G   A 1 15  ? 11.689  35.375  68.566 1.00 46.05  ? 15  G   C N7    1 
ATOM   321  C C5    . G   A 1 15  ? 10.842  34.313  68.848 1.00 50.04  ? 15  G   C C5    1 
ATOM   322  C C6    . G   A 1 15  ? 10.909  32.955  68.444 1.00 62.18  ? 15  G   C C6    1 
ATOM   323  O O6    . G   A 1 15  ? 11.756  32.405  67.727 1.00 71.69  ? 15  G   C O6    1 
ATOM   324  N N1    . G   A 1 15  ? 9.845   32.215  68.956 1.00 58.05  ? 15  G   C N1    1 
ATOM   325  C C2    . G   A 1 15  ? 8.843   32.720  69.746 1.00 57.73  ? 15  G   C C2    1 
ATOM   326  N N2    . G   A 1 15  ? 7.902   31.847  70.136 1.00 52.36  ? 15  G   C N2    1 
ATOM   327  N N3    . G   A 1 15  ? 8.766   33.987  70.125 1.00 55.66  ? 15  G   C N3    1 
ATOM   328  C C4    . G   A 1 15  ? 9.792   34.720  69.642 1.00 51.54  ? 15  G   C C4    1 
ATOM   329  P P     . U   A 1 16  ? 11.219  37.345  74.909 1.00 82.62  ? 16  U   C P     1 
ATOM   330  O OP1   . U   A 1 16  ? 11.058  37.990  76.237 1.00 87.18  ? 16  U   C OP1   1 
ATOM   331  O OP2   . U   A 1 16  ? 12.538  37.377  74.226 1.00 73.93  ? 16  U   C OP2   1 
ATOM   332  O "O5'" . U   A 1 16  ? 10.745  35.828  75.017 1.00 80.35  ? 16  U   C "O5'" 1 
ATOM   333  C "C5'" . U   A 1 16  ? 9.463   35.499  75.549 1.00 73.09  ? 16  U   C "C5'" 1 
ATOM   334  C "C4'" . U   A 1 16  ? 9.138   34.044  75.289 1.00 75.44  ? 16  U   C "C4'" 1 
ATOM   335  O "O4'" . U   A 1 16  ? 9.168   33.806  73.857 1.00 70.73  ? 16  U   C "O4'" 1 
ATOM   336  C "C3'" . U   A 1 16  ? 10.114  33.014  75.838 1.00 82.02  ? 16  U   C "C3'" 1 
ATOM   337  O "O3'" . U   A 1 16  ? 9.857   32.726  77.210 1.00 89.12  ? 16  U   C "O3'" 1 
ATOM   338  C "C2'" . U   A 1 16  ? 9.818   31.806  74.960 1.00 66.29  ? 16  U   C "C2'" 1 
ATOM   339  O "O2'" . U   A 1 16  ? 8.638   31.144  75.365 1.00 78.36  ? 16  U   C "O2'" 1 
ATOM   340  C "C1'" . U   A 1 16  ? 9.581   32.473  73.605 1.00 56.83  ? 16  U   C "C1'" 1 
ATOM   341  N N1    . U   A 1 16  ? 10.769  32.513  72.745 1.00 43.95  ? 16  U   C N1    1 
ATOM   342  C C2    . U   A 1 16  ? 11.144  31.343  72.118 1.00 49.74  ? 16  U   C C2    1 
ATOM   343  O O2    . U   A 1 16  ? 10.547  30.292  72.272 1.00 54.98  ? 16  U   C O2    1 
ATOM   344  N N3    . U   A 1 16  ? 12.247  31.448  71.308 1.00 41.39  ? 16  U   C N3    1 
ATOM   345  C C4    . U   A 1 16  ? 13.006  32.582  71.079 1.00 47.15  ? 16  U   C C4    1 
ATOM   346  O O4    . U   A 1 16  ? 13.979  32.518  70.323 1.00 56.09  ? 16  U   C O4    1 
ATOM   347  C C5    . U   A 1 16  ? 12.560  33.749  71.774 1.00 40.39  ? 16  U   C C5    1 
ATOM   348  C C6    . U   A 1 16  ? 11.482  33.677  72.563 1.00 48.79  ? 16  U   C C6    1 
ATOM   349  P P     . C   A 1 17  ? 11.069  32.274  78.169 1.00 88.21  ? 17  C   C P     1 
ATOM   350  O OP1   . C   A 1 17  ? 10.555  32.349  79.561 1.00 79.94  ? 17  C   C OP1   1 
ATOM   351  O OP2   . C   A 1 17  ? 12.281  33.045  77.789 1.00 75.81  ? 17  C   C OP2   1 
ATOM   352  O "O5'" . C   A 1 17  ? 11.308  30.740  77.805 1.00 81.37  ? 17  C   C "O5'" 1 
ATOM   353  C "C5'" . C   A 1 17  ? 10.355  29.747  78.184 1.00 85.14  ? 17  C   C "C5'" 1 
ATOM   354  C "C4'" . C   A 1 17  ? 10.662  28.430  77.509 1.00 81.06  ? 17  C   C "C4'" 1 
ATOM   355  O "O4'" . C   A 1 17  ? 10.694  28.638  76.076 1.00 74.78  ? 17  C   C "O4'" 1 
ATOM   356  C "C3'" . C   A 1 17  ? 12.022  27.819  77.809 1.00 92.61  ? 17  C   C "C3'" 1 
ATOM   357  O "O3'" . C   A 1 17  ? 12.000  27.066  79.015 1.00 98.13  ? 17  C   C "O3'" 1 
ATOM   358  C "C2'" . C   A 1 17  ? 12.239  26.910  76.606 1.00 80.49  ? 17  C   C "C2'" 1 
ATOM   359  O "O2'" . C   A 1 17  ? 11.542  25.683  76.717 1.00 81.31  ? 17  C   C "O2'" 1 
ATOM   360  C "C1'" . C   A 1 17  ? 11.626  27.749  75.486 1.00 68.15  ? 17  C   C "C1'" 1 
ATOM   361  N N1    . C   A 1 17  ? 12.611  28.536  74.735 1.00 50.74  ? 17  C   C N1    1 
ATOM   362  C C2    . C   A 1 17  ? 13.309  27.913  73.705 1.00 53.69  ? 17  C   C C2    1 
ATOM   363  O O2    . C   A 1 17  ? 13.101  26.710  73.492 1.00 65.58  ? 17  C   C O2    1 
ATOM   364  N N3    . C   A 1 17  ? 14.193  28.628  72.972 1.00 43.14  ? 17  C   C N3    1 
ATOM   365  C C4    . C   A 1 17  ? 14.400  29.915  73.253 1.00 49.21  ? 17  C   C C4    1 
ATOM   366  N N4    . C   A 1 17  ? 15.276  30.585  72.502 1.00 55.03  ? 17  C   C N4    1 
ATOM   367  C C5    . C   A 1 17  ? 13.717  30.574  74.317 1.00 45.92  ? 17  C   C C5    1 
ATOM   368  C C6    . C   A 1 17  ? 12.837  29.853  75.025 1.00 44.31  ? 17  C   C C6    1 
ATOM   369  P P     . A   A 1 18  ? 13.343  26.926  79.883 1.00 93.41  ? 18  A   C P     1 
ATOM   370  O OP1   . A   A 1 18  ? 12.974  26.159  81.101 1.00 91.52  ? 18  A   C OP1   1 
ATOM   371  O OP2   . A   A 1 18  ? 13.945  28.279  80.013 1.00 80.72  ? 18  A   C OP2   1 
ATOM   372  O "O5'" . A   A 1 18  ? 14.305  26.027  78.982 1.00 80.15  ? 18  A   C "O5'" 1 
ATOM   373  C "C5'" . A   A 1 18  ? 14.031  24.644  78.788 1.00 80.29  ? 18  A   C "C5'" 1 
ATOM   374  C "C4'" . A   A 1 18  ? 14.934  24.064  77.723 1.00 85.00  ? 18  A   C "C4'" 1 
ATOM   375  O "O4'" . A   A 1 18  ? 14.726  24.760  76.464 1.00 88.07  ? 18  A   C "O4'" 1 
ATOM   376  C "C3'" . A   A 1 18  ? 16.428  24.207  77.948 1.00 90.55  ? 18  A   C "C3'" 1 
ATOM   377  O "O3'" . A   A 1 18  ? 16.914  23.225  78.851 1.00 99.09  ? 18  A   C "O3'" 1 
ATOM   378  C "C2'" . A   A 1 18  ? 16.974  23.994  76.541 1.00 86.94  ? 18  A   C "C2'" 1 
ATOM   379  O "O2'" . A   A 1 18  ? 17.027  22.631  76.168 1.00 91.61  ? 18  A   C "O2'" 1 
ATOM   380  C "C1'" . A   A 1 18  ? 15.920  24.710  75.696 1.00 79.35  ? 18  A   C "C1'" 1 
ATOM   381  N N9    . A   A 1 18  ? 16.315  26.072  75.343 1.00 68.21  ? 18  A   C N9    1 
ATOM   382  C C8    . A   A 1 18  ? 15.919  27.261  75.910 1.00 65.46  ? 18  A   C C8    1 
ATOM   383  N N7    . A   A 1 18  ? 16.460  28.320  75.350 1.00 50.32  ? 18  A   C N7    1 
ATOM   384  C C5    . A   A 1 18  ? 17.264  27.791  74.350 1.00 39.46  ? 18  A   C C5    1 
ATOM   385  C C6    . A   A 1 18  ? 18.100  28.391  73.397 1.00 50.51  ? 18  A   C C6    1 
ATOM   386  N N6    . A   A 1 18  ? 18.275  29.709  73.297 1.00 54.93  ? 18  A   C N6    1 
ATOM   387  N N1    . A   A 1 18  ? 18.763  27.580  72.540 1.00 54.68  ? 18  A   C N1    1 
ATOM   388  C C2    . A   A 1 18  ? 18.593  26.255  72.652 1.00 59.19  ? 18  A   C C2    1 
ATOM   389  N N3    . A   A 1 18  ? 17.835  25.571  73.512 1.00 51.22  ? 18  A   C N3    1 
ATOM   390  C C4    . A   A 1 18  ? 17.189  26.409  74.339 1.00 49.41  ? 18  A   C C4    1 
ATOM   391  P P     . U   A 1 19  ? 18.226  23.535  79.728 1.00 97.95  ? 19  U   C P     1 
ATOM   392  O OP1   . U   A 1 19  ? 18.417  22.389  80.654 1.00 89.95  ? 19  U   C OP1   1 
ATOM   393  O OP2   . U   A 1 19  ? 18.100  24.911  80.276 1.00 91.56  ? 19  U   C OP2   1 
ATOM   394  O "O5'" . U   A 1 19  ? 19.409  23.523  78.662 1.00 81.59  ? 19  U   C "O5'" 1 
ATOM   395  C "C5'" . U   A 1 19  ? 19.686  22.355  77.902 1.00 84.60  ? 19  U   C "C5'" 1 
ATOM   396  C "C4'" . U   A 1 19  ? 20.605  22.686  76.755 1.00 91.72  ? 19  U   C "C4'" 1 
ATOM   397  O "O4'" . U   A 1 19  ? 19.942  23.611  75.851 1.00 92.95  ? 19  U   C "O4'" 1 
ATOM   398  C "C3'" . U   A 1 19  ? 21.881  23.411  77.138 1.00 98.34  ? 19  U   C "C3'" 1 
ATOM   399  O "O3'" . U   A 1 19  ? 22.869  22.502  77.605 1.00 109.93 ? 19  U   C "O3'" 1 
ATOM   400  C "C2'" . U   A 1 19  ? 22.262  24.075  75.821 1.00 94.00  ? 19  U   C "C2'" 1 
ATOM   401  O "O2'" . U   A 1 19  ? 22.826  23.175  74.890 1.00 89.85  ? 19  U   C "O2'" 1 
ATOM   402  C "C1'" . U   A 1 19  ? 20.891  24.524  75.319 1.00 86.83  ? 19  U   C "C1'" 1 
ATOM   403  N N1    . U   A 1 19  ? 20.546  25.870  75.796 1.00 77.00  ? 19  U   C N1    1 
ATOM   404  C C2    . U   A 1 19  ? 20.996  26.952  75.059 1.00 69.00  ? 19  U   C C2    1 
ATOM   405  O O2    . U   A 1 19  ? 21.650  26.831  74.034 1.00 59.31  ? 19  U   C O2    1 
ATOM   406  N N3    . U   A 1 19  ? 20.648  28.180  75.566 1.00 57.79  ? 19  U   C N3    1 
ATOM   407  C C4    . U   A 1 19  ? 19.908  28.429  76.709 1.00 74.53  ? 19  U   C C4    1 
ATOM   408  O O4    . U   A 1 19  ? 19.661  29.594  77.031 1.00 81.28  ? 19  U   C O4    1 
ATOM   409  C C5    . U   A 1 19  ? 19.480  27.256  77.410 1.00 75.94  ? 19  U   C C5    1 
ATOM   410  C C6    . U   A 1 19  ? 19.805  26.048  76.942 1.00 76.83  ? 19  U   C C6    1 
ATOM   411  P P     . U   A 1 20  ? 23.940  22.988  78.700 1.00 110.64 ? 20  U   C P     1 
ATOM   412  O OP1   . U   A 1 20  ? 24.505  21.765  79.323 1.00 110.46 ? 20  U   C OP1   1 
ATOM   413  O OP2   . U   A 1 20  ? 23.305  24.022  79.557 1.00 106.64 ? 20  U   C OP2   1 
ATOM   414  O "O5'" . U   A 1 20  ? 25.075  23.685  77.825 1.00 96.08  ? 20  U   C "O5'" 1 
ATOM   415  C "C5'" . U   A 1 20  ? 25.768  22.948  76.827 1.00 87.92  ? 20  U   C "C5'" 1 
ATOM   416  C "C4'" . U   A 1 20  ? 26.501  23.881  75.899 1.00 92.82  ? 20  U   C "C4'" 1 
ATOM   417  O "O4'" . U   A 1 20  ? 25.546  24.672  75.141 1.00 94.76  ? 20  U   C "O4'" 1 
ATOM   418  C "C3'" . U   A 1 20  ? 27.359  24.937  76.569 1.00 104.53 ? 20  U   C "C3'" 1 
ATOM   419  O "O3'" . U   A 1 20  ? 28.601  24.422  77.025 1.00 112.53 ? 20  U   C "O3'" 1 
ATOM   420  C "C2'" . U   A 1 20  ? 27.520  25.950  75.444 1.00 101.82 ? 20  U   C "C2'" 1 
ATOM   421  O "O2'" . U   A 1 20  ? 28.456  25.549  74.463 1.00 103.02 ? 20  U   C "O2'" 1 
ATOM   422  C "C1'" . U   A 1 20  ? 26.111  25.945  74.851 1.00 93.01  ? 20  U   C "C1'" 1 
ATOM   423  N N1    . U   A 1 20  ? 25.277  26.989  75.465 1.00 80.63  ? 20  U   C N1    1 
ATOM   424  C C2    . U   A 1 20  ? 25.460  28.284  75.019 1.00 75.91  ? 20  U   C C2    1 
ATOM   425  O O2    . U   A 1 20  ? 26.248  28.570  74.131 1.00 77.17  ? 20  U   C O2    1 
ATOM   426  N N3    . U   A 1 20  ? 24.692  29.232  75.648 1.00 63.07  ? 20  U   C N3    1 
ATOM   427  C C4    . U   A 1 20  ? 23.774  29.021  76.656 1.00 68.09  ? 20  U   C C4    1 
ATOM   428  O O4    . U   A 1 20  ? 23.202  29.988  77.164 1.00 66.45  ? 20  U   C O4    1 
ATOM   429  C C5    . U   A 1 20  ? 23.625  27.649  77.051 1.00 66.27  ? 20  U   C C5    1 
ATOM   430  C C6    . U   A 1 20  ? 24.363  26.704  76.455 1.00 69.69  ? 20  U   C C6    1 
ATOM   431  P P     . C   A 1 21  ? 29.291  25.067  78.326 1.00 118.91 ? 21  C   C P     1 
ATOM   432  O OP1   . C   A 1 21  ? 30.422  24.184  78.703 1.00 125.31 ? 21  C   C OP1   1 
ATOM   433  O OP2   . C   A 1 21  ? 28.229  25.367  79.323 1.00 104.61 ? 21  C   C OP2   1 
ATOM   434  O "O5'" . C   A 1 21  ? 29.891  26.443  77.792 1.00 110.70 ? 21  C   C "O5'" 1 
ATOM   435  C "C5'" . C   A 1 21  ? 30.733  26.464  76.643 1.00 106.60 ? 21  C   C "C5'" 1 
ATOM   436  C "C4'" . C   A 1 21  ? 30.953  27.883  76.175 1.00 109.19 ? 21  C   C "C4'" 1 
ATOM   437  O "O4'" . C   A 1 21  ? 29.679  28.476  75.819 1.00 106.20 ? 21  C   C "O4'" 1 
ATOM   438  C "C3'" . C   A 1 21  ? 31.534  28.846  77.197 1.00 108.47 ? 21  C   C "C3'" 1 
ATOM   439  O "O3'" . C   A 1 21  ? 32.955  28.728  77.238 1.00 112.87 ? 21  C   C "O3'" 1 
ATOM   440  C "C2'" . C   A 1 21  ? 31.104  30.203  76.643 1.00 101.05 ? 21  C   C "C2'" 1 
ATOM   441  O "O2'" . C   A 1 21  ? 31.965  30.684  75.631 1.00 100.01 ? 21  C   C "O2'" 1 
ATOM   442  C "C1'" . C   A 1 21  ? 29.737  29.876  76.034 1.00 99.52  ? 21  C   C "C1'" 1 
ATOM   443  N N1    . C   A 1 21  ? 28.592  30.274  76.867 1.00 87.59  ? 21  C   C N1    1 
ATOM   444  C C2    . C   A 1 21  ? 28.291  31.634  76.984 1.00 78.65  ? 21  C   C C2    1 
ATOM   445  O O2    . C   A 1 21  ? 28.999  32.456  76.386 1.00 79.18  ? 21  C   C O2    1 
ATOM   446  N N3    . C   A 1 21  ? 27.241  32.017  77.742 1.00 68.57  ? 21  C   C N3    1 
ATOM   447  C C4    . C   A 1 21  ? 26.502  31.100  78.368 1.00 75.92  ? 21  C   C C4    1 
ATOM   448  N N4    . C   A 1 21  ? 25.473  31.526  79.104 1.00 72.12  ? 21  C   C N4    1 
ATOM   449  C C5    . C   A 1 21  ? 26.785  29.706  78.267 1.00 80.09  ? 21  C   C C5    1 
ATOM   450  C C6    . C   A 1 21  ? 27.831  29.340  77.513 1.00 82.21  ? 21  C   C C6    1 
ATOM   451  P P     . G   A 1 22  ? 33.727  28.805  78.648 1.00 118.26 ? 22  G   C P     1 
ATOM   452  O OP1   . G   A 1 22  ? 35.136  28.414  78.395 1.00 118.95 ? 22  G   C OP1   1 
ATOM   453  O OP2   . G   A 1 22  ? 32.932  28.068  79.664 1.00 112.56 ? 22  G   C OP2   1 
ATOM   454  O "O5'" . G   A 1 22  ? 33.705  30.354  79.021 1.00 118.41 ? 22  G   C "O5'" 1 
ATOM   455  C "C5'" . G   A 1 22  ? 34.360  31.315  78.194 1.00 124.70 ? 22  G   C "C5'" 1 
ATOM   456  C "C4'" . G   A 1 22  ? 33.728  32.675  78.377 1.00 129.49 ? 22  G   C "C4'" 1 
ATOM   457  O "O4'" . G   A 1 22  ? 32.323  32.586  78.021 1.00 128.64 ? 22  G   C "O4'" 1 
ATOM   458  C "C3'" . G   A 1 22  ? 33.730  33.210  79.801 1.00 133.28 ? 22  G   C "C3'" 1 
ATOM   459  O "O3'" . G   A 1 22  ? 34.925  33.931  80.069 1.00 143.83 ? 22  G   C "O3'" 1 
ATOM   460  C "C2'" . G   A 1 22  ? 32.528  34.142  79.800 1.00 129.02 ? 22  G   C "C2'" 1 
ATOM   461  O "O2'" . G   A 1 22  ? 32.822  35.394  79.216 1.00 128.91 ? 22  G   C "O2'" 1 
ATOM   462  C "C1'" . G   A 1 22  ? 31.551  33.369  78.914 1.00 122.96 ? 22  G   C "C1'" 1 
ATOM   463  N N9    . G   A 1 22  ? 30.680  32.470  79.664 1.00 112.53 ? 22  G   C N9    1 
ATOM   464  C C8    . G   A 1 22  ? 30.853  31.121  79.866 1.00 105.60 ? 22  G   C C8    1 
ATOM   465  N N7    . G   A 1 22  ? 29.895  30.581  80.569 1.00 98.60  ? 22  G   C N7    1 
ATOM   466  C C5    . G   A 1 22  ? 29.040  31.638  80.851 1.00 99.21  ? 22  G   C C5    1 
ATOM   467  C C6    . G   A 1 22  ? 27.823  31.666  81.577 1.00 98.39  ? 22  G   C C6    1 
ATOM   468  O O6    . G   A 1 22  ? 27.235  30.729  82.129 1.00 97.47  ? 22  G   C O6    1 
ATOM   469  N N1    . G   A 1 22  ? 27.286  32.949  81.623 1.00 97.82  ? 22  G   C N1    1 
ATOM   470  C C2    . G   A 1 22  ? 27.846  34.062  81.043 1.00 99.83  ? 22  G   C C2    1 
ATOM   471  N N2    . G   A 1 22  ? 27.180  35.217  81.200 1.00 99.73  ? 22  G   C N2    1 
ATOM   472  N N3    . G   A 1 22  ? 28.977  34.046  80.360 1.00 98.95  ? 22  G   C N3    1 
ATOM   473  C C4    . G   A 1 22  ? 29.515  32.811  80.304 1.00 103.77 ? 22  G   C C4    1 
ATOM   474  P P     . C   A 1 23  ? 35.314  34.289  81.585 1.00 152.12 ? 23  C   C P     1 
ATOM   475  O OP1   . C   A 1 23  ? 36.538  33.515  81.915 1.00 152.12 ? 23  C   C OP1   1 
ATOM   476  O OP2   . C   A 1 23  ? 34.098  34.136  82.427 1.00 152.12 ? 23  C   C OP2   1 
ATOM   477  O "O5'" . C   A 1 23  ? 35.695  35.836  81.528 1.00 152.12 ? 23  C   C "O5'" 1 
ATOM   478  C "C5'" . C   A 1 23  ? 36.649  36.396  82.430 1.00 152.12 ? 23  C   C "C5'" 1 
ATOM   479  C "C4'" . C   A 1 23  ? 37.165  37.707  81.885 1.00 152.12 ? 23  C   C "C4'" 1 
ATOM   480  O "O4'" . C   A 1 23  ? 37.805  37.457  80.607 1.00 152.12 ? 23  C   C "O4'" 1 
ATOM   481  C "C3'" . C   A 1 23  ? 36.087  38.739  81.590 1.00 152.12 ? 23  C   C "C3'" 1 
ATOM   482  O "O3'" . C   A 1 23  ? 35.836  39.531  82.749 1.00 152.12 ? 23  C   C "O3'" 1 
ATOM   483  C "C2'" . C   A 1 23  ? 36.721  39.567  80.477 1.00 152.12 ? 23  C   C "C2'" 1 
ATOM   484  O "O2'" . C   A 1 23  ? 37.625  40.540  80.960 1.00 151.72 ? 23  C   C "O2'" 1 
ATOM   485  C "C1'" . C   A 1 23  ? 37.491  38.497  79.699 1.00 151.75 ? 23  C   C "C1'" 1 
ATOM   486  N N1    . C   A 1 23  ? 36.733  37.911  78.584 1.00 150.42 ? 23  C   C N1    1 
ATOM   487  C C2    . C   A 1 23  ? 36.828  38.501  77.320 1.00 150.57 ? 23  C   C C2    1 
ATOM   488  O O2    . C   A 1 23  ? 37.542  39.507  77.179 1.00 147.13 ? 23  C   C O2    1 
ATOM   489  N N3    . C   A 1 23  ? 36.141  37.961  76.285 1.00 151.28 ? 23  C   C N3    1 
ATOM   490  C C4    . C   A 1 23  ? 35.383  36.879  76.480 1.00 149.10 ? 23  C   C C4    1 
ATOM   491  N N4    . C   A 1 23  ? 34.725  36.378  75.431 1.00 146.83 ? 23  C   C N4    1 
ATOM   492  C C5    . C   A 1 23  ? 35.266  36.261  77.759 1.00 146.81 ? 23  C   C C5    1 
ATOM   493  C C6    . C   A 1 23  ? 35.951  36.805  78.773 1.00 146.83 ? 23  C   C C6    1 
ATOM   494  P P     . A   A 1 24  ? 34.644  39.127  83.752 1.00 151.32 ? 24  A   C P     1 
ATOM   495  O OP1   . A   A 1 24  ? 35.201  39.100  85.129 1.00 151.43 ? 24  A   C OP1   1 
ATOM   496  O OP2   . A   A 1 24  ? 33.976  37.917  83.210 1.00 152.12 ? 24  A   C OP2   1 
ATOM   497  O "O5'" . A   A 1 24  ? 33.623  40.346  83.664 1.00 144.93 ? 24  A   C "O5'" 1 
ATOM   498  C "C5'" . A   A 1 24  ? 32.554  40.459  84.598 1.00 134.40 ? 24  A   C "C5'" 1 
ATOM   499  C "C4'" . A   A 1 24  ? 31.225  40.399  83.884 1.00 122.88 ? 24  A   C "C4'" 1 
ATOM   500  O "O4'" . A   A 1 24  ? 31.253  39.321  82.917 1.00 107.82 ? 24  A   C "O4'" 1 
ATOM   501  C "C3'" . A   A 1 24  ? 30.031  40.116  84.784 1.00 123.51 ? 24  A   C "C3'" 1 
ATOM   502  O "O3'" . A   A 1 24  ? 29.607  41.327  85.441 1.00 129.74 ? 24  A   C "O3'" 1 
ATOM   503  C "C2'" . A   A 1 24  ? 29.057  39.379  83.863 1.00 115.48 ? 24  A   C "C2'" 1 
ATOM   504  O "O2'" . A   A 1 24  ? 28.233  40.216  83.084 1.00 122.47 ? 24  A   C "O2'" 1 
ATOM   505  C "C1'" . A   A 1 24  ? 30.013  38.646  82.915 1.00 106.65 ? 24  A   C "C1'" 1 
ATOM   506  N N9    . A   A 1 24  ? 30.270  37.223  83.147 1.00 94.71  ? 24  A   C N9    1 
ATOM   507  C C8    . A   A 1 24  ? 31.421  36.560  82.800 1.00 91.85  ? 24  A   C C8    1 
ATOM   508  N N7    . A   A 1 24  ? 31.398  35.278  83.066 1.00 84.88  ? 24  A   C N7    1 
ATOM   509  C C5    . A   A 1 24  ? 30.151  35.081  83.639 1.00 79.64  ? 24  A   C C5    1 
ATOM   510  C C6    . A   A 1 24  ? 29.519  33.932  84.137 1.00 77.28  ? 24  A   C C6    1 
ATOM   511  N N6    . A   A 1 24  ? 30.084  32.722  84.136 1.00 72.98  ? 24  A   C N6    1 
ATOM   512  N N1    . A   A 1 24  ? 28.273  34.068  84.642 1.00 75.81  ? 24  A   C N1    1 
ATOM   513  C C2    . A   A 1 24  ? 27.714  35.285  84.643 1.00 88.84  ? 24  A   C C2    1 
ATOM   514  N N3    . A   A 1 24  ? 28.210  36.444  84.203 1.00 93.78  ? 24  A   C N3    1 
ATOM   515  C C4    . A   A 1 24  ? 29.447  36.272  83.705 1.00 87.06  ? 24  A   C C4    1 
ATOM   516  P P     . A   A 1 25  ? 28.234  42.073  85.029 1.00 126.78 ? 25  A   C P     1 
ATOM   517  O OP1   . A   A 1 25  ? 28.059  43.171  86.012 1.00 128.39 ? 25  A   C OP1   1 
ATOM   518  O OP2   . A   A 1 25  ? 27.138  41.088  84.839 1.00 124.74 ? 25  A   C OP2   1 
ATOM   519  O "O5'" . A   A 1 25  ? 28.579  42.771  83.636 1.00 123.46 ? 25  A   C "O5'" 1 
ATOM   520  C "C5'" . A   A 1 25  ? 27.591  42.923  82.619 1.00 118.83 ? 25  A   C "C5'" 1 
ATOM   521  C "C4'" . A   A 1 25  ? 28.244  43.336  81.319 1.00 111.42 ? 25  A   C "C4'" 1 
ATOM   522  O "O4'" . A   A 1 25  ? 29.475  42.584  81.150 1.00 110.78 ? 25  A   C "O4'" 1 
ATOM   523  C "C3'" . A   A 1 25  ? 27.430  43.057  80.062 1.00 109.23 ? 25  A   C "C3'" 1 
ATOM   524  O "O3'" . A   A 1 25  ? 26.527  44.115  79.750 1.00 108.96 ? 25  A   C "O3'" 1 
ATOM   525  C "C2'" . A   A 1 25  ? 28.518  42.887  79.007 1.00 104.36 ? 25  A   C "C2'" 1 
ATOM   526  O "O2'" . A   A 1 25  ? 29.035  44.117  78.536 1.00 94.93  ? 25  A   C "O2'" 1 
ATOM   527  C "C1'" . A   A 1 25  ? 29.590  42.143  79.807 1.00 101.27 ? 25  A   C "C1'" 1 
ATOM   528  N N9    . A   A 1 25  ? 29.408  40.691  79.808 1.00 89.75  ? 25  A   C N9    1 
ATOM   529  C C8    . A   A 1 25  ? 28.404  39.977  80.420 1.00 84.71  ? 25  A   C C8    1 
ATOM   530  N N7    . A   A 1 25  ? 28.508  38.680  80.270 1.00 73.55  ? 25  A   C N7    1 
ATOM   531  C C5    . A   A 1 25  ? 29.652  38.528  79.501 1.00 74.19  ? 25  A   C C5    1 
ATOM   532  C C6    . A   A 1 25  ? 30.298  37.393  78.998 1.00 78.43  ? 25  A   C C6    1 
ATOM   533  N N6    . A   A 1 25  ? 29.869  36.148  79.215 1.00 71.56  ? 25  A   C N6    1 
ATOM   534  N N1    . A   A 1 25  ? 31.416  37.581  78.259 1.00 84.19  ? 25  A   C N1    1 
ATOM   535  C C2    . A   A 1 25  ? 31.846  38.836  78.054 1.00 82.33  ? 25  A   C C2    1 
ATOM   536  N N3    . A   A 1 25  ? 31.324  39.985  78.480 1.00 73.90  ? 25  A   C N3    1 
ATOM   537  C C4    . A   A 1 25  ? 30.215  39.758  79.204 1.00 75.60  ? 25  A   C C4    1 
ATOM   538  P P     . G   A 1 26  ? 25.119  43.780  79.045 1.00 101.65 ? 26  G   C P     1 
ATOM   539  O OP1   . G   A 1 26  ? 24.957  44.726  77.913 1.00 98.33  ? 26  G   C OP1   1 
ATOM   540  O OP2   . G   A 1 26  ? 24.070  43.700  80.095 1.00 96.80  ? 26  G   C OP2   1 
ATOM   541  O "O5'" . G   A 1 26  ? 25.332  42.321  78.444 1.00 96.98  ? 26  G   C "O5'" 1 
ATOM   542  C "C5'" . G   A 1 26  ? 24.925  41.995  77.117 1.00 100.39 ? 26  G   C "C5'" 1 
ATOM   543  C "C4'" . G   A 1 26  ? 26.127  41.580  76.305 1.00 99.64  ? 26  G   C "C4'" 1 
ATOM   544  O "O4'" . G   A 1 26  ? 27.062  40.907  77.186 1.00 92.27  ? 26  G   C "O4'" 1 
ATOM   545  C "C3'" . G   A 1 26  ? 25.874  40.590  75.174 1.00 103.56 ? 26  G   C "C3'" 1 
ATOM   546  O "O3'" . G   A 1 26  ? 25.496  41.218  73.954 1.00 107.22 ? 26  G   C "O3'" 1 
ATOM   547  C "C2'" . G   A 1 26  ? 27.226  39.903  75.055 1.00 98.52  ? 26  G   C "C2'" 1 
ATOM   548  O "O2'" . G   A 1 26  ? 28.185  40.677  74.361 1.00 101.96 ? 26  G   C "O2'" 1 
ATOM   549  C "C1'" . G   A 1 26  ? 27.617  39.785  76.526 1.00 87.77  ? 26  G   C "C1'" 1 
ATOM   550  N N9    . G   A 1 26  ? 27.044  38.591  77.130 1.00 72.14  ? 26  G   C N9    1 
ATOM   551  C C8    . G   A 1 26  ? 25.991  38.526  78.011 1.00 63.58  ? 26  G   C C8    1 
ATOM   552  N N7    . G   A 1 26  ? 25.696  37.306  78.364 1.00 64.45  ? 26  G   C N7    1 
ATOM   553  C C5    . G   A 1 26  ? 26.612  36.521  77.676 1.00 61.41  ? 26  G   C C5    1 
ATOM   554  C C6    . G   A 1 26  ? 26.787  35.118  77.661 1.00 63.46  ? 26  G   C C6    1 
ATOM   555  O O6    . G   A 1 26  ? 26.141  34.256  78.272 1.00 65.99  ? 26  G   C O6    1 
ATOM   556  N N1    . G   A 1 26  ? 27.841  34.743  76.830 1.00 58.08  ? 26  G   C N1    1 
ATOM   557  C C2    . G   A 1 26  ? 28.629  35.613  76.108 1.00 64.04  ? 26  G   C C2    1 
ATOM   558  N N2    . G   A 1 26  ? 29.603  35.066  75.365 1.00 58.23  ? 26  G   C N2    1 
ATOM   559  N N3    . G   A 1 26  ? 28.472  36.923  76.114 1.00 61.72  ? 26  G   C N3    1 
ATOM   560  C C4    . G   A 1 26  ? 27.452  37.304  76.914 1.00 64.94  ? 26  G   C C4    1 
ATOM   561  P P     . A   A 1 27  ? 24.740  40.359  72.822 1.00 106.13 ? 27  A   C P     1 
ATOM   562  O OP1   . A   A 1 27  ? 24.640  41.218  71.615 1.00 107.53 ? 27  A   C OP1   1 
ATOM   563  O OP2   . A   A 1 27  ? 23.510  39.776  73.417 1.00 103.72 ? 27  A   C OP2   1 
ATOM   564  O "O5'" . A   A 1 27  ? 25.745  39.169  72.489 1.00 102.49 ? 27  A   C "O5'" 1 
ATOM   565  C "C5'" . A   A 1 27  ? 26.990  39.423  71.843 1.00 102.91 ? 27  A   C "C5'" 1 
ATOM   566  C "C4'" . A   A 1 27  ? 27.681  38.120  71.512 1.00 102.70 ? 27  A   C "C4'" 1 
ATOM   567  O "O4'" . A   A 1 27  ? 27.932  37.382  72.739 1.00 98.65  ? 27  A   C "O4'" 1 
ATOM   568  C "C3'" . A   A 1 27  ? 26.873  37.152  70.665 1.00 104.09 ? 27  A   C "C3'" 1 
ATOM   569  O "O3'" . A   A 1 27  ? 26.981  37.470  69.281 1.00 110.76 ? 27  A   C "O3'" 1 
ATOM   570  C "C2'" . A   A 1 27  ? 27.525  35.817  71.003 1.00 97.46  ? 27  A   C "C2'" 1 
ATOM   571  O "O2'" . A   A 1 27  ? 28.751  35.623  70.326 1.00 91.03  ? 27  A   C "O2'" 1 
ATOM   572  C "C1'" . A   A 1 27  ? 27.798  35.990  72.497 1.00 89.28  ? 27  A   C "C1'" 1 
ATOM   573  N N9    . A   A 1 27  ? 26.737  35.475  73.364 1.00 81.35  ? 27  A   C N9    1 
ATOM   574  C C8    . A   A 1 27  ? 25.794  36.197  74.054 1.00 82.42  ? 27  A   C C8    1 
ATOM   575  N N7    . A   A 1 27  ? 24.987  35.458  74.778 1.00 82.22  ? 27  A   C N7    1 
ATOM   576  C C5    . A   A 1 27  ? 25.422  34.161  74.544 1.00 71.62  ? 27  A   C C5    1 
ATOM   577  C C6    . A   A 1 27  ? 24.982  32.912  75.025 1.00 68.30  ? 27  A   C C6    1 
ATOM   578  N N6    . A   A 1 27  ? 23.968  32.760  75.879 1.00 64.31  ? 27  A   C N6    1 
ATOM   579  N N1    . A   A 1 27  ? 25.631  31.810  74.595 1.00 71.39  ? 27  A   C N1    1 
ATOM   580  C C2    . A   A 1 27  ? 26.653  31.961  73.743 1.00 79.79  ? 27  A   C C2    1 
ATOM   581  N N3    . A   A 1 27  ? 27.161  33.078  73.223 1.00 79.30  ? 27  A   C N3    1 
ATOM   582  C C4    . A   A 1 27  ? 26.494  34.156  73.668 1.00 75.80  ? 27  A   C C4    1 
ATOM   583  P P     . G   A 1 28  ? 25.924  36.850  68.241 1.00 113.69 ? 28  G   C P     1 
ATOM   584  O OP1   . G   A 1 28  ? 26.215  37.438  66.906 1.00 108.73 ? 28  G   C OP1   1 
ATOM   585  O OP2   . G   A 1 28  ? 24.564  36.989  68.824 1.00 107.80 ? 28  G   C OP2   1 
ATOM   586  O "O5'" . G   A 1 28  ? 26.302  35.302  68.207 1.00 107.23 ? 28  G   C "O5'" 1 
ATOM   587  C "C5'" . G   A 1 28  ? 25.382  34.330  67.726 1.00 101.67 ? 28  G   C "C5'" 1 
ATOM   588  C "C4'" . G   A 1 28  ? 25.955  32.944  67.903 1.00 100.86 ? 28  G   C "C4'" 1 
ATOM   589  O "O4'" . G   A 1 28  ? 26.220  32.708  69.312 1.00 96.35  ? 28  G   C "O4'" 1 
ATOM   590  C "C3'" . G   A 1 28  ? 25.029  31.804  67.515 1.00 106.48 ? 28  G   C "C3'" 1 
ATOM   591  O "O3'" . G   A 1 28  ? 25.060  31.568  66.113 1.00 112.28 ? 28  G   C "O3'" 1 
ATOM   592  C "C2'" . G   A 1 28  ? 25.605  30.641  68.314 1.00 98.75  ? 28  G   C "C2'" 1 
ATOM   593  O "O2'" . G   A 1 28  ? 26.764  30.081  67.726 1.00 97.48  ? 28  G   C "O2'" 1 
ATOM   594  C "C1'" . G   A 1 28  ? 25.986  31.341  69.619 1.00 88.56  ? 28  G   C "C1'" 1 
ATOM   595  N N9    . G   A 1 28  ? 24.945  31.269  70.640 1.00 78.29  ? 28  G   C N9    1 
ATOM   596  C C8    . G   A 1 28  ? 24.306  32.322  71.249 1.00 76.82  ? 28  G   C C8    1 
ATOM   597  N N7    . G   A 1 28  ? 23.436  31.944  72.147 1.00 73.76  ? 28  G   C N7    1 
ATOM   598  C C5    . G   A 1 28  ? 23.500  30.557  72.126 1.00 67.52  ? 28  G   C C5    1 
ATOM   599  C C6    . G   A 1 28  ? 22.792  29.590  72.891 1.00 65.95  ? 28  G   C C6    1 
ATOM   600  O O6    . G   A 1 28  ? 21.942  29.773  73.774 1.00 62.17  ? 28  G   C O6    1 
ATOM   601  N N1    . G   A 1 28  ? 23.163  28.295  72.545 1.00 54.21  ? 28  G   C N1    1 
ATOM   602  C C2    . G   A 1 28  ? 24.097  27.968  71.594 1.00 66.13  ? 28  G   C C2    1 
ATOM   603  N N2    . G   A 1 28  ? 24.318  26.657  71.406 1.00 72.30  ? 28  G   C N2    1 
ATOM   604  N N3    . G   A 1 28  ? 24.767  28.859  70.878 1.00 68.02  ? 28  G   C N3    1 
ATOM   605  C C4    . G   A 1 28  ? 24.421  30.124  71.194 1.00 71.85  ? 28  G   C C4    1 
ATOM   606  P P     . U   A 1 29  ? 23.708  31.150  65.353 1.00 117.14 ? 29  U   C P     1 
ATOM   607  O OP1   . U   A 1 29  ? 24.033  31.025  63.908 1.00 110.81 ? 29  U   C OP1   1 
ATOM   608  O OP2   . U   A 1 29  ? 22.624  32.072  65.786 1.00 111.80 ? 29  U   C OP2   1 
ATOM   609  O "O5'" . U   A 1 29  ? 23.386  29.700  65.929 1.00 110.69 ? 29  U   C "O5'" 1 
ATOM   610  C "C5'" . U   A 1 29  ? 24.225  28.592  65.621 1.00 102.96 ? 29  U   C "C5'" 1 
ATOM   611  C "C4'" . U   A 1 29  ? 23.702  27.338  66.279 1.00 98.73  ? 29  U   C "C4'" 1 
ATOM   612  O "O4'" . U   A 1 29  ? 23.791  27.477  67.720 1.00 91.10  ? 29  U   C "O4'" 1 
ATOM   613  C "C3'" . U   A 1 29  ? 22.235  27.021  66.039 1.00 103.62 ? 29  U   C "C3'" 1 
ATOM   614  O "O3'" . U   A 1 29  ? 22.030  26.376  64.787 1.00 104.22 ? 29  U   C "O3'" 1 
ATOM   615  C "C2'" . U   A 1 29  ? 21.921  26.105  67.215 1.00 98.78  ? 29  U   C "C2'" 1 
ATOM   616  O "O2'" . U   A 1 29  ? 22.389  24.784  67.026 1.00 105.60 ? 29  U   C "O2'" 1 
ATOM   617  C "C1'" . U   A 1 29  ? 22.723  26.771  68.334 1.00 87.23  ? 29  U   C "C1'" 1 
ATOM   618  N N1    . U   A 1 29  ? 21.921  27.729  69.105 1.00 78.30  ? 29  U   C N1    1 
ATOM   619  C C2    . U   A 1 29  ? 21.196  27.244  70.180 1.00 78.96  ? 29  U   C C2    1 
ATOM   620  O O2    . U   A 1 29  ? 21.201  26.069  70.507 1.00 79.09  ? 29  U   C O2    1 
ATOM   621  N N3    . U   A 1 29  ? 20.464  28.186  70.858 1.00 68.29  ? 29  U   C N3    1 
ATOM   622  C C4    . U   A 1 29  ? 20.384  29.534  70.574 1.00 71.53  ? 29  U   C C4    1 
ATOM   623  O O4    . U   A 1 29  ? 19.665  30.254  71.267 1.00 69.12  ? 29  U   C O4    1 
ATOM   624  C C5    . U   A 1 29  ? 21.165  29.958  69.450 1.00 69.77  ? 29  U   C C5    1 
ATOM   625  C C6    . U   A 1 29  ? 21.888  29.062  68.771 1.00 68.03  ? 29  U   C C6    1 
ATOM   626  P P     . G   A 1 30  ? 20.633  26.571  64.012 1.00 106.02 ? 30  G   C P     1 
ATOM   627  O OP1   . G   A 1 30  ? 20.787  25.930  62.680 1.00 104.20 ? 30  G   C OP1   1 
ATOM   628  O OP2   . G   A 1 30  ? 20.238  28.000  64.096 1.00 102.46 ? 30  G   C OP2   1 
ATOM   629  O "O5'" . G   A 1 30  ? 19.594  25.717  64.866 1.00 95.34  ? 30  G   C "O5'" 1 
ATOM   630  C "C5'" . G   A 1 30  ? 19.701  24.300  64.930 1.00 93.08  ? 30  G   C "C5'" 1 
ATOM   631  C "C4'" . G   A 1 30  ? 18.828  23.755  66.033 1.00 96.90  ? 30  G   C "C4'" 1 
ATOM   632  O "O4'" . G   A 1 30  ? 19.226  24.357  67.295 1.00 92.47  ? 30  G   C "O4'" 1 
ATOM   633  C "C3'" . G   A 1 30  ? 17.344  24.072  65.938 1.00 102.25 ? 30  G   C "C3'" 1 
ATOM   634  O "O3'" . G   A 1 30  ? 16.666  23.175  65.062 1.00 107.30 ? 30  G   C "O3'" 1 
ATOM   635  C "C2'" . G   A 1 30  ? 16.904  23.897  67.386 1.00 100.45 ? 30  G   C "C2'" 1 
ATOM   636  O "O2'" . G   A 1 30  ? 16.769  22.539  67.759 1.00 102.51 ? 30  G   C "O2'" 1 
ATOM   637  C "C1'" . G   A 1 30  ? 18.089  24.516  68.129 1.00 89.23  ? 30  G   C "C1'" 1 
ATOM   638  N N9    . G   A 1 30  ? 17.896  25.941  68.376 1.00 84.36  ? 30  G   C N9    1 
ATOM   639  C C8    . G   A 1 30  ? 18.457  26.991  67.687 1.00 84.27  ? 30  G   C C8    1 
ATOM   640  N N7    . G   A 1 30  ? 18.078  28.158  68.135 1.00 77.26  ? 30  G   C N7    1 
ATOM   641  C C5    . G   A 1 30  ? 17.217  27.860  69.184 1.00 78.05  ? 30  G   C C5    1 
ATOM   642  C C6    . G   A 1 30  ? 16.488  28.719  70.052 1.00 81.47  ? 30  G   C C6    1 
ATOM   643  O O6    . G   A 1 30  ? 16.450  29.957  70.062 1.00 87.45  ? 30  G   C O6    1 
ATOM   644  N N1    . G   A 1 30  ? 15.743  27.995  70.978 1.00 68.79  ? 30  G   C N1    1 
ATOM   645  C C2    . G   A 1 30  ? 15.697  26.625  71.055 1.00 70.82  ? 30  G   C C2    1 
ATOM   646  N N2    . G   A 1 30  ? 14.920  26.112  72.016 1.00 55.23  ? 30  G   C N2    1 
ATOM   647  N N3    . G   A 1 30  ? 16.365  25.815  70.249 1.00 71.00  ? 30  G   C N3    1 
ATOM   648  C C4    . G   A 1 30  ? 17.100  26.495  69.347 1.00 76.40  ? 30  G   C C4    1 
ATOM   649  P P     . G   A 1 31  ? 15.235  23.589  64.450 1.00 113.04 ? 31  G   C P     1 
ATOM   650  O OP1   . G   A 1 31  ? 14.865  22.548  63.457 1.00 113.33 ? 31  G   C OP1   1 
ATOM   651  O OP2   . G   A 1 31  ? 15.278  25.016  64.036 1.00 112.06 ? 31  G   C OP2   1 
ATOM   652  O "O5'" . G   A 1 31  ? 14.236  23.465  65.684 1.00 100.37 ? 31  G   C "O5'" 1 
ATOM   653  C "C5'" . G   A 1 31  ? 13.864  22.189  66.192 1.00 94.34  ? 31  G   C "C5'" 1 
ATOM   654  C "C4'" . G   A 1 31  ? 12.790  22.338  67.240 1.00 91.55  ? 31  G   C "C4'" 1 
ATOM   655  O "O4'" . G   A 1 31  ? 13.334  23.022  68.400 1.00 92.74  ? 31  G   C "O4'" 1 
ATOM   656  C "C3'" . G   A 1 31  ? 11.604  23.197  66.838 1.00 91.52  ? 31  G   C "C3'" 1 
ATOM   657  O "O3'" . G   A 1 31  ? 10.663  22.466  66.065 1.00 93.17  ? 31  G   C "O3'" 1 
ATOM   658  C "C2'" . G   A 1 31  ? 11.047  23.607  68.192 1.00 85.70  ? 31  G   C "C2'" 1 
ATOM   659  O "O2'" . G   A 1 31  ? 10.303  22.577  68.811 1.00 80.34  ? 31  G   C "O2'" 1 
ATOM   660  C "C1'" . G   A 1 31  ? 12.337  23.853  68.975 1.00 80.74  ? 31  G   C "C1'" 1 
ATOM   661  N N9    . G   A 1 31  ? 12.790  25.239  68.889 1.00 72.22  ? 31  G   C N9    1 
ATOM   662  C C8    . G   A 1 31  ? 13.763  25.749  68.061 1.00 70.55  ? 31  G   C C8    1 
ATOM   663  N N7    . G   A 1 31  ? 13.943  27.034  68.212 1.00 58.11  ? 31  G   C N7    1 
ATOM   664  C C5    . G   A 1 31  ? 13.036  27.392  69.200 1.00 59.62  ? 31  G   C C5    1 
ATOM   665  C C6    . G   A 1 31  ? 12.772  28.654  69.788 1.00 68.34  ? 31  G   C C6    1 
ATOM   666  O O6    . G   A 1 31  ? 13.307  29.744  69.546 1.00 78.58  ? 31  G   C O6    1 
ATOM   667  N N1    . G   A 1 31  ? 11.772  28.569  70.751 1.00 58.64  ? 31  G   C N1    1 
ATOM   668  C C2    . G   A 1 31  ? 11.112  27.415  71.105 1.00 64.37  ? 31  G   C C2    1 
ATOM   669  N N2    . G   A 1 31  ? 10.176  27.533  72.059 1.00 64.11  ? 31  G   C N2    1 
ATOM   670  N N3    . G   A 1 31  ? 11.352  26.233  70.564 1.00 58.26  ? 31  G   C N3    1 
ATOM   671  C C4    . G   A 1 31  ? 12.318  26.295  69.627 1.00 55.94  ? 31  G   C C4    1 
ATOM   672  P P     . C   A 1 32  ? 9.784   23.233  64.963 1.00 91.22  ? 32  C   C P     1 
ATOM   673  O OP1   . C   A 1 32  ? 8.981   22.209  64.251 1.00 91.14  ? 32  C   C OP1   1 
ATOM   674  O OP2   . C   A 1 32  ? 10.692  24.120  64.193 1.00 82.79  ? 32  C   C OP2   1 
ATOM   675  O "O5'" . C   A 1 32  ? 8.790   24.127  65.834 1.00 83.88  ? 32  C   C "O5'" 1 
ATOM   676  C "C5'" . C   A 1 32  ? 7.854   23.512  66.715 1.00 78.05  ? 32  C   C "C5'" 1 
ATOM   677  C "C4'" . C   A 1 32  ? 7.241   24.531  67.652 1.00 84.05  ? 32  C   C "C4'" 1 
ATOM   678  O "O4'" . C   A 1 32  ? 8.270   25.116  68.502 1.00 84.69  ? 32  C   C "O4'" 1 
ATOM   679  C "C3'" . C   A 1 32  ? 6.580   25.741  67.016 1.00 85.61  ? 32  C   C "C3'" 1 
ATOM   680  O "O3'" . C   A 1 32  ? 5.275   25.447  66.539 1.00 86.98  ? 32  C   C "O3'" 1 
ATOM   681  C "C2'" . C   A 1 32  ? 6.553   26.709  68.189 1.00 83.12  ? 32  C   C "C2'" 1 
ATOM   682  O "O2'" . C   A 1 32  ? 5.560   26.371  69.139 1.00 78.98  ? 32  C   C "O2'" 1 
ATOM   683  C "C1'" . C   A 1 32  ? 7.940   26.470  68.787 1.00 75.10  ? 32  C   C "C1'" 1 
ATOM   684  N N1    . C   A 1 32  ? 8.952   27.335  68.158 1.00 68.63  ? 32  C   C N1    1 
ATOM   685  C C2    . C   A 1 32  ? 9.039   28.677  68.554 1.00 68.28  ? 32  C   C C2    1 
ATOM   686  O O2    . C   A 1 32  ? 8.278   29.091  69.445 1.00 63.83  ? 32  C   C O2    1 
ATOM   687  N N3    . C   A 1 32  ? 9.949   29.486  67.955 1.00 57.03  ? 32  C   C N3    1 
ATOM   688  C C4    . C   A 1 32  ? 10.746  28.999  66.999 1.00 55.05  ? 32  C   C C4    1 
ATOM   689  N N4    . C   A 1 32  ? 11.612  29.830  66.420 1.00 49.66  ? 32  C   C N4    1 
ATOM   690  C C5    . C   A 1 32  ? 10.687  27.635  66.589 1.00 57.93  ? 32  C   C C5    1 
ATOM   691  C C6    . C   A 1 32  ? 9.787   26.847  67.190 1.00 61.43  ? 32  C   C C6    1 
ATOM   692  P P     . C   A 1 33  ? 4.696   26.251  65.274 1.00 83.58  ? 33  C   C P     1 
ATOM   693  O OP1   . C   A 1 33  ? 3.481   25.531  64.823 1.00 90.39  ? 33  C   C OP1   1 
ATOM   694  O OP2   . C   A 1 33  ? 5.806   26.494  64.316 1.00 68.67  ? 33  C   C OP2   1 
ATOM   695  O "O5'" . C   A 1 33  ? 4.240   27.649  65.881 1.00 78.94  ? 33  C   C "O5'" 1 
ATOM   696  C "C5'" . C   A 1 33  ? 3.234   27.710  66.888 1.00 81.22  ? 33  C   C "C5'" 1 
ATOM   697  C "C4'" . C   A 1 33  ? 3.091   29.125  67.399 1.00 86.52  ? 33  C   C "C4'" 1 
ATOM   698  O "O4'" . C   A 1 33  ? 4.323   29.536  68.053 1.00 81.59  ? 33  C   C "O4'" 1 
ATOM   699  C "C3'" . C   A 1 33  ? 2.869   30.186  66.333 1.00 82.68  ? 33  C   C "C3'" 1 
ATOM   700  O "O3'" . C   A 1 33  ? 1.497   30.264  65.968 1.00 83.92  ? 33  C   C "O3'" 1 
ATOM   701  C "C2'" . C   A 1 33  ? 3.337   31.447  67.046 1.00 76.36  ? 33  C   C "C2'" 1 
ATOM   702  O "O2'" . C   A 1 33  ? 2.368   31.946  67.947 1.00 64.80  ? 33  C   C "O2'" 1 
ATOM   703  C "C1'" . C   A 1 33  ? 4.548   30.918  67.819 1.00 76.65  ? 33  C   C "C1'" 1 
ATOM   704  N N1    . C   A 1 33  ? 5.799   31.056  67.060 1.00 73.73  ? 33  C   C N1    1 
ATOM   705  C C2    . C   A 1 33  ? 6.379   32.323  66.941 1.00 75.44  ? 33  C   C C2    1 
ATOM   706  O O2    . C   A 1 33  ? 5.834   33.288  67.503 1.00 78.12  ? 33  C   C O2    1 
ATOM   707  N N3    . C   A 1 33  ? 7.516   32.464  66.220 1.00 63.72  ? 33  C   C N3    1 
ATOM   708  C C4    . C   A 1 33  ? 8.071   31.399  65.637 1.00 58.55  ? 33  C   C C4    1 
ATOM   709  N N4    . C   A 1 33  ? 9.181   31.586  64.924 1.00 54.23  ? 33  C   C N4    1 
ATOM   710  C C5    . C   A 1 33  ? 7.509   30.096  65.755 1.00 60.29  ? 33  C   C C5    1 
ATOM   711  C C6    . C   A 1 33  ? 6.384   29.971  66.469 1.00 65.74  ? 33  C   C C6    1 
ATOM   712  P P     . U   A 1 34  ? 1.095   30.665  64.465 1.00 84.30  ? 34  U   C P     1 
ATOM   713  O OP1   . U   A 1 34  ? -0.375  30.497  64.370 1.00 81.28  ? 34  U   C OP1   1 
ATOM   714  O OP2   . U   A 1 34  ? 1.983   29.946  63.516 1.00 72.99  ? 34  U   C OP2   1 
ATOM   715  O "O5'" . U   A 1 34  ? 1.418   32.222  64.372 1.00 78.24  ? 34  U   C "O5'" 1 
ATOM   716  C "C5'" . U   A 1 34  ? 0.681   33.159  65.148 1.00 80.14  ? 34  U   C "C5'" 1 
ATOM   717  C "C4'" . U   A 1 34  ? 1.314   34.528  65.071 1.00 82.10  ? 34  U   C "C4'" 1 
ATOM   718  O "O4'" . U   A 1 34  ? 2.648   34.496  65.648 1.00 79.38  ? 34  U   C "O4'" 1 
ATOM   719  C "C3'" . U   A 1 34  ? 1.545   35.086  63.679 1.00 85.42  ? 34  U   C "C3'" 1 
ATOM   720  O "O3'" . U   A 1 34  ? 0.350   35.647  63.153 1.00 84.82  ? 34  U   C "O3'" 1 
ATOM   721  C "C2'" . U   A 1 34  ? 2.599   36.153  63.950 1.00 79.49  ? 34  U   C "C2'" 1 
ATOM   722  O "O2'" . U   A 1 34  ? 2.057   37.337  64.498 1.00 85.17  ? 34  U   C "O2'" 1 
ATOM   723  C "C1'" . U   A 1 34  ? 3.467   35.456  64.999 1.00 68.24  ? 34  U   C "C1'" 1 
ATOM   724  N N1    . U   A 1 34  ? 4.607   34.764  64.386 1.00 60.56  ? 34  U   C N1    1 
ATOM   725  C C2    . U   A 1 34  ? 5.652   35.542  63.940 1.00 63.81  ? 34  U   C C2    1 
ATOM   726  O O2    . U   A 1 34  ? 5.675   36.751  64.071 1.00 80.47  ? 34  U   C O2    1 
ATOM   727  N N3    . U   A 1 34  ? 6.670   34.854  63.336 1.00 50.74  ? 34  U   C N3    1 
ATOM   728  C C4    . U   A 1 34  ? 6.751   33.498  63.145 1.00 50.91  ? 34  U   C C4    1 
ATOM   729  O O4    . U   A 1 34  ? 7.726   33.030  62.560 1.00 60.88  ? 34  U   C O4    1 
ATOM   730  C C5    . U   A 1 34  ? 5.641   32.756  63.652 1.00 51.98  ? 34  U   C C5    1 
ATOM   731  C C6    . U   A 1 34  ? 4.631   33.399  64.243 1.00 60.93  ? 34  U   C C6    1 
ATOM   732  P P     . U   A 1 35  ? 0.148   35.744  61.563 1.00 88.64  ? 35  U   C P     1 
ATOM   733  O OP1   . U   A 1 35  ? -1.246  36.216  61.361 1.00 86.14  ? 35  U   C OP1   1 
ATOM   734  O OP2   . U   A 1 35  ? 0.593   34.474  60.933 1.00 75.62  ? 35  U   C OP2   1 
ATOM   735  O "O5'" . U   A 1 35  ? 1.150   36.902  61.115 1.00 80.82  ? 35  U   C "O5'" 1 
ATOM   736  C "C5'" . U   A 1 35  ? 0.955   38.241  61.561 1.00 77.11  ? 35  U   C "C5'" 1 
ATOM   737  C "C4'" . U   A 1 35  ? 2.120   39.115  61.159 1.00 73.05  ? 35  U   C "C4'" 1 
ATOM   738  O "O4'" . U   A 1 35  ? 3.338   38.618  61.771 1.00 77.22  ? 35  U   C "O4'" 1 
ATOM   739  C "C3'" . U   A 1 35  ? 2.452   39.166  59.678 1.00 77.71  ? 35  U   C "C3'" 1 
ATOM   740  O "O3'" . U   A 1 35  ? 1.600   40.096  59.012 1.00 83.88  ? 35  U   C "O3'" 1 
ATOM   741  C "C2'" . U   A 1 35  ? 3.903   39.641  59.703 1.00 75.67  ? 35  U   C "C2'" 1 
ATOM   742  O "O2'" . U   A 1 35  ? 4.033   41.033  59.906 1.00 78.05  ? 35  U   C "O2'" 1 
ATOM   743  C "C1'" . U   A 1 35  ? 4.444   38.907  60.931 1.00 69.01  ? 35  U   C "C1'" 1 
ATOM   744  N N1    . U   A 1 35  ? 5.110   37.646  60.583 1.00 63.39  ? 35  U   C N1    1 
ATOM   745  C C2    . U   A 1 35  ? 6.354   37.729  59.990 1.00 62.45  ? 35  U   C C2    1 
ATOM   746  O O2    . U   A 1 35  ? 6.911   38.790  59.777 1.00 68.81  ? 35  U   C O2    1 
ATOM   747  N N3    . U   A 1 35  ? 6.921   36.525  59.655 1.00 53.80  ? 35  U   C N3    1 
ATOM   748  C C4    . U   A 1 35  ? 6.381   35.273  59.856 1.00 59.73  ? 35  U   C C4    1 
ATOM   749  O O4    . U   A 1 35  ? 6.994   34.281  59.462 1.00 62.64  ? 35  U   C O4    1 
ATOM   750  C C5    . U   A 1 35  ? 5.098   35.270  60.492 1.00 55.56  ? 35  U   C C5    1 
ATOM   751  C C6    . U   A 1 35  ? 4.520   36.428  60.824 1.00 58.44  ? 35  U   C C6    1 
ATOM   752  P P     . G   A 1 36  ? 1.221   39.874  57.462 1.00 75.46  ? 36  G   C P     1 
ATOM   753  O OP1   . G   A 1 36  ? 0.097   40.803  57.182 1.00 69.18  ? 36  G   C OP1   1 
ATOM   754  O OP2   . G   A 1 36  ? 1.062   38.424  57.195 1.00 76.37  ? 36  G   C OP2   1 
ATOM   755  O "O5'" . G   A 1 36  ? 2.501   40.382  56.663 1.00 61.67  ? 36  G   C "O5'" 1 
ATOM   756  C "C5'" . G   A 1 36  ? 2.868   41.757  56.679 1.00 62.50  ? 36  G   C "C5'" 1 
ATOM   757  C "C4'" . G   A 1 36  ? 4.240   41.938  56.079 1.00 60.82  ? 36  G   C "C4'" 1 
ATOM   758  O "O4'" . G   A 1 36  ? 5.207   41.206  56.873 1.00 68.18  ? 36  G   C "O4'" 1 
ATOM   759  C "C3'" . G   A 1 36  ? 4.425   41.373  54.684 1.00 70.80  ? 36  G   C "C3'" 1 
ATOM   760  O "O3'" . G   A 1 36  ? 3.955   42.297  53.709 1.00 78.53  ? 36  G   C "O3'" 1 
ATOM   761  C "C2'" . G   A 1 36  ? 5.936   41.194  54.614 1.00 61.42  ? 36  G   C "C2'" 1 
ATOM   762  O "O2'" . G   A 1 36  ? 6.609   42.409  54.358 1.00 53.71  ? 36  G   C "O2'" 1 
ATOM   763  C "C1'" . G   A 1 36  ? 6.253   40.739  56.038 1.00 60.65  ? 36  G   C "C1'" 1 
ATOM   764  N N9    . G   A 1 36  ? 6.359   39.292  56.199 1.00 57.22  ? 36  G   C N9    1 
ATOM   765  C C8    . G   A 1 36  ? 5.412   38.449  56.726 1.00 59.99  ? 36  G   C C8    1 
ATOM   766  N N7    . G   A 1 36  ? 5.795   37.201  56.752 1.00 64.96  ? 36  G   C N7    1 
ATOM   767  C C5    . G   A 1 36  ? 7.071   37.220  56.207 1.00 51.26  ? 36  G   C C5    1 
ATOM   768  C C6    . G   A 1 36  ? 7.984   36.158  55.968 1.00 56.06  ? 36  G   C C6    1 
ATOM   769  O O6    . G   A 1 36  ? 7.842   34.951  56.207 1.00 61.62  ? 36  G   C O6    1 
ATOM   770  N N1    . G   A 1 36  ? 9.163   36.618  55.390 1.00 50.54  ? 36  G   C N1    1 
ATOM   771  C C2    . G   A 1 36  ? 9.433   37.931  55.086 1.00 60.33  ? 36  G   C C2    1 
ATOM   772  N N2    . G   A 1 36  ? 10.633  38.176  54.541 1.00 51.66  ? 36  G   C N2    1 
ATOM   773  N N3    . G   A 1 36  ? 8.588   38.930  55.302 1.00 55.87  ? 36  G   C N3    1 
ATOM   774  C C4    . G   A 1 36  ? 7.435   38.503  55.859 1.00 51.40  ? 36  G   C C4    1 
ATOM   775  P P     . C   A 1 37  ? 3.255   41.754  52.369 1.00 71.59  ? 37  C   C P     1 
ATOM   776  O OP1   . C   A 1 37  ? 2.540   42.904  51.767 1.00 75.25  ? 37  C   C OP1   1 
ATOM   777  O OP2   . C   A 1 37  ? 2.506   40.515  52.705 1.00 65.42  ? 37  C   C OP2   1 
ATOM   778  O "O5'" . C   A 1 37  ? 4.479   41.371  51.423 1.00 51.45  ? 37  C   C "O5'" 1 
ATOM   779  C "C5'" . C   A 1 37  ? 5.399   42.363  50.993 1.00 52.09  ? 37  C   C "C5'" 1 
ATOM   780  C "C4'" . C   A 1 37  ? 6.708   41.728  50.582 1.00 63.67  ? 37  C   C "C4'" 1 
ATOM   781  O "O4'" . C   A 1 37  ? 7.258   40.983  51.701 1.00 69.08  ? 37  C   C "O4'" 1 
ATOM   782  C "C3'" . C   A 1 37  ? 6.636   40.693  49.476 1.00 77.27  ? 37  C   C "C3'" 1 
ATOM   783  O "O3'" . C   A 1 37  ? 6.583   41.322  48.197 1.00 87.79  ? 37  C   C "O3'" 1 
ATOM   784  C "C2'" . C   A 1 37  ? 7.935   39.919  49.693 1.00 73.50  ? 37  C   C "C2'" 1 
ATOM   785  O "O2'" . C   A 1 37  ? 9.076   40.596  49.204 1.00 77.89  ? 37  C   C "O2'" 1 
ATOM   786  C "C1'" . C   A 1 37  ? 8.011   39.881  51.218 1.00 57.53  ? 37  C   C "C1'" 1 
ATOM   787  N N1    . C   A 1 37  ? 7.465   38.650  51.808 1.00 54.64  ? 37  C   C N1    1 
ATOM   788  C C2    . C   A 1 37  ? 8.180   37.448  51.662 1.00 54.66  ? 37  C   C C2    1 
ATOM   789  O O2    . C   A 1 37  ? 9.254   37.457  51.038 1.00 42.98  ? 37  C   C O2    1 
ATOM   790  N N3    . C   A 1 37  ? 7.678   36.311  52.204 1.00 43.99  ? 37  C   C N3    1 
ATOM   791  C C4    . C   A 1 37  ? 6.513   36.345  52.863 1.00 56.27  ? 37  C   C C4    1 
ATOM   792  N N4    . C   A 1 37  ? 6.048   35.205  53.373 1.00 60.65  ? 37  C   C N4    1 
ATOM   793  C C5    . C   A 1 37  ? 5.771   37.552  53.027 1.00 52.76  ? 37  C   C C5    1 
ATOM   794  C C6    . C   A 1 37  ? 6.279   38.668  52.489 1.00 58.23  ? 37  C   C C6    1 
ATOM   795  P P     . G   A 1 38  ? 5.725   40.648  47.014 1.00 88.27  ? 38  G   C P     1 
ATOM   796  O OP1   . G   A 1 38  ? 5.617   41.651  45.923 1.00 86.71  ? 38  G   C OP1   1 
ATOM   797  O OP2   . G   A 1 38  ? 4.488   40.072  47.604 1.00 80.53  ? 38  G   C OP2   1 
ATOM   798  O "O5'" . G   A 1 38  ? 6.650   39.452  46.511 1.00 72.51  ? 38  G   C "O5'" 1 
ATOM   799  C "C5'" . G   A 1 38  ? 7.964   39.708  46.029 1.00 68.48  ? 38  G   C "C5'" 1 
ATOM   800  C "C4'" . G   A 1 38  ? 8.726   38.415  45.858 1.00 76.55  ? 38  G   C "C4'" 1 
ATOM   801  O "O4'" . G   A 1 38  ? 8.940   37.795  47.149 1.00 76.64  ? 38  G   C "O4'" 1 
ATOM   802  C "C3'" . G   A 1 38  ? 8.032   37.337  45.046 1.00 82.90  ? 38  G   C "C3'" 1 
ATOM   803  O "O3'" . G   A 1 38  ? 8.230   37.566  43.657 1.00 93.22  ? 38  G   C "O3'" 1 
ATOM   804  C "C2'" . G   A 1 38  ? 8.744   36.073  45.517 1.00 79.93  ? 38  G   C "C2'" 1 
ATOM   805  O "O2'" . G   A 1 38  ? 9.993   35.863  44.885 1.00 78.68  ? 38  G   C "O2'" 1 
ATOM   806  C "C1'" . G   A 1 38  ? 8.974   36.386  46.996 1.00 70.15  ? 38  G   C "C1'" 1 
ATOM   807  N N9    . G   A 1 38  ? 7.986   35.804  47.898 1.00 60.93  ? 38  G   C N9    1 
ATOM   808  C C8    . G   A 1 38  ? 6.961   36.456  48.540 1.00 56.79  ? 38  G   C C8    1 
ATOM   809  N N7    . G   A 1 38  ? 6.271   35.675  49.327 1.00 48.52  ? 38  G   C N7    1 
ATOM   810  C C5    . G   A 1 38  ? 6.867   34.431  49.183 1.00 39.20  ? 38  G   C C5    1 
ATOM   811  C C6    . G   A 1 38  ? 6.557   33.193  49.794 1.00 52.68  ? 38  G   C C6    1 
ATOM   812  O O6    . G   A 1 38  ? 5.662   32.942  50.614 1.00 53.22  ? 38  G   C O6    1 
ATOM   813  N N1    . G   A 1 38  ? 7.416   32.183  49.370 1.00 43.21  ? 38  G   C N1    1 
ATOM   814  C C2    . G   A 1 38  ? 8.444   32.347  48.473 1.00 56.21  ? 38  G   C C2    1 
ATOM   815  N N2    . G   A 1 38  ? 9.171   31.251  48.199 1.00 48.42  ? 38  G   C N2    1 
ATOM   816  N N3    . G   A 1 38  ? 8.740   33.499  47.892 1.00 50.47  ? 38  G   C N3    1 
ATOM   817  C C4    . G   A 1 38  ? 7.918   34.490  48.294 1.00 47.40  ? 38  G   C C4    1 
ATOM   818  P P     . C   A 1 39  ? 7.115   37.089  42.606 1.00 87.92  ? 39  C   C P     1 
ATOM   819  O OP1   . C   A 1 39  ? 7.526   37.617  41.282 1.00 86.84  ? 39  C   C OP1   1 
ATOM   820  O OP2   . C   A 1 39  ? 5.779   37.431  43.155 1.00 85.95  ? 39  C   C OP2   1 
ATOM   821  O "O5'" . C   A 1 39  ? 7.273   35.505  42.572 1.00 80.66  ? 39  C   C "O5'" 1 
ATOM   822  C "C5'" . C   A 1 39  ? 8.428   34.907  41.995 1.00 77.42  ? 39  C   C "C5'" 1 
ATOM   823  C "C4'" . C   A 1 39  ? 8.440   33.422  42.264 1.00 77.52  ? 39  C   C "C4'" 1 
ATOM   824  O "O4'" . C   A 1 39  ? 8.522   33.192  43.694 1.00 80.64  ? 39  C   C "O4'" 1 
ATOM   825  C "C3'" . C   A 1 39  ? 7.186   32.672  41.854 1.00 88.17  ? 39  C   C "C3'" 1 
ATOM   826  O "O3'" . C   A 1 39  ? 7.198   32.365  40.465 1.00 95.28  ? 39  C   C "O3'" 1 
ATOM   827  C "C2'" . C   A 1 39  ? 7.266   31.427  42.730 1.00 79.17  ? 39  C   C "C2'" 1 
ATOM   828  O "O2'" . C   A 1 39  ? 8.196   30.475  42.257 1.00 85.40  ? 39  C   C "O2'" 1 
ATOM   829  C "C1'" . C   A 1 39  ? 7.792   32.022  44.034 1.00 69.84  ? 39  C   C "C1'" 1 
ATOM   830  N N1    . C   A 1 39  ? 6.725   32.397  44.972 1.00 55.80  ? 39  C   C N1    1 
ATOM   831  C C2    . C   A 1 39  ? 6.131   31.398  45.745 1.00 54.09  ? 39  C   C C2    1 
ATOM   832  O O2    . C   A 1 39  ? 6.496   30.226  45.587 1.00 54.01  ? 39  C   C O2    1 
ATOM   833  N N3    . C   A 1 39  ? 5.170   31.734  46.636 1.00 45.26  ? 39  C   C N3    1 
ATOM   834  C C4    . C   A 1 39  ? 4.786   33.007  46.751 1.00 51.42  ? 39  C   C C4    1 
ATOM   835  N N4    . C   A 1 39  ? 3.824   33.295  47.631 1.00 45.78  ? 39  C   C N4    1 
ATOM   836  C C5    . C   A 1 39  ? 5.366   34.043  45.965 1.00 53.92  ? 39  C   C C5    1 
ATOM   837  C C6    . C   A 1 39  ? 6.324   33.697  45.097 1.00 57.94  ? 39  C   C C6    1 
ATOM   838  P P     . U   A 1 40  ? 5.821   32.387  39.637 1.00 90.41  ? 40  U   C P     1 
ATOM   839  O OP1   . U   A 1 40  ? 6.192   32.285  38.202 1.00 80.79  ? 40  U   C OP1   1 
ATOM   840  O OP2   . U   A 1 40  ? 5.012   33.542  40.108 1.00 76.16  ? 40  U   C OP2   1 
ATOM   841  O "O5'" . U   A 1 40  ? 5.089   31.042  40.083 1.00 80.62  ? 40  U   C "O5'" 1 
ATOM   842  C "C5'" . U   A 1 40  ? 5.664   29.774  39.785 1.00 76.42  ? 40  U   C "C5'" 1 
ATOM   843  C "C4'" . U   A 1 40  ? 4.958   28.676  40.546 1.00 79.95  ? 40  U   C "C4'" 1 
ATOM   844  O "O4'" . U   A 1 40  ? 5.138   28.874  41.974 1.00 85.64  ? 40  U   C "O4'" 1 
ATOM   845  C "C3'" . U   A 1 40  ? 3.451   28.604  40.386 1.00 87.88  ? 40  U   C "C3'" 1 
ATOM   846  O "O3'" . U   A 1 40  ? 3.090   27.946  39.174 1.00 88.35  ? 40  U   C "O3'" 1 
ATOM   847  C "C2'" . U   A 1 40  ? 3.046   27.801  41.619 1.00 84.61  ? 40  U   C "C2'" 1 
ATOM   848  O "O2'" . U   A 1 40  ? 3.257   26.412  41.463 1.00 86.42  ? 40  U   C "O2'" 1 
ATOM   849  C "C1'" . U   A 1 40  ? 4.015   28.349  42.671 1.00 80.76  ? 40  U   C "C1'" 1 
ATOM   850  N N1    . U   A 1 40  ? 3.424   29.423  43.482 1.00 71.16  ? 40  U   C N1    1 
ATOM   851  C C2    . U   A 1 40  ? 2.645   29.059  44.565 1.00 66.85  ? 40  U   C C2    1 
ATOM   852  O O2    . U   A 1 40  ? 2.458   27.901  44.888 1.00 67.47  ? 40  U   C O2    1 
ATOM   853  N N3    . U   A 1 40  ? 2.093   30.105  45.259 1.00 59.85  ? 40  U   C N3    1 
ATOM   854  C C4    . U   A 1 40  ? 2.242   31.450  44.992 1.00 62.89  ? 40  U   C C4    1 
ATOM   855  O O4    . U   A 1 40  ? 1.642   32.274  45.682 1.00 65.88  ? 40  U   C O4    1 
ATOM   856  C C5    . U   A 1 40  ? 3.077   31.746  43.870 1.00 65.76  ? 40  U   C C5    1 
ATOM   857  C C6    . U   A 1 40  ? 3.627   30.746  43.170 1.00 72.55  ? 40  U   C C6    1 
ATOM   858  P P     . U   A 1 41  ? 1.722   28.348  38.426 1.00 89.93  ? 41  U   C P     1 
ATOM   859  O OP1   . U   A 1 41  ? 1.734   27.685  37.098 1.00 85.33  ? 41  U   C OP1   1 
ATOM   860  O OP2   . U   A 1 41  ? 1.561   29.821  38.505 1.00 84.72  ? 41  U   C OP2   1 
ATOM   861  O "O5'" . U   A 1 41  ? 0.585   27.665  39.309 1.00 72.89  ? 41  U   C "O5'" 1 
ATOM   862  C "C5'" . U   A 1 41  ? 0.557   26.252  39.479 1.00 70.65  ? 41  U   C "C5'" 1 
ATOM   863  C "C4'" . U   A 1 41  ? -0.360  25.870  40.616 1.00 71.89  ? 41  U   C "C4'" 1 
ATOM   864  O "O4'" . U   A 1 41  ? 0.108   26.490  41.839 1.00 76.03  ? 41  U   C "O4'" 1 
ATOM   865  C "C3'" . U   A 1 41  ? -1.807  26.327  40.510 1.00 80.64  ? 41  U   C "C3'" 1 
ATOM   866  O "O3'" . U   A 1 41  ? -2.555  25.421  39.699 1.00 85.38  ? 41  U   C "O3'" 1 
ATOM   867  C "C2'" . U   A 1 41  ? -2.262  26.273  41.966 1.00 75.80  ? 41  U   C "C2'" 1 
ATOM   868  O "O2'" . U   A 1 41  ? -2.609  24.965  42.374 1.00 73.36  ? 41  U   C "O2'" 1 
ATOM   869  C "C1'" . U   A 1 41  ? -0.993  26.709  42.706 1.00 74.63  ? 41  U   C "C1'" 1 
ATOM   870  N N1    . U   A 1 41  ? -0.990  28.116  43.134 1.00 66.17  ? 41  U   C N1    1 
ATOM   871  C C2    . U   A 1 41  ? -1.693  28.434  44.284 1.00 65.81  ? 41  U   C C2    1 
ATOM   872  O O2    . U   A 1 41  ? -2.296  27.603  44.941 1.00 63.21  ? 41  U   C O2    1 
ATOM   873  N N3    . U   A 1 41  ? -1.662  29.760  44.637 1.00 59.47  ? 41  U   C N3    1 
ATOM   874  C C4    . U   A 1 41  ? -1.009  30.778  43.975 1.00 68.31  ? 41  U   C C4    1 
ATOM   875  O O4    . U   A 1 41  ? -1.075  31.924  44.418 1.00 75.54  ? 41  U   C O4    1 
ATOM   876  C C5    . U   A 1 41  ? -0.298  30.371  42.798 1.00 62.57  ? 41  U   C C5    1 
ATOM   877  C C6    . U   A 1 41  ? -0.314  29.085  42.427 1.00 67.19  ? 41  U   C C6    1 
ATOM   878  P P     . G   A 1 42  ? -3.893  25.921  38.957 1.00 80.05  ? 42  G   C P     1 
ATOM   879  O OP1   . G   A 1 42  ? -4.239  24.873  37.965 1.00 85.38  ? 42  G   C OP1   1 
ATOM   880  O OP2   . G   A 1 42  ? -3.715  27.326  38.508 1.00 75.19  ? 42  G   C OP2   1 
ATOM   881  O "O5'" . G   A 1 42  ? -5.004  25.895  40.097 1.00 68.88  ? 42  G   C "O5'" 1 
ATOM   882  C "C5'" . G   A 1 42  ? -5.433  24.662  40.660 1.00 60.41  ? 42  G   C "C5'" 1 
ATOM   883  C "C4'" . G   A 1 42  ? -6.245  24.909  41.907 1.00 66.84  ? 42  G   C "C4'" 1 
ATOM   884  O "O4'" . G   A 1 42  ? -5.425  25.591  42.888 1.00 70.50  ? 42  G   C "O4'" 1 
ATOM   885  C "C3'" . G   A 1 42  ? -7.451  25.817  41.744 1.00 71.52  ? 42  G   C "C3'" 1 
ATOM   886  O "O3'" . G   A 1 42  ? -8.564  25.065  41.274 1.00 78.61  ? 42  G   C "O3'" 1 
ATOM   887  C "C2'" . G   A 1 42  ? -7.678  26.298  43.173 1.00 69.92  ? 42  G   C "C2'" 1 
ATOM   888  O "O2'" . G   A 1 42  ? -8.364  25.342  43.954 1.00 71.04  ? 42  G   C "O2'" 1 
ATOM   889  C "C1'" . G   A 1 42  ? -6.242  26.430  43.686 1.00 67.36  ? 42  G   C "C1'" 1 
ATOM   890  N N9    . G   A 1 42  ? -5.706  27.787  43.634 1.00 57.38  ? 42  G   C N9    1 
ATOM   891  C C8    . G   A 1 42  ? -4.758  28.272  42.765 1.00 58.46  ? 42  G   C C8    1 
ATOM   892  N N7    . G   A 1 42  ? -4.468  29.529  42.972 1.00 60.58  ? 42  G   C N7    1 
ATOM   893  C C5    . G   A 1 42  ? -5.275  29.894  44.041 1.00 49.98  ? 42  G   C C5    1 
ATOM   894  C C6    . G   A 1 42  ? -5.402  31.135  44.710 1.00 57.35  ? 42  G   C C6    1 
ATOM   895  O O6    . G   A 1 42  ? -4.801  32.192  44.489 1.00 71.95  ? 42  G   C O6    1 
ATOM   896  N N1    . G   A 1 42  ? -6.341  31.072  45.734 1.00 45.77  ? 42  G   C N1    1 
ATOM   897  C C2    . G   A 1 42  ? -7.064  29.957  46.071 1.00 55.83  ? 42  G   C C2    1 
ATOM   898  N N2    . G   A 1 42  ? -7.925  30.096  47.088 1.00 52.41  ? 42  G   C N2    1 
ATOM   899  N N3    . G   A 1 42  ? -6.953  28.791  45.456 1.00 51.15  ? 42  G   C N3    1 
ATOM   900  C C4    . G   A 1 42  ? -6.047  28.832  44.458 1.00 47.95  ? 42  G   C C4    1 
ATOM   901  P P     . U   A 1 43  ? -9.585  25.717  40.217 1.00 77.25  ? 43  U   C P     1 
ATOM   902  O OP1   . U   A 1 43  ? -10.363 24.585  39.649 1.00 77.77  ? 43  U   C OP1   1 
ATOM   903  O OP2   . U   A 1 43  ? -8.837  26.624  39.310 1.00 61.59  ? 43  U   C OP2   1 
ATOM   904  O "O5'" . U   A 1 43  ? -10.573 26.583  41.117 1.00 58.68  ? 43  U   C "O5'" 1 
ATOM   905  C "C5'" . U   A 1 43  ? -11.558 25.945  41.919 1.00 70.32  ? 43  U   C "C5'" 1 
ATOM   906  C "C4'" . U   A 1 43  ? -12.162 26.928  42.891 1.00 81.84  ? 43  U   C "C4'" 1 
ATOM   907  O "O4'" . U   A 1 43  ? -11.131 27.397  43.801 1.00 81.45  ? 43  U   C "O4'" 1 
ATOM   908  C "C3'" . U   A 1 43  ? -12.707 28.212  42.287 1.00 89.14  ? 43  U   C "C3'" 1 
ATOM   909  O "O3'" . U   A 1 43  ? -14.007 28.045  41.736 1.00 94.05  ? 43  U   C "O3'" 1 
ATOM   910  C "C2'" . U   A 1 43  ? -12.711 29.137  43.495 1.00 86.83  ? 43  U   C "C2'" 1 
ATOM   911  O "O2'" . U   A 1 43  ? -13.784 28.880  44.383 1.00 86.64  ? 43  U   C "O2'" 1 
ATOM   912  C "C1'" . U   A 1 43  ? -11.389 28.749  44.156 1.00 77.59  ? 43  U   C "C1'" 1 
ATOM   913  N N1    . U   A 1 43  ? -10.271 29.578  43.684 1.00 66.00  ? 43  U   C N1    1 
ATOM   914  C C2    . U   A 1 43  ? -10.159 30.851  44.206 1.00 64.74  ? 43  U   C C2    1 
ATOM   915  O O2    . U   A 1 43  ? -10.945 31.298  45.023 1.00 69.27  ? 43  U   C O2    1 
ATOM   916  N N3    . U   A 1 43  ? -9.097  31.582  43.734 1.00 51.79  ? 43  U   C N3    1 
ATOM   917  C C4    . U   A 1 43  ? -8.157  31.176  42.808 1.00 61.94  ? 43  U   C C4    1 
ATOM   918  O O4    . U   A 1 43  ? -7.260  31.952  42.477 1.00 59.35  ? 43  U   C O4    1 
ATOM   919  C C5    . U   A 1 43  ? -8.342  29.847  42.311 1.00 58.37  ? 43  U   C C5    1 
ATOM   920  C C6    . U   A 1 43  ? -9.368  29.111  42.756 1.00 65.15  ? 43  U   C C6    1 
ATOM   921  P P     . C   A 1 44  ? -14.447 28.931  40.469 1.00 94.04  ? 44  C   C P     1 
ATOM   922  O OP1   . C   A 1 44  ? -15.751 28.395  40.006 1.00 98.00  ? 44  C   C OP1   1 
ATOM   923  O OP2   . C   A 1 44  ? -13.305 28.998  39.522 1.00 84.24  ? 44  C   C OP2   1 
ATOM   924  O "O5'" . C   A 1 44  ? -14.675 30.386  41.077 1.00 84.50  ? 44  C   C "O5'" 1 
ATOM   925  C "C5'" . C   A 1 44  ? -15.628 30.603  42.116 1.00 79.91  ? 44  C   C "C5'" 1 
ATOM   926  C "C4'" . C   A 1 44  ? -15.421 31.962  42.750 1.00 84.69  ? 44  C   C "C4'" 1 
ATOM   927  O "O4'" . C   A 1 44  ? -14.099 32.021  43.355 1.00 85.47  ? 44  C   C "O4'" 1 
ATOM   928  C "C3'" . C   A 1 44  ? -15.432 33.152  41.806 1.00 88.44  ? 44  C   C "C3'" 1 
ATOM   929  O "O3'" . C   A 1 44  ? -16.760 33.562  41.499 1.00 96.35  ? 44  C   C "O3'" 1 
ATOM   930  C "C2'" . C   A 1 44  ? -14.677 34.198  42.618 1.00 81.54  ? 44  C   C "C2'" 1 
ATOM   931  O "O2'" . C   A 1 44  ? -15.463 34.790  43.631 1.00 77.59  ? 44  C   C "O2'" 1 
ATOM   932  C "C1'" . C   A 1 44  ? -13.589 33.342  43.263 1.00 72.21  ? 44  C   C "C1'" 1 
ATOM   933  N N1    . C   A 1 44  ? -12.356 33.313  42.464 1.00 65.80  ? 44  C   C N1    1 
ATOM   934  C C2    . C   A 1 44  ? -11.524 34.434  42.479 1.00 70.61  ? 44  C   C C2    1 
ATOM   935  O O2    . C   A 1 44  ? -11.847 35.407  43.178 1.00 74.65  ? 44  C   C O2    1 
ATOM   936  N N3    . C   A 1 44  ? -10.392 34.432  41.736 1.00 59.23  ? 44  C   C N3    1 
ATOM   937  C C4    . C   A 1 44  ? -10.081 33.361  41.001 1.00 65.66  ? 44  C   C C4    1 
ATOM   938  N N4    . C   A 1 44  ? -8.958  33.402  40.278 1.00 62.40  ? 44  C   C N4    1 
ATOM   939  C C5    . C   A 1 44  ? -10.910 32.198  40.973 1.00 61.90  ? 44  C   C C5    1 
ATOM   940  C C6    . C   A 1 44  ? -12.027 32.218  41.713 1.00 62.76  ? 44  C   C C6    1 
ATOM   941  P P     . C   A 1 45  ? -17.100 34.117  40.027 1.00 99.49  ? 45  C   C P     1 
ATOM   942  O OP1   . C   A 1 45  ? -18.570 34.018  39.857 1.00 99.24  ? 45  C   C OP1   1 
ATOM   943  O OP2   . C   A 1 45  ? -16.202 33.447  39.054 1.00 93.77  ? 45  C   C OP2   1 
ATOM   944  O "O5'" . C   A 1 45  ? -16.701 35.660  40.089 1.00 94.71  ? 45  C   C "O5'" 1 
ATOM   945  C "C5'" . C   A 1 45  ? -17.322 36.535  41.025 1.00 88.65  ? 45  C   C "C5'" 1 
ATOM   946  C "C4'" . C   A 1 45  ? -16.527 37.813  41.163 1.00 90.55  ? 45  C   C "C4'" 1 
ATOM   947  O "O4'" . C   A 1 45  ? -15.192 37.510  41.649 1.00 88.46  ? 45  C   C "O4'" 1 
ATOM   948  C "C3'" . C   A 1 45  ? -16.273 38.588  39.882 1.00 94.63  ? 45  C   C "C3'" 1 
ATOM   949  O "O3'" . C   A 1 45  ? -17.396 39.397  39.551 1.00 97.15  ? 45  C   C "O3'" 1 
ATOM   950  C "C2'" . C   A 1 45  ? -15.070 39.439  40.272 1.00 93.08  ? 45  C   C "C2'" 1 
ATOM   951  O "O2'" . C   A 1 45  ? -15.426 40.555  41.064 1.00 93.29  ? 45  C   C "O2'" 1 
ATOM   952  C "C1'" . C   A 1 45  ? -14.271 38.457  41.129 1.00 83.03  ? 45  C   C "C1'" 1 
ATOM   953  N N1    . C   A 1 45  ? -13.233 37.739  40.371 1.00 82.17  ? 45  C   C N1    1 
ATOM   954  C C2    . C   A 1 45  ? -12.073 38.431  39.991 1.00 86.19  ? 45  C   C C2    1 
ATOM   955  O O2    . C   A 1 45  ? -11.956 39.625  40.306 1.00 92.08  ? 45  C   C O2    1 
ATOM   956  N N3    . C   A 1 45  ? -11.113 37.781  39.291 1.00 76.66  ? 45  C   C N3    1 
ATOM   957  C C4    . C   A 1 45  ? -11.278 36.495  38.969 1.00 79.33  ? 45  C   C C4    1 
ATOM   958  N N4    . C   A 1 45  ? -10.311 35.896  38.272 1.00 77.47  ? 45  C   C N4    1 
ATOM   959  C C5    . C   A 1 45  ? -12.446 35.766  39.345 1.00 79.27  ? 45  C   C C5    1 
ATOM   960  C C6    . C   A 1 45  ? -13.389 36.421  40.038 1.00 85.21  ? 45  C   C C6    1 
ATOM   961  P P     . C   A 1 46  ? -17.676 39.784  38.016 1.00 98.35  ? 46  C   C P     1 
ATOM   962  O OP1   . C   A 1 46  ? -18.899 40.627  38.017 1.00 98.11  ? 46  C   C OP1   1 
ATOM   963  O OP2   . C   A 1 46  ? -17.638 38.544  37.198 1.00 96.39  ? 46  C   C OP2   1 
ATOM   964  O "O5'" . C   A 1 46  ? -16.438 40.701  37.604 1.00 93.09  ? 46  C   C "O5'" 1 
ATOM   965  C "C5'" . C   A 1 46  ? -16.304 42.022  38.124 1.00 92.39  ? 46  C   C "C5'" 1 
ATOM   966  C "C4'" . C   A 1 46  ? -15.047 42.676  37.596 1.00 90.07  ? 46  C   C "C4'" 1 
ATOM   967  O "O4'" . C   A 1 46  ? -13.882 41.945  38.052 1.00 89.36  ? 46  C   C "O4'" 1 
ATOM   968  C "C3'" . C   A 1 46  ? -14.886 42.690  36.087 1.00 93.50  ? 46  C   C "C3'" 1 
ATOM   969  O "O3'" . C   A 1 46  ? -15.711 43.678  35.462 1.00 98.58  ? 46  C   C "O3'" 1 
ATOM   970  C "C2'" . C   A 1 46  ? -13.383 42.891  35.922 1.00 88.64  ? 46  C   C "C2'" 1 
ATOM   971  O "O2'" . C   A 1 46  ? -12.970 44.236  36.046 1.00 89.42  ? 46  C   C "O2'" 1 
ATOM   972  C "C1'" . C   A 1 46  ? -12.837 42.083  37.102 1.00 84.73  ? 46  C   C "C1'" 1 
ATOM   973  N N1    . C   A 1 46  ? -12.384 40.744  36.707 1.00 76.15  ? 46  C   C N1    1 
ATOM   974  C C2    . C   A 1 46  ? -11.120 40.612  36.126 1.00 76.06  ? 46  C   C C2    1 
ATOM   975  O O2    . C   A 1 46  ? -10.416 41.626  35.988 1.00 67.79  ? 46  C   C O2    1 
ATOM   976  N N3    . C   A 1 46  ? -10.697 39.388  35.734 1.00 70.39  ? 46  C   C N3    1 
ATOM   977  C C4    . C   A 1 46  ? -11.482 38.322  35.914 1.00 73.84  ? 46  C   C C4    1 
ATOM   978  N N4    . C   A 1 46  ? -11.025 37.133  35.514 1.00 74.92  ? 46  C   C N4    1 
ATOM   979  C C5    . C   A 1 46  ? -12.771 38.429  36.514 1.00 70.38  ? 46  C   C C5    1 
ATOM   980  C C6    . C   A 1 46  ? -13.178 39.648  36.892 1.00 71.54  ? 46  C   C C6    1 
ATOM   981  N N     . LYS B 2 2   ? -0.052  -12.932 27.105 1.00 119.17 ? 2   LYS A N     1 
ATOM   982  C CA    . LYS B 2 2   ? -0.331  -13.259 25.679 1.00 123.14 ? 2   LYS A CA    1 
ATOM   983  C C     . LYS B 2 2   ? 0.950   -13.609 24.922 1.00 125.56 ? 2   LYS A C     1 
ATOM   984  O O     . LYS B 2 2   ? 1.445   -14.734 25.008 1.00 127.66 ? 2   LYS A O     1 
ATOM   985  C CB    . LYS B 2 2   ? -1.032  -12.079 24.997 1.00 123.50 ? 2   LYS A CB    1 
ATOM   986  C CG    . LYS B 2 2   ? -1.415  -12.334 23.544 1.00 124.90 ? 2   LYS A CG    1 
ATOM   987  C CD    . LYS B 2 2   ? -2.196  -11.168 22.959 1.00 126.99 ? 2   LYS A CD    1 
ATOM   988  C CE    . LYS B 2 2   ? -1.383  -9.885  22.982 1.00 132.06 ? 2   LYS A CE    1 
ATOM   989  N NZ    . LYS B 2 2   ? -2.159  -8.728  22.457 1.00 136.38 ? 2   LYS A NZ    1 
ATOM   990  N N     . MET B 2 3   ? 1.487   -12.643 24.184 1.00 126.67 ? 3   MET A N     1 
ATOM   991  C CA    . MET B 2 3   ? 2.703   -12.867 23.413 1.00 129.25 ? 3   MET A CA    1 
ATOM   992  C C     . MET B 2 3   ? 3.916   -12.250 24.094 1.00 130.29 ? 3   MET A C     1 
ATOM   993  O O     . MET B 2 3   ? 4.070   -11.029 24.127 1.00 130.23 ? 3   MET A O     1 
ATOM   994  C CB    . MET B 2 3   ? 2.555   -12.277 22.009 1.00 134.68 ? 3   MET A CB    1 
ATOM   995  C CG    . MET B 2 3   ? 3.722   -12.582 21.084 1.00 138.83 ? 3   MET A CG    1 
ATOM   996  S SD    . MET B 2 3   ? 3.887   -14.345 20.730 1.00 146.07 ? 3   MET A SD    1 
ATOM   997  C CE    . MET B 2 3   ? 5.014   -14.858 22.026 1.00 143.12 ? 3   MET A CE    1 
ATOM   998  N N     . LEU B 2 4   ? 4.780   -13.104 24.632 1.00 132.33 ? 4   LEU A N     1 
ATOM   999  C CA    . LEU B 2 4   ? 5.983   -12.644 25.313 1.00 131.82 ? 4   LEU A CA    1 
ATOM   1000 C C     . LEU B 2 4   ? 7.038   -12.185 24.310 1.00 129.97 ? 4   LEU A C     1 
ATOM   1001 O O     . LEU B 2 4   ? 8.224   -12.110 24.632 1.00 127.39 ? 4   LEU A O     1 
ATOM   1002 C CB    . LEU B 2 4   ? 6.551   -13.762 26.193 1.00 131.40 ? 4   LEU A CB    1 
ATOM   1003 C CG    . LEU B 2 4   ? 5.608   -14.336 27.256 1.00 133.77 ? 4   LEU A CG    1 
ATOM   1004 C CD1   . LEU B 2 4   ? 6.339   -15.399 28.061 1.00 133.77 ? 4   LEU A CD1   1 
ATOM   1005 C CD2   . LEU B 2 4   ? 5.109   -13.227 28.170 1.00 131.11 ? 4   LEU A CD2   1 
ATOM   1006 N N     . GLU B 2 5   ? 6.602   -11.889 23.089 1.00 129.13 ? 5   GLU A N     1 
ATOM   1007 C CA    . GLU B 2 5   ? 7.507   -11.417 22.050 1.00 131.14 ? 5   GLU A CA    1 
ATOM   1008 C C     . GLU B 2 5   ? 7.018   -10.086 21.490 1.00 130.38 ? 5   GLU A C     1 
ATOM   1009 O O     . GLU B 2 5   ? 7.798   -9.312  20.935 1.00 130.00 ? 5   GLU A O     1 
ATOM   1010 C CB    . GLU B 2 5   ? 7.640   -12.451 20.927 1.00 133.27 ? 5   GLU A CB    1 
ATOM   1011 C CG    . GLU B 2 5   ? 8.516   -13.644 21.296 1.00 137.18 ? 5   GLU A CG    1 
ATOM   1012 C CD    . GLU B 2 5   ? 8.837   -14.532 20.107 1.00 136.86 ? 5   GLU A CD    1 
ATOM   1013 O OE1   . GLU B 2 5   ? 9.406   -14.022 19.118 1.00 136.74 ? 5   GLU A OE1   1 
ATOM   1014 O OE2   . GLU B 2 5   ? 8.524   -15.741 20.162 1.00 135.35 ? 5   GLU A OE2   1 
ATOM   1015 N N     . GLN B 2 6   ? 5.724   -9.823  21.642 1.00 130.65 ? 6   GLN A N     1 
ATOM   1016 C CA    . GLN B 2 6   ? 5.145   -8.569  21.173 1.00 130.47 ? 6   GLN A CA    1 
ATOM   1017 C C     . GLN B 2 6   ? 5.636   -7.464  22.099 1.00 129.06 ? 6   GLN A C     1 
ATOM   1018 O O     . GLN B 2 6   ? 5.830   -6.321  21.683 1.00 127.66 ? 6   GLN A O     1 
ATOM   1019 C CB    . GLN B 2 6   ? 3.614   -8.634  21.220 1.00 131.46 ? 6   GLN A CB    1 
ATOM   1020 C CG    . GLN B 2 6   ? 2.919   -7.696  20.235 1.00 134.39 ? 6   GLN A CG    1 
ATOM   1021 C CD    . GLN B 2 6   ? 1.595   -7.156  20.757 1.00 134.65 ? 6   GLN A CD    1 
ATOM   1022 O OE1   . GLN B 2 6   ? 1.423   -5.946  20.915 1.00 131.54 ? 6   GLN A OE1   1 
ATOM   1023 N NE2   . GLN B 2 6   ? 0.654   -8.053  21.028 1.00 133.60 ? 6   GLN A NE2   1 
ATOM   1024 N N     . LEU B 2 7   ? 5.834   -7.829  23.363 1.00 127.93 ? 7   LEU A N     1 
ATOM   1025 C CA    . LEU B 2 7   ? 6.307   -6.907  24.386 1.00 124.02 ? 7   LEU A CA    1 
ATOM   1026 C C     . LEU B 2 7   ? 7.788   -6.606  24.183 1.00 122.42 ? 7   LEU A C     1 
ATOM   1027 O O     . LEU B 2 7   ? 8.243   -5.489  24.429 1.00 120.17 ? 7   LEU A O     1 
ATOM   1028 C CB    . LEU B 2 7   ? 6.081   -7.515  25.772 1.00 119.43 ? 7   LEU A CB    1 
ATOM   1029 C CG    . LEU B 2 7   ? 6.570   -6.725  26.986 1.00 118.67 ? 7   LEU A CG    1 
ATOM   1030 C CD1   . LEU B 2 7   ? 5.967   -5.330  26.978 1.00 121.79 ? 7   LEU A CD1   1 
ATOM   1031 C CD2   . LEU B 2 7   ? 6.188   -7.470  28.254 1.00 117.24 ? 7   LEU A CD2   1 
ATOM   1032 N N     . GLU B 2 8   ? 8.534   -7.611  23.735 1.00 122.93 ? 8   GLU A N     1 
ATOM   1033 C CA    . GLU B 2 8   ? 9.961   -7.450  23.488 1.00 126.59 ? 8   GLU A CA    1 
ATOM   1034 C C     . GLU B 2 8   ? 10.171  -6.433  22.375 1.00 126.25 ? 8   GLU A C     1 
ATOM   1035 O O     . GLU B 2 8   ? 11.067  -5.591  22.450 1.00 125.85 ? 8   GLU A O     1 
ATOM   1036 C CB    . GLU B 2 8   ? 10.588  -8.784  23.079 1.00 130.62 ? 8   GLU A CB    1 
ATOM   1037 C CG    . GLU B 2 8   ? 10.510  -9.871  24.136 1.00 137.42 ? 8   GLU A CG    1 
ATOM   1038 C CD    . GLU B 2 8   ? 11.186  -11.158 23.696 1.00 140.56 ? 8   GLU A CD    1 
ATOM   1039 O OE1   . GLU B 2 8   ? 11.729  -11.197 22.571 1.00 140.49 ? 8   GLU A OE1   1 
ATOM   1040 O OE2   . GLU B 2 8   ? 11.175  -12.132 24.476 1.00 144.47 ? 8   GLU A OE2   1 
ATOM   1041 N N     . LYS B 2 9   ? 9.338   -6.522  21.341 1.00 124.64 ? 9   LYS A N     1 
ATOM   1042 C CA    . LYS B 2 9   ? 9.426   -5.609  20.208 1.00 124.56 ? 9   LYS A CA    1 
ATOM   1043 C C     . LYS B 2 9   ? 9.261   -4.172  20.697 1.00 122.00 ? 9   LYS A C     1 
ATOM   1044 O O     . LYS B 2 9   ? 10.064  -3.298  20.366 1.00 118.20 ? 9   LYS A O     1 
ATOM   1045 C CB    . LYS B 2 9   ? 8.343   -5.937  19.173 1.00 124.45 ? 9   LYS A CB    1 
ATOM   1046 C CG    . LYS B 2 9   ? 8.504   -5.188  17.855 1.00 124.21 ? 9   LYS A CG    1 
ATOM   1047 C CD    . LYS B 2 9   ? 7.391   -5.522  16.871 1.00 119.57 ? 9   LYS A CD    1 
ATOM   1048 C CE    . LYS B 2 9   ? 7.632   -4.860  15.518 1.00 117.58 ? 9   LYS A CE    1 
ATOM   1049 N NZ    . LYS B 2 9   ? 7.730   -3.375  15.616 1.00 112.05 ? 9   LYS A NZ    1 
ATOM   1050 N N     . LYS B 2 10  ? 8.219   -3.935  21.488 1.00 119.11 ? 10  LYS A N     1 
ATOM   1051 C CA    . LYS B 2 10  ? 7.965   -2.607  22.027 1.00 120.52 ? 10  LYS A CA    1 
ATOM   1052 C C     . LYS B 2 10  ? 9.173   -2.133  22.829 1.00 121.84 ? 10  LYS A C     1 
ATOM   1053 O O     . LYS B 2 10  ? 9.777   -1.107  22.516 1.00 122.60 ? 10  LYS A O     1 
ATOM   1054 C CB    . LYS B 2 10  ? 6.732   -2.622  22.931 1.00 117.91 ? 10  LYS A CB    1 
ATOM   1055 C CG    . LYS B 2 10  ? 5.510   -3.270  22.314 1.00 120.11 ? 10  LYS A CG    1 
ATOM   1056 C CD    . LYS B 2 10  ? 4.241   -2.764  22.978 1.00 119.21 ? 10  LYS A CD    1 
ATOM   1057 C CE    . LYS B 2 10  ? 3.064   -2.806  22.022 1.00 122.43 ? 10  LYS A CE    1 
ATOM   1058 N NZ    . LYS B 2 10  ? 1.877   -3.443  22.652 1.00 125.34 ? 10  LYS A NZ    1 
ATOM   1059 N N     . LEU B 2 11  ? 9.523   -2.896  23.861 1.00 121.14 ? 11  LEU A N     1 
ATOM   1060 C CA    . LEU B 2 11  ? 10.650  -2.567  24.727 1.00 120.88 ? 11  LEU A CA    1 
ATOM   1061 C C     . LEU B 2 11  ? 11.947  -2.282  23.977 1.00 120.72 ? 11  LEU A C     1 
ATOM   1062 O O     . LEU B 2 11  ? 12.765  -1.477  24.423 1.00 120.48 ? 11  LEU A O     1 
ATOM   1063 C CB    . LEU B 2 11  ? 10.885  -3.697  25.732 1.00 120.31 ? 11  LEU A CB    1 
ATOM   1064 C CG    . LEU B 2 11  ? 9.801   -3.894  26.793 1.00 124.81 ? 11  LEU A CG    1 
ATOM   1065 C CD1   . LEU B 2 11  ? 10.115  -5.124  27.626 1.00 125.09 ? 11  LEU A CD1   1 
ATOM   1066 C CD2   . LEU B 2 11  ? 9.718   -2.655  27.675 1.00 125.74 ? 11  LEU A CD2   1 
ATOM   1067 N N     . GLY B 2 12  ? 12.138  -2.941  22.840 1.00 119.19 ? 12  GLY A N     1 
ATOM   1068 C CA    . GLY B 2 12  ? 13.352  -2.731  22.075 1.00 117.67 ? 12  GLY A CA    1 
ATOM   1069 C C     . GLY B 2 12  ? 14.483  -3.578  22.623 1.00 116.45 ? 12  GLY A C     1 
ATOM   1070 O O     . GLY B 2 12  ? 15.657  -3.235  22.485 1.00 112.79 ? 12  GLY A O     1 
ATOM   1071 N N     . TYR B 2 13  ? 14.119  -4.691  23.251 1.00 116.85 ? 13  TYR A N     1 
ATOM   1072 C CA    . TYR B 2 13  ? 15.096  -5.606  23.828 1.00 120.15 ? 13  TYR A CA    1 
ATOM   1073 C C     . TYR B 2 13  ? 14.669  -7.050  23.577 1.00 120.91 ? 13  TYR A C     1 
ATOM   1074 O O     . TYR B 2 13  ? 13.506  -7.410  23.777 1.00 117.30 ? 13  TYR A O     1 
ATOM   1075 C CB    . TYR B 2 13  ? 15.224  -5.359  25.336 1.00 120.08 ? 13  TYR A CB    1 
ATOM   1076 C CG    . TYR B 2 13  ? 16.276  -6.208  26.021 1.00 117.79 ? 13  TYR A CG    1 
ATOM   1077 C CD1   . TYR B 2 13  ? 17.634  -6.019  25.758 1.00 115.26 ? 13  TYR A CD1   1 
ATOM   1078 C CD2   . TYR B 2 13  ? 15.915  -7.203  26.932 1.00 114.16 ? 13  TYR A CD2   1 
ATOM   1079 C CE1   . TYR B 2 13  ? 18.604  -6.798  26.385 1.00 110.53 ? 13  TYR A CE1   1 
ATOM   1080 C CE2   . TYR B 2 13  ? 16.879  -7.988  27.563 1.00 110.92 ? 13  TYR A CE2   1 
ATOM   1081 C CZ    . TYR B 2 13  ? 18.220  -7.778  27.284 1.00 111.54 ? 13  TYR A CZ    1 
ATOM   1082 O OH    . TYR B 2 13  ? 19.177  -8.545  27.904 1.00 114.46 ? 13  TYR A OH    1 
ATOM   1083 N N     . THR B 2 14  ? 15.616  -7.871  23.133 1.00 122.28 ? 14  THR A N     1 
ATOM   1084 C CA    . THR B 2 14  ? 15.349  -9.277  22.858 1.00 125.08 ? 14  THR A CA    1 
ATOM   1085 C C     . THR B 2 14  ? 15.799  -10.120 24.047 1.00 124.27 ? 14  THR A C     1 
ATOM   1086 O O     . THR B 2 14  ? 16.996  -10.289 24.283 1.00 123.91 ? 14  THR A O     1 
ATOM   1087 C CB    . THR B 2 14  ? 16.100  -9.748  21.594 1.00 126.89 ? 14  THR A CB    1 
ATOM   1088 O OG1   . THR B 2 14  ? 15.801  -8.869  20.502 1.00 127.17 ? 14  THR A OG1   1 
ATOM   1089 C CG2   . THR B 2 14  ? 15.680  -11.164 21.221 1.00 126.69 ? 14  THR A CG2   1 
ATOM   1090 N N     . PHE B 2 15  ? 14.833  -10.640 24.797 1.00 123.80 ? 15  PHE A N     1 
ATOM   1091 C CA    . PHE B 2 15  ? 15.133  -11.459 25.965 1.00 126.27 ? 15  PHE A CA    1 
ATOM   1092 C C     . PHE B 2 15  ? 15.823  -12.769 25.619 1.00 125.45 ? 15  PHE A C     1 
ATOM   1093 O O     . PHE B 2 15  ? 15.303  -13.572 24.842 1.00 125.97 ? 15  PHE A O     1 
ATOM   1094 C CB    . PHE B 2 15  ? 13.851  -11.757 26.748 1.00 124.90 ? 15  PHE A CB    1 
ATOM   1095 C CG    . PHE B 2 15  ? 13.517  -10.721 27.780 1.00 124.90 ? 15  PHE A CG    1 
ATOM   1096 C CD1   . PHE B 2 15  ? 13.320  -9.393  27.417 1.00 124.12 ? 15  PHE A CD1   1 
ATOM   1097 C CD2   . PHE B 2 15  ? 13.409  -11.072 29.122 1.00 122.26 ? 15  PHE A CD2   1 
ATOM   1098 C CE1   . PHE B 2 15  ? 13.021  -8.430  28.376 1.00 124.67 ? 15  PHE A CE1   1 
ATOM   1099 C CE2   . PHE B 2 15  ? 13.111  -10.116 30.087 1.00 123.27 ? 15  PHE A CE2   1 
ATOM   1100 C CZ    . PHE B 2 15  ? 12.917  -8.793  29.713 1.00 123.24 ? 15  PHE A CZ    1 
ATOM   1101 N N     . LYS B 2 16  ? 16.999  -12.976 26.202 1.00 123.27 ? 16  LYS A N     1 
ATOM   1102 C CA    . LYS B 2 16  ? 17.762  -14.196 25.981 1.00 121.86 ? 16  LYS A CA    1 
ATOM   1103 C C     . LYS B 2 16  ? 17.566  -15.113 27.184 1.00 121.76 ? 16  LYS A C     1 
ATOM   1104 O O     . LYS B 2 16  ? 18.408  -15.956 27.489 1.00 122.13 ? 16  LYS A O     1 
ATOM   1105 C CB    . LYS B 2 16  ? 19.244  -13.867 25.780 1.00 115.17 ? 16  LYS A CB    1 
ATOM   1106 C CG    . LYS B 2 16  ? 19.884  -13.071 26.903 1.00 107.91 ? 16  LYS A CG    1 
ATOM   1107 C CD    . LYS B 2 16  ? 21.211  -12.473 26.452 1.00 102.90 ? 16  LYS A CD    1 
ATOM   1108 C CE    . LYS B 2 16  ? 22.162  -13.544 25.940 1.00 104.12 ? 16  LYS A CE    1 
ATOM   1109 N NZ    . LYS B 2 16  ? 23.404  -12.965 25.361 1.00 102.06 ? 16  LYS A NZ    1 
ATOM   1110 N N     . ASP B 2 17  ? 16.432  -14.925 27.857 1.00 122.94 ? 17  ASP A N     1 
ATOM   1111 C CA    . ASP B 2 17  ? 16.048  -15.705 29.032 1.00 125.20 ? 17  ASP A CA    1 
ATOM   1112 C C     . ASP B 2 17  ? 14.546  -15.548 29.252 1.00 122.64 ? 17  ASP A C     1 
ATOM   1113 O O     . ASP B 2 17  ? 14.112  -15.173 30.340 1.00 121.78 ? 17  ASP A O     1 
ATOM   1114 C CB    . ASP B 2 17  ? 16.784  -15.211 30.281 1.00 125.99 ? 17  ASP A CB    1 
ATOM   1115 C CG    . ASP B 2 17  ? 18.274  -15.464 30.220 1.00 130.69 ? 17  ASP A CG    1 
ATOM   1116 O OD1   . ASP B 2 17  ? 18.669  -16.641 30.083 1.00 132.98 ? 17  ASP A OD1   1 
ATOM   1117 O OD2   . ASP B 2 17  ? 19.049  -14.489 30.313 1.00 132.17 ? 17  ASP A OD2   1 
ATOM   1118 N N     . LYS B 2 18  ? 13.766  -15.832 28.211 1.00 122.40 ? 18  LYS A N     1 
ATOM   1119 C CA    . LYS B 2 18  ? 12.307  -15.721 28.249 1.00 120.22 ? 18  LYS A CA    1 
ATOM   1120 C C     . LYS B 2 18  ? 11.704  -15.997 29.621 1.00 117.81 ? 18  LYS A C     1 
ATOM   1121 O O     . LYS B 2 18  ? 10.703  -15.391 29.998 1.00 117.24 ? 18  LYS A O     1 
ATOM   1122 C CB    . LYS B 2 18  ? 11.681  -16.682 27.234 1.00 117.11 ? 18  LYS A CB    1 
ATOM   1123 C CG    . LYS B 2 18  ? 12.082  -16.435 25.789 1.00 115.59 ? 18  LYS A CG    1 
ATOM   1124 C CD    . LYS B 2 18  ? 11.560  -15.105 25.278 1.00 114.06 ? 18  LYS A CD    1 
ATOM   1125 C CE    . LYS B 2 18  ? 11.905  -14.911 23.810 1.00 116.68 ? 18  LYS A CE    1 
ATOM   1126 N NZ    . LYS B 2 18  ? 13.377  -14.920 23.573 1.00 115.22 ? 18  LYS A NZ    1 
ATOM   1127 N N     . SER B 2 19  ? 12.312  -16.920 30.356 1.00 118.28 ? 19  SER A N     1 
ATOM   1128 C CA    . SER B 2 19  ? 11.840  -17.281 31.687 1.00 120.70 ? 19  SER A CA    1 
ATOM   1129 C C     . SER B 2 19  ? 11.657  -16.062 32.593 1.00 119.82 ? 19  SER A C     1 
ATOM   1130 O O     . SER B 2 19  ? 10.671  -15.967 33.328 1.00 116.31 ? 19  SER A O     1 
ATOM   1131 C CB    . SER B 2 19  ? 12.817  -18.271 32.329 1.00 119.97 ? 19  SER A CB    1 
ATOM   1132 O OG    . SER B 2 19  ? 14.145  -17.778 32.284 1.00 122.10 ? 19  SER A OG    1 
ATOM   1133 N N     . LEU B 2 20  ? 12.607  -15.133 32.537 1.00 119.01 ? 20  LEU A N     1 
ATOM   1134 C CA    . LEU B 2 20  ? 12.547  -13.925 33.354 1.00 117.30 ? 20  LEU A CA    1 
ATOM   1135 C C     . LEU B 2 20  ? 11.285  -13.125 33.059 1.00 114.84 ? 20  LEU A C     1 
ATOM   1136 O O     . LEU B 2 20  ? 10.399  -13.014 33.907 1.00 116.87 ? 20  LEU A O     1 
ATOM   1137 C CB    . LEU B 2 20  ? 13.781  -13.055 33.101 1.00 115.72 ? 20  LEU A CB    1 
ATOM   1138 C CG    . LEU B 2 20  ? 15.127  -13.686 33.461 1.00 116.88 ? 20  LEU A CG    1 
ATOM   1139 C CD1   . LEU B 2 20  ? 16.258  -12.725 33.120 1.00 115.52 ? 20  LEU A CD1   1 
ATOM   1140 C CD2   . LEU B 2 20  ? 15.144  -14.034 34.942 1.00 112.06 ? 20  LEU A CD2   1 
ATOM   1141 N N     . LEU B 2 21  ? 11.213  -12.567 31.854 1.00 111.28 ? 21  LEU A N     1 
ATOM   1142 C CA    . LEU B 2 21  ? 10.063  -11.776 31.426 1.00 110.10 ? 21  LEU A CA    1 
ATOM   1143 C C     . LEU B 2 21  ? 8.763   -12.448 31.861 1.00 109.06 ? 21  LEU A C     1 
ATOM   1144 O O     . LEU B 2 21  ? 7.768   -11.785 32.155 1.00 105.63 ? 21  LEU A O     1 
ATOM   1145 C CB    . LEU B 2 21  ? 10.082  -11.621 29.903 1.00 111.25 ? 21  LEU A CB    1 
ATOM   1146 C CG    . LEU B 2 21  ? 8.966   -10.814 29.240 1.00 110.33 ? 21  LEU A CG    1 
ATOM   1147 C CD1   . LEU B 2 21  ? 8.927   -9.404  29.807 1.00 111.54 ? 21  LEU A CD1   1 
ATOM   1148 C CD2   . LEU B 2 21  ? 9.207   -10.776 27.742 1.00 108.08 ? 21  LEU A CD2   1 
ATOM   1149 N N     . GLU B 2 22  ? 8.790   -13.774 31.899 1.00 110.50 ? 22  GLU A N     1 
ATOM   1150 C CA    . GLU B 2 22  ? 7.640   -14.569 32.299 1.00 113.79 ? 22  GLU A CA    1 
ATOM   1151 C C     . GLU B 2 22  ? 7.255   -14.245 33.734 1.00 111.68 ? 22  GLU A C     1 
ATOM   1152 O O     . GLU B 2 22  ? 6.121   -13.861 34.017 1.00 113.16 ? 22  GLU A O     1 
ATOM   1153 C CB    . GLU B 2 22  ? 7.981   -16.056 32.177 1.00 118.87 ? 22  GLU A CB    1 
ATOM   1154 C CG    . GLU B 2 22  ? 6.909   -17.004 32.679 1.00 123.24 ? 22  GLU A CG    1 
ATOM   1155 C CD    . GLU B 2 22  ? 5.603   -16.842 31.939 1.00 124.54 ? 22  GLU A CD    1 
ATOM   1156 O OE1   . GLU B 2 22  ? 4.924   -15.815 32.145 1.00 127.02 ? 22  GLU A OE1   1 
ATOM   1157 O OE2   . GLU B 2 22  ? 5.259   -17.741 31.144 1.00 127.89 ? 22  GLU A OE2   1 
ATOM   1158 N N     . LYS B 2 23  ? 8.218   -14.406 34.635 1.00 110.93 ? 23  LYS A N     1 
ATOM   1159 C CA    . LYS B 2 23  ? 8.014   -14.146 36.055 1.00 107.50 ? 23  LYS A CA    1 
ATOM   1160 C C     . LYS B 2 23  ? 7.635   -12.689 36.309 1.00 101.32 ? 23  LYS A C     1 
ATOM   1161 O O     . LYS B 2 23  ? 6.656   -12.400 37.001 1.00 97.23  ? 23  LYS A O     1 
ATOM   1162 C CB    . LYS B 2 23  ? 9.292   -14.490 36.823 1.00 106.37 ? 23  LYS A CB    1 
ATOM   1163 C CG    . LYS B 2 23  ? 9.147   -14.465 38.333 1.00 105.45 ? 23  LYS A CG    1 
ATOM   1164 C CD    . LYS B 2 23  ? 10.483  -14.704 39.017 1.00 101.27 ? 23  LYS A CD    1 
ATOM   1165 C CE    . LYS B 2 23  ? 11.076  -16.049 38.630 1.00 99.55  ? 23  LYS A CE    1 
ATOM   1166 N NZ    . LYS B 2 23  ? 12.442  -16.230 39.190 1.00 96.90  ? 23  LYS A NZ    1 
ATOM   1167 N N     . ALA B 2 24  ? 8.416   -11.776 35.741 1.00 93.64  ? 24  ALA A N     1 
ATOM   1168 C CA    . ALA B 2 24  ? 8.186   -10.348 35.902 1.00 95.16  ? 24  ALA A CA    1 
ATOM   1169 C C     . ALA B 2 24  ? 6.765   -9.920  35.554 1.00 93.66  ? 24  ALA A C     1 
ATOM   1170 O O     . ALA B 2 24  ? 6.360   -8.801  35.865 1.00 95.34  ? 24  ALA A O     1 
ATOM   1171 C CB    . ALA B 2 24  ? 9.179   -9.570  35.058 1.00 91.31  ? 24  ALA A CB    1 
ATOM   1172 N N     . LEU B 2 25  ? 6.009   -10.811 34.917 1.00 94.30  ? 25  LEU A N     1 
ATOM   1173 C CA    . LEU B 2 25  ? 4.634   -10.511 34.522 1.00 94.46  ? 25  LEU A CA    1 
ATOM   1174 C C     . LEU B 2 25  ? 3.608   -11.384 35.227 1.00 89.93  ? 25  LEU A C     1 
ATOM   1175 O O     . LEU B 2 25  ? 2.421   -11.069 35.232 1.00 90.51  ? 25  LEU A O     1 
ATOM   1176 C CB    . LEU B 2 25  ? 4.475   -10.677 33.010 1.00 92.61  ? 25  LEU A CB    1 
ATOM   1177 C CG    . LEU B 2 25  ? 5.275   -9.712  32.136 1.00 96.68  ? 25  LEU A CG    1 
ATOM   1178 C CD1   . LEU B 2 25  ? 5.233   -10.163 30.686 1.00 99.30  ? 25  LEU A CD1   1 
ATOM   1179 C CD2   . LEU B 2 25  ? 4.703   -8.314  32.284 1.00 96.70  ? 25  LEU A CD2   1 
ATOM   1180 N N     . THR B 2 26  ? 4.065   -12.480 35.821 1.00 89.75  ? 26  THR A N     1 
ATOM   1181 C CA    . THR B 2 26  ? 3.168   -13.399 36.511 1.00 92.15  ? 26  THR A CA    1 
ATOM   1182 C C     . THR B 2 26  ? 2.865   -12.959 37.942 1.00 90.74  ? 26  THR A C     1 
ATOM   1183 O O     . THR B 2 26  ? 3.763   -12.857 38.777 1.00 89.06  ? 26  THR A O     1 
ATOM   1184 C CB    . THR B 2 26  ? 3.760   -14.816 36.543 1.00 91.02  ? 26  THR A CB    1 
ATOM   1185 O OG1   . THR B 2 26  ? 4.180   -15.185 35.223 1.00 84.76  ? 26  THR A OG1   1 
ATOM   1186 C CG2   . THR B 2 26  ? 2.720   -15.812 37.032 1.00 91.48  ? 26  THR A CG2   1 
ATOM   1187 N N     . HIS B 2 27  ? 1.591   -12.706 38.218 1.00 90.93  ? 27  HIS A N     1 
ATOM   1188 C CA    . HIS B 2 27  ? 1.158   -12.275 39.542 1.00 95.04  ? 27  HIS A CA    1 
ATOM   1189 C C     . HIS B 2 27  ? 1.225   -13.433 40.534 1.00 96.89  ? 27  HIS A C     1 
ATOM   1190 O O     . HIS B 2 27  ? 1.612   -14.544 40.175 1.00 99.05  ? 27  HIS A O     1 
ATOM   1191 C CB    . HIS B 2 27  ? -0.266  -11.711 39.461 1.00 85.29  ? 27  HIS A CB    1 
ATOM   1192 C CG    . HIS B 2 27  ? -0.764  -11.119 40.743 1.00 78.45  ? 27  HIS A CG    1 
ATOM   1193 N ND1   . HIS B 2 27  ? -1.309  -11.881 41.754 1.00 77.41  ? 27  HIS A ND1   1 
ATOM   1194 C CD2   . HIS B 2 27  ? -0.802  -9.836  41.176 1.00 73.26  ? 27  HIS A CD2   1 
ATOM   1195 C CE1   . HIS B 2 27  ? -1.666  -11.093 42.753 1.00 75.75  ? 27  HIS A CE1   1 
ATOM   1196 N NE2   . HIS B 2 27  ? -1.369  -9.848  42.428 1.00 78.04  ? 27  HIS A NE2   1 
ATOM   1197 N N     . VAL B 2 28  ? 0.852   -13.164 41.781 1.00 101.46 ? 28  VAL A N     1 
ATOM   1198 C CA    . VAL B 2 28  ? 0.883   -14.167 42.838 1.00 106.80 ? 28  VAL A CA    1 
ATOM   1199 C C     . VAL B 2 28  ? -0.211  -15.227 42.713 1.00 109.77 ? 28  VAL A C     1 
ATOM   1200 O O     . VAL B 2 28  ? 0.083   -16.418 42.602 1.00 110.36 ? 28  VAL A O     1 
ATOM   1201 C CB    . VAL B 2 28  ? 0.761   -13.502 44.227 1.00 103.51 ? 28  VAL A CB    1 
ATOM   1202 C CG1   . VAL B 2 28  ? 1.004   -14.529 45.320 1.00 95.81  ? 28  VAL A CG1   1 
ATOM   1203 C CG2   . VAL B 2 28  ? 1.747   -12.348 44.338 1.00 103.02 ? 28  VAL A CG2   1 
ATOM   1204 N N     . SER B 2 29  ? -1.468  -14.793 42.731 1.00 112.99 ? 29  SER A N     1 
ATOM   1205 C CA    . SER B 2 29  ? -2.596  -15.716 42.641 1.00 114.70 ? 29  SER A CA    1 
ATOM   1206 C C     . SER B 2 29  ? -2.635  -16.487 41.328 1.00 115.33 ? 29  SER A C     1 
ATOM   1207 O O     . SER B 2 29  ? -3.406  -17.436 41.182 1.00 114.03 ? 29  SER A O     1 
ATOM   1208 C CB    . SER B 2 29  ? -3.915  -14.965 42.832 1.00 113.76 ? 29  SER A CB    1 
ATOM   1209 O OG    . SER B 2 29  ? -5.001  -15.871 42.921 1.00 113.06 ? 29  SER A OG    1 
ATOM   1210 N N     . TYR B 2 30  ? -1.810  -16.074 40.373 1.00 116.27 ? 30  TYR A N     1 
ATOM   1211 C CA    . TYR B 2 30  ? -1.746  -16.747 39.083 1.00 117.33 ? 30  TYR A CA    1 
ATOM   1212 C C     . TYR B 2 30  ? -0.727  -17.878 39.169 1.00 117.62 ? 30  TYR A C     1 
ATOM   1213 O O     . TYR B 2 30  ? -0.864  -18.901 38.500 1.00 119.96 ? 30  TYR A O     1 
ATOM   1214 C CB    . TYR B 2 30  ? -1.349  -15.755 37.982 1.00 119.84 ? 30  TYR A CB    1 
ATOM   1215 C CG    . TYR B 2 30  ? -1.327  -16.350 36.589 1.00 125.03 ? 30  TYR A CG    1 
ATOM   1216 C CD1   . TYR B 2 30  ? -0.283  -17.182 36.177 1.00 127.90 ? 30  TYR A CD1   1 
ATOM   1217 C CD2   . TYR B 2 30  ? -2.366  -16.108 35.691 1.00 123.86 ? 30  TYR A CD2   1 
ATOM   1218 C CE1   . TYR B 2 30  ? -0.277  -17.758 34.908 1.00 126.13 ? 30  TYR A CE1   1 
ATOM   1219 C CE2   . TYR B 2 30  ? -2.370  -16.680 34.420 1.00 124.31 ? 30  TYR A CE2   1 
ATOM   1220 C CZ    . TYR B 2 30  ? -1.324  -17.504 34.036 1.00 126.61 ? 30  TYR A CZ    1 
ATOM   1221 O OH    . TYR B 2 30  ? -1.330  -18.082 32.787 1.00 127.57 ? 30  TYR A OH    1 
ATOM   1222 N N     . SER B 2 31  ? 0.288   -17.690 40.007 1.00 117.26 ? 31  SER A N     1 
ATOM   1223 C CA    . SER B 2 31  ? 1.337   -18.688 40.190 1.00 115.98 ? 31  SER A CA    1 
ATOM   1224 C C     . SER B 2 31  ? 2.131   -18.417 41.466 1.00 118.71 ? 31  SER A C     1 
ATOM   1225 O O     . SER B 2 31  ? 3.146   -17.718 41.434 1.00 122.54 ? 31  SER A O     1 
ATOM   1226 C CB    . SER B 2 31  ? 2.282   -18.679 38.984 1.00 108.04 ? 31  SER A CB    1 
ATOM   1227 O OG    . SER B 2 31  ? 3.339   -19.606 39.152 1.00 97.56  ? 31  SER A OG    1 
ATOM   1228 N N     . LYS B 2 32  ? 1.668   -18.967 42.587 1.00 117.11 ? 32  LYS A N     1 
ATOM   1229 C CA    . LYS B 2 32  ? 2.352   -18.776 43.864 1.00 116.23 ? 32  LYS A CA    1 
ATOM   1230 C C     . LYS B 2 32  ? 3.609   -19.632 43.916 1.00 112.85 ? 32  LYS A C     1 
ATOM   1231 O O     . LYS B 2 32  ? 4.103   -19.981 44.987 1.00 109.85 ? 32  LYS A O     1 
ATOM   1232 C CB    . LYS B 2 32  ? 1.428   -19.135 45.031 1.00 115.75 ? 32  LYS A CB    1 
ATOM   1233 C CG    . LYS B 2 32  ? 1.004   -20.594 45.087 1.00 118.16 ? 32  LYS A CG    1 
ATOM   1234 C CD    . LYS B 2 32  ? 0.232   -20.879 46.367 1.00 117.56 ? 32  LYS A CD    1 
ATOM   1235 C CE    . LYS B 2 32  ? -0.141  -22.347 46.482 1.00 120.50 ? 32  LYS A CE    1 
ATOM   1236 N NZ    . LYS B 2 32  ? -0.818  -22.643 47.778 1.00 122.48 ? 32  LYS A NZ    1 
ATOM   1237 N N     . LYS B 2 33  ? 4.121   -19.961 42.737 1.00 114.07 ? 33  LYS A N     1 
ATOM   1238 C CA    . LYS B 2 33  ? 5.316   -20.775 42.607 1.00 118.20 ? 33  LYS A CA    1 
ATOM   1239 C C     . LYS B 2 33  ? 6.434   -19.910 42.036 1.00 119.01 ? 33  LYS A C     1 
ATOM   1240 O O     . LYS B 2 33  ? 7.600   -20.075 42.393 1.00 120.38 ? 33  LYS A O     1 
ATOM   1241 C CB    . LYS B 2 33  ? 5.032   -21.950 41.669 1.00 121.14 ? 33  LYS A CB    1 
ATOM   1242 C CG    . LYS B 2 33  ? 6.162   -22.956 41.548 1.00 128.54 ? 33  LYS A CG    1 
ATOM   1243 C CD    . LYS B 2 33  ? 5.839   -24.021 40.503 1.00 132.23 ? 33  LYS A CD    1 
ATOM   1244 C CE    . LYS B 2 33  ? 4.563   -24.781 40.842 1.00 130.97 ? 33  LYS A CE    1 
ATOM   1245 N NZ    . LYS B 2 33  ? 4.224   -25.785 39.796 1.00 126.38 ? 33  LYS A NZ    1 
ATOM   1246 N N     . GLU B 2 34  ? 6.069   -18.980 41.155 1.00 119.40 ? 34  GLU A N     1 
ATOM   1247 C CA    . GLU B 2 34  ? 7.044   -18.092 40.525 1.00 122.07 ? 34  GLU A CA    1 
ATOM   1248 C C     . GLU B 2 34  ? 6.471   -16.732 40.117 1.00 119.03 ? 34  GLU A C     1 
ATOM   1249 O O     . GLU B 2 34  ? 6.303   -16.464 38.926 1.00 118.99 ? 34  GLU A O     1 
ATOM   1250 C CB    . GLU B 2 34  ? 7.638   -18.766 39.283 1.00 123.71 ? 34  GLU A CB    1 
ATOM   1251 C CG    . GLU B 2 34  ? 8.486   -19.997 39.563 1.00 133.15 ? 34  GLU A CG    1 
ATOM   1252 C CD    . GLU B 2 34  ? 9.785   -19.661 40.271 1.00 139.38 ? 34  GLU A CD    1 
ATOM   1253 O OE1   . GLU B 2 34  ? 10.569  -18.856 39.723 1.00 139.78 ? 34  GLU A OE1   1 
ATOM   1254 O OE2   . GLU B 2 34  ? 10.025  -20.203 41.371 1.00 140.67 ? 34  GLU A OE2   1 
ATOM   1255 N N     . HIS B 2 35  ? 6.182   -15.871 41.091 1.00 115.35 ? 35  HIS A N     1 
ATOM   1256 C CA    . HIS B 2 35  ? 5.643   -14.547 40.785 1.00 110.74 ? 35  HIS A CA    1 
ATOM   1257 C C     . HIS B 2 35  ? 6.722   -13.467 40.678 1.00 106.35 ? 35  HIS A C     1 
ATOM   1258 O O     . HIS B 2 35  ? 7.914   -13.773 40.651 1.00 103.73 ? 35  HIS A O     1 
ATOM   1259 C CB    . HIS B 2 35  ? 4.580   -14.143 41.815 1.00 108.55 ? 35  HIS A CB    1 
ATOM   1260 C CG    . HIS B 2 35  ? 4.851   -14.639 43.199 1.00 111.84 ? 35  HIS A CG    1 
ATOM   1261 N ND1   . HIS B 2 35  ? 6.048   -15.219 43.559 1.00 118.39 ? 35  HIS A ND1   1 
ATOM   1262 C CD2   . HIS B 2 35  ? 4.077   -14.653 44.309 1.00 109.66 ? 35  HIS A CD2   1 
ATOM   1263 C CE1   . HIS B 2 35  ? 5.999   -15.570 44.832 1.00 116.65 ? 35  HIS A CE1   1 
ATOM   1264 N NE2   . HIS B 2 35  ? 4.814   -15.238 45.310 1.00 115.40 ? 35  HIS A NE2   1 
ATOM   1265 N N     . TYR B 2 36  ? 6.296   -12.213 40.544 1.00 105.82 ? 36  TYR A N     1 
ATOM   1266 C CA    . TYR B 2 36  ? 7.219   -11.088 40.381 1.00 104.52 ? 36  TYR A CA    1 
ATOM   1267 C C     . TYR B 2 36  ? 7.729   -10.398 41.648 1.00 101.38 ? 36  TYR A C     1 
ATOM   1268 O O     . TYR B 2 36  ? 8.658   -9.593  41.579 1.00 97.24  ? 36  TYR A O     1 
ATOM   1269 C CB    . TYR B 2 36  ? 6.581   -10.034 39.469 1.00 103.55 ? 36  TYR A CB    1 
ATOM   1270 C CG    . TYR B 2 36  ? 5.357   -9.352  40.054 1.00 104.61 ? 36  TYR A CG    1 
ATOM   1271 C CD1   . TYR B 2 36  ? 5.458   -8.540  41.183 1.00 105.84 ? 36  TYR A CD1   1 
ATOM   1272 C CD2   . TYR B 2 36  ? 4.101   -9.506  39.469 1.00 106.18 ? 36  TYR A CD2   1 
ATOM   1273 C CE1   . TYR B 2 36  ? 4.342   -7.897  41.714 1.00 104.27 ? 36  TYR A CE1   1 
ATOM   1274 C CE2   . TYR B 2 36  ? 2.975   -8.865  39.994 1.00 103.23 ? 36  TYR A CE2   1 
ATOM   1275 C CZ    . TYR B 2 36  ? 3.106   -8.063  41.115 1.00 101.28 ? 36  TYR A CZ    1 
ATOM   1276 O OH    . TYR B 2 36  ? 2.006   -7.421  41.638 1.00 93.60  ? 36  TYR A OH    1 
ATOM   1277 N N     . GLU B 2 37  ? 7.122   -10.703 42.793 1.00 100.46 ? 37  GLU A N     1 
ATOM   1278 C CA    . GLU B 2 37  ? 7.505   -10.093 44.068 1.00 97.76  ? 37  GLU A CA    1 
ATOM   1279 C C     . GLU B 2 37  ? 8.981   -9.717  44.206 1.00 94.37  ? 37  GLU A C     1 
ATOM   1280 O O     . GLU B 2 37  ? 9.326   -8.537  44.274 1.00 97.26  ? 37  GLU A O     1 
ATOM   1281 C CB    . GLU B 2 37  ? 7.126   -11.008 45.227 1.00 93.77  ? 37  GLU A CB    1 
ATOM   1282 C CG    . GLU B 2 37  ? 7.590   -10.491 46.575 1.00 96.89  ? 37  GLU A CG    1 
ATOM   1283 C CD    . GLU B 2 37  ? 7.251   -11.436 47.704 1.00 98.31  ? 37  GLU A CD    1 
ATOM   1284 O OE1   . GLU B 2 37  ? 6.056   -11.558 48.049 1.00 97.47  ? 37  GLU A OE1   1 
ATOM   1285 O OE2   . GLU B 2 37  ? 8.184   -12.066 48.241 1.00 97.44  ? 37  GLU A OE2   1 
ATOM   1286 N N     . THR B 2 38  ? 9.847   -10.722 44.263 1.00 86.96  ? 38  THR A N     1 
ATOM   1287 C CA    . THR B 2 38  ? 11.276  -10.484 44.405 1.00 85.79  ? 38  THR A CA    1 
ATOM   1288 C C     . THR B 2 38  ? 11.812  -9.494  43.375 1.00 87.01  ? 38  THR A C     1 
ATOM   1289 O O     . THR B 2 38  ? 12.555  -8.573  43.718 1.00 84.03  ? 38  THR A O     1 
ATOM   1290 C CB    . THR B 2 38  ? 12.066  -11.798 44.288 1.00 82.18  ? 38  THR A CB    1 
ATOM   1291 O OG1   . THR B 2 38  ? 11.682  -12.674 45.355 1.00 82.40  ? 38  THR A OG1   1 
ATOM   1292 C CG2   . THR B 2 38  ? 13.563  -11.534 44.366 1.00 68.30  ? 38  THR A CG2   1 
ATOM   1293 N N     . LEU B 2 39  ? 11.441  -9.685  42.113 1.00 88.23  ? 39  LEU A N     1 
ATOM   1294 C CA    . LEU B 2 39  ? 11.897  -8.788  41.056 1.00 85.86  ? 39  LEU A CA    1 
ATOM   1295 C C     . LEU B 2 39  ? 11.384  -7.367  41.268 1.00 80.05  ? 39  LEU A C     1 
ATOM   1296 O O     . LEU B 2 39  ? 12.059  -6.402  40.921 1.00 75.48  ? 39  LEU A O     1 
ATOM   1297 C CB    . LEU B 2 39  ? 11.456  -9.306  39.683 1.00 83.05  ? 39  LEU A CB    1 
ATOM   1298 C CG    . LEU B 2 39  ? 12.328  -10.416 39.086 1.00 85.25  ? 39  LEU A CG    1 
ATOM   1299 C CD1   . LEU B 2 39  ? 11.692  -10.951 37.812 1.00 85.65  ? 39  LEU A CD1   1 
ATOM   1300 C CD2   . LEU B 2 39  ? 13.724  -9.869  38.803 1.00 81.54  ? 39  LEU A CD2   1 
ATOM   1301 N N     . GLU B 2 40  ? 10.191  -7.240  41.840 1.00 75.53  ? 40  GLU A N     1 
ATOM   1302 C CA    . GLU B 2 40  ? 9.626   -5.924  42.096 1.00 83.71  ? 40  GLU A CA    1 
ATOM   1303 C C     . GLU B 2 40  ? 10.564  -5.203  43.047 1.00 85.82  ? 40  GLU A C     1 
ATOM   1304 O O     . GLU B 2 40  ? 10.877  -4.027  42.865 1.00 89.55  ? 40  GLU A O     1 
ATOM   1305 C CB    . GLU B 2 40  ? 8.254   -6.041  42.753 1.00 83.54  ? 40  GLU A CB    1 
ATOM   1306 C CG    . GLU B 2 40  ? 7.527   -4.714  42.869 1.00 91.64  ? 40  GLU A CG    1 
ATOM   1307 C CD    . GLU B 2 40  ? 6.455   -4.729  43.937 1.00 98.89  ? 40  GLU A CD    1 
ATOM   1308 O OE1   . GLU B 2 40  ? 5.780   -5.770  44.090 1.00 103.53 ? 40  GLU A OE1   1 
ATOM   1309 O OE2   . GLU B 2 40  ? 6.279   -3.694  44.616 1.00 98.87  ? 40  GLU A OE2   1 
ATOM   1310 N N     . PHE B 2 41  ? 11.007  -5.933  44.065 1.00 86.70  ? 41  PHE A N     1 
ATOM   1311 C CA    . PHE B 2 41  ? 11.911  -5.405  45.077 1.00 84.13  ? 41  PHE A CA    1 
ATOM   1312 C C     . PHE B 2 41  ? 13.139  -4.778  44.424 1.00 77.86  ? 41  PHE A C     1 
ATOM   1313 O O     . PHE B 2 41  ? 13.465  -3.622  44.678 1.00 77.11  ? 41  PHE A O     1 
ATOM   1314 C CB    . PHE B 2 41  ? 12.349  -6.532  46.018 1.00 84.32  ? 41  PHE A CB    1 
ATOM   1315 C CG    . PHE B 2 41  ? 12.913  -6.052  47.323 1.00 82.70  ? 41  PHE A CG    1 
ATOM   1316 C CD1   . PHE B 2 41  ? 12.088  -5.460  48.275 1.00 78.13  ? 41  PHE A CD1   1 
ATOM   1317 C CD2   . PHE B 2 41  ? 14.269  -6.194  47.604 1.00 83.58  ? 41  PHE A CD2   1 
ATOM   1318 C CE1   . PHE B 2 41  ? 12.606  -5.016  49.488 1.00 77.66  ? 41  PHE A CE1   1 
ATOM   1319 C CE2   . PHE B 2 41  ? 14.798  -5.753  48.814 1.00 74.14  ? 41  PHE A CE2   1 
ATOM   1320 C CZ    . PHE B 2 41  ? 13.965  -5.163  49.757 1.00 77.80  ? 41  PHE A CZ    1 
ATOM   1321 N N     . LEU B 2 42  ? 13.816  -5.546  43.580 1.00 73.92  ? 42  LEU A N     1 
ATOM   1322 C CA    . LEU B 2 42  ? 15.007  -5.052  42.903 1.00 77.67  ? 42  LEU A CA    1 
ATOM   1323 C C     . LEU B 2 42  ? 14.683  -3.961  41.892 1.00 78.19  ? 42  LEU A C     1 
ATOM   1324 O O     . LEU B 2 42  ? 15.447  -3.010  41.724 1.00 76.82  ? 42  LEU A O     1 
ATOM   1325 C CB    . LEU B 2 42  ? 15.727  -6.202  42.194 1.00 73.28  ? 42  LEU A CB    1 
ATOM   1326 C CG    . LEU B 2 42  ? 16.815  -5.784  41.199 1.00 75.87  ? 42  LEU A CG    1 
ATOM   1327 C CD1   . LEU B 2 42  ? 17.882  -4.964  41.907 1.00 65.67  ? 42  LEU A CD1   1 
ATOM   1328 C CD2   . LEU B 2 42  ? 17.419  -7.020  40.553 1.00 76.13  ? 42  LEU A CD2   1 
ATOM   1329 N N     . GLY B 2 43  ? 13.548  -4.110  41.216 1.00 82.50  ? 43  GLY A N     1 
ATOM   1330 C CA    . GLY B 2 43  ? 13.146  -3.140  40.215 1.00 80.71  ? 43  GLY A CA    1 
ATOM   1331 C C     . GLY B 2 43  ? 12.820  -1.781  40.795 1.00 77.69  ? 43  GLY A C     1 
ATOM   1332 O O     . GLY B 2 43  ? 13.081  -0.755  40.172 1.00 78.06  ? 43  GLY A O     1 
ATOM   1333 N N     . ASP B 2 44  ? 12.250  -1.770  41.993 1.00 78.36  ? 44  ASP A N     1 
ATOM   1334 C CA    . ASP B 2 44  ? 11.889  -0.521  42.645 1.00 84.08  ? 44  ASP A CA    1 
ATOM   1335 C C     . ASP B 2 44  ? 13.122  0.347   42.904 1.00 85.46  ? 44  ASP A C     1 
ATOM   1336 O O     . ASP B 2 44  ? 13.091  1.562   42.713 1.00 85.26  ? 44  ASP A O     1 
ATOM   1337 C CB    . ASP B 2 44  ? 11.169  -0.811  43.961 1.00 83.89  ? 44  ASP A CB    1 
ATOM   1338 C CG    . ASP B 2 44  ? 10.547  0.427   44.565 1.00 95.33  ? 44  ASP A CG    1 
ATOM   1339 O OD1   . ASP B 2 44  ? 9.678   1.035   43.904 1.00 100.82 ? 44  ASP A OD1   1 
ATOM   1340 O OD2   . ASP B 2 44  ? 10.927  0.793   45.698 1.00 102.68 ? 44  ASP A OD2   1 
ATOM   1341 N N     . ALA B 2 45  ? 14.209  -0.284  43.337 1.00 86.35  ? 45  ALA A N     1 
ATOM   1342 C CA    . ALA B 2 45  ? 15.445  0.435   43.619 1.00 86.37  ? 45  ALA A CA    1 
ATOM   1343 C C     . ALA B 2 45  ? 16.124  0.847   42.321 1.00 83.90  ? 45  ALA A C     1 
ATOM   1344 O O     . ALA B 2 45  ? 16.761  1.898   42.245 1.00 85.60  ? 45  ALA A O     1 
ATOM   1345 C CB    . ALA B 2 45  ? 16.383  -0.439  44.443 1.00 84.83  ? 45  ALA A CB    1 
ATOM   1346 N N     . LEU B 2 46  ? 15.982  0.007   41.303 1.00 83.55  ? 46  LEU A N     1 
ATOM   1347 C CA    . LEU B 2 46  ? 16.579  0.260   39.997 1.00 83.59  ? 46  LEU A CA    1 
ATOM   1348 C C     . LEU B 2 46  ? 15.907  1.440   39.298 1.00 80.17  ? 46  LEU A C     1 
ATOM   1349 O O     . LEU B 2 46  ? 16.568  2.412   38.933 1.00 74.29  ? 46  LEU A O     1 
ATOM   1350 C CB    . LEU B 2 46  ? 16.467  -0.996  39.126 1.00 80.21  ? 46  LEU A CB    1 
ATOM   1351 C CG    . LEU B 2 46  ? 17.139  -0.982  37.752 1.00 82.20  ? 46  LEU A CG    1 
ATOM   1352 C CD1   . LEU B 2 46  ? 18.639  -0.835  37.911 1.00 85.61  ? 46  LEU A CD1   1 
ATOM   1353 C CD2   . LEU B 2 46  ? 16.819  -2.270  37.017 1.00 89.93  ? 46  LEU A CD2   1 
ATOM   1354 N N     . VAL B 2 47  ? 14.593  1.349   39.115 1.00 80.14  ? 47  VAL A N     1 
ATOM   1355 C CA    . VAL B 2 47  ? 13.834  2.408   38.459 1.00 82.87  ? 47  VAL A CA    1 
ATOM   1356 C C     . VAL B 2 47  ? 13.954  3.714   39.230 1.00 84.11  ? 47  VAL A C     1 
ATOM   1357 O O     . VAL B 2 47  ? 13.992  4.794   38.640 1.00 87.26  ? 47  VAL A O     1 
ATOM   1358 C CB    . VAL B 2 47  ? 12.341  2.035   38.337 1.00 78.94  ? 47  VAL A CB    1 
ATOM   1359 C CG1   . VAL B 2 47  ? 11.545  3.217   37.811 1.00 73.11  ? 47  VAL A CG1   1 
ATOM   1360 C CG2   . VAL B 2 47  ? 12.185  0.848   37.406 1.00 81.75  ? 47  VAL A CG2   1 
ATOM   1361 N N     . ASN B 2 48  ? 14.016  3.609   40.552 1.00 85.21  ? 48  ASN A N     1 
ATOM   1362 C CA    . ASN B 2 48  ? 14.136  4.785   41.404 1.00 86.47  ? 48  ASN A CA    1 
ATOM   1363 C C     . ASN B 2 48  ? 15.414  5.550   41.056 1.00 87.37  ? 48  ASN A C     1 
ATOM   1364 O O     . ASN B 2 48  ? 15.428  6.781   41.018 1.00 86.41  ? 48  ASN A O     1 
ATOM   1365 C CB    . ASN B 2 48  ? 14.161  4.359   42.874 1.00 81.13  ? 48  ASN A CB    1 
ATOM   1366 C CG    . ASN B 2 48  ? 14.075  5.533   43.822 1.00 79.91  ? 48  ASN A CG    1 
ATOM   1367 O OD1   . ASN B 2 48  ? 14.936  6.411   43.819 1.00 82.68  ? 48  ASN A OD1   1 
ATOM   1368 N ND2   . ASN B 2 48  ? 13.031  5.557   44.641 1.00 81.34  ? 48  ASN A ND2   1 
ATOM   1369 N N     . PHE B 2 49  ? 16.485  4.808   40.798 1.00 85.54  ? 49  PHE A N     1 
ATOM   1370 C CA    . PHE B 2 49  ? 17.762  5.408   40.447 1.00 87.69  ? 49  PHE A CA    1 
ATOM   1371 C C     . PHE B 2 49  ? 17.671  6.212   39.151 1.00 91.69  ? 49  PHE A C     1 
ATOM   1372 O O     . PHE B 2 49  ? 17.966  7.407   39.136 1.00 91.66  ? 49  PHE A O     1 
ATOM   1373 C CB    . PHE B 2 49  ? 18.828  4.318   40.318 1.00 89.67  ? 49  PHE A CB    1 
ATOM   1374 C CG    . PHE B 2 49  ? 20.092  4.780   39.657 1.00 88.33  ? 49  PHE A CG    1 
ATOM   1375 C CD1   . PHE B 2 49  ? 20.814  5.849   40.174 1.00 90.22  ? 49  PHE A CD1   1 
ATOM   1376 C CD2   . PHE B 2 49  ? 20.559  4.146   38.510 1.00 91.89  ? 49  PHE A CD2   1 
ATOM   1377 C CE1   . PHE B 2 49  ? 21.984  6.283   39.558 1.00 99.46  ? 49  PHE A CE1   1 
ATOM   1378 C CE2   . PHE B 2 49  ? 21.727  4.570   37.886 1.00 100.99 ? 49  PHE A CE2   1 
ATOM   1379 C CZ    . PHE B 2 49  ? 22.443  5.642   38.411 1.00 104.07 ? 49  PHE A CZ    1 
ATOM   1380 N N     . PHE B 2 50  ? 17.262  5.557   38.067 1.00 92.45  ? 50  PHE A N     1 
ATOM   1381 C CA    . PHE B 2 50  ? 17.142  6.234   36.777 1.00 92.08  ? 50  PHE A CA    1 
ATOM   1382 C C     . PHE B 2 50  ? 16.377  7.547   36.933 1.00 92.59  ? 50  PHE A C     1 
ATOM   1383 O O     . PHE B 2 50  ? 16.885  8.618   36.591 1.00 91.50  ? 50  PHE A O     1 
ATOM   1384 C CB    . PHE B 2 50  ? 16.422  5.343   35.754 1.00 88.81  ? 50  PHE A CB    1 
ATOM   1385 C CG    . PHE B 2 50  ? 17.066  3.998   35.547 1.00 84.20  ? 50  PHE A CG    1 
ATOM   1386 C CD1   . PHE B 2 50  ? 18.450  3.868   35.514 1.00 86.72  ? 50  PHE A CD1   1 
ATOM   1387 C CD2   . PHE B 2 50  ? 16.285  2.861   35.368 1.00 81.03  ? 50  PHE A CD2   1 
ATOM   1388 C CE1   . PHE B 2 50  ? 19.046  2.626   35.307 1.00 82.21  ? 50  PHE A CE1   1 
ATOM   1389 C CE2   . PHE B 2 50  ? 16.871  1.615   35.159 1.00 76.13  ? 50  PHE A CE2   1 
ATOM   1390 C CZ    . PHE B 2 50  ? 18.252  1.498   35.129 1.00 78.83  ? 50  PHE A CZ    1 
ATOM   1391 N N     . ILE B 2 51  ? 15.157  7.452   37.455 1.00 88.49  ? 51  ILE A N     1 
ATOM   1392 C CA    . ILE B 2 51  ? 14.300  8.614   37.662 1.00 87.72  ? 51  ILE A CA    1 
ATOM   1393 C C     . ILE B 2 51  ? 15.017  9.759   38.369 1.00 92.54  ? 51  ILE A C     1 
ATOM   1394 O O     . ILE B 2 51  ? 14.987  10.899  37.909 1.00 91.58  ? 51  ILE A O     1 
ATOM   1395 C CB    . ILE B 2 51  ? 13.060  8.240   38.498 1.00 87.19  ? 51  ILE A CB    1 
ATOM   1396 C CG1   . ILE B 2 51  ? 12.212  7.213   37.748 1.00 93.11  ? 51  ILE A CG1   1 
ATOM   1397 C CG2   . ILE B 2 51  ? 12.240  9.481   38.797 1.00 82.49  ? 51  ILE A CG2   1 
ATOM   1398 C CD1   . ILE B 2 51  ? 11.608  7.733   36.465 1.00 97.61  ? 51  ILE A CD1   1 
ATOM   1399 N N     . VAL B 2 52  ? 15.659  9.450   39.491 1.00 96.37  ? 52  VAL A N     1 
ATOM   1400 C CA    . VAL B 2 52  ? 16.370  10.460  40.270 1.00 94.61  ? 52  VAL A CA    1 
ATOM   1401 C C     . VAL B 2 52  ? 17.616  11.005  39.571 1.00 93.70  ? 52  VAL A C     1 
ATOM   1402 O O     . VAL B 2 52  ? 17.888  12.203  39.632 1.00 92.05  ? 52  VAL A O     1 
ATOM   1403 C CB    . VAL B 2 52  ? 16.763  9.905   41.663 1.00 98.59  ? 52  VAL A CB    1 
ATOM   1404 C CG1   . VAL B 2 52  ? 17.562  10.945  42.441 1.00 95.32  ? 52  VAL A CG1   1 
ATOM   1405 C CG2   . VAL B 2 52  ? 15.506  9.520   42.435 1.00 88.17  ? 52  VAL A CG2   1 
ATOM   1406 N N     . ASP B 2 53  ? 18.372  10.135  38.910 1.00 92.96  ? 53  ASP A N     1 
ATOM   1407 C CA    . ASP B 2 53  ? 19.576  10.573  38.212 1.00 97.56  ? 53  ASP A CA    1 
ATOM   1408 C C     . ASP B 2 53  ? 19.220  11.492  37.052 1.00 99.35  ? 53  ASP A C     1 
ATOM   1409 O O     . ASP B 2 53  ? 19.963  12.417  36.723 1.00 98.33  ? 53  ASP A O     1 
ATOM   1410 C CB    . ASP B 2 53  ? 20.361  9.369   37.687 1.00 103.67 ? 53  ASP A CB    1 
ATOM   1411 C CG    . ASP B 2 53  ? 21.599  9.780   36.909 1.00 107.61 ? 53  ASP A CG    1 
ATOM   1412 O OD1   . ASP B 2 53  ? 22.374  10.611  37.429 1.00 107.20 ? 53  ASP A OD1   1 
ATOM   1413 O OD2   . ASP B 2 53  ? 21.800  9.271   35.784 1.00 109.47 ? 53  ASP A OD2   1 
ATOM   1414 N N     . LEU B 2 54  ? 18.075  11.227  36.434 1.00 102.54 ? 54  LEU A N     1 
ATOM   1415 C CA    . LEU B 2 54  ? 17.606  12.025  35.311 1.00 104.50 ? 54  LEU A CA    1 
ATOM   1416 C C     . LEU B 2 54  ? 17.027  13.348  35.801 1.00 105.26 ? 54  LEU A C     1 
ATOM   1417 O O     . LEU B 2 54  ? 17.211  14.389  35.172 1.00 109.53 ? 54  LEU A O     1 
ATOM   1418 C CB    . LEU B 2 54  ? 16.537  11.251  34.537 1.00 107.91 ? 54  LEU A CB    1 
ATOM   1419 C CG    . LEU B 2 54  ? 15.871  11.968  33.361 1.00 113.65 ? 54  LEU A CG    1 
ATOM   1420 C CD1   . LEU B 2 54  ? 16.917  12.318  32.311 1.00 116.07 ? 54  LEU A CD1   1 
ATOM   1421 C CD2   . LEU B 2 54  ? 14.790  11.073  32.769 1.00 113.70 ? 54  LEU A CD2   1 
ATOM   1422 N N     . LEU B 2 55  ? 16.331  13.297  36.931 1.00 103.25 ? 55  LEU A N     1 
ATOM   1423 C CA    . LEU B 2 55  ? 15.710  14.478  37.516 1.00 100.34 ? 55  LEU A CA    1 
ATOM   1424 C C     . LEU B 2 55  ? 16.714  15.484  38.075 1.00 101.35 ? 55  LEU A C     1 
ATOM   1425 O O     . LEU B 2 55  ? 16.446  16.685  38.098 1.00 101.03 ? 55  LEU A O     1 
ATOM   1426 C CB    . LEU B 2 55  ? 14.742  14.056  38.626 1.00 101.44 ? 55  LEU A CB    1 
ATOM   1427 C CG    . LEU B 2 55  ? 14.104  15.173  39.457 1.00 105.00 ? 55  LEU A CG    1 
ATOM   1428 C CD1   . LEU B 2 55  ? 13.293  16.088  38.556 1.00 106.76 ? 55  LEU A CD1   1 
ATOM   1429 C CD2   . LEU B 2 55  ? 13.221  14.564  40.537 1.00 109.18 ? 55  LEU A CD2   1 
ATOM   1430 N N     . VAL B 2 56  ? 17.869  14.997  38.521 1.00 100.44 ? 56  VAL A N     1 
ATOM   1431 C CA    . VAL B 2 56  ? 18.888  15.872  39.092 1.00 103.38 ? 56  VAL A CA    1 
ATOM   1432 C C     . VAL B 2 56  ? 19.649  16.655  38.023 1.00 105.03 ? 56  VAL A C     1 
ATOM   1433 O O     . VAL B 2 56  ? 20.322  17.639  38.328 1.00 109.13 ? 56  VAL A O     1 
ATOM   1434 C CB    . VAL B 2 56  ? 19.893  15.067  39.961 1.00 100.81 ? 56  VAL A CB    1 
ATOM   1435 C CG1   . VAL B 2 56  ? 20.798  14.224  39.078 1.00 105.25 ? 56  VAL A CG1   1 
ATOM   1436 C CG2   . VAL B 2 56  ? 20.702  16.010  40.828 1.00 92.59  ? 56  VAL A CG2   1 
ATOM   1437 N N     . GLN B 2 57  ? 19.544  16.220  36.771 1.00 105.45 ? 57  GLN A N     1 
ATOM   1438 C CA    . GLN B 2 57  ? 20.216  16.909  35.673 1.00 104.89 ? 57  GLN A CA    1 
ATOM   1439 C C     . GLN B 2 57  ? 19.325  18.008  35.116 1.00 103.21 ? 57  GLN A C     1 
ATOM   1440 O O     . GLN B 2 57  ? 19.540  19.193  35.366 1.00 97.17  ? 57  GLN A O     1 
ATOM   1441 C CB    . GLN B 2 57  ? 20.548  15.942  34.536 1.00 101.10 ? 57  GLN A CB    1 
ATOM   1442 C CG    . GLN B 2 57  ? 21.607  14.913  34.843 1.00 102.73 ? 57  GLN A CG    1 
ATOM   1443 C CD    . GLN B 2 57  ? 21.959  14.087  33.621 1.00 102.67 ? 57  GLN A CD    1 
ATOM   1444 O OE1   . GLN B 2 57  ? 22.377  14.625  32.593 1.00 95.67  ? 57  GLN A OE1   1 
ATOM   1445 N NE2   . GLN B 2 57  ? 21.787  12.773  33.723 1.00 100.88 ? 57  GLN A NE2   1 
ATOM   1446 N N     . TYR B 2 58  ? 18.317  17.588  34.358 1.00 106.88 ? 58  TYR A N     1 
ATOM   1447 C CA    . TYR B 2 58  ? 17.375  18.499  33.725 1.00 111.21 ? 58  TYR A CA    1 
ATOM   1448 C C     . TYR B 2 58  ? 16.286  18.945  34.693 1.00 112.99 ? 58  TYR A C     1 
ATOM   1449 O O     . TYR B 2 58  ? 15.165  18.436  34.664 1.00 116.15 ? 58  TYR A O     1 
ATOM   1450 C CB    . TYR B 2 58  ? 16.744  17.824  32.503 1.00 111.32 ? 58  TYR A CB    1 
ATOM   1451 C CG    . TYR B 2 58  ? 17.707  16.950  31.727 1.00 111.53 ? 58  TYR A CG    1 
ATOM   1452 C CD1   . TYR B 2 58  ? 18.088  15.698  32.211 1.00 111.93 ? 58  TYR A CD1   1 
ATOM   1453 C CD2   . TYR B 2 58  ? 18.257  17.382  30.521 1.00 111.85 ? 58  TYR A CD2   1 
ATOM   1454 C CE1   . TYR B 2 58  ? 18.992  14.899  31.518 1.00 114.14 ? 58  TYR A CE1   1 
ATOM   1455 C CE2   . TYR B 2 58  ? 19.164  16.590  29.817 1.00 114.67 ? 58  TYR A CE2   1 
ATOM   1456 C CZ    . TYR B 2 58  ? 19.527  15.350  30.323 1.00 115.86 ? 58  TYR A CZ    1 
ATOM   1457 O OH    . TYR B 2 58  ? 20.428  14.564  29.641 1.00 117.41 ? 58  TYR A OH    1 
ATOM   1458 N N     . SER B 2 59  ? 16.626  19.902  35.548 1.00 115.96 ? 59  SER A N     1 
ATOM   1459 C CA    . SER B 2 59  ? 15.688  20.426  36.531 1.00 116.24 ? 59  SER A CA    1 
ATOM   1460 C C     . SER B 2 59  ? 15.972  21.896  36.810 1.00 120.97 ? 59  SER A C     1 
ATOM   1461 O O     . SER B 2 59  ? 17.129  22.308  36.909 1.00 121.52 ? 59  SER A O     1 
ATOM   1462 C CB    . SER B 2 59  ? 15.789  19.631  37.834 1.00 115.31 ? 59  SER A CB    1 
ATOM   1463 O OG    . SER B 2 59  ? 14.949  20.183  38.832 1.00 112.92 ? 59  SER A OG    1 
ATOM   1464 N N     . PRO B 2 60  ? 14.914  22.711  36.935 1.00 124.28 ? 60  PRO A N     1 
ATOM   1465 C CA    . PRO B 2 60  ? 15.067  24.143  37.206 1.00 122.50 ? 60  PRO A CA    1 
ATOM   1466 C C     . PRO B 2 60  ? 15.949  24.374  38.429 1.00 123.35 ? 60  PRO A C     1 
ATOM   1467 O O     . PRO B 2 60  ? 17.142  24.655  38.308 1.00 122.83 ? 60  PRO A O     1 
ATOM   1468 C CB    . PRO B 2 60  ? 13.629  24.599  37.440 1.00 125.32 ? 60  PRO A CB    1 
ATOM   1469 C CG    . PRO B 2 60  ? 12.848  23.697  36.539 1.00 125.10 ? 60  PRO A CG    1 
ATOM   1470 C CD    . PRO B 2 60  ? 13.490  22.354  36.800 1.00 126.41 ? 60  PRO A CD    1 
ATOM   1471 N N     . ASN B 2 61  ? 15.348  24.248  39.606 1.00 123.22 ? 61  ASN A N     1 
ATOM   1472 C CA    . ASN B 2 61  ? 16.058  24.433  40.863 1.00 121.13 ? 61  ASN A CA    1 
ATOM   1473 C C     . ASN B 2 61  ? 16.667  23.091  41.275 1.00 120.32 ? 61  ASN A C     1 
ATOM   1474 O O     . ASN B 2 61  ? 16.225  22.038  40.814 1.00 120.93 ? 61  ASN A O     1 
ATOM   1475 C CB    . ASN B 2 61  ? 15.078  24.935  41.929 1.00 126.09 ? 61  ASN A CB    1 
ATOM   1476 C CG    . ASN B 2 61  ? 15.773  25.426  43.179 1.00 133.84 ? 61  ASN A CG    1 
ATOM   1477 O OD1   . ASN B 2 61  ? 16.435  24.661  43.876 1.00 141.39 ? 61  ASN A OD1   1 
ATOM   1478 N ND2   . ASN B 2 61  ? 15.625  26.713  43.471 1.00 136.08 ? 61  ASN A ND2   1 
ATOM   1479 N N     . LYS B 2 62  ? 17.683  23.130  42.131 1.00 115.81 ? 62  LYS A N     1 
ATOM   1480 C CA    . LYS B 2 62  ? 18.346  21.910  42.583 1.00 108.41 ? 62  LYS A CA    1 
ATOM   1481 C C     . LYS B 2 62  ? 18.208  21.655  44.081 1.00 108.44 ? 62  LYS A C     1 
ATOM   1482 O O     . LYS B 2 62  ? 18.719  20.660  44.593 1.00 111.90 ? 62  LYS A O     1 
ATOM   1483 C CB    . LYS B 2 62  ? 19.834  21.952  42.211 1.00 107.56 ? 62  LYS A CB    1 
ATOM   1484 C CG    . LYS B 2 62  ? 20.144  21.619  40.752 1.00 103.06 ? 62  LYS A CG    1 
ATOM   1485 C CD    . LYS B 2 62  ? 19.509  22.601  39.781 1.00 100.62 ? 62  LYS A CD    1 
ATOM   1486 C CE    . LYS B 2 62  ? 19.884  22.268  38.341 1.00 97.08  ? 62  LYS A CE    1 
ATOM   1487 N NZ    . LYS B 2 62  ? 19.479  20.888  37.948 1.00 87.82  ? 62  LYS A NZ    1 
ATOM   1488 N N     . ARG B 2 63  ? 17.514  22.542  44.785 1.00 105.02 ? 63  ARG A N     1 
ATOM   1489 C CA    . ARG B 2 63  ? 17.340  22.385  46.225 1.00 104.79 ? 63  ARG A CA    1 
ATOM   1490 C C     . ARG B 2 63  ? 16.437  21.208  46.582 1.00 104.54 ? 63  ARG A C     1 
ATOM   1491 O O     . ARG B 2 63  ? 15.438  20.949  45.913 1.00 103.06 ? 63  ARG A O     1 
ATOM   1492 C CB    . ARG B 2 63  ? 16.773  23.670  46.837 1.00 108.85 ? 63  ARG A CB    1 
ATOM   1493 C CG    . ARG B 2 63  ? 17.629  24.903  46.591 1.00 114.38 ? 63  ARG A CG    1 
ATOM   1494 C CD    . ARG B 2 63  ? 17.307  26.012  47.579 1.00 117.47 ? 63  ARG A CD    1 
ATOM   1495 N NE    . ARG B 2 63  ? 17.623  25.619  48.951 1.00 120.33 ? 63  ARG A NE    1 
ATOM   1496 C CZ    . ARG B 2 63  ? 18.830  25.242  49.365 1.00 120.75 ? 63  ARG A CZ    1 
ATOM   1497 N NH1   . ARG B 2 63  ? 19.849  25.205  48.514 1.00 116.03 ? 63  ARG A NH1   1 
ATOM   1498 N NH2   . ARG B 2 63  ? 19.020  24.899  50.631 1.00 119.19 ? 63  ARG A NH2   1 
ATOM   1499 N N     . GLU B 2 64  ? 16.806  20.501  47.646 1.00 105.74 ? 64  GLU A N     1 
ATOM   1500 C CA    . GLU B 2 64  ? 16.055  19.347  48.125 1.00 107.11 ? 64  GLU A CA    1 
ATOM   1501 C C     . GLU B 2 64  ? 14.556  19.624  48.166 1.00 108.52 ? 64  GLU A C     1 
ATOM   1502 O O     . GLU B 2 64  ? 13.762  18.886  47.582 1.00 112.86 ? 64  GLU A O     1 
ATOM   1503 C CB    . GLU B 2 64  ? 16.540  18.957  49.525 1.00 109.84 ? 64  GLU A CB    1 
ATOM   1504 C CG    . GLU B 2 64  ? 15.796  17.785  50.153 1.00 112.98 ? 64  GLU A CG    1 
ATOM   1505 C CD    . GLU B 2 64  ? 16.006  16.482  49.405 1.00 115.28 ? 64  GLU A CD    1 
ATOM   1506 O OE1   . GLU B 2 64  ? 17.173  16.059  49.256 1.00 117.08 ? 64  GLU A OE1   1 
ATOM   1507 O OE2   . GLU B 2 64  ? 15.005  15.877  48.969 1.00 115.15 ? 64  GLU A OE2   1 
ATOM   1508 N N     . GLY B 2 65  ? 14.175  20.692  48.857 1.00 105.46 ? 65  GLY A N     1 
ATOM   1509 C CA    . GLY B 2 65  ? 12.771  21.041  48.970 1.00 103.71 ? 65  GLY A CA    1 
ATOM   1510 C C     . GLY B 2 65  ? 12.043  21.148  47.643 1.00 106.93 ? 65  GLY A C     1 
ATOM   1511 O O     . GLY B 2 65  ? 10.814  21.093  47.602 1.00 106.63 ? 65  GLY A O     1 
ATOM   1512 N N     . PHE B 2 66  ? 12.791  21.303  46.555 1.00 106.11 ? 66  PHE A N     1 
ATOM   1513 C CA    . PHE B 2 66  ? 12.181  21.419  45.236 1.00 105.49 ? 66  PHE A CA    1 
ATOM   1514 C C     . PHE B 2 66  ? 12.171  20.091  44.486 1.00 108.83 ? 66  PHE A C     1 
ATOM   1515 O O     . PHE B 2 66  ? 11.216  19.778  43.778 1.00 112.45 ? 66  PHE A O     1 
ATOM   1516 C CB    . PHE B 2 66  ? 12.911  22.466  44.392 1.00 109.07 ? 66  PHE A CB    1 
ATOM   1517 C CG    . PHE B 2 66  ? 12.278  22.708  43.049 1.00 113.94 ? 66  PHE A CG    1 
ATOM   1518 C CD1   . PHE B 2 66  ? 10.987  23.222  42.957 1.00 114.62 ? 66  PHE A CD1   1 
ATOM   1519 C CD2   . PHE B 2 66  ? 12.967  22.418  41.876 1.00 118.74 ? 66  PHE A CD2   1 
ATOM   1520 C CE1   . PHE B 2 66  ? 10.390  23.445  41.716 1.00 115.72 ? 66  PHE A CE1   1 
ATOM   1521 C CE2   . PHE B 2 66  ? 12.381  22.637  40.627 1.00 119.43 ? 66  PHE A CE2   1 
ATOM   1522 C CZ    . PHE B 2 66  ? 11.090  23.152  40.548 1.00 118.29 ? 66  PHE A CZ    1 
ATOM   1523 N N     . LEU B 2 67  ? 13.235  19.312  44.641 1.00 107.31 ? 67  LEU A N     1 
ATOM   1524 C CA    . LEU B 2 67  ? 13.334  18.029  43.961 1.00 104.63 ? 67  LEU A CA    1 
ATOM   1525 C C     . LEU B 2 67  ? 12.433  16.954  44.560 1.00 106.19 ? 67  LEU A C     1 
ATOM   1526 O O     . LEU B 2 67  ? 11.976  16.055  43.852 1.00 108.95 ? 67  LEU A O     1 
ATOM   1527 C CB    . LEU B 2 67  ? 14.787  17.544  43.961 1.00 106.84 ? 67  LEU A CB    1 
ATOM   1528 C CG    . LEU B 2 67  ? 15.761  18.343  43.091 1.00 105.49 ? 67  LEU A CG    1 
ATOM   1529 C CD1   . LEU B 2 67  ? 17.160  17.764  43.222 1.00 101.24 ? 67  LEU A CD1   1 
ATOM   1530 C CD2   . LEU B 2 67  ? 15.300  18.304  41.638 1.00 105.28 ? 67  LEU A CD2   1 
ATOM   1531 N N     . SER B 2 68  ? 12.178  17.047  45.859 1.00 101.97 ? 68  SER A N     1 
ATOM   1532 C CA    . SER B 2 68  ? 11.333  16.068  46.535 1.00 100.34 ? 68  SER A CA    1 
ATOM   1533 C C     . SER B 2 68  ? 9.908   15.998  45.974 1.00 100.60 ? 68  SER A C     1 
ATOM   1534 O O     . SER B 2 68  ? 9.377   14.907  45.758 1.00 93.61  ? 68  SER A O     1 
ATOM   1535 C CB    . SER B 2 68  ? 11.292  16.364  48.036 1.00 103.53 ? 68  SER A CB    1 
ATOM   1536 O OG    . SER B 2 68  ? 12.581  16.235  48.609 1.00 100.82 ? 68  SER A OG    1 
ATOM   1537 N N     . PRO B 2 69  ? 9.267   17.159  45.738 1.00 99.90  ? 69  PRO A N     1 
ATOM   1538 C CA    . PRO B 2 69  ? 7.901   17.188  45.200 1.00 97.75  ? 69  PRO A CA    1 
ATOM   1539 C C     . PRO B 2 69  ? 7.791   16.528  43.828 1.00 100.45 ? 69  PRO A C     1 
ATOM   1540 O O     . PRO B 2 69  ? 6.792   15.874  43.523 1.00 102.37 ? 69  PRO A O     1 
ATOM   1541 C CB    . PRO B 2 69  ? 7.585   18.680  45.144 1.00 101.74 ? 69  PRO A CB    1 
ATOM   1542 C CG    . PRO B 2 69  ? 8.376   19.227  46.287 1.00 104.77 ? 69  PRO A CG    1 
ATOM   1543 C CD    . PRO B 2 69  ? 9.697   18.515  46.121 1.00 102.37 ? 69  PRO A CD    1 
ATOM   1544 N N     . LEU B 2 70  ? 8.815   16.709  42.999 1.00 97.80  ? 70  LEU A N     1 
ATOM   1545 C CA    . LEU B 2 70  ? 8.826   16.111  41.669 1.00 94.34  ? 70  LEU A CA    1 
ATOM   1546 C C     . LEU B 2 70  ? 8.999   14.599  41.780 1.00 97.60  ? 70  LEU A C     1 
ATOM   1547 O O     . LEU B 2 70  ? 8.146   13.836  41.325 1.00 96.46  ? 70  LEU A O     1 
ATOM   1548 C CB    . LEU B 2 70  ? 9.953   16.705  40.818 1.00 97.91  ? 70  LEU A CB    1 
ATOM   1549 C CG    . LEU B 2 70  ? 9.742   18.121  40.268 1.00 101.49 ? 70  LEU A CG    1 
ATOM   1550 C CD1   . LEU B 2 70  ? 9.530   19.101  41.408 1.00 106.24 ? 70  LEU A CD1   1 
ATOM   1551 C CD2   . LEU B 2 70  ? 10.951  18.528  39.440 1.00 106.96 ? 70  LEU A CD2   1 
ATOM   1552 N N     . LYS B 2 71  ? 10.098  14.172  42.395 1.00 97.14  ? 71  LYS A N     1 
ATOM   1553 C CA    . LYS B 2 71  ? 10.373  12.748  42.567 1.00 93.60  ? 71  LYS A CA    1 
ATOM   1554 C C     . LYS B 2 71  ? 9.173   12.021  43.177 1.00 92.38  ? 71  LYS A C     1 
ATOM   1555 O O     . LYS B 2 71  ? 8.979   10.827  42.949 1.00 90.52  ? 71  LYS A O     1 
ATOM   1556 C CB    . LYS B 2 71  ? 11.597  12.545  43.463 1.00 93.70  ? 71  LYS A CB    1 
ATOM   1557 C CG    . LYS B 2 71  ? 11.915  11.081  43.739 1.00 91.83  ? 71  LYS A CG    1 
ATOM   1558 C CD    . LYS B 2 71  ? 12.963  10.929  44.826 1.00 92.84  ? 71  LYS A CD    1 
ATOM   1559 C CE    . LYS B 2 71  ? 13.196  9.465   45.159 1.00 93.11  ? 71  LYS A CE    1 
ATOM   1560 N NZ    . LYS B 2 71  ? 14.163  9.293   46.280 1.00 90.19  ? 71  LYS A NZ    1 
ATOM   1561 N N     . ALA B 2 72  ? 8.375   12.746  43.954 1.00 89.42  ? 72  ALA A N     1 
ATOM   1562 C CA    . ALA B 2 72  ? 7.196   12.174  44.591 1.00 86.72  ? 72  ALA A CA    1 
ATOM   1563 C C     . ALA B 2 72  ? 6.184   11.737  43.536 1.00 88.21  ? 72  ALA A C     1 
ATOM   1564 O O     . ALA B 2 72  ? 5.413   10.799  43.747 1.00 87.60  ? 72  ALA A O     1 
ATOM   1565 C CB    . ALA B 2 72  ? 6.567   13.193  45.531 1.00 85.72  ? 72  ALA A CB    1 
ATOM   1566 N N     . TYR B 2 73  ? 6.194   12.427  42.400 1.00 87.94  ? 73  TYR A N     1 
ATOM   1567 C CA    . TYR B 2 73  ? 5.290   12.118  41.302 1.00 86.91  ? 73  TYR A CA    1 
ATOM   1568 C C     . TYR B 2 73  ? 5.984   11.203  40.303 1.00 87.32  ? 73  TYR A C     1 
ATOM   1569 O O     . TYR B 2 73  ? 5.381   10.265  39.787 1.00 88.03  ? 73  TYR A O     1 
ATOM   1570 C CB    . TYR B 2 73  ? 4.846   13.410  40.611 1.00 95.76  ? 73  TYR A CB    1 
ATOM   1571 C CG    . TYR B 2 73  ? 3.981   13.202  39.385 1.00 102.54 ? 73  TYR A CG    1 
ATOM   1572 C CD1   . TYR B 2 73  ? 4.546   12.840  38.160 1.00 104.49 ? 73  TYR A CD1   1 
ATOM   1573 C CD2   . TYR B 2 73  ? 2.595   13.359  39.450 1.00 103.77 ? 73  TYR A CD2   1 
ATOM   1574 C CE1   . TYR B 2 73  ? 3.753   12.641  37.031 1.00 105.61 ? 73  TYR A CE1   1 
ATOM   1575 C CE2   . TYR B 2 73  ? 1.793   13.161  38.328 1.00 104.00 ? 73  TYR A CE2   1 
ATOM   1576 C CZ    . TYR B 2 73  ? 2.379   12.803  37.122 1.00 106.61 ? 73  TYR A CZ    1 
ATOM   1577 O OH    . TYR B 2 73  ? 1.593   12.610  36.009 1.00 103.64 ? 73  TYR A OH    1 
ATOM   1578 N N     . LEU B 2 74  ? 7.255   11.480  40.037 1.00 87.76  ? 74  LEU A N     1 
ATOM   1579 C CA    . LEU B 2 74  ? 8.025   10.678  39.094 1.00 89.23  ? 74  LEU A CA    1 
ATOM   1580 C C     . LEU B 2 74  ? 8.070   9.202   39.470 1.00 91.54  ? 74  LEU A C     1 
ATOM   1581 O O     . LEU B 2 74  ? 8.355   8.354   38.625 1.00 100.44 ? 74  LEU A O     1 
ATOM   1582 C CB    . LEU B 2 74  ? 9.452   11.223  38.969 1.00 92.14  ? 74  LEU A CB    1 
ATOM   1583 C CG    . LEU B 2 74  ? 9.659   12.421  38.034 1.00 94.80  ? 74  LEU A CG    1 
ATOM   1584 C CD1   . LEU B 2 74  ? 8.849   13.611  38.519 1.00 94.89  ? 74  LEU A CD1   1 
ATOM   1585 C CD2   . LEU B 2 74  ? 11.136  12.774  37.976 1.00 88.89  ? 74  LEU A CD2   1 
ATOM   1586 N N     . ILE B 2 75  ? 7.796   8.890   40.732 1.00 89.70  ? 75  ILE A N     1 
ATOM   1587 C CA    . ILE B 2 75  ? 7.805   7.499   41.171 1.00 84.62  ? 75  ILE A CA    1 
ATOM   1588 C C     . ILE B 2 75  ? 6.474   7.115   41.805 1.00 81.48  ? 75  ILE A C     1 
ATOM   1589 O O     . ILE B 2 75  ? 6.377   6.106   42.500 1.00 74.45  ? 75  ILE A O     1 
ATOM   1590 C CB    . ILE B 2 75  ? 8.950   7.220   42.179 1.00 85.27  ? 75  ILE A CB    1 
ATOM   1591 C CG1   . ILE B 2 75  ? 8.701   7.974   43.484 1.00 84.03  ? 75  ILE A CG1   1 
ATOM   1592 C CG2   . ILE B 2 75  ? 10.288  7.635   41.575 1.00 77.45  ? 75  ILE A CG2   1 
ATOM   1593 C CD1   . ILE B 2 75  ? 9.682   7.625   44.579 1.00 89.17  ? 75  ILE A CD1   1 
ATOM   1594 N N     . SER B 2 76  ? 5.450   7.927   41.560 1.00 84.95  ? 76  SER A N     1 
ATOM   1595 C CA    . SER B 2 76  ? 4.118   7.664   42.090 1.00 89.56  ? 76  SER A CA    1 
ATOM   1596 C C     . SER B 2 76  ? 3.427   6.624   41.219 1.00 93.38  ? 76  SER A C     1 
ATOM   1597 O O     . SER B 2 76  ? 3.778   6.450   40.052 1.00 99.58  ? 76  SER A O     1 
ATOM   1598 C CB    . SER B 2 76  ? 3.285   8.947   42.113 1.00 90.19  ? 76  SER A CB    1 
ATOM   1599 O OG    . SER B 2 76  ? 3.085   9.453   40.805 1.00 94.38  ? 76  SER A OG    1 
ATOM   1600 N N     . GLU B 2 77  ? 2.444   5.933   41.785 1.00 98.10  ? 77  GLU A N     1 
ATOM   1601 C CA    . GLU B 2 77  ? 1.717   4.909   41.042 1.00 104.25 ? 77  GLU A CA    1 
ATOM   1602 C C     . GLU B 2 77  ? 1.106   5.484   39.766 1.00 103.53 ? 77  GLU A C     1 
ATOM   1603 O O     . GLU B 2 77  ? 1.106   4.833   38.721 1.00 101.82 ? 77  GLU A O     1 
ATOM   1604 C CB    . GLU B 2 77  ? 0.623   4.296   41.921 1.00 110.63 ? 77  GLU A CB    1 
ATOM   1605 C CG    . GLU B 2 77  ? -0.382  5.301   42.461 1.00 126.85 ? 77  GLU A CG    1 
ATOM   1606 C CD    . GLU B 2 77  ? -1.376  4.673   43.418 1.00 132.58 ? 77  GLU A CD    1 
ATOM   1607 O OE1   . GLU B 2 77  ? -2.088  3.732   43.004 1.00 135.75 ? 77  GLU A OE1   1 
ATOM   1608 O OE2   . GLU B 2 77  ? -1.444  5.122   44.583 1.00 131.82 ? 77  GLU A OE2   1 
ATOM   1609 N N     . GLU B 2 78  ? 0.597   6.709   39.853 1.00 102.87 ? 78  GLU A N     1 
ATOM   1610 C CA    . GLU B 2 78  ? -0.010  7.359   38.700 1.00 99.91  ? 78  GLU A CA    1 
ATOM   1611 C C     . GLU B 2 78  ? 0.989   7.445   37.550 1.00 98.77  ? 78  GLU A C     1 
ATOM   1612 O O     . GLU B 2 78  ? 0.790   6.839   36.498 1.00 98.82  ? 78  GLU A O     1 
ATOM   1613 C CB    . GLU B 2 78  ? -0.492  8.765   39.067 1.00 99.97  ? 78  GLU A CB    1 
ATOM   1614 C CG    . GLU B 2 78  ? -1.319  9.436   37.975 1.00 102.64 ? 78  GLU A CG    1 
ATOM   1615 C CD    . GLU B 2 78  ? -1.636  10.892  38.278 1.00 104.22 ? 78  GLU A CD    1 
ATOM   1616 O OE1   . GLU B 2 78  ? -2.199  11.167  39.360 1.00 101.42 ? 78  GLU A OE1   1 
ATOM   1617 O OE2   . GLU B 2 78  ? -1.327  11.760  37.430 1.00 97.39  ? 78  GLU A OE2   1 
ATOM   1618 N N     . PHE B 2 79  ? 2.071   8.189   37.760 1.00 97.93  ? 79  PHE A N     1 
ATOM   1619 C CA    . PHE B 2 79  ? 3.089   8.359   36.729 1.00 100.27 ? 79  PHE A CA    1 
ATOM   1620 C C     . PHE B 2 79  ? 3.677   7.038   36.236 1.00 97.74  ? 79  PHE A C     1 
ATOM   1621 O O     . PHE B 2 79  ? 4.174   6.955   35.114 1.00 97.89  ? 79  PHE A O     1 
ATOM   1622 C CB    . PHE B 2 79  ? 4.217   9.264   37.236 1.00 99.61  ? 79  PHE A CB    1 
ATOM   1623 C CG    . PHE B 2 79  ? 5.251   9.578   36.193 1.00 97.56  ? 79  PHE A CG    1 
ATOM   1624 C CD1   . PHE B 2 79  ? 4.897   10.243  35.025 1.00 96.43  ? 79  PHE A CD1   1 
ATOM   1625 C CD2   . PHE B 2 79  ? 6.574   9.192   36.368 1.00 101.44 ? 79  PHE A CD2   1 
ATOM   1626 C CE1   . PHE B 2 79  ? 5.848   10.517  34.044 1.00 100.10 ? 79  PHE A CE1   1 
ATOM   1627 C CE2   . PHE B 2 79  ? 7.534   9.462   35.392 1.00 102.21 ? 79  PHE A CE2   1 
ATOM   1628 C CZ    . PHE B 2 79  ? 7.170   10.125  34.228 1.00 98.19  ? 79  PHE A CZ    1 
ATOM   1629 N N     . PHE B 2 80  ? 3.629   6.008   37.072 1.00 96.97  ? 80  PHE A N     1 
ATOM   1630 C CA    . PHE B 2 80  ? 4.156   4.708   36.681 1.00 98.33  ? 80  PHE A CA    1 
ATOM   1631 C C     . PHE B 2 80  ? 3.175   3.990   35.767 1.00 98.95  ? 80  PHE A C     1 
ATOM   1632 O O     . PHE B 2 80  ? 3.557   3.091   35.016 1.00 96.27  ? 80  PHE A O     1 
ATOM   1633 C CB    . PHE B 2 80  ? 4.449   3.861   37.920 1.00 95.46  ? 80  PHE A CB    1 
ATOM   1634 C CG    . PHE B 2 80  ? 5.884   3.907   38.355 1.00 88.50  ? 80  PHE A CG    1 
ATOM   1635 C CD1   . PHE B 2 80  ? 6.573   5.111   38.400 1.00 88.43  ? 80  PHE A CD1   1 
ATOM   1636 C CD2   . PHE B 2 80  ? 6.546   2.745   38.728 1.00 84.27  ? 80  PHE A CD2   1 
ATOM   1637 C CE1   . PHE B 2 80  ? 7.902   5.155   38.809 1.00 84.43  ? 80  PHE A CE1   1 
ATOM   1638 C CE2   . PHE B 2 80  ? 7.874   2.781   39.138 1.00 77.66  ? 80  PHE A CE2   1 
ATOM   1639 C CZ    . PHE B 2 80  ? 8.552   3.987   39.178 1.00 74.30  ? 80  PHE A CZ    1 
ATOM   1640 N N     . ASN B 2 81  ? 1.910   4.392   35.837 1.00 99.44  ? 81  ASN A N     1 
ATOM   1641 C CA    . ASN B 2 81  ? 0.879   3.804   34.993 1.00 103.73 ? 81  ASN A CA    1 
ATOM   1642 C C     . ASN B 2 81  ? 0.941   4.425   33.603 1.00 103.76 ? 81  ASN A C     1 
ATOM   1643 O O     . ASN B 2 81  ? 0.785   3.734   32.599 1.00 104.84 ? 81  ASN A O     1 
ATOM   1644 C CB    . ASN B 2 81  ? -0.508  4.035   35.593 1.00 101.19 ? 81  ASN A CB    1 
ATOM   1645 C CG    . ASN B 2 81  ? -0.827  3.067   36.711 1.00 106.95 ? 81  ASN A CG    1 
ATOM   1646 O OD1   . ASN B 2 81  ? -1.753  3.287   37.491 1.00 114.70 ? 81  ASN A OD1   1 
ATOM   1647 N ND2   . ASN B 2 81  ? -0.056  1.991   36.801 1.00 110.65 ? 81  ASN A ND2   1 
ATOM   1648 N N     . LEU B 2 82  ? 1.172   5.734   33.553 1.00 103.93 ? 82  LEU A N     1 
ATOM   1649 C CA    . LEU B 2 82  ? 1.256   6.447   32.286 1.00 105.01 ? 82  LEU A CA    1 
ATOM   1650 C C     . LEU B 2 82  ? 2.401   5.942   31.426 1.00 105.23 ? 82  LEU A C     1 
ATOM   1651 O O     . LEU B 2 82  ? 2.347   6.036   30.201 1.00 107.51 ? 82  LEU A O     1 
ATOM   1652 C CB    . LEU B 2 82  ? 1.413   7.951   32.526 1.00 106.86 ? 82  LEU A CB    1 
ATOM   1653 C CG    . LEU B 2 82  ? 0.127   8.736   32.811 1.00 112.32 ? 82  LEU A CG    1 
ATOM   1654 C CD1   . LEU B 2 82  ? -0.748  8.743   31.564 1.00 113.74 ? 82  LEU A CD1   1 
ATOM   1655 C CD2   . LEU B 2 82  ? -0.620  8.120   33.989 1.00 114.44 ? 82  LEU A CD2   1 
ATOM   1656 N N     . LEU B 2 83  ? 3.438   5.408   32.065 1.00 105.52 ? 83  LEU A N     1 
ATOM   1657 C CA    . LEU B 2 83  ? 4.580   4.881   31.329 1.00 108.10 ? 83  LEU A CA    1 
ATOM   1658 C C     . LEU B 2 83  ? 4.346   3.419   30.979 1.00 109.96 ? 83  LEU A C     1 
ATOM   1659 O O     . LEU B 2 83  ? 4.908   2.905   30.013 1.00 111.26 ? 83  LEU A O     1 
ATOM   1660 C CB    . LEU B 2 83  ? 5.866   5.017   32.148 1.00 104.58 ? 83  LEU A CB    1 
ATOM   1661 C CG    . LEU B 2 83  ? 6.379   6.439   32.384 1.00 102.11 ? 83  LEU A CG    1 
ATOM   1662 C CD1   . LEU B 2 83  ? 7.733   6.380   33.070 1.00 101.64 ? 83  LEU A CD1   1 
ATOM   1663 C CD2   . LEU B 2 83  ? 6.497   7.175   31.059 1.00 106.30 ? 83  LEU A CD2   1 
ATOM   1664 N N     . ALA B 2 84  ? 3.512   2.754   31.771 1.00 111.94 ? 84  ALA A N     1 
ATOM   1665 C CA    . ALA B 2 84  ? 3.194   1.353   31.532 1.00 115.67 ? 84  ALA A CA    1 
ATOM   1666 C C     . ALA B 2 84  ? 2.235   1.253   30.351 1.00 117.48 ? 84  ALA A C     1 
ATOM   1667 O O     . ALA B 2 84  ? 2.379   0.379   29.497 1.00 120.90 ? 84  ALA A O     1 
ATOM   1668 C CB    . ALA B 2 84  ? 2.564   0.739   32.774 1.00 114.65 ? 84  ALA A CB    1 
ATOM   1669 N N     . GLN B 2 85  ? 1.259   2.156   30.309 1.00 118.70 ? 85  GLN A N     1 
ATOM   1670 C CA    . GLN B 2 85  ? 0.282   2.178   29.226 1.00 118.09 ? 85  GLN A CA    1 
ATOM   1671 C C     . GLN B 2 85  ? 1.001   2.288   27.889 1.00 115.81 ? 85  GLN A C     1 
ATOM   1672 O O     . GLN B 2 85  ? 0.576   1.697   26.896 1.00 117.34 ? 85  GLN A O     1 
ATOM   1673 C CB    . GLN B 2 85  ? -0.672  3.365   29.382 1.00 117.29 ? 85  GLN A CB    1 
ATOM   1674 C CG    . GLN B 2 85  ? -1.490  3.354   30.660 1.00 123.30 ? 85  GLN A CG    1 
ATOM   1675 C CD    . GLN B 2 85  ? -2.280  2.075   30.833 1.00 125.59 ? 85  GLN A CD    1 
ATOM   1676 O OE1   . GLN B 2 85  ? -3.035  1.673   29.946 1.00 124.13 ? 85  GLN A OE1   1 
ATOM   1677 N NE2   . GLN B 2 85  ? -2.113  1.427   31.981 1.00 123.06 ? 85  GLN A NE2   1 
ATOM   1678 N N     . LYS B 2 86  ? 2.096   3.043   27.872 1.00 111.16 ? 86  LYS A N     1 
ATOM   1679 C CA    . LYS B 2 86  ? 2.877   3.234   26.656 1.00 108.87 ? 86  LYS A CA    1 
ATOM   1680 C C     . LYS B 2 86  ? 3.553   1.933   26.236 1.00 104.89 ? 86  LYS A C     1 
ATOM   1681 O O     . LYS B 2 86  ? 4.387   1.914   25.331 1.00 101.63 ? 86  LYS A O     1 
ATOM   1682 C CB    . LYS B 2 86  ? 3.926   4.328   26.869 1.00 110.07 ? 86  LYS A CB    1 
ATOM   1683 C CG    . LYS B 2 86  ? 4.659   4.737   25.600 1.00 114.86 ? 86  LYS A CG    1 
ATOM   1684 C CD    . LYS B 2 86  ? 5.599   5.905   25.848 1.00 121.14 ? 86  LYS A CD    1 
ATOM   1685 C CE    . LYS B 2 86  ? 6.316   6.311   24.569 1.00 125.61 ? 86  LYS A CE    1 
ATOM   1686 N NZ    . LYS B 2 86  ? 5.359   6.673   23.483 1.00 126.06 ? 86  LYS A NZ    1 
ATOM   1687 N N     . LEU B 2 87  ? 3.190   0.846   26.908 1.00 103.77 ? 87  LEU A N     1 
ATOM   1688 C CA    . LEU B 2 87  ? 3.729   -0.473  26.607 1.00 110.68 ? 87  LEU A CA    1 
ATOM   1689 C C     . LEU B 2 87  ? 2.581   -1.469  26.565 1.00 113.64 ? 87  LEU A C     1 
ATOM   1690 O O     . LEU B 2 87  ? 2.765   -2.631  26.203 1.00 116.01 ? 87  LEU A O     1 
ATOM   1691 C CB    . LEU B 2 87  ? 4.739   -0.911  27.673 1.00 109.58 ? 87  LEU A CB    1 
ATOM   1692 C CG    . LEU B 2 87  ? 6.091   -0.197  27.734 1.00 111.42 ? 87  LEU A CG    1 
ATOM   1693 C CD1   . LEU B 2 87  ? 6.935   -0.805  28.846 1.00 109.34 ? 87  LEU A CD1   1 
ATOM   1694 C CD2   . LEU B 2 87  ? 6.805   -0.327  26.399 1.00 110.53 ? 87  LEU A CD2   1 
ATOM   1695 N N     . GLU B 2 88  ? 1.394   -1.003  26.941 1.00 118.03 ? 88  GLU A N     1 
ATOM   1696 C CA    . GLU B 2 88  ? 0.207   -1.849  26.951 1.00 126.42 ? 88  GLU A CA    1 
ATOM   1697 C C     . GLU B 2 88  ? 0.499   -3.048  27.852 1.00 126.91 ? 88  GLU A C     1 
ATOM   1698 O O     . GLU B 2 88  ? 0.118   -4.180  27.550 1.00 131.15 ? 88  GLU A O     1 
ATOM   1699 C CB    . GLU B 2 88  ? -0.106  -2.321  25.526 1.00 132.27 ? 88  GLU A CB    1 
ATOM   1700 C CG    . GLU B 2 88  ? -1.576  -2.593  25.258 1.00 138.03 ? 88  GLU A CG    1 
ATOM   1701 C CD    . GLU B 2 88  ? -1.963  -2.323  23.817 1.00 142.96 ? 88  GLU A CD    1 
ATOM   1702 O OE1   . GLU B 2 88  ? -1.789  -1.176  23.354 1.00 143.01 ? 88  GLU A OE1   1 
ATOM   1703 O OE2   . GLU B 2 88  ? -2.443  -3.262  23.144 1.00 146.70 ? 88  GLU A OE2   1 
ATOM   1704 N N     . LEU B 2 89  ? 1.178   -2.779  28.963 1.00 124.74 ? 89  LEU A N     1 
ATOM   1705 C CA    . LEU B 2 89  ? 1.562   -3.812  29.917 1.00 121.61 ? 89  LEU A CA    1 
ATOM   1706 C C     . LEU B 2 89  ? 0.376   -4.574  30.495 1.00 120.85 ? 89  LEU A C     1 
ATOM   1707 O O     . LEU B 2 89  ? 0.485   -5.765  30.783 1.00 119.62 ? 89  LEU A O     1 
ATOM   1708 C CB    . LEU B 2 89  ? 2.377   -3.186  31.052 1.00 119.92 ? 89  LEU A CB    1 
ATOM   1709 C CG    . LEU B 2 89  ? 3.307   -4.114  31.835 1.00 119.53 ? 89  LEU A CG    1 
ATOM   1710 C CD1   . LEU B 2 89  ? 4.403   -4.633  30.915 1.00 114.67 ? 89  LEU A CD1   1 
ATOM   1711 C CD2   . LEU B 2 89  ? 3.916   -3.356  33.003 1.00 119.02 ? 89  LEU A CD2   1 
ATOM   1712 N N     . HIS B 2 90  ? -0.754  -3.893  30.661 1.00 121.65 ? 90  HIS A N     1 
ATOM   1713 C CA    . HIS B 2 90  ? -1.947  -4.528  31.213 1.00 126.81 ? 90  HIS A CA    1 
ATOM   1714 C C     . HIS B 2 90  ? -2.472  -5.660  30.335 1.00 125.02 ? 90  HIS A C     1 
ATOM   1715 O O     . HIS B 2 90  ? -3.417  -6.354  30.710 1.00 124.05 ? 90  HIS A O     1 
ATOM   1716 C CB    . HIS B 2 90  ? -3.048  -3.487  31.437 1.00 134.48 ? 90  HIS A CB    1 
ATOM   1717 C CG    . HIS B 2 90  ? -3.649  -2.962  30.173 1.00 145.01 ? 90  HIS A CG    1 
ATOM   1718 N ND1   . HIS B 2 90  ? -4.958  -3.204  29.813 1.00 148.37 ? 90  HIS A ND1   1 
ATOM   1719 C CD2   . HIS B 2 90  ? -3.122  -2.203  29.183 1.00 149.44 ? 90  HIS A CD2   1 
ATOM   1720 C CE1   . HIS B 2 90  ? -5.209  -2.619  28.656 1.00 152.12 ? 90  HIS A CE1   1 
ATOM   1721 N NE2   . HIS B 2 90  ? -4.112  -2.005  28.252 1.00 152.12 ? 90  HIS A NE2   1 
ATOM   1722 N N     . LYS B 2 91  ? -1.855  -5.849  29.173 1.00 124.38 ? 91  LYS A N     1 
ATOM   1723 C CA    . LYS B 2 91  ? -2.269  -6.907  28.256 1.00 126.77 ? 91  LYS A CA    1 
ATOM   1724 C C     . LYS B 2 91  ? -1.317  -8.098  28.265 1.00 125.46 ? 91  LYS A C     1 
ATOM   1725 O O     . LYS B 2 91  ? -1.537  -9.078  27.553 1.00 129.30 ? 91  LYS A O     1 
ATOM   1726 C CB    . LYS B 2 91  ? -2.383  -6.368  26.824 1.00 130.76 ? 91  LYS A CB    1 
ATOM   1727 C CG    . LYS B 2 91  ? -3.588  -5.471  26.576 1.00 136.68 ? 91  LYS A CG    1 
ATOM   1728 C CD    . LYS B 2 91  ? -3.746  -5.157  25.092 1.00 137.10 ? 91  LYS A CD    1 
ATOM   1729 C CE    . LYS B 2 91  ? -4.987  -4.315  24.828 1.00 135.83 ? 91  LYS A CE    1 
ATOM   1730 N NZ    . LYS B 2 91  ? -6.236  -5.013  25.243 1.00 133.10 ? 91  LYS A NZ    1 
ATOM   1731 N N     . PHE B 2 92  ? -0.264  -8.018  29.073 1.00 120.66 ? 92  PHE A N     1 
ATOM   1732 C CA    . PHE B 2 92  ? 0.712   -9.100  29.147 1.00 114.81 ? 92  PHE A CA    1 
ATOM   1733 C C     . PHE B 2 92  ? 0.740   -9.745  30.529 1.00 110.64 ? 92  PHE A C     1 
ATOM   1734 O O     . PHE B 2 92  ? 1.368   -10.786 30.723 1.00 109.38 ? 92  PHE A O     1 
ATOM   1735 C CB    . PHE B 2 92  ? 2.107   -8.567  28.808 1.00 115.21 ? 92  PHE A CB    1 
ATOM   1736 C CG    . PHE B 2 92  ? 2.162   -7.774  27.534 1.00 118.08 ? 92  PHE A CG    1 
ATOM   1737 C CD1   . PHE B 2 92  ? 1.863   -8.369  26.313 1.00 118.62 ? 92  PHE A CD1   1 
ATOM   1738 C CD2   . PHE B 2 92  ? 2.502   -6.425  27.555 1.00 119.25 ? 92  PHE A CD2   1 
ATOM   1739 C CE1   . PHE B 2 92  ? 1.901   -7.631  25.131 1.00 119.66 ? 92  PHE A CE1   1 
ATOM   1740 C CE2   . PHE B 2 92  ? 2.543   -5.679  26.380 1.00 115.51 ? 92  PHE A CE2   1 
ATOM   1741 C CZ    . PHE B 2 92  ? 2.242   -6.282  25.166 1.00 117.57 ? 92  PHE A CZ    1 
ATOM   1742 N N     . ILE B 2 93  ? 0.052   -9.127  31.485 1.00 105.82 ? 93  ILE A N     1 
ATOM   1743 C CA    . ILE B 2 93  ? 0.019   -9.630  32.854 1.00 104.24 ? 93  ILE A CA    1 
ATOM   1744 C C     . ILE B 2 93  ? -0.727  -10.944 33.051 1.00 101.73 ? 93  ILE A C     1 
ATOM   1745 O O     . ILE B 2 93  ? -1.839  -11.128 32.556 1.00 105.78 ? 93  ILE A O     1 
ATOM   1746 C CB    . ILE B 2 93  ? -0.584  -8.583  33.825 1.00 100.65 ? 93  ILE A CB    1 
ATOM   1747 C CG1   . ILE B 2 93  ? 0.426   -7.460  34.070 1.00 94.60  ? 93  ILE A CG1   1 
ATOM   1748 C CG2   . ILE B 2 93  ? -0.970  -9.242  35.142 1.00 94.97  ? 93  ILE A CG2   1 
ATOM   1749 C CD1   . ILE B 2 93  ? -0.054  -6.407  35.049 1.00 89.02  ? 93  ILE A CD1   1 
ATOM   1750 N N     . ARG B 2 94  ? -0.092  -11.851 33.788 1.00 99.56  ? 94  ARG A N     1 
ATOM   1751 C CA    . ARG B 2 94  ? -0.660  -13.154 34.112 1.00 95.33  ? 94  ARG A CA    1 
ATOM   1752 C C     . ARG B 2 94  ? -1.204  -13.094 35.526 1.00 93.43  ? 94  ARG A C     1 
ATOM   1753 O O     . ARG B 2 94  ? -0.436  -13.168 36.480 1.00 98.00  ? 94  ARG A O     1 
ATOM   1754 C CB    . ARG B 2 94  ? 0.409   -14.234 34.046 1.00 92.51  ? 94  ARG A CB    1 
ATOM   1755 C CG    . ARG B 2 94  ? 1.037   -14.443 32.682 1.00 91.55  ? 94  ARG A CG    1 
ATOM   1756 C CD    . ARG B 2 94  ? 1.816   -15.743 32.721 1.00 100.00 ? 94  ARG A CD    1 
ATOM   1757 N NE    . ARG B 2 94  ? 2.155   -16.267 31.402 1.00 109.25 ? 94  ARG A NE    1 
ATOM   1758 C CZ    . ARG B 2 94  ? 2.533   -17.525 31.184 1.00 114.48 ? 94  ARG A CZ    1 
ATOM   1759 N NH1   . ARG B 2 94  ? 2.611   -18.377 32.201 1.00 111.56 ? 94  ARG A NH1   1 
ATOM   1760 N NH2   . ARG B 2 94  ? 2.843   -17.930 29.955 1.00 113.64 ? 94  ARG A NH2   1 
ATOM   1761 N N     . ILE B 2 95  ? -2.523  -12.974 35.654 1.00 90.48  ? 95  ILE A N     1 
ATOM   1762 C CA    . ILE B 2 95  ? -3.180  -12.880 36.955 1.00 84.75  ? 95  ILE A CA    1 
ATOM   1763 C C     . ILE B 2 95  ? -4.630  -13.322 36.847 1.00 83.75  ? 95  ILE A C     1 
ATOM   1764 O O     . ILE B 2 95  ? -5.173  -13.403 35.759 1.00 87.54  ? 95  ILE A O     1 
ATOM   1765 C CB    . ILE B 2 95  ? -3.168  -11.424 37.452 1.00 81.55  ? 95  ILE A CB    1 
ATOM   1766 C CG1   . ILE B 2 95  ? -3.898  -11.300 38.790 1.00 84.41  ? 95  ILE A CG1   1 
ATOM   1767 C CG2   . ILE B 2 95  ? -3.821  -10.540 36.420 1.00 74.28  ? 95  ILE A CG2   1 
ATOM   1768 C CD1   . ILE B 2 95  ? -4.033  -9.869  39.286 1.00 80.39  ? 95  ILE A CD1   1 
ATOM   1769 N N     . LYS B 2 96  ? -5.259  -13.624 37.973 1.00 83.74  ? 96  LYS A N     1 
ATOM   1770 C CA    . LYS B 2 96  ? -6.656  -14.002 37.945 1.00 85.88  ? 96  LYS A CA    1 
ATOM   1771 C C     . LYS B 2 96  ? -7.425  -12.746 37.560 1.00 92.52  ? 96  LYS A C     1 
ATOM   1772 O O     . LYS B 2 96  ? -6.967  -11.630 37.807 1.00 88.46  ? 96  LYS A O     1 
ATOM   1773 C CB    . LYS B 2 96  ? -7.129  -14.462 39.317 1.00 81.64  ? 96  LYS A CB    1 
ATOM   1774 C CG    . LYS B 2 96  ? -6.918  -15.928 39.626 1.00 82.15  ? 96  LYS A CG    1 
ATOM   1775 C CD    . LYS B 2 96  ? -7.817  -16.320 40.812 1.00 88.09  ? 96  LYS A CD    1 
ATOM   1776 C CE    . LYS B 2 96  ? -7.592  -17.754 41.240 1.00 95.48  ? 96  LYS A CE    1 
ATOM   1777 N NZ    . LYS B 2 96  ? -7.632  -18.664 40.059 1.00 104.91 ? 96  LYS A NZ    1 
ATOM   1778 N N     . ARG B 2 97  ? -8.596  -12.929 36.957 1.00 103.14 ? 97  ARG A N     1 
ATOM   1779 C CA    . ARG B 2 97  ? -9.423  -11.800 36.546 1.00 110.78 ? 97  ARG A CA    1 
ATOM   1780 C C     . ARG B 2 97  ? -10.090 -11.114 37.743 1.00 112.60 ? 97  ARG A C     1 
ATOM   1781 O O     . ARG B 2 97  ? -10.213 -11.695 38.826 1.00 109.11 ? 97  ARG A O     1 
ATOM   1782 C CB    . ARG B 2 97  ? -10.508 -12.257 35.551 1.00 116.39 ? 97  ARG A CB    1 
ATOM   1783 C CG    . ARG B 2 97  ? -11.660 -13.077 36.161 1.00 120.51 ? 97  ARG A CG    1 
ATOM   1784 C CD    . ARG B 2 97  ? -12.916 -13.048 35.273 1.00 118.65 ? 97  ARG A CD    1 
ATOM   1785 N NE    . ARG B 2 97  ? -14.048 -13.749 35.883 1.00 123.58 ? 97  ARG A NE    1 
ATOM   1786 C CZ    . ARG B 2 97  ? -14.255 -15.063 35.812 1.00 124.90 ? 97  ARG A CZ    1 
ATOM   1787 N NH1   . ARG B 2 97  ? -13.411 -15.841 35.149 1.00 124.88 ? 97  ARG A NH1   1 
ATOM   1788 N NH2   . ARG B 2 97  ? -15.306 -15.606 36.414 1.00 124.40 ? 97  ARG A NH2   1 
ATOM   1789 N N     . GLY B 2 98  ? -10.522 -9.873  37.529 1.00 113.40 ? 98  GLY A N     1 
ATOM   1790 C CA    . GLY B 2 98  ? -11.187 -9.115  38.575 1.00 116.46 ? 98  GLY A CA    1 
ATOM   1791 C C     . GLY B 2 98  ? -10.429 -9.125  39.884 1.00 118.00 ? 98  GLY A C     1 
ATOM   1792 O O     . GLY B 2 98  ? -10.991 -9.444  40.940 1.00 115.34 ? 98  GLY A O     1 
ATOM   1793 N N     . LYS B 2 99  ? -9.149  -8.768  39.807 1.00 120.26 ? 99  LYS A N     1 
ATOM   1794 C CA    . LYS B 2 99  ? -8.278  -8.734  40.975 1.00 120.16 ? 99  LYS A CA    1 
ATOM   1795 C C     . LYS B 2 99  ? -7.133  -7.766  40.705 1.00 118.22 ? 99  LYS A C     1 
ATOM   1796 O O     . LYS B 2 99  ? -6.416  -7.367  41.623 1.00 115.90 ? 99  LYS A O     1 
ATOM   1797 C CB    . LYS B 2 99  ? -7.709  -10.134 41.242 1.00 121.07 ? 99  LYS A CB    1 
ATOM   1798 C CG    . LYS B 2 99  ? -7.248  -10.380 42.672 1.00 122.02 ? 99  LYS A CG    1 
ATOM   1799 C CD    . LYS B 2 99  ? -6.620  -11.766 42.836 1.00 126.48 ? 99  LYS A CD    1 
ATOM   1800 C CE    . LYS B 2 99  ? -6.588  -12.215 44.305 1.00 127.30 ? 99  LYS A CE    1 
ATOM   1801 N NZ    . LYS B 2 99  ? -5.921  -11.248 45.232 1.00 127.95 ? 99  LYS A NZ    1 
ATOM   1802 N N     . ILE B 2 100 ? -6.970  -7.388  39.439 1.00 116.36 ? 100 ILE A N     1 
ATOM   1803 C CA    . ILE B 2 100 ? -5.892  -6.489  39.043 1.00 113.41 ? 100 ILE A CA    1 
ATOM   1804 C C     . ILE B 2 100 ? -6.259  -5.018  39.060 1.00 111.67 ? 100 ILE A C     1 
ATOM   1805 O O     . ILE B 2 100 ? -7.285  -4.610  38.527 1.00 112.54 ? 100 ILE A O     1 
ATOM   1806 C CB    . ILE B 2 100 ? -5.369  -6.818  37.636 1.00 112.67 ? 100 ILE A CB    1 
ATOM   1807 C CG1   . ILE B 2 100 ? -4.143  -5.961  37.329 1.00 108.95 ? 100 ILE A CG1   1 
ATOM   1808 C CG2   . ILE B 2 100 ? -6.452  -6.547  36.601 1.00 110.41 ? 100 ILE A CG2   1 
ATOM   1809 C CD1   . ILE B 2 100 ? -3.461  -6.329  36.037 1.00 108.76 ? 100 ILE A CD1   1 
ATOM   1810 N N     . ASN B 2 101 ? -5.394  -4.226  39.675 1.00 111.52 ? 101 ASN A N     1 
ATOM   1811 C CA    . ASN B 2 101 ? -5.601  -2.795  39.761 1.00 111.77 ? 101 ASN A CA    1 
ATOM   1812 C C     . ASN B 2 101 ? -4.337  -2.110  39.258 1.00 109.21 ? 101 ASN A C     1 
ATOM   1813 O O     . ASN B 2 101 ? -3.467  -2.769  38.683 1.00 106.18 ? 101 ASN A O     1 
ATOM   1814 C CB    . ASN B 2 101 ? -5.940  -2.383  41.208 1.00 115.01 ? 101 ASN A CB    1 
ATOM   1815 C CG    . ASN B 2 101 ? -4.793  -2.606  42.184 1.00 113.85 ? 101 ASN A CG    1 
ATOM   1816 O OD1   . ASN B 2 101 ? -3.864  -1.806  42.258 1.00 113.22 ? 101 ASN A OD1   1 
ATOM   1817 N ND2   . ASN B 2 101 ? -4.861  -3.697  42.941 1.00 113.50 ? 101 ASN A ND2   1 
ATOM   1818 N N     . GLU B 2 102 ? -4.255  -0.797  39.452 1.00 107.51 ? 102 GLU A N     1 
ATOM   1819 C CA    . GLU B 2 102 ? -3.110  -0.021  38.993 1.00 109.32 ? 102 GLU A CA    1 
ATOM   1820 C C     . GLU B 2 102 ? -1.856  -0.237  39.828 1.00 106.89 ? 102 GLU A C     1 
ATOM   1821 O O     . GLU B 2 102 ? -0.741  -0.056  39.338 1.00 105.22 ? 102 GLU A O     1 
ATOM   1822 C CB    . GLU B 2 102 ? -3.467  1.467   38.955 1.00 114.98 ? 102 GLU A CB    1 
ATOM   1823 C CG    . GLU B 2 102 ? -4.057  2.002   40.245 1.00 129.34 ? 102 GLU A CG    1 
ATOM   1824 C CD    . GLU B 2 102 ? -4.458  3.461   40.135 1.00 135.74 ? 102 GLU A CD    1 
ATOM   1825 O OE1   . GLU B 2 102 ? -3.568  4.307   39.904 1.00 139.96 ? 102 GLU A OE1   1 
ATOM   1826 O OE2   . GLU B 2 102 ? -5.663  3.760   40.276 1.00 135.13 ? 102 GLU A OE2   1 
ATOM   1827 N N     . THR B 2 103 ? -2.034  -0.614  41.090 1.00 102.38 ? 103 THR A N     1 
ATOM   1828 C CA    . THR B 2 103 ? -0.893  -0.871  41.961 1.00 96.92  ? 103 THR A CA    1 
ATOM   1829 C C     . THR B 2 103 ? -0.089  -1.993  41.317 1.00 92.08  ? 103 THR A C     1 
ATOM   1830 O O     . THR B 2 103 ? 1.094   -1.834  41.009 1.00 94.01  ? 103 THR A O     1 
ATOM   1831 C CB    . THR B 2 103 ? -1.336  -1.329  43.372 1.00 97.54  ? 103 THR A CB    1 
ATOM   1832 O OG1   . THR B 2 103 ? -2.121  -0.301  43.992 1.00 96.31  ? 103 THR A OG1   1 
ATOM   1833 C CG2   . THR B 2 103 ? -0.124  -1.625  44.237 1.00 93.64  ? 103 THR A CG2   1 
ATOM   1834 N N     . ILE B 2 104 ? -0.758  -3.123  41.104 1.00 83.30  ? 104 ILE A N     1 
ATOM   1835 C CA    . ILE B 2 104 ? -0.150  -4.298  40.496 1.00 78.62  ? 104 ILE A CA    1 
ATOM   1836 C C     . ILE B 2 104 ? 0.578   -3.977  39.198 1.00 78.29  ? 104 ILE A C     1 
ATOM   1837 O O     . ILE B 2 104 ? 1.617   -4.564  38.904 1.00 81.28  ? 104 ILE A O     1 
ATOM   1838 C CB    . ILE B 2 104 ? -1.210  -5.369  40.217 1.00 70.72  ? 104 ILE A CB    1 
ATOM   1839 C CG1   . ILE B 2 104 ? -1.912  -5.745  41.523 1.00 72.09  ? 104 ILE A CG1   1 
ATOM   1840 C CG2   . ILE B 2 104 ? -0.566  -6.586  39.585 1.00 75.18  ? 104 ILE A CG2   1 
ATOM   1841 C CD1   . ILE B 2 104 ? -2.977  -6.802  41.372 1.00 76.73  ? 104 ILE A CD1   1 
ATOM   1842 N N     . ILE B 2 105 ? 0.031   -3.054  38.417 1.00 83.28  ? 105 ILE A N     1 
ATOM   1843 C CA    . ILE B 2 105 ? 0.664   -2.672  37.159 1.00 88.95  ? 105 ILE A CA    1 
ATOM   1844 C C     . ILE B 2 105 ? 2.041   -2.087  37.454 1.00 86.31  ? 105 ILE A C     1 
ATOM   1845 O O     . ILE B 2 105 ? 3.030   -2.448  36.816 1.00 79.79  ? 105 ILE A O     1 
ATOM   1846 C CB    . ILE B 2 105 ? -0.169  -1.616  36.396 1.00 89.63  ? 105 ILE A CB    1 
ATOM   1847 C CG1   . ILE B 2 105 ? -1.567  -2.163  36.102 1.00 90.79  ? 105 ILE A CG1   1 
ATOM   1848 C CG2   . ILE B 2 105 ? 0.532   -1.243  35.096 1.00 82.98  ? 105 ILE A CG2   1 
ATOM   1849 C CD1   . ILE B 2 105 ? -2.445  -1.210  35.316 1.00 92.23  ? 105 ILE A CD1   1 
ATOM   1850 N N     . GLY B 2 106 ? 2.092   -1.184  38.430 1.00 86.43  ? 106 GLY A N     1 
ATOM   1851 C CA    . GLY B 2 106 ? 3.348   -0.560  38.803 1.00 90.70  ? 106 GLY A CA    1 
ATOM   1852 C C     . GLY B 2 106 ? 4.384   -1.585  39.223 1.00 87.90  ? 106 GLY A C     1 
ATOM   1853 O O     . GLY B 2 106 ? 5.519   -1.574  38.744 1.00 82.36  ? 106 GLY A O     1 
ATOM   1854 N N     . ASP B 2 107 ? 3.989   -2.473  40.127 1.00 83.73  ? 107 ASP A N     1 
ATOM   1855 C CA    . ASP B 2 107 ? 4.881   -3.515  40.609 1.00 91.54  ? 107 ASP A CA    1 
ATOM   1856 C C     . ASP B 2 107 ? 5.463   -4.277  39.425 1.00 88.68  ? 107 ASP A C     1 
ATOM   1857 O O     . ASP B 2 107 ? 6.663   -4.559  39.375 1.00 84.06  ? 107 ASP A O     1 
ATOM   1858 C CB    . ASP B 2 107 ? 4.141   -4.466  41.553 1.00 96.51  ? 107 ASP A CB    1 
ATOM   1859 C CG    . ASP B 2 107 ? 3.667   -3.798  42.809 1.00 105.68 ? 107 ASP A CG    1 
ATOM   1860 O OD1   . ASP B 2 107 ? 3.386   -2.580  42.774 1.00 110.99 ? 107 ASP A OD1   1 
ATOM   1861 O OD2   . ASP B 2 107 ? 3.559   -4.488  43.849 1.00 107.55 ? 107 ASP A OD2   1 
ATOM   1862 N N     . VAL B 2 108 ? 4.601   -4.597  38.467 1.00 87.55  ? 108 VAL A N     1 
ATOM   1863 C CA    . VAL B 2 108 ? 5.016   -5.323  37.277 1.00 86.20  ? 108 VAL A CA    1 
ATOM   1864 C C     . VAL B 2 108 ? 5.971   -4.476  36.443 1.00 80.89  ? 108 VAL A C     1 
ATOM   1865 O O     . VAL B 2 108 ? 6.913   -4.994  35.847 1.00 79.39  ? 108 VAL A O     1 
ATOM   1866 C CB    . VAL B 2 108 ? 3.797   -5.711  36.416 1.00 78.57  ? 108 VAL A CB    1 
ATOM   1867 C CG1   . VAL B 2 108 ? 4.222   -6.351  35.106 1.00 83.28  ? 108 VAL A CG1   1 
ATOM   1868 C CG2   . VAL B 2 108 ? 2.889   -6.638  37.197 1.00 73.74  ? 108 VAL A CG2   1 
ATOM   1869 N N     . PHE B 2 109 ? 5.705   -3.173  36.398 1.00 79.69  ? 109 PHE A N     1 
ATOM   1870 C CA    . PHE B 2 109 ? 6.578   -2.280  35.650 1.00 84.14  ? 109 PHE A CA    1 
ATOM   1871 C C     . PHE B 2 109 ? 8.008   -2.344  36.161 1.00 85.51  ? 109 PHE A C     1 
ATOM   1872 O O     . PHE B 2 109 ? 8.954   -2.469  35.383 1.00 85.61  ? 109 PHE A O     1 
ATOM   1873 C CB    . PHE B 2 109 ? 6.060   -0.845  35.746 1.00 85.00  ? 109 PHE A CB    1 
ATOM   1874 C CG    . PHE B 2 109 ? 6.890   0.147   34.985 1.00 89.60  ? 109 PHE A CG    1 
ATOM   1875 C CD1   . PHE B 2 109 ? 7.041   0.035   33.607 1.00 87.32  ? 109 PHE A CD1   1 
ATOM   1876 C CD2   . PHE B 2 109 ? 7.536   1.184   35.647 1.00 90.39  ? 109 PHE A CD2   1 
ATOM   1877 C CE1   . PHE B 2 109 ? 7.825   0.942   32.900 1.00 95.56  ? 109 PHE A CE1   1 
ATOM   1878 C CE2   . PHE B 2 109 ? 8.323   2.097   34.948 1.00 94.87  ? 109 PHE A CE2   1 
ATOM   1879 C CZ    . PHE B 2 109 ? 8.468   1.976   33.573 1.00 95.40  ? 109 PHE A CZ    1 
ATOM   1880 N N     . GLU B 2 110 ? 8.150   -2.258  37.479 1.00 89.46  ? 110 GLU A N     1 
ATOM   1881 C CA    . GLU B 2 110 ? 9.453   -2.306  38.135 1.00 84.86  ? 110 GLU A CA    1 
ATOM   1882 C C     . GLU B 2 110 ? 10.024  -3.698  37.955 1.00 77.89  ? 110 GLU A C     1 
ATOM   1883 O O     . GLU B 2 110 ? 11.167  -3.861  37.537 1.00 80.23  ? 110 GLU A O     1 
ATOM   1884 C CB    . GLU B 2 110 ? 9.358   -1.955  39.623 1.00 87.64  ? 110 GLU A CB    1 
ATOM   1885 C CG    . GLU B 2 110 ? 8.215   -1.016  39.916 1.00 95.67  ? 110 GLU A CG    1 
ATOM   1886 C CD    . GLU B 2 110 ? 8.158   -0.650  41.381 1.00 100.99 ? 110 GLU A CD    1 
ATOM   1887 O OE1   . GLU B 2 110 ? 7.961   -1.552  42.206 1.00 100.23 ? 110 GLU A OE1   1 
ATOM   1888 O OE2   . GLU B 2 110 ? 8.316   0.557   41.693 1.00 104.00 ? 110 GLU A OE2   1 
ATOM   1889 N N     . ALA B 2 111 ? 9.211   -4.696  38.284 1.00 69.87  ? 111 ALA A N     1 
ATOM   1890 C CA    . ALA B 2 111 ? 9.607   -6.087  38.154 1.00 75.84  ? 111 ALA A CA    1 
ATOM   1891 C C     . ALA B 2 111 ? 10.145  -6.333  36.752 1.00 77.77  ? 111 ALA A C     1 
ATOM   1892 O O     . ALA B 2 111 ? 11.013  -7.181  36.545 1.00 80.40  ? 111 ALA A O     1 
ATOM   1893 C CB    . ALA B 2 111 ? 8.449   -7.016  38.447 1.00 68.82  ? 111 ALA A CB    1 
ATOM   1894 N N     . LEU B 2 112 ? 9.622   -5.574  35.794 1.00 81.87  ? 112 LEU A N     1 
ATOM   1895 C CA    . LEU B 2 112 ? 10.026  -5.692  34.402 1.00 86.89  ? 112 LEU A CA    1 
ATOM   1896 C C     . LEU B 2 112 ? 11.483  -5.312  34.188 1.00 86.57  ? 112 LEU A C     1 
ATOM   1897 O O     . LEU B 2 112 ? 12.285  -6.132  33.742 1.00 88.33  ? 112 LEU A O     1 
ATOM   1898 C CB    . LEU B 2 112 ? 9.143   -4.807  33.520 1.00 91.96  ? 112 LEU A CB    1 
ATOM   1899 C CG    . LEU B 2 112 ? 9.556   -4.719  32.047 1.00 94.30  ? 112 LEU A CG    1 
ATOM   1900 C CD1   . LEU B 2 112 ? 9.497   -6.090  31.395 1.00 88.62  ? 112 LEU A CD1   1 
ATOM   1901 C CD2   . LEU B 2 112 ? 8.685   -3.731  31.299 1.00 94.25  ? 112 LEU A CD2   1 
ATOM   1902 N N     . TRP B 2 113 ? 11.822  -4.065  34.500 1.00 88.81  ? 113 TRP A N     1 
ATOM   1903 C CA    . TRP B 2 113 ? 13.189  -3.592  34.322 1.00 93.60  ? 113 TRP A CA    1 
ATOM   1904 C C     . TRP B 2 113 ? 14.173  -4.324  35.217 1.00 91.90  ? 113 TRP A C     1 
ATOM   1905 O O     . TRP B 2 113 ? 15.377  -4.369  34.921 1.00 88.55  ? 113 TRP A O     1 
ATOM   1906 C CB    . TRP B 2 113 ? 13.269  -2.086  34.563 1.00 91.12  ? 113 TRP A CB    1 
ATOM   1907 C CG    . TRP B 2 113 ? 12.555  -1.339  33.510 1.00 94.05  ? 113 TRP A CG    1 
ATOM   1908 C CD1   . TRP B 2 113 ? 11.243  -0.964  33.515 1.00 93.19  ? 113 TRP A CD1   1 
ATOM   1909 C CD2   . TRP B 2 113 ? 13.093  -0.872  32.256 1.00 91.65  ? 113 TRP A CD2   1 
ATOM   1910 N NE1   . TRP B 2 113 ? 10.930  -0.291  32.342 1.00 96.44  ? 113 TRP A NE1   1 
ATOM   1911 C CE2   . TRP B 2 113 ? 12.047  -0.240  31.550 1.00 95.07  ? 113 TRP A CE2   1 
ATOM   1912 C CE3   . TRP B 2 113 ? 14.359  -0.956  31.659 1.00 91.18  ? 113 TRP A CE3   1 
ATOM   1913 C CZ2   . TRP B 2 113 ? 12.226  0.308   30.273 1.00 94.55  ? 113 TRP A CZ2   1 
ATOM   1914 C CZ3   . TRP B 2 113 ? 14.538  -0.411  30.389 1.00 93.52  ? 113 TRP A CZ3   1 
ATOM   1915 C CH2   . TRP B 2 113 ? 13.475  0.213   29.712 1.00 95.18  ? 113 TRP A CH2   1 
ATOM   1916 N N     . ALA B 2 114 ? 13.661  -4.896  36.314 1.00 91.86  ? 114 ALA A N     1 
ATOM   1917 C CA    . ALA B 2 114 ? 14.512  -5.688  37.179 1.00 95.63  ? 114 ALA A CA    1 
ATOM   1918 C C     . ALA B 2 114 ? 14.968  -6.884  36.352 1.00 97.15  ? 114 ALA A C     1 
ATOM   1919 O O     . ALA B 2 114 ? 16.104  -7.337  36.445 1.00 100.40 ? 114 ALA A O     1 
ATOM   1920 C CB    . ALA B 2 114 ? 13.783  -6.151  38.424 1.00 87.28  ? 114 ALA A CB    1 
ATOM   1921 N N     . ALA B 2 115 ? 14.047  -7.413  35.533 1.00 95.90  ? 115 ALA A N     1 
ATOM   1922 C CA    . ALA B 2 115 ? 14.300  -8.592  34.671 1.00 95.27  ? 115 ALA A CA    1 
ATOM   1923 C C     . ALA B 2 115 ? 15.272  -8.264  33.540 1.00 91.43  ? 115 ALA A C     1 
ATOM   1924 O O     . ALA B 2 115 ? 16.152  -9.061  33.221 1.00 96.20  ? 115 ALA A O     1 
ATOM   1925 C CB    . ALA B 2 115 ? 12.987  -9.106  34.096 1.00 88.69  ? 115 ALA A CB    1 
ATOM   1926 N N     . VAL B 2 116 ? 15.109  -7.099  32.925 1.00 87.66  ? 116 VAL A N     1 
ATOM   1927 C CA    . VAL B 2 116 ? 15.995  -6.700  31.839 1.00 91.19  ? 116 VAL A CA    1 
ATOM   1928 C C     . VAL B 2 116 ? 17.393  -6.466  32.394 1.00 92.89  ? 116 VAL A C     1 
ATOM   1929 O O     . VAL B 2 116 ? 18.391  -6.757  31.735 1.00 87.22  ? 116 VAL A O     1 
ATOM   1930 C CB    . VAL B 2 116 ? 15.516  -5.399  31.159 1.00 91.14  ? 116 VAL A CB    1 
ATOM   1931 C CG1   . VAL B 2 116 ? 16.492  -4.996  30.066 1.00 80.25  ? 116 VAL A CG1   1 
ATOM   1932 C CG2   . VAL B 2 116 ? 14.123  -5.590  30.587 1.00 88.85  ? 116 VAL A CG2   1 
ATOM   1933 N N     . TYR B 2 117 ? 17.454  -5.931  33.611 1.00 98.77  ? 117 TYR A N     1 
ATOM   1934 C CA    . TYR B 2 117 ? 18.728  -5.659  34.267 1.00 104.36 ? 117 TYR A CA    1 
ATOM   1935 C C     . TYR B 2 117 ? 19.493  -6.961  34.458 1.00 104.80 ? 117 TYR A C     1 
ATOM   1936 O O     . TYR B 2 117 ? 20.666  -7.063  34.102 1.00 101.31 ? 117 TYR A O     1 
ATOM   1937 C CB    . TYR B 2 117 ? 18.494  -4.994  35.626 1.00 99.20  ? 117 TYR A CB    1 
ATOM   1938 C CG    . TYR B 2 117 ? 19.748  -4.846  36.460 1.00 96.97  ? 117 TYR A CG    1 
ATOM   1939 C CD1   . TYR B 2 117 ? 20.828  -4.092  36.005 1.00 93.09  ? 117 TYR A CD1   1 
ATOM   1940 C CD2   . TYR B 2 117 ? 19.855  -5.463  37.705 1.00 94.51  ? 117 TYR A CD2   1 
ATOM   1941 C CE1   . TYR B 2 117 ? 21.985  -3.956  36.770 1.00 94.99  ? 117 TYR A CE1   1 
ATOM   1942 C CE2   . TYR B 2 117 ? 21.005  -5.333  38.477 1.00 93.75  ? 117 TYR A CE2   1 
ATOM   1943 C CZ    . TYR B 2 117 ? 22.066  -4.579  38.006 1.00 95.59  ? 117 TYR A CZ    1 
ATOM   1944 O OH    . TYR B 2 117 ? 23.204  -4.447  38.771 1.00 92.74  ? 117 TYR A OH    1 
ATOM   1945 N N     . ILE B 2 118 ? 18.815  -7.955  35.020 1.00 106.30 ? 118 ILE A N     1 
ATOM   1946 C CA    . ILE B 2 118 ? 19.417  -9.258  35.258 1.00 111.49 ? 118 ILE A CA    1 
ATOM   1947 C C     . ILE B 2 118 ? 19.802  -9.895  33.929 1.00 111.52 ? 118 ILE A C     1 
ATOM   1948 O O     . ILE B 2 118 ? 20.972  -10.186 33.682 1.00 110.56 ? 118 ILE A O     1 
ATOM   1949 C CB    . ILE B 2 118 ? 18.429  -10.203 35.978 1.00 111.81 ? 118 ILE A CB    1 
ATOM   1950 C CG1   . ILE B 2 118 ? 17.896  -9.538  37.250 1.00 112.67 ? 118 ILE A CG1   1 
ATOM   1951 C CG2   . ILE B 2 118 ? 19.115  -11.517 36.312 1.00 112.86 ? 118 ILE A CG2   1 
ATOM   1952 C CD1   . ILE B 2 118 ? 18.964  -9.171  38.257 1.00 115.20 ? 118 ILE A CD1   1 
ATOM   1953 N N     . ASP B 2 119 ? 18.801  -10.100 33.078 1.00 113.16 ? 119 ASP A N     1 
ATOM   1954 C CA    . ASP B 2 119 ? 18.994  -10.711 31.769 1.00 116.76 ? 119 ASP A CA    1 
ATOM   1955 C C     . ASP B 2 119 ? 20.218  -10.183 31.029 1.00 115.49 ? 119 ASP A C     1 
ATOM   1956 O O     . ASP B 2 119 ? 21.061  -10.958 30.581 1.00 116.95 ? 119 ASP A O     1 
ATOM   1957 C CB    . ASP B 2 119 ? 17.747  -10.500 30.907 1.00 118.09 ? 119 ASP A CB    1 
ATOM   1958 C CG    . ASP B 2 119 ? 17.838  -11.207 29.570 1.00 116.26 ? 119 ASP A CG    1 
ATOM   1959 O OD1   . ASP B 2 119 ? 18.743  -10.873 28.777 1.00 110.65 ? 119 ASP A OD1   1 
ATOM   1960 O OD2   . ASP B 2 119 ? 17.004  -12.101 29.314 1.00 118.57 ? 119 ASP A OD2   1 
ATOM   1961 N N     . SER B 2 120 ? 20.313  -8.864  30.900 1.00 114.08 ? 120 SER A N     1 
ATOM   1962 C CA    . SER B 2 120 ? 21.436  -8.247  30.203 1.00 114.64 ? 120 SER A CA    1 
ATOM   1963 C C     . SER B 2 120 ? 22.744  -8.402  30.973 1.00 110.84 ? 120 SER A C     1 
ATOM   1964 O O     . SER B 2 120 ? 23.719  -7.704  30.699 1.00 109.91 ? 120 SER A O     1 
ATOM   1965 C CB    . SER B 2 120 ? 21.153  -6.761  29.965 1.00 118.35 ? 120 SER A CB    1 
ATOM   1966 O OG    . SER B 2 120 ? 20.933  -6.077  31.188 1.00 121.25 ? 120 SER A OG    1 
ATOM   1967 N N     . GLY B 2 121 ? 22.761  -9.322  31.932 1.00 109.69 ? 121 GLY A N     1 
ATOM   1968 C CA    . GLY B 2 121 ? 23.959  -9.540  32.724 1.00 113.56 ? 121 GLY A CA    1 
ATOM   1969 C C     . GLY B 2 121 ? 24.218  -8.392  33.679 1.00 112.11 ? 121 GLY A C     1 
ATOM   1970 O O     . GLY B 2 121 ? 25.347  -7.916  33.803 1.00 106.63 ? 121 GLY A O     1 
ATOM   1971 N N     . ARG B 2 122 ? 23.162  -7.953  34.358 1.00 113.25 ? 122 ARG A N     1 
ATOM   1972 C CA    . ARG B 2 122 ? 23.239  -6.847  35.305 1.00 113.65 ? 122 ARG A CA    1 
ATOM   1973 C C     . ARG B 2 122 ? 24.027  -5.661  34.767 1.00 113.47 ? 122 ARG A C     1 
ATOM   1974 O O     . ARG B 2 122 ? 24.907  -5.125  35.441 1.00 113.07 ? 122 ARG A O     1 
ATOM   1975 C CB    . ARG B 2 122 ? 23.832  -7.316  36.635 1.00 110.23 ? 122 ARG A CB    1 
ATOM   1976 C CG    . ARG B 2 122 ? 22.848  -8.084  37.498 1.00 99.52  ? 122 ARG A CG    1 
ATOM   1977 C CD    . ARG B 2 122 ? 23.365  -8.248  38.912 1.00 94.90  ? 122 ARG A CD    1 
ATOM   1978 N NE    . ARG B 2 122 ? 22.356  -8.833  39.789 1.00 96.78  ? 122 ARG A NE    1 
ATOM   1979 C CZ    . ARG B 2 122 ? 21.812  -10.032 39.608 1.00 95.55  ? 122 ARG A CZ    1 
ATOM   1980 N NH1   . ARG B 2 122 ? 22.182  -10.779 38.577 1.00 91.64  ? 122 ARG A NH1   1 
ATOM   1981 N NH2   . ARG B 2 122 ? 20.897  -10.482 40.456 1.00 86.60  ? 122 ARG A NH2   1 
ATOM   1982 N N     . ASP B 2 123 ? 23.700  -5.250  33.548 1.00 114.70 ? 123 ASP A N     1 
ATOM   1983 C CA    . ASP B 2 123 ? 24.377  -4.121  32.930 1.00 117.86 ? 123 ASP A CA    1 
ATOM   1984 C C     . ASP B 2 123 ? 23.590  -2.842  33.195 1.00 116.94 ? 123 ASP A C     1 
ATOM   1985 O O     . ASP B 2 123 ? 22.615  -2.541  32.504 1.00 114.30 ? 123 ASP A O     1 
ATOM   1986 C CB    . ASP B 2 123 ? 24.517  -4.343  31.424 1.00 118.08 ? 123 ASP A CB    1 
ATOM   1987 C CG    . ASP B 2 123 ? 25.457  -3.347  30.776 1.00 117.33 ? 123 ASP A CG    1 
ATOM   1988 O OD1   . ASP B 2 123 ? 25.212  -2.127  30.890 1.00 118.59 ? 123 ASP A OD1   1 
ATOM   1989 O OD2   . ASP B 2 123 ? 26.445  -3.787  30.153 1.00 118.22 ? 123 ASP A OD2   1 
ATOM   1990 N N     . ALA B 2 124 ? 24.017  -2.096  34.206 1.00 117.46 ? 124 ALA A N     1 
ATOM   1991 C CA    . ALA B 2 124 ? 23.357  -0.851  34.569 1.00 119.24 ? 124 ALA A CA    1 
ATOM   1992 C C     . ALA B 2 124 ? 23.321  0.112   33.390 1.00 119.03 ? 124 ALA A C     1 
ATOM   1993 O O     . ALA B 2 124 ? 22.268  0.331   32.793 1.00 122.01 ? 124 ALA A O     1 
ATOM   1994 C CB    . ALA B 2 124 ? 24.075  -0.207  35.748 1.00 117.68 ? 124 ALA A CB    1 
ATOM   1995 N N     . ASN B 2 125 ? 24.479  0.678   33.062 1.00 118.56 ? 125 ASN A N     1 
ATOM   1996 C CA    . ASN B 2 125 ? 24.608  1.633   31.964 1.00 117.72 ? 125 ASN A CA    1 
ATOM   1997 C C     . ASN B 2 125 ? 23.709  1.330   30.770 1.00 115.58 ? 125 ASN A C     1 
ATOM   1998 O O     . ASN B 2 125 ? 23.077  2.230   30.217 1.00 115.25 ? 125 ASN A O     1 
ATOM   1999 C CB    . ASN B 2 125 ? 26.062  1.701   31.499 1.00 120.30 ? 125 ASN A CB    1 
ATOM   2000 C CG    . ASN B 2 125 ? 26.996  2.182   32.586 1.00 125.52 ? 125 ASN A CG    1 
ATOM   2001 O OD1   . ASN B 2 125 ? 27.145  1.537   33.622 1.00 129.41 ? 125 ASN A OD1   1 
ATOM   2002 N ND2   . ASN B 2 125 ? 27.628  3.326   32.359 1.00 130.69 ? 125 ASN A ND2   1 
ATOM   2003 N N     . PHE B 2 126 ? 23.659  0.064   30.370 1.00 112.70 ? 126 PHE A N     1 
ATOM   2004 C CA    . PHE B 2 126 ? 22.829  -0.335  29.242 1.00 111.41 ? 126 PHE A CA    1 
ATOM   2005 C C     . PHE B 2 126 ? 21.350  -0.116  29.548 1.00 109.38 ? 126 PHE A C     1 
ATOM   2006 O O     . PHE B 2 126 ? 20.680  0.681   28.887 1.00 106.79 ? 126 PHE A O     1 
ATOM   2007 C CB    . PHE B 2 126 ? 23.067  -1.805  28.901 1.00 111.90 ? 126 PHE A CB    1 
ATOM   2008 C CG    . PHE B 2 126 ? 22.134  -2.340  27.856 1.00 118.23 ? 126 PHE A CG    1 
ATOM   2009 C CD1   . PHE B 2 126 ? 22.107  -1.786  26.580 1.00 120.41 ? 126 PHE A CD1   1 
ATOM   2010 C CD2   . PHE B 2 126 ? 21.269  -3.390  28.151 1.00 119.17 ? 126 PHE A CD2   1 
ATOM   2011 C CE1   . PHE B 2 126 ? 21.232  -2.270  25.610 1.00 123.12 ? 126 PHE A CE1   1 
ATOM   2012 C CE2   . PHE B 2 126 ? 20.390  -3.881  27.189 1.00 122.91 ? 126 PHE A CE2   1 
ATOM   2013 C CZ    . PHE B 2 126 ? 20.371  -3.320  25.916 1.00 122.88 ? 126 PHE A CZ    1 
ATOM   2014 N N     . THR B 2 127 ? 20.851  -0.830  30.552 1.00 107.04 ? 127 THR A N     1 
ATOM   2015 C CA    . THR B 2 127 ? 19.453  -0.728  30.957 1.00 104.75 ? 127 THR A CA    1 
ATOM   2016 C C     . THR B 2 127 ? 19.055  0.731   31.155 1.00 103.32 ? 127 THR A C     1 
ATOM   2017 O O     . THR B 2 127 ? 17.940  1.134   30.822 1.00 101.92 ? 127 THR A O     1 
ATOM   2018 C CB    . THR B 2 127 ? 19.200  -1.492  32.275 1.00 103.01 ? 127 THR A CB    1 
ATOM   2019 O OG1   . THR B 2 127 ? 19.681  -2.835  32.152 1.00 104.13 ? 127 THR A OG1   1 
ATOM   2020 C CG2   . THR B 2 127 ? 17.713  -1.527  32.595 1.00 102.03 ? 127 THR A CG2   1 
ATOM   2021 N N     . ARG B 2 128 ? 19.979  1.518   31.699 1.00 104.15 ? 128 ARG A N     1 
ATOM   2022 C CA    . ARG B 2 128 ? 19.739  2.933   31.947 1.00 103.31 ? 128 ARG A CA    1 
ATOM   2023 C C     . ARG B 2 128 ? 19.425  3.628   30.631 1.00 106.37 ? 128 ARG A C     1 
ATOM   2024 O O     . ARG B 2 128 ? 18.466  4.393   30.536 1.00 109.32 ? 128 ARG A O     1 
ATOM   2025 C CB    . ARG B 2 128 ? 20.974  3.569   32.594 1.00 100.12 ? 128 ARG A CB    1 
ATOM   2026 C CG    . ARG B 2 128 ? 20.752  4.981   33.117 1.00 101.33 ? 128 ARG A CG    1 
ATOM   2027 C CD    . ARG B 2 128 ? 21.980  5.513   33.853 1.00 97.60  ? 128 ARG A CD    1 
ATOM   2028 N NE    . ARG B 2 128 ? 22.722  6.511   33.083 1.00 94.26  ? 128 ARG A NE    1 
ATOM   2029 C CZ    . ARG B 2 128 ? 23.359  6.267   31.942 1.00 96.72  ? 128 ARG A CZ    1 
ATOM   2030 N NH1   . ARG B 2 128 ? 23.356  5.050   31.416 1.00 99.70  ? 128 ARG A NH1   1 
ATOM   2031 N NH2   . ARG B 2 128 ? 24.002  7.247   31.322 1.00 93.76  ? 128 ARG A NH2   1 
ATOM   2032 N N     . GLU B 2 129 ? 20.241  3.351   29.618 1.00 108.41 ? 129 GLU A N     1 
ATOM   2033 C CA    . GLU B 2 129 ? 20.056  3.939   28.297 1.00 106.93 ? 129 GLU A CA    1 
ATOM   2034 C C     . GLU B 2 129 ? 18.776  3.400   27.679 1.00 100.46 ? 129 GLU A C     1 
ATOM   2035 O O     . GLU B 2 129 ? 17.992  4.151   27.102 1.00 98.80  ? 129 GLU A O     1 
ATOM   2036 C CB    . GLU B 2 129 ? 21.252  3.604   27.402 1.00 113.04 ? 129 GLU A CB    1 
ATOM   2037 C CG    . GLU B 2 129 ? 22.574  4.183   27.893 1.00 124.00 ? 129 GLU A CG    1 
ATOM   2038 C CD    . GLU B 2 129 ? 23.754  3.770   27.028 1.00 132.07 ? 129 GLU A CD    1 
ATOM   2039 O OE1   . GLU B 2 129 ? 23.703  4.000   25.800 1.00 130.60 ? 129 GLU A OE1   1 
ATOM   2040 O OE2   . GLU B 2 129 ? 24.735  3.220   27.577 1.00 130.65 ? 129 GLU A OE2   1 
ATOM   2041 N N     . LEU B 2 130 ? 18.566  2.094   27.805 1.00 97.55  ? 130 LEU A N     1 
ATOM   2042 C CA    . LEU B 2 130 ? 17.369  1.463   27.268 1.00 97.58  ? 130 LEU A CA    1 
ATOM   2043 C C     . LEU B 2 130 ? 16.130  2.049   27.933 1.00 98.45  ? 130 LEU A C     1 
ATOM   2044 O O     . LEU B 2 130 ? 15.034  2.003   27.376 1.00 100.49 ? 130 LEU A O     1 
ATOM   2045 C CB    . LEU B 2 130 ? 17.416  -0.051  27.500 1.00 97.34  ? 130 LEU A CB    1 
ATOM   2046 C CG    . LEU B 2 130 ? 16.151  -0.848  27.166 1.00 94.11  ? 130 LEU A CG    1 
ATOM   2047 C CD1   . LEU B 2 130 ? 15.737  -0.586  25.731 1.00 101.89 ? 130 LEU A CD1   1 
ATOM   2048 C CD2   . LEU B 2 130 ? 16.409  -2.328  27.381 1.00 92.94  ? 130 LEU A CD2   1 
ATOM   2049 N N     . PHE B 2 131 ? 16.313  2.605   29.127 1.00 99.06  ? 131 PHE A N     1 
ATOM   2050 C CA    . PHE B 2 131 ? 15.211  3.203   29.870 1.00 98.42  ? 131 PHE A CA    1 
ATOM   2051 C C     . PHE B 2 131 ? 14.882  4.593   29.335 1.00 101.58 ? 131 PHE A C     1 
ATOM   2052 O O     . PHE B 2 131 ? 13.714  4.947   29.177 1.00 103.18 ? 131 PHE A O     1 
ATOM   2053 C CB    . PHE B 2 131 ? 15.565  3.309   31.351 1.00 90.69  ? 131 PHE A CB    1 
ATOM   2054 C CG    . PHE B 2 131 ? 14.413  3.730   32.218 1.00 88.00  ? 131 PHE A CG    1 
ATOM   2055 C CD1   . PHE B 2 131 ? 13.374  2.848   32.491 1.00 78.61  ? 131 PHE A CD1   1 
ATOM   2056 C CD2   . PHE B 2 131 ? 14.363  5.012   32.759 1.00 91.18  ? 131 PHE A CD2   1 
ATOM   2057 C CE1   . PHE B 2 131 ? 12.302  3.233   33.289 1.00 81.08  ? 131 PHE A CE1   1 
ATOM   2058 C CE2   . PHE B 2 131 ? 13.293  5.409   33.561 1.00 85.32  ? 131 PHE A CE2   1 
ATOM   2059 C CZ    . PHE B 2 131 ? 12.261  4.517   33.825 1.00 82.40  ? 131 PHE A CZ    1 
ATOM   2060 N N     . TYR B 2 132 ? 15.915  5.382   29.065 1.00 106.23 ? 132 TYR A N     1 
ATOM   2061 C CA    . TYR B 2 132 ? 15.719  6.730   28.548 1.00 111.99 ? 132 TYR A CA    1 
ATOM   2062 C C     . TYR B 2 132 ? 15.155  6.686   27.132 1.00 112.78 ? 132 TYR A C     1 
ATOM   2063 O O     . TYR B 2 132 ? 14.282  7.479   26.779 1.00 116.10 ? 132 TYR A O     1 
ATOM   2064 C CB    . TYR B 2 132 ? 17.043  7.503   28.547 1.00 111.52 ? 132 TYR A CB    1 
ATOM   2065 C CG    . TYR B 2 132 ? 17.649  7.708   29.919 1.00 112.99 ? 132 TYR A CG    1 
ATOM   2066 C CD1   . TYR B 2 132 ? 16.915  8.301   30.947 1.00 113.44 ? 132 TYR A CD1   1 
ATOM   2067 C CD2   . TYR B 2 132 ? 18.965  7.326   30.184 1.00 111.60 ? 132 TYR A CD2   1 
ATOM   2068 C CE1   . TYR B 2 132 ? 17.478  8.507   32.207 1.00 115.38 ? 132 TYR A CE1   1 
ATOM   2069 C CE2   . TYR B 2 132 ? 19.536  7.529   31.439 1.00 110.35 ? 132 TYR A CE2   1 
ATOM   2070 C CZ    . TYR B 2 132 ? 18.788  8.119   32.446 1.00 113.63 ? 132 TYR A CZ    1 
ATOM   2071 O OH    . TYR B 2 132 ? 19.348  8.319   33.689 1.00 110.04 ? 132 TYR A OH    1 
ATOM   2072 N N     . LYS B 2 133 ? 15.658  5.754   26.328 1.00 112.04 ? 133 LYS A N     1 
ATOM   2073 C CA    . LYS B 2 133 ? 15.213  5.601   24.947 1.00 111.65 ? 133 LYS A CA    1 
ATOM   2074 C C     . LYS B 2 133 ? 13.731  5.270   24.840 1.00 112.62 ? 133 LYS A C     1 
ATOM   2075 O O     . LYS B 2 133 ? 13.239  4.954   23.757 1.00 119.13 ? 133 LYS A O     1 
ATOM   2076 C CB    . LYS B 2 133 ? 16.022  4.505   24.248 1.00 108.55 ? 133 LYS A CB    1 
ATOM   2077 C CG    . LYS B 2 133 ? 17.378  4.946   23.714 1.00 108.01 ? 133 LYS A CG    1 
ATOM   2078 C CD    . LYS B 2 133 ? 17.234  5.792   22.457 1.00 106.63 ? 133 LYS A CD    1 
ATOM   2079 C CE    . LYS B 2 133 ? 18.582  6.029   21.792 1.00 109.27 ? 133 LYS A CE    1 
ATOM   2080 N NZ    . LYS B 2 133 ? 18.452  6.729   20.482 1.00 108.89 ? 133 LYS A NZ    1 
ATOM   2081 N N     . LEU B 2 134 ? 13.018  5.345   25.959 1.00 108.39 ? 134 LEU A N     1 
ATOM   2082 C CA    . LEU B 2 134 ? 11.594  5.042   25.962 1.00 107.06 ? 134 LEU A CA    1 
ATOM   2083 C C     . LEU B 2 134 ? 10.784  6.055   26.753 1.00 108.70 ? 134 LEU A C     1 
ATOM   2084 O O     . LEU B 2 134 ? 9.679   6.423   26.351 1.00 114.89 ? 134 LEU A O     1 
ATOM   2085 C CB    . LEU B 2 134 ? 11.350  3.657   26.566 1.00 103.49 ? 134 LEU A CB    1 
ATOM   2086 C CG    . LEU B 2 134 ? 11.990  2.439   25.903 1.00 105.20 ? 134 LEU A CG    1 
ATOM   2087 C CD1   . LEU B 2 134 ? 11.723  1.208   26.756 1.00 104.17 ? 134 LEU A CD1   1 
ATOM   2088 C CD2   . LEU B 2 134 ? 11.432  2.257   24.500 1.00 102.61 ? 134 LEU A CD2   1 
ATOM   2089 N N     . PHE B 2 135 ? 11.334  6.510   27.875 1.00 104.71 ? 135 PHE A N     1 
ATOM   2090 C CA    . PHE B 2 135 ? 10.613  7.443   28.728 1.00 98.99  ? 135 PHE A CA    1 
ATOM   2091 C C     . PHE B 2 135 ? 11.318  8.756   29.062 1.00 97.68  ? 135 PHE A C     1 
ATOM   2092 O O     . PHE B 2 135 ? 10.703  9.651   29.639 1.00 98.67  ? 135 PHE A O     1 
ATOM   2093 C CB    . PHE B 2 135 ? 10.242  6.737   30.032 1.00 94.74  ? 135 PHE A CB    1 
ATOM   2094 C CG    . PHE B 2 135 ? 9.635   5.376   29.837 1.00 97.20  ? 135 PHE A CG    1 
ATOM   2095 C CD1   . PHE B 2 135 ? 8.397   5.231   29.218 1.00 97.55  ? 135 PHE A CD1   1 
ATOM   2096 C CD2   . PHE B 2 135 ? 10.298  4.237   30.283 1.00 93.55  ? 135 PHE A CD2   1 
ATOM   2097 C CE1   . PHE B 2 135 ? 7.827   3.971   29.049 1.00 91.28  ? 135 PHE A CE1   1 
ATOM   2098 C CE2   . PHE B 2 135 ? 9.738   2.973   30.119 1.00 89.71  ? 135 PHE A CE2   1 
ATOM   2099 C CZ    . PHE B 2 135 ? 8.500   2.840   29.501 1.00 93.16  ? 135 PHE A CZ    1 
ATOM   2100 N N     . LYS B 2 136 ? 12.591  8.884   28.707 1.00 97.98  ? 136 LYS A N     1 
ATOM   2101 C CA    . LYS B 2 136 ? 13.325  10.106  29.023 1.00 101.17 ? 136 LYS A CA    1 
ATOM   2102 C C     . LYS B 2 136 ? 12.540  11.377  28.712 1.00 103.77 ? 136 LYS A C     1 
ATOM   2103 O O     . LYS B 2 136 ? 12.451  12.279  29.546 1.00 100.15 ? 136 LYS A O     1 
ATOM   2104 C CB    . LYS B 2 136 ? 14.664  10.145  28.286 1.00 100.61 ? 136 LYS A CB    1 
ATOM   2105 C CG    . LYS B 2 136 ? 15.507  11.359  28.651 1.00 96.39  ? 136 LYS A CG    1 
ATOM   2106 C CD    . LYS B 2 136 ? 16.892  11.289  28.042 1.00 97.37  ? 136 LYS A CD    1 
ATOM   2107 C CE    . LYS B 2 136 ? 17.726  12.491  28.452 1.00 96.28  ? 136 LYS A CE    1 
ATOM   2108 N NZ    . LYS B 2 136 ? 19.133  12.369  27.980 1.00 96.13  ? 136 LYS A NZ    1 
ATOM   2109 N N     . GLU B 2 137 ? 11.969  11.445  27.514 1.00 107.61 ? 137 GLU A N     1 
ATOM   2110 C CA    . GLU B 2 137 ? 11.203  12.618  27.112 1.00 109.29 ? 137 GLU A CA    1 
ATOM   2111 C C     . GLU B 2 137 ? 9.879   12.704  27.856 1.00 108.44 ? 137 GLU A C     1 
ATOM   2112 O O     . GLU B 2 137 ? 9.397   13.797  28.153 1.00 108.17 ? 137 GLU A O     1 
ATOM   2113 C CB    . GLU B 2 137 ? 10.962  12.600  25.601 1.00 110.14 ? 137 GLU A CB    1 
ATOM   2114 C CG    . GLU B 2 137 ? 12.243  12.637  24.777 1.00 108.08 ? 137 GLU A CG    1 
ATOM   2115 C CD    . GLU B 2 137 ? 13.105  13.856  25.072 1.00 106.86 ? 137 GLU A CD    1 
ATOM   2116 O OE1   . GLU B 2 137 ? 12.692  14.706  25.888 1.00 107.22 ? 137 GLU A OE1   1 
ATOM   2117 O OE2   . GLU B 2 137 ? 14.202  13.965  24.484 1.00 103.69 ? 137 GLU A OE2   1 
ATOM   2118 N N     . ASP B 2 138 ? 9.292   11.550  28.158 1.00 109.23 ? 138 ASP A N     1 
ATOM   2119 C CA    . ASP B 2 138 ? 8.029   11.513  28.885 1.00 112.18 ? 138 ASP A CA    1 
ATOM   2120 C C     . ASP B 2 138 ? 8.268   11.984  30.317 1.00 109.41 ? 138 ASP A C     1 
ATOM   2121 O O     . ASP B 2 138 ? 7.348   12.444  30.996 1.00 109.34 ? 138 ASP A O     1 
ATOM   2122 C CB    . ASP B 2 138 ? 7.456   10.092  28.892 1.00 118.18 ? 138 ASP A CB    1 
ATOM   2123 C CG    . ASP B 2 138 ? 7.126   9.588   27.500 1.00 125.96 ? 138 ASP A CG    1 
ATOM   2124 O OD1   . ASP B 2 138 ? 6.342   10.260  26.796 1.00 131.17 ? 138 ASP A OD1   1 
ATOM   2125 O OD2   . ASP B 2 138 ? 7.645   8.520   27.109 1.00 126.25 ? 138 ASP A OD2   1 
ATOM   2126 N N     . ILE B 2 139 ? 9.513   11.866  30.768 1.00 105.72 ? 139 ILE A N     1 
ATOM   2127 C CA    . ILE B 2 139 ? 9.895   12.282  32.113 1.00 102.49 ? 139 ILE A CA    1 
ATOM   2128 C C     . ILE B 2 139 ? 10.250  13.768  32.127 1.00 99.18  ? 139 ILE A C     1 
ATOM   2129 O O     . ILE B 2 139 ? 9.714   14.536  32.927 1.00 94.34  ? 139 ILE A O     1 
ATOM   2130 C CB    . ILE B 2 139 ? 11.106  11.459  32.633 1.00 102.06 ? 139 ILE A CB    1 
ATOM   2131 C CG1   . ILE B 2 139 ? 10.678  10.009  32.886 1.00 95.65  ? 139 ILE A CG1   1 
ATOM   2132 C CG2   . ILE B 2 139 ? 11.661  12.081  33.910 1.00 98.68  ? 139 ILE A CG2   1 
ATOM   2133 C CD1   . ILE B 2 139 ? 11.800  9.102   33.343 1.00 86.34  ? 139 ILE A CD1   1 
ATOM   2134 N N     . LEU B 2 140 ? 11.155  14.168  31.238 1.00 98.06  ? 140 LEU A N     1 
ATOM   2135 C CA    . LEU B 2 140 ? 11.565  15.563  31.151 1.00 99.43  ? 140 LEU A CA    1 
ATOM   2136 C C     . LEU B 2 140 ? 10.335  16.453  31.024 1.00 103.00 ? 140 LEU A C     1 
ATOM   2137 O O     . LEU B 2 140 ? 10.281  17.540  31.601 1.00 103.10 ? 140 LEU A O     1 
ATOM   2138 C CB    . LEU B 2 140 ? 12.473  15.778  29.939 1.00 96.10  ? 140 LEU A CB    1 
ATOM   2139 C CG    . LEU B 2 140 ? 13.828  15.071  29.955 1.00 101.41 ? 140 LEU A CG    1 
ATOM   2140 C CD1   . LEU B 2 140 ? 14.544  15.310  28.637 1.00 104.01 ? 140 LEU A CD1   1 
ATOM   2141 C CD2   . LEU B 2 140 ? 14.659  15.586  31.116 1.00 99.40  ? 140 LEU A CD2   1 
ATOM   2142 N N     . SER B 2 141 ? 9.350   15.980  30.265 1.00 105.24 ? 141 SER A N     1 
ATOM   2143 C CA    . SER B 2 141 ? 8.114   16.724  30.059 1.00 106.04 ? 141 SER A CA    1 
ATOM   2144 C C     . SER B 2 141 ? 7.440   17.010  31.395 1.00 103.71 ? 141 SER A C     1 
ATOM   2145 O O     . SER B 2 141 ? 7.158   18.162  31.719 1.00 102.30 ? 141 SER A O     1 
ATOM   2146 C CB    . SER B 2 141 ? 7.158   15.935  29.160 1.00 108.49 ? 141 SER A CB    1 
ATOM   2147 O OG    . SER B 2 141 ? 6.742   14.730  29.780 1.00 115.22 ? 141 SER A OG    1 
ATOM   2148 N N     . ALA B 2 142 ? 7.184   15.956  32.167 1.00 105.00 ? 142 ALA A N     1 
ATOM   2149 C CA    . ALA B 2 142 ? 6.550   16.095  33.475 1.00 105.05 ? 142 ALA A CA    1 
ATOM   2150 C C     . ALA B 2 142 ? 7.294   17.147  34.290 1.00 105.48 ? 142 ALA A C     1 
ATOM   2151 O O     . ALA B 2 142 ? 6.686   17.935  35.018 1.00 101.18 ? 142 ALA A O     1 
ATOM   2152 C CB    . ALA B 2 142 ? 6.563   14.757  34.207 1.00 103.46 ? 142 ALA A CB    1 
ATOM   2153 N N     . ILE B 2 143 ? 8.617   17.149  34.156 1.00 105.33 ? 143 ILE A N     1 
ATOM   2154 C CA    . ILE B 2 143 ? 9.465   18.103  34.854 1.00 102.14 ? 143 ILE A CA    1 
ATOM   2155 C C     . ILE B 2 143 ? 9.192   19.497  34.300 1.00 103.86 ? 143 ILE A C     1 
ATOM   2156 O O     . ILE B 2 143 ? 8.713   20.378  35.013 1.00 100.81 ? 143 ILE A O     1 
ATOM   2157 C CB    . ILE B 2 143 ? 10.959  17.766  34.652 1.00 99.97  ? 143 ILE A CB    1 
ATOM   2158 C CG1   . ILE B 2 143 ? 11.252  16.371  35.206 1.00 101.03 ? 143 ILE A CG1   1 
ATOM   2159 C CG2   . ILE B 2 143 ? 11.833  18.806  35.340 1.00 95.78  ? 143 ILE A CG2   1 
ATOM   2160 C CD1   . ILE B 2 143 ? 12.698  15.946  35.065 1.00 102.73 ? 143 ILE A CD1   1 
ATOM   2161 N N     . LYS B 2 144 ? 9.497   19.682  33.019 1.00 106.45 ? 144 LYS A N     1 
ATOM   2162 C CA    . LYS B 2 144 ? 9.292   20.959  32.344 1.00 109.09 ? 144 LYS A CA    1 
ATOM   2163 C C     . LYS B 2 144 ? 7.928   21.549  32.697 1.00 111.56 ? 144 LYS A C     1 
ATOM   2164 O O     . LYS B 2 144 ? 7.810   22.742  32.974 1.00 113.97 ? 144 LYS A O     1 
ATOM   2165 C CB    . LYS B 2 144 ? 9.401   20.765  30.829 1.00 110.83 ? 144 LYS A CB    1 
ATOM   2166 C CG    . LYS B 2 144 ? 9.351   22.049  30.014 1.00 112.40 ? 144 LYS A CG    1 
ATOM   2167 C CD    . LYS B 2 144 ? 9.457   21.751  28.524 1.00 114.94 ? 144 LYS A CD    1 
ATOM   2168 C CE    . LYS B 2 144 ? 9.565   23.026  27.708 1.00 114.12 ? 144 LYS A CE    1 
ATOM   2169 N NZ    . LYS B 2 144 ? 10.781  23.804  28.075 1.00 115.80 ? 144 LYS A NZ    1 
ATOM   2170 N N     . GLU B 2 145 ? 6.900   20.705  32.687 1.00 111.80 ? 145 GLU A N     1 
ATOM   2171 C CA    . GLU B 2 145 ? 5.546   21.136  33.015 1.00 110.97 ? 145 GLU A CA    1 
ATOM   2172 C C     . GLU B 2 145 ? 5.493   21.632  34.455 1.00 110.69 ? 145 GLU A C     1 
ATOM   2173 O O     . GLU B 2 145 ? 5.049   22.749  34.722 1.00 107.73 ? 145 GLU A O     1 
ATOM   2174 C CB    . GLU B 2 145 ? 4.565   19.975  32.837 1.00 117.71 ? 145 GLU A CB    1 
ATOM   2175 C CG    . GLU B 2 145 ? 4.472   19.446  31.415 1.00 125.55 ? 145 GLU A CG    1 
ATOM   2176 C CD    . GLU B 2 145 ? 3.644   18.178  31.320 1.00 133.36 ? 145 GLU A CD    1 
ATOM   2177 O OE1   . GLU B 2 145 ? 2.474   18.198  31.758 1.00 137.90 ? 145 GLU A OE1   1 
ATOM   2178 O OE2   . GLU B 2 145 ? 4.160   17.161  30.805 1.00 132.97 ? 145 GLU A OE2   1 
ATOM   2179 N N     . GLY B 2 146 ? 5.949   20.791  35.379 1.00 109.85 ? 146 GLY A N     1 
ATOM   2180 C CA    . GLY B 2 146 ? 5.952   21.163  36.782 1.00 106.01 ? 146 GLY A CA    1 
ATOM   2181 C C     . GLY B 2 146 ? 5.193   20.194  37.664 1.00 106.34 ? 146 GLY A C     1 
ATOM   2182 O O     . GLY B 2 146 ? 4.966   20.469  38.841 1.00 108.55 ? 146 GLY A O     1 
ATOM   2183 N N     . ARG B 2 147 ? 4.802   19.058  37.096 1.00 106.70 ? 147 ARG A N     1 
ATOM   2184 C CA    . ARG B 2 147 ? 4.061   18.037  37.834 1.00 107.47 ? 147 ARG A CA    1 
ATOM   2185 C C     . ARG B 2 147 ? 4.746   17.671  39.154 1.00 106.92 ? 147 ARG A C     1 
ATOM   2186 O O     . ARG B 2 147 ? 5.948   17.396  39.187 1.00 111.44 ? 147 ARG A O     1 
ATOM   2187 C CB    . ARG B 2 147 ? 3.905   16.785  36.967 1.00 111.78 ? 147 ARG A CB    1 
ATOM   2188 C CG    . ARG B 2 147 ? 3.162   17.021  35.658 1.00 116.30 ? 147 ARG A CG    1 
ATOM   2189 C CD    . ARG B 2 147 ? 3.158   15.770  34.793 1.00 118.24 ? 147 ARG A CD    1 
ATOM   2190 N NE    . ARG B 2 147 ? 2.372   15.944  33.576 1.00 119.61 ? 147 ARG A NE    1 
ATOM   2191 C CZ    . ARG B 2 147 ? 2.271   15.029  32.617 1.00 124.24 ? 147 ARG A CZ    1 
ATOM   2192 N NH1   . ARG B 2 147 ? 2.911   13.873  32.731 1.00 122.68 ? 147 ARG A NH1   1 
ATOM   2193 N NH2   . ARG B 2 147 ? 1.527   15.269  31.544 1.00 123.78 ? 147 ARG A NH2   1 
ATOM   2194 N N     . VAL B 2 148 ? 3.977   17.673  40.239 1.00 100.47 ? 148 VAL A N     1 
ATOM   2195 C CA    . VAL B 2 148 ? 4.506   17.339  41.558 1.00 94.10  ? 148 VAL A CA    1 
ATOM   2196 C C     . VAL B 2 148 ? 3.428   16.719  42.437 1.00 92.66  ? 148 VAL A C     1 
ATOM   2197 O O     . VAL B 2 148 ? 2.255   16.705  42.073 1.00 93.02  ? 148 VAL A O     1 
ATOM   2198 C CB    . VAL B 2 148 ? 5.048   18.586  42.282 1.00 94.18  ? 148 VAL A CB    1 
ATOM   2199 C CG1   . VAL B 2 148 ? 6.234   19.154  41.526 1.00 94.26  ? 148 VAL A CG1   1 
ATOM   2200 C CG2   . VAL B 2 148 ? 3.949   19.625  42.412 1.00 89.47  ? 148 VAL A CG2   1 
ATOM   2201 N N     . LYS B 2 149 ? 3.834   16.207  43.595 1.00 92.76  ? 149 LYS A N     1 
ATOM   2202 C CA    . LYS B 2 149 ? 2.894   15.600  44.527 1.00 93.05  ? 149 LYS A CA    1 
ATOM   2203 C C     . LYS B 2 149 ? 2.579   16.594  45.632 1.00 95.03  ? 149 LYS A C     1 
ATOM   2204 O O     . LYS B 2 149 ? 3.259   16.642  46.653 1.00 95.79  ? 149 LYS A O     1 
ATOM   2205 C CB    . LYS B 2 149 ? 3.480   14.330  45.145 1.00 97.59  ? 149 LYS A CB    1 
ATOM   2206 C CG    . LYS B 2 149 ? 2.461   13.507  45.927 1.00 106.44 ? 149 LYS A CG    1 
ATOM   2207 C CD    . LYS B 2 149 ? 3.107   12.327  46.642 1.00 113.59 ? 149 LYS A CD    1 
ATOM   2208 C CE    . LYS B 2 149 ? 3.798   12.755  47.928 1.00 112.23 ? 149 LYS A CE    1 
ATOM   2209 N NZ    . LYS B 2 149 ? 2.819   13.241  48.945 1.00 110.59 ? 149 LYS A NZ    1 
ATOM   2210 N N     . LYS B 2 150 ? 1.541   17.390  45.411 1.00 97.13  ? 150 LYS A N     1 
ATOM   2211 C CA    . LYS B 2 150 ? 1.111   18.394  46.369 1.00 97.11  ? 150 LYS A CA    1 
ATOM   2212 C C     . LYS B 2 150 ? 0.938   17.790  47.761 1.00 95.25  ? 150 LYS A C     1 
ATOM   2213 O O     . LYS B 2 150 ? 0.591   16.616  47.900 1.00 88.64  ? 150 LYS A O     1 
ATOM   2214 C CB    . LYS B 2 150 ? -0.202  19.009  45.888 1.00 102.04 ? 150 LYS A CB    1 
ATOM   2215 C CG    . LYS B 2 150 ? -0.109  19.567  44.475 1.00 106.32 ? 150 LYS A CG    1 
ATOM   2216 C CD    . LYS B 2 150 ? -1.475  19.901  43.902 1.00 108.74 ? 150 LYS A CD    1 
ATOM   2217 C CE    . LYS B 2 150 ? -1.348  20.454  42.491 1.00 107.29 ? 150 LYS A CE    1 
ATOM   2218 N NZ    . LYS B 2 150 ? -0.621  19.510  41.595 1.00 109.26 ? 150 LYS A NZ    1 
ATOM   2219 N N     . ASP B 2 151 ? 1.192   18.593  48.790 1.00 91.79  ? 151 ASP A N     1 
ATOM   2220 C CA    . ASP B 2 151 ? 1.054   18.123  50.160 1.00 88.29  ? 151 ASP A CA    1 
ATOM   2221 C C     . ASP B 2 151 ? -0.418  18.004  50.507 1.00 87.70  ? 151 ASP A C     1 
ATOM   2222 O O     . ASP B 2 151 ? -1.282  18.500  49.784 1.00 90.42  ? 151 ASP A O     1 
ATOM   2223 C CB    . ASP B 2 151 ? 1.735   19.079  51.134 1.00 93.12  ? 151 ASP A CB    1 
ATOM   2224 C CG    . ASP B 2 151 ? 1.147   20.467  51.086 1.00 99.28  ? 151 ASP A CG    1 
ATOM   2225 O OD1   . ASP B 2 151 ? 1.381   21.178  50.084 1.00 103.07 ? 151 ASP A OD1   1 
ATOM   2226 O OD2   . ASP B 2 151 ? 0.444   20.843  52.047 1.00 101.10 ? 151 ASP A OD2   1 
ATOM   2227 N N     . TYR B 2 152 ? -0.694  17.353  51.629 1.00 86.41  ? 152 TYR A N     1 
ATOM   2228 C CA    . TYR B 2 152 ? -2.060  17.132  52.077 1.00 90.38  ? 152 TYR A CA    1 
ATOM   2229 C C     . TYR B 2 152 ? -2.921  18.391  52.148 1.00 89.20  ? 152 TYR A C     1 
ATOM   2230 O O     . TYR B 2 152 ? -3.878  18.522  51.388 1.00 90.24  ? 152 TYR A O     1 
ATOM   2231 C CB    . TYR B 2 152 ? -2.031  16.401  53.420 1.00 94.05  ? 152 TYR A CB    1 
ATOM   2232 C CG    . TYR B 2 152 ? -1.312  15.074  53.315 1.00 100.63 ? 152 TYR A CG    1 
ATOM   2233 C CD1   . TYR B 2 152 ? -1.869  14.012  52.600 1.00 101.14 ? 152 TYR A CD1   1 
ATOM   2234 C CD2   . TYR B 2 152 ? -0.045  14.899  53.871 1.00 106.57 ? 152 TYR A CD2   1 
ATOM   2235 C CE1   . TYR B 2 152 ? -1.181  12.809  52.438 1.00 101.65 ? 152 TYR A CE1   1 
ATOM   2236 C CE2   . TYR B 2 152 ? 0.652   13.699  53.714 1.00 108.49 ? 152 TYR A CE2   1 
ATOM   2237 C CZ    . TYR B 2 152 ? 0.078   12.660  52.996 1.00 105.50 ? 152 TYR A CZ    1 
ATOM   2238 O OH    . TYR B 2 152 ? 0.765   11.479  52.832 1.00 105.25 ? 152 TYR A OH    1 
ATOM   2239 N N     . LYS B 2 153 ? -2.590  19.316  53.043 1.00 89.27  ? 153 LYS A N     1 
ATOM   2240 C CA    . LYS B 2 153 ? -3.376  20.539  53.163 1.00 83.64  ? 153 LYS A CA    1 
ATOM   2241 C C     . LYS B 2 153 ? -3.684  21.130  51.792 1.00 80.61  ? 153 LYS A C     1 
ATOM   2242 O O     . LYS B 2 153 ? -4.800  21.588  51.550 1.00 82.16  ? 153 LYS A O     1 
ATOM   2243 C CB    . LYS B 2 153 ? -2.647  21.574  54.025 1.00 86.64  ? 153 LYS A CB    1 
ATOM   2244 C CG    . LYS B 2 153 ? -2.604  21.227  55.504 1.00 86.30  ? 153 LYS A CG    1 
ATOM   2245 C CD    . LYS B 2 153 ? -1.906  22.311  56.312 1.00 87.68  ? 153 LYS A CD    1 
ATOM   2246 C CE    . LYS B 2 153 ? -2.693  23.608  56.302 1.00 83.89  ? 153 LYS A CE    1 
ATOM   2247 N NZ    . LYS B 2 153 ? -1.979  24.685  57.039 1.00 87.54  ? 153 LYS A NZ    1 
ATOM   2248 N N     . THR B 2 154 ? -2.699  21.113  50.896 1.00 72.29  ? 154 THR A N     1 
ATOM   2249 C CA    . THR B 2 154 ? -2.891  21.642  49.547 1.00 71.90  ? 154 THR A CA    1 
ATOM   2250 C C     . THR B 2 154 ? -3.949  20.836  48.811 1.00 71.95  ? 154 THR A C     1 
ATOM   2251 O O     . THR B 2 154 ? -4.892  21.391  48.250 1.00 70.60  ? 154 THR A O     1 
ATOM   2252 C CB    . THR B 2 154 ? -1.594  21.588  48.722 1.00 63.95  ? 154 THR A CB    1 
ATOM   2253 O OG1   . THR B 2 154 ? -0.705  22.624  49.154 1.00 70.80  ? 154 THR A OG1   1 
ATOM   2254 C CG2   . THR B 2 154 ? -1.899  21.776  47.251 1.00 67.48  ? 154 THR A CG2   1 
ATOM   2255 N N     . ILE B 2 155 ? -3.774  19.520  48.812 1.00 70.71  ? 155 ILE A N     1 
ATOM   2256 C CA    . ILE B 2 155 ? -4.709  18.618  48.156 1.00 65.83  ? 155 ILE A CA    1 
ATOM   2257 C C     . ILE B 2 155 ? -6.131  18.827  48.666 1.00 66.38  ? 155 ILE A C     1 
ATOM   2258 O O     . ILE B 2 155 ? -7.040  19.116  47.891 1.00 70.44  ? 155 ILE A O     1 
ATOM   2259 C CB    . ILE B 2 155 ? -4.306  17.153  48.387 1.00 61.30  ? 155 ILE A CB    1 
ATOM   2260 C CG1   . ILE B 2 155 ? -2.998  16.859  47.652 1.00 58.62  ? 155 ILE A CG1   1 
ATOM   2261 C CG2   . ILE B 2 155 ? -5.416  16.228  47.924 1.00 61.48  ? 155 ILE A CG2   1 
ATOM   2262 C CD1   . ILE B 2 155 ? -2.492  15.456  47.859 1.00 59.12  ? 155 ILE A CD1   1 
ATOM   2263 N N     . LEU B 2 156 ? -6.316  18.680  49.972 1.00 65.05  ? 156 LEU A N     1 
ATOM   2264 C CA    . LEU B 2 156 ? -7.628  18.848  50.573 1.00 69.77  ? 156 LEU A CA    1 
ATOM   2265 C C     . LEU B 2 156 ? -8.261  20.181  50.192 1.00 73.93  ? 156 LEU A C     1 
ATOM   2266 O O     . LEU B 2 156 ? -9.485  20.295  50.119 1.00 79.69  ? 156 LEU A O     1 
ATOM   2267 C CB    . LEU B 2 156 ? -7.534  18.738  52.095 1.00 66.11  ? 156 LEU A CB    1 
ATOM   2268 C CG    . LEU B 2 156 ? -8.837  19.011  52.851 1.00 70.27  ? 156 LEU A CG    1 
ATOM   2269 C CD1   . LEU B 2 156 ? -9.916  18.052  52.372 1.00 75.98  ? 156 LEU A CD1   1 
ATOM   2270 C CD2   . LEU B 2 156 ? -8.609  18.864  54.348 1.00 74.08  ? 156 LEU A CD2   1 
ATOM   2271 N N     . GLN B 2 157 ? -7.432  21.191  49.953 1.00 73.19  ? 157 GLN A N     1 
ATOM   2272 C CA    . GLN B 2 157 ? -7.951  22.498  49.573 1.00 76.03  ? 157 GLN A CA    1 
ATOM   2273 C C     . GLN B 2 157 ? -8.540  22.446  48.169 1.00 82.21  ? 157 GLN A C     1 
ATOM   2274 O O     . GLN B 2 157 ? -9.695  22.816  47.952 1.00 82.96  ? 157 GLN A O     1 
ATOM   2275 C CB    . GLN B 2 157 ? -6.853  23.563  49.627 1.00 70.74  ? 157 GLN A CB    1 
ATOM   2276 C CG    . GLN B 2 157 ? -7.192  24.800  48.813 1.00 68.72  ? 157 GLN A CG    1 
ATOM   2277 C CD    . GLN B 2 157 ? -6.757  26.091  49.469 1.00 69.86  ? 157 GLN A CD    1 
ATOM   2278 O OE1   . GLN B 2 157 ? -7.199  26.421  50.574 1.00 61.45  ? 157 GLN A OE1   1 
ATOM   2279 N NE2   . GLN B 2 157 ? -5.895  26.840  48.786 1.00 55.90  ? 157 GLN A NE2   1 
ATOM   2280 N N     . GLU B 2 158 ? -7.737  21.983  47.217 1.00 81.94  ? 158 GLU A N     1 
ATOM   2281 C CA    . GLU B 2 158 ? -8.173  21.886  45.833 1.00 81.45  ? 158 GLU A CA    1 
ATOM   2282 C C     . GLU B 2 158 ? -9.423  21.026  45.682 1.00 85.04  ? 158 GLU A C     1 
ATOM   2283 O O     . GLU B 2 158 ? -10.234 21.251  44.783 1.00 87.25  ? 158 GLU A O     1 
ATOM   2284 C CB    . GLU B 2 158 ? -7.036  21.342  44.971 1.00 79.83  ? 158 GLU A CB    1 
ATOM   2285 C CG    . GLU B 2 158 ? -5.928  22.361  44.753 1.00 90.75  ? 158 GLU A CG    1 
ATOM   2286 C CD    . GLU B 2 158 ? -4.785  21.826  43.916 1.00 101.23 ? 158 GLU A CD    1 
ATOM   2287 O OE1   . GLU B 2 158 ? -5.045  21.310  42.807 1.00 108.44 ? 158 GLU A OE1   1 
ATOM   2288 O OE2   . GLU B 2 158 ? -3.624  21.931  44.364 1.00 104.89 ? 158 GLU A OE2   1 
ATOM   2289 N N     . ILE B 2 159 ? -9.581  20.050  46.570 1.00 83.79  ? 159 ILE A N     1 
ATOM   2290 C CA    . ILE B 2 159 ? -10.744 19.174  46.536 1.00 79.78  ? 159 ILE A CA    1 
ATOM   2291 C C     . ILE B 2 159 ? -11.979 19.922  47.021 1.00 82.12  ? 159 ILE A C     1 
ATOM   2292 O O     . ILE B 2 159 ? -12.961 20.054  46.296 1.00 86.80  ? 159 ILE A O     1 
ATOM   2293 C CB    . ILE B 2 159 ? -10.547 17.932  47.435 1.00 78.28  ? 159 ILE A CB    1 
ATOM   2294 C CG1   . ILE B 2 159 ? -9.460  17.031  46.848 1.00 77.58  ? 159 ILE A CG1   1 
ATOM   2295 C CG2   . ILE B 2 159 ? -11.860 17.170  47.568 1.00 75.90  ? 159 ILE A CG2   1 
ATOM   2296 C CD1   . ILE B 2 159 ? -9.237  15.754  47.630 1.00 75.30  ? 159 ILE A CD1   1 
ATOM   2297 N N     . THR B 2 160 ? -11.921 20.411  48.254 1.00 83.50  ? 160 THR A N     1 
ATOM   2298 C CA    . THR B 2 160 ? -13.039 21.135  48.843 1.00 83.86  ? 160 THR A CA    1 
ATOM   2299 C C     . THR B 2 160 ? -13.514 22.302  47.979 1.00 82.59  ? 160 THR A C     1 
ATOM   2300 O O     . THR B 2 160 ? -14.711 22.562  47.887 1.00 80.06  ? 160 THR A O     1 
ATOM   2301 C CB    . THR B 2 160 ? -12.677 21.667  50.253 1.00 85.76  ? 160 THR A CB    1 
ATOM   2302 O OG1   . THR B 2 160 ? -11.461 22.423  50.189 1.00 78.43  ? 160 THR A OG1   1 
ATOM   2303 C CG2   . THR B 2 160 ? -12.496 20.513  51.225 1.00 83.51  ? 160 THR A CG2   1 
ATOM   2304 N N     . GLN B 2 161 ? -12.579 23.001  47.345 1.00 81.02  ? 161 GLN A N     1 
ATOM   2305 C CA    . GLN B 2 161 ? -12.930 24.136  46.501 1.00 85.71  ? 161 GLN A CA    1 
ATOM   2306 C C     . GLN B 2 161 ? -13.600 23.709  45.196 1.00 90.14  ? 161 GLN A C     1 
ATOM   2307 O O     . GLN B 2 161 ? -14.544 24.351  44.738 1.00 91.30  ? 161 GLN A O     1 
ATOM   2308 C CB    . GLN B 2 161 ? -11.683 24.982  46.203 1.00 87.15  ? 161 GLN A CB    1 
ATOM   2309 C CG    . GLN B 2 161 ? -11.337 25.995  47.299 1.00 79.68  ? 161 GLN A CG    1 
ATOM   2310 C CD    . GLN B 2 161 ? -10.071 26.791  47.000 1.00 77.37  ? 161 GLN A CD    1 
ATOM   2311 O OE1   . GLN B 2 161 ? -9.878  27.892  47.519 1.00 61.93  ? 161 GLN A OE1   1 
ATOM   2312 N NE2   . GLN B 2 161 ? -9.199  26.230  46.171 1.00 69.51  ? 161 GLN A NE2   1 
ATOM   2313 N N     . LYS B 2 162 ? -13.113 22.627  44.598 1.00 90.80  ? 162 LYS A N     1 
ATOM   2314 C CA    . LYS B 2 162 ? -13.685 22.127  43.352 1.00 86.38  ? 162 LYS A CA    1 
ATOM   2315 C C     . LYS B 2 162 ? -14.745 21.075  43.660 1.00 88.12  ? 162 LYS A C     1 
ATOM   2316 O O     . LYS B 2 162 ? -14.688 19.955  43.153 1.00 90.67  ? 162 LYS A O     1 
ATOM   2317 C CB    . LYS B 2 162 ? -12.588 21.520  42.474 1.00 90.06  ? 162 LYS A CB    1 
ATOM   2318 C CG    . LYS B 2 162 ? -13.060 21.094  41.093 1.00 99.84  ? 162 LYS A CG    1 
ATOM   2319 C CD    . LYS B 2 162 ? -11.905 20.580  40.250 1.00 106.42 ? 162 LYS A CD    1 
ATOM   2320 C CE    . LYS B 2 162 ? -12.352 20.243  38.835 1.00 108.77 ? 162 LYS A CE    1 
ATOM   2321 N NZ    . LYS B 2 162 ? -11.207 19.829  37.977 1.00 108.91 ? 162 LYS A NZ    1 
ATOM   2322 N N     . ARG B 2 163 ? -15.713 21.442  44.494 1.00 84.90  ? 163 ARG A N     1 
ATOM   2323 C CA    . ARG B 2 163 ? -16.779 20.528  44.880 1.00 86.35  ? 163 ARG A CA    1 
ATOM   2324 C C     . ARG B 2 163 ? -17.759 21.239  45.810 1.00 89.29  ? 163 ARG A C     1 
ATOM   2325 O O     . ARG B 2 163 ? -18.888 20.791  46.002 1.00 95.98  ? 163 ARG A O     1 
ATOM   2326 C CB    . ARG B 2 163 ? -16.178 19.305  45.579 1.00 90.24  ? 163 ARG A CB    1 
ATOM   2327 C CG    . ARG B 2 163 ? -17.172 18.212  45.930 1.00 102.95 ? 163 ARG A CG    1 
ATOM   2328 C CD    . ARG B 2 163 ? -16.456 17.010  46.528 1.00 108.58 ? 163 ARG A CD    1 
ATOM   2329 N NE    . ARG B 2 163 ? -17.381 15.955  46.936 1.00 115.04 ? 163 ARG A NE    1 
ATOM   2330 C CZ    . ARG B 2 163 ? -17.007 14.810  47.501 1.00 116.53 ? 163 ARG A CZ    1 
ATOM   2331 N NH1   . ARG B 2 163 ? -15.721 14.566  47.727 1.00 111.27 ? 163 ARG A NH1   1 
ATOM   2332 N NH2   . ARG B 2 163 ? -17.919 13.909  47.844 1.00 116.78 ? 163 ARG A NH2   1 
ATOM   2333 N N     . TRP B 2 164 ? -17.312 22.352  46.383 1.00 89.06  ? 164 TRP A N     1 
ATOM   2334 C CA    . TRP B 2 164 ? -18.125 23.155  47.293 1.00 83.63  ? 164 TRP A CA    1 
ATOM   2335 C C     . TRP B 2 164 ? -17.651 24.601  47.224 1.00 80.88  ? 164 TRP A C     1 
ATOM   2336 O O     . TRP B 2 164 ? -18.268 25.497  47.801 1.00 69.99  ? 164 TRP A O     1 
ATOM   2337 C CB    . TRP B 2 164 ? -17.975 22.668  48.736 1.00 86.24  ? 164 TRP A CB    1 
ATOM   2338 C CG    . TRP B 2 164 ? -18.473 21.283  49.003 1.00 88.60  ? 164 TRP A CG    1 
ATOM   2339 C CD1   . TRP B 2 164 ? -19.742 20.814  48.820 1.00 85.12  ? 164 TRP A CD1   1 
ATOM   2340 C CD2   . TRP B 2 164 ? -17.724 20.203  49.569 1.00 93.61  ? 164 TRP A CD2   1 
ATOM   2341 N NE1   . TRP B 2 164 ? -19.831 19.510  49.241 1.00 84.41  ? 164 TRP A NE1   1 
ATOM   2342 C CE2   . TRP B 2 164 ? -18.607 19.109  49.706 1.00 90.63  ? 164 TRP A CE2   1 
ATOM   2343 C CE3   . TRP B 2 164 ? -16.390 20.054  49.978 1.00 93.53  ? 164 TRP A CE3   1 
ATOM   2344 C CZ2   . TRP B 2 164 ? -18.201 17.880  50.236 1.00 90.81  ? 164 TRP A CZ2   1 
ATOM   2345 C CZ3   . TRP B 2 164 ? -15.986 18.832  50.506 1.00 90.98  ? 164 TRP A CZ3   1 
ATOM   2346 C CH2   . TRP B 2 164 ? -16.891 17.761  50.630 1.00 91.67  ? 164 TRP A CH2   1 
ATOM   2347 N N     . LYS B 2 165 ? -16.545 24.817  46.520 1.00 82.48  ? 165 LYS A N     1 
ATOM   2348 C CA    . LYS B 2 165 ? -15.967 26.146  46.382 1.00 91.16  ? 165 LYS A CA    1 
ATOM   2349 C C     . LYS B 2 165 ? -15.730 26.763  47.758 1.00 93.79  ? 165 LYS A C     1 
ATOM   2350 O O     . LYS B 2 165 ? -15.686 27.984  47.913 1.00 96.90  ? 165 LYS A O     1 
ATOM   2351 C CB    . LYS B 2 165 ? -16.883 27.034  45.533 1.00 90.22  ? 165 LYS A CB    1 
ATOM   2352 C CG    . LYS B 2 165 ? -17.006 26.552  44.094 1.00 95.01  ? 165 LYS A CG    1 
ATOM   2353 C CD    . LYS B 2 165 ? -17.816 27.504  43.239 1.00 101.27 ? 165 LYS A CD    1 
ATOM   2354 C CE    . LYS B 2 165 ? -17.916 26.995  41.808 1.00 104.88 ? 165 LYS A CE    1 
ATOM   2355 N NZ    . LYS B 2 165 ? -18.706 27.913  40.938 1.00 110.25 ? 165 LYS A NZ    1 
ATOM   2356 N N     . GLU B 2 166 ? -15.568 25.894  48.752 1.00 93.13  ? 166 GLU A N     1 
ATOM   2357 C CA    . GLU B 2 166 ? -15.326 26.312  50.126 1.00 89.70  ? 166 GLU A CA    1 
ATOM   2358 C C     . GLU B 2 166 ? -13.983 25.731  50.561 1.00 87.32  ? 166 GLU A C     1 
ATOM   2359 O O     . GLU B 2 166 ? -13.431 24.862  49.886 1.00 83.14  ? 166 GLU A O     1 
ATOM   2360 C CB    . GLU B 2 166 ? -16.442 25.788  51.037 1.00 88.59  ? 166 GLU A CB    1 
ATOM   2361 C CG    . GLU B 2 166 ? -16.934 26.789  52.078 1.00 100.29 ? 166 GLU A CG    1 
ATOM   2362 C CD    . GLU B 2 166 ? -15.888 27.126  53.128 1.00 108.70 ? 166 GLU A CD    1 
ATOM   2363 O OE1   . GLU B 2 166 ? -15.529 26.230  53.921 1.00 113.75 ? 166 GLU A OE1   1 
ATOM   2364 O OE2   . GLU B 2 166 ? -15.425 28.287  53.163 1.00 105.35 ? 166 GLU A OE2   1 
ATOM   2365 N N     . ARG B 2 167 ? -13.457 26.213  51.682 1.00 87.93  ? 167 ARG A N     1 
ATOM   2366 C CA    . ARG B 2 167 ? -12.179 25.731  52.198 1.00 87.78  ? 167 ARG A CA    1 
ATOM   2367 C C     . ARG B 2 167 ? -12.355 25.022  53.539 1.00 81.98  ? 167 ARG A C     1 
ATOM   2368 O O     . ARG B 2 167 ? -13.420 25.084  54.150 1.00 80.48  ? 167 ARG A O     1 
ATOM   2369 C CB    . ARG B 2 167 ? -11.206 26.898  52.368 1.00 87.88  ? 167 ARG A CB    1 
ATOM   2370 C CG    . ARG B 2 167 ? -10.670 27.475  51.068 1.00 102.52 ? 167 ARG A CG    1 
ATOM   2371 C CD    . ARG B 2 167 ? -9.844  28.739  51.310 1.00 112.53 ? 167 ARG A CD    1 
ATOM   2372 N NE    . ARG B 2 167 ? -8.851  28.568  52.370 1.00 126.70 ? 167 ARG A NE    1 
ATOM   2373 C CZ    . ARG B 2 167 ? -9.095  28.737  53.669 1.00 129.13 ? 167 ARG A CZ    1 
ATOM   2374 N NH1   . ARG B 2 167 ? -10.305 29.091  54.083 1.00 128.40 ? 167 ARG A NH1   1 
ATOM   2375 N NH2   . ARG B 2 167 ? -8.128  28.543  54.557 1.00 126.15 ? 167 ARG A NH2   1 
ATOM   2376 N N     . PRO B 2 168 ? -11.312 24.317  54.003 1.00 78.10  ? 168 PRO A N     1 
ATOM   2377 C CA    . PRO B 2 168 ? -11.383 23.607  55.284 1.00 78.93  ? 168 PRO A CA    1 
ATOM   2378 C C     . PRO B 2 168 ? -11.109 24.575  56.429 1.00 76.59  ? 168 PRO A C     1 
ATOM   2379 O O     . PRO B 2 168 ? -10.505 25.628  56.225 1.00 79.35  ? 168 PRO A O     1 
ATOM   2380 C CB    . PRO B 2 168 ? -10.275 22.560  55.169 1.00 73.51  ? 168 PRO A CB    1 
ATOM   2381 C CG    . PRO B 2 168 ? -10.042 22.433  53.692 1.00 80.79  ? 168 PRO A CG    1 
ATOM   2382 C CD    . PRO B 2 168 ? -10.157 23.851  53.225 1.00 80.02  ? 168 PRO A CD    1 
ATOM   2383 N N     . GLU B 2 169 ? -11.545 24.218  57.630 1.00 79.63  ? 169 GLU A N     1 
ATOM   2384 C CA    . GLU B 2 169 ? -11.323 25.065  58.796 1.00 85.43  ? 169 GLU A CA    1 
ATOM   2385 C C     . GLU B 2 169 ? -10.517 24.319  59.856 1.00 82.11  ? 169 GLU A C     1 
ATOM   2386 O O     . GLU B 2 169 ? -10.976 23.318  60.405 1.00 68.98  ? 169 GLU A O     1 
ATOM   2387 C CB    . GLU B 2 169 ? -12.660 25.513  59.393 1.00 86.24  ? 169 GLU A CB    1 
ATOM   2388 C CG    . GLU B 2 169 ? -13.602 26.165  58.392 1.00 106.58 ? 169 GLU A CG    1 
ATOM   2389 C CD    . GLU B 2 169 ? -14.822 26.785  59.054 1.00 115.38 ? 169 GLU A CD    1 
ATOM   2390 O OE1   . GLU B 2 169 ? -15.485 26.091  59.856 1.00 116.59 ? 169 GLU A OE1   1 
ATOM   2391 O OE2   . GLU B 2 169 ? -15.118 27.965  58.767 1.00 114.89 ? 169 GLU A OE2   1 
ATOM   2392 N N     . TYR B 2 170 ? -9.313  24.808  60.137 1.00 83.35  ? 170 TYR A N     1 
ATOM   2393 C CA    . TYR B 2 170 ? -8.457  24.184  61.141 1.00 84.31  ? 170 TYR A CA    1 
ATOM   2394 C C     . TYR B 2 170 ? -8.570  24.906  62.484 1.00 79.60  ? 170 TYR A C     1 
ATOM   2395 O O     . TYR B 2 170 ? -8.507  26.132  62.550 1.00 76.64  ? 170 TYR A O     1 
ATOM   2396 C CB    . TYR B 2 170 ? -6.999  24.186  60.684 1.00 74.73  ? 170 TYR A CB    1 
ATOM   2397 C CG    . TYR B 2 170 ? -6.785  23.648  59.290 1.00 70.84  ? 170 TYR A CG    1 
ATOM   2398 C CD1   . TYR B 2 170 ? -7.112  24.409  58.170 1.00 66.97  ? 170 TYR A CD1   1 
ATOM   2399 C CD2   . TYR B 2 170 ? -6.228  22.386  59.089 1.00 66.89  ? 170 TYR A CD2   1 
ATOM   2400 C CE1   . TYR B 2 170 ? -6.884  23.931  56.885 1.00 72.11  ? 170 TYR A CE1   1 
ATOM   2401 C CE2   . TYR B 2 170 ? -5.999  21.898  57.806 1.00 70.49  ? 170 TYR A CE2   1 
ATOM   2402 C CZ    . TYR B 2 170 ? -6.328  22.676  56.709 1.00 69.56  ? 170 TYR A CZ    1 
ATOM   2403 O OH    . TYR B 2 170 ? -6.095  22.201  55.438 1.00 77.72  ? 170 TYR A OH    1 
ATOM   2404 N N     . ARG B 2 171 ? -8.737  24.131  63.549 1.00 80.00  ? 171 ARG A N     1 
ATOM   2405 C CA    . ARG B 2 171 ? -8.865  24.680  64.891 1.00 81.96  ? 171 ARG A CA    1 
ATOM   2406 C C     . ARG B 2 171 ? -8.045  23.911  65.910 1.00 82.92  ? 171 ARG A C     1 
ATOM   2407 O O     . ARG B 2 171 ? -8.238  22.711  66.101 1.00 84.90  ? 171 ARG A O     1 
ATOM   2408 C CB    . ARG B 2 171 ? -10.328 24.665  65.333 1.00 79.27  ? 171 ARG A CB    1 
ATOM   2409 C CG    . ARG B 2 171 ? -10.910 26.029  65.608 1.00 90.86  ? 171 ARG A CG    1 
ATOM   2410 C CD    . ARG B 2 171 ? -11.288 26.150  67.076 1.00 97.20  ? 171 ARG A CD    1 
ATOM   2411 N NE    . ARG B 2 171 ? -12.690 25.811  67.306 1.00 100.88 ? 171 ARG A NE    1 
ATOM   2412 C CZ    . ARG B 2 171 ? -13.388 26.198  68.369 1.00 104.04 ? 171 ARG A CZ    1 
ATOM   2413 N NH1   . ARG B 2 171 ? -12.817 26.940  69.308 1.00 101.95 ? 171 ARG A NH1   1 
ATOM   2414 N NH2   . ARG B 2 171 ? -14.663 25.848  68.490 1.00 103.96 ? 171 ARG A NH2   1 
ATOM   2415 N N     . LEU B 2 172 ? -7.126  24.609  66.564 1.00 84.97  ? 172 LEU A N     1 
ATOM   2416 C CA    . LEU B 2 172 ? -6.298  23.992  67.588 1.00 85.22  ? 172 LEU A CA    1 
ATOM   2417 C C     . LEU B 2 172 ? -7.231  23.684  68.748 1.00 80.77  ? 172 LEU A C     1 
ATOM   2418 O O     . LEU B 2 172 ? -8.090  24.500  69.081 1.00 73.95  ? 172 LEU A O     1 
ATOM   2419 C CB    . LEU B 2 172 ? -5.213  24.968  68.042 1.00 82.66  ? 172 LEU A CB    1 
ATOM   2420 C CG    . LEU B 2 172 ? -4.280  24.507  69.159 1.00 85.32  ? 172 LEU A CG    1 
ATOM   2421 C CD1   . LEU B 2 172 ? -3.415  23.355  68.672 1.00 85.98  ? 172 LEU A CD1   1 
ATOM   2422 C CD2   . LEU B 2 172 ? -3.416  25.676  69.596 1.00 88.26  ? 172 LEU A CD2   1 
ATOM   2423 N N     . ILE B 2 173 ? -7.083  22.511  69.354 1.00 83.96  ? 173 ILE A N     1 
ATOM   2424 C CA    . ILE B 2 173 ? -7.940  22.151  70.476 1.00 89.20  ? 173 ILE A CA    1 
ATOM   2425 C C     . ILE B 2 173 ? -7.146  21.924  71.755 1.00 88.25  ? 173 ILE A C     1 
ATOM   2426 O O     . ILE B 2 173 ? -7.715  21.916  72.845 1.00 92.03  ? 173 ILE A O     1 
ATOM   2427 C CB    . ILE B 2 173 ? -8.771  20.887  70.183 1.00 88.23  ? 173 ILE A CB    1 
ATOM   2428 C CG1   . ILE B 2 173 ? -7.865  19.661  70.155 1.00 97.06  ? 173 ILE A CG1   1 
ATOM   2429 C CG2   . ILE B 2 173 ? -9.492  21.038  68.852 1.00 85.84  ? 173 ILE A CG2   1 
ATOM   2430 C CD1   . ILE B 2 173 ? -8.611  18.368  69.941 1.00 107.93 ? 173 ILE A CD1   1 
ATOM   2431 N N     . SER B 2 174 ? -5.833  21.741  71.625 1.00 93.34  ? 174 SER A N     1 
ATOM   2432 C CA    . SER B 2 174 ? -4.987  21.522  72.796 1.00 96.33  ? 174 SER A CA    1 
ATOM   2433 C C     . SER B 2 174 ? -3.493  21.533  72.491 1.00 92.21  ? 174 SER A C     1 
ATOM   2434 O O     . SER B 2 174 ? -3.063  21.223  71.378 1.00 87.50  ? 174 SER A O     1 
ATOM   2435 C CB    . SER B 2 174 ? -5.342  20.194  73.477 1.00 95.52  ? 174 SER A CB    1 
ATOM   2436 O OG    . SER B 2 174 ? -4.887  19.083  72.721 1.00 97.87  ? 174 SER A OG    1 
ATOM   2437 N N     . VAL B 2 175 ? -2.710  21.896  73.502 1.00 95.23  ? 175 VAL A N     1 
ATOM   2438 C CA    . VAL B 2 175 ? -1.256  21.943  73.399 1.00 95.64  ? 175 VAL A CA    1 
ATOM   2439 C C     . VAL B 2 175 ? -0.690  21.337  74.683 1.00 93.77  ? 175 VAL A C     1 
ATOM   2440 O O     . VAL B 2 175 ? -0.944  21.838  75.778 1.00 89.51  ? 175 VAL A O     1 
ATOM   2441 C CB    . VAL B 2 175 ? -0.746  23.393  73.253 1.00 90.62  ? 175 VAL A CB    1 
ATOM   2442 C CG1   . VAL B 2 175 ? 0.740   23.392  72.928 1.00 86.07  ? 175 VAL A CG1   1 
ATOM   2443 C CG2   . VAL B 2 175 ? -1.526  24.112  72.170 1.00 84.44  ? 175 VAL A CG2   1 
ATOM   2444 N N     . GLU B 2 176 ? 0.069   20.255  74.545 1.00 96.20  ? 176 GLU A N     1 
ATOM   2445 C CA    . GLU B 2 176 ? 0.643   19.576  75.701 1.00 100.65 ? 176 GLU A CA    1 
ATOM   2446 C C     . GLU B 2 176 ? 2.166   19.604  75.695 1.00 101.64 ? 176 GLU A C     1 
ATOM   2447 O O     . GLU B 2 176 ? 2.792   19.798  74.652 1.00 103.82 ? 176 GLU A O     1 
ATOM   2448 C CB    . GLU B 2 176 ? 0.171   18.119  75.736 1.00 105.65 ? 176 GLU A CB    1 
ATOM   2449 C CG    . GLU B 2 176 ? -1.332  17.941  75.572 1.00 114.21 ? 176 GLU A CG    1 
ATOM   2450 C CD    . GLU B 2 176 ? -1.756  16.480  75.546 1.00 117.07 ? 176 GLU A CD    1 
ATOM   2451 O OE1   . GLU B 2 176 ? -1.249  15.721  74.691 1.00 111.20 ? 176 GLU A OE1   1 
ATOM   2452 O OE2   . GLU B 2 176 ? -2.604  16.094  76.380 1.00 117.63 ? 176 GLU A OE2   1 
ATOM   2453 N N     . GLY B 2 177 ? 2.751   19.410  76.873 1.00 103.25 ? 177 GLY A N     1 
ATOM   2454 C CA    . GLY B 2 177 ? 4.197   19.385  77.000 1.00 104.84 ? 177 GLY A CA    1 
ATOM   2455 C C     . GLY B 2 177 ? 4.895   20.730  77.077 1.00 103.89 ? 177 GLY A C     1 
ATOM   2456 O O     . GLY B 2 177 ? 4.258   21.779  76.945 1.00 101.14 ? 177 GLY A O     1 
ATOM   2457 N N     . PRO B 2 178 ? 6.223   20.720  77.292 1.00 100.65 ? 178 PRO A N     1 
ATOM   2458 C CA    . PRO B 2 178 ? 7.089   21.898  77.399 1.00 100.34 ? 178 PRO A CA    1 
ATOM   2459 C C     . PRO B 2 178 ? 7.256   22.619  76.067 1.00 100.35 ? 178 PRO A C     1 
ATOM   2460 O O     . PRO B 2 178 ? 7.112   22.018  75.006 1.00 101.95 ? 178 PRO A O     1 
ATOM   2461 C CB    . PRO B 2 178 ? 8.399   21.308  77.903 1.00 101.85 ? 178 PRO A CB    1 
ATOM   2462 C CG    . PRO B 2 178 ? 8.424   19.975  77.236 1.00 99.55  ? 178 PRO A CG    1 
ATOM   2463 C CD    . PRO B 2 178 ? 7.012   19.487  77.465 1.00 97.97  ? 178 PRO A CD    1 
ATOM   2464 N N     . HIS B 2 179 ? 7.584   23.903  76.132 1.00 97.45  ? 179 HIS A N     1 
ATOM   2465 C CA    . HIS B 2 179 ? 7.748   24.717  74.935 1.00 98.75  ? 179 HIS A CA    1 
ATOM   2466 C C     . HIS B 2 179 ? 8.775   24.213  73.924 1.00 98.54  ? 179 HIS A C     1 
ATOM   2467 O O     . HIS B 2 179 ? 8.454   24.043  72.748 1.00 101.94 ? 179 HIS A O     1 
ATOM   2468 C CB    . HIS B 2 179 ? 8.072   26.154  75.340 1.00 98.64  ? 179 HIS A CB    1 
ATOM   2469 C CG    . HIS B 2 179 ? 7.083   26.737  76.298 1.00 104.74 ? 179 HIS A CG    1 
ATOM   2470 N ND1   . HIS B 2 179 ? 5.728   26.758  76.045 1.00 107.43 ? 179 HIS A ND1   1 
ATOM   2471 C CD2   . HIS B 2 179 ? 7.245   27.292  77.522 1.00 110.14 ? 179 HIS A CD2   1 
ATOM   2472 C CE1   . HIS B 2 179 ? 5.098   27.298  77.072 1.00 108.46 ? 179 HIS A CE1   1 
ATOM   2473 N NE2   . HIS B 2 179 ? 5.995   27.630  77.982 1.00 112.83 ? 179 HIS A NE2   1 
ATOM   2474 N N     . HIS B 2 180 ? 10.003  23.974  74.371 1.00 98.47  ? 180 HIS A N     1 
ATOM   2475 C CA    . HIS B 2 180 ? 11.049  23.501  73.468 1.00 96.02  ? 180 HIS A CA    1 
ATOM   2476 C C     . HIS B 2 180 ? 10.653  22.207  72.753 1.00 95.41  ? 180 HIS A C     1 
ATOM   2477 O O     . HIS B 2 180 ? 11.258  21.838  71.747 1.00 95.11  ? 180 HIS A O     1 
ATOM   2478 C CB    . HIS B 2 180 ? 12.365  23.298  74.229 1.00 90.92  ? 180 HIS A CB    1 
ATOM   2479 C CG    . HIS B 2 180 ? 12.261  22.346  75.378 1.00 88.97  ? 180 HIS A CG    1 
ATOM   2480 N ND1   . HIS B 2 180 ? 11.551  22.637  76.524 1.00 88.66  ? 180 HIS A ND1   1 
ATOM   2481 C CD2   . HIS B 2 180 ? 12.757  21.098  75.549 1.00 90.80  ? 180 HIS A CD2   1 
ATOM   2482 C CE1   . HIS B 2 180 ? 11.615  21.608  77.350 1.00 88.43  ? 180 HIS A CE1   1 
ATOM   2483 N NE2   . HIS B 2 180 ? 12.340  20.662  76.782 1.00 94.16  ? 180 HIS A NE2   1 
ATOM   2484 N N     . LYS B 2 181 ? 9.636   21.526  73.273 1.00 93.74  ? 181 LYS A N     1 
ATOM   2485 C CA    . LYS B 2 181 ? 9.156   20.280  72.677 1.00 95.79  ? 181 LYS A CA    1 
ATOM   2486 C C     . LYS B 2 181 ? 7.718   20.004  73.110 1.00 96.61  ? 181 LYS A C     1 
ATOM   2487 O O     . LYS B 2 181 ? 7.477   19.345  74.124 1.00 95.53  ? 181 LYS A O     1 
ATOM   2488 C CB    . LYS B 2 181 ? 10.048  19.104  73.091 1.00 97.03  ? 181 LYS A CB    1 
ATOM   2489 C CG    . LYS B 2 181 ? 9.605   17.767  72.508 1.00 98.64  ? 181 LYS A CG    1 
ATOM   2490 C CD    . LYS B 2 181 ? 10.328  16.587  73.149 1.00 99.28  ? 181 LYS A CD    1 
ATOM   2491 C CE    . LYS B 2 181 ? 9.781   15.262  72.623 1.00 89.39  ? 181 LYS A CE    1 
ATOM   2492 N NZ    . LYS B 2 181 ? 10.387  14.075  73.289 1.00 85.32  ? 181 LYS A NZ    1 
ATOM   2493 N N     . LYS B 2 182 ? 6.764   20.510  72.335 1.00 96.31  ? 182 LYS A N     1 
ATOM   2494 C CA    . LYS B 2 182 ? 5.348   20.333  72.642 1.00 92.88  ? 182 LYS A CA    1 
ATOM   2495 C C     . LYS B 2 182 ? 4.623   19.640  71.502 1.00 90.28  ? 182 LYS A C     1 
ATOM   2496 O O     . LYS B 2 182 ? 5.112   19.618  70.371 1.00 87.62  ? 182 LYS A O     1 
ATOM   2497 C CB    . LYS B 2 182 ? 4.698   21.693  72.908 1.00 89.89  ? 182 LYS A CB    1 
ATOM   2498 C CG    . LYS B 2 182 ? 5.009   22.735  71.840 1.00 85.48  ? 182 LYS A CG    1 
ATOM   2499 C CD    . LYS B 2 182 ? 4.291   24.053  72.094 1.00 80.96  ? 182 LYS A CD    1 
ATOM   2500 C CE    . LYS B 2 182 ? 4.702   24.674  73.408 1.00 76.30  ? 182 LYS A CE    1 
ATOM   2501 N NZ    . LYS B 2 182 ? 4.021   25.977  73.619 1.00 85.30  ? 182 LYS A NZ    1 
ATOM   2502 N N     . LYS B 2 183 ? 3.457   19.072  71.807 1.00 88.95  ? 183 LYS A N     1 
ATOM   2503 C CA    . LYS B 2 183 ? 2.649   18.384  70.804 1.00 91.31  ? 183 LYS A CA    1 
ATOM   2504 C C     . LYS B 2 183 ? 1.302   19.079  70.607 1.00 88.99  ? 183 LYS A C     1 
ATOM   2505 O O     . LYS B 2 183 ? 0.543   19.276  71.560 1.00 83.84  ? 183 LYS A O     1 
ATOM   2506 C CB    . LYS B 2 183 ? 2.437   16.921  71.199 1.00 90.74  ? 183 LYS A CB    1 
ATOM   2507 C CG    . LYS B 2 183 ? 1.808   16.722  72.562 1.00 97.77  ? 183 LYS A CG    1 
ATOM   2508 C CD    . LYS B 2 183 ? 1.523   15.250  72.821 1.00 104.36 ? 183 LYS A CD    1 
ATOM   2509 C CE    . LYS B 2 183 ? 0.489   14.708  71.843 1.00 99.73  ? 183 LYS A CE    1 
ATOM   2510 N NZ    . LYS B 2 183 ? -0.804  15.436  71.963 1.00 96.69  ? 183 LYS A NZ    1 
ATOM   2511 N N     . PHE B 2 184 ? 1.020   19.452  69.361 1.00 87.02  ? 184 PHE A N     1 
ATOM   2512 C CA    . PHE B 2 184 ? -0.223  20.133  69.009 1.00 86.61  ? 184 PHE A CA    1 
ATOM   2513 C C     . PHE B 2 184 ? -1.297  19.157  68.543 1.00 82.81  ? 184 PHE A C     1 
ATOM   2514 O O     . PHE B 2 184 ? -0.998  18.070  68.044 1.00 79.92  ? 184 PHE A O     1 
ATOM   2515 C CB    . PHE B 2 184 ? 0.037   21.152  67.901 1.00 87.87  ? 184 PHE A CB    1 
ATOM   2516 C CG    . PHE B 2 184 ? 0.846   22.332  68.342 1.00 88.54  ? 184 PHE A CG    1 
ATOM   2517 C CD1   . PHE B 2 184 ? 0.253   23.370  69.052 1.00 88.90  ? 184 PHE A CD1   1 
ATOM   2518 C CD2   . PHE B 2 184 ? 2.202   22.403  68.059 1.00 84.62  ? 184 PHE A CD2   1 
ATOM   2519 C CE1   . PHE B 2 184 ? 1.002   24.461  69.473 1.00 90.41  ? 184 PHE A CE1   1 
ATOM   2520 C CE2   . PHE B 2 184 ? 2.962   23.490  68.475 1.00 89.01  ? 184 PHE A CE2   1 
ATOM   2521 C CZ    . PHE B 2 184 ? 2.361   24.522  69.183 1.00 92.25  ? 184 PHE A CZ    1 
ATOM   2522 N N     . ILE B 2 185 ? -2.550  19.560  68.713 1.00 79.20  ? 185 ILE A N     1 
ATOM   2523 C CA    . ILE B 2 185 ? -3.686  18.748  68.299 1.00 80.29  ? 185 ILE A CA    1 
ATOM   2524 C C     . ILE B 2 185 ? -4.739  19.623  67.621 1.00 80.64  ? 185 ILE A C     1 
ATOM   2525 O O     . ILE B 2 185 ? -5.576  20.239  68.289 1.00 70.48  ? 185 ILE A O     1 
ATOM   2526 C CB    . ILE B 2 185 ? -4.331  18.023  69.500 1.00 79.08  ? 185 ILE A CB    1 
ATOM   2527 C CG1   . ILE B 2 185 ? -3.359  16.983  70.061 1.00 79.91  ? 185 ILE A CG1   1 
ATOM   2528 C CG2   . ILE B 2 185 ? -5.629  17.353  69.070 1.00 71.83  ? 185 ILE A CG2   1 
ATOM   2529 C CD1   . ILE B 2 185 ? -3.930  16.158  71.201 1.00 76.14  ? 185 ILE A CD1   1 
ATOM   2530 N N     . VAL B 2 186 ? -4.686  19.676  66.291 1.00 77.29  ? 186 VAL A N     1 
ATOM   2531 C CA    . VAL B 2 186 ? -5.630  20.476  65.521 1.00 78.05  ? 186 VAL A CA    1 
ATOM   2532 C C     . VAL B 2 186 ? -6.836  19.661  65.077 1.00 81.25  ? 186 VAL A C     1 
ATOM   2533 O O     . VAL B 2 186 ? -6.842  18.433  65.168 1.00 81.00  ? 186 VAL A O     1 
ATOM   2534 C CB    . VAL B 2 186 ? -4.972  21.074  64.266 1.00 74.66  ? 186 VAL A CB    1 
ATOM   2535 C CG1   . VAL B 2 186 ? -3.823  21.978  64.664 1.00 82.88  ? 186 VAL A CG1   1 
ATOM   2536 C CG2   . VAL B 2 186 ? -4.489  19.961  63.354 1.00 72.04  ? 186 VAL A CG2   1 
ATOM   2537 N N     . GLU B 2 187 ? -7.853  20.364  64.592 1.00 85.63  ? 187 GLU A N     1 
ATOM   2538 C CA    . GLU B 2 187 ? -9.089  19.746  64.125 1.00 86.56  ? 187 GLU A CA    1 
ATOM   2539 C C     . GLU B 2 187 ? -9.416  20.254  62.729 1.00 85.81  ? 187 GLU A C     1 
ATOM   2540 O O     . GLU B 2 187 ? -9.603  21.452  62.534 1.00 88.22  ? 187 GLU A O     1 
ATOM   2541 C CB    . GLU B 2 187 ? -10.242 20.103  65.073 1.00 86.56  ? 187 GLU A CB    1 
ATOM   2542 C CG    . GLU B 2 187 ? -11.635 19.746  64.557 1.00 80.57  ? 187 GLU A CG    1 
ATOM   2543 C CD    . GLU B 2 187 ? -12.752 20.255  65.465 1.00 82.83  ? 187 GLU A CD    1 
ATOM   2544 O OE1   . GLU B 2 187 ? -12.886 21.488  65.620 1.00 84.50  ? 187 GLU A OE1   1 
ATOM   2545 O OE2   . GLU B 2 187 ? -13.497 19.422  66.024 1.00 76.63  ? 187 GLU A OE2   1 
ATOM   2546 N N     . ALA B 2 188 ? -9.480  19.347  61.760 1.00 90.87  ? 188 ALA A N     1 
ATOM   2547 C CA    . ALA B 2 188 ? -9.812  19.726  60.387 1.00 89.42  ? 188 ALA A CA    1 
ATOM   2548 C C     . ALA B 2 188 ? -11.294 19.454  60.144 1.00 85.57  ? 188 ALA A C     1 
ATOM   2549 O O     . ALA B 2 188 ? -11.781 18.354  60.414 1.00 84.35  ? 188 ALA A O     1 
ATOM   2550 C CB    . ALA B 2 188 ? -8.962  18.935  59.395 1.00 84.20  ? 188 ALA A CB    1 
ATOM   2551 N N     . LYS B 2 189 ? -12.017 20.454  59.651 1.00 83.04  ? 189 LYS A N     1 
ATOM   2552 C CA    . LYS B 2 189 ? -13.437 20.271  59.391 1.00 79.97  ? 189 LYS A CA    1 
ATOM   2553 C C     . LYS B 2 189 ? -13.959 20.990  58.156 1.00 78.32  ? 189 LYS A C     1 
ATOM   2554 O O     . LYS B 2 189 ? -13.540 22.101  57.837 1.00 75.54  ? 189 LYS A O     1 
ATOM   2555 C CB    . LYS B 2 189 ? -14.263 20.674  60.622 1.00 71.05  ? 189 LYS A CB    1 
ATOM   2556 C CG    . LYS B 2 189 ? -14.212 22.147  60.975 1.00 81.58  ? 189 LYS A CG    1 
ATOM   2557 C CD    . LYS B 2 189 ? -14.855 22.443  62.333 1.00 86.61  ? 189 LYS A CD    1 
ATOM   2558 C CE    . LYS B 2 189 ? -16.364 22.201  62.352 1.00 90.84  ? 189 LYS A CE    1 
ATOM   2559 N NZ    . LYS B 2 189 ? -16.736 20.760  62.290 1.00 93.69  ? 189 LYS A NZ    1 
ATOM   2560 N N     . ILE B 2 190 ? -14.839 20.323  57.455 1.00 84.38  ? 190 ILE A N     1 
ATOM   2561 C CA    . ILE B 2 190 ? -15.441 20.862  56.257 1.00 84.12  ? 190 ILE A CA    1 
ATOM   2562 C C     . ILE B 2 190 ? -16.812 20.271  56.160 1.00 86.41  ? 190 ILE A C     1 
ATOM   2563 O O     . ILE B 2 190 ? -16.955 19.053  56.040 1.00 89.37  ? 190 ILE A O     1 
ATOM   2564 C CB    . ILE B 2 190 ? -14.574 20.584  55.015 1.00 79.09  ? 190 ILE A CB    1 
ATOM   2565 C CG1   . ILE B 2 190 ? -15.354 20.899  53.738 1.00 73.31  ? 190 ILE A CG1   1 
ATOM   2566 C CG2   . ILE B 2 190 ? -14.093 19.141  55.014 1.00 79.12  ? 190 ILE A CG2   1 
ATOM   2567 C CD1   . ILE B 2 190 ? -15.314 22.359  53.342 1.00 20.35  ? 190 ILE A CD1   1 
ATOM   2568 N N     . LYS B 2 191 ? -17.843 21.117  56.222 1.00 89.61  ? 191 LYS A N     1 
ATOM   2569 C CA    . LYS B 2 191 ? -19.158 20.553  56.177 1.00 93.36  ? 191 LYS A CA    1 
ATOM   2570 C C     . LYS B 2 191 ? -19.393 19.787  57.441 1.00 90.50  ? 191 LYS A C     1 
ATOM   2571 O O     . LYS B 2 191 ? -19.267 20.295  58.546 1.00 94.35  ? 191 LYS A O     1 
ATOM   2572 C CB    . LYS B 2 191 ? -19.315 19.644  54.965 1.00 99.36  ? 191 LYS A CB    1 
ATOM   2573 C CG    . LYS B 2 191 ? -19.488 20.397  53.665 1.00 103.90 ? 191 LYS A CG    1 
ATOM   2574 C CD    . LYS B 2 191 ? -20.813 21.147  53.682 1.00 102.30 ? 191 LYS A CD    1 
ATOM   2575 C CE    . LYS B 2 191 ? -20.990 21.954  52.407 1.00 97.07  ? 191 LYS A CE    1 
ATOM   2576 N NZ    . LYS B 2 191 ? -19.918 22.971  52.238 1.00 101.02 ? 191 LYS A NZ    1 
ATOM   2577 N N     . GLU B 2 192 ? -19.728 18.557  57.240 1.00 91.70  ? 192 GLU A N     1 
ATOM   2578 C CA    . GLU B 2 192 ? -20.044 17.719  58.344 1.00 95.25  ? 192 GLU A CA    1 
ATOM   2579 C C     . GLU B 2 192 ? -18.955 16.757  58.737 1.00 94.83  ? 192 GLU A C     1 
ATOM   2580 O O     . GLU B 2 192 ? -19.150 15.936  59.634 1.00 84.44  ? 192 GLU A O     1 
ATOM   2581 C CB    . GLU B 2 192 ? -21.339 16.958  58.069 1.00 96.63  ? 192 GLU A CB    1 
ATOM   2582 C CG    . GLU B 2 192 ? -21.222 15.963  56.925 1.00 101.60 ? 192 GLU A CG    1 
ATOM   2583 C CD    . GLU B 2 192 ? -20.859 16.585  55.592 1.00 111.39 ? 192 GLU A CD    1 
ATOM   2584 O OE1   . GLU B 2 192 ? -21.646 17.410  55.082 1.00 114.87 ? 192 GLU A OE1   1 
ATOM   2585 O OE2   . GLU B 2 192 ? -19.784 16.251  55.054 1.00 116.28 ? 192 GLU A OE2   1 
ATOM   2586 N N     . TYR B 2 193 ? -17.813 16.834  58.061 1.00 99.17  ? 193 TYR A N     1 
ATOM   2587 C CA    . TYR B 2 193 ? -16.689 15.948  58.345 1.00 99.12  ? 193 TYR A CA    1 
ATOM   2588 C C     . TYR B 2 193 ? -15.749 16.608  59.349 1.00 100.81 ? 193 TYR A C     1 
ATOM   2589 O O     . TYR B 2 193 ? -15.667 17.835  59.415 1.00 102.74 ? 193 TYR A O     1 
ATOM   2590 C CB    . TYR B 2 193 ? -15.913 15.641  57.060 1.00 97.76  ? 193 TYR A CB    1 
ATOM   2591 C CG    . TYR B 2 193 ? -16.733 14.974  55.979 1.00 103.66 ? 193 TYR A CG    1 
ATOM   2592 C CD1   . TYR B 2 193 ? -17.368 13.754  56.208 1.00 105.94 ? 193 TYR A CD1   1 
ATOM   2593 C CD2   . TYR B 2 193 ? -16.864 15.555  54.720 1.00 104.10 ? 193 TYR A CD2   1 
ATOM   2594 C CE1   . TYR B 2 193 ? -18.113 13.127  55.208 1.00 103.50 ? 193 TYR A CE1   1 
ATOM   2595 C CE2   . TYR B 2 193 ? -17.606 14.937  53.712 1.00 104.71 ? 193 TYR A CE2   1 
ATOM   2596 C CZ    . TYR B 2 193 ? -18.227 13.725  53.964 1.00 103.31 ? 193 TYR A CZ    1 
ATOM   2597 O OH    . TYR B 2 193 ? -18.960 13.113  52.973 1.00 101.10 ? 193 TYR A OH    1 
ATOM   2598 N N     . ARG B 2 194 ? -15.053 15.794  60.135 1.00 100.15 ? 194 ARG A N     1 
ATOM   2599 C CA    . ARG B 2 194 ? -14.102 16.308  61.115 1.00 101.38 ? 194 ARG A CA    1 
ATOM   2600 C C     . ARG B 2 194 ? -13.135 15.247  61.609 1.00 99.69  ? 194 ARG A C     1 
ATOM   2601 O O     . ARG B 2 194 ? -13.540 14.175  62.053 1.00 105.57 ? 194 ARG A O     1 
ATOM   2602 C CB    . ARG B 2 194 ? -14.824 16.945  62.309 1.00 100.24 ? 194 ARG A CB    1 
ATOM   2603 C CG    . ARG B 2 194 ? -15.944 16.125  62.908 1.00 103.40 ? 194 ARG A CG    1 
ATOM   2604 C CD    . ARG B 2 194 ? -17.279 16.463  62.264 1.00 109.92 ? 194 ARG A CD    1 
ATOM   2605 N NE    . ARG B 2 194 ? -18.401 15.897  63.007 1.00 110.92 ? 194 ARG A NE    1 
ATOM   2606 C CZ    . ARG B 2 194 ? -18.669 16.171  64.281 1.00 115.11 ? 194 ARG A CZ    1 
ATOM   2607 N NH1   . ARG B 2 194 ? -17.897 17.007  64.963 1.00 111.73 ? 194 ARG A NH1   1 
ATOM   2608 N NH2   . ARG B 2 194 ? -19.705 15.603  64.878 1.00 122.07 ? 194 ARG A NH2   1 
ATOM   2609 N N     . THR B 2 195 ? -11.847 15.560  61.528 1.00 94.09  ? 195 THR A N     1 
ATOM   2610 C CA    . THR B 2 195 ? -10.804 14.642  61.956 1.00 92.57  ? 195 THR A CA    1 
ATOM   2611 C C     . THR B 2 195 ? -9.818  15.334  62.892 1.00 93.31  ? 195 THR A C     1 
ATOM   2612 O O     . THR B 2 195 ? -9.896  16.545  63.104 1.00 94.48  ? 195 THR A O     1 
ATOM   2613 C CB    . THR B 2 195 ? -10.042 14.090  60.740 1.00 91.23  ? 195 THR A CB    1 
ATOM   2614 O OG1   . THR B 2 195 ? -9.472  15.176  60.002 1.00 82.04  ? 195 THR A OG1   1 
ATOM   2615 C CG2   . THR B 2 195 ? -10.984 13.311  59.834 1.00 90.46  ? 195 THR A CG2   1 
ATOM   2616 N N     . LEU B 2 196 ? -8.897  14.557  63.454 1.00 88.36  ? 196 LEU A N     1 
ATOM   2617 C CA    . LEU B 2 196 ? -7.888  15.094  64.357 1.00 85.39  ? 196 LEU A CA    1 
ATOM   2618 C C     . LEU B 2 196 ? -6.490  14.796  63.825 1.00 86.13  ? 196 LEU A C     1 
ATOM   2619 O O     . LEU B 2 196 ? -6.322  13.975  62.922 1.00 84.85  ? 196 LEU A O     1 
ATOM   2620 C CB    . LEU B 2 196 ? -8.061  14.496  65.751 1.00 84.58  ? 196 LEU A CB    1 
ATOM   2621 C CG    . LEU B 2 196 ? -9.343  14.934  66.463 1.00 89.52  ? 196 LEU A CG    1 
ATOM   2622 C CD1   . LEU B 2 196 ? -9.507  14.174  67.768 1.00 89.90  ? 196 LEU A CD1   1 
ATOM   2623 C CD2   . LEU B 2 196 ? -9.292  16.435  66.713 1.00 92.95  ? 196 LEU A CD2   1 
ATOM   2624 N N     . GLY B 2 197 ? -5.492  15.476  64.381 1.00 89.10  ? 197 GLY A N     1 
ATOM   2625 C CA    . GLY B 2 197 ? -4.124  15.264  63.946 1.00 89.33  ? 197 GLY A CA    1 
ATOM   2626 C C     . GLY B 2 197 ? -3.089  15.742  64.943 1.00 87.37  ? 197 GLY A C     1 
ATOM   2627 O O     . GLY B 2 197 ? -3.067  16.919  65.299 1.00 89.88  ? 197 GLY A O     1 
ATOM   2628 N N     . GLU B 2 198 ? -2.237  14.824  65.396 1.00 88.25  ? 198 GLU A N     1 
ATOM   2629 C CA    . GLU B 2 198 ? -1.179  15.147  66.352 1.00 85.83  ? 198 GLU A CA    1 
ATOM   2630 C C     . GLU B 2 198 ? 0.053   15.612  65.591 1.00 81.00  ? 198 GLU A C     1 
ATOM   2631 O O     . GLU B 2 198 ? 0.377   15.068  64.536 1.00 76.93  ? 198 GLU A O     1 
ATOM   2632 C CB    . GLU B 2 198 ? -0.812  13.920  67.191 1.00 91.94  ? 198 GLU A CB    1 
ATOM   2633 C CG    . GLU B 2 198 ? -1.914  13.415  68.109 1.00 102.89 ? 198 GLU A CG    1 
ATOM   2634 C CD    . GLU B 2 198 ? -1.458  12.244  68.968 1.00 109.04 ? 198 GLU A CD    1 
ATOM   2635 O OE1   . GLU B 2 198 ? -0.512  12.421  69.766 1.00 110.68 ? 198 GLU A OE1   1 
ATOM   2636 O OE2   . GLU B 2 198 ? -2.043  11.147  68.844 1.00 110.85 ? 198 GLU A OE2   1 
ATOM   2637 N N     . GLY B 2 199 ? 0.743   16.613  66.124 1.00 77.66  ? 199 GLY A N     1 
ATOM   2638 C CA    . GLY B 2 199 ? 1.927   17.106  65.445 1.00 81.18  ? 199 GLY A CA    1 
ATOM   2639 C C     . GLY B 2 199 ? 2.858   17.923  66.317 1.00 83.83  ? 199 GLY A C     1 
ATOM   2640 O O     . GLY B 2 199 ? 2.415   18.623  67.230 1.00 79.34  ? 199 GLY A O     1 
ATOM   2641 N N     . LYS B 2 200 ? 4.155   17.832  66.034 1.00 84.73  ? 200 LYS A N     1 
ATOM   2642 C CA    . LYS B 2 200 ? 5.149   18.579  66.790 1.00 89.99  ? 200 LYS A CA    1 
ATOM   2643 C C     . LYS B 2 200 ? 4.829   20.067  66.693 1.00 92.54  ? 200 LYS A C     1 
ATOM   2644 O O     . LYS B 2 200 ? 5.099   20.834  67.619 1.00 98.63  ? 200 LYS A O     1 
ATOM   2645 C CB    . LYS B 2 200 ? 6.556   18.327  66.239 1.00 92.83  ? 200 LYS A CB    1 
ATOM   2646 C CG    . LYS B 2 200 ? 6.774   18.834  64.820 1.00 99.56  ? 200 LYS A CG    1 
ATOM   2647 C CD    . LYS B 2 200 ? 8.245   18.786  64.431 1.00 104.63 ? 200 LYS A CD    1 
ATOM   2648 C CE    . LYS B 2 200 ? 8.448   19.133  62.958 1.00 111.98 ? 200 LYS A CE    1 
ATOM   2649 N NZ    . LYS B 2 200 ? 7.850   20.445  62.577 1.00 112.47 ? 200 LYS A NZ    1 
ATOM   2650 N N     . SER B 2 201 ? 4.246   20.463  65.565 1.00 86.59  ? 201 SER A N     1 
ATOM   2651 C CA    . SER B 2 201 ? 3.884   21.855  65.326 1.00 80.82  ? 201 SER A CA    1 
ATOM   2652 C C     . SER B 2 201 ? 2.460   21.975  64.791 1.00 80.14  ? 201 SER A C     1 
ATOM   2653 O O     . SER B 2 201 ? 1.861   20.985  64.374 1.00 80.27  ? 201 SER A O     1 
ATOM   2654 C CB    . SER B 2 201 ? 4.857   22.475  64.327 1.00 71.88  ? 201 SER A CB    1 
ATOM   2655 O OG    . SER B 2 201 ? 4.873   21.729  63.124 1.00 69.68  ? 201 SER A OG    1 
ATOM   2656 N N     . LYS B 2 202 ? 1.922   23.192  64.810 1.00 79.10  ? 202 LYS A N     1 
ATOM   2657 C CA    . LYS B 2 202 ? 0.574   23.445  64.314 1.00 77.69  ? 202 LYS A CA    1 
ATOM   2658 C C     . LYS B 2 202 ? 0.398   22.867  62.918 1.00 83.54  ? 202 LYS A C     1 
ATOM   2659 O O     . LYS B 2 202 ? -0.408  21.960  62.707 1.00 88.65  ? 202 LYS A O     1 
ATOM   2660 C CB    . LYS B 2 202 ? 0.294   24.947  64.248 1.00 69.56  ? 202 LYS A CB    1 
ATOM   2661 C CG    . LYS B 2 202 ? -0.505  25.511  65.409 1.00 67.88  ? 202 LYS A CG    1 
ATOM   2662 C CD    . LYS B 2 202 ? -0.774  26.994  65.185 1.00 62.07  ? 202 LYS A CD    1 
ATOM   2663 C CE    . LYS B 2 202 ? -1.483  27.628  66.364 1.00 68.44  ? 202 LYS A CE    1 
ATOM   2664 N NZ    . LYS B 2 202 ? -1.561  29.108  66.213 1.00 69.17  ? 202 LYS A NZ    1 
ATOM   2665 N N     . LYS B 2 203 ? 1.154   23.402  61.965 1.00 81.38  ? 203 LYS A N     1 
ATOM   2666 C CA    . LYS B 2 203 ? 1.066   22.946  60.588 1.00 81.28  ? 203 LYS A CA    1 
ATOM   2667 C C     . LYS B 2 203 ? 1.192   21.437  60.464 1.00 83.48  ? 203 LYS A C     1 
ATOM   2668 O O     . LYS B 2 203 ? 0.378   20.796  59.799 1.00 88.01  ? 203 LYS A O     1 
ATOM   2669 C CB    . LYS B 2 203 ? 2.123   23.641  59.727 1.00 78.01  ? 203 LYS A CB    1 
ATOM   2670 C CG    . LYS B 2 203 ? 1.849   25.123  59.542 1.00 83.81  ? 203 LYS A CG    1 
ATOM   2671 C CD    . LYS B 2 203 ? 2.712   25.747  58.461 1.00 89.71  ? 203 LYS A CD    1 
ATOM   2672 C CE    . LYS B 2 203 ? 2.322   27.207  58.250 1.00 98.87  ? 203 LYS A CE    1 
ATOM   2673 N NZ    . LYS B 2 203 ? 3.074   27.855  57.138 1.00 103.55 ? 203 LYS A NZ    1 
ATOM   2674 N N     . GLU B 2 204 ? 2.202   20.866  61.110 1.00 83.68  ? 204 GLU A N     1 
ATOM   2675 C CA    . GLU B 2 204 ? 2.404   19.425  61.050 1.00 82.70  ? 204 GLU A CA    1 
ATOM   2676 C C     . GLU B 2 204 ? 1.172   18.679  61.544 1.00 80.24  ? 204 GLU A C     1 
ATOM   2677 O O     . GLU B 2 204 ? 0.850   17.606  61.039 1.00 80.40  ? 204 GLU A O     1 
ATOM   2678 C CB    . GLU B 2 204 ? 3.622   19.027  61.879 1.00 85.32  ? 204 GLU A CB    1 
ATOM   2679 C CG    . GLU B 2 204 ? 3.859   17.530  61.937 1.00 92.86  ? 204 GLU A CG    1 
ATOM   2680 C CD    . GLU B 2 204 ? 5.151   17.177  62.642 1.00 96.48  ? 204 GLU A CD    1 
ATOM   2681 O OE1   . GLU B 2 204 ? 6.225   17.511  62.100 1.00 98.45  ? 204 GLU A OE1   1 
ATOM   2682 O OE2   . GLU B 2 204 ? 5.093   16.572  63.736 1.00 94.86  ? 204 GLU A OE2   1 
ATOM   2683 N N     . ALA B 2 205 ? 0.485   19.252  62.526 1.00 78.79  ? 205 ALA A N     1 
ATOM   2684 C CA    . ALA B 2 205 ? -0.720  18.638  63.078 1.00 79.57  ? 205 ALA A CA    1 
ATOM   2685 C C     . ALA B 2 205 ? -1.870  18.751  62.088 1.00 81.08  ? 205 ALA A C     1 
ATOM   2686 O O     . ALA B 2 205 ? -2.744  17.889  62.033 1.00 81.37  ? 205 ALA A O     1 
ATOM   2687 C CB    . ALA B 2 205 ? -1.099  19.310  64.392 1.00 73.37  ? 205 ALA A CB    1 
ATOM   2688 N N     . GLU B 2 206 ? -1.864  19.825  61.307 1.00 83.85  ? 206 GLU A N     1 
ATOM   2689 C CA    . GLU B 2 206 ? -2.907  20.058  60.322 1.00 84.26  ? 206 GLU A CA    1 
ATOM   2690 C C     . GLU B 2 206 ? -2.746  19.111  59.141 1.00 80.02  ? 206 GLU A C     1 
ATOM   2691 O O     . GLU B 2 206 ? -3.717  18.508  58.693 1.00 83.93  ? 206 GLU A O     1 
ATOM   2692 C CB    . GLU B 2 206 ? -2.863  21.514  59.858 1.00 89.75  ? 206 GLU A CB    1 
ATOM   2693 C CG    . GLU B 2 206 ? -2.959  22.501  61.010 1.00 98.67  ? 206 GLU A CG    1 
ATOM   2694 C CD    . GLU B 2 206 ? -2.902  23.943  60.555 1.00 107.37 ? 206 GLU A CD    1 
ATOM   2695 O OE1   . GLU B 2 206 ? -1.982  24.284  59.782 1.00 112.19 ? 206 GLU A OE1   1 
ATOM   2696 O OE2   . GLU B 2 206 ? -3.770  24.737  60.976 1.00 112.67 ? 206 GLU A OE2   1 
ATOM   2697 N N     . GLN B 2 207 ? -1.522  18.979  58.640 1.00 75.44  ? 207 GLN A N     1 
ATOM   2698 C CA    . GLN B 2 207 ? -1.255  18.078  57.523 1.00 80.22  ? 207 GLN A CA    1 
ATOM   2699 C C     . GLN B 2 207 ? -1.827  16.702  57.855 1.00 86.59  ? 207 GLN A C     1 
ATOM   2700 O O     . GLN B 2 207 ? -2.325  15.991  56.983 1.00 92.38  ? 207 GLN A O     1 
ATOM   2701 C CB    . GLN B 2 207 ? 0.251   17.950  57.294 1.00 76.71  ? 207 GLN A CB    1 
ATOM   2702 C CG    . GLN B 2 207 ? 0.883   19.107  56.557 1.00 82.31  ? 207 GLN A CG    1 
ATOM   2703 C CD    . GLN B 2 207 ? 0.533   19.111  55.086 1.00 83.93  ? 207 GLN A CD    1 
ATOM   2704 O OE1   . GLN B 2 207 ? 0.730   18.117  54.388 1.00 92.18  ? 207 GLN A OE1   1 
ATOM   2705 N NE2   . GLN B 2 207 ? 0.019   20.232  54.604 1.00 78.31  ? 207 GLN A NE2   1 
ATOM   2706 N N     . ARG B 2 208 ? -1.748  16.342  59.131 1.00 89.00  ? 208 ARG A N     1 
ATOM   2707 C CA    . ARG B 2 208 ? -2.238  15.061  59.620 1.00 89.84  ? 208 ARG A CA    1 
ATOM   2708 C C     . ARG B 2 208 ? -3.758  15.008  59.561 1.00 86.80  ? 208 ARG A C     1 
ATOM   2709 O O     . ARG B 2 208 ? -4.332  14.097  58.968 1.00 87.39  ? 208 ARG A O     1 
ATOM   2710 C CB    . ARG B 2 208 ? -1.771  14.852  61.065 1.00 96.70  ? 208 ARG A CB    1 
ATOM   2711 C CG    . ARG B 2 208 ? -2.094  13.491  61.660 1.00 104.22 ? 208 ARG A CG    1 
ATOM   2712 C CD    . ARG B 2 208 ? -1.218  12.402  61.066 1.00 110.19 ? 208 ARG A CD    1 
ATOM   2713 N NE    . ARG B 2 208 ? -1.362  11.142  61.790 1.00 119.99 ? 208 ARG A NE    1 
ATOM   2714 C CZ    . ARG B 2 208 ? -0.643  10.050  61.544 1.00 122.29 ? 208 ARG A CZ    1 
ATOM   2715 N NH1   . ARG B 2 208 ? 0.276   10.057  60.588 1.00 120.13 ? 208 ARG A NH1   1 
ATOM   2716 N NH2   . ARG B 2 208 ? -0.840  8.952   62.262 1.00 120.29 ? 208 ARG A NH2   1 
ATOM   2717 N N     . ALA B 2 209 ? -4.403  15.988  60.188 1.00 86.09  ? 209 ALA A N     1 
ATOM   2718 C CA    . ALA B 2 209 ? -5.859  16.063  60.208 1.00 85.51  ? 209 ALA A CA    1 
ATOM   2719 C C     . ALA B 2 209 ? -6.409  16.150  58.784 1.00 84.68  ? 209 ALA A C     1 
ATOM   2720 O O     . ALA B 2 209 ? -7.539  15.746  58.517 1.00 83.33  ? 209 ALA A O     1 
ATOM   2721 C CB    . ALA B 2 209 ? -6.309  17.273  61.020 1.00 80.72  ? 209 ALA A CB    1 
ATOM   2722 N N     . ALA B 2 210 ? -5.598  16.674  57.873 1.00 81.14  ? 210 ALA A N     1 
ATOM   2723 C CA    . ALA B 2 210 ? -6.002  16.814  56.484 1.00 80.66  ? 210 ALA A CA    1 
ATOM   2724 C C     . ALA B 2 210 ? -5.955  15.470  55.778 1.00 86.95  ? 210 ALA A C     1 
ATOM   2725 O O     . ALA B 2 210 ? -6.906  15.078  55.101 1.00 93.42  ? 210 ALA A O     1 
ATOM   2726 C CB    . ALA B 2 210 ? -5.091  17.808  55.778 1.00 79.84  ? 210 ALA A CB    1 
ATOM   2727 N N     . GLU B 2 211 ? -4.836  14.773  55.933 1.00 87.41  ? 211 GLU A N     1 
ATOM   2728 C CA    . GLU B 2 211 ? -4.653  13.466  55.317 1.00 86.39  ? 211 GLU A CA    1 
ATOM   2729 C C     . GLU B 2 211 ? -5.824  12.559  55.692 1.00 88.00  ? 211 GLU A C     1 
ATOM   2730 O O     . GLU B 2 211 ? -6.338  11.810  54.864 1.00 88.67  ? 211 GLU A O     1 
ATOM   2731 C CB    . GLU B 2 211 ? -3.344  12.850  55.807 1.00 87.39  ? 211 GLU A CB    1 
ATOM   2732 C CG    . GLU B 2 211 ? -3.022  11.495  55.211 1.00 96.35  ? 211 GLU A CG    1 
ATOM   2733 C CD    . GLU B 2 211 ? -1.788  10.877  55.833 1.00 97.86  ? 211 GLU A CD    1 
ATOM   2734 O OE1   . GLU B 2 211 ? -1.810  10.613  57.054 1.00 104.18 ? 211 GLU A OE1   1 
ATOM   2735 O OE2   . GLU B 2 211 ? -0.796  10.658  55.105 1.00 95.85  ? 211 GLU A OE2   1 
ATOM   2736 N N     . GLU B 2 212 ? -6.248  12.647  56.946 1.00 87.83  ? 212 GLU A N     1 
ATOM   2737 C CA    . GLU B 2 212 ? -7.346  11.835  57.448 1.00 94.68  ? 212 GLU A CA    1 
ATOM   2738 C C     . GLU B 2 212 ? -8.692  12.259  56.874 1.00 99.82  ? 212 GLU A C     1 
ATOM   2739 O O     . GLU B 2 212 ? -9.592  11.438  56.698 1.00 103.57 ? 212 GLU A O     1 
ATOM   2740 C CB    . GLU B 2 212 ? -7.394  11.922  58.973 1.00 98.94  ? 212 GLU A CB    1 
ATOM   2741 C CG    . GLU B 2 212 ? -7.563  10.585  59.667 1.00 105.15 ? 212 GLU A CG    1 
ATOM   2742 C CD    . GLU B 2 212 ? -6.511  9.579   59.240 1.00 111.29 ? 212 GLU A CD    1 
ATOM   2743 O OE1   . GLU B 2 212 ? -5.328  9.966   59.124 1.00 118.08 ? 212 GLU A OE1   1 
ATOM   2744 O OE2   . GLU B 2 212 ? -6.863  8.400   59.028 1.00 114.30 ? 212 GLU A OE2   1 
ATOM   2745 N N     . LEU B 2 213 ? -8.828  13.549  56.593 1.00 100.83 ? 213 LEU A N     1 
ATOM   2746 C CA    . LEU B 2 213 ? -10.066 14.084  56.044 1.00 95.43  ? 213 LEU A CA    1 
ATOM   2747 C C     . LEU B 2 213 ? -10.188 13.662  54.585 1.00 94.71  ? 213 LEU A C     1 
ATOM   2748 O O     . LEU B 2 213 ? -11.270 13.299  54.125 1.00 97.46  ? 213 LEU A O     1 
ATOM   2749 C CB    . LEU B 2 213 ? -10.063 15.610  56.161 1.00 93.73  ? 213 LEU A CB    1 
ATOM   2750 C CG    . LEU B 2 213 ? -11.404 16.333  56.059 1.00 95.95  ? 213 LEU A CG    1 
ATOM   2751 C CD1   . LEU B 2 213 ? -12.384 15.759  57.074 1.00 99.78  ? 213 LEU A CD1   1 
ATOM   2752 C CD2   . LEU B 2 213 ? -11.189 17.815  56.308 1.00 95.76  ? 213 LEU A CD2   1 
ATOM   2753 N N     . ILE B 2 214 ? -9.072  13.707  53.863 1.00 90.44  ? 214 ILE A N     1 
ATOM   2754 C CA    . ILE B 2 214 ? -9.059  13.312  52.460 1.00 88.97  ? 214 ILE A CA    1 
ATOM   2755 C C     . ILE B 2 214 ? -9.635  11.908  52.360 1.00 90.39  ? 214 ILE A C     1 
ATOM   2756 O O     . ILE B 2 214 ? -10.544 11.651  51.573 1.00 88.63  ? 214 ILE A O     1 
ATOM   2757 C CB    . ILE B 2 214 ? -7.628  13.300  51.886 1.00 88.63  ? 214 ILE A CB    1 
ATOM   2758 C CG1   . ILE B 2 214 ? -7.043  14.712  51.917 1.00 91.82  ? 214 ILE A CG1   1 
ATOM   2759 C CG2   . ILE B 2 214 ? -7.641  12.759  50.463 1.00 81.49  ? 214 ILE A CG2   1 
ATOM   2760 C CD1   . ILE B 2 214 ? -5.629  14.801  51.385 1.00 96.24  ? 214 ILE A CD1   1 
ATOM   2761 N N     . LYS B 2 215 ? -9.093  11.004  53.169 1.00 93.68  ? 215 LYS A N     1 
ATOM   2762 C CA    . LYS B 2 215 ? -9.556  9.624   53.194 1.00 94.03  ? 215 LYS A CA    1 
ATOM   2763 C C     . LYS B 2 215 ? -11.062 9.604   53.401 1.00 93.01  ? 215 LYS A C     1 
ATOM   2764 O O     . LYS B 2 215 ? -11.788 8.892   52.710 1.00 96.77  ? 215 LYS A O     1 
ATOM   2765 C CB    . LYS B 2 215 ? -8.883  8.852   54.335 1.00 94.84  ? 215 LYS A CB    1 
ATOM   2766 C CG    . LYS B 2 215 ? -7.435  8.469   54.079 1.00 99.14  ? 215 LYS A CG    1 
ATOM   2767 C CD    . LYS B 2 215 ? -6.873  7.657   55.241 1.00 101.57 ? 215 LYS A CD    1 
ATOM   2768 C CE    . LYS B 2 215 ? -5.534  7.023   54.884 1.00 104.01 ? 215 LYS A CE    1 
ATOM   2769 N NZ    . LYS B 2 215 ? -4.526  8.028   54.440 1.00 101.08 ? 215 LYS A NZ    1 
ATOM   2770 N N     . LEU B 2 216 ? -11.521 10.401  54.356 1.00 91.09  ? 216 LEU A N     1 
ATOM   2771 C CA    . LEU B 2 216 ? -12.936 10.479  54.679 1.00 92.68  ? 216 LEU A CA    1 
ATOM   2772 C C     . LEU B 2 216 ? -13.760 10.925  53.476 1.00 94.29  ? 216 LEU A C     1 
ATOM   2773 O O     . LEU B 2 216 ? -14.886 10.470  53.284 1.00 97.02  ? 216 LEU A O     1 
ATOM   2774 C CB    . LEU B 2 216 ? -13.144 11.456  55.838 1.00 92.22  ? 216 LEU A CB    1 
ATOM   2775 C CG    . LEU B 2 216 ? -14.223 11.087  56.856 1.00 93.16  ? 216 LEU A CG    1 
ATOM   2776 C CD1   . LEU B 2 216 ? -15.572 10.950  56.170 1.00 98.79  ? 216 LEU A CD1   1 
ATOM   2777 C CD2   . LEU B 2 216 ? -13.836 9.784   57.535 1.00 95.39  ? 216 LEU A CD2   1 
ATOM   2778 N N     . LEU B 2 217 ? -13.198 11.816  52.668 1.00 94.34  ? 217 LEU A N     1 
ATOM   2779 C CA    . LEU B 2 217 ? -13.898 12.318  51.491 1.00 98.55  ? 217 LEU A CA    1 
ATOM   2780 C C     . LEU B 2 217 ? -13.909 11.303  50.356 1.00 107.32 ? 217 LEU A C     1 
ATOM   2781 O O     . LEU B 2 217 ? -14.703 11.415  49.419 1.00 111.87 ? 217 LEU A O     1 
ATOM   2782 C CB    . LEU B 2 217 ? -13.248 13.612  51.001 1.00 91.51  ? 217 LEU A CB    1 
ATOM   2783 C CG    . LEU B 2 217 ? -13.284 14.812  51.947 1.00 93.26  ? 217 LEU A CG    1 
ATOM   2784 C CD1   . LEU B 2 217 ? -12.531 15.972  51.326 1.00 91.39  ? 217 LEU A CD1   1 
ATOM   2785 C CD2   . LEU B 2 217 ? -14.719 15.201  52.224 1.00 88.33  ? 217 LEU A CD2   1 
ATOM   2786 N N     . GLU B 2 218 ? -13.026 10.315  50.438 1.00 113.58 ? 218 GLU A N     1 
ATOM   2787 C CA    . GLU B 2 218 ? -12.939 9.287   49.409 1.00 116.20 ? 218 GLU A CA    1 
ATOM   2788 C C     . GLU B 2 218 ? -14.042 8.247   49.583 1.00 118.59 ? 218 GLU A C     1 
ATOM   2789 O O     . GLU B 2 218 ? -13.771 7.074   49.840 1.00 116.24 ? 218 GLU A O     1 
ATOM   2790 C CB    . GLU B 2 218 ? -11.568 8.613   49.461 1.00 115.15 ? 218 GLU A CB    1 
ATOM   2791 C CG    . GLU B 2 218 ? -10.406 9.583   49.323 1.00 114.84 ? 218 GLU A CG    1 
ATOM   2792 C CD    . GLU B 2 218 ? -9.061  8.903   49.467 1.00 117.95 ? 218 GLU A CD    1 
ATOM   2793 O OE1   . GLU B 2 218 ? -8.831  8.256   50.512 1.00 115.53 ? 218 GLU A OE1   1 
ATOM   2794 O OE2   . GLU B 2 218 ? -8.232  9.019   48.537 1.00 113.63 ? 218 GLU A OE2   1 
ATOM   2795 N N     . GLU B 2 219 ? -15.287 8.689   49.443 1.00 123.79 ? 219 GLU A N     1 
ATOM   2796 C CA    . GLU B 2 219 ? -16.438 7.805   49.577 1.00 130.20 ? 219 GLU A CA    1 
ATOM   2797 C C     . GLU B 2 219 ? -17.544 8.177   48.595 1.00 134.06 ? 219 GLU A C     1 
ATOM   2798 O O     . GLU B 2 219 ? -17.783 7.461   47.621 1.00 133.22 ? 219 GLU A O     1 
ATOM   2799 C CB    . GLU B 2 219 ? -16.981 7.848   51.008 1.00 130.76 ? 219 GLU A CB    1 
ATOM   2800 C CG    . GLU B 2 219 ? -16.043 7.251   52.044 1.00 137.68 ? 219 GLU A CG    1 
ATOM   2801 C CD    . GLU B 2 219 ? -16.679 7.153   53.418 1.00 144.79 ? 219 GLU A CD    1 
ATOM   2802 O OE1   . GLU B 2 219 ? -17.742 6.506   53.537 1.00 146.55 ? 219 GLU A OE1   1 
ATOM   2803 O OE2   . GLU B 2 219 ? -16.116 7.719   54.380 1.00 147.31 ? 219 GLU A OE2   1 
ATOM   2804 N N     . SER B 2 220 ? -18.216 9.297   48.851 1.00 137.28 ? 220 SER A N     1 
ATOM   2805 C CA    . SER B 2 220 ? -19.298 9.748   47.980 1.00 140.98 ? 220 SER A CA    1 
ATOM   2806 C C     . SER B 2 220 ? -19.714 11.189  48.273 1.00 141.64 ? 220 SER A C     1 
ATOM   2807 O O     . SER B 2 220 ? -19.187 11.828  49.185 1.00 141.49 ? 220 SER A O     1 
ATOM   2808 C CB    . SER B 2 220 ? -20.510 8.821   48.132 1.00 143.04 ? 220 SER A CB    1 
ATOM   2809 O OG    . SER B 2 220 ? -21.562 9.197   47.259 1.00 146.24 ? 220 SER A OG    1 
ATOM   2810 N N     . GLU B 2 221 ? -20.663 11.690  47.486 1.00 141.51 ? 221 GLU A N     1 
ATOM   2811 C CA    . GLU B 2 221 ? -21.175 13.048  47.641 1.00 139.84 ? 221 GLU A CA    1 
ATOM   2812 C C     . GLU B 2 221 ? -22.639 13.025  48.077 1.00 140.29 ? 221 GLU A C     1 
ATOM   2813 O O     . GLU B 2 221 ? -22.932 13.540  49.177 1.00 138.63 ? 221 GLU A O     1 
ATOM   2814 C CB    . GLU B 2 221 ? -21.035 13.815  46.320 1.00 135.46 ? 221 GLU A CB    1 
ATOM   2815 C CG    . GLU B 2 221 ? -21.776 15.151  46.265 1.00 133.78 ? 221 GLU A CG    1 
ATOM   2816 C CD    . GLU B 2 221 ? -21.327 16.133  47.334 1.00 131.11 ? 221 GLU A CD    1 
ATOM   2817 O OE1   . GLU B 2 221 ? -21.546 15.858  48.532 1.00 131.21 ? 221 GLU A OE1   1 
ATOM   2818 O OE2   . GLU B 2 221 ? -20.757 17.184  46.973 1.00 129.51 ? 221 GLU A OE2   1 
ATOM   2819 O OXT   . GLU B 2 221 ? -23.475 12.489  47.316 1.00 139.87 ? 221 GLU A OXT   1 
ATOM   2820 N N     . MET C 2 1   ? 43.493  20.590  49.457 1.00 130.33 ? 1   MET B N     1 
ATOM   2821 C CA    . MET C 2 1   ? 43.716  19.685  48.295 1.00 131.41 ? 1   MET B CA    1 
ATOM   2822 C C     . MET C 2 1   ? 44.528  18.466  48.724 1.00 133.44 ? 1   MET B C     1 
ATOM   2823 O O     . MET C 2 1   ? 44.233  17.340  48.322 1.00 133.95 ? 1   MET B O     1 
ATOM   2824 C CB    . MET C 2 1   ? 44.453  20.434  47.180 1.00 130.42 ? 1   MET B CB    1 
ATOM   2825 C CG    . MET C 2 1   ? 44.397  19.756  45.812 1.00 134.60 ? 1   MET B CG    1 
ATOM   2826 S SD    . MET C 2 1   ? 45.190  18.134  45.730 1.00 138.27 ? 1   MET B SD    1 
ATOM   2827 C CE    . MET C 2 1   ? 46.803  18.569  45.077 1.00 138.81 ? 1   MET B CE    1 
ATOM   2828 N N     . LYS C 2 2   ? 45.551  18.692  49.543 1.00 135.41 ? 2   LYS B N     1 
ATOM   2829 C CA    . LYS C 2 2   ? 46.398  17.604  50.016 1.00 137.20 ? 2   LYS B CA    1 
ATOM   2830 C C     . LYS C 2 2   ? 45.557  16.575  50.767 1.00 138.67 ? 2   LYS B C     1 
ATOM   2831 O O     . LYS C 2 2   ? 45.883  15.386  50.780 1.00 137.46 ? 2   LYS B O     1 
ATOM   2832 C CB    . LYS C 2 2   ? 47.504  18.152  50.925 1.00 137.04 ? 2   LYS B CB    1 
ATOM   2833 C CG    . LYS C 2 2   ? 48.590  17.145  51.284 1.00 136.58 ? 2   LYS B CG    1 
ATOM   2834 C CD    . LYS C 2 2   ? 49.713  17.814  52.067 1.00 136.87 ? 2   LYS B CD    1 
ATOM   2835 C CE    . LYS C 2 2   ? 50.895  16.877  52.281 1.00 138.73 ? 2   LYS B CE    1 
ATOM   2836 N NZ    . LYS C 2 2   ? 50.546  15.693  53.111 1.00 136.58 ? 2   LYS B NZ    1 
ATOM   2837 N N     . MET C 2 3   ? 44.474  17.037  51.387 1.00 140.21 ? 3   MET B N     1 
ATOM   2838 C CA    . MET C 2 3   ? 43.579  16.153  52.128 1.00 141.13 ? 3   MET B CA    1 
ATOM   2839 C C     . MET C 2 3   ? 42.687  15.418  51.131 1.00 140.00 ? 3   MET B C     1 
ATOM   2840 O O     . MET C 2 3   ? 42.527  14.198  51.202 1.00 138.59 ? 3   MET B O     1 
ATOM   2841 C CB    . MET C 2 3   ? 42.695  16.949  53.095 1.00 141.94 ? 3   MET B CB    1 
ATOM   2842 C CG    . MET C 2 3   ? 43.423  17.950  53.978 1.00 145.78 ? 3   MET B CG    1 
ATOM   2843 S SD    . MET C 2 3   ? 43.930  19.440  53.090 1.00 152.12 ? 3   MET B SD    1 
ATOM   2844 C CE    . MET C 2 3   ? 45.701  19.388  53.312 1.00 151.09 ? 3   MET B CE    1 
ATOM   2845 N N     . LEU C 2 4   ? 42.110  16.177  50.203 1.00 137.59 ? 4   LEU B N     1 
ATOM   2846 C CA    . LEU C 2 4   ? 41.233  15.625  49.175 1.00 133.26 ? 4   LEU B CA    1 
ATOM   2847 C C     . LEU C 2 4   ? 42.037  14.749  48.224 1.00 134.20 ? 4   LEU B C     1 
ATOM   2848 O O     . LEU C 2 4   ? 41.574  14.403  47.137 1.00 135.19 ? 4   LEU B O     1 
ATOM   2849 C CB    . LEU C 2 4   ? 40.563  16.752  48.381 1.00 130.08 ? 4   LEU B CB    1 
ATOM   2850 C CG    . LEU C 2 4   ? 39.712  17.783  49.130 1.00 129.25 ? 4   LEU B CG    1 
ATOM   2851 C CD1   . LEU C 2 4   ? 38.647  17.065  49.944 1.00 130.17 ? 4   LEU B CD1   1 
ATOM   2852 C CD2   . LEU C 2 4   ? 40.591  18.639  50.030 1.00 124.72 ? 4   LEU B CD2   1 
ATOM   2853 N N     . GLU C 2 5   ? 43.248  14.400  48.644 1.00 134.80 ? 5   GLU B N     1 
ATOM   2854 C CA    . GLU C 2 5   ? 44.142  13.573  47.849 1.00 134.14 ? 5   GLU B CA    1 
ATOM   2855 C C     . GLU C 2 5   ? 44.431  12.287  48.614 1.00 134.97 ? 5   GLU B C     1 
ATOM   2856 O O     . GLU C 2 5   ? 44.936  11.313  48.053 1.00 134.17 ? 5   GLU B O     1 
ATOM   2857 C CB    . GLU C 2 5   ? 45.437  14.344  47.580 1.00 134.82 ? 5   GLU B CB    1 
ATOM   2858 C CG    . GLU C 2 5   ? 46.361  13.708  46.562 1.00 137.61 ? 5   GLU B CG    1 
ATOM   2859 C CD    . GLU C 2 5   ? 47.507  14.626  46.178 1.00 138.31 ? 5   GLU B CD    1 
ATOM   2860 O OE1   . GLU C 2 5   ? 48.267  15.038  47.080 1.00 135.94 ? 5   GLU B OE1   1 
ATOM   2861 O OE2   . GLU C 2 5   ? 47.645  14.938  44.976 1.00 137.99 ? 5   GLU B OE2   1 
ATOM   2862 N N     . GLN C 2 6   ? 44.103  12.301  49.903 1.00 134.83 ? 6   GLN B N     1 
ATOM   2863 C CA    . GLN C 2 6   ? 44.295  11.142  50.766 1.00 134.09 ? 6   GLN B CA    1 
ATOM   2864 C C     . GLN C 2 6   ? 43.087  10.226  50.596 1.00 133.94 ? 6   GLN B C     1 
ATOM   2865 O O     . GLN C 2 6   ? 43.226  9.013   50.432 1.00 133.09 ? 6   GLN B O     1 
ATOM   2866 C CB    . GLN C 2 6   ? 44.402  11.580  52.230 1.00 135.88 ? 6   GLN B CB    1 
ATOM   2867 C CG    . GLN C 2 6   ? 45.589  12.480  52.533 1.00 136.63 ? 6   GLN B CG    1 
ATOM   2868 C CD    . GLN C 2 6   ? 45.635  12.910  53.988 1.00 136.40 ? 6   GLN B CD    1 
ATOM   2869 O OE1   . GLN C 2 6   ? 44.755  13.629  54.464 1.00 133.78 ? 6   GLN B OE1   1 
ATOM   2870 N NE2   . GLN C 2 6   ? 46.663  12.466  54.704 1.00 133.36 ? 6   GLN B NE2   1 
ATOM   2871 N N     . LEU C 2 7   ? 41.901  10.828  50.633 1.00 131.84 ? 7   LEU B N     1 
ATOM   2872 C CA    . LEU C 2 7   ? 40.651  10.096  50.485 1.00 128.30 ? 7   LEU B CA    1 
ATOM   2873 C C     . LEU C 2 7   ? 40.614  9.334   49.164 1.00 129.78 ? 7   LEU B C     1 
ATOM   2874 O O     . LEU C 2 7   ? 40.064  8.236   49.086 1.00 129.76 ? 7   LEU B O     1 
ATOM   2875 C CB    . LEU C 2 7   ? 39.467  11.064  50.559 1.00 126.85 ? 7   LEU B CB    1 
ATOM   2876 C CG    . LEU C 2 7   ? 38.069  10.472  50.361 1.00 127.78 ? 7   LEU B CG    1 
ATOM   2877 C CD1   . LEU C 2 7   ? 37.835  9.342   51.352 1.00 126.83 ? 7   LEU B CD1   1 
ATOM   2878 C CD2   . LEU C 2 7   ? 37.028  11.566  50.537 1.00 125.94 ? 7   LEU B CD2   1 
ATOM   2879 N N     . GLU C 2 8   ? 41.201  9.926   48.128 1.00 130.68 ? 8   GLU B N     1 
ATOM   2880 C CA    . GLU C 2 8   ? 41.243  9.301   46.810 1.00 130.54 ? 8   GLU B CA    1 
ATOM   2881 C C     . GLU C 2 8   ? 42.010  7.984   46.895 1.00 129.64 ? 8   GLU B C     1 
ATOM   2882 O O     . GLU C 2 8   ? 41.622  6.981   46.295 1.00 126.82 ? 8   GLU B O     1 
ATOM   2883 C CB    . GLU C 2 8   ? 41.936  10.225  45.804 1.00 134.50 ? 8   GLU B CB    1 
ATOM   2884 C CG    . GLU C 2 8   ? 41.285  11.591  45.643 1.00 141.30 ? 8   GLU B CG    1 
ATOM   2885 C CD    . GLU C 2 8   ? 42.043  12.488  44.680 1.00 147.06 ? 8   GLU B CD    1 
ATOM   2886 O OE1   . GLU C 2 8   ? 43.236  12.761  44.933 1.00 148.53 ? 8   GLU B OE1   1 
ATOM   2887 O OE2   . GLU C 2 8   ? 41.448  12.922  43.670 1.00 147.97 ? 8   GLU B OE2   1 
ATOM   2888 N N     . LYS C 2 9   ? 43.103  8.005   47.650 1.00 129.42 ? 9   LYS B N     1 
ATOM   2889 C CA    . LYS C 2 9   ? 43.949  6.832   47.830 1.00 126.90 ? 9   LYS B CA    1 
ATOM   2890 C C     . LYS C 2 9   ? 43.173  5.732   48.549 1.00 124.53 ? 9   LYS B C     1 
ATOM   2891 O O     . LYS C 2 9   ? 43.265  4.556   48.193 1.00 121.41 ? 9   LYS B O     1 
ATOM   2892 C CB    . LYS C 2 9   ? 45.188  7.211   48.649 1.00 127.78 ? 9   LYS B CB    1 
ATOM   2893 C CG    . LYS C 2 9   ? 46.488  6.579   48.172 1.00 130.29 ? 9   LYS B CG    1 
ATOM   2894 C CD    . LYS C 2 9   ? 46.451  5.060   48.224 1.00 133.39 ? 9   LYS B CD    1 
ATOM   2895 C CE    . LYS C 2 9   ? 47.760  4.470   47.715 1.00 135.17 ? 9   LYS B CE    1 
ATOM   2896 N NZ    . LYS C 2 9   ? 47.767  2.982   47.742 1.00 136.15 ? 9   LYS B NZ    1 
ATOM   2897 N N     . LYS C 2 10  ? 42.408  6.130   49.561 1.00 124.74 ? 10  LYS B N     1 
ATOM   2898 C CA    . LYS C 2 10  ? 41.611  5.199   50.356 1.00 124.55 ? 10  LYS B CA    1 
ATOM   2899 C C     . LYS C 2 10  ? 40.458  4.640   49.534 1.00 124.48 ? 10  LYS B C     1 
ATOM   2900 O O     . LYS C 2 10  ? 40.115  3.462   49.639 1.00 121.66 ? 10  LYS B O     1 
ATOM   2901 C CB    . LYS C 2 10  ? 41.049  5.915   51.588 1.00 124.43 ? 10  LYS B CB    1 
ATOM   2902 C CG    . LYS C 2 10  ? 42.045  6.831   52.288 1.00 126.93 ? 10  LYS B CG    1 
ATOM   2903 C CD    . LYS C 2 10  ? 41.423  7.554   53.479 1.00 127.66 ? 10  LYS B CD    1 
ATOM   2904 C CE    . LYS C 2 10  ? 41.271  6.642   54.691 1.00 128.26 ? 10  LYS B CE    1 
ATOM   2905 N NZ    . LYS C 2 10  ? 40.402  5.462   54.433 1.00 129.15 ? 10  LYS B NZ    1 
ATOM   2906 N N     . LEU C 2 11  ? 39.867  5.505   48.717 1.00 125.12 ? 11  LEU B N     1 
ATOM   2907 C CA    . LEU C 2 11  ? 38.739  5.145   47.868 1.00 122.79 ? 11  LEU B CA    1 
ATOM   2908 C C     . LEU C 2 11  ? 39.155  4.200   46.744 1.00 119.95 ? 11  LEU B C     1 
ATOM   2909 O O     . LEU C 2 11  ? 38.485  3.202   46.477 1.00 118.52 ? 11  LEU B O     1 
ATOM   2910 C CB    . LEU C 2 11  ? 38.122  6.418   47.280 1.00 124.04 ? 11  LEU B CB    1 
ATOM   2911 C CG    . LEU C 2 11  ? 36.763  6.316   46.587 1.00 124.59 ? 11  LEU B CG    1 
ATOM   2912 C CD1   . LEU C 2 11  ? 35.722  5.807   47.575 1.00 123.53 ? 11  LEU B CD1   1 
ATOM   2913 C CD2   . LEU C 2 11  ? 36.364  7.684   46.048 1.00 121.32 ? 11  LEU B CD2   1 
ATOM   2914 N N     . GLY C 2 12  ? 40.269  4.515   46.092 1.00 118.45 ? 12  GLY B N     1 
ATOM   2915 C CA    . GLY C 2 12  ? 40.740  3.687   44.999 1.00 118.07 ? 12  GLY B CA    1 
ATOM   2916 C C     . GLY C 2 12  ? 40.301  4.275   43.673 1.00 119.61 ? 12  GLY B C     1 
ATOM   2917 O O     . GLY C 2 12  ? 40.132  3.559   42.685 1.00 115.90 ? 12  GLY B O     1 
ATOM   2918 N N     . TYR C 2 13  ? 40.110  5.591   43.659 1.00 121.22 ? 13  TYR B N     1 
ATOM   2919 C CA    . TYR C 2 13  ? 39.688  6.301   42.459 1.00 123.45 ? 13  TYR B CA    1 
ATOM   2920 C C     . TYR C 2 13  ? 40.287  7.702   42.412 1.00 125.46 ? 13  TYR B C     1 
ATOM   2921 O O     . TYR C 2 13  ? 40.227  8.448   43.390 1.00 122.16 ? 13  TYR B O     1 
ATOM   2922 C CB    . TYR C 2 13  ? 38.162  6.406   42.410 1.00 124.40 ? 13  TYR B CB    1 
ATOM   2923 C CG    . TYR C 2 13  ? 37.645  7.191   41.223 1.00 126.50 ? 13  TYR B CG    1 
ATOM   2924 C CD1   . TYR C 2 13  ? 37.772  6.697   39.924 1.00 127.04 ? 13  TYR B CD1   1 
ATOM   2925 C CD2   . TYR C 2 13  ? 37.039  8.434   41.397 1.00 126.82 ? 13  TYR B CD2   1 
ATOM   2926 C CE1   . TYR C 2 13  ? 37.309  7.423   38.828 1.00 129.88 ? 13  TYR B CE1   1 
ATOM   2927 C CE2   . TYR C 2 13  ? 36.573  9.168   40.308 1.00 128.45 ? 13  TYR B CE2   1 
ATOM   2928 C CZ    . TYR C 2 13  ? 36.711  8.657   39.028 1.00 129.71 ? 13  TYR B CZ    1 
ATOM   2929 O OH    . TYR C 2 13  ? 36.253  9.381   37.950 1.00 130.46 ? 13  TYR B OH    1 
ATOM   2930 N N     . THR C 2 14  ? 40.860  8.055   41.266 1.00 128.27 ? 14  THR B N     1 
ATOM   2931 C CA    . THR C 2 14  ? 41.467  9.368   41.086 1.00 130.28 ? 14  THR B CA    1 
ATOM   2932 C C     . THR C 2 14  ? 40.459  10.324  40.447 1.00 133.50 ? 14  THR B C     1 
ATOM   2933 O O     . THR C 2 14  ? 40.052  10.134  39.299 1.00 132.87 ? 14  THR B O     1 
ATOM   2934 C CB    . THR C 2 14  ? 42.718  9.281   40.186 1.00 132.15 ? 14  THR B CB    1 
ATOM   2935 O OG1   . THR C 2 14  ? 43.639  8.331   40.737 1.00 123.92 ? 14  THR B OG1   1 
ATOM   2936 C CG2   . THR C 2 14  ? 43.400  10.640  40.086 1.00 129.84 ? 14  THR B CG2   1 
ATOM   2937 N N     . PHE C 2 15  ? 40.059  11.347  41.198 1.00 133.90 ? 15  PHE B N     1 
ATOM   2938 C CA    . PHE C 2 15  ? 39.097  12.332  40.710 1.00 132.43 ? 15  PHE B CA    1 
ATOM   2939 C C     . PHE C 2 15  ? 39.661  13.235  39.620 1.00 132.30 ? 15  PHE B C     1 
ATOM   2940 O O     . PHE C 2 15  ? 40.584  14.014  39.857 1.00 132.38 ? 15  PHE B O     1 
ATOM   2941 C CB    . PHE C 2 15  ? 38.582  13.197  41.864 1.00 134.34 ? 15  PHE B CB    1 
ATOM   2942 C CG    . PHE C 2 15  ? 37.337  12.662  42.513 1.00 135.53 ? 15  PHE B CG    1 
ATOM   2943 C CD1   . PHE C 2 15  ? 37.332  11.409  43.118 1.00 135.13 ? 15  PHE B CD1   1 
ATOM   2944 C CD2   . PHE C 2 15  ? 36.164  13.412  42.514 1.00 136.10 ? 15  PHE B CD2   1 
ATOM   2945 C CE1   . PHE C 2 15  ? 36.175  10.910  43.713 1.00 136.27 ? 15  PHE B CE1   1 
ATOM   2946 C CE2   . PHE C 2 15  ? 35.003  12.923  43.105 1.00 135.82 ? 15  PHE B CE2   1 
ATOM   2947 C CZ    . PHE C 2 15  ? 35.008  11.669  43.707 1.00 135.90 ? 15  PHE B CZ    1 
ATOM   2948 N N     . LYS C 2 16  ? 39.088  13.126  38.426 1.00 131.76 ? 16  LYS B N     1 
ATOM   2949 C CA    . LYS C 2 16  ? 39.515  13.928  37.287 1.00 130.85 ? 16  LYS B CA    1 
ATOM   2950 C C     . LYS C 2 16  ? 38.929  15.332  37.395 1.00 133.47 ? 16  LYS B C     1 
ATOM   2951 O O     . LYS C 2 16  ? 39.152  16.180  36.530 1.00 134.19 ? 16  LYS B O     1 
ATOM   2952 C CB    . LYS C 2 16  ? 39.054  13.265  35.985 1.00 132.72 ? 16  LYS B CB    1 
ATOM   2953 C CG    . LYS C 2 16  ? 39.514  11.820  35.842 1.00 137.92 ? 16  LYS B CG    1 
ATOM   2954 C CD    . LYS C 2 16  ? 38.989  11.174  34.569 1.00 136.84 ? 16  LYS B CD    1 
ATOM   2955 C CE    . LYS C 2 16  ? 39.475  9.735   34.449 1.00 134.37 ? 16  LYS B CE    1 
ATOM   2956 N NZ    . LYS C 2 16  ? 39.000  9.077   33.201 1.00 132.10 ? 16  LYS B NZ    1 
ATOM   2957 N N     . ASP C 2 17  ? 38.176  15.562  38.467 1.00 133.00 ? 17  ASP B N     1 
ATOM   2958 C CA    . ASP C 2 17  ? 37.553  16.856  38.721 1.00 130.99 ? 17  ASP B CA    1 
ATOM   2959 C C     . ASP C 2 17  ? 37.318  17.020  40.217 1.00 131.93 ? 17  ASP B C     1 
ATOM   2960 O O     . ASP C 2 17  ? 36.185  16.935  40.691 1.00 133.26 ? 17  ASP B O     1 
ATOM   2961 C CB    . ASP C 2 17  ? 36.225  16.968  37.974 1.00 131.63 ? 17  ASP B CB    1 
ATOM   2962 C CG    . ASP C 2 17  ? 35.536  18.294  38.218 1.00 133.64 ? 17  ASP B CG    1 
ATOM   2963 O OD1   . ASP C 2 17  ? 36.145  19.343  37.917 1.00 133.47 ? 17  ASP B OD1   1 
ATOM   2964 O OD2   . ASP C 2 17  ? 34.390  18.289  38.713 1.00 134.47 ? 17  ASP B OD2   1 
ATOM   2965 N N     . LYS C 2 18  ? 38.398  17.258  40.952 1.00 130.89 ? 18  LYS B N     1 
ATOM   2966 C CA    . LYS C 2 18  ? 38.331  17.421  42.399 1.00 127.58 ? 18  LYS B CA    1 
ATOM   2967 C C     . LYS C 2 18  ? 37.259  18.395  42.878 1.00 127.35 ? 18  LYS B C     1 
ATOM   2968 O O     . LYS C 2 18  ? 36.899  18.391  44.053 1.00 125.86 ? 18  LYS B O     1 
ATOM   2969 C CB    . LYS C 2 18  ? 39.699  17.841  42.942 1.00 128.69 ? 18  LYS B CB    1 
ATOM   2970 C CG    . LYS C 2 18  ? 40.749  16.746  42.842 1.00 128.64 ? 18  LYS B CG    1 
ATOM   2971 C CD    . LYS C 2 18  ? 42.079  17.187  43.425 1.00 129.00 ? 18  LYS B CD    1 
ATOM   2972 C CE    . LYS C 2 18  ? 43.083  16.044  43.417 1.00 129.14 ? 18  LYS B CE    1 
ATOM   2973 N NZ    . LYS C 2 18  ? 43.306  15.501  42.049 1.00 125.00 ? 18  LYS B NZ    1 
ATOM   2974 N N     . SER C 2 19  ? 36.744  19.220  41.972 1.00 127.13 ? 19  SER B N     1 
ATOM   2975 C CA    . SER C 2 19  ? 35.710  20.186  42.332 1.00 127.41 ? 19  SER B CA    1 
ATOM   2976 C C     . SER C 2 19  ? 34.478  19.475  42.888 1.00 127.98 ? 19  SER B C     1 
ATOM   2977 O O     . SER C 2 19  ? 33.753  20.026  43.719 1.00 126.59 ? 19  SER B O     1 
ATOM   2978 C CB    . SER C 2 19  ? 35.318  21.023  41.112 1.00 129.31 ? 19  SER B CB    1 
ATOM   2979 O OG    . SER C 2 19  ? 34.362  22.010  41.459 1.00 132.72 ? 19  SER B OG    1 
ATOM   2980 N N     . LEU C 2 20  ? 34.247  18.249  42.424 1.00 125.84 ? 20  LEU B N     1 
ATOM   2981 C CA    . LEU C 2 20  ? 33.109  17.453  42.874 1.00 120.30 ? 20  LEU B CA    1 
ATOM   2982 C C     . LEU C 2 20  ? 33.342  16.945  44.291 1.00 119.47 ? 20  LEU B C     1 
ATOM   2983 O O     . LEU C 2 20  ? 32.569  17.245  45.201 1.00 119.23 ? 20  LEU B O     1 
ATOM   2984 C CB    . LEU C 2 20  ? 32.892  16.256  41.944 1.00 120.23 ? 20  LEU B CB    1 
ATOM   2985 C CG    . LEU C 2 20  ? 32.623  16.537  40.465 1.00 118.85 ? 20  LEU B CG    1 
ATOM   2986 C CD1   . LEU C 2 20  ? 32.474  15.219  39.722 1.00 115.34 ? 20  LEU B CD1   1 
ATOM   2987 C CD2   . LEU C 2 20  ? 31.367  17.381  40.317 1.00 120.01 ? 20  LEU B CD2   1 
ATOM   2988 N N     . LEU C 2 21  ? 34.413  16.173  44.464 1.00 116.83 ? 21  LEU B N     1 
ATOM   2989 C CA    . LEU C 2 21  ? 34.769  15.613  45.765 1.00 114.38 ? 21  LEU B CA    1 
ATOM   2990 C C     . LEU C 2 21  ? 34.690  16.678  46.853 1.00 114.22 ? 21  LEU B C     1 
ATOM   2991 O O     . LEU C 2 21  ? 34.327  16.392  47.994 1.00 109.19 ? 21  LEU B O     1 
ATOM   2992 C CB    . LEU C 2 21  ? 36.184  15.026  45.711 1.00 113.57 ? 21  LEU B CB    1 
ATOM   2993 C CG    . LEU C 2 21  ? 36.724  14.354  46.978 1.00 112.02 ? 21  LEU B CG    1 
ATOM   2994 C CD1   . LEU C 2 21  ? 35.803  13.219  47.391 1.00 110.99 ? 21  LEU B CD1   1 
ATOM   2995 C CD2   . LEU C 2 21  ? 38.128  13.830  46.723 1.00 110.82 ? 21  LEU B CD2   1 
ATOM   2996 N N     . GLU C 2 22  ? 35.030  17.909  46.485 1.00 117.08 ? 22  GLU B N     1 
ATOM   2997 C CA    . GLU C 2 22  ? 34.993  19.028  47.417 1.00 120.47 ? 22  GLU B CA    1 
ATOM   2998 C C     . GLU C 2 22  ? 33.569  19.249  47.911 1.00 118.72 ? 22  GLU B C     1 
ATOM   2999 O O     . GLU C 2 22  ? 33.298  19.201  49.112 1.00 117.04 ? 22  GLU B O     1 
ATOM   3000 C CB    . GLU C 2 22  ? 35.486  20.305  46.732 1.00 128.40 ? 22  GLU B CB    1 
ATOM   3001 C CG    . GLU C 2 22  ? 36.906  20.228  46.201 1.00 141.28 ? 22  GLU B CG    1 
ATOM   3002 C CD    . GLU C 2 22  ? 37.305  21.472  45.429 1.00 147.80 ? 22  GLU B CD    1 
ATOM   3003 O OE1   . GLU C 2 22  ? 37.327  22.567  46.032 1.00 152.12 ? 22  GLU B OE1   1 
ATOM   3004 O OE2   . GLU C 2 22  ? 37.593  21.355  44.219 1.00 147.26 ? 22  GLU B OE2   1 
ATOM   3005 N N     . LYS C 2 23  ? 32.664  19.488  46.967 1.00 116.04 ? 23  LYS B N     1 
ATOM   3006 C CA    . LYS C 2 23  ? 31.261  19.738  47.274 1.00 112.96 ? 23  LYS B CA    1 
ATOM   3007 C C     . LYS C 2 23  ? 30.612  18.542  47.964 1.00 112.64 ? 23  LYS B C     1 
ATOM   3008 O O     . LYS C 2 23  ? 29.649  18.694  48.718 1.00 109.78 ? 23  LYS B O     1 
ATOM   3009 C CB    . LYS C 2 23  ? 30.508  20.079  45.985 1.00 114.51 ? 23  LYS B CB    1 
ATOM   3010 C CG    . LYS C 2 23  ? 29.197  20.811  46.204 1.00 116.30 ? 23  LYS B CG    1 
ATOM   3011 C CD    . LYS C 2 23  ? 28.708  21.451  44.915 1.00 116.25 ? 23  LYS B CD    1 
ATOM   3012 C CE    . LYS C 2 23  ? 27.485  22.318  45.160 1.00 118.14 ? 23  LYS B CE    1 
ATOM   3013 N NZ    . LYS C 2 23  ? 27.072  23.055  43.933 1.00 119.61 ? 23  LYS B NZ    1 
ATOM   3014 N N     . ALA C 2 24  ? 31.153  17.355  47.712 1.00 113.39 ? 24  ALA B N     1 
ATOM   3015 C CA    . ALA C 2 24  ? 30.633  16.129  48.306 1.00 109.79 ? 24  ALA B CA    1 
ATOM   3016 C C     . ALA C 2 24  ? 31.092  15.977  49.755 1.00 111.82 ? 24  ALA B C     1 
ATOM   3017 O O     . ALA C 2 24  ? 30.864  14.941  50.380 1.00 114.11 ? 24  ALA B O     1 
ATOM   3018 C CB    . ALA C 2 24  ? 31.084  14.922  47.487 1.00 108.58 ? 24  ALA B CB    1 
ATOM   3019 N N     . LEU C 2 25  ? 31.743  17.011  50.282 1.00 110.92 ? 25  LEU B N     1 
ATOM   3020 C CA    . LEU C 2 25  ? 32.231  16.996  51.660 1.00 104.42 ? 25  LEU B CA    1 
ATOM   3021 C C     . LEU C 2 25  ? 31.897  18.304  52.372 1.00 104.55 ? 25  LEU B C     1 
ATOM   3022 O O     . LEU C 2 25  ? 31.966  18.391  53.600 1.00 100.39 ? 25  LEU B O     1 
ATOM   3023 C CB    . LEU C 2 25  ? 33.748  16.776  51.692 1.00 102.69 ? 25  LEU B CB    1 
ATOM   3024 C CG    . LEU C 2 25  ? 34.295  15.422  51.230 1.00 98.37  ? 25  LEU B CG    1 
ATOM   3025 C CD1   . LEU C 2 25  ? 35.816  15.451  51.258 1.00 95.79  ? 25  LEU B CD1   1 
ATOM   3026 C CD2   . LEU C 2 25  ? 33.768  14.318  52.130 1.00 95.84  ? 25  LEU B CD2   1 
ATOM   3027 N N     . THR C 2 26  ? 31.538  19.318  51.593 1.00 103.90 ? 26  THR B N     1 
ATOM   3028 C CA    . THR C 2 26  ? 31.195  20.624  52.141 1.00 103.66 ? 26  THR B CA    1 
ATOM   3029 C C     . THR C 2 26  ? 29.758  20.635  52.655 1.00 105.59 ? 26  THR B C     1 
ATOM   3030 O O     . THR C 2 26  ? 28.826  20.302  51.921 1.00 105.66 ? 26  THR B O     1 
ATOM   3031 C CB    . THR C 2 26  ? 31.336  21.729  51.077 1.00 110.72 ? 26  THR B CB    1 
ATOM   3032 O OG1   . THR C 2 26  ? 30.400  21.492  50.018 1.00 116.06 ? 26  THR B OG1   1 
ATOM   3033 C CG2   . THR C 2 26  ? 32.748  21.743  50.503 1.00 108.14 ? 26  THR B CG2   1 
ATOM   3034 N N     . HIS C 2 27  ? 29.587  21.021  53.916 1.00 105.58 ? 27  HIS B N     1 
ATOM   3035 C CA    . HIS C 2 27  ? 28.266  21.084  54.534 1.00 104.63 ? 27  HIS B CA    1 
ATOM   3036 C C     . HIS C 2 27  ? 27.553  22.355  54.065 1.00 108.73 ? 27  HIS B C     1 
ATOM   3037 O O     . HIS C 2 27  ? 28.048  23.058  53.185 1.00 112.11 ? 27  HIS B O     1 
ATOM   3038 C CB    . HIS C 2 27  ? 28.404  21.097  56.060 1.00 106.88 ? 27  HIS B CB    1 
ATOM   3039 C CG    . HIS C 2 27  ? 27.128  20.809  56.789 1.00 115.27 ? 27  HIS B CG    1 
ATOM   3040 N ND1   . HIS C 2 27  ? 27.009  20.940  58.156 1.00 121.19 ? 27  HIS B ND1   1 
ATOM   3041 C CD2   . HIS C 2 27  ? 25.921  20.383  56.346 1.00 119.41 ? 27  HIS B CD2   1 
ATOM   3042 C CE1   . HIS C 2 27  ? 25.784  20.608  58.523 1.00 122.24 ? 27  HIS B CE1   1 
ATOM   3043 N NE2   . HIS C 2 27  ? 25.104  20.265  57.444 1.00 118.83 ? 27  HIS B NE2   1 
ATOM   3044 N N     . VAL C 2 28  ? 26.396  22.649  54.649 1.00 108.44 ? 28  VAL B N     1 
ATOM   3045 C CA    . VAL C 2 28  ? 25.638  23.837  54.274 1.00 111.19 ? 28  VAL B CA    1 
ATOM   3046 C C     . VAL C 2 28  ? 26.208  25.087  54.936 1.00 116.93 ? 28  VAL B C     1 
ATOM   3047 O O     . VAL C 2 28  ? 26.452  26.095  54.272 1.00 118.06 ? 28  VAL B O     1 
ATOM   3048 C CB    . VAL C 2 28  ? 24.146  23.702  54.661 1.00 109.83 ? 28  VAL B CB    1 
ATOM   3049 C CG1   . VAL C 2 28  ? 24.010  23.475  56.161 1.00 100.81 ? 28  VAL B CG1   1 
ATOM   3050 C CG2   . VAL C 2 28  ? 23.383  24.951  54.233 1.00 102.51 ? 28  VAL B CG2   1 
ATOM   3051 N N     . SER C 2 29  ? 26.413  25.014  56.248 1.00 120.63 ? 29  SER B N     1 
ATOM   3052 C CA    . SER C 2 29  ? 26.962  26.133  57.003 1.00 119.38 ? 29  SER B CA    1 
ATOM   3053 C C     . SER C 2 29  ? 28.297  26.528  56.386 1.00 120.34 ? 29  SER B C     1 
ATOM   3054 O O     . SER C 2 29  ? 28.513  27.685  56.028 1.00 122.09 ? 29  SER B O     1 
ATOM   3055 C CB    . SER C 2 29  ? 27.174  25.730  58.464 1.00 117.99 ? 29  SER B CB    1 
ATOM   3056 O OG    . SER C 2 29  ? 28.083  24.645  58.563 1.00 110.27 ? 29  SER B OG    1 
ATOM   3057 N N     . TYR C 2 30  ? 29.185  25.547  56.260 1.00 119.99 ? 30  TYR B N     1 
ATOM   3058 C CA    . TYR C 2 30  ? 30.507  25.762  55.690 1.00 121.51 ? 30  TYR B CA    1 
ATOM   3059 C C     . TYR C 2 30  ? 30.445  26.655  54.457 1.00 120.44 ? 30  TYR B C     1 
ATOM   3060 O O     . TYR C 2 30  ? 31.184  27.634  54.357 1.00 120.65 ? 30  TYR B O     1 
ATOM   3061 C CB    . TYR C 2 30  ? 31.139  24.418  55.321 1.00 129.60 ? 30  TYR B CB    1 
ATOM   3062 C CG    . TYR C 2 30  ? 32.514  24.523  54.698 1.00 138.45 ? 30  TYR B CG    1 
ATOM   3063 C CD1   . TYR C 2 30  ? 33.595  25.030  55.420 1.00 140.10 ? 30  TYR B CD1   1 
ATOM   3064 C CD2   . TYR C 2 30  ? 32.738  24.100  53.388 1.00 143.25 ? 30  TYR B CD2   1 
ATOM   3065 C CE1   . TYR C 2 30  ? 34.865  25.112  54.853 1.00 144.58 ? 30  TYR B CE1   1 
ATOM   3066 C CE2   . TYR C 2 30  ? 34.003  24.178  52.811 1.00 146.36 ? 30  TYR B CE2   1 
ATOM   3067 C CZ    . TYR C 2 30  ? 35.061  24.683  53.549 1.00 148.18 ? 30  TYR B CZ    1 
ATOM   3068 O OH    . TYR C 2 30  ? 36.314  24.750  52.982 1.00 150.37 ? 30  TYR B OH    1 
ATOM   3069 N N     . SER C 2 31  ? 29.561  26.318  53.522 1.00 121.22 ? 31  SER B N     1 
ATOM   3070 C CA    . SER C 2 31  ? 29.415  27.096  52.296 1.00 119.36 ? 31  SER B CA    1 
ATOM   3071 C C     . SER C 2 31  ? 28.022  26.982  51.691 1.00 119.73 ? 31  SER B C     1 
ATOM   3072 O O     . SER C 2 31  ? 27.708  25.996  51.026 1.00 118.44 ? 31  SER B O     1 
ATOM   3073 C CB    . SER C 2 31  ? 30.447  26.648  51.259 1.00 117.67 ? 31  SER B CB    1 
ATOM   3074 O OG    . SER C 2 31  ? 31.767  26.866  51.722 1.00 124.21 ? 31  SER B OG    1 
ATOM   3075 N N     . LYS C 2 32  ? 27.190  27.993  51.923 1.00 121.88 ? 32  LYS B N     1 
ATOM   3076 C CA    . LYS C 2 32  ? 25.834  28.001  51.383 1.00 121.37 ? 32  LYS B CA    1 
ATOM   3077 C C     . LYS C 2 32  ? 25.896  27.988  49.861 1.00 122.24 ? 32  LYS B C     1 
ATOM   3078 O O     . LYS C 2 32  ? 25.064  27.367  49.198 1.00 122.35 ? 32  LYS B O     1 
ATOM   3079 C CB    . LYS C 2 32  ? 25.076  29.252  51.840 1.00 119.38 ? 32  LYS B CB    1 
ATOM   3080 C CG    . LYS C 2 32  ? 23.723  29.430  51.155 1.00 116.63 ? 32  LYS B CG    1 
ATOM   3081 C CD    . LYS C 2 32  ? 23.069  30.754  51.522 1.00 114.48 ? 32  LYS B CD    1 
ATOM   3082 C CE    . LYS C 2 32  ? 21.746  30.937  50.789 1.00 110.45 ? 32  LYS B CE    1 
ATOM   3083 N NZ    . LYS C 2 32  ? 21.089  32.233  51.121 1.00 99.04  ? 32  LYS B NZ    1 
ATOM   3084 N N     . LYS C 2 33  ? 26.890  28.681  49.318 1.00 120.85 ? 33  LYS B N     1 
ATOM   3085 C CA    . LYS C 2 33  ? 27.070  28.765  47.877 1.00 121.86 ? 33  LYS B CA    1 
ATOM   3086 C C     . LYS C 2 33  ? 27.153  27.398  47.201 1.00 124.42 ? 33  LYS B C     1 
ATOM   3087 O O     . LYS C 2 33  ? 26.524  27.177  46.165 1.00 125.58 ? 33  LYS B O     1 
ATOM   3088 C CB    . LYS C 2 33  ? 28.320  29.594  47.559 1.00 121.94 ? 33  LYS B CB    1 
ATOM   3089 C CG    . LYS C 2 33  ? 29.557  29.177  48.335 1.00 121.26 ? 33  LYS B CG    1 
ATOM   3090 C CD    . LYS C 2 33  ? 30.709  30.137  48.093 1.00 118.58 ? 33  LYS B CD    1 
ATOM   3091 C CE    . LYS C 2 33  ? 31.915  29.765  48.941 1.00 122.14 ? 33  LYS B CE    1 
ATOM   3092 N NZ    . LYS C 2 33  ? 33.021  30.751  48.798 1.00 121.57 ? 33  LYS B NZ    1 
ATOM   3093 N N     . GLU C 2 34  ? 27.924  26.484  47.784 1.00 125.63 ? 34  GLU B N     1 
ATOM   3094 C CA    . GLU C 2 34  ? 28.070  25.143  47.225 1.00 126.42 ? 34  GLU B CA    1 
ATOM   3095 C C     . GLU C 2 34  ? 28.187  24.065  48.300 1.00 129.37 ? 34  GLU B C     1 
ATOM   3096 O O     . GLU C 2 34  ? 29.232  23.923  48.935 1.00 133.53 ? 34  GLU B O     1 
ATOM   3097 C CB    . GLU C 2 34  ? 29.292  25.078  46.305 1.00 125.98 ? 34  GLU B CB    1 
ATOM   3098 C CG    . GLU C 2 34  ? 29.156  25.895  45.031 1.00 131.32 ? 34  GLU B CG    1 
ATOM   3099 C CD    . GLU C 2 34  ? 30.282  25.631  44.049 1.00 137.41 ? 34  GLU B CD    1 
ATOM   3100 O OE1   . GLU C 2 34  ? 30.443  24.466  43.626 1.00 138.29 ? 34  GLU B OE1   1 
ATOM   3101 O OE2   . GLU C 2 34  ? 31.006  26.587  43.698 1.00 138.26 ? 34  GLU B OE2   1 
ATOM   3102 N N     . HIS C 2 35  ? 27.108  23.309  48.497 1.00 128.14 ? 35  HIS B N     1 
ATOM   3103 C CA    . HIS C 2 35  ? 27.090  22.235  49.487 1.00 121.75 ? 35  HIS B CA    1 
ATOM   3104 C C     . HIS C 2 35  ? 26.767  20.881  48.856 1.00 120.95 ? 35  HIS B C     1 
ATOM   3105 O O     . HIS C 2 35  ? 26.573  20.778  47.644 1.00 118.39 ? 35  HIS B O     1 
ATOM   3106 C CB    . HIS C 2 35  ? 26.096  22.554  50.614 1.00 125.70 ? 35  HIS B CB    1 
ATOM   3107 C CG    . HIS C 2 35  ? 24.758  23.034  50.138 1.00 131.39 ? 35  HIS B CG    1 
ATOM   3108 N ND1   . HIS C 2 35  ? 23.765  23.436  51.005 1.00 130.52 ? 35  HIS B ND1   1 
ATOM   3109 C CD2   . HIS C 2 35  ? 24.251  23.182  48.891 1.00 133.50 ? 35  HIS B CD2   1 
ATOM   3110 C CE1   . HIS C 2 35  ? 22.705  23.813  50.313 1.00 131.86 ? 35  HIS B CE1   1 
ATOM   3111 N NE2   . HIS C 2 35  ? 22.974  23.669  49.028 1.00 136.06 ? 35  HIS B NE2   1 
ATOM   3112 N N     . TYR C 2 36  ? 26.707  19.848  49.692 1.00 119.84 ? 36  TYR B N     1 
ATOM   3113 C CA    . TYR C 2 36  ? 26.449  18.480  49.242 1.00 114.10 ? 36  TYR B CA    1 
ATOM   3114 C C     . TYR C 2 36  ? 24.974  18.087  49.201 1.00 111.11 ? 36  TYR B C     1 
ATOM   3115 O O     . TYR C 2 36  ? 24.650  16.929  48.938 1.00 110.40 ? 36  TYR B O     1 
ATOM   3116 C CB    . TYR C 2 36  ? 27.191  17.501  50.155 1.00 117.13 ? 36  TYR B CB    1 
ATOM   3117 C CG    . TYR C 2 36  ? 26.578  17.395  51.535 1.00 118.69 ? 36  TYR B CG    1 
ATOM   3118 C CD1   . TYR C 2 36  ? 26.264  18.540  52.271 1.00 118.17 ? 36  TYR B CD1   1 
ATOM   3119 C CD2   . TYR C 2 36  ? 26.298  16.153  52.100 1.00 120.52 ? 36  TYR B CD2   1 
ATOM   3120 C CE1   . TYR C 2 36  ? 25.683  18.450  53.534 1.00 116.98 ? 36  TYR B CE1   1 
ATOM   3121 C CE2   . TYR C 2 36  ? 25.718  16.052  53.365 1.00 120.80 ? 36  TYR B CE2   1 
ATOM   3122 C CZ    . TYR C 2 36  ? 25.413  17.204  54.075 1.00 118.28 ? 36  TYR B CZ    1 
ATOM   3123 O OH    . TYR C 2 36  ? 24.833  17.109  55.320 1.00 112.58 ? 36  TYR B OH    1 
ATOM   3124 N N     . GLU C 2 37  ? 24.087  19.039  49.462 1.00 109.02 ? 37  GLU B N     1 
ATOM   3125 C CA    . GLU C 2 37  ? 22.653  18.765  49.466 1.00 106.50 ? 37  GLU B CA    1 
ATOM   3126 C C     . GLU C 2 37  ? 22.163  17.990  48.248 1.00 109.87 ? 37  GLU B C     1 
ATOM   3127 O O     . GLU C 2 37  ? 21.717  16.849  48.366 1.00 109.75 ? 37  GLU B O     1 
ATOM   3128 C CB    . GLU C 2 37  ? 21.866  20.071  49.560 1.00 108.83 ? 37  GLU B CB    1 
ATOM   3129 C CG    . GLU C 2 37  ? 20.360  19.875  49.525 1.00 108.56 ? 37  GLU B CG    1 
ATOM   3130 C CD    . GLU C 2 37  ? 19.619  21.156  49.210 1.00 114.42 ? 37  GLU B CD    1 
ATOM   3131 O OE1   . GLU C 2 37  ? 19.828  21.701  48.104 1.00 112.14 ? 37  GLU B OE1   1 
ATOM   3132 O OE2   . GLU C 2 37  ? 18.833  21.616  50.065 1.00 114.95 ? 37  GLU B OE2   1 
ATOM   3133 N N     . THR C 2 38  ? 22.240  18.622  47.081 1.00 108.91 ? 38  THR B N     1 
ATOM   3134 C CA    . THR C 2 38  ? 21.782  18.005  45.841 1.00 104.51 ? 38  THR B CA    1 
ATOM   3135 C C     . THR C 2 38  ? 22.454  16.667  45.562 1.00 103.29 ? 38  THR B C     1 
ATOM   3136 O O     . THR C 2 38  ? 21.811  15.736  45.077 1.00 106.19 ? 38  THR B O     1 
ATOM   3137 C CB    . THR C 2 38  ? 22.027  18.928  44.635 1.00 109.80 ? 38  THR B CB    1 
ATOM   3138 O OG1   . THR C 2 38  ? 23.433  19.013  44.378 1.00 126.53 ? 38  THR B OG1   1 
ATOM   3139 C CG2   . THR C 2 38  ? 21.492  20.323  44.917 1.00 111.55 ? 38  THR B CG2   1 
ATOM   3140 N N     . LEU C 2 39  ? 23.743  16.568  45.869 1.00 98.87  ? 39  LEU B N     1 
ATOM   3141 C CA    . LEU C 2 39  ? 24.470  15.329  45.626 1.00 93.62  ? 39  LEU B CA    1 
ATOM   3142 C C     . LEU C 2 39  ? 24.012  14.190  46.525 1.00 93.20  ? 39  LEU B C     1 
ATOM   3143 O O     . LEU C 2 39  ? 24.041  13.033  46.114 1.00 95.87  ? 39  LEU B O     1 
ATOM   3144 C CB    . LEU C 2 39  ? 25.977  15.541  45.787 1.00 97.48  ? 39  LEU B CB    1 
ATOM   3145 C CG    . LEU C 2 39  ? 26.659  16.408  44.724 1.00 100.70 ? 39  LEU B CG    1 
ATOM   3146 C CD1   . LEU C 2 39  ? 26.289  17.873  44.927 1.00 97.31  ? 39  LEU B CD1   1 
ATOM   3147 C CD2   . LEU C 2 39  ? 28.166  16.227  44.816 1.00 101.09 ? 39  LEU B CD2   1 
ATOM   3148 N N     . GLU C 2 40  ? 23.589  14.503  47.746 1.00 92.44  ? 40  GLU B N     1 
ATOM   3149 C CA    . GLU C 2 40  ? 23.132  13.450  48.644 1.00 94.24  ? 40  GLU B CA    1 
ATOM   3150 C C     . GLU C 2 40  ? 21.792  12.924  48.148 1.00 98.92  ? 40  GLU B C     1 
ATOM   3151 O O     . GLU C 2 40  ? 21.413  11.790  48.439 1.00 101.24 ? 40  GLU B O     1 
ATOM   3152 C CB    . GLU C 2 40  ? 22.972  13.960  50.079 1.00 91.22  ? 40  GLU B CB    1 
ATOM   3153 C CG    . GLU C 2 40  ? 21.639  14.631  50.364 1.00 97.12  ? 40  GLU B CG    1 
ATOM   3154 C CD    . GLU C 2 40  ? 21.228  14.506  51.819 1.00 106.17 ? 40  GLU B CD    1 
ATOM   3155 O OE1   . GLU C 2 40  ? 21.127  13.361  52.309 1.00 106.66 ? 40  GLU B OE1   1 
ATOM   3156 O OE2   . GLU C 2 40  ? 21.003  15.545  52.474 1.00 110.83 ? 40  GLU B OE2   1 
ATOM   3157 N N     . PHE C 2 41  ? 21.078  13.761  47.401 1.00 98.79  ? 41  PHE B N     1 
ATOM   3158 C CA    . PHE C 2 41  ? 19.778  13.384  46.860 1.00 93.74  ? 41  PHE B CA    1 
ATOM   3159 C C     . PHE C 2 41  ? 19.970  12.325  45.785 1.00 94.56  ? 41  PHE B C     1 
ATOM   3160 O O     . PHE C 2 41  ? 19.178  11.391  45.674 1.00 99.47  ? 41  PHE B O     1 
ATOM   3161 C CB    . PHE C 2 41  ? 19.076  14.601  46.260 1.00 92.98  ? 41  PHE B CB    1 
ATOM   3162 C CG    . PHE C 2 41  ? 17.644  14.350  45.888 1.00 94.98  ? 41  PHE B CG    1 
ATOM   3163 C CD1   . PHE C 2 41  ? 16.699  14.061  46.867 1.00 100.99 ? 41  PHE B CD1   1 
ATOM   3164 C CD2   . PHE C 2 41  ? 17.235  14.405  44.561 1.00 95.93  ? 41  PHE B CD2   1 
ATOM   3165 C CE1   . PHE C 2 41  ? 15.365  13.831  46.528 1.00 98.00  ? 41  PHE B CE1   1 
ATOM   3166 C CE2   . PHE C 2 41  ? 15.905  14.176  44.213 1.00 93.78  ? 41  PHE B CE2   1 
ATOM   3167 C CZ    . PHE C 2 41  ? 14.969  13.889  45.200 1.00 92.83  ? 41  PHE B CZ    1 
ATOM   3168 N N     . LEU C 2 42  ? 21.027  12.478  44.994 1.00 88.89  ? 42  LEU B N     1 
ATOM   3169 C CA    . LEU C 2 42  ? 21.330  11.525  43.936 1.00 85.72  ? 42  LEU B CA    1 
ATOM   3170 C C     . LEU C 2 42  ? 22.027  10.306  44.516 1.00 87.90  ? 42  LEU B C     1 
ATOM   3171 O O     . LEU C 2 42  ? 21.692  9.172   44.181 1.00 93.15  ? 42  LEU B O     1 
ATOM   3172 C CB    . LEU C 2 42  ? 22.226  12.168  42.874 1.00 85.28  ? 42  LEU B CB    1 
ATOM   3173 C CG    . LEU C 2 42  ? 22.868  11.213  41.861 1.00 83.82  ? 42  LEU B CG    1 
ATOM   3174 C CD1   . LEU C 2 42  ? 21.808  10.332  41.214 1.00 70.28  ? 42  LEU B CD1   1 
ATOM   3175 C CD2   . LEU C 2 42  ? 23.613  12.022  40.813 1.00 82.30  ? 42  LEU B CD2   1 
ATOM   3176 N N     . GLY C 2 43  ? 22.999  10.545  45.389 1.00 88.74  ? 43  GLY B N     1 
ATOM   3177 C CA    . GLY C 2 43  ? 23.732  9.450   45.996 1.00 91.20  ? 43  GLY B CA    1 
ATOM   3178 C C     . GLY C 2 43  ? 22.845  8.525   46.804 1.00 96.93  ? 43  GLY B C     1 
ATOM   3179 O O     . GLY C 2 43  ? 23.133  7.335   46.945 1.00 94.98  ? 43  GLY B O     1 
ATOM   3180 N N     . ASP C 2 44  ? 21.759  9.078   47.335 1.00 99.71  ? 44  ASP B N     1 
ATOM   3181 C CA    . ASP C 2 44  ? 20.813  8.310   48.138 1.00 96.41  ? 44  ASP B CA    1 
ATOM   3182 C C     . ASP C 2 44  ? 20.175  7.219   47.283 1.00 95.78  ? 44  ASP B C     1 
ATOM   3183 O O     . ASP C 2 44  ? 20.117  6.055   47.681 1.00 96.23  ? 44  ASP B O     1 
ATOM   3184 C CB    . ASP C 2 44  ? 19.735  9.245   48.696 1.00 97.20  ? 44  ASP B CB    1 
ATOM   3185 C CG    . ASP C 2 44  ? 18.882  8.586   49.760 1.00 100.48 ? 44  ASP B CG    1 
ATOM   3186 O OD1   . ASP C 2 44  ? 19.453  8.078   50.749 1.00 102.90 ? 44  ASP B OD1   1 
ATOM   3187 O OD2   . ASP C 2 44  ? 17.642  8.584   49.613 1.00 103.58 ? 44  ASP B OD2   1 
ATOM   3188 N N     . ALA C 2 45  ? 19.710  7.607   46.100 1.00 93.14  ? 45  ALA B N     1 
ATOM   3189 C CA    . ALA C 2 45  ? 19.072  6.682   45.173 1.00 89.75  ? 45  ALA B CA    1 
ATOM   3190 C C     . ALA C 2 45  ? 20.082  5.787   44.461 1.00 87.13  ? 45  ALA B C     1 
ATOM   3191 O O     . ALA C 2 45  ? 19.706  4.791   43.845 1.00 88.90  ? 45  ALA B O     1 
ATOM   3192 C CB    . ALA C 2 45  ? 18.254  7.461   44.148 1.00 90.31  ? 45  ALA B CB    1 
ATOM   3193 N N     . LEU C 2 46  ? 21.361  6.141   44.541 1.00 86.54  ? 46  LEU B N     1 
ATOM   3194 C CA    . LEU C 2 46  ? 22.407  5.353   43.894 1.00 87.18  ? 46  LEU B CA    1 
ATOM   3195 C C     . LEU C 2 46  ? 22.997  4.324   44.854 1.00 89.00  ? 46  LEU B C     1 
ATOM   3196 O O     . LEU C 2 46  ? 23.254  3.181   44.472 1.00 84.75  ? 46  LEU B O     1 
ATOM   3197 C CB    . LEU C 2 46  ? 23.514  6.270   43.364 1.00 91.05  ? 46  LEU B CB    1 
ATOM   3198 C CG    . LEU C 2 46  ? 24.681  5.610   42.621 1.00 92.83  ? 46  LEU B CG    1 
ATOM   3199 C CD1   . LEU C 2 46  ? 24.163  4.686   41.528 1.00 94.23  ? 46  LEU B CD1   1 
ATOM   3200 C CD2   . LEU C 2 46  ? 25.565  6.693   42.027 1.00 91.46  ? 46  LEU B CD2   1 
ATOM   3201 N N     . VAL C 2 47  ? 23.209  4.734   46.101 1.00 89.63  ? 47  VAL B N     1 
ATOM   3202 C CA    . VAL C 2 47  ? 23.754  3.841   47.118 1.00 89.31  ? 47  VAL B CA    1 
ATOM   3203 C C     . VAL C 2 47  ? 22.717  2.776   47.452 1.00 88.87  ? 47  VAL B C     1 
ATOM   3204 O O     . VAL C 2 47  ? 23.056  1.646   47.806 1.00 88.52  ? 47  VAL B O     1 
ATOM   3205 C CB    . VAL C 2 47  ? 24.110  4.612   48.410 1.00 89.25  ? 47  VAL B CB    1 
ATOM   3206 C CG1   . VAL C 2 47  ? 24.523  3.642   49.503 1.00 85.79  ? 47  VAL B CG1   1 
ATOM   3207 C CG2   . VAL C 2 47  ? 25.230  5.597   48.131 1.00 87.35  ? 47  VAL B CG2   1 
ATOM   3208 N N     . ASN C 2 48  ? 21.449  3.151   47.333 1.00 85.46  ? 48  ASN B N     1 
ATOM   3209 C CA    . ASN C 2 48  ? 20.351  2.239   47.610 1.00 84.28  ? 48  ASN B CA    1 
ATOM   3210 C C     . ASN C 2 48  ? 20.386  1.086   46.606 1.00 82.77  ? 48  ASN B C     1 
ATOM   3211 O O     . ASN C 2 48  ? 20.241  -0.080  46.974 1.00 78.33  ? 48  ASN B O     1 
ATOM   3212 C CB    . ASN C 2 48  ? 19.020  2.987   47.507 1.00 84.52  ? 48  ASN B CB    1 
ATOM   3213 C CG    . ASN C 2 48  ? 17.866  2.213   48.107 1.00 83.61  ? 48  ASN B CG    1 
ATOM   3214 O OD1   . ASN C 2 48  ? 17.559  1.102   47.679 1.00 86.57  ? 48  ASN B OD1   1 
ATOM   3215 N ND2   . ASN C 2 48  ? 17.216  2.799   49.106 1.00 83.64  ? 48  ASN B ND2   1 
ATOM   3216 N N     . PHE C 2 49  ? 20.592  1.419   45.337 1.00 83.76  ? 49  PHE B N     1 
ATOM   3217 C CA    . PHE C 2 49  ? 20.643  0.413   44.283 1.00 88.84  ? 49  PHE B CA    1 
ATOM   3218 C C     . PHE C 2 49  ? 21.714  -0.646  44.534 1.00 88.95  ? 49  PHE B C     1 
ATOM   3219 O O     . PHE C 2 49  ? 21.421  -1.842  44.531 1.00 88.63  ? 49  PHE B O     1 
ATOM   3220 C CB    . PHE C 2 49  ? 20.890  1.076   42.925 1.00 93.17  ? 49  PHE B CB    1 
ATOM   3221 C CG    . PHE C 2 49  ? 21.177  0.100   41.819 1.00 94.12  ? 49  PHE B CG    1 
ATOM   3222 C CD1   . PHE C 2 49  ? 20.242  -0.868  41.467 1.00 95.67  ? 49  PHE B CD1   1 
ATOM   3223 C CD2   . PHE C 2 49  ? 22.395  0.133   41.145 1.00 93.05  ? 49  PHE B CD2   1 
ATOM   3224 C CE1   . PHE C 2 49  ? 20.515  -1.793  40.461 1.00 96.22  ? 49  PHE B CE1   1 
ATOM   3225 C CE2   . PHE C 2 49  ? 22.678  -0.786  40.138 1.00 94.60  ? 49  PHE B CE2   1 
ATOM   3226 C CZ    . PHE C 2 49  ? 21.736  -1.752  39.796 1.00 97.68  ? 49  PHE B CZ    1 
ATOM   3227 N N     . PHE C 2 50  ? 22.952  -0.206  44.741 1.00 89.89  ? 50  PHE B N     1 
ATOM   3228 C CA    . PHE C 2 50  ? 24.057  -1.130  44.986 1.00 87.76  ? 50  PHE B CA    1 
ATOM   3229 C C     . PHE C 2 50  ? 23.717  -2.114  46.100 1.00 86.72  ? 50  PHE B C     1 
ATOM   3230 O O     . PHE C 2 50  ? 23.921  -3.322  45.964 1.00 82.26  ? 50  PHE B O     1 
ATOM   3231 C CB    . PHE C 2 50  ? 25.331  -0.369  45.376 1.00 86.62  ? 50  PHE B CB    1 
ATOM   3232 C CG    . PHE C 2 50  ? 25.812  0.603   44.335 1.00 90.16  ? 50  PHE B CG    1 
ATOM   3233 C CD1   . PHE C 2 50  ? 25.963  0.210   43.009 1.00 93.11  ? 50  PHE B CD1   1 
ATOM   3234 C CD2   . PHE C 2 50  ? 26.135  1.910   44.686 1.00 92.76  ? 50  PHE B CD2   1 
ATOM   3235 C CE1   . PHE C 2 50  ? 26.430  1.107   42.048 1.00 92.86  ? 50  PHE B CE1   1 
ATOM   3236 C CE2   . PHE C 2 50  ? 26.604  2.814   43.731 1.00 91.68  ? 50  PHE B CE2   1 
ATOM   3237 C CZ    . PHE C 2 50  ? 26.751  2.411   42.410 1.00 89.66  ? 50  PHE B CZ    1 
ATOM   3238 N N     . ILE C 2 51  ? 23.199  -1.589  47.204 1.00 86.61  ? 51  ILE B N     1 
ATOM   3239 C CA    . ILE C 2 51  ? 22.844  -2.416  48.348 1.00 89.07  ? 51  ILE B CA    1 
ATOM   3240 C C     . ILE C 2 51  ? 21.759  -3.434  48.013 1.00 90.04  ? 51  ILE B C     1 
ATOM   3241 O O     . ILE C 2 51  ? 21.954  -4.637  48.183 1.00 88.20  ? 51  ILE B O     1 
ATOM   3242 C CB    . ILE C 2 51  ? 22.368  -1.547  49.528 1.00 92.88  ? 51  ILE B CB    1 
ATOM   3243 C CG1   . ILE C 2 51  ? 23.466  -0.549  49.910 1.00 96.27  ? 51  ILE B CG1   1 
ATOM   3244 C CG2   . ILE C 2 51  ? 22.018  -2.430  50.717 1.00 88.23  ? 51  ILE B CG2   1 
ATOM   3245 C CD1   . ILE C 2 51  ? 23.047  0.456   50.966 1.00 100.27 ? 51  ILE B CD1   1 
ATOM   3246 N N     . VAL C 2 52  ? 20.618  -2.950  47.533 1.00 90.04  ? 52  VAL B N     1 
ATOM   3247 C CA    . VAL C 2 52  ? 19.506  -3.827  47.188 1.00 86.73  ? 52  VAL B CA    1 
ATOM   3248 C C     . VAL C 2 52  ? 19.905  -4.901  46.181 1.00 89.98  ? 52  VAL B C     1 
ATOM   3249 O O     . VAL C 2 52  ? 19.635  -6.083  46.391 1.00 90.82  ? 52  VAL B O     1 
ATOM   3250 C CB    . VAL C 2 52  ? 18.322  -3.025  46.622 1.00 78.46  ? 52  VAL B CB    1 
ATOM   3251 C CG1   . VAL C 2 52  ? 17.167  -3.958  46.299 1.00 77.28  ? 52  VAL B CG1   1 
ATOM   3252 C CG2   . VAL C 2 52  ? 17.891  -1.977  47.628 1.00 72.53  ? 52  VAL B CG2   1 
ATOM   3253 N N     . ASP C 2 53  ? 20.549  -4.496  45.092 1.00 93.03  ? 53  ASP B N     1 
ATOM   3254 C CA    . ASP C 2 53  ? 20.970  -5.452  44.077 1.00 97.44  ? 53  ASP B CA    1 
ATOM   3255 C C     . ASP C 2 53  ? 21.807  -6.545  44.728 1.00 97.42  ? 53  ASP B C     1 
ATOM   3256 O O     . ASP C 2 53  ? 21.576  -7.733  44.507 1.00 97.68  ? 53  ASP B O     1 
ATOM   3257 C CB    . ASP C 2 53  ? 21.781  -4.753  42.981 1.00 105.09 ? 53  ASP B CB    1 
ATOM   3258 C CG    . ASP C 2 53  ? 22.187  -5.700  41.858 1.00 114.71 ? 53  ASP B CG    1 
ATOM   3259 O OD1   . ASP C 2 53  ? 21.297  -6.373  41.293 1.00 115.22 ? 53  ASP B OD1   1 
ATOM   3260 O OD2   . ASP C 2 53  ? 23.393  -5.768  41.535 1.00 120.07 ? 53  ASP B OD2   1 
ATOM   3261 N N     . LEU C 2 54  ? 22.772  -6.133  45.544 1.00 97.22  ? 54  LEU B N     1 
ATOM   3262 C CA    . LEU C 2 54  ? 23.648  -7.071  46.234 1.00 98.73  ? 54  LEU B CA    1 
ATOM   3263 C C     . LEU C 2 54  ? 22.871  -7.965  47.197 1.00 95.73  ? 54  LEU B C     1 
ATOM   3264 O O     . LEU C 2 54  ? 23.144  -9.161  47.313 1.00 92.37  ? 54  LEU B O     1 
ATOM   3265 C CB    . LEU C 2 54  ? 24.724  -6.306  47.007 1.00 98.61  ? 54  LEU B CB    1 
ATOM   3266 C CG    . LEU C 2 54  ? 25.726  -7.169  47.775 1.00 103.46 ? 54  LEU B CG    1 
ATOM   3267 C CD1   . LEU C 2 54  ? 26.438  -8.092  46.803 1.00 107.09 ? 54  LEU B CD1   1 
ATOM   3268 C CD2   . LEU C 2 54  ? 26.725  -6.287  48.509 1.00 103.42 ? 54  LEU B CD2   1 
ATOM   3269 N N     . LEU C 2 55  ? 21.899  -7.374  47.882 1.00 94.31  ? 55  LEU B N     1 
ATOM   3270 C CA    . LEU C 2 55  ? 21.075  -8.089  48.848 1.00 95.25  ? 55  LEU B CA    1 
ATOM   3271 C C     . LEU C 2 55  ? 20.256  -9.228  48.240 1.00 97.56  ? 55  LEU B C     1 
ATOM   3272 O O     . LEU C 2 55  ? 20.246  -10.341 48.764 1.00 97.89  ? 55  LEU B O     1 
ATOM   3273 C CB    . LEU C 2 55  ? 20.140  -7.102  49.551 1.00 89.49  ? 55  LEU B CB    1 
ATOM   3274 C CG    . LEU C 2 55  ? 19.100  -7.670  50.517 1.00 88.68  ? 55  LEU B CG    1 
ATOM   3275 C CD1   . LEU C 2 55  ? 19.782  -8.499  51.587 1.00 89.70  ? 55  LEU B CD1   1 
ATOM   3276 C CD2   . LEU C 2 55  ? 18.318  -6.526  51.140 1.00 87.91  ? 55  LEU B CD2   1 
ATOM   3277 N N     . VAL C 2 56  ? 19.567  -8.949  47.138 1.00 100.77 ? 56  VAL B N     1 
ATOM   3278 C CA    . VAL C 2 56  ? 18.745  -9.961  46.484 1.00 104.32 ? 56  VAL B CA    1 
ATOM   3279 C C     . VAL C 2 56  ? 19.565  -11.144 45.971 1.00 108.47 ? 56  VAL B C     1 
ATOM   3280 O O     . VAL C 2 56  ? 19.027  -12.226 45.743 1.00 107.53 ? 56  VAL B O     1 
ATOM   3281 C CB    . VAL C 2 56  ? 17.947  -9.359  45.304 1.00 102.70 ? 56  VAL B CB    1 
ATOM   3282 C CG1   . VAL C 2 56  ? 17.077  -10.427 44.660 1.00 92.02  ? 56  VAL B CG1   1 
ATOM   3283 C CG2   . VAL C 2 56  ? 17.083  -8.214  45.798 1.00 105.08 ? 56  VAL B CG2   1 
ATOM   3284 N N     . GLN C 2 57  ? 20.866  -10.939 45.791 1.00 111.06 ? 57  GLN B N     1 
ATOM   3285 C CA    . GLN C 2 57  ? 21.740  -12.003 45.306 1.00 111.92 ? 57  GLN B CA    1 
ATOM   3286 C C     . GLN C 2 57  ? 22.171  -12.928 46.441 1.00 115.45 ? 57  GLN B C     1 
ATOM   3287 O O     . GLN C 2 57  ? 21.770  -14.093 46.487 1.00 115.63 ? 57  GLN B O     1 
ATOM   3288 C CB    . GLN C 2 57  ? 22.982  -11.411 44.637 1.00 116.47 ? 57  GLN B CB    1 
ATOM   3289 C CG    . GLN C 2 57  ? 22.691  -10.538 43.429 1.00 118.57 ? 57  GLN B CG    1 
ATOM   3290 C CD    . GLN C 2 57  ? 23.956  -10.062 42.740 1.00 117.90 ? 57  GLN B CD    1 
ATOM   3291 O OE1   . GLN C 2 57  ? 24.748  -10.866 42.248 1.00 114.16 ? 57  GLN B OE1   1 
ATOM   3292 N NE2   . GLN C 2 57  ? 24.153  -8.748  42.702 1.00 117.05 ? 57  GLN B NE2   1 
ATOM   3293 N N     . TYR C 2 58  ? 22.989  -12.403 47.351 1.00 115.00 ? 58  TYR B N     1 
ATOM   3294 C CA    . TYR C 2 58  ? 23.482  -13.179 48.486 1.00 112.16 ? 58  TYR B CA    1 
ATOM   3295 C C     . TYR C 2 58  ? 22.532  -13.098 49.676 1.00 112.14 ? 58  TYR B C     1 
ATOM   3296 O O     . TYR C 2 58  ? 22.801  -12.381 50.640 1.00 114.85 ? 58  TYR B O     1 
ATOM   3297 C CB    . TYR C 2 58  ? 24.852  -12.668 48.934 1.00 110.42 ? 58  TYR B CB    1 
ATOM   3298 C CG    . TYR C 2 58  ? 25.909  -12.626 47.859 1.00 112.74 ? 58  TYR B CG    1 
ATOM   3299 C CD1   . TYR C 2 58  ? 26.279  -13.777 47.168 1.00 112.30 ? 58  TYR B CD1   1 
ATOM   3300 C CD2   . TYR C 2 58  ? 26.559  -11.433 47.550 1.00 116.70 ? 58  TYR B CD2   1 
ATOM   3301 C CE1   . TYR C 2 58  ? 27.276  -13.740 46.194 1.00 118.61 ? 58  TYR B CE1   1 
ATOM   3302 C CE2   . TYR C 2 58  ? 27.555  -11.384 46.581 1.00 119.87 ? 58  TYR B CE2   1 
ATOM   3303 C CZ    . TYR C 2 58  ? 27.908  -12.539 45.908 1.00 121.19 ? 58  TYR B CZ    1 
ATOM   3304 O OH    . TYR C 2 58  ? 28.896  -12.489 44.951 1.00 126.95 ? 58  TYR B OH    1 
ATOM   3305 N N     . SER C 2 59  ? 21.426  -13.829 49.612 1.00 110.07 ? 59  SER B N     1 
ATOM   3306 C CA    . SER C 2 59  ? 20.463  -13.829 50.706 1.00 108.18 ? 59  SER B CA    1 
ATOM   3307 C C     . SER C 2 59  ? 19.829  -15.202 50.868 1.00 105.87 ? 59  SER B C     1 
ATOM   3308 O O     . SER C 2 59  ? 19.515  -15.871 49.886 1.00 104.80 ? 59  SER B O     1 
ATOM   3309 C CB    . SER C 2 59  ? 19.369  -12.790 50.463 1.00 103.74 ? 59  SER B CB    1 
ATOM   3310 O OG    . SER C 2 59  ? 18.414  -12.814 51.509 1.00 95.99  ? 59  SER B OG    1 
ATOM   3311 N N     . PRO C 2 60  ? 19.632  -15.640 52.118 1.00 104.51 ? 60  PRO B N     1 
ATOM   3312 C CA    . PRO C 2 60  ? 19.027  -16.950 52.367 1.00 109.24 ? 60  PRO B CA    1 
ATOM   3313 C C     . PRO C 2 60  ? 17.674  -17.088 51.673 1.00 110.97 ? 60  PRO B C     1 
ATOM   3314 O O     . PRO C 2 60  ? 17.522  -17.888 50.749 1.00 111.37 ? 60  PRO B O     1 
ATOM   3315 C CB    . PRO C 2 60  ? 18.923  -16.997 53.891 1.00 105.43 ? 60  PRO B CB    1 
ATOM   3316 C CG    . PRO C 2 60  ? 18.791  -15.553 54.269 1.00 103.81 ? 60  PRO B CG    1 
ATOM   3317 C CD    . PRO C 2 60  ? 19.800  -14.890 53.374 1.00 102.39 ? 60  PRO B CD    1 
ATOM   3318 N N     . ASN C 2 61  ? 16.701  -16.300 52.121 1.00 112.28 ? 61  ASN B N     1 
ATOM   3319 C CA    . ASN C 2 61  ? 15.360  -16.314 51.547 1.00 111.37 ? 61  ASN B CA    1 
ATOM   3320 C C     . ASN C 2 61  ? 15.258  -15.169 50.541 1.00 107.35 ? 61  ASN B C     1 
ATOM   3321 O O     . ASN C 2 61  ? 16.193  -14.380 50.402 1.00 109.17 ? 61  ASN B O     1 
ATOM   3322 C CB    . ASN C 2 61  ? 14.315  -16.135 52.648 1.00 110.54 ? 61  ASN B CB    1 
ATOM   3323 C CG    . ASN C 2 61  ? 13.001  -16.809 52.319 1.00 116.89 ? 61  ASN B CG    1 
ATOM   3324 O OD1   . ASN C 2 61  ? 12.404  -16.560 51.272 1.00 119.11 ? 61  ASN B OD1   1 
ATOM   3325 N ND2   . ASN C 2 61  ? 12.540  -17.669 53.219 1.00 120.13 ? 61  ASN B ND2   1 
ATOM   3326 N N     . LYS C 2 62  ? 14.132  -15.075 49.841 1.00 102.21 ? 62  LYS B N     1 
ATOM   3327 C CA    . LYS C 2 62  ? 13.955  -14.010 48.860 1.00 97.73  ? 62  LYS B CA    1 
ATOM   3328 C C     . LYS C 2 62  ? 12.624  -13.277 48.978 1.00 89.77  ? 62  LYS B C     1 
ATOM   3329 O O     . LYS C 2 62  ? 12.436  -12.227 48.366 1.00 84.62  ? 62  LYS B O     1 
ATOM   3330 C CB    . LYS C 2 62  ? 14.102  -14.562 47.441 1.00 93.76  ? 62  LYS B CB    1 
ATOM   3331 C CG    . LYS C 2 62  ? 15.487  -15.091 47.121 1.00 95.41  ? 62  LYS B CG    1 
ATOM   3332 C CD    . LYS C 2 62  ? 16.550  -14.021 47.311 1.00 94.94  ? 62  LYS B CD    1 
ATOM   3333 C CE    . LYS C 2 62  ? 17.926  -14.540 46.917 1.00 97.68  ? 62  LYS B CE    1 
ATOM   3334 N NZ    . LYS C 2 62  ? 18.315  -15.761 47.674 1.00 102.45 ? 62  LYS B NZ    1 
ATOM   3335 N N     . ARG C 2 63  ? 11.702  -13.824 49.759 1.00 83.18  ? 63  ARG B N     1 
ATOM   3336 C CA    . ARG C 2 63  ? 10.408  -13.185 49.927 1.00 91.13  ? 63  ARG B CA    1 
ATOM   3337 C C     . ARG C 2 63  ? 10.602  -11.751 50.410 1.00 94.23  ? 63  ARG B C     1 
ATOM   3338 O O     . ARG C 2 63  ? 11.639  -11.412 50.976 1.00 100.72 ? 63  ARG B O     1 
ATOM   3339 C CB    . ARG C 2 63  ? 9.549   -13.978 50.910 1.00 88.12  ? 63  ARG B CB    1 
ATOM   3340 C CG    . ARG C 2 63  ? 9.485   -15.466 50.587 1.00 94.52  ? 63  ARG B CG    1 
ATOM   3341 C CD    . ARG C 2 63  ? 8.953   -15.748 49.181 1.00 93.72  ? 63  ARG B CD    1 
ATOM   3342 N NE    . ARG C 2 63  ? 7.515   -16.009 49.166 1.00 95.65  ? 63  ARG B NE    1 
ATOM   3343 C CZ    . ARG C 2 63  ? 6.576   -15.077 49.290 1.00 96.01  ? 63  ARG B CZ    1 
ATOM   3344 N NH1   . ARG C 2 63  ? 6.913   -13.806 49.434 1.00 98.07  ? 63  ARG B NH1   1 
ATOM   3345 N NH2   . ARG C 2 63  ? 5.296   -15.420 49.286 1.00 90.18  ? 63  ARG B NH2   1 
ATOM   3346 N N     . GLU C 2 64  ? 9.600   -10.913 50.176 1.00 101.27 ? 64  GLU B N     1 
ATOM   3347 C CA    . GLU C 2 64  ? 9.651   -9.505  50.554 1.00 103.43 ? 64  GLU B CA    1 
ATOM   3348 C C     . GLU C 2 64  ? 9.769   -9.299  52.063 1.00 103.47 ? 64  GLU B C     1 
ATOM   3349 O O     . GLU C 2 64  ? 10.666  -8.599  52.533 1.00 105.41 ? 64  GLU B O     1 
ATOM   3350 C CB    . GLU C 2 64  ? 8.402   -8.794  50.025 1.00 105.03 ? 64  GLU B CB    1 
ATOM   3351 C CG    . GLU C 2 64  ? 8.612   -7.348  49.605 1.00 114.02 ? 64  GLU B CG    1 
ATOM   3352 C CD    . GLU C 2 64  ? 8.951   -6.435  50.763 1.00 119.77 ? 64  GLU B CD    1 
ATOM   3353 O OE1   . GLU C 2 64  ? 8.160   -6.380  51.730 1.00 119.22 ? 64  GLU B OE1   1 
ATOM   3354 O OE2   . GLU C 2 64  ? 10.005  -5.766  50.701 1.00 123.13 ? 64  GLU B OE2   1 
ATOM   3355 N N     . GLY C 2 65  ? 8.865   -9.915  52.818 1.00 102.06 ? 65  GLY B N     1 
ATOM   3356 C CA    . GLY C 2 65  ? 8.880   -9.773  54.264 1.00 101.16 ? 65  GLY B CA    1 
ATOM   3357 C C     . GLY C 2 65  ? 10.142  -10.283 54.929 1.00 100.29 ? 65  GLY B C     1 
ATOM   3358 O O     . GLY C 2 65  ? 10.269  -10.244 56.153 1.00 100.18 ? 65  GLY B O     1 
ATOM   3359 N N     . PHE C 2 66  ? 11.081  -10.762 54.123 1.00 98.94  ? 66  PHE B N     1 
ATOM   3360 C CA    . PHE C 2 66  ? 12.336  -11.281 54.643 1.00 97.56  ? 66  PHE B CA    1 
ATOM   3361 C C     . PHE C 2 66  ? 13.485  -10.376 54.223 1.00 96.29  ? 66  PHE B C     1 
ATOM   3362 O O     . PHE C 2 66  ? 14.532  -10.354 54.863 1.00 102.73 ? 66  PHE B O     1 
ATOM   3363 C CB    . PHE C 2 66  ? 12.563  -12.703 54.124 1.00 96.52  ? 66  PHE B CB    1 
ATOM   3364 C CG    . PHE C 2 66  ? 13.726  -13.410 54.765 1.00 99.40  ? 66  PHE B CG    1 
ATOM   3365 C CD1   . PHE C 2 66  ? 15.035  -13.067 54.442 1.00 96.19  ? 66  PHE B CD1   1 
ATOM   3366 C CD2   . PHE C 2 66  ? 13.509  -14.423 55.694 1.00 96.20  ? 66  PHE B CD2   1 
ATOM   3367 C CE1   . PHE C 2 66  ? 16.110  -13.721 55.033 1.00 89.95  ? 66  PHE B CE1   1 
ATOM   3368 C CE2   . PHE C 2 66  ? 14.578  -15.083 56.290 1.00 93.65  ? 66  PHE B CE2   1 
ATOM   3369 C CZ    . PHE C 2 66  ? 15.882  -14.731 55.958 1.00 88.92  ? 66  PHE B CZ    1 
ATOM   3370 N N     . LEU C 2 67  ? 13.282  -9.623  53.148 1.00 92.70  ? 67  LEU B N     1 
ATOM   3371 C CA    . LEU C 2 67  ? 14.310  -8.717  52.659 1.00 91.21  ? 67  LEU B CA    1 
ATOM   3372 C C     . LEU C 2 67  ? 14.167  -7.309  53.233 1.00 89.64  ? 67  LEU B C     1 
ATOM   3373 O O     . LEU C 2 67  ? 15.161  -6.617  53.442 1.00 83.60  ? 67  LEU B O     1 
ATOM   3374 C CB    . LEU C 2 67  ? 14.270  -8.658  51.133 1.00 87.56  ? 67  LEU B CB    1 
ATOM   3375 C CG    . LEU C 2 67  ? 14.673  -9.946  50.416 1.00 89.52  ? 67  LEU B CG    1 
ATOM   3376 C CD1   . LEU C 2 67  ? 14.524  -9.759  48.915 1.00 88.54  ? 67  LEU B CD1   1 
ATOM   3377 C CD2   . LEU C 2 67  ? 16.110  -10.308 50.777 1.00 84.59  ? 67  LEU B CD2   1 
ATOM   3378 N N     . SER C 2 68  ? 12.934  -6.883  53.487 1.00 91.87  ? 68  SER B N     1 
ATOM   3379 C CA    . SER C 2 68  ? 12.698  -5.548  54.030 1.00 92.88  ? 68  SER B CA    1 
ATOM   3380 C C     . SER C 2 68  ? 13.533  -5.260  55.273 1.00 86.07  ? 68  SER B C     1 
ATOM   3381 O O     . SER C 2 68  ? 14.287  -4.289  55.303 1.00 88.00  ? 68  SER B O     1 
ATOM   3382 C CB    . SER C 2 68  ? 11.213  -5.348  54.347 1.00 89.46  ? 68  SER B CB    1 
ATOM   3383 O OG    . SER C 2 68  ? 10.451  -5.247  53.159 1.00 84.14  ? 68  SER B OG    1 
ATOM   3384 N N     . PRO C 2 69  ? 13.412  -6.101  56.315 1.00 81.80  ? 69  PRO B N     1 
ATOM   3385 C CA    . PRO C 2 69  ? 14.187  -5.881  57.540 1.00 81.74  ? 69  PRO B CA    1 
ATOM   3386 C C     . PRO C 2 69  ? 15.685  -5.713  57.275 1.00 71.94  ? 69  PRO B C     1 
ATOM   3387 O O     . PRO C 2 69  ? 16.325  -4.833  57.845 1.00 72.86  ? 69  PRO B O     1 
ATOM   3388 C CB    . PRO C 2 69  ? 13.861  -7.116  58.380 1.00 81.92  ? 69  PRO B CB    1 
ATOM   3389 C CG    . PRO C 2 69  ? 13.535  -8.159  57.354 1.00 81.69  ? 69  PRO B CG    1 
ATOM   3390 C CD    . PRO C 2 69  ? 12.696  -7.386  56.379 1.00 84.08  ? 69  PRO B CD    1 
ATOM   3391 N N     . LEU C 2 70  ? 16.236  -6.557  56.409 1.00 66.12  ? 70  LEU B N     1 
ATOM   3392 C CA    . LEU C 2 70  ? 17.650  -6.479  56.059 1.00 74.08  ? 70  LEU B CA    1 
ATOM   3393 C C     . LEU C 2 70  ? 17.959  -5.105  55.483 1.00 75.04  ? 70  LEU B C     1 
ATOM   3394 O O     . LEU C 2 70  ? 18.713  -4.331  56.065 1.00 84.07  ? 70  LEU B O     1 
ATOM   3395 C CB    . LEU C 2 70  ? 18.010  -7.556  55.027 1.00 66.85  ? 70  LEU B CB    1 
ATOM   3396 C CG    . LEU C 2 70  ? 18.203  -9.001  55.503 1.00 76.31  ? 70  LEU B CG    1 
ATOM   3397 C CD1   . LEU C 2 70  ? 19.450  -9.093  56.375 1.00 85.25  ? 70  LEU B CD1   1 
ATOM   3398 C CD2   . LEU C 2 70  ? 16.982  -9.463  56.272 1.00 81.70  ? 70  LEU B CD2   1 
ATOM   3399 N N     . LYS C 2 71  ? 17.364  -4.808  54.334 1.00 82.05  ? 71  LYS B N     1 
ATOM   3400 C CA    . LYS C 2 71  ? 17.566  -3.530  53.667 1.00 82.73  ? 71  LYS B CA    1 
ATOM   3401 C C     . LYS C 2 71  ? 17.398  -2.359  54.628 1.00 77.01  ? 71  LYS B C     1 
ATOM   3402 O O     . LYS C 2 71  ? 18.045  -1.326  54.474 1.00 73.44  ? 71  LYS B O     1 
ATOM   3403 C CB    . LYS C 2 71  ? 16.578  -3.386  52.504 1.00 82.03  ? 71  LYS B CB    1 
ATOM   3404 C CG    . LYS C 2 71  ? 16.582  -2.012  51.857 1.00 85.80  ? 71  LYS B CG    1 
ATOM   3405 C CD    . LYS C 2 71  ? 15.546  -1.916  50.755 1.00 84.27  ? 71  LYS B CD    1 
ATOM   3406 C CE    . LYS C 2 71  ? 15.440  -0.498  50.225 1.00 83.67  ? 71  LYS B CE    1 
ATOM   3407 N NZ    . LYS C 2 71  ? 14.952  0.443   51.271 1.00 86.63  ? 71  LYS B NZ    1 
ATOM   3408 N N     . ALA C 2 72  ? 16.528  -2.527  55.618 1.00 74.84  ? 72  ALA B N     1 
ATOM   3409 C CA    . ALA C 2 72  ? 16.271  -1.477  56.597 1.00 80.55  ? 72  ALA B CA    1 
ATOM   3410 C C     . ALA C 2 72  ? 17.536  -1.125  57.370 1.00 82.57  ? 72  ALA B C     1 
ATOM   3411 O O     . ALA C 2 72  ? 17.722  0.014   57.800 1.00 83.57  ? 72  ALA B O     1 
ATOM   3412 C CB    . ALA C 2 72  ? 15.179  -1.922  57.559 1.00 77.07  ? 72  ALA B CB    1 
ATOM   3413 N N     . TYR C 2 73  ? 18.401  -2.117  57.542 1.00 84.12  ? 73  TYR B N     1 
ATOM   3414 C CA    . TYR C 2 73  ? 19.653  -1.940  58.259 1.00 82.91  ? 73  TYR B CA    1 
ATOM   3415 C C     . TYR C 2 73  ? 20.777  -1.502  57.323 1.00 81.49  ? 73  TYR B C     1 
ATOM   3416 O O     . TYR C 2 73  ? 21.529  -0.583  57.637 1.00 83.62  ? 73  TYR B O     1 
ATOM   3417 C CB    . TYR C 2 73  ? 20.032  -3.250  58.953 1.00 92.70  ? 73  TYR B CB    1 
ATOM   3418 C CG    . TYR C 2 73  ? 21.440  -3.279  59.501 1.00 100.91 ? 73  TYR B CG    1 
ATOM   3419 C CD1   . TYR C 2 73  ? 21.827  -2.432  60.537 1.00 100.59 ? 73  TYR B CD1   1 
ATOM   3420 C CD2   . TYR C 2 73  ? 22.392  -4.148  58.970 1.00 104.60 ? 73  TYR B CD2   1 
ATOM   3421 C CE1   . TYR C 2 73  ? 23.132  -2.448  61.029 1.00 106.28 ? 73  TYR B CE1   1 
ATOM   3422 C CE2   . TYR C 2 73  ? 23.695  -4.172  59.452 1.00 107.77 ? 73  TYR B CE2   1 
ATOM   3423 C CZ    . TYR C 2 73  ? 24.059  -3.322  60.481 1.00 108.53 ? 73  TYR B CZ    1 
ATOM   3424 O OH    . TYR C 2 73  ? 25.349  -3.351  60.960 1.00 105.28 ? 73  TYR B OH    1 
ATOM   3425 N N     . LEU C 2 74  ? 20.879  -2.163  56.172 1.00 80.05  ? 74  LEU B N     1 
ATOM   3426 C CA    . LEU C 2 74  ? 21.917  -1.862  55.191 1.00 78.98  ? 74  LEU B CA    1 
ATOM   3427 C C     . LEU C 2 74  ? 21.916  -0.422  54.687 1.00 78.64  ? 74  LEU B C     1 
ATOM   3428 O O     . LEU C 2 74  ? 22.911  0.047   54.137 1.00 83.30  ? 74  LEU B O     1 
ATOM   3429 C CB    . LEU C 2 74  ? 21.814  -2.827  54.009 1.00 76.32  ? 74  LEU B CB    1 
ATOM   3430 C CG    . LEU C 2 74  ? 22.102  -4.295  54.337 1.00 83.99  ? 74  LEU B CG    1 
ATOM   3431 C CD1   . LEU C 2 74  ? 21.919  -5.148  53.092 1.00 87.25  ? 74  LEU B CD1   1 
ATOM   3432 C CD2   . LEU C 2 74  ? 23.518  -4.436  54.872 1.00 75.44  ? 74  LEU B CD2   1 
ATOM   3433 N N     . ILE C 2 75  ? 20.803  0.280   54.862 1.00 79.19  ? 75  ILE B N     1 
ATOM   3434 C CA    . ILE C 2 75  ? 20.722  1.670   54.433 1.00 81.60  ? 75  ILE B CA    1 
ATOM   3435 C C     . ILE C 2 75  ? 20.451  2.519   55.663 1.00 85.76  ? 75  ILE B C     1 
ATOM   3436 O O     . ILE C 2 75  ? 20.044  3.677   55.565 1.00 82.36  ? 75  ILE B O     1 
ATOM   3437 C CB    . ILE C 2 75  ? 19.591  1.899   53.404 1.00 84.34  ? 75  ILE B CB    1 
ATOM   3438 C CG1   . ILE C 2 75  ? 18.241  1.543   54.024 1.00 85.18  ? 75  ILE B CG1   1 
ATOM   3439 C CG2   . ILE C 2 75  ? 19.849  1.076   52.150 1.00 75.50  ? 75  ILE B CG2   1 
ATOM   3440 C CD1   . ILE C 2 75  ? 17.065  1.842   53.129 1.00 90.40  ? 75  ILE B CD1   1 
ATOM   3441 N N     . SER C 2 76  ? 20.681  1.919   56.827 1.00 91.46  ? 76  SER B N     1 
ATOM   3442 C CA    . SER C 2 76  ? 20.477  2.587   58.106 1.00 95.01  ? 76  SER B CA    1 
ATOM   3443 C C     . SER C 2 76  ? 21.584  3.596   58.376 1.00 98.93  ? 76  SER B C     1 
ATOM   3444 O O     . SER C 2 76  ? 22.698  3.463   57.867 1.00 101.91 ? 76  SER B O     1 
ATOM   3445 C CB    . SER C 2 76  ? 20.454  1.555   59.237 1.00 92.96  ? 76  SER B CB    1 
ATOM   3446 O OG    . SER C 2 76  ? 20.430  2.183   60.508 1.00 97.65  ? 76  SER B OG    1 
ATOM   3447 N N     . GLU C 2 77  ? 21.271  4.608   59.178 1.00 100.16 ? 77  GLU B N     1 
ATOM   3448 C CA    . GLU C 2 77  ? 22.253  5.623   59.530 1.00 100.08 ? 77  GLU B CA    1 
ATOM   3449 C C     . GLU C 2 77  ? 23.409  4.905   60.219 1.00 97.91  ? 77  GLU B C     1 
ATOM   3450 O O     . GLU C 2 77  ? 24.573  5.256   60.046 1.00 97.37  ? 77  GLU B O     1 
ATOM   3451 C CB    . GLU C 2 77  ? 21.633  6.641   60.487 1.00 98.63  ? 77  GLU B CB    1 
ATOM   3452 C CG    . GLU C 2 77  ? 22.588  7.733   60.935 1.00 109.88 ? 77  GLU B CG    1 
ATOM   3453 C CD    . GLU C 2 77  ? 22.015  8.594   62.045 1.00 116.08 ? 77  GLU B CD    1 
ATOM   3454 O OE1   . GLU C 2 77  ? 21.756  8.060   63.147 1.00 115.77 ? 77  GLU B OE1   1 
ATOM   3455 O OE2   . GLU C 2 77  ? 21.823  9.807   61.816 1.00 117.15 ? 77  GLU B OE2   1 
ATOM   3456 N N     . GLU C 2 78  ? 23.064  3.883   60.993 1.00 97.29  ? 78  GLU B N     1 
ATOM   3457 C CA    . GLU C 2 78  ? 24.040  3.091   61.727 1.00 98.42  ? 78  GLU B CA    1 
ATOM   3458 C C     . GLU C 2 78  ? 25.004  2.361   60.795 1.00 98.17  ? 78  GLU B C     1 
ATOM   3459 O O     . GLU C 2 78  ? 26.219  2.525   60.899 1.00 101.36 ? 78  GLU B O     1 
ATOM   3460 C CB    . GLU C 2 78  ? 23.310  2.082   62.619 1.00 99.61  ? 78  GLU B CB    1 
ATOM   3461 C CG    . GLU C 2 78  ? 24.202  1.299   63.567 1.00 101.86 ? 78  GLU B CG    1 
ATOM   3462 C CD    . GLU C 2 78  ? 23.416  0.345   64.452 1.00 103.57 ? 78  GLU B CD    1 
ATOM   3463 O OE1   . GLU C 2 78  ? 22.515  0.813   65.180 1.00 99.61  ? 78  GLU B OE1   1 
ATOM   3464 O OE2   . GLU C 2 78  ? 23.697  -0.872  64.421 1.00 107.01 ? 78  GLU B OE2   1 
ATOM   3465 N N     . PHE C 2 79  ? 24.462  1.559   59.882 1.00 99.47  ? 79  PHE B N     1 
ATOM   3466 C CA    . PHE C 2 79  ? 25.290  0.802   58.946 1.00 100.96 ? 79  PHE B CA    1 
ATOM   3467 C C     . PHE C 2 79  ? 26.119  1.691   58.023 1.00 101.60 ? 79  PHE B C     1 
ATOM   3468 O O     . PHE C 2 79  ? 27.233  1.329   57.640 1.00 100.01 ? 79  PHE B O     1 
ATOM   3469 C CB    . PHE C 2 79  ? 24.430  -0.125  58.089 1.00 98.69  ? 79  PHE B CB    1 
ATOM   3470 C CG    . PHE C 2 79  ? 25.229  -1.042  57.213 1.00 96.96  ? 79  PHE B CG    1 
ATOM   3471 C CD1   . PHE C 2 79  ? 25.847  -2.167  57.746 1.00 97.02  ? 79  PHE B CD1   1 
ATOM   3472 C CD2   . PHE C 2 79  ? 25.392  -0.767  55.860 1.00 98.24  ? 79  PHE B CD2   1 
ATOM   3473 C CE1   . PHE C 2 79  ? 26.618  -3.007  56.945 1.00 98.61  ? 79  PHE B CE1   1 
ATOM   3474 C CE2   . PHE C 2 79  ? 26.161  -1.600  55.050 1.00 97.63  ? 79  PHE B CE2   1 
ATOM   3475 C CZ    . PHE C 2 79  ? 26.775  -2.723  55.594 1.00 94.84  ? 79  PHE B CZ    1 
ATOM   3476 N N     . PHE C 2 80  ? 25.569  2.843   57.651 1.00 102.13 ? 80  PHE B N     1 
ATOM   3477 C CA    . PHE C 2 80  ? 26.279  3.770   56.777 1.00 101.70 ? 80  PHE B CA    1 
ATOM   3478 C C     . PHE C 2 80  ? 27.542  4.280   57.461 1.00 104.84 ? 80  PHE B C     1 
ATOM   3479 O O     . PHE C 2 80  ? 28.605  4.359   56.840 1.00 102.28 ? 80  PHE B O     1 
ATOM   3480 C CB    . PHE C 2 80  ? 25.370  4.944   56.398 1.00 101.57 ? 80  PHE B CB    1 
ATOM   3481 C CG    . PHE C 2 80  ? 24.676  4.773   55.073 1.00 101.41 ? 80  PHE B CG    1 
ATOM   3482 C CD1   . PHE C 2 80  ? 24.072  3.565   54.735 1.00 103.02 ? 80  PHE B CD1   1 
ATOM   3483 C CD2   . PHE C 2 80  ? 24.620  5.825   54.165 1.00 97.87  ? 80  PHE B CD2   1 
ATOM   3484 C CE1   . PHE C 2 80  ? 23.423  3.407   53.509 1.00 97.70  ? 80  PHE B CE1   1 
ATOM   3485 C CE2   . PHE C 2 80  ? 23.973  5.677   52.938 1.00 93.72  ? 80  PHE B CE2   1 
ATOM   3486 C CZ    . PHE C 2 80  ? 23.374  4.466   52.610 1.00 91.96  ? 80  PHE B CZ    1 
ATOM   3487 N N     . ASN C 2 81  ? 27.425  4.621   58.742 1.00 107.19 ? 81  ASN B N     1 
ATOM   3488 C CA    . ASN C 2 81  ? 28.567  5.109   59.505 1.00 107.00 ? 81  ASN B CA    1 
ATOM   3489 C C     . ASN C 2 81  ? 29.658  4.046   59.554 1.00 104.96 ? 81  ASN B C     1 
ATOM   3490 O O     . ASN C 2 81  ? 30.833  4.340   59.337 1.00 105.12 ? 81  ASN B O     1 
ATOM   3491 C CB    . ASN C 2 81  ? 28.149  5.486   60.930 1.00 112.73 ? 81  ASN B CB    1 
ATOM   3492 C CG    . ASN C 2 81  ? 28.005  6.988   61.122 1.00 121.44 ? 81  ASN B CG    1 
ATOM   3493 O OD1   . ASN C 2 81  ? 28.640  7.576   61.998 1.00 129.52 ? 81  ASN B OD1   1 
ATOM   3494 N ND2   . ASN C 2 81  ? 27.160  7.612   60.310 1.00 121.54 ? 81  ASN B ND2   1 
ATOM   3495 N N     . LEU C 2 82  ? 29.263  2.809   59.836 1.00 101.07 ? 82  LEU B N     1 
ATOM   3496 C CA    . LEU C 2 82  ? 30.216  1.711   59.906 1.00 102.51 ? 82  LEU B CA    1 
ATOM   3497 C C     . LEU C 2 82  ? 31.036  1.611   58.626 1.00 105.01 ? 82  LEU B C     1 
ATOM   3498 O O     . LEU C 2 82  ? 32.188  1.177   58.653 1.00 108.65 ? 82  LEU B O     1 
ATOM   3499 C CB    . LEU C 2 82  ? 29.486  0.388   60.154 1.00 101.27 ? 82  LEU B CB    1 
ATOM   3500 C CG    . LEU C 2 82  ? 30.347  -0.879  60.090 1.00 105.75 ? 82  LEU B CG    1 
ATOM   3501 C CD1   . LEU C 2 82  ? 31.514  -0.768  61.062 1.00 110.07 ? 82  LEU B CD1   1 
ATOM   3502 C CD2   . LEU C 2 82  ? 29.491  -2.093  60.414 1.00 102.06 ? 82  LEU B CD2   1 
ATOM   3503 N N     . LEU C 2 83  ? 30.442  2.013   57.507 1.00 107.96 ? 83  LEU B N     1 
ATOM   3504 C CA    . LEU C 2 83  ? 31.132  1.967   56.221 1.00 110.66 ? 83  LEU B CA    1 
ATOM   3505 C C     . LEU C 2 83  ? 31.988  3.211   56.013 1.00 111.95 ? 83  LEU B C     1 
ATOM   3506 O O     . LEU C 2 83  ? 33.094  3.131   55.477 1.00 109.63 ? 83  LEU B O     1 
ATOM   3507 C CB    . LEU C 2 83  ? 30.125  1.843   55.073 1.00 109.59 ? 83  LEU B CB    1 
ATOM   3508 C CG    . LEU C 2 83  ? 29.252  0.587   55.018 1.00 108.76 ? 83  LEU B CG    1 
ATOM   3509 C CD1   . LEU C 2 83  ? 28.526  0.551   53.685 1.00 106.38 ? 83  LEU B CD1   1 
ATOM   3510 C CD2   . LEU C 2 83  ? 30.108  -0.660  55.180 1.00 108.05 ? 83  LEU B CD2   1 
ATOM   3511 N N     . ALA C 2 84  ? 31.469  4.359   56.434 1.00 113.79 ? 84  ALA B N     1 
ATOM   3512 C CA    . ALA C 2 84  ? 32.193  5.615   56.297 1.00 116.36 ? 84  ALA B CA    1 
ATOM   3513 C C     . ALA C 2 84  ? 33.449  5.593   57.164 1.00 119.31 ? 84  ALA B C     1 
ATOM   3514 O O     . ALA C 2 84  ? 34.520  6.012   56.728 1.00 119.72 ? 84  ALA B O     1 
ATOM   3515 C CB    . ALA C 2 84  ? 31.297  6.782   56.696 1.00 116.55 ? 84  ALA B CB    1 
ATOM   3516 N N     . GLN C 2 85  ? 33.311  5.096   58.389 1.00 121.00 ? 85  GLN B N     1 
ATOM   3517 C CA    . GLN C 2 85  ? 34.434  5.021   59.316 1.00 123.01 ? 85  GLN B CA    1 
ATOM   3518 C C     . GLN C 2 85  ? 35.591  4.220   58.727 1.00 124.02 ? 85  GLN B C     1 
ATOM   3519 O O     . GLN C 2 85  ? 36.730  4.336   59.182 1.00 126.92 ? 85  GLN B O     1 
ATOM   3520 C CB    . GLN C 2 85  ? 33.988  4.393   60.641 1.00 128.25 ? 85  GLN B CB    1 
ATOM   3521 C CG    . GLN C 2 85  ? 35.114  4.197   61.648 1.00 133.54 ? 85  GLN B CG    1 
ATOM   3522 C CD    . GLN C 2 85  ? 34.616  3.710   62.996 1.00 137.53 ? 85  GLN B CD    1 
ATOM   3523 O OE1   . GLN C 2 85  ? 33.902  4.424   63.701 1.00 137.26 ? 85  GLN B OE1   1 
ATOM   3524 N NE2   . GLN C 2 85  ? 34.987  2.488   63.359 1.00 137.94 ? 85  GLN B NE2   1 
ATOM   3525 N N     . LYS C 2 86  ? 35.297  3.406   57.718 1.00 120.72 ? 86  LYS B N     1 
ATOM   3526 C CA    . LYS C 2 86  ? 36.327  2.603   57.072 1.00 117.49 ? 86  LYS B CA    1 
ATOM   3527 C C     . LYS C 2 86  ? 36.950  3.402   55.934 1.00 115.97 ? 86  LYS B C     1 
ATOM   3528 O O     . LYS C 2 86  ? 37.555  2.850   55.015 1.00 113.46 ? 86  LYS B O     1 
ATOM   3529 C CB    . LYS C 2 86  ? 35.734  1.287   56.560 1.00 118.26 ? 86  LYS B CB    1 
ATOM   3530 C CG    . LYS C 2 86  ? 35.179  0.424   57.686 1.00 121.50 ? 86  LYS B CG    1 
ATOM   3531 C CD    . LYS C 2 86  ? 34.757  -0.962  57.227 1.00 121.39 ? 86  LYS B CD    1 
ATOM   3532 C CE    . LYS C 2 86  ? 34.231  -1.769  58.410 1.00 120.95 ? 86  LYS B CE    1 
ATOM   3533 N NZ    . LYS C 2 86  ? 33.889  -3.172  58.054 1.00 121.02 ? 86  LYS B NZ    1 
ATOM   3534 N N     . LEU C 2 87  ? 36.787  4.718   56.021 1.00 115.83 ? 87  LEU B N     1 
ATOM   3535 C CA    . LEU C 2 87  ? 37.324  5.664   55.050 1.00 118.41 ? 87  LEU B CA    1 
ATOM   3536 C C     . LEU C 2 87  ? 37.558  6.988   55.772 1.00 122.54 ? 87  LEU B C     1 
ATOM   3537 O O     . LEU C 2 87  ? 37.880  8.003   55.153 1.00 120.81 ? 87  LEU B O     1 
ATOM   3538 C CB    . LEU C 2 87  ? 36.344  5.869   53.892 1.00 120.60 ? 87  LEU B CB    1 
ATOM   3539 C CG    . LEU C 2 87  ? 36.150  4.722   52.897 1.00 121.54 ? 87  LEU B CG    1 
ATOM   3540 C CD1   . LEU C 2 87  ? 35.040  5.079   51.925 1.00 125.59 ? 87  LEU B CD1   1 
ATOM   3541 C CD2   . LEU C 2 87  ? 37.446  4.460   52.149 1.00 120.01 ? 87  LEU B CD2   1 
ATOM   3542 N N     . GLU C 2 88  ? 37.389  6.956   57.092 1.00 126.74 ? 88  GLU B N     1 
ATOM   3543 C CA    . GLU C 2 88  ? 37.578  8.126   57.944 1.00 127.64 ? 88  GLU B CA    1 
ATOM   3544 C C     . GLU C 2 88  ? 37.004  9.411   57.350 1.00 126.19 ? 88  GLU B C     1 
ATOM   3545 O O     . GLU C 2 88  ? 37.710  10.413  57.226 1.00 126.12 ? 88  GLU B O     1 
ATOM   3546 C CB    . GLU C 2 88  ? 39.066  8.325   58.247 1.00 133.27 ? 88  GLU B CB    1 
ATOM   3547 C CG    . GLU C 2 88  ? 39.668  7.323   59.228 1.00 138.48 ? 88  GLU B CG    1 
ATOM   3548 C CD    . GLU C 2 88  ? 39.849  5.939   58.634 1.00 142.61 ? 88  GLU B CD    1 
ATOM   3549 O OE1   . GLU C 2 88  ? 40.592  5.809   57.637 1.00 143.62 ? 88  GLU B OE1   1 
ATOM   3550 O OE2   . GLU C 2 88  ? 39.254  4.978   59.167 1.00 143.22 ? 88  GLU B OE2   1 
ATOM   3551 N N     . LEU C 2 89  ? 35.725  9.379   56.989 1.00 123.37 ? 89  LEU B N     1 
ATOM   3552 C CA    . LEU C 2 89  ? 35.063  10.547  56.417 1.00 122.33 ? 89  LEU B CA    1 
ATOM   3553 C C     . LEU C 2 89  ? 34.997  11.692  57.420 1.00 122.75 ? 89  LEU B C     1 
ATOM   3554 O O     . LEU C 2 89  ? 35.069  12.863  57.048 1.00 121.33 ? 89  LEU B O     1 
ATOM   3555 C CB    . LEU C 2 89  ? 33.640  10.198  55.971 1.00 123.88 ? 89  LEU B CB    1 
ATOM   3556 C CG    . LEU C 2 89  ? 33.450  9.480   54.635 1.00 127.27 ? 89  LEU B CG    1 
ATOM   3557 C CD1   . LEU C 2 89  ? 33.939  10.376  53.509 1.00 127.28 ? 89  LEU B CD1   1 
ATOM   3558 C CD2   . LEU C 2 89  ? 34.198  8.161   54.641 1.00 128.03 ? 89  LEU B CD2   1 
ATOM   3559 N N     . HIS C 2 90  ? 34.855  11.344  58.695 1.00 124.61 ? 90  HIS B N     1 
ATOM   3560 C CA    . HIS C 2 90  ? 34.768  12.335  59.762 1.00 127.72 ? 90  HIS B CA    1 
ATOM   3561 C C     . HIS C 2 90  ? 35.999  13.235  59.817 1.00 126.79 ? 90  HIS B C     1 
ATOM   3562 O O     . HIS C 2 90  ? 36.085  14.128  60.660 1.00 122.80 ? 90  HIS B O     1 
ATOM   3563 C CB    . HIS C 2 90  ? 34.598  11.633  61.114 1.00 134.51 ? 90  HIS B CB    1 
ATOM   3564 C CG    . HIS C 2 90  ? 35.756  10.762  61.494 1.00 139.45 ? 90  HIS B CG    1 
ATOM   3565 N ND1   . HIS C 2 90  ? 36.181  9.705   60.718 1.00 140.43 ? 90  HIS B ND1   1 
ATOM   3566 C CD2   . HIS C 2 90  ? 36.581  10.794  62.569 1.00 139.93 ? 90  HIS B CD2   1 
ATOM   3567 C CE1   . HIS C 2 90  ? 37.216  9.123   61.297 1.00 140.15 ? 90  HIS B CE1   1 
ATOM   3568 N NE2   . HIS C 2 90  ? 37.480  9.765   62.421 1.00 138.98 ? 90  HIS B NE2   1 
ATOM   3569 N N     . LYS C 2 91  ? 36.948  12.994  58.916 1.00 127.25 ? 91  LYS B N     1 
ATOM   3570 C CA    . LYS C 2 91  ? 38.180  13.773  58.868 1.00 126.08 ? 91  LYS B CA    1 
ATOM   3571 C C     . LYS C 2 91  ? 38.177  14.752  57.698 1.00 122.39 ? 91  LYS B C     1 
ATOM   3572 O O     . LYS C 2 91  ? 38.625  15.891  57.826 1.00 122.22 ? 91  LYS B O     1 
ATOM   3573 C CB    . LYS C 2 91  ? 39.387  12.838  58.732 1.00 129.85 ? 91  LYS B CB    1 
ATOM   3574 C CG    . LYS C 2 91  ? 39.348  11.611  59.636 1.00 136.37 ? 91  LYS B CG    1 
ATOM   3575 C CD    . LYS C 2 91  ? 40.591  10.743  59.457 1.00 136.65 ? 91  LYS B CD    1 
ATOM   3576 C CE    . LYS C 2 91  ? 41.779  11.268  60.244 1.00 136.31 ? 91  LYS B CE    1 
ATOM   3577 N NZ    . LYS C 2 91  ? 41.558  11.136  61.713 1.00 139.78 ? 91  LYS B NZ    1 
ATOM   3578 N N     . PHE C 2 92  ? 37.663  14.297  56.560 1.00 119.84 ? 92  PHE B N     1 
ATOM   3579 C CA    . PHE C 2 92  ? 37.620  15.105  55.345 1.00 117.77 ? 92  PHE B CA    1 
ATOM   3580 C C     . PHE C 2 92  ? 36.397  16.013  55.242 1.00 115.27 ? 92  PHE B C     1 
ATOM   3581 O O     . PHE C 2 92  ? 36.236  16.736  54.258 1.00 114.59 ? 92  PHE B O     1 
ATOM   3582 C CB    . PHE C 2 92  ? 37.675  14.182  54.127 1.00 118.13 ? 92  PHE B CB    1 
ATOM   3583 C CG    . PHE C 2 92  ? 38.696  13.088  54.246 1.00 118.47 ? 92  PHE B CG    1 
ATOM   3584 C CD1   . PHE C 2 92  ? 40.052  13.387  54.316 1.00 118.75 ? 92  PHE B CD1   1 
ATOM   3585 C CD2   . PHE C 2 92  ? 38.301  11.755  54.314 1.00 119.55 ? 92  PHE B CD2   1 
ATOM   3586 C CE1   . PHE C 2 92  ? 41.000  12.374  54.452 1.00 121.73 ? 92  PHE B CE1   1 
ATOM   3587 C CE2   . PHE C 2 92  ? 39.240  10.735  54.451 1.00 119.45 ? 92  PHE B CE2   1 
ATOM   3588 C CZ    . PHE C 2 92  ? 40.592  11.045  54.520 1.00 120.57 ? 92  PHE B CZ    1 
ATOM   3589 N N     . ILE C 2 93  ? 35.540  15.979  56.255 1.00 112.34 ? 93  ILE B N     1 
ATOM   3590 C CA    . ILE C 2 93  ? 34.335  16.800  56.262 1.00 112.98 ? 93  ILE B CA    1 
ATOM   3591 C C     . ILE C 2 93  ? 34.661  18.280  56.112 1.00 114.88 ? 93  ILE B C     1 
ATOM   3592 O O     . ILE C 2 93  ? 35.826  18.667  56.044 1.00 114.07 ? 93  ILE B O     1 
ATOM   3593 C CB    . ILE C 2 93  ? 33.554  16.621  57.572 1.00 117.53 ? 93  ILE B CB    1 
ATOM   3594 C CG1   . ILE C 2 93  ? 34.409  17.104  58.748 1.00 118.16 ? 93  ILE B CG1   1 
ATOM   3595 C CG2   . ILE C 2 93  ? 33.170  15.159  57.749 1.00 116.11 ? 93  ILE B CG2   1 
ATOM   3596 C CD1   . ILE C 2 93  ? 33.671  17.174  60.068 1.00 118.75 ? 93  ILE B CD1   1 
ATOM   3597 N N     . ARG C 2 94  ? 33.617  19.102  56.064 1.00 116.84 ? 94  ARG B N     1 
ATOM   3598 C CA    . ARG C 2 94  ? 33.766  20.552  55.942 1.00 120.33 ? 94  ARG B CA    1 
ATOM   3599 C C     . ARG C 2 94  ? 32.545  21.234  56.520 1.00 122.29 ? 94  ARG B C     1 
ATOM   3600 O O     . ARG C 2 94  ? 31.538  21.399  55.835 1.00 121.78 ? 94  ARG B O     1 
ATOM   3601 C CB    . ARG C 2 94  ? 33.935  20.974  54.484 1.00 119.99 ? 94  ARG B CB    1 
ATOM   3602 C CG    . ARG C 2 94  ? 35.286  20.643  53.907 1.00 123.91 ? 94  ARG B CG    1 
ATOM   3603 C CD    . ARG C 2 94  ? 35.418  21.180  52.505 1.00 134.35 ? 94  ARG B CD    1 
ATOM   3604 N NE    . ARG C 2 94  ? 36.540  20.566  51.805 1.00 144.74 ? 94  ARG B NE    1 
ATOM   3605 C CZ    . ARG C 2 94  ? 36.764  20.687  50.501 1.00 149.64 ? 94  ARG B CZ    1 
ATOM   3606 N NH1   . ARG C 2 94  ? 35.938  21.408  49.749 1.00 150.69 ? 94  ARG B NH1   1 
ATOM   3607 N NH2   . ARG C 2 94  ? 37.809  20.082  49.947 1.00 150.61 ? 94  ARG B NH2   1 
ATOM   3608 N N     . ILE C 2 95  ? 32.651  21.640  57.782 1.00 125.65 ? 95  ILE B N     1 
ATOM   3609 C CA    . ILE C 2 95  ? 31.548  22.285  58.485 1.00 127.71 ? 95  ILE B CA    1 
ATOM   3610 C C     . ILE C 2 95  ? 31.774  23.772  58.789 1.00 129.80 ? 95  ILE B C     1 
ATOM   3611 O O     . ILE C 2 95  ? 32.543  24.456  58.111 1.00 129.60 ? 95  ILE B O     1 
ATOM   3612 C CB    . ILE C 2 95  ? 31.253  21.550  59.825 1.00 127.48 ? 95  ILE B CB    1 
ATOM   3613 C CG1   . ILE C 2 95  ? 32.477  21.634  60.748 1.00 128.74 ? 95  ILE B CG1   1 
ATOM   3614 C CG2   . ILE C 2 95  ? 30.890  20.088  59.553 1.00 125.91 ? 95  ILE B CG2   1 
ATOM   3615 C CD1   . ILE C 2 95  ? 32.214  21.197  62.185 1.00 128.62 ? 95  ILE B CD1   1 
ATOM   3616 N N     . LYS C 2 96  ? 31.074  24.251  59.814 1.00 131.33 ? 96  LYS B N     1 
ATOM   3617 C CA    . LYS C 2 96  ? 31.151  25.632  60.284 1.00 132.17 ? 96  LYS B CA    1 
ATOM   3618 C C     . LYS C 2 96  ? 30.428  25.722  61.634 1.00 133.98 ? 96  LYS B C     1 
ATOM   3619 O O     . LYS C 2 96  ? 30.999  25.400  62.681 1.00 133.00 ? 96  LYS B O     1 
ATOM   3620 C CB    . LYS C 2 96  ? 30.494  26.591  59.280 1.00 129.75 ? 96  LYS B CB    1 
ATOM   3621 C CG    . LYS C 2 96  ? 30.286  28.014  59.818 1.00 130.55 ? 96  LYS B CG    1 
ATOM   3622 C CD    . LYS C 2 96  ? 29.420  28.867  58.888 1.00 129.52 ? 96  LYS B CD    1 
ATOM   3623 C CE    . LYS C 2 96  ? 30.253  29.828  58.028 1.00 127.97 ? 96  LYS B CE    1 
ATOM   3624 N NZ    . LYS C 2 96  ? 30.823  30.968  58.812 1.00 121.50 ? 96  LYS B NZ    1 
ATOM   3625 N N     . ARG C 2 97  ? 29.164  26.142  61.589 1.00 137.42 ? 97  ARG B N     1 
ATOM   3626 C CA    . ARG C 2 97  ? 28.318  26.302  62.775 1.00 140.64 ? 97  ARG B CA    1 
ATOM   3627 C C     . ARG C 2 97  ? 28.174  25.005  63.587 1.00 141.29 ? 97  ARG B C     1 
ATOM   3628 O O     . ARG C 2 97  ? 27.598  24.026  63.105 1.00 142.70 ? 97  ARG B O     1 
ATOM   3629 C CB    . ARG C 2 97  ? 26.915  26.777  62.358 1.00 141.20 ? 97  ARG B CB    1 
ATOM   3630 C CG    . ARG C 2 97  ? 26.868  27.956  61.373 1.00 137.97 ? 97  ARG B CG    1 
ATOM   3631 C CD    . ARG C 2 97  ? 25.445  28.140  60.820 1.00 133.92 ? 97  ARG B CD    1 
ATOM   3632 N NE    . ARG C 2 97  ? 24.498  28.582  61.843 1.00 126.14 ? 97  ARG B NE    1 
ATOM   3633 C CZ    . ARG C 2 97  ? 23.240  28.161  61.944 1.00 119.51 ? 97  ARG B CZ    1 
ATOM   3634 N NH1   . ARG C 2 97  ? 22.752  27.271  61.086 1.00 114.39 ? 97  ARG B NH1   1 
ATOM   3635 N NH2   . ARG C 2 97  ? 22.464  28.644  62.903 1.00 113.67 ? 97  ARG B NH2   1 
ATOM   3636 N N     . GLY C 2 98  ? 28.677  25.006  64.820 1.00 140.75 ? 98  GLY B N     1 
ATOM   3637 C CA    . GLY C 2 98  ? 28.579  23.820  65.657 1.00 140.46 ? 98  GLY B CA    1 
ATOM   3638 C C     . GLY C 2 98  ? 29.419  22.649  65.165 1.00 140.11 ? 98  GLY B C     1 
ATOM   3639 O O     . GLY C 2 98  ? 30.091  22.739  64.129 1.00 140.41 ? 98  GLY B O     1 
ATOM   3640 N N     . LYS C 2 99  ? 29.382  21.546  65.911 1.00 137.32 ? 99  LYS B N     1 
ATOM   3641 C CA    . LYS C 2 99  ? 30.145  20.353  65.553 1.00 133.16 ? 99  LYS B CA    1 
ATOM   3642 C C     . LYS C 2 99  ? 29.355  19.397  64.652 1.00 130.85 ? 99  LYS B C     1 
ATOM   3643 O O     . LYS C 2 99  ? 28.275  19.742  64.168 1.00 127.74 ? 99  LYS B O     1 
ATOM   3644 C CB    . LYS C 2 99  ? 30.641  19.628  66.818 1.00 127.57 ? 99  LYS B CB    1 
ATOM   3645 C CG    . LYS C 2 99  ? 29.751  19.781  68.046 1.00 123.48 ? 99  LYS B CG    1 
ATOM   3646 C CD    . LYS C 2 99  ? 29.890  21.164  68.668 1.00 119.72 ? 99  LYS B CD    1 
ATOM   3647 C CE    . LYS C 2 99  ? 28.919  21.364  69.817 1.00 113.15 ? 99  LYS B CE    1 
ATOM   3648 N NZ    . LYS C 2 99  ? 28.989  22.754  70.334 1.00 105.40 ? 99  LYS B NZ    1 
ATOM   3649 N N     . ILE C 2 100 ? 29.898  18.198  64.442 1.00 128.04 ? 100 ILE B N     1 
ATOM   3650 C CA    . ILE C 2 100 ? 29.302  17.189  63.563 1.00 122.82 ? 100 ILE B CA    1 
ATOM   3651 C C     . ILE C 2 100 ? 28.351  16.189  64.235 1.00 120.11 ? 100 ILE B C     1 
ATOM   3652 O O     . ILE C 2 100 ? 28.131  16.248  65.445 1.00 119.17 ? 100 ILE B O     1 
ATOM   3653 C CB    . ILE C 2 100 ? 30.429  16.401  62.853 1.00 123.43 ? 100 ILE B CB    1 
ATOM   3654 C CG1   . ILE C 2 100 ? 29.950  15.894  61.500 1.00 129.02 ? 100 ILE B CG1   1 
ATOM   3655 C CG2   . ILE C 2 100 ? 30.869  15.221  63.711 1.00 121.22 ? 100 ILE B CG2   1 
ATOM   3656 C CD1   . ILE C 2 100 ? 31.052  15.266  60.685 1.00 130.86 ? 100 ILE B CD1   1 
ATOM   3657 N N     . ASN C 2 101 ? 27.785  15.288  63.424 1.00 117.99 ? 101 ASN B N     1 
ATOM   3658 C CA    . ASN C 2 101 ? 26.871  14.230  63.885 1.00 115.24 ? 101 ASN B CA    1 
ATOM   3659 C C     . ASN C 2 101 ? 26.862  13.061  62.888 1.00 114.72 ? 101 ASN B C     1 
ATOM   3660 O O     . ASN C 2 101 ? 27.256  13.228  61.727 1.00 113.27 ? 101 ASN B O     1 
ATOM   3661 C CB    . ASN C 2 101 ? 25.436  14.766  64.091 1.00 113.92 ? 101 ASN B CB    1 
ATOM   3662 C CG    . ASN C 2 101 ? 24.768  15.220  62.797 1.00 110.46 ? 101 ASN B CG    1 
ATOM   3663 O OD1   . ASN C 2 101 ? 24.698  14.475  61.820 1.00 109.57 ? 101 ASN B OD1   1 
ATOM   3664 N ND2   . ASN C 2 101 ? 24.255  16.447  62.797 1.00 104.31 ? 101 ASN B ND2   1 
ATOM   3665 N N     . GLU C 2 102 ? 26.418  11.898  63.359 1.00 114.20 ? 102 GLU B N     1 
ATOM   3666 C CA    . GLU C 2 102 ? 26.352  10.681  62.554 1.00 112.62 ? 102 GLU B CA    1 
ATOM   3667 C C     . GLU C 2 102 ? 25.514  10.876  61.296 1.00 107.86 ? 102 GLU B C     1 
ATOM   3668 O O     . GLU C 2 102 ? 25.866  10.385  60.223 1.00 106.62 ? 102 GLU B O     1 
ATOM   3669 C CB    . GLU C 2 102 ? 25.765  9.545   63.394 1.00 117.30 ? 102 GLU B CB    1 
ATOM   3670 C CG    . GLU C 2 102 ? 26.473  9.350   64.728 1.00 130.10 ? 102 GLU B CG    1 
ATOM   3671 C CD    . GLU C 2 102 ? 25.716  8.434   65.670 1.00 137.14 ? 102 GLU B CD    1 
ATOM   3672 O OE1   . GLU C 2 102 ? 24.542  8.734   65.977 1.00 138.85 ? 102 GLU B OE1   1 
ATOM   3673 O OE2   . GLU C 2 102 ? 26.296  7.419   66.110 1.00 141.47 ? 102 GLU B OE2   1 
ATOM   3674 N N     . THR C 2 103 ? 24.403  11.590  61.437 1.00 102.40 ? 103 THR B N     1 
ATOM   3675 C CA    . THR C 2 103 ? 23.516  11.854  60.314 1.00 100.22 ? 103 THR B CA    1 
ATOM   3676 C C     . THR C 2 103 ? 24.310  12.425  59.147 1.00 101.31 ? 103 THR B C     1 
ATOM   3677 O O     . THR C 2 103 ? 24.324  11.853  58.056 1.00 104.97 ? 103 THR B O     1 
ATOM   3678 C CB    . THR C 2 103 ? 22.418  12.863  60.695 1.00 101.00 ? 103 THR B CB    1 
ATOM   3679 O OG1   . THR C 2 103 ? 21.714  12.391  61.850 1.00 103.71 ? 103 THR B OG1   1 
ATOM   3680 C CG2   . THR C 2 103 ? 21.436  13.038  59.546 1.00 99.72  ? 103 THR B CG2   1 
ATOM   3681 N N     . ILE C 2 104 ? 24.974  13.552  59.389 1.00 98.90  ? 104 ILE B N     1 
ATOM   3682 C CA    . ILE C 2 104 ? 25.774  14.215  58.363 1.00 95.78  ? 104 ILE B CA    1 
ATOM   3683 C C     . ILE C 2 104 ? 26.765  13.254  57.712 1.00 97.29  ? 104 ILE B C     1 
ATOM   3684 O O     . ILE C 2 104 ? 26.988  13.310  56.501 1.00 94.99  ? 104 ILE B O     1 
ATOM   3685 C CB    . ILE C 2 104 ? 26.553  15.414  58.948 1.00 99.91  ? 104 ILE B CB    1 
ATOM   3686 C CG1   . ILE C 2 104 ? 25.573  16.409  59.574 1.00 101.18 ? 104 ILE B CG1   1 
ATOM   3687 C CG2   . ILE C 2 104 ? 27.362  16.097  57.851 1.00 97.26  ? 104 ILE B CG2   1 
ATOM   3688 C CD1   . ILE C 2 104 ? 26.228  17.639  60.157 1.00 103.41 ? 104 ILE B CD1   1 
ATOM   3689 N N     . ILE C 2 105 ? 27.357  12.376  58.516 1.00 96.64  ? 105 ILE B N     1 
ATOM   3690 C CA    . ILE C 2 105 ? 28.310  11.401  57.998 1.00 99.28  ? 105 ILE B CA    1 
ATOM   3691 C C     . ILE C 2 105 ? 27.625  10.527  56.949 1.00 101.69 ? 105 ILE B C     1 
ATOM   3692 O O     . ILE C 2 105 ? 28.228  10.163  55.939 1.00 102.40 ? 105 ILE B O     1 
ATOM   3693 C CB    . ILE C 2 105 ? 28.857  10.491  59.125 1.00 106.01 ? 105 ILE B CB    1 
ATOM   3694 C CG1   . ILE C 2 105 ? 29.590  11.335  60.168 1.00 109.26 ? 105 ILE B CG1   1 
ATOM   3695 C CG2   . ILE C 2 105 ? 29.807  9.447   58.543 1.00 100.65 ? 105 ILE B CG2   1 
ATOM   3696 C CD1   . ILE C 2 105 ? 30.820  12.040  59.629 1.00 114.52 ? 105 ILE B CD1   1 
ATOM   3697 N N     . GLY C 2 106 ? 26.362  10.192  57.195 1.00 101.15 ? 106 GLY B N     1 
ATOM   3698 C CA    . GLY C 2 106 ? 25.622  9.372   56.252 1.00 97.92  ? 106 GLY B CA    1 
ATOM   3699 C C     . GLY C 2 106 ? 25.350  10.127  54.966 1.00 98.50  ? 106 GLY B C     1 
ATOM   3700 O O     . GLY C 2 106 ? 25.566  9.611   53.869 1.00 96.16  ? 106 GLY B O     1 
ATOM   3701 N N     . ASP C 2 107 ? 24.875  11.360  55.101 1.00 98.04  ? 107 ASP B N     1 
ATOM   3702 C CA    . ASP C 2 107 ? 24.578  12.191  53.944 1.00 100.44 ? 107 ASP B CA    1 
ATOM   3703 C C     . ASP C 2 107 ? 25.815  12.376  53.079 1.00 100.71 ? 107 ASP B C     1 
ATOM   3704 O O     . ASP C 2 107 ? 25.770  12.163  51.870 1.00 99.91  ? 107 ASP B O     1 
ATOM   3705 C CB    . ASP C 2 107 ? 24.058  13.556  54.393 1.00 110.14 ? 107 ASP B CB    1 
ATOM   3706 C CG    . ASP C 2 107 ? 22.727  13.466  55.108 1.00 120.57 ? 107 ASP B CG    1 
ATOM   3707 O OD1   . ASP C 2 107 ? 22.189  12.344  55.226 1.00 124.40 ? 107 ASP B OD1   1 
ATOM   3708 O OD2   . ASP C 2 107 ? 22.220  14.520  55.550 1.00 127.66 ? 107 ASP B OD2   1 
ATOM   3709 N N     . VAL C 2 108 ? 26.921  12.770  53.705 1.00 102.48 ? 108 VAL B N     1 
ATOM   3710 C CA    . VAL C 2 108 ? 28.167  12.953  52.978 1.00 101.55 ? 108 VAL B CA    1 
ATOM   3711 C C     . VAL C 2 108 ? 28.671  11.666  52.332 1.00 99.33  ? 108 VAL B C     1 
ATOM   3712 O O     . VAL C 2 108 ? 29.368  11.706  51.315 1.00 97.32  ? 108 VAL B O     1 
ATOM   3713 C CB    . VAL C 2 108 ? 29.271  13.548  53.903 1.00 106.46 ? 108 VAL B CB    1 
ATOM   3714 C CG1   . VAL C 2 108 ? 29.572  12.597  55.049 1.00 114.50 ? 108 VAL B CG1   1 
ATOM   3715 C CG2   . VAL C 2 108 ? 30.526  13.834  53.097 1.00 104.77 ? 108 VAL B CG2   1 
ATOM   3716 N N     . PHE C 2 109 ? 28.314  10.500  52.910 1.00 94.15  ? 109 PHE B N     1 
ATOM   3717 C CA    . PHE C 2 109 ? 28.707  9.217   52.345 1.00 92.59  ? 109 PHE B CA    1 
ATOM   3718 C C     . PHE C 2 109 ? 27.999  9.025   51.010 1.00 94.13  ? 109 PHE B C     1 
ATOM   3719 O O     . PHE C 2 109 ? 28.629  8.710   50.002 1.00 92.29  ? 109 PHE B O     1 
ATOM   3720 C CB    . PHE C 2 109 ? 28.340  8.075   53.288 1.00 92.19  ? 109 PHE B CB    1 
ATOM   3721 C CG    . PHE C 2 109 ? 28.708  6.720   52.759 1.00 100.35 ? 109 PHE B CG    1 
ATOM   3722 C CD1   . PHE C 2 109 ? 30.040  6.386   52.537 1.00 99.86  ? 109 PHE B CD1   1 
ATOM   3723 C CD2   . PHE C 2 109 ? 27.723  5.780   52.473 1.00 104.37 ? 109 PHE B CD2   1 
ATOM   3724 C CE1   . PHE C 2 109 ? 30.388  5.132   52.037 1.00 100.21 ? 109 PHE B CE1   1 
ATOM   3725 C CE2   . PHE C 2 109 ? 28.059  4.524   51.973 1.00 105.76 ? 109 PHE B CE2   1 
ATOM   3726 C CZ    . PHE C 2 109 ? 29.395  4.199   51.755 1.00 105.10 ? 109 PHE B CZ    1 
ATOM   3727 N N     . GLU C 2 110 ? 26.683  9.213   51.008 1.00 92.47  ? 110 GLU B N     1 
ATOM   3728 C CA    . GLU C 2 110 ? 25.907  9.074   49.785 1.00 90.62  ? 110 GLU B CA    1 
ATOM   3729 C C     . GLU C 2 110 ? 26.282  10.194  48.824 1.00 88.51  ? 110 GLU B C     1 
ATOM   3730 O O     . GLU C 2 110 ? 26.366  9.988   47.614 1.00 81.63  ? 110 GLU B O     1 
ATOM   3731 C CB    . GLU C 2 110 ? 24.405  9.106   50.098 1.00 93.97  ? 110 GLU B CB    1 
ATOM   3732 C CG    . GLU C 2 110 ? 23.996  10.111  51.162 1.00 103.84 ? 110 GLU B CG    1 
ATOM   3733 C CD    . GLU C 2 110 ? 22.563  9.901   51.631 1.00 103.55 ? 110 GLU B CD    1 
ATOM   3734 O OE1   . GLU C 2 110 ? 22.179  8.719   51.811 1.00 97.07  ? 110 GLU B OE1   1 
ATOM   3735 O OE2   . GLU C 2 110 ? 21.831  10.908  51.804 1.00 100.25 ? 110 GLU B OE2   1 
ATOM   3736 N N     . ALA C 2 111 ? 26.519  11.378  49.377 1.00 90.19  ? 111 ALA B N     1 
ATOM   3737 C CA    . ALA C 2 111 ? 26.904  12.532  48.576 1.00 91.79  ? 111 ALA B CA    1 
ATOM   3738 C C     . ALA C 2 111 ? 28.266  12.277  47.940 1.00 96.42  ? 111 ALA B C     1 
ATOM   3739 O O     . ALA C 2 111 ? 28.608  12.877  46.921 1.00 98.35  ? 111 ALA B O     1 
ATOM   3740 C CB    . ALA C 2 111 ? 26.929  13.809  49.420 1.00 95.68  ? 111 ALA B CB    1 
ATOM   3741 N N     . LEU C 2 112 ? 29.038  11.382  48.550 1.00 98.31  ? 112 LEU B N     1 
ATOM   3742 C CA    . LEU C 2 112 ? 30.362  11.037  48.048 1.00 100.75 ? 112 LEU B CA    1 
ATOM   3743 C C     . LEU C 2 112 ? 30.269  10.238  46.753 1.00 106.15 ? 112 LEU B C     1 
ATOM   3744 O O     . LEU C 2 112 ? 30.763  10.672  45.712 1.00 106.15 ? 112 LEU B O     1 
ATOM   3745 C CB    . LEU C 2 112 ? 31.160  10.251  49.091 1.00 107.41 ? 112 LEU B CB    1 
ATOM   3746 C CG    . LEU C 2 112 ? 32.484  9.658   48.643 1.00 109.71 ? 112 LEU B CG    1 
ATOM   3747 C CD1   . LEU C 2 112 ? 33.500  10.767  48.380 1.00 108.15 ? 112 LEU B CD1   1 
ATOM   3748 C CD2   . LEU C 2 112 ? 33.006  8.680   49.684 1.00 110.87 ? 112 LEU B CD2   1 
ATOM   3749 N N     . TRP C 2 113 ? 29.634  9.070   46.823 1.00 108.51 ? 113 TRP B N     1 
ATOM   3750 C CA    . TRP C 2 113 ? 29.489  8.213   45.652 1.00 108.09 ? 113 TRP B CA    1 
ATOM   3751 C C     . TRP C 2 113 ? 28.693  8.874   44.537 1.00 110.16 ? 113 TRP B C     1 
ATOM   3752 O O     . TRP C 2 113 ? 28.797  8.482   43.374 1.00 110.79 ? 113 TRP B O     1 
ATOM   3753 C CB    . TRP C 2 113 ? 28.848  6.883   46.044 1.00 113.92 ? 113 TRP B CB    1 
ATOM   3754 C CG    . TRP C 2 113 ? 29.748  6.052   46.894 1.00 121.89 ? 113 TRP B CG    1 
ATOM   3755 C CD1   . TRP C 2 113 ? 29.834  6.064   48.255 1.00 124.09 ? 113 TRP B CD1   1 
ATOM   3756 C CD2   . TRP C 2 113 ? 30.738  5.125   46.436 1.00 126.14 ? 113 TRP B CD2   1 
ATOM   3757 N NE1   . TRP C 2 113 ? 30.818  5.201   48.674 1.00 127.45 ? 113 TRP B NE1   1 
ATOM   3758 C CE2   . TRP C 2 113 ? 31.389  4.611   47.578 1.00 126.64 ? 113 TRP B CE2   1 
ATOM   3759 C CE3   . TRP C 2 113 ? 31.140  4.679   45.169 1.00 128.22 ? 113 TRP B CE3   1 
ATOM   3760 C CZ2   . TRP C 2 113 ? 32.422  3.672   47.493 1.00 128.81 ? 113 TRP B CZ2   1 
ATOM   3761 C CZ3   . TRP C 2 113 ? 32.169  3.744   45.085 1.00 126.83 ? 113 TRP B CZ3   1 
ATOM   3762 C CH2   . TRP C 2 113 ? 32.797  3.251   46.241 1.00 126.27 ? 113 TRP B CH2   1 
ATOM   3763 N N     . ALA C 2 114 ? 27.895  9.875   44.891 1.00 107.83 ? 114 ALA B N     1 
ATOM   3764 C CA    . ALA C 2 114 ? 27.122  10.598  43.895 1.00 103.94 ? 114 ALA B CA    1 
ATOM   3765 C C     . ALA C 2 114 ? 28.111  11.323  43.021 1.00 105.92 ? 114 ALA B C     1 
ATOM   3766 O O     . ALA C 2 114 ? 27.919  11.409  41.797 1.00 104.77 ? 114 ALA B O     1 
ATOM   3767 C CB    . ALA C 2 114 ? 26.135  11.569  44.542 1.00 101.81 ? 114 ALA B CB    1 
ATOM   3768 N N     . ALA C 2 115 ? 29.165  11.830  43.643 1.00 106.24 ? 115 ALA B N     1 
ATOM   3769 C CA    . ALA C 2 115 ? 30.248  12.521  42.958 1.00 102.62 ? 115 ALA B CA    1 
ATOM   3770 C C     . ALA C 2 115 ? 31.004  11.559  42.051 1.00 101.02 ? 115 ALA B C     1 
ATOM   3771 O O     . ALA C 2 115 ? 31.132  11.800  40.851 1.00 99.68  ? 115 ALA B O     1 
ATOM   3772 C CB    . ALA C 2 115 ? 31.198  13.171  43.945 1.00 109.63 ? 115 ALA B CB    1 
ATOM   3773 N N     . VAL C 2 116 ? 31.501  10.470  42.630 1.00 98.42  ? 116 VAL B N     1 
ATOM   3774 C CA    . VAL C 2 116 ? 32.243  9.473   41.867 1.00 101.74 ? 116 VAL B CA    1 
ATOM   3775 C C     . VAL C 2 116 ? 31.464  9.105   40.609 1.00 108.97 ? 116 VAL B C     1 
ATOM   3776 O O     . VAL C 2 116 ? 32.018  9.069   39.508 1.00 109.66 ? 116 VAL B O     1 
ATOM   3777 C CB    . VAL C 2 116 ? 32.476  8.190   42.693 1.00 99.25  ? 116 VAL B CB    1 
ATOM   3778 C CG1   . VAL C 2 116 ? 33.299  7.198   41.891 1.00 95.01  ? 116 VAL B CG1   1 
ATOM   3779 C CG2   . VAL C 2 116 ? 33.178  8.529   43.992 1.00 102.77 ? 116 VAL B CG2   1 
ATOM   3780 N N     . TYR C 2 117 ? 30.173  8.840   40.786 1.00 111.24 ? 117 TYR B N     1 
ATOM   3781 C CA    . TYR C 2 117 ? 29.293  8.476   39.682 1.00 110.92 ? 117 TYR B CA    1 
ATOM   3782 C C     . TYR C 2 117 ? 29.382  9.472   38.527 1.00 116.93 ? 117 TYR B C     1 
ATOM   3783 O O     . TYR C 2 117 ? 29.625  9.086   37.383 1.00 118.38 ? 117 TYR B O     1 
ATOM   3784 C CB    . TYR C 2 117 ? 27.848  8.388   40.180 1.00 107.52 ? 117 TYR B CB    1 
ATOM   3785 C CG    . TYR C 2 117 ? 26.829  8.184   39.085 1.00 103.84 ? 117 TYR B CG    1 
ATOM   3786 C CD1   . TYR C 2 117 ? 26.860  7.049   38.277 1.00 104.41 ? 117 TYR B CD1   1 
ATOM   3787 C CD2   . TYR C 2 117 ? 25.837  9.132   38.849 1.00 103.13 ? 117 TYR B CD2   1 
ATOM   3788 C CE1   . TYR C 2 117 ? 25.926  6.864   37.259 1.00 106.81 ? 117 TYR B CE1   1 
ATOM   3789 C CE2   . TYR C 2 117 ? 24.900  8.958   37.836 1.00 108.14 ? 117 TYR B CE2   1 
ATOM   3790 C CZ    . TYR C 2 117 ? 24.949  7.823   37.044 1.00 107.59 ? 117 TYR B CZ    1 
ATOM   3791 O OH    . TYR C 2 117 ? 24.026  7.652   36.037 1.00 108.67 ? 117 TYR B OH    1 
ATOM   3792 N N     . ILE C 2 118 ? 29.185  10.753  38.827 1.00 119.07 ? 118 ILE B N     1 
ATOM   3793 C CA    . ILE C 2 118 ? 29.244  11.788  37.800 1.00 119.81 ? 118 ILE B CA    1 
ATOM   3794 C C     . ILE C 2 118 ? 30.672  12.011  37.316 1.00 123.69 ? 118 ILE B C     1 
ATOM   3795 O O     . ILE C 2 118 ? 30.907  12.243  36.129 1.00 125.16 ? 118 ILE B O     1 
ATOM   3796 C CB    . ILE C 2 118 ? 28.692  13.138  38.320 1.00 119.43 ? 118 ILE B CB    1 
ATOM   3797 C CG1   . ILE C 2 118 ? 27.213  12.994  38.689 1.00 116.51 ? 118 ILE B CG1   1 
ATOM   3798 C CG2   . ILE C 2 118 ? 28.865  14.215  37.255 1.00 116.51 ? 118 ILE B CG2   1 
ATOM   3799 C CD1   . ILE C 2 118 ? 26.578  14.276  39.190 1.00 108.82 ? 118 ILE B CD1   1 
ATOM   3800 N N     . ASP C 2 119 ? 31.620  11.933  38.243 1.00 125.09 ? 119 ASP B N     1 
ATOM   3801 C CA    . ASP C 2 119 ? 33.028  12.140  37.928 1.00 123.74 ? 119 ASP B CA    1 
ATOM   3802 C C     . ASP C 2 119 ? 33.540  11.141  36.891 1.00 122.09 ? 119 ASP B C     1 
ATOM   3803 O O     . ASP C 2 119 ? 34.256  11.515  35.963 1.00 121.11 ? 119 ASP B O     1 
ATOM   3804 C CB    . ASP C 2 119 ? 33.864  12.036  39.208 1.00 129.56 ? 119 ASP B CB    1 
ATOM   3805 C CG    . ASP C 2 119 ? 35.249  12.632  39.052 1.00 131.65 ? 119 ASP B CG    1 
ATOM   3806 O OD1   . ASP C 2 119 ? 35.350  13.852  38.802 1.00 129.35 ? 119 ASP B OD1   1 
ATOM   3807 O OD2   . ASP C 2 119 ? 36.238  11.881  39.181 1.00 133.87 ? 119 ASP B OD2   1 
ATOM   3808 N N     . SER C 2 120 ? 33.173  9.873   37.048 1.00 120.20 ? 120 SER B N     1 
ATOM   3809 C CA    . SER C 2 120 ? 33.610  8.839   36.116 1.00 119.84 ? 120 SER B CA    1 
ATOM   3810 C C     . SER C 2 120 ? 32.862  8.946   34.795 1.00 121.15 ? 120 SER B C     1 
ATOM   3811 O O     . SER C 2 120 ? 33.168  8.234   33.839 1.00 121.14 ? 120 SER B O     1 
ATOM   3812 C CB    . SER C 2 120 ? 33.384  7.447   36.711 1.00 122.46 ? 120 SER B CB    1 
ATOM   3813 O OG    . SER C 2 120 ? 32.002  7.158   36.823 1.00 125.87 ? 120 SER B OG    1 
ATOM   3814 N N     . GLY C 2 121 ? 31.877  9.837   34.750 1.00 122.82 ? 121 GLY B N     1 
ATOM   3815 C CA    . GLY C 2 121 ? 31.099  10.020  33.538 1.00 121.23 ? 121 GLY B CA    1 
ATOM   3816 C C     . GLY C 2 121 ? 29.789  9.256   33.567 1.00 124.11 ? 121 GLY B C     1 
ATOM   3817 O O     . GLY C 2 121 ? 29.428  8.592   32.594 1.00 125.46 ? 121 GLY B O     1 
ATOM   3818 N N     . ARG C 2 122 ? 29.080  9.344   34.690 1.00 124.08 ? 122 ARG B N     1 
ATOM   3819 C CA    . ARG C 2 122 ? 27.797  8.666   34.848 1.00 120.38 ? 122 ARG B CA    1 
ATOM   3820 C C     . ARG C 2 122 ? 27.938  7.162   34.614 1.00 119.53 ? 122 ARG B C     1 
ATOM   3821 O O     . ARG C 2 122 ? 26.982  6.495   34.211 1.00 115.77 ? 122 ARG B O     1 
ATOM   3822 C CB    . ARG C 2 122 ? 26.780  9.237   33.852 1.00 121.71 ? 122 ARG B CB    1 
ATOM   3823 C CG    . ARG C 2 122 ? 26.599  10.750  33.904 1.00 118.00 ? 122 ARG B CG    1 
ATOM   3824 C CD    . ARG C 2 122 ? 25.739  11.190  35.080 1.00 118.75 ? 122 ARG B CD    1 
ATOM   3825 N NE    . ARG C 2 122 ? 25.483  12.629  35.048 1.00 118.95 ? 122 ARG B NE    1 
ATOM   3826 C CZ    . ARG C 2 122 ? 24.663  13.268  35.879 1.00 118.79 ? 122 ARG B CZ    1 
ATOM   3827 N NH1   . ARG C 2 122 ? 24.007  12.600  36.817 1.00 119.68 ? 122 ARG B NH1   1 
ATOM   3828 N NH2   . ARG C 2 122 ? 24.499  14.580  35.772 1.00 115.66 ? 122 ARG B NH2   1 
ATOM   3829 N N     . ASP C 2 123 ? 29.129  6.630   34.867 1.00 118.94 ? 123 ASP B N     1 
ATOM   3830 C CA    . ASP C 2 123 ? 29.377  5.207   34.668 1.00 122.93 ? 123 ASP B CA    1 
ATOM   3831 C C     . ASP C 2 123 ? 28.890  4.395   35.868 1.00 126.82 ? 123 ASP B C     1 
ATOM   3832 O O     . ASP C 2 123 ? 29.585  4.285   36.880 1.00 129.59 ? 123 ASP B O     1 
ATOM   3833 C CB    . ASP C 2 123 ? 30.873  4.962   34.446 1.00 122.73 ? 123 ASP B CB    1 
ATOM   3834 C CG    . ASP C 2 123 ? 31.147  3.680   33.679 1.00 121.87 ? 123 ASP B CG    1 
ATOM   3835 O OD1   . ASP C 2 123 ? 30.663  2.611   34.108 1.00 122.23 ? 123 ASP B OD1   1 
ATOM   3836 O OD2   . ASP C 2 123 ? 31.850  3.742   32.646 1.00 115.92 ? 123 ASP B OD2   1 
ATOM   3837 N N     . ALA C 2 124 ? 27.694  3.826   35.745 1.00 128.03 ? 124 ALA B N     1 
ATOM   3838 C CA    . ALA C 2 124 ? 27.105  3.026   36.817 1.00 125.06 ? 124 ALA B CA    1 
ATOM   3839 C C     . ALA C 2 124 ? 27.888  1.739   37.059 1.00 124.34 ? 124 ALA B C     1 
ATOM   3840 O O     . ALA C 2 124 ? 28.506  1.572   38.111 1.00 124.21 ? 124 ALA B O     1 
ATOM   3841 C CB    . ALA C 2 124 ? 25.651  2.701   36.486 1.00 124.26 ? 124 ALA B CB    1 
ATOM   3842 N N     . ASN C 2 125 ? 27.856  0.836   36.082 1.00 124.13 ? 125 ASN B N     1 
ATOM   3843 C CA    . ASN C 2 125 ? 28.557  -0.442  36.177 1.00 121.50 ? 125 ASN B CA    1 
ATOM   3844 C C     . ASN C 2 125 ? 29.929  -0.293  36.823 1.00 122.33 ? 125 ASN B C     1 
ATOM   3845 O O     . ASN C 2 125 ? 30.363  -1.156  37.588 1.00 124.29 ? 125 ASN B O     1 
ATOM   3846 C CB    . ASN C 2 125 ? 28.705  -1.069  34.788 1.00 117.48 ? 125 ASN B CB    1 
ATOM   3847 C CG    . ASN C 2 125 ? 27.371  -1.471  34.185 1.00 114.92 ? 125 ASN B CG    1 
ATOM   3848 O OD1   . ASN C 2 125 ? 26.626  -2.259  34.767 1.00 111.34 ? 125 ASN B OD1   1 
ATOM   3849 N ND2   . ASN C 2 125 ? 27.066  -0.933  33.010 1.00 113.79 ? 125 ASN B ND2   1 
ATOM   3850 N N     . PHE C 2 126 ? 30.610  0.804   36.510 1.00 118.77 ? 126 PHE B N     1 
ATOM   3851 C CA    . PHE C 2 126 ? 31.925  1.065   37.079 1.00 117.43 ? 126 PHE B CA    1 
ATOM   3852 C C     . PHE C 2 126 ? 31.794  1.300   38.577 1.00 117.42 ? 126 PHE B C     1 
ATOM   3853 O O     . PHE C 2 126 ? 32.204  0.466   39.385 1.00 117.44 ? 126 PHE B O     1 
ATOM   3854 C CB    . PHE C 2 126 ? 32.557  2.295   36.416 1.00 123.81 ? 126 PHE B CB    1 
ATOM   3855 C CG    . PHE C 2 126 ? 33.745  2.846   37.161 1.00 129.29 ? 126 PHE B CG    1 
ATOM   3856 C CD1   . PHE C 2 126 ? 34.853  2.046   37.426 1.00 128.24 ? 126 PHE B CD1   1 
ATOM   3857 C CD2   . PHE C 2 126 ? 33.750  4.165   37.606 1.00 132.29 ? 126 PHE B CD2   1 
ATOM   3858 C CE1   . PHE C 2 126 ? 35.948  2.551   38.126 1.00 128.39 ? 126 PHE B CE1   1 
ATOM   3859 C CE2   . PHE C 2 126 ? 34.840  4.681   38.307 1.00 133.27 ? 126 PHE B CE2   1 
ATOM   3860 C CZ    . PHE C 2 126 ? 35.940  3.871   38.568 1.00 131.71 ? 126 PHE B CZ    1 
ATOM   3861 N N     . THR C 2 127 ? 31.210  2.440   38.935 1.00 114.15 ? 127 THR B N     1 
ATOM   3862 C CA    . THR C 2 127 ? 31.023  2.808   40.333 1.00 110.05 ? 127 THR B CA    1 
ATOM   3863 C C     . THR C 2 127 ? 30.490  1.640   41.157 1.00 109.64 ? 127 THR B C     1 
ATOM   3864 O O     . THR C 2 127 ? 30.817  1.506   42.335 1.00 109.32 ? 127 THR B O     1 
ATOM   3865 C CB    . THR C 2 127 ? 30.058  4.006   40.467 1.00 112.29 ? 127 THR B CB    1 
ATOM   3866 O OG1   . THR C 2 127 ? 30.559  5.114   39.707 1.00 107.85 ? 127 THR B OG1   1 
ATOM   3867 C CG2   . THR C 2 127 ? 29.932  4.425   41.924 1.00 113.61 ? 127 THR B CG2   1 
ATOM   3868 N N     . ARG C 2 128 ? 29.675  0.793   40.534 1.00 109.83 ? 128 ARG B N     1 
ATOM   3869 C CA    . ARG C 2 128 ? 29.112  -0.365  41.221 1.00 110.37 ? 128 ARG B CA    1 
ATOM   3870 C C     . ARG C 2 128 ? 30.217  -1.255  41.778 1.00 111.95 ? 128 ARG B C     1 
ATOM   3871 O O     . ARG C 2 128 ? 30.290  -1.494  42.985 1.00 108.58 ? 128 ARG B O     1 
ATOM   3872 C CB    . ARG C 2 128 ? 28.237  -1.184  40.270 1.00 114.67 ? 128 ARG B CB    1 
ATOM   3873 C CG    . ARG C 2 128 ? 27.680  -2.446  40.909 1.00 116.50 ? 128 ARG B CG    1 
ATOM   3874 C CD    . ARG C 2 128 ? 26.866  -3.275  39.935 1.00 119.25 ? 128 ARG B CD    1 
ATOM   3875 N NE    . ARG C 2 128 ? 27.656  -3.713  38.790 1.00 120.61 ? 128 ARG B NE    1 
ATOM   3876 C CZ    . ARG C 2 128 ? 27.196  -4.511  37.832 1.00 121.97 ? 128 ARG B CZ    1 
ATOM   3877 N NH1   . ARG C 2 128 ? 25.950  -4.962  37.885 1.00 120.32 ? 128 ARG B NH1   1 
ATOM   3878 N NH2   . ARG C 2 128 ? 27.980  -4.857  36.820 1.00 120.89 ? 128 ARG B NH2   1 
ATOM   3879 N N     . GLU C 2 129 ? 31.072  -1.750  40.887 1.00 113.68 ? 129 GLU B N     1 
ATOM   3880 C CA    . GLU C 2 129 ? 32.175  -2.611  41.287 1.00 112.26 ? 129 GLU B CA    1 
ATOM   3881 C C     . GLU C 2 129 ? 33.120  -1.870  42.218 1.00 111.13 ? 129 GLU B C     1 
ATOM   3882 O O     . GLU C 2 129 ? 33.654  -2.449  43.165 1.00 113.70 ? 129 GLU B O     1 
ATOM   3883 C CB    . GLU C 2 129 ? 32.934  -3.116  40.059 1.00 111.80 ? 129 GLU B CB    1 
ATOM   3884 C CG    . GLU C 2 129 ? 32.568  -4.536  39.663 1.00 113.33 ? 129 GLU B CG    1 
ATOM   3885 C CD    . GLU C 2 129 ? 31.085  -4.713  39.391 1.00 117.83 ? 129 GLU B CD    1 
ATOM   3886 O OE1   . GLU C 2 129 ? 30.360  -3.700  39.291 1.00 119.06 ? 129 GLU B OE1   1 
ATOM   3887 O OE2   . GLU C 2 129 ? 30.643  -5.874  39.271 1.00 118.43 ? 129 GLU B OE2   1 
ATOM   3888 N N     . LEU C 2 130 ? 33.323  -0.586  41.947 1.00 105.75 ? 130 LEU B N     1 
ATOM   3889 C CA    . LEU C 2 130 ? 34.192  0.224   42.782 1.00 102.59 ? 130 LEU B CA    1 
ATOM   3890 C C     . LEU C 2 130 ? 33.593  0.292   44.180 1.00 105.38 ? 130 LEU B C     1 
ATOM   3891 O O     . LEU C 2 130 ? 34.294  0.563   45.153 1.00 108.10 ? 130 LEU B O     1 
ATOM   3892 C CB    . LEU C 2 130 ? 34.322  1.635   42.208 1.00 103.14 ? 130 LEU B CB    1 
ATOM   3893 C CG    . LEU C 2 130 ? 35.093  2.641   43.068 1.00 103.23 ? 130 LEU B CG    1 
ATOM   3894 C CD1   . LEU C 2 130 ? 36.502  2.131   43.330 1.00 108.22 ? 130 LEU B CD1   1 
ATOM   3895 C CD2   . LEU C 2 130 ? 35.134  3.983   42.361 1.00 106.35 ? 130 LEU B CD2   1 
ATOM   3896 N N     . PHE C 2 131 ? 32.291  0.039   44.271 1.00 104.05 ? 131 PHE B N     1 
ATOM   3897 C CA    . PHE C 2 131 ? 31.594  0.072   45.549 1.00 102.14 ? 131 PHE B CA    1 
ATOM   3898 C C     . PHE C 2 131 ? 31.715  -1.267  46.265 1.00 107.96 ? 131 PHE B C     1 
ATOM   3899 O O     . PHE C 2 131 ? 31.939  -1.316  47.474 1.00 109.77 ? 131 PHE B O     1 
ATOM   3900 C CB    . PHE C 2 131 ? 30.117  0.428   45.336 1.00 96.35  ? 131 PHE B CB    1 
ATOM   3901 C CG    . PHE C 2 131 ? 29.325  0.531   46.611 1.00 87.11  ? 131 PHE B CG    1 
ATOM   3902 C CD1   . PHE C 2 131 ? 28.837  -0.610  47.240 1.00 81.55  ? 131 PHE B CD1   1 
ATOM   3903 C CD2   . PHE C 2 131 ? 29.081  1.771   47.192 1.00 89.23  ? 131 PHE B CD2   1 
ATOM   3904 C CE1   . PHE C 2 131 ? 28.119  -0.519  48.430 1.00 79.23  ? 131 PHE B CE1   1 
ATOM   3905 C CE2   . PHE C 2 131 ? 28.364  1.875   48.383 1.00 86.95  ? 131 PHE B CE2   1 
ATOM   3906 C CZ    . PHE C 2 131 ? 27.883  0.727   49.003 1.00 86.59  ? 131 PHE B CZ    1 
ATOM   3907 N N     . TYR C 2 132 ? 31.571  -2.354  45.516 1.00 112.06 ? 132 TYR B N     1 
ATOM   3908 C CA    . TYR C 2 132 ? 31.671  -3.685  46.098 1.00 116.43 ? 132 TYR B CA    1 
ATOM   3909 C C     . TYR C 2 132 ? 33.114  -4.032  46.442 1.00 118.04 ? 132 TYR B C     1 
ATOM   3910 O O     . TYR C 2 132 ? 33.371  -4.856  47.319 1.00 117.75 ? 132 TYR B O     1 
ATOM   3911 C CB    . TYR C 2 132 ? 31.106  -4.727  45.132 1.00 120.85 ? 132 TYR B CB    1 
ATOM   3912 C CG    . TYR C 2 132 ? 29.611  -4.629  44.935 1.00 122.07 ? 132 TYR B CG    1 
ATOM   3913 C CD1   . TYR C 2 132 ? 28.738  -4.770  46.012 1.00 121.99 ? 132 TYR B CD1   1 
ATOM   3914 C CD2   . TYR C 2 132 ? 29.067  -4.412  43.672 1.00 122.31 ? 132 TYR B CD2   1 
ATOM   3915 C CE1   . TYR C 2 132 ? 27.364  -4.699  45.834 1.00 123.92 ? 132 TYR B CE1   1 
ATOM   3916 C CE2   . TYR C 2 132 ? 27.693  -4.342  43.485 1.00 124.38 ? 132 TYR B CE2   1 
ATOM   3917 C CZ    . TYR C 2 132 ? 26.849  -4.487  44.570 1.00 126.31 ? 132 TYR B CZ    1 
ATOM   3918 O OH    . TYR C 2 132 ? 25.488  -4.433  44.389 1.00 130.57 ? 132 TYR B OH    1 
ATOM   3919 N N     . LYS C 2 133 ? 34.051  -3.394  45.749 1.00 118.02 ? 133 LYS B N     1 
ATOM   3920 C CA    . LYS C 2 133 ? 35.468  -3.636  45.978 1.00 117.62 ? 133 LYS B CA    1 
ATOM   3921 C C     . LYS C 2 133 ? 35.828  -3.467  47.452 1.00 119.45 ? 133 LYS B C     1 
ATOM   3922 O O     . LYS C 2 133 ? 36.617  -4.240  47.999 1.00 123.34 ? 133 LYS B O     1 
ATOM   3923 C CB    . LYS C 2 133 ? 36.311  -2.683  45.122 1.00 121.55 ? 133 LYS B CB    1 
ATOM   3924 C CG    . LYS C 2 133 ? 37.818  -2.886  45.253 1.00 124.10 ? 133 LYS B CG    1 
ATOM   3925 C CD    . LYS C 2 133 ? 38.602  -1.990  44.296 1.00 123.73 ? 133 LYS B CD    1 
ATOM   3926 C CE    . LYS C 2 133 ? 38.410  -0.510  44.606 1.00 122.46 ? 133 LYS B CE    1 
ATOM   3927 N NZ    . LYS C 2 133 ? 38.934  -0.143  45.949 1.00 127.32 ? 133 LYS B NZ    1 
ATOM   3928 N N     . LEU C 2 134 ? 35.243  -2.465  48.100 1.00 113.76 ? 134 LEU B N     1 
ATOM   3929 C CA    . LEU C 2 134 ? 35.532  -2.220  49.507 1.00 108.67 ? 134 LEU B CA    1 
ATOM   3930 C C     . LEU C 2 134 ? 34.311  -2.167  50.420 1.00 107.81 ? 134 LEU B C     1 
ATOM   3931 O O     . LEU C 2 134 ? 34.273  -1.373  51.360 1.00 107.93 ? 134 LEU B O     1 
ATOM   3932 C CB    . LEU C 2 134 ? 36.347  -0.930  49.665 1.00 105.48 ? 134 LEU B CB    1 
ATOM   3933 C CG    . LEU C 2 134 ? 35.831  0.353   49.008 1.00 101.56 ? 134 LEU B CG    1 
ATOM   3934 C CD1   . LEU C 2 134 ? 36.543  1.559   49.600 1.00 96.61  ? 134 LEU B CD1   1 
ATOM   3935 C CD2   . LEU C 2 134 ? 36.052  0.280   47.507 1.00 97.77  ? 134 LEU B CD2   1 
ATOM   3936 N N     . PHE C 2 135 ? 33.325  -3.020  50.154 1.00 104.21 ? 135 PHE B N     1 
ATOM   3937 C CA    . PHE C 2 135 ? 32.106  -3.067  50.963 1.00 99.30  ? 135 PHE B CA    1 
ATOM   3938 C C     . PHE C 2 135 ? 31.348  -4.384  50.789 1.00 98.66  ? 135 PHE B C     1 
ATOM   3939 O O     . PHE C 2 135 ? 30.721  -4.876  51.728 1.00 89.68  ? 135 PHE B O     1 
ATOM   3940 C CB    . PHE C 2 135 ? 31.174  -1.909  50.590 1.00 99.38  ? 135 PHE B CB    1 
ATOM   3941 C CG    . PHE C 2 135 ? 31.689  -0.556  50.983 1.00 91.77  ? 135 PHE B CG    1 
ATOM   3942 C CD1   . PHE C 2 135 ? 31.753  -0.183  52.320 1.00 91.88  ? 135 PHE B CD1   1 
ATOM   3943 C CD2   . PHE C 2 135 ? 32.108  0.349   50.015 1.00 86.81  ? 135 PHE B CD2   1 
ATOM   3944 C CE1   . PHE C 2 135 ? 32.225  1.075   52.688 1.00 90.82  ? 135 PHE B CE1   1 
ATOM   3945 C CE2   . PHE C 2 135 ? 32.581  1.607   50.373 1.00 94.18  ? 135 PHE B CE2   1 
ATOM   3946 C CZ    . PHE C 2 135 ? 32.640  1.971   51.714 1.00 91.74  ? 135 PHE B CZ    1 
ATOM   3947 N N     . LYS C 2 136 ? 31.405  -4.943  49.582 1.00 99.27  ? 136 LYS B N     1 
ATOM   3948 C CA    . LYS C 2 136 ? 30.712  -6.189  49.269 1.00 102.62 ? 136 LYS B CA    1 
ATOM   3949 C C     . LYS C 2 136 ? 30.778  -7.205  50.398 1.00 104.60 ? 136 LYS B C     1 
ATOM   3950 O O     . LYS C 2 136 ? 29.757  -7.754  50.811 1.00 106.77 ? 136 LYS B O     1 
ATOM   3951 C CB    . LYS C 2 136 ? 31.284  -6.809  47.992 1.00 105.93 ? 136 LYS B CB    1 
ATOM   3952 C CG    . LYS C 2 136 ? 30.645  -8.139  47.609 1.00 111.59 ? 136 LYS B CG    1 
ATOM   3953 C CD    . LYS C 2 136 ? 31.097  -8.604  46.229 1.00 115.48 ? 136 LYS B CD    1 
ATOM   3954 C CE    . LYS C 2 136 ? 32.607  -8.789  46.158 1.00 117.27 ? 136 LYS B CE    1 
ATOM   3955 N NZ    . LYS C 2 136 ? 33.054  -9.201  44.796 1.00 112.33 ? 136 LYS B NZ    1 
ATOM   3956 N N     . GLU C 2 137 ? 31.983  -7.460  50.891 1.00 110.48 ? 137 GLU B N     1 
ATOM   3957 C CA    . GLU C 2 137 ? 32.168  -8.408  51.980 1.00 113.88 ? 137 GLU B CA    1 
ATOM   3958 C C     . GLU C 2 137 ? 31.546  -7.856  53.261 1.00 115.73 ? 137 GLU B C     1 
ATOM   3959 O O     . GLU C 2 137 ? 30.886  -8.581  54.008 1.00 111.98 ? 137 GLU B O     1 
ATOM   3960 C CB    . GLU C 2 137 ? 33.662  -8.685  52.192 1.00 117.79 ? 137 GLU B CB    1 
ATOM   3961 C CG    . GLU C 2 137 ? 34.522  -7.439  52.392 1.00 123.95 ? 137 GLU B CG    1 
ATOM   3962 C CD    . GLU C 2 137 ? 34.638  -6.589  51.136 1.00 126.82 ? 137 GLU B CD    1 
ATOM   3963 O OE1   . GLU C 2 137 ? 35.167  -7.090  50.121 1.00 124.55 ? 137 GLU B OE1   1 
ATOM   3964 O OE2   . GLU C 2 137 ? 34.200  -5.420  51.164 1.00 126.34 ? 137 GLU B OE2   1 
ATOM   3965 N N     . ASP C 2 138 ? 31.756  -6.564  53.497 1.00 116.54 ? 138 ASP B N     1 
ATOM   3966 C CA    . ASP C 2 138 ? 31.226  -5.889  54.678 1.00 116.46 ? 138 ASP B CA    1 
ATOM   3967 C C     . ASP C 2 138 ? 29.708  -6.014  54.739 1.00 113.67 ? 138 ASP B C     1 
ATOM   3968 O O     . ASP C 2 138 ? 29.128  -6.130  55.818 1.00 118.31 ? 138 ASP B O     1 
ATOM   3969 C CB    . ASP C 2 138 ? 31.611  -4.407  54.653 1.00 121.46 ? 138 ASP B CB    1 
ATOM   3970 C CG    . ASP C 2 138 ? 33.113  -4.192  54.627 1.00 125.55 ? 138 ASP B CG    1 
ATOM   3971 O OD1   . ASP C 2 138 ? 33.786  -4.779  53.753 1.00 128.09 ? 138 ASP B OD1   1 
ATOM   3972 O OD2   . ASP C 2 138 ? 33.620  -3.429  55.477 1.00 123.63 ? 138 ASP B OD2   1 
ATOM   3973 N N     . ILE C 2 139 ? 29.070  -5.987  53.574 1.00 108.52 ? 139 ILE B N     1 
ATOM   3974 C CA    . ILE C 2 139 ? 27.618  -6.093  53.493 1.00 101.20 ? 139 ILE B CA    1 
ATOM   3975 C C     . ILE C 2 139 ? 27.156  -7.540  53.619 1.00 97.54  ? 139 ILE B C     1 
ATOM   3976 O O     . ILE C 2 139 ? 26.383  -7.879  54.518 1.00 90.03  ? 139 ILE B O     1 
ATOM   3977 C CB    . ILE C 2 139 ? 27.097  -5.514  52.165 1.00 97.19  ? 139 ILE B CB    1 
ATOM   3978 C CG1   . ILE C 2 139 ? 27.493  -4.041  52.057 1.00 97.57  ? 139 ILE B CG1   1 
ATOM   3979 C CG2   . ILE C 2 139 ? 25.588  -5.665  52.090 1.00 99.71  ? 139 ILE B CG2   1 
ATOM   3980 C CD1   . ILE C 2 139 ? 27.032  -3.367  50.787 1.00 98.12  ? 139 ILE B CD1   1 
ATOM   3981 N N     . LEU C 2 140 ? 27.635  -8.389  52.715 1.00 96.94  ? 140 LEU B N     1 
ATOM   3982 C CA    . LEU C 2 140 ? 27.274  -9.801  52.719 1.00 99.50  ? 140 LEU B CA    1 
ATOM   3983 C C     . LEU C 2 140 ? 27.420  -10.431 54.103 1.00 104.49 ? 140 LEU B C     1 
ATOM   3984 O O     . LEU C 2 140 ? 26.722  -11.393 54.431 1.00 104.45 ? 140 LEU B O     1 
ATOM   3985 C CB    . LEU C 2 140 ? 28.127  -10.562 51.700 1.00 93.83  ? 140 LEU B CB    1 
ATOM   3986 C CG    . LEU C 2 140 ? 28.029  -12.090 51.731 1.00 102.10 ? 140 LEU B CG    1 
ATOM   3987 C CD1   . LEU C 2 140 ? 26.570  -12.526 51.714 1.00 102.30 ? 140 LEU B CD1   1 
ATOM   3988 C CD2   . LEU C 2 140 ? 28.786  -12.672 50.546 1.00 97.70  ? 140 LEU B CD2   1 
ATOM   3989 N N     . SER C 2 141 ? 28.325  -9.888  54.913 1.00 107.88 ? 141 SER B N     1 
ATOM   3990 C CA    . SER C 2 141 ? 28.539  -10.406 56.263 1.00 108.68 ? 141 SER B CA    1 
ATOM   3991 C C     . SER C 2 141 ? 27.329  -10.057 57.123 1.00 108.27 ? 141 SER B C     1 
ATOM   3992 O O     . SER C 2 141 ? 26.793  -10.906 57.839 1.00 106.96 ? 141 SER B O     1 
ATOM   3993 C CB    . SER C 2 141 ? 29.802  -9.797  56.880 1.00 104.65 ? 141 SER B CB    1 
ATOM   3994 O OG    . SER C 2 141 ? 29.629  -8.416  57.145 1.00 100.93 ? 141 SER B OG    1 
ATOM   3995 N N     . ALA C 2 142 ? 26.905  -8.798  57.042 1.00 105.41 ? 142 ALA B N     1 
ATOM   3996 C CA    . ALA C 2 142 ? 25.756  -8.318  57.797 1.00 100.24 ? 142 ALA B CA    1 
ATOM   3997 C C     . ALA C 2 142 ? 24.572  -9.221  57.504 1.00 98.09  ? 142 ALA B C     1 
ATOM   3998 O O     . ALA C 2 142 ? 23.793  -9.558  58.398 1.00 92.19  ? 142 ALA B O     1 
ATOM   3999 C CB    . ALA C 2 142 ? 25.433  -6.889  57.398 1.00 95.66  ? 142 ALA B CB    1 
ATOM   4000 N N     . ILE C 2 143 ? 24.452  -9.611  56.238 1.00 100.16 ? 143 ILE B N     1 
ATOM   4001 C CA    . ILE C 2 143 ? 23.373  -10.483 55.793 1.00 101.20 ? 143 ILE B CA    1 
ATOM   4002 C C     . ILE C 2 143 ? 23.552  -11.868 56.397 1.00 99.90  ? 143 ILE B C     1 
ATOM   4003 O O     . ILE C 2 143 ? 22.700  -12.342 57.148 1.00 97.97  ? 143 ILE B O     1 
ATOM   4004 C CB    . ILE C 2 143 ? 23.357  -10.615 54.249 1.00 100.69 ? 143 ILE B CB    1 
ATOM   4005 C CG1   . ILE C 2 143 ? 23.148  -9.240  53.611 1.00 98.04  ? 143 ILE B CG1   1 
ATOM   4006 C CG2   . ILE C 2 143 ? 22.255  -11.573 53.815 1.00 98.55  ? 143 ILE B CG2   1 
ATOM   4007 C CD1   . ILE C 2 143 ? 23.191  -9.256  52.101 1.00 92.91  ? 143 ILE B CD1   1 
ATOM   4008 N N     . LYS C 2 144 ? 24.670  -12.507 56.066 1.00 101.29 ? 144 LYS B N     1 
ATOM   4009 C CA    . LYS C 2 144 ? 24.969  -13.842 56.566 1.00 103.56 ? 144 LYS B CA    1 
ATOM   4010 C C     . LYS C 2 144 ? 24.691  -13.917 58.062 1.00 105.36 ? 144 LYS B C     1 
ATOM   4011 O O     . LYS C 2 144 ? 24.148  -14.907 58.555 1.00 101.01 ? 144 LYS B O     1 
ATOM   4012 C CB    . LYS C 2 144 ? 26.430  -14.191 56.282 1.00 100.47 ? 144 LYS B CB    1 
ATOM   4013 C CG    . LYS C 2 144 ? 26.769  -15.658 56.485 1.00 97.04  ? 144 LYS B CG    1 
ATOM   4014 C CD    . LYS C 2 144 ? 28.171  -15.963 55.980 1.00 98.36  ? 144 LYS B CD    1 
ATOM   4015 C CE    . LYS C 2 144 ? 28.309  -15.631 54.498 1.00 95.58  ? 144 LYS B CE    1 
ATOM   4016 N NZ    . LYS C 2 144 ? 29.686  -15.881 53.989 1.00 97.81  ? 144 LYS B NZ    1 
ATOM   4017 N N     . GLU C 2 145 ? 25.058  -12.860 58.781 1.00 108.98 ? 145 GLU B N     1 
ATOM   4018 C CA    . GLU C 2 145 ? 24.827  -12.810 60.217 1.00 109.76 ? 145 GLU B CA    1 
ATOM   4019 C C     . GLU C 2 145 ? 23.324  -12.761 60.468 1.00 106.44 ? 145 GLU B C     1 
ATOM   4020 O O     . GLU C 2 145 ? 22.778  -13.597 61.185 1.00 106.68 ? 145 GLU B O     1 
ATOM   4021 C CB    . GLU C 2 145 ? 25.489  -11.573 60.830 1.00 111.08 ? 145 GLU B CB    1 
ATOM   4022 C CG    . GLU C 2 145 ? 25.420  -11.541 62.352 1.00 114.51 ? 145 GLU B CG    1 
ATOM   4023 C CD    . GLU C 2 145 ? 26.044  -10.296 62.946 1.00 116.56 ? 145 GLU B CD    1 
ATOM   4024 O OE1   . GLU C 2 145 ? 27.215  -10.003 62.625 1.00 119.79 ? 145 GLU B OE1   1 
ATOM   4025 O OE2   . GLU C 2 145 ? 25.365  -9.612  63.740 1.00 117.45 ? 145 GLU B OE2   1 
ATOM   4026 N N     . GLY C 2 146 ? 22.661  -11.779 59.865 1.00 103.71 ? 146 GLY B N     1 
ATOM   4027 C CA    . GLY C 2 146 ? 21.228  -11.641 60.038 1.00 100.42 ? 146 GLY B CA    1 
ATOM   4028 C C     . GLY C 2 146 ? 20.863  -10.313 60.670 1.00 98.87  ? 146 GLY B C     1 
ATOM   4029 O O     . GLY C 2 146 ? 19.849  -10.198 61.360 1.00 94.75  ? 146 GLY B O     1 
ATOM   4030 N N     . ARG C 2 147 ? 21.693  -9.303  60.435 1.00 98.86  ? 147 ARG B N     1 
ATOM   4031 C CA    . ARG C 2 147 ? 21.453  -7.976  60.988 1.00 101.51 ? 147 ARG B CA    1 
ATOM   4032 C C     . ARG C 2 147 ? 20.208  -7.366  60.356 1.00 96.61  ? 147 ARG B C     1 
ATOM   4033 O O     . ARG C 2 147 ? 20.165  -7.130  59.149 1.00 100.58 ? 147 ARG B O     1 
ATOM   4034 C CB    . ARG C 2 147 ? 22.662  -7.074  60.732 1.00 105.86 ? 147 ARG B CB    1 
ATOM   4035 C CG    . ARG C 2 147 ? 23.988  -7.685  61.159 1.00 112.98 ? 147 ARG B CG    1 
ATOM   4036 C CD    . ARG C 2 147 ? 25.154  -6.743  60.899 1.00 118.35 ? 147 ARG B CD    1 
ATOM   4037 N NE    . ARG C 2 147 ? 26.438  -7.436  60.980 1.00 124.79 ? 147 ARG B NE    1 
ATOM   4038 C CZ    . ARG C 2 147 ? 27.609  -6.884  60.678 1.00 124.02 ? 147 ARG B CZ    1 
ATOM   4039 N NH1   . ARG C 2 147 ? 27.667  -5.621  60.275 1.00 124.52 ? 147 ARG B NH1   1 
ATOM   4040 N NH2   . ARG C 2 147 ? 28.722  -7.601  60.763 1.00 121.94 ? 147 ARG B NH2   1 
ATOM   4041 N N     . VAL C 2 148 ? 19.197  -7.111  61.177 1.00 89.54  ? 148 VAL B N     1 
ATOM   4042 C CA    . VAL C 2 148 ? 17.950  -6.537  60.692 1.00 87.14  ? 148 VAL B CA    1 
ATOM   4043 C C     . VAL C 2 148 ? 17.589  -5.270  61.451 1.00 85.82  ? 148 VAL B C     1 
ATOM   4044 O O     . VAL C 2 148 ? 18.411  -4.725  62.186 1.00 87.61  ? 148 VAL B O     1 
ATOM   4045 C CB    . VAL C 2 148 ? 16.798  -7.542  60.833 1.00 85.25  ? 148 VAL B CB    1 
ATOM   4046 C CG1   . VAL C 2 148 ? 17.075  -8.764  59.974 1.00 82.47  ? 148 VAL B CG1   1 
ATOM   4047 C CG2   . VAL C 2 148 ? 16.637  -7.945  62.291 1.00 73.11  ? 148 VAL B CG2   1 
ATOM   4048 N N     . LYS C 2 149 ? 16.357  -4.804  61.272 1.00 82.39  ? 149 LYS B N     1 
ATOM   4049 C CA    . LYS C 2 149 ? 15.899  -3.596  61.945 1.00 86.60  ? 149 LYS B CA    1 
ATOM   4050 C C     . LYS C 2 149 ? 14.503  -3.795  62.527 1.00 85.39  ? 149 LYS B C     1 
ATOM   4051 O O     . LYS C 2 149 ? 13.522  -3.284  61.993 1.00 89.71  ? 149 LYS B O     1 
ATOM   4052 C CB    . LYS C 2 149 ? 15.896  -2.419  60.967 1.00 88.35  ? 149 LYS B CB    1 
ATOM   4053 C CG    . LYS C 2 149 ? 15.933  -1.056  61.636 1.00 95.04  ? 149 LYS B CG    1 
ATOM   4054 C CD    . LYS C 2 149 ? 16.167  0.053   60.618 1.00 103.21 ? 149 LYS B CD    1 
ATOM   4055 C CE    . LYS C 2 149 ? 16.564  1.361   61.295 1.00 104.20 ? 149 LYS B CE    1 
ATOM   4056 N NZ    . LYS C 2 149 ? 17.850  1.235   62.042 1.00 93.70  ? 149 LYS B NZ    1 
ATOM   4057 N N     . LYS C 2 150 ? 14.438  -4.543  63.625 1.00 84.45  ? 150 LYS B N     1 
ATOM   4058 C CA    . LYS C 2 150 ? 13.196  -4.852  64.335 1.00 85.52  ? 150 LYS B CA    1 
ATOM   4059 C C     . LYS C 2 150 ? 12.008  -3.955  63.989 1.00 82.30  ? 150 LYS B C     1 
ATOM   4060 O O     . LYS C 2 150 ? 12.155  -2.742  63.833 1.00 74.01  ? 150 LYS B O     1 
ATOM   4061 C CB    . LYS C 2 150 ? 13.431  -4.778  65.848 1.00 94.64  ? 150 LYS B CB    1 
ATOM   4062 C CG    . LYS C 2 150 ? 14.570  -5.645  66.370 1.00 99.08  ? 150 LYS B CG    1 
ATOM   4063 C CD    . LYS C 2 150 ? 14.816  -5.373  67.852 1.00 98.77  ? 150 LYS B CD    1 
ATOM   4064 C CE    . LYS C 2 150 ? 16.033  -6.121  68.376 1.00 96.01  ? 150 LYS B CE    1 
ATOM   4065 N NZ    . LYS C 2 150 ? 15.855  -7.596  68.337 1.00 92.64  ? 150 LYS B NZ    1 
ATOM   4066 N N     . ASP C 2 151 ? 10.826  -4.557  63.892 1.00 83.97  ? 151 ASP B N     1 
ATOM   4067 C CA    . ASP C 2 151 ? 9.613   -3.808  63.582 1.00 86.79  ? 151 ASP B CA    1 
ATOM   4068 C C     . ASP C 2 151 ? 9.055   -3.146  64.842 1.00 86.56  ? 151 ASP B C     1 
ATOM   4069 O O     . ASP C 2 151 ? 9.588   -3.318  65.938 1.00 90.37  ? 151 ASP B O     1 
ATOM   4070 C CB    . ASP C 2 151 ? 8.549   -4.727  62.987 1.00 85.59  ? 151 ASP B CB    1 
ATOM   4071 C CG    . ASP C 2 151 ? 7.994   -5.697  64.000 1.00 92.25  ? 151 ASP B CG    1 
ATOM   4072 O OD1   . ASP C 2 151 ? 8.768   -6.546  64.490 1.00 98.38  ? 151 ASP B OD1   1 
ATOM   4073 O OD2   . ASP C 2 151 ? 6.788   -5.606  64.313 1.00 94.05  ? 151 ASP B OD2   1 
ATOM   4074 N N     . TYR C 2 152 ? 7.964   -2.408  64.672 1.00 82.15  ? 152 TYR B N     1 
ATOM   4075 C CA    . TYR C 2 152 ? 7.327   -1.686  65.763 1.00 82.00  ? 152 TYR B CA    1 
ATOM   4076 C C     . TYR C 2 152 ? 6.720   -2.555  66.859 1.00 81.19  ? 152 TYR B C     1 
ATOM   4077 O O     . TYR C 2 152 ? 6.910   -2.279  68.043 1.00 84.81  ? 152 TYR B O     1 
ATOM   4078 C CB    . TYR C 2 152 ? 6.269   -0.747  65.186 1.00 85.09  ? 152 TYR B CB    1 
ATOM   4079 C CG    . TYR C 2 152 ? 6.858   0.247   64.217 1.00 83.75  ? 152 TYR B CG    1 
ATOM   4080 C CD1   . TYR C 2 152 ? 7.584   1.344   64.671 1.00 85.35  ? 152 TYR B CD1   1 
ATOM   4081 C CD2   . TYR C 2 152 ? 6.748   0.055   62.842 1.00 85.55  ? 152 TYR B CD2   1 
ATOM   4082 C CE1   . TYR C 2 152 ? 8.191   2.225   63.779 1.00 86.45  ? 152 TYR B CE1   1 
ATOM   4083 C CE2   . TYR C 2 152 ? 7.353   0.927   61.942 1.00 81.57  ? 152 TYR B CE2   1 
ATOM   4084 C CZ    . TYR C 2 152 ? 8.072   2.008   62.417 1.00 83.35  ? 152 TYR B CZ    1 
ATOM   4085 O OH    . TYR C 2 152 ? 8.679   2.864   61.529 1.00 87.11  ? 152 TYR B OH    1 
ATOM   4086 N N     . LYS C 2 153 ? 5.986   -3.596  66.484 1.00 80.64  ? 153 LYS B N     1 
ATOM   4087 C CA    . LYS C 2 153 ? 5.383   -4.463  67.490 1.00 77.99  ? 153 LYS B CA    1 
ATOM   4088 C C     . LYS C 2 153 ? 6.454   -5.094  68.375 1.00 73.43  ? 153 LYS B C     1 
ATOM   4089 O O     . LYS C 2 153 ? 6.266   -5.225  69.583 1.00 66.95  ? 153 LYS B O     1 
ATOM   4090 C CB    . LYS C 2 153 ? 4.535   -5.556  66.833 1.00 77.61  ? 153 LYS B CB    1 
ATOM   4091 C CG    . LYS C 2 153 ? 3.201   -5.063  66.290 1.00 77.89  ? 153 LYS B CG    1 
ATOM   4092 C CD    . LYS C 2 153 ? 2.326   -6.220  65.819 1.00 81.92  ? 153 LYS B CD    1 
ATOM   4093 C CE    . LYS C 2 153 ? 1.909   -7.119  66.975 1.00 82.33  ? 153 LYS B CE    1 
ATOM   4094 N NZ    . LYS C 2 153 ? 1.106   -8.294  66.530 1.00 74.48  ? 153 LYS B NZ    1 
ATOM   4095 N N     . THR C 2 154 ? 7.577   -5.479  67.773 1.00 72.68  ? 154 THR B N     1 
ATOM   4096 C CA    . THR C 2 154 ? 8.676   -6.080  68.525 1.00 72.69  ? 154 THR B CA    1 
ATOM   4097 C C     . THR C 2 154 ? 9.313   -5.027  69.428 1.00 70.01  ? 154 THR B C     1 
ATOM   4098 O O     . THR C 2 154 ? 9.485   -5.243  70.624 1.00 62.99  ? 154 THR B O     1 
ATOM   4099 C CB    . THR C 2 154 ? 9.765   -6.656  67.593 1.00 75.82  ? 154 THR B CB    1 
ATOM   4100 O OG1   . THR C 2 154 ? 9.231   -7.761  66.852 1.00 65.53  ? 154 THR B OG1   1 
ATOM   4101 C CG2   . THR C 2 154 ? 10.961  -7.133  68.409 1.00 79.10  ? 154 THR B CG2   1 
ATOM   4102 N N     . ILE C 2 155 ? 9.666   -3.887  68.844 1.00 67.38  ? 155 ILE B N     1 
ATOM   4103 C CA    . ILE C 2 155 ? 10.265  -2.795  69.597 1.00 61.36  ? 155 ILE B CA    1 
ATOM   4104 C C     . ILE C 2 155 ? 9.408   -2.466  70.812 1.00 68.25  ? 155 ILE B C     1 
ATOM   4105 O O     . ILE C 2 155 ? 9.919   -2.338  71.921 1.00 78.56  ? 155 ILE B O     1 
ATOM   4106 C CB    . ILE C 2 155 ? 10.409  -1.548  68.717 1.00 55.09  ? 155 ILE B CB    1 
ATOM   4107 C CG1   . ILE C 2 155 ? 11.539  -1.770  67.708 1.00 52.25  ? 155 ILE B CG1   1 
ATOM   4108 C CG2   . ILE C 2 155 ? 10.637  -0.323  69.576 1.00 52.28  ? 155 ILE B CG2   1 
ATOM   4109 C CD1   . ILE C 2 155 ? 11.710  -0.650  66.718 1.00 44.82  ? 155 ILE B CD1   1 
ATOM   4110 N N     . LEU C 2 156 ? 8.104   -2.328  70.604 1.00 68.74  ? 156 LEU B N     1 
ATOM   4111 C CA    . LEU C 2 156 ? 7.192   -2.038  71.705 1.00 69.50  ? 156 LEU B CA    1 
ATOM   4112 C C     . LEU C 2 156 ? 7.221   -3.215  72.677 1.00 69.91  ? 156 LEU B C     1 
ATOM   4113 O O     . LEU C 2 156 ? 7.088   -3.046  73.889 1.00 71.92  ? 156 LEU B O     1 
ATOM   4114 C CB    . LEU C 2 156 ? 5.768   -1.852  71.179 1.00 63.58  ? 156 LEU B CB    1 
ATOM   4115 C CG    . LEU C 2 156 ? 4.675   -1.732  72.244 1.00 59.56  ? 156 LEU B CG    1 
ATOM   4116 C CD1   . LEU C 2 156 ? 4.654   -0.319  72.809 1.00 54.11  ? 156 LEU B CD1   1 
ATOM   4117 C CD2   . LEU C 2 156 ? 3.336   -2.082  71.631 1.00 56.79  ? 156 LEU B CD2   1 
ATOM   4118 N N     . GLN C 2 157 ? 7.390   -4.410  72.120 1.00 71.40  ? 157 GLN B N     1 
ATOM   4119 C CA    . GLN C 2 157 ? 7.443   -5.655  72.882 1.00 72.12  ? 157 GLN B CA    1 
ATOM   4120 C C     . GLN C 2 157 ? 8.587   -5.640  73.893 1.00 76.60  ? 157 GLN B C     1 
ATOM   4121 O O     . GLN C 2 157 ? 8.389   -5.910  75.080 1.00 73.75  ? 157 GLN B O     1 
ATOM   4122 C CB    . GLN C 2 157 ? 7.624   -6.823  71.906 1.00 68.73  ? 157 GLN B CB    1 
ATOM   4123 C CG    . GLN C 2 157 ? 7.953   -8.159  72.532 1.00 62.90  ? 157 GLN B CG    1 
ATOM   4124 C CD    . GLN C 2 157 ? 6.729   -8.886  73.014 1.00 63.51  ? 157 GLN B CD    1 
ATOM   4125 O OE1   . GLN C 2 157 ? 5.947   -8.354  73.799 1.00 72.66  ? 157 GLN B OE1   1 
ATOM   4126 N NE2   . GLN C 2 157 ? 6.555   -10.118 72.549 1.00 60.05  ? 157 GLN B NE2   1 
ATOM   4127 N N     . GLU C 2 158 ? 9.785   -5.321  73.413 1.00 74.36  ? 158 GLU B N     1 
ATOM   4128 C CA    . GLU C 2 158 ? 10.969  -5.270  74.259 1.00 76.51  ? 158 GLU B CA    1 
ATOM   4129 C C     . GLU C 2 158 ? 10.853  -4.192  75.329 1.00 77.33  ? 158 GLU B C     1 
ATOM   4130 O O     . GLU C 2 158 ? 11.177  -4.420  76.494 1.00 82.68  ? 158 GLU B O     1 
ATOM   4131 C CB    . GLU C 2 158 ? 12.202  -5.011  73.402 1.00 71.20  ? 158 GLU B CB    1 
ATOM   4132 C CG    . GLU C 2 158 ? 12.367  -6.009  72.277 1.00 82.55  ? 158 GLU B CG    1 
ATOM   4133 C CD    . GLU C 2 158 ? 13.596  -5.736  71.442 1.00 90.25  ? 158 GLU B CD    1 
ATOM   4134 O OE1   . GLU C 2 158 ? 13.841  -4.553  71.120 1.00 94.91  ? 158 GLU B OE1   1 
ATOM   4135 O OE2   . GLU C 2 158 ? 14.310  -6.704  71.101 1.00 93.19  ? 158 GLU B OE2   1 
ATOM   4136 N N     . ILE C 2 159 ? 10.390  -3.016  74.924 1.00 75.46  ? 159 ILE B N     1 
ATOM   4137 C CA    . ILE C 2 159 ? 10.227  -1.900  75.843 1.00 76.59  ? 159 ILE B CA    1 
ATOM   4138 C C     . ILE C 2 159 ? 9.320   -2.257  77.017 1.00 76.10  ? 159 ILE B C     1 
ATOM   4139 O O     . ILE C 2 159 ? 9.759   -2.304  78.165 1.00 77.40  ? 159 ILE B O     1 
ATOM   4140 C CB    . ILE C 2 159 ? 9.628   -0.674  75.119 1.00 74.98  ? 159 ILE B CB    1 
ATOM   4141 C CG1   . ILE C 2 159 ? 10.587  -0.196  74.024 1.00 74.76  ? 159 ILE B CG1   1 
ATOM   4142 C CG2   . ILE C 2 159 ? 9.347   0.436   76.121 1.00 73.65  ? 159 ILE B CG2   1 
ATOM   4143 C CD1   . ILE C 2 159 ? 10.073  0.979   73.219 1.00 75.90  ? 159 ILE B CD1   1 
ATOM   4144 N N     . THR C 2 160 ? 8.050   -2.505  76.716 1.00 78.02  ? 160 THR B N     1 
ATOM   4145 C CA    . THR C 2 160 ? 7.056   -2.842  77.727 1.00 79.30  ? 160 THR B CA    1 
ATOM   4146 C C     . THR C 2 160 ? 7.501   -3.943  78.686 1.00 78.26  ? 160 THR B C     1 
ATOM   4147 O O     . THR C 2 160 ? 7.042   -4.001  79.825 1.00 75.91  ? 160 THR B O     1 
ATOM   4148 C CB    . THR C 2 160 ? 5.728   -3.265  77.067 1.00 79.55  ? 160 THR B CB    1 
ATOM   4149 O OG1   . THR C 2 160 ? 5.955   -4.386  76.203 1.00 76.59  ? 160 THR B OG1   1 
ATOM   4150 C CG2   . THR C 2 160 ? 5.156   -2.118  76.252 1.00 76.86  ? 160 THR B CG2   1 
ATOM   4151 N N     . GLN C 2 161 ? 8.389   -4.818  78.228 1.00 79.71  ? 161 GLN B N     1 
ATOM   4152 C CA    . GLN C 2 161 ? 8.875   -5.904  79.074 1.00 81.46  ? 161 GLN B CA    1 
ATOM   4153 C C     . GLN C 2 161 ? 10.048  -5.465  79.956 1.00 82.67  ? 161 GLN B C     1 
ATOM   4154 O O     . GLN C 2 161 ? 10.174  -5.902  81.101 1.00 84.23  ? 161 GLN B O     1 
ATOM   4155 C CB    . GLN C 2 161 ? 9.270   -7.113  78.213 1.00 71.91  ? 161 GLN B CB    1 
ATOM   4156 C CG    . GLN C 2 161 ? 8.087   -8.007  77.840 1.00 63.45  ? 161 GLN B CG    1 
ATOM   4157 C CD    . GLN C 2 161 ? 8.487   -9.233  77.037 1.00 61.01  ? 161 GLN B CD    1 
ATOM   4158 O OE1   . GLN C 2 161 ? 7.783   -10.241 77.040 1.00 53.39  ? 161 GLN B OE1   1 
ATOM   4159 N NE2   . GLN C 2 161 ? 9.610   -9.147  76.336 1.00 43.80  ? 161 GLN B NE2   1 
ATOM   4160 N N     . LYS C 2 162 ? 10.896  -4.591  79.425 1.00 77.36  ? 162 LYS B N     1 
ATOM   4161 C CA    . LYS C 2 162 ? 12.048  -4.101  80.169 1.00 77.55  ? 162 LYS B CA    1 
ATOM   4162 C C     . LYS C 2 162 ? 11.677  -2.867  80.990 1.00 80.32  ? 162 LYS B C     1 
ATOM   4163 O O     . LYS C 2 162 ? 12.511  -1.995  81.230 1.00 88.37  ? 162 LYS B O     1 
ATOM   4164 C CB    . LYS C 2 162 ? 13.179  -3.753  79.200 1.00 71.42  ? 162 LYS B CB    1 
ATOM   4165 C CG    . LYS C 2 162 ? 14.450  -3.276  79.869 1.00 71.68  ? 162 LYS B CG    1 
ATOM   4166 C CD    . LYS C 2 162 ? 15.425  -2.707  78.859 1.00 80.12  ? 162 LYS B CD    1 
ATOM   4167 C CE    . LYS C 2 162 ? 16.628  -2.094  79.553 1.00 81.26  ? 162 LYS B CE    1 
ATOM   4168 N NZ    . LYS C 2 162 ? 17.620  -1.570  78.577 1.00 89.10  ? 162 LYS B NZ    1 
ATOM   4169 N N     . ARG C 2 163 ? 10.427  -2.791  81.427 1.00 74.19  ? 163 ARG B N     1 
ATOM   4170 C CA    . ARG C 2 163 ? 9.982   -1.642  82.205 1.00 79.57  ? 163 ARG B CA    1 
ATOM   4171 C C     . ARG C 2 163 ? 8.787   -1.984  83.080 1.00 80.99  ? 163 ARG B C     1 
ATOM   4172 O O     . ARG C 2 163 ? 8.459   -1.252  84.012 1.00 81.59  ? 163 ARG B O     1 
ATOM   4173 C CB    . ARG C 2 163 ? 9.626   -0.487  81.263 1.00 83.11  ? 163 ARG B CB    1 
ATOM   4174 C CG    . ARG C 2 163 ? 8.950   0.708   81.928 1.00 90.71  ? 163 ARG B CG    1 
ATOM   4175 C CD    . ARG C 2 163 ? 8.734   1.841   80.927 1.00 93.74  ? 163 ARG B CD    1 
ATOM   4176 N NE    . ARG C 2 163 ? 7.886   2.905   81.460 1.00 103.60 ? 163 ARG B NE    1 
ATOM   4177 C CZ    . ARG C 2 163 ? 8.192   3.662   82.510 1.00 108.92 ? 163 ARG B CZ    1 
ATOM   4178 N NH1   . ARG C 2 163 ? 9.339   3.480   83.154 1.00 109.00 ? 163 ARG B NH1   1 
ATOM   4179 N NH2   . ARG C 2 163 ? 7.345   4.598   82.921 1.00 101.95 ? 163 ARG B NH2   1 
ATOM   4180 N N     . TRP C 2 164 ? 8.138   -3.100  82.769 1.00 83.54  ? 164 TRP B N     1 
ATOM   4181 C CA    . TRP C 2 164 ? 6.975   -3.556  83.520 1.00 82.73  ? 164 TRP B CA    1 
ATOM   4182 C C     . TRP C 2 164 ? 6.917   -5.075  83.470 1.00 82.35  ? 164 TRP B C     1 
ATOM   4183 O O     . TRP C 2 164 ? 6.065   -5.698  84.107 1.00 81.04  ? 164 TRP B O     1 
ATOM   4184 C CB    . TRP C 2 164 ? 5.687   -2.982  82.922 1.00 82.00  ? 164 TRP B CB    1 
ATOM   4185 C CG    . TRP C 2 164 ? 5.556   -1.490  83.025 1.00 81.56  ? 164 TRP B CG    1 
ATOM   4186 C CD1   . TRP C 2 164 ? 5.450   -0.752  84.168 1.00 81.65  ? 164 TRP B CD1   1 
ATOM   4187 C CD2   . TRP C 2 164 ? 5.472   -0.561  81.938 1.00 82.70  ? 164 TRP B CD2   1 
ATOM   4188 N NE1   . TRP C 2 164 ? 5.301   0.579   83.861 1.00 84.47  ? 164 TRP B NE1   1 
ATOM   4189 C CE2   . TRP C 2 164 ? 5.312   0.725   82.498 1.00 85.49  ? 164 TRP B CE2   1 
ATOM   4190 C CE3   . TRP C 2 164 ? 5.515   -0.691  80.543 1.00 83.87  ? 164 TRP B CE3   1 
ATOM   4191 C CZ2   . TRP C 2 164 ? 5.192   1.875   81.714 1.00 87.16  ? 164 TRP B CZ2   1 
ATOM   4192 C CZ3   . TRP C 2 164 ? 5.396   0.454   79.761 1.00 87.52  ? 164 TRP B CZ3   1 
ATOM   4193 C CH2   . TRP C 2 164 ? 5.237   1.721   80.351 1.00 90.19  ? 164 TRP B CH2   1 
ATOM   4194 N N     . LYS C 2 165 ? 7.827   -5.663  82.701 1.00 81.84  ? 165 LYS B N     1 
ATOM   4195 C CA    . LYS C 2 165 ? 7.893   -7.110  82.560 1.00 90.30  ? 165 LYS B CA    1 
ATOM   4196 C C     . LYS C 2 165 ? 6.567   -7.642  82.022 1.00 94.46  ? 165 LYS B C     1 
ATOM   4197 O O     . LYS C 2 165 ? 6.264   -8.830  82.151 1.00 93.12  ? 165 LYS B O     1 
ATOM   4198 C CB    . LYS C 2 165 ? 8.204   -7.752  83.919 1.00 89.08  ? 165 LYS B CB    1 
ATOM   4199 C CG    . LYS C 2 165 ? 9.292   -7.034  84.712 1.00 87.32  ? 165 LYS B CG    1 
ATOM   4200 C CD    . LYS C 2 165 ? 10.594  -6.936  83.931 1.00 92.17  ? 165 LYS B CD    1 
ATOM   4201 C CE    . LYS C 2 165 ? 11.585  -6.000  84.612 1.00 88.96  ? 165 LYS B CE    1 
ATOM   4202 N NZ    . LYS C 2 165 ? 11.910  -6.439  85.995 1.00 89.49  ? 165 LYS B NZ    1 
ATOM   4203 N N     . GLU C 2 166 ? 5.784   -6.752  81.417 1.00 98.64  ? 166 GLU B N     1 
ATOM   4204 C CA    . GLU C 2 166 ? 4.485   -7.116  80.860 1.00 96.82  ? 166 GLU B CA    1 
ATOM   4205 C C     . GLU C 2 166 ? 4.440   -6.804  79.366 1.00 97.65  ? 166 GLU B C     1 
ATOM   4206 O O     . GLU C 2 166 ? 5.263   -6.045  78.856 1.00 92.87  ? 166 GLU B O     1 
ATOM   4207 C CB    . GLU C 2 166 ? 3.372   -6.356  81.588 1.00 101.89 ? 166 GLU B CB    1 
ATOM   4208 C CG    . GLU C 2 166 ? 2.154   -7.207  81.937 1.00 113.78 ? 166 GLU B CG    1 
ATOM   4209 C CD    . GLU C 2 166 ? 2.469   -8.311  82.941 1.00 115.33 ? 166 GLU B CD    1 
ATOM   4210 O OE1   . GLU C 2 166 ? 3.303   -9.186  82.626 1.00 112.64 ? 166 GLU B OE1   1 
ATOM   4211 O OE2   . GLU C 2 166 ? 1.881   -8.303  84.045 1.00 110.98 ? 166 GLU B OE2   1 
ATOM   4212 N N     . ARG C 2 167 ? 3.472   -7.390  78.670 1.00 99.79  ? 167 ARG B N     1 
ATOM   4213 C CA    . ARG C 2 167 ? 3.331   -7.185  77.232 1.00 96.03  ? 167 ARG B CA    1 
ATOM   4214 C C     . ARG C 2 167 ? 2.102   -6.342  76.903 1.00 92.73  ? 167 ARG B C     1 
ATOM   4215 O O     . ARG C 2 167 ? 1.203   -6.186  77.729 1.00 90.85  ? 167 ARG B O     1 
ATOM   4216 C CB    . ARG C 2 167 ? 3.204   -8.534  76.524 1.00 96.39  ? 167 ARG B CB    1 
ATOM   4217 C CG    . ARG C 2 167 ? 4.188   -9.584  76.988 1.00 96.69  ? 167 ARG B CG    1 
ATOM   4218 C CD    . ARG C 2 167 ? 3.809   -10.948 76.435 1.00 97.90  ? 167 ARG B CD    1 
ATOM   4219 N NE    . ARG C 2 167 ? 4.577   -12.023 77.055 1.00 109.30 ? 167 ARG B NE    1 
ATOM   4220 C CZ    . ARG C 2 167 ? 4.534   -12.331 78.349 1.00 109.28 ? 167 ARG B CZ    1 
ATOM   4221 N NH1   . ARG C 2 167 ? 3.753   -11.646 79.177 1.00 104.58 ? 167 ARG B NH1   1 
ATOM   4222 N NH2   . ARG C 2 167 ? 5.276   -13.328 78.817 1.00 105.42 ? 167 ARG B NH2   1 
ATOM   4223 N N     . PRO C 2 168 ? 2.056   -5.779  75.686 1.00 88.78  ? 168 PRO B N     1 
ATOM   4224 C CA    . PRO C 2 168 ? 0.920   -4.957  75.264 1.00 84.58  ? 168 PRO B CA    1 
ATOM   4225 C C     . PRO C 2 168 ? -0.239  -5.847  74.830 1.00 84.35  ? 168 PRO B C     1 
ATOM   4226 O O     . PRO C 2 168 ? -0.046  -7.028  74.541 1.00 83.14  ? 168 PRO B O     1 
ATOM   4227 C CB    . PRO C 2 168 ? 1.495   -4.154  74.106 1.00 83.52  ? 168 PRO B CB    1 
ATOM   4228 C CG    . PRO C 2 168 ? 2.449   -5.123  73.487 1.00 88.23  ? 168 PRO B CG    1 
ATOM   4229 C CD    . PRO C 2 168 ? 3.144   -5.718  74.692 1.00 83.45  ? 168 PRO B CD    1 
ATOM   4230 N N     . GLU C 2 169 ? -1.439  -5.280  74.792 1.00 88.72  ? 169 GLU B N     1 
ATOM   4231 C CA    . GLU C 2 169 ? -2.629  -6.017  74.378 1.00 89.51  ? 169 GLU B CA    1 
ATOM   4232 C C     . GLU C 2 169 ? -3.273  -5.336  73.168 1.00 85.23  ? 169 GLU B C     1 
ATOM   4233 O O     . GLU C 2 169 ? -3.577  -4.142  73.206 1.00 81.56  ? 169 GLU B O     1 
ATOM   4234 C CB    . GLU C 2 169 ? -3.623  -6.107  75.545 1.00 91.09  ? 169 GLU B CB    1 
ATOM   4235 C CG    . GLU C 2 169 ? -3.968  -4.765  76.183 1.00 109.05 ? 169 GLU B CG    1 
ATOM   4236 C CD    . GLU C 2 169 ? -4.738  -4.906  77.490 1.00 114.81 ? 169 GLU B CD    1 
ATOM   4237 O OE1   . GLU C 2 169 ? -5.845  -5.489  77.478 1.00 116.62 ? 169 GLU B OE1   1 
ATOM   4238 O OE2   . GLU C 2 169 ? -4.234  -4.430  78.532 1.00 116.37 ? 169 GLU B OE2   1 
ATOM   4239 N N     . TYR C 2 170 ? -3.462  -6.100  72.093 1.00 86.07  ? 170 TYR B N     1 
ATOM   4240 C CA    . TYR C 2 170 ? -4.061  -5.585  70.856 1.00 89.95  ? 170 TYR B CA    1 
ATOM   4241 C C     . TYR C 2 170 ? -5.484  -6.114  70.649 1.00 89.32  ? 170 TYR B C     1 
ATOM   4242 O O     . TYR C 2 170 ? -5.701  -7.326  70.613 1.00 86.33  ? 170 TYR B O     1 
ATOM   4243 C CB    . TYR C 2 170 ? -3.217  -5.997  69.643 1.00 88.04  ? 170 TYR B CB    1 
ATOM   4244 C CG    . TYR C 2 170 ? -1.740  -5.684  69.747 1.00 89.36  ? 170 TYR B CG    1 
ATOM   4245 C CD1   . TYR C 2 170 ? -1.271  -4.375  69.655 1.00 90.03  ? 170 TYR B CD1   1 
ATOM   4246 C CD2   . TYR C 2 170 ? -0.809  -6.705  69.926 1.00 89.01  ? 170 TYR B CD2   1 
ATOM   4247 C CE1   . TYR C 2 170 ? 0.093   -4.093  69.736 1.00 90.46  ? 170 TYR B CE1   1 
ATOM   4248 C CE2   . TYR C 2 170 ? 0.552   -6.434  70.009 1.00 88.35  ? 170 TYR B CE2   1 
ATOM   4249 C CZ    . TYR C 2 170 ? 0.998   -5.128  69.913 1.00 90.84  ? 170 TYR B CZ    1 
ATOM   4250 O OH    . TYR C 2 170 ? 2.347   -4.865  69.995 1.00 93.30  ? 170 TYR B OH    1 
ATOM   4251 N N     . ARG C 2 171 ? -6.448  -5.207  70.500 1.00 90.39  ? 171 ARG B N     1 
ATOM   4252 C CA    . ARG C 2 171 ? -7.839  -5.601  70.280 1.00 88.44  ? 171 ARG B CA    1 
ATOM   4253 C C     . ARG C 2 171 ? -8.438  -4.930  69.045 1.00 89.22  ? 171 ARG B C     1 
ATOM   4254 O O     . ARG C 2 171 ? -8.327  -3.715  68.877 1.00 88.53  ? 171 ARG B O     1 
ATOM   4255 C CB    . ARG C 2 171 ? -8.703  -5.254  71.495 1.00 80.35  ? 171 ARG B CB    1 
ATOM   4256 C CG    . ARG C 2 171 ? -10.134 -5.754  71.363 1.00 89.10  ? 171 ARG B CG    1 
ATOM   4257 C CD    . ARG C 2 171 ? -11.023 -5.318  72.518 1.00 91.38  ? 171 ARG B CD    1 
ATOM   4258 N NE    . ARG C 2 171 ? -11.261 -3.877  72.523 1.00 104.09 ? 171 ARG B NE    1 
ATOM   4259 C CZ    . ARG C 2 171 ? -12.106 -3.264  73.346 1.00 109.79 ? 171 ARG B CZ    1 
ATOM   4260 N NH1   . ARG C 2 171 ? -12.799 -3.966  74.234 1.00 109.08 ? 171 ARG B NH1   1 
ATOM   4261 N NH2   . ARG C 2 171 ? -12.260 -1.947  73.285 1.00 113.61 ? 171 ARG B NH2   1 
ATOM   4262 N N     . LEU C 2 172 ? -9.076  -5.718  68.183 1.00 93.44  ? 172 LEU B N     1 
ATOM   4263 C CA    . LEU C 2 172 ? -9.700  -5.161  66.985 1.00 93.67  ? 172 LEU B CA    1 
ATOM   4264 C C     . LEU C 2 172 ? -11.007 -4.488  67.384 1.00 92.90  ? 172 LEU B C     1 
ATOM   4265 O O     . LEU C 2 172 ? -11.860 -5.098  68.032 1.00 87.38  ? 172 LEU B O     1 
ATOM   4266 C CB    . LEU C 2 172 ? -9.978  -6.252  65.944 1.00 96.29  ? 172 LEU B CB    1 
ATOM   4267 C CG    . LEU C 2 172 ? -11.068 -7.285  66.233 1.00 102.73 ? 172 LEU B CG    1 
ATOM   4268 C CD1   . LEU C 2 172 ? -11.282 -8.144  64.996 1.00 100.83 ? 172 LEU B CD1   1 
ATOM   4269 C CD2   . LEU C 2 172 ? -10.679 -8.143  67.431 1.00 108.32 ? 172 LEU B CD2   1 
ATOM   4270 N N     . ILE C 2 173 ? -11.157 -3.226  67.000 1.00 95.31  ? 173 ILE B N     1 
ATOM   4271 C CA    . ILE C 2 173 ? -12.356 -2.473  67.337 1.00 97.53  ? 173 ILE B CA    1 
ATOM   4272 C C     . ILE C 2 173 ? -13.368 -2.426  66.198 1.00 101.78 ? 173 ILE B C     1 
ATOM   4273 O O     . ILE C 2 173 ? -14.570 -2.342  66.443 1.00 102.69 ? 173 ILE B O     1 
ATOM   4274 C CB    . ILE C 2 173 ? -11.997 -1.029  67.760 1.00 98.44  ? 173 ILE B CB    1 
ATOM   4275 C CG1   . ILE C 2 173 ? -11.036 -1.069  68.955 1.00 97.20  ? 173 ILE B CG1   1 
ATOM   4276 C CG2   . ILE C 2 173 ? -13.264 -0.257  68.120 1.00 92.96  ? 173 ILE B CG2   1 
ATOM   4277 C CD1   . ILE C 2 173 ? -10.654 0.296   69.496 1.00 94.79  ? 173 ILE B CD1   1 
ATOM   4278 N N     . SER C 2 174 ? -12.892 -2.484  64.957 1.00 105.05 ? 174 SER B N     1 
ATOM   4279 C CA    . SER C 2 174 ? -13.797 -2.446  63.813 1.00 106.50 ? 174 SER B CA    1 
ATOM   4280 C C     . SER C 2 174 ? -13.126 -2.804  62.494 1.00 110.45 ? 174 SER B C     1 
ATOM   4281 O O     . SER C 2 174 ? -11.905 -2.720  62.358 1.00 112.06 ? 174 SER B O     1 
ATOM   4282 C CB    . SER C 2 174 ? -14.430 -1.056  63.685 1.00 111.52 ? 174 SER B CB    1 
ATOM   4283 O OG    . SER C 2 174 ? -13.473 -0.088  63.285 1.00 110.61 ? 174 SER B OG    1 
ATOM   4284 N N     . VAL C 2 175 ? -13.948 -3.204  61.527 1.00 112.73 ? 175 VAL B N     1 
ATOM   4285 C CA    . VAL C 2 175 ? -13.482 -3.567  60.193 1.00 113.28 ? 175 VAL B CA    1 
ATOM   4286 C C     . VAL C 2 175 ? -14.426 -2.899  59.198 1.00 115.58 ? 175 VAL B C     1 
ATOM   4287 O O     . VAL C 2 175 ? -15.243 -3.561  58.556 1.00 117.38 ? 175 VAL B O     1 
ATOM   4288 C CB    . VAL C 2 175 ? -13.526 -5.093  59.970 1.00 108.39 ? 175 VAL B CB    1 
ATOM   4289 C CG1   . VAL C 2 175 ? -12.821 -5.445  58.672 1.00 109.19 ? 175 VAL B CG1   1 
ATOM   4290 C CG2   . VAL C 2 175 ? -12.882 -5.811  61.141 1.00 107.52 ? 175 VAL B CG2   1 
ATOM   4291 N N     . GLU C 2 176 ? -14.306 -1.580  59.084 1.00 118.22 ? 176 GLU B N     1 
ATOM   4292 C CA    . GLU C 2 176 ? -15.150 -0.785  58.197 1.00 121.07 ? 176 GLU B CA    1 
ATOM   4293 C C     . GLU C 2 176 ? -14.901 -1.034  56.708 1.00 119.16 ? 176 GLU B C     1 
ATOM   4294 O O     . GLU C 2 176 ? -13.936 -1.697  56.326 1.00 116.40 ? 176 GLU B O     1 
ATOM   4295 C CB    . GLU C 2 176 ? -14.951 0.703   58.505 1.00 126.54 ? 176 GLU B CB    1 
ATOM   4296 C CG    . GLU C 2 176 ? -15.116 1.065   59.979 1.00 130.72 ? 176 GLU B CG    1 
ATOM   4297 C CD    . GLU C 2 176 ? -14.824 2.531   60.264 1.00 131.95 ? 176 GLU B CD    1 
ATOM   4298 O OE1   . GLU C 2 176 ? -15.553 3.404   59.745 1.00 130.58 ? 176 GLU B OE1   1 
ATOM   4299 O OE2   . GLU C 2 176 ? -13.859 2.811   61.007 1.00 132.65 ? 176 GLU B OE2   1 
ATOM   4300 N N     . GLY C 2 177 ? -15.791 -0.498  55.875 1.00 118.51 ? 177 GLY B N     1 
ATOM   4301 C CA    . GLY C 2 177 ? -15.656 -0.642  54.435 1.00 121.12 ? 177 GLY B CA    1 
ATOM   4302 C C     . GLY C 2 177 ? -16.261 -1.899  53.835 1.00 122.02 ? 177 GLY B C     1 
ATOM   4303 O O     . GLY C 2 177 ? -16.674 -2.801  54.563 1.00 124.53 ? 177 GLY B O     1 
ATOM   4304 N N     . PRO C 2 178 ? -16.335 -1.980  52.495 1.00 120.48 ? 178 PRO B N     1 
ATOM   4305 C CA    . PRO C 2 178 ? -16.888 -3.128  51.769 1.00 121.40 ? 178 PRO B CA    1 
ATOM   4306 C C     . PRO C 2 178 ? -15.977 -4.351  51.859 1.00 123.10 ? 178 PRO B C     1 
ATOM   4307 O O     . PRO C 2 178 ? -14.764 -4.217  52.015 1.00 125.35 ? 178 PRO B O     1 
ATOM   4308 C CB    . PRO C 2 178 ? -17.010 -2.601  50.344 1.00 119.88 ? 178 PRO B CB    1 
ATOM   4309 C CG    . PRO C 2 178 ? -15.848 -1.668  50.247 1.00 117.70 ? 178 PRO B CG    1 
ATOM   4310 C CD    . PRO C 2 178 ? -15.939 -0.917  51.553 1.00 117.95 ? 178 PRO B CD    1 
ATOM   4311 N N     . HIS C 2 179 ? -16.567 -5.537  51.747 1.00 125.15 ? 179 HIS B N     1 
ATOM   4312 C CA    . HIS C 2 179 ? -15.820 -6.790  51.837 1.00 126.33 ? 179 HIS B CA    1 
ATOM   4313 C C     . HIS C 2 179 ? -14.622 -6.923  50.891 1.00 124.88 ? 179 HIS B C     1 
ATOM   4314 O O     . HIS C 2 179 ? -13.766 -7.784  51.097 1.00 124.99 ? 179 HIS B O     1 
ATOM   4315 C CB    . HIS C 2 179 ? -16.766 -7.977  51.627 1.00 132.66 ? 179 HIS B CB    1 
ATOM   4316 C CG    . HIS C 2 179 ? -17.815 -8.114  52.690 1.00 143.43 ? 179 HIS B CG    1 
ATOM   4317 N ND1   . HIS C 2 179 ? -17.508 -8.246  54.028 1.00 146.22 ? 179 HIS B ND1   1 
ATOM   4318 C CD2   . HIS C 2 179 ? -19.166 -8.154  52.610 1.00 146.97 ? 179 HIS B CD2   1 
ATOM   4319 C CE1   . HIS C 2 179 ? -18.624 -8.363  54.725 1.00 143.62 ? 179 HIS B CE1   1 
ATOM   4320 N NE2   . HIS C 2 179 ? -19.645 -8.311  53.889 1.00 145.35 ? 179 HIS B NE2   1 
ATOM   4321 N N     . HIS C 2 180 ? -14.553 -6.081  49.862 1.00 123.51 ? 180 HIS B N     1 
ATOM   4322 C CA    . HIS C 2 180 ? -13.443 -6.148  48.910 1.00 121.81 ? 180 HIS B CA    1 
ATOM   4323 C C     . HIS C 2 180 ? -12.410 -5.047  49.142 1.00 119.95 ? 180 HIS B C     1 
ATOM   4324 O O     . HIS C 2 180 ? -11.422 -4.947  48.410 1.00 116.46 ? 180 HIS B O     1 
ATOM   4325 C CB    . HIS C 2 180 ? -13.963 -6.058  47.471 1.00 123.20 ? 180 HIS B CB    1 
ATOM   4326 C CG    . HIS C 2 180 ? -14.522 -4.717  47.112 1.00 124.94 ? 180 HIS B CG    1 
ATOM   4327 N ND1   . HIS C 2 180 ? -15.695 -4.229  47.648 1.00 124.94 ? 180 HIS B ND1   1 
ATOM   4328 C CD2   . HIS C 2 180 ? -14.056 -3.750  46.286 1.00 124.43 ? 180 HIS B CD2   1 
ATOM   4329 C CE1   . HIS C 2 180 ? -15.926 -3.020  47.168 1.00 124.13 ? 180 HIS B CE1   1 
ATOM   4330 N NE2   . HIS C 2 180 ? -14.946 -2.706  46.339 1.00 123.11 ? 180 HIS B NE2   1 
ATOM   4331 N N     . LYS C 2 181 ? -12.647 -4.222  50.158 1.00 117.78 ? 181 LYS B N     1 
ATOM   4332 C CA    . LYS C 2 181 ? -11.744 -3.126  50.497 1.00 112.73 ? 181 LYS B CA    1 
ATOM   4333 C C     . LYS C 2 181 ? -11.942 -2.740  51.964 1.00 105.99 ? 181 LYS B C     1 
ATOM   4334 O O     . LYS C 2 181 ? -12.021 -1.561  52.314 1.00 93.24  ? 181 LYS B O     1 
ATOM   4335 C CB    . LYS C 2 181 ? -12.017 -1.923  49.588 1.00 116.71 ? 181 LYS B CB    1 
ATOM   4336 C CG    . LYS C 2 181 ? -10.991 -0.805  49.700 1.00 123.74 ? 181 LYS B CG    1 
ATOM   4337 C CD    . LYS C 2 181 ? -11.258 0.290   48.679 1.00 127.89 ? 181 LYS B CD    1 
ATOM   4338 C CE    . LYS C 2 181 ? -10.205 1.384   48.752 1.00 128.18 ? 181 LYS B CE    1 
ATOM   4339 N NZ    . LYS C 2 181 ? -10.423 2.428   47.713 1.00 133.31 ? 181 LYS B NZ    1 
ATOM   4340 N N     . LYS C 2 182 ? -12.022 -3.756  52.816 1.00 104.37 ? 182 LYS B N     1 
ATOM   4341 C CA    . LYS C 2 182 ? -12.214 -3.557  54.246 1.00 105.92 ? 182 LYS B CA    1 
ATOM   4342 C C     . LYS C 2 182 ? -10.928 -3.098  54.925 1.00 106.54 ? 182 LYS B C     1 
ATOM   4343 O O     . LYS C 2 182 ? -9.828  -3.516  54.553 1.00 103.24 ? 182 LYS B O     1 
ATOM   4344 C CB    . LYS C 2 182 ? -12.695 -4.856  54.898 1.00 107.63 ? 182 LYS B CB    1 
ATOM   4345 C CG    . LYS C 2 182 ? -11.718 -6.019  54.760 1.00 103.74 ? 182 LYS B CG    1 
ATOM   4346 C CD    . LYS C 2 182 ? -12.236 -7.276  55.444 1.00 102.29 ? 182 LYS B CD    1 
ATOM   4347 C CE    . LYS C 2 182 ? -13.531 -7.760  54.814 1.00 102.29 ? 182 LYS B CE    1 
ATOM   4348 N NZ    . LYS C 2 182 ? -14.052 -8.984  55.479 1.00 100.77 ? 182 LYS B NZ    1 
ATOM   4349 N N     . LYS C 2 183 ? -11.079 -2.237  55.926 1.00 101.42 ? 183 LYS B N     1 
ATOM   4350 C CA    . LYS C 2 183 ? -9.940  -1.725  56.669 1.00 95.24  ? 183 LYS B CA    1 
ATOM   4351 C C     . LYS C 2 183 ? -10.134 -2.042  58.153 1.00 95.84  ? 183 LYS B C     1 
ATOM   4352 O O     . LYS C 2 183 ? -11.204 -1.790  58.718 1.00 87.21  ? 183 LYS B O     1 
ATOM   4353 C CB    . LYS C 2 183 ? -9.811  -0.210  56.473 1.00 91.76  ? 183 LYS B CB    1 
ATOM   4354 C CG    . LYS C 2 183 ? -10.754 0.626   57.331 1.00 91.52  ? 183 LYS B CG    1 
ATOM   4355 C CD    . LYS C 2 183 ? -10.529 2.116   57.108 1.00 96.96  ? 183 LYS B CD    1 
ATOM   4356 C CE    . LYS C 2 183 ? -11.146 2.951   58.221 1.00 95.94  ? 183 LYS B CE    1 
ATOM   4357 N NZ    . LYS C 2 183 ? -12.593 2.671   58.406 1.00 95.05  ? 183 LYS B NZ    1 
ATOM   4358 N N     . PHE C 2 184 ? -9.102  -2.599  58.781 1.00 93.35  ? 184 PHE B N     1 
ATOM   4359 C CA    . PHE C 2 184 ? -9.179  -2.948  60.194 1.00 87.22  ? 184 PHE B CA    1 
ATOM   4360 C C     . PHE C 2 184 ? -8.742  -1.804  61.097 1.00 89.81  ? 184 PHE B C     1 
ATOM   4361 O O     . PHE C 2 184 ? -7.948  -0.945  60.701 1.00 88.49  ? 184 PHE B O     1 
ATOM   4362 C CB    . PHE C 2 184 ? -8.311  -4.168  60.506 1.00 77.86  ? 184 PHE B CB    1 
ATOM   4363 C CG    . PHE C 2 184 ? -8.614  -5.374  59.665 1.00 78.28  ? 184 PHE B CG    1 
ATOM   4364 C CD1   . PHE C 2 184 ? -8.229  -5.423  58.327 1.00 71.00  ? 184 PHE B CD1   1 
ATOM   4365 C CD2   . PHE C 2 184 ? -9.239  -6.486  60.225 1.00 73.58  ? 184 PHE B CD2   1 
ATOM   4366 C CE1   . PHE C 2 184 ? -8.453  -6.569  57.560 1.00 65.62  ? 184 PHE B CE1   1 
ATOM   4367 C CE2   . PHE C 2 184 ? -9.469  -7.635  59.468 1.00 69.80  ? 184 PHE B CE2   1 
ATOM   4368 C CZ    . PHE C 2 184 ? -9.074  -7.677  58.133 1.00 68.28  ? 184 PHE B CZ    1 
ATOM   4369 N N     . ILE C 2 185 ? -9.271  -1.807  62.316 1.00 89.18  ? 185 ILE B N     1 
ATOM   4370 C CA    . ILE C 2 185 ? -8.948  -0.794  63.310 1.00 91.69  ? 185 ILE B CA    1 
ATOM   4371 C C     . ILE C 2 185 ? -8.685  -1.490  64.638 1.00 93.34  ? 185 ILE B C     1 
ATOM   4372 O O     . ILE C 2 185 ? -9.622  -1.881  65.335 1.00 90.93  ? 185 ILE B O     1 
ATOM   4373 C CB    . ILE C 2 185 ? -10.109 0.203   63.518 1.00 96.65  ? 185 ILE B CB    1 
ATOM   4374 C CG1   . ILE C 2 185 ? -10.382 0.985   62.229 1.00 103.45 ? 185 ILE B CG1   1 
ATOM   4375 C CG2   . ILE C 2 185 ? -9.773  1.153   64.655 1.00 93.73  ? 185 ILE B CG2   1 
ATOM   4376 C CD1   . ILE C 2 185 ? -11.107 0.191   61.155 1.00 110.43 ? 185 ILE B CD1   1 
ATOM   4377 N N     . VAL C 2 186 ? -7.410  -1.645  64.982 1.00 96.50  ? 186 VAL B N     1 
ATOM   4378 C CA    . VAL C 2 186 ? -7.031  -2.297  66.232 1.00 94.76  ? 186 VAL B CA    1 
ATOM   4379 C C     . VAL C 2 186 ? -6.650  -1.273  67.295 1.00 90.33  ? 186 VAL B C     1 
ATOM   4380 O O     . VAL C 2 186 ? -6.381  -0.111  66.990 1.00 87.44  ? 186 VAL B O     1 
ATOM   4381 C CB    . VAL C 2 186 ? -5.839  -3.256  66.028 1.00 100.14 ? 186 VAL B CB    1 
ATOM   4382 C CG1   . VAL C 2 186 ? -6.140  -4.222  64.888 1.00 101.33 ? 186 VAL B CG1   1 
ATOM   4383 C CG2   . VAL C 2 186 ? -4.570  -2.463  65.747 1.00 101.62 ? 186 VAL B CG2   1 
ATOM   4384 N N     . GLU C 2 187 ? -6.630  -1.716  68.545 1.00 90.71  ? 187 GLU B N     1 
ATOM   4385 C CA    . GLU C 2 187 ? -6.282  -0.849  69.660 1.00 91.86  ? 187 GLU B CA    1 
ATOM   4386 C C     . GLU C 2 187 ? -5.147  -1.435  70.493 1.00 91.68  ? 187 GLU B C     1 
ATOM   4387 O O     . GLU C 2 187 ? -5.282  -2.509  71.079 1.00 87.76  ? 187 GLU B O     1 
ATOM   4388 C CB    . GLU C 2 187 ? -7.512  -0.611  70.538 1.00 93.76  ? 187 GLU B CB    1 
ATOM   4389 C CG    . GLU C 2 187 ? -7.228  0.140   71.826 1.00 104.97 ? 187 GLU B CG    1 
ATOM   4390 C CD    . GLU C 2 187 ? -7.378  -0.739  73.054 1.00 111.82 ? 187 GLU B CD    1 
ATOM   4391 O OE1   . GLU C 2 187 ? -6.718  -1.799  73.114 1.00 114.20 ? 187 GLU B OE1   1 
ATOM   4392 O OE2   . GLU C 2 187 ? -8.157  -0.369  73.960 1.00 114.68 ? 187 GLU B OE2   1 
ATOM   4393 N N     . ALA C 2 188 ? -4.026  -0.721  70.530 1.00 92.27  ? 188 ALA B N     1 
ATOM   4394 C CA    . ALA C 2 188 ? -2.857  -1.144  71.295 1.00 90.74  ? 188 ALA B CA    1 
ATOM   4395 C C     . ALA C 2 188 ? -2.979  -0.579  72.703 1.00 88.28  ? 188 ALA B C     1 
ATOM   4396 O O     . ALA C 2 188 ? -3.334  0.584   72.878 1.00 86.22  ? 188 ALA B O     1 
ATOM   4397 C CB    . ALA C 2 188 ? -1.583  -0.627  70.633 1.00 87.33  ? 188 ALA B CB    1 
ATOM   4398 N N     . LYS C 2 189 ? -2.686  -1.399  73.704 1.00 90.96  ? 189 LYS B N     1 
ATOM   4399 C CA    . LYS C 2 189 ? -2.781  -0.955  75.089 1.00 92.80  ? 189 LYS B CA    1 
ATOM   4400 C C     . LYS C 2 189 ? -1.719  -1.592  75.985 1.00 91.27  ? 189 LYS B C     1 
ATOM   4401 O O     . LYS C 2 189 ? -1.308  -2.732  75.773 1.00 90.21  ? 189 LYS B O     1 
ATOM   4402 C CB    . LYS C 2 189 ? -4.169  -1.288  75.646 1.00 89.91  ? 189 LYS B CB    1 
ATOM   4403 C CG    . LYS C 2 189 ? -4.324  -0.984  77.124 1.00 94.51  ? 189 LYS B CG    1 
ATOM   4404 C CD    . LYS C 2 189 ? -5.638  -1.503  77.673 1.00 102.47 ? 189 LYS B CD    1 
ATOM   4405 C CE    . LYS C 2 189 ? -5.726  -1.279  79.177 1.00 112.33 ? 189 LYS B CE    1 
ATOM   4406 N NZ    . LYS C 2 189 ? -4.611  -1.947  79.910 1.00 109.36 ? 189 LYS B NZ    1 
ATOM   4407 N N     . ILE C 2 190 ? -1.288  -0.836  76.988 1.00 92.16  ? 190 ILE B N     1 
ATOM   4408 C CA    . ILE C 2 190 ? -0.295  -1.259  77.955 1.00 89.56  ? 190 ILE B CA    1 
ATOM   4409 C C     . ILE C 2 190 ? -0.397  -0.361  79.152 1.00 93.32  ? 190 ILE B C     1 
ATOM   4410 O O     . ILE C 2 190 ? -0.027  0.812   79.100 1.00 90.82  ? 190 ILE B O     1 
ATOM   4411 C CB    . ILE C 2 190 ? 1.122   -1.241  77.353 1.00 89.45  ? 190 ILE B CB    1 
ATOM   4412 C CG1   . ILE C 2 190 ? 2.159   -1.601  78.419 1.00 80.41  ? 190 ILE B CG1   1 
ATOM   4413 C CG2   . ILE C 2 190 ? 1.424   0.119   76.741 1.00 89.53  ? 190 ILE B CG2   1 
ATOM   4414 C CD1   . ILE C 2 190 ? 1.864   -2.894  79.147 1.00 20.35  ? 190 ILE B CD1   1 
ATOM   4415 N N     . LYS C 2 191 ? -0.885  -0.911  80.227 1.00 96.90  ? 191 LYS B N     1 
ATOM   4416 C CA    . LYS C 2 191 ? -1.067  -0.116  81.402 1.00 99.17  ? 191 LYS B CA    1 
ATOM   4417 C C     . LYS C 2 191 ? -2.122  0.912   81.078 1.00 101.24 ? 191 LYS B C     1 
ATOM   4418 O O     . LYS C 2 191 ? -3.242  0.588   80.695 1.00 101.78 ? 191 LYS B O     1 
ATOM   4419 C CB    . LYS C 2 191 ? 0.251   0.582   81.798 1.00 101.94 ? 191 LYS B CB    1 
ATOM   4420 C CG    . LYS C 2 191 ? 1.247   -0.297  82.508 1.00 93.72  ? 191 LYS B CG    1 
ATOM   4421 C CD    . LYS C 2 191 ? 0.775   -0.587  83.917 1.00 91.36  ? 191 LYS B CD    1 
ATOM   4422 C CE    . LYS C 2 191 ? 1.686   -1.600  84.584 1.00 95.27  ? 191 LYS B CE    1 
ATOM   4423 N NZ    . LYS C 2 191 ? 1.175   -2.000  85.925 1.00 101.26 ? 191 LYS B NZ    1 
ATOM   4424 N N     . GLU C 2 192 ? -1.750  2.138   81.245 1.00 104.16 ? 192 GLU B N     1 
ATOM   4425 C CA    . GLU C 2 192 ? -2.712  3.153   81.010 1.00 109.47 ? 192 GLU B CA    1 
ATOM   4426 C C     . GLU C 2 192 ? -2.398  3.955   79.764 1.00 108.86 ? 192 GLU B C     1 
ATOM   4427 O O     . GLU C 2 192 ? -2.571  5.167   79.759 1.00 111.70 ? 192 GLU B O     1 
ATOM   4428 C CB    . GLU C 2 192 ? -2.810  4.058   82.242 1.00 117.75 ? 192 GLU B CB    1 
ATOM   4429 C CG    . GLU C 2 192 ? -3.381  3.366   83.461 1.00 132.26 ? 192 GLU B CG    1 
ATOM   4430 C CD    . GLU C 2 192 ? -4.848  3.021   83.248 1.00 140.50 ? 192 GLU B CD    1 
ATOM   4431 O OE1   . GLU C 2 192 ? -5.155  2.228   82.330 1.00 144.42 ? 192 GLU B OE1   1 
ATOM   4432 O OE2   . GLU C 2 192 ? -5.697  3.545   84.000 1.00 143.29 ? 192 GLU B OE2   1 
ATOM   4433 N N     . TYR C 2 193 ? -1.931  3.298   78.708 1.00 107.85 ? 193 TYR B N     1 
ATOM   4434 C CA    . TYR C 2 193 ? -1.625  3.976   77.454 1.00 106.14 ? 193 TYR B CA    1 
ATOM   4435 C C     . TYR C 2 193 ? -2.309  3.245   76.304 1.00 106.77 ? 193 TYR B C     1 
ATOM   4436 O O     . TYR C 2 193 ? -2.122  2.041   76.131 1.00 105.75 ? 193 TYR B O     1 
ATOM   4437 C CB    . TYR C 2 193 ? -0.113  4.029   77.209 1.00 107.52 ? 193 TYR B CB    1 
ATOM   4438 C CG    . TYR C 2 193 ? 0.703   4.651   78.305 1.00 109.70 ? 193 TYR B CG    1 
ATOM   4439 C CD1   . TYR C 2 193 ? 0.731   4.120   79.595 1.00 115.60 ? 193 TYR B CD1   1 
ATOM   4440 C CD2   . TYR C 2 193 ? 1.470   5.786   78.045 1.00 111.31 ? 193 TYR B CD2   1 
ATOM   4441 C CE1   . TYR C 2 193 ? 1.504   4.700   80.599 1.00 117.25 ? 193 TYR B CE1   1 
ATOM   4442 C CE2   . TYR C 2 193 ? 2.247   6.374   79.042 1.00 113.59 ? 193 TYR B CE2   1 
ATOM   4443 C CZ    . TYR C 2 193 ? 2.260   5.826   80.314 1.00 117.10 ? 193 TYR B CZ    1 
ATOM   4444 O OH    . TYR C 2 193 ? 3.034   6.396   81.299 1.00 119.98 ? 193 TYR B OH    1 
ATOM   4445 N N     . ARG C 2 194 ? -3.099  3.974   75.520 1.00 109.03 ? 194 ARG B N     1 
ATOM   4446 C CA    . ARG C 2 194 ? -3.809  3.381   74.389 1.00 107.44 ? 194 ARG B CA    1 
ATOM   4447 C C     . ARG C 2 194 ? -3.615  4.195   73.112 1.00 102.26 ? 194 ARG B C     1 
ATOM   4448 O O     . ARG C 2 194 ? -3.380  5.403   73.157 1.00 99.91  ? 194 ARG B O     1 
ATOM   4449 C CB    . ARG C 2 194 ? -5.307  3.285   74.692 1.00 105.72 ? 194 ARG B CB    1 
ATOM   4450 C CG    . ARG C 2 194 ? -5.632  2.555   75.977 1.00 114.86 ? 194 ARG B CG    1 
ATOM   4451 C CD    . ARG C 2 194 ? -7.130  2.444   76.190 1.00 118.77 ? 194 ARG B CD    1 
ATOM   4452 N NE    . ARG C 2 194 ? -7.441  1.918   77.516 1.00 128.03 ? 194 ARG B NE    1 
ATOM   4453 C CZ    . ARG C 2 194 ? -8.669  1.659   77.950 1.00 131.27 ? 194 ARG B CZ    1 
ATOM   4454 N NH1   . ARG C 2 194 ? -9.714  1.874   77.161 1.00 132.87 ? 194 ARG B NH1   1 
ATOM   4455 N NH2   . ARG C 2 194 ? -8.853  1.188   79.176 1.00 131.26 ? 194 ARG B NH2   1 
ATOM   4456 N N     . THR C 2 195 ? -3.716  3.517   71.975 1.00 99.85  ? 195 THR B N     1 
ATOM   4457 C CA    . THR C 2 195 ? -3.575  4.149   70.668 1.00 96.07  ? 195 THR B CA    1 
ATOM   4458 C C     . THR C 2 195 ? -4.374  3.344   69.648 1.00 93.35  ? 195 THR B C     1 
ATOM   4459 O O     . THR C 2 195 ? -4.740  2.196   69.904 1.00 88.53  ? 195 THR B O     1 
ATOM   4460 C CB    . THR C 2 195 ? -2.104  4.184   70.196 1.00 97.57  ? 195 THR B CB    1 
ATOM   4461 O OG1   . THR C 2 195 ? -1.570  2.853   70.192 1.00 91.86  ? 195 THR B OG1   1 
ATOM   4462 C CG2   . THR C 2 195 ? -1.267  5.066   71.102 1.00 99.29  ? 195 THR B CG2   1 
ATOM   4463 N N     . LEU C 2 196 ? -4.640  3.947   68.494 1.00 91.39  ? 196 LEU B N     1 
ATOM   4464 C CA    . LEU C 2 196 ? -5.392  3.275   67.438 1.00 86.07  ? 196 LEU B CA    1 
ATOM   4465 C C     . LEU C 2 196 ? -4.561  3.161   66.170 1.00 85.25  ? 196 LEU B C     1 
ATOM   4466 O O     . LEU C 2 196 ? -3.591  3.893   65.983 1.00 83.62  ? 196 LEU B O     1 
ATOM   4467 C CB    . LEU C 2 196 ? -6.686  4.038   67.121 1.00 81.36  ? 196 LEU B CB    1 
ATOM   4468 C CG    . LEU C 2 196 ? -7.788  4.165   68.181 1.00 82.39  ? 196 LEU B CG    1 
ATOM   4469 C CD1   . LEU C 2 196 ? -8.265  2.778   68.582 1.00 80.42  ? 196 LEU B CD1   1 
ATOM   4470 C CD2   . LEU C 2 196 ? -7.276  4.936   69.395 1.00 81.75  ? 196 LEU B CD2   1 
ATOM   4471 N N     . GLY C 2 197 ? -4.950  2.241   65.296 1.00 90.22  ? 197 GLY B N     1 
ATOM   4472 C CA    . GLY C 2 197 ? -4.224  2.063   64.052 1.00 95.07  ? 197 GLY B CA    1 
ATOM   4473 C C     . GLY C 2 197 ? -5.101  1.521   62.936 1.00 95.67  ? 197 GLY B C     1 
ATOM   4474 O O     . GLY C 2 197 ? -5.808  0.528   63.115 1.00 98.46  ? 197 GLY B O     1 
ATOM   4475 N N     . GLU C 2 198 ? -5.062  2.182   61.785 1.00 90.54  ? 198 GLU B N     1 
ATOM   4476 C CA    . GLU C 2 198 ? -5.843  1.757   60.632 1.00 89.27  ? 198 GLU B CA    1 
ATOM   4477 C C     . GLU C 2 198 ? -4.963  0.908   59.730 1.00 85.91  ? 198 GLU B C     1 
ATOM   4478 O O     . GLU C 2 198 ? -3.823  1.275   59.447 1.00 85.15  ? 198 GLU B O     1 
ATOM   4479 C CB    . GLU C 2 198 ? -6.341  2.975   59.849 1.00 99.65  ? 198 GLU B CB    1 
ATOM   4480 C CG    . GLU C 2 198 ? -6.924  2.637   58.476 1.00 110.17 ? 198 GLU B CG    1 
ATOM   4481 C CD    . GLU C 2 198 ? -7.242  3.870   57.645 1.00 114.90 ? 198 GLU B CD    1 
ATOM   4482 O OE1   . GLU C 2 198 ? -8.159  4.630   58.027 1.00 114.60 ? 198 GLU B OE1   1 
ATOM   4483 O OE2   . GLU C 2 198 ? -6.571  4.081   56.610 1.00 114.03 ? 198 GLU B OE2   1 
ATOM   4484 N N     . GLY C 2 199 ? -5.488  -0.223  59.273 1.00 82.43  ? 199 GLY B N     1 
ATOM   4485 C CA    . GLY C 2 199 ? -4.702  -1.078  58.404 1.00 82.01  ? 199 GLY B CA    1 
ATOM   4486 C C     . GLY C 2 199 ? -5.513  -1.961  57.477 1.00 82.21  ? 199 GLY B C     1 
ATOM   4487 O O     . GLY C 2 199 ? -6.644  -2.338  57.783 1.00 77.81  ? 199 GLY B O     1 
ATOM   4488 N N     . LYS C 2 200 ? -4.918  -2.291  56.337 1.00 80.13  ? 200 LYS B N     1 
ATOM   4489 C CA    . LYS C 2 200 ? -5.553  -3.140  55.339 1.00 86.33  ? 200 LYS B CA    1 
ATOM   4490 C C     . LYS C 2 200 ? -5.763  -4.534  55.926 1.00 91.05  ? 200 LYS B C     1 
ATOM   4491 O O     . LYS C 2 200 ? -6.586  -5.310  55.440 1.00 97.93  ? 200 LYS B O     1 
ATOM   4492 C CB    . LYS C 2 200 ? -4.659  -3.234  54.099 1.00 87.29  ? 200 LYS B CB    1 
ATOM   4493 C CG    . LYS C 2 200 ? -5.367  -2.966  52.781 1.00 100.96 ? 200 LYS B CG    1 
ATOM   4494 C CD    . LYS C 2 200 ? -5.882  -1.536  52.709 1.00 105.38 ? 200 LYS B CD    1 
ATOM   4495 C CE    . LYS C 2 200 ? -6.593  -1.265  51.391 1.00 105.25 ? 200 LYS B CE    1 
ATOM   4496 N NZ    . LYS C 2 200 ? -7.131  0.123   51.327 1.00 103.29 ? 200 LYS B NZ    1 
ATOM   4497 N N     . SER C 2 201 ? -5.005  -4.844  56.974 1.00 91.69  ? 201 SER B N     1 
ATOM   4498 C CA    . SER C 2 201 ? -5.091  -6.139  57.641 1.00 88.75  ? 201 SER B CA    1 
ATOM   4499 C C     . SER C 2 201 ? -5.082  -5.937  59.151 1.00 87.06  ? 201 SER B C     1 
ATOM   4500 O O     . SER C 2 201 ? -5.013  -4.807  59.627 1.00 87.70  ? 201 SER B O     1 
ATOM   4501 C CB    . SER C 2 201 ? -3.912  -7.019  57.229 1.00 85.13  ? 201 SER B CB    1 
ATOM   4502 O OG    . SER C 2 201 ? -2.680  -6.378  57.509 1.00 89.96  ? 201 SER B OG    1 
ATOM   4503 N N     . LYS C 2 202 ? -5.160  -7.027  59.907 1.00 91.26  ? 202 LYS B N     1 
ATOM   4504 C CA    . LYS C 2 202 ? -5.147  -6.914  61.360 1.00 94.98  ? 202 LYS B CA    1 
ATOM   4505 C C     . LYS C 2 202 ? -3.737  -6.564  61.823 1.00 95.84  ? 202 LYS B C     1 
ATOM   4506 O O     . LYS C 2 202 ? -3.542  -5.617  62.586 1.00 95.04  ? 202 LYS B O     1 
ATOM   4507 C CB    . LYS C 2 202 ? -5.594  -8.223  62.017 1.00 96.10  ? 202 LYS B CB    1 
ATOM   4508 C CG    . LYS C 2 202 ? -5.904  -8.077  63.503 1.00 102.93 ? 202 LYS B CG    1 
ATOM   4509 C CD    . LYS C 2 202 ? -6.191  -9.416  64.167 1.00 111.82 ? 202 LYS B CD    1 
ATOM   4510 C CE    . LYS C 2 202 ? -4.944  -10.290 64.219 1.00 118.25 ? 202 LYS B CE    1 
ATOM   4511 N NZ    . LYS C 2 202 ? -5.190  -11.587 64.909 1.00 116.47 ? 202 LYS B NZ    1 
ATOM   4512 N N     . LYS C 2 203 ? -2.755  -7.325  61.348 1.00 94.89  ? 203 LYS B N     1 
ATOM   4513 C CA    . LYS C 2 203 ? -1.366  -7.089  61.719 1.00 95.50  ? 203 LYS B CA    1 
ATOM   4514 C C     . LYS C 2 203 ? -0.910  -5.697  61.303 1.00 96.36  ? 203 LYS B C     1 
ATOM   4515 O O     . LYS C 2 203 ? -0.283  -4.988  62.090 1.00 98.07  ? 203 LYS B O     1 
ATOM   4516 C CB    . LYS C 2 203 ? -0.458  -8.142  61.085 1.00 95.56  ? 203 LYS B CB    1 
ATOM   4517 C CG    . LYS C 2 203 ? 1.004   -8.003  61.476 1.00 98.83  ? 203 LYS B CG    1 
ATOM   4518 C CD    . LYS C 2 203 ? 1.804   -9.232  61.079 1.00 103.73 ? 203 LYS B CD    1 
ATOM   4519 C CE    . LYS C 2 203 ? 1.304   -10.467 61.815 1.00 107.40 ? 203 LYS B CE    1 
ATOM   4520 N NZ    . LYS C 2 203 ? 2.068   -11.691 61.450 1.00 118.24 ? 203 LYS B NZ    1 
ATOM   4521 N N     . GLU C 2 204 ? -1.221  -5.307  60.070 1.00 94.92  ? 204 GLU B N     1 
ATOM   4522 C CA    . GLU C 2 204 ? -0.838  -3.984  59.584 1.00 90.46  ? 204 GLU B CA    1 
ATOM   4523 C C     . GLU C 2 204 ? -1.402  -2.910  60.510 1.00 88.72  ? 204 GLU B C     1 
ATOM   4524 O O     . GLU C 2 204 ? -0.736  -1.920  60.817 1.00 87.07  ? 204 GLU B O     1 
ATOM   4525 C CB    . GLU C 2 204 ? -1.365  -3.742  58.169 1.00 90.34  ? 204 GLU B CB    1 
ATOM   4526 C CG    . GLU C 2 204 ? -1.094  -2.329  57.674 1.00 99.88  ? 204 GLU B CG    1 
ATOM   4527 C CD    . GLU C 2 204 ? -1.718  -2.038  56.325 1.00 100.56 ? 204 GLU B CD    1 
ATOM   4528 O OE1   . GLU C 2 204 ? -1.389  -2.751  55.353 1.00 97.53  ? 204 GLU B OE1   1 
ATOM   4529 O OE2   . GLU C 2 204 ? -2.534  -1.093  56.240 1.00 99.95  ? 204 GLU B OE2   1 
ATOM   4530 N N     . ALA C 2 205 ? -2.639  -3.116  60.947 1.00 86.52  ? 205 ALA B N     1 
ATOM   4531 C CA    . ALA C 2 205 ? -3.303  -2.176  61.835 1.00 85.69  ? 205 ALA B CA    1 
ATOM   4532 C C     . ALA C 2 205 ? -2.551  -2.096  63.155 1.00 85.88  ? 205 ALA B C     1 
ATOM   4533 O O     . ALA C 2 205 ? -2.375  -1.014  63.713 1.00 83.61  ? 205 ALA B O     1 
ATOM   4534 C CB    . ALA C 2 205 ? -4.743  -2.618  62.077 1.00 81.79  ? 205 ALA B CB    1 
ATOM   4535 N N     . GLU C 2 206 ? -2.109  -3.251  63.645 1.00 89.69  ? 206 GLU B N     1 
ATOM   4536 C CA    . GLU C 2 206 ? -1.377  -3.328  64.905 1.00 88.47  ? 206 GLU B CA    1 
ATOM   4537 C C     . GLU C 2 206 ? -0.030  -2.606  64.829 1.00 85.51  ? 206 GLU B C     1 
ATOM   4538 O O     . GLU C 2 206 ? 0.305   -1.814  65.712 1.00 78.19  ? 206 GLU B O     1 
ATOM   4539 C CB    . GLU C 2 206 ? -1.170  -4.795  65.301 1.00 88.66  ? 206 GLU B CB    1 
ATOM   4540 C CG    . GLU C 2 206 ? -2.471  -5.568  65.495 1.00 94.00  ? 206 GLU B CG    1 
ATOM   4541 C CD    . GLU C 2 206 ? -2.253  -7.018  65.909 1.00 98.37  ? 206 GLU B CD    1 
ATOM   4542 O OE1   . GLU C 2 206 ? -1.578  -7.763  65.164 1.00 98.84  ? 206 GLU B OE1   1 
ATOM   4543 O OE2   . GLU C 2 206 ? -2.763  -7.415  66.979 1.00 97.54  ? 206 GLU B OE2   1 
ATOM   4544 N N     . GLN C 2 207 ? 0.738   -2.878  63.777 1.00 79.41  ? 207 GLN B N     1 
ATOM   4545 C CA    . GLN C 2 207 ? 2.032   -2.231  63.603 1.00 78.41  ? 207 GLN B CA    1 
ATOM   4546 C C     . GLN C 2 207 ? 1.855   -0.728  63.747 1.00 81.78  ? 207 GLN B C     1 
ATOM   4547 O O     . GLN C 2 207 ? 2.723   -0.036  64.274 1.00 87.78  ? 207 GLN B O     1 
ATOM   4548 C CB    . GLN C 2 207 ? 2.607   -2.539  62.222 1.00 75.24  ? 207 GLN B CB    1 
ATOM   4549 C CG    . GLN C 2 207 ? 3.027   -3.985  62.010 1.00 78.00  ? 207 GLN B CG    1 
ATOM   4550 C CD    . GLN C 2 207 ? 4.153   -4.412  62.930 1.00 74.31  ? 207 GLN B CD    1 
ATOM   4551 O OE1   . GLN C 2 207 ? 5.131   -3.688  63.114 1.00 72.70  ? 207 GLN B OE1   1 
ATOM   4552 N NE2   . GLN C 2 207 ? 4.027   -5.600  63.501 1.00 72.73  ? 207 GLN B NE2   1 
ATOM   4553 N N     . ARG C 2 208 ? 0.722   -0.229  63.267 1.00 84.73  ? 208 ARG B N     1 
ATOM   4554 C CA    . ARG C 2 208 ? 0.414   1.192   63.350 1.00 89.07  ? 208 ARG B CA    1 
ATOM   4555 C C     . ARG C 2 208 ? 0.190   1.581   64.806 1.00 85.52  ? 208 ARG B C     1 
ATOM   4556 O O     . ARG C 2 208 ? 0.911   2.410   65.357 1.00 87.18  ? 208 ARG B O     1 
ATOM   4557 C CB    . ARG C 2 208 ? -0.841  1.507   62.536 1.00 100.69 ? 208 ARG B CB    1 
ATOM   4558 C CG    . ARG C 2 208 ? -0.648  1.500   61.027 1.00 109.42 ? 208 ARG B CG    1 
ATOM   4559 C CD    . ARG C 2 208 ? 0.045   2.768   60.553 1.00 115.23 ? 208 ARG B CD    1 
ATOM   4560 N NE    . ARG C 2 208 ? -0.597  3.329   59.365 1.00 125.17 ? 208 ARG B NE    1 
ATOM   4561 C CZ    . ARG C 2 208 ? -1.846  3.791   59.331 1.00 127.18 ? 208 ARG B CZ    1 
ATOM   4562 N NH1   . ARG C 2 208 ? -2.601  3.762   60.423 1.00 126.42 ? 208 ARG B NH1   1 
ATOM   4563 N NH2   . ARG C 2 208 ? -2.342  4.286   58.205 1.00 125.50 ? 208 ARG B NH2   1 
ATOM   4564 N N     . ALA C 2 209 ? -0.818  0.974   65.424 1.00 82.25  ? 209 ALA B N     1 
ATOM   4565 C CA    . ALA C 2 209 ? -1.147  1.254   66.814 1.00 82.63  ? 209 ALA B CA    1 
ATOM   4566 C C     . ALA C 2 209 ? 0.094   1.179   67.687 1.00 81.43  ? 209 ALA B C     1 
ATOM   4567 O O     . ALA C 2 209 ? 0.213   1.905   68.671 1.00 81.26  ? 209 ALA B O     1 
ATOM   4568 C CB    . ALA C 2 209 ? -2.189  0.266   67.309 1.00 85.06  ? 209 ALA B CB    1 
ATOM   4569 N N     . ALA C 2 210 ? 1.013   0.292   67.321 1.00 82.82  ? 210 ALA B N     1 
ATOM   4570 C CA    . ALA C 2 210 ? 2.254   0.121   68.067 1.00 77.57  ? 210 ALA B CA    1 
ATOM   4571 C C     . ALA C 2 210 ? 3.128   1.353   67.888 1.00 74.06  ? 210 ALA B C     1 
ATOM   4572 O O     . ALA C 2 210 ? 3.444   2.045   68.851 1.00 73.67  ? 210 ALA B O     1 
ATOM   4573 C CB    . ALA C 2 210 ? 2.992   -1.116  67.579 1.00 79.64  ? 210 ALA B CB    1 
ATOM   4574 N N     . GLU C 2 211 ? 3.506   1.626   66.644 1.00 72.78  ? 211 GLU B N     1 
ATOM   4575 C CA    . GLU C 2 211 ? 4.346   2.773   66.327 1.00 74.89  ? 211 GLU B CA    1 
ATOM   4576 C C     . GLU C 2 211 ? 3.882   4.046   67.021 1.00 74.78  ? 211 GLU B C     1 
ATOM   4577 O O     . GLU C 2 211 ? 4.678   4.942   67.285 1.00 73.47  ? 211 GLU B O     1 
ATOM   4578 C CB    . GLU C 2 211 ? 4.372   3.000   64.816 1.00 73.83  ? 211 GLU B CB    1 
ATOM   4579 C CG    . GLU C 2 211 ? 5.309   4.109   64.371 1.00 81.44  ? 211 GLU B CG    1 
ATOM   4580 C CD    . GLU C 2 211 ? 5.292   4.317   62.869 1.00 83.01  ? 211 GLU B CD    1 
ATOM   4581 O OE1   . GLU C 2 211 ? 5.463   3.327   62.130 1.00 82.13  ? 211 GLU B OE1   1 
ATOM   4582 O OE2   . GLU C 2 211 ? 5.113   5.470   62.424 1.00 89.15  ? 211 GLU B OE2   1 
ATOM   4583 N N     . GLU C 2 212 ? 2.589   4.123   67.311 1.00 80.44  ? 212 GLU B N     1 
ATOM   4584 C CA    . GLU C 2 212 ? 2.026   5.292   67.974 1.00 87.71  ? 212 GLU B CA    1 
ATOM   4585 C C     . GLU C 2 212 ? 2.229   5.183   69.480 1.00 89.00  ? 212 GLU B C     1 
ATOM   4586 O O     . GLU C 2 212 ? 2.447   6.186   70.160 1.00 95.00  ? 212 GLU B O     1 
ATOM   4587 C CB    . GLU C 2 212 ? 0.532   5.406   67.651 1.00 93.26  ? 212 GLU B CB    1 
ATOM   4588 C CG    . GLU C 2 212 ? 0.159   6.637   66.830 1.00 97.00  ? 212 GLU B CG    1 
ATOM   4589 C CD    . GLU C 2 212 ? 1.040   6.820   65.607 1.00 101.97 ? 212 GLU B CD    1 
ATOM   4590 O OE1   . GLU C 2 212 ? 1.128   5.884   64.782 1.00 102.86 ? 212 GLU B OE1   1 
ATOM   4591 O OE2   . GLU C 2 212 ? 1.645   7.905   65.471 1.00 104.78 ? 212 GLU B OE2   1 
ATOM   4592 N N     . LEU C 2 213 ? 2.160   3.959   69.994 1.00 84.88  ? 213 LEU B N     1 
ATOM   4593 C CA    . LEU C 2 213 ? 2.335   3.721   71.421 1.00 79.28  ? 213 LEU B CA    1 
ATOM   4594 C C     . LEU C 2 213 ? 3.800   3.894   71.817 1.00 79.30  ? 213 LEU B C     1 
ATOM   4595 O O     . LEU C 2 213 ? 4.106   4.345   72.920 1.00 80.42  ? 213 LEU B O     1 
ATOM   4596 C CB    . LEU C 2 213 ? 1.845   2.316   71.789 1.00 63.04  ? 213 LEU B CB    1 
ATOM   4597 C CG    . LEU C 2 213 ? 1.764   1.957   73.275 1.00 62.28  ? 213 LEU B CG    1 
ATOM   4598 C CD1   . LEU C 2 213 ? 1.039   3.050   74.037 1.00 57.75  ? 213 LEU B CD1   1 
ATOM   4599 C CD2   . LEU C 2 213 ? 1.039   0.627   73.441 1.00 61.11  ? 213 LEU B CD2   1 
ATOM   4600 N N     . ILE C 2 214 ? 4.705   3.540   70.911 1.00 79.57  ? 214 ILE B N     1 
ATOM   4601 C CA    . ILE C 2 214 ? 6.130   3.679   71.172 1.00 78.88  ? 214 ILE B CA    1 
ATOM   4602 C C     . ILE C 2 214 ? 6.458   5.154   71.350 1.00 88.33  ? 214 ILE B C     1 
ATOM   4603 O O     . ILE C 2 214 ? 7.276   5.516   72.191 1.00 98.02  ? 214 ILE B O     1 
ATOM   4604 C CB    . ILE C 2 214 ? 6.975   3.135   70.009 1.00 71.65  ? 214 ILE B CB    1 
ATOM   4605 C CG1   . ILE C 2 214 ? 6.704   1.640   69.825 1.00 70.28  ? 214 ILE B CG1   1 
ATOM   4606 C CG2   . ILE C 2 214 ? 8.452   3.398   70.277 1.00 59.84  ? 214 ILE B CG2   1 
ATOM   4607 C CD1   . ILE C 2 214 ? 7.388   1.039   68.613 1.00 64.24  ? 214 ILE B CD1   1 
ATOM   4608 N N     . LYS C 2 215 ? 5.816   6.000   70.551 1.00 93.38  ? 215 LYS B N     1 
ATOM   4609 C CA    . LYS C 2 215 ? 6.039   7.437   70.624 1.00 91.91  ? 215 LYS B CA    1 
ATOM   4610 C C     . LYS C 2 215 ? 5.399   8.007   71.886 1.00 90.14  ? 215 LYS B C     1 
ATOM   4611 O O     . LYS C 2 215 ? 5.807   9.061   72.374 1.00 87.49  ? 215 LYS B O     1 
ATOM   4612 C CB    . LYS C 2 215 ? 5.479   8.118   69.373 1.00 97.21  ? 215 LYS B CB    1 
ATOM   4613 C CG    . LYS C 2 215 ? 6.132   7.637   68.076 1.00 102.76 ? 215 LYS B CG    1 
ATOM   4614 C CD    . LYS C 2 215 ? 5.520   8.294   66.841 1.00 108.81 ? 215 LYS B CD    1 
ATOM   4615 C CE    . LYS C 2 215 ? 5.813   9.790   66.779 1.00 111.91 ? 215 LYS B CE    1 
ATOM   4616 N NZ    . LYS C 2 215 ? 7.266   10.086  66.603 1.00 115.23 ? 215 LYS B NZ    1 
ATOM   4617 N N     . LEU C 2 216 ? 4.394   7.313   72.412 1.00 89.91  ? 216 LEU B N     1 
ATOM   4618 C CA    . LEU C 2 216 ? 3.746   7.754   73.642 1.00 95.41  ? 216 LEU B CA    1 
ATOM   4619 C C     . LEU C 2 216 ? 4.700   7.445   74.783 1.00 100.94 ? 216 LEU B C     1 
ATOM   4620 O O     . LEU C 2 216 ? 4.922   8.271   75.666 1.00 105.71 ? 216 LEU B O     1 
ATOM   4621 C CB    . LEU C 2 216 ? 2.424   7.019   73.875 1.00 97.91  ? 216 LEU B CB    1 
ATOM   4622 C CG    . LEU C 2 216 ? 1.177   7.530   73.154 1.00 101.31 ? 216 LEU B CG    1 
ATOM   4623 C CD1   . LEU C 2 216 ? -0.030  6.729   73.618 1.00 99.86  ? 216 LEU B CD1   1 
ATOM   4624 C CD2   . LEU C 2 216 ? 0.971   9.009   73.455 1.00 95.51  ? 216 LEU B CD2   1 
ATOM   4625 N N     . LEU C 2 217 ? 5.261   6.239   74.754 1.00 103.16 ? 217 LEU B N     1 
ATOM   4626 C CA    . LEU C 2 217 ? 6.214   5.808   75.768 1.00 102.50 ? 217 LEU B CA    1 
ATOM   4627 C C     . LEU C 2 217 ? 7.506   6.589   75.553 1.00 104.18 ? 217 LEU B C     1 
ATOM   4628 O O     . LEU C 2 217 ? 8.190   6.965   76.504 1.00 102.20 ? 217 LEU B O     1 
ATOM   4629 C CB    . LEU C 2 217 ? 6.483   4.307   75.637 1.00 100.33 ? 217 LEU B CB    1 
ATOM   4630 C CG    . LEU C 2 217 ? 5.291   3.360   75.803 1.00 95.57  ? 217 LEU B CG    1 
ATOM   4631 C CD1   . LEU C 2 217 ? 5.752   1.932   75.565 1.00 97.72  ? 217 LEU B CD1   1 
ATOM   4632 C CD2   . LEU C 2 217 ? 4.697   3.502   77.195 1.00 93.95  ? 217 LEU B CD2   1 
ATOM   4633 N N     . GLU C 2 218 ? 7.821   6.831   74.284 1.00 105.96 ? 218 GLU B N     1 
ATOM   4634 C CA    . GLU C 2 218 ? 9.012   7.571   73.891 1.00 108.31 ? 218 GLU B CA    1 
ATOM   4635 C C     . GLU C 2 218 ? 9.051   8.913   74.613 1.00 114.12 ? 218 GLU B C     1 
ATOM   4636 O O     . GLU C 2 218 ? 10.108  9.530   74.739 1.00 119.64 ? 218 GLU B O     1 
ATOM   4637 C CB    . GLU C 2 218 ? 8.995   7.794   72.378 1.00 109.82 ? 218 GLU B CB    1 
ATOM   4638 C CG    . GLU C 2 218 ? 10.151  8.604   71.828 1.00 117.96 ? 218 GLU B CG    1 
ATOM   4639 C CD    . GLU C 2 218 ? 9.978   8.915   70.351 1.00 124.78 ? 218 GLU B CD    1 
ATOM   4640 O OE1   . GLU C 2 218 ? 9.876   7.961   69.550 1.00 128.14 ? 218 GLU B OE1   1 
ATOM   4641 O OE2   . GLU C 2 218 ? 9.941   10.112  69.993 1.00 124.57 ? 218 GLU B OE2   1 
ATOM   4642 N N     . GLU C 2 219 ? 7.890   9.357   75.086 1.00 117.52 ? 219 GLU B N     1 
ATOM   4643 C CA    . GLU C 2 219 ? 7.781   10.626  75.798 1.00 122.23 ? 219 GLU B CA    1 
ATOM   4644 C C     . GLU C 2 219 ? 8.659   10.607  77.049 1.00 124.55 ? 219 GLU B C     1 
ATOM   4645 O O     . GLU C 2 219 ? 9.775   11.132  77.043 1.00 123.44 ? 219 GLU B O     1 
ATOM   4646 C CB    . GLU C 2 219 ? 6.315   10.885  76.176 1.00 121.83 ? 219 GLU B CB    1 
ATOM   4647 C CG    . GLU C 2 219 ? 6.017   12.281  76.723 1.00 121.73 ? 219 GLU B CG    1 
ATOM   4648 C CD    . GLU C 2 219 ? 6.499   12.482  78.149 1.00 123.43 ? 219 GLU B CD    1 
ATOM   4649 O OE1   . GLU C 2 219 ? 6.048   11.732  79.041 1.00 120.57 ? 219 GLU B OE1   1 
ATOM   4650 O OE2   . GLU C 2 219 ? 7.325   13.392  78.378 1.00 121.17 ? 219 GLU B OE2   1 
ATOM   4651 N N     . SER C 2 220 ? 8.152   9.997   78.116 1.00 125.41 ? 220 SER B N     1 
ATOM   4652 C CA    . SER C 2 220 ? 8.887   9.907   79.374 1.00 124.40 ? 220 SER B CA    1 
ATOM   4653 C C     . SER C 2 220 ? 8.098   9.090   80.392 1.00 126.12 ? 220 SER B C     1 
ATOM   4654 O O     . SER C 2 220 ? 8.653   8.096   80.907 1.00 126.04 ? 220 SER B O     1 
ATOM   4655 C CB    . SER C 2 220 ? 9.159   11.309  79.931 1.00 121.04 ? 220 SER B CB    1 
ATOM   4656 O OG    . SER C 2 220 ? 9.963   11.252  81.097 1.00 112.47 ? 220 SER B OG    1 
HETATM 4657 O O     . HOH D 3 .   ? -13.412 39.165  48.879 1.00 95.16  ? 47  HOH C O     1 
HETATM 4658 O O     . HOH D 3 .   ? 2.826   41.671  46.421 1.00 80.09  ? 48  HOH C O     1 
HETATM 4659 O O     . HOH D 3 .   ? -1.461  42.804  55.309 1.00 65.67  ? 49  HOH C O     1 
HETATM 4660 O O     . HOH D 3 .   ? -1.055  41.798  50.165 1.00 75.06  ? 50  HOH C O     1 
HETATM 4661 O O     . HOH D 3 .   ? -13.803 36.156  48.481 1.00 74.82  ? 51  HOH C O     1 
HETATM 4662 O O     . HOH D 3 .   ? -3.754  42.682  50.200 1.00 74.28  ? 52  HOH C O     1 
HETATM 4663 O O     . HOH D 3 .   ? -6.006  31.698  40.377 1.00 52.67  ? 53  HOH C O     1 
HETATM 4664 O O     . HOH D 3 .   ? 31.055  34.761  73.247 1.00 64.10  ? 54  HOH C O     1 
HETATM 4665 O O     . HOH E 3 .   ? -1.074  12.293  29.813 1.00 59.93  ? 222 HOH A O     1 
HETATM 4666 O O     . HOH E 3 .   ? -0.175  16.527  41.610 1.00 86.13  ? 223 HOH A O     1 
HETATM 4667 O O     . HOH E 3 .   ? -4.720  0.676   44.889 1.00 76.70  ? 224 HOH A O     1 
HETATM 4668 O O     . HOH E 3 .   ? -4.892  1.725   47.750 1.00 91.17  ? 225 HOH A O     1 
HETATM 4669 O O     . HOH E 3 .   ? -14.075 26.058  64.844 1.00 69.53  ? 226 HOH A O     1 
HETATM 4670 O O     . HOH E 3 .   ? -18.269 4.503   42.624 1.00 86.70  ? 227 HOH A O     1 
HETATM 4671 O O     . HOH E 3 .   ? -5.544  -0.944  25.243 1.00 77.09  ? 228 HOH A O     1 
HETATM 4672 O O     . HOH E 3 .   ? -17.224 7.601   43.071 1.00 85.39  ? 229 HOH A O     1 
HETATM 4673 O O     . HOH E 3 .   ? 19.656  -15.383 41.005 1.00 73.40  ? 230 HOH A O     1 
HETATM 4674 O O     . HOH E 3 .   ? 20.540  -13.061 40.041 1.00 74.09  ? 231 HOH A O     1 
HETATM 4675 O O     . HOH E 3 .   ? 1.578   13.954  29.243 1.00 77.73  ? 232 HOH A O     1 
HETATM 4676 O O     . HOH E 3 .   ? -19.333 5.980   44.877 1.00 87.69  ? 233 HOH A O     1 
HETATM 4677 O O     . HOH F 3 .   ? 11.754  0.947   62.694 1.00 73.65  ? 222 HOH B O     1 
HETATM 4678 O O     . HOH F 3 .   ? 4.924   5.189   88.950 1.00 78.15  ? 223 HOH B O     1 
HETATM 4679 O O     . HOH F 3 .   ? 6.180   3.838   86.085 1.00 77.48  ? 224 HOH B O     1 
HETATM 4680 O O     . HOH F 3 .   ? 17.827  3.893   57.201 1.00 68.51  ? 225 HOH B O     1 
HETATM 4681 O O     . HOH F 3 .   ? 36.699  7.461   35.475 1.00 83.74  ? 226 HOH B O     1 
HETATM 4682 O O     . HOH F 3 .   ? 9.265   -0.102  59.896 1.00 83.80  ? 227 HOH B O     1 
HETATM 4683 O O     . HOH F 3 .   ? 11.648  3.225   61.790 1.00 80.89  ? 228 HOH B O     1 
HETATM 4684 O O     . HOH F 3 .   ? 3.218   -5.721  85.466 1.00 62.99  ? 229 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   C . n 
A 1 2   G   2   2   2   G   G   C . n 
A 1 3   G   3   3   3   G   G   C . n 
A 1 4   A   4   4   4   A   A   C . n 
A 1 5   C   5   5   5   C   C   C . n 
A 1 6   A   6   6   6   A   A   C . n 
A 1 7   A   7   7   7   A   A   C . n 
A 1 8   G   8   8   8   G   G   C . n 
A 1 9   C   9   9   9   C   C   C . n 
A 1 10  G   10  10  10  G   G   C . n 
A 1 11  C   11  11  11  C   C   C . n 
A 1 12  A   12  12  12  A   A   C . n 
A 1 13  A   13  13  13  A   A   C . n 
A 1 14  G   14  14  14  G   G   C . n 
A 1 15  G   15  15  15  G   G   C . n 
A 1 16  U   16  16  16  U   U   C . n 
A 1 17  C   17  17  17  C   C   C . n 
A 1 18  A   18  18  18  A   A   C . n 
A 1 19  U   19  19  19  U   U   C . n 
A 1 20  U   20  20  20  U   U   C . n 
A 1 21  C   21  21  21  C   C   C . n 
A 1 22  G   22  22  22  G   G   C . n 
A 1 23  C   23  23  23  C   C   C . n 
A 1 24  A   24  24  24  A   A   C . n 
A 1 25  A   25  25  25  A   A   C . n 
A 1 26  G   26  26  26  G   G   C . n 
A 1 27  A   27  27  27  A   A   C . n 
A 1 28  G   28  28  28  G   G   C . n 
A 1 29  U   29  29  29  U   U   C . n 
A 1 30  G   30  30  30  G   G   C . n 
A 1 31  G   31  31  31  G   G   C . n 
A 1 32  C   32  32  32  C   C   C . n 
A 1 33  C   33  33  33  C   C   C . n 
A 1 34  U   34  34  34  U   U   C . n 
A 1 35  U   35  35  35  U   U   C . n 
A 1 36  G   36  36  36  G   G   C . n 
A 1 37  C   37  37  37  C   C   C . n 
A 1 38  G   38  38  38  G   G   C . n 
A 1 39  C   39  39  39  C   C   C . n 
A 1 40  U   40  40  40  U   U   C . n 
A 1 41  U   41  41  41  U   U   C . n 
A 1 42  G   42  42  42  G   G   C . n 
A 1 43  U   43  43  43  U   U   C . n 
A 1 44  C   44  44  44  C   C   C . n 
A 1 45  C   45  45  45  C   C   C . n 
A 1 46  C   46  46  46  C   C   C . n 
B 2 1   MET 1   1   ?   ?   ?   A . n 
B 2 2   LYS 2   2   2   LYS LYS A . n 
B 2 3   MET 3   3   3   MET MET A . n 
B 2 4   LEU 4   4   4   LEU LEU A . n 
B 2 5   GLU 5   5   5   GLU GLU A . n 
B 2 6   GLN 6   6   6   GLN GLN A . n 
B 2 7   LEU 7   7   7   LEU LEU A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   LYS 9   9   9   LYS LYS A . n 
B 2 10  LYS 10  10  10  LYS LYS A . n 
B 2 11  LEU 11  11  11  LEU LEU A . n 
B 2 12  GLY 12  12  12  GLY GLY A . n 
B 2 13  TYR 13  13  13  TYR TYR A . n 
B 2 14  THR 14  14  14  THR THR A . n 
B 2 15  PHE 15  15  15  PHE PHE A . n 
B 2 16  LYS 16  16  16  LYS LYS A . n 
B 2 17  ASP 17  17  17  ASP ASP A . n 
B 2 18  LYS 18  18  18  LYS LYS A . n 
B 2 19  SER 19  19  19  SER SER A . n 
B 2 20  LEU 20  20  20  LEU LEU A . n 
B 2 21  LEU 21  21  21  LEU LEU A . n 
B 2 22  GLU 22  22  22  GLU GLU A . n 
B 2 23  LYS 23  23  23  LYS LYS A . n 
B 2 24  ALA 24  24  24  ALA ALA A . n 
B 2 25  LEU 25  25  25  LEU LEU A . n 
B 2 26  THR 26  26  26  THR THR A . n 
B 2 27  HIS 27  27  27  HIS HIS A . n 
B 2 28  VAL 28  28  28  VAL VAL A . n 
B 2 29  SER 29  29  29  SER SER A . n 
B 2 30  TYR 30  30  30  TYR TYR A . n 
B 2 31  SER 31  31  31  SER SER A . n 
B 2 32  LYS 32  32  32  LYS LYS A . n 
B 2 33  LYS 33  33  33  LYS LYS A . n 
B 2 34  GLU 34  34  34  GLU GLU A . n 
B 2 35  HIS 35  35  35  HIS HIS A . n 
B 2 36  TYR 36  36  36  TYR TYR A . n 
B 2 37  GLU 37  37  37  GLU GLU A . n 
B 2 38  THR 38  38  38  THR THR A . n 
B 2 39  LEU 39  39  39  LEU LEU A . n 
B 2 40  GLU 40  40  40  GLU GLU A . n 
B 2 41  PHE 41  41  41  PHE PHE A . n 
B 2 42  LEU 42  42  42  LEU LEU A . n 
B 2 43  GLY 43  43  43  GLY GLY A . n 
B 2 44  ASP 44  44  44  ASP ASP A . n 
B 2 45  ALA 45  45  45  ALA ALA A . n 
B 2 46  LEU 46  46  46  LEU LEU A . n 
B 2 47  VAL 47  47  47  VAL VAL A . n 
B 2 48  ASN 48  48  48  ASN ASN A . n 
B 2 49  PHE 49  49  49  PHE PHE A . n 
B 2 50  PHE 50  50  50  PHE PHE A . n 
B 2 51  ILE 51  51  51  ILE ILE A . n 
B 2 52  VAL 52  52  52  VAL VAL A . n 
B 2 53  ASP 53  53  53  ASP ASP A . n 
B 2 54  LEU 54  54  54  LEU LEU A . n 
B 2 55  LEU 55  55  55  LEU LEU A . n 
B 2 56  VAL 56  56  56  VAL VAL A . n 
B 2 57  GLN 57  57  57  GLN GLN A . n 
B 2 58  TYR 58  58  58  TYR TYR A . n 
B 2 59  SER 59  59  59  SER SER A . n 
B 2 60  PRO 60  60  60  PRO PRO A . n 
B 2 61  ASN 61  61  61  ASN ASN A . n 
B 2 62  LYS 62  62  62  LYS LYS A . n 
B 2 63  ARG 63  63  63  ARG ARG A . n 
B 2 64  GLU 64  64  64  GLU GLU A . n 
B 2 65  GLY 65  65  65  GLY GLY A . n 
B 2 66  PHE 66  66  66  PHE PHE A . n 
B 2 67  LEU 67  67  67  LEU LEU A . n 
B 2 68  SER 68  68  68  SER SER A . n 
B 2 69  PRO 69  69  69  PRO PRO A . n 
B 2 70  LEU 70  70  70  LEU LEU A . n 
B 2 71  LYS 71  71  71  LYS LYS A . n 
B 2 72  ALA 72  72  72  ALA ALA A . n 
B 2 73  TYR 73  73  73  TYR TYR A . n 
B 2 74  LEU 74  74  74  LEU LEU A . n 
B 2 75  ILE 75  75  75  ILE ILE A . n 
B 2 76  SER 76  76  76  SER SER A . n 
B 2 77  GLU 77  77  77  GLU GLU A . n 
B 2 78  GLU 78  78  78  GLU GLU A . n 
B 2 79  PHE 79  79  79  PHE PHE A . n 
B 2 80  PHE 80  80  80  PHE PHE A . n 
B 2 81  ASN 81  81  81  ASN ASN A . n 
B 2 82  LEU 82  82  82  LEU LEU A . n 
B 2 83  LEU 83  83  83  LEU LEU A . n 
B 2 84  ALA 84  84  84  ALA ALA A . n 
B 2 85  GLN 85  85  85  GLN GLN A . n 
B 2 86  LYS 86  86  86  LYS LYS A . n 
B 2 87  LEU 87  87  87  LEU LEU A . n 
B 2 88  GLU 88  88  88  GLU GLU A . n 
B 2 89  LEU 89  89  89  LEU LEU A . n 
B 2 90  HIS 90  90  90  HIS HIS A . n 
B 2 91  LYS 91  91  91  LYS LYS A . n 
B 2 92  PHE 92  92  92  PHE PHE A . n 
B 2 93  ILE 93  93  93  ILE ILE A . n 
B 2 94  ARG 94  94  94  ARG ARG A . n 
B 2 95  ILE 95  95  95  ILE ILE A . n 
B 2 96  LYS 96  96  96  LYS LYS A . n 
B 2 97  ARG 97  97  97  ARG ARG A . n 
B 2 98  GLY 98  98  98  GLY GLY A . n 
B 2 99  LYS 99  99  99  LYS LYS A . n 
B 2 100 ILE 100 100 100 ILE ILE A . n 
B 2 101 ASN 101 101 101 ASN ASN A . n 
B 2 102 GLU 102 102 102 GLU GLU A . n 
B 2 103 THR 103 103 103 THR THR A . n 
B 2 104 ILE 104 104 104 ILE ILE A . n 
B 2 105 ILE 105 105 105 ILE ILE A . n 
B 2 106 GLY 106 106 106 GLY GLY A . n 
B 2 107 ASP 107 107 107 ASP ASP A . n 
B 2 108 VAL 108 108 108 VAL VAL A . n 
B 2 109 PHE 109 109 109 PHE PHE A . n 
B 2 110 GLU 110 110 110 GLU GLU A . n 
B 2 111 ALA 111 111 111 ALA ALA A . n 
B 2 112 LEU 112 112 112 LEU LEU A . n 
B 2 113 TRP 113 113 113 TRP TRP A . n 
B 2 114 ALA 114 114 114 ALA ALA A . n 
B 2 115 ALA 115 115 115 ALA ALA A . n 
B 2 116 VAL 116 116 116 VAL VAL A . n 
B 2 117 TYR 117 117 117 TYR TYR A . n 
B 2 118 ILE 118 118 118 ILE ILE A . n 
B 2 119 ASP 119 119 119 ASP ASP A . n 
B 2 120 SER 120 120 120 SER SER A . n 
B 2 121 GLY 121 121 121 GLY GLY A . n 
B 2 122 ARG 122 122 122 ARG ARG A . n 
B 2 123 ASP 123 123 123 ASP ASP A . n 
B 2 124 ALA 124 124 124 ALA ALA A . n 
B 2 125 ASN 125 125 125 ASN ASN A . n 
B 2 126 PHE 126 126 126 PHE PHE A . n 
B 2 127 THR 127 127 127 THR THR A . n 
B 2 128 ARG 128 128 128 ARG ARG A . n 
B 2 129 GLU 129 129 129 GLU GLU A . n 
B 2 130 LEU 130 130 130 LEU LEU A . n 
B 2 131 PHE 131 131 131 PHE PHE A . n 
B 2 132 TYR 132 132 132 TYR TYR A . n 
B 2 133 LYS 133 133 133 LYS LYS A . n 
B 2 134 LEU 134 134 134 LEU LEU A . n 
B 2 135 PHE 135 135 135 PHE PHE A . n 
B 2 136 LYS 136 136 136 LYS LYS A . n 
B 2 137 GLU 137 137 137 GLU GLU A . n 
B 2 138 ASP 138 138 138 ASP ASP A . n 
B 2 139 ILE 139 139 139 ILE ILE A . n 
B 2 140 LEU 140 140 140 LEU LEU A . n 
B 2 141 SER 141 141 141 SER SER A . n 
B 2 142 ALA 142 142 142 ALA ALA A . n 
B 2 143 ILE 143 143 143 ILE ILE A . n 
B 2 144 LYS 144 144 144 LYS LYS A . n 
B 2 145 GLU 145 145 145 GLU GLU A . n 
B 2 146 GLY 146 146 146 GLY GLY A . n 
B 2 147 ARG 147 147 147 ARG ARG A . n 
B 2 148 VAL 148 148 148 VAL VAL A . n 
B 2 149 LYS 149 149 149 LYS LYS A . n 
B 2 150 LYS 150 150 150 LYS LYS A . n 
B 2 151 ASP 151 151 151 ASP ASP A . n 
B 2 152 TYR 152 152 152 TYR TYR A . n 
B 2 153 LYS 153 153 153 LYS LYS A . n 
B 2 154 THR 154 154 154 THR THR A . n 
B 2 155 ILE 155 155 155 ILE ILE A . n 
B 2 156 LEU 156 156 156 LEU LEU A . n 
B 2 157 GLN 157 157 157 GLN GLN A . n 
B 2 158 GLU 158 158 158 GLU GLU A . n 
B 2 159 ILE 159 159 159 ILE ILE A . n 
B 2 160 THR 160 160 160 THR THR A . n 
B 2 161 GLN 161 161 161 GLN GLN A . n 
B 2 162 LYS 162 162 162 LYS LYS A . n 
B 2 163 ARG 163 163 163 ARG ARG A . n 
B 2 164 TRP 164 164 164 TRP TRP A . n 
B 2 165 LYS 165 165 165 LYS LYS A . n 
B 2 166 GLU 166 166 166 GLU GLU A . n 
B 2 167 ARG 167 167 167 ARG ARG A . n 
B 2 168 PRO 168 168 168 PRO PRO A . n 
B 2 169 GLU 169 169 169 GLU GLU A . n 
B 2 170 TYR 170 170 170 TYR TYR A . n 
B 2 171 ARG 171 171 171 ARG ARG A . n 
B 2 172 LEU 172 172 172 LEU LEU A . n 
B 2 173 ILE 173 173 173 ILE ILE A . n 
B 2 174 SER 174 174 174 SER SER A . n 
B 2 175 VAL 175 175 175 VAL VAL A . n 
B 2 176 GLU 176 176 176 GLU GLU A . n 
B 2 177 GLY 177 177 177 GLY GLY A . n 
B 2 178 PRO 178 178 178 PRO PRO A . n 
B 2 179 HIS 179 179 179 HIS HIS A . n 
B 2 180 HIS 180 180 180 HIS HIS A . n 
B 2 181 LYS 181 181 181 LYS LYS A . n 
B 2 182 LYS 182 182 182 LYS LYS A . n 
B 2 183 LYS 183 183 183 LYS LYS A . n 
B 2 184 PHE 184 184 184 PHE PHE A . n 
B 2 185 ILE 185 185 185 ILE ILE A . n 
B 2 186 VAL 186 186 186 VAL VAL A . n 
B 2 187 GLU 187 187 187 GLU GLU A . n 
B 2 188 ALA 188 188 188 ALA ALA A . n 
B 2 189 LYS 189 189 189 LYS LYS A . n 
B 2 190 ILE 190 190 190 ILE ILE A . n 
B 2 191 LYS 191 191 191 LYS LYS A . n 
B 2 192 GLU 192 192 192 GLU GLU A . n 
B 2 193 TYR 193 193 193 TYR TYR A . n 
B 2 194 ARG 194 194 194 ARG ARG A . n 
B 2 195 THR 195 195 195 THR THR A . n 
B 2 196 LEU 196 196 196 LEU LEU A . n 
B 2 197 GLY 197 197 197 GLY GLY A . n 
B 2 198 GLU 198 198 198 GLU GLU A . n 
B 2 199 GLY 199 199 199 GLY GLY A . n 
B 2 200 LYS 200 200 200 LYS LYS A . n 
B 2 201 SER 201 201 201 SER SER A . n 
B 2 202 LYS 202 202 202 LYS LYS A . n 
B 2 203 LYS 203 203 203 LYS LYS A . n 
B 2 204 GLU 204 204 204 GLU GLU A . n 
B 2 205 ALA 205 205 205 ALA ALA A . n 
B 2 206 GLU 206 206 206 GLU GLU A . n 
B 2 207 GLN 207 207 207 GLN GLN A . n 
B 2 208 ARG 208 208 208 ARG ARG A . n 
B 2 209 ALA 209 209 209 ALA ALA A . n 
B 2 210 ALA 210 210 210 ALA ALA A . n 
B 2 211 GLU 211 211 211 GLU GLU A . n 
B 2 212 GLU 212 212 212 GLU GLU A . n 
B 2 213 LEU 213 213 213 LEU LEU A . n 
B 2 214 ILE 214 214 214 ILE ILE A . n 
B 2 215 LYS 215 215 215 LYS LYS A . n 
B 2 216 LEU 216 216 216 LEU LEU A . n 
B 2 217 LEU 217 217 217 LEU LEU A . n 
B 2 218 GLU 218 218 218 GLU GLU A . n 
B 2 219 GLU 219 219 219 GLU GLU A . n 
B 2 220 SER 220 220 220 SER SER A . n 
B 2 221 GLU 221 221 221 GLU GLU A . n 
C 2 1   MET 1   1   1   MET MET B . n 
C 2 2   LYS 2   2   2   LYS LYS B . n 
C 2 3   MET 3   3   3   MET MET B . n 
C 2 4   LEU 4   4   4   LEU LEU B . n 
C 2 5   GLU 5   5   5   GLU GLU B . n 
C 2 6   GLN 6   6   6   GLN GLN B . n 
C 2 7   LEU 7   7   7   LEU LEU B . n 
C 2 8   GLU 8   8   8   GLU GLU B . n 
C 2 9   LYS 9   9   9   LYS LYS B . n 
C 2 10  LYS 10  10  10  LYS LYS B . n 
C 2 11  LEU 11  11  11  LEU LEU B . n 
C 2 12  GLY 12  12  12  GLY GLY B . n 
C 2 13  TYR 13  13  13  TYR TYR B . n 
C 2 14  THR 14  14  14  THR THR B . n 
C 2 15  PHE 15  15  15  PHE PHE B . n 
C 2 16  LYS 16  16  16  LYS LYS B . n 
C 2 17  ASP 17  17  17  ASP ASP B . n 
C 2 18  LYS 18  18  18  LYS LYS B . n 
C 2 19  SER 19  19  19  SER SER B . n 
C 2 20  LEU 20  20  20  LEU LEU B . n 
C 2 21  LEU 21  21  21  LEU LEU B . n 
C 2 22  GLU 22  22  22  GLU GLU B . n 
C 2 23  LYS 23  23  23  LYS LYS B . n 
C 2 24  ALA 24  24  24  ALA ALA B . n 
C 2 25  LEU 25  25  25  LEU LEU B . n 
C 2 26  THR 26  26  26  THR THR B . n 
C 2 27  HIS 27  27  27  HIS HIS B . n 
C 2 28  VAL 28  28  28  VAL VAL B . n 
C 2 29  SER 29  29  29  SER SER B . n 
C 2 30  TYR 30  30  30  TYR TYR B . n 
C 2 31  SER 31  31  31  SER SER B . n 
C 2 32  LYS 32  32  32  LYS LYS B . n 
C 2 33  LYS 33  33  33  LYS LYS B . n 
C 2 34  GLU 34  34  34  GLU GLU B . n 
C 2 35  HIS 35  35  35  HIS HIS B . n 
C 2 36  TYR 36  36  36  TYR TYR B . n 
C 2 37  GLU 37  37  37  GLU GLU B . n 
C 2 38  THR 38  38  38  THR THR B . n 
C 2 39  LEU 39  39  39  LEU LEU B . n 
C 2 40  GLU 40  40  40  GLU GLU B . n 
C 2 41  PHE 41  41  41  PHE PHE B . n 
C 2 42  LEU 42  42  42  LEU LEU B . n 
C 2 43  GLY 43  43  43  GLY GLY B . n 
C 2 44  ASP 44  44  44  ASP ASP B . n 
C 2 45  ALA 45  45  45  ALA ALA B . n 
C 2 46  LEU 46  46  46  LEU LEU B . n 
C 2 47  VAL 47  47  47  VAL VAL B . n 
C 2 48  ASN 48  48  48  ASN ASN B . n 
C 2 49  PHE 49  49  49  PHE PHE B . n 
C 2 50  PHE 50  50  50  PHE PHE B . n 
C 2 51  ILE 51  51  51  ILE ILE B . n 
C 2 52  VAL 52  52  52  VAL VAL B . n 
C 2 53  ASP 53  53  53  ASP ASP B . n 
C 2 54  LEU 54  54  54  LEU LEU B . n 
C 2 55  LEU 55  55  55  LEU LEU B . n 
C 2 56  VAL 56  56  56  VAL VAL B . n 
C 2 57  GLN 57  57  57  GLN GLN B . n 
C 2 58  TYR 58  58  58  TYR TYR B . n 
C 2 59  SER 59  59  59  SER SER B . n 
C 2 60  PRO 60  60  60  PRO PRO B . n 
C 2 61  ASN 61  61  61  ASN ASN B . n 
C 2 62  LYS 62  62  62  LYS LYS B . n 
C 2 63  ARG 63  63  63  ARG ARG B . n 
C 2 64  GLU 64  64  64  GLU GLU B . n 
C 2 65  GLY 65  65  65  GLY GLY B . n 
C 2 66  PHE 66  66  66  PHE PHE B . n 
C 2 67  LEU 67  67  67  LEU LEU B . n 
C 2 68  SER 68  68  68  SER SER B . n 
C 2 69  PRO 69  69  69  PRO PRO B . n 
C 2 70  LEU 70  70  70  LEU LEU B . n 
C 2 71  LYS 71  71  71  LYS LYS B . n 
C 2 72  ALA 72  72  72  ALA ALA B . n 
C 2 73  TYR 73  73  73  TYR TYR B . n 
C 2 74  LEU 74  74  74  LEU LEU B . n 
C 2 75  ILE 75  75  75  ILE ILE B . n 
C 2 76  SER 76  76  76  SER SER B . n 
C 2 77  GLU 77  77  77  GLU GLU B . n 
C 2 78  GLU 78  78  78  GLU GLU B . n 
C 2 79  PHE 79  79  79  PHE PHE B . n 
C 2 80  PHE 80  80  80  PHE PHE B . n 
C 2 81  ASN 81  81  81  ASN ASN B . n 
C 2 82  LEU 82  82  82  LEU LEU B . n 
C 2 83  LEU 83  83  83  LEU LEU B . n 
C 2 84  ALA 84  84  84  ALA ALA B . n 
C 2 85  GLN 85  85  85  GLN GLN B . n 
C 2 86  LYS 86  86  86  LYS LYS B . n 
C 2 87  LEU 87  87  87  LEU LEU B . n 
C 2 88  GLU 88  88  88  GLU GLU B . n 
C 2 89  LEU 89  89  89  LEU LEU B . n 
C 2 90  HIS 90  90  90  HIS HIS B . n 
C 2 91  LYS 91  91  91  LYS LYS B . n 
C 2 92  PHE 92  92  92  PHE PHE B . n 
C 2 93  ILE 93  93  93  ILE ILE B . n 
C 2 94  ARG 94  94  94  ARG ARG B . n 
C 2 95  ILE 95  95  95  ILE ILE B . n 
C 2 96  LYS 96  96  96  LYS LYS B . n 
C 2 97  ARG 97  97  97  ARG ARG B . n 
C 2 98  GLY 98  98  98  GLY GLY B . n 
C 2 99  LYS 99  99  99  LYS LYS B . n 
C 2 100 ILE 100 100 100 ILE ILE B . n 
C 2 101 ASN 101 101 101 ASN ASN B . n 
C 2 102 GLU 102 102 102 GLU GLU B . n 
C 2 103 THR 103 103 103 THR THR B . n 
C 2 104 ILE 104 104 104 ILE ILE B . n 
C 2 105 ILE 105 105 105 ILE ILE B . n 
C 2 106 GLY 106 106 106 GLY GLY B . n 
C 2 107 ASP 107 107 107 ASP ASP B . n 
C 2 108 VAL 108 108 108 VAL VAL B . n 
C 2 109 PHE 109 109 109 PHE PHE B . n 
C 2 110 GLU 110 110 110 GLU GLU B . n 
C 2 111 ALA 111 111 111 ALA ALA B . n 
C 2 112 LEU 112 112 112 LEU LEU B . n 
C 2 113 TRP 113 113 113 TRP TRP B . n 
C 2 114 ALA 114 114 114 ALA ALA B . n 
C 2 115 ALA 115 115 115 ALA ALA B . n 
C 2 116 VAL 116 116 116 VAL VAL B . n 
C 2 117 TYR 117 117 117 TYR TYR B . n 
C 2 118 ILE 118 118 118 ILE ILE B . n 
C 2 119 ASP 119 119 119 ASP ASP B . n 
C 2 120 SER 120 120 120 SER SER B . n 
C 2 121 GLY 121 121 121 GLY GLY B . n 
C 2 122 ARG 122 122 122 ARG ARG B . n 
C 2 123 ASP 123 123 123 ASP ASP B . n 
C 2 124 ALA 124 124 124 ALA ALA B . n 
C 2 125 ASN 125 125 125 ASN ASN B . n 
C 2 126 PHE 126 126 126 PHE PHE B . n 
C 2 127 THR 127 127 127 THR THR B . n 
C 2 128 ARG 128 128 128 ARG ARG B . n 
C 2 129 GLU 129 129 129 GLU GLU B . n 
C 2 130 LEU 130 130 130 LEU LEU B . n 
C 2 131 PHE 131 131 131 PHE PHE B . n 
C 2 132 TYR 132 132 132 TYR TYR B . n 
C 2 133 LYS 133 133 133 LYS LYS B . n 
C 2 134 LEU 134 134 134 LEU LEU B . n 
C 2 135 PHE 135 135 135 PHE PHE B . n 
C 2 136 LYS 136 136 136 LYS LYS B . n 
C 2 137 GLU 137 137 137 GLU GLU B . n 
C 2 138 ASP 138 138 138 ASP ASP B . n 
C 2 139 ILE 139 139 139 ILE ILE B . n 
C 2 140 LEU 140 140 140 LEU LEU B . n 
C 2 141 SER 141 141 141 SER SER B . n 
C 2 142 ALA 142 142 142 ALA ALA B . n 
C 2 143 ILE 143 143 143 ILE ILE B . n 
C 2 144 LYS 144 144 144 LYS LYS B . n 
C 2 145 GLU 145 145 145 GLU GLU B . n 
C 2 146 GLY 146 146 146 GLY GLY B . n 
C 2 147 ARG 147 147 147 ARG ARG B . n 
C 2 148 VAL 148 148 148 VAL VAL B . n 
C 2 149 LYS 149 149 149 LYS LYS B . n 
C 2 150 LYS 150 150 150 LYS LYS B . n 
C 2 151 ASP 151 151 151 ASP ASP B . n 
C 2 152 TYR 152 152 152 TYR TYR B . n 
C 2 153 LYS 153 153 153 LYS LYS B . n 
C 2 154 THR 154 154 154 THR THR B . n 
C 2 155 ILE 155 155 155 ILE ILE B . n 
C 2 156 LEU 156 156 156 LEU LEU B . n 
C 2 157 GLN 157 157 157 GLN GLN B . n 
C 2 158 GLU 158 158 158 GLU GLU B . n 
C 2 159 ILE 159 159 159 ILE ILE B . n 
C 2 160 THR 160 160 160 THR THR B . n 
C 2 161 GLN 161 161 161 GLN GLN B . n 
C 2 162 LYS 162 162 162 LYS LYS B . n 
C 2 163 ARG 163 163 163 ARG ARG B . n 
C 2 164 TRP 164 164 164 TRP TRP B . n 
C 2 165 LYS 165 165 165 LYS LYS B . n 
C 2 166 GLU 166 166 166 GLU GLU B . n 
C 2 167 ARG 167 167 167 ARG ARG B . n 
C 2 168 PRO 168 168 168 PRO PRO B . n 
C 2 169 GLU 169 169 169 GLU GLU B . n 
C 2 170 TYR 170 170 170 TYR TYR B . n 
C 2 171 ARG 171 171 171 ARG ARG B . n 
C 2 172 LEU 172 172 172 LEU LEU B . n 
C 2 173 ILE 173 173 173 ILE ILE B . n 
C 2 174 SER 174 174 174 SER SER B . n 
C 2 175 VAL 175 175 175 VAL VAL B . n 
C 2 176 GLU 176 176 176 GLU GLU B . n 
C 2 177 GLY 177 177 177 GLY GLY B . n 
C 2 178 PRO 178 178 178 PRO PRO B . n 
C 2 179 HIS 179 179 179 HIS HIS B . n 
C 2 180 HIS 180 180 180 HIS HIS B . n 
C 2 181 LYS 181 181 181 LYS LYS B . n 
C 2 182 LYS 182 182 182 LYS LYS B . n 
C 2 183 LYS 183 183 183 LYS LYS B . n 
C 2 184 PHE 184 184 184 PHE PHE B . n 
C 2 185 ILE 185 185 185 ILE ILE B . n 
C 2 186 VAL 186 186 186 VAL VAL B . n 
C 2 187 GLU 187 187 187 GLU GLU B . n 
C 2 188 ALA 188 188 188 ALA ALA B . n 
C 2 189 LYS 189 189 189 LYS LYS B . n 
C 2 190 ILE 190 190 190 ILE ILE B . n 
C 2 191 LYS 191 191 191 LYS LYS B . n 
C 2 192 GLU 192 192 192 GLU GLU B . n 
C 2 193 TYR 193 193 193 TYR TYR B . n 
C 2 194 ARG 194 194 194 ARG ARG B . n 
C 2 195 THR 195 195 195 THR THR B . n 
C 2 196 LEU 196 196 196 LEU LEU B . n 
C 2 197 GLY 197 197 197 GLY GLY B . n 
C 2 198 GLU 198 198 198 GLU GLU B . n 
C 2 199 GLY 199 199 199 GLY GLY B . n 
C 2 200 LYS 200 200 200 LYS LYS B . n 
C 2 201 SER 201 201 201 SER SER B . n 
C 2 202 LYS 202 202 202 LYS LYS B . n 
C 2 203 LYS 203 203 203 LYS LYS B . n 
C 2 204 GLU 204 204 204 GLU GLU B . n 
C 2 205 ALA 205 205 205 ALA ALA B . n 
C 2 206 GLU 206 206 206 GLU GLU B . n 
C 2 207 GLN 207 207 207 GLN GLN B . n 
C 2 208 ARG 208 208 208 ARG ARG B . n 
C 2 209 ALA 209 209 209 ALA ALA B . n 
C 2 210 ALA 210 210 210 ALA ALA B . n 
C 2 211 GLU 211 211 211 GLU GLU B . n 
C 2 212 GLU 212 212 212 GLU GLU B . n 
C 2 213 LEU 213 213 213 LEU LEU B . n 
C 2 214 ILE 214 214 214 ILE ILE B . n 
C 2 215 LYS 215 215 215 LYS LYS B . n 
C 2 216 LEU 216 216 216 LEU LEU B . n 
C 2 217 LEU 217 217 217 LEU LEU B . n 
C 2 218 GLU 218 218 218 GLU GLU B . n 
C 2 219 GLU 219 219 219 GLU GLU B . n 
C 2 220 SER 220 220 220 SER SER B . n 
C 2 221 GLU 221 221 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1  47  2  HOH HOH C . 
D 3 HOH 2  48  3  HOH HOH C . 
D 3 HOH 3  49  4  HOH HOH C . 
D 3 HOH 4  50  5  HOH HOH C . 
D 3 HOH 5  51  10 HOH HOH C . 
D 3 HOH 6  52  25 HOH HOH C . 
D 3 HOH 7  53  27 HOH HOH C . 
D 3 HOH 8  54  28 HOH HOH C . 
E 3 HOH 1  222 1  HOH HOH A . 
E 3 HOH 2  223 6  HOH HOH A . 
E 3 HOH 3  224 7  HOH HOH A . 
E 3 HOH 4  225 8  HOH HOH A . 
E 3 HOH 5  226 9  HOH HOH A . 
E 3 HOH 6  227 12 HOH HOH A . 
E 3 HOH 7  228 13 HOH HOH A . 
E 3 HOH 8  229 14 HOH HOH A . 
E 3 HOH 9  230 15 HOH HOH A . 
E 3 HOH 10 231 16 HOH HOH A . 
E 3 HOH 11 232 19 HOH HOH A . 
E 3 HOH 12 233 20 HOH HOH A . 
F 3 HOH 1  222 11 HOH HOH B . 
F 3 HOH 2  223 17 HOH HOH B . 
F 3 HOH 3  224 18 HOH HOH B . 
F 3 HOH 4  225 21 HOH HOH B . 
F 3 HOH 5  226 22 HOH HOH B . 
F 3 HOH 6  227 23 HOH HOH B . 
F 3 HOH 7  228 24 HOH HOH B . 
F 3 HOH 8  229 26 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.0 ? 1 
MAR345   'data collection' .   ? 2 
HKL-2000 'data reduction'  .   ? 3 
HKL-2000 'data scaling'    .   ? 4 
PHASER   phasing           .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 17  ? ? -161.56 53.80   
2  1 LYS A 18  ? ? -31.21  -34.71  
3  1 SER A 31  ? ? -163.53 88.46   
4  1 LYS A 32  ? ? -75.27  24.08   
5  1 GLU A 34  ? ? -151.90 71.78   
6  1 GLN A 57  ? ? -88.24  -75.22  
7  1 PRO A 60  ? ? -52.95  -81.04  
8  1 LYS A 86  ? ? -67.61  8.59    
9  1 LYS A 99  ? ? -156.06 -14.04  
10 1 ASN A 101 ? ? -127.83 -169.94 
11 1 SER A 120 ? ? -68.91  16.57   
12 1 ALA A 124 ? ? -57.20  -72.66  
13 1 LYS A 133 ? ? -61.07  8.88    
14 1 LEU A 134 ? ? -135.49 -38.60  
15 1 LYS A 162 ? ? -92.94  54.23   
16 1 ARG A 163 ? ? -178.41 -17.88  
17 1 TRP A 164 ? ? -152.51 -7.76   
18 1 LYS A 181 ? ? -158.36 89.68   
19 1 LYS A 191 ? ? 68.39   -124.45 
20 1 GLU A 219 ? ? -143.53 -71.97  
21 1 LEU B 4   ? ? -67.49  14.69   
22 1 ASP B 17  ? ? -154.60 73.74   
23 1 LYS B 18  ? ? -49.09  -16.17  
24 1 LEU B 87  ? ? -152.38 7.51    
25 1 HIS B 90  ? ? -58.77  -0.18   
26 1 ILE B 93  ? ? -56.98  177.88  
27 1 ILE B 95  ? ? -110.97 -155.99 
28 1 LYS B 96  ? ? -168.75 -96.74  
29 1 PHE B 126 ? ? -66.44  -70.50  
30 1 PHE B 135 ? ? -160.77 -33.69  
31 1 VAL B 148 ? ? -125.32 -167.63 
32 1 LYS B 150 ? ? -16.67  140.49  
33 1 LYS B 162 ? ? -88.32  30.59   
34 1 ARG B 163 ? ? -155.78 -16.47  
35 1 TRP B 164 ? ? -149.87 -5.02   
36 1 LYS B 165 ? ? 58.56   19.38   
37 1 LYS B 181 ? ? -157.07 44.71   
38 1 ILE B 190 ? ? -161.67 109.28  
39 1 LYS B 191 ? ? 65.46   -123.15 
40 1 GLU B 219 ? ? -60.06  -80.95  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? B MET 1   
2 1 Y 1 B GLU 221 ? C GLU 221 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2NUE 'double helix'         
2NUE 'a-form double helix'  
2NUE tetraloop              
2NUE 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1  1_555 A C 46 1_555 -0.893 -0.650 0.186  -2.555 -10.900 1.340  1  C_G1:C46_C  C 1  ? C 46 ? 19 1 
1 A G 2  1_555 A C 45 1_555 -0.676 -0.254 0.025  -3.153 -8.042  0.041  2  C_G2:C45_C  C 2  ? C 45 ? 19 1 
1 A G 3  1_555 A C 44 1_555 -0.590 -0.364 -0.052 -4.120 -11.609 -0.603 3  C_G3:C44_C  C 3  ? C 44 ? 19 1 
1 A A 4  1_555 A U 43 1_555 -0.254 0.002  0.106  -8.208 -1.992  -0.718 4  C_A4:U43_C  C 4  ? C 43 ? 20 1 
1 A C 5  1_555 A G 42 1_555 0.127  -0.086 0.290  -4.677 -6.585  -0.623 5  C_C5:G42_C  C 5  ? C 42 ? 19 1 
1 A A 6  1_555 A U 41 1_555 0.037  -0.289 0.159  -6.967 0.115   -0.081 6  C_A6:U41_C  C 6  ? C 41 ? 20 1 
1 A A 7  1_555 A U 40 1_555 -0.226 -0.519 0.156  -1.680 -8.585  0.408  7  C_A7:U40_C  C 7  ? C 40 ? 20 1 
1 A G 8  1_555 A C 39 1_555 -0.581 -0.392 0.127  2.521  -11.263 1.328  8  C_G8:C39_C  C 8  ? C 39 ? 19 1 
1 A C 9  1_555 A G 38 1_555 0.339  -0.460 -0.199 -2.040 -13.340 -1.011 9  C_C9:G38_C  C 9  ? C 38 ? 19 1 
1 A G 10 1_555 A C 37 1_555 -0.231 -0.472 0.150  -6.893 -10.887 -3.725 10 C_G10:C37_C C 10 ? C 37 ? 19 1 
1 A C 11 1_555 A G 36 1_555 0.104  -0.287 0.043  -8.217 -5.634  -0.018 11 C_C11:G36_C C 11 ? C 36 ? 19 1 
1 A A 12 1_555 A U 35 1_555 0.413  -0.318 0.510  -0.014 -5.063  -2.186 12 C_A12:U35_C C 12 ? C 35 ? 20 1 
1 A A 13 1_555 A U 34 1_555 0.145  -0.306 0.328  1.653  -1.208  -3.726 13 C_A13:U34_C C 13 ? C 34 ? 20 1 
1 A G 14 1_555 A C 33 1_555 0.066  -0.167 0.342  3.879  -5.290  -1.395 14 C_G14:C33_C C 14 ? C 33 ? 19 1 
1 A G 15 1_555 A C 32 1_555 -0.430 -0.192 0.153  -1.772 -10.661 -1.765 15 C_G15:C32_C C 15 ? C 32 ? 19 1 
1 A U 16 1_555 A G 31 1_555 1.419  -0.716 0.217  -2.073 -7.785  -1.210 16 C_U16:G31_C C 16 ? C 31 ? 28 1 
1 A C 17 1_555 A G 30 1_555 -0.570 -0.367 0.122  3.978  -15.084 3.142  17 C_C17:G30_C C 17 ? C 30 ? 19 1 
1 A A 18 1_555 A U 29 1_555 0.340  -0.476 -0.283 -5.062 -11.735 -0.470 18 C_A18:U29_C C 18 ? C 29 ? 20 1 
1 A U 19 1_555 A G 28 1_555 2.916  -0.842 -0.087 5.902  -9.977  1.827  19 C_U19:G28_C C 19 ? C 28 ? 28 ? 
1 A U 20 1_555 A A 27 1_555 0.477  -0.052 -0.135 4.709  -6.033  4.057  20 C_U20:A27_C C 20 ? C 27 ? 20 1 
1 A C 21 1_555 A G 26 1_555 1.619  -0.781 0.130  0.537  2.527   -0.073 21 C_C21:G26_C C 21 ? C 26 ? 19 1 
1 A G 22 1_555 A A 25 1_555 6.700  -3.218 0.457  8.785  -10.912 26.102 22 C_G22:A25_C C 22 ? C 25 ? ?  5 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1  1_555 A C 46 1_555 A G 2  1_555 A C 45 1_555 -0.170 -1.887 3.116 0.198  8.025  35.344 -4.041  0.298  2.638 13.010 -0.320 
36.216 1  CC_G1G2:C45C46_CC   C 1  ? C 46 ? C 2  ? C 45 ? 
1 A G 2  1_555 A C 45 1_555 A G 3  1_555 A C 44 1_555 0.770  -2.030 3.267 1.665  6.184  27.538 -5.507  -1.214 2.794 12.772 -3.438 
28.258 2  CC_G2G3:C44C45_CC   C 2  ? C 45 ? C 3  ? C 44 ? 
1 A G 3  1_555 A C 44 1_555 A A 4  1_555 A U 43 1_555 -0.771 -1.620 3.202 -2.630 6.185  38.253 -3.154  0.856  2.959 9.349  3.975  
38.817 3  CC_G3A4:U43C44_CC   C 3  ? C 44 ? C 4  ? C 43 ? 
1 A A 4  1_555 A U 43 1_555 A C 5  1_555 A G 42 1_555 0.629  -1.301 3.190 1.630  7.036  33.668 -3.231  -0.824 2.894 11.977 -2.775 
34.412 4  CC_A4C5:G42U43_CC   C 4  ? C 43 ? C 5  ? C 42 ? 
1 A C 5  1_555 A G 42 1_555 A A 6  1_555 A U 41 1_555 0.681  -1.702 3.079 2.234  11.126 29.453 -4.913  -0.897 2.341 20.930 -4.203 
31.518 5  CC_C5A6:U41G42_CC   C 5  ? C 42 ? C 6  ? C 41 ? 
1 A A 6  1_555 A U 41 1_555 A A 7  1_555 A U 40 1_555 -0.342 -1.647 3.151 -0.277 5.393  29.456 -4.214  0.609  2.814 10.495 0.539  
29.936 6  CC_A6A7:U40U41_CC   C 6  ? C 41 ? C 7  ? C 40 ? 
1 A A 7  1_555 A U 40 1_555 A G 8  1_555 A C 39 1_555 -0.078 -1.325 3.113 -0.732 8.600  30.460 -3.861  0.021  2.650 15.970 1.360  
31.631 7  CC_A7G8:C39U40_CC   C 7  ? C 40 ? C 8  ? C 39 ? 
1 A G 8  1_555 A C 39 1_555 A C 9  1_555 A G 38 1_555 0.290  -1.051 3.382 2.580  5.361  37.398 -2.319  -0.111 3.219 8.297  -3.992 
37.851 8  CC_G8C9:G38C39_CC   C 8  ? C 39 ? C 9  ? C 38 ? 
1 A C 9  1_555 A G 38 1_555 A G 10 1_555 A C 37 1_555 0.201  -1.847 3.271 0.086  9.483  30.691 -4.906  -0.350 2.600 17.402 -0.157 
32.089 9  CC_C9G10:C37G38_CC  C 9  ? C 38 ? C 10 ? C 37 ? 
1 A G 10 1_555 A C 37 1_555 A C 11 1_555 A G 36 1_555 0.236  -1.356 3.337 3.476  7.422  34.948 -3.247  0.107  3.005 12.153 -5.691 
35.867 10 CC_G10C11:G36C37_CC C 10 ? C 37 ? C 11 ? C 36 ? 
1 A C 11 1_555 A G 36 1_555 A A 12 1_555 A U 35 1_555 0.648  -1.607 2.894 -0.752 7.695  30.007 -4.233  -1.333 2.401 14.561 1.424  
30.965 11 CC_C11A12:U35G36_CC C 11 ? C 36 ? C 12 ? C 35 ? 
1 A A 12 1_555 A U 35 1_555 A A 13 1_555 A U 34 1_555 -0.142 -1.891 3.137 0.816  5.253  30.339 -4.495  0.412  2.773 9.942  -1.545 
30.790 12 CC_A12A13:U34U35_CC C 12 ? C 35 ? C 13 ? C 34 ? 
1 A A 13 1_555 A U 34 1_555 A G 14 1_555 A C 33 1_555 -0.059 -1.587 3.154 0.371  5.781  32.010 -3.767  0.165  2.831 10.376 -0.666 
32.516 13 CC_A13G14:C33U34_CC C 13 ? C 34 ? C 14 ? C 33 ? 
1 A G 14 1_555 A C 33 1_555 A G 15 1_555 A C 32 1_555 0.299  -1.844 3.335 0.875  9.157  29.264 -5.183  -0.403 2.657 17.584 -1.681 
30.645 14 CC_G14G15:C32C33_CC C 14 ? C 33 ? C 15 ? C 32 ? 
1 A G 15 1_555 A C 32 1_555 A U 16 1_555 A G 31 1_555 -0.078 -1.373 3.378 -0.406 2.397  38.935 -2.351  0.066  3.292 3.591  0.608  
39.008 15 CC_G15U16:G31C32_CC C 15 ? C 32 ? C 16 ? C 31 ? 
1 A U 16 1_555 A G 31 1_555 A C 17 1_555 A G 30 1_555 0.387  -1.563 2.790 4.210  9.028  29.034 -4.365  -0.074 2.247 17.375 -8.102 
30.661 16 CC_U16C17:G30G31_CC C 16 ? C 31 ? C 17 ? C 30 ? 
1 A C 17 1_555 A G 30 1_555 A A 18 1_555 A U 29 1_555 -0.223 -1.164 3.524 0.606  10.887 34.517 -3.452  0.447  3.026 17.805 -0.992 
36.148 17 CC_C17A18:U29G30_CC C 17 ? C 30 ? C 18 ? C 29 ? 
1 A A 18 1_555 A U 29 1_555 A U 19 1_555 A G 28 1_555 0.441  -1.093 3.125 -1.145 -2.251 44.781 -1.236  -0.678 3.162 -2.951 1.502  
44.849 18 CC_A18U19:G28U29_CC C 18 ? C 29 ? C 19 ? C 28 ? 
1 A U 19 1_555 A G 28 1_555 A U 20 1_555 A A 27 1_555 -0.236 -2.377 3.163 0.859  9.860  18.049 -10.064 0.958  1.640 28.791 -2.508 
20.565 19 CC_U19U20:A27G28_CC C 19 ? C 28 ? C 20 ? C 27 ? 
1 A U 20 1_555 A A 27 1_555 A C 21 1_555 A G 26 1_555 -0.050 -2.159 3.463 -1.551 4.642  33.386 -4.485  -0.169 3.142 8.026  2.681  
33.733 20 CC_U20C21:G26A27_CC C 20 ? C 27 ? C 21 ? C 26 ? 
1 A C 21 1_555 A G 26 1_555 A G 22 1_555 A A 25 1_555 -0.501 -0.089 3.246 3.651  4.321  40.310 -0.600  1.119  3.165 6.233  -5.267 
40.688 21 CC_C21G22:A25G26_CC C 21 ? C 26 ? C 22 ? C 25 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#