data_2NUF
# 
_entry.id   2NUF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NUF         
NDB   PR0240       
RCSB  RCSB040314   
WWPDB D_1000040314 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RC7 
;Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with ds-RNA (5'-GGCGCGCGCC-3')
;
unspecified 
PDB 2EZ6 'Crystal structure of RNase III mutant D44N from Aquifex aeolicus complexed with products at 2.05-Angstrom Resolution' 
unspecified 
PDB 1YZ9 
;Crystal structure of RNase III mutant E110Q from Aquifex aeolicus complexed with ds-RNA (5'-CGAACUUCGCG-3') at 2.1-Angstrom Resolution
;
unspecified 
PDB 1YYO 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-CGCGAAUUCGCG-3') at 2.5-Angstrom Resolution
;
unspecified 
PDB 1YYW 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-AAAUAUAUAUUU-3') at 2.8-Angstrom Resolution
;
unspecified 
PDB 2NUE . unspecified 
PDB 2NUG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NUF 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.H.'    1 
'Shaw, G.'     2 
'Tropea, J.E.' 3 
'Waugh, D.S.'  4 
'Court, D.L.'  5 
'Ji, X.'       6 
# 
_citation.id                        primary 
_citation.title                     'A stepwise model for double-stranded RNA processing by ribonuclease III.' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            67 
_citation.page_first                143 
_citation.page_last                 154 
_citation.year                      2007 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18047582 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2007.06032.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gan, J.'      1 
primary 'Shaw, G.'     2 
primary 'Tropea, J.E.' 3 
primary 'Waugh, D.S.'  4 
primary 'Court, D.L.'  5 
primary 'Ji, X.'       6 
# 
_cell.entry_id           2NUF 
_cell.length_a           64.1 
_cell.length_b           51.1 
_cell.length_c           113.4 
_cell.angle_alpha        90.0 
_cell.angle_beta         104.9 
_cell.angle_gamma        90.0 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NUF 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 28-MER             9010.397  2   ?        ? ? ? 
2 polymer     man 'Ribonuclease III' 26147.381 2   3.1.26.3 ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'    24.305    8   ?        ? ? ? 
4 water       nat water              18.015    120 ?        ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'RNase III' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no CAAGGUCAUUCGCAAGAGUGGCCUUGCG CAAGGUCAUUCGCAAGAGUGGCCUUGCG C,D ? 
2 'polypeptide(L)'   no no 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   C   n 
1 2   A   n 
1 3   A   n 
1 4   G   n 
1 5   G   n 
1 6   U   n 
1 7   C   n 
1 8   A   n 
1 9   U   n 
1 10  U   n 
1 11  C   n 
1 12  G   n 
1 13  C   n 
1 14  A   n 
1 15  A   n 
1 16  G   n 
1 17  A   n 
1 18  G   n 
1 19  U   n 
1 20  G   n 
1 21  G   n 
1 22  C   n 
1 23  C   n 
1 24  U   n 
1 25  U   n 
1 26  G   n 
1 27  C   n 
1 28  G   n 
2 1   MET n 
2 2   LYS n 
2 3   MET n 
2 4   LEU n 
2 5   GLU n 
2 6   GLN n 
2 7   LEU n 
2 8   GLU n 
2 9   LYS n 
2 10  LYS n 
2 11  LEU n 
2 12  GLY n 
2 13  TYR n 
2 14  THR n 
2 15  PHE n 
2 16  LYS n 
2 17  ASP n 
2 18  LYS n 
2 19  SER n 
2 20  LEU n 
2 21  LEU n 
2 22  GLU n 
2 23  LYS n 
2 24  ALA n 
2 25  LEU n 
2 26  THR n 
2 27  HIS n 
2 28  VAL n 
2 29  SER n 
2 30  TYR n 
2 31  SER n 
2 32  LYS n 
2 33  LYS n 
2 34  GLU n 
2 35  HIS n 
2 36  TYR n 
2 37  GLU n 
2 38  THR n 
2 39  LEU n 
2 40  GLU n 
2 41  PHE n 
2 42  LEU n 
2 43  GLY n 
2 44  ASP n 
2 45  ALA n 
2 46  LEU n 
2 47  VAL n 
2 48  ASN n 
2 49  PHE n 
2 50  PHE n 
2 51  ILE n 
2 52  VAL n 
2 53  ASP n 
2 54  LEU n 
2 55  LEU n 
2 56  VAL n 
2 57  GLN n 
2 58  TYR n 
2 59  SER n 
2 60  PRO n 
2 61  ASN n 
2 62  LYS n 
2 63  ARG n 
2 64  GLU n 
2 65  GLY n 
2 66  PHE n 
2 67  LEU n 
2 68  SER n 
2 69  PRO n 
2 70  LEU n 
2 71  LYS n 
2 72  ALA n 
2 73  TYR n 
2 74  LEU n 
2 75  ILE n 
2 76  SER n 
2 77  GLU n 
2 78  GLU n 
2 79  PHE n 
2 80  PHE n 
2 81  ASN n 
2 82  LEU n 
2 83  LEU n 
2 84  ALA n 
2 85  GLN n 
2 86  LYS n 
2 87  LEU n 
2 88  GLU n 
2 89  LEU n 
2 90  HIS n 
2 91  LYS n 
2 92  PHE n 
2 93  ILE n 
2 94  ARG n 
2 95  ILE n 
2 96  LYS n 
2 97  ARG n 
2 98  GLY n 
2 99  LYS n 
2 100 ILE n 
2 101 ASN n 
2 102 GLU n 
2 103 THR n 
2 104 ILE n 
2 105 ILE n 
2 106 GLY n 
2 107 ASP n 
2 108 VAL n 
2 109 PHE n 
2 110 GLU n 
2 111 ALA n 
2 112 LEU n 
2 113 TRP n 
2 114 ALA n 
2 115 ALA n 
2 116 VAL n 
2 117 TYR n 
2 118 ILE n 
2 119 ASP n 
2 120 SER n 
2 121 GLY n 
2 122 ARG n 
2 123 ASP n 
2 124 ALA n 
2 125 ASN n 
2 126 PHE n 
2 127 THR n 
2 128 ARG n 
2 129 GLU n 
2 130 LEU n 
2 131 PHE n 
2 132 TYR n 
2 133 LYS n 
2 134 LEU n 
2 135 PHE n 
2 136 LYS n 
2 137 GLU n 
2 138 ASP n 
2 139 ILE n 
2 140 LEU n 
2 141 SER n 
2 142 ALA n 
2 143 ILE n 
2 144 LYS n 
2 145 GLU n 
2 146 GLY n 
2 147 ARG n 
2 148 VAL n 
2 149 LYS n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 LYS n 
2 154 THR n 
2 155 ILE n 
2 156 LEU n 
2 157 GLN n 
2 158 GLU n 
2 159 ILE n 
2 160 THR n 
2 161 GLN n 
2 162 LYS n 
2 163 ARG n 
2 164 TRP n 
2 165 LYS n 
2 166 GLU n 
2 167 ARG n 
2 168 PRO n 
2 169 GLU n 
2 170 TYR n 
2 171 ARG n 
2 172 LEU n 
2 173 ILE n 
2 174 SER n 
2 175 VAL n 
2 176 GLU n 
2 177 GLY n 
2 178 PRO n 
2 179 HIS n 
2 180 HIS n 
2 181 LYS n 
2 182 LYS n 
2 183 LYS n 
2 184 PHE n 
2 185 ILE n 
2 186 VAL n 
2 187 GLU n 
2 188 ALA n 
2 189 LYS n 
2 190 ILE n 
2 191 LYS n 
2 192 GLU n 
2 193 TYR n 
2 194 ARG n 
2 195 THR n 
2 196 LEU n 
2 197 GLY n 
2 198 GLU n 
2 199 GLY n 
2 200 LYS n 
2 201 SER n 
2 202 LYS n 
2 203 LYS n 
2 204 GLU n 
2 205 ALA n 
2 206 GLU n 
2 207 GLN n 
2 208 ARG n 
2 209 ALA n 
2 210 ALA n 
2 211 GLU n 
2 212 GLU n 
2 213 LEU n 
2 214 ILE n 
2 215 LYS n 
2 216 LEU n 
2 217 LEU n 
2 218 GLU n 
2 219 GLU n 
2 220 SER n 
2 221 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 rnc 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHPK1409 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RNC_AQUAE O67082 2 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
1 ? 
2 PDB 2NUF      2NUF   1 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2NUF A 1 ? 221 ? O67082 1 ? 221 ? 1 221 
2 1 2NUF B 1 ? 221 ? O67082 1 ? 221 ? 1 221 
3 2 2NUF C 1 ? 28  ? 2NUF   1 ? 28  ? 1 28  
4 2 2NUF D 1 ? 28  ? 2NUF   1 ? 28  ? 1 28  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2NUF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.80 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.2 M NaCl + 25% w/v PEG 3350 in 0.1 M Tris-Cl, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 NaCl       ? ? ? 
1 2 1 'PEG 3350' ? ? ? 
1 3 1 Tris-Cl    ? ? ? 
1 4 1 H2O        ? ? ? 
1 5 2 NaCl       ? ? ? 
1 6 2 'PEG 3350' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-11-23 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2NUF 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   22168 
_reflns.number_all                   22168 
_reflns.percent_possible_obs         84.5 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.5 
_reflns.B_iso_Wilson_estimate        49.6 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   62.6 
_reflns_shell.Rmerge_I_obs           0.16 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        1.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1656 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NUF 
_refine.ls_number_reflns_obs                     20962 
_refine.ls_number_reflns_all                     20962 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               502322.38 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.76 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    84.1 
_refine.ls_R_factor_obs                          0.222 
_refine.ls_R_factor_all                          0.226 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.284 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1030 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               56.8 
_refine.aniso_B[1][1]                            14.54 
_refine.aniso_B[2][2]                            -7.68 
_refine.aniso_B[3][3]                            -6.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            15.37 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.338915 
_refine.solvent_model_param_bsol                 41.145 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2EZ6 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2NUF 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           30.00 
_refine_analyze.Luzzati_coordinate_error_free   0.48 
_refine_analyze.Luzzati_sigma_a_free            0.54 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3658 
_refine_hist.pdbx_number_atoms_nucleic_acid   1200 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             122 
_refine_hist.number_atoms_total               4988 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        29.76 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      17.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.01  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.55  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             4.11  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.86  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             2542 
_refine_ls_shell.R_factor_R_work                  0.33 
_refine_ls_shell.percent_reflns_obs               64.9 
_refine_ls_shell.R_factor_R_free                  0.384 
_refine_ls_shell.R_factor_R_free_error            0.033 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             137 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2542 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NUF 
_struct.title                     
'Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA at 2.5-Angstrom Resolution' 
_struct.pdbx_descriptor           'PROTEIN/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NUF 
_struct_keywords.pdbx_keywords   hydrolase/RNA 
_struct_keywords.text            'Ribonuclease III, dsRNA, RNA interference, endonucleolytic cleavage, hydrolase-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET C 3   ? GLY C 12  ? MET A 3   GLY A 12  1 ? 10 
HELX_P HELX_P2  2  ASP C 17  ? THR C 26  ? ASP A 17  THR A 26  1 ? 10 
HELX_P HELX_P3  3  TYR C 36  ? SER C 59  ? TYR A 36  SER A 59  1 ? 24 
HELX_P HELX_P4  4  ARG C 63  ? ILE C 75  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER C 76  ? GLN C 85  ? SER A 76  GLN A 85  1 ? 10 
HELX_P HELX_P6  6  LYS C 86  ? PHE C 92  ? LYS A 86  PHE A 92  5 ? 7  
HELX_P HELX_P7  7  ASN C 101 ? SER C 120 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP C 123 ? GLU C 145 ? ASP A 123 GLU A 145 1 ? 23 
HELX_P HELX_P9  9  ASP C 151 ? TRP C 164 ? ASP A 151 TRP A 164 1 ? 14 
HELX_P HELX_P10 10 SER C 201 ? SER C 220 ? SER A 201 SER A 220 1 ? 20 
HELX_P HELX_P11 11 MET D 3   ? GLY D 12  ? MET B 3   GLY B 12  1 ? 10 
HELX_P HELX_P12 12 ASP D 17  ? THR D 26  ? ASP B 17  THR B 26  1 ? 10 
HELX_P HELX_P13 13 TYR D 36  ? SER D 59  ? TYR B 36  SER B 59  1 ? 24 
HELX_P HELX_P14 14 ARG D 63  ? ILE D 75  ? ARG B 63  ILE B 75  1 ? 13 
HELX_P HELX_P15 15 SER D 76  ? GLN D 85  ? SER B 76  GLN B 85  1 ? 10 
HELX_P HELX_P16 16 LYS D 86  ? PHE D 92  ? LYS B 86  PHE B 92  5 ? 7  
HELX_P HELX_P17 17 ASN D 101 ? SER D 120 ? ASN B 101 SER B 120 1 ? 20 
HELX_P HELX_P18 18 ASP D 123 ? GLU D 145 ? ASP B 123 GLU B 145 1 ? 23 
HELX_P HELX_P19 19 ASP D 151 ? TRP D 164 ? ASP B 151 TRP B 164 1 ? 14 
HELX_P HELX_P20 20 SER D 201 ? GLU D 219 ? SER B 201 GLU B 219 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A C   1   OP1 ? ? ? 1_555 E MG  .  MG ? ? C C   1   C MG  202 1_555 ? ? ? ? ? ? ?             1.994 ? 
metalc2  metalc ? ? A A   2   OP2 ? ? ? 1_555 E MG  .  MG ? ? C A   2   C MG  202 1_555 ? ? ? ? ? ? ?             2.369 ? 
metalc3  metalc ? ? B C   1   OP1 ? ? ? 1_555 F MG  .  MG ? ? D C   1   D MG  206 1_555 ? ? ? ? ? ? ?             1.903 ? 
metalc4  metalc ? ? B A   2   OP1 ? ? ? 1_555 G MG  .  MG ? ? D A   2   D MG  208 1_555 ? ? ? ? ? ? ?             2.187 ? 
metalc5  metalc ? ? B A   2   OP2 ? ? ? 1_555 F MG  .  MG ? ? D A   2   D MG  206 1_555 ? ? ? ? ? ? ?             2.056 ? 
metalc6  metalc ? ? C GLU 40  OE1 ? ? ? 1_555 J MG  .  MG ? ? A GLU 40  A MG  224 1_555 ? ? ? ? ? ? ?             2.315 ? 
metalc7  metalc ? ? C GLU 40  OE2 ? ? ? 1_555 I MG  .  MG ? ? A GLU 40  A MG  223 1_555 ? ? ? ? ? ? ?             2.353 ? 
metalc8  metalc ? ? C ASP 107 OD1 ? ? ? 1_555 I MG  .  MG ? ? A ASP 107 A MG  223 1_555 ? ? ? ? ? ? ?             2.153 ? 
metalc9  metalc ? ? C GLU 110 OE2 ? ? ? 1_555 H MG  .  MG ? ? A GLU 110 A MG  222 1_555 ? ? ? ? ? ? ?             2.143 ? 
metalc10 metalc ? ? D ASP 107 OD1 ? ? ? 1_555 L MG  .  MG ? ? B ASP 107 B MG  223 1_555 ? ? ? ? ? ? ?             2.299 ? 
metalc11 metalc ? ? J MG  .   MG  ? ? ? 1_555 O HOH .  O  ? ? A MG  224 A HOH 279 1_555 ? ? ? ? ? ? ?             2.141 ? 
metalc12 metalc ? ? J MG  .   MG  ? ? ? 1_555 O HOH .  O  ? ? A MG  224 A HOH 277 1_555 ? ? ? ? ? ? ?             2.408 ? 
metalc13 metalc ? ? J MG  .   MG  ? ? ? 1_555 O HOH .  O  ? ? A MG  224 A HOH 276 1_555 ? ? ? ? ? ? ?             2.004 ? 
metalc14 metalc ? ? J MG  .   MG  ? ? ? 1_555 O HOH .  O  ? ? A MG  224 A HOH 278 1_555 ? ? ? ? ? ? ?             2.174 ? 
metalc15 metalc ? ? K MG  .   MG  ? ? ? 1_555 P HOH .  O  ? ? B MG  222 B HOH 248 1_555 ? ? ? ? ? ? ?             2.004 ? 
metalc16 metalc ? ? L MG  .   MG  ? ? ? 1_555 P HOH .  O  ? ? B MG  223 B HOH 232 1_555 ? ? ? ? ? ? ?             2.186 ? 
metalc17 metalc ? ? L MG  .   MG  ? ? ? 1_555 P HOH .  O  ? ? B MG  223 B HOH 248 1_555 ? ? ? ? ? ? ?             2.024 ? 
hydrog1  hydrog ? ? A C   1   N3  ? ? ? 1_555 A G   26 N1 ? ? C C   1   C G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2  hydrog ? ? A C   1   N4  ? ? ? 1_555 A G   26 O6 ? ? C C   1   C G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3  hydrog ? ? A C   1   O2  ? ? ? 1_555 A G   26 N2 ? ? C C   1   C G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4  hydrog ? ? A A   2   N1  ? ? ? 1_555 A U   25 N3 ? ? C A   2   C U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5  hydrog ? ? A A   2   N6  ? ? ? 1_555 A U   25 O4 ? ? C A   2   C U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? A A   3   N1  ? ? ? 1_555 A U   24 N3 ? ? C A   3   C U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? A A   3   N6  ? ? ? 1_555 A U   24 O4 ? ? C A   3   C U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog8  hydrog ? ? A G   4   N1  ? ? ? 1_555 A C   23 N3 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9  hydrog ? ? A G   4   N2  ? ? ? 1_555 A C   23 O2 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10 hydrog ? ? A G   4   O6  ? ? ? 1_555 A C   23 N4 ? ? C G   4   C C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? A G   5   N1  ? ? ? 1_555 A C   22 N3 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? A G   5   N2  ? ? ? 1_555 A C   22 O2 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? A G   5   O6  ? ? ? 1_555 A C   22 N4 ? ? C G   5   C C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? A U   6   N3  ? ? ? 1_555 A G   21 O6 ? ? C U   6   C G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog15 hydrog ? ? A U   6   O2  ? ? ? 1_555 A G   21 N1 ? ? C U   6   C G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog16 hydrog ? ? A C   7   N3  ? ? ? 1_555 A G   20 N1 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17 hydrog ? ? A C   7   N4  ? ? ? 1_555 A G   20 O6 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? A C   7   O2  ? ? ? 1_555 A G   20 N2 ? ? C C   7   C G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19 hydrog ? ? A A   8   N1  ? ? ? 1_555 A U   19 N3 ? ? C A   8   C U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? A A   8   N6  ? ? ? 1_555 A U   19 O4 ? ? C A   8   C U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? A U   9   N3  ? ? ? 1_555 A G   18 O6 ? ? C U   9   C G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog22 hydrog ? ? A U   9   O2  ? ? ? 1_555 A G   18 N1 ? ? C U   9   C G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog23 hydrog ? ? A U   10  N3  ? ? ? 1_555 A A   17 N1 ? ? C U   10  C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog24 hydrog ? ? A U   10  O4  ? ? ? 1_555 A A   17 N6 ? ? C U   10  C A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog25 hydrog ? ? A C   11  N3  ? ? ? 1_555 A G   16 N1 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog26 hydrog ? ? A C   11  N4  ? ? ? 1_555 A G   16 O6 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog27 hydrog ? ? A C   11  O2  ? ? ? 1_555 A G   16 N2 ? ? C C   11  C G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog28 hydrog ? ? A G   12  N2  ? ? ? 1_555 A A   15 N7 ? ? C G   12  C A   15  1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog29 hydrog ? ? A G   12  N3  ? ? ? 1_555 A A   15 N6 ? ? C G   12  C A   15  1_555 ? ? ? ? ? ? TYPE_11_PAIR  ?     ? 
hydrog30 hydrog ? ? A C   27  N3  ? ? ? 1_555 B G   28 N1 ? ? C C   27  D G   28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog31 hydrog ? ? A C   27  N4  ? ? ? 1_555 B G   28 O6 ? ? C C   27  D G   28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog32 hydrog ? ? A C   27  O2  ? ? ? 1_555 B G   28 N2 ? ? C C   27  D G   28  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog33 hydrog ? ? A G   28  N1  ? ? ? 1_555 B C   27 N3 ? ? C G   28  D C   27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog34 hydrog ? ? A G   28  N2  ? ? ? 1_555 B C   27 O2 ? ? C G   28  D C   27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog35 hydrog ? ? A G   28  O6  ? ? ? 1_555 B C   27 N4 ? ? C G   28  D C   27  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog36 hydrog ? ? B C   1   N3  ? ? ? 1_555 B G   26 N1 ? ? D C   1   D G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog37 hydrog ? ? B C   1   N4  ? ? ? 1_555 B G   26 O6 ? ? D C   1   D G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog38 hydrog ? ? B C   1   O2  ? ? ? 1_555 B G   26 N2 ? ? D C   1   D G   26  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog39 hydrog ? ? B A   2   N1  ? ? ? 1_555 B U   25 N3 ? ? D A   2   D U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog40 hydrog ? ? B A   2   N6  ? ? ? 1_555 B U   25 O4 ? ? D A   2   D U   25  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog41 hydrog ? ? B A   3   N1  ? ? ? 1_555 B U   24 N3 ? ? D A   3   D U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog42 hydrog ? ? B A   3   N6  ? ? ? 1_555 B U   24 O4 ? ? D A   3   D U   24  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog43 hydrog ? ? B G   4   N1  ? ? ? 1_555 B C   23 N3 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog44 hydrog ? ? B G   4   N2  ? ? ? 1_555 B C   23 O2 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog45 hydrog ? ? B G   4   O6  ? ? ? 1_555 B C   23 N4 ? ? D G   4   D C   23  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog46 hydrog ? ? B G   5   N1  ? ? ? 1_555 B C   22 N3 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog47 hydrog ? ? B G   5   N2  ? ? ? 1_555 B C   22 O2 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog48 hydrog ? ? B G   5   O6  ? ? ? 1_555 B C   22 N4 ? ? D G   5   D C   22  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog49 hydrog ? ? B U   6   N3  ? ? ? 1_555 B G   21 O6 ? ? D U   6   D G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog50 hydrog ? ? B U   6   O2  ? ? ? 1_555 B G   21 N1 ? ? D U   6   D G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog51 hydrog ? ? B C   7   N3  ? ? ? 1_555 B G   20 N1 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog52 hydrog ? ? B C   7   N4  ? ? ? 1_555 B G   20 O6 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog53 hydrog ? ? B C   7   O2  ? ? ? 1_555 B G   20 N2 ? ? D C   7   D G   20  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog54 hydrog ? ? B A   8   N1  ? ? ? 1_555 B U   19 N3 ? ? D A   8   D U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog55 hydrog ? ? B A   8   N6  ? ? ? 1_555 B U   19 O4 ? ? D A   8   D U   19  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog56 hydrog ? ? B U   9   N3  ? ? ? 1_555 B G   18 O6 ? ? D U   9   D G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog57 hydrog ? ? B U   9   O2  ? ? ? 1_555 B G   18 N1 ? ? D U   9   D G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? 
hydrog58 hydrog ? ? B U   10  N3  ? ? ? 1_555 B A   17 N1 ? ? D U   10  D A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog59 hydrog ? ? B U   10  O4  ? ? ? 1_555 B A   17 N6 ? ? D U   10  D A   17  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog60 hydrog ? ? B C   11  N3  ? ? ? 1_555 B G   16 N1 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog61 hydrog ? ? B C   11  N4  ? ? ? 1_555 B G   16 O6 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog62 hydrog ? ? B C   11  O2  ? ? ? 1_555 B G   16 N2 ? ? D C   11  D G   16  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog63 hydrog ? ? B G   12  N2  ? ? ? 1_555 B A   15 N7 ? ? D G   12  D A   15  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 169 ? GLU C 176 ? GLU A 169 GLU A 176 
A 2 LYS C 183 ? ILE C 190 ? LYS A 183 ILE A 190 
A 3 TYR C 193 ? GLY C 199 ? TYR A 193 GLY A 199 
B 1 GLU D 169 ? GLU D 176 ? GLU B 169 GLU B 176 
B 2 LYS D 183 ? ILE D 190 ? LYS B 183 ILE B 190 
B 3 TYR D 193 ? GLY D 199 ? TYR B 193 GLY B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE C 173 ? N ILE A 173 O ILE C 185 ? O ILE A 185 
A 2 3 N VAL C 186 ? N VAL A 186 O GLY C 197 ? O GLY A 197 
B 1 2 N GLU D 169 ? N GLU B 169 O LYS D 189 ? O LYS B 189 
B 2 3 N VAL D 186 ? N VAL B 186 O GLY D 197 ? O GLY B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 222' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG C 202' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 223' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 224' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 222' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 206' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 223' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 208' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASP C 44  ? ASP A 44  . ? 1_555 ? 
2  AC1 2 GLU C 110 ? GLU A 110 . ? 1_555 ? 
3  AC2 3 C   A 1   ? C   C 1   . ? 1_555 ? 
4  AC2 3 A   A 2   ? A   C 2   . ? 1_555 ? 
5  AC2 3 HOH M .   ? HOH C 223 . ? 1_555 ? 
6  AC3 3 GLU C 40  ? GLU A 40  . ? 1_555 ? 
7  AC3 3 ASP C 107 ? ASP A 107 . ? 1_555 ? 
8  AC3 3 GLU C 110 ? GLU A 110 . ? 1_555 ? 
9  AC4 7 GLU C 40  ? GLU A 40  . ? 1_555 ? 
10 AC4 7 HOH O .   ? HOH A 276 . ? 1_555 ? 
11 AC4 7 HOH O .   ? HOH A 277 . ? 1_555 ? 
12 AC4 7 HOH O .   ? HOH A 278 . ? 1_555 ? 
13 AC4 7 HOH O .   ? HOH A 279 . ? 1_555 ? 
14 AC4 7 C   A 1   ? C   C 1   . ? 1_555 ? 
15 AC4 7 A   A 2   ? A   C 2   . ? 1_555 ? 
16 AC5 4 ASP D 44  ? ASP B 44  . ? 1_555 ? 
17 AC5 4 GLU D 110 ? GLU B 110 . ? 1_555 ? 
18 AC5 4 HOH P .   ? HOH B 248 . ? 1_555 ? 
19 AC5 4 C   B 1   ? C   D 1   . ? 1_555 ? 
20 AC6 3 C   B 1   ? C   D 1   . ? 1_555 ? 
21 AC6 3 A   B 2   ? A   D 2   . ? 1_555 ? 
22 AC6 3 HOH N .   ? HOH D 210 . ? 1_555 ? 
23 AC7 5 GLU D 40  ? GLU B 40  . ? 1_555 ? 
24 AC7 5 ASP D 107 ? ASP B 107 . ? 1_555 ? 
25 AC7 5 GLU D 110 ? GLU B 110 . ? 1_555 ? 
26 AC7 5 HOH P .   ? HOH B 232 . ? 1_555 ? 
27 AC7 5 HOH P .   ? HOH B 248 . ? 1_555 ? 
28 AC8 3 GLU D 40  ? GLU B 40  . ? 1_555 ? 
29 AC8 3 C   B 1   ? C   D 1   . ? 1_555 ? 
30 AC8 3 A   B 2   ? A   D 2   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NUF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NUF 
_atom_sites.fract_transf_matrix[1][1]   0.015597 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004154 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019589 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009127 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  OP3   . C   A 1 1   ? -1.016  7.639   23.811  1.00 61.38  ? 1   C   C OP3   1 
ATOM   2    P  P     . C   A 1 1   ? 0.466   7.261   23.740  1.00 64.78  ? 1   C   C P     1 
ATOM   3    O  OP1   . C   A 1 1   ? 1.033   7.234   22.327  1.00 56.06  ? 1   C   C OP1   1 
ATOM   4    O  OP2   . C   A 1 1   ? 1.338   8.062   24.705  1.00 58.09  ? 1   C   C OP2   1 
ATOM   5    O  "O5'" . C   A 1 1   ? 0.528   5.724   24.272  1.00 56.27  ? 1   C   C "O5'" 1 
ATOM   6    C  "C5'" . C   A 1 1   ? 1.780   5.043   24.400  1.00 48.68  ? 1   C   C "C5'" 1 
ATOM   7    C  "C4'" . C   A 1 1   ? 1.701   3.700   23.735  1.00 48.22  ? 1   C   C "C4'" 1 
ATOM   8    O  "O4'" . C   A 1 1   ? 0.619   2.924   24.326  1.00 50.54  ? 1   C   C "O4'" 1 
ATOM   9    C  "C3'" . C   A 1 1   ? 1.354   3.750   22.260  1.00 50.82  ? 1   C   C "C3'" 1 
ATOM   10   O  "O3'" . C   A 1 1   ? 2.510   4.046   21.474  1.00 51.74  ? 1   C   C "O3'" 1 
ATOM   11   C  "C2'" . C   A 1 1   ? 0.789   2.348   22.030  1.00 48.15  ? 1   C   C "C2'" 1 
ATOM   12   O  "O2'" . C   A 1 1   ? 1.817   1.383   21.968  1.00 46.17  ? 1   C   C "O2'" 1 
ATOM   13   C  "C1'" . C   A 1 1   ? 0.004   2.122   23.325  1.00 45.98  ? 1   C   C "C1'" 1 
ATOM   14   N  N1    . C   A 1 1   ? -1.441  2.446   23.272  1.00 43.69  ? 1   C   C N1    1 
ATOM   15   C  C2    . C   A 1 1   ? -2.335  1.453   22.863  1.00 43.53  ? 1   C   C C2    1 
ATOM   16   O  O2    . C   A 1 1   ? -1.881  0.373   22.482  1.00 44.26  ? 1   C   C O2    1 
ATOM   17   N  N3    . C   A 1 1   ? -3.670  1.704   22.883  1.00 35.41  ? 1   C   C N3    1 
ATOM   18   C  C4    . C   A 1 1   ? -4.114  2.900   23.263  1.00 37.98  ? 1   C   C C4    1 
ATOM   19   N  N4    . C   A 1 1   ? -5.429  3.104   23.266  1.00 35.68  ? 1   C   C N4    1 
ATOM   20   C  C5    . C   A 1 1   ? -3.227  3.943   23.656  1.00 35.79  ? 1   C   C C5    1 
ATOM   21   C  C6    . C   A 1 1   ? -1.909  3.676   23.640  1.00 37.17  ? 1   C   C C6    1 
ATOM   22   P  P     . A   A 1 2   ? 2.333   4.567   19.958  1.00 58.94  ? 2   A   C P     1 
ATOM   23   O  OP1   . A   A 1 2   ? 3.674   4.828   19.373  1.00 55.88  ? 2   A   C OP1   1 
ATOM   24   O  OP2   . A   A 1 2   ? 1.303   5.645   19.950  1.00 57.51  ? 2   A   C OP2   1 
ATOM   25   O  "O5'" . A   A 1 2   ? 1.734   3.296   19.204  1.00 57.23  ? 2   A   C "O5'" 1 
ATOM   26   C  "C5'" . A   A 1 2   ? 0.754   3.436   18.185  1.00 51.23  ? 2   A   C "C5'" 1 
ATOM   27   C  "C4'" . A   A 1 2   ? 0.216   2.085   17.806  1.00 47.70  ? 2   A   C "C4'" 1 
ATOM   28   O  "O4'" . A   A 1 2   ? -0.468  1.515   18.956  1.00 52.02  ? 2   A   C "O4'" 1 
ATOM   29   C  "C3'" . A   A 1 2   ? -0.833  2.075   16.711  1.00 46.52  ? 2   A   C "C3'" 1 
ATOM   30   O  "O3'" . A   A 1 2   ? -0.215  2.103   15.424  1.00 46.61  ? 2   A   C "O3'" 1 
ATOM   31   C  "C2'" . A   A 1 2   ? -1.560  0.768   17.005  1.00 44.84  ? 2   A   C "C2'" 1 
ATOM   32   O  "O2'" . A   A 1 2   ? -0.834  -0.374  16.601  1.00 49.46  ? 2   A   C "O2'" 1 
ATOM   33   C  "C1'" . A   A 1 2   ? -1.621  0.805   18.532  1.00 42.80  ? 2   A   C "C1'" 1 
ATOM   34   N  N9    . A   A 1 2   ? -2.785  1.549   19.004  1.00 43.27  ? 2   A   C N9    1 
ATOM   35   C  C8    . A   A 1 2   ? -2.777  2.756   19.642  1.00 40.01  ? 2   A   C C8    1 
ATOM   36   N  N7    . A   A 1 2   ? -3.970  3.235   19.886  1.00 39.60  ? 2   A   C N7    1 
ATOM   37   C  C5    . A   A 1 2   ? -4.825  2.269   19.385  1.00 40.04  ? 2   A   C C5    1 
ATOM   38   C  C6    . A   A 1 2   ? -6.224  2.191   19.308  1.00 40.17  ? 2   A   C C6    1 
ATOM   39   N  N6    . A   A 1 2   ? -7.052  3.147   19.737  1.00 28.99  ? 2   A   C N6    1 
ATOM   40   N  N1    . A   A 1 2   ? -6.756  1.085   18.753  1.00 41.64  ? 2   A   C N1    1 
ATOM   41   C  C2    . A   A 1 2   ? -5.935  0.140   18.298  1.00 42.36  ? 2   A   C C2    1 
ATOM   42   N  N3    . A   A 1 2   ? -4.609  0.105   18.298  1.00 44.29  ? 2   A   C N3    1 
ATOM   43   C  C4    . A   A 1 2   ? -4.108  1.212   18.861  1.00 41.08  ? 2   A   C C4    1 
ATOM   44   P  P     . A   A 1 3   ? -0.904  2.925   14.223  1.00 49.29  ? 3   A   C P     1 
ATOM   45   O  OP1   . A   A 1 3   ? 0.034   2.890   13.082  1.00 46.92  ? 3   A   C OP1   1 
ATOM   46   O  OP2   . A   A 1 3   ? -1.367  4.229   14.743  1.00 47.99  ? 3   A   C OP2   1 
ATOM   47   O  "O5'" . A   A 1 3   ? -2.187  2.059   13.854  1.00 45.36  ? 3   A   C "O5'" 1 
ATOM   48   C  "C5'" . A   A 1 3   ? -2.041  0.767   13.282  1.00 44.25  ? 3   A   C "C5'" 1 
ATOM   49   C  "C4'" . A   A 1 3   ? -3.395  0.126   13.080  1.00 47.66  ? 3   A   C "C4'" 1 
ATOM   50   O  "O4'" . A   A 1 3   ? -4.048  -0.053  14.371  1.00 48.18  ? 3   A   C "O4'" 1 
ATOM   51   C  "C3'" . A   A 1 3   ? -4.408  0.928   12.278  1.00 44.94  ? 3   A   C "C3'" 1 
ATOM   52   O  "O3'" . A   A 1 3   ? -4.202  0.790   10.880  1.00 47.47  ? 3   A   C "O3'" 1 
ATOM   53   C  "C2'" . A   A 1 3   ? -5.708  0.280   12.723  1.00 47.86  ? 3   A   C "C2'" 1 
ATOM   54   O  "O2'" . A   A 1 3   ? -5.878  -1.000  12.162  1.00 48.01  ? 3   A   C "O2'" 1 
ATOM   55   C  "C1'" . A   A 1 3   ? -5.450  0.122   14.221  1.00 45.69  ? 3   A   C "C1'" 1 
ATOM   56   N  N9    . A   A 1 3   ? -5.834  1.329   14.949  1.00 45.20  ? 3   A   C N9    1 
ATOM   57   C  C8    . A   A 1 3   ? -5.014  2.252   15.547  1.00 41.54  ? 3   A   C C8    1 
ATOM   58   N  N7    . A   A 1 3   ? -5.661  3.225   16.138  1.00 39.78  ? 3   A   C N7    1 
ATOM   59   C  C5    . A   A 1 3   ? -6.995  2.926   15.909  1.00 40.36  ? 3   A   C C5    1 
ATOM   60   C  C6    . A   A 1 3   ? -8.187  3.566   16.286  1.00 44.48  ? 3   A   C C6    1 
ATOM   61   N  N6    . A   A 1 3   ? -8.228  4.678   17.032  1.00 47.21  ? 3   A   C N6    1 
ATOM   62   N  N1    . A   A 1 3   ? -9.353  3.014   15.880  1.00 40.22  ? 3   A   C N1    1 
ATOM   63   C  C2    . A   A 1 3   ? -9.309  1.894   15.161  1.00 38.36  ? 3   A   C C2    1 
ATOM   64   N  N3    . A   A 1 3   ? -8.255  1.192   14.757  1.00 40.60  ? 3   A   C N3    1 
ATOM   65   C  C4    . A   A 1 3   ? -7.116  1.768   15.170  1.00 40.49  ? 3   A   C C4    1 
ATOM   66   P  P     . G   A 1 4   ? -4.285  2.087   9.929   1.00 49.39  ? 4   G   C P     1 
ATOM   67   O  OP1   . G   A 1 4   ? -3.476  1.768   8.729   1.00 48.80  ? 4   G   C OP1   1 
ATOM   68   O  OP2   . G   A 1 4   ? -3.979  3.304   10.720  1.00 49.33  ? 4   G   C OP2   1 
ATOM   69   O  "O5'" . G   A 1 4   ? -5.815  2.152   9.510   1.00 48.33  ? 4   G   C "O5'" 1 
ATOM   70   C  "C5'" . G   A 1 4   ? -6.439  1.021   8.927   1.00 45.50  ? 4   G   C "C5'" 1 
ATOM   71   C  "C4'" . G   A 1 4   ? -7.934  1.119   9.058   1.00 47.49  ? 4   G   C "C4'" 1 
ATOM   72   O  "O4'" . G   A 1 4   ? -8.327  1.047   10.458  1.00 49.98  ? 4   G   C "O4'" 1 
ATOM   73   C  "C3'" . G   A 1 4   ? -8.575  2.410   8.586   1.00 46.82  ? 4   G   C "C3'" 1 
ATOM   74   O  "O3'" . G   A 1 4   ? -8.711  2.436   7.176   1.00 52.16  ? 4   G   C "O3'" 1 
ATOM   75   C  "C2'" . G   A 1 4   ? -9.932  2.309   9.257   1.00 48.93  ? 4   G   C "C2'" 1 
ATOM   76   O  "O2'" . G   A 1 4   ? -10.745 1.357   8.595   1.00 46.78  ? 4   G   C "O2'" 1 
ATOM   77   C  "C1'" . G   A 1 4   ? -9.531  1.785   10.641  1.00 50.70  ? 4   G   C "C1'" 1 
ATOM   78   N  N9    . G   A 1 4   ? -9.268  2.882   11.569  1.00 47.27  ? 4   G   C N9    1 
ATOM   79   C  C8    . G   A 1 4   ? -8.041  3.389   11.923  1.00 47.25  ? 4   G   C C8    1 
ATOM   80   N  N7    . G   A 1 4   ? -8.122  4.402   12.746  1.00 50.73  ? 4   G   C N7    1 
ATOM   81   C  C5    . G   A 1 4   ? -9.486  4.572   12.950  1.00 46.52  ? 4   G   C C5    1 
ATOM   82   C  C6    . G   A 1 4   ? -10.185 5.522   13.746  1.00 46.61  ? 4   G   C C6    1 
ATOM   83   O  O6    . G   A 1 4   ? -9.724  6.431   14.441  1.00 51.61  ? 4   G   C O6    1 
ATOM   84   N  N1    . G   A 1 4   ? -11.561 5.334   13.678  1.00 45.96  ? 4   G   C N1    1 
ATOM   85   C  C2    . G   A 1 4   ? -12.187 4.355   12.942  1.00 44.93  ? 4   G   C C2    1 
ATOM   86   N  N2    . G   A 1 4   ? -13.527 4.338   13.007  1.00 38.29  ? 4   G   C N2    1 
ATOM   87   N  N3    . G   A 1 4   ? -11.547 3.464   12.196  1.00 42.40  ? 4   G   C N3    1 
ATOM   88   C  C4    . G   A 1 4   ? -10.207 3.633   12.244  1.00 45.33  ? 4   G   C C4    1 
ATOM   89   P  P     . G   A 1 5   ? -8.639  3.840   6.392   1.00 60.00  ? 5   G   C P     1 
ATOM   90   O  OP1   . G   A 1 5   ? -8.492  3.484   4.956   1.00 57.69  ? 5   G   C OP1   1 
ATOM   91   O  OP2   . G   A 1 5   ? -7.633  4.740   7.032   1.00 54.85  ? 5   G   C OP2   1 
ATOM   92   O  "O5'" . G   A 1 5   ? -10.086 4.481   6.606   1.00 55.82  ? 5   G   C "O5'" 1 
ATOM   93   C  "C5'" . G   A 1 5   ? -11.254 3.831   6.117   1.00 48.71  ? 5   G   C "C5'" 1 
ATOM   94   C  "C4'" . G   A 1 5   ? -12.496 4.544   6.606   1.00 53.42  ? 5   G   C "C4'" 1 
ATOM   95   O  "O4'" . G   A 1 5   ? -12.606 4.414   8.050   1.00 54.24  ? 5   G   C "O4'" 1 
ATOM   96   C  "C3'" . G   A 1 5   ? -12.551 6.048   6.389   1.00 55.85  ? 5   G   C "C3'" 1 
ATOM   97   O  "O3'" . G   A 1 5   ? -12.933 6.379   5.060   1.00 57.53  ? 5   G   C "O3'" 1 
ATOM   98   C  "C2'" . G   A 1 5   ? -13.609 6.450   7.403   1.00 54.13  ? 5   G   C "C2'" 1 
ATOM   99   O  "O2'" . G   A 1 5   ? -14.902 6.070   6.971   1.00 55.71  ? 5   G   C "O2'" 1 
ATOM   100  C  "C1'" . G   A 1 5   ? -13.209 5.581   8.597   1.00 51.08  ? 5   G   C "C1'" 1 
ATOM   101  N  N9    . G   A 1 5   ? -12.226 6.231   9.460   1.00 50.13  ? 5   G   C N9    1 
ATOM   102  C  C8    . G   A 1 5   ? -10.869 6.014   9.457   1.00 49.36  ? 5   G   C C8    1 
ATOM   103  N  N7    . G   A 1 5   ? -10.229 6.756   10.319  1.00 50.95  ? 5   G   C N7    1 
ATOM   104  C  C5    . G   A 1 5   ? -11.217 7.502   10.937  1.00 43.00  ? 5   G   C C5    1 
ATOM   105  C  C6    . G   A 1 5   ? -11.119 8.478   11.960  1.00 47.71  ? 5   G   C C6    1 
ATOM   106  O  O6    . G   A 1 5   ? -10.106 8.865   12.568  1.00 49.83  ? 5   G   C O6    1 
ATOM   107  N  N1    . G   A 1 5   ? -12.364 9.017   12.271  1.00 43.58  ? 5   G   C N1    1 
ATOM   108  C  C2    . G   A 1 5   ? -13.550 8.647   11.691  1.00 42.74  ? 5   G   C C2    1 
ATOM   109  N  N2    . G   A 1 5   ? -14.633 9.309   12.111  1.00 43.09  ? 5   G   C N2    1 
ATOM   110  N  N3    . G   A 1 5   ? -13.662 7.706   10.761  1.00 45.84  ? 5   G   C N3    1 
ATOM   111  C  C4    . G   A 1 5   ? -12.460 7.189   10.425  1.00 47.51  ? 5   G   C C4    1 
ATOM   112  P  P     . U   A 1 6   ? -12.504 7.800   4.442   1.00 63.72  ? 6   U   C P     1 
ATOM   113  O  OP1   . U   A 1 6   ? -13.120 7.872   3.091   1.00 64.90  ? 6   U   C OP1   1 
ATOM   114  O  OP2   . U   A 1 6   ? -11.034 8.006   4.585   1.00 58.32  ? 6   U   C OP2   1 
ATOM   115  O  "O5'" . U   A 1 6   ? -13.268 8.844   5.371   1.00 58.82  ? 6   U   C "O5'" 1 
ATOM   116  C  "C5'" . U   A 1 6   ? -14.687 8.920   5.347   1.00 54.26  ? 6   U   C "C5'" 1 
ATOM   117  C  "C4'" . U   A 1 6   ? -15.170 9.911   6.365   1.00 52.82  ? 6   U   C "C4'" 1 
ATOM   118  O  "O4'" . U   A 1 6   ? -14.657 9.504   7.659   1.00 57.46  ? 6   U   C "O4'" 1 
ATOM   119  C  "C3'" . U   A 1 6   ? -14.652 11.329  6.192   1.00 56.80  ? 6   U   C "C3'" 1 
ATOM   120  O  "O3'" . U   A 1 6   ? -15.451 12.074  5.271   1.00 59.59  ? 6   U   C "O3'" 1 
ATOM   121  C  "C2'" . U   A 1 6   ? -14.747 11.878  7.612   1.00 58.30  ? 6   U   C "C2'" 1 
ATOM   122  O  "O2'" . U   A 1 6   ? -16.050 12.286  7.972   1.00 58.81  ? 6   U   C "O2'" 1 
ATOM   123  C  "C1'" . U   A 1 6   ? -14.341 10.653  8.438   1.00 55.88  ? 6   U   C "C1'" 1 
ATOM   124  N  N1    . U   A 1 6   ? -12.904 10.620  8.756   1.00 47.26  ? 6   U   C N1    1 
ATOM   125  C  C2    . U   A 1 6   ? -12.429 11.520  9.693   1.00 46.03  ? 6   U   C C2    1 
ATOM   126  O  O2    . U   A 1 6   ? -13.151 12.304  10.295  1.00 46.85  ? 6   U   C O2    1 
ATOM   127  N  N3    . U   A 1 6   ? -11.077 11.468  9.905   1.00 43.21  ? 6   U   C N3    1 
ATOM   128  C  C4    . U   A 1 6   ? -10.173 10.613  9.305   1.00 46.18  ? 6   U   C C4    1 
ATOM   129  O  O4    . U   A 1 6   ? -8.978  10.680  9.610   1.00 41.22  ? 6   U   C O4    1 
ATOM   130  C  C5    . U   A 1 6   ? -10.750 9.700   8.368   1.00 44.12  ? 6   U   C C5    1 
ATOM   131  C  C6    . U   A 1 6   ? -12.061 9.737   8.132   1.00 43.76  ? 6   U   C C6    1 
ATOM   132  P  P     . C   A 1 7   ? -14.788 13.289  4.441   1.00 63.28  ? 7   C   C P     1 
ATOM   133  O  OP1   . C   A 1 7   ? -15.725 13.670  3.351   1.00 69.40  ? 7   C   C OP1   1 
ATOM   134  O  OP2   . C   A 1 7   ? -13.380 12.943  4.110   1.00 66.78  ? 7   C   C OP2   1 
ATOM   135  O  "O5'" . C   A 1 7   ? -14.750 14.494  5.475   1.00 57.79  ? 7   C   C "O5'" 1 
ATOM   136  C  "C5'" . C   A 1 7   ? -15.940 15.156  5.845   1.00 53.90  ? 7   C   C "C5'" 1 
ATOM   137  C  "C4'" . C   A 1 7   ? -15.637 16.229  6.848   1.00 57.25  ? 7   C   C "C4'" 1 
ATOM   138  O  "O4'" . C   A 1 7   ? -15.116 15.626  8.063   1.00 56.73  ? 7   C   C "O4'" 1 
ATOM   139  C  "C3'" . C   A 1 7   ? -14.544 17.203  6.455   1.00 63.36  ? 7   C   C "C3'" 1 
ATOM   140  O  "O3'" . C   A 1 7   ? -15.036 18.185  5.549   1.00 67.60  ? 7   C   C "O3'" 1 
ATOM   141  C  "C2'" . C   A 1 7   ? -14.168 17.784  7.813   1.00 65.22  ? 7   C   C "C2'" 1 
ATOM   142  O  "O2'" . C   A 1 7   ? -15.109 18.734  8.281   1.00 69.22  ? 7   C   C "O2'" 1 
ATOM   143  C  "C1'" . C   A 1 7   ? -14.223 16.531  8.693   1.00 56.60  ? 7   C   C "C1'" 1 
ATOM   144  N  N1    . C   A 1 7   ? -12.915 15.879  8.801   1.00 50.79  ? 7   C   C N1    1 
ATOM   145  C  C2    . C   A 1 7   ? -11.988 16.374  9.727   1.00 46.61  ? 7   C   C C2    1 
ATOM   146  O  O2    . C   A 1 7   ? -12.304 17.347  10.425  1.00 46.12  ? 7   C   C O2    1 
ATOM   147  N  N3    . C   A 1 7   ? -10.776 15.783  9.831   1.00 41.78  ? 7   C   C N3    1 
ATOM   148  C  C4    . C   A 1 7   ? -10.470 14.748  9.043   1.00 48.12  ? 7   C   C C4    1 
ATOM   149  N  N4    . C   A 1 7   ? -9.255  14.198  9.160   1.00 41.65  ? 7   C   C N4    1 
ATOM   150  C  C5    . C   A 1 7   ? -11.398 14.226  8.091   1.00 50.72  ? 7   C   C C5    1 
ATOM   151  C  C6    . C   A 1 7   ? -12.598 14.813  8.009   1.00 47.50  ? 7   C   C C6    1 
ATOM   152  P  P     . A   A 1 8   ? -14.034 18.866  4.490   1.00 68.81  ? 8   A   C P     1 
ATOM   153  O  OP1   . A   A 1 8   ? -14.841 19.604  3.517   1.00 64.65  ? 8   A   C OP1   1 
ATOM   154  O  OP2   . A   A 1 8   ? -13.095 17.860  3.998   1.00 66.33  ? 8   A   C OP2   1 
ATOM   155  O  "O5'" . A   A 1 8   ? -13.219 19.905  5.380   1.00 66.27  ? 8   A   C "O5'" 1 
ATOM   156  C  "C5'" . A   A 1 8   ? -13.898 20.909  6.118   1.00 58.73  ? 8   A   C "C5'" 1 
ATOM   157  C  "C4'" . A   A 1 8   ? -12.971 21.516  7.127   1.00 58.84  ? 8   A   C "C4'" 1 
ATOM   158  O  "O4'" . A   A 1 8   ? -12.610 20.510  8.105   1.00 56.79  ? 8   A   C "O4'" 1 
ATOM   159  C  "C3'" . A   A 1 8   ? -11.633 21.977  6.575   1.00 59.00  ? 8   A   C "C3'" 1 
ATOM   160  O  "O3'" . A   A 1 8   ? -11.740 23.274  6.007   1.00 63.40  ? 8   A   C "O3'" 1 
ATOM   161  C  "C2'" . A   A 1 8   ? -10.781 21.994  7.832   1.00 56.99  ? 8   A   C "C2'" 1 
ATOM   162  O  "O2'" . A   A 1 8   ? -11.050 23.136  8.614   1.00 55.89  ? 8   A   C "O2'" 1 
ATOM   163  C  "C1'" . A   A 1 8   ? -11.285 20.738  8.548   1.00 53.17  ? 8   A   C "C1'" 1 
ATOM   164  N  N9    . A   A 1 8   ? -10.487 19.564  8.213   1.00 43.52  ? 8   A   C N9    1 
ATOM   165  C  C8    . A   A 1 8   ? -10.804 18.510  7.386   1.00 46.42  ? 8   A   C C8    1 
ATOM   166  N  N7    . A   A 1 8   ? -9.847  17.615  7.279   1.00 43.85  ? 8   A   C N7    1 
ATOM   167  C  C5    . A   A 1 8   ? -8.836  18.114  8.095   1.00 44.38  ? 8   A   C C5    1 
ATOM   168  C  C6    . A   A 1 8   ? -7.550  17.639  8.418   1.00 39.81  ? 8   A   C C6    1 
ATOM   169  N  N6    . A   A 1 8   ? -7.025  16.520  7.931   1.00 37.51  ? 8   A   C N6    1 
ATOM   170  N  N1    . A   A 1 8   ? -6.808  18.373  9.268   1.00 42.33  ? 8   A   C N1    1 
ATOM   171  C  C2    . A   A 1 8   ? -7.320  19.511  9.753   1.00 42.06  ? 8   A   C C2    1 
ATOM   172  N  N3    . A   A 1 8   ? -8.505  20.065  9.524   1.00 41.93  ? 8   A   C N3    1 
ATOM   173  C  C4    . A   A 1 8   ? -9.223  19.309  8.679   1.00 41.53  ? 8   A   C C4    1 
ATOM   174  P  P     . U   A 1 9   ? -10.809 23.677  4.759   1.00 66.99  ? 9   U   C P     1 
ATOM   175  O  OP1   . U   A 1 9   ? -11.167 25.048  4.372   1.00 64.02  ? 9   U   C OP1   1 
ATOM   176  O  OP2   . U   A 1 9   ? -10.854 22.625  3.745   1.00 60.06  ? 9   U   C OP2   1 
ATOM   177  O  "O5'" . U   A 1 9   ? -9.335  23.689  5.359   1.00 65.56  ? 9   U   C "O5'" 1 
ATOM   178  C  "C5'" . U   A 1 9   ? -8.950  24.659  6.321   1.00 56.05  ? 9   U   C "C5'" 1 
ATOM   179  C  "C4'" . U   A 1 9   ? -7.566  24.364  6.833   1.00 57.23  ? 9   U   C "C4'" 1 
ATOM   180  O  "O4'" . U   A 1 9   ? -7.557  23.078  7.514   1.00 55.64  ? 9   U   C "O4'" 1 
ATOM   181  C  "C3'" . U   A 1 9   ? -6.488  24.196  5.779   1.00 57.86  ? 9   U   C "C3'" 1 
ATOM   182  O  "O3'" . U   A 1 9   ? -6.001  25.440  5.312   1.00 58.42  ? 9   U   C "O3'" 1 
ATOM   183  C  "C2'" . U   A 1 9   ? -5.420  23.461  6.570   1.00 59.88  ? 9   U   C "C2'" 1 
ATOM   184  O  "O2'" . U   A 1 9   ? -4.748  24.346  7.451   1.00 59.48  ? 9   U   C "O2'" 1 
ATOM   185  C  "C1'" . U   A 1 9   ? -6.278  22.473  7.365   1.00 54.24  ? 9   U   C "C1'" 1 
ATOM   186  N  N1    . U   A 1 9   ? -6.447  21.191  6.665   1.00 49.07  ? 9   U   C N1    1 
ATOM   187  C  C2    . U   A 1 9   ? -5.445  20.240  6.795   1.00 46.70  ? 9   U   C C2    1 
ATOM   188  O  O2    . U   A 1 9   ? -4.455  20.410  7.479   1.00 45.06  ? 9   U   C O2    1 
ATOM   189  N  N3    . U   A 1 9   ? -5.651  19.081  6.092   1.00 43.37  ? 9   U   C N3    1 
ATOM   190  C  C4    . U   A 1 9   ? -6.736  18.777  5.292   1.00 49.64  ? 9   U   C C4    1 
ATOM   191  O  O4    . U   A 1 9   ? -6.759  17.709  4.681   1.00 57.73  ? 9   U   C O4    1 
ATOM   192  C  C5    . U   A 1 9   ? -7.733  19.800  5.223   1.00 49.91  ? 9   U   C C5    1 
ATOM   193  C  C6    . U   A 1 9   ? -7.558  20.945  5.895   1.00 50.22  ? 9   U   C C6    1 
ATOM   194  P  P     . U   A 1 10  ? -5.261  25.510  3.891   1.00 64.85  ? 10  U   C P     1 
ATOM   195  O  OP1   . U   A 1 10  ? -5.095  26.943  3.553   1.00 66.82  ? 10  U   C OP1   1 
ATOM   196  O  OP2   . U   A 1 10  ? -5.937  24.601  2.935   1.00 66.67  ? 10  U   C OP2   1 
ATOM   197  O  "O5'" . U   A 1 10  ? -3.815  24.922  4.176   1.00 61.59  ? 10  U   C "O5'" 1 
ATOM   198  C  "C5'" . U   A 1 10  ? -2.907  25.634  4.999   1.00 63.75  ? 10  U   C "C5'" 1 
ATOM   199  C  "C4'" . U   A 1 10  ? -1.676  24.807  5.248   1.00 63.70  ? 10  U   C "C4'" 1 
ATOM   200  O  "O4'" . U   A 1 10  ? -2.058  23.569  5.900   1.00 60.20  ? 10  U   C "O4'" 1 
ATOM   201  C  "C3'" . U   A 1 10  ? -0.943  24.325  4.012   1.00 62.04  ? 10  U   C "C3'" 1 
ATOM   202  O  "O3'" . U   A 1 10  ? -0.104  25.340  3.487   1.00 59.76  ? 10  U   C "O3'" 1 
ATOM   203  C  "C2'" . U   A 1 10  ? -0.133  23.179  4.590   1.00 62.91  ? 10  U   C "C2'" 1 
ATOM   204  O  "O2'" . U   A 1 10  ? 0.939   23.651  5.383   1.00 65.82  ? 10  U   C "O2'" 1 
ATOM   205  C  "C1'" . U   A 1 10  ? -1.160  22.543  5.522   1.00 60.63  ? 10  U   C "C1'" 1 
ATOM   206  N  N1    . U   A 1 10  ? -1.918  21.439  4.912   1.00 58.42  ? 10  U   C N1    1 
ATOM   207  C  C2    . U   A 1 10  ? -1.315  20.190  4.907   1.00 57.43  ? 10  U   C C2    1 
ATOM   208  O  O2    . U   A 1 10  ? -0.201  19.995  5.355   1.00 54.02  ? 10  U   C O2    1 
ATOM   209  N  N3    . U   A 1 10  ? -2.066  19.178  4.363   1.00 52.49  ? 10  U   C N3    1 
ATOM   210  C  C4    . U   A 1 10  ? -3.329  19.277  3.837   1.00 52.02  ? 10  U   C C4    1 
ATOM   211  O  O4    . U   A 1 10  ? -3.906  18.251  3.467   1.00 46.90  ? 10  U   C O4    1 
ATOM   212  C  C5    . U   A 1 10  ? -3.882  20.604  3.857   1.00 50.02  ? 10  U   C C5    1 
ATOM   213  C  C6    . U   A 1 10  ? -3.173  21.616  4.380   1.00 49.07  ? 10  U   C C6    1 
ATOM   214  P  P     . C   A 1 11  ? 0.264   25.335  1.926   1.00 62.33  ? 11  C   C P     1 
ATOM   215  O  OP1   . C   A 1 11  ? 1.092   26.532  1.646   1.00 59.63  ? 11  C   C OP1   1 
ATOM   216  O  OP2   . C   A 1 11  ? -0.991  25.107  1.171   1.00 67.58  ? 11  C   C OP2   1 
ATOM   217  O  "O5'" . C   A 1 11  ? 1.172   24.044  1.730   1.00 61.96  ? 11  C   C "O5'" 1 
ATOM   218  C  "C5'" . C   A 1 11  ? 2.474   23.983  2.290   1.00 58.41  ? 11  C   C "C5'" 1 
ATOM   219  C  "C4'" . C   A 1 11  ? 3.118   22.649  1.988   1.00 61.93  ? 11  C   C "C4'" 1 
ATOM   220  O  "O4'" . C   A 1 11  ? 2.434   21.566  2.679   1.00 60.37  ? 11  C   C "O4'" 1 
ATOM   221  C  "C3'" . C   A 1 11  ? 3.084   22.179  0.547   1.00 60.70  ? 11  C   C "C3'" 1 
ATOM   222  O  "O3'" . C   A 1 11  ? 4.033   22.863  -0.249  1.00 66.49  ? 11  C   C "O3'" 1 
ATOM   223  C  "C2'" . C   A 1 11  ? 3.448   20.709  0.709   1.00 61.23  ? 11  C   C "C2'" 1 
ATOM   224  O  "O2'" . C   A 1 11  ? 4.838   20.509  0.917   1.00 62.25  ? 11  C   C "O2'" 1 
ATOM   225  C  "C1'" . C   A 1 11  ? 2.665   20.351  1.976   1.00 57.22  ? 11  C   C "C1'" 1 
ATOM   226  N  N1    . C   A 1 11  ? 1.374   19.718  1.658   1.00 51.88  ? 11  C   C N1    1 
ATOM   227  C  C2    . C   A 1 11  ? 1.341   18.328  1.496   1.00 51.16  ? 11  C   C C2    1 
ATOM   228  O  O2    . C   A 1 11  ? 2.389   17.683  1.656   1.00 50.97  ? 11  C   C O2    1 
ATOM   229  N  N3    . C   A 1 11  ? 0.174   17.724  1.173   1.00 50.32  ? 11  C   C N3    1 
ATOM   230  C  C4    . C   A 1 11  ? -0.936  18.454  1.026   1.00 51.78  ? 11  C   C C4    1 
ATOM   231  N  N4    . C   A 1 11  ? -2.066  17.810  0.720   1.00 52.60  ? 11  C   C N4    1 
ATOM   232  C  C5    . C   A 1 11  ? -0.934  19.874  1.190   1.00 43.81  ? 11  C   C C5    1 
ATOM   233  C  C6    . C   A 1 11  ? 0.232   20.459  1.505   1.00 47.57  ? 11  C   C C6    1 
ATOM   234  P  P     . G   A 1 12  ? 3.719   23.126  -1.798  1.00 66.29  ? 12  G   C P     1 
ATOM   235  O  OP1   . G   A 1 12  ? 4.925   23.797  -2.330  1.00 68.63  ? 12  G   C OP1   1 
ATOM   236  O  OP2   . G   A 1 12  ? 2.392   23.788  -1.919  1.00 70.96  ? 12  G   C OP2   1 
ATOM   237  O  "O5'" . G   A 1 12  ? 3.611   21.667  -2.433  1.00 63.06  ? 12  G   C "O5'" 1 
ATOM   238  C  "C5'" . G   A 1 12  ? 4.788   20.914  -2.691  1.00 62.94  ? 12  G   C "C5'" 1 
ATOM   239  C  "C4'" . G   A 1 12  ? 4.450   19.518  -3.167  1.00 62.55  ? 12  G   C "C4'" 1 
ATOM   240  O  "O4'" . G   A 1 12  ? 3.720   18.800  -2.137  1.00 63.30  ? 12  G   C "O4'" 1 
ATOM   241  C  "C3'" . G   A 1 12  ? 3.556   19.389  -4.385  1.00 63.54  ? 12  G   C "C3'" 1 
ATOM   242  O  "O3'" . G   A 1 12  ? 4.278   19.602  -5.588  1.00 66.24  ? 12  G   C "O3'" 1 
ATOM   243  C  "C2'" . G   A 1 12  ? 3.096   17.944  -4.257  1.00 60.57  ? 12  G   C "C2'" 1 
ATOM   244  O  "O2'" . G   A 1 12  ? 4.065   17.011  -4.682  1.00 59.74  ? 12  G   C "O2'" 1 
ATOM   245  C  "C1'" . G   A 1 12  ? 2.873   17.839  -2.746  1.00 58.25  ? 12  G   C "C1'" 1 
ATOM   246  N  N9    . G   A 1 12  ? 1.492   18.199  -2.463  1.00 52.41  ? 12  G   C N9    1 
ATOM   247  C  C8    . G   A 1 12  ? 1.004   19.429  -2.095  1.00 50.64  ? 12  G   C C8    1 
ATOM   248  N  N7    . G   A 1 12  ? -0.301  19.470  -2.061  1.00 51.93  ? 12  G   C N7    1 
ATOM   249  C  C5    . G   A 1 12  ? -0.691  18.180  -2.406  1.00 54.18  ? 12  G   C C5    1 
ATOM   250  C  C6    . G   A 1 12  ? -1.986  17.621  -2.582  1.00 51.04  ? 12  G   C C6    1 
ATOM   251  O  O6    . G   A 1 12  ? -3.085  18.184  -2.519  1.00 59.58  ? 12  G   C O6    1 
ATOM   252  N  N1    . G   A 1 12  ? -1.921  16.266  -2.886  1.00 46.47  ? 12  G   C N1    1 
ATOM   253  C  C2    . G   A 1 12  ? -0.762  15.543  -3.034  1.00 54.44  ? 12  G   C C2    1 
ATOM   254  N  N2    . G   A 1 12  ? -0.901  14.229  -3.304  1.00 56.60  ? 12  G   C N2    1 
ATOM   255  N  N3    . G   A 1 12  ? 0.448   16.062  -2.918  1.00 55.87  ? 12  G   C N3    1 
ATOM   256  C  C4    . G   A 1 12  ? 0.407   17.375  -2.604  1.00 53.30  ? 12  G   C C4    1 
ATOM   257  P  P     . C   A 1 13  ? 4.032   20.947  -6.435  1.00 75.58  ? 13  C   C P     1 
ATOM   258  O  OP1   . C   A 1 13  ? 5.329   21.244  -7.088  1.00 78.70  ? 13  C   C OP1   1 
ATOM   259  O  OP2   . C   A 1 13  ? 3.389   21.980  -5.572  1.00 70.12  ? 13  C   C OP2   1 
ATOM   260  O  "O5'" . C   A 1 13  ? 3.006   20.535  -7.584  1.00 71.79  ? 13  C   C "O5'" 1 
ATOM   261  C  "C5'" . C   A 1 13  ? 1.896   19.687  -7.317  1.00 70.25  ? 13  C   C "C5'" 1 
ATOM   262  C  "C4'" . C   A 1 13  ? 1.432   19.031  -8.592  1.00 64.32  ? 13  C   C "C4'" 1 
ATOM   263  O  "O4'" . C   A 1 13  ? 2.590   18.745  -9.409  1.00 65.20  ? 13  C   C "O4'" 1 
ATOM   264  C  "C3'" . C   A 1 13  ? 0.734   17.698  -8.386  1.00 69.28  ? 13  C   C "C3'" 1 
ATOM   265  O  "O3'" . C   A 1 13  ? -0.671  17.869  -8.242  1.00 74.25  ? 13  C   C "O3'" 1 
ATOM   266  C  "C2'" . C   A 1 13  ? 1.070   16.946  -9.662  1.00 67.08  ? 13  C   C "C2'" 1 
ATOM   267  O  "O2'" . C   A 1 13  ? 0.218   17.316  -10.720 1.00 70.18  ? 13  C   C "O2'" 1 
ATOM   268  C  "C1'" . C   A 1 13  ? 2.488   17.443  -9.945  1.00 65.70  ? 13  C   C "C1'" 1 
ATOM   269  N  N1    . C   A 1 13  ? 3.574   16.628  -9.366  1.00 68.57  ? 13  C   C N1    1 
ATOM   270  C  C2    . C   A 1 13  ? 3.777   15.328  -9.843  1.00 67.46  ? 13  C   C C2    1 
ATOM   271  O  O2    . C   A 1 13  ? 3.029   14.889  -10.728 1.00 70.92  ? 13  C   C O2    1 
ATOM   272  N  N3    . C   A 1 13  ? 4.787   14.588  -9.332  1.00 69.27  ? 13  C   C N3    1 
ATOM   273  C  C4    . C   A 1 13  ? 5.583   15.103  -8.390  1.00 69.66  ? 13  C   C C4    1 
ATOM   274  N  N4    . C   A 1 13  ? 6.584   14.344  -7.934  1.00 72.73  ? 13  C   C N4    1 
ATOM   275  C  C5    . C   A 1 13  ? 5.393   16.419  -7.879  1.00 66.14  ? 13  C   C C5    1 
ATOM   276  C  C6    . C   A 1 13  ? 4.385   17.138  -8.387  1.00 67.36  ? 13  C   C C6    1 
ATOM   277  P  P     . A   A 1 14  ? -1.391  17.408  -6.884  1.00 78.69  ? 14  A   C P     1 
ATOM   278  O  OP1   . A   A 1 14  ? -2.791  17.904  -6.901  1.00 78.86  ? 14  A   C OP1   1 
ATOM   279  O  OP2   . A   A 1 14  ? -0.482  17.817  -5.779  1.00 75.61  ? 14  A   C OP2   1 
ATOM   280  O  "O5'" . A   A 1 14  ? -1.415  15.813  -6.963  1.00 81.85  ? 14  A   C "O5'" 1 
ATOM   281  C  "C5'" . A   A 1 14  ? -2.255  15.129  -7.896  1.00 82.50  ? 14  A   C "C5'" 1 
ATOM   282  C  "C4'" . A   A 1 14  ? -1.769  13.706  -8.108  1.00 84.13  ? 14  A   C "C4'" 1 
ATOM   283  O  "O4'" . A   A 1 14  ? -0.389  13.737  -8.572  1.00 81.14  ? 14  A   C "O4'" 1 
ATOM   284  C  "C3'" . A   A 1 14  ? -1.756  12.805  -6.878  1.00 83.02  ? 14  A   C "C3'" 1 
ATOM   285  O  "O3'" . A   A 1 14  ? -3.027  12.168  -6.707  1.00 87.84  ? 14  A   C "O3'" 1 
ATOM   286  C  "C2'" . A   A 1 14  ? -0.655  11.807  -7.220  1.00 80.01  ? 14  A   C "C2'" 1 
ATOM   287  O  "O2'" . A   A 1 14  ? -1.089  10.780  -8.089  1.00 75.26  ? 14  A   C "O2'" 1 
ATOM   288  C  "C1'" . A   A 1 14  ? 0.347   12.697  -7.960  1.00 77.57  ? 14  A   C "C1'" 1 
ATOM   289  N  N9    . A   A 1 14  ? 1.369   13.322  -7.120  1.00 75.57  ? 14  A   C N9    1 
ATOM   290  C  C8    . A   A 1 14  ? 1.329   14.574  -6.554  1.00 74.16  ? 14  A   C C8    1 
ATOM   291  N  N7    . A   A 1 14  ? 2.428   14.904  -5.919  1.00 71.71  ? 14  A   C N7    1 
ATOM   292  C  C5    . A   A 1 14  ? 3.239   13.786  -6.058  1.00 69.81  ? 14  A   C C5    1 
ATOM   293  C  C6    . A   A 1 14  ? 4.545   13.510  -5.628  1.00 64.88  ? 14  A   C C6    1 
ATOM   294  N  N6    . A   A 1 14  ? 5.303   14.380  -4.962  1.00 66.61  ? 14  A   C N6    1 
ATOM   295  N  N1    . A   A 1 14  ? 5.058   12.300  -5.920  1.00 63.06  ? 14  A   C N1    1 
ATOM   296  C  C2    . A   A 1 14  ? 4.304   11.435  -6.608  1.00 71.19  ? 14  A   C C2    1 
ATOM   297  N  N3    . A   A 1 14  ? 3.068   11.581  -7.081  1.00 69.51  ? 14  A   C N3    1 
ATOM   298  C  C4    . A   A 1 14  ? 2.588   12.794  -6.772  1.00 72.62  ? 14  A   C C4    1 
ATOM   299  P  P     . A   A 1 15  ? -3.476  11.645  -5.249  1.00 94.05  ? 15  A   C P     1 
ATOM   300  O  OP1   . A   A 1 15  ? -4.787  10.950  -5.384  1.00 82.57  ? 15  A   C OP1   1 
ATOM   301  O  OP2   . A   A 1 15  ? -3.340  12.763  -4.268  1.00 91.23  ? 15  A   C OP2   1 
ATOM   302  O  "O5'" . A   A 1 15  ? -2.368  10.551  -4.903  1.00 91.42  ? 15  A   C "O5'" 1 
ATOM   303  C  "C5'" . A   A 1 15  ? -2.361  9.282   -5.555  1.00 89.14  ? 15  A   C "C5'" 1 
ATOM   304  C  "C4'" . A   A 1 15  ? -1.134  8.492   -5.157  1.00 85.55  ? 15  A   C "C4'" 1 
ATOM   305  O  "O4'" . A   A 1 15  ? 0.057   9.146   -5.678  1.00 83.64  ? 15  A   C "O4'" 1 
ATOM   306  C  "C3'" . A   A 1 15  ? -0.876  8.387   -3.663  1.00 85.14  ? 15  A   C "C3'" 1 
ATOM   307  O  "O3'" . A   A 1 15  ? -1.645  7.351   -3.063  1.00 87.42  ? 15  A   C "O3'" 1 
ATOM   308  C  "C2'" . A   A 1 15  ? 0.617   8.102   -3.637  1.00 83.77  ? 15  A   C "C2'" 1 
ATOM   309  O  "O2'" . A   A 1 15  ? 0.909   6.772   -4.005  1.00 81.84  ? 15  A   C "O2'" 1 
ATOM   310  C  "C1'" . A   A 1 15  ? 1.111   9.047   -4.733  1.00 80.14  ? 15  A   C "C1'" 1 
ATOM   311  N  N9    . A   A 1 15  ? 1.373   10.389  -4.212  1.00 76.05  ? 15  A   C N9    1 
ATOM   312  C  C8    . A   A 1 15  ? 0.538   11.478  -4.254  1.00 75.71  ? 15  A   C C8    1 
ATOM   313  N  N7    . A   A 1 15  ? 1.032   12.548  -3.680  1.00 71.93  ? 15  A   C N7    1 
ATOM   314  C  C5    . A   A 1 15  ? 2.279   12.139  -3.233  1.00 68.06  ? 15  A   C C5    1 
ATOM   315  C  C6    . A   A 1 15  ? 3.300   12.812  -2.542  1.00 62.57  ? 15  A   C C6    1 
ATOM   316  N  N6    . A   A 1 15  ? 3.213   14.083  -2.145  1.00 51.96  ? 15  A   C N6    1 
ATOM   317  N  N1    . A   A 1 15  ? 4.427   12.123  -2.265  1.00 61.48  ? 15  A   C N1    1 
ATOM   318  C  C2    . A   A 1 15  ? 4.504   10.839  -2.647  1.00 68.93  ? 15  A   C C2    1 
ATOM   319  N  N3    . A   A 1 15  ? 3.606   10.092  -3.290  1.00 67.58  ? 15  A   C N3    1 
ATOM   320  C  C4    . A   A 1 15  ? 2.505   10.811  -3.561  1.00 71.55  ? 15  A   C C4    1 
ATOM   321  P  P     . G   A 1 16  ? -2.569  7.686   -1.785  1.00 94.46  ? 16  G   C P     1 
ATOM   322  O  OP1   . G   A 1 16  ? -3.338  6.461   -1.445  1.00 97.62  ? 16  G   C OP1   1 
ATOM   323  O  OP2   . G   A 1 16  ? -3.294  8.955   -2.047  1.00 95.11  ? 16  G   C OP2   1 
ATOM   324  O  "O5'" . G   A 1 16  ? -1.537  7.969   -0.606  1.00 91.06  ? 16  G   C "O5'" 1 
ATOM   325  C  "C5'" . G   A 1 16  ? -0.433  7.100   -0.368  1.00 85.94  ? 16  G   C "C5'" 1 
ATOM   326  C  "C4'" . G   A 1 16  ? 0.730   7.885   0.188   1.00 80.79  ? 16  G   C "C4'" 1 
ATOM   327  O  "O4'" . G   A 1 16  ? 1.016   8.976   -0.735  1.00 80.97  ? 16  G   C "O4'" 1 
ATOM   328  C  "C3'" . G   A 1 16  ? 0.492   8.592   1.518   1.00 78.52  ? 16  G   C "C3'" 1 
ATOM   329  O  "O3'" . G   A 1 16  ? 0.683   7.726   2.641   1.00 74.97  ? 16  G   C "O3'" 1 
ATOM   330  C  "C2'" . G   A 1 16  ? 1.531   9.705   1.455   1.00 78.67  ? 16  G   C "C2'" 1 
ATOM   331  O  "O2'" . G   A 1 16  ? 2.849   9.257   1.699   1.00 76.33  ? 16  G   C "O2'" 1 
ATOM   332  C  "C1'" . G   A 1 16  ? 1.407   10.133  -0.007  1.00 77.02  ? 16  G   C "C1'" 1 
ATOM   333  N  N9    . G   A 1 16  ? 0.378   11.157  -0.168  1.00 69.80  ? 16  G   C N9    1 
ATOM   334  C  C8    . G   A 1 16  ? -0.905  10.992  -0.634  1.00 70.92  ? 16  G   C C8    1 
ATOM   335  N  N7    . G   A 1 16  ? -1.605  12.095  -0.609  1.00 70.48  ? 16  G   C N7    1 
ATOM   336  C  C5    . G   A 1 16  ? -0.729  13.046  -0.104  1.00 64.01  ? 16  G   C C5    1 
ATOM   337  C  C6    . G   A 1 16  ? -0.921  14.427  0.161   1.00 58.27  ? 16  G   C C6    1 
ATOM   338  O  O6    . G   A 1 16  ? -1.947  15.108  0.017   1.00 53.44  ? 16  G   C O6    1 
ATOM   339  N  N1    . G   A 1 16  ? 0.240   15.017  0.650   1.00 58.23  ? 16  G   C N1    1 
ATOM   340  C  C2    . G   A 1 16  ? 1.432   14.364  0.869   1.00 59.06  ? 16  G   C C2    1 
ATOM   341  N  N2    . G   A 1 16  ? 2.442   15.108  1.341   1.00 46.06  ? 16  G   C N2    1 
ATOM   342  N  N3    . G   A 1 16  ? 1.618   13.075  0.640   1.00 61.91  ? 16  G   C N3    1 
ATOM   343  C  C4    . G   A 1 16  ? 0.505   12.484  0.157   1.00 66.19  ? 16  G   C C4    1 
ATOM   344  P  P     . A   A 1 17  ? -0.060  8.046   4.042   1.00 72.62  ? 17  A   C P     1 
ATOM   345  O  OP1   . A   A 1 17  ? 0.186   6.900   4.956   1.00 67.37  ? 17  A   C OP1   1 
ATOM   346  O  OP2   . A   A 1 17  ? -1.463  8.496   3.793   1.00 71.56  ? 17  A   C OP2   1 
ATOM   347  O  "O5'" . A   A 1 17  ? 0.756   9.286   4.616   1.00 69.41  ? 17  A   C "O5'" 1 
ATOM   348  C  "C5'" . A   A 1 17  ? 2.157   9.186   4.843   1.00 60.64  ? 17  A   C "C5'" 1 
ATOM   349  C  "C4'" . A   A 1 17  ? 2.744   10.548  5.106   1.00 54.04  ? 17  A   C "C4'" 1 
ATOM   350  O  "O4'" . A   A 1 17  ? 2.476   11.404  3.964   1.00 56.26  ? 17  A   C "O4'" 1 
ATOM   351  C  "C3'" . A   A 1 17  ? 2.131   11.332  6.247   1.00 57.00  ? 17  A   C "C3'" 1 
ATOM   352  O  "O3'" . A   A 1 17  ? 2.604   10.897  7.514   1.00 62.00  ? 17  A   C "O3'" 1 
ATOM   353  C  "C2'" . A   A 1 17  ? 2.589   12.741  5.906   1.00 58.89  ? 17  A   C "C2'" 1 
ATOM   354  O  "O2'" . A   A 1 17  ? 3.962   12.961  6.176   1.00 63.41  ? 17  A   C "O2'" 1 
ATOM   355  C  "C1'" . A   A 1 17  ? 2.358   12.753  4.395   1.00 54.21  ? 17  A   C "C1'" 1 
ATOM   356  N  N9    . A   A 1 17  ? 1.013   13.241  4.081   1.00 50.05  ? 17  A   C N9    1 
ATOM   357  C  C8    . A   A 1 17  ? -0.106  12.537  3.700   1.00 44.76  ? 17  A   C C8    1 
ATOM   358  N  N7    . A   A 1 17  ? -1.180  13.281  3.564   1.00 37.74  ? 17  A   C N7    1 
ATOM   359  C  C5    . A   A 1 17  ? -0.738  14.562  3.860   1.00 39.44  ? 17  A   C C5    1 
ATOM   360  C  C6    . A   A 1 17  ? -1.397  15.802  3.919   1.00 38.62  ? 17  A   C C6    1 
ATOM   361  N  N6    . A   A 1 17  ? -2.702  15.968  3.681   1.00 35.17  ? 17  A   C N6    1 
ATOM   362  N  N1    . A   A 1 17  ? -0.660  16.884  4.250   1.00 40.42  ? 17  A   C N1    1 
ATOM   363  C  C2    . A   A 1 17  ? 0.645   16.726  4.515   1.00 39.51  ? 17  A   C C2    1 
ATOM   364  N  N3    . A   A 1 17  ? 1.376   15.617  4.503   1.00 46.15  ? 17  A   C N3    1 
ATOM   365  C  C4    . A   A 1 17  ? 0.616   14.556  4.163   1.00 47.37  ? 17  A   C C4    1 
ATOM   366  P  P     . G   A 1 18  ? 1.678   11.088  8.816   1.00 61.27  ? 18  G   C P     1 
ATOM   367  O  OP1   . G   A 1 18  ? 2.241   10.236  9.897   1.00 64.77  ? 18  G   C OP1   1 
ATOM   368  O  OP2   . G   A 1 18  ? 0.244   10.938  8.432   1.00 60.02  ? 18  G   C OP2   1 
ATOM   369  O  "O5'" . G   A 1 18  ? 1.897   12.616  9.206   1.00 61.64  ? 18  G   C "O5'" 1 
ATOM   370  C  "C5'" . G   A 1 18  ? 3.200   13.158  9.329   1.00 50.93  ? 18  G   C "C5'" 1 
ATOM   371  C  "C4'" . G   A 1 18  ? 3.121   14.650  9.493   1.00 51.98  ? 18  G   C "C4'" 1 
ATOM   372  O  "O4'" . G   A 1 18  ? 2.589   15.245  8.281   1.00 54.32  ? 18  G   C "O4'" 1 
ATOM   373  C  "C3'" . G   A 1 18  ? 2.160   15.148  10.552  1.00 49.96  ? 18  G   C "C3'" 1 
ATOM   374  O  "O3'" . G   A 1 18  ? 2.723   15.081  11.847  1.00 55.80  ? 18  G   C "O3'" 1 
ATOM   375  C  "C2'" . G   A 1 18  ? 1.980   16.594  10.126  1.00 50.65  ? 18  G   C "C2'" 1 
ATOM   376  O  "O2'" . G   A 1 18  ? 3.111   17.372  10.458  1.00 53.20  ? 18  G   C "O2'" 1 
ATOM   377  C  "C1'" . G   A 1 18  ? 1.897   16.444  8.609   1.00 48.47  ? 18  G   C "C1'" 1 
ATOM   378  N  N9    . G   A 1 18  ? 0.519   16.329  8.141   1.00 47.46  ? 18  G   C N9    1 
ATOM   379  C  C8    . G   A 1 18  ? -0.110  15.192  7.696   1.00 43.82  ? 18  G   C C8    1 
ATOM   380  N  N7    . G   A 1 18  ? -1.346  15.399  7.341   1.00 39.35  ? 18  G   C N7    1 
ATOM   381  C  C5    . G   A 1 18  ? -1.545  16.754  7.555   1.00 38.21  ? 18  G   C C5    1 
ATOM   382  C  C6    . G   A 1 18  ? -2.694  17.565  7.320   1.00 41.06  ? 18  G   C C6    1 
ATOM   383  O  O6    . G   A 1 18  ? -3.786  17.238  6.829   1.00 41.57  ? 18  G   C O6    1 
ATOM   384  N  N1    . G   A 1 18  ? -2.472  18.882  7.699   1.00 37.18  ? 18  G   C N1    1 
ATOM   385  C  C2    . G   A 1 18  ? -1.297  19.370  8.206   1.00 40.83  ? 18  G   C C2    1 
ATOM   386  N  N2    . G   A 1 18  ? -1.296  20.673  8.514   1.00 37.60  ? 18  G   C N2    1 
ATOM   387  N  N3    . G   A 1 18  ? -0.205  18.632  8.400   1.00 38.68  ? 18  G   C N3    1 
ATOM   388  C  C4    . G   A 1 18  ? -0.406  17.341  8.059   1.00 38.73  ? 18  G   C C4    1 
ATOM   389  P  P     . U   A 1 19  ? 1.775   14.785  13.110  1.00 58.05  ? 19  U   C P     1 
ATOM   390  O  OP1   . U   A 1 19  ? 2.642   14.743  14.316  1.00 52.46  ? 19  U   C OP1   1 
ATOM   391  O  OP2   . U   A 1 19  ? 0.918   13.620  12.773  1.00 59.95  ? 19  U   C OP2   1 
ATOM   392  O  "O5'" . U   A 1 19  ? 0.846   16.072  13.228  1.00 57.61  ? 19  U   C "O5'" 1 
ATOM   393  C  "C5'" . U   A 1 19  ? 1.366   17.293  13.735  1.00 55.55  ? 19  U   C "C5'" 1 
ATOM   394  C  "C4'" . U   A 1 19  ? 0.291   18.350  13.760  1.00 52.67  ? 19  U   C "C4'" 1 
ATOM   395  O  "O4'" . U   A 1 19  ? -0.159  18.614  12.405  1.00 50.77  ? 19  U   C "O4'" 1 
ATOM   396  C  "C3'" . U   A 1 19  ? -0.994  17.992  14.479  1.00 56.10  ? 19  U   C "C3'" 1 
ATOM   397  O  "O3'" . U   A 1 19  ? -0.871  18.104  15.895  1.00 60.76  ? 19  U   C "O3'" 1 
ATOM   398  C  "C2'" . U   A 1 19  ? -1.949  19.024  13.895  1.00 55.76  ? 19  U   C "C2'" 1 
ATOM   399  O  "O2'" . U   A 1 19  ? -1.772  20.312  14.459  1.00 58.67  ? 19  U   C "O2'" 1 
ATOM   400  C  "C1'" . U   A 1 19  ? -1.515  19.025  12.426  1.00 50.11  ? 19  U   C "C1'" 1 
ATOM   401  N  N1    . U   A 1 19  ? -2.289  18.065  11.632  1.00 45.69  ? 19  U   C N1    1 
ATOM   402  C  C2    . U   A 1 19  ? -3.505  18.483  11.111  1.00 46.19  ? 19  U   C C2    1 
ATOM   403  O  O2    . U   A 1 19  ? -3.945  19.599  11.268  1.00 47.51  ? 19  U   C O2    1 
ATOM   404  N  N3    . U   A 1 19  ? -4.188  17.531  10.400  1.00 50.18  ? 19  U   C N3    1 
ATOM   405  C  C4    . U   A 1 19  ? -3.789  16.225  10.163  1.00 55.00  ? 19  U   C C4    1 
ATOM   406  O  O4    . U   A 1 19  ? -4.536  15.467  9.530   1.00 56.59  ? 19  U   C O4    1 
ATOM   407  C  C5    . U   A 1 19  ? -2.509  15.875  10.729  1.00 48.16  ? 19  U   C C5    1 
ATOM   408  C  C6    . U   A 1 19  ? -1.824  16.787  11.424  1.00 41.91  ? 19  U   C C6    1 
ATOM   409  P  P     . G   A 1 20  ? -1.841  17.243  16.853  1.00 58.10  ? 20  G   C P     1 
ATOM   410  O  OP1   . G   A 1 20  ? -1.403  17.498  18.247  1.00 61.09  ? 20  G   C OP1   1 
ATOM   411  O  OP2   . G   A 1 20  ? -1.944  15.844  16.359  1.00 50.38  ? 20  G   C OP2   1 
ATOM   412  O  "O5'" . G   A 1 20  ? -3.256  17.944  16.661  1.00 60.67  ? 20  G   C "O5'" 1 
ATOM   413  C  "C5'" . G   A 1 20  ? -3.489  19.250  17.180  1.00 58.83  ? 20  G   C "C5'" 1 
ATOM   414  C  "C4'" . G   A 1 20  ? -4.864  19.738  16.790  1.00 57.52  ? 20  G   C "C4'" 1 
ATOM   415  O  "O4'" . G   A 1 20  ? -4.940  19.913  15.344  1.00 52.68  ? 20  G   C "O4'" 1 
ATOM   416  C  "C3'" . G   A 1 20  ? -6.023  18.797  17.079  1.00 59.08  ? 20  G   C "C3'" 1 
ATOM   417  O  "O3'" . G   A 1 20  ? -6.423  18.790  18.449  1.00 60.33  ? 20  G   C "O3'" 1 
ATOM   418  C  "C2'" . G   A 1 20  ? -7.092  19.376  16.165  1.00 57.38  ? 20  G   C "C2'" 1 
ATOM   419  O  "O2'" . G   A 1 20  ? -7.639  20.585  16.661  1.00 59.08  ? 20  G   C "O2'" 1 
ATOM   420  C  "C1'" . G   A 1 20  ? -6.270  19.656  14.906  1.00 51.16  ? 20  G   C "C1'" 1 
ATOM   421  N  N9    . G   A 1 20  ? -6.265  18.482  14.039  1.00 46.12  ? 20  G   C N9    1 
ATOM   422  C  C8    . G   A 1 20  ? -5.254  17.568  13.878  1.00 48.41  ? 20  G   C C8    1 
ATOM   423  N  N7    . G   A 1 20  ? -5.566  16.598  13.057  1.00 48.97  ? 20  G   C N7    1 
ATOM   424  C  C5    . G   A 1 20  ? -6.858  16.896  12.647  1.00 43.97  ? 20  G   C C5    1 
ATOM   425  C  C6    . G   A 1 20  ? -7.726  16.204  11.759  1.00 42.56  ? 20  G   C C6    1 
ATOM   426  O  O6    . G   A 1 20  ? -7.508  15.166  11.117  1.00 42.97  ? 20  G   C O6    1 
ATOM   427  N  N1    . G   A 1 20  ? -8.954  16.847  11.642  1.00 42.40  ? 20  G   C N1    1 
ATOM   428  C  C2    . G   A 1 20  ? -9.299  18.012  12.274  1.00 43.70  ? 20  G   C C2    1 
ATOM   429  N  N2    . G   A 1 20  ? -10.538 18.475  12.033  1.00 42.18  ? 20  G   C N2    1 
ATOM   430  N  N3    . G   A 1 20  ? -8.493  18.675  13.088  1.00 45.68  ? 20  G   C N3    1 
ATOM   431  C  C4    . G   A 1 20  ? -7.301  18.060  13.234  1.00 43.72  ? 20  G   C C4    1 
ATOM   432  P  P     . G   A 1 21  ? -7.217  17.522  19.038  1.00 60.77  ? 21  G   C P     1 
ATOM   433  O  OP1   . G   A 1 21  ? -7.414  17.771  20.484  1.00 57.90  ? 21  G   C OP1   1 
ATOM   434  O  OP2   . G   A 1 21  ? -6.567  16.259  18.583  1.00 61.03  ? 21  G   C OP2   1 
ATOM   435  O  "O5'" . G   A 1 21  ? -8.631  17.588  18.317  1.00 60.03  ? 21  G   C "O5'" 1 
ATOM   436  C  "C5'" . G   A 1 21  ? -9.535  18.638  18.595  1.00 55.46  ? 21  G   C "C5'" 1 
ATOM   437  C  "C4'" . G   A 1 21  ? -10.833 18.403  17.871  1.00 55.50  ? 21  G   C "C4'" 1 
ATOM   438  O  "O4'" . G   A 1 21  ? -10.600 18.459  16.435  1.00 54.31  ? 21  G   C "O4'" 1 
ATOM   439  C  "C3'" . G   A 1 21  ? -11.467 17.034  18.037  1.00 52.84  ? 21  G   C "C3'" 1 
ATOM   440  O  "O3'" . G   A 1 21  ? -12.144 16.861  19.270  1.00 53.98  ? 21  G   C "O3'" 1 
ATOM   441  C  "C2'" . G   A 1 21  ? -12.428 17.020  16.862  1.00 52.58  ? 21  G   C "C2'" 1 
ATOM   442  O  "O2'" . G   A 1 21  ? -13.560 17.835  17.099  1.00 49.94  ? 21  G   C "O2'" 1 
ATOM   443  C  "C1'" . G   A 1 21  ? -11.549 17.634  15.774  1.00 49.68  ? 21  G   C "C1'" 1 
ATOM   444  N  N9    . G   A 1 21  ? -10.831 16.591  15.055  1.00 49.25  ? 21  G   C N9    1 
ATOM   445  C  C8    . G   A 1 21  ? -9.518  16.219  15.202  1.00 45.85  ? 21  G   C C8    1 
ATOM   446  N  N7    . G   A 1 21  ? -9.186  15.212  14.437  1.00 48.08  ? 21  G   C N7    1 
ATOM   447  C  C5    . G   A 1 21  ? -10.349 14.911  13.740  1.00 47.18  ? 21  G   C C5    1 
ATOM   448  C  C6    . G   A 1 21  ? -10.614 13.901  12.773  1.00 49.81  ? 21  G   C C6    1 
ATOM   449  O  O6    . G   A 1 21  ? -9.841  13.038  12.320  1.00 51.96  ? 21  G   C O6    1 
ATOM   450  N  N1    . G   A 1 21  ? -11.935 13.952  12.331  1.00 50.44  ? 21  G   C N1    1 
ATOM   451  C  C2    . G   A 1 21  ? -12.877 14.855  12.763  1.00 50.16  ? 21  G   C C2    1 
ATOM   452  N  N2    . G   A 1 21  ? -14.104 14.745  12.224  1.00 47.13  ? 21  G   C N2    1 
ATOM   453  N  N3    . G   A 1 21  ? -12.639 15.797  13.659  1.00 46.80  ? 21  G   C N3    1 
ATOM   454  C  C4    . G   A 1 21  ? -11.368 15.763  14.103  1.00 48.36  ? 21  G   C C4    1 
ATOM   455  P  P     . C   A 1 22  ? -12.298 15.379  19.876  1.00 54.94  ? 22  C   C P     1 
ATOM   456  O  OP1   . C   A 1 22  ? -12.837 15.498  21.257  1.00 56.84  ? 22  C   C OP1   1 
ATOM   457  O  OP2   . C   A 1 22  ? -11.025 14.646  19.640  1.00 57.50  ? 22  C   C OP2   1 
ATOM   458  O  "O5'" . C   A 1 22  ? -13.401 14.694  18.956  1.00 54.81  ? 22  C   C "O5'" 1 
ATOM   459  C  "C5'" . C   A 1 22  ? -14.686 15.275  18.794  1.00 48.52  ? 22  C   C "C5'" 1 
ATOM   460  C  "C4'" . C   A 1 22  ? -15.468 14.524  17.743  1.00 48.58  ? 22  C   C "C4'" 1 
ATOM   461  O  "O4'" . C   A 1 22  ? -14.798 14.615  16.454  1.00 45.95  ? 22  C   C "O4'" 1 
ATOM   462  C  "C3'" . C   A 1 22  ? -15.567 13.028  17.952  1.00 49.92  ? 22  C   C "C3'" 1 
ATOM   463  O  "O3'" . C   A 1 22  ? -16.528 12.677  18.930  1.00 51.95  ? 22  C   C "O3'" 1 
ATOM   464  C  "C2'" . C   A 1 22  ? -15.946 12.543  16.557  1.00 49.32  ? 22  C   C "C2'" 1 
ATOM   465  O  "O2'" . C   A 1 22  ? -17.309 12.710  16.248  1.00 56.78  ? 22  C   C "O2'" 1 
ATOM   466  C  "C1'" . C   A 1 22  ? -15.083 13.453  15.683  1.00 42.92  ? 22  C   C "C1'" 1 
ATOM   467  N  N1    . C   A 1 22  ? -13.820 12.781  15.351  1.00 42.30  ? 22  C   C N1    1 
ATOM   468  C  C2    . C   A 1 22  ? -13.833 11.808  14.362  1.00 45.27  ? 22  C   C C2    1 
ATOM   469  O  O2    . C   A 1 22  ? -14.895 11.567  13.781  1.00 49.65  ? 22  C   C O2    1 
ATOM   470  N  N3    . C   A 1 22  ? -12.694 11.151  14.063  1.00 45.11  ? 22  C   C N3    1 
ATOM   471  C  C4    . C   A 1 22  ? -11.570 11.440  14.712  1.00 40.29  ? 22  C   C C4    1 
ATOM   472  N  N4    . C   A 1 22  ? -10.471 10.769  14.375  1.00 43.70  ? 22  C   C N4    1 
ATOM   473  C  C5    . C   A 1 22  ? -11.524 12.431  15.727  1.00 36.57  ? 22  C   C C5    1 
ATOM   474  C  C6    . C   A 1 22  ? -12.660 13.077  16.008  1.00 43.12  ? 22  C   C C6    1 
ATOM   475  P  P     . C   A 1 23  ? -16.463 11.223  19.601  1.00 52.25  ? 23  C   C P     1 
ATOM   476  O  OP1   . C   A 1 23  ? -17.546 11.149  20.612  1.00 51.59  ? 23  C   C OP1   1 
ATOM   477  O  OP2   . C   A 1 23  ? -15.062 10.967  20.003  1.00 55.75  ? 23  C   C OP2   1 
ATOM   478  O  "O5'" . C   A 1 23  ? -16.796 10.232  18.395  1.00 54.73  ? 23  C   C "O5'" 1 
ATOM   479  C  "C5'" . C   A 1 23  ? -18.122 10.098  17.900  1.00 46.52  ? 23  C   C "C5'" 1 
ATOM   480  C  "C4'" . C   A 1 23  ? -18.215 8.918   16.964  1.00 44.50  ? 23  C   C "C4'" 1 
ATOM   481  O  "O4'" . C   A 1 23  ? -17.363 9.159   15.815  1.00 46.11  ? 23  C   C "O4'" 1 
ATOM   482  C  "C3'" . C   A 1 23  ? -17.721 7.582   17.498  1.00 44.16  ? 23  C   C "C3'" 1 
ATOM   483  O  "O3'" . C   A 1 23  ? -18.694 6.899   18.267  1.00 46.15  ? 23  C   C "O3'" 1 
ATOM   484  C  "C2'" . C   A 1 23  ? -17.448 6.826   16.210  1.00 48.22  ? 23  C   C "C2'" 1 
ATOM   485  O  "O2'" . C   A 1 23  ? -18.638 6.348   15.616  1.00 43.58  ? 23  C   C "O2'" 1 
ATOM   486  C  "C1'" . C   A 1 23  ? -16.819 7.926   15.359  1.00 46.69  ? 23  C   C "C1'" 1 
ATOM   487  N  N1    . C   A 1 23  ? -15.363 7.988   15.532  1.00 43.20  ? 23  C   C N1    1 
ATOM   488  C  C2    . C   A 1 23  ? -14.548 7.148   14.758  1.00 46.32  ? 23  C   C C2    1 
ATOM   489  O  O2    . C   A 1 23  ? -15.085 6.348   13.973  1.00 47.00  ? 23  C   C O2    1 
ATOM   490  N  N3    . C   A 1 23  ? -13.195 7.238   14.882  1.00 44.25  ? 23  C   C N3    1 
ATOM   491  C  C4    . C   A 1 23  ? -12.664 8.124   15.731  1.00 43.64  ? 23  C   C C4    1 
ATOM   492  N  N4    . C   A 1 23  ? -11.337 8.212   15.792  1.00 38.97  ? 23  C   C N4    1 
ATOM   493  C  C5    . C   A 1 23  ? -13.476 8.969   16.550  1.00 44.75  ? 23  C   C C5    1 
ATOM   494  C  C6    . C   A 1 23  ? -14.805 8.865   16.422  1.00 45.57  ? 23  C   C C6    1 
ATOM   495  P  P     . U   A 1 24  ? -18.224 5.942   19.475  1.00 48.21  ? 24  U   C P     1 
ATOM   496  O  OP1   . U   A 1 24  ? -19.455 5.505   20.183  1.00 38.02  ? 24  U   C OP1   1 
ATOM   497  O  OP2   . U   A 1 24  ? -17.148 6.638   20.216  1.00 46.72  ? 24  U   C OP2   1 
ATOM   498  O  "O5'" . U   A 1 24  ? -17.565 4.680   18.767  1.00 46.33  ? 24  U   C "O5'" 1 
ATOM   499  C  "C5'" . U   A 1 24  ? -18.288 3.929   17.805  1.00 47.92  ? 24  U   C "C5'" 1 
ATOM   500  C  "C4'" . U   A 1 24  ? -17.363 3.000   17.053  1.00 46.52  ? 24  U   C "C4'" 1 
ATOM   501  O  "O4'" . U   A 1 24  ? -16.418 3.761   16.244  1.00 42.28  ? 24  U   C "O4'" 1 
ATOM   502  C  "C3'" . U   A 1 24  ? -16.451 2.130   17.897  1.00 47.50  ? 24  U   C "C3'" 1 
ATOM   503  O  "O3'" . U   A 1 24  ? -17.130 1.028   18.479  1.00 45.49  ? 24  U   C "O3'" 1 
ATOM   504  C  "C2'" . U   A 1 24  ? -15.424 1.705   16.857  1.00 44.33  ? 24  U   C "C2'" 1 
ATOM   505  O  "O2'" . U   A 1 24  ? -15.959 0.762   15.963  1.00 41.69  ? 24  U   C "O2'" 1 
ATOM   506  C  "C1'" . U   A 1 24  ? -15.212 3.016   16.103  1.00 43.73  ? 24  U   C "C1'" 1 
ATOM   507  N  N1    . U   A 1 24  ? -14.100 3.796   16.666  1.00 42.63  ? 24  U   C N1    1 
ATOM   508  C  C2    . U   A 1 24  ? -12.816 3.427   16.314  1.00 44.75  ? 24  U   C C2    1 
ATOM   509  O  O2    . U   A 1 24  ? -12.579 2.476   15.606  1.00 49.11  ? 24  U   C O2    1 
ATOM   510  N  N3    . U   A 1 24  ? -11.817 4.212   16.832  1.00 45.68  ? 24  U   C N3    1 
ATOM   511  C  C4    . U   A 1 24  ? -11.969 5.301   17.660  1.00 48.85  ? 24  U   C C4    1 
ATOM   512  O  O4    . U   A 1 24  ? -10.975 5.949   18.002  1.00 51.39  ? 24  U   C O4    1 
ATOM   513  C  C5    . U   A 1 24  ? -13.325 5.603   18.001  1.00 46.20  ? 24  U   C C5    1 
ATOM   514  C  C6    . U   A 1 24  ? -14.319 4.858   17.504  1.00 42.88  ? 24  U   C C6    1 
ATOM   515  P  P     . U   A 1 25  ? -16.377 0.125   19.576  1.00 48.52  ? 25  U   C P     1 
ATOM   516  O  OP1   . U   A 1 25  ? -17.311 -0.946  19.984  1.00 50.45  ? 25  U   C OP1   1 
ATOM   517  O  OP2   . U   A 1 25  ? -15.773 0.994   20.606  1.00 53.27  ? 25  U   C OP2   1 
ATOM   518  O  "O5'" . U   A 1 25  ? -15.180 -0.542  18.764  1.00 47.81  ? 25  U   C "O5'" 1 
ATOM   519  C  "C5'" . U   A 1 25  ? -15.429 -1.572  17.818  1.00 44.84  ? 25  U   C "C5'" 1 
ATOM   520  C  "C4'" . U   A 1 25  ? -14.133 -2.223  17.405  1.00 44.77  ? 25  U   C "C4'" 1 
ATOM   521  O  "O4'" . U   A 1 25  ? -13.294 -1.241  16.747  1.00 48.21  ? 25  U   C "O4'" 1 
ATOM   522  C  "C3'" . U   A 1 25  ? -13.243 -2.719  18.528  1.00 48.01  ? 25  U   C "C3'" 1 
ATOM   523  O  "O3'" . U   A 1 25  ? -13.628 -3.983  19.014  1.00 48.55  ? 25  U   C "O3'" 1 
ATOM   524  C  "C2'" . U   A 1 25  ? -11.906 -2.814  17.829  1.00 47.74  ? 25  U   C "C2'" 1 
ATOM   525  O  "O2'" . U   A 1 25  ? -11.878 -3.921  16.955  1.00 52.42  ? 25  U   C "O2'" 1 
ATOM   526  C  "C1'" . U   A 1 25  ? -11.928 -1.522  17.019  1.00 46.77  ? 25  U   C "C1'" 1 
ATOM   527  N  N1    . U   A 1 25  ? -11.366 -0.404  17.788  1.00 43.38  ? 25  U   C N1    1 
ATOM   528  C  C2    . U   A 1 25  ? -9.996  -0.369  17.941  1.00 41.10  ? 25  U   C C2    1 
ATOM   529  O  O2    . U   A 1 25  ? -9.269  -1.244  17.525  1.00 46.73  ? 25  U   C O2    1 
ATOM   530  N  N3    . U   A 1 25  ? -9.510  0.717   18.614  1.00 40.98  ? 25  U   C N3    1 
ATOM   531  C  C4    . U   A 1 25  ? -10.238 1.745   19.159  1.00 44.42  ? 25  U   C C4    1 
ATOM   532  O  O4    . U   A 1 25  ? -9.644  2.696   19.681  1.00 45.82  ? 25  U   C O4    1 
ATOM   533  C  C5    . U   A 1 25  ? -11.660 1.619   18.995  1.00 47.16  ? 25  U   C C5    1 
ATOM   534  C  C6    . U   A 1 25  ? -12.160 0.572   18.327  1.00 41.54  ? 25  U   C C6    1 
ATOM   535  P  P     . G   A 1 26  ? -13.319 -4.348  20.537  1.00 47.96  ? 26  G   C P     1 
ATOM   536  O  OP1   . G   A 1 26  ? -14.076 -5.568  20.898  1.00 42.52  ? 26  G   C OP1   1 
ATOM   537  O  OP2   . G   A 1 26  ? -13.535 -3.099  21.301  1.00 42.46  ? 26  G   C OP2   1 
ATOM   538  O  "O5'" . G   A 1 26  ? -11.771 -4.700  20.512  1.00 40.56  ? 26  G   C "O5'" 1 
ATOM   539  C  "C5'" . G   A 1 26  ? -11.286 -5.740  19.682  1.00 41.96  ? 26  G   C "C5'" 1 
ATOM   540  C  "C4'" . G   A 1 26  ? -9.773  -5.720  19.637  1.00 47.64  ? 26  G   C "C4'" 1 
ATOM   541  O  "O4'" . G   A 1 26  ? -9.300  -4.450  19.088  1.00 47.67  ? 26  G   C "O4'" 1 
ATOM   542  C  "C3'" . G   A 1 26  ? -9.072  -5.794  20.985  1.00 47.15  ? 26  G   C "C3'" 1 
ATOM   543  O  "O3'" . G   A 1 26  ? -8.998  -7.121  21.481  1.00 43.71  ? 26  G   C "O3'" 1 
ATOM   544  C  "C2'" . G   A 1 26  ? -7.697  -5.252  20.640  1.00 44.48  ? 26  G   C "C2'" 1 
ATOM   545  O  "O2'" . G   A 1 26  ? -6.931  -6.210  19.946  1.00 42.73  ? 26  G   C "O2'" 1 
ATOM   546  C  "C1'" . G   A 1 26  ? -8.062  -4.102  19.702  1.00 40.39  ? 26  G   C "C1'" 1 
ATOM   547  N  N9    . G   A 1 26  ? -8.227  -2.845  20.425  1.00 34.76  ? 26  G   C N9    1 
ATOM   548  C  C8    . G   A 1 26  ? -9.400  -2.211  20.753  1.00 36.48  ? 26  G   C C8    1 
ATOM   549  N  N7    . G   A 1 26  ? -9.215  -1.085  21.387  1.00 38.11  ? 26  G   C N7    1 
ATOM   550  C  C5    . G   A 1 26  ? -7.832  -0.971  21.482  1.00 40.23  ? 26  G   C C5    1 
ATOM   551  C  C6    . G   A 1 26  ? -7.010  0.059   22.067  1.00 37.66  ? 26  G   C C6    1 
ATOM   552  O  O6    . G   A 1 26  ? -7.356  1.109   22.638  1.00 36.15  ? 26  G   C O6    1 
ATOM   553  N  N1    . G   A 1 26  ? -5.661  -0.242  21.947  1.00 35.85  ? 26  G   C N1    1 
ATOM   554  C  C2    . G   A 1 26  ? -5.154  -1.379  21.364  1.00 41.50  ? 26  G   C C2    1 
ATOM   555  N  N2    . G   A 1 26  ? -3.820  -1.503  21.371  1.00 36.94  ? 26  G   C N2    1 
ATOM   556  N  N3    . G   A 1 26  ? -5.899  -2.332  20.818  1.00 40.17  ? 26  G   C N3    1 
ATOM   557  C  C4    . G   A 1 26  ? -7.215  -2.060  20.907  1.00 34.95  ? 26  G   C C4    1 
ATOM   558  P  P     . C   A 1 27  ? -8.974  -7.366  23.071  1.00 48.53  ? 27  C   C P     1 
ATOM   559  O  OP1   . C   A 1 27  ? -9.112  -8.840  23.250  1.00 44.56  ? 27  C   C OP1   1 
ATOM   560  O  OP2   . C   A 1 27  ? -9.923  -6.455  23.759  1.00 36.67  ? 27  C   C OP2   1 
ATOM   561  O  "O5'" . C   A 1 27  ? -7.508  -6.903  23.492  1.00 44.30  ? 27  C   C "O5'" 1 
ATOM   562  C  "C5'" . C   A 1 27  ? -6.361  -7.613  23.033  1.00 45.42  ? 27  C   C "C5'" 1 
ATOM   563  C  "C4'" . C   A 1 27  ? -5.110  -6.890  23.454  1.00 43.54  ? 27  C   C "C4'" 1 
ATOM   564  O  "O4'" . C   A 1 27  ? -5.150  -5.560  22.884  1.00 44.38  ? 27  C   C "O4'" 1 
ATOM   565  C  "C3'" . C   A 1 27  ? -4.989  -6.633  24.946  1.00 47.28  ? 27  C   C "C3'" 1 
ATOM   566  O  "O3'" . C   A 1 27  ? -4.449  -7.746  25.652  1.00 45.46  ? 27  C   C "O3'" 1 
ATOM   567  C  "C2'" . C   A 1 27  ? -4.074  -5.419  24.992  1.00 42.47  ? 27  C   C "C2'" 1 
ATOM   568  O  "O2'" . C   A 1 27  ? -2.712  -5.720  24.827  1.00 40.29  ? 27  C   C "O2'" 1 
ATOM   569  C  "C1'" . C   A 1 27  ? -4.568  -4.636  23.781  1.00 41.18  ? 27  C   C "C1'" 1 
ATOM   570  N  N1    . C   A 1 27  ? -5.583  -3.652  24.157  1.00 41.16  ? 27  C   C N1    1 
ATOM   571  C  C2    . C   A 1 27  ? -5.154  -2.437  24.691  1.00 41.31  ? 27  C   C C2    1 
ATOM   572  O  O2    . C   A 1 27  ? -3.938  -2.255  24.860  1.00 43.61  ? 27  C   C O2    1 
ATOM   573  N  N3    . C   A 1 27  ? -6.067  -1.501  25.020  1.00 34.84  ? 27  C   C N3    1 
ATOM   574  C  C4    . C   A 1 27  ? -7.362  -1.754  24.859  1.00 33.89  ? 27  C   C C4    1 
ATOM   575  N  N4    . C   A 1 27  ? -8.218  -0.809  25.208  1.00 25.08  ? 27  C   C N4    1 
ATOM   576  C  C5    . C   A 1 27  ? -7.832  -2.993  24.333  1.00 35.24  ? 27  C   C C5    1 
ATOM   577  C  C6    . C   A 1 27  ? -6.914  -3.906  23.993  1.00 36.25  ? 27  C   C C6    1 
ATOM   578  P  P     . G   A 1 28  ? -4.901  -8.007  27.170  1.00 51.78  ? 28  G   C P     1 
ATOM   579  O  OP1   . G   A 1 28  ? -4.376  -9.335  27.579  1.00 52.85  ? 28  G   C OP1   1 
ATOM   580  O  OP2   . G   A 1 28  ? -6.359  -7.728  27.279  1.00 48.70  ? 28  G   C OP2   1 
ATOM   581  O  "O5'" . G   A 1 28  ? -4.125  -6.886  27.996  1.00 47.36  ? 28  G   C "O5'" 1 
ATOM   582  C  "C5'" . G   A 1 28  ? -2.707  -6.868  28.048  1.00 43.62  ? 28  G   C "C5'" 1 
ATOM   583  C  "C4'" . G   A 1 28  ? -2.234  -5.598  28.706  1.00 48.43  ? 28  G   C "C4'" 1 
ATOM   584  O  "O4'" . G   A 1 28  ? -2.652  -4.459  27.908  1.00 48.90  ? 28  G   C "O4'" 1 
ATOM   585  C  "C3'" . G   A 1 28  ? -2.810  -5.291  30.076  1.00 51.41  ? 28  G   C "C3'" 1 
ATOM   586  O  "O3'" . G   A 1 28  ? -2.212  -6.004  31.160  1.00 59.56  ? 28  G   C "O3'" 1 
ATOM   587  C  "C2'" . G   A 1 28  ? -2.555  -3.799  30.180  1.00 53.69  ? 28  G   C "C2'" 1 
ATOM   588  O  "O2'" . G   A 1 28  ? -1.192  -3.522  30.445  1.00 60.45  ? 28  G   C "O2'" 1 
ATOM   589  C  "C1'" . G   A 1 28  ? -2.888  -3.346  28.758  1.00 49.42  ? 28  G   C "C1'" 1 
ATOM   590  N  N9    . G   A 1 28  ? -4.280  -2.927  28.609  1.00 47.69  ? 28  G   C N9    1 
ATOM   591  C  C8    . G   A 1 28  ? -5.327  -3.670  28.120  1.00 46.53  ? 28  G   C C8    1 
ATOM   592  N  N7    . G   A 1 28  ? -6.460  -3.021  28.124  1.00 47.07  ? 28  G   C N7    1 
ATOM   593  C  C5    . G   A 1 28  ? -6.140  -1.775  28.642  1.00 41.70  ? 28  G   C C5    1 
ATOM   594  C  C6    . G   A 1 28  ? -6.951  -0.646  28.876  1.00 40.58  ? 28  G   C C6    1 
ATOM   595  O  O6    . G   A 1 28  ? -8.154  -0.502  28.666  1.00 41.71  ? 28  G   C O6    1 
ATOM   596  N  N1    . G   A 1 28  ? -6.224  0.400   29.416  1.00 40.49  ? 28  G   C N1    1 
ATOM   597  C  C2    . G   A 1 28  ? -4.890  0.371   29.696  1.00 41.72  ? 28  G   C C2    1 
ATOM   598  N  N2    . G   A 1 28  ? -4.392  1.477   30.254  1.00 41.47  ? 28  G   C N2    1 
ATOM   599  N  N3    . G   A 1 28  ? -4.112  -0.664  29.459  1.00 41.08  ? 28  G   C N3    1 
ATOM   600  C  C4    . G   A 1 28  ? -4.799  -1.700  28.943  1.00 44.05  ? 28  G   C C4    1 
ATOM   601  O  OP3   . C   B 1 1   ? -3.229  -6.336  33.532  1.00 61.21  ? 1   C   D OP3   1 
ATOM   602  P  P     . C   B 1 1   ? -1.980  -5.894  34.275  1.00 57.19  ? 1   C   D P     1 
ATOM   603  O  OP1   . C   B 1 1   ? -2.156  -5.925  35.781  1.00 54.67  ? 1   C   D OP1   1 
ATOM   604  O  OP2   . C   B 1 1   ? -0.704  -6.588  33.813  1.00 53.68  ? 1   C   D OP2   1 
ATOM   605  O  "O5'" . C   B 1 1   ? -1.794  -4.327  33.876  1.00 54.93  ? 1   C   D "O5'" 1 
ATOM   606  C  "C5'" . C   B 1 1   ? -0.632  -3.597  34.302  1.00 52.78  ? 1   C   D "C5'" 1 
ATOM   607  C  "C4'" . C   B 1 1   ? -1.042  -2.266  34.868  1.00 50.03  ? 1   C   D "C4'" 1 
ATOM   608  O  "O4'" . C   B 1 1   ? -1.716  -1.491  33.842  1.00 51.52  ? 1   C   D "O4'" 1 
ATOM   609  C  "C3'" . C   B 1 1   ? -2.050  -2.343  35.997  1.00 50.70  ? 1   C   D "C3'" 1 
ATOM   610  O  "O3'" . C   B 1 1   ? -1.395  -2.590  37.242  1.00 53.28  ? 1   C   D "O3'" 1 
ATOM   611  C  "C2'" . C   B 1 1   ? -2.700  -0.965  35.935  1.00 46.80  ? 1   C   D "C2'" 1 
ATOM   612  O  "O2'" . C   B 1 1   ? -1.879  0.018   36.525  1.00 47.82  ? 1   C   D "O2'" 1 
ATOM   613  C  "C1'" . C   B 1 1   ? -2.751  -0.718  34.428  1.00 44.23  ? 1   C   D "C1'" 1 
ATOM   614  N  N1    . C   B 1 1   ? -4.025  -1.068  33.767  1.00 41.59  ? 1   C   D N1    1 
ATOM   615  C  C2    . C   B 1 1   ? -5.059  -0.123  33.740  1.00 43.93  ? 1   C   D C2    1 
ATOM   616  O  O2    . C   B 1 1   ? -4.887  0.975   34.291  1.00 41.55  ? 1   C   D O2    1 
ATOM   617  N  N3    . C   B 1 1   ? -6.221  -0.431  33.109  1.00 41.85  ? 1   C   D N3    1 
ATOM   618  C  C4    . C   B 1 1   ? -6.369  -1.626  32.524  1.00 40.29  ? 1   C   D C4    1 
ATOM   619  N  N4    . C   B 1 1   ? -7.527  -1.884  31.901  1.00 35.57  ? 1   C   D N4    1 
ATOM   620  C  C5    . C   B 1 1   ? -5.338  -2.606  32.548  1.00 32.66  ? 1   C   D C5    1 
ATOM   621  C  C6    . C   B 1 1   ? -4.195  -2.288  33.174  1.00 37.31  ? 1   C   D C6    1 
ATOM   622  P  P     . A   B 1 2   ? -2.236  -3.179  38.476  1.00 60.10  ? 2   A   D P     1 
ATOM   623  O  OP1   . A   B 1 2   ? -1.312  -3.596  39.563  1.00 60.50  ? 2   A   D OP1   1 
ATOM   624  O  OP2   . A   B 1 2   ? -3.199  -4.162  37.909  1.00 57.66  ? 2   A   D OP2   1 
ATOM   625  O  "O5'" . A   B 1 2   ? -3.050  -1.913  38.998  1.00 58.73  ? 2   A   D "O5'" 1 
ATOM   626  C  "C5'" . A   B 1 2   ? -4.410  -2.026  39.397  1.00 50.40  ? 2   A   D "C5'" 1 
ATOM   627  C  "C4'" . A   B 1 2   ? -5.036  -0.659  39.476  1.00 45.31  ? 2   A   D "C4'" 1 
ATOM   628  O  "O4'" . A   B 1 2   ? -5.110  -0.086  38.138  1.00 48.95  ? 2   A   D "O4'" 1 
ATOM   629  C  "C3'" . A   B 1 2   ? -6.470  -0.647  39.951  1.00 46.73  ? 2   A   D "C3'" 1 
ATOM   630  O  "O3'" . A   B 1 2   ? -6.550  -0.683  41.370  1.00 42.27  ? 2   A   D "O3'" 1 
ATOM   631  C  "C2'" . A   B 1 2   ? -6.966  0.655   39.358  1.00 43.53  ? 2   A   D "C2'" 1 
ATOM   632  O  "O2'" . A   B 1 2   ? -6.424  1.747   40.060  1.00 53.08  ? 2   A   D "O2'" 1 
ATOM   633  C  "C1'" . A   B 1 2   ? -6.341  0.592   37.968  1.00 41.52  ? 2   A   D "C1'" 1 
ATOM   634  N  N9    . A   B 1 2   ? -7.144  -0.192  37.028  1.00 44.73  ? 2   A   D N9    1 
ATOM   635  C  C8    . A   B 1 2   ? -6.811  -1.416  36.509  1.00 41.62  ? 2   A   D C8    1 
ATOM   636  N  N7    . A   B 1 2   ? -7.720  -1.920  35.715  1.00 39.75  ? 2   A   D N7    1 
ATOM   637  C  C5    . A   B 1 2   ? -8.720  -0.962  35.704  1.00 41.46  ? 2   A   D C5    1 
ATOM   638  C  C6    . A   B 1 2   ? -9.960  -0.909  35.052  1.00 42.19  ? 2   A   D C6    1 
ATOM   639  N  N6    . A   B 1 2   ? -10.407 -1.879  34.247  1.00 33.03  ? 2   A   D N6    1 
ATOM   640  N  N1    . A   B 1 2   ? -10.730 0.185   35.249  1.00 42.33  ? 2   A   D N1    1 
ATOM   641  C  C2    . A   B 1 2   ? -10.265 1.151   36.044  1.00 43.88  ? 2   A   D C2    1 
ATOM   642  N  N3    . A   B 1 2   ? -9.109  1.217   36.710  1.00 44.42  ? 2   A   D N3    1 
ATOM   643  C  C4    . A   B 1 2   ? -8.376  0.114   36.498  1.00 40.66  ? 2   A   D C4    1 
ATOM   644  P  P     . A   B 1 3   ? -7.738  -1.510  42.064  1.00 45.21  ? 3   A   D P     1 
ATOM   645  O  OP1   . A   B 1 3   ? -7.525  -1.492  43.532  1.00 45.94  ? 3   A   D OP1   1 
ATOM   646  O  OP2   . A   B 1 3   ? -7.903  -2.809  41.364  1.00 43.69  ? 3   A   D OP2   1 
ATOM   647  O  "O5'" . A   B 1 3   ? -9.031  -0.645  41.756  1.00 43.10  ? 3   A   D "O5'" 1 
ATOM   648  C  "C5'" . A   B 1 3   ? -9.169  0.653   42.300  1.00 44.68  ? 3   A   D "C5'" 1 
ATOM   649  C  "C4'" . A   B 1 3   ? -10.485 1.248   41.882  1.00 46.43  ? 3   A   D "C4'" 1 
ATOM   650  O  "O4'" . A   B 1 3   ? -10.498 1.409   40.440  1.00 44.27  ? 3   A   D "O4'" 1 
ATOM   651  C  "C3'" . A   B 1 3   ? -11.715 0.402   42.156  1.00 42.75  ? 3   A   D "C3'" 1 
ATOM   652  O  "O3'" . A   B 1 3   ? -12.129 0.535   43.512  1.00 45.28  ? 3   A   D "O3'" 1 
ATOM   653  C  "C2'" . A   B 1 3   ? -12.695 1.027   41.176  1.00 44.87  ? 3   A   D "C2'" 1 
ATOM   654  O  "O2'" . A   B 1 3   ? -13.060 2.330   41.560  1.00 42.74  ? 3   A   D "O2'" 1 
ATOM   655  C  "C1'" . A   B 1 3   ? -11.806 1.179   39.948  1.00 43.17  ? 3   A   D "C1'" 1 
ATOM   656  N  N9    . A   B 1 3   ? -11.778 -0.029  39.123  1.00 45.16  ? 3   A   D N9    1 
ATOM   657  C  C8    . A   B 1 3   ? -10.782 -0.971  39.040  1.00 40.51  ? 3   A   D C8    1 
ATOM   658  N  N7    . A   B 1 3   ? -11.042 -1.938  38.203  1.00 38.84  ? 3   A   D N7    1 
ATOM   659  C  C5    . A   B 1 3   ? -12.299 -1.620  37.706  1.00 43.24  ? 3   A   D C5    1 
ATOM   660  C  C6    . A   B 1 3   ? -13.140 -2.260  36.789  1.00 40.33  ? 3   A   D C6    1 
ATOM   661  N  N6    . A   B 1 3   ? -12.829 -3.398  36.173  1.00 37.44  ? 3   A   D N6    1 
ATOM   662  N  N1    . A   B 1 3   ? -14.329 -1.684  36.522  1.00 36.95  ? 3   A   D N1    1 
ATOM   663  C  C2    . A   B 1 3   ? -14.642 -0.549  37.139  1.00 38.14  ? 3   A   D C2    1 
ATOM   664  N  N3    . A   B 1 3   ? -13.939 0.151   38.017  1.00 43.31  ? 3   A   D N3    1 
ATOM   665  C  C4    . A   B 1 3   ? -12.761 -0.446  38.262  1.00 41.81  ? 3   A   D C4    1 
ATOM   666  P  P     . G   B 1 4   ? -12.689 -0.745  44.312  1.00 45.39  ? 4   G   D P     1 
ATOM   667  O  OP1   . G   B 1 4   ? -12.706 -0.426  45.759  1.00 47.81  ? 4   G   D OP1   1 
ATOM   668  O  OP2   . G   B 1 4   ? -11.988 -1.957  43.839  1.00 50.12  ? 4   G   D OP2   1 
ATOM   669  O  "O5'" . G   B 1 4   ? -14.208 -0.844  43.858  1.00 49.13  ? 4   G   D "O5'" 1 
ATOM   670  C  "C5'" . G   B 1 4   ? -15.094 0.224   44.125  1.00 45.14  ? 4   G   D "C5'" 1 
ATOM   671  C  "C4'" . G   B 1 4   ? -16.342 0.080   43.305  1.00 48.72  ? 4   G   D "C4'" 1 
ATOM   672  O  "O4'" . G   B 1 4   ? -16.016 0.149   41.890  1.00 48.15  ? 4   G   D "O4'" 1 
ATOM   673  C  "C3'" . G   B 1 4   ? -17.089 -1.237  43.411  1.00 48.07  ? 4   G   D "C3'" 1 
ATOM   674  O  "O3'" . G   B 1 4   ? -17.852 -1.299  44.611  1.00 51.76  ? 4   G   D "O3'" 1 
ATOM   675  C  "C2'" . G   B 1 4   ? -17.976 -1.137  42.181  1.00 48.89  ? 4   G   D "C2'" 1 
ATOM   676  O  "O2'" . G   B 1 4   ? -19.002 -0.182  42.378  1.00 50.07  ? 4   G   D "O2'" 1 
ATOM   677  C  "C1'" . G   B 1 4   ? -16.984 -0.586  41.156  1.00 48.98  ? 4   G   D "C1'" 1 
ATOM   678  N  N9    . G   B 1 4   ? -16.300 -1.651  40.433  1.00 47.54  ? 4   G   D N9    1 
ATOM   679  C  C8    . G   B 1 4   ? -15.026 -2.116  40.647  1.00 44.93  ? 4   G   D C8    1 
ATOM   680  N  N7    . G   B 1 4   ? -14.700 -3.096  39.847  1.00 45.69  ? 4   G   D N7    1 
ATOM   681  C  C5    . G   B 1 4   ? -15.829 -3.288  39.058  1.00 45.70  ? 4   G   D C5    1 
ATOM   682  C  C6    . G   B 1 4   ? -16.085 -4.227  38.016  1.00 45.15  ? 4   G   D C6    1 
ATOM   683  O  O6    . G   B 1 4   ? -15.338 -5.108  37.561  1.00 44.58  ? 4   G   D O6    1 
ATOM   684  N  N1    . G   B 1 4   ? -17.363 -4.070  37.495  1.00 41.93  ? 4   G   D N1    1 
ATOM   685  C  C2    . G   B 1 4   ? -18.276 -3.136  37.909  1.00 43.14  ? 4   G   D C2    1 
ATOM   686  N  N2    . G   B 1 4   ? -19.461 -3.136  37.267  1.00 40.43  ? 4   G   D N2    1 
ATOM   687  N  N3    . G   B 1 4   ? -18.053 -2.265  38.875  1.00 43.63  ? 4   G   D N3    1 
ATOM   688  C  C4    . G   B 1 4   ? -16.821 -2.398  39.402  1.00 44.44  ? 4   G   D C4    1 
ATOM   689  P  P     . G   B 1 5   ? -18.166 -2.724  45.295  1.00 51.50  ? 5   G   D P     1 
ATOM   690  O  OP1   . G   B 1 5   ? -18.742 -2.418  46.629  1.00 49.34  ? 5   G   D OP1   1 
ATOM   691  O  OP2   . G   B 1 5   ? -16.981 -3.616  45.200  1.00 53.10  ? 5   G   D OP2   1 
ATOM   692  O  "O5'" . G   B 1 5   ? -19.318 -3.345  44.380  1.00 54.78  ? 5   G   D "O5'" 1 
ATOM   693  C  "C5'" . G   B 1 5   ? -20.607 -2.739  44.327  1.00 50.83  ? 5   G   D "C5'" 1 
ATOM   694  C  "C4'" . G   B 1 5   ? -21.475 -3.440  43.320  1.00 53.95  ? 5   G   D "C4'" 1 
ATOM   695  O  "O4'" . G   B 1 5   ? -20.913 -3.279  41.991  1.00 54.60  ? 5   G   D "O4'" 1 
ATOM   696  C  "C3'" . G   B 1 5   ? -21.585 -4.945  43.477  1.00 53.57  ? 5   G   D "C3'" 1 
ATOM   697  O  "O3'" . G   B 1 5   ? -22.546 -5.275  44.467  1.00 54.52  ? 5   G   D "O3'" 1 
ATOM   698  C  "C2'" . G   B 1 5   ? -22.048 -5.353  42.087  1.00 55.01  ? 5   G   D "C2'" 1 
ATOM   699  O  "O2'" . G   B 1 5   ? -23.417 -5.035  41.887  1.00 53.53  ? 5   G   D "O2'" 1 
ATOM   700  C  "C1'" . G   B 1 5   ? -21.174 -4.445  41.219  1.00 52.26  ? 5   G   D "C1'" 1 
ATOM   701  N  N9    . G   B 1 5   ? -19.893 -5.053  40.878  1.00 48.63  ? 5   G   D N9    1 
ATOM   702  C  C8    . G   B 1 5   ? -18.691 -4.826  41.496  1.00 46.87  ? 5   G   D C8    1 
ATOM   703  N  N7    . G   B 1 5   ? -17.714 -5.525  40.987  1.00 47.26  ? 5   G   D N7    1 
ATOM   704  C  C5    . G   B 1 5   ? -18.304 -6.257  39.971  1.00 41.30  ? 5   G   D C5    1 
ATOM   705  C  C6    . G   B 1 5   ? -17.749 -7.210  39.086  1.00 44.63  ? 5   G   D C6    1 
ATOM   706  O  O6    . G   B 1 5   ? -16.581 -7.609  39.006  1.00 48.29  ? 5   G   D O6    1 
ATOM   707  N  N1    . G   B 1 5   ? -18.706 -7.730  38.233  1.00 42.83  ? 5   G   D N1    1 
ATOM   708  C  C2    . G   B 1 5   ? -20.026 -7.391  38.231  1.00 40.69  ? 5   G   D C2    1 
ATOM   709  N  N2    . G   B 1 5   ? -20.787 -8.056  37.368  1.00 39.09  ? 5   G   D N2    1 
ATOM   710  N  N3    . G   B 1 5   ? -20.560 -6.485  39.032  1.00 46.22  ? 5   G   D N3    1 
ATOM   711  C  C4    . G   B 1 5   ? -19.648 -5.971  39.881  1.00 46.92  ? 5   G   D C4    1 
ATOM   712  P  P     . U   B 1 6   ? -22.485 -6.706  45.195  1.00 54.19  ? 6   U   D P     1 
ATOM   713  O  OP1   . U   B 1 6   ? -23.655 -6.757  46.094  1.00 55.54  ? 6   U   D OP1   1 
ATOM   714  O  OP2   . U   B 1 6   ? -21.129 -6.928  45.741  1.00 54.66  ? 6   U   D OP2   1 
ATOM   715  O  "O5'" . U   B 1 6   ? -22.739 -7.747  44.021  1.00 55.17  ? 6   U   D "O5'" 1 
ATOM   716  C  "C5'" . U   B 1 6   ? -23.998 -7.798  43.372  1.00 50.91  ? 6   U   D "C5'" 1 
ATOM   717  C  "C4'" . U   B 1 6   ? -23.946 -8.771  42.231  1.00 49.94  ? 6   U   D "C4'" 1 
ATOM   718  O  "O4'" . U   B 1 6   ? -22.889 -8.356  41.337  1.00 50.66  ? 6   U   D "O4'" 1 
ATOM   719  C  "C3'" . U   B 1 6   ? -23.576 -10.192 42.607  1.00 53.13  ? 6   U   D "C3'" 1 
ATOM   720  O  "O3'" . U   B 1 6   ? -24.715 -10.930 43.028  1.00 53.88  ? 6   U   D "O3'" 1 
ATOM   721  C  "C2'" . U   B 1 6   ? -22.995 -10.728 41.307  1.00 56.14  ? 6   U   D "C2'" 1 
ATOM   722  O  "O2'" . U   B 1 6   ? -23.980 -11.145 40.381  1.00 62.97  ? 6   U   D "O2'" 1 
ATOM   723  C  "C1'" . U   B 1 6   ? -22.262 -9.496  40.777  1.00 51.66  ? 6   U   D "C1'" 1 
ATOM   724  N  N1    . U   B 1 6   ? -20.847 -9.458  41.156  1.00 46.88  ? 6   U   D N1    1 
ATOM   725  C  C2    . U   B 1 6   ? -19.991 -10.308 40.505  1.00 45.98  ? 6   U   D C2    1 
ATOM   726  O  O2    . U   B 1 6   ? -20.366 -11.106 39.662  1.00 47.14  ? 6   U   D O2    1 
ATOM   727  N  N3    . U   B 1 6   ? -18.676 -10.194 40.877  1.00 45.31  ? 6   U   D N3    1 
ATOM   728  C  C4    . U   B 1 6   ? -18.150 -9.337  41.821  1.00 44.50  ? 6   U   D C4    1 
ATOM   729  O  O4    . U   B 1 6   ? -16.939 -9.363  42.053  1.00 42.91  ? 6   U   D O4    1 
ATOM   730  C  C5    . U   B 1 6   ? -19.106 -8.499  42.463  1.00 42.60  ? 6   U   D C5    1 
ATOM   731  C  C6    . U   B 1 6   ? -20.392 -8.589  42.121  1.00 46.02  ? 6   U   D C6    1 
ATOM   732  P  P     . C   B 1 7   ? -24.531 -12.174 44.031  1.00 57.48  ? 7   C   D P     1 
ATOM   733  O  OP1   . C   B 1 7   ? -25.883 -12.567 44.485  1.00 65.30  ? 7   C   D OP1   1 
ATOM   734  O  OP2   . C   B 1 7   ? -23.492 -11.851 45.040  1.00 66.98  ? 7   C   D OP2   1 
ATOM   735  O  "O5'" . C   B 1 7   ? -23.953 -13.333 43.106  1.00 55.36  ? 7   C   D "O5'" 1 
ATOM   736  C  "C5'" . C   B 1 7   ? -24.808 -14.045 42.231  1.00 53.89  ? 7   C   D "C5'" 1 
ATOM   737  C  "C4'" . C   B 1 7   ? -24.035 -15.098 41.491  1.00 57.27  ? 7   C   D "C4'" 1 
ATOM   738  O  "O4'" . C   B 1 7   ? -23.016 -14.461 40.684  1.00 56.45  ? 7   C   D "O4'" 1 
ATOM   739  C  "C3'" . C   B 1 7   ? -23.236 -16.075 42.335  1.00 60.67  ? 7   C   D "C3'" 1 
ATOM   740  O  "O3'" . C   B 1 7   ? -24.054 -17.106 42.871  1.00 63.54  ? 7   C   D "O3'" 1 
ATOM   741  C  "C2'" . C   B 1 7   ? -22.262 -16.620 41.303  1.00 63.62  ? 7   C   D "C2'" 1 
ATOM   742  O  "O2'" . C   B 1 7   ? -22.858 -17.579 40.448  1.00 64.47  ? 7   C   D "O2'" 1 
ATOM   743  C  "C1'" . C   B 1 7   ? -21.922 -15.349 40.520  1.00 55.43  ? 7   C   D "C1'" 1 
ATOM   744  N  N1    . C   B 1 7   ? -20.714 -14.699 41.041  1.00 48.84  ? 7   C   D N1    1 
ATOM   745  C  C2    . C   B 1 7   ? -19.484 -15.142 40.590  1.00 48.27  ? 7   C   D C2    1 
ATOM   746  O  O2    . C   B 1 7   ? -19.454 -16.054 39.754  1.00 51.24  ? 7   C   D O2    1 
ATOM   747  N  N3    . C   B 1 7   ? -18.352 -14.573 41.070  1.00 43.65  ? 7   C   D N3    1 
ATOM   748  C  C4    . C   B 1 7   ? -18.427 -13.588 41.966  1.00 48.65  ? 7   C   D C4    1 
ATOM   749  N  N4    . C   B 1 7   ? -17.281 -13.047 42.397  1.00 43.08  ? 7   C   D N4    1 
ATOM   750  C  C5    . C   B 1 7   ? -19.679 -13.108 42.450  1.00 47.61  ? 7   C   D C5    1 
ATOM   751  C  C6    . C   B 1 7   ? -20.790 -13.687 41.959  1.00 51.18  ? 7   C   D C6    1 
ATOM   752  P  P     . A   B 1 8   ? -23.652 -17.796 44.267  1.00 66.21  ? 8   A   D P     1 
ATOM   753  O  OP1   . A   B 1 8   ? -24.784 -18.595 44.721  1.00 68.15  ? 8   A   D OP1   1 
ATOM   754  O  OP2   . A   B 1 8   ? -23.104 -16.784 45.172  1.00 68.39  ? 8   A   D OP2   1 
ATOM   755  O  "O5'" . A   B 1 8   ? -22.499 -18.804 43.853  1.00 64.67  ? 8   A   D "O5'" 1 
ATOM   756  C  "C5'" . A   B 1 8   ? -22.743 -19.781 42.855  1.00 59.79  ? 8   A   D "C5'" 1 
ATOM   757  C  "C4'" . A   B 1 8   ? -21.445 -20.363 42.378  1.00 58.92  ? 8   A   D "C4'" 1 
ATOM   758  O  "O4'" . A   B 1 8   ? -20.695 -19.344 41.673  1.00 56.76  ? 8   A   D "O4'" 1 
ATOM   759  C  "C3'" . A   B 1 8   ? -20.508 -20.816 43.481  1.00 58.29  ? 8   A   D "C3'" 1 
ATOM   760  O  "O3'" . A   B 1 8   ? -20.848 -22.120 43.918  1.00 63.40  ? 8   A   D "O3'" 1 
ATOM   761  C  "C2'" . A   B 1 8   ? -19.168 -20.792 42.771  1.00 56.62  ? 8   A   D "C2'" 1 
ATOM   762  O  "O2'" . A   B 1 8   ? -18.994 -21.928 41.949  1.00 55.14  ? 8   A   D "O2'" 1 
ATOM   763  C  "C1'" . A   B 1 8   ? -19.313 -19.531 41.910  1.00 54.71  ? 8   A   D "C1'" 1 
ATOM   764  N  N9    . A   B 1 8   ? -18.805 -18.334 42.573  1.00 43.99  ? 8   A   D N9    1 
ATOM   765  C  C8    . A   B 1 8   ? -19.511 -17.272 43.076  1.00 46.06  ? 8   A   D C8    1 
ATOM   766  N  N7    . A   B 1 8   ? -18.754 -16.350 43.626  1.00 47.89  ? 8   A   D N7    1 
ATOM   767  C  C5    . A   B 1 8   ? -17.466 -16.842 43.471  1.00 43.04  ? 8   A   D C5    1 
ATOM   768  C  C6    . A   B 1 8   ? -16.206 -16.336 43.839  1.00 47.34  ? 8   A   D C6    1 
ATOM   769  N  N6    . A   B 1 8   ? -16.027 -15.167 44.466  1.00 43.58  ? 8   A   D N6    1 
ATOM   770  N  N1    . A   B 1 8   ? -15.117 -17.081 43.533  1.00 46.73  ? 8   A   D N1    1 
ATOM   771  C  C2    . A   B 1 8   ? -15.297 -18.247 42.902  1.00 42.40  ? 8   A   D C2    1 
ATOM   772  N  N3    . A   B 1 8   ? -16.426 -18.823 42.505  1.00 43.46  ? 8   A   D N3    1 
ATOM   773  C  C4    . A   B 1 8   ? -17.484 -18.060 42.823  1.00 39.84  ? 8   A   D C4    1 
ATOM   774  P  P     . U   B 1 9   ? -20.733 -22.497 45.479  1.00 69.74  ? 9   U   D P     1 
ATOM   775  O  OP1   . U   B 1 9   ? -21.284 -23.855 45.568  1.00 66.62  ? 9   U   D OP1   1 
ATOM   776  O  OP2   . U   B 1 9   ? -21.338 -21.455 46.307  1.00 59.90  ? 9   U   D OP2   1 
ATOM   777  O  "O5'" . U   B 1 9   ? -19.157 -22.513 45.751  1.00 61.88  ? 9   U   D "O5'" 1 
ATOM   778  C  "C5'" . U   B 1 9   ? -18.309 -23.427 45.060  1.00 56.03  ? 9   U   D "C5'" 1 
ATOM   779  C  "C4'" . U   B 1 9   ? -16.850 -23.099 45.304  1.00 57.89  ? 9   U   D "C4'" 1 
ATOM   780  O  "O4'" . U   B 1 9   ? -16.531 -21.813 44.711  1.00 53.74  ? 9   U   D "O4'" 1 
ATOM   781  C  "C3'" . U   B 1 9   ? -16.386 -22.966 46.750  1.00 57.32  ? 9   U   D "C3'" 1 
ATOM   782  O  "O3'" . U   B 1 9   ? -16.112 -24.243 47.329  1.00 55.01  ? 9   U   D "O3'" 1 
ATOM   783  C  "C2'" . U   B 1 9   ? -15.106 -22.153 46.585  1.00 58.80  ? 9   U   D "C2'" 1 
ATOM   784  O  "O2'" . U   B 1 9   ? -14.014 -22.949 46.157  1.00 59.90  ? 9   U   D "O2'" 1 
ATOM   785  C  "C1'" . U   B 1 9   ? -15.499 -21.189 45.461  1.00 54.53  ? 9   U   D "C1'" 1 
ATOM   786  N  N1    . U   B 1 9   ? -15.997 -19.892 45.945  1.00 50.27  ? 9   U   D N1    1 
ATOM   787  C  C2    . U   B 1 9   ? -15.069 -18.925 46.302  1.00 46.88  ? 9   U   D C2    1 
ATOM   788  O  O2    . U   B 1 9   ? -13.865 -19.094 46.227  1.00 42.62  ? 9   U   D O2    1 
ATOM   789  N  N3    . U   B 1 9   ? -15.606 -17.748 46.750  1.00 43.85  ? 9   U   D N3    1 
ATOM   790  C  C4    . U   B 1 9   ? -16.938 -17.442 46.882  1.00 49.10  ? 9   U   D C4    1 
ATOM   791  O  O4    . U   B 1 9   ? -17.259 -16.373 47.389  1.00 56.80  ? 9   U   D O4    1 
ATOM   792  C  C5    . U   B 1 9   ? -17.836 -18.485 46.484  1.00 51.59  ? 9   U   D C5    1 
ATOM   793  C  C6    . U   B 1 9   ? -17.346 -19.645 46.042  1.00 51.70  ? 9   U   D C6    1 
ATOM   794  P  P     . U   B 1 10  ? -16.085 -24.416 48.935  1.00 63.85  ? 10  U   D P     1 
ATOM   795  O  OP1   . U   B 1 10  ? -16.041 -25.879 49.183  1.00 62.41  ? 10  U   D OP1   1 
ATOM   796  O  OP2   . U   B 1 10  ? -17.132 -23.597 49.581  1.00 58.09  ? 10  U   D OP2   1 
ATOM   797  O  "O5'" . U   B 1 10  ? -14.701 -23.780 49.394  1.00 59.69  ? 10  U   D "O5'" 1 
ATOM   798  C  "C5'" . U   B 1 10  ? -13.467 -24.426 49.114  1.00 57.01  ? 10  U   D "C5'" 1 
ATOM   799  C  "C4'" . U   B 1 10  ? -12.324 -23.564 49.576  1.00 58.37  ? 10  U   D "C4'" 1 
ATOM   800  O  "O4'" . U   B 1 10  ? -12.356 -22.313 48.831  1.00 61.45  ? 10  U   D "O4'" 1 
ATOM   801  C  "C3'" . U   B 1 10  ? -12.407 -23.086 51.018  1.00 61.04  ? 10  U   D "C3'" 1 
ATOM   802  O  "O3'" . U   B 1 10  ? -12.023 -24.079 51.970  1.00 61.17  ? 10  U   D "O3'" 1 
ATOM   803  C  "C2'" . U   B 1 10  ? -11.464 -21.889 50.987  1.00 61.25  ? 10  U   D "C2'" 1 
ATOM   804  O  "O2'" . U   B 1 10  ? -10.096 -22.262 50.963  1.00 54.81  ? 10  U   D "O2'" 1 
ATOM   805  C  "C1'" . U   B 1 10  ? -11.840 -21.263 49.641  1.00 58.75  ? 10  U   D "C1'" 1 
ATOM   806  N  N1    . U   B 1 10  ? -12.842 -20.186 49.751  1.00 53.96  ? 10  U   D N1    1 
ATOM   807  C  C2    . U   B 1 10  ? -12.361 -18.902 50.006  1.00 50.72  ? 10  U   D C2    1 
ATOM   808  O  O2    . U   B 1 10  ? -11.175 -18.657 50.127  1.00 49.12  ? 10  U   D O2    1 
ATOM   809  N  N3    . U   B 1 10  ? -13.319 -17.920 50.105  1.00 42.38  ? 10  U   D N3    1 
ATOM   810  C  C4    . U   B 1 10  ? -14.678 -18.074 49.966  1.00 49.38  ? 10  U   D C4    1 
ATOM   811  O  O4    . U   B 1 10  ? -15.403 -17.072 50.028  1.00 49.90  ? 10  U   D O4    1 
ATOM   812  C  C5    . U   B 1 10  ? -15.110 -19.433 49.703  1.00 44.18  ? 10  U   D C5    1 
ATOM   813  C  C6    . U   B 1 10  ? -14.200 -20.416 49.610  1.00 48.54  ? 10  U   D C6    1 
ATOM   814  P  P     . C   B 1 11  ? -12.588 -23.997 53.480  1.00 58.90  ? 11  C   D P     1 
ATOM   815  O  OP1   . C   B 1 11  ? -12.032 -25.139 54.240  1.00 64.95  ? 11  C   D OP1   1 
ATOM   816  O  OP2   . C   B 1 11  ? -14.054 -23.787 53.447  1.00 65.36  ? 11  C   D OP2   1 
ATOM   817  O  "O5'" . C   B 1 11  ? -11.919 -22.683 54.073  1.00 56.34  ? 11  C   D "O5'" 1 
ATOM   818  C  "C5'" . C   B 1 11  ? -10.523 -22.636 54.322  1.00 52.52  ? 11  C   D "C5'" 1 
ATOM   819  C  "C4'" . C   B 1 11  ? -10.148 -21.307 54.922  1.00 55.68  ? 11  C   D "C4'" 1 
ATOM   820  O  "O4'" . C   B 1 11  ? -10.290 -20.250 53.932  1.00 53.24  ? 11  C   D "O4'" 1 
ATOM   821  C  "C3'" . C   B 1 11  ? -11.042 -20.827 56.047  1.00 53.72  ? 11  C   D "C3'" 1 
ATOM   822  O  "O3'" . C   B 1 11  ? -10.773 -21.479 57.281  1.00 56.71  ? 11  C   D "O3'" 1 
ATOM   823  C  "C2'" . C   B 1 11  ? -10.694 -19.349 56.088  1.00 56.13  ? 11  C   D "C2'" 1 
ATOM   824  O  "O2'" . C   B 1 11  ? -9.475  -19.088 56.758  1.00 62.30  ? 11  C   D "O2'" 1 
ATOM   825  C  "C1'" . C   B 1 11  ? -10.583 -19.031 54.593  1.00 50.64  ? 11  C   D "C1'" 1 
ATOM   826  N  N1    . C   B 1 11  ? -11.862 -18.507 54.098  1.00 40.36  ? 11  C   D N1    1 
ATOM   827  C  C2    . C   B 1 11  ? -12.096 -17.141 54.224  1.00 42.75  ? 11  C   D C2    1 
ATOM   828  O  O2    . C   B 1 11  ? -11.180 -16.428 54.642  1.00 36.24  ? 11  C   D O2    1 
ATOM   829  N  N3    . C   B 1 11  ? -13.311 -16.632 53.881  1.00 42.65  ? 11  C   D N3    1 
ATOM   830  C  C4    . C   B 1 11  ? -14.258 -17.446 53.400  1.00 46.55  ? 11  C   D C4    1 
ATOM   831  N  N4    . C   B 1 11  ? -15.446 -16.914 53.102  1.00 51.63  ? 11  C   D N4    1 
ATOM   832  C  C5    . C   B 1 11  ? -14.027 -18.844 53.212  1.00 38.19  ? 11  C   D C5    1 
ATOM   833  C  C6    . C   B 1 11  ? -12.823 -19.326 53.569  1.00 41.95  ? 11  C   D C6    1 
ATOM   834  P  P     . G   B 1 12  ? -11.991 -21.826 58.270  1.00 55.90  ? 12  G   D P     1 
ATOM   835  O  OP1   . G   B 1 12  ? -11.406 -22.539 59.424  1.00 65.89  ? 12  G   D OP1   1 
ATOM   836  O  OP2   . G   B 1 12  ? -13.092 -22.460 57.502  1.00 57.32  ? 12  G   D OP2   1 
ATOM   837  O  "O5'" . G   B 1 12  ? -12.495 -20.396 58.773  1.00 59.67  ? 12  G   D "O5'" 1 
ATOM   838  C  "C5'" . G   B 1 12  ? -11.652 -19.567 59.574  1.00 57.36  ? 12  G   D "C5'" 1 
ATOM   839  C  "C4'" . G   B 1 12  ? -12.272 -18.198 59.771  1.00 58.03  ? 12  G   D "C4'" 1 
ATOM   840  O  "O4'" . G   B 1 12  ? -12.394 -17.524 58.489  1.00 57.40  ? 12  G   D "O4'" 1 
ATOM   841  C  "C3'" . G   B 1 12  ? -13.686 -18.136 60.327  1.00 57.82  ? 12  G   D "C3'" 1 
ATOM   842  O  "O3'" . G   B 1 12  ? -13.722 -18.273 61.739  1.00 62.87  ? 12  G   D "O3'" 1 
ATOM   843  C  "C2'" . G   B 1 12  ? -14.098 -16.728 59.935  1.00 54.49  ? 12  G   D "C2'" 1 
ATOM   844  O  "O2'" . G   B 1 12  ? -13.566 -15.753 60.808  1.00 52.21  ? 12  G   D "O2'" 1 
ATOM   845  C  "C1'" . G   B 1 12  ? -13.480 -16.615 58.539  1.00 53.17  ? 12  G   D "C1'" 1 
ATOM   846  N  N9    . G   B 1 12  ? -14.472 -17.013 57.551  1.00 53.54  ? 12  G   D N9    1 
ATOM   847  C  C8    . G   B 1 12  ? -14.649 -18.252 56.981  1.00 51.50  ? 12  G   D C8    1 
ATOM   848  N  N7    . G   B 1 12  ? -15.712 -18.317 56.226  1.00 50.73  ? 12  G   D N7    1 
ATOM   849  C  C5    . G   B 1 12  ? -16.250 -17.038 56.280  1.00 50.61  ? 12  G   D C5    1 
ATOM   850  C  C6    . G   B 1 12  ? -17.426 -16.506 55.688  1.00 50.68  ? 12  G   D C6    1 
ATOM   851  O  O6    . G   B 1 12  ? -18.252 -17.078 54.970  1.00 54.66  ? 12  G   D O6    1 
ATOM   852  N  N1    . G   B 1 12  ? -17.602 -15.162 56.014  1.00 48.47  ? 12  G   D N1    1 
ATOM   853  C  C2    . G   B 1 12  ? -16.752 -14.422 56.806  1.00 50.54  ? 12  G   D C2    1 
ATOM   854  N  N2    . G   B 1 12  ? -17.089 -13.140 57.016  1.00 48.43  ? 12  G   D N2    1 
ATOM   855  N  N3    . G   B 1 12  ? -15.653 -14.907 57.358  1.00 48.40  ? 12  G   D N3    1 
ATOM   856  C  C4    . G   B 1 12  ? -15.473 -16.214 57.063  1.00 52.16  ? 12  G   D C4    1 
ATOM   857  P  P     . C   B 1 13  ? -14.935 -19.073 62.430  1.00 70.62  ? 13  C   D P     1 
ATOM   858  O  OP1   . C   B 1 13  ? -14.889 -18.800 63.891  1.00 76.08  ? 13  C   D OP1   1 
ATOM   859  O  OP2   . C   B 1 13  ? -14.908 -20.477 61.938  1.00 72.54  ? 13  C   D OP2   1 
ATOM   860  O  "O5'" . C   B 1 13  ? -16.254 -18.375 61.880  1.00 67.58  ? 13  C   D "O5'" 1 
ATOM   861  C  "C5'" . C   B 1 13  ? -17.538 -18.835 62.282  1.00 55.74  ? 13  C   D "C5'" 1 
ATOM   862  C  "C4'" . C   B 1 13  ? -18.303 -17.713 62.934  1.00 57.90  ? 13  C   D "C4'" 1 
ATOM   863  O  "O4'" . C   B 1 13  ? -17.588 -17.314 64.129  1.00 58.41  ? 13  C   D "O4'" 1 
ATOM   864  C  "C3'" . C   B 1 13  ? -18.413 -16.426 62.128  1.00 60.17  ? 13  C   D "C3'" 1 
ATOM   865  O  "O3'" . C   B 1 13  ? -19.513 -16.477 61.213  1.00 64.84  ? 13  C   D "O3'" 1 
ATOM   866  C  "C2'" . C   B 1 13  ? -18.652 -15.385 63.217  1.00 61.51  ? 13  C   D "C2'" 1 
ATOM   867  O  "O2'" . C   B 1 13  ? -20.008 -15.285 63.598  1.00 65.17  ? 13  C   D "O2'" 1 
ATOM   868  C  "C1'" . C   B 1 13  ? -17.826 -15.942 64.382  1.00 58.28  ? 13  C   D "C1'" 1 
ATOM   869  N  N1    . C   B 1 13  ? -16.535 -15.263 64.575  1.00 51.15  ? 13  C   D N1    1 
ATOM   870  C  C2    . C   B 1 13  ? -16.517 -14.061 65.280  1.00 46.88  ? 13  C   D C2    1 
ATOM   871  O  O2    . C   B 1 13  ? -17.574 -13.636 65.757  1.00 49.18  ? 13  C   D O2    1 
ATOM   872  N  N3    . C   B 1 13  ? -15.352 -13.399 65.439  1.00 45.23  ? 13  C   D N3    1 
ATOM   873  C  C4    . C   B 1 13  ? -14.225 -13.912 64.947  1.00 47.96  ? 13  C   D C4    1 
ATOM   874  N  N4    . C   B 1 13  ? -13.097 -13.227 65.141  1.00 48.12  ? 13  C   D N4    1 
ATOM   875  C  C5    . C   B 1 13  ? -14.206 -15.151 64.238  1.00 48.65  ? 13  C   D C5    1 
ATOM   876  C  C6    . C   B 1 13  ? -15.376 -15.786 64.074  1.00 49.16  ? 13  C   D C6    1 
ATOM   877  P  P     . A   B 1 14  ? -19.277 -16.149 59.650  1.00 65.76  ? 14  A   D P     1 
ATOM   878  O  OP1   . A   B 1 14  ? -20.432 -16.666 58.881  1.00 66.86  ? 14  A   D OP1   1 
ATOM   879  O  OP2   . A   B 1 14  ? -17.906 -16.600 59.296  1.00 63.30  ? 14  A   D OP2   1 
ATOM   880  O  "O5'" . A   B 1 14  ? -19.339 -14.561 59.582  1.00 66.71  ? 14  A   D "O5'" 1 
ATOM   881  C  "C5'" . A   B 1 14  ? -20.487 -13.863 60.058  1.00 67.86  ? 14  A   D "C5'" 1 
ATOM   882  C  "C4'" . A   B 1 14  ? -20.084 -12.519 60.614  1.00 69.50  ? 14  A   D "C4'" 1 
ATOM   883  O  "O4'" . A   B 1 14  ? -19.143 -12.716 61.700  1.00 67.60  ? 14  A   D "O4'" 1 
ATOM   884  C  "C3'" . A   B 1 14  ? -19.346 -11.624 59.636  1.00 69.22  ? 14  A   D "C3'" 1 
ATOM   885  O  "O3'" . A   B 1 14  ? -20.270 -10.893 58.838  1.00 75.33  ? 14  A   D "O3'" 1 
ATOM   886  C  "C2'" . A   B 1 14  ? -18.546 -10.716 60.558  1.00 64.63  ? 14  A   D "C2'" 1 
ATOM   887  O  "O2'" . A   B 1 14  ? -19.312 -9.641  61.053  1.00 65.90  ? 14  A   D "O2'" 1 
ATOM   888  C  "C1'" . A   B 1 14  ? -18.183 -11.675 61.695  1.00 63.07  ? 14  A   D "C1'" 1 
ATOM   889  N  N9    . A   B 1 14  ? -16.861 -12.275 61.537  1.00 58.04  ? 14  A   D N9    1 
ATOM   890  C  C8    . A   B 1 14  ? -16.548 -13.517 61.041  1.00 57.41  ? 14  A   D C8    1 
ATOM   891  N  N7    . A   B 1 14  ? -15.261 -13.757 60.994  1.00 53.84  ? 14  A   D N7    1 
ATOM   892  C  C5    . A   B 1 14  ? -14.688 -12.596 61.497  1.00 51.71  ? 14  A   D C5    1 
ATOM   893  C  C6    . A   B 1 14  ? -13.350 -12.209 61.698  1.00 48.75  ? 14  A   D C6    1 
ATOM   894  N  N6    . A   B 1 14  ? -12.308 -12.974 61.392  1.00 42.69  ? 14  A   D N6    1 
ATOM   895  N  N1    . A   B 1 14  ? -13.119 -10.988 62.226  1.00 52.24  ? 14  A   D N1    1 
ATOM   896  C  C2    . A   B 1 14  ? -14.171 -10.214 62.526  1.00 55.49  ? 14  A   D C2    1 
ATOM   897  N  N3    . A   B 1 14  ? -15.473 -10.461 62.375  1.00 57.20  ? 14  A   D N3    1 
ATOM   898  C  C4    . A   B 1 14  ? -15.664 -11.682 61.847  1.00 54.22  ? 14  A   D C4    1 
ATOM   899  P  P     . A   B 1 15  ? -19.816 -10.355 57.394  1.00 75.92  ? 15  A   D P     1 
ATOM   900  O  OP1   . A   B 1 15  ? -20.971 -9.622  56.810  1.00 75.63  ? 15  A   D OP1   1 
ATOM   901  O  OP2   . A   B 1 15  ? -19.205 -11.477 56.635  1.00 74.23  ? 15  A   D OP2   1 
ATOM   902  O  "O5'" . A   B 1 15  ? -18.667 -9.314  57.755  1.00 77.32  ? 15  A   D "O5'" 1 
ATOM   903  C  "C5'" . A   B 1 15  ? -18.959 -8.111  58.466  1.00 76.27  ? 15  A   D "C5'" 1 
ATOM   904  C  "C4'" . A   B 1 15  ? -17.691 -7.327  58.689  1.00 77.87  ? 15  A   D "C4'" 1 
ATOM   905  O  "O4'" . A   B 1 15  ? -16.857 -8.039  59.640  1.00 79.66  ? 15  A   D "O4'" 1 
ATOM   906  C  "C3'" . A   B 1 15  ? -16.811 -7.190  57.456  1.00 82.34  ? 15  A   D "C3'" 1 
ATOM   907  O  "O3'" . A   B 1 15  ? -17.223 -6.108  56.629  1.00 83.78  ? 15  A   D "O3'" 1 
ATOM   908  C  "C2'" . A   B 1 15  ? -15.438 -6.968  58.073  1.00 82.03  ? 15  A   D "C2'" 1 
ATOM   909  O  "O2'" . A   B 1 15  ? -15.252 -5.652  58.548  1.00 87.74  ? 15  A   D "O2'" 1 
ATOM   910  C  "C1'" . A   B 1 15  ? -15.495 -7.931  59.256  1.00 78.51  ? 15  A   D "C1'" 1 
ATOM   911  N  N9    . A   B 1 15  ? -15.018 -9.263  58.898  1.00 76.09  ? 15  A   D N9    1 
ATOM   912  C  C8    . A   B 1 15  ? -15.740 -10.340 58.430  1.00 75.27  ? 15  A   D C8    1 
ATOM   913  N  N7    . A   B 1 15  ? -15.011 -11.407 58.202  1.00 68.29  ? 15  A   D N7    1 
ATOM   914  C  C5    . A   B 1 15  ? -13.726 -11.007 58.543  1.00 69.87  ? 15  A   D C5    1 
ATOM   915  C  C6    . A   B 1 15  ? -12.499 -11.679 58.534  1.00 68.84  ? 15  A   D C6    1 
ATOM   916  N  N6    . A   B 1 15  ? -12.359 -12.953 58.162  1.00 66.58  ? 15  A   D N6    1 
ATOM   917  N  N1    . A   B 1 15  ? -11.405 -10.993 58.931  1.00 71.78  ? 15  A   D N1    1 
ATOM   918  C  C2    . A   B 1 15  ? -11.550 -9.715  59.315  1.00 73.09  ? 15  A   D C2    1 
ATOM   919  N  N3    . A   B 1 15  ? -12.654 -8.973  59.372  1.00 70.73  ? 15  A   D N3    1 
ATOM   920  C  C4    . A   B 1 15  ? -13.717 -9.688  58.968  1.00 73.31  ? 15  A   D C4    1 
ATOM   921  P  P     . G   B 1 16  ? -17.399 -6.338  55.047  1.00 83.39  ? 16  G   D P     1 
ATOM   922  O  OP1   . G   B 1 16  ? -17.764 -5.018  54.482  1.00 89.69  ? 16  G   D OP1   1 
ATOM   923  O  OP2   . G   B 1 16  ? -18.294 -7.501  54.820  1.00 83.67  ? 16  G   D OP2   1 
ATOM   924  O  "O5'" . G   B 1 16  ? -15.939 -6.729  54.529  1.00 80.50  ? 16  G   D "O5'" 1 
ATOM   925  C  "C5'" . G   B 1 16  ? -14.831 -5.842  54.694  1.00 73.98  ? 16  G   D "C5'" 1 
ATOM   926  C  "C4'" . G   B 1 16  ? -13.547 -6.626  54.855  1.00 71.76  ? 16  G   D "C4'" 1 
ATOM   927  O  "O4'" . G   B 1 16  ? -13.803 -7.717  55.788  1.00 73.05  ? 16  G   D "O4'" 1 
ATOM   928  C  "C3'" . G   B 1 16  ? -13.005 -7.342  53.625  1.00 72.30  ? 16  G   D "C3'" 1 
ATOM   929  O  "O3'" . G   B 1 16  ? -12.211 -6.496  52.793  1.00 73.88  ? 16  G   D "O3'" 1 
ATOM   930  C  "C2'" . G   B 1 16  ? -12.144 -8.424  54.264  1.00 70.71  ? 16  G   D "C2'" 1 
ATOM   931  O  "O2'" . G   B 1 16  ? -10.928 -7.908  54.769  1.00 65.64  ? 16  G   D "O2'" 1 
ATOM   932  C  "C1'" . G   B 1 16  ? -13.041 -8.861  55.420  1.00 67.15  ? 16  G   D "C1'" 1 
ATOM   933  N  N9    . G   B 1 16  ? -13.963 -9.932  55.038  1.00 62.47  ? 16  G   D N9    1 
ATOM   934  C  C8    . G   B 1 16  ? -15.313 -9.822  54.794  1.00 60.91  ? 16  G   D C8    1 
ATOM   935  N  N7    . G   B 1 16  ? -15.867 -10.955 54.448  1.00 59.44  ? 16  G   D N7    1 
ATOM   936  C  C5    . G   B 1 16  ? -14.823 -11.872 54.469  1.00 52.92  ? 16  G   D C5    1 
ATOM   937  C  C6    . G   B 1 16  ? -14.814 -13.259 54.179  1.00 50.20  ? 16  G   D C6    1 
ATOM   938  O  O6    . G   B 1 16  ? -15.748 -13.970 53.806  1.00 53.94  ? 16  G   D O6    1 
ATOM   939  N  N1    . G   B 1 16  ? -13.549 -13.813 54.348  1.00 49.81  ? 16  G   D N1    1 
ATOM   940  C  C2    . G   B 1 16  ? -12.425 -13.116 54.725  1.00 49.62  ? 16  G   D C2    1 
ATOM   941  N  N2    . G   B 1 16  ? -11.298 -13.825 54.828  1.00 37.20  ? 16  G   D N2    1 
ATOM   942  N  N3    . G   B 1 16  ? -12.414 -11.815 54.981  1.00 53.27  ? 16  G   D N3    1 
ATOM   943  C  C4    . G   B 1 16  ? -13.641 -11.261 54.838  1.00 58.72  ? 16  G   D C4    1 
ATOM   944  P  P     . A   B 1 17  ? -12.001 -6.875  51.238  1.00 67.79  ? 17  A   D P     1 
ATOM   945  O  OP1   . A   B 1 17  ? -11.391 -5.708  50.561  1.00 65.82  ? 17  A   D OP1   1 
ATOM   946  O  OP2   . A   B 1 17  ? -13.288 -7.424  50.745  1.00 69.45  ? 17  A   D OP2   1 
ATOM   947  O  "O5'" . A   B 1 17  ? -10.949 -8.074  51.237  1.00 64.52  ? 17  A   D "O5'" 1 
ATOM   948  C  "C5'" . A   B 1 17  ? -9.599  -7.875  51.635  1.00 59.45  ? 17  A   D "C5'" 1 
ATOM   949  C  "C4'" . A   B 1 17  ? -8.875  -9.199  51.701  1.00 54.96  ? 17  A   D "C4'" 1 
ATOM   950  O  "O4'" . A   B 1 17  ? -9.608  -10.081 52.592  1.00 57.52  ? 17  A   D "O4'" 1 
ATOM   951  C  "C3'" . A   B 1 17  ? -8.816  -10.004 50.418  1.00 56.75  ? 17  A   D "C3'" 1 
ATOM   952  O  "O3'" . A   B 1 17  ? -7.792  -9.556  49.541  1.00 62.97  ? 17  A   D "O3'" 1 
ATOM   953  C  "C2'" . A   B 1 17  ? -8.538  -11.399 50.952  1.00 57.36  ? 17  A   D "C2'" 1 
ATOM   954  O  "O2'" . A   B 1 17  ? -7.200  -11.573 51.382  1.00 61.89  ? 17  A   D "O2'" 1 
ATOM   955  C  "C1'" . A   B 1 17  ? -9.466  -11.426 52.163  1.00 53.29  ? 17  A   D "C1'" 1 
ATOM   956  N  N9    . A   B 1 17  ? -10.790 -11.942 51.823  1.00 49.70  ? 17  A   D N9    1 
ATOM   957  C  C8    . A   B 1 17  ? -11.978 -11.255 51.727  1.00 43.61  ? 17  A   D C8    1 
ATOM   958  N  N7    . A   B 1 17  ? -12.996 -12.006 51.373  1.00 40.52  ? 17  A   D N7    1 
ATOM   959  C  C5    . A   B 1 17  ? -12.442 -13.274 51.235  1.00 41.06  ? 17  A   D C5    1 
ATOM   960  C  C6    . A   B 1 17  ? -12.995 -14.514 50.876  1.00 38.86  ? 17  A   D C6    1 
ATOM   961  N  N6    . A   B 1 17  ? -14.278 -14.691 50.566  1.00 38.80  ? 17  A   D N6    1 
ATOM   962  N  N1    . A   B 1 17  ? -12.170 -15.583 50.840  1.00 39.88  ? 17  A   D N1    1 
ATOM   963  C  C2    . A   B 1 17  ? -10.877 -15.405 51.138  1.00 42.29  ? 17  A   D C2    1 
ATOM   964  N  N3    . A   B 1 17  ? -10.238 -14.290 51.483  1.00 44.97  ? 17  A   D N3    1 
ATOM   965  C  C4    . A   B 1 17  ? -11.087 -13.249 51.515  1.00 44.14  ? 17  A   D C4    1 
ATOM   966  P  P     . G   B 1 18  ? -7.974  -9.754  47.958  1.00 65.05  ? 18  G   D P     1 
ATOM   967  O  OP1   . G   B 1 18  ? -7.018  -8.867  47.240  1.00 62.60  ? 18  G   D OP1   1 
ATOM   968  O  OP2   . G   B 1 18  ? -9.435  -9.667  47.655  1.00 60.85  ? 18  G   D OP2   1 
ATOM   969  O  "O5'" . G   B 1 18  ? -7.548  -11.270 47.717  1.00 61.78  ? 18  G   D "O5'" 1 
ATOM   970  C  "C5'" . G   B 1 18  ? -6.311  -11.771 48.182  1.00 48.79  ? 18  G   D "C5'" 1 
ATOM   971  C  "C4'" . G   B 1 18  ? -6.286  -13.267 48.030  1.00 53.43  ? 18  G   D "C4'" 1 
ATOM   972  O  "O4'" . G   B 1 18  ? -7.378  -13.842 48.804  1.00 54.70  ? 18  G   D "O4'" 1 
ATOM   973  C  "C3'" . G   B 1 18  ? -6.581  -13.794 46.640  1.00 51.90  ? 18  G   D "C3'" 1 
ATOM   974  O  "O3'" . G   B 1 18  ? -5.456  -13.712 45.785  1.00 54.50  ? 18  G   D "O3'" 1 
ATOM   975  C  "C2'" . G   B 1 18  ? -6.960  -15.238 46.941  1.00 50.55  ? 18  G   D "C2'" 1 
ATOM   976  O  "O2'" . G   B 1 18  ? -5.838  -16.042 47.241  1.00 50.65  ? 18  G   D "O2'" 1 
ATOM   977  C  "C1'" . G   B 1 18  ? -7.800  -15.059 48.204  1.00 48.53  ? 18  G   D "C1'" 1 
ATOM   978  N  N9    . G   B 1 18  ? -9.235  -14.977 47.937  1.00 47.55  ? 18  G   D N9    1 
ATOM   979  C  C8    . G   B 1 18  ? -10.035 -13.863 48.034  1.00 46.45  ? 18  G   D C8    1 
ATOM   980  N  N7    . G   B 1 18  ? -11.287 -14.107 47.748  1.00 43.63  ? 18  G   D N7    1 
ATOM   981  C  C5    . G   B 1 18  ? -11.313 -15.461 47.443  1.00 39.88  ? 18  G   D C5    1 
ATOM   982  C  C6    . G   B 1 18  ? -12.401 -16.303 47.069  1.00 40.63  ? 18  G   D C6    1 
ATOM   983  O  O6    . G   B 1 18  ? -13.587 -16.009 46.929  1.00 43.89  ? 18  G   D O6    1 
ATOM   984  N  N1    . G   B 1 18  ? -11.988 -17.611 46.859  1.00 39.81  ? 18  G   D N1    1 
ATOM   985  C  C2    . G   B 1 18  ? -10.696 -18.059 46.993  1.00 41.71  ? 18  G   D C2    1 
ATOM   986  N  N2    . G   B 1 18  ? -10.508 -19.367 46.779  1.00 40.32  ? 18  G   D N2    1 
ATOM   987  N  N3    . G   B 1 18  ? -9.673  -17.286 47.323  1.00 37.35  ? 18  G   D N3    1 
ATOM   988  C  C4    . G   B 1 18  ? -10.053 -16.010 47.542  1.00 37.23  ? 18  G   D C4    1 
ATOM   989  P  P     . U   B 1 19  ? -5.677  -13.457 44.216  1.00 52.79  ? 19  U   D P     1 
ATOM   990  O  OP1   . U   B 1 19  ? -4.329  -13.496 43.602  1.00 46.27  ? 19  U   D OP1   1 
ATOM   991  O  OP2   . U   B 1 19  ? -6.540  -12.254 44.054  1.00 55.93  ? 19  U   D OP2   1 
ATOM   992  O  "O5'" . U   B 1 19  ? -6.492  -14.735 43.715  1.00 55.38  ? 19  U   D "O5'" 1 
ATOM   993  C  "C5'" . U   B 1 19  ? -5.832  -15.981 43.523  1.00 54.70  ? 19  U   D "C5'" 1 
ATOM   994  C  "C4'" . U   B 1 19  ? -6.783  -17.013 42.959  1.00 56.00  ? 19  U   D "C4'" 1 
ATOM   995  O  "O4'" . U   B 1 19  ? -7.831  -17.309 43.918  1.00 55.93  ? 19  U   D "O4'" 1 
ATOM   996  C  "C3'" . U   B 1 19  ? -7.562  -16.634 41.714  1.00 57.81  ? 19  U   D "C3'" 1 
ATOM   997  O  "O3'" . U   B 1 19  ? -6.782  -16.746 40.531  1.00 61.46  ? 19  U   D "O3'" 1 
ATOM   998  C  "C2'" . U   B 1 19  ? -8.675  -17.667 41.734  1.00 51.83  ? 19  U   D "C2'" 1 
ATOM   999  O  "O2'" . U   B 1 19  ? -8.198  -18.924 41.310  1.00 58.51  ? 19  U   D "O2'" 1 
ATOM   1000 C  "C1'" . U   B 1 19  ? -9.007  -17.710 43.225  1.00 51.46  ? 19  U   D "C1'" 1 
ATOM   1001 N  N1    . U   B 1 19  ? -10.084 -16.770 43.563  1.00 50.84  ? 19  U   D N1    1 
ATOM   1002 C  C2    . U   B 1 19  ? -11.391 -17.187 43.362  1.00 51.02  ? 19  U   D C2    1 
ATOM   1003 O  O2    . U   B 1 19  ? -11.676 -18.293 42.953  1.00 58.87  ? 19  U   D O2    1 
ATOM   1004 N  N3    . U   B 1 19  ? -12.351 -16.256 43.656  1.00 49.38  ? 19  U   D N3    1 
ATOM   1005 C  C4    . U   B 1 19  ? -12.146 -14.979 44.120  1.00 51.40  ? 19  U   D C4    1 
ATOM   1006 O  O4    . U   B 1 19  ? -13.117 -14.251 44.311  1.00 51.59  ? 19  U   D O4    1 
ATOM   1007 C  C5    . U   B 1 19  ? -10.771 -14.624 44.320  1.00 49.46  ? 19  U   D C5    1 
ATOM   1008 C  C6    . U   B 1 19  ? -9.811  -15.511 44.043  1.00 47.79  ? 19  U   D C6    1 
ATOM   1009 P  P     . G   B 1 20  ? -7.155  -15.843 39.262  1.00 60.03  ? 20  G   D P     1 
ATOM   1010 O  OP1   . G   B 1 20  ? -6.076  -16.013 38.257  1.00 61.17  ? 20  G   D OP1   1 
ATOM   1011 O  OP2   . G   B 1 20  ? -7.502  -14.481 39.751  1.00 48.75  ? 20  G   D OP2   1 
ATOM   1012 O  "O5'" . G   B 1 20  ? -8.477  -16.534 38.702  1.00 63.52  ? 20  G   D "O5'" 1 
ATOM   1013 C  "C5'" . G   B 1 20  ? -8.418  -17.824 38.096  1.00 60.22  ? 20  G   D "C5'" 1 
ATOM   1014 C  "C4'" . G   B 1 20  ? -9.807  -18.335 37.787  1.00 55.57  ? 20  G   D "C4'" 1 
ATOM   1015 O  "O4'" . G   B 1 20  ? -10.538 -18.528 39.026  1.00 52.46  ? 20  G   D "O4'" 1 
ATOM   1016 C  "C3'" . G   B 1 20  ? -10.725 -17.419 36.998  1.00 57.66  ? 20  G   D "C3'" 1 
ATOM   1017 O  "O3'" . G   B 1 20  ? -10.435 -17.417 35.606  1.00 60.79  ? 20  G   D "O3'" 1 
ATOM   1018 C  "C2'" . G   B 1 20  ? -12.078 -18.043 37.304  1.00 55.86  ? 20  G   D "C2'" 1 
ATOM   1019 O  "O2'" . G   B 1 20  ? -12.283 -19.265 36.619  1.00 57.95  ? 20  G   D "O2'" 1 
ATOM   1020 C  "C1'" . G   B 1 20  ? -11.925 -18.329 38.795  1.00 50.69  ? 20  G   D "C1'" 1 
ATOM   1021 N  N9    . G   B 1 20  ? -12.364 -17.183 39.578  1.00 47.15  ? 20  G   D N9    1 
ATOM   1022 C  C8    . G   B 1 20  ? -11.579 -16.259 40.226  1.00 48.72  ? 20  G   D C8    1 
ATOM   1023 N  N7    . G   B 1 20  ? -12.275 -15.314 40.802  1.00 48.12  ? 20  G   D N7    1 
ATOM   1024 C  C5    . G   B 1 20  ? -13.594 -15.640 40.517  1.00 41.65  ? 20  G   D C5    1 
ATOM   1025 C  C6    . G   B 1 20  ? -14.790 -14.979 40.852  1.00 39.51  ? 20  G   D C6    1 
ATOM   1026 O  O6    . G   B 1 20  ? -14.940 -13.929 41.477  1.00 42.68  ? 20  G   D O6    1 
ATOM   1027 N  N1    . G   B 1 20  ? -15.901 -15.658 40.372  1.00 43.91  ? 20  G   D N1    1 
ATOM   1028 C  C2    . G   B 1 20  ? -15.866 -16.821 39.653  1.00 43.10  ? 20  G   D C2    1 
ATOM   1029 N  N2    . G   B 1 20  ? -17.060 -17.339 39.292  1.00 44.30  ? 20  G   D N2    1 
ATOM   1030 N  N3    . G   B 1 20  ? -14.750 -17.439 39.314  1.00 43.47  ? 20  G   D N3    1 
ATOM   1031 C  C4    . G   B 1 20  ? -13.663 -16.799 39.778  1.00 42.08  ? 20  G   D C4    1 
ATOM   1032 P  P     . G   B 1 21  ? -10.842 -16.140 34.711  1.00 62.84  ? 21  G   D P     1 
ATOM   1033 O  OP1   . G   B 1 21  ? -10.298 -16.390 33.348  1.00 61.01  ? 21  G   D OP1   1 
ATOM   1034 O  OP2   . G   B 1 21  ? -10.469 -14.896 35.434  1.00 63.53  ? 21  G   D OP2   1 
ATOM   1035 O  "O5'" . G   B 1 21  ? -12.432 -16.200 34.660  1.00 58.38  ? 21  G   D "O5'" 1 
ATOM   1036 C  "C5'" . G   B 1 21  ? -13.090 -17.290 34.035  1.00 54.33  ? 21  G   D "C5'" 1 
ATOM   1037 C  "C4'" . G   B 1 21  ? -14.577 -17.079 34.051  1.00 52.54  ? 21  G   D "C4'" 1 
ATOM   1038 O  "O4'" . G   B 1 21  ? -15.066 -17.150 35.416  1.00 50.84  ? 21  G   D "O4'" 1 
ATOM   1039 C  "C3'" . G   B 1 21  ? -15.055 -15.715 33.597  1.00 52.36  ? 21  G   D "C3'" 1 
ATOM   1040 O  "O3'" . G   B 1 21  ? -15.053 -15.559 32.190  1.00 55.70  ? 21  G   D "O3'" 1 
ATOM   1041 C  "C2'" . G   B 1 21  ? -16.461 -15.686 34.175  1.00 53.84  ? 21  G   D "C2'" 1 
ATOM   1042 O  "O2'" . G   B 1 21  ? -17.388 -16.436 33.414  1.00 50.48  ? 21  G   D "O2'" 1 
ATOM   1043 C  "C1'" . G   B 1 21  ? -16.220 -16.327 35.543  1.00 48.93  ? 21  G   D "C1'" 1 
ATOM   1044 N  N9    . G   B 1 21  ? -15.954 -15.292 36.532  1.00 47.53  ? 21  G   D N9    1 
ATOM   1045 C  C8    . G   B 1 21  ? -14.738 -14.893 37.042  1.00 46.36  ? 21  G   D C8    1 
ATOM   1046 N  N7    . G   B 1 21  ? -14.840 -13.901 37.884  1.00 45.10  ? 21  G   D N7    1 
ATOM   1047 C  C5    . G   B 1 21  ? -16.203 -13.636 37.935  1.00 46.04  ? 21  G   D C5    1 
ATOM   1048 C  C6    . G   B 1 21  ? -16.931 -12.656 38.668  1.00 48.72  ? 21  G   D C6    1 
ATOM   1049 O  O6    . G   B 1 21  ? -16.506 -11.793 39.440  1.00 53.35  ? 21  G   D O6    1 
ATOM   1050 N  N1    . G   B 1 21  ? -18.298 -12.745 38.424  1.00 52.02  ? 21  G   D N1    1 
ATOM   1051 C  C2    . G   B 1 21  ? -18.895 -13.654 37.580  1.00 51.86  ? 21  G   D C2    1 
ATOM   1052 N  N2    . G   B 1 21  ? -20.230 -13.580 37.474  1.00 46.98  ? 21  G   D N2    1 
ATOM   1053 N  N3    . G   B 1 21  ? -18.229 -14.568 36.892  1.00 50.56  ? 21  G   D N3    1 
ATOM   1054 C  C4    . G   B 1 21  ? -16.899 -14.499 37.115  1.00 48.27  ? 21  G   D C4    1 
ATOM   1055 P  P     . C   B 1 22  ? -14.881 -14.088 31.564  1.00 58.95  ? 22  C   D P     1 
ATOM   1056 O  OP1   . C   B 1 22  ? -14.690 -14.221 30.094  1.00 61.37  ? 22  C   D OP1   1 
ATOM   1057 O  OP2   . C   B 1 22  ? -13.849 -13.393 32.377  1.00 61.15  ? 22  C   D OP2   1 
ATOM   1058 O  "O5'" . C   B 1 22  ? -16.296 -13.392 31.822  1.00 55.12  ? 22  C   D "O5'" 1 
ATOM   1059 C  "C5'" . C   B 1 22  ? -17.502 -13.971 31.324  1.00 48.14  ? 22  C   D "C5'" 1 
ATOM   1060 C  "C4'" . C   B 1 22  ? -18.707 -13.238 31.871  1.00 49.23  ? 22  C   D "C4'" 1 
ATOM   1061 O  "O4'" . C   B 1 22  ? -18.738 -13.351 33.320  1.00 47.36  ? 22  C   D "O4'" 1 
ATOM   1062 C  "C3'" . C   B 1 22  ? -18.735 -11.736 31.655  1.00 48.96  ? 22  C   D "C3'" 1 
ATOM   1063 O  "O3'" . C   B 1 22  ? -19.177 -11.373 30.358  1.00 53.05  ? 22  C   D "O3'" 1 
ATOM   1064 C  "C2'" . C   B 1 22  ? -19.737 -11.291 32.704  1.00 50.07  ? 22  C   D "C2'" 1 
ATOM   1065 O  "O2'" . C   B 1 22  ? -21.074 -11.529 32.314  1.00 57.29  ? 22  C   D "O2'" 1 
ATOM   1066 C  "C1'" . C   B 1 22  ? -19.357 -12.195 33.874  1.00 46.85  ? 22  C   D "C1'" 1 
ATOM   1067 N  N1    . C   B 1 22  ? -18.404 -11.524 34.768  1.00 44.59  ? 22  C   D N1    1 
ATOM   1068 C  C2    . C   B 1 22  ? -18.888 -10.584 35.663  1.00 41.78  ? 22  C   D C2    1 
ATOM   1069 O  O2    . C   B 1 22  ? -20.094 -10.346 35.679  1.00 45.87  ? 22  C   D O2    1 
ATOM   1070 N  N3    . C   B 1 22  ? -18.032 -9.955  36.491  1.00 44.62  ? 22  C   D N3    1 
ATOM   1071 C  C4    . C   B 1 22  ? -16.728 -10.240 36.449  1.00 42.71  ? 22  C   D C4    1 
ATOM   1072 N  N4    . C   B 1 22  ? -15.924 -9.594  37.292  1.00 44.47  ? 22  C   D N4    1 
ATOM   1073 C  C5    . C   B 1 22  ? -16.197 -11.197 35.542  1.00 39.32  ? 22  C   D C5    1 
ATOM   1074 C  C6    . C   B 1 22  ? -17.064 -11.812 34.725  1.00 46.77  ? 22  C   D C6    1 
ATOM   1075 P  P     . C   B 1 23  ? -18.858 -9.900  29.807  1.00 53.80  ? 23  C   D P     1 
ATOM   1076 O  OP1   . C   B 1 23  ? -19.377 -9.820  28.424  1.00 56.45  ? 23  C   D OP1   1 
ATOM   1077 O  OP2   . C   B 1 23  ? -17.421 -9.627  30.063  1.00 57.78  ? 23  C   D OP2   1 
ATOM   1078 O  "O5'" . C   B 1 23  ? -19.720 -8.941  30.750  1.00 52.59  ? 23  C   D "O5'" 1 
ATOM   1079 C  "C5'" . C   B 1 23  ? -21.141 -8.861  30.627  1.00 47.48  ? 23  C   D "C5'" 1 
ATOM   1080 C  "C4'" . C   B 1 23  ? -21.684 -7.664  31.396  1.00 46.49  ? 23  C   D "C4'" 1 
ATOM   1081 O  "O4'" . C   B 1 23  ? -21.551 -7.879  32.827  1.00 45.75  ? 23  C   D "O4'" 1 
ATOM   1082 C  "C3'" . C   B 1 23  ? -21.003 -6.320  31.161  1.00 48.30  ? 23  C   D "C3'" 1 
ATOM   1083 O  "O3'" . C   B 1 23  ? -21.497 -5.651  30.005  1.00 48.94  ? 23  C   D "O3'" 1 
ATOM   1084 C  "C2'" . C   B 1 23  ? -21.393 -5.557  32.414  1.00 46.81  ? 23  C   D "C2'" 1 
ATOM   1085 O  "O2'" . C   B 1 23  ? -22.729 -5.111  32.347  1.00 45.11  ? 23  C   D "O2'" 1 
ATOM   1086 C  "C1'" . C   B 1 23  ? -21.261 -6.648  33.473  1.00 44.58  ? 23  C   D "C1'" 1 
ATOM   1087 N  N1    . C   B 1 23  ? -19.887 -6.719  33.981  1.00 42.52  ? 23  C   D N1    1 
ATOM   1088 C  C2    . C   B 1 23  ? -19.524 -5.928  35.073  1.00 43.89  ? 23  C   D C2    1 
ATOM   1089 O  O2    . C   B 1 23  ? -20.375 -5.195  35.591  1.00 44.09  ? 23  C   D O2    1 
ATOM   1090 N  N3    . C   B 1 23  ? -18.257 -5.991  35.548  1.00 43.17  ? 23  C   D N3    1 
ATOM   1091 C  C4    . C   B 1 23  ? -17.377 -6.820  34.985  1.00 45.72  ? 23  C   D C4    1 
ATOM   1092 N  N4    . C   B 1 23  ? -16.150 -6.875  35.504  1.00 41.80  ? 23  C   D N4    1 
ATOM   1093 C  C5    . C   B 1 23  ? -17.721 -7.638  33.863  1.00 48.20  ? 23  C   D C5    1 
ATOM   1094 C  C6    . C   B 1 23  ? -18.972 -7.553  33.397  1.00 42.61  ? 23  C   D C6    1 
ATOM   1095 P  P     . U   B 1 24  ? -20.505 -4.728  29.141  1.00 50.71  ? 24  U   D P     1 
ATOM   1096 O  OP1   . U   B 1 24  ? -21.271 -4.282  27.950  1.00 47.39  ? 24  U   D OP1   1 
ATOM   1097 O  OP2   . U   B 1 24  ? -19.209 -5.432  28.973  1.00 46.54  ? 24  U   D OP2   1 
ATOM   1098 O  "O5'" . U   B 1 24  ? -20.230 -3.463  30.066  1.00 49.70  ? 24  U   D "O5'" 1 
ATOM   1099 C  "C5'" . U   B 1 24  ? -21.300 -2.651  30.511  1.00 48.16  ? 24  U   D "C5'" 1 
ATOM   1100 C  "C4'" . U   B 1 24  ? -20.844 -1.760  31.635  1.00 47.44  ? 24  U   D "C4'" 1 
ATOM   1101 O  "O4'" . U   B 1 24  ? -20.349 -2.582  32.724  1.00 42.79  ? 24  U   D "O4'" 1 
ATOM   1102 C  "C3'" . U   B 1 24  ? -19.661 -0.842  31.374  1.00 45.34  ? 24  U   D "C3'" 1 
ATOM   1103 O  "O3'" . U   B 1 24  ? -20.012 0.313   30.618  1.00 47.02  ? 24  U   D "O3'" 1 
ATOM   1104 C  "C2'" . U   B 1 24  ? -19.289 -0.475  32.799  1.00 39.62  ? 24  U   D "C2'" 1 
ATOM   1105 O  "O2'" . U   B 1 24  ? -20.251 0.356   33.378  1.00 36.92  ? 24  U   D "O2'" 1 
ATOM   1106 C  "C1'" . U   B 1 24  ? -19.425 -1.825  33.488  1.00 43.93  ? 24  U   D "C1'" 1 
ATOM   1107 N  N1    . U   B 1 24  ? -18.145 -2.535  33.530  1.00 43.01  ? 24  U   D N1    1 
ATOM   1108 C  C2    . U   B 1 24  ? -17.242 -2.162  34.507  1.00 45.44  ? 24  U   D C2    1 
ATOM   1109 O  O2    . U   B 1 24  ? -17.467 -1.269  35.315  1.00 45.16  ? 24  U   D O2    1 
ATOM   1110 N  N3    . U   B 1 24  ? -16.072 -2.873  34.510  1.00 44.49  ? 24  U   D N3    1 
ATOM   1111 C  C4    . U   B 1 24  ? -15.727 -3.894  33.661  1.00 50.13  ? 24  U   D C4    1 
ATOM   1112 O  O4    . U   B 1 24  ? -14.661 -4.490  33.828  1.00 50.85  ? 24  U   D O4    1 
ATOM   1113 C  C5    . U   B 1 24  ? -16.713 -4.203  32.675  1.00 48.89  ? 24  U   D C5    1 
ATOM   1114 C  C6    . U   B 1 24  ? -17.859 -3.526  32.647  1.00 42.41  ? 24  U   D C6    1 
ATOM   1115 P  P     . U   B 1 25  ? -18.857 1.196   29.918  1.00 49.62  ? 25  U   D P     1 
ATOM   1116 O  OP1   . U   B 1 25  ? -19.520 2.240   29.108  1.00 56.33  ? 25  U   D OP1   1 
ATOM   1117 O  OP2   . U   B 1 25  ? -17.845 0.319   29.283  1.00 49.77  ? 25  U   D OP2   1 
ATOM   1118 O  "O5'" . U   B 1 25  ? -18.164 1.944   31.139  1.00 50.14  ? 25  U   D "O5'" 1 
ATOM   1119 C  "C5'" . U   B 1 25  ? -18.883 2.882   31.922  1.00 42.25  ? 25  U   D "C5'" 1 
ATOM   1120 C  "C4'" . U   B 1 25  ? -17.961 3.519   32.930  1.00 45.67  ? 25  U   D "C4'" 1 
ATOM   1121 O  "O4'" . U   B 1 25  ? -17.545 2.523   33.900  1.00 46.76  ? 25  U   D "O4'" 1 
ATOM   1122 C  "C3'" . U   B 1 25  ? -16.640 4.016   32.373  1.00 47.32  ? 25  U   D "C3'" 1 
ATOM   1123 O  "O3'" . U   B 1 25  ? -16.751 5.281   31.746  1.00 45.02  ? 25  U   D "O3'" 1 
ATOM   1124 C  "C2'" . U   B 1 25  ? -15.784 4.072   33.627  1.00 44.86  ? 25  U   D "C2'" 1 
ATOM   1125 O  "O2'" . U   B 1 25  ? -16.103 5.156   34.468  1.00 47.80  ? 25  U   D "O2'" 1 
ATOM   1126 C  "C1'" . U   B 1 25  ? -16.211 2.784   34.315  1.00 44.14  ? 25  U   D "C1'" 1 
ATOM   1127 N  N1    . U   B 1 25  ? -15.363 1.664   33.894  1.00 40.31  ? 25  U   D N1    1 
ATOM   1128 C  C2    . U   B 1 25  ? -14.090 1.596   34.421  1.00 39.88  ? 25  U   D C2    1 
ATOM   1129 O  O2    . U   B 1 25  ? -13.659 2.416   35.193  1.00 43.98  ? 25  U   D O2    1 
ATOM   1130 N  N3    . U   B 1 25  ? -13.341 0.529   34.006  1.00 40.73  ? 25  U   D N3    1 
ATOM   1131 C  C4    . U   B 1 25  ? -13.730 -0.459  33.130  1.00 43.56  ? 25  U   D C4    1 
ATOM   1132 O  O4    . U   B 1 25  ? -12.969 -1.400  32.896  1.00 41.40  ? 25  U   D O4    1 
ATOM   1133 C  C5    . U   B 1 25  ? -15.061 -0.307  32.619  1.00 46.84  ? 25  U   D C5    1 
ATOM   1134 C  C6    . U   B 1 25  ? -15.813 0.726   33.014  1.00 38.00  ? 25  U   D C6    1 
ATOM   1135 P  P     . G   B 1 26  ? -15.736 5.654   30.574  1.00 45.68  ? 26  G   D P     1 
ATOM   1136 O  OP1   . G   B 1 26  ? -16.236 6.841   29.855  1.00 40.63  ? 26  G   D OP1   1 
ATOM   1137 O  OP2   . G   B 1 26  ? -15.428 4.410   29.825  1.00 44.44  ? 26  G   D OP2   1 
ATOM   1138 O  "O5'" . G   B 1 26  ? -14.409 6.059   31.337  1.00 45.56  ? 26  G   D "O5'" 1 
ATOM   1139 C  "C5'" . G   B 1 26  ? -14.432 7.052   32.336  1.00 45.73  ? 26  G   D "C5'" 1 
ATOM   1140 C  "C4'" . G   B 1 26  ? -13.141 7.031   33.096  1.00 45.71  ? 26  G   D "C4'" 1 
ATOM   1141 O  "O4'" . G   B 1 26  ? -12.986 5.743   33.752  1.00 41.70  ? 26  G   D "O4'" 1 
ATOM   1142 C  "C3'" . G   B 1 26  ? -11.893 7.126   32.240  1.00 43.43  ? 26  G   D "C3'" 1 
ATOM   1143 O  "O3'" . G   B 1 26  ? -11.623 8.465   31.866  1.00 38.90  ? 26  G   D "O3'" 1 
ATOM   1144 C  "C2'" . G   B 1 26  ? -10.842 6.573   33.192  1.00 42.64  ? 26  G   D "C2'" 1 
ATOM   1145 O  "O2'" . G   B 1 26  ? -10.485 7.485   34.215  1.00 34.79  ? 26  G   D "O2'" 1 
ATOM   1146 C  "C1'" . G   B 1 26  ? -11.608 5.407   33.808  1.00 36.98  ? 26  G   D "C1'" 1 
ATOM   1147 N  N9    . G   B 1 26  ? -11.392 4.158   33.085  1.00 38.95  ? 26  G   D N9    1 
ATOM   1148 C  C8    . G   B 1 26  ? -12.245 3.526   32.208  1.00 36.65  ? 26  G   D C8    1 
ATOM   1149 N  N7    . G   B 1 26  ? -11.762 2.398   31.749  1.00 41.61  ? 26  G   D N7    1 
ATOM   1150 C  C5    . G   B 1 26  ? -10.513 2.282   32.357  1.00 40.85  ? 26  G   D C5    1 
ATOM   1151 C  C6    . G   B 1 26  ? -9.507  1.256   32.257  1.00 41.49  ? 26  G   D C6    1 
ATOM   1152 O  O6    . G   B 1 26  ? -9.527  0.187   31.606  1.00 36.78  ? 26  G   D O6    1 
ATOM   1153 N  N1    . G   B 1 26  ? -8.392  1.573   33.024  1.00 39.49  ? 26  G   D N1    1 
ATOM   1154 C  C2    . G   B 1 26  ? -8.252  2.705   33.792  1.00 39.49  ? 26  G   D C2    1 
ATOM   1155 N  N2    . G   B 1 26  ? -7.081  2.847   34.428  1.00 38.54  ? 26  G   D N2    1 
ATOM   1156 N  N3    . G   B 1 26  ? -9.179  3.633   33.919  1.00 30.81  ? 26  G   D N3    1 
ATOM   1157 C  C4    . G   B 1 26  ? -10.268 3.366   33.176  1.00 36.59  ? 26  G   D C4    1 
ATOM   1158 P  P     . C   B 1 27  ? -10.884 8.760   30.481  1.00 44.84  ? 27  C   D P     1 
ATOM   1159 O  OP1   . C   B 1 27  ? -10.987 10.229  30.268  1.00 39.71  ? 27  C   D OP1   1 
ATOM   1160 O  OP2   . C   B 1 27  ? -11.375 7.825   29.443  1.00 41.66  ? 27  C   D OP2   1 
ATOM   1161 O  "O5'" . C   B 1 27  ? -9.367  8.355   30.737  1.00 44.02  ? 27  C   D "O5'" 1 
ATOM   1162 C  "C5'" . C   B 1 27  ? -8.555  9.084   31.640  1.00 44.29  ? 27  C   D "C5'" 1 
ATOM   1163 C  "C4'" . C   B 1 27  ? -7.273  8.338   31.882  1.00 43.79  ? 27  C   D "C4'" 1 
ATOM   1164 O  "O4'" . C   B 1 27  ? -7.609  7.000   32.320  1.00 43.85  ? 27  C   D "O4'" 1 
ATOM   1165 C  "C3'" . C   B 1 27  ? -6.440  8.073   30.651  1.00 44.06  ? 27  C   D "C3'" 1 
ATOM   1166 O  "O3'" . C   B 1 27  ? -5.645  9.182   30.301  1.00 43.22  ? 27  C   D "O3'" 1 
ATOM   1167 C  "C2'" . C   B 1 27  ? -5.600  6.888   31.089  1.00 42.53  ? 27  C   D "C2'" 1 
ATOM   1168 O  "O2'" . C   B 1 27  ? -4.560  7.232   31.970  1.00 46.26  ? 27  C   D "O2'" 1 
ATOM   1169 C  "C1'" . C   B 1 27  ? -6.632  6.086   31.861  1.00 39.38  ? 27  C   D "C1'" 1 
ATOM   1170 N  N1    . C   B 1 27  ? -7.294  5.083   31.029  1.00 42.00  ? 27  C   D N1    1 
ATOM   1171 C  C2    . C   B 1 27  ? -6.612  3.899   30.751  1.00 38.22  ? 27  C   D C2    1 
ATOM   1172 O  O2    . C   B 1 27  ? -5.454  3.767   31.161  1.00 40.03  ? 27  C   D O2    1 
ATOM   1173 N  N3    . C   B 1 27  ? -7.229  2.936   30.043  1.00 37.23  ? 27  C   D N3    1 
ATOM   1174 C  C4    . C   B 1 27  ? -8.478  3.125   29.607  1.00 38.01  ? 27  C   D C4    1 
ATOM   1175 N  N4    . C   B 1 27  ? -9.061  2.124   28.950  1.00 28.39  ? 27  C   D N4    1 
ATOM   1176 C  C5    . C   B 1 27  ? -9.184  4.343   29.839  1.00 36.06  ? 27  C   D C5    1 
ATOM   1177 C  C6    . C   B 1 27  ? -8.560  5.286   30.550  1.00 37.71  ? 27  C   D C6    1 
ATOM   1178 P  P     . G   B 1 28  ? -5.315  9.446   28.760  1.00 49.23  ? 28  G   D P     1 
ATOM   1179 O  OP1   . G   B 1 28  ? -4.658  10.775  28.704  1.00 53.22  ? 28  G   D OP1   1 
ATOM   1180 O  OP2   . G   B 1 28  ? -6.537  9.190   27.958  1.00 46.39  ? 28  G   D OP2   1 
ATOM   1181 O  "O5'" . G   B 1 28  ? -4.258  8.314   28.389  1.00 50.26  ? 28  G   D "O5'" 1 
ATOM   1182 C  "C5'" . G   B 1 28  ? -2.936  8.353   28.907  1.00 47.31  ? 28  G   D "C5'" 1 
ATOM   1183 C  "C4'" . G   B 1 28  ? -2.204  7.083   28.560  1.00 47.43  ? 28  G   D "C4'" 1 
ATOM   1184 O  "O4'" . G   B 1 28  ? -2.933  5.957   29.113  1.00 46.76  ? 28  G   D "O4'" 1 
ATOM   1185 C  "C3'" . G   B 1 28  ? -2.104  6.737   27.085  1.00 50.18  ? 28  G   D "C3'" 1 
ATOM   1186 O  "O3'" . G   B 1 28  ? -1.140  7.456   26.314  1.00 56.33  ? 28  G   D "O3'" 1 
ATOM   1187 C  "C2'" . G   B 1 28  ? -1.831  5.244   27.138  1.00 51.49  ? 28  G   D "C2'" 1 
ATOM   1188 O  "O2'" . G   B 1 28  ? -0.491  4.916   27.454  1.00 61.13  ? 28  G   D "O2'" 1 
ATOM   1189 C  "C1'" . G   B 1 28  ? -2.746  4.823   28.285  1.00 48.13  ? 28  G   D "C1'" 1 
ATOM   1190 N  N9    . G   B 1 28  ? -4.042  4.399   27.774  1.00 48.70  ? 28  G   D N9    1 
ATOM   1191 C  C8    . G   B 1 28  ? -5.207  5.125   27.709  1.00 42.49  ? 28  G   D C8    1 
ATOM   1192 N  N7    . G   B 1 28  ? -6.189  4.464   27.158  1.00 46.35  ? 28  G   D N7    1 
ATOM   1193 C  C5    . G   B 1 28  ? -5.636  3.226   26.849  1.00 45.66  ? 28  G   D C5    1 
ATOM   1194 C  C6    . G   B 1 28  ? -6.214  2.073   26.233  1.00 42.54  ? 28  G   D C6    1 
ATOM   1195 O  O6    . G   B 1 28  ? -7.373  1.909   25.822  1.00 40.83  ? 28  G   D O6    1 
ATOM   1196 N  N1    . G   B 1 28  ? -5.290  1.044   26.115  1.00 34.71  ? 28  G   D N1    1 
ATOM   1197 C  C2    . G   B 1 28  ? -3.985  1.102   26.530  1.00 44.75  ? 28  G   D C2    1 
ATOM   1198 N  N2    . G   B 1 28  ? -3.239  0.000   26.303  1.00 42.93  ? 28  G   D N2    1 
ATOM   1199 N  N3    . G   B 1 28  ? -3.440  2.157   27.115  1.00 41.64  ? 28  G   D N3    1 
ATOM   1200 C  C4    . G   B 1 28  ? -4.315  3.172   27.235  1.00 45.38  ? 28  G   D C4    1 
ATOM   1201 N  N     . LYS C 2 2   ? 27.499  27.319  18.688  1.00 79.07  ? 2   LYS A N     1 
ATOM   1202 C  CA    . LYS C 2 2   ? 26.358  26.459  18.254  1.00 76.09  ? 2   LYS A CA    1 
ATOM   1203 C  C     . LYS C 2 2   ? 25.213  26.670  19.226  1.00 77.16  ? 2   LYS A C     1 
ATOM   1204 O  O     . LYS C 2 2   ? 25.328  27.463  20.162  1.00 77.05  ? 2   LYS A O     1 
ATOM   1205 C  CB    . LYS C 2 2   ? 26.784  24.991  18.247  1.00 72.90  ? 2   LYS A CB    1 
ATOM   1206 C  CG    . LYS C 2 2   ? 25.848  24.061  17.506  1.00 69.96  ? 2   LYS A CG    1 
ATOM   1207 C  CD    . LYS C 2 2   ? 26.582  22.794  17.093  1.00 68.69  ? 2   LYS A CD    1 
ATOM   1208 C  CE    . LYS C 2 2   ? 27.183  22.072  18.294  1.00 66.99  ? 2   LYS A CE    1 
ATOM   1209 N  NZ    . LYS C 2 2   ? 27.984  20.889  17.884  1.00 66.00  ? 2   LYS A NZ    1 
ATOM   1210 N  N     . MET C 2 3   ? 24.104  25.974  19.007  1.00 79.67  ? 3   MET A N     1 
ATOM   1211 C  CA    . MET C 2 3   ? 22.961  26.134  19.894  1.00 79.83  ? 3   MET A CA    1 
ATOM   1212 C  C     . MET C 2 3   ? 22.572  24.854  20.611  1.00 78.23  ? 3   MET A C     1 
ATOM   1213 O  O     . MET C 2 3   ? 21.940  24.897  21.668  1.00 77.11  ? 3   MET A O     1 
ATOM   1214 C  CB    . MET C 2 3   ? 21.753  26.684  19.134  1.00 79.86  ? 3   MET A CB    1 
ATOM   1215 C  CG    . MET C 2 3   ? 20.615  27.056  20.070  1.00 86.79  ? 3   MET A CG    1 
ATOM   1216 S  SD    . MET C 2 3   ? 19.380  28.122  19.352  1.00 92.52  ? 3   MET A SD    1 
ATOM   1217 C  CE    . MET C 2 3   ? 20.131  29.761  19.600  1.00 90.18  ? 3   MET A CE    1 
ATOM   1218 N  N     . LEU C 2 4   ? 22.939  23.711  20.044  1.00 76.68  ? 4   LEU A N     1 
ATOM   1219 C  CA    . LEU C 2 4   ? 22.611  22.455  20.695  1.00 77.51  ? 4   LEU A CA    1 
ATOM   1220 C  C     . LEU C 2 4   ? 23.559  22.285  21.875  1.00 74.78  ? 4   LEU A C     1 
ATOM   1221 O  O     . LEU C 2 4   ? 23.312  21.472  22.769  1.00 71.10  ? 4   LEU A O     1 
ATOM   1222 C  CB    . LEU C 2 4   ? 22.716  21.281  19.714  1.00 78.27  ? 4   LEU A CB    1 
ATOM   1223 C  CG    . LEU C 2 4   ? 24.068  20.861  19.155  1.00 79.72  ? 4   LEU A CG    1 
ATOM   1224 C  CD1   . LEU C 2 4   ? 24.910  20.223  20.248  1.00 83.80  ? 4   LEU A CD1   1 
ATOM   1225 C  CD2   . LEU C 2 4   ? 23.839  19.873  18.026  1.00 81.67  ? 4   LEU A CD2   1 
ATOM   1226 N  N     . GLU C 2 5   ? 24.639  23.069  21.871  1.00 71.56  ? 5   GLU A N     1 
ATOM   1227 C  CA    . GLU C 2 5   ? 25.610  23.044  22.958  1.00 67.68  ? 5   GLU A CA    1 
ATOM   1228 C  C     . GLU C 2 5   ? 24.932  23.741  24.134  1.00 65.07  ? 5   GLU A C     1 
ATOM   1229 O  O     . GLU C 2 5   ? 25.258  23.516  25.296  1.00 64.10  ? 5   GLU A O     1 
ATOM   1230 C  CB    . GLU C 2 5   ? 26.883  23.792  22.558  1.00 71.05  ? 5   GLU A CB    1 
ATOM   1231 C  CG    . GLU C 2 5   ? 26.751  25.315  22.523  1.00 76.31  ? 5   GLU A CG    1 
ATOM   1232 C  CD    . GLU C 2 5   ? 27.977  25.996  21.927  1.00 78.93  ? 5   GLU A CD    1 
ATOM   1233 O  OE1   . GLU C 2 5   ? 28.900  25.288  21.465  1.00 80.57  ? 5   GLU A OE1   1 
ATOM   1234 O  OE2   . GLU C 2 5   ? 28.015  27.242  21.912  1.00 79.72  ? 5   GLU A OE2   1 
ATOM   1235 N  N     . GLN C 2 6   ? 23.965  24.587  23.805  1.00 65.43  ? 6   GLN A N     1 
ATOM   1236 C  CA    . GLN C 2 6   ? 23.199  25.323  24.799  1.00 64.40  ? 6   GLN A CA    1 
ATOM   1237 C  C     . GLN C 2 6   ? 22.238  24.346  25.491  1.00 61.87  ? 6   GLN A C     1 
ATOM   1238 O  O     . GLN C 2 6   ? 21.994  24.439  26.699  1.00 61.96  ? 6   GLN A O     1 
ATOM   1239 C  CB    . GLN C 2 6   ? 22.436  26.453  24.100  1.00 64.39  ? 6   GLN A CB    1 
ATOM   1240 C  CG    . GLN C 2 6   ? 21.678  27.393  25.013  1.00 75.07  ? 6   GLN A CG    1 
ATOM   1241 C  CD    . GLN C 2 6   ? 21.089  28.575  24.258  1.00 79.13  ? 6   GLN A CD    1 
ATOM   1242 O  OE1   . GLN C 2 6   ? 20.150  29.223  24.728  1.00 80.31  ? 6   GLN A OE1   1 
ATOM   1243 N  NE2   . GLN C 2 6   ? 21.645  28.866  23.083  1.00 77.60  ? 6   GLN A NE2   1 
ATOM   1244 N  N     . LEU C 2 7   ? 21.704  23.400  24.723  1.00 56.95  ? 7   LEU A N     1 
ATOM   1245 C  CA    . LEU C 2 7   ? 20.790  22.413  25.282  1.00 55.81  ? 7   LEU A CA    1 
ATOM   1246 C  C     . LEU C 2 7   ? 21.566  21.419  26.136  1.00 52.50  ? 7   LEU A C     1 
ATOM   1247 O  O     . LEU C 2 7   ? 21.105  21.013  27.204  1.00 48.01  ? 7   LEU A O     1 
ATOM   1248 C  CB    . LEU C 2 7   ? 20.043  21.662  24.171  1.00 54.68  ? 7   LEU A CB    1 
ATOM   1249 C  CG    . LEU C 2 7   ? 19.078  20.575  24.678  1.00 52.72  ? 7   LEU A CG    1 
ATOM   1250 C  CD1   . LEU C 2 7   ? 18.072  21.185  25.648  1.00 46.85  ? 7   LEU A CD1   1 
ATOM   1251 C  CD2   . LEU C 2 7   ? 18.366  19.912  23.506  1.00 47.49  ? 7   LEU A CD2   1 
ATOM   1252 N  N     . GLU C 2 8   ? 22.749  21.035  25.659  1.00 53.41  ? 8   GLU A N     1 
ATOM   1253 C  CA    . GLU C 2 8   ? 23.602  20.093  26.384  1.00 51.78  ? 8   GLU A CA    1 
ATOM   1254 C  C     . GLU C 2 8   ? 23.999  20.667  27.730  1.00 49.65  ? 8   GLU A C     1 
ATOM   1255 O  O     . GLU C 2 8   ? 24.229  19.927  28.672  1.00 50.18  ? 8   GLU A O     1 
ATOM   1256 C  CB    . GLU C 2 8   ? 24.865  19.762  25.588  1.00 53.96  ? 8   GLU A CB    1 
ATOM   1257 C  CG    . GLU C 2 8   ? 24.615  19.056  24.273  1.00 56.85  ? 8   GLU A CG    1 
ATOM   1258 C  CD    . GLU C 2 8   ? 25.893  18.757  23.515  1.00 62.91  ? 8   GLU A CD    1 
ATOM   1259 O  OE1   . GLU C 2 8   ? 26.794  19.625  23.507  1.00 69.35  ? 8   GLU A OE1   1 
ATOM   1260 O  OE2   . GLU C 2 8   ? 25.997  17.663  22.914  1.00 65.66  ? 8   GLU A OE2   1 
ATOM   1261 N  N     . LYS C 2 9   ? 24.077  21.986  27.830  1.00 46.12  ? 9   LYS A N     1 
ATOM   1262 C  CA    . LYS C 2 9   ? 24.439  22.585  29.097  1.00 47.28  ? 9   LYS A CA    1 
ATOM   1263 C  C     . LYS C 2 9   ? 23.264  22.444  30.073  1.00 52.53  ? 9   LYS A C     1 
ATOM   1264 O  O     . LYS C 2 9   ? 23.459  22.206  31.275  1.00 48.76  ? 9   LYS A O     1 
ATOM   1265 C  CB    . LYS C 2 9   ? 24.831  24.051  28.879  1.00 50.22  ? 9   LYS A CB    1 
ATOM   1266 C  CG    . LYS C 2 9   ? 25.452  24.715  30.092  1.00 53.68  ? 9   LYS A CG    1 
ATOM   1267 C  CD    . LYS C 2 9   ? 26.099  26.051  29.730  1.00 61.00  ? 9   LYS A CD    1 
ATOM   1268 C  CE    . LYS C 2 9   ? 26.563  26.806  30.978  1.00 58.16  ? 9   LYS A CE    1 
ATOM   1269 N  NZ    . LYS C 2 9   ? 27.153  28.136  30.663  1.00 60.85  ? 9   LYS A NZ    1 
ATOM   1270 N  N     . LYS C 2 10  ? 22.041  22.564  29.549  1.00 57.25  ? 10  LYS A N     1 
ATOM   1271 C  CA    . LYS C 2 10  ? 20.829  22.437  30.365  1.00 57.02  ? 10  LYS A CA    1 
ATOM   1272 C  C     . LYS C 2 10  ? 20.705  21.011  30.899  1.00 57.12  ? 10  LYS A C     1 
ATOM   1273 O  O     . LYS C 2 10  ? 20.473  20.800  32.092  1.00 59.89  ? 10  LYS A O     1 
ATOM   1274 C  CB    . LYS C 2 10  ? 19.592  22.781  29.536  1.00 56.22  ? 10  LYS A CB    1 
ATOM   1275 C  CG    . LYS C 2 10  ? 19.622  24.177  28.971  1.00 60.60  ? 10  LYS A CG    1 
ATOM   1276 C  CD    . LYS C 2 10  ? 18.398  24.450  28.120  1.00 66.30  ? 10  LYS A CD    1 
ATOM   1277 C  CE    . LYS C 2 10  ? 18.318  25.916  27.720  1.00 64.13  ? 10  LYS A CE    1 
ATOM   1278 N  NZ    . LYS C 2 10  ? 18.172  26.788  28.912  1.00 62.83  ? 10  LYS A NZ    1 
ATOM   1279 N  N     . LEU C 2 11  ? 20.858  20.035  30.009  1.00 54.59  ? 11  LEU A N     1 
ATOM   1280 C  CA    . LEU C 2 11  ? 20.781  18.631  30.396  1.00 53.54  ? 11  LEU A CA    1 
ATOM   1281 C  C     . LEU C 2 11  ? 21.933  18.261  31.310  1.00 54.03  ? 11  LEU A C     1 
ATOM   1282 O  O     . LEU C 2 11  ? 21.776  17.430  32.196  1.00 61.46  ? 11  LEU A O     1 
ATOM   1283 C  CB    . LEU C 2 11  ? 20.849  17.710  29.174  1.00 52.83  ? 11  LEU A CB    1 
ATOM   1284 C  CG    . LEU C 2 11  ? 19.684  17.565  28.197  1.00 51.94  ? 11  LEU A CG    1 
ATOM   1285 C  CD1   . LEU C 2 11  ? 20.078  16.565  27.132  1.00 49.11  ? 11  LEU A CD1   1 
ATOM   1286 C  CD2   . LEU C 2 11  ? 18.435  17.096  28.920  1.00 49.33  ? 11  LEU A CD2   1 
ATOM   1287 N  N     . GLY C 2 12  ? 23.095  18.868  31.083  1.00 52.20  ? 12  GLY A N     1 
ATOM   1288 C  CA    . GLY C 2 12  ? 24.259  18.560  31.887  1.00 46.29  ? 12  GLY A CA    1 
ATOM   1289 C  C     . GLY C 2 12  ? 24.913  17.304  31.350  1.00 46.46  ? 12  GLY A C     1 
ATOM   1290 O  O     . GLY C 2 12  ? 25.358  16.440  32.110  1.00 47.62  ? 12  GLY A O     1 
ATOM   1291 N  N     . TYR C 2 13  ? 24.952  17.194  30.029  1.00 43.15  ? 13  TYR A N     1 
ATOM   1292 C  CA    . TYR C 2 13  ? 25.556  16.048  29.356  1.00 44.81  ? 13  TYR A CA    1 
ATOM   1293 C  C     . TYR C 2 13  ? 25.907  16.438  27.928  1.00 49.52  ? 13  TYR A C     1 
ATOM   1294 O  O     . TYR C 2 13  ? 25.147  17.154  27.270  1.00 48.51  ? 13  TYR A O     1 
ATOM   1295 C  CB    . TYR C 2 13  ? 24.586  14.861  29.320  1.00 47.46  ? 13  TYR A CB    1 
ATOM   1296 C  CG    . TYR C 2 13  ? 25.047  13.738  28.427  1.00 44.90  ? 13  TYR A CG    1 
ATOM   1297 C  CD1   . TYR C 2 13  ? 25.904  12.751  28.903  1.00 48.56  ? 13  TYR A CD1   1 
ATOM   1298 C  CD2   . TYR C 2 13  ? 24.689  13.704  27.076  1.00 47.61  ? 13  TYR A CD2   1 
ATOM   1299 C  CE1   . TYR C 2 13  ? 26.405  11.753  28.053  1.00 47.53  ? 13  TYR A CE1   1 
ATOM   1300 C  CE2   . TYR C 2 13  ? 25.185  12.718  26.221  1.00 47.63  ? 13  TYR A CE2   1 
ATOM   1301 C  CZ    . TYR C 2 13  ? 26.043  11.749  26.720  1.00 45.07  ? 13  TYR A CZ    1 
ATOM   1302 O  OH    . TYR C 2 13  ? 26.545  10.788  25.889  1.00 39.74  ? 13  TYR A OH    1 
ATOM   1303 N  N     . THR C 2 14  ? 27.057  15.962  27.451  1.00 53.52  ? 14  THR A N     1 
ATOM   1304 C  CA    . THR C 2 14  ? 27.512  16.250  26.089  1.00 54.77  ? 14  THR A CA    1 
ATOM   1305 C  C     . THR C 2 14  ? 27.518  14.996  25.226  1.00 54.43  ? 14  THR A C     1 
ATOM   1306 O  O     . THR C 2 14  ? 28.021  13.942  25.624  1.00 53.72  ? 14  THR A O     1 
ATOM   1307 C  CB    . THR C 2 14  ? 28.939  16.860  26.065  1.00 54.31  ? 14  THR A CB    1 
ATOM   1308 O  OG1   . THR C 2 14  ? 28.912  18.169  26.644  1.00 58.29  ? 14  THR A OG1   1 
ATOM   1309 C  CG2   . THR C 2 14  ? 29.445  16.968  24.637  1.00 44.07  ? 14  THR A CG2   1 
ATOM   1310 N  N     . PHE C 2 15  ? 26.966  15.116  24.030  1.00 52.11  ? 15  PHE A N     1 
ATOM   1311 C  CA    . PHE C 2 15  ? 26.918  13.974  23.149  1.00 51.51  ? 15  PHE A CA    1 
ATOM   1312 C  C     . PHE C 2 15  ? 28.235  13.782  22.464  1.00 53.86  ? 15  PHE A C     1 
ATOM   1313 O  O     . PHE C 2 15  ? 29.032  14.712  22.352  1.00 54.66  ? 15  PHE A O     1 
ATOM   1314 C  CB    . PHE C 2 15  ? 25.828  14.136  22.090  1.00 43.90  ? 15  PHE A CB    1 
ATOM   1315 C  CG    . PHE C 2 15  ? 24.452  13.903  22.611  1.00 38.60  ? 15  PHE A CG    1 
ATOM   1316 C  CD1   . PHE C 2 15  ? 23.918  14.732  23.594  1.00 38.67  ? 15  PHE A CD1   1 
ATOM   1317 C  CD2   . PHE C 2 15  ? 23.706  12.826  22.163  1.00 33.71  ? 15  PHE A CD2   1 
ATOM   1318 C  CE1   . PHE C 2 15  ? 22.662  14.489  24.130  1.00 40.27  ? 15  PHE A CE1   1 
ATOM   1319 C  CE2   . PHE C 2 15  ? 22.447  12.572  22.695  1.00 39.36  ? 15  PHE A CE2   1 
ATOM   1320 C  CZ    . PHE C 2 15  ? 21.924  13.403  23.680  1.00 37.61  ? 15  PHE A CZ    1 
ATOM   1321 N  N     . LYS C 2 16  ? 28.452  12.549  22.027  1.00 55.05  ? 16  LYS A N     1 
ATOM   1322 C  CA    . LYS C 2 16  ? 29.642  12.163  21.289  1.00 56.09  ? 16  LYS A CA    1 
ATOM   1323 C  C     . LYS C 2 16  ? 29.157  12.176  19.840  1.00 54.57  ? 16  LYS A C     1 
ATOM   1324 O  O     . LYS C 2 16  ? 29.900  12.474  18.915  1.00 51.67  ? 16  LYS A O     1 
ATOM   1325 C  CB    . LYS C 2 16  ? 30.076  10.751  21.705  1.00 51.74  ? 16  LYS A CB    1 
ATOM   1326 C  CG    . LYS C 2 16  ? 31.120  10.106  20.812  1.00 51.18  ? 16  LYS A CG    1 
ATOM   1327 C  CD    . LYS C 2 16  ? 31.383  8.678   21.271  1.00 57.24  ? 16  LYS A CD    1 
ATOM   1328 C  CE    . LYS C 2 16  ? 32.141  7.859   20.235  1.00 53.74  ? 16  LYS A CE    1 
ATOM   1329 N  NZ    . LYS C 2 16  ? 33.526  8.339   20.051  1.00 59.05  ? 16  LYS A NZ    1 
ATOM   1330 N  N     . ASP C 2 17  ? 27.876  11.861  19.680  1.00 59.31  ? 17  ASP A N     1 
ATOM   1331 C  CA    . ASP C 2 17  ? 27.208  11.816  18.390  1.00 60.69  ? 17  ASP A CA    1 
ATOM   1332 C  C     . ASP C 2 17  ? 26.098  12.872  18.375  1.00 58.89  ? 17  ASP A C     1 
ATOM   1333 O  O     . ASP C 2 17  ? 24.946  12.584  18.703  1.00 56.27  ? 17  ASP A O     1 
ATOM   1334 C  CB    . ASP C 2 17  ? 26.612  10.424  18.166  1.00 64.67  ? 17  ASP A CB    1 
ATOM   1335 C  CG    . ASP C 2 17  ? 25.915  10.296  16.822  1.00 73.82  ? 17  ASP A CG    1 
ATOM   1336 O  OD1   . ASP C 2 17  ? 24.998  11.100  16.548  1.00 76.37  ? 17  ASP A OD1   1 
ATOM   1337 O  OD2   . ASP C 2 17  ? 26.280  9.392   16.038  1.00 78.21  ? 17  ASP A OD2   1 
ATOM   1338 N  N     . LYS C 2 18  ? 26.463  14.092  17.997  1.00 57.95  ? 18  LYS A N     1 
ATOM   1339 C  CA    . LYS C 2 18  ? 25.525  15.205  17.949  1.00 58.20  ? 18  LYS A CA    1 
ATOM   1340 C  C     . LYS C 2 18  ? 24.310  14.924  17.058  1.00 56.43  ? 18  LYS A C     1 
ATOM   1341 O  O     . LYS C 2 18  ? 23.215  15.403  17.330  1.00 55.15  ? 18  LYS A O     1 
ATOM   1342 C  CB    . LYS C 2 18  ? 26.243  16.464  17.451  1.00 60.24  ? 18  LYS A CB    1 
ATOM   1343 C  CG    . LYS C 2 18  ? 27.462  16.895  18.264  1.00 62.87  ? 18  LYS A CG    1 
ATOM   1344 C  CD    . LYS C 2 18  ? 27.078  17.303  19.677  1.00 68.87  ? 18  LYS A CD    1 
ATOM   1345 C  CE    . LYS C 2 18  ? 28.236  17.978  20.421  1.00 73.02  ? 18  LYS A CE    1 
ATOM   1346 N  NZ    . LYS C 2 18  ? 29.463  17.134  20.555  1.00 73.23  ? 18  LYS A NZ    1 
ATOM   1347 N  N     . SER C 2 19  ? 24.496  14.142  16.001  1.00 56.46  ? 19  SER A N     1 
ATOM   1348 C  CA    . SER C 2 19  ? 23.391  13.846  15.090  1.00 56.99  ? 19  SER A CA    1 
ATOM   1349 C  C     . SER C 2 19  ? 22.295  13.018  15.759  1.00 57.23  ? 19  SER A C     1 
ATOM   1350 O  O     . SER C 2 19  ? 21.148  13.006  15.309  1.00 58.07  ? 19  SER A O     1 
ATOM   1351 C  CB    . SER C 2 19  ? 23.898  13.115  13.842  1.00 57.35  ? 19  SER A CB    1 
ATOM   1352 O  OG    . SER C 2 19  ? 24.037  11.732  14.085  1.00 58.47  ? 19  SER A OG    1 
ATOM   1353 N  N     . LEU C 2 20  ? 22.650  12.318  16.829  1.00 55.46  ? 20  LEU A N     1 
ATOM   1354 C  CA    . LEU C 2 20  ? 21.682  11.513  17.551  1.00 52.62  ? 20  LEU A CA    1 
ATOM   1355 C  C     . LEU C 2 20  ? 20.811  12.486  18.324  1.00 52.58  ? 20  LEU A C     1 
ATOM   1356 O  O     . LEU C 2 20  ? 19.588  12.329  18.388  1.00 53.74  ? 20  LEU A O     1 
ATOM   1357 C  CB    . LEU C 2 20  ? 22.397  10.565  18.509  1.00 54.74  ? 20  LEU A CB    1 
ATOM   1358 C  CG    . LEU C 2 20  ? 21.562  9.465   19.156  1.00 55.46  ? 20  LEU A CG    1 
ATOM   1359 C  CD1   . LEU C 2 20  ? 20.769  8.710   18.081  1.00 51.98  ? 20  LEU A CD1   1 
ATOM   1360 C  CD2   . LEU C 2 20  ? 22.490  8.515   19.910  1.00 54.46  ? 20  LEU A CD2   1 
ATOM   1361 N  N     . LEU C 2 21  ? 21.455  13.501  18.895  1.00 47.87  ? 21  LEU A N     1 
ATOM   1362 C  CA    . LEU C 2 21  ? 20.762  14.530  19.652  1.00 45.89  ? 21  LEU A CA    1 
ATOM   1363 C  C     . LEU C 2 21  ? 19.817  15.276  18.721  1.00 47.14  ? 21  LEU A C     1 
ATOM   1364 O  O     . LEU C 2 21  ? 18.710  15.646  19.111  1.00 46.79  ? 21  LEU A O     1 
ATOM   1365 C  CB    . LEU C 2 21  ? 21.759  15.519  20.251  1.00 45.30  ? 21  LEU A CB    1 
ATOM   1366 C  CG    . LEU C 2 21  ? 21.122  16.727  20.934  1.00 41.40  ? 21  LEU A CG    1 
ATOM   1367 C  CD1   . LEU C 2 21  ? 20.448  16.275  22.192  1.00 46.15  ? 21  LEU A CD1   1 
ATOM   1368 C  CD2   . LEU C 2 21  ? 22.156  17.759  21.258  1.00 45.33  ? 21  LEU A CD2   1 
ATOM   1369 N  N     . GLU C 2 22  ? 20.265  15.507  17.491  1.00 47.66  ? 22  GLU A N     1 
ATOM   1370 C  CA    . GLU C 2 22  ? 19.452  16.209  16.510  1.00 51.70  ? 22  GLU A CA    1 
ATOM   1371 C  C     . GLU C 2 22  ? 18.251  15.361  16.150  1.00 53.21  ? 22  GLU A C     1 
ATOM   1372 O  O     . GLU C 2 22  ? 17.173  15.884  15.842  1.00 53.77  ? 22  GLU A O     1 
ATOM   1373 C  CB    . GLU C 2 22  ? 20.250  16.481  15.242  1.00 58.21  ? 22  GLU A CB    1 
ATOM   1374 C  CG    . GLU C 2 22  ? 21.571  17.181  15.467  1.00 68.53  ? 22  GLU A CG    1 
ATOM   1375 C  CD    . GLU C 2 22  ? 22.279  17.509  14.164  1.00 72.53  ? 22  GLU A CD    1 
ATOM   1376 O  OE1   . GLU C 2 22  ? 22.537  16.580  13.364  1.00 74.34  ? 22  GLU A OE1   1 
ATOM   1377 O  OE2   . GLU C 2 22  ? 22.577  18.700  13.942  1.00 77.50  ? 22  GLU A OE2   1 
ATOM   1378 N  N     . LYS C 2 23  ? 18.447  14.048  16.178  1.00 51.40  ? 23  LYS A N     1 
ATOM   1379 C  CA    . LYS C 2 23  ? 17.383  13.112  15.854  1.00 52.48  ? 23  LYS A CA    1 
ATOM   1380 C  C     . LYS C 2 23  ? 16.247  13.265  16.854  1.00 50.84  ? 23  LYS A C     1 
ATOM   1381 O  O     . LYS C 2 23  ? 15.084  13.359  16.464  1.00 53.55  ? 23  LYS A O     1 
ATOM   1382 C  CB    . LYS C 2 23  ? 17.913  11.679  15.891  1.00 57.12  ? 23  LYS A CB    1 
ATOM   1383 C  CG    . LYS C 2 23  ? 16.950  10.623  15.361  1.00 59.62  ? 23  LYS A CG    1 
ATOM   1384 C  CD    . LYS C 2 23  ? 17.622  9.257   15.387  1.00 65.37  ? 23  LYS A CD    1 
ATOM   1385 C  CE    . LYS C 2 23  ? 16.848  8.214   14.606  1.00 67.93  ? 23  LYS A CE    1 
ATOM   1386 N  NZ    . LYS C 2 23  ? 17.510  6.875   14.650  1.00 71.10  ? 23  LYS A NZ    1 
ATOM   1387 N  N     . ALA C 2 24  ? 16.588  13.300  18.142  1.00 46.10  ? 24  ALA A N     1 
ATOM   1388 C  CA    . ALA C 2 24  ? 15.581  13.435  19.197  1.00 43.20  ? 24  ALA A CA    1 
ATOM   1389 C  C     . ALA C 2 24  ? 14.760  14.721  19.076  1.00 45.22  ? 24  ALA A C     1 
ATOM   1390 O  O     . ALA C 2 24  ? 13.623  14.785  19.525  1.00 44.39  ? 24  ALA A O     1 
ATOM   1391 C  CB    . ALA C 2 24  ? 16.243  13.375  20.555  1.00 36.99  ? 24  ALA A CB    1 
ATOM   1392 N  N     . LEU C 2 25  ? 15.343  15.736  18.455  1.00 45.50  ? 25  LEU A N     1 
ATOM   1393 C  CA    . LEU C 2 25  ? 14.687  17.018  18.285  1.00 48.03  ? 25  LEU A CA    1 
ATOM   1394 C  C     . LEU C 2 25  ? 13.933  17.183  16.952  1.00 51.81  ? 25  LEU A C     1 
ATOM   1395 O  O     . LEU C 2 25  ? 13.189  18.144  16.775  1.00 52.26  ? 25  LEU A O     1 
ATOM   1396 C  CB    . LEU C 2 25  ? 15.731  18.130  18.398  1.00 45.82  ? 25  LEU A CB    1 
ATOM   1397 C  CG    . LEU C 2 25  ? 16.555  18.237  19.682  1.00 43.82  ? 25  LEU A CG    1 
ATOM   1398 C  CD1   . LEU C 2 25  ? 17.912  18.872  19.345  1.00 30.83  ? 25  LEU A CD1   1 
ATOM   1399 C  CD2   . LEU C 2 25  ? 15.787  19.046  20.738  1.00 30.83  ? 25  LEU A CD2   1 
ATOM   1400 N  N     . THR C 2 26  ? 14.104  16.257  16.019  1.00 51.22  ? 26  THR A N     1 
ATOM   1401 C  CA    . THR C 2 26  ? 13.457  16.396  14.724  1.00 48.62  ? 26  THR A CA    1 
ATOM   1402 C  C     . THR C 2 26  ? 12.132  15.686  14.512  1.00 52.76  ? 26  THR A C     1 
ATOM   1403 O  O     . THR C 2 26  ? 12.028  14.467  14.658  1.00 51.83  ? 26  THR A O     1 
ATOM   1404 C  CB    . THR C 2 26  ? 14.387  15.948  13.636  1.00 48.53  ? 26  THR A CB    1 
ATOM   1405 O  OG1   . THR C 2 26  ? 15.656  16.583  13.824  1.00 48.68  ? 26  THR A OG1   1 
ATOM   1406 C  CG2   . THR C 2 26  ? 13.820  16.316  12.281  1.00 52.21  ? 26  THR A CG2   1 
ATOM   1407 N  N     . HIS C 2 27  ? 11.128  16.470  14.129  1.00 52.13  ? 27  HIS A N     1 
ATOM   1408 C  CA    . HIS C 2 27  ? 9.790   15.963  13.877  1.00 49.03  ? 27  HIS A CA    1 
ATOM   1409 C  C     . HIS C 2 27  ? 9.744   15.425  12.450  1.00 51.59  ? 27  HIS A C     1 
ATOM   1410 O  O     . HIS C 2 27  ? 10.540  15.824  11.604  1.00 50.72  ? 27  HIS A O     1 
ATOM   1411 C  CB    . HIS C 2 27  ? 8.785   17.097  14.074  1.00 49.13  ? 27  HIS A CB    1 
ATOM   1412 C  CG    . HIS C 2 27  ? 7.352   16.678  13.958  1.00 55.21  ? 27  HIS A CG    1 
ATOM   1413 N  ND1   . HIS C 2 27  ? 6.679   16.034  14.976  1.00 58.22  ? 27  HIS A ND1   1 
ATOM   1414 C  CD2   . HIS C 2 27  ? 6.470   16.792  12.937  1.00 47.42  ? 27  HIS A CD2   1 
ATOM   1415 C  CE1   . HIS C 2 27  ? 5.447   15.769  14.585  1.00 52.85  ? 27  HIS A CE1   1 
ATOM   1416 N  NE2   . HIS C 2 27  ? 5.294   16.218  13.352  1.00 49.35  ? 27  HIS A NE2   1 
ATOM   1417 N  N     . VAL C 2 28  ? 8.820   14.506  12.197  1.00 51.09  ? 28  VAL A N     1 
ATOM   1418 C  CA    . VAL C 2 28  ? 8.667   13.893  10.886  1.00 48.35  ? 28  VAL A CA    1 
ATOM   1419 C  C     . VAL C 2 28  ? 8.561   14.867  9.718   1.00 47.40  ? 28  VAL A C     1 
ATOM   1420 O  O     . VAL C 2 28  ? 9.201   14.673  8.694   1.00 46.67  ? 28  VAL A O     1 
ATOM   1421 C  CB    . VAL C 2 28  ? 7.427   12.969  10.858  1.00 48.84  ? 28  VAL A CB    1 
ATOM   1422 C  CG1   . VAL C 2 28  ? 6.219   13.720  11.372  1.00 44.99  ? 28  VAL A CG1   1 
ATOM   1423 C  CG2   . VAL C 2 28  ? 7.170   12.471  9.439   1.00 49.16  ? 28  VAL A CG2   1 
ATOM   1424 N  N     . SER C 2 29  ? 7.749   15.906  9.851   1.00 51.69  ? 29  SER A N     1 
ATOM   1425 C  CA    . SER C 2 29  ? 7.591   16.859  8.748   1.00 53.77  ? 29  SER A CA    1 
ATOM   1426 C  C     . SER C 2 29  ? 8.903   17.516  8.331   1.00 53.46  ? 29  SER A C     1 
ATOM   1427 O  O     . SER C 2 29  ? 9.117   17.780  7.155   1.00 56.01  ? 29  SER A O     1 
ATOM   1428 C  CB    . SER C 2 29  ? 6.582   17.949  9.106   1.00 51.92  ? 29  SER A CB    1 
ATOM   1429 O  OG    . SER C 2 29  ? 7.069   18.780  10.149  1.00 54.44  ? 29  SER A OG    1 
ATOM   1430 N  N     . TYR C 2 30  ? 9.781   17.776  9.292   1.00 56.20  ? 30  TYR A N     1 
ATOM   1431 C  CA    . TYR C 2 30  ? 11.060  18.413  8.998   1.00 55.76  ? 30  TYR A CA    1 
ATOM   1432 C  C     . TYR C 2 30  ? 12.034  17.472  8.302   1.00 60.00  ? 30  TYR A C     1 
ATOM   1433 O  O     . TYR C 2 30  ? 12.880  17.923  7.530   1.00 65.40  ? 30  TYR A O     1 
ATOM   1434 C  CB    . TYR C 2 30  ? 11.676  18.957  10.286  1.00 54.17  ? 30  TYR A CB    1 
ATOM   1435 C  CG    . TYR C 2 30  ? 12.948  19.764  10.101  1.00 56.07  ? 30  TYR A CG    1 
ATOM   1436 C  CD1   . TYR C 2 30  ? 14.177  19.132  9.905   1.00 53.31  ? 30  TYR A CD1   1 
ATOM   1437 C  CD2   . TYR C 2 30  ? 12.926  21.162  10.155  1.00 56.87  ? 30  TYR A CD2   1 
ATOM   1438 C  CE1   . TYR C 2 30  ? 15.351  19.864  9.773   1.00 54.94  ? 30  TYR A CE1   1 
ATOM   1439 C  CE2   . TYR C 2 30  ? 14.099  21.906  10.021  1.00 58.89  ? 30  TYR A CE2   1 
ATOM   1440 C  CZ    . TYR C 2 30  ? 15.310  21.249  9.831   1.00 59.64  ? 30  TYR A CZ    1 
ATOM   1441 O  OH    . TYR C 2 30  ? 16.480  21.970  9.698   1.00 58.57  ? 30  TYR A OH    1 
ATOM   1442 N  N     . SER C 2 31  ? 11.915  16.172  8.569   1.00 59.07  ? 31  SER A N     1 
ATOM   1443 C  CA    . SER C 2 31  ? 12.782  15.162  7.953   1.00 56.65  ? 31  SER A CA    1 
ATOM   1444 C  C     . SER C 2 31  ? 12.116  13.791  7.959   1.00 56.67  ? 31  SER A C     1 
ATOM   1445 O  O     . SER C 2 31  ? 11.846  13.232  9.021   1.00 59.06  ? 31  SER A O     1 
ATOM   1446 C  CB    . SER C 2 31  ? 14.118  15.081  8.697   1.00 53.96  ? 31  SER A CB    1 
ATOM   1447 O  OG    . SER C 2 31  ? 14.710  13.803  8.522   1.00 48.66  ? 31  SER A OG    1 
ATOM   1448 N  N     . LYS C 2 32  ? 11.861  13.245  6.775   1.00 57.34  ? 32  LYS A N     1 
ATOM   1449 C  CA    . LYS C 2 32  ? 11.217  11.939  6.664   1.00 58.58  ? 32  LYS A CA    1 
ATOM   1450 C  C     . LYS C 2 32  ? 12.135  10.766  7.031   1.00 57.36  ? 32  LYS A C     1 
ATOM   1451 O  O     . LYS C 2 32  ? 11.658  9.706   7.417   1.00 55.33  ? 32  LYS A O     1 
ATOM   1452 C  CB    . LYS C 2 32  ? 10.672  11.743  5.239   1.00 59.67  ? 32  LYS A CB    1 
ATOM   1453 C  CG    . LYS C 2 32  ? 11.746  11.582  4.161   1.00 64.79  ? 32  LYS A CG    1 
ATOM   1454 C  CD    . LYS C 2 32  ? 11.484  12.462  2.937   1.00 67.76  ? 32  LYS A CD    1 
ATOM   1455 C  CE    . LYS C 2 32  ? 12.447  13.661  2.846   1.00 65.58  ? 32  LYS A CE    1 
ATOM   1456 N  NZ    . LYS C 2 32  ? 12.291  14.652  3.950   1.00 56.83  ? 32  LYS A NZ    1 
ATOM   1457 N  N     . LYS C 2 33  ? 13.449  10.963  6.935   1.00 61.02  ? 33  LYS A N     1 
ATOM   1458 C  CA    . LYS C 2 33  ? 14.410  9.892   7.224   1.00 60.59  ? 33  LYS A CA    1 
ATOM   1459 C  C     . LYS C 2 33  ? 14.879  9.807   8.674   1.00 57.12  ? 33  LYS A C     1 
ATOM   1460 O  O     . LYS C 2 33  ? 14.854  8.736   9.276   1.00 57.51  ? 33  LYS A O     1 
ATOM   1461 C  CB    . LYS C 2 33  ? 15.643  10.024  6.319   1.00 65.27  ? 33  LYS A CB    1 
ATOM   1462 C  CG    . LYS C 2 33  ? 15.329  10.271  4.846   1.00 74.08  ? 33  LYS A CG    1 
ATOM   1463 C  CD    . LYS C 2 33  ? 14.732  9.051   4.169   1.00 78.95  ? 33  LYS A CD    1 
ATOM   1464 C  CE    . LYS C 2 33  ? 15.824  8.115   3.688   1.00 81.94  ? 33  LYS A CE    1 
ATOM   1465 N  NZ    . LYS C 2 33  ? 16.828  7.862   4.754   1.00 85.08  ? 33  LYS A NZ    1 
ATOM   1466 N  N     . GLU C 2 34  ? 15.304  10.926  9.242   1.00 55.79  ? 34  GLU A N     1 
ATOM   1467 C  CA    . GLU C 2 34  ? 15.797  10.903  10.612  1.00 55.68  ? 34  GLU A CA    1 
ATOM   1468 C  C     . GLU C 2 34  ? 15.016  11.768  11.607  1.00 51.03  ? 34  GLU A C     1 
ATOM   1469 O  O     . GLU C 2 34  ? 15.351  12.936  11.813  1.00 47.21  ? 34  GLU A O     1 
ATOM   1470 C  CB    . GLU C 2 34  ? 17.277  11.296  10.609  1.00 62.08  ? 34  GLU A CB    1 
ATOM   1471 C  CG    . GLU C 2 34  ? 18.144  10.396  9.740   1.00 72.36  ? 34  GLU A CG    1 
ATOM   1472 C  CD    . GLU C 2 34  ? 18.475  9.034   10.378  1.00 81.72  ? 34  GLU A CD    1 
ATOM   1473 O  OE1   . GLU C 2 34  ? 18.971  9.017   11.526  1.00 88.26  ? 34  GLU A OE1   1 
ATOM   1474 O  OE2   . GLU C 2 34  ? 18.230  7.983   9.738   1.00 80.21  ? 34  GLU A OE2   1 
ATOM   1475 N  N     . HIS C 2 35  ? 13.982  11.183  12.218  1.00 45.78  ? 35  HIS A N     1 
ATOM   1476 C  CA    . HIS C 2 35  ? 13.159  11.886  13.200  1.00 49.00  ? 35  HIS A CA    1 
ATOM   1477 C  C     . HIS C 2 35  ? 12.986  11.068  14.507  1.00 46.51  ? 35  HIS A C     1 
ATOM   1478 O  O     . HIS C 2 35  ? 13.476  9.944   14.618  1.00 48.24  ? 35  HIS A O     1 
ATOM   1479 C  CB    . HIS C 2 35  ? 11.829  12.292  12.613  1.00 46.44  ? 35  HIS A CB    1 
ATOM   1480 C  CG    . HIS C 2 35  ? 10.973  11.087  12.200  1.00 47.23  ? 35  HIS A CG    1 
ATOM   1481 N  ND1   . HIS C 2 35  ? 10.257  10.328  13.099  1.00 50.02  ? 35  HIS A ND1   1 
ATOM   1482 C  CD2   . HIS C 2 35  ? 10.753  10.538  10.983  1.00 45.23  ? 35  HIS A CD2   1 
ATOM   1483 C  CE1   . HIS C 2 35  ? 9.630   9.362   12.452  1.00 50.05  ? 35  HIS A CE1   1 
ATOM   1484 N  NE2   . HIS C 2 35  ? 9.914   9.467   11.166  1.00 50.25  ? 35  HIS A NE2   1 
ATOM   1485 N  N     . TYR C 2 36  ? 12.275  11.665  15.465  1.00 47.67  ? 36  TYR A N     1 
ATOM   1486 C  CA    . TYR C 2 36  ? 12.202  11.075  16.813  1.00 49.04  ? 36  TYR A CA    1 
ATOM   1487 C  C     . TYR C 2 36  ? 11.202  9.947   17.108  1.00 50.94  ? 36  TYR A C     1 
ATOM   1488 O  O     . TYR C 2 36  ? 11.160  9.459   18.236  1.00 51.12  ? 36  TYR A O     1 
ATOM   1489 C  CB    . TYR C 2 36  ? 11.992  12.206  17.825  1.00 44.81  ? 36  TYR A CB    1 
ATOM   1490 C  CG    . TYR C 2 36  ? 10.638  12.852  17.777  1.00 47.28  ? 36  TYR A CG    1 
ATOM   1491 C  CD1   . TYR C 2 36  ? 9.472   12.167  18.122  1.00 47.27  ? 36  TYR A CD1   1 
ATOM   1492 C  CD2   . TYR C 2 36  ? 10.522  14.181  17.359  1.00 49.17  ? 36  TYR A CD2   1 
ATOM   1493 C  CE1   . TYR C 2 36  ? 8.233   12.777  18.056  1.00 45.22  ? 36  TYR A CE1   1 
ATOM   1494 C  CE2   . TYR C 2 36  ? 9.283   14.802  17.288  1.00 46.75  ? 36  TYR A CE2   1 
ATOM   1495 C  CZ    . TYR C 2 36  ? 8.143   14.094  17.636  1.00 52.27  ? 36  TYR A CZ    1 
ATOM   1496 O  OH    . TYR C 2 36  ? 6.905   14.691  17.548  1.00 55.38  ? 36  TYR A OH    1 
ATOM   1497 N  N     . GLU C 2 37  ? 10.406  9.508   16.145  1.00 53.27  ? 37  GLU A N     1 
ATOM   1498 C  CA    . GLU C 2 37  ? 9.413   8.462   16.460  1.00 50.46  ? 37  GLU A CA    1 
ATOM   1499 C  C     . GLU C 2 37  ? 9.946   7.224   17.211  1.00 45.86  ? 37  GLU A C     1 
ATOM   1500 O  O     . GLU C 2 37  ? 9.416   6.861   18.262  1.00 45.12  ? 37  GLU A O     1 
ATOM   1501 C  CB    . GLU C 2 37  ? 8.741   8.019   15.157  1.00 53.05  ? 37  GLU A CB    1 
ATOM   1502 C  CG    . GLU C 2 37  ? 7.380   7.369   15.322  1.00 58.21  ? 37  GLU A CG    1 
ATOM   1503 C  CD    . GLU C 2 37  ? 6.849   6.815   14.011  1.00 65.51  ? 37  GLU A CD    1 
ATOM   1504 O  OE1   . GLU C 2 37  ? 6.698   7.599   13.052  1.00 75.20  ? 37  GLU A OE1   1 
ATOM   1505 O  OE2   . GLU C 2 37  ? 6.582   5.598   13.958  1.00 67.44  ? 37  GLU A OE2   1 
ATOM   1506 N  N     . THR C 2 38  ? 10.995  6.587   16.700  1.00 44.07  ? 38  THR A N     1 
ATOM   1507 C  CA    . THR C 2 38  ? 11.517  5.386   17.356  1.00 48.49  ? 38  THR A CA    1 
ATOM   1508 C  C     . THR C 2 38  ? 12.140  5.632   18.730  1.00 48.42  ? 38  THR A C     1 
ATOM   1509 O  O     . THR C 2 38  ? 12.016  4.805   19.636  1.00 48.61  ? 38  THR A O     1 
ATOM   1510 C  CB    . THR C 2 38  ? 12.567  4.646   16.495  1.00 50.61  ? 38  THR A CB    1 
ATOM   1511 O  OG1   . THR C 2 38  ? 12.342  4.901   15.104  1.00 52.61  ? 38  THR A OG1   1 
ATOM   1512 C  CG2   . THR C 2 38  ? 12.460  3.145   16.738  1.00 48.89  ? 38  THR A CG2   1 
ATOM   1513 N  N     . LEU C 2 39  ? 12.821  6.761   18.878  1.00 49.82  ? 39  LEU A N     1 
ATOM   1514 C  CA    . LEU C 2 39  ? 13.445  7.121   20.148  1.00 45.33  ? 39  LEU A CA    1 
ATOM   1515 C  C     . LEU C 2 39  ? 12.380  7.344   21.226  1.00 44.95  ? 39  LEU A C     1 
ATOM   1516 O  O     . LEU C 2 39  ? 12.550  6.955   22.387  1.00 41.36  ? 39  LEU A O     1 
ATOM   1517 C  CB    . LEU C 2 39  ? 14.266  8.394   19.974  1.00 46.37  ? 39  LEU A CB    1 
ATOM   1518 C  CG    . LEU C 2 39  ? 15.512  8.272   19.105  1.00 48.92  ? 39  LEU A CG    1 
ATOM   1519 C  CD1   . LEU C 2 39  ? 15.990  9.662   18.693  1.00 51.98  ? 39  LEU A CD1   1 
ATOM   1520 C  CD2   . LEU C 2 39  ? 16.590  7.525   19.887  1.00 46.40  ? 39  LEU A CD2   1 
ATOM   1521 N  N     . GLU C 2 40  ? 11.281  7.983   20.842  1.00 42.95  ? 40  GLU A N     1 
ATOM   1522 C  CA    . GLU C 2 40  ? 10.208  8.237   21.794  1.00 46.04  ? 40  GLU A CA    1 
ATOM   1523 C  C     . GLU C 2 40  ? 9.666   6.898   22.298  1.00 41.75  ? 40  GLU A C     1 
ATOM   1524 O  O     . GLU C 2 40  ? 9.243   6.779   23.449  1.00 40.73  ? 40  GLU A O     1 
ATOM   1525 C  CB    . GLU C 2 40  ? 9.103   9.072   21.127  1.00 46.22  ? 40  GLU A CB    1 
ATOM   1526 C  CG    . GLU C 2 40  ? 7.899   9.389   22.008  1.00 50.80  ? 40  GLU A CG    1 
ATOM   1527 C  CD    . GLU C 2 40  ? 6.795   8.346   21.894  1.00 52.05  ? 40  GLU A CD    1 
ATOM   1528 O  OE1   . GLU C 2 40  ? 6.540   7.872   20.769  1.00 51.75  ? 40  GLU A OE1   1 
ATOM   1529 O  OE2   . GLU C 2 40  ? 6.169   8.010   22.922  1.00 61.45  ? 40  GLU A OE2   1 
ATOM   1530 N  N     . PHE C 2 41  ? 9.688   5.893   21.427  1.00 41.09  ? 41  PHE A N     1 
ATOM   1531 C  CA    . PHE C 2 41  ? 9.224   4.564   21.787  1.00 40.98  ? 41  PHE A CA    1 
ATOM   1532 C  C     . PHE C 2 41  ? 10.092  4.070   22.951  1.00 41.33  ? 41  PHE A C     1 
ATOM   1533 O  O     . PHE C 2 41  ? 9.578   3.700   24.000  1.00 42.20  ? 41  PHE A O     1 
ATOM   1534 C  CB    . PHE C 2 41  ? 9.360   3.636   20.579  1.00 43.57  ? 41  PHE A CB    1 
ATOM   1535 C  CG    . PHE C 2 41  ? 8.760   2.271   20.782  1.00 41.61  ? 41  PHE A CG    1 
ATOM   1536 C  CD1   . PHE C 2 41  ? 7.387   2.111   20.901  1.00 46.83  ? 41  PHE A CD1   1 
ATOM   1537 C  CD2   . PHE C 2 41  ? 9.574   1.145   20.866  1.00 46.16  ? 41  PHE A CD2   1 
ATOM   1538 C  CE1   . PHE C 2 41  ? 6.827   0.837   21.105  1.00 53.88  ? 41  PHE A CE1   1 
ATOM   1539 C  CE2   . PHE C 2 41  ? 9.033   -0.132  21.070  1.00 48.64  ? 41  PHE A CE2   1 
ATOM   1540 C  CZ    . PHE C 2 41  ? 7.656   -0.287  21.190  1.00 51.41  ? 41  PHE A CZ    1 
ATOM   1541 N  N     . LEU C 2 42  ? 11.411  4.091   22.759  1.00 41.34  ? 42  LEU A N     1 
ATOM   1542 C  CA    . LEU C 2 42  ? 12.367  3.668   23.780  1.00 36.84  ? 42  LEU A CA    1 
ATOM   1543 C  C     . LEU C 2 42  ? 12.367  4.589   24.992  1.00 38.44  ? 42  LEU A C     1 
ATOM   1544 O  O     . LEU C 2 42  ? 12.443  4.134   26.136  1.00 42.01  ? 42  LEU A O     1 
ATOM   1545 C  CB    . LEU C 2 42  ? 13.771  3.624   23.184  1.00 34.84  ? 42  LEU A CB    1 
ATOM   1546 C  CG    . LEU C 2 42  ? 14.989  3.483   24.105  1.00 34.02  ? 42  LEU A CG    1 
ATOM   1547 C  CD1   . LEU C 2 42  ? 14.897  2.222   24.937  1.00 35.93  ? 42  LEU A CD1   1 
ATOM   1548 C  CD2   . LEU C 2 42  ? 16.241  3.448   23.243  1.00 27.02  ? 42  LEU A CD2   1 
ATOM   1549 N  N     . GLY C 2 43  ? 12.286  5.890   24.740  1.00 37.21  ? 43  GLY A N     1 
ATOM   1550 C  CA    . GLY C 2 43  ? 12.282  6.839   25.833  1.00 35.80  ? 43  GLY A CA    1 
ATOM   1551 C  C     . GLY C 2 43  ? 11.119  6.622   26.774  1.00 42.47  ? 43  GLY A C     1 
ATOM   1552 O  O     . GLY C 2 43  ? 11.243  6.837   27.983  1.00 44.23  ? 43  GLY A O     1 
ATOM   1553 N  N     . ASP C 2 44  ? 9.987   6.198   26.215  1.00 44.81  ? 44  ASP A N     1 
ATOM   1554 C  CA    . ASP C 2 44  ? 8.774   5.957   26.979  1.00 47.48  ? 44  ASP A CA    1 
ATOM   1555 C  C     . ASP C 2 44  ? 9.053   4.956   28.103  1.00 48.34  ? 44  ASP A C     1 
ATOM   1556 O  O     . ASP C 2 44  ? 8.653   5.157   29.248  1.00 52.82  ? 44  ASP A O     1 
ATOM   1557 C  CB    . ASP C 2 44  ? 7.696   5.414   26.038  1.00 61.07  ? 44  ASP A CB    1 
ATOM   1558 C  CG    . ASP C 2 44  ? 6.311   5.966   26.341  1.00 69.78  ? 44  ASP A CG    1 
ATOM   1559 O  OD1   . ASP C 2 44  ? 5.868   5.837   27.504  1.00 76.47  ? 44  ASP A OD1   1 
ATOM   1560 O  OD2   . ASP C 2 44  ? 5.664   6.519   25.415  1.00 67.32  ? 44  ASP A OD2   1 
ATOM   1561 N  N     . ALA C 2 45  ? 9.759   3.883   27.764  1.00 47.35  ? 45  ALA A N     1 
ATOM   1562 C  CA    . ALA C 2 45  ? 10.101  2.827   28.717  1.00 47.35  ? 45  ALA A CA    1 
ATOM   1563 C  C     . ALA C 2 45  ? 11.119  3.286   29.753  1.00 45.29  ? 45  ALA A C     1 
ATOM   1564 O  O     . ALA C 2 45  ? 10.948  3.071   30.952  1.00 45.36  ? 45  ALA A O     1 
ATOM   1565 C  CB    . ALA C 2 45  ? 10.645  1.621   27.968  1.00 52.45  ? 45  ALA A CB    1 
ATOM   1566 N  N     . LEU C 2 46  ? 12.185  3.909   29.275  1.00 43.76  ? 46  LEU A N     1 
ATOM   1567 C  CA    . LEU C 2 46  ? 13.236  4.403   30.144  1.00 43.21  ? 46  LEU A CA    1 
ATOM   1568 C  C     . LEU C 2 46  ? 12.668  5.280   31.258  1.00 40.98  ? 46  LEU A C     1 
ATOM   1569 O  O     . LEU C 2 46  ? 12.881  5.026   32.450  1.00 38.28  ? 46  LEU A O     1 
ATOM   1570 C  CB    . LEU C 2 46  ? 14.236  5.205   29.324  1.00 42.78  ? 46  LEU A CB    1 
ATOM   1571 C  CG    . LEU C 2 46  ? 15.560  5.379   30.053  1.00 50.91  ? 46  LEU A CG    1 
ATOM   1572 C  CD1   . LEU C 2 46  ? 16.228  4.005   30.232  1.00 43.69  ? 46  LEU A CD1   1 
ATOM   1573 C  CD2   . LEU C 2 46  ? 16.458  6.315   29.257  1.00 53.11  ? 46  LEU A CD2   1 
ATOM   1574 N  N     . VAL C 2 47  ? 11.918  6.302   30.862  1.00 43.32  ? 47  VAL A N     1 
ATOM   1575 C  CA    . VAL C 2 47  ? 11.330  7.243   31.812  1.00 38.92  ? 47  VAL A CA    1 
ATOM   1576 C  C     . VAL C 2 47  ? 10.294  6.606   32.710  1.00 37.95  ? 47  VAL A C     1 
ATOM   1577 O  O     . VAL C 2 47  ? 10.235  6.893   33.913  1.00 35.93  ? 47  VAL A O     1 
ATOM   1578 C  CB    . VAL C 2 47  ? 10.716  8.427   31.071  1.00 33.56  ? 47  VAL A CB    1 
ATOM   1579 C  CG1   . VAL C 2 47  ? 9.920   9.284   32.006  1.00 36.11  ? 47  VAL A CG1   1 
ATOM   1580 C  CG2   . VAL C 2 47  ? 11.821  9.243   30.458  1.00 35.66  ? 47  VAL A CG2   1 
ATOM   1581 N  N     . ASN C 2 48  ? 9.473   5.744   32.124  1.00 37.10  ? 48  ASN A N     1 
ATOM   1582 C  CA    . ASN C 2 48  ? 8.450   5.054   32.892  1.00 36.76  ? 48  ASN A CA    1 
ATOM   1583 C  C     . ASN C 2 48  ? 9.167   4.419   34.069  1.00 39.56  ? 48  ASN A C     1 
ATOM   1584 O  O     . ASN C 2 48  ? 8.753   4.550   35.226  1.00 40.41  ? 48  ASN A O     1 
ATOM   1585 C  CB    . ASN C 2 48  ? 7.821   3.961   32.054  1.00 39.56  ? 48  ASN A CB    1 
ATOM   1586 C  CG    . ASN C 2 48  ? 6.591   3.396   32.690  1.00 46.61  ? 48  ASN A CG    1 
ATOM   1587 O  OD1   . ASN C 2 48  ? 5.513   3.989   32.609  1.00 51.37  ? 48  ASN A OD1   1 
ATOM   1588 N  ND2   . ASN C 2 48  ? 6.736   2.251   33.349  1.00 43.55  ? 48  ASN A ND2   1 
ATOM   1589 N  N     . PHE C 2 49  ? 10.259  3.731   33.750  1.00 39.72  ? 49  PHE A N     1 
ATOM   1590 C  CA    . PHE C 2 49  ? 11.095  3.068   34.746  1.00 41.75  ? 49  PHE A CA    1 
ATOM   1591 C  C     . PHE C 2 49  ? 11.678  4.041   35.798  1.00 39.66  ? 49  PHE A C     1 
ATOM   1592 O  O     . PHE C 2 49  ? 11.754  3.722   36.989  1.00 38.63  ? 49  PHE A O     1 
ATOM   1593 C  CB    . PHE C 2 49  ? 12.211  2.308   34.025  1.00 39.90  ? 49  PHE A CB    1 
ATOM   1594 C  CG    . PHE C 2 49  ? 13.335  1.919   34.904  1.00 41.91  ? 49  PHE A CG    1 
ATOM   1595 C  CD1   . PHE C 2 49  ? 13.098  1.302   36.125  1.00 43.75  ? 49  PHE A CD1   1 
ATOM   1596 C  CD2   . PHE C 2 49  ? 14.647  2.185   34.523  1.00 48.37  ? 49  PHE A CD2   1 
ATOM   1597 C  CE1   . PHE C 2 49  ? 14.163  0.955   36.970  1.00 46.88  ? 49  PHE A CE1   1 
ATOM   1598 C  CE2   . PHE C 2 49  ? 15.712  1.845   35.351  1.00 49.26  ? 49  PHE A CE2   1 
ATOM   1599 C  CZ    . PHE C 2 49  ? 15.466  1.227   36.584  1.00 47.25  ? 49  PHE A CZ    1 
ATOM   1600 N  N     . PHE C 2 50  ? 12.069  5.234   35.367  1.00 37.14  ? 50  PHE A N     1 
ATOM   1601 C  CA    . PHE C 2 50  ? 12.613  6.200   36.306  1.00 35.56  ? 50  PHE A CA    1 
ATOM   1602 C  C     . PHE C 2 50  ? 11.567  6.669   37.292  1.00 40.50  ? 50  PHE A C     1 
ATOM   1603 O  O     . PHE C 2 50  ? 11.835  6.752   38.495  1.00 43.01  ? 50  PHE A O     1 
ATOM   1604 C  CB    . PHE C 2 50  ? 13.199  7.388   35.559  1.00 33.38  ? 50  PHE A CB    1 
ATOM   1605 C  CG    . PHE C 2 50  ? 14.349  7.022   34.678  1.00 35.85  ? 50  PHE A CG    1 
ATOM   1606 C  CD1   . PHE C 2 50  ? 15.050  5.833   34.889  1.00 31.83  ? 50  PHE A CD1   1 
ATOM   1607 C  CD2   . PHE C 2 50  ? 14.733  7.848   33.630  1.00 36.30  ? 50  PHE A CD2   1 
ATOM   1608 C  CE1   . PHE C 2 50  ? 16.116  5.467   34.064  1.00 28.15  ? 50  PHE A CE1   1 
ATOM   1609 C  CE2   . PHE C 2 50  ? 15.805  7.487   32.802  1.00 36.33  ? 50  PHE A CE2   1 
ATOM   1610 C  CZ    . PHE C 2 50  ? 16.493  6.286   33.029  1.00 31.27  ? 50  PHE A CZ    1 
ATOM   1611 N  N     . ILE C 2 51  ? 10.367  6.965   36.791  1.00 43.71  ? 51  ILE A N     1 
ATOM   1612 C  CA    . ILE C 2 51  ? 9.260   7.428   37.639  1.00 37.26  ? 51  ILE A CA    1 
ATOM   1613 C  C     . ILE C 2 51  ? 8.822   6.320   38.583  1.00 34.96  ? 51  ILE A C     1 
ATOM   1614 O  O     . ILE C 2 51  ? 8.658   6.533   39.782  1.00 37.80  ? 51  ILE A O     1 
ATOM   1615 C  CB    . ILE C 2 51  ? 8.045   7.862   36.787  1.00 38.25  ? 51  ILE A CB    1 
ATOM   1616 C  CG1   . ILE C 2 51  ? 8.456   8.993   35.849  1.00 41.34  ? 51  ILE A CG1   1 
ATOM   1617 C  CG2   . ILE C 2 51  ? 6.911   8.332   37.671  1.00 34.03  ? 51  ILE A CG2   1 
ATOM   1618 C  CD1   . ILE C 2 51  ? 9.015   10.184  36.567  1.00 45.29  ? 51  ILE A CD1   1 
ATOM   1619 N  N     . VAL C 2 52  ? 8.638   5.123   38.051  1.00 36.18  ? 52  VAL A N     1 
ATOM   1620 C  CA    . VAL C 2 52  ? 8.216   4.028   38.901  1.00 38.94  ? 52  VAL A CA    1 
ATOM   1621 C  C     . VAL C 2 52  ? 9.191   3.796   40.054  1.00 39.64  ? 52  VAL A C     1 
ATOM   1622 O  O     . VAL C 2 52  ? 8.786   3.669   41.203  1.00 38.79  ? 52  VAL A O     1 
ATOM   1623 C  CB    . VAL C 2 52  ? 8.033   2.728   38.079  1.00 42.19  ? 52  VAL A CB    1 
ATOM   1624 C  CG1   . VAL C 2 52  ? 8.110   1.496   38.995  1.00 35.72  ? 52  VAL A CG1   1 
ATOM   1625 C  CG2   . VAL C 2 52  ? 6.679   2.766   37.363  1.00 37.80  ? 52  VAL A CG2   1 
ATOM   1626 N  N     . ASP C 2 53  ? 10.480  3.756   39.756  1.00 41.70  ? 53  ASP A N     1 
ATOM   1627 C  CA    . ASP C 2 53  ? 11.453  3.527   40.807  1.00 41.63  ? 53  ASP A CA    1 
ATOM   1628 C  C     . ASP C 2 53  ? 11.264  4.520   41.957  1.00 41.76  ? 53  ASP A C     1 
ATOM   1629 O  O     . ASP C 2 53  ? 11.303  4.127   43.113  1.00 45.93  ? 53  ASP A O     1 
ATOM   1630 C  CB    . ASP C 2 53  ? 12.876  3.614   40.246  1.00 50.97  ? 53  ASP A CB    1 
ATOM   1631 C  CG    . ASP C 2 53  ? 13.890  2.951   41.151  1.00 53.14  ? 53  ASP A CG    1 
ATOM   1632 O  OD1   . ASP C 2 53  ? 13.468  2.432   42.205  1.00 58.51  ? 53  ASP A OD1   1 
ATOM   1633 O  OD2   . ASP C 2 53  ? 15.093  2.946   40.816  1.00 53.40  ? 53  ASP A OD2   1 
ATOM   1634 N  N     . LEU C 2 54  ? 11.057  5.799   41.655  1.00 38.27  ? 54  LEU A N     1 
ATOM   1635 C  CA    . LEU C 2 54  ? 10.842  6.791   42.712  1.00 38.89  ? 54  LEU A CA    1 
ATOM   1636 C  C     . LEU C 2 54  ? 9.506   6.583   43.415  1.00 46.78  ? 54  LEU A C     1 
ATOM   1637 O  O     . LEU C 2 54  ? 9.419   6.605   44.645  1.00 49.28  ? 54  LEU A O     1 
ATOM   1638 C  CB    . LEU C 2 54  ? 10.841  8.215   42.159  1.00 29.03  ? 54  LEU A CB    1 
ATOM   1639 C  CG    . LEU C 2 54  ? 12.154  8.864   41.749  1.00 37.84  ? 54  LEU A CG    1 
ATOM   1640 C  CD1   . LEU C 2 54  ? 11.910  10.340  41.433  1.00 40.45  ? 54  LEU A CD1   1 
ATOM   1641 C  CD2   . LEU C 2 54  ? 13.166  8.737   42.885  1.00 44.95  ? 54  LEU A CD2   1 
ATOM   1642 N  N     . LEU C 2 55  ? 8.456   6.406   42.622  1.00 46.97  ? 55  LEU A N     1 
ATOM   1643 C  CA    . LEU C 2 55  ? 7.126   6.217   43.169  1.00 44.35  ? 55  LEU A CA    1 
ATOM   1644 C  C     . LEU C 2 55  ? 7.103   5.152   44.248  1.00 47.00  ? 55  LEU A C     1 
ATOM   1645 O  O     . LEU C 2 55  ? 6.538   5.362   45.318  1.00 50.59  ? 55  LEU A O     1 
ATOM   1646 C  CB    . LEU C 2 55  ? 6.166   5.815   42.065  1.00 41.64  ? 55  LEU A CB    1 
ATOM   1647 C  CG    . LEU C 2 55  ? 4.932   6.659   41.790  1.00 38.56  ? 55  LEU A CG    1 
ATOM   1648 C  CD1   . LEU C 2 55  ? 4.056   5.823   40.862  1.00 30.35  ? 55  LEU A CD1   1 
ATOM   1649 C  CD2   . LEU C 2 55  ? 4.179   7.013   43.076  1.00 28.98  ? 55  LEU A CD2   1 
ATOM   1650 N  N     . VAL C 2 56  ? 7.731   4.010   43.987  1.00 45.42  ? 56  VAL A N     1 
ATOM   1651 C  CA    . VAL C 2 56  ? 7.704   2.944   44.975  1.00 45.24  ? 56  VAL A CA    1 
ATOM   1652 C  C     . VAL C 2 56  ? 8.535   3.206   46.214  1.00 48.48  ? 56  VAL A C     1 
ATOM   1653 O  O     . VAL C 2 56  ? 8.298   2.609   47.260  1.00 50.70  ? 56  VAL A O     1 
ATOM   1654 C  CB    . VAL C 2 56  ? 8.129   1.588   44.378  1.00 45.10  ? 56  VAL A CB    1 
ATOM   1655 C  CG1   . VAL C 2 56  ? 7.228   1.247   43.206  1.00 41.03  ? 56  VAL A CG1   1 
ATOM   1656 C  CG2   . VAL C 2 56  ? 9.596   1.616   43.980  1.00 40.59  ? 56  VAL A CG2   1 
ATOM   1657 N  N     . GLN C 2 57  ? 9.506   4.100   46.124  1.00 52.62  ? 57  GLN A N     1 
ATOM   1658 C  CA    . GLN C 2 57  ? 10.307  4.374   47.300  1.00 55.20  ? 57  GLN A CA    1 
ATOM   1659 C  C     . GLN C 2 57  ? 9.703   5.469   48.167  1.00 58.49  ? 57  GLN A C     1 
ATOM   1660 O  O     . GLN C 2 57  ? 9.715   5.375   49.393  1.00 62.09  ? 57  GLN A O     1 
ATOM   1661 C  CB    . GLN C 2 57  ? 11.718  4.749   46.889  1.00 55.33  ? 57  GLN A CB    1 
ATOM   1662 C  CG    . GLN C 2 57  ? 12.331  3.720   45.987  1.00 59.55  ? 57  GLN A CG    1 
ATOM   1663 C  CD    . GLN C 2 57  ? 13.697  4.121   45.521  1.00 65.45  ? 57  GLN A CD    1 
ATOM   1664 O  OE1   . GLN C 2 57  ? 14.645  4.126   46.303  1.00 68.61  ? 57  GLN A OE1   1 
ATOM   1665 N  NE2   . GLN C 2 57  ? 13.812  4.479   44.240  1.00 65.01  ? 57  GLN A NE2   1 
ATOM   1666 N  N     . TYR C 2 58  ? 9.135   6.490   47.539  1.00 59.04  ? 58  TYR A N     1 
ATOM   1667 C  CA    . TYR C 2 58  ? 8.573   7.593   48.301  1.00 58.31  ? 58  TYR A CA    1 
ATOM   1668 C  C     . TYR C 2 58  ? 7.060   7.703   48.395  1.00 59.23  ? 58  TYR A C     1 
ATOM   1669 O  O     . TYR C 2 58  ? 6.568   8.485   49.207  1.00 59.73  ? 58  TYR A O     1 
ATOM   1670 C  CB    . TYR C 2 58  ? 9.133   8.904   47.766  1.00 59.38  ? 58  TYR A CB    1 
ATOM   1671 C  CG    . TYR C 2 58  ? 10.636  8.915   47.718  1.00 64.02  ? 58  TYR A CG    1 
ATOM   1672 C  CD1   . TYR C 2 58  ? 11.316  8.399   46.616  1.00 64.43  ? 58  TYR A CD1   1 
ATOM   1673 C  CD2   . TYR C 2 58  ? 11.385  9.386   48.793  1.00 65.15  ? 58  TYR A CD2   1 
ATOM   1674 C  CE1   . TYR C 2 58  ? 12.709  8.344   46.584  1.00 66.45  ? 58  TYR A CE1   1 
ATOM   1675 C  CE2   . TYR C 2 58  ? 12.779  9.339   48.772  1.00 69.56  ? 58  TYR A CE2   1 
ATOM   1676 C  CZ    . TYR C 2 58  ? 13.436  8.814   47.664  1.00 70.00  ? 58  TYR A CZ    1 
ATOM   1677 O  OH    . TYR C 2 58  ? 14.814  8.760   47.636  1.00 70.78  ? 58  TYR A OH    1 
ATOM   1678 N  N     . SER C 2 59  ? 6.303   6.951   47.601  1.00 56.38  ? 59  SER A N     1 
ATOM   1679 C  CA    . SER C 2 59  ? 4.859   7.099   47.714  1.00 61.53  ? 59  SER A CA    1 
ATOM   1680 C  C     . SER C 2 59  ? 4.378   6.816   49.135  1.00 65.07  ? 59  SER A C     1 
ATOM   1681 O  O     . SER C 2 59  ? 4.741   5.804   49.743  1.00 66.32  ? 59  SER A O     1 
ATOM   1682 C  CB    . SER C 2 59  ? 4.115   6.192   46.750  1.00 60.13  ? 59  SER A CB    1 
ATOM   1683 O  OG    . SER C 2 59  ? 2.727   6.433   46.883  1.00 58.00  ? 59  SER A OG    1 
ATOM   1684 N  N     . PRO C 2 60  ? 3.547   7.716   49.684  1.00 65.74  ? 60  PRO A N     1 
ATOM   1685 C  CA    . PRO C 2 60  ? 3.024   7.548   51.041  1.00 65.92  ? 60  PRO A CA    1 
ATOM   1686 C  C     . PRO C 2 60  ? 2.142   6.310   51.145  1.00 67.09  ? 60  PRO A C     1 
ATOM   1687 O  O     . PRO C 2 60  ? 2.207   5.567   52.127  1.00 71.15  ? 60  PRO A O     1 
ATOM   1688 C  CB    . PRO C 2 60  ? 2.262   8.848   51.274  1.00 60.81  ? 60  PRO A CB    1 
ATOM   1689 C  CG    . PRO C 2 60  ? 1.778   9.191   49.892  1.00 62.20  ? 60  PRO A CG    1 
ATOM   1690 C  CD    . PRO C 2 60  ? 2.973   8.909   49.037  1.00 61.80  ? 60  PRO A CD    1 
ATOM   1691 N  N     . ASN C 2 61  ? 1.328   6.088   50.119  1.00 65.17  ? 61  ASN A N     1 
ATOM   1692 C  CA    . ASN C 2 61  ? 0.433   4.936   50.073  1.00 61.57  ? 61  ASN A CA    1 
ATOM   1693 C  C     . ASN C 2 61  ? 0.926   3.998   48.973  1.00 60.05  ? 61  ASN A C     1 
ATOM   1694 O  O     . ASN C 2 61  ? 1.259   4.443   47.877  1.00 58.52  ? 61  ASN A O     1 
ATOM   1695 C  CB    . ASN C 2 61  ? -0.993  5.408   49.770  1.00 60.47  ? 61  ASN A CB    1 
ATOM   1696 C  CG    . ASN C 2 61  ? -1.965  4.262   49.603  1.00 62.60  ? 61  ASN A CG    1 
ATOM   1697 O  OD1   . ASN C 2 61  ? -1.695  3.313   48.873  1.00 61.25  ? 61  ASN A OD1   1 
ATOM   1698 N  ND2   . ASN C 2 61  ? -3.116  4.353   50.265  1.00 67.22  ? 61  ASN A ND2   1 
ATOM   1699 N  N     . LYS C 2 62  ? 0.980   2.701   49.258  1.00 60.69  ? 62  LYS A N     1 
ATOM   1700 C  CA    . LYS C 2 62  ? 1.443   1.738   48.257  1.00 63.01  ? 62  LYS A CA    1 
ATOM   1701 C  C     . LYS C 2 62  ? 0.389   0.751   47.752  1.00 64.75  ? 62  LYS A C     1 
ATOM   1702 O  O     . LYS C 2 62  ? 0.725   -0.352  47.329  1.00 62.99  ? 62  LYS A O     1 
ATOM   1703 C  CB    . LYS C 2 62  ? 2.650   0.964   48.787  1.00 61.26  ? 62  LYS A CB    1 
ATOM   1704 C  CG    . LYS C 2 62  ? 3.782   1.873   49.179  1.00 62.34  ? 62  LYS A CG    1 
ATOM   1705 C  CD    . LYS C 2 62  ? 5.072   1.135   49.374  1.00 60.72  ? 62  LYS A CD    1 
ATOM   1706 C  CE    . LYS C 2 62  ? 6.090   2.082   49.957  1.00 64.55  ? 62  LYS A CE    1 
ATOM   1707 N  NZ    . LYS C 2 62  ? 6.018   3.391   49.251  1.00 66.25  ? 62  LYS A NZ    1 
ATOM   1708 N  N     . ARG C 2 63  ? -0.880  1.151   47.798  1.00 65.65  ? 63  ARG A N     1 
ATOM   1709 C  CA    . ARG C 2 63  ? -1.972  0.317   47.321  1.00 64.99  ? 63  ARG A CA    1 
ATOM   1710 C  C     . ARG C 2 63  ? -2.030  0.473   45.802  1.00 65.79  ? 63  ARG A C     1 
ATOM   1711 O  O     . ARG C 2 63  ? -1.814  1.564   45.272  1.00 65.13  ? 63  ARG A O     1 
ATOM   1712 C  CB    . ARG C 2 63  ? -3.292  0.769   47.954  1.00 68.97  ? 63  ARG A CB    1 
ATOM   1713 C  CG    . ARG C 2 63  ? -3.382  0.537   49.461  1.00 76.96  ? 63  ARG A CG    1 
ATOM   1714 C  CD    . ARG C 2 63  ? -4.397  1.482   50.105  1.00 86.16  ? 63  ARG A CD    1 
ATOM   1715 N  NE    . ARG C 2 63  ? -4.674  1.150   51.505  1.00 94.22  ? 63  ARG A NE    1 
ATOM   1716 C  CZ    . ARG C 2 63  ? -5.353  1.934   52.342  1.00 96.23  ? 63  ARG A CZ    1 
ATOM   1717 N  NH1   . ARG C 2 63  ? -5.822  3.104   51.924  1.00 95.50  ? 63  ARG A NH1   1 
ATOM   1718 N  NH2   . ARG C 2 63  ? -5.575  1.545   53.593  1.00 92.83  ? 63  ARG A NH2   1 
ATOM   1719 N  N     . GLU C 2 64  ? -2.312  -0.617  45.100  1.00 65.46  ? 64  GLU A N     1 
ATOM   1720 C  CA    . GLU C 2 64  ? -2.370  -0.579  43.644  1.00 63.42  ? 64  GLU A CA    1 
ATOM   1721 C  C     . GLU C 2 64  ? -3.392  0.428   43.115  1.00 57.29  ? 64  GLU A C     1 
ATOM   1722 O  O     . GLU C 2 64  ? -3.170  1.061   42.084  1.00 53.39  ? 64  GLU A O     1 
ATOM   1723 C  CB    . GLU C 2 64  ? -2.634  -1.993  43.087  1.00 68.43  ? 64  GLU A CB    1 
ATOM   1724 C  CG    . GLU C 2 64  ? -3.406  -2.932  44.027  1.00 80.54  ? 64  GLU A CG    1 
ATOM   1725 C  CD    . GLU C 2 64  ? -3.464  -4.385  43.524  1.00 86.92  ? 64  GLU A CD    1 
ATOM   1726 O  OE1   . GLU C 2 64  ? -2.793  -4.697  42.513  1.00 92.09  ? 64  GLU A OE1   1 
ATOM   1727 O  OE2   . GLU C 2 64  ? -4.177  -5.215  44.142  1.00 84.52  ? 64  GLU A OE2   1 
ATOM   1728 N  N     . GLY C 2 65  ? -4.498  0.592   43.828  1.00 49.66  ? 65  GLY A N     1 
ATOM   1729 C  CA    . GLY C 2 65  ? -5.501  1.532   43.384  1.00 47.97  ? 65  GLY A CA    1 
ATOM   1730 C  C     . GLY C 2 65  ? -5.041  2.979   43.459  1.00 49.07  ? 65  GLY A C     1 
ATOM   1731 O  O     . GLY C 2 65  ? -5.612  3.843   42.792  1.00 50.30  ? 65  GLY A O     1 
ATOM   1732 N  N     . PHE C 2 66  ? -4.011  3.247   44.263  1.00 46.98  ? 66  PHE A N     1 
ATOM   1733 C  CA    . PHE C 2 66  ? -3.480  4.600   44.435  1.00 41.69  ? 66  PHE A CA    1 
ATOM   1734 C  C     . PHE C 2 66  ? -2.277  4.812   43.541  1.00 40.10  ? 66  PHE A C     1 
ATOM   1735 O  O     . PHE C 2 66  ? -2.128  5.868   42.925  1.00 41.64  ? 66  PHE A O     1 
ATOM   1736 C  CB    . PHE C 2 66  ? -3.082  4.816   45.892  1.00 34.33  ? 66  PHE A CB    1 
ATOM   1737 C  CG    . PHE C 2 66  ? -2.501  6.177   46.183  1.00 37.41  ? 66  PHE A CG    1 
ATOM   1738 C  CD1   . PHE C 2 66  ? -1.136  6.415   46.036  1.00 33.93  ? 66  PHE A CD1   1 
ATOM   1739 C  CD2   . PHE C 2 66  ? -3.309  7.207   46.672  1.00 38.22  ? 66  PHE A CD2   1 
ATOM   1740 C  CE1   . PHE C 2 66  ? -0.578  7.652   46.377  1.00 37.85  ? 66  PHE A CE1   1 
ATOM   1741 C  CE2   . PHE C 2 66  ? -2.764  8.445   47.017  1.00 36.63  ? 66  PHE A CE2   1 
ATOM   1742 C  CZ    . PHE C 2 66  ? -1.392  8.668   46.870  1.00 38.96  ? 66  PHE A CZ    1 
ATOM   1743 N  N     . LEU C 2 67  ? -1.423  3.798   43.472  1.00 37.90  ? 67  LEU A N     1 
ATOM   1744 C  CA    . LEU C 2 67  ? -0.218  3.853   42.663  1.00 36.07  ? 67  LEU A CA    1 
ATOM   1745 C  C     . LEU C 2 67  ? -0.461  3.886   41.154  1.00 37.65  ? 67  LEU A C     1 
ATOM   1746 O  O     . LEU C 2 67  ? 0.322   4.473   40.418  1.00 38.25  ? 67  LEU A O     1 
ATOM   1747 C  CB    . LEU C 2 67  ? 0.680   2.663   42.995  1.00 37.81  ? 67  LEU A CB    1 
ATOM   1748 C  CG    . LEU C 2 67  ? 1.402   2.666   44.340  1.00 40.09  ? 67  LEU A CG    1 
ATOM   1749 C  CD1   . LEU C 2 67  ? 2.187   1.367   44.475  1.00 39.25  ? 67  LEU A CD1   1 
ATOM   1750 C  CD2   . LEU C 2 67  ? 2.341   3.866   44.435  1.00 28.23  ? 67  LEU A CD2   1 
ATOM   1751 N  N     . SER C 2 68  ? -1.522  3.240   40.684  1.00 39.33  ? 68  SER A N     1 
ATOM   1752 C  CA    . SER C 2 68  ? -1.816  3.233   39.257  1.00 42.10  ? 68  SER A CA    1 
ATOM   1753 C  C     . SER C 2 68  ? -2.232  4.616   38.793  1.00 41.27  ? 68  SER A C     1 
ATOM   1754 O  O     . SER C 2 68  ? -1.681  5.140   37.830  1.00 45.24  ? 68  SER A O     1 
ATOM   1755 C  CB    . SER C 2 68  ? -2.921  2.234   38.935  1.00 41.50  ? 68  SER A CB    1 
ATOM   1756 O  OG    . SER C 2 68  ? -2.452  0.914   39.127  1.00 56.01  ? 68  SER A OG    1 
ATOM   1757 N  N     . PRO C 2 69  ? -3.218  5.226   39.464  1.00 40.64  ? 69  PRO A N     1 
ATOM   1758 C  CA    . PRO C 2 69  ? -3.660  6.567   39.064  1.00 40.78  ? 69  PRO A CA    1 
ATOM   1759 C  C     . PRO C 2 69  ? -2.486  7.538   39.073  1.00 43.86  ? 69  PRO A C     1 
ATOM   1760 O  O     . PRO C 2 69  ? -2.235  8.237   38.089  1.00 45.23  ? 69  PRO A O     1 
ATOM   1761 C  CB    . PRO C 2 69  ? -4.697  6.915   40.120  1.00 39.72  ? 69  PRO A CB    1 
ATOM   1762 C  CG    . PRO C 2 69  ? -5.287  5.599   40.448  1.00 41.13  ? 69  PRO A CG    1 
ATOM   1763 C  CD    . PRO C 2 69  ? -4.077  4.690   40.533  1.00 40.47  ? 69  PRO A CD    1 
ATOM   1764 N  N     . LEU C 2 70  ? -1.759  7.559   40.188  1.00 44.66  ? 70  LEU A N     1 
ATOM   1765 C  CA    . LEU C 2 70  ? -0.608  8.430   40.339  1.00 42.20  ? 70  LEU A CA    1 
ATOM   1766 C  C     . LEU C 2 70  ? 0.444   8.168   39.260  1.00 43.74  ? 70  LEU A C     1 
ATOM   1767 O  O     . LEU C 2 70  ? 0.963   9.102   38.650  1.00 47.15  ? 70  LEU A O     1 
ATOM   1768 C  CB    . LEU C 2 70  ? -0.017  8.266   41.735  1.00 42.95  ? 70  LEU A CB    1 
ATOM   1769 C  CG    . LEU C 2 70  ? 1.162   9.164   42.127  1.00 49.74  ? 70  LEU A CG    1 
ATOM   1770 C  CD1   . LEU C 2 70  ? 0.845   10.627  41.857  1.00 44.82  ? 70  LEU A CD1   1 
ATOM   1771 C  CD2   . LEU C 2 70  ? 1.474   8.954   43.601  1.00 51.34  ? 70  LEU A CD2   1 
ATOM   1772 N  N     . LYS C 2 71  ? 0.764   6.911   38.996  1.00 41.70  ? 71  LYS A N     1 
ATOM   1773 C  CA    . LYS C 2 71  ? 1.740   6.640   37.945  1.00 43.27  ? 71  LYS A CA    1 
ATOM   1774 C  C     . LYS C 2 71  ? 1.202   7.165   36.626  1.00 44.25  ? 71  LYS A C     1 
ATOM   1775 O  O     . LYS C 2 71  ? 1.958   7.618   35.771  1.00 47.63  ? 71  LYS A O     1 
ATOM   1776 C  CB    . LYS C 2 71  ? 2.070   5.144   37.823  1.00 42.48  ? 71  LYS A CB    1 
ATOM   1777 C  CG    . LYS C 2 71  ? 2.907   4.822   36.594  1.00 49.49  ? 71  LYS A CG    1 
ATOM   1778 C  CD    . LYS C 2 71  ? 3.140   3.323   36.447  1.00 56.36  ? 71  LYS A CD    1 
ATOM   1779 C  CE    . LYS C 2 71  ? 3.860   2.986   35.151  1.00 60.09  ? 71  LYS A CE    1 
ATOM   1780 N  NZ    . LYS C 2 71  ? 3.002   3.226   33.956  1.00 66.81  ? 71  LYS A NZ    1 
ATOM   1781 N  N     . ALA C 2 72  ? -0.113  7.086   36.455  1.00 43.97  ? 72  ALA A N     1 
ATOM   1782 C  CA    . ALA C 2 72  ? -0.749  7.558   35.228  1.00 42.75  ? 72  ALA A CA    1 
ATOM   1783 C  C     . ALA C 2 72  ? -0.435  9.025   35.019  1.00 41.61  ? 72  ALA A C     1 
ATOM   1784 O  O     . ALA C 2 72  ? -0.142  9.458   33.909  1.00 44.62  ? 72  ALA A O     1 
ATOM   1785 C  CB    . ALA C 2 72  ? -2.261  7.331   35.272  1.00 38.99  ? 72  ALA A CB    1 
ATOM   1786 N  N     . TYR C 2 73  ? -0.494  9.790   36.099  1.00 40.21  ? 73  TYR A N     1 
ATOM   1787 C  CA    . TYR C 2 73  ? -0.229  11.215  36.024  1.00 42.70  ? 73  TYR A CA    1 
ATOM   1788 C  C     . TYR C 2 73  ? 1.254   11.523  35.829  1.00 45.05  ? 73  TYR A C     1 
ATOM   1789 O  O     . TYR C 2 73  ? 1.634   12.264  34.928  1.00 48.04  ? 73  TYR A O     1 
ATOM   1790 C  CB    . TYR C 2 73  ? -0.695  11.903  37.262  1.00 47.15  ? 73  TYR A CB    1 
ATOM   1791 C  CG    . TYR C 2 73  ? -0.267  13.337  37.268  1.00 53.16  ? 73  TYR A CG    1 
ATOM   1792 C  CD1   . TYR C 2 73  ? -0.865  14.259  36.409  1.00 59.21  ? 73  TYR A CD1   1 
ATOM   1793 C  CD2   . TYR C 2 73  ? 0.697   13.797  38.157  1.00 55.35  ? 73  TYR A CD2   1 
ATOM   1794 C  CE1   . TYR C 2 73  ? -0.496  15.598  36.388  1.00 56.66  ? 73  TYR A CE1   1 
ATOM   1795 C  CE2   . TYR C 2 73  ? 1.073   15.127  38.144  1.00 57.97  ? 73  TYR A CE2   1 
ATOM   1796 C  CZ    . TYR C 2 73  ? 0.479   16.019  37.269  1.00 58.84  ? 73  TYR A CZ    1 
ATOM   1797 O  OH    . TYR C 2 73  ? 0.871   17.353  37.275  1.00 66.69  ? 73  TYR A OH    1 
ATOM   1798 N  N     . LEU C 2 74  ? 2.090   10.948  36.671  1.00 42.26  ? 74  LEU A N     1 
ATOM   1799 C  CA    . LEU C 2 74  ? 3.527   11.222  36.630  1.00 44.36  ? 74  LEU A CA    1 
ATOM   1800 C  C     . LEU C 2 74  ? 4.215   10.925  35.304  1.00 46.42  ? 74  LEU A C     1 
ATOM   1801 O  O     . LEU C 2 74  ? 5.318   11.430  35.082  1.00 49.41  ? 74  LEU A O     1 
ATOM   1802 C  CB    . LEU C 2 74  ? 4.213   10.465  37.748  1.00 44.23  ? 74  LEU A CB    1 
ATOM   1803 C  CG    . LEU C 2 74  ? 3.870   10.948  39.154  1.00 43.45  ? 74  LEU A CG    1 
ATOM   1804 C  CD1   . LEU C 2 74  ? 4.528   10.059  40.202  1.00 33.30  ? 74  LEU A CD1   1 
ATOM   1805 C  CD2   . LEU C 2 74  ? 4.280   12.408  39.321  1.00 37.30  ? 74  LEU A CD2   1 
ATOM   1806 N  N     . ILE C 2 75  ? 3.599   10.135  34.426  1.00 50.10  ? 75  ILE A N     1 
ATOM   1807 C  CA    . ILE C 2 75  ? 4.227   9.852   33.131  1.00 46.87  ? 75  ILE A CA    1 
ATOM   1808 C  C     . ILE C 2 75  ? 3.403   10.433  32.000  1.00 45.46  ? 75  ILE A C     1 
ATOM   1809 O  O     . ILE C 2 75  ? 3.660   10.136  30.847  1.00 50.00  ? 75  ILE A O     1 
ATOM   1810 C  CB    . ILE C 2 75  ? 4.392   8.329   32.845  1.00 45.49  ? 75  ILE A CB    1 
ATOM   1811 C  CG1   . ILE C 2 75  ? 3.028   7.647   32.815  1.00 44.51  ? 75  ILE A CG1   1 
ATOM   1812 C  CG2   . ILE C 2 75  ? 5.294   7.667   33.879  1.00 43.95  ? 75  ILE A CG2   1 
ATOM   1813 C  CD1   . ILE C 2 75  ? 3.072   6.228   32.292  1.00 42.35  ? 75  ILE A CD1   1 
ATOM   1814 N  N     . SER C 2 76  ? 2.417   11.261  32.320  1.00 45.99  ? 76  SER A N     1 
ATOM   1815 C  CA    . SER C 2 76  ? 1.565   11.846  31.284  1.00 46.92  ? 76  SER A CA    1 
ATOM   1816 C  C     . SER C 2 76  ? 2.154   13.078  30.617  1.00 51.94  ? 76  SER A C     1 
ATOM   1817 O  O     . SER C 2 76  ? 2.983   13.781  31.194  1.00 56.65  ? 76  SER A O     1 
ATOM   1818 C  CB    . SER C 2 76  ? 0.220   12.197  31.898  1.00 40.18  ? 76  SER A CB    1 
ATOM   1819 O  OG    . SER C 2 76  ? 0.378   12.985  33.069  1.00 43.88  ? 76  SER A OG    1 
ATOM   1820 N  N     . GLU C 2 77  ? 1.704   13.327  29.391  1.00 54.30  ? 77  GLU A N     1 
ATOM   1821 C  CA    . GLU C 2 77  ? 2.124   14.480  28.597  1.00 57.59  ? 77  GLU A CA    1 
ATOM   1822 C  C     . GLU C 2 77  ? 2.077   15.742  29.466  1.00 57.18  ? 77  GLU A C     1 
ATOM   1823 O  O     . GLU C 2 77  ? 3.037   16.508  29.527  1.00 55.45  ? 77  GLU A O     1 
ATOM   1824 C  CB    . GLU C 2 77  ? 1.174   14.638  27.407  1.00 61.31  ? 77  GLU A CB    1 
ATOM   1825 C  CG    . GLU C 2 77  ? 1.198   16.007  26.757  1.00 71.35  ? 77  GLU A CG    1 
ATOM   1826 C  CD    . GLU C 2 77  ? -0.105  16.331  26.033  1.00 77.65  ? 77  GLU A CD    1 
ATOM   1827 O  OE1   . GLU C 2 77  ? -0.445  15.595  25.074  1.00 76.52  ? 77  GLU A OE1   1 
ATOM   1828 O  OE2   . GLU C 2 77  ? -0.782  17.317  26.432  1.00 74.88  ? 77  GLU A OE2   1 
ATOM   1829 N  N     . GLU C 2 78  ? 0.943   15.939  30.127  1.00 52.37  ? 78  GLU A N     1 
ATOM   1830 C  CA    . GLU C 2 78  ? 0.732   17.069  31.015  1.00 54.71  ? 78  GLU A CA    1 
ATOM   1831 C  C     . GLU C 2 78  ? 1.911   17.262  31.965  1.00 53.50  ? 78  GLU A C     1 
ATOM   1832 O  O     . GLU C 2 78  ? 2.379   18.377  32.163  1.00 51.24  ? 78  GLU A O     1 
ATOM   1833 C  CB    . GLU C 2 78  ? -0.543  16.831  31.825  1.00 58.36  ? 78  GLU A CB    1 
ATOM   1834 C  CG    . GLU C 2 78  ? -1.083  18.041  32.557  1.00 67.87  ? 78  GLU A CG    1 
ATOM   1835 C  CD    . GLU C 2 78  ? -2.196  17.673  33.529  1.00 72.61  ? 78  GLU A CD    1 
ATOM   1836 O  OE1   . GLU C 2 78  ? -2.969  16.746  33.211  1.00 72.48  ? 78  GLU A OE1   1 
ATOM   1837 O  OE2   . GLU C 2 78  ? -2.302  18.309  34.603  1.00 75.51  ? 78  GLU A OE2   1 
ATOM   1838 N  N     . PHE C 2 79  ? 2.384   16.172  32.558  1.00 52.46  ? 79  PHE A N     1 
ATOM   1839 C  CA    . PHE C 2 79  ? 3.496   16.252  33.491  1.00 52.92  ? 79  PHE A CA    1 
ATOM   1840 C  C     . PHE C 2 79  ? 4.863   16.434  32.834  1.00 55.35  ? 79  PHE A C     1 
ATOM   1841 O  O     . PHE C 2 79  ? 5.767   17.034  33.415  1.00 57.38  ? 79  PHE A O     1 
ATOM   1842 C  CB    . PHE C 2 79  ? 3.543   15.016  34.373  1.00 50.14  ? 79  PHE A CB    1 
ATOM   1843 C  CG    . PHE C 2 79  ? 4.443   15.168  35.555  1.00 45.03  ? 79  PHE A CG    1 
ATOM   1844 C  CD1   . PHE C 2 79  ? 4.155   16.103  36.542  1.00 41.18  ? 79  PHE A CD1   1 
ATOM   1845 C  CD2   . PHE C 2 79  ? 5.585   14.382  35.687  1.00 51.19  ? 79  PHE A CD2   1 
ATOM   1846 C  CE1   . PHE C 2 79  ? 4.985   16.253  37.643  1.00 40.17  ? 79  PHE A CE1   1 
ATOM   1847 C  CE2   . PHE C 2 79  ? 6.431   14.523  36.794  1.00 46.06  ? 79  PHE A CE2   1 
ATOM   1848 C  CZ    . PHE C 2 79  ? 6.130   15.458  37.770  1.00 41.84  ? 79  PHE A CZ    1 
ATOM   1849 N  N     . PHE C 2 80  ? 5.035   15.908  31.630  1.00 54.04  ? 80  PHE A N     1 
ATOM   1850 C  CA    . PHE C 2 80  ? 6.313   16.068  30.959  1.00 51.80  ? 80  PHE A CA    1 
ATOM   1851 C  C     . PHE C 2 80  ? 6.503   17.494  30.463  1.00 52.38  ? 80  PHE A C     1 
ATOM   1852 O  O     . PHE C 2 80  ? 7.623   17.989  30.393  1.00 53.01  ? 80  PHE A O     1 
ATOM   1853 C  CB    . PHE C 2 80  ? 6.437   15.060  29.820  1.00 44.88  ? 80  PHE A CB    1 
ATOM   1854 C  CG    . PHE C 2 80  ? 6.692   13.652  30.298  1.00 46.56  ? 80  PHE A CG    1 
ATOM   1855 C  CD1   . PHE C 2 80  ? 6.924   13.395  31.645  1.00 37.18  ? 80  PHE A CD1   1 
ATOM   1856 C  CD2   . PHE C 2 80  ? 6.696   12.583  29.405  1.00 43.62  ? 80  PHE A CD2   1 
ATOM   1857 C  CE1   . PHE C 2 80  ? 7.150   12.112  32.089  1.00 42.02  ? 80  PHE A CE1   1 
ATOM   1858 C  CE2   . PHE C 2 80  ? 6.923   11.294  29.845  1.00 40.84  ? 80  PHE A CE2   1 
ATOM   1859 C  CZ    . PHE C 2 80  ? 7.149   11.055  31.188  1.00 41.07  ? 80  PHE A CZ    1 
ATOM   1860 N  N     . ASN C 2 81  ? 5.402   18.152  30.123  1.00 52.83  ? 81  ASN A N     1 
ATOM   1861 C  CA    . ASN C 2 81  ? 5.455   19.535  29.671  1.00 52.97  ? 81  ASN A CA    1 
ATOM   1862 C  C     . ASN C 2 81  ? 5.916   20.391  30.844  1.00 50.72  ? 81  ASN A C     1 
ATOM   1863 O  O     . ASN C 2 81  ? 6.663   21.345  30.660  1.00 56.17  ? 81  ASN A O     1 
ATOM   1864 C  CB    . ASN C 2 81  ? 4.074   20.001  29.191  1.00 52.70  ? 81  ASN A CB    1 
ATOM   1865 C  CG    . ASN C 2 81  ? 3.867   19.785  27.703  1.00 51.64  ? 81  ASN A CG    1 
ATOM   1866 O  OD1   . ASN C 2 81  ? 4.247   20.620  26.877  1.00 54.12  ? 81  ASN A OD1   1 
ATOM   1867 N  ND2   . ASN C 2 81  ? 3.266   18.659  27.351  1.00 55.71  ? 81  ASN A ND2   1 
ATOM   1868 N  N     . LEU C 2 82  ? 5.478   20.053  32.051  1.00 47.53  ? 82  LEU A N     1 
ATOM   1869 C  CA    . LEU C 2 82  ? 5.895   20.818  33.215  1.00 48.23  ? 82  LEU A CA    1 
ATOM   1870 C  C     . LEU C 2 82  ? 7.382   20.602  33.500  1.00 50.80  ? 82  LEU A C     1 
ATOM   1871 O  O     . LEU C 2 82  ? 8.105   21.557  33.786  1.00 54.36  ? 82  LEU A O     1 
ATOM   1872 C  CB    . LEU C 2 82  ? 5.058   20.444  34.438  1.00 48.73  ? 82  LEU A CB    1 
ATOM   1873 C  CG    . LEU C 2 82  ? 3.561   20.769  34.342  1.00 58.77  ? 82  LEU A CG    1 
ATOM   1874 C  CD1   . LEU C 2 82  ? 2.866   20.445  35.663  1.00 56.62  ? 82  LEU A CD1   1 
ATOM   1875 C  CD2   . LEU C 2 82  ? 3.369   22.235  34.001  1.00 58.44  ? 82  LEU A CD2   1 
ATOM   1876 N  N     . LEU C 2 83  ? 7.841   19.354  33.417  1.00 49.47  ? 83  LEU A N     1 
ATOM   1877 C  CA    . LEU C 2 83  ? 9.250   19.055  33.650  1.00 48.57  ? 83  LEU A CA    1 
ATOM   1878 C  C     . LEU C 2 83  ? 10.118  19.623  32.528  1.00 49.20  ? 83  LEU A C     1 
ATOM   1879 O  O     . LEU C 2 83  ? 11.247  20.051  32.755  1.00 52.48  ? 83  LEU A O     1 
ATOM   1880 C  CB    . LEU C 2 83  ? 9.477   17.546  33.720  1.00 52.53  ? 83  LEU A CB    1 
ATOM   1881 C  CG    . LEU C 2 83  ? 8.932   16.712  34.879  1.00 56.82  ? 83  LEU A CG    1 
ATOM   1882 C  CD1   . LEU C 2 83  ? 9.377   15.246  34.711  1.00 51.32  ? 83  LEU A CD1   1 
ATOM   1883 C  CD2   . LEU C 2 83  ? 9.457   17.272  36.188  1.00 56.20  ? 83  LEU A CD2   1 
ATOM   1884 N  N     . ALA C 2 84  ? 9.578   19.622  31.315  1.00 48.00  ? 84  ALA A N     1 
ATOM   1885 C  CA    . ALA C 2 84  ? 10.299  20.109  30.144  1.00 47.49  ? 84  ALA A CA    1 
ATOM   1886 C  C     . ALA C 2 84  ? 10.488  21.622  30.085  1.00 49.54  ? 84  ALA A C     1 
ATOM   1887 O  O     . ALA C 2 84  ? 11.310  22.110  29.304  1.00 51.01  ? 84  ALA A O     1 
ATOM   1888 C  CB    . ALA C 2 84  ? 9.599   19.631  28.871  1.00 42.57  ? 84  ALA A CB    1 
ATOM   1889 N  N     . GLN C 2 85  ? 9.732   22.367  30.884  1.00 48.36  ? 85  GLN A N     1 
ATOM   1890 C  CA    . GLN C 2 85  ? 9.856   23.814  30.868  1.00 53.43  ? 85  GLN A CA    1 
ATOM   1891 C  C     . GLN C 2 85  ? 11.287  24.227  31.167  1.00 52.80  ? 85  GLN A C     1 
ATOM   1892 O  O     . GLN C 2 85  ? 11.827  25.114  30.517  1.00 55.69  ? 85  GLN A O     1 
ATOM   1893 C  CB    . GLN C 2 85  ? 8.905   24.449  31.883  1.00 57.48  ? 85  GLN A CB    1 
ATOM   1894 C  CG    . GLN C 2 85  ? 7.433   24.246  31.574  1.00 58.48  ? 85  GLN A CG    1 
ATOM   1895 C  CD    . GLN C 2 85  ? 6.532   24.834  32.650  1.00 69.52  ? 85  GLN A CD    1 
ATOM   1896 O  OE1   . GLN C 2 85  ? 5.311   24.704  32.585  1.00 76.70  ? 85  GLN A OE1   1 
ATOM   1897 N  NE2   . GLN C 2 85  ? 7.132   25.484  33.647  1.00 68.64  ? 85  GLN A NE2   1 
ATOM   1898 N  N     . LYS C 2 86  ? 11.898  23.559  32.136  1.00 53.82  ? 86  LYS A N     1 
ATOM   1899 C  CA    . LYS C 2 86  ? 13.273  23.835  32.543  1.00 57.06  ? 86  LYS A CA    1 
ATOM   1900 C  C     . LYS C 2 86  ? 14.291  23.737  31.392  1.00 61.16  ? 86  LYS A C     1 
ATOM   1901 O  O     . LYS C 2 86  ? 15.377  24.330  31.466  1.00 63.53  ? 86  LYS A O     1 
ATOM   1902 C  CB    . LYS C 2 86  ? 13.663  22.859  33.661  1.00 56.06  ? 86  LYS A CB    1 
ATOM   1903 C  CG    . LYS C 2 86  ? 15.138  22.837  34.005  1.00 55.00  ? 86  LYS A CG    1 
ATOM   1904 C  CD    . LYS C 2 86  ? 15.495  21.566  34.766  1.00 53.54  ? 86  LYS A CD    1 
ATOM   1905 C  CE    . LYS C 2 86  ? 14.932  21.544  36.185  1.00 55.87  ? 86  LYS A CE    1 
ATOM   1906 N  NZ    . LYS C 2 86  ? 15.903  22.061  37.212  1.00 52.31  ? 86  LYS A NZ    1 
ATOM   1907 N  N     . LEU C 2 87  ? 13.934  23.000  30.336  1.00 60.06  ? 87  LEU A N     1 
ATOM   1908 C  CA    . LEU C 2 87  ? 14.820  22.786  29.181  1.00 58.12  ? 87  LEU A CA    1 
ATOM   1909 C  C     . LEU C 2 87  ? 14.605  23.695  27.978  1.00 59.07  ? 87  LEU A C     1 
ATOM   1910 O  O     . LEU C 2 87  ? 15.421  23.683  27.054  1.00 57.66  ? 87  LEU A O     1 
ATOM   1911 C  CB    . LEU C 2 87  ? 14.703  21.350  28.683  1.00 56.71  ? 87  LEU A CB    1 
ATOM   1912 C  CG    . LEU C 2 87  ? 14.858  20.197  29.666  1.00 58.94  ? 87  LEU A CG    1 
ATOM   1913 C  CD1   . LEU C 2 87  ? 14.423  18.898  28.982  1.00 60.78  ? 87  LEU A CD1   1 
ATOM   1914 C  CD2   . LEU C 2 87  ? 16.296  20.120  30.144  1.00 60.86  ? 87  LEU A CD2   1 
ATOM   1915 N  N     . GLU C 2 88  ? 13.506  24.450  27.971  1.00 61.25  ? 88  GLU A N     1 
ATOM   1916 C  CA    . GLU C 2 88  ? 13.184  25.361  26.864  1.00 62.83  ? 88  GLU A CA    1 
ATOM   1917 C  C     . GLU C 2 88  ? 13.275  24.645  25.512  1.00 61.32  ? 88  GLU A C     1 
ATOM   1918 O  O     . GLU C 2 88  ? 13.953  25.126  24.603  1.00 60.51  ? 88  GLU A O     1 
ATOM   1919 C  CB    . GLU C 2 88  ? 14.154  26.557  26.829  1.00 66.03  ? 88  GLU A CB    1 
ATOM   1920 C  CG    . GLU C 2 88  ? 14.624  27.117  28.175  1.00 71.28  ? 88  GLU A CG    1 
ATOM   1921 C  CD    . GLU C 2 88  ? 15.602  28.293  28.009  1.00 76.62  ? 88  GLU A CD    1 
ATOM   1922 O  OE1   . GLU C 2 88  ? 15.563  28.983  26.960  1.00 76.13  ? 88  GLU A OE1   1 
ATOM   1923 O  OE2   . GLU C 2 88  ? 16.406  28.535  28.934  1.00 74.85  ? 88  GLU A OE2   1 
ATOM   1924 N  N     . LEU C 2 89  ? 12.594  23.512  25.365  1.00 58.13  ? 89  LEU A N     1 
ATOM   1925 C  CA    . LEU C 2 89  ? 12.674  22.763  24.114  1.00 57.97  ? 89  LEU A CA    1 
ATOM   1926 C  C     . LEU C 2 89  ? 12.133  23.446  22.859  1.00 59.93  ? 89  LEU A C     1 
ATOM   1927 O  O     . LEU C 2 89  ? 12.588  23.161  21.748  1.00 58.48  ? 89  LEU A O     1 
ATOM   1928 C  CB    . LEU C 2 89  ? 12.007  21.397  24.273  1.00 58.54  ? 89  LEU A CB    1 
ATOM   1929 C  CG    . LEU C 2 89  ? 12.757  20.355  25.107  1.00 59.03  ? 89  LEU A CG    1 
ATOM   1930 C  CD1   . LEU C 2 89  ? 12.051  19.025  24.957  1.00 57.43  ? 89  LEU A CD1   1 
ATOM   1931 C  CD2   . LEU C 2 89  ? 14.213  20.233  24.647  1.00 57.70  ? 89  LEU A CD2   1 
ATOM   1932 N  N     . HIS C 2 90  ? 11.173  24.348  23.022  1.00 62.24  ? 90  HIS A N     1 
ATOM   1933 C  CA    . HIS C 2 90  ? 10.600  25.039  21.876  1.00 63.31  ? 90  HIS A CA    1 
ATOM   1934 C  C     . HIS C 2 90  ? 11.666  25.674  20.994  1.00 63.34  ? 90  HIS A C     1 
ATOM   1935 O  O     . HIS C 2 90  ? 11.477  25.809  19.784  1.00 65.53  ? 90  HIS A O     1 
ATOM   1936 C  CB    . HIS C 2 90  ? 9.610   26.106  22.343  1.00 69.58  ? 90  HIS A CB    1 
ATOM   1937 C  CG    . HIS C 2 90  ? 10.151  27.011  23.405  1.00 75.78  ? 90  HIS A CG    1 
ATOM   1938 N  ND1   . HIS C 2 90  ? 11.214  27.861  23.189  1.00 77.30  ? 90  HIS A ND1   1 
ATOM   1939 C  CD2   . HIS C 2 90  ? 9.781   27.191  24.694  1.00 77.57  ? 90  HIS A CD2   1 
ATOM   1940 C  CE1   . HIS C 2 90  ? 11.474  28.528  24.299  1.00 78.72  ? 90  HIS A CE1   1 
ATOM   1941 N  NE2   . HIS C 2 90  ? 10.619  28.140  25.228  1.00 78.49  ? 90  HIS A NE2   1 
ATOM   1942 N  N     . LYS C 2 91  ? 12.793  26.052  21.589  1.00 61.40  ? 91  LYS A N     1 
ATOM   1943 C  CA    . LYS C 2 91  ? 13.867  26.682  20.822  1.00 61.05  ? 91  LYS A CA    1 
ATOM   1944 C  C     . LYS C 2 91  ? 14.937  25.736  20.265  1.00 59.13  ? 91  LYS A C     1 
ATOM   1945 O  O     . LYS C 2 91  ? 15.929  26.192  19.705  1.00 61.54  ? 91  LYS A O     1 
ATOM   1946 C  CB    . LYS C 2 91  ? 14.531  27.783  21.664  1.00 61.24  ? 91  LYS A CB    1 
ATOM   1947 C  CG    . LYS C 2 91  ? 14.911  27.359  23.072  1.00 62.56  ? 91  LYS A CG    1 
ATOM   1948 C  CD    . LYS C 2 91  ? 15.004  28.550  24.025  1.00 60.63  ? 91  LYS A CD    1 
ATOM   1949 C  CE    . LYS C 2 91  ? 16.387  29.170  24.037  1.00 65.40  ? 91  LYS A CE    1 
ATOM   1950 N  NZ    . LYS C 2 91  ? 16.812  29.645  22.701  1.00 69.55  ? 91  LYS A NZ    1 
ATOM   1951 N  N     . PHE C 2 92  ? 14.743  24.428  20.406  1.00 55.13  ? 92  PHE A N     1 
ATOM   1952 C  CA    . PHE C 2 92  ? 15.716  23.465  19.901  1.00 51.04  ? 92  PHE A CA    1 
ATOM   1953 C  C     . PHE C 2 92  ? 15.049  22.528  18.913  1.00 52.37  ? 92  PHE A C     1 
ATOM   1954 O  O     . PHE C 2 92  ? 15.706  21.938  18.051  1.00 53.48  ? 92  PHE A O     1 
ATOM   1955 C  CB    . PHE C 2 92  ? 16.283  22.627  21.043  1.00 47.95  ? 92  PHE A CB    1 
ATOM   1956 C  CG    . PHE C 2 92  ? 17.020  23.417  22.068  1.00 45.20  ? 92  PHE A CG    1 
ATOM   1957 C  CD1   . PHE C 2 92  ? 18.229  24.024  21.758  1.00 45.89  ? 92  PHE A CD1   1 
ATOM   1958 C  CD2   . PHE C 2 92  ? 16.491  23.583  23.343  1.00 47.45  ? 92  PHE A CD2   1 
ATOM   1959 C  CE1   . PHE C 2 92  ? 18.903  24.794  22.705  1.00 49.53  ? 92  PHE A CE1   1 
ATOM   1960 C  CE2   . PHE C 2 92  ? 17.156  24.352  24.299  1.00 52.35  ? 92  PHE A CE2   1 
ATOM   1961 C  CZ    . PHE C 2 92  ? 18.364  24.960  23.979  1.00 47.17  ? 92  PHE A CZ    1 
ATOM   1962 N  N     . ILE C 2 93  ? 13.737  22.385  19.056  1.00 49.94  ? 93  ILE A N     1 
ATOM   1963 C  CA    . ILE C 2 93  ? 12.959  21.503  18.202  1.00 47.82  ? 93  ILE A CA    1 
ATOM   1964 C  C     . ILE C 2 93  ? 12.900  21.940  16.746  1.00 48.10  ? 93  ILE A C     1 
ATOM   1965 O  O     . ILE C 2 93  ? 12.733  23.116  16.454  1.00 53.39  ? 93  ILE A O     1 
ATOM   1966 C  CB    . ILE C 2 93  ? 11.538  21.366  18.755  1.00 48.52  ? 93  ILE A CB    1 
ATOM   1967 C  CG1   . ILE C 2 93  ? 11.586  20.497  20.008  1.00 44.28  ? 93  ILE A CG1   1 
ATOM   1968 C  CG2   . ILE C 2 93  ? 10.596  20.787  17.690  1.00 48.48  ? 93  ILE A CG2   1 
ATOM   1969 C  CD1   . ILE C 2 93  ? 10.328  20.545  20.819  1.00 50.61  ? 93  ILE A CD1   1 
ATOM   1970 N  N     . ARG C 2 94  ? 13.038  20.977  15.840  1.00 50.58  ? 94  ARG A N     1 
ATOM   1971 C  CA    . ARG C 2 94  ? 13.005  21.236  14.404  1.00 51.37  ? 94  ARG A CA    1 
ATOM   1972 C  C     . ARG C 2 94  ? 11.683  20.789  13.797  1.00 54.27  ? 94  ARG A C     1 
ATOM   1973 O  O     . ARG C 2 94  ? 11.376  19.598  13.726  1.00 56.64  ? 94  ARG A O     1 
ATOM   1974 C  CB    . ARG C 2 94  ? 14.163  20.518  13.725  1.00 44.70  ? 94  ARG A CB    1 
ATOM   1975 C  CG    . ARG C 2 94  ? 15.486  20.846  14.379  1.00 53.05  ? 94  ARG A CG    1 
ATOM   1976 C  CD    . ARG C 2 94  ? 16.625  20.732  13.401  1.00 57.02  ? 94  ARG A CD    1 
ATOM   1977 N  NE    . ARG C 2 94  ? 16.952  19.349  13.086  1.00 61.64  ? 94  ARG A NE    1 
ATOM   1978 C  CZ    . ARG C 2 94  ? 17.832  18.994  12.155  1.00 67.91  ? 94  ARG A CZ    1 
ATOM   1979 N  NH1   . ARG C 2 94  ? 18.455  19.932  11.451  1.00 65.42  ? 94  ARG A NH1   1 
ATOM   1980 N  NH2   . ARG C 2 94  ? 18.106  17.709  11.940  1.00 63.42  ? 94  ARG A NH2   1 
ATOM   1981 N  N     . ILE C 2 95  ? 10.895  21.758  13.360  1.00 58.97  ? 95  ILE A N     1 
ATOM   1982 C  CA    . ILE C 2 95  ? 9.605   21.454  12.773  1.00 62.62  ? 95  ILE A CA    1 
ATOM   1983 C  C     . ILE C 2 95  ? 9.350   22.239  11.493  1.00 66.40  ? 95  ILE A C     1 
ATOM   1984 O  O     . ILE C 2 95  ? 9.669   23.426  11.397  1.00 66.24  ? 95  ILE A O     1 
ATOM   1985 C  CB    . ILE C 2 95  ? 8.485   21.758  13.765  1.00 60.42  ? 95  ILE A CB    1 
ATOM   1986 C  CG1   . ILE C 2 95  ? 7.136   21.415  13.136  1.00 62.73  ? 95  ILE A CG1   1 
ATOM   1987 C  CG2   . ILE C 2 95  ? 8.555   23.217  14.179  1.00 58.20  ? 95  ILE A CG2   1 
ATOM   1988 C  CD1   . ILE C 2 95  ? 7.054   19.992  12.628  1.00 66.68  ? 95  ILE A CD1   1 
ATOM   1989 N  N     . LYS C 2 96  ? 8.737   21.532  10.537  1.00 69.95  ? 96  LYS A N     1 
ATOM   1990 C  CA    . LYS C 2 96  ? 8.427   22.155  9.262   1.00 72.63  ? 96  LYS A CA    1 
ATOM   1991 C  C     . LYS C 2 96  ? 6.929   22.435  9.201   1.00 77.15  ? 96  LYS A C     1 
ATOM   1992 O  O     . LYS C 2 96  ? 6.113   21.511  9.232   1.00 78.51  ? 96  LYS A O     1 
ATOM   1993 C  CB    . LYS C 2 96  ? 8.827   21.233  8.115   1.00 66.78  ? 96  LYS A CB    1 
ATOM   1994 C  CG    . LYS C 2 96  ? 9.188   21.964  6.853   1.00 65.34  ? 96  LYS A CG    1 
ATOM   1995 C  CD    . LYS C 2 96  ? 10.548  22.623  6.971   1.00 65.29  ? 96  LYS A CD    1 
ATOM   1996 C  CE    . LYS C 2 96  ? 11.668  21.594  6.897   1.00 68.50  ? 96  LYS A CE    1 
ATOM   1997 N  NZ    . LYS C 2 96  ? 13.018  22.217  6.998   1.00 69.23  ? 96  LYS A NZ    1 
ATOM   1998 N  N     . ARG C 2 97  ? 6.562   23.705  9.124   1.00 81.39  ? 97  ARG A N     1 
ATOM   1999 C  CA    . ARG C 2 97  ? 5.172   24.189  9.095   1.00 88.72  ? 97  ARG A CA    1 
ATOM   2000 C  C     . ARG C 2 97  ? 4.288   23.590  10.170  1.00 90.69  ? 97  ARG A C     1 
ATOM   2001 O  O     . ARG C 2 97  ? 3.072   23.673  10.075  1.00 92.93  ? 97  ARG A O     1 
ATOM   2002 C  CB    . ARG C 2 97  ? 4.474   23.931  7.750   1.00 92.04  ? 97  ARG A CB    1 
ATOM   2003 C  CG    . ARG C 2 97  ? 5.304   23.305  6.666   1.00 96.35  ? 97  ARG A CG    1 
ATOM   2004 C  CD    . ARG C 2 97  ? 4.451   22.721  5.553   1.00 102.23 ? 97  ARG A CD    1 
ATOM   2005 N  NE    . ARG C 2 97  ? 5.285   21.936  4.645   1.00 107.63 ? 97  ARG A NE    1 
ATOM   2006 C  CZ    . ARG C 2 97  ? 5.601   20.657  4.831   1.00 109.16 ? 97  ARG A CZ    1 
ATOM   2007 N  NH1   . ARG C 2 97  ? 5.143   20.003  5.894   1.00 109.49 ? 97  ARG A NH1   1 
ATOM   2008 N  NH2   . ARG C 2 97  ? 6.392   20.037  3.962   1.00 111.07 ? 97  ARG A NH2   1 
ATOM   2009 N  N     . GLY C 2 98  ? 4.882   22.999  11.182  1.00 91.35  ? 98  GLY A N     1 
ATOM   2010 C  CA    . GLY C 2 98  ? 4.075   22.481  12.282  1.00 87.95  ? 98  GLY A CA    1 
ATOM   2011 C  C     . GLY C 2 98  ? 4.012   23.539  13.369  1.00 85.66  ? 98  GLY A C     1 
ATOM   2012 O  O     . GLY C 2 98  ? 4.635   24.583  13.254  1.00 85.43  ? 98  GLY A O     1 
ATOM   2013 N  N     . LYS C 2 99  ? 3.249   23.265  14.417  1.00 80.94  ? 99  LYS A N     1 
ATOM   2014 C  CA    . LYS C 2 99  ? 3.142   24.143  15.579  1.00 76.16  ? 99  LYS A CA    1 
ATOM   2015 C  C     . LYS C 2 99  ? 3.606   23.338  16.775  1.00 72.90  ? 99  LYS A C     1 
ATOM   2016 O  O     . LYS C 2 99  ? 2.987   22.328  17.104  1.00 75.80  ? 99  LYS A O     1 
ATOM   2017 C  CB    . LYS C 2 99  ? 1.690   24.616  15.775  1.00 78.06  ? 99  LYS A CB    1 
ATOM   2018 C  CG    . LYS C 2 99  ? 1.459   25.657  16.850  1.00 80.61  ? 99  LYS A CG    1 
ATOM   2019 C  CD    . LYS C 2 99  ? -0.022  25.982  16.953  1.00 82.10  ? 99  LYS A CD    1 
ATOM   2020 C  CE    . LYS C 2 99  ? -0.287  27.139  17.902  1.00 83.23  ? 99  LYS A CE    1 
ATOM   2021 N  NZ    . LYS C 2 99  ? -1.745  27.379  18.087  1.00 83.39  ? 99  LYS A NZ    1 
ATOM   2022 N  N     . ILE C 2 100 ? 4.691   23.752  17.421  1.00 65.10  ? 100 ILE A N     1 
ATOM   2023 C  CA    . ILE C 2 100 ? 5.231   23.017  18.558  1.00 60.78  ? 100 ILE A CA    1 
ATOM   2024 C  C     . ILE C 2 100 ? 4.259   22.870  19.736  1.00 60.88  ? 100 ILE A C     1 
ATOM   2025 O  O     . ILE C 2 100 ? 4.373   23.594  20.717  1.00 61.76  ? 100 ILE A O     1 
ATOM   2026 C  CB    . ILE C 2 100 ? 6.527   23.676  19.039  1.00 55.82  ? 100 ILE A CB    1 
ATOM   2027 C  CG1   . ILE C 2 100 ? 7.536   23.678  17.893  1.00 56.23  ? 100 ILE A CG1   1 
ATOM   2028 C  CG2   . ILE C 2 100 ? 7.078   22.939  20.248  1.00 50.16  ? 100 ILE A CG2   1 
ATOM   2029 C  CD1   . ILE C 2 100 ? 8.854   24.320  18.252  1.00 63.67  ? 100 ILE A CD1   1 
ATOM   2030 N  N     . ASN C 2 101 ? 3.323   21.933  19.608  1.00 57.65  ? 101 ASN A N     1 
ATOM   2031 C  CA    . ASN C 2 101 ? 2.310   21.698  20.632  1.00 57.81  ? 101 ASN A CA    1 
ATOM   2032 C  C     . ASN C 2 101 ? 2.781   20.943  21.887  1.00 59.29  ? 101 ASN A C     1 
ATOM   2033 O  O     . ASN C 2 101 ? 3.948   20.580  22.021  1.00 59.26  ? 101 ASN A O     1 
ATOM   2034 C  CB    . ASN C 2 101 ? 1.119   20.972  19.999  1.00 56.99  ? 101 ASN A CB    1 
ATOM   2035 C  CG    . ASN C 2 101 ? 1.516   19.663  19.361  1.00 62.75  ? 101 ASN A CG    1 
ATOM   2036 O  OD1   . ASN C 2 101 ? 1.926   18.738  20.051  1.00 72.72  ? 101 ASN A OD1   1 
ATOM   2037 N  ND2   . ASN C 2 101 ? 1.412   19.579  18.035  1.00 65.93  ? 101 ASN A ND2   1 
ATOM   2038 N  N     . GLU C 2 102 ? 1.877   20.819  22.801  1.00 59.69  ? 102 GLU A N     1 
ATOM   2039 C  CA    . GLU C 2 102 ? 2.142   20.112  24.046  1.00 58.02  ? 102 GLU A CA    1 
ATOM   2040 C  C     . GLU C 2 102 ? 2.423   18.635  23.800  1.00 55.65  ? 102 GLU A C     1 
ATOM   2041 O  O     . GLU C 2 102 ? 2.997   17.963  24.652  1.00 54.61  ? 102 GLU A O     1 
ATOM   2042 C  CB    . GLU C 2 102 ? 0.943   20.258  24.989  1.00 65.50  ? 102 GLU A CB    1 
ATOM   2043 C  CG    . GLU C 2 102 ? 0.404   21.686  25.101  1.00 74.51  ? 102 GLU A CG    1 
ATOM   2044 C  CD    . GLU C 2 102 ? 0.706   22.346  26.445  1.00 81.77  ? 102 GLU A CD    1 
ATOM   2045 O  OE1   . GLU C 2 102 ? 0.278   21.806  27.492  1.00 83.74  ? 102 GLU A OE1   1 
ATOM   2046 O  OE2   . GLU C 2 102 ? 1.366   23.411  26.453  1.00 83.75  ? 102 GLU A OE2   1 
ATOM   2047 N  N     . THR C 2 103 ? 2.019   18.129  22.638  1.00 50.60  ? 103 THR A N     1 
ATOM   2048 C  CA    . THR C 2 103 ? 2.246   16.727  22.305  1.00 45.16  ? 103 THR A CA    1 
ATOM   2049 C  C     . THR C 2 103 ? 3.643   16.546  21.740  1.00 46.95  ? 103 THR A C     1 
ATOM   2050 O  O     . THR C 2 103 ? 4.330   15.566  22.045  1.00 45.57  ? 103 THR A O     1 
ATOM   2051 C  CB    . THR C 2 103 ? 1.230   16.208  21.279  1.00 35.08  ? 103 THR A CB    1 
ATOM   2052 O  OG1   . THR C 2 103 ? -0.070  16.189  21.866  1.00 43.40  ? 103 THR A OG1   1 
ATOM   2053 C  CG2   . THR C 2 103 ? 1.571   14.820  20.867  1.00 32.75  ? 103 THR A CG2   1 
ATOM   2054 N  N     . ILE C 2 104 ? 4.063   17.493  20.911  1.00 45.51  ? 104 ILE A N     1 
ATOM   2055 C  CA    . ILE C 2 104 ? 5.383   17.416  20.333  1.00 46.80  ? 104 ILE A CA    1 
ATOM   2056 C  C     . ILE C 2 104 ? 6.389   17.463  21.466  1.00 48.23  ? 104 ILE A C     1 
ATOM   2057 O  O     . ILE C 2 104 ? 7.217   16.569  21.590  1.00 54.49  ? 104 ILE A O     1 
ATOM   2058 C  CB    . ILE C 2 104 ? 5.655   18.570  19.366  1.00 46.09  ? 104 ILE A CB    1 
ATOM   2059 C  CG1   . ILE C 2 104 ? 4.658   18.525  18.206  1.00 45.93  ? 104 ILE A CG1   1 
ATOM   2060 C  CG2   . ILE C 2 104 ? 7.077   18.472  18.836  1.00 42.12  ? 104 ILE A CG2   1 
ATOM   2061 C  CD1   . ILE C 2 104 ? 4.673   17.238  17.419  1.00 37.66  ? 104 ILE A CD1   1 
ATOM   2062 N  N     . ILE C 2 105 ? 6.306   18.494  22.300  1.00 48.09  ? 105 ILE A N     1 
ATOM   2063 C  CA    . ILE C 2 105 ? 7.218   18.637  23.434  1.00 49.83  ? 105 ILE A CA    1 
ATOM   2064 C  C     . ILE C 2 105 ? 7.287   17.344  24.241  1.00 52.19  ? 105 ILE A C     1 
ATOM   2065 O  O     . ILE C 2 105 ? 8.376   16.864  24.587  1.00 50.24  ? 105 ILE A O     1 
ATOM   2066 C  CB    . ILE C 2 105 ? 6.773   19.765  24.379  1.00 49.82  ? 105 ILE A CB    1 
ATOM   2067 C  CG1   . ILE C 2 105 ? 7.002   21.118  23.721  1.00 49.11  ? 105 ILE A CG1   1 
ATOM   2068 C  CG2   . ILE C 2 105 ? 7.539   19.685  25.690  1.00 50.03  ? 105 ILE A CG2   1 
ATOM   2069 C  CD1   . ILE C 2 105 ? 6.473   22.271  24.541  1.00 57.68  ? 105 ILE A CD1   1 
ATOM   2070 N  N     . GLY C 2 106 ? 6.117   16.790  24.537  1.00 49.88  ? 106 GLY A N     1 
ATOM   2071 C  CA    . GLY C 2 106 ? 6.061   15.557  25.296  1.00 51.52  ? 106 GLY A CA    1 
ATOM   2072 C  C     . GLY C 2 106 ? 6.889   14.450  24.679  1.00 48.54  ? 106 GLY A C     1 
ATOM   2073 O  O     . GLY C 2 106 ? 7.618   13.756  25.377  1.00 50.81  ? 106 GLY A O     1 
ATOM   2074 N  N     . ASP C 2 107 ? 6.794   14.292  23.367  1.00 47.76  ? 107 ASP A N     1 
ATOM   2075 C  CA    . ASP C 2 107 ? 7.544   13.246  22.701  1.00 49.65  ? 107 ASP A CA    1 
ATOM   2076 C  C     . ASP C 2 107 ? 9.026   13.529  22.618  1.00 49.50  ? 107 ASP A C     1 
ATOM   2077 O  O     . ASP C 2 107 ? 9.849   12.614  22.747  1.00 48.72  ? 107 ASP A O     1 
ATOM   2078 C  CB    . ASP C 2 107 ? 6.972   12.979  21.313  1.00 49.36  ? 107 ASP A CB    1 
ATOM   2079 C  CG    . ASP C 2 107 ? 5.611   12.324  21.385  1.00 57.97  ? 107 ASP A CG    1 
ATOM   2080 O  OD1   . ASP C 2 107 ? 5.433   11.456  22.271  1.00 57.50  ? 107 ASP A OD1   1 
ATOM   2081 O  OD2   . ASP C 2 107 ? 4.723   12.669  20.574  1.00 62.74  ? 107 ASP A OD2   1 
ATOM   2082 N  N     . VAL C 2 108 ? 9.384   14.785  22.405  1.00 43.13  ? 108 VAL A N     1 
ATOM   2083 C  CA    . VAL C 2 108 ? 10.788  15.092  22.328  1.00 41.38  ? 108 VAL A CA    1 
ATOM   2084 C  C     . VAL C 2 108 ? 11.402  14.862  23.697  1.00 42.48  ? 108 VAL A C     1 
ATOM   2085 O  O     . VAL C 2 108 ? 12.533  14.383  23.800  1.00 42.95  ? 108 VAL A O     1 
ATOM   2086 C  CB    . VAL C 2 108 ? 11.029  16.528  21.893  1.00 46.34  ? 108 VAL A CB    1 
ATOM   2087 C  CG1   . VAL C 2 108 ? 12.529  16.783  21.798  1.00 45.95  ? 108 VAL A CG1   1 
ATOM   2088 C  CG2   . VAL C 2 108 ? 10.364  16.773  20.542  1.00 46.23  ? 108 VAL A CG2   1 
ATOM   2089 N  N     . PHE C 2 109 ? 10.654  15.178  24.750  1.00 38.63  ? 109 PHE A N     1 
ATOM   2090 C  CA    . PHE C 2 109 ? 11.168  14.988  26.101  1.00 40.61  ? 109 PHE A CA    1 
ATOM   2091 C  C     . PHE C 2 109 ? 11.589  13.525  26.242  1.00 44.54  ? 109 PHE A C     1 
ATOM   2092 O  O     . PHE C 2 109 ? 12.736  13.211  26.584  1.00 41.07  ? 109 PHE A O     1 
ATOM   2093 C  CB    . PHE C 2 109 ? 10.091  15.306  27.121  1.00 37.51  ? 109 PHE A CB    1 
ATOM   2094 C  CG    . PHE C 2 109 ? 10.556  15.220  28.547  1.00 46.78  ? 109 PHE A CG    1 
ATOM   2095 C  CD1   . PHE C 2 109 ? 11.471  16.143  29.055  1.00 46.40  ? 109 PHE A CD1   1 
ATOM   2096 C  CD2   . PHE C 2 109 ? 10.048  14.237  29.403  1.00 46.39  ? 109 PHE A CD2   1 
ATOM   2097 C  CE1   . PHE C 2 109 ? 11.874  16.092  30.394  1.00 44.81  ? 109 PHE A CE1   1 
ATOM   2098 C  CE2   . PHE C 2 109 ? 10.444  14.176  30.747  1.00 43.19  ? 109 PHE A CE2   1 
ATOM   2099 C  CZ    . PHE C 2 109 ? 11.359  15.107  31.241  1.00 47.91  ? 109 PHE A CZ    1 
ATOM   2100 N  N     . GLU C 2 110 ? 10.647  12.634  25.953  1.00 46.58  ? 110 GLU A N     1 
ATOM   2101 C  CA    . GLU C 2 110 ? 10.899  11.206  26.035  1.00 49.35  ? 110 GLU A CA    1 
ATOM   2102 C  C     . GLU C 2 110 ? 12.051  10.804  25.110  1.00 50.07  ? 110 GLU A C     1 
ATOM   2103 O  O     . GLU C 2 110 ? 12.979  10.125  25.538  1.00 50.11  ? 110 GLU A O     1 
ATOM   2104 C  CB    . GLU C 2 110 ? 9.631   10.436  25.669  1.00 49.29  ? 110 GLU A CB    1 
ATOM   2105 C  CG    . GLU C 2 110 ? 8.478   10.682  26.614  1.00 53.91  ? 110 GLU A CG    1 
ATOM   2106 C  CD    . GLU C 2 110 ? 7.150   10.192  26.061  1.00 59.41  ? 110 GLU A CD    1 
ATOM   2107 O  OE1   . GLU C 2 110 ? 6.751   10.663  24.969  1.00 65.72  ? 110 GLU A OE1   1 
ATOM   2108 O  OE2   . GLU C 2 110 ? 6.502   9.341   26.715  1.00 59.66  ? 110 GLU A OE2   1 
ATOM   2109 N  N     . ALA C 2 111 ? 11.994  11.233  23.853  1.00 45.41  ? 111 ALA A N     1 
ATOM   2110 C  CA    . ALA C 2 111 ? 13.037  10.912  22.892  1.00 45.92  ? 111 ALA A CA    1 
ATOM   2111 C  C     . ALA C 2 111 ? 14.421  11.430  23.322  1.00 50.14  ? 111 ALA A C     1 
ATOM   2112 O  O     . ALA C 2 111 ? 15.439  10.796  23.051  1.00 49.56  ? 111 ALA A O     1 
ATOM   2113 C  CB    . ALA C 2 111 ? 12.664  11.469  21.536  1.00 44.79  ? 111 ALA A CB    1 
ATOM   2114 N  N     . LEU C 2 112 ? 14.461  12.577  23.995  1.00 49.79  ? 112 LEU A N     1 
ATOM   2115 C  CA    . LEU C 2 112 ? 15.730  13.134  24.453  1.00 47.58  ? 112 LEU A CA    1 
ATOM   2116 C  C     . LEU C 2 112 ? 16.457  12.213  25.413  1.00 47.38  ? 112 LEU A C     1 
ATOM   2117 O  O     . LEU C 2 112 ? 17.678  12.097  25.360  1.00 44.22  ? 112 LEU A O     1 
ATOM   2118 C  CB    . LEU C 2 112 ? 15.511  14.478  25.139  1.00 44.13  ? 112 LEU A CB    1 
ATOM   2119 C  CG    . LEU C 2 112 ? 15.663  15.656  24.191  1.00 48.63  ? 112 LEU A CG    1 
ATOM   2120 C  CD1   . LEU C 2 112 ? 15.249  16.951  24.870  1.00 49.85  ? 112 LEU A CD1   1 
ATOM   2121 C  CD2   . LEU C 2 112 ? 17.107  15.703  23.721  1.00 46.70  ? 112 LEU A CD2   1 
ATOM   2122 N  N     . TRP C 2 113 ? 15.702  11.573  26.301  1.00 45.27  ? 113 TRP A N     1 
ATOM   2123 C  CA    . TRP C 2 113 ? 16.289  10.667  27.278  1.00 50.19  ? 113 TRP A CA    1 
ATOM   2124 C  C     . TRP C 2 113 ? 16.682  9.307   26.706  1.00 49.83  ? 113 TRP A C     1 
ATOM   2125 O  O     . TRP C 2 113 ? 17.546  8.621   27.248  1.00 47.18  ? 113 TRP A O     1 
ATOM   2126 C  CB    . TRP C 2 113 ? 15.358  10.523  28.480  1.00 53.37  ? 113 TRP A CB    1 
ATOM   2127 C  CG    . TRP C 2 113 ? 15.370  11.770  29.281  1.00 58.27  ? 113 TRP A CG    1 
ATOM   2128 C  CD1   . TRP C 2 113 ? 14.433  12.763  29.276  1.00 59.23  ? 113 TRP A CD1   1 
ATOM   2129 C  CD2   . TRP C 2 113 ? 16.438  12.228  30.116  1.00 62.14  ? 113 TRP A CD2   1 
ATOM   2130 N  NE1   . TRP C 2 113 ? 14.853  13.816  30.054  1.00 59.18  ? 113 TRP A NE1   1 
ATOM   2131 C  CE2   . TRP C 2 113 ? 16.082  13.515  30.581  1.00 61.78  ? 113 TRP A CE2   1 
ATOM   2132 C  CE3   . TRP C 2 113 ? 17.668  11.678  30.515  1.00 60.03  ? 113 TRP A CE3   1 
ATOM   2133 C  CZ2   . TRP C 2 113 ? 16.914  14.265  31.427  1.00 63.63  ? 113 TRP A CZ2   1 
ATOM   2134 C  CZ3   . TRP C 2 113 ? 18.497  12.422  31.357  1.00 59.80  ? 113 TRP A CZ3   1 
ATOM   2135 C  CH2   . TRP C 2 113 ? 18.114  13.703  31.803  1.00 63.18  ? 113 TRP A CH2   1 
ATOM   2136 N  N     . ALA C 2 114 ? 16.052  8.913   25.608  1.00 47.88  ? 114 ALA A N     1 
ATOM   2137 C  CA    . ALA C 2 114 ? 16.430  7.670   24.983  1.00 44.96  ? 114 ALA A CA    1 
ATOM   2138 C  C     . ALA C 2 114 ? 17.777  7.991   24.333  1.00 46.45  ? 114 ALA A C     1 
ATOM   2139 O  O     . ALA C 2 114 ? 18.727  7.205   24.411  1.00 47.71  ? 114 ALA A O     1 
ATOM   2140 C  CB    . ALA C 2 114 ? 15.409  7.269   23.929  1.00 35.96  ? 114 ALA A CB    1 
ATOM   2141 N  N     . ALA C 2 115 ? 17.859  9.171   23.720  1.00 42.90  ? 115 ALA A N     1 
ATOM   2142 C  CA    . ALA C 2 115 ? 19.072  9.586   23.032  1.00 41.09  ? 115 ALA A CA    1 
ATOM   2143 C  C     . ALA C 2 115 ? 20.275  9.714   23.958  1.00 39.11  ? 115 ALA A C     1 
ATOM   2144 O  O     . ALA C 2 115 ? 21.400  9.484   23.549  1.00 41.20  ? 115 ALA A O     1 
ATOM   2145 C  CB    . ALA C 2 115 ? 18.829  10.893  22.282  1.00 41.62  ? 115 ALA A CB    1 
ATOM   2146 N  N     . VAL C 2 116 ? 20.042  10.094  25.203  1.00 40.78  ? 116 VAL A N     1 
ATOM   2147 C  CA    . VAL C 2 116 ? 21.130  10.209  26.156  1.00 44.08  ? 116 VAL A CA    1 
ATOM   2148 C  C     . VAL C 2 116 ? 21.611  8.808   26.496  1.00 45.68  ? 116 VAL A C     1 
ATOM   2149 O  O     . VAL C 2 116 ? 22.805  8.531   26.501  1.00 46.92  ? 116 VAL A O     1 
ATOM   2150 C  CB    . VAL C 2 116 ? 20.658  10.889  27.429  1.00 47.35  ? 116 VAL A CB    1 
ATOM   2151 C  CG1   . VAL C 2 116 ? 21.678  10.669  28.537  1.00 47.17  ? 116 VAL A CG1   1 
ATOM   2152 C  CG2   . VAL C 2 116 ? 20.436  12.388  27.156  1.00 47.29  ? 116 VAL A CG2   1 
ATOM   2153 N  N     . TYR C 2 117 ? 20.648  7.934   26.770  1.00 46.52  ? 117 TYR A N     1 
ATOM   2154 C  CA    . TYR C 2 117 ? 20.880  6.537   27.101  1.00 44.42  ? 117 TYR A CA    1 
ATOM   2155 C  C     . TYR C 2 117 ? 21.793  5.893   26.068  1.00 46.15  ? 117 TYR A C     1 
ATOM   2156 O  O     . TYR C 2 117 ? 22.880  5.402   26.392  1.00 47.91  ? 117 TYR A O     1 
ATOM   2157 C  CB    . TYR C 2 117 ? 19.538  5.816   27.132  1.00 48.02  ? 117 TYR A CB    1 
ATOM   2158 C  CG    . TYR C 2 117 ? 19.626  4.314   27.287  1.00 56.02  ? 117 TYR A CG    1 
ATOM   2159 C  CD1   . TYR C 2 117 ? 20.223  3.740   28.411  1.00 51.62  ? 117 TYR A CD1   1 
ATOM   2160 C  CD2   . TYR C 2 117 ? 19.098  3.466   26.315  1.00 53.12  ? 117 TYR A CD2   1 
ATOM   2161 C  CE1   . TYR C 2 117 ? 20.290  2.371   28.564  1.00 47.27  ? 117 TYR A CE1   1 
ATOM   2162 C  CE2   . TYR C 2 117 ? 19.166  2.098   26.460  1.00 54.01  ? 117 TYR A CE2   1 
ATOM   2163 C  CZ    . TYR C 2 117 ? 19.765  1.553   27.586  1.00 52.75  ? 117 TYR A CZ    1 
ATOM   2164 O  OH    . TYR C 2 117 ? 19.864  0.183   27.712  1.00 54.97  ? 117 TYR A OH    1 
ATOM   2165 N  N     . ILE C 2 118 ? 21.340  5.904   24.819  1.00 43.68  ? 118 ILE A N     1 
ATOM   2166 C  CA    . ILE C 2 118 ? 22.096  5.343   23.701  1.00 41.97  ? 118 ILE A CA    1 
ATOM   2167 C  C     . ILE C 2 118 ? 23.506  5.927   23.576  1.00 46.41  ? 118 ILE A C     1 
ATOM   2168 O  O     . ILE C 2 118 ? 24.494  5.186   23.579  1.00 45.31  ? 118 ILE A O     1 
ATOM   2169 C  CB    . ILE C 2 118 ? 21.359  5.592   22.379  1.00 38.38  ? 118 ILE A CB    1 
ATOM   2170 C  CG1   . ILE C 2 118 ? 20.061  4.787   22.355  1.00 42.36  ? 118 ILE A CG1   1 
ATOM   2171 C  CG2   . ILE C 2 118 ? 22.237  5.229   21.218  1.00 29.28  ? 118 ILE A CG2   1 
ATOM   2172 C  CD1   . ILE C 2 118 ? 19.137  5.128   21.200  1.00 39.80  ? 118 ILE A CD1   1 
ATOM   2173 N  N     . ASP C 2 119 ? 23.591  7.254   23.461  1.00 45.92  ? 119 ASP A N     1 
ATOM   2174 C  CA    . ASP C 2 119 ? 24.876  7.939   23.317  1.00 46.71  ? 119 ASP A CA    1 
ATOM   2175 C  C     . ASP C 2 119 ? 25.783  7.678   24.513  1.00 44.08  ? 119 ASP A C     1 
ATOM   2176 O  O     . ASP C 2 119 ? 26.992  7.796   24.422  1.00 41.54  ? 119 ASP A O     1 
ATOM   2177 C  CB    . ASP C 2 119 ? 24.659  9.446   23.164  1.00 46.90  ? 119 ASP A CB    1 
ATOM   2178 C  CG    . ASP C 2 119 ? 25.852  10.145  22.532  1.00 51.44  ? 119 ASP A CG    1 
ATOM   2179 O  OD1   . ASP C 2 119 ? 26.087  9.933   21.320  1.00 56.35  ? 119 ASP A OD1   1 
ATOM   2180 O  OD2   . ASP C 2 119 ? 26.557  10.898  23.239  1.00 47.54  ? 119 ASP A OD2   1 
ATOM   2181 N  N     . SER C 2 120 ? 25.174  7.323   25.632  1.00 46.15  ? 120 SER A N     1 
ATOM   2182 C  CA    . SER C 2 120 ? 25.885  7.040   26.870  1.00 47.65  ? 120 SER A CA    1 
ATOM   2183 C  C     . SER C 2 120 ? 26.484  5.629   26.858  1.00 50.12  ? 120 SER A C     1 
ATOM   2184 O  O     . SER C 2 120 ? 27.077  5.186   27.849  1.00 44.55  ? 120 SER A O     1 
ATOM   2185 C  CB    . SER C 2 120 ? 24.903  7.165   28.029  1.00 37.79  ? 120 SER A CB    1 
ATOM   2186 O  OG    . SER C 2 120 ? 25.526  6.858   29.250  1.00 57.70  ? 120 SER A OG    1 
ATOM   2187 N  N     . GLY C 2 121 ? 26.327  4.937   25.728  1.00 51.06  ? 121 GLY A N     1 
ATOM   2188 C  CA    . GLY C 2 121 ? 26.811  3.575   25.604  1.00 49.25  ? 121 GLY A CA    1 
ATOM   2189 C  C     . GLY C 2 121 ? 25.781  2.624   26.198  1.00 48.88  ? 121 GLY A C     1 
ATOM   2190 O  O     . GLY C 2 121 ? 26.074  1.466   26.483  1.00 48.35  ? 121 GLY A O     1 
ATOM   2191 N  N     . ARG C 2 122 ? 24.568  3.141   26.389  1.00 50.54  ? 122 ARG A N     1 
ATOM   2192 C  CA    . ARG C 2 122 ? 23.425  2.407   26.954  1.00 48.12  ? 122 ARG A CA    1 
ATOM   2193 C  C     . ARG C 2 122 ? 23.546  2.158   28.445  1.00 47.09  ? 122 ARG A C     1 
ATOM   2194 O  O     . ARG C 2 122 ? 23.156  1.106   28.946  1.00 46.10  ? 122 ARG A O     1 
ATOM   2195 C  CB    . ARG C 2 122 ? 23.201  1.090   26.213  1.00 45.43  ? 122 ARG A CB    1 
ATOM   2196 C  CG    . ARG C 2 122 ? 23.096  1.281   24.703  1.00 48.31  ? 122 ARG A CG    1 
ATOM   2197 C  CD    . ARG C 2 122 ? 22.639  0.030   24.026  1.00 50.10  ? 122 ARG A CD    1 
ATOM   2198 N  NE    . ARG C 2 122 ? 21.226  0.108   23.710  1.00 49.01  ? 122 ARG A NE    1 
ATOM   2199 C  CZ    . ARG C 2 122 ? 20.763  0.688   22.614  1.00 55.49  ? 122 ARG A CZ    1 
ATOM   2200 N  NH1   . ARG C 2 122 ? 21.619  1.224   21.754  1.00 48.93  ? 122 ARG A NH1   1 
ATOM   2201 N  NH2   . ARG C 2 122 ? 19.453  0.725   22.377  1.00 55.27  ? 122 ARG A NH2   1 
ATOM   2202 N  N     . ASP C 2 123 ? 24.074  3.164   29.140  1.00 49.83  ? 123 ASP A N     1 
ATOM   2203 C  CA    . ASP C 2 123 ? 24.279  3.157   30.588  1.00 49.72  ? 123 ASP A CA    1 
ATOM   2204 C  C     . ASP C 2 123 ? 22.977  3.655   31.210  1.00 50.28  ? 123 ASP A C     1 
ATOM   2205 O  O     . ASP C 2 123 ? 22.689  4.852   31.175  1.00 49.95  ? 123 ASP A O     1 
ATOM   2206 C  CB    . ASP C 2 123 ? 25.415  4.127   30.938  1.00 49.68  ? 123 ASP A CB    1 
ATOM   2207 C  CG    . ASP C 2 123 ? 25.874  4.021   32.384  1.00 55.54  ? 123 ASP A CG    1 
ATOM   2208 O  OD1   . ASP C 2 123 ? 25.051  3.751   33.288  1.00 51.49  ? 123 ASP A OD1   1 
ATOM   2209 O  OD2   . ASP C 2 123 ? 27.081  4.236   32.618  1.00 56.40  ? 123 ASP A OD2   1 
ATOM   2210 N  N     . ALA C 2 124 ? 22.190  2.747   31.780  1.00 50.07  ? 124 ALA A N     1 
ATOM   2211 C  CA    . ALA C 2 124 ? 20.912  3.130   32.385  1.00 50.95  ? 124 ALA A CA    1 
ATOM   2212 C  C     . ALA C 2 124 ? 21.029  3.767   33.769  1.00 53.16  ? 124 ALA A C     1 
ATOM   2213 O  O     . ALA C 2 124 ? 20.100  4.441   34.218  1.00 54.63  ? 124 ALA A O     1 
ATOM   2214 C  CB    . ALA C 2 124 ? 19.983  1.928   32.448  1.00 42.62  ? 124 ALA A CB    1 
ATOM   2215 N  N     . ASN C 2 125 ? 22.154  3.556   34.447  1.00 53.06  ? 125 ASN A N     1 
ATOM   2216 C  CA    . ASN C 2 125 ? 22.351  4.137   35.775  1.00 54.22  ? 125 ASN A CA    1 
ATOM   2217 C  C     . ASN C 2 125 ? 22.684  5.614   35.634  1.00 50.90  ? 125 ASN A C     1 
ATOM   2218 O  O     . ASN C 2 125 ? 22.087  6.477   36.279  1.00 43.56  ? 125 ASN A O     1 
ATOM   2219 C  CB    . ASN C 2 125 ? 23.492  3.430   36.512  1.00 60.13  ? 125 ASN A CB    1 
ATOM   2220 C  CG    . ASN C 2 125 ? 23.243  1.941   36.684  1.00 65.45  ? 125 ASN A CG    1 
ATOM   2221 O  OD1   . ASN C 2 125 ? 22.125  1.518   36.996  1.00 66.82  ? 125 ASN A OD1   1 
ATOM   2222 N  ND2   . ASN C 2 125 ? 24.289  1.137   36.495  1.00 63.86  ? 125 ASN A ND2   1 
ATOM   2223 N  N     . PHE C 2 126 ? 23.660  5.893   34.786  1.00 50.40  ? 126 PHE A N     1 
ATOM   2224 C  CA    . PHE C 2 126 ? 24.066  7.256   34.550  1.00 47.76  ? 126 PHE A CA    1 
ATOM   2225 C  C     . PHE C 2 126 ? 22.879  8.076   34.075  1.00 48.52  ? 126 PHE A C     1 
ATOM   2226 O  O     . PHE C 2 126 ? 22.628  9.163   34.595  1.00 45.33  ? 126 PHE A O     1 
ATOM   2227 C  CB    . PHE C 2 126 ? 25.175  7.306   33.509  1.00 49.81  ? 126 PHE A CB    1 
ATOM   2228 C  CG    . PHE C 2 126 ? 25.534  8.697   33.089  1.00 54.54  ? 126 PHE A CG    1 
ATOM   2229 C  CD1   . PHE C 2 126 ? 25.778  9.680   34.044  1.00 46.72  ? 126 PHE A CD1   1 
ATOM   2230 C  CD2   . PHE C 2 126 ? 25.612  9.034   31.742  1.00 53.70  ? 126 PHE A CD2   1 
ATOM   2231 C  CE1   . PHE C 2 126 ? 26.088  10.972  33.664  1.00 48.81  ? 126 PHE A CE1   1 
ATOM   2232 C  CE2   . PHE C 2 126 ? 25.925  10.332  31.358  1.00 54.11  ? 126 PHE A CE2   1 
ATOM   2233 C  CZ    . PHE C 2 126 ? 26.161  11.301  32.322  1.00 48.22  ? 126 PHE A CZ    1 
ATOM   2234 N  N     . THR C 2 127 ? 22.144  7.547   33.096  1.00 47.67  ? 127 THR A N     1 
ATOM   2235 C  CA    . THR C 2 127 ? 20.975  8.243   32.552  1.00 48.20  ? 127 THR A CA    1 
ATOM   2236 C  C     . THR C 2 127 ? 19.895  8.430   33.615  1.00 45.32  ? 127 THR A C     1 
ATOM   2237 O  O     . THR C 2 127 ? 19.224  9.459   33.661  1.00 43.37  ? 127 THR A O     1 
ATOM   2238 C  CB    . THR C 2 127 ? 20.372  7.499   31.350  1.00 48.09  ? 127 THR A CB    1 
ATOM   2239 O  OG1   . THR C 2 127 ? 21.400  7.226   30.387  1.00 48.38  ? 127 THR A OG1   1 
ATOM   2240 C  CG2   . THR C 2 127 ? 19.307  8.349   30.696  1.00 40.71  ? 127 THR A CG2   1 
ATOM   2241 N  N     . ARG C 2 128 ? 19.725  7.439   34.475  1.00 43.86  ? 128 ARG A N     1 
ATOM   2242 C  CA    . ARG C 2 128 ? 18.744  7.570   35.536  1.00 42.86  ? 128 ARG A CA    1 
ATOM   2243 C  C     . ARG C 2 128 ? 19.214  8.680   36.487  1.00 44.64  ? 128 ARG A C     1 
ATOM   2244 O  O     . ARG C 2 128 ? 18.400  9.389   37.073  1.00 47.20  ? 128 ARG A O     1 
ATOM   2245 C  CB    . ARG C 2 128 ? 18.597  6.253   36.302  1.00 34.57  ? 128 ARG A CB    1 
ATOM   2246 C  CG    . ARG C 2 128 ? 17.699  6.360   37.524  1.00 34.01  ? 128 ARG A CG    1 
ATOM   2247 C  CD    . ARG C 2 128 ? 17.878  5.163   38.423  1.00 40.07  ? 128 ARG A CD    1 
ATOM   2248 N  NE    . ARG C 2 128 ? 19.296  4.930   38.653  1.00 50.07  ? 128 ARG A NE    1 
ATOM   2249 C  CZ    . ARG C 2 128 ? 19.800  3.879   39.289  1.00 53.78  ? 128 ARG A CZ    1 
ATOM   2250 N  NH1   . ARG C 2 128 ? 18.997  2.943   39.772  1.00 59.63  ? 128 ARG A NH1   1 
ATOM   2251 N  NH2   . ARG C 2 128 ? 21.117  3.763   39.431  1.00 58.37  ? 128 ARG A NH2   1 
ATOM   2252 N  N     . GLU C 2 129 ? 20.523  8.847   36.642  1.00 45.74  ? 129 GLU A N     1 
ATOM   2253 C  CA    . GLU C 2 129 ? 21.010  9.883   37.547  1.00 44.70  ? 129 GLU A CA    1 
ATOM   2254 C  C     . GLU C 2 129 ? 20.888  11.284  36.971  1.00 42.68  ? 129 GLU A C     1 
ATOM   2255 O  O     . GLU C 2 129 ? 20.583  12.224  37.695  1.00 43.60  ? 129 GLU A O     1 
ATOM   2256 C  CB    . GLU C 2 129 ? 22.448  9.595   37.967  1.00 48.75  ? 129 GLU A CB    1 
ATOM   2257 C  CG    . GLU C 2 129 ? 22.578  8.282   38.707  1.00 48.98  ? 129 GLU A CG    1 
ATOM   2258 C  CD    . GLU C 2 129 ? 21.472  8.099   39.721  1.00 53.88  ? 129 GLU A CD    1 
ATOM   2259 O  OE1   . GLU C 2 129 ? 21.332  8.958   40.612  1.00 54.41  ? 129 GLU A OE1   1 
ATOM   2260 O  OE2   . GLU C 2 129 ? 20.735  7.100   39.629  1.00 61.40  ? 129 GLU A OE2   1 
ATOM   2261 N  N     . LEU C 2 130 ? 21.130  11.430  35.673  1.00 45.03  ? 130 LEU A N     1 
ATOM   2262 C  CA    . LEU C 2 130 ? 20.993  12.734  35.031  1.00 44.71  ? 130 LEU A CA    1 
ATOM   2263 C  C     . LEU C 2 130 ? 19.538  13.155  35.222  1.00 46.31  ? 130 LEU A C     1 
ATOM   2264 O  O     . LEU C 2 130 ? 19.244  14.271  35.638  1.00 46.27  ? 130 LEU A O     1 
ATOM   2265 C  CB    . LEU C 2 130 ? 21.283  12.634  33.536  1.00 42.48  ? 130 LEU A CB    1 
ATOM   2266 C  CG    . LEU C 2 130 ? 22.645  13.042  32.980  1.00 46.15  ? 130 LEU A CG    1 
ATOM   2267 C  CD1   . LEU C 2 130 ? 22.574  12.992  31.457  1.00 50.32  ? 130 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU C 2 130 ? 23.005  14.439  33.440  1.00 44.73  ? 130 LEU A CD2   1 
ATOM   2269 N  N     . PHE C 2 131 ? 18.633  12.232  34.918  1.00 44.70  ? 131 PHE A N     1 
ATOM   2270 C  CA    . PHE C 2 131 ? 17.210  12.469  35.048  1.00 44.18  ? 131 PHE A CA    1 
ATOM   2271 C  C     . PHE C 2 131 ? 16.877  12.947  36.456  1.00 46.86  ? 131 PHE A C     1 
ATOM   2272 O  O     . PHE C 2 131 ? 16.171  13.940  36.622  1.00 50.11  ? 131 PHE A O     1 
ATOM   2273 C  CB    . PHE C 2 131 ? 16.439  11.177  34.742  1.00 42.23  ? 131 PHE A CB    1 
ATOM   2274 C  CG    . PHE C 2 131 ? 14.955  11.369  34.632  1.00 36.34  ? 131 PHE A CG    1 
ATOM   2275 C  CD1   . PHE C 2 131 ? 14.381  11.813  33.440  1.00 41.22  ? 131 PHE A CD1   1 
ATOM   2276 C  CD2   . PHE C 2 131 ? 14.132  11.158  35.728  1.00 33.78  ? 131 PHE A CD2   1 
ATOM   2277 C  CE1   . PHE C 2 131 ? 13.013  12.045  33.351  1.00 30.61  ? 131 PHE A CE1   1 
ATOM   2278 C  CE2   . PHE C 2 131 ? 12.767  11.392  35.642  1.00 29.67  ? 131 PHE A CE2   1 
ATOM   2279 C  CZ    . PHE C 2 131 ? 12.214  11.836  34.452  1.00 29.89  ? 131 PHE A CZ    1 
ATOM   2280 N  N     . TYR C 2 132 ? 17.376  12.249  37.472  1.00 45.89  ? 132 TYR A N     1 
ATOM   2281 C  CA    . TYR C 2 132 ? 17.088  12.648  38.844  1.00 49.16  ? 132 TYR A CA    1 
ATOM   2282 C  C     . TYR C 2 132 ? 17.699  13.992  39.212  1.00 53.63  ? 132 TYR A C     1 
ATOM   2283 O  O     . TYR C 2 132 ? 17.027  14.836  39.826  1.00 53.87  ? 132 TYR A O     1 
ATOM   2284 C  CB    . TYR C 2 132 ? 17.563  11.596  39.845  1.00 49.59  ? 132 TYR A CB    1 
ATOM   2285 C  CG    . TYR C 2 132 ? 16.794  10.301  39.790  1.00 48.20  ? 132 TYR A CG    1 
ATOM   2286 C  CD1   . TYR C 2 132 ? 15.468  10.272  39.361  1.00 48.84  ? 132 TYR A CD1   1 
ATOM   2287 C  CD2   . TYR C 2 132 ? 17.381  9.106   40.184  1.00 48.95  ? 132 TYR A CD2   1 
ATOM   2288 C  CE1   . TYR C 2 132 ? 14.746  9.081   39.322  1.00 45.22  ? 132 TYR A CE1   1 
ATOM   2289 C  CE2   . TYR C 2 132 ? 16.662  7.904   40.154  1.00 52.69  ? 132 TYR A CE2   1 
ATOM   2290 C  CZ    . TYR C 2 132 ? 15.345  7.902   39.720  1.00 47.21  ? 132 TYR A CZ    1 
ATOM   2291 O  OH    . TYR C 2 132 ? 14.637  6.722   39.687  1.00 48.49  ? 132 TYR A OH    1 
ATOM   2292 N  N     . LYS C 2 133 ? 18.965  14.200  38.850  1.00 51.34  ? 133 LYS A N     1 
ATOM   2293 C  CA    . LYS C 2 133 ? 19.617  15.468  39.168  1.00 50.87  ? 133 LYS A CA    1 
ATOM   2294 C  C     . LYS C 2 133 ? 18.745  16.630  38.705  1.00 48.76  ? 133 LYS A C     1 
ATOM   2295 O  O     . LYS C 2 133 ? 18.740  17.698  39.313  1.00 48.78  ? 133 LYS A O     1 
ATOM   2296 C  CB    . LYS C 2 133 ? 21.002  15.565  38.514  1.00 48.49  ? 133 LYS A CB    1 
ATOM   2297 C  CG    . LYS C 2 133 ? 22.108  14.851  39.284  1.00 57.37  ? 133 LYS A CG    1 
ATOM   2298 C  CD    . LYS C 2 133 ? 23.496  15.420  38.950  1.00 63.78  ? 133 LYS A CD    1 
ATOM   2299 C  CE    . LYS C 2 133 ? 24.060  14.928  37.610  1.00 65.51  ? 133 LYS A CE    1 
ATOM   2300 N  NZ    . LYS C 2 133 ? 24.501  13.494  37.655  1.00 69.06  ? 133 LYS A NZ    1 
ATOM   2301 N  N     . LEU C 2 134 ? 17.991  16.399  37.639  1.00 48.04  ? 134 LEU A N     1 
ATOM   2302 C  CA    . LEU C 2 134 ? 17.113  17.410  37.071  1.00 46.20  ? 134 LEU A CA    1 
ATOM   2303 C  C     . LEU C 2 134 ? 15.664  17.375  37.535  1.00 46.48  ? 134 LEU A C     1 
ATOM   2304 O  O     . LEU C 2 134 ? 15.047  18.419  37.656  1.00 44.36  ? 134 LEU A O     1 
ATOM   2305 C  CB    . LEU C 2 134 ? 17.101  17.302  35.546  1.00 45.11  ? 134 LEU A CB    1 
ATOM   2306 C  CG    . LEU C 2 134 ? 18.325  17.719  34.733  1.00 47.26  ? 134 LEU A CG    1 
ATOM   2307 C  CD1   . LEU C 2 134 ? 18.168  17.158  33.350  1.00 48.65  ? 134 LEU A CD1   1 
ATOM   2308 C  CD2   . LEU C 2 134 ? 18.460  19.244  34.679  1.00 39.81  ? 134 LEU A CD2   1 
ATOM   2309 N  N     . PHE C 2 135 ? 15.110  16.198  37.811  1.00 46.50  ? 135 PHE A N     1 
ATOM   2310 C  CA    . PHE C 2 135 ? 13.695  16.162  38.162  1.00 45.07  ? 135 PHE A CA    1 
ATOM   2311 C  C     . PHE C 2 135 ? 13.241  15.445  39.418  1.00 47.34  ? 135 PHE A C     1 
ATOM   2312 O  O     . PHE C 2 135 ? 12.047  15.424  39.689  1.00 46.36  ? 135 PHE A O     1 
ATOM   2313 C  CB    . PHE C 2 135 ? 12.902  15.584  36.981  1.00 43.97  ? 135 PHE A CB    1 
ATOM   2314 C  CG    . PHE C 2 135 ? 13.292  16.152  35.645  1.00 32.89  ? 135 PHE A CG    1 
ATOM   2315 C  CD1   . PHE C 2 135 ? 12.979  17.452  35.311  1.00 30.35  ? 135 PHE A CD1   1 
ATOM   2316 C  CD2   . PHE C 2 135 ? 13.969  15.376  34.724  1.00 38.15  ? 135 PHE A CD2   1 
ATOM   2317 C  CE1   . PHE C 2 135 ? 13.328  17.971  34.083  1.00 27.67  ? 135 PHE A CE1   1 
ATOM   2318 C  CE2   . PHE C 2 135 ? 14.327  15.886  33.491  1.00 33.73  ? 135 PHE A CE2   1 
ATOM   2319 C  CZ    . PHE C 2 135 ? 14.005  17.185  33.170  1.00 35.78  ? 135 PHE A CZ    1 
ATOM   2320 N  N     . LYS C 2 136 ? 14.147  14.856  40.189  1.00 50.53  ? 136 LYS A N     1 
ATOM   2321 C  CA    . LYS C 2 136 ? 13.709  14.146  41.384  1.00 51.07  ? 136 LYS A CA    1 
ATOM   2322 C  C     . LYS C 2 136 ? 12.869  15.019  42.304  1.00 55.40  ? 136 LYS A C     1 
ATOM   2323 O  O     . LYS C 2 136 ? 11.806  14.600  42.765  1.00 57.54  ? 136 LYS A O     1 
ATOM   2324 C  CB    . LYS C 2 136 ? 14.901  13.582  42.151  1.00 50.82  ? 136 LYS A CB    1 
ATOM   2325 C  CG    . LYS C 2 136 ? 14.512  12.883  43.441  1.00 49.97  ? 136 LYS A CG    1 
ATOM   2326 C  CD    . LYS C 2 136 ? 15.677  12.096  44.007  1.00 57.71  ? 136 LYS A CD    1 
ATOM   2327 C  CE    . LYS C 2 136 ? 15.273  11.288  45.238  1.00 61.47  ? 136 LYS A CE    1 
ATOM   2328 N  NZ    . LYS C 2 136 ? 16.357  10.358  45.678  1.00 60.69  ? 136 LYS A NZ    1 
ATOM   2329 N  N     . GLU C 2 137 ? 13.336  16.236  42.556  1.00 60.31  ? 137 GLU A N     1 
ATOM   2330 C  CA    . GLU C 2 137 ? 12.623  17.167  43.430  1.00 63.81  ? 137 GLU A CA    1 
ATOM   2331 C  C     . GLU C 2 137 ? 11.190  17.439  42.962  1.00 60.95  ? 137 GLU A C     1 
ATOM   2332 O  O     . GLU C 2 137 ? 10.260  17.405  43.764  1.00 57.71  ? 137 GLU A O     1 
ATOM   2333 C  CB    . GLU C 2 137 ? 13.389  18.486  43.535  1.00 68.24  ? 137 GLU A CB    1 
ATOM   2334 C  CG    . GLU C 2 137 ? 12.607  19.588  44.217  1.00 81.10  ? 137 GLU A CG    1 
ATOM   2335 C  CD    . GLU C 2 137 ? 13.269  20.943  44.080  1.00 92.81  ? 137 GLU A CD    1 
ATOM   2336 O  OE1   . GLU C 2 137 ? 13.693  21.286  42.952  1.00 99.42  ? 137 GLU A OE1   1 
ATOM   2337 O  OE2   . GLU C 2 137 ? 13.357  21.669  45.096  1.00 97.02  ? 137 GLU A OE2   1 
ATOM   2338 N  N     . ASP C 2 138 ? 11.019  17.731  41.676  1.00 58.85  ? 138 ASP A N     1 
ATOM   2339 C  CA    . ASP C 2 138 ? 9.689   17.988  41.124  1.00 60.67  ? 138 ASP A CA    1 
ATOM   2340 C  C     . ASP C 2 138 ? 8.805   16.759  41.324  1.00 61.02  ? 138 ASP A C     1 
ATOM   2341 O  O     . ASP C 2 138 ? 7.655   16.858  41.758  1.00 59.47  ? 138 ASP A O     1 
ATOM   2342 C  CB    . ASP C 2 138 ? 9.761   18.265  39.617  1.00 64.81  ? 138 ASP A CB    1 
ATOM   2343 C  CG    . ASP C 2 138 ? 10.206  19.682  39.285  1.00 75.77  ? 138 ASP A CG    1 
ATOM   2344 O  OD1   . ASP C 2 138 ? 9.459   20.642  39.588  1.00 75.02  ? 138 ASP A OD1   1 
ATOM   2345 O  OD2   . ASP C 2 138 ? 11.305  19.833  38.705  1.00 79.17  ? 138 ASP A OD2   1 
ATOM   2346 N  N     . ILE C 2 139 ? 9.360   15.599  40.987  1.00 57.77  ? 139 ILE A N     1 
ATOM   2347 C  CA    . ILE C 2 139 ? 8.651   14.336  41.089  1.00 51.86  ? 139 ILE A CA    1 
ATOM   2348 C  C     . ILE C 2 139 ? 8.290   13.997  42.514  1.00 51.44  ? 139 ILE A C     1 
ATOM   2349 O  O     . ILE C 2 139 ? 7.166   13.586  42.781  1.00 50.02  ? 139 ILE A O     1 
ATOM   2350 C  CB    . ILE C 2 139 ? 9.489   13.194  40.496  1.00 50.92  ? 139 ILE A CB    1 
ATOM   2351 C  CG1   . ILE C 2 139 ? 9.863   13.535  39.054  1.00 44.03  ? 139 ILE A CG1   1 
ATOM   2352 C  CG2   . ILE C 2 139 ? 8.710   11.886  40.549  1.00 50.84  ? 139 ILE A CG2   1 
ATOM   2353 C  CD1   . ILE C 2 139 ? 10.740  12.501  38.390  1.00 41.35  ? 139 ILE A CD1   1 
ATOM   2354 N  N     . LEU C 2 140 ? 9.244   14.159  43.427  1.00 51.00  ? 140 LEU A N     1 
ATOM   2355 C  CA    . LEU C 2 140 ? 9.007   13.874  44.845  1.00 50.46  ? 140 LEU A CA    1 
ATOM   2356 C  C     . LEU C 2 140 ? 7.899   14.771  45.400  1.00 48.61  ? 140 LEU A C     1 
ATOM   2357 O  O     . LEU C 2 140 ? 7.103   14.363  46.244  1.00 52.31  ? 140 LEU A O     1 
ATOM   2358 C  CB    . LEU C 2 140 ? 10.291  14.090  45.645  1.00 43.90  ? 140 LEU A CB    1 
ATOM   2359 C  CG    . LEU C 2 140 ? 11.000  12.876  46.244  1.00 48.19  ? 140 LEU A CG    1 
ATOM   2360 C  CD1   . LEU C 2 140 ? 10.894  11.667  45.321  1.00 48.05  ? 140 LEU A CD1   1 
ATOM   2361 C  CD2   . LEU C 2 140 ? 12.451  13.230  46.481  1.00 45.68  ? 140 LEU A CD2   1 
ATOM   2362 N  N     . SER C 2 141 ? 7.846   15.991  44.896  1.00 43.08  ? 141 SER A N     1 
ATOM   2363 C  CA    . SER C 2 141 ? 6.857   16.958  45.329  1.00 44.26  ? 141 SER A CA    1 
ATOM   2364 C  C     . SER C 2 141 ? 5.461   16.550  44.870  1.00 44.10  ? 141 SER A C     1 
ATOM   2365 O  O     . SER C 2 141 ? 4.514   16.509  45.661  1.00 42.29  ? 141 SER A O     1 
ATOM   2366 C  CB    . SER C 2 141 ? 7.205   18.325  44.738  1.00 39.20  ? 141 SER A CB    1 
ATOM   2367 O  OG    . SER C 2 141 ? 6.855   19.353  45.631  1.00 43.07  ? 141 SER A OG    1 
ATOM   2368 N  N     . ALA C 2 142 ? 5.345   16.264  43.576  1.00 44.71  ? 142 ALA A N     1 
ATOM   2369 C  CA    . ALA C 2 142 ? 4.078   15.872  42.974  1.00 43.47  ? 142 ALA A CA    1 
ATOM   2370 C  C     . ALA C 2 142 ? 3.541   14.611  43.632  1.00 45.36  ? 142 ALA A C     1 
ATOM   2371 O  O     . ALA C 2 142 ? 2.338   14.466  43.789  1.00 47.93  ? 142 ALA A O     1 
ATOM   2372 C  CB    . ALA C 2 142 ? 4.261   15.657  41.477  1.00 42.20  ? 142 ALA A CB    1 
ATOM   2373 N  N     . ILE C 2 143 ? 4.444   13.705  44.014  1.00 46.92  ? 143 ILE A N     1 
ATOM   2374 C  CA    . ILE C 2 143 ? 4.091   12.446  44.685  1.00 43.08  ? 143 ILE A CA    1 
ATOM   2375 C  C     . ILE C 2 143 ? 3.579   12.766  46.085  1.00 48.57  ? 143 ILE A C     1 
ATOM   2376 O  O     . ILE C 2 143 ? 2.605   12.170  46.567  1.00 48.73  ? 143 ILE A O     1 
ATOM   2377 C  CB    . ILE C 2 143 ? 5.327   11.526  44.891  1.00 37.52  ? 143 ILE A CB    1 
ATOM   2378 C  CG1   . ILE C 2 143 ? 5.876   11.025  43.565  1.00 37.36  ? 143 ILE A CG1   1 
ATOM   2379 C  CG2   . ILE C 2 143 ? 4.973   10.376  45.797  1.00 21.95  ? 143 ILE A CG2   1 
ATOM   2380 C  CD1   . ILE C 2 143 ? 7.059   10.064  43.737  1.00 39.80  ? 143 ILE A CD1   1 
ATOM   2381 N  N     . LYS C 2 144 ? 4.270   13.697  46.740  1.00 51.51  ? 144 LYS A N     1 
ATOM   2382 C  CA    . LYS C 2 144 ? 3.924   14.104  48.092  1.00 58.66  ? 144 LYS A CA    1 
ATOM   2383 C  C     . LYS C 2 144 ? 2.491   14.618  48.140  1.00 61.21  ? 144 LYS A C     1 
ATOM   2384 O  O     . LYS C 2 144 ? 1.758   14.325  49.088  1.00 59.43  ? 144 LYS A O     1 
ATOM   2385 C  CB    . LYS C 2 144 ? 4.903   15.179  48.588  1.00 58.80  ? 144 LYS A CB    1 
ATOM   2386 C  CG    . LYS C 2 144 ? 4.757   15.537  50.063  1.00 66.93  ? 144 LYS A CG    1 
ATOM   2387 C  CD    . LYS C 2 144 ? 5.904   16.428  50.568  1.00 74.94  ? 144 LYS A CD    1 
ATOM   2388 C  CE    . LYS C 2 144 ? 7.240   15.671  50.635  1.00 79.70  ? 144 LYS A CE    1 
ATOM   2389 N  NZ    . LYS C 2 144 ? 8.381   16.519  51.108  1.00 80.86  ? 144 LYS A NZ    1 
ATOM   2390 N  N     . GLU C 2 145 ? 2.089   15.361  47.109  1.00 61.95  ? 145 GLU A N     1 
ATOM   2391 C  CA    . GLU C 2 145 ? 0.741   15.916  47.059  1.00 67.19  ? 145 GLU A CA    1 
ATOM   2392 C  C     . GLU C 2 145 ? -0.202  15.135  46.150  1.00 69.43  ? 145 GLU A C     1 
ATOM   2393 O  O     . GLU C 2 145 ? -1.279  15.620  45.797  1.00 70.65  ? 145 GLU A O     1 
ATOM   2394 C  CB    . GLU C 2 145 ? 0.787   17.374  46.603  1.00 66.07  ? 145 GLU A CB    1 
ATOM   2395 C  CG    . GLU C 2 145 ? 1.194   17.572  45.161  1.00 73.88  ? 145 GLU A CG    1 
ATOM   2396 C  CD    . GLU C 2 145 ? 1.169   19.035  44.750  1.00 82.13  ? 145 GLU A CD    1 
ATOM   2397 O  OE1   . GLU C 2 145 ? 0.123   19.690  44.964  1.00 82.11  ? 145 GLU A OE1   1 
ATOM   2398 O  OE2   . GLU C 2 145 ? 2.189   19.529  44.210  1.00 85.58  ? 145 GLU A OE2   1 
ATOM   2399 N  N     . GLY C 2 146 ? 0.196   13.924  45.779  1.00 69.05  ? 146 GLY A N     1 
ATOM   2400 C  CA    . GLY C 2 146 ? -0.637  13.113  44.908  1.00 69.47  ? 146 GLY A CA    1 
ATOM   2401 C  C     . GLY C 2 146 ? -2.014  12.791  45.462  1.00 68.84  ? 146 GLY A C     1 
ATOM   2402 O  O     . GLY C 2 146 ? -2.191  12.633  46.665  1.00 64.68  ? 146 GLY A O     1 
ATOM   2403 N  N     . ARG C 2 147 ? -2.992  12.678  44.571  1.00 72.83  ? 147 ARG A N     1 
ATOM   2404 C  CA    . ARG C 2 147 ? -4.370  12.379  44.962  1.00 76.97  ? 147 ARG A CA    1 
ATOM   2405 C  C     . ARG C 2 147 ? -5.160  11.797  43.791  1.00 75.11  ? 147 ARG A C     1 
ATOM   2406 O  O     . ARG C 2 147 ? -5.172  12.370  42.698  1.00 76.88  ? 147 ARG A O     1 
ATOM   2407 C  CB    . ARG C 2 147 ? -5.057  13.658  45.459  1.00 82.68  ? 147 ARG A CB    1 
ATOM   2408 C  CG    . ARG C 2 147 ? -6.571  13.563  45.654  1.00 88.70  ? 147 ARG A CG    1 
ATOM   2409 C  CD    . ARG C 2 147 ? -7.170  14.921  46.057  1.00 93.89  ? 147 ARG A CD    1 
ATOM   2410 N  NE    . ARG C 2 147 ? -6.693  15.384  47.366  1.00 100.60 ? 147 ARG A NE    1 
ATOM   2411 C  CZ    . ARG C 2 147 ? -6.996  16.562  47.913  1.00 100.17 ? 147 ARG A CZ    1 
ATOM   2412 N  NH1   . ARG C 2 147 ? -7.781  17.420  47.273  1.00 99.02  ? 147 ARG A NH1   1 
ATOM   2413 N  NH2   . ARG C 2 147 ? -6.512  16.886  49.105  1.00 96.61  ? 147 ARG A NH2   1 
ATOM   2414 N  N     . VAL C 2 148 ? -5.808  10.657  44.019  1.00 69.60  ? 148 VAL A N     1 
ATOM   2415 C  CA    . VAL C 2 148 ? -6.615  10.025  42.979  1.00 67.10  ? 148 VAL A CA    1 
ATOM   2416 C  C     . VAL C 2 148 ? -7.827  10.934  42.740  1.00 66.86  ? 148 VAL A C     1 
ATOM   2417 O  O     . VAL C 2 148 ? -8.589  11.212  43.663  1.00 64.09  ? 148 VAL A O     1 
ATOM   2418 C  CB    . VAL C 2 148 ? -7.122  8.618   43.421  1.00 64.53  ? 148 VAL A CB    1 
ATOM   2419 C  CG1   . VAL C 2 148 ? -8.055  8.047   42.377  1.00 62.55  ? 148 VAL A CG1   1 
ATOM   2420 C  CG2   . VAL C 2 148 ? -5.963  7.680   43.636  1.00 60.63  ? 148 VAL A CG2   1 
ATOM   2421 N  N     . LYS C 2 149 ? -8.003  11.404  41.511  1.00 65.70  ? 149 LYS A N     1 
ATOM   2422 C  CA    . LYS C 2 149 ? -9.127  12.279  41.201  1.00 68.02  ? 149 LYS A CA    1 
ATOM   2423 C  C     . LYS C 2 149 ? -10.124 11.570  40.278  1.00 66.15  ? 149 LYS A C     1 
ATOM   2424 O  O     . LYS C 2 149 ? -10.055 11.716  39.064  1.00 69.61  ? 149 LYS A O     1 
ATOM   2425 C  CB    . LYS C 2 149 ? -8.613  13.562  40.535  1.00 70.20  ? 149 LYS A CB    1 
ATOM   2426 C  CG    . LYS C 2 149 ? -7.438  14.234  41.260  1.00 74.23  ? 149 LYS A CG    1 
ATOM   2427 C  CD    . LYS C 2 149 ? -6.923  15.465  40.496  1.00 75.57  ? 149 LYS A CD    1 
ATOM   2428 C  CE    . LYS C 2 149 ? -5.602  16.009  41.063  1.00 75.47  ? 149 LYS A CE    1 
ATOM   2429 N  NZ    . LYS C 2 149 ? -4.409  15.145  40.778  1.00 71.94  ? 149 LYS A NZ    1 
ATOM   2430 N  N     . LYS C 2 150 ? -11.047 10.805  40.855  1.00 62.09  ? 150 LYS A N     1 
ATOM   2431 C  CA    . LYS C 2 150 ? -12.039 10.072  40.069  1.00 58.43  ? 150 LYS A CA    1 
ATOM   2432 C  C     . LYS C 2 150 ? -12.979 10.958  39.261  1.00 57.20  ? 150 LYS A C     1 
ATOM   2433 O  O     . LYS C 2 150 ? -13.412 12.007  39.736  1.00 58.67  ? 150 LYS A O     1 
ATOM   2434 C  CB    . LYS C 2 150 ? -12.860 9.166   40.983  1.00 55.75  ? 150 LYS A CB    1 
ATOM   2435 C  CG    . LYS C 2 150 ? -12.078 7.982   41.499  1.00 53.98  ? 150 LYS A CG    1 
ATOM   2436 C  CD    . LYS C 2 150 ? -12.924 7.082   42.393  1.00 52.86  ? 150 LYS A CD    1 
ATOM   2437 C  CE    . LYS C 2 150 ? -12.175 5.782   42.667  1.00 45.85  ? 150 LYS A CE    1 
ATOM   2438 N  NZ    . LYS C 2 150 ? -12.887 4.944   43.646  1.00 43.12  ? 150 LYS A NZ    1 
ATOM   2439 N  N     . ASP C 2 151 ? -13.297 10.525  38.044  1.00 52.72  ? 151 ASP A N     1 
ATOM   2440 C  CA    . ASP C 2 151 ? -14.185 11.278  37.173  1.00 50.85  ? 151 ASP A CA    1 
ATOM   2441 C  C     . ASP C 2 151 ? -15.645 10.975  37.470  1.00 49.60  ? 151 ASP A C     1 
ATOM   2442 O  O     . ASP C 2 151 ? -15.972 9.949   38.069  1.00 42.51  ? 151 ASP A O     1 
ATOM   2443 C  CB    . ASP C 2 151 ? -13.886 10.986  35.699  1.00 60.55  ? 151 ASP A CB    1 
ATOM   2444 C  CG    . ASP C 2 151 ? -14.256 9.572   35.290  1.00 69.67  ? 151 ASP A CG    1 
ATOM   2445 O  OD1   . ASP C 2 151 ? -13.650 8.612   35.819  1.00 76.40  ? 151 ASP A OD1   1 
ATOM   2446 O  OD2   . ASP C 2 151 ? -15.156 9.418   34.437  1.00 71.40  ? 151 ASP A OD2   1 
ATOM   2447 N  N     . TYR C 2 152 ? -16.513 11.879  37.025  1.00 48.46  ? 152 TYR A N     1 
ATOM   2448 C  CA    . TYR C 2 152 ? -17.953 11.776  37.254  1.00 51.34  ? 152 TYR A CA    1 
ATOM   2449 C  C     . TYR C 2 152 ? -18.614 10.452  36.883  1.00 48.61  ? 152 TYR A C     1 
ATOM   2450 O  O     . TYR C 2 152 ? -19.353 9.884   37.677  1.00 51.24  ? 152 TYR A O     1 
ATOM   2451 C  CB    . TYR C 2 152 ? -18.662 12.934  36.554  1.00 55.06  ? 152 TYR A CB    1 
ATOM   2452 C  CG    . TYR C 2 152 ? -18.261 14.277  37.108  1.00 56.34  ? 152 TYR A CG    1 
ATOM   2453 C  CD1   . TYR C 2 152 ? -18.524 14.601  38.437  1.00 60.12  ? 152 TYR A CD1   1 
ATOM   2454 C  CD2   . TYR C 2 152 ? -17.597 15.215  36.315  1.00 59.94  ? 152 TYR A CD2   1 
ATOM   2455 C  CE1   . TYR C 2 152 ? -18.142 15.823  38.973  1.00 62.78  ? 152 TYR A CE1   1 
ATOM   2456 C  CE2   . TYR C 2 152 ? -17.204 16.450  36.841  1.00 62.36  ? 152 TYR A CE2   1 
ATOM   2457 C  CZ    . TYR C 2 152 ? -17.481 16.748  38.176  1.00 64.48  ? 152 TYR A CZ    1 
ATOM   2458 O  OH    . TYR C 2 152 ? -17.102 17.958  38.722  1.00 62.89  ? 152 TYR A OH    1 
ATOM   2459 N  N     . LYS C 2 153 ? -18.366 9.965   35.678  1.00 45.95  ? 153 LYS A N     1 
ATOM   2460 C  CA    . LYS C 2 153 ? -18.938 8.695   35.259  1.00 44.43  ? 153 LYS A CA    1 
ATOM   2461 C  C     . LYS C 2 153 ? -18.595 7.588   36.276  1.00 45.33  ? 153 LYS A C     1 
ATOM   2462 O  O     . LYS C 2 153 ? -19.462 6.807   36.658  1.00 48.16  ? 153 LYS A O     1 
ATOM   2463 C  CB    . LYS C 2 153 ? -18.433 8.351   33.847  1.00 38.66  ? 153 LYS A CB    1 
ATOM   2464 C  CG    . LYS C 2 153 ? -19.520 8.457   32.780  1.00 46.42  ? 153 LYS A CG    1 
ATOM   2465 C  CD    . LYS C 2 153 ? -19.035 8.956   31.431  1.00 41.73  ? 153 LYS A CD    1 
ATOM   2466 C  CE    . LYS C 2 153 ? -18.470 7.837   30.564  1.00 44.00  ? 153 LYS A CE    1 
ATOM   2467 N  NZ    . LYS C 2 153 ? -19.388 6.888   29.865  1.00 25.74  ? 153 LYS A NZ    1 
ATOM   2468 N  N     . THR C 2 154 ? -17.344 7.544   36.733  1.00 41.71  ? 154 THR A N     1 
ATOM   2469 C  CA    . THR C 2 154 ? -16.911 6.551   37.712  1.00 42.33  ? 154 THR A CA    1 
ATOM   2470 C  C     . THR C 2 154 ? -17.606 6.753   39.059  1.00 42.57  ? 154 THR A C     1 
ATOM   2471 O  O     . THR C 2 154 ? -18.138 5.809   39.652  1.00 43.68  ? 154 THR A O     1 
ATOM   2472 C  CB    . THR C 2 154 ? -15.366 6.611   37.947  1.00 45.49  ? 154 THR A CB    1 
ATOM   2473 O  OG1   . THR C 2 154 ? -14.672 6.128   36.786  1.00 43.19  ? 154 THR A OG1   1 
ATOM   2474 C  CG2   . THR C 2 154 ? -14.964 5.784   39.173  1.00 35.00  ? 154 THR A CG2   1 
ATOM   2475 N  N     . ILE C 2 155 ? -17.594 7.983   39.548  1.00 42.08  ? 155 ILE A N     1 
ATOM   2476 C  CA    . ILE C 2 155 ? -18.221 8.286   40.828  1.00 44.39  ? 155 ILE A CA    1 
ATOM   2477 C  C     . ILE C 2 155 ? -19.680 7.885   40.816  1.00 47.70  ? 155 ILE A C     1 
ATOM   2478 O  O     . ILE C 2 155 ? -20.152 7.203   41.721  1.00 49.49  ? 155 ILE A O     1 
ATOM   2479 C  CB    . ILE C 2 155 ? -18.164 9.775   41.127  1.00 44.30  ? 155 ILE A CB    1 
ATOM   2480 C  CG1   . ILE C 2 155 ? -16.722 10.252  41.103  1.00 40.63  ? 155 ILE A CG1   1 
ATOM   2481 C  CG2   . ILE C 2 155 ? -18.803 10.045  42.457  1.00 48.09  ? 155 ILE A CG2   1 
ATOM   2482 C  CD1   . ILE C 2 155 ? -16.597 11.736  41.073  1.00 45.71  ? 155 ILE A CD1   1 
ATOM   2483 N  N     . LEU C 2 156 ? -20.384 8.336   39.782  1.00 46.85  ? 156 LEU A N     1 
ATOM   2484 C  CA    . LEU C 2 156 ? -21.789 8.045   39.617  1.00 46.45  ? 156 LEU A CA    1 
ATOM   2485 C  C     . LEU C 2 156 ? -22.049 6.553   39.565  1.00 48.76  ? 156 LEU A C     1 
ATOM   2486 O  O     . LEU C 2 156 ? -22.897 6.041   40.295  1.00 52.71  ? 156 LEU A O     1 
ATOM   2487 C  CB    . LEU C 2 156 ? -22.320 8.694   38.344  1.00 45.49  ? 156 LEU A CB    1 
ATOM   2488 C  CG    . LEU C 2 156 ? -23.761 8.287   38.029  1.00 46.26  ? 156 LEU A CG    1 
ATOM   2489 C  CD1   . LEU C 2 156 ? -24.682 8.650   39.185  1.00 41.22  ? 156 LEU A CD1   1 
ATOM   2490 C  CD2   . LEU C 2 156 ? -24.198 8.960   36.752  1.00 50.61  ? 156 LEU A CD2   1 
ATOM   2491 N  N     . GLN C 2 157 ? -21.335 5.851   38.695  1.00 49.54  ? 157 GLN A N     1 
ATOM   2492 C  CA    . GLN C 2 157 ? -21.528 4.409   38.576  1.00 49.47  ? 157 GLN A CA    1 
ATOM   2493 C  C     . GLN C 2 157 ? -21.305 3.712   39.913  1.00 51.40  ? 157 GLN A C     1 
ATOM   2494 O  O     . GLN C 2 157 ? -21.936 2.696   40.212  1.00 47.86  ? 157 GLN A O     1 
ATOM   2495 C  CB    . GLN C 2 157 ? -20.576 3.821   37.529  1.00 49.92  ? 157 GLN A CB    1 
ATOM   2496 C  CG    . GLN C 2 157 ? -20.105 2.414   37.870  1.00 49.79  ? 157 GLN A CG    1 
ATOM   2497 C  CD    . GLN C 2 157 ? -19.351 1.741   36.750  1.00 51.18  ? 157 GLN A CD    1 
ATOM   2498 O  OE1   . GLN C 2 157 ? -19.889 1.557   35.666  1.00 58.88  ? 157 GLN A OE1   1 
ATOM   2499 N  NE2   . GLN C 2 157 ? -18.101 1.359   37.008  1.00 48.54  ? 157 GLN A NE2   1 
ATOM   2500 N  N     . GLU C 2 158 ? -20.405 4.260   40.721  1.00 55.36  ? 158 GLU A N     1 
ATOM   2501 C  CA    . GLU C 2 158 ? -20.108 3.665   42.018  1.00 58.88  ? 158 GLU A CA    1 
ATOM   2502 C  C     . GLU C 2 158 ? -21.174 4.006   43.071  1.00 57.77  ? 158 GLU A C     1 
ATOM   2503 O  O     . GLU C 2 158 ? -21.301 3.332   44.097  1.00 58.25  ? 158 GLU A O     1 
ATOM   2504 C  CB    . GLU C 2 158 ? -18.695 4.074   42.467  1.00 52.83  ? 158 GLU A CB    1 
ATOM   2505 C  CG    . GLU C 2 158 ? -17.682 2.919   42.361  1.00 58.91  ? 158 GLU A CG    1 
ATOM   2506 C  CD    . GLU C 2 158 ? -16.434 3.213   41.502  1.00 60.97  ? 158 GLU A CD    1 
ATOM   2507 O  OE1   . GLU C 2 158 ? -15.662 4.142   41.823  1.00 54.39  ? 158 GLU A OE1   1 
ATOM   2508 O  OE2   . GLU C 2 158 ? -16.210 2.493   40.504  1.00 65.53  ? 158 GLU A OE2   1 
ATOM   2509 N  N     . ILE C 2 159 ? -21.959 5.041   42.801  1.00 56.27  ? 159 ILE A N     1 
ATOM   2510 C  CA    . ILE C 2 159 ? -23.028 5.427   43.706  1.00 50.60  ? 159 ILE A CA    1 
ATOM   2511 C  C     . ILE C 2 159 ? -24.266 4.571   43.432  1.00 49.52  ? 159 ILE A C     1 
ATOM   2512 O  O     . ILE C 2 159 ? -24.914 4.090   44.347  1.00 49.95  ? 159 ILE A O     1 
ATOM   2513 C  CB    . ILE C 2 159 ? -23.400 6.896   43.511  1.00 48.22  ? 159 ILE A CB    1 
ATOM   2514 C  CG1   . ILE C 2 159 ? -22.290 7.785   44.058  1.00 47.39  ? 159 ILE A CG1   1 
ATOM   2515 C  CG2   . ILE C 2 159 ? -24.713 7.198   44.195  1.00 44.40  ? 159 ILE A CG2   1 
ATOM   2516 C  CD1   . ILE C 2 159 ? -22.619 9.253   43.998  1.00 50.74  ? 159 ILE A CD1   1 
ATOM   2517 N  N     . THR C 2 160 ? -24.578 4.374   42.159  1.00 48.37  ? 160 THR A N     1 
ATOM   2518 C  CA    . THR C 2 160 ? -25.748 3.598   41.779  1.00 49.74  ? 160 THR A CA    1 
ATOM   2519 C  C     . THR C 2 160 ? -25.595 2.110   42.082  1.00 56.14  ? 160 THR A C     1 
ATOM   2520 O  O     . THR C 2 160 ? -26.570 1.427   42.409  1.00 59.46  ? 160 THR A O     1 
ATOM   2521 C  CB    . THR C 2 160 ? -26.076 3.783   40.270  1.00 42.73  ? 160 THR A CB    1 
ATOM   2522 O  OG1   . THR C 2 160 ? -24.918 3.482   39.488  1.00 45.43  ? 160 THR A OG1   1 
ATOM   2523 C  CG2   . THR C 2 160 ? -26.495 5.216   39.975  1.00 33.80  ? 160 THR A CG2   1 
ATOM   2524 N  N     . GLN C 2 161 ? -24.374 1.600   41.969  1.00 59.64  ? 161 GLN A N     1 
ATOM   2525 C  CA    . GLN C 2 161 ? -24.132 0.187   42.238  1.00 60.49  ? 161 GLN A CA    1 
ATOM   2526 C  C     . GLN C 2 161 ? -24.204 -0.098  43.736  1.00 64.57  ? 161 GLN A C     1 
ATOM   2527 O  O     . GLN C 2 161 ? -24.645 -1.166  44.160  1.00 63.76  ? 161 GLN A O     1 
ATOM   2528 C  CB    . GLN C 2 161 ? -22.762 -0.235  41.695  1.00 57.65  ? 161 GLN A CB    1 
ATOM   2529 C  CG    . GLN C 2 161 ? -22.762 -0.586  40.214  1.00 56.56  ? 161 GLN A CG    1 
ATOM   2530 C  CD    . GLN C 2 161 ? -21.372 -0.816  39.666  1.00 52.43  ? 161 GLN A CD    1 
ATOM   2531 O  OE1   . GLN C 2 161 ? -21.197 -1.396  38.601  1.00 51.21  ? 161 GLN A OE1   1 
ATOM   2532 N  NE2   . GLN C 2 161 ? -20.374 -0.346  40.389  1.00 58.24  ? 161 GLN A NE2   1 
ATOM   2533 N  N     . LYS C 2 162 ? -23.764 0.864   44.537  1.00 66.55  ? 162 LYS A N     1 
ATOM   2534 C  CA    . LYS C 2 162 ? -23.778 0.713   45.984  1.00 68.69  ? 162 LYS A CA    1 
ATOM   2535 C  C     . LYS C 2 162 ? -25.210 0.787   46.515  1.00 70.18  ? 162 LYS A C     1 
ATOM   2536 O  O     . LYS C 2 162 ? -25.641 -0.064  47.292  1.00 70.74  ? 162 LYS A O     1 
ATOM   2537 C  CB    . LYS C 2 162 ? -22.923 1.814   46.629  1.00 71.27  ? 162 LYS A CB    1 
ATOM   2538 C  CG    . LYS C 2 162 ? -22.953 1.838   48.157  1.00 70.56  ? 162 LYS A CG    1 
ATOM   2539 C  CD    . LYS C 2 162 ? -22.286 3.089   48.716  1.00 71.48  ? 162 LYS A CD    1 
ATOM   2540 C  CE    . LYS C 2 162 ? -20.787 3.127   48.442  1.00 73.82  ? 162 LYS A CE    1 
ATOM   2541 N  NZ    . LYS C 2 162 ? -20.166 4.377   48.977  1.00 73.85  ? 162 LYS A NZ    1 
ATOM   2542 N  N     . ARG C 2 163 ? -25.947 1.803   46.080  1.00 69.81  ? 163 ARG A N     1 
ATOM   2543 C  CA    . ARG C 2 163 ? -27.311 1.995   46.532  1.00 69.82  ? 163 ARG A CA    1 
ATOM   2544 C  C     . ARG C 2 163 ? -28.331 1.050   45.908  1.00 66.92  ? 163 ARG A C     1 
ATOM   2545 O  O     . ARG C 2 163 ? -29.151 0.488   46.620  1.00 67.81  ? 163 ARG A O     1 
ATOM   2546 C  CB    . ARG C 2 163 ? -27.744 3.436   46.283  1.00 75.64  ? 163 ARG A CB    1 
ATOM   2547 C  CG    . ARG C 2 163 ? -28.228 4.131   47.533  1.00 85.86  ? 163 ARG A CG    1 
ATOM   2548 C  CD    . ARG C 2 163 ? -28.487 5.609   47.307  1.00 93.73  ? 163 ARG A CD    1 
ATOM   2549 N  NE    . ARG C 2 163 ? -29.339 6.218   48.328  1.00 103.46 ? 163 ARG A NE    1 
ATOM   2550 C  CZ    . ARG C 2 163 ? -29.819 7.457   48.243  1.00 107.26 ? 163 ARG A CZ    1 
ATOM   2551 N  NH1   . ARG C 2 163 ? -29.532 8.202   47.178  1.00 106.89 ? 163 ARG A NH1   1 
ATOM   2552 N  NH2   . ARG C 2 163 ? -30.563 7.964   49.226  1.00 107.25 ? 163 ARG A NH2   1 
ATOM   2553 N  N     . TRP C 2 164 ? -28.283 0.870   44.589  1.00 64.51  ? 164 TRP A N     1 
ATOM   2554 C  CA    . TRP C 2 164 ? -29.248 0.008   43.909  1.00 59.68  ? 164 TRP A CA    1 
ATOM   2555 C  C     . TRP C 2 164 ? -28.647 -1.181  43.198  1.00 59.06  ? 164 TRP A C     1 
ATOM   2556 O  O     . TRP C 2 164 ? -29.366 -2.056  42.731  1.00 58.37  ? 164 TRP A O     1 
ATOM   2557 C  CB    . TRP C 2 164 ? -30.066 0.813   42.892  1.00 55.74  ? 164 TRP A CB    1 
ATOM   2558 C  CG    . TRP C 2 164 ? -30.884 1.908   43.497  1.00 51.93  ? 164 TRP A CG    1 
ATOM   2559 C  CD1   . TRP C 2 164 ? -31.816 1.788   44.484  1.00 48.67  ? 164 TRP A CD1   1 
ATOM   2560 C  CD2   . TRP C 2 164 ? -30.820 3.300   43.172  1.00 54.03  ? 164 TRP A CD2   1 
ATOM   2561 N  NE1   . TRP C 2 164 ? -32.338 3.021   44.801  1.00 50.37  ? 164 TRP A NE1   1 
ATOM   2562 C  CE2   . TRP C 2 164 ? -31.743 3.968   44.009  1.00 53.16  ? 164 TRP A CE2   1 
ATOM   2563 C  CE3   . TRP C 2 164 ? -30.069 4.052   42.254  1.00 52.41  ? 164 TRP A CE3   1 
ATOM   2564 C  CZ2   . TRP C 2 164 ? -31.937 5.351   43.954  1.00 51.87  ? 164 TRP A CZ2   1 
ATOM   2565 C  CZ3   . TRP C 2 164 ? -30.261 5.426   42.199  1.00 47.32  ? 164 TRP A CZ3   1 
ATOM   2566 C  CH2   . TRP C 2 164 ? -31.190 6.061   43.046  1.00 51.98  ? 164 TRP A CH2   1 
ATOM   2567 N  N     . LYS C 2 165 ? -27.331 -1.220  43.104  1.00 60.96  ? 165 LYS A N     1 
ATOM   2568 C  CA    . LYS C 2 165 ? -26.668 -2.328  42.427  1.00 63.01  ? 165 LYS A CA    1 
ATOM   2569 C  C     . LYS C 2 165 ? -26.962 -2.311  40.928  1.00 64.01  ? 165 LYS A C     1 
ATOM   2570 O  O     . LYS C 2 165 ? -26.967 -3.354  40.267  1.00 58.33  ? 165 LYS A O     1 
ATOM   2571 C  CB    . LYS C 2 165 ? -27.098 -3.669  43.040  1.00 61.60  ? 165 LYS A CB    1 
ATOM   2572 C  CG    . LYS C 2 165 ? -26.638 -3.851  44.476  1.00 63.88  ? 165 LYS A CG    1 
ATOM   2573 C  CD    . LYS C 2 165 ? -26.921 -5.244  45.004  1.00 65.57  ? 165 LYS A CD    1 
ATOM   2574 C  CE    . LYS C 2 165 ? -26.487 -5.374  46.464  1.00 64.98  ? 165 LYS A CE    1 
ATOM   2575 N  NZ    . LYS C 2 165 ? -26.836 -6.706  47.044  1.00 67.44  ? 165 LYS A NZ    1 
ATOM   2576 N  N     . GLU C 2 166 ? -27.192 -1.110  40.402  1.00 65.85  ? 166 GLU A N     1 
ATOM   2577 C  CA    . GLU C 2 166 ? -27.487 -0.919  38.987  1.00 64.67  ? 166 GLU A CA    1 
ATOM   2578 C  C     . GLU C 2 166 ? -26.676 0.246   38.444  1.00 62.74  ? 166 GLU A C     1 
ATOM   2579 O  O     . GLU C 2 166 ? -26.349 1.178   39.177  1.00 63.47  ? 166 GLU A O     1 
ATOM   2580 C  CB    . GLU C 2 166 ? -28.978 -0.653  38.794  1.00 65.95  ? 166 GLU A CB    1 
ATOM   2581 C  CG    . GLU C 2 166 ? -29.849 -1.749  39.376  1.00 75.96  ? 166 GLU A CG    1 
ATOM   2582 C  CD    . GLU C 2 166 ? -31.322 -1.524  39.115  1.00 84.77  ? 166 GLU A CD    1 
ATOM   2583 O  OE1   . GLU C 2 166 ? -31.808 -0.409  39.404  1.00 87.79  ? 166 GLU A OE1   1 
ATOM   2584 O  OE2   . GLU C 2 166 ? -31.996 -2.461  38.627  1.00 89.17  ? 166 GLU A OE2   1 
ATOM   2585 N  N     . ARG C 2 167 ? -26.356 0.185   37.157  1.00 58.79  ? 167 ARG A N     1 
ATOM   2586 C  CA    . ARG C 2 167 ? -25.577 1.230   36.500  1.00 56.61  ? 167 ARG A CA    1 
ATOM   2587 C  C     . ARG C 2 167 ? -26.444 2.170   35.676  1.00 52.38  ? 167 ARG A C     1 
ATOM   2588 O  O     . ARG C 2 167 ? -27.462 1.769   35.142  1.00 52.25  ? 167 ARG A O     1 
ATOM   2589 C  CB    . ARG C 2 167 ? -24.524 0.595   35.592  1.00 52.10  ? 167 ARG A CB    1 
ATOM   2590 C  CG    . ARG C 2 167 ? -23.448 -0.150  36.333  1.00 51.30  ? 167 ARG A CG    1 
ATOM   2591 C  CD    . ARG C 2 167 ? -22.470 -0.832  35.388  1.00 51.47  ? 167 ARG A CD    1 
ATOM   2592 N  NE    . ARG C 2 167 ? -22.861 -2.191  35.002  1.00 51.59  ? 167 ARG A NE    1 
ATOM   2593 C  CZ    . ARG C 2 167 ? -23.168 -3.169  35.855  1.00 51.13  ? 167 ARG A CZ    1 
ATOM   2594 N  NH1   . ARG C 2 167 ? -23.152 -2.948  37.165  1.00 49.61  ? 167 ARG A NH1   1 
ATOM   2595 N  NH2   . ARG C 2 167 ? -23.447 -4.388  35.401  1.00 43.39  ? 167 ARG A NH2   1 
ATOM   2596 N  N     . PRO C 2 168 ? -26.043 3.442   35.566  1.00 54.77  ? 168 PRO A N     1 
ATOM   2597 C  CA    . PRO C 2 168 ? -26.826 4.400   34.783  1.00 54.46  ? 168 PRO A CA    1 
ATOM   2598 C  C     . PRO C 2 168 ? -26.657 4.089   33.304  1.00 56.81  ? 168 PRO A C     1 
ATOM   2599 O  O     . PRO C 2 168 ? -25.714 3.396   32.901  1.00 58.90  ? 168 PRO A O     1 
ATOM   2600 C  CB    . PRO C 2 168 ? -26.195 5.732   35.151  1.00 49.24  ? 168 PRO A CB    1 
ATOM   2601 C  CG    . PRO C 2 168 ? -24.757 5.369   35.288  1.00 51.97  ? 168 PRO A CG    1 
ATOM   2602 C  CD    . PRO C 2 168 ? -24.816 4.074   36.085  1.00 53.49  ? 168 PRO A CD    1 
ATOM   2603 N  N     . GLU C 2 169 ? -27.566 4.593   32.487  1.00 54.58  ? 169 GLU A N     1 
ATOM   2604 C  CA    . GLU C 2 169 ? -27.459 4.356   31.066  1.00 53.67  ? 169 GLU A CA    1 
ATOM   2605 C  C     . GLU C 2 169 ? -27.331 5.711   30.420  1.00 52.94  ? 169 GLU A C     1 
ATOM   2606 O  O     . GLU C 2 169 ? -27.883 6.680   30.909  1.00 56.58  ? 169 GLU A O     1 
ATOM   2607 C  CB    . GLU C 2 169 ? -28.699 3.631   30.560  1.00 57.34  ? 169 GLU A CB    1 
ATOM   2608 C  CG    . GLU C 2 169 ? -28.864 2.240   31.135  1.00 62.25  ? 169 GLU A CG    1 
ATOM   2609 C  CD    . GLU C 2 169 ? -30.197 1.624   30.770  1.00 70.14  ? 169 GLU A CD    1 
ATOM   2610 O  OE1   . GLU C 2 169 ? -30.500 1.535   29.561  1.00 75.87  ? 169 GLU A OE1   1 
ATOM   2611 O  OE2   . GLU C 2 169 ? -30.943 1.228   31.690  1.00 70.39  ? 169 GLU A OE2   1 
ATOM   2612 N  N     . TYR C 2 170 ? -26.576 5.786   29.337  1.00 52.85  ? 170 TYR A N     1 
ATOM   2613 C  CA    . TYR C 2 170 ? -26.401 7.045   28.633  1.00 54.33  ? 170 TYR A CA    1 
ATOM   2614 C  C     . TYR C 2 170 ? -26.961 6.846   27.240  1.00 55.06  ? 170 TYR A C     1 
ATOM   2615 O  O     . TYR C 2 170 ? -26.814 5.772   26.666  1.00 54.33  ? 170 TYR A O     1 
ATOM   2616 C  CB    . TYR C 2 170 ? -24.919 7.405   28.539  1.00 55.57  ? 170 TYR A CB    1 
ATOM   2617 C  CG    . TYR C 2 170 ? -24.235 7.507   29.876  1.00 54.79  ? 170 TYR A CG    1 
ATOM   2618 C  CD1   . TYR C 2 170 ? -24.365 8.646   30.660  1.00 54.21  ? 170 TYR A CD1   1 
ATOM   2619 C  CD2   . TYR C 2 170 ? -23.492 6.443   30.377  1.00 53.05  ? 170 TYR A CD2   1 
ATOM   2620 C  CE1   . TYR C 2 170 ? -23.771 8.725   31.920  1.00 54.87  ? 170 TYR A CE1   1 
ATOM   2621 C  CE2   . TYR C 2 170 ? -22.899 6.509   31.629  1.00 54.16  ? 170 TYR A CE2   1 
ATOM   2622 C  CZ    . TYR C 2 170 ? -23.041 7.652   32.396  1.00 54.19  ? 170 TYR A CZ    1 
ATOM   2623 O  OH    . TYR C 2 170 ? -22.460 7.713   33.643  1.00 57.95  ? 170 TYR A OH    1 
ATOM   2624 N  N     . ARG C 2 171 ? -27.616 7.864   26.699  1.00 53.25  ? 171 ARG A N     1 
ATOM   2625 C  CA    . ARG C 2 171 ? -28.161 7.746   25.363  1.00 52.57  ? 171 ARG A CA    1 
ATOM   2626 C  C     . ARG C 2 171 ? -27.980 9.069   24.633  1.00 53.08  ? 171 ARG A C     1 
ATOM   2627 O  O     . ARG C 2 171 ? -28.096 10.140  25.223  1.00 54.77  ? 171 ARG A O     1 
ATOM   2628 C  CB    . ARG C 2 171 ? -29.637 7.331   25.429  1.00 53.49  ? 171 ARG A CB    1 
ATOM   2629 C  CG    . ARG C 2 171 ? -30.657 8.465   25.471  1.00 60.78  ? 171 ARG A CG    1 
ATOM   2630 C  CD    . ARG C 2 171 ? -31.991 7.979   26.040  1.00 68.04  ? 171 ARG A CD    1 
ATOM   2631 N  NE    . ARG C 2 171 ? -33.129 8.759   25.556  1.00 72.54  ? 171 ARG A NE    1 
ATOM   2632 C  CZ    . ARG C 2 171 ? -33.824 8.462   24.461  1.00 77.07  ? 171 ARG A CZ    1 
ATOM   2633 N  NH1   . ARG C 2 171 ? -33.505 7.395   23.736  1.00 78.91  ? 171 ARG A NH1   1 
ATOM   2634 N  NH2   . ARG C 2 171 ? -34.830 9.239   24.079  1.00 75.17  ? 171 ARG A NH2   1 
ATOM   2635 N  N     . LEU C 2 172 ? -27.662 8.987   23.350  1.00 52.76  ? 172 LEU A N     1 
ATOM   2636 C  CA    . LEU C 2 172 ? -27.461 10.171  22.531  1.00 54.71  ? 172 LEU A CA    1 
ATOM   2637 C  C     . LEU C 2 172 ? -28.818 10.795  22.207  1.00 57.45  ? 172 LEU A C     1 
ATOM   2638 O  O     . LEU C 2 172 ? -29.718 10.112  21.718  1.00 56.07  ? 172 LEU A O     1 
ATOM   2639 C  CB    . LEU C 2 172 ? -26.744 9.779   21.238  1.00 53.87  ? 172 LEU A CB    1 
ATOM   2640 C  CG    . LEU C 2 172 ? -26.116 10.869  20.367  1.00 59.06  ? 172 LEU A CG    1 
ATOM   2641 C  CD1   . LEU C 2 172 ? -24.973 11.539  21.118  1.00 57.97  ? 172 LEU A CD1   1 
ATOM   2642 C  CD2   . LEU C 2 172 ? -25.601 10.247  19.072  1.00 55.38  ? 172 LEU A CD2   1 
ATOM   2643 N  N     . ILE C 2 173 ? -28.963 12.086  22.498  1.00 56.99  ? 173 ILE A N     1 
ATOM   2644 C  CA    . ILE C 2 173 ? -30.205 12.807  22.233  1.00 61.76  ? 173 ILE A CA    1 
ATOM   2645 C  C     . ILE C 2 173 ? -30.128 13.555  20.906  1.00 65.65  ? 173 ILE A C     1 
ATOM   2646 O  O     . ILE C 2 173 ? -31.114 13.642  20.182  1.00 67.14  ? 173 ILE A O     1 
ATOM   2647 C  CB    . ILE C 2 173 ? -30.514 13.838  23.335  1.00 58.52  ? 173 ILE A CB    1 
ATOM   2648 C  CG1   . ILE C 2 173 ? -30.810 13.133  24.655  1.00 60.47  ? 173 ILE A CG1   1 
ATOM   2649 C  CG2   . ILE C 2 173 ? -31.687 14.681  22.932  1.00 62.35  ? 173 ILE A CG2   1 
ATOM   2650 C  CD1   . ILE C 2 173 ? -32.037 12.267  24.629  1.00 61.50  ? 173 ILE A CD1   1 
ATOM   2651 N  N     . SER C 2 174 ? -28.955 14.099  20.596  1.00 68.70  ? 174 SER A N     1 
ATOM   2652 C  CA    . SER C 2 174 ? -28.760 14.842  19.356  1.00 67.95  ? 174 SER A CA    1 
ATOM   2653 C  C     . SER C 2 174 ? -27.295 15.172  19.083  1.00 67.65  ? 174 SER A C     1 
ATOM   2654 O  O     . SER C 2 174 ? -26.457 15.127  19.983  1.00 66.70  ? 174 SER A O     1 
ATOM   2655 C  CB    . SER C 2 174 ? -29.558 16.145  19.400  1.00 67.51  ? 174 SER A CB    1 
ATOM   2656 O  OG    . SER C 2 174 ? -29.133 16.971  20.473  1.00 67.55  ? 174 SER A OG    1 
ATOM   2657 N  N     . VAL C 2 175 ? -27.008 15.509  17.828  1.00 67.50  ? 175 VAL A N     1 
ATOM   2658 C  CA    . VAL C 2 175 ? -25.668 15.881  17.385  1.00 68.73  ? 175 VAL A CA    1 
ATOM   2659 C  C     . VAL C 2 175 ? -25.792 17.149  16.552  1.00 70.66  ? 175 VAL A C     1 
ATOM   2660 O  O     . VAL C 2 175 ? -26.623 17.210  15.645  1.00 70.87  ? 175 VAL A O     1 
ATOM   2661 C  CB    . VAL C 2 175 ? -25.026 14.799  16.494  1.00 66.81  ? 175 VAL A CB    1 
ATOM   2662 C  CG1   . VAL C 2 175 ? -23.637 15.249  16.061  1.00 69.26  ? 175 VAL A CG1   1 
ATOM   2663 C  CG2   . VAL C 2 175 ? -24.937 13.488  17.240  1.00 67.40  ? 175 VAL A CG2   1 
ATOM   2664 N  N     . GLU C 2 176 ? -24.960 18.145  16.855  1.00 73.33  ? 176 GLU A N     1 
ATOM   2665 C  CA    . GLU C 2 176 ? -24.978 19.435  16.152  1.00 77.27  ? 176 GLU A CA    1 
ATOM   2666 C  C     . GLU C 2 176 ? -23.619 19.862  15.585  1.00 75.31  ? 176 GLU A C     1 
ATOM   2667 O  O     . GLU C 2 176 ? -22.573 19.455  16.085  1.00 77.11  ? 176 GLU A O     1 
ATOM   2668 C  CB    . GLU C 2 176 ? -25.418 20.561  17.102  1.00 81.86  ? 176 GLU A CB    1 
ATOM   2669 C  CG    . GLU C 2 176 ? -26.850 20.534  17.631  1.00 90.23  ? 176 GLU A CG    1 
ATOM   2670 C  CD    . GLU C 2 176 ? -27.157 21.743  18.533  1.00 96.41  ? 176 GLU A CD    1 
ATOM   2671 O  OE1   . GLU C 2 176 ? -26.990 22.896  18.071  1.00 98.53  ? 176 GLU A OE1   1 
ATOM   2672 O  OE2   . GLU C 2 176 ? -27.560 21.545  19.703  1.00 97.16  ? 176 GLU A OE2   1 
ATOM   2673 N  N     . GLY C 2 177 ? -23.655 20.698  14.547  1.00 72.51  ? 177 GLY A N     1 
ATOM   2674 C  CA    . GLY C 2 177 ? -22.439 21.251  13.969  1.00 68.76  ? 177 GLY A CA    1 
ATOM   2675 C  C     . GLY C 2 177 ? -21.687 20.552  12.857  1.00 67.51  ? 177 GLY A C     1 
ATOM   2676 O  O     . GLY C 2 177 ? -22.121 19.516  12.355  1.00 70.19  ? 177 GLY A O     1 
ATOM   2677 N  N     . PRO C 2 178 ? -20.544 21.128  12.439  1.00 65.20  ? 178 PRO A N     1 
ATOM   2678 C  CA    . PRO C 2 178 ? -19.676 20.598  11.384  1.00 65.12  ? 178 PRO A CA    1 
ATOM   2679 C  C     . PRO C 2 178 ? -18.956 19.385  11.960  1.00 66.11  ? 178 PRO A C     1 
ATOM   2680 O  O     . PRO C 2 178 ? -18.807 19.278  13.172  1.00 65.90  ? 178 PRO A O     1 
ATOM   2681 C  CB    . PRO C 2 178 ? -18.695 21.743  11.120  1.00 63.99  ? 178 PRO A CB    1 
ATOM   2682 C  CG    . PRO C 2 178 ? -19.371 22.956  11.674  1.00 63.49  ? 178 PRO A CG    1 
ATOM   2683 C  CD    . PRO C 2 178 ? -20.047 22.433  12.902  1.00 63.61  ? 178 PRO A CD    1 
ATOM   2684 N  N     . HIS C 2 179 ? -18.494 18.485  11.103  1.00 68.75  ? 179 HIS A N     1 
ATOM   2685 C  CA    . HIS C 2 179 ? -17.798 17.286  11.568  1.00 69.59  ? 179 HIS A CA    1 
ATOM   2686 C  C     . HIS C 2 179 ? -16.537 17.566  12.387  1.00 67.62  ? 179 HIS A C     1 
ATOM   2687 O  O     . HIS C 2 179 ? -16.210 16.827  13.309  1.00 65.86  ? 179 HIS A O     1 
ATOM   2688 C  CB    . HIS C 2 179 ? -17.444 16.394  10.378  1.00 71.20  ? 179 HIS A CB    1 
ATOM   2689 C  CG    . HIS C 2 179 ? -18.634 15.945  9.590   1.00 74.53  ? 179 HIS A CG    1 
ATOM   2690 N  ND1   . HIS C 2 179 ? -19.365 16.800  8.795   1.00 73.67  ? 179 HIS A ND1   1 
ATOM   2691 C  CD2   . HIS C 2 179 ? -19.226 14.731  9.483   1.00 75.76  ? 179 HIS A CD2   1 
ATOM   2692 C  CE1   . HIS C 2 179 ? -20.354 16.132  8.229   1.00 78.38  ? 179 HIS A CE1   1 
ATOM   2693 N  NE2   . HIS C 2 179 ? -20.293 14.875  8.630   1.00 77.42  ? 179 HIS A NE2   1 
ATOM   2694 N  N     . HIS C 2 180 ? -15.821 18.629  12.046  1.00 66.82  ? 180 HIS A N     1 
ATOM   2695 C  CA    . HIS C 2 180 ? -14.608 18.965  12.777  1.00 66.51  ? 180 HIS A CA    1 
ATOM   2696 C  C     . HIS C 2 180 ? -14.960 19.798  14.009  1.00 67.00  ? 180 HIS A C     1 
ATOM   2697 O  O     . HIS C 2 180 ? -14.080 20.174  14.791  1.00 63.04  ? 180 HIS A O     1 
ATOM   2698 C  CB    . HIS C 2 180 ? -13.656 19.739  11.873  1.00 61.40  ? 180 HIS A CB    1 
ATOM   2699 C  CG    . HIS C 2 180 ? -14.299 20.908  11.205  1.00 61.41  ? 180 HIS A CG    1 
ATOM   2700 N  ND1   . HIS C 2 180 ? -15.332 20.769  10.304  1.00 59.81  ? 180 HIS A ND1   1 
ATOM   2701 C  CD2   . HIS C 2 180 ? -14.088 22.238  11.336  1.00 58.23  ? 180 HIS A CD2   1 
ATOM   2702 C  CE1   . HIS C 2 180 ? -15.730 21.963  9.908   1.00 58.71  ? 180 HIS A CE1   1 
ATOM   2703 N  NE2   . HIS C 2 180 ? -14.992 22.872  10.520  1.00 59.49  ? 180 HIS A NE2   1 
ATOM   2704 N  N     . LYS C 2 181 ? -16.255 20.077  14.163  1.00 68.16  ? 181 LYS A N     1 
ATOM   2705 C  CA    . LYS C 2 181 ? -16.786 20.848  15.287  1.00 70.03  ? 181 LYS A CA    1 
ATOM   2706 C  C     . LYS C 2 181 ? -18.182 20.343  15.648  1.00 71.62  ? 181 LYS A C     1 
ATOM   2707 O  O     . LYS C 2 181 ? -19.180 20.973  15.299  1.00 76.37  ? 181 LYS A O     1 
ATOM   2708 C  CB    . LYS C 2 181 ? -16.884 22.336  14.935  1.00 69.59  ? 181 LYS A CB    1 
ATOM   2709 C  CG    . LYS C 2 181 ? -15.561 23.053  14.755  1.00 72.94  ? 181 LYS A CG    1 
ATOM   2710 C  CD    . LYS C 2 181 ? -15.772 24.525  14.409  1.00 72.89  ? 181 LYS A CD    1 
ATOM   2711 C  CE    . LYS C 2 181 ? -14.440 25.257  14.271  1.00 75.95  ? 181 LYS A CE    1 
ATOM   2712 N  NZ    . LYS C 2 181 ? -13.525 24.622  13.266  1.00 76.28  ? 181 LYS A NZ    1 
ATOM   2713 N  N     . LYS C 2 182 ? -18.262 19.213  16.342  1.00 70.92  ? 182 LYS A N     1 
ATOM   2714 C  CA    . LYS C 2 182 ? -19.556 18.660  16.735  1.00 67.94  ? 182 LYS A CA    1 
ATOM   2715 C  C     . LYS C 2 182 ? -19.920 18.977  18.180  1.00 65.38  ? 182 LYS A C     1 
ATOM   2716 O  O     . LYS C 2 182 ? -19.051 19.097  19.041  1.00 66.78  ? 182 LYS A O     1 
ATOM   2717 C  CB    . LYS C 2 182 ? -19.575 17.139  16.542  1.00 72.55  ? 182 LYS A CB    1 
ATOM   2718 C  CG    . LYS C 2 182 ? -19.889 16.681  15.122  1.00 78.01  ? 182 LYS A CG    1 
ATOM   2719 C  CD    . LYS C 2 182 ? -19.955 15.162  15.015  1.00 78.00  ? 182 LYS A CD    1 
ATOM   2720 C  CE    . LYS C 2 182 ? -20.358 14.729  13.610  1.00 82.72  ? 182 LYS A CE    1 
ATOM   2721 N  NZ    . LYS C 2 182 ? -20.423 13.243  13.455  1.00 86.18  ? 182 LYS A NZ    1 
ATOM   2722 N  N     . LYS C 2 183 ? -21.216 19.124  18.432  1.00 62.85  ? 183 LYS A N     1 
ATOM   2723 C  CA    . LYS C 2 183 ? -21.726 19.397  19.771  1.00 62.85  ? 183 LYS A CA    1 
ATOM   2724 C  C     . LYS C 2 183 ? -22.680 18.262  20.072  1.00 59.85  ? 183 LYS A C     1 
ATOM   2725 O  O     . LYS C 2 183 ? -23.611 18.015  19.307  1.00 62.04  ? 183 LYS A O     1 
ATOM   2726 C  CB    . LYS C 2 183 ? -22.483 20.721  19.802  1.00 67.25  ? 183 LYS A CB    1 
ATOM   2727 C  CG    . LYS C 2 183 ? -23.050 21.072  21.171  1.00 72.47  ? 183 LYS A CG    1 
ATOM   2728 C  CD    . LYS C 2 183 ? -23.775 22.410  21.138  1.00 74.67  ? 183 LYS A CD    1 
ATOM   2729 C  CE    . LYS C 2 183 ? -24.372 22.760  22.491  1.00 77.40  ? 183 LYS A CE    1 
ATOM   2730 N  NZ    . LYS C 2 183 ? -25.200 24.005  22.440  1.00 80.73  ? 183 LYS A NZ    1 
ATOM   2731 N  N     . PHE C 2 184 ? -22.442 17.576  21.179  1.00 57.29  ? 184 PHE A N     1 
ATOM   2732 C  CA    . PHE C 2 184 ? -23.275 16.438  21.529  1.00 52.00  ? 184 PHE A CA    1 
ATOM   2733 C  C     . PHE C 2 184 ? -24.129 16.709  22.733  1.00 51.06  ? 184 PHE A C     1 
ATOM   2734 O  O     . PHE C 2 184 ? -23.737 17.446  23.630  1.00 52.35  ? 184 PHE A O     1 
ATOM   2735 C  CB    . PHE C 2 184 ? -22.426 15.211  21.851  1.00 48.85  ? 184 PHE A CB    1 
ATOM   2736 C  CG    . PHE C 2 184 ? -21.626 14.627  20.699  1.00 39.40  ? 184 PHE A CG    1 
ATOM   2737 C  CD1   . PHE C 2 184 ? -20.353 15.102  20.411  1.00 42.91  ? 184 PHE A CD1   1 
ATOM   2738 C  CD2   . PHE C 2 184 ? -22.125 13.569  19.960  1.00 40.16  ? 184 PHE A CD2   1 
ATOM   2739 C  CE1   . PHE C 2 184 ? -19.583 14.517  19.409  1.00 40.07  ? 184 PHE A CE1   1 
ATOM   2740 C  CE2   . PHE C 2 184 ? -21.369 12.978  18.959  1.00 36.01  ? 184 PHE A CE2   1 
ATOM   2741 C  CZ    . PHE C 2 184 ? -20.093 13.451  18.684  1.00 39.26  ? 184 PHE A CZ    1 
ATOM   2742 N  N     . ILE C 2 185 ? -25.301 16.098  22.752  1.00 52.48  ? 185 ILE A N     1 
ATOM   2743 C  CA    . ILE C 2 185 ? -26.203 16.233  23.881  1.00 55.47  ? 185 ILE A CA    1 
ATOM   2744 C  C     . ILE C 2 185 ? -26.564 14.821  24.281  1.00 55.18  ? 185 ILE A C     1 
ATOM   2745 O  O     . ILE C 2 185 ? -27.139 14.066  23.499  1.00 58.18  ? 185 ILE A O     1 
ATOM   2746 C  CB    . ILE C 2 185 ? -27.451 17.024  23.518  1.00 52.32  ? 185 ILE A CB    1 
ATOM   2747 C  CG1   . ILE C 2 185 ? -27.057 18.474  23.214  1.00 52.56  ? 185 ILE A CG1   1 
ATOM   2748 C  CG2   . ILE C 2 185 ? -28.429 16.966  24.669  1.00 55.91  ? 185 ILE A CG2   1 
ATOM   2749 C  CD1   . ILE C 2 185 ? -28.147 19.314  22.588  1.00 55.45  ? 185 ILE A CD1   1 
ATOM   2750 N  N     . VAL C 2 186 ? -26.197 14.472  25.505  1.00 54.98  ? 186 VAL A N     1 
ATOM   2751 C  CA    . VAL C 2 186 ? -26.403 13.135  26.029  1.00 53.34  ? 186 VAL A CA    1 
ATOM   2752 C  C     . VAL C 2 186 ? -27.350 13.093  27.217  1.00 53.64  ? 186 VAL A C     1 
ATOM   2753 O  O     . VAL C 2 186 ? -27.479 14.067  27.960  1.00 54.00  ? 186 VAL A O     1 
ATOM   2754 C  CB    . VAL C 2 186 ? -25.019 12.526  26.434  1.00 46.68  ? 186 VAL A CB    1 
ATOM   2755 C  CG1   . VAL C 2 186 ? -25.203 11.260  27.247  1.00 44.43  ? 186 VAL A CG1   1 
ATOM   2756 C  CG2   . VAL C 2 186 ? -24.199 12.241  25.181  1.00 35.26  ? 186 VAL A CG2   1 
ATOM   2757 N  N     . GLU C 2 187 ? -28.015 11.958  27.392  1.00 54.81  ? 187 GLU A N     1 
ATOM   2758 C  CA    . GLU C 2 187 ? -28.927 11.794  28.513  1.00 60.04  ? 187 GLU A CA    1 
ATOM   2759 C  C     . GLU C 2 187 ? -28.434 10.684  29.445  1.00 59.53  ? 187 GLU A C     1 
ATOM   2760 O  O     . GLU C 2 187 ? -28.055 9.602   29.004  1.00 60.42  ? 187 GLU A O     1 
ATOM   2761 C  CB    . GLU C 2 187 ? -30.344 11.476  28.011  1.00 62.14  ? 187 GLU A CB    1 
ATOM   2762 C  CG    . GLU C 2 187 ? -31.372 11.282  29.121  1.00 69.97  ? 187 GLU A CG    1 
ATOM   2763 C  CD    . GLU C 2 187 ? -32.799 11.141  28.604  1.00 78.02  ? 187 GLU A CD    1 
ATOM   2764 O  OE1   . GLU C 2 187 ? -33.045 10.263  27.748  1.00 83.96  ? 187 GLU A OE1   1 
ATOM   2765 O  OE2   . GLU C 2 187 ? -33.683 11.902  29.062  1.00 82.64  ? 187 GLU A OE2   1 
ATOM   2766 N  N     . ALA C 2 188 ? -28.408 10.977  30.736  1.00 57.93  ? 188 ALA A N     1 
ATOM   2767 C  CA    . ALA C 2 188 ? -28.000 10.000  31.726  1.00 58.97  ? 188 ALA A CA    1 
ATOM   2768 C  C     . ALA C 2 188 ? -29.271 9.653   32.476  1.00 59.75  ? 188 ALA A C     1 
ATOM   2769 O  O     . ALA C 2 188 ? -30.104 10.520  32.727  1.00 62.55  ? 188 ALA A O     1 
ATOM   2770 C  CB    . ALA C 2 188 ? -26.967 10.599  32.683  1.00 56.34  ? 188 ALA A CB    1 
ATOM   2771 N  N     . LYS C 2 189 ? -29.438 8.385   32.814  1.00 58.96  ? 189 LYS A N     1 
ATOM   2772 C  CA    . LYS C 2 189 ? -30.622 7.970   33.543  1.00 60.68  ? 189 LYS A CA    1 
ATOM   2773 C  C     . LYS C 2 189 ? -30.346 6.773   34.447  1.00 57.54  ? 189 LYS A C     1 
ATOM   2774 O  O     . LYS C 2 189 ? -29.499 5.935   34.152  1.00 58.68  ? 189 LYS A O     1 
ATOM   2775 C  CB    . LYS C 2 189 ? -31.782 7.665   32.572  1.00 61.90  ? 189 LYS A CB    1 
ATOM   2776 C  CG    . LYS C 2 189 ? -31.452 6.734   31.399  1.00 69.97  ? 189 LYS A CG    1 
ATOM   2777 C  CD    . LYS C 2 189 ? -30.980 7.515   30.161  1.00 73.61  ? 189 LYS A CD    1 
ATOM   2778 C  CE    . LYS C 2 189 ? -30.399 6.600   29.077  1.00 74.63  ? 189 LYS A CE    1 
ATOM   2779 N  NZ    . LYS C 2 189 ? -31.312 5.490   28.660  1.00 76.79  ? 189 LYS A NZ    1 
ATOM   2780 N  N     . ILE C 2 190 ? -31.045 6.746   35.574  1.00 55.96  ? 190 ILE A N     1 
ATOM   2781 C  CA    . ILE C 2 190 ? -30.958 5.681   36.557  1.00 55.43  ? 190 ILE A CA    1 
ATOM   2782 C  C     . ILE C 2 190 ? -32.302 5.719   37.274  1.00 60.43  ? 190 ILE A C     1 
ATOM   2783 O  O     . ILE C 2 190 ? -32.623 6.720   37.924  1.00 56.79  ? 190 ILE A O     1 
ATOM   2784 C  CB    . ILE C 2 190 ? -29.762 5.887   37.549  1.00 50.84  ? 190 ILE A CB    1 
ATOM   2785 C  CG1   . ILE C 2 190 ? -29.626 4.696   38.492  1.00 46.14  ? 190 ILE A CG1   1 
ATOM   2786 C  CG2   . ILE C 2 190 ? -29.936 7.163   38.344  1.00 48.14  ? 190 ILE A CG2   1 
ATOM   2787 C  CD1   . ILE C 2 190 ? -29.049 3.459   37.846  1.00 47.39  ? 190 ILE A CD1   1 
ATOM   2788 N  N     . LYS C 2 191 ? -33.075 4.665   37.174  1.00 64.57  ? 191 LYS A N     1 
ATOM   2789 C  CA    . LYS C 2 191 ? -34.406 4.652   37.806  1.00 66.12  ? 191 LYS A CA    1 
ATOM   2790 C  C     . LYS C 2 191 ? -35.270 5.634   37.022  1.00 68.35  ? 191 LYS A C     1 
ATOM   2791 O  O     . LYS C 2 191 ? -35.378 5.530   35.794  1.00 67.96  ? 191 LYS A O     1 
ATOM   2792 C  CB    . LYS C 2 191 ? -34.340 5.081   39.290  1.00 63.72  ? 191 LYS A CB    1 
ATOM   2793 C  CG    . LYS C 2 191 ? -33.613 4.098   40.200  1.00 60.46  ? 191 LYS A CG    1 
ATOM   2794 C  CD    . LYS C 2 191 ? -34.280 2.733   40.140  1.00 64.33  ? 191 LYS A CD    1 
ATOM   2795 C  CE    . LYS C 2 191 ? -33.508 1.720   40.964  1.00 69.28  ? 191 LYS A CE    1 
ATOM   2796 N  NZ    . LYS C 2 191 ? -34.143 0.375   40.914  1.00 72.61  ? 191 LYS A NZ    1 
ATOM   2797 N  N     . GLU C 2 192 ? -35.863 6.560   37.732  1.00 70.82  ? 192 GLU A N     1 
ATOM   2798 C  CA    . GLU C 2 192 ? -36.694 7.558   37.104  1.00 73.97  ? 192 GLU A CA    1 
ATOM   2799 C  C     . GLU C 2 192 ? -36.010 8.919   37.077  1.00 71.88  ? 192 GLU A C     1 
ATOM   2800 O  O     . GLU C 2 192 ? -36.646 9.936   36.809  1.00 69.73  ? 192 GLU A O     1 
ATOM   2801 C  CB    . GLU C 2 192 ? -38.022 7.688   37.850  1.00 74.83  ? 192 GLU A CB    1 
ATOM   2802 C  CG    . GLU C 2 192 ? -38.627 6.374   38.315  1.00 84.07  ? 192 GLU A CG    1 
ATOM   2803 C  CD    . GLU C 2 192 ? -37.932 5.817   39.551  1.00 88.57  ? 192 GLU A CD    1 
ATOM   2804 O  OE1   . GLU C 2 192 ? -37.718 6.592   40.512  1.00 87.47  ? 192 GLU A OE1   1 
ATOM   2805 O  OE2   . GLU C 2 192 ? -37.611 4.607   39.561  1.00 89.88  ? 192 GLU A OE2   1 
ATOM   2806 N  N     . TYR C 2 193 ? -34.714 8.926   37.371  1.00 74.87  ? 193 TYR A N     1 
ATOM   2807 C  CA    . TYR C 2 193 ? -33.913 10.149  37.371  1.00 75.86  ? 193 TYR A CA    1 
ATOM   2808 C  C     . TYR C 2 193 ? -33.236 10.280  36.021  1.00 74.73  ? 193 TYR A C     1 
ATOM   2809 O  O     . TYR C 2 193 ? -32.640 9.325   35.536  1.00 76.02  ? 193 TYR A O     1 
ATOM   2810 C  CB    . TYR C 2 193 ? -32.821 10.113  38.431  1.00 73.14  ? 193 TYR A CB    1 
ATOM   2811 C  CG    . TYR C 2 193 ? -33.318 9.924   39.835  1.00 72.77  ? 193 TYR A CG    1 
ATOM   2812 C  CD1   . TYR C 2 193 ? -33.835 11.003  40.527  1.00 75.46  ? 193 TYR A CD1   1 
ATOM   2813 C  CD2   . TYR C 2 193 ? -33.254 8.694   40.479  1.00 75.81  ? 193 TYR A CD2   1 
ATOM   2814 C  CE1   . TYR C 2 193 ? -34.272 10.873  41.831  1.00 79.88  ? 193 TYR A CE1   1 
ATOM   2815 C  CE2   . TYR C 2 193 ? -33.691 8.546   41.782  1.00 79.36  ? 193 TYR A CE2   1 
ATOM   2816 C  CZ    . TYR C 2 193 ? -34.197 9.644   42.456  1.00 81.90  ? 193 TYR A CZ    1 
ATOM   2817 O  OH    . TYR C 2 193 ? -34.614 9.497   43.764  1.00 86.86  ? 193 TYR A OH    1 
ATOM   2818 N  N     . ARG C 2 194 ? -33.332 11.453  35.409  1.00 74.09  ? 194 ARG A N     1 
ATOM   2819 C  CA    . ARG C 2 194 ? -32.685 11.677  34.126  1.00 72.93  ? 194 ARG A CA    1 
ATOM   2820 C  C     . ARG C 2 194 ? -32.163 13.102  34.052  1.00 71.41  ? 194 ARG A C     1 
ATOM   2821 O  O     . ARG C 2 194 ? -32.751 14.026  34.611  1.00 72.54  ? 194 ARG A O     1 
ATOM   2822 C  CB    . ARG C 2 194 ? -33.640 11.397  32.961  1.00 73.51  ? 194 ARG A CB    1 
ATOM   2823 C  CG    . ARG C 2 194 ? -34.139 9.964   32.904  1.00 74.65  ? 194 ARG A CG    1 
ATOM   2824 C  CD    . ARG C 2 194 ? -34.724 9.649   31.543  1.00 75.75  ? 194 ARG A CD    1 
ATOM   2825 N  NE    . ARG C 2 194 ? -35.130 8.251   31.420  1.00 75.32  ? 194 ARG A NE    1 
ATOM   2826 C  CZ    . ARG C 2 194 ? -35.332 7.634   30.258  1.00 74.71  ? 194 ARG A CZ    1 
ATOM   2827 N  NH1   . ARG C 2 194 ? -35.160 8.290   29.115  1.00 73.66  ? 194 ARG A NH1   1 
ATOM   2828 N  NH2   . ARG C 2 194 ? -35.715 6.364   30.236  1.00 74.41  ? 194 ARG A NH2   1 
ATOM   2829 N  N     . THR C 2 195 ? -31.029 13.320  33.364  1.00 68.86  ? 195 THR A N     1 
ATOM   2830 C  CA    . THR C 2 195 ? -30.395 14.617  33.231  1.00 66.76  ? 195 THR A CA    1 
ATOM   2831 C  C     . THR C 2 195 ? -29.688 14.676  31.886  1.00 67.21  ? 195 THR A C     1 
ATOM   2832 O  O     . THR C 2 195 ? -29.410 13.645  31.277  1.00 70.06  ? 195 THR A O     1 
ATOM   2833 C  CB    . THR C 2 195 ? -29.347 14.827  34.328  1.00 63.46  ? 195 THR A CB    1 
ATOM   2834 O  OG1   . THR C 2 195 ? -28.374 13.787  34.238  1.00 64.18  ? 195 THR A OG1   1 
ATOM   2835 C  CG2   . THR C 2 195 ? -29.982 14.790  35.709  1.00 60.05  ? 195 THR A CG2   1 
ATOM   2836 N  N     . LEU C 2 196 ? -29.388 15.884  31.423  1.00 64.65  ? 196 LEU A N     1 
ATOM   2837 C  CA    . LEU C 2 196 ? -28.709 16.040  30.145  1.00 60.67  ? 196 LEU A CA    1 
ATOM   2838 C  C     . LEU C 2 196 ? -27.286 16.553  30.314  1.00 55.58  ? 196 LEU A C     1 
ATOM   2839 O  O     . LEU C 2 196 ? -26.885 16.991  31.391  1.00 52.37  ? 196 LEU A O     1 
ATOM   2840 C  CB    . LEU C 2 196 ? -29.503 16.984  29.232  1.00 60.10  ? 196 LEU A CB    1 
ATOM   2841 C  CG    . LEU C 2 196 ? -30.931 16.531  28.891  1.00 62.88  ? 196 LEU A CG    1 
ATOM   2842 C  CD1   . LEU C 2 196 ? -31.558 17.523  27.941  1.00 62.26  ? 196 LEU A CD1   1 
ATOM   2843 C  CD2   . LEU C 2 196 ? -30.917 15.142  28.259  1.00 61.52  ? 196 LEU A CD2   1 
ATOM   2844 N  N     . GLY C 2 197 ? -26.521 16.473  29.235  1.00 51.75  ? 197 GLY A N     1 
ATOM   2845 C  CA    . GLY C 2 197 ? -25.155 16.936  29.261  1.00 48.87  ? 197 GLY A CA    1 
ATOM   2846 C  C     . GLY C 2 197 ? -24.726 17.186  27.840  1.00 51.69  ? 197 GLY A C     1 
ATOM   2847 O  O     . GLY C 2 197 ? -25.188 16.497  26.932  1.00 51.86  ? 197 GLY A O     1 
ATOM   2848 N  N     . GLU C 2 198 ? -23.862 18.177  27.642  1.00 54.42  ? 198 GLU A N     1 
ATOM   2849 C  CA    . GLU C 2 198 ? -23.367 18.509  26.309  1.00 61.09  ? 198 GLU A CA    1 
ATOM   2850 C  C     . GLU C 2 198 ? -21.875 18.772  26.320  1.00 60.57  ? 198 GLU A C     1 
ATOM   2851 O  O     . GLU C 2 198 ? -21.316 19.199  27.324  1.00 65.21  ? 198 GLU A O     1 
ATOM   2852 C  CB    . GLU C 2 198 ? -24.105 19.726  25.745  1.00 67.28  ? 198 GLU A CB    1 
ATOM   2853 C  CG    . GLU C 2 198 ? -24.571 20.725  26.792  1.00 79.51  ? 198 GLU A CG    1 
ATOM   2854 C  CD    . GLU C 2 198 ? -25.504 21.785  26.217  1.00 88.41  ? 198 GLU A CD    1 
ATOM   2855 O  OE1   . GLU C 2 198 ? -26.534 21.412  25.609  1.00 93.03  ? 198 GLU A OE1   1 
ATOM   2856 O  OE2   . GLU C 2 198 ? -25.211 22.992  26.375  1.00 90.10  ? 198 GLU A OE2   1 
ATOM   2857 N  N     . GLY C 2 199 ? -21.227 18.502  25.197  1.00 57.87  ? 199 GLY A N     1 
ATOM   2858 C  CA    . GLY C 2 199 ? -19.798 18.713  25.115  1.00 56.80  ? 199 GLY A CA    1 
ATOM   2859 C  C     . GLY C 2 199 ? -19.338 18.418  23.714  1.00 56.67  ? 199 GLY A C     1 
ATOM   2860 O  O     . GLY C 2 199 ? -20.163 18.037  22.871  1.00 54.07  ? 199 GLY A O     1 
ATOM   2861 N  N     . LYS C 2 200 ? -18.033 18.571  23.468  1.00 55.18  ? 200 LYS A N     1 
ATOM   2862 C  CA    . LYS C 2 200 ? -17.472 18.335  22.138  1.00 54.05  ? 200 LYS A CA    1 
ATOM   2863 C  C     . LYS C 2 200 ? -17.377 16.857  21.709  1.00 49.35  ? 200 LYS A C     1 
ATOM   2864 O  O     . LYS C 2 200 ? -16.965 16.557  20.593  1.00 50.84  ? 200 LYS A O     1 
ATOM   2865 C  CB    . LYS C 2 200 ? -16.105 19.021  22.014  1.00 53.35  ? 200 LYS A CB    1 
ATOM   2866 C  CG    . LYS C 2 200 ? -15.052 18.543  22.987  1.00 62.53  ? 200 LYS A CG    1 
ATOM   2867 C  CD    . LYS C 2 200 ? -13.644 18.903  22.490  1.00 65.13  ? 200 LYS A CD    1 
ATOM   2868 C  CE    . LYS C 2 200 ? -12.564 18.363  23.428  1.00 62.10  ? 200 LYS A CE    1 
ATOM   2869 N  NZ    . LYS C 2 200 ? -11.190 18.497  22.868  1.00 62.28  ? 200 LYS A NZ    1 
ATOM   2870 N  N     . SER C 2 201 ? -17.777 15.940  22.585  1.00 45.28  ? 201 SER A N     1 
ATOM   2871 C  CA    . SER C 2 201 ? -17.757 14.512  22.269  1.00 45.17  ? 201 SER A CA    1 
ATOM   2872 C  C     . SER C 2 201 ? -18.791 13.799  23.123  1.00 41.72  ? 201 SER A C     1 
ATOM   2873 O  O     . SER C 2 201 ? -19.295 14.365  24.078  1.00 46.73  ? 201 SER A O     1 
ATOM   2874 C  CB    . SER C 2 201 ? -16.379 13.915  22.554  1.00 45.01  ? 201 SER A CB    1 
ATOM   2875 O  OG    . SER C 2 201 ? -16.119 13.921  23.942  1.00 44.82  ? 201 SER A OG    1 
ATOM   2876 N  N     . LYS C 2 202 ? -19.121 12.563  22.784  1.00 43.07  ? 202 LYS A N     1 
ATOM   2877 C  CA    . LYS C 2 202 ? -20.090 11.840  23.584  1.00 49.09  ? 202 LYS A CA    1 
ATOM   2878 C  C     . LYS C 2 202 ? -19.547 11.778  25.003  1.00 51.70  ? 202 LYS A C     1 
ATOM   2879 O  O     . LYS C 2 202 ? -20.223 12.179  25.949  1.00 54.38  ? 202 LYS A O     1 
ATOM   2880 C  CB    . LYS C 2 202 ? -20.287 10.417  23.069  1.00 50.87  ? 202 LYS A CB    1 
ATOM   2881 C  CG    . LYS C 2 202 ? -20.957 10.269  21.715  1.00 51.89  ? 202 LYS A CG    1 
ATOM   2882 C  CD    . LYS C 2 202 ? -21.324 8.797   21.512  1.00 52.30  ? 202 LYS A CD    1 
ATOM   2883 C  CE    . LYS C 2 202 ? -21.698 8.456   20.073  1.00 55.69  ? 202 LYS A CE    1 
ATOM   2884 N  NZ    . LYS C 2 202 ? -21.815 6.975   19.890  1.00 50.02  ? 202 LYS A NZ    1 
ATOM   2885 N  N     . LYS C 2 203 ? -18.313 11.292  25.135  1.00 51.25  ? 203 LYS A N     1 
ATOM   2886 C  CA    . LYS C 2 203 ? -17.651 11.152  26.428  1.00 52.12  ? 203 LYS A CA    1 
ATOM   2887 C  C     . LYS C 2 203 ? -17.710 12.413  27.295  1.00 49.62  ? 203 LYS A C     1 
ATOM   2888 O  O     . LYS C 2 203 ? -18.164 12.365  28.433  1.00 52.75  ? 203 LYS A O     1 
ATOM   2889 C  CB    . LYS C 2 203 ? -16.196 10.721  26.219  1.00 51.61  ? 203 LYS A CB    1 
ATOM   2890 C  CG    . LYS C 2 203 ? -15.525 10.174  27.473  1.00 56.33  ? 203 LYS A CG    1 
ATOM   2891 C  CD    . LYS C 2 203 ? -14.343 9.254   27.137  1.00 62.96  ? 203 LYS A CD    1 
ATOM   2892 C  CE    . LYS C 2 203 ? -13.181 10.009  26.493  1.00 63.75  ? 203 LYS A CE    1 
ATOM   2893 N  NZ    . LYS C 2 203 ? -12.525 10.962  27.444  1.00 69.14  ? 203 LYS A NZ    1 
ATOM   2894 N  N     . GLU C 2 204 ? -17.256 13.541  26.772  1.00 45.15  ? 204 GLU A N     1 
ATOM   2895 C  CA    . GLU C 2 204 ? -17.308 14.768  27.547  1.00 50.43  ? 204 GLU A CA    1 
ATOM   2896 C  C     . GLU C 2 204 ? -18.773 15.043  27.891  1.00 52.64  ? 204 GLU A C     1 
ATOM   2897 O  O     . GLU C 2 204 ? -19.101 15.368  29.032  1.00 56.80  ? 204 GLU A O     1 
ATOM   2898 C  CB    . GLU C 2 204 ? -16.716 15.920  26.734  1.00 58.34  ? 204 GLU A CB    1 
ATOM   2899 C  CG    . GLU C 2 204 ? -16.652 17.268  27.444  1.00 63.73  ? 204 GLU A CG    1 
ATOM   2900 C  CD    . GLU C 2 204 ? -16.048 18.361  26.550  1.00 70.72  ? 204 GLU A CD    1 
ATOM   2901 O  OE1   . GLU C 2 204 ? -14.867 18.226  26.155  1.00 68.26  ? 204 GLU A OE1   1 
ATOM   2902 O  OE2   . GLU C 2 204 ? -16.754 19.349  26.239  1.00 69.84  ? 204 GLU A OE2   1 
ATOM   2903 N  N     . ALA C 2 205 ? -19.652 14.893  26.903  1.00 50.87  ? 205 ALA A N     1 
ATOM   2904 C  CA    . ALA C 2 205 ? -21.087 15.101  27.097  1.00 50.64  ? 205 ALA A CA    1 
ATOM   2905 C  C     . ALA C 2 205 ? -21.627 14.190  28.201  1.00 53.26  ? 205 ALA A C     1 
ATOM   2906 O  O     . ALA C 2 205 ? -22.380 14.633  29.072  1.00 55.66  ? 205 ALA A O     1 
ATOM   2907 C  CB    . ALA C 2 205 ? -21.833 14.824  25.797  1.00 47.07  ? 205 ALA A CB    1 
ATOM   2908 N  N     . GLU C 2 206 ? -21.249 12.915  28.152  1.00 51.16  ? 206 GLU A N     1 
ATOM   2909 C  CA    . GLU C 2 206 ? -21.691 11.949  29.141  1.00 51.89  ? 206 GLU A CA    1 
ATOM   2910 C  C     . GLU C 2 206 ? -21.206 12.326  30.545  1.00 54.73  ? 206 GLU A C     1 
ATOM   2911 O  O     . GLU C 2 206 ? -21.925 12.114  31.522  1.00 53.94  ? 206 GLU A O     1 
ATOM   2912 C  CB    . GLU C 2 206 ? -21.210 10.550  28.744  1.00 54.96  ? 206 GLU A CB    1 
ATOM   2913 C  CG    . GLU C 2 206 ? -21.849 10.034  27.442  1.00 61.23  ? 206 GLU A CG    1 
ATOM   2914 C  CD    . GLU C 2 206 ? -21.234 8.734   26.913  1.00 64.13  ? 206 GLU A CD    1 
ATOM   2915 O  OE1   . GLU C 2 206 ? -20.413 8.123   27.623  1.00 73.09  ? 206 GLU A OE1   1 
ATOM   2916 O  OE2   . GLU C 2 206 ? -21.582 8.305   25.791  1.00 64.28  ? 206 GLU A OE2   1 
ATOM   2917 N  N     . GLN C 2 207 ? -20.005 12.903  30.643  1.00 56.55  ? 207 GLN A N     1 
ATOM   2918 C  CA    . GLN C 2 207 ? -19.436 13.325  31.940  1.00 57.48  ? 207 GLN A CA    1 
ATOM   2919 C  C     . GLN C 2 207 ? -20.267 14.423  32.597  1.00 56.20  ? 207 GLN A C     1 
ATOM   2920 O  O     . GLN C 2 207 ? -20.633 14.320  33.770  1.00 55.04  ? 207 GLN A O     1 
ATOM   2921 C  CB    . GLN C 2 207 ? -18.014 13.861  31.780  1.00 56.55  ? 207 GLN A CB    1 
ATOM   2922 C  CG    . GLN C 2 207 ? -16.929 12.832  31.504  1.00 58.50  ? 207 GLN A CG    1 
ATOM   2923 C  CD    . GLN C 2 207 ? -16.587 11.979  32.704  1.00 56.48  ? 207 GLN A CD    1 
ATOM   2924 O  OE1   . GLN C 2 207 ? -16.626 12.432  33.847  1.00 59.92  ? 207 GLN A OE1   1 
ATOM   2925 N  NE2   . GLN C 2 207 ? -16.222 10.738  32.445  1.00 61.61  ? 207 GLN A NE2   1 
ATOM   2926 N  N     . ARG C 2 208 ? -20.526 15.493  31.846  1.00 56.92  ? 208 ARG A N     1 
ATOM   2927 C  CA    . ARG C 2 208 ? -21.341 16.599  32.346  1.00 56.80  ? 208 ARG A CA    1 
ATOM   2928 C  C     . ARG C 2 208 ? -22.704 16.037  32.736  1.00 54.58  ? 208 ARG A C     1 
ATOM   2929 O  O     . ARG C 2 208 ? -23.242 16.363  33.794  1.00 55.29  ? 208 ARG A O     1 
ATOM   2930 C  CB    . ARG C 2 208 ? -21.514 17.686  31.277  1.00 58.97  ? 208 ARG A CB    1 
ATOM   2931 C  CG    . ARG C 2 208 ? -20.427 18.755  31.263  1.00 65.27  ? 208 ARG A CG    1 
ATOM   2932 C  CD    . ARG C 2 208 ? -19.045 18.134  31.139  1.00 75.26  ? 208 ARG A CD    1 
ATOM   2933 N  NE    . ARG C 2 208 ? -18.014 19.084  30.719  1.00 81.25  ? 208 ARG A NE    1 
ATOM   2934 C  CZ    . ARG C 2 208 ? -17.962 19.669  29.522  1.00 81.78  ? 208 ARG A CZ    1 
ATOM   2935 N  NH1   . ARG C 2 208 ? -18.890 19.413  28.605  1.00 76.74  ? 208 ARG A NH1   1 
ATOM   2936 N  NH2   . ARG C 2 208 ? -16.967 20.502  29.235  1.00 79.39  ? 208 ARG A NH2   1 
ATOM   2937 N  N     . ALA C 2 209 ? -23.253 15.181  31.882  1.00 46.50  ? 209 ALA A N     1 
ATOM   2938 C  CA    . ALA C 2 209 ? -24.532 14.575  32.168  1.00 48.15  ? 209 ALA A CA    1 
ATOM   2939 C  C     . ALA C 2 209 ? -24.458 13.856  33.510  1.00 48.38  ? 209 ALA A C     1 
ATOM   2940 O  O     . ALA C 2 209 ? -25.358 13.970  34.337  1.00 48.65  ? 209 ALA A O     1 
ATOM   2941 C  CB    . ALA C 2 209 ? -24.894 13.589  31.065  1.00 55.32  ? 209 ALA A CB    1 
ATOM   2942 N  N     . ALA C 2 210 ? -23.372 13.119  33.723  1.00 47.15  ? 210 ALA A N     1 
ATOM   2943 C  CA    . ALA C 2 210 ? -23.179 12.361  34.958  1.00 47.54  ? 210 ALA A CA    1 
ATOM   2944 C  C     . ALA C 2 210 ? -22.962 13.240  36.189  1.00 48.49  ? 210 ALA A C     1 
ATOM   2945 O  O     . ALA C 2 210 ? -23.466 12.951  37.273  1.00 46.16  ? 210 ALA A O     1 
ATOM   2946 C  CB    . ALA C 2 210 ? -22.009 11.397  34.793  1.00 44.46  ? 210 ALA A CB    1 
ATOM   2947 N  N     . GLU C 2 211 ? -22.192 14.303  36.027  1.00 50.49  ? 211 GLU A N     1 
ATOM   2948 C  CA    . GLU C 2 211 ? -21.946 15.207  37.133  1.00 53.96  ? 211 GLU A CA    1 
ATOM   2949 C  C     . GLU C 2 211 ? -23.278 15.722  37.671  1.00 55.46  ? 211 GLU A C     1 
ATOM   2950 O  O     . GLU C 2 211 ? -23.513 15.719  38.880  1.00 52.81  ? 211 GLU A O     1 
ATOM   2951 C  CB    . GLU C 2 211 ? -21.083 16.373  36.662  1.00 50.17  ? 211 GLU A CB    1 
ATOM   2952 C  CG    . GLU C 2 211 ? -21.040 17.527  37.625  1.00 55.45  ? 211 GLU A CG    1 
ATOM   2953 C  CD    . GLU C 2 211 ? -20.184 18.659  37.113  1.00 61.94  ? 211 GLU A CD    1 
ATOM   2954 O  OE1   . GLU C 2 211 ? -19.841 18.638  35.911  1.00 62.98  ? 211 GLU A OE1   1 
ATOM   2955 O  OE2   . GLU C 2 211 ? -19.861 19.572  37.907  1.00 63.00  ? 211 GLU A OE2   1 
ATOM   2956 N  N     . GLU C 2 212 ? -24.150 16.153  36.764  1.00 58.35  ? 212 GLU A N     1 
ATOM   2957 C  CA    . GLU C 2 212 ? -25.457 16.677  37.150  1.00 65.90  ? 212 GLU A CA    1 
ATOM   2958 C  C     . GLU C 2 212 ? -26.366 15.606  37.763  1.00 65.22  ? 212 GLU A C     1 
ATOM   2959 O  O     . GLU C 2 212 ? -27.202 15.914  38.615  1.00 67.68  ? 212 GLU A O     1 
ATOM   2960 C  CB    . GLU C 2 212 ? -26.138 17.327  35.940  1.00 69.37  ? 212 GLU A CB    1 
ATOM   2961 C  CG    . GLU C 2 212 ? -25.230 18.307  35.192  1.00 84.41  ? 212 GLU A CG    1 
ATOM   2962 C  CD    . GLU C 2 212 ? -24.808 19.519  36.028  1.00 90.43  ? 212 GLU A CD    1 
ATOM   2963 O  OE1   . GLU C 2 212 ? -25.575 19.923  36.934  1.00 92.33  ? 212 GLU A OE1   1 
ATOM   2964 O  OE2   . GLU C 2 212 ? -23.711 20.075  35.763  1.00 87.16  ? 212 GLU A OE2   1 
ATOM   2965 N  N     . LEU C 2 213 ? -26.200 14.353  37.343  1.00 59.62  ? 213 LEU A N     1 
ATOM   2966 C  CA    . LEU C 2 213 ? -27.010 13.274  37.884  1.00 57.80  ? 213 LEU A CA    1 
ATOM   2967 C  C     . LEU C 2 213 ? -26.600 13.029  39.339  1.00 59.89  ? 213 LEU A C     1 
ATOM   2968 O  O     . LEU C 2 213 ? -27.446 12.767  40.201  1.00 60.95  ? 213 LEU A O     1 
ATOM   2969 C  CB    . LEU C 2 213 ? -26.835 12.013  37.035  1.00 53.57  ? 213 LEU A CB    1 
ATOM   2970 C  CG    . LEU C 2 213 ? -27.783 10.810  37.188  1.00 54.96  ? 213 LEU A CG    1 
ATOM   2971 C  CD1   . LEU C 2 213 ? -29.248 11.220  37.079  1.00 48.45  ? 213 LEU A CD1   1 
ATOM   2972 C  CD2   . LEU C 2 213 ? -27.442 9.794   36.098  1.00 48.63  ? 213 LEU A CD2   1 
ATOM   2973 N  N     . ILE C 2 214 ? -25.301 13.125  39.615  1.00 61.05  ? 214 ILE A N     1 
ATOM   2974 C  CA    . ILE C 2 214 ? -24.805 12.949  40.978  1.00 61.26  ? 214 ILE A CA    1 
ATOM   2975 C  C     . ILE C 2 214 ? -25.478 14.003  41.843  1.00 63.49  ? 214 ILE A C     1 
ATOM   2976 O  O     . ILE C 2 214 ? -26.008 13.703  42.904  1.00 66.10  ? 214 ILE A O     1 
ATOM   2977 C  CB    . ILE C 2 214 ? -23.286 13.178  41.083  1.00 61.85  ? 214 ILE A CB    1 
ATOM   2978 C  CG1   . ILE C 2 214 ? -22.531 12.159  40.237  1.00 61.44  ? 214 ILE A CG1   1 
ATOM   2979 C  CG2   . ILE C 2 214 ? -22.851 13.082  42.535  1.00 62.50  ? 214 ILE A CG2   1 
ATOM   2980 C  CD1   . ILE C 2 214 ? -21.023 12.284  40.338  1.00 57.13  ? 214 ILE A CD1   1 
ATOM   2981 N  N     . LYS C 2 215 ? -25.436 15.244  41.368  1.00 67.73  ? 215 LYS A N     1 
ATOM   2982 C  CA    . LYS C 2 215 ? -26.034 16.392  42.047  1.00 69.61  ? 215 LYS A CA    1 
ATOM   2983 C  C     . LYS C 2 215 ? -27.535 16.175  42.266  1.00 69.05  ? 215 LYS A C     1 
ATOM   2984 O  O     . LYS C 2 215 ? -28.061 16.414  43.356  1.00 68.23  ? 215 LYS A O     1 
ATOM   2985 C  CB    . LYS C 2 215 ? -25.804 17.646  41.198  1.00 74.34  ? 215 LYS A CB    1 
ATOM   2986 C  CG    . LYS C 2 215 ? -26.423 18.921  41.741  1.00 83.05  ? 215 LYS A CG    1 
ATOM   2987 C  CD    . LYS C 2 215 ? -26.273 20.067  40.744  1.00 88.26  ? 215 LYS A CD    1 
ATOM   2988 C  CE    . LYS C 2 215 ? -26.982 21.331  41.219  1.00 90.67  ? 215 LYS A CE    1 
ATOM   2989 N  NZ    . LYS C 2 215 ? -26.947 22.396  40.174  1.00 97.02  ? 215 LYS A NZ    1 
ATOM   2990 N  N     . LEU C 2 216 ? -28.220 15.729  41.216  1.00 66.92  ? 216 LEU A N     1 
ATOM   2991 C  CA    . LEU C 2 216 ? -29.648 15.456  41.283  1.00 63.27  ? 216 LEU A CA    1 
ATOM   2992 C  C     . LEU C 2 216 ? -29.935 14.431  42.369  1.00 66.91  ? 216 LEU A C     1 
ATOM   2993 O  O     . LEU C 2 216 ? -30.833 14.608  43.188  1.00 67.08  ? 216 LEU A O     1 
ATOM   2994 C  CB    . LEU C 2 216 ? -30.127 14.905  39.953  1.00 62.15  ? 216 LEU A CB    1 
ATOM   2995 C  CG    . LEU C 2 216 ? -31.534 14.324  39.975  1.00 63.70  ? 216 LEU A CG    1 
ATOM   2996 C  CD1   . LEU C 2 216 ? -32.550 15.429  40.170  1.00 64.55  ? 216 LEU A CD1   1 
ATOM   2997 C  CD2   . LEU C 2 216 ? -31.788 13.602  38.673  1.00 70.26  ? 216 LEU A CD2   1 
ATOM   2998 N  N     . LEU C 2 217 ? -29.164 13.349  42.369  1.00 67.26  ? 217 LEU A N     1 
ATOM   2999 C  CA    . LEU C 2 217 ? -29.340 12.294  43.350  1.00 65.78  ? 217 LEU A CA    1 
ATOM   3000 C  C     . LEU C 2 217 ? -29.007 12.699  44.773  1.00 69.30  ? 217 LEU A C     1 
ATOM   3001 O  O     . LEU C 2 217 ? -29.873 12.666  45.641  1.00 68.63  ? 217 LEU A O     1 
ATOM   3002 C  CB    . LEU C 2 217 ? -28.499 11.087  42.973  1.00 59.74  ? 217 LEU A CB    1 
ATOM   3003 C  CG    . LEU C 2 217 ? -28.969 10.330  41.742  1.00 63.60  ? 217 LEU A CG    1 
ATOM   3004 C  CD1   . LEU C 2 217 ? -27.997 9.184   41.490  1.00 62.09  ? 217 LEU A CD1   1 
ATOM   3005 C  CD2   . LEU C 2 217 ? -30.406 9.814   41.949  1.00 57.35  ? 217 LEU A CD2   1 
ATOM   3006 N  N     . GLU C 2 218 ? -27.750 13.066  45.019  1.00 75.27  ? 218 GLU A N     1 
ATOM   3007 C  CA    . GLU C 2 218 ? -27.323 13.449  46.360  1.00 78.73  ? 218 GLU A CA    1 
ATOM   3008 C  C     . GLU C 2 218 ? -28.228 14.519  46.941  1.00 78.65  ? 218 GLU A C     1 
ATOM   3009 O  O     . GLU C 2 218 ? -28.357 14.636  48.155  1.00 76.57  ? 218 GLU A O     1 
ATOM   3010 C  CB    . GLU C 2 218 ? -25.858 13.911  46.355  1.00 83.05  ? 218 GLU A CB    1 
ATOM   3011 C  CG    . GLU C 2 218 ? -24.859 12.754  46.136  1.00 91.62  ? 218 GLU A CG    1 
ATOM   3012 C  CD    . GLU C 2 218 ? -23.392 13.121  46.407  1.00 93.76  ? 218 GLU A CD    1 
ATOM   3013 O  OE1   . GLU C 2 218 ? -22.847 14.001  45.704  1.00 96.42  ? 218 GLU A OE1   1 
ATOM   3014 O  OE2   . GLU C 2 218 ? -22.782 12.518  47.321  1.00 88.78  ? 218 GLU A OE2   1 
ATOM   3015 N  N     . GLU C 2 219 ? -28.870 15.286  46.068  1.00 82.07  ? 219 GLU A N     1 
ATOM   3016 C  CA    . GLU C 2 219 ? -29.788 16.329  46.506  1.00 85.43  ? 219 GLU A CA    1 
ATOM   3017 C  C     . GLU C 2 219 ? -31.151 15.738  46.850  1.00 86.53  ? 219 GLU A C     1 
ATOM   3018 O  O     . GLU C 2 219 ? -31.658 15.931  47.954  1.00 86.93  ? 219 GLU A O     1 
ATOM   3019 C  CB    . GLU C 2 219 ? -29.972 17.378  45.413  1.00 88.83  ? 219 GLU A CB    1 
ATOM   3020 C  CG    . GLU C 2 219 ? -31.099 18.360  45.706  1.00 93.59  ? 219 GLU A CG    1 
ATOM   3021 C  CD    . GLU C 2 219 ? -31.505 19.164  44.489  1.00 96.39  ? 219 GLU A CD    1 
ATOM   3022 O  OE1   . GLU C 2 219 ? -31.807 18.542  43.447  1.00 94.79  ? 219 GLU A OE1   1 
ATOM   3023 O  OE2   . GLU C 2 219 ? -31.530 20.413  44.578  1.00 98.41  ? 219 GLU A OE2   1 
ATOM   3024 N  N     . SER C 2 220 ? -31.738 15.025  45.890  1.00 88.52  ? 220 SER A N     1 
ATOM   3025 C  CA    . SER C 2 220 ? -33.050 14.397  46.056  1.00 91.05  ? 220 SER A CA    1 
ATOM   3026 C  C     . SER C 2 220 ? -33.016 13.154  46.947  1.00 91.28  ? 220 SER A C     1 
ATOM   3027 O  O     . SER C 2 220 ? -32.010 12.960  47.668  1.00 91.36  ? 220 SER A O     1 
ATOM   3028 C  CB    . SER C 2 220 ? -33.632 14.019  44.689  1.00 92.92  ? 220 SER A CB    1 
ATOM   3029 O  OG    . SER C 2 220 ? -32.840 13.032  44.045  1.00 96.54  ? 220 SER A OG    1 
ATOM   3030 N  N     . LYS D 2 2   ? 17.930  -22.173 51.924  1.00 83.71  ? 2   LYS B N     1 
ATOM   3031 C  CA    . LYS D 2 2   ? 17.463  -23.589 51.984  1.00 87.64  ? 2   LYS B CA    1 
ATOM   3032 C  C     . LYS D 2 2   ? 17.455  -24.151 50.574  1.00 86.36  ? 2   LYS B C     1 
ATOM   3033 O  O     . LYS D 2 2   ? 18.471  -24.637 50.085  1.00 85.75  ? 2   LYS B O     1 
ATOM   3034 C  CB    . LYS D 2 2   ? 16.048  -23.672 52.573  1.00 89.66  ? 2   LYS B CB    1 
ATOM   3035 C  CG    . LYS D 2 2   ? 15.909  -23.204 54.025  1.00 88.52  ? 2   LYS B CG    1 
ATOM   3036 C  CD    . LYS D 2 2   ? 16.246  -21.727 54.207  1.00 86.52  ? 2   LYS B CD    1 
ATOM   3037 C  CE    . LYS D 2 2   ? 15.422  -20.827 53.296  1.00 83.87  ? 2   LYS B CE    1 
ATOM   3038 N  NZ    . LYS D 2 2   ? 15.778  -21.008 51.860  1.00 82.28  ? 2   LYS B NZ    1 
ATOM   3039 N  N     . MET D 2 3   ? 16.292  -24.088 49.932  1.00 88.04  ? 3   MET B N     1 
ATOM   3040 C  CA    . MET D 2 3   ? 16.134  -24.554 48.560  1.00 86.44  ? 3   MET B CA    1 
ATOM   3041 C  C     . MET D 2 3   ? 16.214  -23.313 47.672  1.00 85.44  ? 3   MET B C     1 
ATOM   3042 O  O     . MET D 2 3   ? 16.227  -23.399 46.443  1.00 84.79  ? 3   MET B O     1 
ATOM   3043 C  CB    . MET D 2 3   ? 14.782  -25.241 48.382  1.00 88.34  ? 3   MET B CB    1 
ATOM   3044 C  CG    . MET D 2 3   ? 14.649  -25.995 47.075  1.00 91.06  ? 3   MET B CG    1 
ATOM   3045 S  SD    . MET D 2 3   ? 13.118  -26.927 46.984  1.00 95.44  ? 3   MET B SD    1 
ATOM   3046 C  CE    . MET D 2 3   ? 13.536  -28.377 47.974  1.00 94.15  ? 3   MET B CE    1 
ATOM   3047 N  N     . LEU D 2 4   ? 16.255  -22.154 48.327  1.00 82.13  ? 4   LEU B N     1 
ATOM   3048 C  CA    . LEU D 2 4   ? 16.367  -20.871 47.651  1.00 75.72  ? 4   LEU B CA    1 
ATOM   3049 C  C     . LEU D 2 4   ? 17.670  -20.884 46.884  1.00 74.93  ? 4   LEU B C     1 
ATOM   3050 O  O     . LEU D 2 4   ? 17.751  -20.423 45.743  1.00 75.62  ? 4   LEU B O     1 
ATOM   3051 C  CB    . LEU D 2 4   ? 16.414  -19.739 48.672  1.00 73.86  ? 4   LEU B CB    1 
ATOM   3052 C  CG    . LEU D 2 4   ? 15.126  -19.443 49.431  1.00 73.92  ? 4   LEU B CG    1 
ATOM   3053 C  CD1   . LEU D 2 4   ? 15.362  -18.291 50.385  1.00 76.82  ? 4   LEU B CD1   1 
ATOM   3054 C  CD2   . LEU D 2 4   ? 14.023  -19.095 48.445  1.00 69.95  ? 4   LEU B CD2   1 
ATOM   3055 N  N     . GLU D 2 5   ? 18.691  -21.422 47.539  1.00 72.42  ? 5   GLU B N     1 
ATOM   3056 C  CA    . GLU D 2 5   ? 20.018  -21.519 46.966  1.00 70.45  ? 5   GLU B CA    1 
ATOM   3057 C  C     . GLU D 2 5   ? 19.949  -22.176 45.603  1.00 66.75  ? 5   GLU B C     1 
ATOM   3058 O  O     . GLU D 2 5   ? 20.818  -21.956 44.761  1.00 65.63  ? 5   GLU B O     1 
ATOM   3059 C  CB    . GLU D 2 5   ? 20.922  -22.338 47.887  1.00 79.47  ? 5   GLU B CB    1 
ATOM   3060 C  CG    . GLU D 2 5   ? 20.925  -21.856 49.339  1.00 90.23  ? 5   GLU B CG    1 
ATOM   3061 C  CD    . GLU D 2 5   ? 21.898  -22.623 50.230  1.00 93.79  ? 5   GLU B CD    1 
ATOM   3062 O  OE1   . GLU D 2 5   ? 22.584  -23.552 49.739  1.00 88.16  ? 5   GLU B OE1   1 
ATOM   3063 O  OE2   . GLU D 2 5   ? 21.972  -22.286 51.431  1.00 96.38  ? 5   GLU B OE2   1 
ATOM   3064 N  N     . GLN D 2 6   ? 18.908  -22.978 45.387  1.00 64.63  ? 6   GLN B N     1 
ATOM   3065 C  CA    . GLN D 2 6   ? 18.741  -23.679 44.114  1.00 64.65  ? 6   GLN B CA    1 
ATOM   3066 C  C     . GLN D 2 6   ? 18.214  -22.731 43.038  1.00 61.80  ? 6   GLN B C     1 
ATOM   3067 O  O     . GLN D 2 6   ? 18.554  -22.863 41.855  1.00 60.52  ? 6   GLN B O     1 
ATOM   3068 C  CB    . GLN D 2 6   ? 17.801  -24.892 44.280  1.00 67.38  ? 6   GLN B CB    1 
ATOM   3069 C  CG    . GLN D 2 6   ? 17.658  -25.764 43.018  1.00 74.26  ? 6   GLN B CG    1 
ATOM   3070 C  CD    . GLN D 2 6   ? 17.067  -27.153 43.290  1.00 76.99  ? 6   GLN B CD    1 
ATOM   3071 O  OE1   . GLN D 2 6   ? 16.958  -27.581 44.448  1.00 78.99  ? 6   GLN B OE1   1 
ATOM   3072 N  NE2   . GLN D 2 6   ? 16.676  -27.855 42.227  1.00 69.24  ? 6   GLN B NE2   1 
ATOM   3073 N  N     . LEU D 2 7   ? 17.391  -21.769 43.447  1.00 57.44  ? 7   LEU B N     1 
ATOM   3074 C  CA    . LEU D 2 7   ? 16.853  -20.807 42.500  1.00 54.06  ? 7   LEU B CA    1 
ATOM   3075 C  C     . LEU D 2 7   ? 17.922  -19.780 42.173  1.00 53.24  ? 7   LEU B C     1 
ATOM   3076 O  O     . LEU D 2 7   ? 18.012  -19.323 41.030  1.00 48.96  ? 7   LEU B O     1 
ATOM   3077 C  CB    . LEU D 2 7   ? 15.620  -20.112 43.067  1.00 51.92  ? 7   LEU B CB    1 
ATOM   3078 C  CG    . LEU D 2 7   ? 15.016  -19.041 42.159  1.00 44.59  ? 7   LEU B CG    1 
ATOM   3079 C  CD1   . LEU D 2 7   ? 14.778  -19.596 40.770  1.00 42.53  ? 7   LEU B CD1   1 
ATOM   3080 C  CD2   . LEU D 2 7   ? 13.721  -18.560 42.772  1.00 41.63  ? 7   LEU B CD2   1 
ATOM   3081 N  N     . GLU D 2 8   ? 18.734  -19.427 43.174  1.00 51.23  ? 8   GLU B N     1 
ATOM   3082 C  CA    . GLU D 2 8   ? 19.820  -18.467 42.979  1.00 49.81  ? 8   GLU B CA    1 
ATOM   3083 C  C     . GLU D 2 8   ? 20.768  -19.001 41.926  1.00 47.01  ? 8   GLU B C     1 
ATOM   3084 O  O     . GLU D 2 8   ? 21.381  -18.243 41.193  1.00 48.78  ? 8   GLU B O     1 
ATOM   3085 C  CB    . GLU D 2 8   ? 20.604  -18.242 44.272  1.00 56.36  ? 8   GLU B CB    1 
ATOM   3086 C  CG    . GLU D 2 8   ? 19.804  -17.610 45.411  1.00 70.91  ? 8   GLU B CG    1 
ATOM   3087 C  CD    . GLU D 2 8   ? 20.650  -17.329 46.652  1.00 75.57  ? 8   GLU B CD    1 
ATOM   3088 O  OE1   . GLU D 2 8   ? 21.211  -18.285 47.236  1.00 78.65  ? 8   GLU B OE1   1 
ATOM   3089 O  OE2   . GLU D 2 8   ? 20.751  -16.147 47.046  1.00 77.72  ? 8   GLU B OE2   1 
ATOM   3090 N  N     . LYS D 2 9   ? 20.890  -20.316 41.842  1.00 48.14  ? 9   LYS B N     1 
ATOM   3091 C  CA    . LYS D 2 9   ? 21.785  -20.896 40.851  1.00 51.64  ? 9   LYS B CA    1 
ATOM   3092 C  C     . LYS D 2 9   ? 21.227  -20.798 39.440  1.00 51.59  ? 9   LYS B C     1 
ATOM   3093 O  O     . LYS D 2 9   ? 21.993  -20.641 38.495  1.00 46.04  ? 9   LYS B O     1 
ATOM   3094 C  CB    . LYS D 2 9   ? 22.103  -22.358 41.176  1.00 55.00  ? 9   LYS B CB    1 
ATOM   3095 C  CG    . LYS D 2 9   ? 23.257  -22.897 40.346  1.00 59.50  ? 9   LYS B CG    1 
ATOM   3096 C  CD    . LYS D 2 9   ? 23.679  -24.292 40.773  1.00 65.52  ? 9   LYS B CD    1 
ATOM   3097 C  CE    . LYS D 2 9   ? 24.866  -24.784 39.946  1.00 67.44  ? 9   LYS B CE    1 
ATOM   3098 N  NZ    . LYS D 2 9   ? 25.347  -26.125 40.394  1.00 68.65  ? 9   LYS B NZ    1 
ATOM   3099 N  N     . LYS D 2 10  ? 19.900  -20.904 39.297  1.00 57.38  ? 10  LYS B N     1 
ATOM   3100 C  CA    . LYS D 2 10  ? 19.239  -20.798 37.984  1.00 57.08  ? 10  LYS B CA    1 
ATOM   3101 C  C     . LYS D 2 10  ? 19.372  -19.360 37.476  1.00 57.08  ? 10  LYS B C     1 
ATOM   3102 O  O     . LYS D 2 10  ? 19.648  -19.131 36.298  1.00 58.78  ? 10  LYS B O     1 
ATOM   3103 C  CB    . LYS D 2 10  ? 17.752  -21.126 38.082  1.00 57.61  ? 10  LYS B CB    1 
ATOM   3104 C  CG    . LYS D 2 10  ? 17.407  -22.507 38.553  1.00 57.65  ? 10  LYS B CG    1 
ATOM   3105 C  CD    . LYS D 2 10  ? 15.891  -22.605 38.715  1.00 64.40  ? 10  LYS B CD    1 
ATOM   3106 C  CE    . LYS D 2 10  ? 15.446  -23.977 39.177  1.00 62.38  ? 10  LYS B CE    1 
ATOM   3107 N  NZ    . LYS D 2 10  ? 15.930  -25.024 38.239  1.00 68.17  ? 10  LYS B NZ    1 
ATOM   3108 N  N     . LEU D 2 11  ? 19.143  -18.407 38.380  1.00 55.62  ? 11  LEU B N     1 
ATOM   3109 C  CA    . LEU D 2 11  ? 19.267  -16.980 38.090  1.00 52.80  ? 11  LEU B CA    1 
ATOM   3110 C  C     . LEU D 2 11  ? 20.721  -16.629 37.836  1.00 53.94  ? 11  LEU B C     1 
ATOM   3111 O  O     . LEU D 2 11  ? 21.030  -15.805 36.973  1.00 62.19  ? 11  LEU B O     1 
ATOM   3112 C  CB    . LEU D 2 11  ? 18.795  -16.135 39.274  1.00 49.99  ? 11  LEU B CB    1 
ATOM   3113 C  CG    . LEU D 2 11  ? 17.303  -15.879 39.457  1.00 56.41  ? 11  LEU B CG    1 
ATOM   3114 C  CD1   . LEU D 2 11  ? 16.776  -15.106 38.267  1.00 59.30  ? 11  LEU B CD1   1 
ATOM   3115 C  CD2   . LEU D 2 11  ? 16.573  -17.197 39.587  1.00 65.68  ? 11  LEU B CD2   1 
ATOM   3116 N  N     . GLY D 2 12  ? 21.616  -17.252 38.591  1.00 49.05  ? 12  GLY B N     1 
ATOM   3117 C  CA    . GLY D 2 12  ? 23.019  -16.944 38.435  1.00 48.70  ? 12  GLY B CA    1 
ATOM   3118 C  C     . GLY D 2 12  ? 23.292  -15.671 39.209  1.00 48.91  ? 12  GLY B C     1 
ATOM   3119 O  O     . GLY D 2 12  ? 24.062  -14.805 38.793  1.00 49.20  ? 12  GLY B O     1 
ATOM   3120 N  N     . TYR D 2 13  ? 22.626  -15.545 40.343  1.00 44.37  ? 13  TYR B N     1 
ATOM   3121 C  CA    . TYR D 2 13  ? 22.809  -14.387 41.179  1.00 46.82  ? 13  TYR B CA    1 
ATOM   3122 C  C     . TYR D 2 13  ? 22.576  -14.790 42.620  1.00 51.11  ? 13  TYR B C     1 
ATOM   3123 O  O     . TYR D 2 13  ? 21.713  -15.616 42.901  1.00 53.14  ? 13  TYR B O     1 
ATOM   3124 C  CB    . TYR D 2 13  ? 21.828  -13.288 40.795  1.00 51.79  ? 13  TYR B CB    1 
ATOM   3125 C  CG    . TYR D 2 13  ? 21.925  -12.089 41.706  1.00 50.31  ? 13  TYR B CG    1 
ATOM   3126 C  CD1   . TYR D 2 13  ? 22.976  -11.176 41.588  1.00 50.02  ? 13  TYR B CD1   1 
ATOM   3127 C  CD2   . TYR D 2 13  ? 21.001  -11.902 42.728  1.00 48.26  ? 13  TYR B CD2   1 
ATOM   3128 C  CE1   . TYR D 2 13  ? 23.100  -10.105 42.476  1.00 50.71  ? 13  TYR B CE1   1 
ATOM   3129 C  CE2   . TYR D 2 13  ? 21.114  -10.845 43.617  1.00 54.94  ? 13  TYR B CE2   1 
ATOM   3130 C  CZ    . TYR D 2 13  ? 22.164  -9.949  43.488  1.00 52.73  ? 13  TYR B CZ    1 
ATOM   3131 O  OH    . TYR D 2 13  ? 22.262  -8.908  44.379  1.00 49.06  ? 13  TYR B OH    1 
ATOM   3132 N  N     . THR D 2 14  ? 23.344  -14.194 43.530  1.00 54.17  ? 14  THR B N     1 
ATOM   3133 C  CA    . THR D 2 14  ? 23.229  -14.490 44.955  1.00 56.75  ? 14  THR B CA    1 
ATOM   3134 C  C     . THR D 2 14  ? 22.769  -13.255 45.731  1.00 56.09  ? 14  THR B C     1 
ATOM   3135 O  O     . THR D 2 14  ? 23.416  -12.204 45.685  1.00 58.66  ? 14  THR B O     1 
ATOM   3136 C  CB    . THR D 2 14  ? 24.588  -14.965 45.522  1.00 59.26  ? 14  THR B CB    1 
ATOM   3137 O  OG1   . THR D 2 14  ? 24.991  -16.173 44.862  1.00 57.67  ? 14  THR B OG1   1 
ATOM   3138 C  CG2   . THR D 2 14  ? 24.482  -15.219 47.009  1.00 60.00  ? 14  THR B CG2   1 
ATOM   3139 N  N     . PHE D 2 15  ? 21.659  -13.376 46.447  1.00 52.42  ? 15  PHE B N     1 
ATOM   3140 C  CA    . PHE D 2 15  ? 21.161  -12.243 47.203  1.00 55.14  ? 15  PHE B CA    1 
ATOM   3141 C  C     . PHE D 2 15  ? 21.939  -12.039 48.484  1.00 58.22  ? 15  PHE B C     1 
ATOM   3142 O  O     . PHE D 2 15  ? 22.548  -12.976 49.008  1.00 57.88  ? 15  PHE B O     1 
ATOM   3143 C  CB    . PHE D 2 15  ? 19.686  -12.429 47.550  1.00 55.69  ? 15  PHE B CB    1 
ATOM   3144 C  CG    . PHE D 2 15  ? 18.763  -12.216 46.394  1.00 59.35  ? 15  PHE B CG    1 
ATOM   3145 C  CD1   . PHE D 2 15  ? 18.780  -13.080 45.303  1.00 60.01  ? 15  PHE B CD1   1 
ATOM   3146 C  CD2   . PHE D 2 15  ? 17.876  -11.147 46.391  1.00 59.43  ? 15  PHE B CD2   1 
ATOM   3147 C  CE1   . PHE D 2 15  ? 17.928  -12.884 44.228  1.00 57.45  ? 15  PHE B CE1   1 
ATOM   3148 C  CE2   . PHE D 2 15  ? 17.019  -10.942 45.318  1.00 58.67  ? 15  PHE B CE2   1 
ATOM   3149 C  CZ    . PHE D 2 15  ? 17.045  -11.812 44.235  1.00 60.62  ? 15  PHE B CZ    1 
ATOM   3150 N  N     . LYS D 2 16  ? 21.921  -10.800 48.970  1.00 58.60  ? 16  LYS B N     1 
ATOM   3151 C  CA    . LYS D 2 16  ? 22.570  -10.435 50.226  1.00 59.68  ? 16  LYS B CA    1 
ATOM   3152 C  C     . LYS D 2 16  ? 21.447  -10.462 51.260  1.00 59.43  ? 16  LYS B C     1 
ATOM   3153 O  O     . LYS D 2 16  ? 21.660  -10.766 52.429  1.00 58.82  ? 16  LYS B O     1 
ATOM   3154 C  CB    . LYS D 2 16  ? 23.164  -9.025  50.145  1.00 64.45  ? 16  LYS B CB    1 
ATOM   3155 C  CG    . LYS D 2 16  ? 24.279  -8.849  49.112  1.00 68.22  ? 16  LYS B CG    1 
ATOM   3156 C  CD    . LYS D 2 16  ? 23.754  -8.901  47.687  1.00 75.44  ? 16  LYS B CD    1 
ATOM   3157 C  CE    . LYS D 2 16  ? 24.878  -8.699  46.672  1.00 79.78  ? 16  LYS B CE    1 
ATOM   3158 N  NZ    . LYS D 2 16  ? 25.931  -9.757  46.751  1.00 83.11  ? 16  LYS B NZ    1 
ATOM   3159 N  N     . ASP D 2 17  ? 20.238  -10.149 50.796  1.00 63.57  ? 17  ASP B N     1 
ATOM   3160 C  CA    . ASP D 2 17  ? 19.042  -10.128 51.633  1.00 62.24  ? 17  ASP B CA    1 
ATOM   3161 C  C     . ASP D 2 17  ? 18.078  -11.187 51.105  1.00 60.92  ? 17  ASP B C     1 
ATOM   3162 O  O     . ASP D 2 17  ? 17.231  -10.916 50.264  1.00 61.58  ? 17  ASP B O     1 
ATOM   3163 C  CB    . ASP D 2 17  ? 18.371  -8.759  51.564  1.00 61.92  ? 17  ASP B CB    1 
ATOM   3164 C  CG    . ASP D 2 17  ? 17.371  -8.549  52.681  1.00 70.30  ? 17  ASP B CG    1 
ATOM   3165 O  OD1   . ASP D 2 17  ? 16.601  -9.490  52.997  1.00 70.26  ? 17  ASP B OD1   1 
ATOM   3166 O  OD2   . ASP D 2 17  ? 17.354  -7.431  53.240  1.00 74.73  ? 17  ASP B OD2   1 
ATOM   3167 N  N     . LYS D 2 18  ? 18.207  -12.403 51.601  1.00 60.87  ? 18  LYS B N     1 
ATOM   3168 C  CA    . LYS D 2 18  ? 17.350  -13.471 51.135  1.00 60.00  ? 18  LYS B CA    1 
ATOM   3169 C  C     . LYS D 2 18  ? 15.891  -13.232 51.485  1.00 58.26  ? 18  LYS B C     1 
ATOM   3170 O  O     . LYS D 2 18  ? 15.008  -13.870 50.923  1.00 59.36  ? 18  LYS B O     1 
ATOM   3171 C  CB    . LYS D 2 18  ? 17.853  -14.804 51.692  1.00 62.54  ? 18  LYS B CB    1 
ATOM   3172 C  CG    . LYS D 2 18  ? 19.358  -14.968 51.472  1.00 61.04  ? 18  LYS B CG    1 
ATOM   3173 C  CD    . LYS D 2 18  ? 19.792  -16.418 51.423  1.00 61.92  ? 18  LYS B CD    1 
ATOM   3174 C  CE    . LYS D 2 18  ? 21.279  -16.528 51.095  1.00 57.62  ? 18  LYS B CE    1 
ATOM   3175 N  NZ    . LYS D 2 18  ? 21.612  -15.909 49.792  1.00 53.18  ? 18  LYS B NZ    1 
ATOM   3176 N  N     . SER D 2 19  ? 15.632  -12.309 52.406  1.00 57.36  ? 19  SER B N     1 
ATOM   3177 C  CA    . SER D 2 19  ? 14.257  -11.989 52.789  1.00 57.67  ? 19  SER B CA    1 
ATOM   3178 C  C     . SER D 2 19  ? 13.578  -11.277 51.609  1.00 56.36  ? 19  SER B C     1 
ATOM   3179 O  O     . SER D 2 19  ? 12.364  -11.375 51.388  1.00 52.56  ? 19  SER B O     1 
ATOM   3180 C  CB    . SER D 2 19  ? 14.256  -11.080 54.022  1.00 57.43  ? 19  SER B CB    1 
ATOM   3181 O  OG    . SER D 2 19  ? 14.517  -11.818 55.204  1.00 64.62  ? 19  SER B OG    1 
ATOM   3182 N  N     . LEU D 2 20  ? 14.399  -10.556 50.859  1.00 53.08  ? 20  LEU B N     1 
ATOM   3183 C  CA    . LEU D 2 20  ? 13.967  -9.819  49.689  1.00 53.23  ? 20  LEU B CA    1 
ATOM   3184 C  C     . LEU D 2 20  ? 13.489  -10.796 48.611  1.00 53.76  ? 20  LEU B C     1 
ATOM   3185 O  O     . LEU D 2 20  ? 12.425  -10.626 48.007  1.00 52.78  ? 20  LEU B O     1 
ATOM   3186 C  CB    . LEU D 2 20  ? 15.144  -9.015  49.157  1.00 48.70  ? 20  LEU B CB    1 
ATOM   3187 C  CG    . LEU D 2 20  ? 14.823  -8.106  47.993  1.00 50.63  ? 20  LEU B CG    1 
ATOM   3188 C  CD1   . LEU D 2 20  ? 13.871  -7.035  48.472  1.00 47.18  ? 20  LEU B CD1   1 
ATOM   3189 C  CD2   . LEU D 2 20  ? 16.096  -7.505  47.451  1.00 56.44  ? 20  LEU B CD2   1 
ATOM   3190 N  N     . LEU D 2 21  ? 14.313  -11.812 48.376  1.00 51.62  ? 21  LEU B N     1 
ATOM   3191 C  CA    . LEU D 2 21  ? 14.034  -12.841 47.402  1.00 47.58  ? 21  LEU B CA    1 
ATOM   3192 C  C     . LEU D 2 21  ? 12.789  -13.612 47.799  1.00 49.53  ? 21  LEU B C     1 
ATOM   3193 O  O     . LEU D 2 21  ? 12.022  -14.046 46.943  1.00 52.20  ? 21  LEU B O     1 
ATOM   3194 C  CB    . LEU D 2 21  ? 15.229  -13.784 47.301  1.00 49.74  ? 21  LEU B CB    1 
ATOM   3195 C  CG    . LEU D 2 21  ? 15.053  -15.069 46.485  1.00 52.92  ? 21  LEU B CG    1 
ATOM   3196 C  CD1   . LEU D 2 21  ? 14.552  -14.724 45.091  1.00 52.89  ? 21  LEU B CD1   1 
ATOM   3197 C  CD2   . LEU D 2 21  ? 16.381  -15.828 46.415  1.00 47.40  ? 21  LEU B CD2   1 
ATOM   3198 N  N     . GLU D 2 22  ? 12.574  -13.773 49.098  1.00 49.30  ? 22  GLU B N     1 
ATOM   3199 C  CA    . GLU D 2 22  ? 11.411  -14.510 49.574  1.00 54.35  ? 22  GLU B CA    1 
ATOM   3200 C  C     . GLU D 2 22  ? 10.120  -13.731 49.348  1.00 54.76  ? 22  GLU B C     1 
ATOM   3201 O  O     . GLU D 2 22  ? 9.044   -14.310 49.129  1.00 51.97  ? 22  GLU B O     1 
ATOM   3202 C  CB    . GLU D 2 22  ? 11.559  -14.816 51.062  1.00 59.79  ? 22  GLU B CB    1 
ATOM   3203 C  CG    . GLU D 2 22  ? 12.700  -15.755 51.402  1.00 72.83  ? 22  GLU B CG    1 
ATOM   3204 C  CD    . GLU D 2 22  ? 12.749  -16.079 52.891  1.00 82.84  ? 22  GLU B CD    1 
ATOM   3205 O  OE1   . GLU D 2 22  ? 11.992  -15.445 53.671  1.00 83.86  ? 22  GLU B OE1   1 
ATOM   3206 O  OE2   . GLU D 2 22  ? 13.544  -16.966 53.282  1.00 83.91  ? 22  GLU B OE2   1 
ATOM   3207 N  N     . LYS D 2 23  ? 10.237  -12.410 49.417  1.00 53.13  ? 23  LYS B N     1 
ATOM   3208 C  CA    . LYS D 2 23  ? 9.094   -11.538 49.240  1.00 50.46  ? 23  LYS B CA    1 
ATOM   3209 C  C     . LYS D 2 23  ? 8.618   -11.691 47.811  1.00 49.06  ? 23  LYS B C     1 
ATOM   3210 O  O     . LYS D 2 23  ? 7.423   -11.839 47.561  1.00 51.37  ? 23  LYS B O     1 
ATOM   3211 C  CB    . LYS D 2 23  ? 9.507   -10.093 49.509  1.00 56.37  ? 23  LYS B CB    1 
ATOM   3212 C  CG    . LYS D 2 23  ? 8.369   -9.100  49.695  1.00 57.24  ? 23  LYS B CG    1 
ATOM   3213 C  CD    . LYS D 2 23  ? 8.948   -7.723  50.006  1.00 56.12  ? 23  LYS B CD    1 
ATOM   3214 C  CE    . LYS D 2 23  ? 7.875   -6.724  50.355  1.00 64.27  ? 23  LYS B CE    1 
ATOM   3215 N  NZ    . LYS D 2 23  ? 8.432   -5.351  50.499  1.00 72.79  ? 23  LYS B NZ    1 
ATOM   3216 N  N     . ALA D 2 24  ? 9.569   -11.679 46.880  1.00 44.05  ? 24  ALA B N     1 
ATOM   3217 C  CA    . ALA D 2 24  ? 9.277   -11.793 45.456  1.00 41.49  ? 24  ALA B CA    1 
ATOM   3218 C  C     . ALA D 2 24  ? 8.511   -13.065 45.154  1.00 48.04  ? 24  ALA B C     1 
ATOM   3219 O  O     . ALA D 2 24  ? 7.733   -13.119 44.195  1.00 46.64  ? 24  ALA B O     1 
ATOM   3220 C  CB    . ALA D 2 24  ? 10.564  -11.781 44.668  1.00 33.12  ? 24  ALA B CB    1 
ATOM   3221 N  N     . LEU D 2 25  ? 8.734   -14.075 45.995  1.00 49.21  ? 25  LEU B N     1 
ATOM   3222 C  CA    . LEU D 2 25  ? 8.121   -15.393 45.855  1.00 48.89  ? 25  LEU B CA    1 
ATOM   3223 C  C     . LEU D 2 25  ? 6.824   -15.623 46.631  1.00 48.98  ? 25  LEU B C     1 
ATOM   3224 O  O     . LEU D 2 25  ? 6.149   -16.621 46.403  1.00 46.93  ? 25  LEU B O     1 
ATOM   3225 C  CB    . LEU D 2 25  ? 9.133   -16.452 46.286  1.00 43.83  ? 25  LEU B CB    1 
ATOM   3226 C  CG    . LEU D 2 25  ? 10.453  -16.456 45.526  1.00 44.66  ? 25  LEU B CG    1 
ATOM   3227 C  CD1   . LEU D 2 25  ? 11.469  -17.262 46.309  1.00 43.26  ? 25  LEU B CD1   1 
ATOM   3228 C  CD2   . LEU D 2 25  ? 10.255  -17.027 44.125  1.00 40.49  ? 25  LEU B CD2   1 
ATOM   3229 N  N     . THR D 2 26  ? 6.478   -14.709 47.534  1.00 50.14  ? 26  THR B N     1 
ATOM   3230 C  CA    . THR D 2 26  ? 5.283   -14.849 48.372  1.00 48.63  ? 26  THR B CA    1 
ATOM   3231 C  C     . THR D 2 26  ? 4.005   -14.151 47.910  1.00 52.07  ? 26  THR B C     1 
ATOM   3232 O  O     . THR D 2 26  ? 3.999   -12.935 47.675  1.00 52.17  ? 26  THR B O     1 
ATOM   3233 C  CB    . THR D 2 26  ? 5.582   -14.349 49.775  1.00 49.04  ? 26  THR B CB    1 
ATOM   3234 O  OG1   . THR D 2 26  ? 6.694   -15.083 50.309  1.00 47.90  ? 26  THR B OG1   1 
ATOM   3235 C  CG2   . THR D 2 26  ? 4.348   -14.475 50.663  1.00 38.81  ? 26  THR B CG2   1 
ATOM   3236 N  N     . HIS D 2 27  ? 2.921   -14.925 47.819  1.00 50.48  ? 27  HIS B N     1 
ATOM   3237 C  CA    . HIS D 2 27  ? 1.614   -14.412 47.399  1.00 48.65  ? 27  HIS B CA    1 
ATOM   3238 C  C     . HIS D 2 27  ? 0.928   -13.806 48.621  1.00 53.49  ? 27  HIS B C     1 
ATOM   3239 O  O     . HIS D 2 27  ? 1.329   -14.067 49.758  1.00 55.62  ? 27  HIS B O     1 
ATOM   3240 C  CB    . HIS D 2 27  ? 0.769   -15.561 46.820  1.00 49.22  ? 27  HIS B CB    1 
ATOM   3241 C  CG    . HIS D 2 27  ? -0.572  -15.141 46.292  1.00 51.67  ? 27  HIS B CG    1 
ATOM   3242 N  ND1   . HIS D 2 27  ? -1.759  -15.566 46.851  1.00 54.06  ? 27  HIS B ND1   1 
ATOM   3243 C  CD2   . HIS D 2 27  ? -0.916  -14.350 45.246  1.00 52.54  ? 27  HIS B CD2   1 
ATOM   3244 C  CE1   . HIS D 2 27  ? -2.773  -15.056 46.174  1.00 52.08  ? 27  HIS B CE1   1 
ATOM   3245 N  NE2   . HIS D 2 27  ? -2.289  -14.314 45.194  1.00 51.24  ? 27  HIS B NE2   1 
ATOM   3246 N  N     . VAL D 2 28  ? -0.102  -12.996 48.396  1.00 54.49  ? 28  VAL B N     1 
ATOM   3247 C  CA    . VAL D 2 28  ? -0.824  -12.362 49.498  1.00 51.18  ? 28  VAL B CA    1 
ATOM   3248 C  C     . VAL D 2 28  ? -1.447  -13.351 50.483  1.00 52.17  ? 28  VAL B C     1 
ATOM   3249 O  O     . VAL D 2 28  ? -1.424  -13.125 51.695  1.00 51.29  ? 28  VAL B O     1 
ATOM   3250 C  CB    . VAL D 2 28  ? -1.958  -11.449 48.978  1.00 48.38  ? 28  VAL B CB    1 
ATOM   3251 C  CG1   . VAL D 2 28  ? -2.948  -12.259 48.175  1.00 47.04  ? 28  VAL B CG1   1 
ATOM   3252 C  CG2   . VAL D 2 28  ? -2.666  -10.787 50.143  1.00 41.61  ? 28  VAL B CG2   1 
ATOM   3253 N  N     . SER D 2 29  ? -2.020  -14.431 49.957  1.00 51.72  ? 29  SER B N     1 
ATOM   3254 C  CA    . SER D 2 29  ? -2.672  -15.447 50.786  1.00 54.28  ? 29  SER B CA    1 
ATOM   3255 C  C     . SER D 2 29  ? -1.738  -16.067 51.822  1.00 52.67  ? 29  SER B C     1 
ATOM   3256 O  O     . SER D 2 29  ? -2.145  -16.366 52.943  1.00 50.54  ? 29  SER B O     1 
ATOM   3257 C  CB    . SER D 2 29  ? -3.240  -16.560 49.906  1.00 52.78  ? 29  SER B CB    1 
ATOM   3258 O  OG    . SER D 2 29  ? -2.201  -17.295 49.280  1.00 57.63  ? 29  SER B OG    1 
ATOM   3259 N  N     . TYR D 2 30  ? -0.483  -16.253 51.436  1.00 53.56  ? 30  TYR B N     1 
ATOM   3260 C  CA    . TYR D 2 30  ? 0.498   -16.846 52.317  1.00 54.71  ? 30  TYR B CA    1 
ATOM   3261 C  C     . TYR D 2 30  ? 1.039   -15.899 53.390  1.00 59.54  ? 30  TYR B C     1 
ATOM   3262 O  O     . TYR D 2 30  ? 1.447   -16.343 54.467  1.00 62.78  ? 30  TYR B O     1 
ATOM   3263 C  CB    . TYR D 2 30  ? 1.633   -17.401 51.485  1.00 53.37  ? 30  TYR B CB    1 
ATOM   3264 C  CG    . TYR D 2 30  ? 2.598   -18.250 52.265  1.00 56.60  ? 30  TYR B CG    1 
ATOM   3265 C  CD1   . TYR D 2 30  ? 3.597   -17.664 53.039  1.00 51.15  ? 30  TYR B CD1   1 
ATOM   3266 C  CD2   . TYR D 2 30  ? 2.527   -19.644 52.212  1.00 57.09  ? 30  TYR B CD2   1 
ATOM   3267 C  CE1   . TYR D 2 30  ? 4.504   -18.435 53.735  1.00 58.11  ? 30  TYR B CE1   1 
ATOM   3268 C  CE2   . TYR D 2 30  ? 3.436   -20.433 52.911  1.00 63.16  ? 30  TYR B CE2   1 
ATOM   3269 C  CZ    . TYR D 2 30  ? 4.424   -19.816 53.669  1.00 62.42  ? 30  TYR B CZ    1 
ATOM   3270 O  OH    . TYR D 2 30  ? 5.339   -20.572 54.355  1.00 67.80  ? 30  TYR B OH    1 
ATOM   3271 N  N     . SER D 2 31  ? 1.041   -14.601 53.103  1.00 59.59  ? 31  SER B N     1 
ATOM   3272 C  CA    . SER D 2 31  ? 1.521   -13.596 54.056  1.00 57.73  ? 31  SER B CA    1 
ATOM   3273 C  C     . SER D 2 31  ? 0.908   -12.236 53.731  1.00 58.02  ? 31  SER B C     1 
ATOM   3274 O  O     . SER D 2 31  ? 1.180   -11.664 52.678  1.00 61.98  ? 31  SER B O     1 
ATOM   3275 C  CB    . SER D 2 31  ? 3.050   -13.494 54.001  1.00 60.54  ? 31  SER B CB    1 
ATOM   3276 O  OG    . SER D 2 31  ? 3.536   -12.407 54.777  1.00 60.00  ? 31  SER B OG    1 
ATOM   3277 N  N     . LYS D 2 32  ? 0.084   -11.719 54.634  1.00 58.78  ? 32  LYS B N     1 
ATOM   3278 C  CA    . LYS D 2 32  ? -0.567  -10.433 54.420  1.00 59.84  ? 32  LYS B CA    1 
ATOM   3279 C  C     . LYS D 2 32  ? 0.385   -9.261  54.563  1.00 57.99  ? 32  LYS B C     1 
ATOM   3280 O  O     . LYS D 2 32  ? 0.111   -8.174  54.072  1.00 57.05  ? 32  LYS B O     1 
ATOM   3281 C  CB    . LYS D 2 32  ? -1.755  -10.269 55.378  1.00 60.37  ? 32  LYS B CB    1 
ATOM   3282 C  CG    . LYS D 2 32  ? -3.008  -11.048 54.950  1.00 69.47  ? 32  LYS B CG    1 
ATOM   3283 C  CD    . LYS D 2 32  ? -2.711  -12.528 54.669  1.00 73.18  ? 32  LYS B CD    1 
ATOM   3284 C  CE    . LYS D 2 32  ? -3.933  -13.277 54.116  1.00 78.94  ? 32  LYS B CE    1 
ATOM   3285 N  NZ    . LYS D 2 32  ? -4.287  -12.891 52.718  1.00 77.62  ? 32  LYS B NZ    1 
ATOM   3286 N  N     . LYS D 2 33  ? 1.519   -9.479  55.213  1.00 59.35  ? 33  LYS B N     1 
ATOM   3287 C  CA    . LYS D 2 33  ? 2.457   -8.389  55.391  1.00 58.54  ? 33  LYS B CA    1 
ATOM   3288 C  C     . LYS D 2 33  ? 3.557   -8.327  54.363  1.00 56.72  ? 33  LYS B C     1 
ATOM   3289 O  O     . LYS D 2 33  ? 3.842   -7.258  53.848  1.00 59.12  ? 33  LYS B O     1 
ATOM   3290 C  CB    . LYS D 2 33  ? 3.070   -8.422  56.788  1.00 60.88  ? 33  LYS B CB    1 
ATOM   3291 C  CG    . LYS D 2 33  ? 2.350   -7.531  57.794  1.00 65.87  ? 33  LYS B CG    1 
ATOM   3292 C  CD    . LYS D 2 33  ? 3.191   -7.339  59.047  1.00 71.81  ? 33  LYS B CD    1 
ATOM   3293 C  CE    . LYS D 2 33  ? 2.543   -6.364  60.015  1.00 78.69  ? 33  LYS B CE    1 
ATOM   3294 N  NZ    . LYS D 2 33  ? 3.303   -6.261  61.297  1.00 79.76  ? 33  LYS B NZ    1 
ATOM   3295 N  N     . GLU D 2 34  ? 4.175   -9.458  54.046  1.00 55.62  ? 34  GLU B N     1 
ATOM   3296 C  CA    . GLU D 2 34  ? 5.264   -9.437  53.082  1.00 54.16  ? 34  GLU B CA    1 
ATOM   3297 C  C     . GLU D 2 34  ? 5.016   -10.209 51.803  1.00 53.23  ? 34  GLU B C     1 
ATOM   3298 O  O     . GLU D 2 34  ? 5.367   -11.380 51.713  1.00 52.34  ? 34  GLU B O     1 
ATOM   3299 C  CB    . GLU D 2 34  ? 6.544   -9.977  53.717  1.00 59.22  ? 34  GLU B CB    1 
ATOM   3300 C  CG    . GLU D 2 34  ? 7.030   -9.223  54.940  1.00 68.33  ? 34  GLU B CG    1 
ATOM   3301 C  CD    . GLU D 2 34  ? 7.141   -7.732  54.702  1.00 73.27  ? 34  GLU B CD    1 
ATOM   3302 O  OE1   . GLU D 2 34  ? 7.558   -7.339  53.592  1.00 75.37  ? 34  GLU B OE1   1 
ATOM   3303 O  OE2   . GLU D 2 34  ? 6.820   -6.955  55.629  1.00 78.27  ? 34  GLU B OE2   1 
ATOM   3304 N  N     . HIS D 2 35  ? 4.402   -9.569  50.810  1.00 47.13  ? 35  HIS B N     1 
ATOM   3305 C  CA    . HIS D 2 35  ? 4.168   -10.281 49.545  1.00 50.92  ? 35  HIS B CA    1 
ATOM   3306 C  C     . HIS D 2 35  ? 4.694   -9.480  48.350  1.00 48.24  ? 35  HIS B C     1 
ATOM   3307 O  O     . HIS D 2 35  ? 5.156   -8.352  48.489  1.00 50.76  ? 35  HIS B O     1 
ATOM   3308 C  CB    . HIS D 2 35  ? 2.719   -10.633 49.370  1.00 55.62  ? 35  HIS B CB    1 
ATOM   3309 C  CG    . HIS D 2 35  ? 1.764   -9.430  49.415  1.00 56.48  ? 35  HIS B CG    1 
ATOM   3310 N  ND1   . HIS D 2 35  ? 1.596   -8.573  48.349  1.00 59.72  ? 35  HIS B ND1   1 
ATOM   3311 C  CD2   . HIS D 2 35  ? 0.912   -9.008  50.378  1.00 57.18  ? 35  HIS B CD2   1 
ATOM   3312 C  CE1   . HIS D 2 35  ? 0.674   -7.677  48.653  1.00 62.34  ? 35  HIS B CE1   1 
ATOM   3313 N  NE2   . HIS D 2 35  ? 0.242   -7.919  49.878  1.00 61.12  ? 35  HIS B NE2   1 
ATOM   3314 N  N     . TYR D 2 36  ? 4.618   -10.085 47.167  1.00 50.42  ? 36  TYR B N     1 
ATOM   3315 C  CA    . TYR D 2 36  ? 5.210   -9.502  45.952  1.00 49.48  ? 36  TYR B CA    1 
ATOM   3316 C  C     . TYR D 2 36  ? 4.471   -8.388  45.206  1.00 50.44  ? 36  TYR B C     1 
ATOM   3317 O  O     . TYR D 2 36  ? 4.971   -7.903  44.194  1.00 50.47  ? 36  TYR B O     1 
ATOM   3318 C  CB    . TYR D 2 36  ? 5.510   -10.639 44.954  1.00 51.06  ? 36  TYR B CB    1 
ATOM   3319 C  CG    . TYR D 2 36  ? 4.290   -11.345 44.391  1.00 46.72  ? 36  TYR B CG    1 
ATOM   3320 C  CD1   . TYR D 2 36  ? 3.221   -10.654 43.835  1.00 44.01  ? 36  TYR B CD1   1 
ATOM   3321 C  CD2   . TYR D 2 36  ? 4.218   -12.740 44.435  1.00 52.19  ? 36  TYR B CD2   1 
ATOM   3322 C  CE1   . TYR D 2 36  ? 2.110   -11.320 43.339  1.00 52.88  ? 36  TYR B CE1   1 
ATOM   3323 C  CE2   . TYR D 2 36  ? 3.106   -13.425 43.939  1.00 49.57  ? 36  TYR B CE2   1 
ATOM   3324 C  CZ    . TYR D 2 36  ? 2.056   -12.705 43.394  1.00 54.74  ? 36  TYR B CZ    1 
ATOM   3325 O  OH    . TYR D 2 36  ? 0.944   -13.358 42.916  1.00 55.45  ? 36  TYR B OH    1 
ATOM   3326 N  N     . GLU D 2 37  ? 3.303   -7.986  45.670  1.00 49.63  ? 37  GLU B N     1 
ATOM   3327 C  CA    . GLU D 2 37  ? 2.510   -7.014  44.912  1.00 49.34  ? 37  GLU B CA    1 
ATOM   3328 C  C     . GLU D 2 37  ? 3.226   -5.725  44.495  1.00 47.17  ? 37  GLU B C     1 
ATOM   3329 O  O     . GLU D 2 37  ? 3.115   -5.316  43.335  1.00 47.08  ? 37  GLU B O     1 
ATOM   3330 C  CB    . GLU D 2 37  ? 1.234   -6.671  45.672  1.00 53.04  ? 37  GLU B CB    1 
ATOM   3331 C  CG    . GLU D 2 37  ? 0.329   -5.732  44.895  1.00 63.97  ? 37  GLU B CG    1 
ATOM   3332 C  CD    . GLU D 2 37  ? -1.000  -5.495  45.575  1.00 68.71  ? 37  GLU B CD    1 
ATOM   3333 O  OE1   . GLU D 2 37  ? -1.706  -6.493  45.838  1.00 71.21  ? 37  GLU B OE1   1 
ATOM   3334 O  OE2   . GLU D 2 37  ? -1.341  -4.314  45.840  1.00 70.41  ? 37  GLU B OE2   1 
ATOM   3335 N  N     . THR D 2 38  ? 3.970   -5.101  45.409  1.00 45.07  ? 38  THR B N     1 
ATOM   3336 C  CA    . THR D 2 38  ? 4.666   -3.847  45.110  1.00 43.88  ? 38  THR B CA    1 
ATOM   3337 C  C     . THR D 2 38  ? 5.900   -4.049  44.251  1.00 44.76  ? 38  THR B C     1 
ATOM   3338 O  O     . THR D 2 38  ? 6.220   -3.210  43.414  1.00 45.37  ? 38  THR B O     1 
ATOM   3339 C  CB    . THR D 2 38  ? 5.068   -3.126  46.399  1.00 43.75  ? 38  THR B CB    1 
ATOM   3340 O  OG1   . THR D 2 38  ? 3.928   -3.051  47.259  1.00 47.45  ? 38  THR B OG1   1 
ATOM   3341 C  CG2   . THR D 2 38  ? 5.564   -1.729  46.089  1.00 49.25  ? 38  THR B CG2   1 
ATOM   3342 N  N     . LEU D 2 39  ? 6.571   -5.166  44.470  1.00 44.73  ? 39  LEU B N     1 
ATOM   3343 C  CA    . LEU D 2 39  ? 7.749   -5.499  43.694  1.00 40.85  ? 39  LEU B CA    1 
ATOM   3344 C  C     . LEU D 2 39  ? 7.332   -5.828  42.260  1.00 40.53  ? 39  LEU B C     1 
ATOM   3345 O  O     . LEU D 2 39  ? 8.105   -5.660  41.328  1.00 42.02  ? 39  LEU B O     1 
ATOM   3346 C  CB    . LEU D 2 39  ? 8.454   -6.701  44.319  1.00 43.07  ? 39  LEU B CB    1 
ATOM   3347 C  CG    . LEU D 2 39  ? 9.383   -6.520  45.524  1.00 40.34  ? 39  LEU B CG    1 
ATOM   3348 C  CD1   . LEU D 2 39  ? 9.738   -7.892  46.084  1.00 42.87  ? 39  LEU B CD1   1 
ATOM   3349 C  CD2   . LEU D 2 39  ? 10.646  -5.788  45.100  1.00 31.77  ? 39  LEU B CD2   1 
ATOM   3350 N  N     . GLU D 2 40  ? 6.112   -6.320  42.086  1.00 41.31  ? 40  GLU B N     1 
ATOM   3351 C  CA    . GLU D 2 40  ? 5.621   -6.637  40.759  1.00 43.07  ? 40  GLU B CA    1 
ATOM   3352 C  C     . GLU D 2 40  ? 5.432   -5.314  40.038  1.00 39.31  ? 40  GLU B C     1 
ATOM   3353 O  O     . GLU D 2 40  ? 5.685   -5.198  38.847  1.00 40.35  ? 40  GLU B O     1 
ATOM   3354 C  CB    . GLU D 2 40  ? 4.293   -7.392  40.841  1.00 49.17  ? 40  GLU B CB    1 
ATOM   3355 C  CG    . GLU D 2 40  ? 3.801   -7.898  39.492  1.00 55.39  ? 40  GLU B CG    1 
ATOM   3356 C  CD    . GLU D 2 40  ? 2.483   -7.271  39.068  1.00 59.90  ? 40  GLU B CD    1 
ATOM   3357 O  OE1   . GLU D 2 40  ? 1.455   -7.540  39.731  1.00 66.50  ? 40  GLU B OE1   1 
ATOM   3358 O  OE2   . GLU D 2 40  ? 2.474   -6.513  38.075  1.00 60.53  ? 40  GLU B OE2   1 
ATOM   3359 N  N     . PHE D 2 41  ? 5.003   -4.306  40.782  1.00 44.14  ? 41  PHE B N     1 
ATOM   3360 C  CA    . PHE D 2 41  ? 4.801   -2.968  40.227  1.00 44.58  ? 41  PHE B CA    1 
ATOM   3361 C  C     . PHE D 2 41  ? 6.113   -2.474  39.619  1.00 43.74  ? 41  PHE B C     1 
ATOM   3362 O  O     . PHE D 2 41  ? 6.162   -2.024  38.474  1.00 44.54  ? 41  PHE B O     1 
ATOM   3363 C  CB    . PHE D 2 41  ? 4.351   -2.010  41.339  1.00 52.13  ? 41  PHE B CB    1 
ATOM   3364 C  CG    . PHE D 2 41  ? 4.009   -0.625  40.856  1.00 59.23  ? 41  PHE B CG    1 
ATOM   3365 C  CD1   . PHE D 2 41  ? 2.936   -0.416  39.994  1.00 63.31  ? 41  PHE B CD1   1 
ATOM   3366 C  CD2   . PHE D 2 41  ? 4.770   0.472   41.252  1.00 64.97  ? 41  PHE B CD2   1 
ATOM   3367 C  CE1   . PHE D 2 41  ? 2.626   0.868   39.529  1.00 64.87  ? 41  PHE B CE1   1 
ATOM   3368 C  CE2   . PHE D 2 41  ? 4.468   1.761   40.793  1.00 68.01  ? 41  PHE B CE2   1 
ATOM   3369 C  CZ    . PHE D 2 41  ? 3.393   1.955   39.929  1.00 66.73  ? 41  PHE B CZ    1 
ATOM   3370 N  N     . LEU D 2 42  ? 7.179   -2.566  40.406  1.00 42.94  ? 42  LEU B N     1 
ATOM   3371 C  CA    . LEU D 2 42  ? 8.505   -2.138  39.977  1.00 38.08  ? 42  LEU B CA    1 
ATOM   3372 C  C     . LEU D 2 42  ? 9.068   -3.053  38.906  1.00 36.08  ? 42  LEU B C     1 
ATOM   3373 O  O     . LEU D 2 42  ? 9.765   -2.602  38.000  1.00 41.85  ? 42  LEU B O     1 
ATOM   3374 C  CB    . LEU D 2 42  ? 9.443   -2.101  41.179  1.00 38.20  ? 42  LEU B CB    1 
ATOM   3375 C  CG    . LEU D 2 42  ? 10.897  -1.702  40.947  1.00 42.64  ? 42  LEU B CG    1 
ATOM   3376 C  CD1   . LEU D 2 42  ? 10.973  -0.283  40.412  1.00 38.70  ? 42  LEU B CD1   1 
ATOM   3377 C  CD2   . LEU D 2 42  ? 11.646  -1.817  42.263  1.00 42.52  ? 42  LEU B CD2   1 
ATOM   3378 N  N     . GLY D 2 43  ? 8.758   -4.342  39.004  1.00 37.21  ? 43  GLY B N     1 
ATOM   3379 C  CA    . GLY D 2 43  ? 9.238   -5.299  38.024  1.00 35.71  ? 43  GLY B CA    1 
ATOM   3380 C  C     . GLY D 2 43  ? 8.709   -5.029  36.625  1.00 39.34  ? 43  GLY B C     1 
ATOM   3381 O  O     . GLY D 2 43  ? 9.445   -5.168  35.638  1.00 35.28  ? 43  GLY B O     1 
ATOM   3382 N  N     . ASP D 2 44  ? 7.430   -4.653  36.538  1.00 42.98  ? 44  ASP B N     1 
ATOM   3383 C  CA    . ASP D 2 44  ? 6.777   -4.348  35.258  1.00 47.54  ? 44  ASP B CA    1 
ATOM   3384 C  C     . ASP D 2 44  ? 7.613   -3.347  34.459  1.00 48.85  ? 44  ASP B C     1 
ATOM   3385 O  O     . ASP D 2 44  ? 7.950   -3.576  33.290  1.00 52.64  ? 44  ASP B O     1 
ATOM   3386 C  CB    . ASP D 2 44  ? 5.384   -3.754  35.504  1.00 53.98  ? 44  ASP B CB    1 
ATOM   3387 C  CG    . ASP D 2 44  ? 4.252   -4.717  35.160  1.00 59.79  ? 44  ASP B CG    1 
ATOM   3388 O  OD1   . ASP D 2 44  ? 4.513   -5.743  34.506  1.00 63.88  ? 44  ASP B OD1   1 
ATOM   3389 O  OD2   . ASP D 2 44  ? 3.091   -4.438  35.538  1.00 64.95  ? 44  ASP B OD2   1 
ATOM   3390 N  N     . ALA D 2 45  ? 7.950   -2.236  35.106  1.00 44.68  ? 45  ALA B N     1 
ATOM   3391 C  CA    . ALA D 2 45  ? 8.741   -1.190  34.484  1.00 43.43  ? 45  ALA B CA    1 
ATOM   3392 C  C     . ALA D 2 45  ? 10.091  -1.721  34.027  1.00 43.29  ? 45  ALA B C     1 
ATOM   3393 O  O     . ALA D 2 45  ? 10.431  -1.652  32.846  1.00 44.07  ? 45  ALA B O     1 
ATOM   3394 C  CB    . ALA D 2 45  ? 8.939   -0.047  35.467  1.00 41.17  ? 45  ALA B CB    1 
ATOM   3395 N  N     . LEU D 2 46  ? 10.852  -2.262  34.975  1.00 44.28  ? 46  LEU B N     1 
ATOM   3396 C  CA    . LEU D 2 46  ? 12.182  -2.796  34.699  1.00 43.03  ? 46  LEU B CA    1 
ATOM   3397 C  C     . LEU D 2 46  ? 12.203  -3.692  33.469  1.00 40.90  ? 46  LEU B C     1 
ATOM   3398 O  O     . LEU D 2 46  ? 12.953  -3.453  32.526  1.00 37.27  ? 46  LEU B O     1 
ATOM   3399 C  CB    . LEU D 2 46  ? 12.680  -3.581  35.905  1.00 46.07  ? 46  LEU B CB    1 
ATOM   3400 C  CG    . LEU D 2 46  ? 14.186  -3.825  35.896  1.00 53.35  ? 46  LEU B CG    1 
ATOM   3401 C  CD1   . LEU D 2 46  ? 14.914  -2.487  36.012  1.00 51.07  ? 46  LEU B CD1   1 
ATOM   3402 C  CD2   . LEU D 2 46  ? 14.566  -4.726  37.057  1.00 57.25  ? 46  LEU B CD2   1 
ATOM   3403 N  N     . VAL D 2 47  ? 11.361  -4.720  33.478  1.00 42.50  ? 47  VAL B N     1 
ATOM   3404 C  CA    . VAL D 2 47  ? 11.289  -5.659  32.366  1.00 39.29  ? 47  VAL B CA    1 
ATOM   3405 C  C     . VAL D 2 47  ? 10.771  -5.052  31.077  1.00 38.14  ? 47  VAL B C     1 
ATOM   3406 O  O     . VAL D 2 47  ? 11.294  -5.350  30.000  1.00 34.45  ? 47  VAL B O     1 
ATOM   3407 C  CB    . VAL D 2 47  ? 10.412  -6.853  32.714  1.00 40.59  ? 47  VAL B CB    1 
ATOM   3408 C  CG1   . VAL D 2 47  ? 10.181  -7.695  31.469  1.00 41.25  ? 47  VAL B CG1   1 
ATOM   3409 C  CG2   . VAL D 2 47  ? 11.085  -7.676  33.809  1.00 40.56  ? 47  VAL B CG2   1 
ATOM   3410 N  N     . ASN D 2 48  ? 9.737   -4.220  31.168  1.00 38.35  ? 48  ASN B N     1 
ATOM   3411 C  CA    . ASN D 2 48  ? 9.218   -3.609  29.958  1.00 38.03  ? 48  ASN B CA    1 
ATOM   3412 C  C     . ASN D 2 48  ? 10.368  -2.889  29.288  1.00 38.92  ? 48  ASN B C     1 
ATOM   3413 O  O     . ASN D 2 48  ? 10.532  -2.954  28.071  1.00 38.36  ? 48  ASN B O     1 
ATOM   3414 C  CB    . ASN D 2 48  ? 8.101   -2.614  30.263  1.00 45.13  ? 48  ASN B CB    1 
ATOM   3415 C  CG    . ASN D 2 48  ? 7.812   -1.701  29.083  1.00 50.31  ? 48  ASN B CG    1 
ATOM   3416 O  OD1   . ASN D 2 48  ? 7.734   -2.155  27.940  1.00 58.82  ? 48  ASN B OD1   1 
ATOM   3417 N  ND2   . ASN D 2 48  ? 7.656   -0.413  29.351  1.00 49.67  ? 48  ASN B ND2   1 
ATOM   3418 N  N     . PHE D 2 49  ? 11.177  -2.219  30.104  1.00 40.93  ? 49  PHE B N     1 
ATOM   3419 C  CA    . PHE D 2 49  ? 12.337  -1.488  29.611  1.00 41.50  ? 49  PHE B CA    1 
ATOM   3420 C  C     . PHE D 2 49  ? 13.380  -2.402  28.945  1.00 39.17  ? 49  PHE B C     1 
ATOM   3421 O  O     . PHE D 2 49  ? 13.925  -2.065  27.892  1.00 43.31  ? 49  PHE B O     1 
ATOM   3422 C  CB    . PHE D 2 49  ? 12.965  -0.680  30.757  1.00 42.53  ? 49  PHE B CB    1 
ATOM   3423 C  CG    . PHE D 2 49  ? 14.348  -0.198  30.461  1.00 48.64  ? 49  PHE B CG    1 
ATOM   3424 C  CD1   . PHE D 2 49  ? 14.645  0.397   29.237  1.00 45.87  ? 49  PHE B CD1   1 
ATOM   3425 C  CD2   . PHE D 2 49  ? 15.376  -0.400  31.378  1.00 46.89  ? 49  PHE B CD2   1 
ATOM   3426 C  CE1   . PHE D 2 49  ? 15.951  0.770   28.927  1.00 49.34  ? 49  PHE B CE1   1 
ATOM   3427 C  CE2   . PHE D 2 49  ? 16.673  -0.030  31.081  1.00 40.58  ? 49  PHE B CE2   1 
ATOM   3428 C  CZ    . PHE D 2 49  ? 16.968  0.554   29.850  1.00 43.82  ? 49  PHE B CZ    1 
ATOM   3429 N  N     . PHE D 2 50  ? 13.654  -3.564  29.528  1.00 36.79  ? 50  PHE B N     1 
ATOM   3430 C  CA    . PHE D 2 50  ? 14.632  -4.457  28.918  1.00 37.39  ? 50  PHE B CA    1 
ATOM   3431 C  C     . PHE D 2 50  ? 14.153  -4.933  27.550  1.00 40.24  ? 50  PHE B C     1 
ATOM   3432 O  O     . PHE D 2 50  ? 14.922  -4.933  26.579  1.00 40.84  ? 50  PHE B O     1 
ATOM   3433 C  CB    . PHE D 2 50  ? 14.907  -5.676  29.807  1.00 40.44  ? 50  PHE B CB    1 
ATOM   3434 C  CG    . PHE D 2 50  ? 15.449  -5.340  31.167  1.00 42.71  ? 50  PHE B CG    1 
ATOM   3435 C  CD1   . PHE D 2 50  ? 16.201  -4.191  31.373  1.00 41.63  ? 50  PHE B CD1   1 
ATOM   3436 C  CD2   . PHE D 2 50  ? 15.200  -6.180  32.245  1.00 43.32  ? 50  PHE B CD2   1 
ATOM   3437 C  CE1   . PHE D 2 50  ? 16.687  -3.883  32.631  1.00 42.83  ? 50  PHE B CE1   1 
ATOM   3438 C  CE2   . PHE D 2 50  ? 15.687  -5.880  33.508  1.00 45.10  ? 50  PHE B CE2   1 
ATOM   3439 C  CZ    . PHE D 2 50  ? 16.428  -4.732  33.702  1.00 45.77  ? 50  PHE B CZ    1 
ATOM   3440 N  N     . ILE D 2 51  ? 12.884  -5.341  27.484  1.00 41.79  ? 51  ILE B N     1 
ATOM   3441 C  CA    . ILE D 2 51  ? 12.271  -5.835  26.250  1.00 40.16  ? 51  ILE B CA    1 
ATOM   3442 C  C     . ILE D 2 51  ? 12.302  -4.753  25.184  1.00 39.09  ? 51  ILE B C     1 
ATOM   3443 O  O     . ILE D 2 51  ? 12.754  -4.963  24.057  1.00 38.79  ? 51  ILE B O     1 
ATOM   3444 C  CB    . ILE D 2 51  ? 10.808  -6.232  26.495  1.00 44.55  ? 51  ILE B CB    1 
ATOM   3445 C  CG1   . ILE D 2 51  ? 10.742  -7.290  27.590  1.00 44.74  ? 51  ILE B CG1   1 
ATOM   3446 C  CG2   . ILE D 2 51  ? 10.182  -6.755  25.220  1.00 47.31  ? 51  ILE B CG2   1 
ATOM   3447 C  CD1   . ILE D 2 51  ? 11.339  -8.600  27.202  1.00 44.70  ? 51  ILE B CD1   1 
ATOM   3448 N  N     . VAL D 2 52  ? 11.818  -3.579  25.551  1.00 39.51  ? 52  VAL B N     1 
ATOM   3449 C  CA    . VAL D 2 52  ? 11.807  -2.477  24.617  1.00 38.60  ? 52  VAL B CA    1 
ATOM   3450 C  C     . VAL D 2 52  ? 13.216  -2.172  24.133  1.00 40.06  ? 52  VAL B C     1 
ATOM   3451 O  O     . VAL D 2 52  ? 13.430  -1.927  22.945  1.00 44.02  ? 52  VAL B O     1 
ATOM   3452 C  CB    . VAL D 2 52  ? 11.185  -1.235  25.265  1.00 40.09  ? 52  VAL B CB    1 
ATOM   3453 C  CG1   . VAL D 2 52  ? 11.444  -0.014  24.412  1.00 34.49  ? 52  VAL B CG1   1 
ATOM   3454 C  CG2   . VAL D 2 52  ? 9.667   -1.474  25.479  1.00 34.00  ? 52  VAL B CG2   1 
ATOM   3455 N  N     . ASP D 2 53  ? 14.189  -2.201  25.033  1.00 41.07  ? 53  ASP B N     1 
ATOM   3456 C  CA    . ASP D 2 53  ? 15.555  -1.909  24.616  1.00 42.83  ? 53  ASP B CA    1 
ATOM   3457 C  C     . ASP D 2 53  ? 15.963  -2.781  23.427  1.00 41.35  ? 53  ASP B C     1 
ATOM   3458 O  O     . ASP D 2 53  ? 16.475  -2.290  22.427  1.00 46.91  ? 53  ASP B O     1 
ATOM   3459 C  CB    . ASP D 2 53  ? 16.512  -2.117  25.787  1.00 50.97  ? 53  ASP B CB    1 
ATOM   3460 C  CG    . ASP D 2 53  ? 17.866  -1.469  25.555  1.00 56.39  ? 53  ASP B CG    1 
ATOM   3461 O  OD1   . ASP D 2 53  ? 18.048  -0.854  24.477  1.00 56.35  ? 53  ASP B OD1   1 
ATOM   3462 O  OD2   . ASP D 2 53  ? 18.741  -1.573  26.450  1.00 55.28  ? 53  ASP B OD2   1 
ATOM   3463 N  N     . LEU D 2 54  ? 15.707  -4.076  23.528  1.00 41.67  ? 54  LEU B N     1 
ATOM   3464 C  CA    . LEU D 2 54  ? 16.054  -5.000  22.457  1.00 45.73  ? 54  LEU B CA    1 
ATOM   3465 C  C     . LEU D 2 54  ? 15.198  -4.812  21.205  1.00 47.22  ? 54  LEU B C     1 
ATOM   3466 O  O     . LEU D 2 54  ? 15.707  -4.716  20.084  1.00 47.48  ? 54  LEU B O     1 
ATOM   3467 C  CB    . LEU D 2 54  ? 15.896  -6.441  22.944  1.00 43.27  ? 54  LEU B CB    1 
ATOM   3468 C  CG    . LEU D 2 54  ? 16.700  -6.833  24.175  1.00 45.88  ? 54  LEU B CG    1 
ATOM   3469 C  CD1   . LEU D 2 54  ? 16.287  -8.216  24.622  1.00 46.43  ? 54  LEU B CD1   1 
ATOM   3470 C  CD2   . LEU D 2 54  ? 18.193  -6.783  23.855  1.00 50.24  ? 54  LEU B CD2   1 
ATOM   3471 N  N     . LEU D 2 55  ? 13.890  -4.785  21.416  1.00 45.87  ? 55  LEU B N     1 
ATOM   3472 C  CA    . LEU D 2 55  ? 12.930  -4.649  20.336  1.00 45.43  ? 55  LEU B CA    1 
ATOM   3473 C  C     . LEU D 2 55  ? 13.353  -3.573  19.362  1.00 48.14  ? 55  LEU B C     1 
ATOM   3474 O  O     . LEU D 2 55  ? 13.327  -3.764  18.153  1.00 50.66  ? 55  LEU B O     1 
ATOM   3475 C  CB    . LEU D 2 55  ? 11.572  -4.323  20.937  1.00 46.75  ? 55  LEU B CB    1 
ATOM   3476 C  CG    . LEU D 2 55  ? 10.327  -4.396  20.073  1.00 46.94  ? 55  LEU B CG    1 
ATOM   3477 C  CD1   . LEU D 2 55  ? 10.351  -5.610  19.151  1.00 46.80  ? 55  LEU B CD1   1 
ATOM   3478 C  CD2   . LEU D 2 55  ? 9.141   -4.462  21.015  1.00 45.72  ? 55  LEU B CD2   1 
ATOM   3479 N  N     . VAL D 2 56  ? 13.775  -2.445  19.921  1.00 51.88  ? 56  VAL B N     1 
ATOM   3480 C  CA    . VAL D 2 56  ? 14.209  -1.281  19.174  1.00 45.73  ? 56  VAL B CA    1 
ATOM   3481 C  C     . VAL D 2 56  ? 15.499  -1.544  18.423  1.00 49.25  ? 56  VAL B C     1 
ATOM   3482 O  O     . VAL D 2 56  ? 15.724  -0.981  17.353  1.00 53.43  ? 56  VAL B O     1 
ATOM   3483 C  CB    . VAL D 2 56  ? 14.367  -0.084  20.146  1.00 47.21  ? 56  VAL B CB    1 
ATOM   3484 C  CG1   . VAL D 2 56  ? 15.201  1.020   19.533  1.00 46.04  ? 56  VAL B CG1   1 
ATOM   3485 C  CG2   . VAL D 2 56  ? 12.989  0.445   20.510  1.00 36.79  ? 56  VAL B CG2   1 
ATOM   3486 N  N     . GLN D 2 57  ? 16.347  -2.411  18.957  1.00 53.40  ? 57  GLN B N     1 
ATOM   3487 C  CA    . GLN D 2 57  ? 17.604  -2.698  18.280  1.00 53.98  ? 57  GLN B CA    1 
ATOM   3488 C  C     . GLN D 2 57  ? 17.470  -3.731  17.163  1.00 57.24  ? 57  GLN B C     1 
ATOM   3489 O  O     . GLN D 2 57  ? 18.055  -3.585  16.081  1.00 58.70  ? 57  GLN B O     1 
ATOM   3490 C  CB    . GLN D 2 57  ? 18.648  -3.197  19.278  1.00 53.68  ? 57  GLN B CB    1 
ATOM   3491 C  CG    . GLN D 2 57  ? 18.900  -2.287  20.464  1.00 59.54  ? 57  GLN B CG    1 
ATOM   3492 C  CD    . GLN D 2 57  ? 20.053  -2.772  21.337  1.00 59.86  ? 57  GLN B CD    1 
ATOM   3493 O  OE1   . GLN D 2 57  ? 21.206  -2.775  20.899  1.00 48.33  ? 57  GLN B OE1   1 
ATOM   3494 N  NE2   . GLN D 2 57  ? 19.964  -3.211  22.577  1.00 56.93  ? 57  GLN B NE2   1 
ATOM   3495 N  N     . TYR D 2 58  ? 16.670  -4.788  17.413  1.00 57.79  ? 58  TYR B N     1 
ATOM   3496 C  CA    . TYR D 2 58  ? 16.589  -5.878  16.454  1.00 57.82  ? 58  TYR B CA    1 
ATOM   3497 C  C     . TYR D 2 58  ? 15.342  -6.031  15.605  1.00 58.22  ? 58  TYR B C     1 
ATOM   3498 O  O     . TYR D 2 58  ? 15.386  -6.716  14.580  1.00 58.02  ? 58  TYR B O     1 
ATOM   3499 C  CB    . TYR D 2 58  ? 16.875  -7.186  17.192  1.00 56.81  ? 58  TYR B CB    1 
ATOM   3500 C  CG    . TYR D 2 58  ? 18.144  -7.041  17.966  1.00 61.63  ? 58  TYR B CG    1 
ATOM   3501 C  CD1   . TYR D 2 58  ? 19.381  -7.230  17.358  1.00 65.25  ? 58  TYR B CD1   1 
ATOM   3502 C  CD2   . TYR D 2 58  ? 18.121  -6.699  19.317  1.00 62.02  ? 58  TYR B CD2   1 
ATOM   3503 C  CE1   . TYR D 2 58  ? 20.567  -7.074  18.071  1.00 64.56  ? 58  TYR B CE1   1 
ATOM   3504 C  CE2   . TYR D 2 58  ? 19.303  -6.537  20.041  1.00 61.21  ? 58  TYR B CE2   1 
ATOM   3505 C  CZ    . TYR D 2 58  ? 20.522  -6.725  19.410  1.00 65.24  ? 58  TYR B CZ    1 
ATOM   3506 O  OH    . TYR D 2 58  ? 21.696  -6.557  20.114  1.00 66.31  ? 58  TYR B OH    1 
ATOM   3507 N  N     . SER D 2 59  ? 14.235  -5.413  16.001  1.00 58.54  ? 59  SER B N     1 
ATOM   3508 C  CA    . SER D 2 59  ? 13.048  -5.539  15.203  1.00 61.95  ? 59  SER B CA    1 
ATOM   3509 C  C     . SER D 2 59  ? 13.432  -5.336  13.727  1.00 65.09  ? 59  SER B C     1 
ATOM   3510 O  O     . SER D 2 59  ? 14.241  -4.474  13.391  1.00 65.98  ? 59  SER B O     1 
ATOM   3511 C  CB    . SER D 2 59  ? 11.955  -4.550  15.668  1.00 62.96  ? 59  SER B CB    1 
ATOM   3512 O  OG    . SER D 2 59  ? 10.908  -4.462  14.722  1.00 64.16  ? 59  SER B OG    1 
ATOM   3513 N  N     . PRO D 2 60  ? 12.820  -6.163  12.855  1.00 67.25  ? 60  PRO B N     1 
ATOM   3514 C  CA    . PRO D 2 60  ? 12.986  -5.990  11.412  1.00 69.07  ? 60  PRO B CA    1 
ATOM   3515 C  C     . PRO D 2 60  ? 12.245  -4.758  10.897  1.00 69.81  ? 60  PRO B C     1 
ATOM   3516 O  O     . PRO D 2 60  ? 12.789  -3.976  10.107  1.00 73.49  ? 60  PRO B O     1 
ATOM   3517 C  CB    . PRO D 2 60  ? 12.429  -7.296  10.848  1.00 66.30  ? 60  PRO B CB    1 
ATOM   3518 C  CG    . PRO D 2 60  ? 11.335  -7.629  11.819  1.00 65.52  ? 60  PRO B CG    1 
ATOM   3519 C  CD    . PRO D 2 60  ? 12.001  -7.356  13.148  1.00 66.41  ? 60  PRO B CD    1 
ATOM   3520 N  N     . ASN D 2 61  ? 11.005  -4.597  11.353  1.00 65.82  ? 61  ASN B N     1 
ATOM   3521 C  CA    . ASN D 2 61  ? 10.160  -3.472  10.959  1.00 62.97  ? 61  ASN B CA    1 
ATOM   3522 C  C     . ASN D 2 61  ? 10.001  -2.548  12.155  1.00 60.31  ? 61  ASN B C     1 
ATOM   3523 O  O     . ASN D 2 61  ? 9.556   -2.980  13.210  1.00 60.82  ? 61  ASN B O     1 
ATOM   3524 C  CB    . ASN D 2 61  ? 8.793   -3.994  10.511  1.00 66.13  ? 61  ASN B CB    1 
ATOM   3525 C  CG    . ASN D 2 61  ? 7.766   -2.892  10.349  1.00 72.52  ? 61  ASN B CG    1 
ATOM   3526 O  OD1   . ASN D 2 61  ? 7.415   -2.212  11.310  1.00 75.23  ? 61  ASN B OD1   1 
ATOM   3527 N  ND2   . ASN D 2 61  ? 7.273   -2.713  9.128   1.00 76.28  ? 61  ASN B ND2   1 
ATOM   3528 N  N     . LYS D 2 62  ? 10.352  -1.280  11.999  1.00 59.55  ? 62  LYS B N     1 
ATOM   3529 C  CA    . LYS D 2 62  ? 10.245  -0.349  13.114  1.00 62.32  ? 62  LYS B CA    1 
ATOM   3530 C  C     . LYS D 2 62  ? 9.076   0.636   13.044  1.00 64.04  ? 62  LYS B C     1 
ATOM   3531 O  O     . LYS D 2 62  ? 9.179   1.771   13.501  1.00 63.08  ? 62  LYS B O     1 
ATOM   3532 C  CB    . LYS D 2 62  ? 11.579  0.383   13.284  1.00 61.06  ? 62  LYS B CB    1 
ATOM   3533 C  CG    . LYS D 2 62  ? 12.689  -0.586  13.652  1.00 63.95  ? 62  LYS B CG    1 
ATOM   3534 C  CD    . LYS D 2 62  ? 14.008  0.073   13.986  1.00 62.77  ? 62  LYS B CD    1 
ATOM   3535 C  CE    . LYS D 2 62  ? 14.997  -0.999  14.423  1.00 62.14  ? 62  LYS B CE    1 
ATOM   3536 N  NZ    . LYS D 2 62  ? 16.316  -0.441  14.808  1.00 63.98  ? 62  LYS B NZ    1 
ATOM   3537 N  N     . ARG D 2 63  ? 7.958   0.179   12.484  1.00 66.09  ? 63  ARG B N     1 
ATOM   3538 C  CA    . ARG D 2 63  ? 6.750   0.994   12.360  1.00 66.53  ? 63  ARG B CA    1 
ATOM   3539 C  C     . ARG D 2 63  ? 5.967   0.931   13.668  1.00 66.44  ? 63  ARG B C     1 
ATOM   3540 O  O     . ARG D 2 63  ? 5.954   -0.105  14.332  1.00 66.35  ? 63  ARG B O     1 
ATOM   3541 C  CB    . ARG D 2 63  ? 5.863   0.473   11.218  1.00 70.59  ? 63  ARG B CB    1 
ATOM   3542 C  CG    . ARG D 2 63  ? 6.495   0.534   9.826   1.00 77.97  ? 63  ARG B CG    1 
ATOM   3543 C  CD    . ARG D 2 63  ? 5.469   0.243   8.729   1.00 81.98  ? 63  ARG B CD    1 
ATOM   3544 N  NE    . ARG D 2 63  ? 5.056   -1.158  8.702   1.00 86.71  ? 63  ARG B NE    1 
ATOM   3545 C  CZ    . ARG D 2 63  ? 3.791   -1.565  8.640   1.00 88.93  ? 63  ARG B CZ    1 
ATOM   3546 N  NH1   . ARG D 2 63  ? 2.803   -0.675  8.602   1.00 86.12  ? 63  ARG B NH1   1 
ATOM   3547 N  NH2   . ARG D 2 63  ? 3.513   -2.865  8.616   1.00 89.19  ? 63  ARG B NH2   1 
ATOM   3548 N  N     . GLU D 2 64  ? 5.316   2.033   14.036  1.00 66.68  ? 64  GLU B N     1 
ATOM   3549 C  CA    . GLU D 2 64  ? 4.529   2.094   15.272  1.00 65.18  ? 64  GLU B CA    1 
ATOM   3550 C  C     . GLU D 2 64  ? 3.496   0.978   15.308  1.00 59.51  ? 64  GLU B C     1 
ATOM   3551 O  O     . GLU D 2 64  ? 3.276   0.340   16.341  1.00 56.23  ? 64  GLU B O     1 
ATOM   3552 C  CB    . GLU D 2 64  ? 3.788   3.436   15.380  1.00 72.51  ? 64  GLU B CB    1 
ATOM   3553 C  CG    . GLU D 2 64  ? 4.622   4.623   15.857  1.00 82.75  ? 64  GLU B CG    1 
ATOM   3554 C  CD    . GLU D 2 64  ? 3.823   5.931   15.907  1.00 85.64  ? 64  GLU B CD    1 
ATOM   3555 O  OE1   . GLU D 2 64  ? 3.430   6.441   14.831  1.00 86.07  ? 64  GLU B OE1   1 
ATOM   3556 O  OE2   . GLU D 2 64  ? 3.588   6.445   17.025  1.00 83.10  ? 64  GLU B OE2   1 
ATOM   3557 N  N     . GLY D 2 65  ? 2.864   0.756   14.162  1.00 53.59  ? 65  GLY B N     1 
ATOM   3558 C  CA    . GLY D 2 65  ? 1.831   -0.254  14.063  1.00 49.70  ? 65  GLY B CA    1 
ATOM   3559 C  C     . GLY D 2 65  ? 2.310   -1.674  14.221  1.00 46.39  ? 65  GLY B C     1 
ATOM   3560 O  O     . GLY D 2 65  ? 1.511   -2.565  14.484  1.00 46.09  ? 65  GLY B O     1 
ATOM   3561 N  N     . PHE D 2 66  ? 3.607   -1.890  14.049  1.00 45.08  ? 66  PHE B N     1 
ATOM   3562 C  CA    . PHE D 2 66  ? 4.190   -3.223  14.187  1.00 45.61  ? 66  PHE B CA    1 
ATOM   3563 C  C     . PHE D 2 66  ? 4.759   -3.389  15.593  1.00 42.90  ? 66  PHE B C     1 
ATOM   3564 O  O     . PHE D 2 66  ? 4.464   -4.368  16.278  1.00 41.68  ? 66  PHE B O     1 
ATOM   3565 C  CB    . PHE D 2 66  ? 5.305   -3.422  13.154  1.00 45.03  ? 66  PHE B CB    1 
ATOM   3566 C  CG    . PHE D 2 66  ? 5.997   -4.750  13.256  1.00 51.70  ? 66  PHE B CG    1 
ATOM   3567 C  CD1   . PHE D 2 66  ? 5.314   -5.929  12.985  1.00 52.66  ? 66  PHE B CD1   1 
ATOM   3568 C  CD2   . PHE D 2 66  ? 7.345   -4.821  13.615  1.00 54.56  ? 66  PHE B CD2   1 
ATOM   3569 C  CE1   . PHE D 2 66  ? 5.961   -7.160  13.067  1.00 52.91  ? 66  PHE B CE1   1 
ATOM   3570 C  CE2   . PHE D 2 66  ? 8.003   -6.047  13.701  1.00 48.93  ? 66  PHE B CE2   1 
ATOM   3571 C  CZ    . PHE D 2 66  ? 7.311   -7.218  13.426  1.00 51.27  ? 66  PHE B CZ    1 
ATOM   3572 N  N     . LEU D 2 67  ? 5.565   -2.408  16.000  1.00 40.86  ? 67  LEU B N     1 
ATOM   3573 C  CA    . LEU D 2 67  ? 6.220   -2.359  17.303  1.00 37.23  ? 67  LEU B CA    1 
ATOM   3574 C  C     . LEU D 2 67  ? 5.307   -2.452  18.525  1.00 40.97  ? 67  LEU B C     1 
ATOM   3575 O  O     . LEU D 2 67  ? 5.641   -3.146  19.488  1.00 42.60  ? 67  LEU B O     1 
ATOM   3576 C  CB    . LEU D 2 67  ? 7.036   -1.080  17.414  1.00 39.14  ? 67  LEU B CB    1 
ATOM   3577 C  CG    . LEU D 2 67  ? 8.344   -1.049  16.632  1.00 41.76  ? 67  LEU B CG    1 
ATOM   3578 C  CD1   . LEU D 2 67  ? 9.013   0.293   16.865  1.00 40.93  ? 67  LEU B CD1   1 
ATOM   3579 C  CD2   . LEU D 2 67  ? 9.255   -2.201  17.073  1.00 38.42  ? 67  LEU B CD2   1 
ATOM   3580 N  N     . SER D 2 68  ? 4.182   -1.738  18.511  1.00 39.35  ? 68  SER B N     1 
ATOM   3581 C  CA    . SER D 2 68  ? 3.256   -1.789  19.633  1.00 42.53  ? 68  SER B CA    1 
ATOM   3582 C  C     . SER D 2 68  ? 2.674   -3.183  19.853  1.00 46.98  ? 68  SER B C     1 
ATOM   3583 O  O     . SER D 2 68  ? 2.726   -3.708  20.963  1.00 49.53  ? 68  SER B O     1 
ATOM   3584 C  CB    . SER D 2 68  ? 2.104   -0.802  19.440  1.00 44.33  ? 68  SER B CB    1 
ATOM   3585 O  OG    . SER D 2 68  ? 2.547   0.526   19.631  1.00 60.07  ? 68  SER B OG    1 
ATOM   3586 N  N     . PRO D 2 69  ? 2.103   -3.799  18.800  1.00 49.02  ? 69  PRO B N     1 
ATOM   3587 C  CA    . PRO D 2 69  ? 1.514   -5.137  18.914  1.00 46.65  ? 69  PRO B CA    1 
ATOM   3588 C  C     . PRO D 2 69  ? 2.547   -6.161  19.370  1.00 46.91  ? 69  PRO B C     1 
ATOM   3589 O  O     . PRO D 2 69  ? 2.266   -7.028  20.197  1.00 46.70  ? 69  PRO B O     1 
ATOM   3590 C  CB    . PRO D 2 69  ? 1.030   -5.421  17.495  1.00 50.98  ? 69  PRO B CB    1 
ATOM   3591 C  CG    . PRO D 2 69  ? 0.769   -4.064  16.946  1.00 54.01  ? 69  PRO B CG    1 
ATOM   3592 C  CD    . PRO D 2 69  ? 1.972   -3.302  17.422  1.00 52.11  ? 69  PRO B CD    1 
ATOM   3593 N  N     . LEU D 2 70  ? 3.749   -6.052  18.819  1.00 45.50  ? 70  LEU B N     1 
ATOM   3594 C  CA    . LEU D 2 70  ? 4.814   -6.972  19.164  1.00 46.14  ? 70  LEU B CA    1 
ATOM   3595 C  C     . LEU D 2 70  ? 5.251   -6.744  20.608  1.00 47.46  ? 70  LEU B C     1 
ATOM   3596 O  O     . LEU D 2 70  ? 5.349   -7.693  21.393  1.00 48.40  ? 70  LEU B O     1 
ATOM   3597 C  CB    . LEU D 2 70  ? 5.988   -6.799  18.190  1.00 43.87  ? 70  LEU B CB    1 
ATOM   3598 C  CG    . LEU D 2 70  ? 7.191   -7.748  18.298  1.00 46.79  ? 70  LEU B CG    1 
ATOM   3599 C  CD1   . LEU D 2 70  ? 6.788   -9.100  18.852  1.00 41.85  ? 70  LEU B CD1   1 
ATOM   3600 C  CD2   . LEU D 2 70  ? 7.800   -7.905  16.924  1.00 42.87  ? 70  LEU B CD2   1 
ATOM   3601 N  N     . LYS D 2 71  ? 5.494   -5.492  20.974  1.00 43.79  ? 71  LYS B N     1 
ATOM   3602 C  CA    . LYS D 2 71  ? 5.910   -5.215  22.338  1.00 45.33  ? 71  LYS B CA    1 
ATOM   3603 C  C     . LYS D 2 71  ? 4.868   -5.722  23.317  1.00 44.37  ? 71  LYS B C     1 
ATOM   3604 O  O     . LYS D 2 71  ? 5.211   -6.254  24.371  1.00 45.37  ? 71  LYS B O     1 
ATOM   3605 C  CB    . LYS D 2 71  ? 6.128   -3.718  22.559  1.00 44.34  ? 71  LYS B CB    1 
ATOM   3606 C  CG    . LYS D 2 71  ? 6.945   -3.422  23.813  1.00 47.79  ? 71  LYS B CG    1 
ATOM   3607 C  CD    . LYS D 2 71  ? 6.105   -3.017  25.010  1.00 44.91  ? 71  LYS B CD    1 
ATOM   3608 C  CE    . LYS D 2 71  ? 5.904   -1.503  25.058  1.00 39.56  ? 71  LYS B CE    1 
ATOM   3609 N  NZ    . LYS D 2 71  ? 5.118   -1.131  26.262  1.00 42.19  ? 71  LYS B NZ    1 
ATOM   3610 N  N     . ALA D 2 72  ? 3.594   -5.564  22.965  1.00 43.62  ? 72  ALA B N     1 
ATOM   3611 C  CA    . ALA D 2 72  ? 2.507   -6.005  23.833  1.00 40.35  ? 72  ALA B CA    1 
ATOM   3612 C  C     . ALA D 2 72  ? 2.600   -7.503  24.108  1.00 42.57  ? 72  ALA B C     1 
ATOM   3613 O  O     . ALA D 2 72  ? 2.359   -7.956  25.228  1.00 45.87  ? 72  ALA B O     1 
ATOM   3614 C  CB    . ALA D 2 72  ? 1.182   -5.670  23.214  1.00 33.93  ? 72  ALA B CB    1 
ATOM   3615 N  N     . TYR D 2 73  ? 2.966   -8.271  23.092  1.00 40.75  ? 73  TYR B N     1 
ATOM   3616 C  CA    . TYR D 2 73  ? 3.091   -9.702  23.266  1.00 42.38  ? 73  TYR B CA    1 
ATOM   3617 C  C     . TYR D 2 73  ? 4.343   -10.056 24.073  1.00 44.91  ? 73  TYR B C     1 
ATOM   3618 O  O     . TYR D 2 73  ? 4.259   -10.776 25.064  1.00 48.49  ? 73  TYR B O     1 
ATOM   3619 C  CB    . TYR D 2 73  ? 3.133   -10.388 21.909  1.00 41.72  ? 73  TYR B CB    1 
ATOM   3620 C  CG    . TYR D 2 73  ? 3.466   -11.844 22.011  1.00 45.34  ? 73  TYR B CG    1 
ATOM   3621 C  CD1   . TYR D 2 73  ? 2.611   -12.724 22.659  1.00 49.26  ? 73  TYR B CD1   1 
ATOM   3622 C  CD2   . TYR D 2 73  ? 4.672   -12.334 21.521  1.00 48.91  ? 73  TYR B CD2   1 
ATOM   3623 C  CE1   . TYR D 2 73  ? 2.950   -14.054 22.823  1.00 46.03  ? 73  TYR B CE1   1 
ATOM   3624 C  CE2   . TYR D 2 73  ? 5.019   -13.657 21.681  1.00 43.06  ? 73  TYR B CE2   1 
ATOM   3625 C  CZ    . TYR D 2 73  ? 4.151   -14.506 22.336  1.00 46.15  ? 73  TYR B CZ    1 
ATOM   3626 O  OH    . TYR D 2 73  ? 4.495   -15.815 22.515  1.00 60.83  ? 73  TYR B OH    1 
ATOM   3627 N  N     . LEU D 2 74  ? 5.498   -9.546  23.659  1.00 42.51  ? 74  LEU B N     1 
ATOM   3628 C  CA    . LEU D 2 74  ? 6.748   -9.829  24.363  1.00 45.11  ? 74  LEU B CA    1 
ATOM   3629 C  C     . LEU D 2 74  ? 6.743   -9.443  25.838  1.00 46.75  ? 74  LEU B C     1 
ATOM   3630 O  O     . LEU D 2 74  ? 7.613   -9.861  26.596  1.00 43.10  ? 74  LEU B O     1 
ATOM   3631 C  CB    . LEU D 2 74  ? 7.915   -9.106  23.694  1.00 43.80  ? 74  LEU B CB    1 
ATOM   3632 C  CG    . LEU D 2 74  ? 8.339   -9.607  22.319  1.00 47.57  ? 74  LEU B CG    1 
ATOM   3633 C  CD1   . LEU D 2 74  ? 9.457   -8.717  21.792  1.00 48.06  ? 74  LEU B CD1   1 
ATOM   3634 C  CD2   . LEU D 2 74  ? 8.792   -11.070 22.412  1.00 40.60  ? 74  LEU B CD2   1 
ATOM   3635 N  N     . ILE D 2 75  ? 5.759   -8.648  26.237  1.00 49.63  ? 75  ILE B N     1 
ATOM   3636 C  CA    . ILE D 2 75  ? 5.659   -8.165  27.614  1.00 50.28  ? 75  ILE B CA    1 
ATOM   3637 C  C     . ILE D 2 75  ? 4.479   -8.835  28.335  1.00 49.32  ? 75  ILE B C     1 
ATOM   3638 O  O     . ILE D 2 75  ? 4.261   -8.632  29.531  1.00 51.08  ? 75  ILE B O     1 
ATOM   3639 C  CB    . ILE D 2 75  ? 5.530   -6.584  27.582  1.00 50.41  ? 75  ILE B CB    1 
ATOM   3640 C  CG1   . ILE D 2 75  ? 6.797   -5.938  28.150  1.00 44.41  ? 75  ILE B CG1   1 
ATOM   3641 C  CG2   . ILE D 2 75  ? 4.264   -6.106  28.290  1.00 47.04  ? 75  ILE B CG2   1 
ATOM   3642 C  CD1   . ILE D 2 75  ? 6.839   -5.885  29.676  1.00 53.03  ? 75  ILE B CD1   1 
ATOM   3643 N  N     . SER D 2 76  ? 3.751   -9.673  27.604  1.00 47.31  ? 76  SER B N     1 
ATOM   3644 C  CA    . SER D 2 76  ? 2.580   -10.354 28.147  1.00 47.74  ? 76  SER B CA    1 
ATOM   3645 C  C     . SER D 2 76  ? 2.843   -11.565 29.040  1.00 52.04  ? 76  SER B C     1 
ATOM   3646 O  O     . SER D 2 76  ? 3.887   -12.217 28.960  1.00 55.32  ? 76  SER B O     1 
ATOM   3647 C  CB    . SER D 2 76  ? 1.672   -10.796 27.009  1.00 43.74  ? 76  SER B CB    1 
ATOM   3648 O  OG    . SER D 2 76  ? 2.294   -11.822 26.261  1.00 43.04  ? 76  SER B OG    1 
ATOM   3649 N  N     . GLU D 2 77  ? 1.863   -11.846 29.892  1.00 52.22  ? 77  GLU B N     1 
ATOM   3650 C  CA    . GLU D 2 77  ? 1.893   -12.971 30.804  1.00 54.74  ? 77  GLU B CA    1 
ATOM   3651 C  C     . GLU D 2 77  ? 2.298   -14.219 30.023  1.00 58.41  ? 77  GLU B C     1 
ATOM   3652 O  O     . GLU D 2 77  ? 3.280   -14.893 30.358  1.00 55.07  ? 77  GLU B O     1 
ATOM   3653 C  CB    . GLU D 2 77  ? 0.500   -13.151 31.383  1.00 54.21  ? 77  GLU B CB    1 
ATOM   3654 C  CG    . GLU D 2 77  ? 0.232   -14.490 31.999  1.00 57.88  ? 77  GLU B CG    1 
ATOM   3655 C  CD    . GLU D 2 77  ? -1.238  -14.679 32.314  1.00 64.31  ? 77  GLU B CD    1 
ATOM   3656 O  OE1   . GLU D 2 77  ? -1.796  -13.846 33.062  1.00 61.06  ? 77  GLU B OE1   1 
ATOM   3657 O  OE2   . GLU D 2 77  ? -1.835  -15.662 31.808  1.00 71.02  ? 77  GLU B OE2   1 
ATOM   3658 N  N     . GLU D 2 78  ? 1.529   -14.510 28.975  1.00 58.65  ? 78  GLU B N     1 
ATOM   3659 C  CA    . GLU D 2 78  ? 1.769   -15.659 28.116  1.00 57.22  ? 78  GLU B CA    1 
ATOM   3660 C  C     . GLU D 2 78  ? 3.253   -15.802 27.818  1.00 57.16  ? 78  GLU B C     1 
ATOM   3661 O  O     . GLU D 2 78  ? 3.825   -16.889 27.934  1.00 57.74  ? 78  GLU B O     1 
ATOM   3662 C  CB    . GLU D 2 78  ? 1.009   -15.499 26.802  1.00 62.30  ? 78  GLU B CB    1 
ATOM   3663 C  CG    . GLU D 2 78  ? 1.060   -16.727 25.907  1.00 72.18  ? 78  GLU B CG    1 
ATOM   3664 C  CD    . GLU D 2 78  ? 0.500   -16.464 24.518  1.00 81.11  ? 78  GLU B CD    1 
ATOM   3665 O  OE1   . GLU D 2 78  ? -0.583  -15.842 24.426  1.00 82.30  ? 78  GLU B OE1   1 
ATOM   3666 O  OE2   . GLU D 2 78  ? 1.139   -16.883 23.521  1.00 82.84  ? 78  GLU B OE2   1 
ATOM   3667 N  N     . PHE D 2 79  ? 3.878   -14.695 27.437  1.00 55.47  ? 79  PHE B N     1 
ATOM   3668 C  CA    . PHE D 2 79  ? 5.294   -14.717 27.116  1.00 53.60  ? 79  PHE B CA    1 
ATOM   3669 C  C     . PHE D 2 79  ? 6.224   -14.884 28.329  1.00 55.49  ? 79  PHE B C     1 
ATOM   3670 O  O     . PHE D 2 79  ? 7.299   -15.468 28.214  1.00 55.39  ? 79  PHE B O     1 
ATOM   3671 C  CB    . PHE D 2 79  ? 5.673   -13.455 26.359  1.00 49.97  ? 79  PHE B CB    1 
ATOM   3672 C  CG    . PHE D 2 79  ? 7.058   -13.492 25.808  1.00 47.17  ? 79  PHE B CG    1 
ATOM   3673 C  CD1   . PHE D 2 79  ? 7.392   -14.395 24.807  1.00 44.61  ? 79  PHE B CD1   1 
ATOM   3674 C  CD2   . PHE D 2 79  ? 8.036   -12.634 26.292  1.00 48.17  ? 79  PHE B CD2   1 
ATOM   3675 C  CE1   . PHE D 2 79  ? 8.674   -14.444 24.293  1.00 41.55  ? 79  PHE B CE1   1 
ATOM   3676 C  CE2   . PHE D 2 79  ? 9.328   -12.674 25.783  1.00 44.20  ? 79  PHE B CE2   1 
ATOM   3677 C  CZ    . PHE D 2 79  ? 9.647   -13.580 24.781  1.00 45.77  ? 79  PHE B CZ    1 
ATOM   3678 N  N     . PHE D 2 80  ? 5.831   -14.371 29.489  1.00 55.05  ? 80  PHE B N     1 
ATOM   3679 C  CA    . PHE D 2 80  ? 6.680   -14.527 30.667  1.00 53.78  ? 80  PHE B CA    1 
ATOM   3680 C  C     . PHE D 2 80  ? 6.615   -15.929 31.247  1.00 53.77  ? 80  PHE B C     1 
ATOM   3681 O  O     . PHE D 2 80  ? 7.518   -16.343 31.958  1.00 55.16  ? 80  PHE B O     1 
ATOM   3682 C  CB    . PHE D 2 80  ? 6.316   -13.509 31.745  1.00 52.19  ? 80  PHE B CB    1 
ATOM   3683 C  CG    . PHE D 2 80  ? 6.696   -12.115 31.392  1.00 45.34  ? 80  PHE B CG    1 
ATOM   3684 C  CD1   . PHE D 2 80  ? 7.522   -11.871 30.311  1.00 40.83  ? 80  PHE B CD1   1 
ATOM   3685 C  CD2   . PHE D 2 80  ? 6.212   -11.050 32.120  1.00 45.52  ? 80  PHE B CD2   1 
ATOM   3686 C  CE1   . PHE D 2 80  ? 7.856   -10.592 29.961  1.00 48.03  ? 80  PHE B CE1   1 
ATOM   3687 C  CE2   . PHE D 2 80  ? 6.543   -9.762  31.777  1.00 49.33  ? 80  PHE B CE2   1 
ATOM   3688 C  CZ    . PHE D 2 80  ? 7.366   -9.529  30.693  1.00 46.18  ? 80  PHE B CZ    1 
ATOM   3689 N  N     . ASN D 2 81  ? 5.536   -16.650 30.960  1.00 54.65  ? 81  ASN B N     1 
ATOM   3690 C  CA    . ASN D 2 81  ? 5.404   -18.019 31.436  1.00 55.13  ? 81  ASN B CA    1 
ATOM   3691 C  C     . ASN D 2 81  ? 6.404   -18.893 30.665  1.00 50.89  ? 81  ASN B C     1 
ATOM   3692 O  O     . ASN D 2 81  ? 6.985   -19.822 31.203  1.00 52.81  ? 81  ASN B O     1 
ATOM   3693 C  CB    . ASN D 2 81  ? 3.969   -18.519 31.213  1.00 59.41  ? 81  ASN B CB    1 
ATOM   3694 C  CG    . ASN D 2 81  ? 3.033   -18.167 32.371  1.00 63.46  ? 81  ASN B CG    1 
ATOM   3695 O  OD1   . ASN D 2 81  ? 3.149   -18.715 33.471  1.00 62.61  ? 81  ASN B OD1   1 
ATOM   3696 N  ND2   . ASN D 2 81  ? 2.099   -17.255 32.124  1.00 67.69  ? 81  ASN B ND2   1 
ATOM   3697 N  N     . LEU D 2 82  ? 6.603   -18.571 29.398  1.00 48.52  ? 82  LEU B N     1 
ATOM   3698 C  CA    . LEU D 2 82  ? 7.521   -19.306 28.555  1.00 45.63  ? 82  LEU B CA    1 
ATOM   3699 C  C     . LEU D 2 82  ? 8.954   -19.077 29.032  1.00 47.29  ? 82  LEU B C     1 
ATOM   3700 O  O     . LEU D 2 82  ? 9.753   -20.000 29.091  1.00 49.26  ? 82  LEU B O     1 
ATOM   3701 C  CB    . LEU D 2 82  ? 7.331   -18.840 27.110  1.00 45.91  ? 82  LEU B CB    1 
ATOM   3702 C  CG    . LEU D 2 82  ? 8.219   -19.325 25.966  1.00 53.51  ? 82  LEU B CG    1 
ATOM   3703 C  CD1   . LEU D 2 82  ? 9.589   -18.684 26.081  1.00 60.35  ? 82  LEU B CD1   1 
ATOM   3704 C  CD2   . LEU D 2 82  ? 8.323   -20.843 25.980  1.00 58.62  ? 82  LEU B CD2   1 
ATOM   3705 N  N     . LEU D 2 83  ? 9.280   -17.840 29.375  1.00 48.35  ? 83  LEU B N     1 
ATOM   3706 C  CA    . LEU D 2 83  ? 10.618  -17.509 29.855  1.00 48.52  ? 83  LEU B CA    1 
ATOM   3707 C  C     . LEU D 2 83  ? 10.850  -18.035 31.272  1.00 50.49  ? 83  LEU B C     1 
ATOM   3708 O  O     . LEU D 2 83  ? 11.970  -18.377 31.637  1.00 55.42  ? 83  LEU B O     1 
ATOM   3709 C  CB    . LEU D 2 83  ? 10.828  -15.992 29.877  1.00 47.86  ? 83  LEU B CB    1 
ATOM   3710 C  CG    . LEU D 2 83  ? 10.779  -15.198 28.574  1.00 47.60  ? 83  LEU B CG    1 
ATOM   3711 C  CD1   . LEU D 2 83  ? 10.965  -13.722 28.898  1.00 51.46  ? 83  LEU B CD1   1 
ATOM   3712 C  CD2   . LEU D 2 83  ? 11.858  -15.682 27.616  1.00 44.05  ? 83  LEU B CD2   1 
ATOM   3713 N  N     . ALA D 2 84  ? 9.795   -18.084 32.073  1.00 47.76  ? 84  ALA B N     1 
ATOM   3714 C  CA    . ALA D 2 84  ? 9.899   -18.538 33.453  1.00 48.03  ? 84  ALA B CA    1 
ATOM   3715 C  C     . ALA D 2 84  ? 10.053  -20.056 33.622  1.00 52.37  ? 84  ALA B C     1 
ATOM   3716 O  O     . ALA D 2 84  ? 10.343  -20.549 34.717  1.00 48.69  ? 84  ALA B O     1 
ATOM   3717 C  CB    . ALA D 2 84  ? 8.688   -18.056 34.230  1.00 50.02  ? 84  ALA B CB    1 
ATOM   3718 N  N     . GLN D 2 85  ? 9.841   -20.799 32.546  1.00 53.48  ? 85  GLN B N     1 
ATOM   3719 C  CA    . GLN D 2 85  ? 9.960   -22.239 32.622  1.00 55.72  ? 85  GLN B CA    1 
ATOM   3720 C  C     . GLN D 2 85  ? 11.377  -22.593 33.040  1.00 56.29  ? 85  GLN B C     1 
ATOM   3721 O  O     . GLN D 2 85  ? 11.586  -23.367 33.971  1.00 56.52  ? 85  GLN B O     1 
ATOM   3722 C  CB    . GLN D 2 85  ? 9.630   -22.855 31.270  1.00 57.82  ? 85  GLN B CB    1 
ATOM   3723 C  CG    . GLN D 2 85  ? 8.164   -22.768 30.937  1.00 57.75  ? 85  GLN B CG    1 
ATOM   3724 C  CD    . GLN D 2 85  ? 7.846   -23.354 29.580  1.00 66.06  ? 85  GLN B CD    1 
ATOM   3725 O  OE1   . GLN D 2 85  ? 6.678   -23.591 29.262  1.00 70.56  ? 85  GLN B OE1   1 
ATOM   3726 N  NE2   . GLN D 2 85  ? 8.880   -23.585 28.764  1.00 53.71  ? 85  GLN B NE2   1 
ATOM   3727 N  N     . LYS D 2 86  ? 12.344  -21.998 32.355  1.00 56.20  ? 86  LYS B N     1 
ATOM   3728 C  CA    . LYS D 2 86  ? 13.755  -22.226 32.638  1.00 56.61  ? 86  LYS B CA    1 
ATOM   3729 C  C     . LYS D 2 86  ? 14.090  -22.134 34.143  1.00 59.61  ? 86  LYS B C     1 
ATOM   3730 O  O     . LYS D 2 86  ? 15.104  -22.677 34.596  1.00 58.87  ? 86  LYS B O     1 
ATOM   3731 C  CB    . LYS D 2 86  ? 14.590  -21.199 31.858  1.00 53.62  ? 86  LYS B CB    1 
ATOM   3732 C  CG    . LYS D 2 86  ? 16.090  -21.419 31.945  1.00 49.62  ? 86  LYS B CG    1 
ATOM   3733 C  CD    . LYS D 2 86  ? 16.846  -20.106 31.934  1.00 47.56  ? 86  LYS B CD    1 
ATOM   3734 C  CE    . LYS D 2 86  ? 17.003  -19.517 30.546  1.00 49.22  ? 86  LYS B CE    1 
ATOM   3735 N  NZ    . LYS D 2 86  ? 18.146  -20.101 29.789  1.00 46.56  ? 86  LYS B NZ    1 
ATOM   3736 N  N     . LEU D 2 87  ? 13.234  -21.457 34.909  1.00 58.55  ? 87  LEU B N     1 
ATOM   3737 C  CA    . LEU D 2 87  ? 13.450  -21.262 36.346  1.00 57.52  ? 87  LEU B CA    1 
ATOM   3738 C  C     . LEU D 2 87  ? 12.619  -22.112 37.306  1.00 57.66  ? 87  LEU B C     1 
ATOM   3739 O  O     . LEU D 2 87  ? 12.818  -22.042 38.510  1.00 55.62  ? 87  LEU B O     1 
ATOM   3740 C  CB    . LEU D 2 87  ? 13.224  -19.800 36.700  1.00 57.95  ? 87  LEU B CB    1 
ATOM   3741 C  CG    . LEU D 2 87  ? 14.145  -18.815 35.999  1.00 62.48  ? 87  LEU B CG    1 
ATOM   3742 C  CD1   . LEU D 2 87  ? 13.663  -17.401 36.259  1.00 65.16  ? 87  LEU B CD1   1 
ATOM   3743 C  CD2   . LEU D 2 87  ? 15.569  -19.018 36.496  1.00 64.64  ? 87  LEU B CD2   1 
ATOM   3744 N  N     . GLU D 2 88  ? 11.678  -22.889 36.785  1.00 61.01  ? 88  GLU B N     1 
ATOM   3745 C  CA    . GLU D 2 88  ? 10.841  -23.742 37.630  1.00 62.87  ? 88  GLU B CA    1 
ATOM   3746 C  C     . GLU D 2 88  ? 10.309  -23.003 38.846  1.00 61.24  ? 88  GLU B C     1 
ATOM   3747 O  O     . GLU D 2 88  ? 10.478  -23.464 39.974  1.00 63.40  ? 88  GLU B O     1 
ATOM   3748 C  CB    . GLU D 2 88  ? 11.635  -24.945 38.140  1.00 64.48  ? 88  GLU B CB    1 
ATOM   3749 C  CG    . GLU D 2 88  ? 12.342  -25.768 37.092  1.00 67.84  ? 88  GLU B CG    1 
ATOM   3750 C  CD    . GLU D 2 88  ? 13.073  -26.937 37.717  1.00 72.47  ? 88  GLU B CD    1 
ATOM   3751 O  OE1   . GLU D 2 88  ? 12.397  -27.837 38.258  1.00 73.46  ? 88  GLU B OE1   1 
ATOM   3752 O  OE2   . GLU D 2 88  ? 14.321  -26.951 37.685  1.00 72.28  ? 88  GLU B OE2   1 
ATOM   3753 N  N     . LEU D 2 89  ? 9.656   -21.872 38.637  1.00 59.86  ? 89  LEU B N     1 
ATOM   3754 C  CA    . LEU D 2 89  ? 9.151   -21.118 39.770  1.00 59.43  ? 89  LEU B CA    1 
ATOM   3755 C  C     . LEU D 2 89  ? 8.098   -21.826 40.612  1.00 59.27  ? 89  LEU B C     1 
ATOM   3756 O  O     . LEU D 2 89  ? 7.957   -21.535 41.801  1.00 59.55  ? 89  LEU B O     1 
ATOM   3757 C  CB    . LEU D 2 89  ? 8.615   -19.764 39.306  1.00 64.62  ? 89  LEU B CB    1 
ATOM   3758 C  CG    . LEU D 2 89  ? 9.675   -18.744 38.881  1.00 66.52  ? 89  LEU B CG    1 
ATOM   3759 C  CD1   . LEU D 2 89  ? 8.995   -17.407 38.568  1.00 64.45  ? 89  LEU B CD1   1 
ATOM   3760 C  CD2   . LEU D 2 89  ? 10.715  -18.580 40.000  1.00 57.99  ? 89  LEU B CD2   1 
ATOM   3761 N  N     . HIS D 2 90  ? 7.365   -22.758 40.015  1.00 60.54  ? 90  HIS B N     1 
ATOM   3762 C  CA    . HIS D 2 90  ? 6.321   -23.467 40.753  1.00 63.03  ? 90  HIS B CA    1 
ATOM   3763 C  C     . HIS D 2 90  ? 6.804   -24.065 42.076  1.00 62.12  ? 90  HIS B C     1 
ATOM   3764 O  O     . HIS D 2 90  ? 6.051   -24.107 43.046  1.00 60.78  ? 90  HIS B O     1 
ATOM   3765 C  CB    . HIS D 2 90  ? 5.720   -24.572 39.887  1.00 64.78  ? 90  HIS B CB    1 
ATOM   3766 C  CG    . HIS D 2 90  ? 6.741   -25.501 39.317  1.00 68.87  ? 90  HIS B CG    1 
ATOM   3767 N  ND1   . HIS D 2 90  ? 7.691   -25.090 38.407  1.00 70.26  ? 90  HIS B ND1   1 
ATOM   3768 C  CD2   . HIS D 2 90  ? 6.986   -26.811 39.554  1.00 67.88  ? 90  HIS B CD2   1 
ATOM   3769 C  CE1   . HIS D 2 90  ? 8.479   -26.108 38.109  1.00 71.58  ? 90  HIS B CE1   1 
ATOM   3770 N  NE2   . HIS D 2 90  ? 8.074   -27.163 38.792  1.00 70.94  ? 90  HIS B NE2   1 
ATOM   3771 N  N     . LYS D 2 91  ? 8.058   -24.511 42.127  1.00 61.23  ? 91  LYS B N     1 
ATOM   3772 C  CA    . LYS D 2 91  ? 8.587   -25.116 43.352  1.00 61.27  ? 91  LYS B CA    1 
ATOM   3773 C  C     . LYS D 2 91  ? 9.188   -24.147 44.389  1.00 60.64  ? 91  LYS B C     1 
ATOM   3774 O  O     . LYS D 2 91  ? 9.621   -24.568 45.461  1.00 59.97  ? 91  LYS B O     1 
ATOM   3775 C  CB    . LYS D 2 91  ? 9.629   -26.180 42.999  1.00 60.59  ? 91  LYS B CB    1 
ATOM   3776 C  CG    . LYS D 2 91  ? 10.899  -25.628 42.395  1.00 60.53  ? 91  LYS B CG    1 
ATOM   3777 C  CD    . LYS D 2 91  ? 11.942  -26.717 42.188  1.00 58.75  ? 91  LYS B CD    1 
ATOM   3778 C  CE    . LYS D 2 91  ? 11.438  -27.798 41.256  1.00 55.43  ? 91  LYS B CE    1 
ATOM   3779 N  NZ    . LYS D 2 91  ? 12.529  -28.716 40.852  1.00 56.16  ? 91  LYS B NZ    1 
ATOM   3780 N  N     . PHE D 2 92  ? 9.215   -22.856 44.084  1.00 57.51  ? 92  PHE B N     1 
ATOM   3781 C  CA    . PHE D 2 92  ? 9.770   -21.887 45.018  1.00 50.65  ? 92  PHE B CA    1 
ATOM   3782 C  C     . PHE D 2 92  ? 8.693   -20.942 45.557  1.00 50.84  ? 92  PHE B C     1 
ATOM   3783 O  O     . PHE D 2 92  ? 8.786   -20.454 46.684  1.00 51.42  ? 92  PHE B O     1 
ATOM   3784 C  CB    . PHE D 2 92  ? 10.868  -21.086 44.331  1.00 47.88  ? 92  PHE B CB    1 
ATOM   3785 C  CG    . PHE D 2 92  ? 11.998  -21.922 43.810  1.00 48.45  ? 92  PHE B CG    1 
ATOM   3786 C  CD1   . PHE D 2 92  ? 12.848  -22.591 44.686  1.00 52.39  ? 92  PHE B CD1   1 
ATOM   3787 C  CD2   . PHE D 2 92  ? 12.232  -22.021 42.442  1.00 46.95  ? 92  PHE B CD2   1 
ATOM   3788 C  CE1   . PHE D 2 92  ? 13.924  -23.348 44.201  1.00 55.63  ? 92  PHE B CE1   1 
ATOM   3789 C  CE2   . PHE D 2 92  ? 13.301  -22.773 41.949  1.00 51.26  ? 92  PHE B CE2   1 
ATOM   3790 C  CZ    . PHE D 2 92  ? 14.149  -23.437 42.827  1.00 51.91  ? 92  PHE B CZ    1 
ATOM   3791 N  N     . ILE D 2 93  ? 7.668   -20.694 44.747  1.00 49.47  ? 93  ILE B N     1 
ATOM   3792 C  CA    . ILE D 2 93  ? 6.576   -19.804 45.127  1.00 45.83  ? 93  ILE B CA    1 
ATOM   3793 C  C     . ILE D 2 93  ? 5.908   -20.264 46.414  1.00 46.54  ? 93  ILE B C     1 
ATOM   3794 O  O     . ILE D 2 93  ? 5.750   -21.451 46.642  1.00 50.66  ? 93  ILE B O     1 
ATOM   3795 C  CB    . ILE D 2 93  ? 5.514   -19.731 43.992  1.00 43.58  ? 93  ILE B CB    1 
ATOM   3796 C  CG1   . ILE D 2 93  ? 6.145   -19.124 42.744  1.00 40.80  ? 93  ILE B CG1   1 
ATOM   3797 C  CG2   . ILE D 2 93  ? 4.314   -18.900 44.416  1.00 31.04  ? 93  ILE B CG2   1 
ATOM   3798 C  CD1   . ILE D 2 93  ? 5.262   -19.181 41.514  1.00 46.22  ? 93  ILE B CD1   1 
ATOM   3799 N  N     . ARG D 2 94  ? 5.517   -19.314 47.254  1.00 49.44  ? 94  ARG B N     1 
ATOM   3800 C  CA    . ARG D 2 94  ? 4.847   -19.629 48.511  1.00 50.52  ? 94  ARG B CA    1 
ATOM   3801 C  C     . ARG D 2 94  ? 3.399   -19.211 48.462  1.00 51.83  ? 94  ARG B C     1 
ATOM   3802 O  O     . ARG D 2 94  ? 3.107   -18.017 48.384  1.00 55.12  ? 94  ARG B O     1 
ATOM   3803 C  CB    . ARG D 2 94  ? 5.592   -18.973 49.687  1.00 45.17  ? 94  ARG B CB    1 
ATOM   3804 C  CG    . ARG D 2 94  ? 7.066   -19.362 49.733  1.00 52.48  ? 94  ARG B CG    1 
ATOM   3805 C  CD    . ARG D 2 94  ? 7.698   -19.083 51.078  1.00 59.13  ? 94  ARG B CD    1 
ATOM   3806 N  NE    . ARG D 2 94  ? 7.693   -17.664 51.419  1.00 67.90  ? 94  ARG B NE    1 
ATOM   3807 C  CZ    . ARG D 2 94  ? 7.953   -17.192 52.636  1.00 68.84  ? 94  ARG B CZ    1 
ATOM   3808 N  NH1   . ARG D 2 94  ? 8.237   -18.033 53.620  1.00 66.71  ? 94  ARG B NH1   1 
ATOM   3809 N  NH2   . ARG D 2 94  ? 7.927   -15.887 52.872  1.00 63.26  ? 94  ARG B NH2   1 
ATOM   3810 N  N     . ILE D 2 95  ? 2.470   -20.175 48.495  1.00 56.22  ? 95  ILE B N     1 
ATOM   3811 C  CA    . ILE D 2 95  ? 1.074   -19.780 48.482  1.00 60.95  ? 95  ILE B CA    1 
ATOM   3812 C  C     . ILE D 2 95  ? 0.207   -20.653 49.382  1.00 66.68  ? 95  ILE B C     1 
ATOM   3813 O  O     . ILE D 2 95  ? 0.434   -21.857 49.508  1.00 69.71  ? 95  ILE B O     1 
ATOM   3814 C  CB    . ILE D 2 95  ? 0.501   -19.800 47.070  1.00 61.64  ? 95  ILE B CB    1 
ATOM   3815 C  CG1   . ILE D 2 95  ? -0.825  -19.034 47.054  1.00 63.49  ? 95  ILE B CG1   1 
ATOM   3816 C  CG2   . ILE D 2 95  ? 0.293   -21.214 46.571  1.00 55.65  ? 95  ILE B CG2   1 
ATOM   3817 C  CD1   . ILE D 2 95  ? -1.335  -18.716 45.666  1.00 63.12  ? 95  ILE B CD1   1 
ATOM   3818 N  N     . LYS D 2 96  ? -0.789  -20.023 50.001  1.00 70.76  ? 96  LYS B N     1 
ATOM   3819 C  CA    . LYS D 2 96  ? -1.739  -20.688 50.919  1.00 73.54  ? 96  LYS B CA    1 
ATOM   3820 C  C     . LYS D 2 96  ? -3.102  -20.933 50.239  1.00 75.98  ? 96  LYS B C     1 
ATOM   3821 O  O     . LYS D 2 96  ? -3.726  -19.980 49.772  1.00 76.33  ? 96  LYS B O     1 
ATOM   3822 C  CB    . LYS D 2 96  ? -1.917  -19.828 52.172  1.00 76.43  ? 96  LYS B CB    1 
ATOM   3823 C  CG    . LYS D 2 96  ? -2.670  -20.497 53.308  1.00 77.31  ? 96  LYS B CG    1 
ATOM   3824 C  CD    . LYS D 2 96  ? -1.744  -21.332 54.186  1.00 82.11  ? 96  LYS B CD    1 
ATOM   3825 C  CE    . LYS D 2 96  ? -0.634  -20.488 54.797  1.00 83.35  ? 96  LYS B CE    1 
ATOM   3826 N  NZ    . LYS D 2 96  ? 0.255   -21.292 55.674  1.00 82.64  ? 96  LYS B NZ    1 
ATOM   3827 N  N     . ARG D 2 97  ? -3.571  -22.214 50.199  1.00 82.08  ? 97  ARG B N     1 
ATOM   3828 C  CA    . ARG D 2 97  ? -4.829  -22.692 49.563  1.00 89.28  ? 97  ARG B CA    1 
ATOM   3829 C  C     . ARG D 2 97  ? -5.073  -22.148 48.160  1.00 91.16  ? 97  ARG B C     1 
ATOM   3830 O  O     . ARG D 2 97  ? -6.198  -22.180 47.692  1.00 94.58  ? 97  ARG B O     1 
ATOM   3831 C  CB    . ARG D 2 97  ? -6.048  -22.425 50.426  1.00 93.75  ? 97  ARG B CB    1 
ATOM   3832 C  CG    . ARG D 2 97  ? -5.794  -21.559 51.634  1.00 98.80  ? 97  ARG B CG    1 
ATOM   3833 C  CD    . ARG D 2 97  ? -7.073  -20.938 52.113  1.00 103.71 ? 97  ARG B CD    1 
ATOM   3834 N  NE    . ARG D 2 97  ? -6.932  -20.353 53.433  1.00 109.68 ? 97  ARG B NE    1 
ATOM   3835 C  CZ    . ARG D 2 97  ? -6.199  -19.269 53.681  1.00 112.08 ? 97  ARG B CZ    1 
ATOM   3836 N  NH1   . ARG D 2 97  ? -5.532  -18.675 52.697  1.00 114.67 ? 97  ARG B NH1   1 
ATOM   3837 N  NH2   . ARG D 2 97  ? -6.145  -18.766 54.909  1.00 110.55 ? 97  ARG B NH2   1 
ATOM   3838 N  N     . GLY D 2 98  ? -4.058  -21.675 47.477  1.00 92.37  ? 98  GLY B N     1 
ATOM   3839 C  CA    . GLY D 2 98  ? -4.249  -21.211 46.139  1.00 88.81  ? 98  GLY B CA    1 
ATOM   3840 C  C     . GLY D 2 98  ? -3.607  -22.195 45.179  1.00 85.99  ? 98  GLY B C     1 
ATOM   3841 O  O     . GLY D 2 98  ? -2.879  -23.095 45.600  1.00 85.98  ? 98  GLY B O     1 
ATOM   3842 N  N     . LYS D 2 99  ? -3.853  -22.014 43.884  1.00 81.23  ? 99  LYS B N     1 
ATOM   3843 C  CA    . LYS D 2 99  ? -3.250  -22.889 42.886  1.00 77.12  ? 99  LYS B CA    1 
ATOM   3844 C  C     . LYS D 2 99  ? -2.342  -22.024 42.053  1.00 72.55  ? 99  LYS B C     1 
ATOM   3845 O  O     . LYS D 2 99  ? -2.786  -21.011 41.487  1.00 74.25  ? 99  LYS B O     1 
ATOM   3846 C  CB    . LYS D 2 99  ? -4.324  -23.570 42.024  1.00 80.74  ? 99  LYS B CB    1 
ATOM   3847 C  CG    . LYS D 2 99  ? -3.777  -24.368 40.840  1.00 81.90  ? 99  LYS B CG    1 
ATOM   3848 C  CD    . LYS D 2 99  ? -4.886  -24.798 39.885  1.00 80.89  ? 99  LYS B CD    1 
ATOM   3849 C  CE    . LYS D 2 99  ? -5.924  -25.656 40.585  1.00 79.94  ? 99  LYS B CE    1 
ATOM   3850 N  NZ    . LYS D 2 99  ? -7.024  -26.066 39.671  1.00 76.30  ? 99  LYS B NZ    1 
ATOM   3851 N  N     . ILE D 2 100 ? -1.072  -22.393 41.950  1.00 65.37  ? 100 ILE B N     1 
ATOM   3852 C  CA    . ILE D 2 100 ? -0.117  -21.591 41.210  1.00 62.29  ? 100 ILE B CA    1 
ATOM   3853 C  C     . ILE D 2 100 ? -0.406  -21.531 39.717  1.00 61.54  ? 100 ILE B C     1 
ATOM   3854 O  O     . ILE D 2 100 ? 0.128   -22.312 38.925  1.00 62.59  ? 100 ILE B O     1 
ATOM   3855 C  CB    . ILE D 2 100 ? 1.307   -22.091 41.454  1.00 61.85  ? 100 ILE B CB    1 
ATOM   3856 C  CG1   . ILE D 2 100 ? 1.656   -22.020 42.927  1.00 64.17  ? 100 ILE B CG1   1 
ATOM   3857 C  CG2   . ILE D 2 100 ? 2.298   -21.276 40.633  1.00 64.30  ? 100 ILE B CG2   1 
ATOM   3858 C  CD1   . ILE D 2 100 ? 3.107   -22.317 43.239  1.00 73.22  ? 100 ILE B CD1   1 
ATOM   3859 N  N     . ASN D 2 101 ? -1.275  -20.605 39.336  1.00 58.95  ? 101 ASN B N     1 
ATOM   3860 C  CA    . ASN D 2 101 ? -1.663  -20.463 37.947  1.00 57.14  ? 101 ASN B CA    1 
ATOM   3861 C  C     . ASN D 2 101 ? -0.653  -19.665 37.133  1.00 59.47  ? 101 ASN B C     1 
ATOM   3862 O  O     . ASN D 2 101 ? 0.405   -19.279 37.634  1.00 58.32  ? 101 ASN B O     1 
ATOM   3863 C  CB    . ASN D 2 101 ? -3.039  -19.817 37.874  1.00 48.28  ? 101 ASN B CB    1 
ATOM   3864 C  CG    . ASN D 2 101 ? -3.081  -18.521 38.599  1.00 52.21  ? 101 ASN B CG    1 
ATOM   3865 O  OD1   . ASN D 2 101 ? -2.359  -17.598 38.246  1.00 57.02  ? 101 ASN B OD1   1 
ATOM   3866 N  ND2   . ASN D 2 101 ? -3.908  -18.436 39.637  1.00 52.34  ? 101 ASN B ND2   1 
ATOM   3867 N  N     . GLU D 2 102 ? -0.998  -19.400 35.881  1.00 58.92  ? 102 GLU B N     1 
ATOM   3868 C  CA    . GLU D 2 102 ? -0.173  -18.663 34.943  1.00 57.34  ? 102 GLU B CA    1 
ATOM   3869 C  C     . GLU D 2 102 ? -0.166  -17.172 35.261  1.00 54.64  ? 102 GLU B C     1 
ATOM   3870 O  O     . GLU D 2 102 ? 0.665   -16.432 34.740  1.00 54.54  ? 102 GLU B O     1 
ATOM   3871 C  CB    . GLU D 2 102 ? -0.669  -18.897 33.510  1.00 65.22  ? 102 GLU B CB    1 
ATOM   3872 C  CG    . GLU D 2 102 ? -1.004  -20.364 33.161  1.00 69.96  ? 102 GLU B CG    1 
ATOM   3873 C  CD    . GLU D 2 102 ? -2.288  -20.878 33.838  1.00 71.57  ? 102 GLU B CD    1 
ATOM   3874 O  OE1   . GLU D 2 102 ? -3.341  -20.212 33.725  1.00 71.15  ? 102 GLU B OE1   1 
ATOM   3875 O  OE2   . GLU D 2 102 ? -2.249  -21.956 34.477  1.00 69.37  ? 102 GLU B OE2   1 
ATOM   3876 N  N     . THR D 2 103 ? -1.092  -16.729 36.109  1.00 50.54  ? 103 THR B N     1 
ATOM   3877 C  CA    . THR D 2 103 ? -1.153  -15.317 36.503  1.00 46.57  ? 103 THR B CA    1 
ATOM   3878 C  C     . THR D 2 103 ? -0.113  -15.094 37.578  1.00 46.39  ? 103 THR B C     1 
ATOM   3879 O  O     . THR D 2 103 ? 0.618   -14.104 37.569  1.00 46.86  ? 103 THR B O     1 
ATOM   3880 C  CB    . THR D 2 103 ? -2.497  -14.914 37.153  1.00 44.32  ? 103 THR B CB    1 
ATOM   3881 O  OG1   . THR D 2 103 ? -3.550  -14.928 36.187  1.00 39.75  ? 103 THR B OG1   1 
ATOM   3882 C  CG2   . THR D 2 103 ? -2.377  -13.531 37.754  1.00 38.49  ? 103 THR B CG2   1 
ATOM   3883 N  N     . ILE D 2 104 ? -0.083  -16.020 38.526  1.00 46.03  ? 104 ILE B N     1 
ATOM   3884 C  CA    . ILE D 2 104 ? 0.857   -15.946 39.630  1.00 49.38  ? 104 ILE B CA    1 
ATOM   3885 C  C     . ILE D 2 104 ? 2.272   -15.903 39.068  1.00 49.73  ? 104 ILE B C     1 
ATOM   3886 O  O     . ILE D 2 104 ? 3.011   -14.939 39.280  1.00 53.59  ? 104 ILE B O     1 
ATOM   3887 C  CB    . ILE D 2 104 ? 0.738   -17.172 40.564  1.00 45.11  ? 104 ILE B CB    1 
ATOM   3888 C  CG1   . ILE D 2 104 ? -0.672  -17.270 41.142  1.00 45.40  ? 104 ILE B CG1   1 
ATOM   3889 C  CG2   . ILE D 2 104 ? 1.727   -17.053 41.691  1.00 45.14  ? 104 ILE B CG2   1 
ATOM   3890 C  CD1   . ILE D 2 104 ? -1.021  -16.167 42.090  1.00 44.58  ? 104 ILE B CD1   1 
ATOM   3891 N  N     . ILE D 2 105 ? 2.624   -16.943 38.328  1.00 45.54  ? 105 ILE B N     1 
ATOM   3892 C  CA    . ILE D 2 105 ? 3.948   -17.050 37.748  1.00 47.65  ? 105 ILE B CA    1 
ATOM   3893 C  C     . ILE D 2 105 ? 4.385   -15.766 37.049  1.00 50.50  ? 105 ILE B C     1 
ATOM   3894 O  O     . ILE D 2 105 ? 5.508   -15.287 37.244  1.00 47.31  ? 105 ILE B O     1 
ATOM   3895 C  CB    . ILE D 2 105 ? 3.997   -18.229 36.772  1.00 46.67  ? 105 ILE B CB    1 
ATOM   3896 C  CG1   . ILE D 2 105 ? 3.451   -19.478 37.469  1.00 40.79  ? 105 ILE B CG1   1 
ATOM   3897 C  CG2   . ILE D 2 105 ? 5.432   -18.468 36.306  1.00 47.51  ? 105 ILE B CG2   1 
ATOM   3898 C  CD1   . ILE D 2 105 ? 3.542   -20.724 36.648  1.00 45.10  ? 105 ILE B CD1   1 
ATOM   3899 N  N     . GLY D 2 106 ? 3.493   -15.210 36.236  1.00 51.18  ? 106 GLY B N     1 
ATOM   3900 C  CA    . GLY D 2 106 ? 3.808   -13.977 35.541  1.00 51.12  ? 106 GLY B CA    1 
ATOM   3901 C  C     . GLY D 2 106 ? 4.186   -12.880 36.522  1.00 49.03  ? 106 GLY B C     1 
ATOM   3902 O  O     . GLY D 2 106 ? 5.137   -12.140 36.291  1.00 50.40  ? 106 GLY B O     1 
ATOM   3903 N  N     . ASP D 2 107 ? 3.458   -12.791 37.631  1.00 47.79  ? 107 ASP B N     1 
ATOM   3904 C  CA    . ASP D 2 107 ? 3.734   -11.776 38.640  1.00 49.04  ? 107 ASP B CA    1 
ATOM   3905 C  C     . ASP D 2 107 ? 5.021   -11.994 39.441  1.00 47.92  ? 107 ASP B C     1 
ATOM   3906 O  O     . ASP D 2 107 ? 5.732   -11.036 39.750  1.00 45.58  ? 107 ASP B O     1 
ATOM   3907 C  CB    . ASP D 2 107 ? 2.533   -11.627 39.581  1.00 49.66  ? 107 ASP B CB    1 
ATOM   3908 C  CG    . ASP D 2 107 ? 1.368   -10.893 38.915  1.00 56.53  ? 107 ASP B CG    1 
ATOM   3909 O  OD1   . ASP D 2 107 ? 1.619   -9.886  38.225  1.00 51.65  ? 107 ASP B OD1   1 
ATOM   3910 O  OD2   . ASP D 2 107 ? 0.203   -11.312 39.073  1.00 63.86  ? 107 ASP B OD2   1 
ATOM   3911 N  N     . VAL D 2 108 ? 5.326   -13.242 39.774  1.00 41.41  ? 108 VAL B N     1 
ATOM   3912 C  CA    . VAL D 2 108 ? 6.534   -13.531 40.520  1.00 38.30  ? 108 VAL B CA    1 
ATOM   3913 C  C     . VAL D 2 108 ? 7.729   -13.304 39.601  1.00 43.26  ? 108 VAL B C     1 
ATOM   3914 O  O     . VAL D 2 108 ? 8.792   -12.828 40.032  1.00 44.03  ? 108 VAL B O     1 
ATOM   3915 C  CB    . VAL D 2 108 ? 6.549   -14.987 41.042  1.00 38.12  ? 108 VAL B CB    1 
ATOM   3916 C  CG1   . VAL D 2 108 ? 7.963   -15.409 41.375  1.00 38.81  ? 108 VAL B CG1   1 
ATOM   3917 C  CG2   . VAL D 2 108 ? 5.687   -15.106 42.286  1.00 35.50  ? 108 VAL B CG2   1 
ATOM   3918 N  N     . PHE D 2 109 ? 7.550   -13.626 38.325  1.00 41.28  ? 109 PHE B N     1 
ATOM   3919 C  CA    . PHE D 2 109 ? 8.627   -13.448 37.358  1.00 40.78  ? 109 PHE B CA    1 
ATOM   3920 C  C     . PHE D 2 109 ? 9.067   -11.993 37.395  1.00 44.45  ? 109 PHE B C     1 
ATOM   3921 O  O     . PHE D 2 109 ? 10.232  -11.690 37.589  1.00 44.24  ? 109 PHE B O     1 
ATOM   3922 C  CB    . PHE D 2 109 ? 8.127   -13.791 35.964  1.00 37.28  ? 109 PHE B CB    1 
ATOM   3923 C  CG    . PHE D 2 109 ? 9.158   -13.627 34.900  1.00 39.42  ? 109 PHE B CG    1 
ATOM   3924 C  CD1   . PHE D 2 109 ? 10.252  -14.486 34.840  1.00 36.91  ? 109 PHE B CD1   1 
ATOM   3925 C  CD2   . PHE D 2 109 ? 9.048   -12.597 33.961  1.00 31.89  ? 109 PHE B CD2   1 
ATOM   3926 C  CE1   . PHE D 2 109 ? 11.232  -14.322 33.857  1.00 36.95  ? 109 PHE B CE1   1 
ATOM   3927 C  CE2   . PHE D 2 109 ? 10.008  -12.420 32.982  1.00 33.28  ? 109 PHE B CE2   1 
ATOM   3928 C  CZ    . PHE D 2 109 ? 11.111  -13.285 32.924  1.00 39.36  ? 109 PHE B CZ    1 
ATOM   3929 N  N     . GLU D 2 110 ? 8.105   -11.096 37.215  1.00 46.06  ? 110 GLU B N     1 
ATOM   3930 C  CA    . GLU D 2 110 ? 8.365   -9.668  37.220  1.00 49.09  ? 110 GLU B CA    1 
ATOM   3931 C  C     . GLU D 2 110 ? 8.922   -9.234  38.574  1.00 51.26  ? 110 GLU B C     1 
ATOM   3932 O  O     . GLU D 2 110 ? 9.911   -8.503  38.645  1.00 50.04  ? 110 GLU B O     1 
ATOM   3933 C  CB    . GLU D 2 110 ? 7.067   -8.914  36.918  1.00 49.44  ? 110 GLU B CB    1 
ATOM   3934 C  CG    . GLU D 2 110 ? 6.357   -9.443  35.681  1.00 48.68  ? 110 GLU B CG    1 
ATOM   3935 C  CD    . GLU D 2 110 ? 5.016   -8.803  35.446  1.00 43.91  ? 110 GLU B CD    1 
ATOM   3936 O  OE1   . GLU D 2 110 ? 4.152   -8.905  36.337  1.00 41.00  ? 110 GLU B OE1   1 
ATOM   3937 O  OE2   . GLU D 2 110 ? 4.826   -8.202  34.367  1.00 45.50  ? 110 GLU B OE2   1 
ATOM   3938 N  N     . ALA D 2 111 ? 8.286   -9.688  39.647  1.00 47.90  ? 111 ALA B N     1 
ATOM   3939 C  CA    . ALA D 2 111 ? 8.728   -9.334  40.985  1.00 48.08  ? 111 ALA B CA    1 
ATOM   3940 C  C     . ALA D 2 111 ? 10.155  -9.795  41.235  1.00 52.22  ? 111 ALA B C     1 
ATOM   3941 O  O     . ALA D 2 111 ? 10.928  -9.131  41.928  1.00 49.48  ? 111 ALA B O     1 
ATOM   3942 C  CB    . ALA D 2 111 ? 7.817   -9.954  42.000  1.00 53.99  ? 111 ALA B CB    1 
ATOM   3943 N  N     . LEU D 2 112 ? 10.501  -10.944 40.672  1.00 52.92  ? 112 LEU B N     1 
ATOM   3944 C  CA    . LEU D 2 112 ? 11.837  -11.477 40.856  1.00 50.91  ? 112 LEU B CA    1 
ATOM   3945 C  C     . LEU D 2 112 ? 12.905  -10.535 40.334  1.00 48.92  ? 112 LEU B C     1 
ATOM   3946 O  O     . LEU D 2 112 ? 13.958  -10.376 40.953  1.00 46.20  ? 112 LEU B O     1 
ATOM   3947 C  CB    . LEU D 2 112 ? 11.929  -12.830 40.203  1.00 49.97  ? 112 LEU B CB    1 
ATOM   3948 C  CG    . LEU D 2 112 ? 12.148  -13.874 41.254  1.00 53.78  ? 112 LEU B CG    1 
ATOM   3949 C  CD1   . LEU D 2 112 ? 12.135  -15.286 40.666  1.00 63.36  ? 112 LEU B CD1   1 
ATOM   3950 C  CD2   . LEU D 2 112 ? 13.464  -13.622 41.987  1.00 56.11  ? 112 LEU B CD2   1 
ATOM   3951 N  N     . TRP D 2 113 ? 12.630  -9.913  39.192  1.00 45.23  ? 113 TRP B N     1 
ATOM   3952 C  CA    . TRP D 2 113 ? 13.580  -8.954  38.614  1.00 46.87  ? 113 TRP B CA    1 
ATOM   3953 C  C     . TRP D 2 113 ? 13.667  -7.671  39.379  1.00 44.87  ? 113 TRP B C     1 
ATOM   3954 O  O     . TRP D 2 113 ? 14.710  -7.039  39.396  1.00 43.76  ? 113 TRP B O     1 
ATOM   3955 C  CB    . TRP D 2 113 ? 13.243  -8.707  37.163  1.00 45.37  ? 113 TRP B CB    1 
ATOM   3956 C  CG    . TRP D 2 113 ? 13.580  -9.980  36.456  1.00 50.66  ? 113 TRP B CG    1 
ATOM   3957 C  CD1   . TRP D 2 113 ? 12.702  -10.911 35.979  1.00 59.91  ? 113 TRP B CD1   1 
ATOM   3958 C  CD2   . TRP D 2 113 ? 14.887  -10.497 36.199  1.00 55.24  ? 113 TRP B CD2   1 
ATOM   3959 N  NE1   . TRP D 2 113 ? 13.384  -11.985 35.456  1.00 55.19  ? 113 TRP B NE1   1 
ATOM   3960 C  CE2   . TRP D 2 113 ? 14.727  -11.757 35.581  1.00 56.40  ? 113 TRP B CE2   1 
ATOM   3961 C  CE3   . TRP D 2 113 ? 16.182  -10.021 36.440  1.00 54.86  ? 113 TRP B CE3   1 
ATOM   3962 C  CZ2   . TRP D 2 113 ? 15.816  -12.550 35.204  1.00 56.80  ? 113 TRP B CZ2   1 
ATOM   3963 C  CZ3   . TRP D 2 113 ? 17.266  -10.809 36.062  1.00 57.00  ? 113 TRP B CZ3   1 
ATOM   3964 C  CH2   . TRP D 2 113 ? 17.073  -12.060 35.452  1.00 58.14  ? 113 TRP B CH2   1 
ATOM   3965 N  N     . ALA D 2 114 ? 12.583  -7.257  39.989  1.00 44.31  ? 114 ALA B N     1 
ATOM   3966 C  CA    . ALA D 2 114 ? 12.636  -6.028  40.795  1.00 45.98  ? 114 ALA B CA    1 
ATOM   3967 C  C     . ALA D 2 114 ? 13.535  -6.349  41.986  1.00 46.22  ? 114 ALA B C     1 
ATOM   3968 O  O     . ALA D 2 114 ? 14.387  -5.545  42.386  1.00 42.92  ? 114 ALA B O     1 
ATOM   3969 C  CB    . ALA D 2 114 ? 11.243  -5.602  41.242  1.00 39.08  ? 114 ALA B CB    1 
ATOM   3970 N  N     . ALA D 2 115 ? 13.333  -7.552  42.524  1.00 45.08  ? 115 ALA B N     1 
ATOM   3971 C  CA    . ALA D 2 115 ? 14.068  -8.060  43.677  1.00 42.05  ? 115 ALA B CA    1 
ATOM   3972 C  C     . ALA D 2 115 ? 15.570  -8.066  43.464  1.00 42.75  ? 115 ALA B C     1 
ATOM   3973 O  O     . ALA D 2 115 ? 16.314  -7.687  44.348  1.00 46.25  ? 115 ALA B O     1 
ATOM   3974 C  CB    . ALA D 2 115 ? 13.597  -9.453  44.007  1.00 45.45  ? 115 ALA B CB    1 
ATOM   3975 N  N     . VAL D 2 116 ? 16.019  -8.505  42.297  1.00 42.28  ? 116 VAL B N     1 
ATOM   3976 C  CA    . VAL D 2 116 ? 17.445  -8.531  42.011  1.00 45.58  ? 116 VAL B CA    1 
ATOM   3977 C  C     . VAL D 2 116 ? 17.993  -7.104  41.809  1.00 48.25  ? 116 VAL B C     1 
ATOM   3978 O  O     . VAL D 2 116 ? 19.142  -6.814  42.153  1.00 51.61  ? 116 VAL B O     1 
ATOM   3979 C  CB    . VAL D 2 116 ? 17.751  -9.383  40.742  1.00 49.30  ? 116 VAL B CB    1 
ATOM   3980 C  CG1   . VAL D 2 116 ? 19.222  -9.267  40.379  1.00 54.67  ? 116 VAL B CG1   1 
ATOM   3981 C  CG2   . VAL D 2 116 ? 17.398  -10.843 40.981  1.00 44.99  ? 116 VAL B CG2   1 
ATOM   3982 N  N     . TYR D 2 117 ? 17.171  -6.223  41.246  1.00 46.78  ? 117 TYR B N     1 
ATOM   3983 C  CA    . TYR D 2 117 ? 17.556  -4.838  40.997  1.00 44.28  ? 117 TYR B CA    1 
ATOM   3984 C  C     . TYR D 2 117 ? 17.865  -4.166  42.323  1.00 43.97  ? 117 TYR B C     1 
ATOM   3985 O  O     . TYR D 2 117 ? 18.954  -3.640  42.538  1.00 44.48  ? 117 TYR B O     1 
ATOM   3986 C  CB    . TYR D 2 117 ? 16.408  -4.108  40.310  1.00 50.59  ? 117 TYR B CB    1 
ATOM   3987 C  CG    . TYR D 2 117 ? 16.544  -2.610  40.268  1.00 47.61  ? 117 TYR B CG    1 
ATOM   3988 C  CD1   . TYR D 2 117 ? 17.563  -2.005  39.536  1.00 46.12  ? 117 TYR B CD1   1 
ATOM   3989 C  CD2   . TYR D 2 117 ? 15.624  -1.792  40.926  1.00 43.98  ? 117 TYR B CD2   1 
ATOM   3990 C  CE1   . TYR D 2 117 ? 17.661  -0.619  39.450  1.00 44.71  ? 117 TYR B CE1   1 
ATOM   3991 C  CE2   . TYR D 2 117 ? 15.714  -0.407  40.849  1.00 45.08  ? 117 TYR B CE2   1 
ATOM   3992 C  CZ    . TYR D 2 117 ? 16.736  0.172   40.107  1.00 43.74  ? 117 TYR B CZ    1 
ATOM   3993 O  OH    . TYR D 2 117 ? 16.834  1.535   40.017  1.00 42.41  ? 117 TYR B OH    1 
ATOM   3994 N  N     . ILE D 2 118 ? 16.888  -4.196  43.212  1.00 41.86  ? 118 ILE B N     1 
ATOM   3995 C  CA    . ILE D 2 118 ? 17.025  -3.603  44.532  1.00 45.21  ? 118 ILE B CA    1 
ATOM   3996 C  C     . ILE D 2 118 ? 18.223  -4.182  45.296  1.00 49.00  ? 118 ILE B C     1 
ATOM   3997 O  O     . ILE D 2 118 ? 19.078  -3.446  45.806  1.00 45.11  ? 118 ILE B O     1 
ATOM   3998 C  CB    . ILE D 2 118 ? 15.743  -3.847  45.347  1.00 42.32  ? 118 ILE B CB    1 
ATOM   3999 C  CG1   . ILE D 2 118 ? 14.557  -3.169  44.652  1.00 40.66  ? 118 ILE B CG1   1 
ATOM   4000 C  CG2   . ILE D 2 118 ? 15.921  -3.340  46.747  1.00 39.13  ? 118 ILE B CG2   1 
ATOM   4001 C  CD1   . ILE D 2 118 ? 13.232  -3.392  45.337  1.00 33.16  ? 118 ILE B CD1   1 
ATOM   4002 N  N     . ASP D 2 119 ? 18.268  -5.511  45.354  1.00 48.04  ? 119 ASP B N     1 
ATOM   4003 C  CA    . ASP D 2 119 ? 19.311  -6.243  46.051  1.00 48.71  ? 119 ASP B CA    1 
ATOM   4004 C  C     . ASP D 2 119 ? 20.702  -5.915  45.544  1.00 50.45  ? 119 ASP B C     1 
ATOM   4005 O  O     . ASP D 2 119 ? 21.681  -5.953  46.296  1.00 48.25  ? 119 ASP B O     1 
ATOM   4006 C  CB    . ASP D 2 119 ? 19.082  -7.738  45.907  1.00 51.62  ? 119 ASP B CB    1 
ATOM   4007 C  CG    . ASP D 2 119 ? 19.930  -8.531  46.850  1.00 59.69  ? 119 ASP B CG    1 
ATOM   4008 O  OD1   . ASP D 2 119 ? 19.701  -8.405  48.075  1.00 62.19  ? 119 ASP B OD1   1 
ATOM   4009 O  OD2   . ASP D 2 119 ? 20.828  -9.264  46.373  1.00 64.16  ? 119 ASP B OD2   1 
ATOM   4010 N  N     . SER D 2 120 ? 20.794  -5.609  44.258  1.00 50.32  ? 120 SER B N     1 
ATOM   4011 C  CA    . SER D 2 120 ? 22.076  -5.271  43.664  1.00 47.17  ? 120 SER B CA    1 
ATOM   4012 C  C     . SER D 2 120 ? 22.372  -3.793  43.887  1.00 48.58  ? 120 SER B C     1 
ATOM   4013 O  O     . SER D 2 120 ? 23.189  -3.205  43.180  1.00 46.92  ? 120 SER B O     1 
ATOM   4014 C  CB    . SER D 2 120 ? 22.046  -5.578  42.176  1.00 46.79  ? 120 SER B CB    1 
ATOM   4015 O  OG    . SER D 2 120 ? 20.952  -4.921  41.572  1.00 54.02  ? 120 SER B OG    1 
ATOM   4016 N  N     . GLY D 2 121 ? 21.694  -3.204  44.873  1.00 50.58  ? 121 GLY B N     1 
ATOM   4017 C  CA    . GLY D 2 121 ? 21.875  -1.797  45.191  1.00 52.09  ? 121 GLY B CA    1 
ATOM   4018 C  C     . GLY D 2 121 ? 21.281  -0.859  44.155  1.00 53.11  ? 121 GLY B C     1 
ATOM   4019 O  O     . GLY D 2 121 ? 21.739  0.276   44.016  1.00 52.84  ? 121 GLY B O     1 
ATOM   4020 N  N     . ARG D 2 122 ? 20.250  -1.334  43.451  1.00 53.04  ? 122 ARG B N     1 
ATOM   4021 C  CA    . ARG D 2 122 ? 19.562  -0.597  42.385  1.00 48.51  ? 122 ARG B CA    1 
ATOM   4022 C  C     . ARG D 2 122 ? 20.463  -0.360  41.180  1.00 48.54  ? 122 ARG B C     1 
ATOM   4023 O  O     . ARG D 2 122 ? 20.549  0.747   40.663  1.00 46.58  ? 122 ARG B O     1 
ATOM   4024 C  CB    . ARG D 2 122 ? 19.013  0.734   42.887  1.00 44.53  ? 122 ARG B CB    1 
ATOM   4025 C  CG    . ARG D 2 122 ? 17.889  0.563   43.876  1.00 55.66  ? 122 ARG B CG    1 
ATOM   4026 C  CD    . ARG D 2 122 ? 16.833  1.647   43.706  1.00 58.91  ? 122 ARG B CD    1 
ATOM   4027 N  NE    . ARG D 2 122 ? 15.532  1.222   44.221  1.00 58.90  ? 122 ARG B NE    1 
ATOM   4028 C  CZ    . ARG D 2 122 ? 15.251  1.061   45.508  1.00 61.32  ? 122 ARG B CZ    1 
ATOM   4029 N  NH1   . ARG D 2 122 ? 16.185  1.295   46.423  1.00 59.00  ? 122 ARG B NH1   1 
ATOM   4030 N  NH2   . ARG D 2 122 ? 14.038  0.656   45.877  1.00 62.74  ? 122 ARG B NH2   1 
ATOM   4031 N  N     . ASP D 2 123 ? 21.121  -1.428  40.742  1.00 50.91  ? 123 ASP B N     1 
ATOM   4032 C  CA    . ASP D 2 123 ? 22.026  -1.395  39.600  1.00 52.09  ? 123 ASP B CA    1 
ATOM   4033 C  C     . ASP D 2 123 ? 21.241  -1.874  38.377  1.00 51.80  ? 123 ASP B C     1 
ATOM   4034 O  O     . ASP D 2 123 ? 20.993  -3.065  38.222  1.00 53.54  ? 123 ASP B O     1 
ATOM   4035 C  CB    . ASP D 2 123 ? 23.205  -2.329  39.870  1.00 49.73  ? 123 ASP B CB    1 
ATOM   4036 C  CG    . ASP D 2 123 ? 24.298  -2.199  38.848  1.00 52.93  ? 123 ASP B CG    1 
ATOM   4037 O  OD1   . ASP D 2 123 ? 24.004  -2.143  37.634  1.00 55.31  ? 123 ASP B OD1   1 
ATOM   4038 O  OD2   . ASP D 2 123 ? 25.470  -2.170  39.262  1.00 58.97  ? 123 ASP B OD2   1 
ATOM   4039 N  N     . ALA D 2 124 ? 20.868  -0.941  37.510  1.00 50.32  ? 124 ALA B N     1 
ATOM   4040 C  CA    . ALA D 2 124 ? 20.090  -1.245  36.321  1.00 51.33  ? 124 ALA B CA    1 
ATOM   4041 C  C     . ALA D 2 124 ? 20.833  -1.969  35.191  1.00 52.59  ? 124 ALA B C     1 
ATOM   4042 O  O     . ALA D 2 124 ? 20.241  -2.792  34.489  1.00 55.65  ? 124 ALA B O     1 
ATOM   4043 C  CB    . ALA D 2 124 ? 19.458  0.045   35.796  1.00 50.63  ? 124 ALA B CB    1 
ATOM   4044 N  N     . ASN D 2 125 ? 22.110  -1.658  34.996  1.00 53.47  ? 125 ASN B N     1 
ATOM   4045 C  CA    . ASN D 2 125 ? 22.899  -2.309  33.942  1.00 56.60  ? 125 ASN B CA    1 
ATOM   4046 C  C     . ASN D 2 125 ? 23.150  -3.788  34.260  1.00 54.99  ? 125 ASN B C     1 
ATOM   4047 O  O     . ASN D 2 125 ? 22.997  -4.672  33.405  1.00 50.45  ? 125 ASN B O     1 
ATOM   4048 C  CB    . ASN D 2 125 ? 24.258  -1.625  33.775  1.00 60.54  ? 125 ASN B CB    1 
ATOM   4049 C  CG    . ASN D 2 125 ? 24.138  -0.150  33.474  1.00 65.22  ? 125 ASN B CG    1 
ATOM   4050 O  OD1   . ASN D 2 125 ? 23.322  0.262   32.649  1.00 64.56  ? 125 ASN B OD1   1 
ATOM   4051 N  ND2   . ASN D 2 125 ? 24.969  0.659   34.131  1.00 65.07  ? 125 ASN B ND2   1 
ATOM   4052 N  N     . PHE D 2 126 ? 23.558  -4.034  35.499  1.00 52.60  ? 126 PHE B N     1 
ATOM   4053 C  CA    . PHE D 2 126 ? 23.844  -5.372  35.968  1.00 48.82  ? 126 PHE B CA    1 
ATOM   4054 C  C     . PHE D 2 126 ? 22.607  -6.250  35.809  1.00 48.70  ? 126 PHE B C     1 
ATOM   4055 O  O     . PHE D 2 126 ? 22.681  -7.360  35.290  1.00 49.36  ? 126 PHE B O     1 
ATOM   4056 C  CB    . PHE D 2 126 ? 24.245  -5.304  37.435  1.00 49.13  ? 126 PHE B CB    1 
ATOM   4057 C  CG    . PHE D 2 126 ? 24.553  -6.634  38.038  1.00 51.21  ? 126 PHE B CG    1 
ATOM   4058 C  CD1   . PHE D 2 126 ? 25.727  -7.304  37.715  1.00 57.33  ? 126 PHE B CD1   1 
ATOM   4059 C  CD2   . PHE D 2 126 ? 23.674  -7.223  38.935  1.00 52.29  ? 126 PHE B CD2   1 
ATOM   4060 C  CE1   . PHE D 2 126 ? 26.021  -8.549  38.284  1.00 56.88  ? 126 PHE B CE1   1 
ATOM   4061 C  CE2   . PHE D 2 126 ? 23.960  -8.465  39.508  1.00 53.83  ? 126 PHE B CE2   1 
ATOM   4062 C  CZ    . PHE D 2 126 ? 25.133  -9.125  39.182  1.00 52.91  ? 126 PHE B CZ    1 
ATOM   4063 N  N     . THR D 2 127 ? 21.467  -5.743  36.259  1.00 47.37  ? 127 THR B N     1 
ATOM   4064 C  CA    . THR D 2 127 ? 20.225  -6.490  36.178  1.00 46.25  ? 127 THR B CA    1 
ATOM   4065 C  C     . THR D 2 127 ? 19.809  -6.685  34.726  1.00 44.61  ? 127 THR B C     1 
ATOM   4066 O  O     . THR D 2 127 ? 19.276  -7.729  34.352  1.00 39.13  ? 127 THR B O     1 
ATOM   4067 C  CB    . THR D 2 127 ? 19.113  -5.786  36.966  1.00 48.33  ? 127 THR B CB    1 
ATOM   4068 O  OG1   . THR D 2 127 ? 19.537  -5.600  38.323  1.00 50.85  ? 127 THR B OG1   1 
ATOM   4069 C  CG2   . THR D 2 127 ? 17.863  -6.623  36.972  1.00 49.37  ? 127 THR B CG2   1 
ATOM   4070 N  N     . ARG D 2 128 ? 20.063  -5.684  33.900  1.00 44.13  ? 128 ARG B N     1 
ATOM   4071 C  CA    . ARG D 2 128 ? 19.731  -5.802  32.494  1.00 46.46  ? 128 ARG B CA    1 
ATOM   4072 C  C     . ARG D 2 128 ? 20.617  -6.903  31.901  1.00 48.19  ? 128 ARG B C     1 
ATOM   4073 O  O     . ARG D 2 128 ? 20.196  -7.627  30.989  1.00 47.47  ? 128 ARG B O     1 
ATOM   4074 C  CB    . ARG D 2 128 ? 19.968  -4.467  31.785  1.00 48.25  ? 128 ARG B CB    1 
ATOM   4075 C  CG    . ARG D 2 128 ? 19.842  -4.527  30.277  1.00 46.10  ? 128 ARG B CG    1 
ATOM   4076 C  CD    . ARG D 2 128 ? 19.687  -3.135  29.679  1.00 55.81  ? 128 ARG B CD    1 
ATOM   4077 N  NE    . ARG D 2 128 ? 20.747  -2.817  28.737  1.00 56.98  ? 128 ARG B NE    1 
ATOM   4078 C  CZ    . ARG D 2 128 ? 22.004  -2.585  29.087  1.00 62.53  ? 128 ARG B CZ    1 
ATOM   4079 N  NH1   . ARG D 2 128 ? 22.355  -2.631  30.362  1.00 63.13  ? 128 ARG B NH1   1 
ATOM   4080 N  NH2   . ARG D 2 128 ? 22.916  -2.326  28.159  1.00 69.88  ? 128 ARG B NH2   1 
ATOM   4081 N  N     . GLU D 2 129 ? 21.836  -7.031  32.432  1.00 47.94  ? 129 GLU B N     1 
ATOM   4082 C  CA    . GLU D 2 129 ? 22.784  -8.057  31.983  1.00 46.86  ? 129 GLU B CA    1 
ATOM   4083 C  C     . GLU D 2 129 ? 22.363  -9.470  32.416  1.00 45.87  ? 129 GLU B C     1 
ATOM   4084 O  O     . GLU D 2 129 ? 22.426  -10.413 31.631  1.00 51.19  ? 129 GLU B O     1 
ATOM   4085 C  CB    . GLU D 2 129 ? 24.180  -7.762  32.518  1.00 51.86  ? 129 GLU B CB    1 
ATOM   4086 C  CG    . GLU D 2 129 ? 25.161  -7.285  31.467  1.00 62.78  ? 129 GLU B CG    1 
ATOM   4087 C  CD    . GLU D 2 129 ? 26.591  -7.230  31.994  1.00 75.13  ? 129 GLU B CD    1 
ATOM   4088 O  OE1   . GLU D 2 129 ? 26.847  -6.436  32.929  1.00 79.63  ? 129 GLU B OE1   1 
ATOM   4089 O  OE2   . GLU D 2 129 ? 27.456  -7.982  31.477  1.00 74.83  ? 129 GLU B OE2   1 
ATOM   4090 N  N     . LEU D 2 130 ? 21.952  -9.629  33.666  1.00 44.71  ? 130 LEU B N     1 
ATOM   4091 C  CA    . LEU D 2 130 ? 21.495  -10.930 34.125  1.00 45.75  ? 130 LEU B CA    1 
ATOM   4092 C  C     . LEU D 2 130 ? 20.341  -11.400 33.245  1.00 46.87  ? 130 LEU B C     1 
ATOM   4093 O  O     . LEU D 2 130 ? 20.289  -12.557 32.835  1.00 49.36  ? 130 LEU B O     1 
ATOM   4094 C  CB    . LEU D 2 130 ? 20.978  -10.853 35.560  1.00 47.46  ? 130 LEU B CB    1 
ATOM   4095 C  CG    . LEU D 2 130 ? 21.847  -11.207 36.771  1.00 50.12  ? 130 LEU B CG    1 
ATOM   4096 C  CD1   . LEU D 2 130 ? 20.909  -11.494 37.921  1.00 40.69  ? 130 LEU B CD1   1 
ATOM   4097 C  CD2   . LEU D 2 130 ? 22.713  -12.438 36.508  1.00 49.50  ? 130 LEU B CD2   1 
ATOM   4098 N  N     . PHE D 2 131 ? 19.407  -10.491 32.979  1.00 46.25  ? 131 PHE B N     1 
ATOM   4099 C  CA    . PHE D 2 131 ? 18.229  -10.791 32.172  1.00 47.75  ? 131 PHE B CA    1 
ATOM   4100 C  C     . PHE D 2 131 ? 18.578  -11.201 30.740  1.00 51.19  ? 131 PHE B C     1 
ATOM   4101 O  O     . PHE D 2 131 ? 18.061  -12.193 30.217  1.00 54.18  ? 131 PHE B O     1 
ATOM   4102 C  CB    . PHE D 2 131 ? 17.303  -9.576  32.174  1.00 51.05  ? 131 PHE B CB    1 
ATOM   4103 C  CG    . PHE D 2 131 ? 15.977  -9.813  31.518  1.00 45.50  ? 131 PHE B CG    1 
ATOM   4104 C  CD1   . PHE D 2 131 ? 15.820  -9.634  30.147  1.00 47.98  ? 131 PHE B CD1   1 
ATOM   4105 C  CD2   . PHE D 2 131 ? 14.876  -10.187 32.274  1.00 41.42  ? 131 PHE B CD2   1 
ATOM   4106 C  CE1   . PHE D 2 131 ? 14.570  -9.824  29.540  1.00 51.03  ? 131 PHE B CE1   1 
ATOM   4107 C  CE2   . PHE D 2 131 ? 13.632  -10.379 31.684  1.00 44.85  ? 131 PHE B CE2   1 
ATOM   4108 C  CZ    . PHE D 2 131 ? 13.478  -10.195 30.312  1.00 47.22  ? 131 PHE B CZ    1 
ATOM   4109 N  N     . TYR D 2 132 ? 19.459  -10.452 30.098  1.00 50.15  ? 132 TYR B N     1 
ATOM   4110 C  CA    . TYR D 2 132 ? 19.838  -10.799 28.741  1.00 51.20  ? 132 TYR B CA    1 
ATOM   4111 C  C     . TYR D 2 132 ? 20.606  -12.125 28.720  1.00 53.70  ? 132 TYR B C     1 
ATOM   4112 O  O     . TYR D 2 132 ? 20.465  -12.938 27.796  1.00 53.30  ? 132 TYR B O     1 
ATOM   4113 C  CB    . TYR D 2 132 ? 20.702  -9.695  28.124  1.00 53.07  ? 132 TYR B CB    1 
ATOM   4114 C  CG    . TYR D 2 132 ? 19.994  -8.371  27.892  1.00 55.36  ? 132 TYR B CG    1 
ATOM   4115 C  CD1   . TYR D 2 132 ? 18.611  -8.309  27.738  1.00 56.06  ? 132 TYR B CD1   1 
ATOM   4116 C  CD2   . TYR D 2 132 ? 20.718  -7.186  27.766  1.00 54.82  ? 132 TYR B CD2   1 
ATOM   4117 C  CE1   . TYR D 2 132 ? 17.968  -7.100  27.462  1.00 54.18  ? 132 TYR B CE1   1 
ATOM   4118 C  CE2   . TYR D 2 132 ? 20.084  -5.975  27.486  1.00 53.80  ? 132 TYR B CE2   1 
ATOM   4119 C  CZ    . TYR D 2 132 ? 18.709  -5.941  27.336  1.00 54.27  ? 132 TYR B CZ    1 
ATOM   4120 O  OH    . TYR D 2 132 ? 18.073  -4.752  27.054  1.00 53.45  ? 132 TYR B OH    1 
ATOM   4121 N  N     . LYS D 2 133 ? 21.424  -12.341 29.740  1.00 50.30  ? 133 LYS B N     1 
ATOM   4122 C  CA    . LYS D 2 133 ? 22.215  -13.564 29.820  1.00 52.68  ? 133 LYS B CA    1 
ATOM   4123 C  C     . LYS D 2 133 ? 21.299  -14.788 29.846  1.00 48.59  ? 133 LYS B C     1 
ATOM   4124 O  O     . LYS D 2 133 ? 21.673  -15.869 29.414  1.00 45.88  ? 133 LYS B O     1 
ATOM   4125 C  CB    . LYS D 2 133 ? 23.088  -13.524 31.076  1.00 54.28  ? 133 LYS B CB    1 
ATOM   4126 C  CG    . LYS D 2 133 ? 24.338  -14.356 30.990  1.00 57.09  ? 133 LYS B CG    1 
ATOM   4127 C  CD    . LYS D 2 133 ? 25.316  -13.986 32.093  1.00 60.14  ? 133 LYS B CD    1 
ATOM   4128 C  CE    . LYS D 2 133 ? 26.589  -14.802 31.971  1.00 60.93  ? 133 LYS B CE    1 
ATOM   4129 N  NZ    . LYS D 2 133 ? 26.263  -16.254 31.932  1.00 62.31  ? 133 LYS B NZ    1 
ATOM   4130 N  N     . LEU D 2 134 ? 20.083  -14.590 30.334  1.00 48.33  ? 134 LEU B N     1 
ATOM   4131 C  CA    . LEU D 2 134 ? 19.110  -15.659 30.435  1.00 47.60  ? 134 LEU B CA    1 
ATOM   4132 C  C     . LEU D 2 134 ? 18.024  -15.637 29.369  1.00 49.39  ? 134 LEU B C     1 
ATOM   4133 O  O     . LEU D 2 134 ? 17.462  -16.681 29.055  1.00 50.38  ? 134 LEU B O     1 
ATOM   4134 C  CB    . LEU D 2 134 ? 18.412  -15.603 31.794  1.00 50.41  ? 134 LEU B CB    1 
ATOM   4135 C  CG    . LEU D 2 134 ? 19.200  -15.836 33.079  1.00 51.26  ? 134 LEU B CG    1 
ATOM   4136 C  CD1   . LEU D 2 134 ? 18.271  -15.598 34.247  1.00 55.29  ? 134 LEU B CD1   1 
ATOM   4137 C  CD2   . LEU D 2 134 ? 19.738  -17.260 33.124  1.00 49.54  ? 134 LEU B CD2   1 
ATOM   4138 N  N     . PHE D 2 135 ? 17.718  -14.472 28.804  1.00 47.92  ? 135 PHE B N     1 
ATOM   4139 C  CA    . PHE D 2 135 ? 16.619  -14.433 27.855  1.00 49.39  ? 135 PHE B CA    1 
ATOM   4140 C  C     . PHE D 2 135 ? 16.779  -13.778 26.491  1.00 49.87  ? 135 PHE B C     1 
ATOM   4141 O  O     . PHE D 2 135 ? 15.891  -13.895 25.658  1.00 49.92  ? 135 PHE B O     1 
ATOM   4142 C  CB    . PHE D 2 135 ? 15.410  -13.806 28.541  1.00 52.37  ? 135 PHE B CB    1 
ATOM   4143 C  CG    . PHE D 2 135 ? 15.067  -14.426 29.862  1.00 54.57  ? 135 PHE B CG    1 
ATOM   4144 C  CD1   . PHE D 2 135 ? 14.889  -15.794 29.980  1.00 54.82  ? 135 PHE B CD1   1 
ATOM   4145 C  CD2   . PHE D 2 135 ? 14.884  -13.633 30.987  1.00 60.99  ? 135 PHE B CD2   1 
ATOM   4146 C  CE1   . PHE D 2 135 ? 14.532  -16.365 31.200  1.00 51.62  ? 135 PHE B CE1   1 
ATOM   4147 C  CE2   . PHE D 2 135 ? 14.527  -14.198 32.207  1.00 57.60  ? 135 PHE B CE2   1 
ATOM   4148 C  CZ    . PHE D 2 135 ? 14.352  -15.569 32.309  1.00 49.76  ? 135 PHE B CZ    1 
ATOM   4149 N  N     . LYS D 2 136 ? 17.884  -13.087 26.254  1.00 52.25  ? 136 LYS B N     1 
ATOM   4150 C  CA    . LYS D 2 136 ? 18.079  -12.409 24.975  1.00 55.95  ? 136 LYS B CA    1 
ATOM   4151 C  C     . LYS D 2 136 ? 17.778  -13.297 23.760  1.00 58.41  ? 136 LYS B C     1 
ATOM   4152 O  O     . LYS D 2 136 ? 17.006  -12.919 22.879  1.00 60.73  ? 136 LYS B O     1 
ATOM   4153 C  CB    . LYS D 2 136 ? 19.507  -11.862 24.892  1.00 59.09  ? 136 LYS B CB    1 
ATOM   4154 C  CG    . LYS D 2 136 ? 19.780  -11.024 23.665  1.00 60.01  ? 136 LYS B CG    1 
ATOM   4155 C  CD    . LYS D 2 136 ? 21.179  -10.417 23.684  1.00 61.50  ? 136 LYS B CD    1 
ATOM   4156 C  CE    . LYS D 2 136 ? 21.333  -9.407  22.546  1.00 62.70  ? 136 LYS B CE    1 
ATOM   4157 N  NZ    . LYS D 2 136 ? 22.618  -8.655  22.582  1.00 67.40  ? 136 LYS B NZ    1 
ATOM   4158 N  N     . GLU D 2 137 ? 18.389  -14.476 23.726  1.00 60.83  ? 137 GLU B N     1 
ATOM   4159 C  CA    . GLU D 2 137 ? 18.202  -15.434 22.637  1.00 63.10  ? 137 GLU B CA    1 
ATOM   4160 C  C     . GLU D 2 137 ? 16.717  -15.691 22.391  1.00 61.99  ? 137 GLU B C     1 
ATOM   4161 O  O     . GLU D 2 137 ? 16.215  -15.555 21.270  1.00 59.41  ? 137 GLU B O     1 
ATOM   4162 C  CB    . GLU D 2 137 ? 18.918  -16.743 23.000  1.00 66.61  ? 137 GLU B CB    1 
ATOM   4163 C  CG    . GLU D 2 137 ? 18.446  -17.999 22.269  1.00 77.11  ? 137 GLU B CG    1 
ATOM   4164 C  CD    . GLU D 2 137 ? 18.914  -19.295 22.956  1.00 83.01  ? 137 GLU B CD    1 
ATOM   4165 O  OE1   . GLU D 2 137 ? 18.625  -19.476 24.160  1.00 85.05  ? 137 GLU B OE1   1 
ATOM   4166 O  OE2   . GLU D 2 137 ? 19.566  -20.136 22.295  1.00 85.71  ? 137 GLU B OE2   1 
ATOM   4167 N  N     . ASP D 2 138 ? 16.020  -16.058 23.455  1.00 60.33  ? 138 ASP B N     1 
ATOM   4168 C  CA    . ASP D 2 138 ? 14.605  -16.346 23.369  1.00 62.58  ? 138 ASP B CA    1 
ATOM   4169 C  C     . ASP D 2 138 ? 13.845  -15.144 22.805  1.00 63.29  ? 138 ASP B C     1 
ATOM   4170 O  O     . ASP D 2 138 ? 13.007  -15.280 21.907  1.00 63.19  ? 138 ASP B O     1 
ATOM   4171 C  CB    . ASP D 2 138 ? 14.078  -16.730 24.759  1.00 68.30  ? 138 ASP B CB    1 
ATOM   4172 C  CG    . ASP D 2 138 ? 14.945  -17.807 25.445  1.00 79.69  ? 138 ASP B CG    1 
ATOM   4173 O  OD1   . ASP D 2 138 ? 15.621  -18.574 24.719  1.00 80.33  ? 138 ASP B OD1   1 
ATOM   4174 O  OD2   . ASP D 2 138 ? 14.943  -17.900 26.702  1.00 78.96  ? 138 ASP B OD2   1 
ATOM   4175 N  N     . ILE D 2 139 ? 14.155  -13.958 23.316  1.00 59.92  ? 139 ILE B N     1 
ATOM   4176 C  CA    . ILE D 2 139 ? 13.474  -12.764 22.861  1.00 54.65  ? 139 ILE B CA    1 
ATOM   4177 C  C     . ILE D 2 139 ? 13.857  -12.428 21.425  1.00 55.18  ? 139 ILE B C     1 
ATOM   4178 O  O     . ILE D 2 139 ? 12.991  -12.107 20.606  1.00 52.63  ? 139 ILE B O     1 
ATOM   4179 C  CB    . ILE D 2 139 ? 13.775  -11.576 23.788  1.00 52.59  ? 139 ILE B CB    1 
ATOM   4180 C  CG1   . ILE D 2 139 ? 13.500  -11.984 25.237  1.00 47.44  ? 139 ILE B CG1   1 
ATOM   4181 C  CG2   . ILE D 2 139 ? 12.893  -10.386 23.422  1.00 45.13  ? 139 ILE B CG2   1 
ATOM   4182 C  CD1   . ILE D 2 139 ? 13.873  -10.915 26.268  1.00 40.81  ? 139 ILE B CD1   1 
ATOM   4183 N  N     . LEU D 2 140 ? 15.146  -12.525 21.110  1.00 53.93  ? 140 LEU B N     1 
ATOM   4184 C  CA    . LEU D 2 140 ? 15.600  -12.219 19.756  1.00 53.73  ? 140 LEU B CA    1 
ATOM   4185 C  C     . LEU D 2 140 ? 14.936  -13.103 18.725  1.00 52.39  ? 140 LEU B C     1 
ATOM   4186 O  O     . LEU D 2 140 ? 14.646  -12.657 17.617  1.00 57.75  ? 140 LEU B O     1 
ATOM   4187 C  CB    . LEU D 2 140 ? 17.121  -12.359 19.625  1.00 55.27  ? 140 LEU B CB    1 
ATOM   4188 C  CG    . LEU D 2 140 ? 17.922  -11.048 19.653  1.00 61.76  ? 140 LEU B CG    1 
ATOM   4189 C  CD1   . LEU D 2 140 ? 17.792  -10.403 21.023  1.00 67.91  ? 140 LEU B CD1   1 
ATOM   4190 C  CD2   . LEU D 2 140 ? 19.387  -11.306 19.340  1.00 61.87  ? 140 LEU B CD2   1 
ATOM   4191 N  N     . SER D 2 141 ? 14.688  -14.356 19.075  1.00 48.95  ? 141 SER B N     1 
ATOM   4192 C  CA    . SER D 2 141 ? 14.060  -15.248 18.116  1.00 48.38  ? 141 SER B CA    1 
ATOM   4193 C  C     . SER D 2 141 ? 12.573  -14.940 18.015  1.00 45.49  ? 141 SER B C     1 
ATOM   4194 O  O     . SER D 2 141 ? 11.996  -14.983 16.933  1.00 46.49  ? 141 SER B O     1 
ATOM   4195 C  CB    . SER D 2 141 ? 14.278  -16.714 18.519  1.00 45.90  ? 141 SER B CB    1 
ATOM   4196 O  OG    . SER D 2 141 ? 13.445  -17.095 19.599  1.00 48.40  ? 141 SER B OG    1 
ATOM   4197 N  N     . ALA D 2 142 ? 11.965  -14.619 19.150  1.00 43.91  ? 142 ALA B N     1 
ATOM   4198 C  CA    . ALA D 2 142 ? 10.542  -14.315 19.201  1.00 46.46  ? 142 ALA B CA    1 
ATOM   4199 C  C     . ALA D 2 142 ? 10.245  -13.110 18.329  1.00 48.92  ? 142 ALA B C     1 
ATOM   4200 O  O     . ALA D 2 142 ? 9.184   -13.028 17.709  1.00 52.16  ? 142 ALA B O     1 
ATOM   4201 C  CB    . ALA D 2 142 ? 10.133  -14.042 20.634  1.00 45.33  ? 142 ALA B CB    1 
ATOM   4202 N  N     . ILE D 2 143 ? 11.206  -12.187 18.298  1.00 49.61  ? 143 ILE B N     1 
ATOM   4203 C  CA    . ILE D 2 143 ? 11.141  -10.945 17.522  1.00 47.69  ? 143 ILE B CA    1 
ATOM   4204 C  C     . ILE D 2 143 ? 11.329  -11.242 16.044  1.00 50.25  ? 143 ILE B C     1 
ATOM   4205 O  O     . ILE D 2 143 ? 10.654  -10.676 15.186  1.00 49.44  ? 143 ILE B O     1 
ATOM   4206 C  CB    . ILE D 2 143 ? 12.289  -9.977  17.920  1.00 47.33  ? 143 ILE B CB    1 
ATOM   4207 C  CG1   . ILE D 2 143 ? 12.104  -9.481  19.355  1.00 49.97  ? 143 ILE B CG1   1 
ATOM   4208 C  CG2   . ILE D 2 143 ? 12.362  -8.831  16.937  1.00 46.91  ? 143 ILE B CG2   1 
ATOM   4209 C  CD1   . ILE D 2 143 ? 13.277  -8.670  19.869  1.00 43.62  ? 143 ILE B CD1   1 
ATOM   4210 N  N     . LYS D 2 144 ? 12.291  -12.113 15.766  1.00 53.55  ? 144 LYS B N     1 
ATOM   4211 C  CA    . LYS D 2 144 ? 12.621  -12.506 14.407  1.00 58.61  ? 144 LYS B CA    1 
ATOM   4212 C  C     . LYS D 2 144 ? 11.396  -13.066 13.688  1.00 61.48  ? 144 LYS B C     1 
ATOM   4213 O  O     . LYS D 2 144 ? 11.204  -12.818 12.497  1.00 59.29  ? 144 LYS B O     1 
ATOM   4214 C  CB    . LYS D 2 144 ? 13.742  -13.549 14.435  1.00 57.92  ? 144 LYS B CB    1 
ATOM   4215 C  CG    . LYS D 2 144 ? 14.270  -13.928 13.070  1.00 60.02  ? 144 LYS B CG    1 
ATOM   4216 C  CD    . LYS D 2 144 ? 15.430  -14.914 13.176  1.00 65.89  ? 144 LYS B CD    1 
ATOM   4217 C  CE    . LYS D 2 144 ? 16.048  -15.191 11.804  1.00 65.06  ? 144 LYS B CE    1 
ATOM   4218 N  NZ    . LYS D 2 144 ? 17.100  -16.245 11.862  1.00 61.72  ? 144 LYS B NZ    1 
ATOM   4219 N  N     . GLU D 2 145 ? 10.568  -13.806 14.426  1.00 62.67  ? 145 GLU B N     1 
ATOM   4220 C  CA    . GLU D 2 145 ? 9.364   -14.417 13.878  1.00 67.27  ? 145 GLU B CA    1 
ATOM   4221 C  C     . GLU D 2 145 ? 8.083   -13.697 14.307  1.00 69.70  ? 145 GLU B C     1 
ATOM   4222 O  O     . GLU D 2 145 ? 6.989   -14.266 14.226  1.00 67.96  ? 145 GLU B O     1 
ATOM   4223 C  CB    . GLU D 2 145 ? 9.289   -15.883 14.306  1.00 69.26  ? 145 GLU B CB    1 
ATOM   4224 C  CG    . GLU D 2 145 ? 9.111   -16.087 15.805  1.00 77.16  ? 145 GLU B CG    1 
ATOM   4225 C  CD    . GLU D 2 145 ? 8.968   -17.557 16.188  1.00 80.36  ? 145 GLU B CD    1 
ATOM   4226 O  OE1   . GLU D 2 145 ? 9.965   -18.306 16.082  1.00 77.49  ? 145 GLU B OE1   1 
ATOM   4227 O  OE2   . GLU D 2 145 ? 7.854   -17.966 16.592  1.00 81.11  ? 145 GLU B OE2   1 
ATOM   4228 N  N     . GLY D 2 146 ? 8.228   -12.451 14.760  1.00 71.44  ? 146 GLY B N     1 
ATOM   4229 C  CA    . GLY D 2 146 ? 7.087   -11.657 15.190  1.00 68.45  ? 146 GLY B CA    1 
ATOM   4230 C  C     . GLY D 2 146 ? 6.080   -11.449 14.073  1.00 71.28  ? 146 GLY B C     1 
ATOM   4231 O  O     . GLY D 2 146 ? 6.451   -11.369 12.898  1.00 68.11  ? 146 GLY B O     1 
ATOM   4232 N  N     . ARG D 2 147 ? 4.806   -11.334 14.443  1.00 75.22  ? 147 ARG B N     1 
ATOM   4233 C  CA    . ARG D 2 147 ? 3.723   -11.173 13.469  1.00 77.01  ? 147 ARG B CA    1 
ATOM   4234 C  C     . ARG D 2 147 ? 2.491   -10.503 14.118  1.00 77.00  ? 147 ARG B C     1 
ATOM   4235 O  O     . ARG D 2 147 ? 2.011   -10.973 15.156  1.00 77.00  ? 147 ARG B O     1 
ATOM   4236 C  CB    . ARG D 2 147 ? 3.337   -12.568 12.959  1.00 75.04  ? 147 ARG B CB    1 
ATOM   4237 C  CG    . ARG D 2 147 ? 2.845   -12.643 11.539  1.00 74.08  ? 147 ARG B CG    1 
ATOM   4238 C  CD    . ARG D 2 147 ? 1.632   -13.538 11.475  1.00 79.28  ? 147 ARG B CD    1 
ATOM   4239 N  NE    . ARG D 2 147 ? 0.440   -12.815 11.909  1.00 83.44  ? 147 ARG B NE    1 
ATOM   4240 C  CZ    . ARG D 2 147 ? -0.764  -13.356 12.052  1.00 84.31  ? 147 ARG B CZ    1 
ATOM   4241 N  NH1   . ARG D 2 147 ? -0.952  -14.643 11.800  1.00 85.59  ? 147 ARG B NH1   1 
ATOM   4242 N  NH2   . ARG D 2 147 ? -1.785  -12.603 12.434  1.00 85.33  ? 147 ARG B NH2   1 
ATOM   4243 N  N     . VAL D 2 148 ? 1.984   -9.412  13.534  1.00 72.86  ? 148 VAL B N     1 
ATOM   4244 C  CA    . VAL D 2 148 ? 0.791   -8.771  14.097  1.00 68.47  ? 148 VAL B CA    1 
ATOM   4245 C  C     . VAL D 2 148 ? -0.416  -9.616  13.705  1.00 66.84  ? 148 VAL B C     1 
ATOM   4246 O  O     . VAL D 2 148 ? -0.667  -9.872  12.533  1.00 63.61  ? 148 VAL B O     1 
ATOM   4247 C  CB    . VAL D 2 148 ? 0.579   -7.324  13.582  1.00 68.64  ? 148 VAL B CB    1 
ATOM   4248 C  CG1   . VAL D 2 148 ? -0.804  -6.822  13.999  1.00 63.86  ? 148 VAL B CG1   1 
ATOM   4249 C  CG2   . VAL D 2 148 ? 1.644   -6.405  14.156  1.00 69.25  ? 148 VAL B CG2   1 
ATOM   4250 N  N     . LYS D 2 149 ? -1.164  -10.054 14.703  1.00 67.45  ? 149 LYS B N     1 
ATOM   4251 C  CA    . LYS D 2 149 ? -2.321  -10.897 14.463  1.00 69.39  ? 149 LYS B CA    1 
ATOM   4252 C  C     . LYS D 2 149 ? -3.641  -10.199 14.768  1.00 67.47  ? 149 LYS B C     1 
ATOM   4253 O  O     . LYS D 2 149 ? -4.208  -10.401 15.840  1.00 70.36  ? 149 LYS B O     1 
ATOM   4254 C  CB    . LYS D 2 149 ? -2.192  -12.168 15.310  1.00 72.08  ? 149 LYS B CB    1 
ATOM   4255 C  CG    . LYS D 2 149 ? -1.962  -11.898 16.803  1.00 82.83  ? 149 LYS B CG    1 
ATOM   4256 C  CD    . LYS D 2 149 ? -0.614  -11.219 17.104  1.00 87.57  ? 149 LYS B CD    1 
ATOM   4257 C  CE    . LYS D 2 149 ? 0.508   -12.235 17.331  1.00 93.23  ? 149 LYS B CE    1 
ATOM   4258 N  NZ    . LYS D 2 149 ? 0.743   -13.138 16.166  1.00 91.92  ? 149 LYS B NZ    1 
ATOM   4259 N  N     . LYS D 2 150 ? -4.128  -9.383  13.830  1.00 64.73  ? 150 LYS B N     1 
ATOM   4260 C  CA    . LYS D 2 150 ? -5.401  -8.661  14.007  1.00 61.05  ? 150 LYS B CA    1 
ATOM   4261 C  C     . LYS D 2 150 ? -6.566  -9.593  14.305  1.00 58.17  ? 150 LYS B C     1 
ATOM   4262 O  O     . LYS D 2 150 ? -6.698  -10.660 13.705  1.00 60.86  ? 150 LYS B O     1 
ATOM   4263 C  CB    . LYS D 2 150 ? -5.761  -7.850  12.758  1.00 60.02  ? 150 LYS B CB    1 
ATOM   4264 C  CG    . LYS D 2 150 ? -5.062  -6.515  12.638  1.00 63.08  ? 150 LYS B CG    1 
ATOM   4265 C  CD    . LYS D 2 150 ? -5.498  -5.776  11.375  1.00 64.79  ? 150 LYS B CD    1 
ATOM   4266 C  CE    . LYS D 2 150 ? -4.811  -4.419  11.267  1.00 65.61  ? 150 LYS B CE    1 
ATOM   4267 N  NZ    . LYS D 2 150 ? -5.130  -3.697  10.005  1.00 59.25  ? 150 LYS B NZ    1 
ATOM   4268 N  N     . ASP D 2 151 ? -7.419  -9.172  15.225  1.00 53.63  ? 151 ASP B N     1 
ATOM   4269 C  CA    . ASP D 2 151 ? -8.579  -9.956  15.601  1.00 53.32  ? 151 ASP B CA    1 
ATOM   4270 C  C     . ASP D 2 151 ? -9.728  -9.680  14.642  1.00 52.79  ? 151 ASP B C     1 
ATOM   4271 O  O     . ASP D 2 151 ? -9.779  -8.628  13.997  1.00 49.91  ? 151 ASP B O     1 
ATOM   4272 C  CB    . ASP D 2 151 ? -9.015  -9.610  17.029  1.00 60.78  ? 151 ASP B CB    1 
ATOM   4273 C  CG    . ASP D 2 151 ? -9.383  -8.140  17.192  1.00 71.31  ? 151 ASP B CG    1 
ATOM   4274 O  OD1   . ASP D 2 151 ? -8.476  -7.271  17.227  1.00 74.00  ? 151 ASP B OD1   1 
ATOM   4275 O  OD2   . ASP D 2 151 ? -10.595 -7.854  17.281  1.00 78.23  ? 151 ASP B OD2   1 
ATOM   4276 N  N     . TYR D 2 152 ? -10.658 -10.626 14.577  1.00 49.79  ? 152 TYR B N     1 
ATOM   4277 C  CA    . TYR D 2 152 ? -11.817 -10.526 13.703  1.00 50.80  ? 152 TYR B CA    1 
ATOM   4278 C  C     . TYR D 2 152 ? -12.569 -9.207  13.734  1.00 48.76  ? 152 TYR B C     1 
ATOM   4279 O  O     . TYR D 2 152 ? -12.816 -8.609  12.689  1.00 53.14  ? 152 TYR B O     1 
ATOM   4280 C  CB    . TYR D 2 152 ? -12.768 -11.695 13.978  1.00 51.26  ? 152 TYR B CB    1 
ATOM   4281 C  CG    . TYR D 2 152 ? -12.138 -12.988 13.561  1.00 53.82  ? 152 TYR B CG    1 
ATOM   4282 C  CD1   . TYR D 2 152 ? -11.749 -13.177 12.235  1.00 60.01  ? 152 TYR B CD1   1 
ATOM   4283 C  CD2   . TYR D 2 152 ? -11.841 -13.983 14.487  1.00 54.59  ? 152 TYR B CD2   1 
ATOM   4284 C  CE1   . TYR D 2 152 ? -11.071 -14.316 11.832  1.00 63.09  ? 152 TYR B CE1   1 
ATOM   4285 C  CE2   . TYR D 2 152 ? -11.159 -15.142 14.096  1.00 61.30  ? 152 TYR B CE2   1 
ATOM   4286 C  CZ    . TYR D 2 152 ? -10.776 -15.298 12.761  1.00 65.51  ? 152 TYR B CZ    1 
ATOM   4287 O  OH    . TYR D 2 152 ? -10.105 -16.427 12.332  1.00 72.75  ? 152 TYR B OH    1 
ATOM   4288 N  N     . LYS D 2 153 ? -12.936 -8.742  14.916  1.00 44.97  ? 153 LYS B N     1 
ATOM   4289 C  CA    . LYS D 2 153 ? -13.662 -7.492  14.987  1.00 46.33  ? 153 LYS B CA    1 
ATOM   4290 C  C     . LYS D 2 153 ? -12.911 -6.378  14.256  1.00 47.22  ? 153 LYS B C     1 
ATOM   4291 O  O     . LYS D 2 153 ? -13.510 -5.636  13.478  1.00 50.27  ? 153 LYS B O     1 
ATOM   4292 C  CB    . LYS D 2 153 ? -13.926 -7.113  16.449  1.00 47.74  ? 153 LYS B CB    1 
ATOM   4293 C  CG    . LYS D 2 153 ? -14.902 -8.056  17.153  1.00 48.89  ? 153 LYS B CG    1 
ATOM   4294 C  CD    . LYS D 2 153 ? -15.400 -7.498  18.484  1.00 51.12  ? 153 LYS B CD    1 
ATOM   4295 C  CE    . LYS D 2 153 ? -16.293 -6.267  18.298  1.00 45.97  ? 153 LYS B CE    1 
ATOM   4296 N  NZ    . LYS D 2 153 ? -16.775 -5.706  19.600  1.00 44.41  ? 153 LYS B NZ    1 
ATOM   4297 N  N     . THR D 2 154 ? -11.604 -6.272  14.485  1.00 43.02  ? 154 THR B N     1 
ATOM   4298 C  CA    . THR D 2 154 ? -10.808 -5.236  13.830  1.00 42.65  ? 154 THR B CA    1 
ATOM   4299 C  C     . THR D 2 154 ? -10.816 -5.435  12.318  1.00 45.29  ? 154 THR B C     1 
ATOM   4300 O  O     . THR D 2 154 ? -11.039 -4.495  11.561  1.00 45.02  ? 154 THR B O     1 
ATOM   4301 C  CB    . THR D 2 154 ? -9.334  -5.237  14.316  1.00 38.35  ? 154 THR B CB    1 
ATOM   4302 O  OG1   . THR D 2 154 ? -9.269  -4.953  15.721  1.00 32.56  ? 154 THR B OG1   1 
ATOM   4303 C  CG2   . THR D 2 154 ? -8.560  -4.191  13.585  1.00 38.22  ? 154 THR B CG2   1 
ATOM   4304 N  N     . ILE D 2 155 ? -10.562 -6.667  11.885  1.00 47.41  ? 155 ILE B N     1 
ATOM   4305 C  CA    . ILE D 2 155 ? -10.563 -7.013  10.463  1.00 46.49  ? 155 ILE B CA    1 
ATOM   4306 C  C     . ILE D 2 155 ? -11.883 -6.601  9.813   1.00 50.29  ? 155 ILE B C     1 
ATOM   4307 O  O     . ILE D 2 155 ? -11.913 -5.739  8.935   1.00 54.62  ? 155 ILE B O     1 
ATOM   4308 C  CB    . ILE D 2 155 ? -10.393 -8.527  10.267  1.00 43.66  ? 155 ILE B CB    1 
ATOM   4309 C  CG1   . ILE D 2 155 ? -8.978  -8.939  10.645  1.00 33.79  ? 155 ILE B CG1   1 
ATOM   4310 C  CG2   . ILE D 2 155 ? -10.690 -8.906  8.835   1.00 46.09  ? 155 ILE B CG2   1 
ATOM   4311 C  CD1   . ILE D 2 155 ? -8.851  -10.399 10.852  1.00 35.33  ? 155 ILE B CD1   1 
ATOM   4312 N  N     . LEU D 2 156 ? -12.970 -7.229  10.245  1.00 47.67  ? 156 LEU B N     1 
ATOM   4313 C  CA    . LEU D 2 156 ? -14.291 -6.931  9.711   1.00 49.90  ? 156 LEU B CA    1 
ATOM   4314 C  C     . LEU D 2 156 ? -14.547 -5.430  9.633   1.00 53.03  ? 156 LEU B C     1 
ATOM   4315 O  O     . LEU D 2 156 ? -14.965 -4.910  8.597   1.00 55.24  ? 156 LEU B O     1 
ATOM   4316 C  CB    . LEU D 2 156 ? -15.369 -7.568  10.586  1.00 49.41  ? 156 LEU B CB    1 
ATOM   4317 C  CG    . LEU D 2 156 ? -16.806 -7.118  10.283  1.00 54.58  ? 156 LEU B CG    1 
ATOM   4318 C  CD1   . LEU D 2 156 ? -17.173 -7.556  8.852   1.00 52.81  ? 156 LEU B CD1   1 
ATOM   4319 C  CD2   . LEU D 2 156 ? -17.793 -7.695  11.323  1.00 40.03  ? 156 LEU B CD2   1 
ATOM   4320 N  N     . GLN D 2 157 ? -14.299 -4.737  10.737  1.00 56.69  ? 157 GLN B N     1 
ATOM   4321 C  CA    . GLN D 2 157 ? -14.530 -3.297  10.799  1.00 56.59  ? 157 GLN B CA    1 
ATOM   4322 C  C     . GLN D 2 157 ? -13.720 -2.563  9.732   1.00 56.68  ? 157 GLN B C     1 
ATOM   4323 O  O     . GLN D 2 157 ? -14.166 -1.550  9.187   1.00 55.75  ? 157 GLN B O     1 
ATOM   4324 C  CB    . GLN D 2 157 ? -14.155 -2.771  12.180  1.00 57.08  ? 157 GLN B CB    1 
ATOM   4325 C  CG    . GLN D 2 157 ? -14.896 -1.530  12.597  1.00 54.54  ? 157 GLN B CG    1 
ATOM   4326 C  CD    . GLN D 2 157 ? -13.994 -0.563  13.335  1.00 56.58  ? 157 GLN B CD    1 
ATOM   4327 O  OE1   . GLN D 2 157 ? -14.465 0.306   14.061  1.00 58.60  ? 157 GLN B OE1   1 
ATOM   4328 N  NE2   . GLN D 2 157 ? -12.686 -0.701  13.140  1.00 51.66  ? 157 GLN B NE2   1 
ATOM   4329 N  N     . GLU D 2 158 ? -12.533 -3.068  9.423   1.00 55.48  ? 158 GLU B N     1 
ATOM   4330 C  CA    . GLU D 2 158 ? -11.718 -2.412  8.411   1.00 62.09  ? 158 GLU B CA    1 
ATOM   4331 C  C     . GLU D 2 158 ? -12.160 -2.734  6.978   1.00 62.84  ? 158 GLU B C     1 
ATOM   4332 O  O     . GLU D 2 158 ? -11.887 -1.973  6.051   1.00 63.66  ? 158 GLU B O     1 
ATOM   4333 C  CB    . GLU D 2 158 ? -10.238 -2.741  8.629   1.00 67.22  ? 158 GLU B CB    1 
ATOM   4334 C  CG    . GLU D 2 158 ? -9.625  -1.899  9.754   1.00 74.25  ? 158 GLU B CG    1 
ATOM   4335 C  CD    . GLU D 2 158 ? -8.182  -2.254  10.063  1.00 77.87  ? 158 GLU B CD    1 
ATOM   4336 O  OE1   . GLU D 2 158 ? -7.347  -2.282  9.129   1.00 77.54  ? 158 GLU B OE1   1 
ATOM   4337 O  OE2   . GLU D 2 158 ? -7.884  -2.494  11.250  1.00 80.81  ? 158 GLU B OE2   1 
ATOM   4338 N  N     . ILE D 2 159 ? -12.853 -3.855  6.799   1.00 61.30  ? 159 ILE B N     1 
ATOM   4339 C  CA    . ILE D 2 159 ? -13.363 -4.232  5.486   1.00 54.78  ? 159 ILE B CA    1 
ATOM   4340 C  C     . ILE D 2 159 ? -14.594 -3.384  5.173   1.00 53.03  ? 159 ILE B C     1 
ATOM   4341 O  O     . ILE D 2 159 ? -14.693 -2.790  4.101   1.00 52.02  ? 159 ILE B O     1 
ATOM   4342 C  CB    . ILE D 2 159 ? -13.805 -5.700  5.452   1.00 57.94  ? 159 ILE B CB    1 
ATOM   4343 C  CG1   . ILE D 2 159 ? -12.588 -6.608  5.301   1.00 54.70  ? 159 ILE B CG1   1 
ATOM   4344 C  CG2   . ILE D 2 159 ? -14.815 -5.918  4.328   1.00 54.66  ? 159 ILE B CG2   1 
ATOM   4345 C  CD1   . ILE D 2 159 ? -12.915 -8.076  5.496   1.00 52.45  ? 159 ILE B CD1   1 
ATOM   4346 N  N     . THR D 2 160 ? -15.534 -3.326  6.109   1.00 47.35  ? 160 THR B N     1 
ATOM   4347 C  CA    . THR D 2 160 ? -16.741 -2.561  5.868   1.00 50.20  ? 160 THR B CA    1 
ATOM   4348 C  C     . THR D 2 160 ? -16.491 -1.061  5.747   1.00 56.06  ? 160 THR B C     1 
ATOM   4349 O  O     . THR D 2 160 ? -17.194 -0.373  5.011   1.00 58.84  ? 160 THR B O     1 
ATOM   4350 C  CB    . THR D 2 160 ? -17.798 -2.839  6.951   1.00 48.03  ? 160 THR B CB    1 
ATOM   4351 O  OG1   . THR D 2 160 ? -17.367 -2.320  8.208   1.00 50.00  ? 160 THR B OG1   1 
ATOM   4352 C  CG2   . THR D 2 160 ? -18.003 -4.331  7.101   1.00 50.21  ? 160 THR B CG2   1 
ATOM   4353 N  N     . GLN D 2 161 ? -15.490 -0.541  6.448   1.00 61.18  ? 161 GLN B N     1 
ATOM   4354 C  CA    . GLN D 2 161 ? -15.218 0.885   6.348   1.00 62.57  ? 161 GLN B CA    1 
ATOM   4355 C  C     . GLN D 2 161 ? -14.562 1.189   5.012   1.00 65.34  ? 161 GLN B C     1 
ATOM   4356 O  O     . GLN D 2 161 ? -14.779 2.251   4.432   1.00 66.51  ? 161 GLN B O     1 
ATOM   4357 C  CB    . GLN D 2 161 ? -14.339 1.354   7.504   1.00 62.13  ? 161 GLN B CB    1 
ATOM   4358 C  CG    . GLN D 2 161 ? -15.054 1.316   8.846   1.00 64.29  ? 161 GLN B CG    1 
ATOM   4359 C  CD    . GLN D 2 161 ? -14.309 2.059   9.942   1.00 64.96  ? 161 GLN B CD    1 
ATOM   4360 O  OE1   . GLN D 2 161 ? -14.782 2.161   11.070  1.00 64.93  ? 161 GLN B OE1   1 
ATOM   4361 N  NE2   . GLN D 2 161 ? -13.142 2.584   9.612   1.00 67.04  ? 161 GLN B NE2   1 
ATOM   4362 N  N     . LYS D 2 162 ? -13.774 0.247   4.510   1.00 65.95  ? 162 LYS B N     1 
ATOM   4363 C  CA    . LYS D 2 162 ? -13.112 0.444   3.230   1.00 70.07  ? 162 LYS B CA    1 
ATOM   4364 C  C     . LYS D 2 162 ? -14.129 0.346   2.100   1.00 72.47  ? 162 LYS B C     1 
ATOM   4365 O  O     . LYS D 2 162 ? -14.208 1.221   1.232   1.00 72.68  ? 162 LYS B O     1 
ATOM   4366 C  CB    . LYS D 2 162 ? -12.021 -0.610  3.020   1.00 73.15  ? 162 LYS B CB    1 
ATOM   4367 C  CG    . LYS D 2 162 ? -11.341 -0.539  1.655   1.00 74.71  ? 162 LYS B CG    1 
ATOM   4368 C  CD    . LYS D 2 162 ? -10.276 -1.618  1.486   1.00 80.61  ? 162 LYS B CD    1 
ATOM   4369 C  CE    . LYS D 2 162 ? -9.096  -1.417  2.432   1.00 83.58  ? 162 LYS B CE    1 
ATOM   4370 N  NZ    . LYS D 2 162 ? -8.049  -2.465  2.252   1.00 82.78  ? 162 LYS B NZ    1 
ATOM   4371 N  N     . ARG D 2 163 ? -14.912 -0.727  2.128   1.00 73.40  ? 163 ARG B N     1 
ATOM   4372 C  CA    . ARG D 2 163 ? -15.914 -0.985  1.104   1.00 72.84  ? 163 ARG B CA    1 
ATOM   4373 C  C     . ARG D 2 163 ? -17.119 -0.042  1.118   1.00 72.45  ? 163 ARG B C     1 
ATOM   4374 O  O     . ARG D 2 163 ? -17.475 0.502   0.077   1.00 73.45  ? 163 ARG B O     1 
ATOM   4375 C  CB    . ARG D 2 163 ? -16.379 -2.439  1.211   1.00 76.67  ? 163 ARG B CB    1 
ATOM   4376 C  CG    . ARG D 2 163 ? -17.398 -2.860  0.175   1.00 82.84  ? 163 ARG B CG    1 
ATOM   4377 C  CD    . ARG D 2 163 ? -17.512 -4.372  0.120   1.00 86.10  ? 163 ARG B CD    1 
ATOM   4378 N  NE    . ARG D 2 163 ? -18.662 -4.801  -0.669  1.00 93.69  ? 163 ARG B NE    1 
ATOM   4379 C  CZ    . ARG D 2 163 ? -18.956 -6.070  -0.934  1.00 97.22  ? 163 ARG B CZ    1 
ATOM   4380 N  NH1   . ARG D 2 163 ? -18.181 -7.045  -0.475  1.00 101.14 ? 163 ARG B NH1   1 
ATOM   4381 N  NH2   . ARG D 2 163 ? -20.032 -6.369  -1.649  1.00 99.57  ? 163 ARG B NH2   1 
ATOM   4382 N  N     . TRP D 2 164 ? -17.737 0.165   2.282   1.00 72.08  ? 164 TRP B N     1 
ATOM   4383 C  CA    . TRP D 2 164 ? -18.915 1.037   2.372   1.00 68.37  ? 164 TRP B CA    1 
ATOM   4384 C  C     . TRP D 2 164 ? -18.762 2.258   3.278   1.00 65.98  ? 164 TRP B C     1 
ATOM   4385 O  O     . TRP D 2 164 ? -19.640 3.121   3.314   1.00 61.32  ? 164 TRP B O     1 
ATOM   4386 C  CB    . TRP D 2 164 ? -20.137 0.238   2.846   1.00 75.98  ? 164 TRP B CB    1 
ATOM   4387 C  CG    . TRP D 2 164 ? -20.391 -1.023  2.078   1.00 88.96  ? 164 TRP B CG    1 
ATOM   4388 C  CD1   . TRP D 2 164 ? -19.773 -2.228  2.252   1.00 91.91  ? 164 TRP B CD1   1 
ATOM   4389 C  CD2   . TRP D 2 164 ? -21.323 -1.202  1.004   1.00 93.75  ? 164 TRP B CD2   1 
ATOM   4390 N  NE1   . TRP D 2 164 ? -20.262 -3.146  1.354   1.00 94.72  ? 164 TRP B NE1   1 
ATOM   4391 C  CE2   . TRP D 2 164 ? -21.214 -2.543  0.576   1.00 96.45  ? 164 TRP B CE2   1 
ATOM   4392 C  CE3   . TRP D 2 164 ? -22.240 -0.358  0.362   1.00 98.16  ? 164 TRP B CE3   1 
ATOM   4393 C  CZ2   . TRP D 2 164 ? -21.991 -3.064  -0.468  1.00 101.58 ? 164 TRP B CZ2   1 
ATOM   4394 C  CZ3   . TRP D 2 164 ? -23.016 -0.877  -0.679  1.00 103.26 ? 164 TRP B CZ3   1 
ATOM   4395 C  CH2   . TRP D 2 164 ? -22.884 -2.219  -1.082  1.00 102.77 ? 164 TRP B CH2   1 
ATOM   4396 N  N     . LYS D 2 165 ? -17.654 2.343   4.004   1.00 66.26  ? 165 LYS B N     1 
ATOM   4397 C  CA    . LYS D 2 165 ? -17.447 3.464   4.916   1.00 65.53  ? 165 LYS B CA    1 
ATOM   4398 C  C     . LYS D 2 165 ? -18.466 3.360   6.043   1.00 66.27  ? 165 LYS B C     1 
ATOM   4399 O  O     . LYS D 2 165 ? -19.001 4.367   6.508   1.00 64.11  ? 165 LYS B O     1 
ATOM   4400 C  CB    . LYS D 2 165 ? -17.629 4.794   4.192   1.00 63.94  ? 165 LYS B CB    1 
ATOM   4401 C  CG    . LYS D 2 165 ? -16.756 4.925   2.982   1.00 66.95  ? 165 LYS B CG    1 
ATOM   4402 C  CD    . LYS D 2 165 ? -16.600 6.361   2.563   1.00 67.18  ? 165 LYS B CD    1 
ATOM   4403 C  CE    . LYS D 2 165 ? -15.447 6.465   1.589   1.00 74.51  ? 165 LYS B CE    1 
ATOM   4404 N  NZ    . LYS D 2 165 ? -14.278 5.706   2.122   1.00 74.45  ? 165 LYS B NZ    1 
ATOM   4405 N  N     . GLU D 2 166 ? -18.739 2.129   6.462   1.00 64.28  ? 166 GLU B N     1 
ATOM   4406 C  CA    . GLU D 2 166 ? -19.687 1.865   7.534   1.00 65.97  ? 166 GLU B CA    1 
ATOM   4407 C  C     . GLU D 2 166 ? -19.139 0.801   8.470   1.00 63.93  ? 166 GLU B C     1 
ATOM   4408 O  O     . GLU D 2 166 ? -18.304 -0.009  8.076   1.00 65.00  ? 166 GLU B O     1 
ATOM   4409 C  CB    . GLU D 2 166 ? -21.017 1.379   6.964   1.00 72.20  ? 166 GLU B CB    1 
ATOM   4410 C  CG    . GLU D 2 166 ? -21.979 2.484   6.597   1.00 79.98  ? 166 GLU B CG    1 
ATOM   4411 C  CD    . GLU D 2 166 ? -23.300 1.940   6.093   1.00 85.73  ? 166 GLU B CD    1 
ATOM   4412 O  OE1   . GLU D 2 166 ? -23.362 1.511   4.918   1.00 85.73  ? 166 GLU B OE1   1 
ATOM   4413 O  OE2   . GLU D 2 166 ? -24.273 1.931   6.880   1.00 90.01  ? 166 GLU B OE2   1 
ATOM   4414 N  N     . ARG D 2 167 ? -19.620 0.802   9.708   1.00 59.22  ? 167 ARG B N     1 
ATOM   4415 C  CA    . ARG D 2 167 ? -19.184 -0.169  10.694  1.00 56.31  ? 167 ARG B CA    1 
ATOM   4416 C  C     . ARG D 2 167 ? -20.328 -1.118  11.001  1.00 56.69  ? 167 ARG B C     1 
ATOM   4417 O  O     . ARG D 2 167 ? -21.491 -0.720  10.985  1.00 56.00  ? 167 ARG B O     1 
ATOM   4418 C  CB    . ARG D 2 167 ? -18.768 0.540   11.977  1.00 56.18  ? 167 ARG B CB    1 
ATOM   4419 C  CG    . ARG D 2 167 ? -17.674 1.544   11.783  1.00 57.06  ? 167 ARG B CG    1 
ATOM   4420 C  CD    . ARG D 2 167 ? -17.425 2.339   13.040  1.00 59.94  ? 167 ARG B CD    1 
ATOM   4421 N  NE    . ARG D 2 167 ? -18.571 3.147   13.457  1.00 67.60  ? 167 ARG B NE    1 
ATOM   4422 C  CZ    . ARG D 2 167 ? -19.548 2.730   14.266  1.00 71.17  ? 167 ARG B CZ    1 
ATOM   4423 N  NH1   . ARG D 2 167 ? -19.543 1.494   14.760  1.00 72.22  ? 167 ARG B NH1   1 
ATOM   4424 N  NH2   . ARG D 2 167 ? -20.520 3.566   14.611  1.00 69.22  ? 167 ARG B NH2   1 
ATOM   4425 N  N     . PRO D 2 168 ? -20.015 -2.391  11.293  1.00 58.02  ? 168 PRO B N     1 
ATOM   4426 C  CA    . PRO D 2 168 ? -21.090 -3.335  11.599  1.00 56.22  ? 168 PRO B CA    1 
ATOM   4427 C  C     . PRO D 2 168 ? -21.731 -3.027  12.950  1.00 58.55  ? 168 PRO B C     1 
ATOM   4428 O  O     . PRO D 2 168 ? -21.204 -2.252  13.755  1.00 60.34  ? 168 PRO B O     1 
ATOM   4429 C  CB    . PRO D 2 168 ? -20.369 -4.680  11.599  1.00 57.45  ? 168 PRO B CB    1 
ATOM   4430 C  CG    . PRO D 2 168 ? -19.030 -4.317  12.163  1.00 55.81  ? 168 PRO B CG    1 
ATOM   4431 C  CD    . PRO D 2 168 ? -18.699 -3.051  11.390  1.00 57.10  ? 168 PRO B CD    1 
ATOM   4432 N  N     . GLU D 2 169 ? -22.880 -3.635  13.186  1.00 56.68  ? 169 GLU B N     1 
ATOM   4433 C  CA    . GLU D 2 169 ? -23.590 -3.456  14.436  1.00 57.85  ? 169 GLU B CA    1 
ATOM   4434 C  C     . GLU D 2 169 ? -23.578 -4.802  15.130  1.00 55.90  ? 169 GLU B C     1 
ATOM   4435 O  O     . GLU D 2 169 ? -23.559 -5.832  14.476  1.00 59.01  ? 169 GLU B O     1 
ATOM   4436 C  CB    . GLU D 2 169 ? -25.038 -3.033  14.176  1.00 62.62  ? 169 GLU B CB    1 
ATOM   4437 C  CG    . GLU D 2 169 ? -25.210 -1.596  13.703  1.00 72.18  ? 169 GLU B CG    1 
ATOM   4438 C  CD    . GLU D 2 169 ? -26.657 -1.250  13.364  1.00 78.61  ? 169 GLU B CD    1 
ATOM   4439 O  OE1   . GLU D 2 169 ? -27.511 -2.167  13.314  1.00 82.56  ? 169 GLU B OE1   1 
ATOM   4440 O  OE2   . GLU D 2 169 ? -26.941 -0.054  13.140  1.00 77.70  ? 169 GLU B OE2   1 
ATOM   4441 N  N     . TYR D 2 170 ? -23.578 -4.794  16.453  1.00 55.70  ? 170 TYR B N     1 
ATOM   4442 C  CA    . TYR D 2 170 ? -23.587 -6.025  17.218  1.00 53.57  ? 170 TYR B CA    1 
ATOM   4443 C  C     . TYR D 2 170 ? -24.703 -5.861  18.226  1.00 56.37  ? 170 TYR B C     1 
ATOM   4444 O  O     . TYR D 2 170 ? -24.692 -4.901  18.991  1.00 58.62  ? 170 TYR B O     1 
ATOM   4445 C  CB    . TYR D 2 170 ? -22.264 -6.202  17.952  1.00 54.44  ? 170 TYR B CB    1 
ATOM   4446 C  CG    . TYR D 2 170 ? -21.066 -6.298  17.048  1.00 53.56  ? 170 TYR B CG    1 
ATOM   4447 C  CD1   . TYR D 2 170 ? -20.781 -7.480  16.363  1.00 53.44  ? 170 TYR B CD1   1 
ATOM   4448 C  CD2   . TYR D 2 170 ? -20.223 -5.201  16.858  1.00 49.30  ? 170 TYR B CD2   1 
ATOM   4449 C  CE1   . TYR D 2 170 ? -19.683 -7.571  15.506  1.00 49.88  ? 170 TYR B CE1   1 
ATOM   4450 C  CE2   . TYR D 2 170 ? -19.129 -5.278  16.004  1.00 53.33  ? 170 TYR B CE2   1 
ATOM   4451 C  CZ    . TYR D 2 170 ? -18.865 -6.468  15.330  1.00 54.65  ? 170 TYR B CZ    1 
ATOM   4452 O  OH    . TYR D 2 170 ? -17.794 -6.554  14.469  1.00 62.00  ? 170 TYR B OH    1 
ATOM   4453 N  N     . ARG D 2 171 ? -25.676 -6.772  18.219  1.00 57.91  ? 171 ARG B N     1 
ATOM   4454 C  CA    . ARG D 2 171 ? -26.781 -6.692  19.170  1.00 57.28  ? 171 ARG B CA    1 
ATOM   4455 C  C     . ARG D 2 171 ? -26.888 -8.001  19.924  1.00 54.65  ? 171 ARG B C     1 
ATOM   4456 O  O     . ARG D 2 171 ? -26.724 -9.065  19.341  1.00 56.41  ? 171 ARG B O     1 
ATOM   4457 C  CB    . ARG D 2 171 ? -28.112 -6.388  18.461  1.00 67.20  ? 171 ARG B CB    1 
ATOM   4458 C  CG    . ARG D 2 171 ? -28.835 -7.588  17.825  1.00 77.14  ? 171 ARG B CG    1 
ATOM   4459 C  CD    . ARG D 2 171 ? -30.336 -7.295  17.600  1.00 82.69  ? 171 ARG B CD    1 
ATOM   4460 N  NE    . ARG D 2 171 ? -30.559 -6.138  16.725  1.00 94.33  ? 171 ARG B NE    1 
ATOM   4461 C  CZ    . ARG D 2 171 ? -31.751 -5.601  16.456  1.00 97.38  ? 171 ARG B CZ    1 
ATOM   4462 N  NH1   . ARG D 2 171 ? -32.854 -6.109  16.993  1.00 99.73  ? 171 ARG B NH1   1 
ATOM   4463 N  NH2   . ARG D 2 171 ? -31.843 -4.553  15.642  1.00 94.50  ? 171 ARG B NH2   1 
ATOM   4464 N  N     . LEU D 2 172 ? -27.157 -7.917  21.222  1.00 53.03  ? 172 LEU B N     1 
ATOM   4465 C  CA    . LEU D 2 172 ? -27.283 -9.102  22.061  1.00 55.03  ? 172 LEU B CA    1 
ATOM   4466 C  C     . LEU D 2 172 ? -28.608 -9.806  21.758  1.00 59.01  ? 172 LEU B C     1 
ATOM   4467 O  O     . LEU D 2 172 ? -29.671 -9.193  21.815  1.00 60.48  ? 172 LEU B O     1 
ATOM   4468 C  CB    . LEU D 2 172 ? -27.235 -8.695  23.534  1.00 51.80  ? 172 LEU B CB    1 
ATOM   4469 C  CG    . LEU D 2 172 ? -27.084 -9.821  24.556  1.00 55.29  ? 172 LEU B CG    1 
ATOM   4470 C  CD1   . LEU D 2 172 ? -25.762 -10.511 24.322  1.00 57.08  ? 172 LEU B CD1   1 
ATOM   4471 C  CD2   . LEU D 2 172 ? -27.158 -9.276  25.981  1.00 53.37  ? 172 LEU B CD2   1 
ATOM   4472 N  N     . ILE D 2 173 ? -28.549 -11.090 21.430  1.00 58.82  ? 173 ILE B N     1 
ATOM   4473 C  CA    . ILE D 2 173 ? -29.762 -11.834 21.129  1.00 65.17  ? 173 ILE B CA    1 
ATOM   4474 C  C     . ILE D 2 173 ? -30.308 -12.545 22.370  1.00 69.49  ? 173 ILE B C     1 
ATOM   4475 O  O     . ILE D 2 173 ? -31.523 -12.593 22.593  1.00 70.46  ? 173 ILE B O     1 
ATOM   4476 C  CB    . ILE D 2 173 ? -29.506 -12.874 20.026  1.00 69.21  ? 173 ILE B CB    1 
ATOM   4477 C  CG1   . ILE D 2 173 ? -29.012 -12.168 18.760  1.00 75.03  ? 173 ILE B CG1   1 
ATOM   4478 C  CG2   . ILE D 2 173 ? -30.772 -13.652 19.736  1.00 72.10  ? 173 ILE B CG2   1 
ATOM   4479 C  CD1   . ILE D 2 173 ? -29.901 -11.011 18.303  1.00 74.80  ? 173 ILE B CD1   1 
ATOM   4480 N  N     . SER D 2 174 ? -29.410 -13.094 23.183  1.00 71.69  ? 174 SER B N     1 
ATOM   4481 C  CA    . SER D 2 174 ? -29.824 -13.788 24.395  1.00 69.87  ? 174 SER B CA    1 
ATOM   4482 C  C     . SER D 2 174 ? -28.647 -14.085 25.311  1.00 68.60  ? 174 SER B C     1 
ATOM   4483 O  O     . SER D 2 174 ? -27.485 -13.994 24.906  1.00 68.07  ? 174 SER B O     1 
ATOM   4484 C  CB    . SER D 2 174 ? -30.536 -15.100 24.034  1.00 71.29  ? 174 SER B CB    1 
ATOM   4485 O  OG    . SER D 2 174 ? -29.681 -15.965 23.302  1.00 71.37  ? 174 SER B OG    1 
ATOM   4486 N  N     . VAL D 2 175 ? -28.970 -14.426 26.554  1.00 68.74  ? 175 VAL B N     1 
ATOM   4487 C  CA    . VAL D 2 175 ? -27.980 -14.778 27.563  1.00 70.31  ? 175 VAL B CA    1 
ATOM   4488 C  C     . VAL D 2 175 ? -28.540 -15.979 28.298  1.00 72.00  ? 175 VAL B C     1 
ATOM   4489 O  O     . VAL D 2 175 ? -29.736 -16.018 28.587  1.00 72.74  ? 175 VAL B O     1 
ATOM   4490 C  CB    . VAL D 2 175 ? -27.779 -13.663 28.605  1.00 69.38  ? 175 VAL B CB    1 
ATOM   4491 C  CG1   . VAL D 2 175 ? -26.705 -14.089 29.603  1.00 70.95  ? 175 VAL B CG1   1 
ATOM   4492 C  CG2   . VAL D 2 175 ? -27.394 -12.361 27.923  1.00 72.07  ? 175 VAL B CG2   1 
ATOM   4493 N  N     . GLU D 2 176 ? -27.696 -16.957 28.601  1.00 72.36  ? 176 GLU B N     1 
ATOM   4494 C  CA    . GLU D 2 176 ? -28.174 -18.122 29.322  1.00 75.23  ? 176 GLU B CA    1 
ATOM   4495 C  C     . GLU D 2 176 ? -27.104 -18.766 30.181  1.00 74.51  ? 176 GLU B C     1 
ATOM   4496 O  O     . GLU D 2 176 ? -25.911 -18.632 29.924  1.00 75.62  ? 176 GLU B O     1 
ATOM   4497 C  CB    . GLU D 2 176 ? -28.758 -19.154 28.347  1.00 83.32  ? 176 GLU B CB    1 
ATOM   4498 C  CG    . GLU D 2 176 ? -30.109 -18.765 27.729  1.00 88.43  ? 176 GLU B CG    1 
ATOM   4499 C  CD    . GLU D 2 176 ? -31.229 -18.611 28.763  1.00 94.09  ? 176 GLU B CD    1 
ATOM   4500 O  OE1   . GLU D 2 176 ? -31.624 -19.620 29.397  1.00 93.83  ? 176 GLU B OE1   1 
ATOM   4501 O  OE2   . GLU D 2 176 ? -31.719 -17.474 28.941  1.00 95.91  ? 176 GLU B OE2   1 
ATOM   4502 N  N     . GLY D 2 177 ? -27.550 -19.462 31.217  1.00 74.43  ? 177 GLY B N     1 
ATOM   4503 C  CA    . GLY D 2 177 ? -26.627 -20.136 32.108  1.00 73.04  ? 177 GLY B CA    1 
ATOM   4504 C  C     . GLY D 2 177 ? -26.487 -19.460 33.458  1.00 71.64  ? 177 GLY B C     1 
ATOM   4505 O  O     . GLY D 2 177 ? -27.119 -18.431 33.714  1.00 71.56  ? 177 GLY B O     1 
ATOM   4506 N  N     . PRO D 2 178 ? -25.679 -20.040 34.359  1.00 69.85  ? 178 PRO B N     1 
ATOM   4507 C  CA    . PRO D 2 178 ? -25.474 -19.456 35.684  1.00 67.82  ? 178 PRO B CA    1 
ATOM   4508 C  C     . PRO D 2 178 ? -24.616 -18.208 35.494  1.00 67.80  ? 178 PRO B C     1 
ATOM   4509 O  O     . PRO D 2 178 ? -23.912 -18.088 34.487  1.00 63.07  ? 178 PRO B O     1 
ATOM   4510 C  CB    . PRO D 2 178 ? -24.730 -20.557 36.432  1.00 66.85  ? 178 PRO B CB    1 
ATOM   4511 C  CG    . PRO D 2 178 ? -25.161 -21.802 35.739  1.00 68.66  ? 178 PRO B CG    1 
ATOM   4512 C  CD    . PRO D 2 178 ? -25.102 -21.392 34.300  1.00 68.17  ? 178 PRO B CD    1 
ATOM   4513 N  N     . HIS D 2 179 ? -24.662 -17.288 36.453  1.00 69.33  ? 179 HIS B N     1 
ATOM   4514 C  CA    . HIS D 2 179 ? -23.882 -16.063 36.337  1.00 67.99  ? 179 HIS B CA    1 
ATOM   4515 C  C     . HIS D 2 179 ? -22.376 -16.319 36.263  1.00 66.73  ? 179 HIS B C     1 
ATOM   4516 O  O     . HIS D 2 179 ? -21.649 -15.554 35.637  1.00 65.78  ? 179 HIS B O     1 
ATOM   4517 C  CB    . HIS D 2 179 ? -24.224 -15.104 37.484  1.00 64.31  ? 179 HIS B CB    1 
ATOM   4518 C  CG    . HIS D 2 179 ? -25.631 -14.583 37.433  1.00 70.77  ? 179 HIS B CG    1 
ATOM   4519 N  ND1   . HIS D 2 179 ? -25.978 -13.323 37.875  1.00 70.92  ? 179 HIS B ND1   1 
ATOM   4520 C  CD2   . HIS D 2 179 ? -26.783 -15.161 37.013  1.00 69.75  ? 179 HIS B CD2   1 
ATOM   4521 C  CE1   . HIS D 2 179 ? -27.280 -13.149 37.731  1.00 68.05  ? 179 HIS B CE1   1 
ATOM   4522 N  NE2   . HIS D 2 179 ? -27.792 -14.250 37.211  1.00 69.02  ? 179 HIS B NE2   1 
ATOM   4523 N  N     . HIS D 2 180 ? -21.912 -17.402 36.880  1.00 66.75  ? 180 HIS B N     1 
ATOM   4524 C  CA    . HIS D 2 180 ? -20.491 -17.738 36.863  1.00 68.12  ? 180 HIS B CA    1 
ATOM   4525 C  C     . HIS D 2 180 ? -20.194 -18.628 35.657  1.00 68.07  ? 180 HIS B C     1 
ATOM   4526 O  O     . HIS D 2 180 ? -19.055 -19.046 35.424  1.00 65.00  ? 180 HIS B O     1 
ATOM   4527 C  CB    . HIS D 2 180 ? -20.122 -18.476 38.147  1.00 71.25  ? 180 HIS B CB    1 
ATOM   4528 C  CG    . HIS D 2 180 ? -20.954 -19.696 38.390  1.00 72.14  ? 180 HIS B CG    1 
ATOM   4529 N  ND1   . HIS D 2 180 ? -22.287 -19.627 38.734  1.00 66.61  ? 180 HIS B ND1   1 
ATOM   4530 C  CD2   . HIS D 2 180 ? -20.655 -21.014 38.292  1.00 67.76  ? 180 HIS B CD2   1 
ATOM   4531 C  CE1   . HIS D 2 180 ? -22.773 -20.851 38.837  1.00 69.37  ? 180 HIS B CE1   1 
ATOM   4532 N  NE2   . HIS D 2 180 ? -21.805 -21.710 38.573  1.00 69.68  ? 180 HIS B NE2   1 
ATOM   4533 N  N     . LYS D 2 181 ? -21.233 -18.906 34.885  1.00 69.61  ? 181 LYS B N     1 
ATOM   4534 C  CA    . LYS D 2 181 ? -21.097 -19.759 33.714  1.00 74.19  ? 181 LYS B CA    1 
ATOM   4535 C  C     . LYS D 2 181 ? -22.118 -19.287 32.674  1.00 73.52  ? 181 LYS B C     1 
ATOM   4536 O  O     . LYS D 2 181 ? -23.146 -19.934 32.467  1.00 77.23  ? 181 LYS B O     1 
ATOM   4537 C  CB    . LYS D 2 181 ? -21.377 -21.201 34.147  1.00 79.11  ? 181 LYS B CB    1 
ATOM   4538 C  CG    . LYS D 2 181 ? -20.790 -22.302 33.287  1.00 83.56  ? 181 LYS B CG    1 
ATOM   4539 C  CD    . LYS D 2 181 ? -21.116 -23.653 33.921  1.00 86.02  ? 181 LYS B CD    1 
ATOM   4540 C  CE    . LYS D 2 181 ? -20.534 -24.820 33.147  1.00 88.54  ? 181 LYS B CE    1 
ATOM   4541 N  NZ    . LYS D 2 181 ? -20.871 -26.102 33.826  1.00 88.54  ? 181 LYS B NZ    1 
ATOM   4542 N  N     . LYS D 2 182 ? -21.838 -18.154 32.030  1.00 71.27  ? 182 LYS B N     1 
ATOM   4543 C  CA    . LYS D 2 182 ? -22.752 -17.591 31.036  1.00 68.42  ? 182 LYS B CA    1 
ATOM   4544 C  C     . LYS D 2 182 ? -22.400 -17.930 29.602  1.00 65.05  ? 182 LYS B C     1 
ATOM   4545 O  O     . LYS D 2 182 ? -21.250 -18.235 29.289  1.00 66.49  ? 182 LYS B O     1 
ATOM   4546 C  CB    . LYS D 2 182 ? -22.812 -16.067 31.161  1.00 72.17  ? 182 LYS B CB    1 
ATOM   4547 C  CG    . LYS D 2 182 ? -23.601 -15.548 32.349  1.00 77.14  ? 182 LYS B CG    1 
ATOM   4548 C  CD    . LYS D 2 182 ? -24.030 -14.099 32.129  1.00 78.91  ? 182 LYS B CD    1 
ATOM   4549 C  CE    . LYS D 2 182 ? -24.942 -13.639 33.243  1.00 77.30  ? 182 LYS B CE    1 
ATOM   4550 N  NZ    . LYS D 2 182 ? -24.603 -12.244 33.649  1.00 87.21  ? 182 LYS B NZ    1 
ATOM   4551 N  N     . LYS D 2 183 ? -23.408 -17.872 28.738  1.00 62.22  ? 183 LYS B N     1 
ATOM   4552 C  CA    . LYS D 2 183 ? -23.242 -18.129 27.311  1.00 62.13  ? 183 LYS B CA    1 
ATOM   4553 C  C     . LYS D 2 183 ? -23.979 -17.023 26.583  1.00 59.13  ? 183 LYS B C     1 
ATOM   4554 O  O     . LYS D 2 183 ? -25.180 -16.850 26.770  1.00 61.45  ? 183 LYS B O     1 
ATOM   4555 C  CB    . LYS D 2 183 ? -23.845 -19.468 26.916  1.00 65.28  ? 183 LYS B CB    1 
ATOM   4556 C  CG    . LYS D 2 183 ? -23.763 -19.746 25.421  1.00 69.24  ? 183 LYS B CG    1 
ATOM   4557 C  CD    . LYS D 2 183 ? -24.978 -20.540 24.946  1.00 69.68  ? 183 LYS B CD    1 
ATOM   4558 C  CE    . LYS D 2 183 ? -26.263 -19.744 25.149  1.00 70.79  ? 183 LYS B CE    1 
ATOM   4559 N  NZ    . LYS D 2 183 ? -27.480 -20.531 24.820  1.00 70.24  ? 183 LYS B NZ    1 
ATOM   4560 N  N     . PHE D 2 184 ? -23.258 -16.285 25.748  1.00 58.46  ? 184 PHE B N     1 
ATOM   4561 C  CA    . PHE D 2 184 ? -23.830 -15.162 25.008  1.00 57.98  ? 184 PHE B CA    1 
ATOM   4562 C  C     . PHE D 2 184 ? -24.026 -15.422 23.511  1.00 56.93  ? 184 PHE B C     1 
ATOM   4563 O  O     . PHE D 2 184 ? -23.149 -15.972 22.844  1.00 54.37  ? 184 PHE B O     1 
ATOM   4564 C  CB    . PHE D 2 184 ? -22.924 -13.930 25.170  1.00 64.76  ? 184 PHE B CB    1 
ATOM   4565 C  CG    . PHE D 2 184 ? -22.772 -13.449 26.598  1.00 61.77  ? 184 PHE B CG    1 
ATOM   4566 C  CD1   . PHE D 2 184 ? -23.672 -12.535 27.140  1.00 56.75  ? 184 PHE B CD1   1 
ATOM   4567 C  CD2   . PHE D 2 184 ? -21.717 -13.906 27.391  1.00 60.05  ? 184 PHE B CD2   1 
ATOM   4568 C  CE1   . PHE D 2 184 ? -23.528 -12.080 28.444  1.00 56.87  ? 184 PHE B CE1   1 
ATOM   4569 C  CE2   . PHE D 2 184 ? -21.564 -13.460 28.692  1.00 58.97  ? 184 PHE B CE2   1 
ATOM   4570 C  CZ    . PHE D 2 184 ? -22.472 -12.542 29.223  1.00 61.71  ? 184 PHE B CZ    1 
ATOM   4571 N  N     . ILE D 2 185 ? -25.179 -15.017 22.988  1.00 56.06  ? 185 ILE B N     1 
ATOM   4572 C  CA    . ILE D 2 185 ? -25.473 -15.177 21.564  1.00 59.81  ? 185 ILE B CA    1 
ATOM   4573 C  C     . ILE D 2 185 ? -25.582 -13.777 20.982  1.00 59.74  ? 185 ILE B C     1 
ATOM   4574 O  O     . ILE D 2 185 ? -26.537 -13.047 21.255  1.00 62.76  ? 185 ILE B O     1 
ATOM   4575 C  CB    . ILE D 2 185 ? -26.812 -15.939 21.318  1.00 60.92  ? 185 ILE B CB    1 
ATOM   4576 C  CG1   . ILE D 2 185 ? -26.659 -17.411 21.707  1.00 63.54  ? 185 ILE B CG1   1 
ATOM   4577 C  CG2   . ILE D 2 185 ? -27.206 -15.849 19.855  1.00 55.67  ? 185 ILE B CG2   1 
ATOM   4578 C  CD1   . ILE D 2 185 ? -27.929 -18.243 21.528  1.00 67.67  ? 185 ILE B CD1   1 
ATOM   4579 N  N     . VAL D 2 186 ? -24.596 -13.399 20.181  1.00 59.48  ? 186 VAL B N     1 
ATOM   4580 C  CA    . VAL D 2 186 ? -24.572 -12.071 19.581  1.00 59.45  ? 186 VAL B CA    1 
ATOM   4581 C  C     . VAL D 2 186 ? -24.829 -12.096 18.074  1.00 58.72  ? 186 VAL B C     1 
ATOM   4582 O  O     . VAL D 2 186 ? -24.535 -13.088 17.404  1.00 56.47  ? 186 VAL B O     1 
ATOM   4583 C  CB    . VAL D 2 186 ? -23.196 -11.386 19.835  1.00 59.55  ? 186 VAL B CB    1 
ATOM   4584 C  CG1   . VAL D 2 186 ? -23.135 -10.026 19.118  1.00 61.65  ? 186 VAL B CG1   1 
ATOM   4585 C  CG2   . VAL D 2 186 ? -22.968 -11.219 21.333  1.00 53.42  ? 186 VAL B CG2   1 
ATOM   4586 N  N     . GLU D 2 187 ? -25.393 -11.006 17.554  1.00 59.64  ? 187 GLU B N     1 
ATOM   4587 C  CA    . GLU D 2 187 ? -25.648 -10.883 16.117  1.00 61.73  ? 187 GLU B CA    1 
ATOM   4588 C  C     . GLU D 2 187 ? -24.798 -9.761  15.530  1.00 60.59  ? 187 GLU B C     1 
ATOM   4589 O  O     . GLU D 2 187 ? -24.755 -8.655  16.066  1.00 62.64  ? 187 GLU B O     1 
ATOM   4590 C  CB    . GLU D 2 187 ? -27.119 -10.578 15.816  1.00 61.57  ? 187 GLU B CB    1 
ATOM   4591 C  CG    . GLU D 2 187 ? -27.372 -10.342 14.321  1.00 69.30  ? 187 GLU B CG    1 
ATOM   4592 C  CD    . GLU D 2 187 ? -28.818 -10.003 13.989  1.00 73.76  ? 187 GLU B CD    1 
ATOM   4593 O  OE1   . GLU D 2 187 ? -29.297 -8.929  14.419  1.00 76.72  ? 187 GLU B OE1   1 
ATOM   4594 O  OE2   . GLU D 2 187 ? -29.476 -10.812 13.294  1.00 74.40  ? 187 GLU B OE2   1 
ATOM   4595 N  N     . ALA D 2 188 ? -24.114 -10.062 14.433  1.00 59.10  ? 188 ALA B N     1 
ATOM   4596 C  CA    . ALA D 2 188 ? -23.284 -9.088  13.745  1.00 59.18  ? 188 ALA B CA    1 
ATOM   4597 C  C     . ALA D 2 188 ? -24.075 -8.714  12.499  1.00 63.61  ? 188 ALA B C     1 
ATOM   4598 O  O     . ALA D 2 188 ? -24.676 -9.584  11.858  1.00 62.41  ? 188 ALA B O     1 
ATOM   4599 C  CB    . ALA D 2 188 ? -21.960 -9.713  13.356  1.00 59.83  ? 188 ALA B CB    1 
ATOM   4600 N  N     . LYS D 2 189 ? -24.067 -7.461  12.149  1.00 62.61  ? 189 LYS B N     1 
ATOM   4601 C  CA    . LYS D 2 189 ? -24.838 -7.030  10.998  1.00 63.89  ? 189 LYS B CA    1 
ATOM   4602 C  C     . LYS D 2 189 ? -24.250 -5.792  10.368  1.00 64.25  ? 189 LYS B C     1 
ATOM   4603 O  O     . LYS D 2 189 ? -23.840 -4.842  11.054  1.00 66.12  ? 189 LYS B O     1 
ATOM   4604 C  CB    . LYS D 2 189 ? -26.292 -6.779  11.416  1.00 68.70  ? 189 LYS B CB    1 
ATOM   4605 C  CG    . LYS D 2 189 ? -27.232 -6.500  10.252  1.00 76.02  ? 189 LYS B CG    1 
ATOM   4606 C  CD    . LYS D 2 189 ? -28.684 -6.398  10.696  1.00 76.35  ? 189 LYS B CD    1 
ATOM   4607 C  CE    . LYS D 2 189 ? -29.616 -6.310  9.495   1.00 80.08  ? 189 LYS B CE    1 
ATOM   4608 N  NZ    . LYS D 2 189 ? -29.420 -5.040  8.739   1.00 82.30  ? 189 LYS B NZ    1 
ATOM   4609 N  N     . ILE D 2 190 ? -24.225 -5.808  9.051   1.00 62.26  ? 190 ILE B N     1 
ATOM   4610 C  CA    . ILE D 2 190 ? -23.731 -4.736  8.190   1.00 60.44  ? 190 ILE B CA    1 
ATOM   4611 C  C     . ILE D 2 190 ? -24.587 -4.804  6.915   1.00 65.48  ? 190 ILE B C     1 
ATOM   4612 O  O     . ILE D 2 190 ? -24.608 -5.836  6.245   1.00 61.83  ? 190 ILE B O     1 
ATOM   4613 C  CB    . ILE D 2 190 ? -22.205 -4.848  7.948   1.00 61.37  ? 190 ILE B CB    1 
ATOM   4614 C  CG1   . ILE D 2 190 ? -21.699 -3.625  7.185   1.00 56.28  ? 190 ILE B CG1   1 
ATOM   4615 C  CG2   . ILE D 2 190 ? -21.885 -6.116  7.184   1.00 60.71  ? 190 ILE B CG2   1 
ATOM   4616 C  CD1   . ILE D 2 190 ? -21.802 -2.333  7.968   1.00 57.33  ? 190 ILE B CD1   1 
ATOM   4617 N  N     . LYS D 2 191 ? -25.338 -3.757  6.630   1.00 69.50  ? 191 LYS B N     1 
ATOM   4618 C  CA    . LYS D 2 191 ? -26.221 -3.821  5.471   1.00 70.60  ? 191 LYS B CA    1 
ATOM   4619 C  C     . LYS D 2 191 ? -27.342 -4.807  5.711   1.00 73.15  ? 191 LYS B C     1 
ATOM   4620 O  O     . LYS D 2 191 ? -28.060 -4.732  6.714   1.00 74.10  ? 191 LYS B O     1 
ATOM   4621 C  CB    . LYS D 2 191 ? -25.474 -4.204  4.197   1.00 74.48  ? 191 LYS B CB    1 
ATOM   4622 C  CG    . LYS D 2 191 ? -24.468 -3.160  3.735   1.00 77.81  ? 191 LYS B CG    1 
ATOM   4623 C  CD    . LYS D 2 191 ? -25.095 -1.795  3.505   1.00 81.32  ? 191 LYS B CD    1 
ATOM   4624 C  CE    . LYS D 2 191 ? -24.094 -0.830  2.900   1.00 83.57  ? 191 LYS B CE    1 
ATOM   4625 N  NZ    . LYS D 2 191 ? -24.572 0.578   2.964   1.00 81.28  ? 191 LYS B NZ    1 
ATOM   4626 N  N     . GLU D 2 192 ? -27.478 -5.740  4.801   1.00 74.54  ? 192 GLU B N     1 
ATOM   4627 C  CA    . GLU D 2 192 ? -28.506 -6.725  4.957   1.00 76.65  ? 192 GLU B CA    1 
ATOM   4628 C  C     . GLU D 2 192 ? -27.905 -8.071  5.374   1.00 75.35  ? 192 GLU B C     1 
ATOM   4629 O  O     . GLU D 2 192 ? -28.614 -9.074  5.516   1.00 74.07  ? 192 GLU B O     1 
ATOM   4630 C  CB    . GLU D 2 192 ? -29.303 -6.854  3.666   1.00 78.52  ? 192 GLU B CB    1 
ATOM   4631 C  CG    . GLU D 2 192 ? -30.339 -5.755  3.510   1.00 80.54  ? 192 GLU B CG    1 
ATOM   4632 C  CD    . GLU D 2 192 ? -31.208 -5.547  4.736   1.00 79.07  ? 192 GLU B CD    1 
ATOM   4633 O  OE1   . GLU D 2 192 ? -31.737 -6.543  5.270   1.00 78.32  ? 192 GLU B OE1   1 
ATOM   4634 O  OE2   . GLU D 2 192 ? -31.362 -4.386  5.166   1.00 81.79  ? 192 GLU B OE2   1 
ATOM   4635 N  N     . TYR D 2 193 ? -26.586 -8.102  5.581   1.00 77.41  ? 193 TYR B N     1 
ATOM   4636 C  CA    . TYR D 2 193 ? -25.945 -9.320  5.985   1.00 80.42  ? 193 TYR B CA    1 
ATOM   4637 C  C     . TYR D 2 193 ? -26.006 -9.478  7.505   1.00 80.13  ? 193 TYR B C     1 
ATOM   4638 O  O     . TYR D 2 193 ? -25.680 -8.552  8.254   1.00 81.34  ? 193 TYR B O     1 
ATOM   4639 C  CB    . TYR D 2 193 ? -24.492 -9.348  5.506   1.00 85.40  ? 193 TYR B CB    1 
ATOM   4640 C  CG    . TYR D 2 193 ? -24.369 -9.383  4.004   1.00 90.49  ? 193 TYR B CG    1 
ATOM   4641 C  CD1   . TYR D 2 193 ? -24.802 -8.309  3.226   1.00 94.06  ? 193 TYR B CD1   1 
ATOM   4642 C  CD2   . TYR D 2 193 ? -23.864 -10.508 3.355   1.00 93.62  ? 193 TYR B CD2   1 
ATOM   4643 C  CE1   . TYR D 2 193 ? -24.741 -8.355  1.836   1.00 96.80  ? 193 TYR B CE1   1 
ATOM   4644 C  CE2   . TYR D 2 193 ? -23.796 -10.569 1.968   1.00 96.62  ? 193 TYR B CE2   1 
ATOM   4645 C  CZ    . TYR D 2 193 ? -24.236 -9.490  1.214   1.00 98.90  ? 193 TYR B CZ    1 
ATOM   4646 O  OH    . TYR D 2 193 ? -24.167 -9.545  -0.160  1.00 100.35 ? 193 TYR B OH    1 
ATOM   4647 N  N     . ARG D 2 194 ? -26.433 -10.655 7.950   1.00 78.29  ? 194 ARG B N     1 
ATOM   4648 C  CA    . ARG D 2 194 ? -26.567 -10.946 9.374   1.00 76.45  ? 194 ARG B CA    1 
ATOM   4649 C  C     . ARG D 2 194 ? -25.918 -12.281 9.703   1.00 75.34  ? 194 ARG B C     1 
ATOM   4650 O  O     . ARG D 2 194 ? -25.956 -13.210 8.899   1.00 76.39  ? 194 ARG B O     1 
ATOM   4651 C  CB    . ARG D 2 194 ? -28.048 -10.989 9.791   1.00 77.64  ? 194 ARG B CB    1 
ATOM   4652 C  CG    . ARG D 2 194 ? -28.832 -9.731  9.467   1.00 82.54  ? 194 ARG B CG    1 
ATOM   4653 C  CD    . ARG D 2 194 ? -30.303 -10.042 9.324   1.00 85.98  ? 194 ARG B CD    1 
ATOM   4654 N  NE    . ARG D 2 194 ? -31.152 -8.879  9.574   1.00 88.70  ? 194 ARG B NE    1 
ATOM   4655 C  CZ    . ARG D 2 194 ? -31.433 -8.380  10.775  1.00 94.35  ? 194 ARG B CZ    1 
ATOM   4656 N  NH1   . ARG D 2 194 ? -30.930 -8.947  11.862  1.00 96.76  ? 194 ARG B NH1   1 
ATOM   4657 N  NH2   . ARG D 2 194 ? -32.214 -7.312  10.893  1.00 97.18  ? 194 ARG B NH2   1 
ATOM   4658 N  N     . THR D 2 195 ? -25.317 -12.333 10.918  1.00 73.73  ? 195 THR B N     1 
ATOM   4659 C  CA    . THR D 2 195 ? -24.671 -13.555 11.376  1.00 70.21  ? 195 THR B CA    1 
ATOM   4660 C  C     . THR D 2 195 ? -24.702 -13.597 12.895  1.00 69.67  ? 195 THR B C     1 
ATOM   4661 O  O     . THR D 2 195 ? -24.767 -12.556 13.555  1.00 69.85  ? 195 THR B O     1 
ATOM   4662 C  CB    . THR D 2 195 ? -23.209 -13.644 10.893  1.00 71.74  ? 195 THR B CB    1 
ATOM   4663 O  OG1   . THR D 2 195 ? -22.642 -12.329 10.831  1.00 73.01  ? 195 THR B OG1   1 
ATOM   4664 C  CG2   . THR D 2 195 ? -23.139 -14.304 9.527   1.00 72.86  ? 195 THR B CG2   1 
ATOM   4665 N  N     . LEU D 2 196 ? -24.677 -14.803 13.447  1.00 64.82  ? 196 LEU B N     1 
ATOM   4666 C  CA    . LEU D 2 196 ? -24.699 -14.960 14.891  1.00 61.51  ? 196 LEU B CA    1 
ATOM   4667 C  C     . LEU D 2 196 ? -23.367 -15.477 15.384  1.00 57.47  ? 196 LEU B C     1 
ATOM   4668 O  O     . LEU D 2 196 ? -22.534 -15.895 14.589  1.00 56.83  ? 196 LEU B O     1 
ATOM   4669 C  CB    . LEU D 2 196 ? -25.819 -15.915 15.313  1.00 58.71  ? 196 LEU B CB    1 
ATOM   4670 C  CG    . LEU D 2 196 ? -27.245 -15.470 14.981  1.00 55.39  ? 196 LEU B CG    1 
ATOM   4671 C  CD1   . LEU D 2 196 ? -28.213 -16.339 15.767  1.00 60.51  ? 196 LEU B CD1   1 
ATOM   4672 C  CD2   . LEU D 2 196 ? -27.451 -14.003 15.343  1.00 55.32  ? 196 LEU B CD2   1 
ATOM   4673 N  N     . GLY D 2 197 ? -23.170 -15.423 16.699  1.00 56.21  ? 197 GLY B N     1 
ATOM   4674 C  CA    . GLY D 2 197 ? -21.935 -15.893 17.300  1.00 54.31  ? 197 GLY B CA    1 
ATOM   4675 C  C     . GLY D 2 197 ? -22.176 -16.108 18.774  1.00 55.67  ? 197 GLY B C     1 
ATOM   4676 O  O     . GLY D 2 197 ? -23.035 -15.431 19.349  1.00 53.35  ? 197 GLY B O     1 
ATOM   4677 N  N     . GLU D 2 198 ? -21.465 -17.058 19.385  1.00 55.79  ? 198 GLU B N     1 
ATOM   4678 C  CA    . GLU D 2 198 ? -21.628 -17.303 20.818  1.00 64.02  ? 198 GLU B CA    1 
ATOM   4679 C  C     . GLU D 2 198 ? -20.319 -17.601 21.529  1.00 63.86  ? 198 GLU B C     1 
ATOM   4680 O  O     . GLU D 2 198 ? -19.354 -18.066 20.925  1.00 67.94  ? 198 GLU B O     1 
ATOM   4681 C  CB    . GLU D 2 198 ? -22.626 -18.436 21.094  1.00 71.19  ? 198 GLU B CB    1 
ATOM   4682 C  CG    . GLU D 2 198 ? -22.187 -19.822 20.647  1.00 85.72  ? 198 GLU B CG    1 
ATOM   4683 C  CD    . GLU D 2 198 ? -23.141 -20.923 21.125  1.00 92.61  ? 198 GLU B CD    1 
ATOM   4684 O  OE1   . GLU D 2 198 ? -24.366 -20.799 20.888  1.00 92.42  ? 198 GLU B OE1   1 
ATOM   4685 O  OE2   . GLU D 2 198 ? -22.663 -21.913 21.733  1.00 89.63  ? 198 GLU B OE2   1 
ATOM   4686 N  N     . GLY D 2 199 ? -20.291 -17.316 22.824  1.00 63.23  ? 199 GLY B N     1 
ATOM   4687 C  CA    . GLY D 2 199 ? -19.092 -17.546 23.606  1.00 58.85  ? 199 GLY B CA    1 
ATOM   4688 C  C     . GLY D 2 199 ? -19.346 -17.183 25.050  1.00 57.29  ? 199 GLY B C     1 
ATOM   4689 O  O     . GLY D 2 199 ? -20.428 -16.672 25.376  1.00 53.62  ? 199 GLY B O     1 
ATOM   4690 N  N     . LYS D 2 200 ? -18.350 -17.432 25.902  1.00 56.41  ? 200 LYS B N     1 
ATOM   4691 C  CA    . LYS D 2 200 ? -18.454 -17.149 27.333  1.00 55.71  ? 200 LYS B CA    1 
ATOM   4692 C  C     . LYS D 2 200 ? -18.604 -15.663 27.703  1.00 50.93  ? 200 LYS B C     1 
ATOM   4693 O  O     . LYS D 2 200 ? -18.844 -15.329 28.867  1.00 51.35  ? 200 LYS B O     1 
ATOM   4694 C  CB    . LYS D 2 200 ? -17.261 -17.764 28.083  1.00 55.75  ? 200 LYS B CB    1 
ATOM   4695 C  CG    . LYS D 2 200 ? -15.895 -17.309 27.620  1.00 58.20  ? 200 LYS B CG    1 
ATOM   4696 C  CD    . LYS D 2 200 ? -14.817 -17.653 28.649  1.00 59.68  ? 200 LYS B CD    1 
ATOM   4697 C  CE    . LYS D 2 200 ? -13.463 -17.074 28.234  1.00 62.34  ? 200 LYS B CE    1 
ATOM   4698 N  NZ    . LYS D 2 200 ? -12.449 -17.082 29.322  1.00 59.54  ? 200 LYS B NZ    1 
ATOM   4699 N  N     . SER D 2 201 ? -18.468 -14.781 26.718  1.00 45.74  ? 201 SER B N     1 
ATOM   4700 C  CA    . SER D 2 201 ? -18.612 -13.341 26.946  1.00 48.16  ? 201 SER B CA    1 
ATOM   4701 C  C     . SER D 2 201 ? -19.156 -12.650 25.692  1.00 45.37  ? 201 SER B C     1 
ATOM   4702 O  O     . SER D 2 201 ? -19.158 -13.245 24.618  1.00 48.44  ? 201 SER B O     1 
ATOM   4703 C  CB    . SER D 2 201 ? -17.263 -12.715 27.337  1.00 42.70  ? 201 SER B CB    1 
ATOM   4704 O  OG    . SER D 2 201 ? -16.317 -12.781 26.287  1.00 41.87  ? 201 SER B OG    1 
ATOM   4705 N  N     . LYS D 2 202 ? -19.622 -11.411 25.829  1.00 43.95  ? 202 LYS B N     1 
ATOM   4706 C  CA    . LYS D 2 202 ? -20.134 -10.663 24.682  1.00 46.15  ? 202 LYS B CA    1 
ATOM   4707 C  C     . LYS D 2 202 ? -19.043 -10.561 23.636  1.00 49.95  ? 202 LYS B C     1 
ATOM   4708 O  O     . LYS D 2 202 ? -19.240 -10.946 22.488  1.00 53.40  ? 202 LYS B O     1 
ATOM   4709 C  CB    . LYS D 2 202 ? -20.525 -9.230  25.047  1.00 45.07  ? 202 LYS B CB    1 
ATOM   4710 C  CG    . LYS D 2 202 ? -21.772 -9.043  25.881  1.00 50.20  ? 202 LYS B CG    1 
ATOM   4711 C  CD    . LYS D 2 202 ? -22.087 -7.549  25.977  1.00 50.60  ? 202 LYS B CD    1 
ATOM   4712 C  CE    . LYS D 2 202 ? -23.294 -7.250  26.868  1.00 53.92  ? 202 LYS B CE    1 
ATOM   4713 N  NZ    . LYS D 2 202 ? -23.621 -5.781  26.892  1.00 49.57  ? 202 LYS B NZ    1 
ATOM   4714 N  N     . LYS D 2 203 ? -17.884 -10.037 24.030  1.00 51.87  ? 203 LYS B N     1 
ATOM   4715 C  CA    . LYS D 2 203 ? -16.799 -9.874  23.076  1.00 52.40  ? 203 LYS B CA    1 
ATOM   4716 C  C     . LYS D 2 203 ? -16.394 -11.198 22.423  1.00 52.49  ? 203 LYS B C     1 
ATOM   4717 O  O     . LYS D 2 203 ? -16.241 -11.254 21.196  1.00 52.04  ? 203 LYS B O     1 
ATOM   4718 C  CB    . LYS D 2 203 ? -15.581 -9.171  23.721  1.00 54.75  ? 203 LYS B CB    1 
ATOM   4719 C  CG    . LYS D 2 203 ? -14.666 -10.047 24.574  1.00 60.76  ? 203 LYS B CG    1 
ATOM   4720 C  CD    . LYS D 2 203 ? -13.299 -9.388  24.758  1.00 63.24  ? 203 LYS B CD    1 
ATOM   4721 C  CE    . LYS D 2 203 ? -12.356 -10.243 25.615  1.00 69.04  ? 203 LYS B CE    1 
ATOM   4722 N  NZ    . LYS D 2 203 ? -12.061 -11.600 25.045  1.00 70.57  ? 203 LYS B NZ    1 
ATOM   4723 N  N     . GLU D 2 204 ? -16.229 -12.266 23.204  1.00 49.36  ? 204 GLU B N     1 
ATOM   4724 C  CA    . GLU D 2 204 ? -15.854 -13.525 22.582  1.00 52.90  ? 204 GLU B CA    1 
ATOM   4725 C  C     . GLU D 2 204 ? -16.929 -13.892 21.565  1.00 53.41  ? 204 GLU B C     1 
ATOM   4726 O  O     . GLU D 2 204 ? -16.616 -14.327 20.455  1.00 55.27  ? 204 GLU B O     1 
ATOM   4727 C  CB    . GLU D 2 204 ? -15.707 -14.651 23.608  1.00 59.97  ? 204 GLU B CB    1 
ATOM   4728 C  CG    . GLU D 2 204 ? -15.196 -15.965 22.980  1.00 62.72  ? 204 GLU B CG    1 
ATOM   4729 C  CD    . GLU D 2 204 ? -14.935 -17.082 23.995  1.00 68.46  ? 204 GLU B CD    1 
ATOM   4730 O  OE1   . GLU D 2 204 ? -15.901 -17.538 24.652  1.00 69.01  ? 204 GLU B OE1   1 
ATOM   4731 O  OE2   . GLU D 2 204 ? -13.761 -17.507 24.130  1.00 66.09  ? 204 GLU B OE2   1 
ATOM   4732 N  N     . ALA D 2 205 ? -18.193 -13.698 21.940  1.00 50.66  ? 205 ALA B N     1 
ATOM   4733 C  CA    . ALA D 2 205 ? -19.320 -13.996 21.051  1.00 49.99  ? 205 ALA B CA    1 
ATOM   4734 C  C     . ALA D 2 205 ? -19.393 -13.027 19.874  1.00 53.52  ? 205 ALA B C     1 
ATOM   4735 O  O     . ALA D 2 205 ? -19.718 -13.434 18.762  1.00 56.42  ? 205 ALA B O     1 
ATOM   4736 C  CB    . ALA D 2 205 ? -20.616 -13.953 21.824  1.00 53.79  ? 205 ALA B CB    1 
ATOM   4737 N  N     . GLU D 2 206 ? -19.110 -11.747 20.119  1.00 52.47  ? 206 GLU B N     1 
ATOM   4738 C  CA    . GLU D 2 206 ? -19.127 -10.753 19.057  1.00 53.25  ? 206 GLU B CA    1 
ATOM   4739 C  C     . GLU D 2 206 ? -18.013 -11.100 18.074  1.00 57.36  ? 206 GLU B C     1 
ATOM   4740 O  O     . GLU D 2 206 ? -18.151 -10.867 16.871  1.00 59.92  ? 206 GLU B O     1 
ATOM   4741 C  CB    . GLU D 2 206 ? -18.899 -9.340  19.613  1.00 55.86  ? 206 GLU B CB    1 
ATOM   4742 C  CG    . GLU D 2 206 ? -19.956 -8.851  20.613  1.00 59.16  ? 206 GLU B CG    1 
ATOM   4743 C  CD    . GLU D 2 206 ? -19.603 -7.507  21.262  1.00 60.38  ? 206 GLU B CD    1 
ATOM   4744 O  OE1   . GLU D 2 206 ? -18.431 -7.312  21.645  1.00 64.51  ? 206 GLU B OE1   1 
ATOM   4745 O  OE2   . GLU D 2 206 ? -20.496 -6.648  21.410  1.00 59.82  ? 206 GLU B OE2   1 
ATOM   4746 N  N     . GLN D 2 207 ? -16.913 -11.656 18.590  1.00 59.59  ? 207 GLN B N     1 
ATOM   4747 C  CA    . GLN D 2 207 ? -15.761 -12.059 17.767  1.00 60.16  ? 207 GLN B CA    1 
ATOM   4748 C  C     . GLN D 2 207 ? -16.128 -13.194 16.827  1.00 59.29  ? 207 GLN B C     1 
ATOM   4749 O  O     . GLN D 2 207 ? -15.916 -13.104 15.620  1.00 62.08  ? 207 GLN B O     1 
ATOM   4750 C  CB    . GLN D 2 207 ? -14.598 -12.499 18.657  1.00 62.64  ? 207 GLN B CB    1 
ATOM   4751 C  CG    . GLN D 2 207 ? -13.777 -11.352 19.196  1.00 64.66  ? 207 GLN B CG    1 
ATOM   4752 C  CD    . GLN D 2 207 ? -12.930 -10.726 18.118  1.00 68.18  ? 207 GLN B CD    1 
ATOM   4753 O  OE1   . GLN D 2 207 ? -13.416 -10.459 17.019  1.00 69.32  ? 207 GLN B OE1   1 
ATOM   4754 N  NE2   . GLN D 2 207 ? -11.656 -10.485 18.420  1.00 68.42  ? 207 GLN B NE2   1 
ATOM   4755 N  N     . ARG D 2 208 ? -16.671 -14.265 17.394  1.00 58.97  ? 208 ARG B N     1 
ATOM   4756 C  CA    . ARG D 2 208 ? -17.093 -15.418 16.610  1.00 60.45  ? 208 ARG B CA    1 
ATOM   4757 C  C     . ARG D 2 208 ? -18.088 -14.953 15.545  1.00 57.08  ? 208 ARG B C     1 
ATOM   4758 O  O     . ARG D 2 208 ? -17.970 -15.319 14.378  1.00 56.72  ? 208 ARG B O     1 
ATOM   4759 C  CB    . ARG D 2 208 ? -17.735 -16.471 17.528  1.00 65.60  ? 208 ARG B CB    1 
ATOM   4760 C  CG    . ARG D 2 208 ? -16.855 -17.690 17.835  1.00 70.47  ? 208 ARG B CG    1 
ATOM   4761 C  CD    . ARG D 2 208 ? -15.448 -17.304 18.310  1.00 73.82  ? 208 ARG B CD    1 
ATOM   4762 N  NE    . ARG D 2 208 ? -14.603 -18.473 18.576  1.00 76.64  ? 208 ARG B NE    1 
ATOM   4763 C  CZ    . ARG D 2 208 ? -14.796 -19.338 19.573  1.00 75.88  ? 208 ARG B CZ    1 
ATOM   4764 N  NH1   . ARG D 2 208 ? -15.809 -19.178 20.418  1.00 73.36  ? 208 ARG B NH1   1 
ATOM   4765 N  NH2   . ARG D 2 208 ? -13.973 -20.368 19.727  1.00 70.13  ? 208 ARG B NH2   1 
ATOM   4766 N  N     . ALA D 2 209 ? -19.053 -14.131 15.944  1.00 51.98  ? 209 ALA B N     1 
ATOM   4767 C  CA    . ALA D 2 209 ? -20.039 -13.630 14.999  1.00 52.23  ? 209 ALA B CA    1 
ATOM   4768 C  C     . ALA D 2 209 ? -19.353 -12.849 13.878  1.00 53.89  ? 209 ALA B C     1 
ATOM   4769 O  O     . ALA D 2 209 ? -19.770 -12.915 12.726  1.00 58.16  ? 209 ALA B O     1 
ATOM   4770 C  CB    . ALA D 2 209 ? -21.031 -12.749 15.708  1.00 55.00  ? 209 ALA B CB    1 
ATOM   4771 N  N     . ALA D 2 210 ? -18.289 -12.128 14.214  1.00 52.59  ? 210 ALA B N     1 
ATOM   4772 C  CA    . ALA D 2 210 ? -17.556 -11.331 13.241  1.00 49.06  ? 210 ALA B CA    1 
ATOM   4773 C  C     . ALA D 2 210 ? -16.739 -12.155 12.265  1.00 50.69  ? 210 ALA B C     1 
ATOM   4774 O  O     . ALA D 2 210 ? -16.602 -11.780 11.103  1.00 53.86  ? 210 ALA B O     1 
ATOM   4775 C  CB    . ALA D 2 210 ? -16.658 -10.354 13.954  1.00 56.81  ? 210 ALA B CB    1 
ATOM   4776 N  N     . GLU D 2 211 ? -16.163 -13.259 12.718  1.00 52.21  ? 211 GLU B N     1 
ATOM   4777 C  CA    . GLU D 2 211 ? -15.389 -14.090 11.795  1.00 57.52  ? 211 GLU B CA    1 
ATOM   4778 C  C     . GLU D 2 211 ? -16.317 -14.630 10.702  1.00 59.42  ? 211 GLU B C     1 
ATOM   4779 O  O     . GLU D 2 211 ? -15.968 -14.645 9.520   1.00 56.14  ? 211 GLU B O     1 
ATOM   4780 C  CB    . GLU D 2 211 ? -14.737 -15.273 12.518  1.00 56.36  ? 211 GLU B CB    1 
ATOM   4781 C  CG    . GLU D 2 211 ? -14.593 -16.502 11.623  1.00 64.12  ? 211 GLU B CG    1 
ATOM   4782 C  CD    . GLU D 2 211 ? -13.718 -17.584 12.226  1.00 69.90  ? 211 GLU B CD    1 
ATOM   4783 O  OE1   . GLU D 2 211 ? -13.838 -17.842 13.443  1.00 72.88  ? 211 GLU B OE1   1 
ATOM   4784 O  OE2   . GLU D 2 211 ? -12.915 -18.185 11.475  1.00 71.89  ? 211 GLU B OE2   1 
ATOM   4785 N  N     . GLU D 2 212 ? -17.495 -15.079 11.126  1.00 61.30  ? 212 GLU B N     1 
ATOM   4786 C  CA    . GLU D 2 212 ? -18.503 -15.622 10.230  1.00 66.86  ? 212 GLU B CA    1 
ATOM   4787 C  C     . GLU D 2 212 ? -19.022 -14.560 9.258   1.00 67.06  ? 212 GLU B C     1 
ATOM   4788 O  O     . GLU D 2 212 ? -19.384 -14.877 8.123   1.00 69.02  ? 212 GLU B O     1 
ATOM   4789 C  CB    . GLU D 2 212 ? -19.674 -16.197 11.042  1.00 71.94  ? 212 GLU B CB    1 
ATOM   4790 C  CG    . GLU D 2 212 ? -19.282 -17.333 11.999  1.00 87.75  ? 212 GLU B CG    1 
ATOM   4791 C  CD    . GLU D 2 212 ? -19.290 -18.721 11.351  1.00 94.73  ? 212 GLU B CD    1 
ATOM   4792 O  OE1   . GLU D 2 212 ? -20.396 -19.265 11.118  1.00 96.76  ? 212 GLU B OE1   1 
ATOM   4793 O  OE2   . GLU D 2 212 ? -18.193 -19.267 11.078  1.00 95.84  ? 212 GLU B OE2   1 
ATOM   4794 N  N     . LEU D 2 213 ? -19.077 -13.302 9.682   1.00 62.45  ? 213 LEU B N     1 
ATOM   4795 C  CA    . LEU D 2 213 ? -19.561 -12.290 8.761   1.00 61.46  ? 213 LEU B CA    1 
ATOM   4796 C  C     . LEU D 2 213 ? -18.482 -12.006 7.731   1.00 61.81  ? 213 LEU B C     1 
ATOM   4797 O  O     . LEU D 2 213 ? -18.779 -11.752 6.565   1.00 64.00  ? 213 LEU B O     1 
ATOM   4798 C  CB    . LEU D 2 213 ? -19.978 -11.007 9.486   1.00 59.90  ? 213 LEU B CB    1 
ATOM   4799 C  CG    . LEU D 2 213 ? -20.736 -10.045 8.549   1.00 60.53  ? 213 LEU B CG    1 
ATOM   4800 C  CD1   . LEU D 2 213 ? -21.842 -10.801 7.825   1.00 57.50  ? 213 LEU B CD1   1 
ATOM   4801 C  CD2   . LEU D 2 213 ? -21.321 -8.873  9.325   1.00 53.20  ? 213 LEU B CD2   1 
ATOM   4802 N  N     . ILE D 2 214 ? -17.226 -12.061 8.157   1.00 63.39  ? 214 ILE B N     1 
ATOM   4803 C  CA    . ILE D 2 214 ? -16.118 -11.841 7.241   1.00 63.28  ? 214 ILE B CA    1 
ATOM   4804 C  C     . ILE D 2 214 ? -16.202 -12.888 6.129   1.00 67.30  ? 214 ILE B C     1 
ATOM   4805 O  O     . ILE D 2 214 ? -16.188 -12.551 4.950   1.00 70.97  ? 214 ILE B O     1 
ATOM   4806 C  CB    . ILE D 2 214 ? -14.769 -11.973 7.958   1.00 65.03  ? 214 ILE B CB    1 
ATOM   4807 C  CG1   . ILE D 2 214 ? -14.512 -10.728 8.815   1.00 66.34  ? 214 ILE B CG1   1 
ATOM   4808 C  CG2   . ILE D 2 214 ? -13.660 -12.176 6.940   1.00 68.71  ? 214 ILE B CG2   1 
ATOM   4809 C  CD1   . ILE D 2 214 ? -13.152 -10.710 9.496   1.00 53.43  ? 214 ILE B CD1   1 
ATOM   4810 N  N     . LYS D 2 215 ? -16.287 -14.162 6.500   1.00 70.46  ? 215 LYS B N     1 
ATOM   4811 C  CA    . LYS D 2 215 ? -16.394 -15.220 5.501   1.00 70.02  ? 215 LYS B CA    1 
ATOM   4812 C  C     . LYS D 2 215 ? -17.709 -15.082 4.750   1.00 70.32  ? 215 LYS B C     1 
ATOM   4813 O  O     . LYS D 2 215 ? -17.783 -15.373 3.567   1.00 73.54  ? 215 LYS B O     1 
ATOM   4814 C  CB    . LYS D 2 215 ? -16.318 -16.601 6.153   1.00 71.86  ? 215 LYS B CB    1 
ATOM   4815 C  CG    . LYS D 2 215 ? -14.928 -16.979 6.643   1.00 81.44  ? 215 LYS B CG    1 
ATOM   4816 C  CD    . LYS D 2 215 ? -14.914 -18.353 7.304   1.00 82.07  ? 215 LYS B CD    1 
ATOM   4817 C  CE    . LYS D 2 215 ? -13.511 -18.725 7.765   1.00 83.34  ? 215 LYS B CE    1 
ATOM   4818 N  NZ    . LYS D 2 215 ? -13.475 -20.049 8.452   1.00 83.83  ? 215 LYS B NZ    1 
ATOM   4819 N  N     . LEU D 2 216 ? -18.751 -14.633 5.433   1.00 70.83  ? 216 LEU B N     1 
ATOM   4820 C  CA    . LEU D 2 216 ? -20.033 -14.463 4.778   1.00 75.33  ? 216 LEU B CA    1 
ATOM   4821 C  C     . LEU D 2 216 ? -19.951 -13.388 3.699   1.00 80.40  ? 216 LEU B C     1 
ATOM   4822 O  O     . LEU D 2 216 ? -20.786 -13.342 2.799   1.00 82.45  ? 216 LEU B O     1 
ATOM   4823 C  CB    . LEU D 2 216 ? -21.102 -14.086 5.797   1.00 75.61  ? 216 LEU B CB    1 
ATOM   4824 C  CG    . LEU D 2 216 ? -22.481 -13.824 5.202   1.00 73.84  ? 216 LEU B CG    1 
ATOM   4825 C  CD1   . LEU D 2 216 ? -22.909 -15.025 4.375   1.00 73.44  ? 216 LEU B CD1   1 
ATOM   4826 C  CD2   . LEU D 2 216 ? -23.476 -13.544 6.320   1.00 74.90  ? 216 LEU B CD2   1 
ATOM   4827 N  N     . LEU D 2 217 ? -18.948 -12.517 3.795   1.00 83.82  ? 217 LEU B N     1 
ATOM   4828 C  CA    . LEU D 2 217 ? -18.758 -11.454 2.808   1.00 84.88  ? 217 LEU B CA    1 
ATOM   4829 C  C     . LEU D 2 217 ? -17.702 -11.827 1.778   1.00 86.66  ? 217 LEU B C     1 
ATOM   4830 O  O     . LEU D 2 217 ? -17.772 -11.405 0.626   1.00 87.36  ? 217 LEU B O     1 
ATOM   4831 C  CB    . LEU D 2 217 ? -18.358 -10.141 3.482   1.00 82.29  ? 217 LEU B CB    1 
ATOM   4832 C  CG    . LEU D 2 217 ? -19.453 -9.373  4.223   1.00 84.31  ? 217 LEU B CG    1 
ATOM   4833 C  CD1   . LEU D 2 217 ? -18.942 -7.976  4.540   1.00 80.45  ? 217 LEU B CD1   1 
ATOM   4834 C  CD2   . LEU D 2 217 ? -20.711 -9.283  3.365   1.00 85.06  ? 217 LEU B CD2   1 
ATOM   4835 N  N     . GLU D 2 218 ? -16.715 -12.609 2.199   1.00 90.12  ? 218 GLU B N     1 
ATOM   4836 C  CA    . GLU D 2 218 ? -15.660 -13.051 1.297   1.00 94.22  ? 218 GLU B CA    1 
ATOM   4837 C  C     . GLU D 2 218 ? -16.361 -13.899 0.238   1.00 96.40  ? 218 GLU B C     1 
ATOM   4838 O  O     . GLU D 2 218 ? -15.812 -14.183 -0.824  1.00 98.20  ? 218 GLU B O     1 
ATOM   4839 C  CB    . GLU D 2 218 ? -14.637 -13.894 2.070   1.00 95.08  ? 218 GLU B CB    1 
ATOM   4840 C  CG    . GLU D 2 218 ? -13.297 -14.133 1.366   1.00 102.36 ? 218 GLU B CG    1 
ATOM   4841 C  CD    . GLU D 2 218 ? -13.398 -15.050 0.153   1.00 106.39 ? 218 GLU B CD    1 
ATOM   4842 O  OE1   . GLU D 2 218 ? -14.026 -16.126 0.265   1.00 108.16 ? 218 GLU B OE1   1 
ATOM   4843 O  OE2   . GLU D 2 218 ? -12.837 -14.699 -0.911  1.00 107.85 ? 218 GLU B OE2   1 
ATOM   4844 N  N     . GLU D 2 219 ? -17.599 -14.276 0.542   1.00 97.21  ? 219 GLU B N     1 
ATOM   4845 C  CA    . GLU D 2 219 ? -18.415 -15.104 -0.335  1.00 99.05  ? 219 GLU B CA    1 
ATOM   4846 C  C     . GLU D 2 219 ? -19.548 -14.325 -1.014  1.00 100.09 ? 219 GLU B C     1 
ATOM   4847 O  O     . GLU D 2 219 ? -20.203 -14.835 -1.924  1.00 98.97  ? 219 GLU B O     1 
ATOM   4848 C  CB    . GLU D 2 219 ? -19.002 -16.256 0.485   1.00 100.13 ? 219 GLU B CB    1 
ATOM   4849 C  CG    . GLU D 2 219 ? -19.896 -17.213 -0.279  1.00 103.22 ? 219 GLU B CG    1 
ATOM   4850 C  CD    . GLU D 2 219 ? -20.531 -18.248 0.630   1.00 104.88 ? 219 GLU B CD    1 
ATOM   4851 O  OE1   . GLU D 2 219 ? -21.342 -17.858 1.500   1.00 103.39 ? 219 GLU B OE1   1 
ATOM   4852 O  OE2   . GLU D 2 219 ? -20.216 -19.448 0.479   1.00 106.84 ? 219 GLU B OE2   1 
ATOM   4853 N  N     . SER D 2 220 ? -19.770 -13.088 -0.578  1.00 102.15 ? 220 SER B N     1 
ATOM   4854 C  CA    . SER D 2 220 ? -20.842 -12.266 -1.139  1.00 102.06 ? 220 SER B CA    1 
ATOM   4855 C  C     . SER D 2 220 ? -20.496 -10.770 -1.228  1.00 100.97 ? 220 SER B C     1 
ATOM   4856 O  O     . SER D 2 220 ? -20.523 -10.229 -2.356  1.00 98.90  ? 220 SER B O     1 
ATOM   4857 C  CB    . SER D 2 220 ? -22.110 -12.464 -0.299  1.00 102.90 ? 220 SER B CB    1 
ATOM   4858 O  OG    . SER D 2 220 ? -23.206 -11.750 -0.835  1.00 106.48 ? 220 SER B OG    1 
HETATM 4859 MG MG    . MG  E 3 .   ? 0.108   7.586   20.596  1.00 61.96  ? 202 MG  C MG    1 
HETATM 4860 MG MG    . MG  F 3 .   ? -3.270  -6.128  37.311  1.00 54.20  ? 206 MG  D MG    1 
HETATM 4861 MG MG    . MG  G 3 .   ? 0.217   -4.919  38.730  1.00 75.62  ? 208 MG  D MG    1 
HETATM 4862 MG MG    . MG  H 3 .   ? 4.546   8.656   27.262  1.00 54.84  ? 222 MG  A MG    1 
HETATM 4863 MG MG    . MG  I 3 .   ? 4.719   9.791   23.434  1.00 54.70  ? 223 MG  A MG    1 
HETATM 4864 MG MG    . MG  J 3 .   ? 5.621   5.751   20.644  1.00 47.47  ? 224 MG  A MG    1 
HETATM 4865 MG MG    . MG  K 3 .   ? 2.708   -6.943  33.166  1.00 71.23  ? 222 MG  B MG    1 
HETATM 4866 MG MG    . MG  L 3 .   ? 1.405   -8.730  36.249  1.00 57.74  ? 223 MG  B MG    1 
HETATM 4867 O  O     . HOH M 4 .   ? 1.940   15.993  17.258  1.00 50.39  ? 203 HOH C O     1 
HETATM 4868 O  O     . HOH M 4 .   ? -16.588 13.208  10.513  1.00 46.16  ? 204 HOH C O     1 
HETATM 4869 O  O     . HOH M 4 .   ? -10.548 21.532  15.240  1.00 60.16  ? 205 HOH C O     1 
HETATM 4870 O  O     . HOH M 4 .   ? -1.834  -8.351  24.775  1.00 78.36  ? 206 HOH C O     1 
HETATM 4871 O  O     . HOH M 4 .   ? 1.319   10.299  26.479  1.00 55.60  ? 207 HOH C O     1 
HETATM 4872 O  O     . HOH M 4 .   ? -3.805  4.890   12.879  1.00 53.84  ? 208 HOH C O     1 
HETATM 4873 O  O     . HOH M 4 .   ? -10.439 9.395   17.966  1.00 51.88  ? 209 HOH C O     1 
HETATM 4874 O  O     . HOH M 4 .   ? -7.311  8.370   17.384  1.00 40.73  ? 210 HOH C O     1 
HETATM 4875 O  O     . HOH M 4 .   ? 1.589   7.660   10.074  1.00 51.06  ? 211 HOH C O     1 
HETATM 4876 O  O     . HOH M 4 .   ? 3.774   6.911   7.859   1.00 60.91  ? 212 HOH C O     1 
HETATM 4877 O  O     . HOH M 4 .   ? -8.955  7.421   6.038   1.00 41.52  ? 213 HOH C O     1 
HETATM 4878 O  O     . HOH M 4 .   ? -7.594  15.702  3.021   1.00 62.89  ? 214 HOH C O     1 
HETATM 4879 O  O     . HOH M 4 .   ? -8.297  26.018  1.794   1.00 54.41  ? 215 HOH C O     1 
HETATM 4880 O  O     . HOH M 4 .   ? 7.246   11.607  -5.008  1.00 50.56  ? 216 HOH C O     1 
HETATM 4881 O  O     . HOH M 4 .   ? 4.825   9.252   10.199  1.00 56.37  ? 217 HOH C O     1 
HETATM 4882 O  O     . HOH M 4 .   ? -4.142  14.244  6.793   1.00 43.95  ? 218 HOH C O     1 
HETATM 4883 O  O     . HOH M 4 .   ? -7.054  13.695  15.609  1.00 54.63  ? 219 HOH C O     1 
HETATM 4884 O  O     . HOH M 4 .   ? -19.753 -0.678  17.464  1.00 53.92  ? 220 HOH C O     1 
HETATM 4885 O  O     . HOH M 4 .   ? -13.857 -0.420  21.637  1.00 38.18  ? 221 HOH C O     1 
HETATM 4886 O  O     . HOH M 4 .   ? 0.353   -6.641  30.253  1.00 49.06  ? 222 HOH C O     1 
HETATM 4887 O  O     . HOH M 4 .   ? -2.729  6.722   21.309  1.00 47.98  ? 223 HOH C O     1 
HETATM 4888 O  O     . HOH M 4 .   ? -18.955 -2.857  20.258  1.00 70.31  ? 224 HOH C O     1 
HETATM 4889 O  O     . HOH M 4 .   ? -6.961  11.948  12.919  1.00 67.58  ? 225 HOH C O     1 
HETATM 4890 O  O     . HOH M 4 .   ? -5.661  7.221   13.769  1.00 63.88  ? 226 HOH C O     1 
HETATM 4891 O  O     . HOH M 4 .   ? -7.684  8.514   13.516  1.00 79.16  ? 227 HOH C O     1 
HETATM 4892 O  O     . HOH N 4 .   ? -5.208  4.612   36.534  1.00 40.98  ? 209 HOH D O     1 
HETATM 4893 O  O     . HOH N 4 .   ? -5.404  -4.834  37.955  1.00 44.86  ? 210 HOH D O     1 
HETATM 4894 O  O     . HOH N 4 .   ? -19.481 -14.536 46.194  1.00 57.25  ? 211 HOH D O     1 
HETATM 4895 O  O     . HOH N 4 .   ? -18.523 -27.634 47.888  1.00 62.26  ? 212 HOH D O     1 
HETATM 4896 O  O     . HOH N 4 .   ? -10.782 -9.556  62.872  1.00 59.05  ? 213 HOH D O     1 
HETATM 4897 O  O     . HOH N 4 .   ? -9.959  -13.745 37.612  1.00 49.73  ? 214 HOH D O     1 
HETATM 4898 O  O     . HOH N 4 .   ? -14.797 -7.601  33.302  1.00 58.90  ? 215 HOH D O     1 
HETATM 4899 O  O     . HOH N 4 .   ? -0.448  1.292   28.006  1.00 44.15  ? 216 HOH D O     1 
HETATM 4900 O  O     . HOH N 4 .   ? 1.339   0.148   34.001  1.00 57.73  ? 217 HOH D O     1 
HETATM 4901 O  O     . HOH N 4 .   ? -11.860 -1.246  29.527  1.00 51.93  ? 218 HOH D O     1 
HETATM 4902 O  O     . HOH N 4 .   ? -7.840  -13.626 33.773  1.00 79.17  ? 219 HOH D O     1 
HETATM 4903 O  O     . HOH N 4 .   ? -19.807 -14.629 49.240  1.00 65.19  ? 220 HOH D O     1 
HETATM 4904 O  O     . HOH N 4 .   ? -13.064 -6.323  39.234  1.00 72.98  ? 221 HOH D O     1 
HETATM 4905 O  O     . HOH O 4 .   ? 0.980   1.573   51.813  1.00 35.55  ? 225 HOH A O     1 
HETATM 4906 O  O     . HOH O 4 .   ? -6.174  -0.513  45.939  1.00 40.32  ? 226 HOH A O     1 
HETATM 4907 O  O     . HOH O 4 .   ? -0.746  3.675   35.729  1.00 35.80  ? 227 HOH A O     1 
HETATM 4908 O  O     . HOH O 4 .   ? -2.168  17.280  29.420  1.00 54.40  ? 228 HOH A O     1 
HETATM 4909 O  O     . HOH O 4 .   ? -28.012 -2.033  35.212  1.00 50.71  ? 229 HOH A O     1 
HETATM 4910 O  O     . HOH O 4 .   ? -24.315 8.117   24.753  1.00 43.23  ? 230 HOH A O     1 
HETATM 4911 O  O     . HOH O 4 .   ? -29.260 15.161  15.334  1.00 52.48  ? 231 HOH A O     1 
HETATM 4912 O  O     . HOH O 4 .   ? -18.901 19.523  8.641   1.00 64.28  ? 232 HOH A O     1 
HETATM 4913 O  O     . HOH O 4 .   ? -16.544 18.721  18.699  1.00 38.08  ? 233 HOH A O     1 
HETATM 4914 O  O     . HOH O 4 .   ? -31.902 1.802   36.623  1.00 52.26  ? 234 HOH A O     1 
HETATM 4915 O  O     . HOH O 4 .   ? 21.693  26.849  28.648  1.00 38.69  ? 235 HOH A O     1 
HETATM 4916 O  O     . HOH O 4 .   ? 27.356  19.939  30.156  1.00 53.09  ? 236 HOH A O     1 
HETATM 4917 O  O     . HOH O 4 .   ? 28.713  17.788  29.402  1.00 36.74  ? 237 HOH A O     1 
HETATM 4918 O  O     . HOH O 4 .   ? 29.163  14.552  30.045  1.00 49.74  ? 238 HOH A O     1 
HETATM 4919 O  O     . HOH O 4 .   ? 26.629  14.059  34.097  1.00 58.40  ? 239 HOH A O     1 
HETATM 4920 O  O     . HOH O 4 .   ? 30.243  13.713  27.399  1.00 58.93  ? 240 HOH A O     1 
HETATM 4921 O  O     . HOH O 4 .   ? 27.254  7.181   20.313  1.00 40.61  ? 241 HOH A O     1 
HETATM 4922 O  O     . HOH O 4 .   ? 14.599  6.598   15.403  1.00 54.81  ? 242 HOH A O     1 
HETATM 4923 O  O     . HOH O 4 .   ? 18.454  4.995   16.848  1.00 45.38  ? 243 HOH A O     1 
HETATM 4924 O  O     . HOH O 4 .   ? 15.052  6.068   12.622  1.00 51.90  ? 244 HOH A O     1 
HETATM 4925 O  O     . HOH O 4 .   ? 13.145  7.585   12.050  1.00 57.03  ? 245 HOH A O     1 
HETATM 4926 O  O     . HOH O 4 .   ? 13.087  6.669   9.556   1.00 46.87  ? 246 HOH A O     1 
HETATM 4927 O  O     . HOH O 4 .   ? 8.433   14.408  5.656   1.00 59.32  ? 247 HOH A O     1 
HETATM 4928 O  O     . HOH O 4 .   ? 15.473  13.408  4.239   1.00 58.66  ? 248 HOH A O     1 
HETATM 4929 O  O     . HOH O 4 .   ? 16.393  4.836   42.377  1.00 53.78  ? 249 HOH A O     1 
HETATM 4930 O  O     . HOH O 4 .   ? -3.377  16.965  36.369  1.00 73.44  ? 250 HOH A O     1 
HETATM 4931 O  O     . HOH O 4 .   ? 3.809   3.531   26.049  1.00 53.22  ? 251 HOH A O     1 
HETATM 4932 O  O     . HOH O 4 .   ? -2.676  19.044  37.997  1.00 69.00  ? 252 HOH A O     1 
HETATM 4933 O  O     . HOH O 4 .   ? 3.734   22.906  31.233  1.00 51.18  ? 253 HOH A O     1 
HETATM 4934 O  O     . HOH O 4 .   ? 1.824   21.007  31.510  1.00 64.10  ? 254 HOH A O     1 
HETATM 4935 O  O     . HOH O 4 .   ? 18.187  23.318  36.793  1.00 55.39  ? 255 HOH A O     1 
HETATM 4936 O  O     . HOH O 4 .   ? 18.601  22.670  39.168  1.00 58.03  ? 256 HOH A O     1 
HETATM 4937 O  O     . HOH O 4 .   ? 8.496   25.752  11.707  1.00 58.12  ? 257 HOH A O     1 
HETATM 4938 O  O     . HOH O 4 .   ? 9.670   17.334  47.290  1.00 51.31  ? 258 HOH A O     1 
HETATM 4939 O  O     . HOH O 4 .   ? -1.723  14.999  48.422  1.00 74.55  ? 259 HOH A O     1 
HETATM 4940 O  O     . HOH O 4 .   ? -1.887  13.817  42.356  1.00 47.74  ? 260 HOH A O     1 
HETATM 4941 O  O     . HOH O 4 .   ? 0.215   15.106  41.979  1.00 35.13  ? 261 HOH A O     1 
HETATM 4942 O  O     . HOH O 4 .   ? -5.906  11.293  40.040  1.00 46.41  ? 262 HOH A O     1 
HETATM 4943 O  O     . HOH O 4 .   ? -13.843 15.121  37.884  1.00 57.67  ? 263 HOH A O     1 
HETATM 4944 O  O     . HOH O 4 .   ? -14.449 14.093  35.066  1.00 54.64  ? 264 HOH A O     1 
HETATM 4945 O  O     . HOH O 4 .   ? -30.590 -4.677  39.413  1.00 44.76  ? 265 HOH A O     1 
HETATM 4946 O  O     . HOH O 4 .   ? -23.710 -0.825  32.265  1.00 48.85  ? 266 HOH A O     1 
HETATM 4947 O  O     . HOH O 4 .   ? -25.327 3.518   28.303  1.00 48.40  ? 267 HOH A O     1 
HETATM 4948 O  O     . HOH O 4 .   ? -27.724 22.674  22.803  1.00 82.59  ? 268 HOH A O     1 
HETATM 4949 O  O     . HOH O 4 .   ? -0.333  11.298  28.019  1.00 37.40  ? 269 HOH A O     1 
HETATM 4950 O  O     . HOH O 4 .   ? -18.107 11.722  13.162  1.00 43.86  ? 270 HOH A O     1 
HETATM 4951 O  O     . HOH O 4 .   ? 30.439  25.461  23.352  1.00 54.20  ? 271 HOH A O     1 
HETATM 4952 O  O     . HOH O 4 .   ? 17.192  24.729  10.949  1.00 67.63  ? 272 HOH A O     1 
HETATM 4953 O  O     . HOH O 4 .   ? 4.991   4.387   29.646  1.00 40.60  ? 273 HOH A O     1 
HETATM 4954 O  O     . HOH O 4 .   ? -21.255 4.901   34.441  1.00 47.20  ? 274 HOH A O     1 
HETATM 4955 O  O     . HOH O 4 .   ? -23.251 1.771   31.536  1.00 52.00  ? 275 HOH A O     1 
HETATM 4956 O  O     . HOH O 4 .   ? 5.767   5.142   22.548  1.00 51.39  ? 276 HOH A O     1 
HETATM 4957 O  O     . HOH O 4 .   ? 4.979   7.440   19.052  1.00 26.71  ? 277 HOH A O     1 
HETATM 4958 O  O     . HOH O 4 .   ? 4.015   7.017   21.382  1.00 38.60  ? 278 HOH A O     1 
HETATM 4959 O  O     . HOH O 4 .   ? 6.592   5.772   18.736  1.00 34.97  ? 279 HOH A O     1 
HETATM 4960 O  O     . HOH P 4 .   ? 25.513  -12.760 40.067  1.00 46.38  ? 224 HOH B O     1 
HETATM 4961 O  O     . HOH P 4 .   ? 26.220  -10.719 44.543  1.00 49.78  ? 225 HOH B O     1 
HETATM 4962 O  O     . HOH P 4 .   ? 20.628  -8.883  56.834  1.00 68.77  ? 226 HOH B O     1 
HETATM 4963 O  O     . HOH P 4 .   ? 20.311  -12.027 54.369  1.00 56.74  ? 227 HOH B O     1 
HETATM 4964 O  O     . HOH P 4 .   ? 2.376   -2.029  23.415  1.00 38.17  ? 228 HOH B O     1 
HETATM 4965 O  O     . HOH P 4 .   ? 3.342   2.143   30.148  1.00 51.14  ? 229 HOH B O     1 
HETATM 4966 O  O     . HOH P 4 .   ? 22.623  -3.650  24.592  1.00 59.91  ? 230 HOH B O     1 
HETATM 4967 O  O     . HOH P 4 .   ? 19.139  -19.735 27.309  1.00 52.26  ? 231 HOH B O     1 
HETATM 4968 O  O     . HOH P 4 .   ? -0.647  -8.539  36.977  1.00 47.94  ? 232 HOH B O     1 
HETATM 4969 O  O     . HOH P 4 .   ? 26.061  -13.125 42.958  1.00 50.88  ? 233 HOH B O     1 
HETATM 4970 O  O     . HOH P 4 .   ? 20.399  -8.359  54.220  1.00 66.91  ? 234 HOH B O     1 
HETATM 4971 O  O     . HOH P 4 .   ? 6.750   -5.926  47.756  1.00 57.28  ? 235 HOH B O     1 
HETATM 4972 O  O     . HOH P 4 .   ? 20.079  -3.243  25.668  1.00 44.30  ? 236 HOH B O     1 
HETATM 4973 O  O     . HOH P 4 .   ? 1.792   6.693   12.521  1.00 43.32  ? 237 HOH B O     1 
HETATM 4974 O  O     . HOH P 4 .   ? 3.950   0.727   24.712  1.00 63.17  ? 238 HOH B O     1 
HETATM 4975 O  O     . HOH P 4 .   ? 2.442   -2.933  26.108  1.00 40.97  ? 239 HOH B O     1 
HETATM 4976 O  O     . HOH P 4 .   ? -0.796  -10.312 25.976  1.00 64.59  ? 240 HOH B O     1 
HETATM 4977 O  O     . HOH P 4 .   ? -0.857  -12.961 27.934  1.00 49.83  ? 241 HOH B O     1 
HETATM 4978 O  O     . HOH P 4 .   ? -0.485  -13.086 25.496  1.00 62.70  ? 242 HOH B O     1 
HETATM 4979 O  O     . HOH P 4 .   ? 4.752   -21.444 29.281  1.00 48.04  ? 243 HOH B O     1 
HETATM 4980 O  O     . HOH P 4 .   ? 6.663   -23.511 36.202  1.00 62.10  ? 244 HOH B O     1 
HETATM 4981 O  O     . HOH P 4 .   ? 23.596  -3.633  47.511  1.00 56.13  ? 245 HOH B O     1 
HETATM 4982 O  O     . HOH P 4 .   ? -28.339 -16.045 33.543  1.00 65.44  ? 246 HOH B O     1 
HETATM 4983 O  O     . HOH P 4 .   ? -19.314 -17.344 30.880  1.00 43.98  ? 247 HOH B O     1 
HETATM 4984 O  O     . HOH P 4 .   ? 1.981   -7.237  35.010  1.00 48.63  ? 248 HOH B O     1 
HETATM 4985 O  O     . HOH P 4 .   ? -3.074  -7.672  53.211  1.00 47.96  ? 249 HOH B O     1 
HETATM 4986 O  O     . HOH P 4 .   ? 3.126   -0.231  28.838  1.00 65.63  ? 250 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   C   1   1   1   C   CYT C . n 
A 1 2   A   2   2   2   A   ADE C . n 
A 1 3   A   3   3   3   A   ADE C . n 
A 1 4   G   4   4   4   G   GUA C . n 
A 1 5   G   5   5   5   G   GUA C . n 
A 1 6   U   6   6   6   U   URI C . n 
A 1 7   C   7   7   7   C   CYT C . n 
A 1 8   A   8   8   8   A   ADE C . n 
A 1 9   U   9   9   9   U   URI C . n 
A 1 10  U   10  10  10  U   URI C . n 
A 1 11  C   11  11  11  C   CYT C . n 
A 1 12  G   12  12  12  G   GUA C . n 
A 1 13  C   13  13  13  C   CYT C . n 
A 1 14  A   14  14  14  A   ADE C . n 
A 1 15  A   15  15  15  A   ADE C . n 
A 1 16  G   16  16  16  G   GUA C . n 
A 1 17  A   17  17  17  A   ADE C . n 
A 1 18  G   18  18  18  G   GUA C . n 
A 1 19  U   19  19  19  U   URI C . n 
A 1 20  G   20  20  20  G   GUA C . n 
A 1 21  G   21  21  21  G   GUA C . n 
A 1 22  C   22  22  22  C   CYT C . n 
A 1 23  C   23  23  23  C   CYT C . n 
A 1 24  U   24  24  24  U   URI C . n 
A 1 25  U   25  25  25  U   URI C . n 
A 1 26  G   26  26  26  G   GUA C . n 
A 1 27  C   27  27  27  C   CYT C . n 
A 1 28  G   28  28  28  G   GUA C . n 
B 1 1   C   1   1   1   C   CYT D . n 
B 1 2   A   2   2   2   A   ADE D . n 
B 1 3   A   3   3   3   A   ADE D . n 
B 1 4   G   4   4   4   G   GUA D . n 
B 1 5   G   5   5   5   G   GUA D . n 
B 1 6   U   6   6   6   U   URI D . n 
B 1 7   C   7   7   7   C   CYT D . n 
B 1 8   A   8   8   8   A   ADE D . n 
B 1 9   U   9   9   9   U   URI D . n 
B 1 10  U   10  10  10  U   URI D . n 
B 1 11  C   11  11  11  C   CYT D . n 
B 1 12  G   12  12  12  G   GUA D . n 
B 1 13  C   13  13  13  C   CYT D . n 
B 1 14  A   14  14  14  A   ADE D . n 
B 1 15  A   15  15  15  A   ADE D . n 
B 1 16  G   16  16  16  G   GUA D . n 
B 1 17  A   17  17  17  A   ADE D . n 
B 1 18  G   18  18  18  G   GUA D . n 
B 1 19  U   19  19  19  U   URI D . n 
B 1 20  G   20  20  20  G   GUA D . n 
B 1 21  G   21  21  21  G   GUA D . n 
B 1 22  C   22  22  22  C   CYT D . n 
B 1 23  C   23  23  23  C   CYT D . n 
B 1 24  U   24  24  24  U   URI D . n 
B 1 25  U   25  25  25  U   URI D . n 
B 1 26  G   26  26  26  G   GUA D . n 
B 1 27  C   27  27  27  C   CYT D . n 
B 1 28  G   28  28  28  G   GUA D . n 
C 2 1   MET 1   1   ?   ?   ?   A . n 
C 2 2   LYS 2   2   2   LYS LYS A . n 
C 2 3   MET 3   3   3   MET MET A . n 
C 2 4   LEU 4   4   4   LEU LEU A . n 
C 2 5   GLU 5   5   5   GLU GLU A . n 
C 2 6   GLN 6   6   6   GLN GLN A . n 
C 2 7   LEU 7   7   7   LEU LEU A . n 
C 2 8   GLU 8   8   8   GLU GLU A . n 
C 2 9   LYS 9   9   9   LYS LYS A . n 
C 2 10  LYS 10  10  10  LYS LYS A . n 
C 2 11  LEU 11  11  11  LEU LEU A . n 
C 2 12  GLY 12  12  12  GLY GLY A . n 
C 2 13  TYR 13  13  13  TYR TYR A . n 
C 2 14  THR 14  14  14  THR THR A . n 
C 2 15  PHE 15  15  15  PHE PHE A . n 
C 2 16  LYS 16  16  16  LYS LYS A . n 
C 2 17  ASP 17  17  17  ASP ASP A . n 
C 2 18  LYS 18  18  18  LYS LYS A . n 
C 2 19  SER 19  19  19  SER SER A . n 
C 2 20  LEU 20  20  20  LEU LEU A . n 
C 2 21  LEU 21  21  21  LEU LEU A . n 
C 2 22  GLU 22  22  22  GLU GLU A . n 
C 2 23  LYS 23  23  23  LYS LYS A . n 
C 2 24  ALA 24  24  24  ALA ALA A . n 
C 2 25  LEU 25  25  25  LEU LEU A . n 
C 2 26  THR 26  26  26  THR THR A . n 
C 2 27  HIS 27  27  27  HIS HIS A . n 
C 2 28  VAL 28  28  28  VAL VAL A . n 
C 2 29  SER 29  29  29  SER SER A . n 
C 2 30  TYR 30  30  30  TYR TYR A . n 
C 2 31  SER 31  31  31  SER SER A . n 
C 2 32  LYS 32  32  32  LYS LYS A . n 
C 2 33  LYS 33  33  33  LYS LYS A . n 
C 2 34  GLU 34  34  34  GLU GLU A . n 
C 2 35  HIS 35  35  35  HIS HIS A . n 
C 2 36  TYR 36  36  36  TYR TYR A . n 
C 2 37  GLU 37  37  37  GLU GLU A . n 
C 2 38  THR 38  38  38  THR THR A . n 
C 2 39  LEU 39  39  39  LEU LEU A . n 
C 2 40  GLU 40  40  40  GLU GLU A . n 
C 2 41  PHE 41  41  41  PHE PHE A . n 
C 2 42  LEU 42  42  42  LEU LEU A . n 
C 2 43  GLY 43  43  43  GLY GLY A . n 
C 2 44  ASP 44  44  44  ASP ASP A . n 
C 2 45  ALA 45  45  45  ALA ALA A . n 
C 2 46  LEU 46  46  46  LEU LEU A . n 
C 2 47  VAL 47  47  47  VAL VAL A . n 
C 2 48  ASN 48  48  48  ASN ASN A . n 
C 2 49  PHE 49  49  49  PHE PHE A . n 
C 2 50  PHE 50  50  50  PHE PHE A . n 
C 2 51  ILE 51  51  51  ILE ILE A . n 
C 2 52  VAL 52  52  52  VAL VAL A . n 
C 2 53  ASP 53  53  53  ASP ASP A . n 
C 2 54  LEU 54  54  54  LEU LEU A . n 
C 2 55  LEU 55  55  55  LEU LEU A . n 
C 2 56  VAL 56  56  56  VAL VAL A . n 
C 2 57  GLN 57  57  57  GLN GLN A . n 
C 2 58  TYR 58  58  58  TYR TYR A . n 
C 2 59  SER 59  59  59  SER SER A . n 
C 2 60  PRO 60  60  60  PRO PRO A . n 
C 2 61  ASN 61  61  61  ASN ASN A . n 
C 2 62  LYS 62  62  62  LYS LYS A . n 
C 2 63  ARG 63  63  63  ARG ARG A . n 
C 2 64  GLU 64  64  64  GLU GLU A . n 
C 2 65  GLY 65  65  65  GLY GLY A . n 
C 2 66  PHE 66  66  66  PHE PHE A . n 
C 2 67  LEU 67  67  67  LEU LEU A . n 
C 2 68  SER 68  68  68  SER SER A . n 
C 2 69  PRO 69  69  69  PRO PRO A . n 
C 2 70  LEU 70  70  70  LEU LEU A . n 
C 2 71  LYS 71  71  71  LYS LYS A . n 
C 2 72  ALA 72  72  72  ALA ALA A . n 
C 2 73  TYR 73  73  73  TYR TYR A . n 
C 2 74  LEU 74  74  74  LEU LEU A . n 
C 2 75  ILE 75  75  75  ILE ILE A . n 
C 2 76  SER 76  76  76  SER SER A . n 
C 2 77  GLU 77  77  77  GLU GLU A . n 
C 2 78  GLU 78  78  78  GLU GLU A . n 
C 2 79  PHE 79  79  79  PHE PHE A . n 
C 2 80  PHE 80  80  80  PHE PHE A . n 
C 2 81  ASN 81  81  81  ASN ASN A . n 
C 2 82  LEU 82  82  82  LEU LEU A . n 
C 2 83  LEU 83  83  83  LEU LEU A . n 
C 2 84  ALA 84  84  84  ALA ALA A . n 
C 2 85  GLN 85  85  85  GLN GLN A . n 
C 2 86  LYS 86  86  86  LYS LYS A . n 
C 2 87  LEU 87  87  87  LEU LEU A . n 
C 2 88  GLU 88  88  88  GLU GLU A . n 
C 2 89  LEU 89  89  89  LEU LEU A . n 
C 2 90  HIS 90  90  90  HIS HIS A . n 
C 2 91  LYS 91  91  91  LYS LYS A . n 
C 2 92  PHE 92  92  92  PHE PHE A . n 
C 2 93  ILE 93  93  93  ILE ILE A . n 
C 2 94  ARG 94  94  94  ARG ARG A . n 
C 2 95  ILE 95  95  95  ILE ILE A . n 
C 2 96  LYS 96  96  96  LYS LYS A . n 
C 2 97  ARG 97  97  97  ARG ARG A . n 
C 2 98  GLY 98  98  98  GLY GLY A . n 
C 2 99  LYS 99  99  99  LYS LYS A . n 
C 2 100 ILE 100 100 100 ILE ILE A . n 
C 2 101 ASN 101 101 101 ASN ASN A . n 
C 2 102 GLU 102 102 102 GLU GLU A . n 
C 2 103 THR 103 103 103 THR THR A . n 
C 2 104 ILE 104 104 104 ILE ILE A . n 
C 2 105 ILE 105 105 105 ILE ILE A . n 
C 2 106 GLY 106 106 106 GLY GLY A . n 
C 2 107 ASP 107 107 107 ASP ASP A . n 
C 2 108 VAL 108 108 108 VAL VAL A . n 
C 2 109 PHE 109 109 109 PHE PHE A . n 
C 2 110 GLU 110 110 110 GLU GLU A . n 
C 2 111 ALA 111 111 111 ALA ALA A . n 
C 2 112 LEU 112 112 112 LEU LEU A . n 
C 2 113 TRP 113 113 113 TRP TRP A . n 
C 2 114 ALA 114 114 114 ALA ALA A . n 
C 2 115 ALA 115 115 115 ALA ALA A . n 
C 2 116 VAL 116 116 116 VAL VAL A . n 
C 2 117 TYR 117 117 117 TYR TYR A . n 
C 2 118 ILE 118 118 118 ILE ILE A . n 
C 2 119 ASP 119 119 119 ASP ASP A . n 
C 2 120 SER 120 120 120 SER SER A . n 
C 2 121 GLY 121 121 121 GLY GLY A . n 
C 2 122 ARG 122 122 122 ARG ARG A . n 
C 2 123 ASP 123 123 123 ASP ASP A . n 
C 2 124 ALA 124 124 124 ALA ALA A . n 
C 2 125 ASN 125 125 125 ASN ASN A . n 
C 2 126 PHE 126 126 126 PHE PHE A . n 
C 2 127 THR 127 127 127 THR THR A . n 
C 2 128 ARG 128 128 128 ARG ARG A . n 
C 2 129 GLU 129 129 129 GLU GLU A . n 
C 2 130 LEU 130 130 130 LEU LEU A . n 
C 2 131 PHE 131 131 131 PHE PHE A . n 
C 2 132 TYR 132 132 132 TYR TYR A . n 
C 2 133 LYS 133 133 133 LYS LYS A . n 
C 2 134 LEU 134 134 134 LEU LEU A . n 
C 2 135 PHE 135 135 135 PHE PHE A . n 
C 2 136 LYS 136 136 136 LYS LYS A . n 
C 2 137 GLU 137 137 137 GLU GLU A . n 
C 2 138 ASP 138 138 138 ASP ASP A . n 
C 2 139 ILE 139 139 139 ILE ILE A . n 
C 2 140 LEU 140 140 140 LEU LEU A . n 
C 2 141 SER 141 141 141 SER SER A . n 
C 2 142 ALA 142 142 142 ALA ALA A . n 
C 2 143 ILE 143 143 143 ILE ILE A . n 
C 2 144 LYS 144 144 144 LYS LYS A . n 
C 2 145 GLU 145 145 145 GLU GLU A . n 
C 2 146 GLY 146 146 146 GLY GLY A . n 
C 2 147 ARG 147 147 147 ARG ARG A . n 
C 2 148 VAL 148 148 148 VAL VAL A . n 
C 2 149 LYS 149 149 149 LYS LYS A . n 
C 2 150 LYS 150 150 150 LYS LYS A . n 
C 2 151 ASP 151 151 151 ASP ASP A . n 
C 2 152 TYR 152 152 152 TYR TYR A . n 
C 2 153 LYS 153 153 153 LYS LYS A . n 
C 2 154 THR 154 154 154 THR THR A . n 
C 2 155 ILE 155 155 155 ILE ILE A . n 
C 2 156 LEU 156 156 156 LEU LEU A . n 
C 2 157 GLN 157 157 157 GLN GLN A . n 
C 2 158 GLU 158 158 158 GLU GLU A . n 
C 2 159 ILE 159 159 159 ILE ILE A . n 
C 2 160 THR 160 160 160 THR THR A . n 
C 2 161 GLN 161 161 161 GLN GLN A . n 
C 2 162 LYS 162 162 162 LYS LYS A . n 
C 2 163 ARG 163 163 163 ARG ARG A . n 
C 2 164 TRP 164 164 164 TRP TRP A . n 
C 2 165 LYS 165 165 165 LYS LYS A . n 
C 2 166 GLU 166 166 166 GLU GLU A . n 
C 2 167 ARG 167 167 167 ARG ARG A . n 
C 2 168 PRO 168 168 168 PRO PRO A . n 
C 2 169 GLU 169 169 169 GLU GLU A . n 
C 2 170 TYR 170 170 170 TYR TYR A . n 
C 2 171 ARG 171 171 171 ARG ARG A . n 
C 2 172 LEU 172 172 172 LEU LEU A . n 
C 2 173 ILE 173 173 173 ILE ILE A . n 
C 2 174 SER 174 174 174 SER SER A . n 
C 2 175 VAL 175 175 175 VAL VAL A . n 
C 2 176 GLU 176 176 176 GLU GLU A . n 
C 2 177 GLY 177 177 177 GLY GLY A . n 
C 2 178 PRO 178 178 178 PRO PRO A . n 
C 2 179 HIS 179 179 179 HIS HIS A . n 
C 2 180 HIS 180 180 180 HIS HIS A . n 
C 2 181 LYS 181 181 181 LYS LYS A . n 
C 2 182 LYS 182 182 182 LYS LYS A . n 
C 2 183 LYS 183 183 183 LYS LYS A . n 
C 2 184 PHE 184 184 184 PHE PHE A . n 
C 2 185 ILE 185 185 185 ILE ILE A . n 
C 2 186 VAL 186 186 186 VAL VAL A . n 
C 2 187 GLU 187 187 187 GLU GLU A . n 
C 2 188 ALA 188 188 188 ALA ALA A . n 
C 2 189 LYS 189 189 189 LYS LYS A . n 
C 2 190 ILE 190 190 190 ILE ILE A . n 
C 2 191 LYS 191 191 191 LYS LYS A . n 
C 2 192 GLU 192 192 192 GLU GLU A . n 
C 2 193 TYR 193 193 193 TYR TYR A . n 
C 2 194 ARG 194 194 194 ARG ARG A . n 
C 2 195 THR 195 195 195 THR THR A . n 
C 2 196 LEU 196 196 196 LEU LEU A . n 
C 2 197 GLY 197 197 197 GLY GLY A . n 
C 2 198 GLU 198 198 198 GLU GLU A . n 
C 2 199 GLY 199 199 199 GLY GLY A . n 
C 2 200 LYS 200 200 200 LYS LYS A . n 
C 2 201 SER 201 201 201 SER SER A . n 
C 2 202 LYS 202 202 202 LYS LYS A . n 
C 2 203 LYS 203 203 203 LYS LYS A . n 
C 2 204 GLU 204 204 204 GLU GLU A . n 
C 2 205 ALA 205 205 205 ALA ALA A . n 
C 2 206 GLU 206 206 206 GLU GLU A . n 
C 2 207 GLN 207 207 207 GLN GLN A . n 
C 2 208 ARG 208 208 208 ARG ARG A . n 
C 2 209 ALA 209 209 209 ALA ALA A . n 
C 2 210 ALA 210 210 210 ALA ALA A . n 
C 2 211 GLU 211 211 211 GLU GLU A . n 
C 2 212 GLU 212 212 212 GLU GLU A . n 
C 2 213 LEU 213 213 213 LEU LEU A . n 
C 2 214 ILE 214 214 214 ILE ILE A . n 
C 2 215 LYS 215 215 215 LYS LYS A . n 
C 2 216 LEU 216 216 216 LEU LEU A . n 
C 2 217 LEU 217 217 217 LEU LEU A . n 
C 2 218 GLU 218 218 218 GLU GLU A . n 
C 2 219 GLU 219 219 219 GLU GLU A . n 
C 2 220 SER 220 220 220 SER SER A . n 
C 2 221 GLU 221 221 ?   ?   ?   A . n 
D 2 1   MET 1   1   ?   ?   ?   B . n 
D 2 2   LYS 2   2   2   LYS LYS B . n 
D 2 3   MET 3   3   3   MET MET B . n 
D 2 4   LEU 4   4   4   LEU LEU B . n 
D 2 5   GLU 5   5   5   GLU GLU B . n 
D 2 6   GLN 6   6   6   GLN GLN B . n 
D 2 7   LEU 7   7   7   LEU LEU B . n 
D 2 8   GLU 8   8   8   GLU GLU B . n 
D 2 9   LYS 9   9   9   LYS LYS B . n 
D 2 10  LYS 10  10  10  LYS LYS B . n 
D 2 11  LEU 11  11  11  LEU LEU B . n 
D 2 12  GLY 12  12  12  GLY GLY B . n 
D 2 13  TYR 13  13  13  TYR TYR B . n 
D 2 14  THR 14  14  14  THR THR B . n 
D 2 15  PHE 15  15  15  PHE PHE B . n 
D 2 16  LYS 16  16  16  LYS LYS B . n 
D 2 17  ASP 17  17  17  ASP ASP B . n 
D 2 18  LYS 18  18  18  LYS LYS B . n 
D 2 19  SER 19  19  19  SER SER B . n 
D 2 20  LEU 20  20  20  LEU LEU B . n 
D 2 21  LEU 21  21  21  LEU LEU B . n 
D 2 22  GLU 22  22  22  GLU GLU B . n 
D 2 23  LYS 23  23  23  LYS LYS B . n 
D 2 24  ALA 24  24  24  ALA ALA B . n 
D 2 25  LEU 25  25  25  LEU LEU B . n 
D 2 26  THR 26  26  26  THR THR B . n 
D 2 27  HIS 27  27  27  HIS HIS B . n 
D 2 28  VAL 28  28  28  VAL VAL B . n 
D 2 29  SER 29  29  29  SER SER B . n 
D 2 30  TYR 30  30  30  TYR TYR B . n 
D 2 31  SER 31  31  31  SER SER B . n 
D 2 32  LYS 32  32  32  LYS LYS B . n 
D 2 33  LYS 33  33  33  LYS LYS B . n 
D 2 34  GLU 34  34  34  GLU GLU B . n 
D 2 35  HIS 35  35  35  HIS HIS B . n 
D 2 36  TYR 36  36  36  TYR TYR B . n 
D 2 37  GLU 37  37  37  GLU GLU B . n 
D 2 38  THR 38  38  38  THR THR B . n 
D 2 39  LEU 39  39  39  LEU LEU B . n 
D 2 40  GLU 40  40  40  GLU GLU B . n 
D 2 41  PHE 41  41  41  PHE PHE B . n 
D 2 42  LEU 42  42  42  LEU LEU B . n 
D 2 43  GLY 43  43  43  GLY GLY B . n 
D 2 44  ASP 44  44  44  ASP ASP B . n 
D 2 45  ALA 45  45  45  ALA ALA B . n 
D 2 46  LEU 46  46  46  LEU LEU B . n 
D 2 47  VAL 47  47  47  VAL VAL B . n 
D 2 48  ASN 48  48  48  ASN ASN B . n 
D 2 49  PHE 49  49  49  PHE PHE B . n 
D 2 50  PHE 50  50  50  PHE PHE B . n 
D 2 51  ILE 51  51  51  ILE ILE B . n 
D 2 52  VAL 52  52  52  VAL VAL B . n 
D 2 53  ASP 53  53  53  ASP ASP B . n 
D 2 54  LEU 54  54  54  LEU LEU B . n 
D 2 55  LEU 55  55  55  LEU LEU B . n 
D 2 56  VAL 56  56  56  VAL VAL B . n 
D 2 57  GLN 57  57  57  GLN GLN B . n 
D 2 58  TYR 58  58  58  TYR TYR B . n 
D 2 59  SER 59  59  59  SER SER B . n 
D 2 60  PRO 60  60  60  PRO PRO B . n 
D 2 61  ASN 61  61  61  ASN ASN B . n 
D 2 62  LYS 62  62  62  LYS LYS B . n 
D 2 63  ARG 63  63  63  ARG ARG B . n 
D 2 64  GLU 64  64  64  GLU GLU B . n 
D 2 65  GLY 65  65  65  GLY GLY B . n 
D 2 66  PHE 66  66  66  PHE PHE B . n 
D 2 67  LEU 67  67  67  LEU LEU B . n 
D 2 68  SER 68  68  68  SER SER B . n 
D 2 69  PRO 69  69  69  PRO PRO B . n 
D 2 70  LEU 70  70  70  LEU LEU B . n 
D 2 71  LYS 71  71  71  LYS LYS B . n 
D 2 72  ALA 72  72  72  ALA ALA B . n 
D 2 73  TYR 73  73  73  TYR TYR B . n 
D 2 74  LEU 74  74  74  LEU LEU B . n 
D 2 75  ILE 75  75  75  ILE ILE B . n 
D 2 76  SER 76  76  76  SER SER B . n 
D 2 77  GLU 77  77  77  GLU GLU B . n 
D 2 78  GLU 78  78  78  GLU GLU B . n 
D 2 79  PHE 79  79  79  PHE PHE B . n 
D 2 80  PHE 80  80  80  PHE PHE B . n 
D 2 81  ASN 81  81  81  ASN ASN B . n 
D 2 82  LEU 82  82  82  LEU LEU B . n 
D 2 83  LEU 83  83  83  LEU LEU B . n 
D 2 84  ALA 84  84  84  ALA ALA B . n 
D 2 85  GLN 85  85  85  GLN GLN B . n 
D 2 86  LYS 86  86  86  LYS LYS B . n 
D 2 87  LEU 87  87  87  LEU LEU B . n 
D 2 88  GLU 88  88  88  GLU GLU B . n 
D 2 89  LEU 89  89  89  LEU LEU B . n 
D 2 90  HIS 90  90  90  HIS HIS B . n 
D 2 91  LYS 91  91  91  LYS LYS B . n 
D 2 92  PHE 92  92  92  PHE PHE B . n 
D 2 93  ILE 93  93  93  ILE ILE B . n 
D 2 94  ARG 94  94  94  ARG ARG B . n 
D 2 95  ILE 95  95  95  ILE ILE B . n 
D 2 96  LYS 96  96  96  LYS LYS B . n 
D 2 97  ARG 97  97  97  ARG ARG B . n 
D 2 98  GLY 98  98  98  GLY GLY B . n 
D 2 99  LYS 99  99  99  LYS LYS B . n 
D 2 100 ILE 100 100 100 ILE ILE B . n 
D 2 101 ASN 101 101 101 ASN ASN B . n 
D 2 102 GLU 102 102 102 GLU GLU B . n 
D 2 103 THR 103 103 103 THR THR B . n 
D 2 104 ILE 104 104 104 ILE ILE B . n 
D 2 105 ILE 105 105 105 ILE ILE B . n 
D 2 106 GLY 106 106 106 GLY GLY B . n 
D 2 107 ASP 107 107 107 ASP ASP B . n 
D 2 108 VAL 108 108 108 VAL VAL B . n 
D 2 109 PHE 109 109 109 PHE PHE B . n 
D 2 110 GLU 110 110 110 GLU GLU B . n 
D 2 111 ALA 111 111 111 ALA ALA B . n 
D 2 112 LEU 112 112 112 LEU LEU B . n 
D 2 113 TRP 113 113 113 TRP TRP B . n 
D 2 114 ALA 114 114 114 ALA ALA B . n 
D 2 115 ALA 115 115 115 ALA ALA B . n 
D 2 116 VAL 116 116 116 VAL VAL B . n 
D 2 117 TYR 117 117 117 TYR TYR B . n 
D 2 118 ILE 118 118 118 ILE ILE B . n 
D 2 119 ASP 119 119 119 ASP ASP B . n 
D 2 120 SER 120 120 120 SER SER B . n 
D 2 121 GLY 121 121 121 GLY GLY B . n 
D 2 122 ARG 122 122 122 ARG ARG B . n 
D 2 123 ASP 123 123 123 ASP ASP B . n 
D 2 124 ALA 124 124 124 ALA ALA B . n 
D 2 125 ASN 125 125 125 ASN ASN B . n 
D 2 126 PHE 126 126 126 PHE PHE B . n 
D 2 127 THR 127 127 127 THR THR B . n 
D 2 128 ARG 128 128 128 ARG ARG B . n 
D 2 129 GLU 129 129 129 GLU GLU B . n 
D 2 130 LEU 130 130 130 LEU LEU B . n 
D 2 131 PHE 131 131 131 PHE PHE B . n 
D 2 132 TYR 132 132 132 TYR TYR B . n 
D 2 133 LYS 133 133 133 LYS LYS B . n 
D 2 134 LEU 134 134 134 LEU LEU B . n 
D 2 135 PHE 135 135 135 PHE PHE B . n 
D 2 136 LYS 136 136 136 LYS LYS B . n 
D 2 137 GLU 137 137 137 GLU GLU B . n 
D 2 138 ASP 138 138 138 ASP ASP B . n 
D 2 139 ILE 139 139 139 ILE ILE B . n 
D 2 140 LEU 140 140 140 LEU LEU B . n 
D 2 141 SER 141 141 141 SER SER B . n 
D 2 142 ALA 142 142 142 ALA ALA B . n 
D 2 143 ILE 143 143 143 ILE ILE B . n 
D 2 144 LYS 144 144 144 LYS LYS B . n 
D 2 145 GLU 145 145 145 GLU GLU B . n 
D 2 146 GLY 146 146 146 GLY GLY B . n 
D 2 147 ARG 147 147 147 ARG ARG B . n 
D 2 148 VAL 148 148 148 VAL VAL B . n 
D 2 149 LYS 149 149 149 LYS LYS B . n 
D 2 150 LYS 150 150 150 LYS LYS B . n 
D 2 151 ASP 151 151 151 ASP ASP B . n 
D 2 152 TYR 152 152 152 TYR TYR B . n 
D 2 153 LYS 153 153 153 LYS LYS B . n 
D 2 154 THR 154 154 154 THR THR B . n 
D 2 155 ILE 155 155 155 ILE ILE B . n 
D 2 156 LEU 156 156 156 LEU LEU B . n 
D 2 157 GLN 157 157 157 GLN GLN B . n 
D 2 158 GLU 158 158 158 GLU GLU B . n 
D 2 159 ILE 159 159 159 ILE ILE B . n 
D 2 160 THR 160 160 160 THR THR B . n 
D 2 161 GLN 161 161 161 GLN GLN B . n 
D 2 162 LYS 162 162 162 LYS LYS B . n 
D 2 163 ARG 163 163 163 ARG ARG B . n 
D 2 164 TRP 164 164 164 TRP TRP B . n 
D 2 165 LYS 165 165 165 LYS LYS B . n 
D 2 166 GLU 166 166 166 GLU GLU B . n 
D 2 167 ARG 167 167 167 ARG ARG B . n 
D 2 168 PRO 168 168 168 PRO PRO B . n 
D 2 169 GLU 169 169 169 GLU GLU B . n 
D 2 170 TYR 170 170 170 TYR TYR B . n 
D 2 171 ARG 171 171 171 ARG ARG B . n 
D 2 172 LEU 172 172 172 LEU LEU B . n 
D 2 173 ILE 173 173 173 ILE ILE B . n 
D 2 174 SER 174 174 174 SER SER B . n 
D 2 175 VAL 175 175 175 VAL VAL B . n 
D 2 176 GLU 176 176 176 GLU GLU B . n 
D 2 177 GLY 177 177 177 GLY GLY B . n 
D 2 178 PRO 178 178 178 PRO PRO B . n 
D 2 179 HIS 179 179 179 HIS HIS B . n 
D 2 180 HIS 180 180 180 HIS HIS B . n 
D 2 181 LYS 181 181 181 LYS LYS B . n 
D 2 182 LYS 182 182 182 LYS LYS B . n 
D 2 183 LYS 183 183 183 LYS LYS B . n 
D 2 184 PHE 184 184 184 PHE PHE B . n 
D 2 185 ILE 185 185 185 ILE ILE B . n 
D 2 186 VAL 186 186 186 VAL VAL B . n 
D 2 187 GLU 187 187 187 GLU GLU B . n 
D 2 188 ALA 188 188 188 ALA ALA B . n 
D 2 189 LYS 189 189 189 LYS LYS B . n 
D 2 190 ILE 190 190 190 ILE ILE B . n 
D 2 191 LYS 191 191 191 LYS LYS B . n 
D 2 192 GLU 192 192 192 GLU GLU B . n 
D 2 193 TYR 193 193 193 TYR TYR B . n 
D 2 194 ARG 194 194 194 ARG ARG B . n 
D 2 195 THR 195 195 195 THR THR B . n 
D 2 196 LEU 196 196 196 LEU LEU B . n 
D 2 197 GLY 197 197 197 GLY GLY B . n 
D 2 198 GLU 198 198 198 GLU GLU B . n 
D 2 199 GLY 199 199 199 GLY GLY B . n 
D 2 200 LYS 200 200 200 LYS LYS B . n 
D 2 201 SER 201 201 201 SER SER B . n 
D 2 202 LYS 202 202 202 LYS LYS B . n 
D 2 203 LYS 203 203 203 LYS LYS B . n 
D 2 204 GLU 204 204 204 GLU GLU B . n 
D 2 205 ALA 205 205 205 ALA ALA B . n 
D 2 206 GLU 206 206 206 GLU GLU B . n 
D 2 207 GLN 207 207 207 GLN GLN B . n 
D 2 208 ARG 208 208 208 ARG ARG B . n 
D 2 209 ALA 209 209 209 ALA ALA B . n 
D 2 210 ALA 210 210 210 ALA ALA B . n 
D 2 211 GLU 211 211 211 GLU GLU B . n 
D 2 212 GLU 212 212 212 GLU GLU B . n 
D 2 213 LEU 213 213 213 LEU LEU B . n 
D 2 214 ILE 214 214 214 ILE ILE B . n 
D 2 215 LYS 215 215 215 LYS LYS B . n 
D 2 216 LEU 216 216 216 LEU LEU B . n 
D 2 217 LEU 217 217 217 LEU LEU B . n 
D 2 218 GLU 218 218 218 GLU GLU B . n 
D 2 219 GLU 219 219 219 GLU GLU B . n 
D 2 220 SER 220 220 220 SER SER B . n 
D 2 221 GLU 221 221 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1  202 2   MG  MG2 C . 
F 3 MG  1  206 6   MG  MG2 D . 
G 3 MG  1  208 8   MG  MG2 D . 
H 3 MG  1  222 1   MG  MG2 A . 
I 3 MG  1  223 3   MG  MG2 A . 
J 3 MG  1  224 4   MG  MG2 A . 
K 3 MG  1  222 5   MG  MG2 B . 
L 3 MG  1  223 7   MG  MG2 B . 
M 4 HOH 1  203 5   HOH HOH C . 
M 4 HOH 2  204 9   HOH HOH C . 
M 4 HOH 3  205 55  HOH HOH C . 
M 4 HOH 4  206 67  HOH HOH C . 
M 4 HOH 5  207 76  HOH HOH C . 
M 4 HOH 6  208 78  HOH HOH C . 
M 4 HOH 7  209 79  HOH HOH C . 
M 4 HOH 8  210 80  HOH HOH C . 
M 4 HOH 9  211 81  HOH HOH C . 
M 4 HOH 10 212 82  HOH HOH C . 
M 4 HOH 11 213 83  HOH HOH C . 
M 4 HOH 12 214 84  HOH HOH C . 
M 4 HOH 13 215 85  HOH HOH C . 
M 4 HOH 14 216 88  HOH HOH C . 
M 4 HOH 15 217 89  HOH HOH C . 
M 4 HOH 16 218 90  HOH HOH C . 
M 4 HOH 17 219 91  HOH HOH C . 
M 4 HOH 18 220 93  HOH HOH C . 
M 4 HOH 19 221 94  HOH HOH C . 
M 4 HOH 20 222 95  HOH HOH C . 
M 4 HOH 21 223 114 HOH HOH C . 
M 4 HOH 22 224 116 HOH HOH C . 
M 4 HOH 23 225 117 HOH HOH C . 
M 4 HOH 24 226 118 HOH HOH C . 
M 4 HOH 25 227 119 HOH HOH C . 
N 4 HOH 1  209 33  HOH HOH D . 
N 4 HOH 2  210 86  HOH HOH D . 
N 4 HOH 3  211 96  HOH HOH D . 
N 4 HOH 4  212 97  HOH HOH D . 
N 4 HOH 5  213 98  HOH HOH D . 
N 4 HOH 6  214 99  HOH HOH D . 
N 4 HOH 7  215 100 HOH HOH D . 
N 4 HOH 8  216 108 HOH HOH D . 
N 4 HOH 9  217 109 HOH HOH D . 
N 4 HOH 10 218 115 HOH HOH D . 
N 4 HOH 11 219 120 HOH HOH D . 
N 4 HOH 12 220 121 HOH HOH D . 
N 4 HOH 13 221 122 HOH HOH D . 
O 4 HOH 1  225 1   HOH HOH A . 
O 4 HOH 2  226 2   HOH HOH A . 
O 4 HOH 3  227 3   HOH HOH A . 
O 4 HOH 4  228 4   HOH HOH A . 
O 4 HOH 5  229 6   HOH HOH A . 
O 4 HOH 6  230 7   HOH HOH A . 
O 4 HOH 7  231 8   HOH HOH A . 
O 4 HOH 8  232 10  HOH HOH A . 
O 4 HOH 9  233 11  HOH HOH A . 
O 4 HOH 10 234 12  HOH HOH A . 
O 4 HOH 11 235 18  HOH HOH A . 
O 4 HOH 12 236 19  HOH HOH A . 
O 4 HOH 13 237 20  HOH HOH A . 
O 4 HOH 14 238 21  HOH HOH A . 
O 4 HOH 15 239 22  HOH HOH A . 
O 4 HOH 16 240 23  HOH HOH A . 
O 4 HOH 17 241 24  HOH HOH A . 
O 4 HOH 18 242 25  HOH HOH A . 
O 4 HOH 19 243 26  HOH HOH A . 
O 4 HOH 20 244 27  HOH HOH A . 
O 4 HOH 21 245 28  HOH HOH A . 
O 4 HOH 22 246 29  HOH HOH A . 
O 4 HOH 23 247 30  HOH HOH A . 
O 4 HOH 24 248 31  HOH HOH A . 
O 4 HOH 25 249 32  HOH HOH A . 
O 4 HOH 26 250 34  HOH HOH A . 
O 4 HOH 27 251 35  HOH HOH A . 
O 4 HOH 28 252 37  HOH HOH A . 
O 4 HOH 29 253 38  HOH HOH A . 
O 4 HOH 30 254 39  HOH HOH A . 
O 4 HOH 31 255 40  HOH HOH A . 
O 4 HOH 32 256 41  HOH HOH A . 
O 4 HOH 33 257 44  HOH HOH A . 
O 4 HOH 34 258 45  HOH HOH A . 
O 4 HOH 35 259 46  HOH HOH A . 
O 4 HOH 36 260 47  HOH HOH A . 
O 4 HOH 37 261 48  HOH HOH A . 
O 4 HOH 38 262 49  HOH HOH A . 
O 4 HOH 39 263 50  HOH HOH A . 
O 4 HOH 40 264 51  HOH HOH A . 
O 4 HOH 41 265 52  HOH HOH A . 
O 4 HOH 42 266 53  HOH HOH A . 
O 4 HOH 43 267 54  HOH HOH A . 
O 4 HOH 44 268 56  HOH HOH A . 
O 4 HOH 45 269 77  HOH HOH A . 
O 4 HOH 46 270 92  HOH HOH A . 
O 4 HOH 47 271 101 HOH HOH A . 
O 4 HOH 48 272 102 HOH HOH A . 
O 4 HOH 49 273 103 HOH HOH A . 
O 4 HOH 50 274 104 HOH HOH A . 
O 4 HOH 51 275 105 HOH HOH A . 
O 4 HOH 52 276 110 HOH HOH A . 
O 4 HOH 53 277 111 HOH HOH A . 
O 4 HOH 54 278 112 HOH HOH A . 
O 4 HOH 55 279 113 HOH HOH A . 
P 4 HOH 1  224 13  HOH HOH B . 
P 4 HOH 2  225 14  HOH HOH B . 
P 4 HOH 3  226 15  HOH HOH B . 
P 4 HOH 4  227 16  HOH HOH B . 
P 4 HOH 5  228 17  HOH HOH B . 
P 4 HOH 6  229 36  HOH HOH B . 
P 4 HOH 7  230 42  HOH HOH B . 
P 4 HOH 8  231 43  HOH HOH B . 
P 4 HOH 9  232 57  HOH HOH B . 
P 4 HOH 10 233 59  HOH HOH B . 
P 4 HOH 11 234 61  HOH HOH B . 
P 4 HOH 12 235 62  HOH HOH B . 
P 4 HOH 13 236 63  HOH HOH B . 
P 4 HOH 14 237 64  HOH HOH B . 
P 4 HOH 15 238 65  HOH HOH B . 
P 4 HOH 16 239 66  HOH HOH B . 
P 4 HOH 17 240 68  HOH HOH B . 
P 4 HOH 18 241 69  HOH HOH B . 
P 4 HOH 19 242 70  HOH HOH B . 
P 4 HOH 20 243 71  HOH HOH B . 
P 4 HOH 21 244 72  HOH HOH B . 
P 4 HOH 22 245 73  HOH HOH B . 
P 4 HOH 23 246 74  HOH HOH B . 
P 4 HOH 24 247 75  HOH HOH B . 
P 4 HOH 25 248 87  HOH HOH B . 
P 4 HOH 26 249 106 HOH HOH B . 
P 4 HOH 27 250 107 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP1 ? A C   1   ? C C   1   ? 1_555 MG ? E MG . ? C MG 202 ? 1_555 OP2 ? A A   2   ? C A   2   ? 1_555 81.8  ? 
2  OP1 ? B C   1   ? D C   1   ? 1_555 MG ? F MG . ? D MG 206 ? 1_555 OP2 ? B A   2   ? D A   2   ? 1_555 96.4  ? 
3  OE1 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 279 ? 1_555 81.9  ? 
4  OE1 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 277 ? 1_555 59.9  ? 
5  O   ? O HOH .   ? A HOH 279 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 277 ? 1_555 61.6  ? 
6  OE1 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 276 ? 1_555 101.4 ? 
7  O   ? O HOH .   ? A HOH 279 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 276 ? 1_555 144.7 ? 
8  O   ? O HOH .   ? A HOH 277 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 276 ? 1_555 149.4 ? 
9  OE1 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 278 ? 1_555 75.0  ? 
10 O   ? O HOH .   ? A HOH 279 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 278 ? 1_555 129.2 ? 
11 O   ? O HOH .   ? A HOH 277 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 278 ? 1_555 67.6  ? 
12 O   ? O HOH .   ? A HOH 276 ? 1_555 MG ? J MG . ? A MG 224 ? 1_555 O   ? O HOH .   ? A HOH 278 ? 1_555 84.7  ? 
13 OE2 ? C GLU 40  ? A GLU 40  ? 1_555 MG ? I MG . ? A MG 223 ? 1_555 OD1 ? C ASP 107 ? A ASP 107 ? 1_555 105.3 ? 
14 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 MG ? L MG . ? B MG 223 ? 1_555 O   ? P HOH .   ? B HOH 232 ? 1_555 81.1  ? 
15 OD1 ? D ASP 107 ? B ASP 107 ? 1_555 MG ? L MG . ? B MG 223 ? 1_555 O   ? P HOH .   ? B HOH 248 ? 1_555 150.5 ? 
16 O   ? P HOH .   ? B HOH 232 ? 1_555 MG ? L MG . ? B MG 223 ? 1_555 O   ? P HOH .   ? B HOH 248 ? 1_555 114.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.0 ? 1 
MAR345   'data collection' .   ? 2 
HKL-2000 'data reduction'  .   ? 3 
HKL-2000 'data scaling'    .   ? 4 
AMoRE    phasing           .   ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C C 1 ? ? OP3 C C 1 ? ? 1.531 1.607 -0.076 0.012 N 
2 1 P D C 1 ? ? OP3 D C 1 ? ? 1.519 1.607 -0.088 0.012 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 97  ? ? 48.49  16.53   
2 1 ILE A 100 ? ? -59.79 78.60   
3 1 ARG A 122 ? ? 72.93  38.48   
4 1 LYS A 191 ? ? 69.50  -126.35 
5 1 ARG B 97  ? ? 46.07  20.17   
6 1 ILE B 100 ? ? -65.83 85.06   
7 1 LYS B 191 ? ? 68.64  -125.83 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    G 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     12 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.072 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? C MET 1   
2 1 Y 1 A GLU 221 ? C GLU 221 
3 1 Y 1 B MET 1   ? D MET 1   
4 1 Y 1 B GLU 221 ? D GLU 221 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2NUF 'double helix'         
2NUF 'a-form double helix'  
2NUF tetraloop              
2NUF 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A A 15 1_555 A G 12 1_555 -6.707 -4.898 0.279  -22.224 8.962   -14.412 1  C_A15:G12_C C 15 ? C 12 ? 11 10 
1 A G 16 1_555 A C 11 1_555 -0.124 -0.246 -0.220 -6.662  4.383   0.948   2  C_G16:C11_C C 16 ? C 11 ? 19 1  
1 A A 17 1_555 A U 10 1_555 -0.201 -0.345 -0.092 -0.759  -11.144 -3.684  3  C_A17:U10_C C 17 ? C 10 ? 20 1  
1 A G 18 1_555 A U 9  1_555 -2.356 -0.722 0.387  2.273   -16.253 1.910   4  C_G18:U9_C  C 18 ? C 9  ? 28 1  
1 A U 19 1_555 A A 8  1_555 -0.042 0.045  0.190  4.499   -12.204 1.159   5  C_U19:A8_C  C 19 ? C 8  ? 20 1  
1 A G 20 1_555 A C 7  1_555 -0.123 -0.233 0.043  -3.929  -5.912  0.230   6  C_G20:C7_C  C 20 ? C 7  ? 19 1  
1 A G 21 1_555 A U 6  1_555 -1.918 -0.274 0.421  2.131   -6.960  2.751   7  C_G21:U6_C  C 21 ? C 6  ? 28 1  
1 A C 22 1_555 A G 5  1_555 -0.302 -0.226 -0.141 -1.299  -6.014  -3.566  8  C_C22:G5_C  C 22 ? C 5  ? 19 1  
1 A C 23 1_555 A G 4  1_555 0.040  -0.244 -0.351 1.443   -6.429  -0.513  9  C_C23:G4_C  C 23 ? C 4  ? 19 1  
1 A U 24 1_555 A A 3  1_555 0.459  -0.071 -0.008 6.179   -3.082  5.488   10 C_U24:A3_C  C 24 ? C 3  ? 20 1  
1 A U 25 1_555 A A 2  1_555 -0.161 -0.211 0.240  -4.179  -3.112  -4.926  11 C_U25:A2_C  C 25 ? C 2  ? 20 1  
1 A G 26 1_555 A C 1  1_555 0.060  -0.066 0.010  -5.698  -8.415  -2.016  12 C_G26:C1_C  C 26 ? C 1  ? 19 1  
1 A C 27 1_555 B G 28 1_555 -0.042 -0.121 0.163  1.053   -13.385 0.114   13 C_C27:G28_D C 27 ? D 28 ? 19 1  
1 A G 28 1_555 B C 27 1_555 0.309  -0.207 0.195  0.231   -11.448 -0.560  14 C_G28:C27_D C 28 ? D 27 ? 19 1  
1 B C 1  1_555 B G 26 1_555 0.089  -0.062 0.141  1.466   -8.534  -1.024  15 D_C1:G26_D  D 1  ? D 26 ? 19 1  
1 B A 2  1_555 B U 25 1_555 0.075  -0.046 0.230  5.173   -5.677  -1.850  16 D_A2:U25_D  D 2  ? D 25 ? 20 1  
1 B A 3  1_555 B U 24 1_555 -0.354 -0.051 -0.067 -5.767  -9.204  4.536   17 D_A3:U24_D  D 3  ? D 24 ? 20 1  
1 B G 4  1_555 B C 23 1_555 -0.058 -0.154 -0.350 -2.567  -6.361  -0.243  18 D_G4:C23_D  D 4  ? D 23 ? 19 1  
1 B G 5  1_555 B C 22 1_555 0.183  -0.158 -0.300 0.977   -3.946  -4.092  19 D_G5:C22_D  D 5  ? D 22 ? 19 1  
1 B U 6  1_555 B G 21 1_555 1.906  -0.312 0.152  0.930   -4.853  1.007   20 D_U6:G21_D  D 6  ? D 21 ? 28 1  
1 B C 7  1_555 B G 20 1_555 0.109  -0.285 -0.116 6.978   -8.135  -2.451  21 D_C7:G20_D  D 7  ? D 20 ? 19 1  
1 B A 8  1_555 B U 19 1_555 0.183  -0.053 0.392  -3.376  -7.351  1.309   22 D_A8:U19_D  D 8  ? D 19 ? 20 1  
1 B U 9  1_555 B G 18 1_555 2.469  -0.807 0.375  -0.858  -13.090 0.926   23 D_U9:G18_D  D 9  ? D 18 ? 28 1  
1 B U 10 1_555 B A 17 1_555 0.237  -0.302 -0.141 2.818   -6.380  -1.547  24 D_U10:A17_D D 10 ? D 17 ? 20 1  
1 B C 11 1_555 B G 16 1_555 0.326  -0.128 -0.120 3.585   7.714   4.032   25 D_C11:G16_D D 11 ? D 16 ? 19 1  
1 B G 12 1_555 B A 15 1_555 6.845  -5.412 0.665  22.112  8.747   -12.554 26 D_G12:A15_D D 12 ? D 15 ? ?  ?  
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A A 15 1_555 A G 12 1_555 A G 16 1_555 A C 11 1_555 1.451  -1.014 3.019 3.446  5.584  51.997 -1.487 -1.435 2.987 6.341  -3.913  
52.381 1  CC_A15G16:C11G12_CC C 15 ? C 12 ? C 16 ? C 11 ? 
1 A G 16 1_555 A C 11 1_555 A A 17 1_555 A U 10 1_555 -0.080 -1.975 3.291 -0.185 3.553  26.214 -5.227 0.127  3.002 7.787  0.406   
26.450 2  CC_G16A17:U10C11_CC C 16 ? C 11 ? C 17 ? C 10 ? 
1 A A 17 1_555 A U 10 1_555 A G 18 1_555 A U 9  1_555 0.347  -2.090 2.900 -4.284 8.730  23.832 -6.582 -1.704 1.935 20.102 9.864   
25.713 3  CC_A17G18:U9U10_CC  C 17 ? C 10 ? C 18 ? C 9  ? 
1 A G 18 1_555 A U 9  1_555 A U 19 1_555 A A 8  1_555 -0.157 -1.426 3.259 -0.788 6.864  42.275 -2.614 0.139  3.005 9.441  1.084   
42.811 4  CC_G18U19:A8U9_CC   C 18 ? C 9  ? C 19 ? C 8  ? 
1 A U 19 1_555 A A 8  1_555 A G 20 1_555 A C 7  1_555 -0.150 -1.484 3.297 -0.120 11.658 30.378 -4.550 0.248  2.569 21.288 0.219   
32.490 5  CC_U19G20:C7A8_CC   C 19 ? C 8  ? C 20 ? C 7  ? 
1 A G 20 1_555 A C 7  1_555 A G 21 1_555 A U 6  1_555 0.592  -2.167 2.770 -3.412 9.078  26.461 -6.004 -1.799 1.850 19.037 7.155   
28.152 6  CC_G20G21:U6C7_CC   C 20 ? C 7  ? C 21 ? C 6  ? 
1 A G 21 1_555 A U 6  1_555 A C 22 1_555 A G 5  1_555 -0.357 -1.888 3.422 3.126  3.036  34.762 -3.601 1.071  3.207 5.056  -5.207  
35.026 7  CC_G21C22:G5U6_CC   C 21 ? C 6  ? C 22 ? C 5  ? 
1 A C 22 1_555 A G 5  1_555 A C 23 1_555 A G 4  1_555 0.037  -1.662 3.245 1.015  11.057 35.128 -4.016 0.068  2.620 17.779 -1.632  
36.788 8  CC_C22C23:G4G5_CC   C 22 ? C 5  ? C 23 ? C 4  ? 
1 A C 23 1_555 A G 4  1_555 A U 24 1_555 A A 3  1_555 0.684  -1.732 3.255 -3.499 5.540  29.308 -4.410 -1.994 2.789 10.781 6.809   
30.016 9  CC_C23U24:A3G4_CC   C 23 ? C 4  ? C 24 ? C 3  ? 
1 A U 24 1_555 A A 3  1_555 A U 25 1_555 A A 2  1_555 -0.649 -2.241 3.510 -3.034 5.995  31.104 -5.208 0.618  3.083 11.019 5.576   
31.804 10 CC_U24U25:A2A3_CC   C 24 ? C 3  ? C 25 ? C 2  ? 
1 A U 25 1_555 A A 2  1_555 A G 26 1_555 A C 1  1_555 -0.250 -1.938 3.300 2.119  4.701  28.003 -4.973 0.974  2.916 9.612  -4.332  
28.465 11 CC_U25G26:C1A2_CC   C 25 ? C 2  ? C 26 ? C 1  ? 
1 A G 26 1_555 A C 1  1_555 A C 27 1_555 B G 28 1_555 0.781  -1.222 3.154 -1.608 6.780  37.955 -2.628 -1.367 2.867 10.318 2.448   
38.566 12 CC_G26C27:G28C1_DC  C 26 ? C 1  ? C 27 ? D 28 ? 
1 A C 27 1_555 B G 28 1_555 A G 28 1_555 B C 27 1_555 -0.027 -1.400 3.308 0.108  7.185  32.726 -3.575 0.063  2.943 12.564 -0.189  
33.484 13 CC_C27G28:C27G28_DD C 27 ? D 28 ? C 28 ? D 27 ? 
1 A G 28 1_555 B C 27 1_555 B C 1  1_555 B G 26 1_555 -0.747 -1.147 3.322 0.616  8.256  37.898 -2.717 1.199  3.004 12.530 -0.935  
38.759 14 CD_G28C1:G26C27_DD  C 28 ? D 27 ? D 1  ? D 26 ? 
1 B C 1  1_555 B G 26 1_555 B A 2  1_555 B U 25 1_555 0.199  -1.856 3.141 -0.714 4.299  27.062 -4.891 -0.581 2.811 9.112  1.514   
27.404 15 DD_C1A2:U25G26_DD   D 1  ? D 26 ? D 2  ? D 25 ? 
1 B A 2  1_555 B U 25 1_555 B A 3  1_555 B U 24 1_555 0.430  -2.087 3.523 3.904  6.794  32.194 -4.832 -0.082 3.061 12.029 -6.912  
33.109 16 DD_A2A3:U24U25_DD   D 2  ? D 25 ? D 3  ? D 24 ? 
1 B A 3  1_555 B U 24 1_555 B G 4  1_555 B C 23 1_555 -0.740 -1.741 3.299 0.602  8.344  26.802 -5.418 1.659  2.631 17.468 -1.261  
28.055 17 DD_A3G4:C23U24_DD   D 3  ? D 24 ? D 4  ? D 23 ? 
1 B G 4  1_555 B C 23 1_555 B G 5  1_555 B C 22 1_555 -0.064 -1.620 3.264 -0.709 8.976  35.362 -3.758 0.011  2.784 14.488 1.145   
36.455 18 DD_G4G5:C22C23_DD   D 4  ? D 23 ? D 5  ? D 22 ? 
1 B G 5  1_555 B C 22 1_555 B U 6  1_555 B G 21 1_555 0.246  -1.732 3.388 -2.897 4.680  35.439 -3.484 -0.815 3.113 7.632  4.724   
35.850 19 DD_G5U6:G21C22_DD   D 5  ? D 22 ? D 6  ? D 21 ? 
1 B U 6  1_555 B G 21 1_555 B C 7  1_555 B G 20 1_555 -0.615 -2.154 2.879 2.656  7.685  26.060 -6.061 1.819  2.098 16.537 -5.716  
27.278 20 DD_U6C7:G20G21_DD   D 6  ? D 21 ? D 7  ? D 20 ? 
1 B C 7  1_555 B G 20 1_555 B A 8  1_555 B U 19 1_555 0.238  -1.504 3.243 -3.362 13.258 31.807 -4.382 -0.870 2.408 22.913 5.810   
34.553 21 DD_C7A8:U19G20_DD   D 7  ? D 20 ? D 8  ? D 19 ? 
1 B A 8  1_555 B U 19 1_555 B U 9  1_555 B G 18 1_555 0.027  -1.568 3.199 2.790  6.848  42.137 -2.796 0.226  2.917 9.437  -3.845  
42.752 22 DD_A8U9:G18U19_DD   D 8  ? D 19 ? D 9  ? D 18 ? 
1 B U 9  1_555 B G 18 1_555 B U 10 1_555 B A 17 1_555 -0.259 -2.023 3.062 4.508  5.307  23.597 -6.158 1.803  2.463 12.629 -10.727 
24.589 23 DD_U9U10:A17G18_DD  D 9  ? D 18 ? D 10 ? D 17 ? 
1 B U 10 1_555 B A 17 1_555 B C 11 1_555 B G 16 1_555 0.483  -1.839 3.312 -0.224 7.932  28.916 -5.094 -0.977 2.719 15.519 0.439   
29.962 24 DD_U10C11:G16A17_DD D 10 ? D 17 ? D 11 ? D 16 ? 
1 B C 11 1_555 B G 16 1_555 B G 12 1_555 B A 15 1_555 -1.463 -1.017 2.783 -1.479 8.186  49.870 -1.676 1.626  2.635 9.631  1.740   
50.515 25 DD_C11G12:A15G16_DD D 11 ? D 16 ? D 12 ? D 15 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION' MG  
4 water           HOH 
#