data_2NUG
# 
_entry.id   2NUG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NUG         
NDB   PR0241       
RCSB  RCSB040315   
WWPDB D_1000040315 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RC7 
;Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with ds-RNA (5'-GGCGCGCGCC-3')
;
unspecified 
PDB 2EZ6 'Crystal structure of RNase III mutant D44N from Aquifex aeolicus complexed with products at 2.05-Angstrom Resolution' 
unspecified 
PDB 1YZ9 
;Crystal structure of RNase III mutant E110Q from Aquifex aeolicus complexed with ds-RNA (5'-CGAACUUCGCG-3') at 2.1-Angstrom Resolution
;
unspecified 
PDB 1YYO 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-CGCGAAUUCGCG-3') at 2.5-Angstrom Resolution
;
unspecified 
PDB 1YYW 
;Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA (5'-AAAUAUAUAUUU-3') at 2.8-Angstrom Resolution
;
unspecified 
PDB 2NUE . unspecified 
PDB 2NUF . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NUG 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.H.'    1 
'Shaw, G.'     2 
'Tropea, J.E.' 3 
'Waugh, D.S.'  4 
'Court, D.L.'  5 
'Ji, X.'       6 
# 
_citation.id                        primary 
_citation.title                     'A stepwise model for double-stranded RNA processing by ribonuclease III.' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            67 
_citation.page_first                143 
_citation.page_last                 154 
_citation.year                      2007 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18047582 
_citation.pdbx_database_id_DOI      10.1111/j.1365-2958.2007.06032.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gan, J.'      1 
primary 'Shaw, G.'     2 
primary 'Tropea, J.E.' 3 
primary 'Waugh, D.S.'  4 
primary 'Court, D.L.'  5 
primary 'Ji, X.'       6 
# 
_cell.entry_id           2NUG 
_cell.length_a           95.4 
_cell.length_b           119.9 
_cell.length_c           58.9 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NUG 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'" 3507.138  2   ?        ? ? ? 
2 polymer     syn "5'-R(P*AP*GP*UP*GP*GP*CP*CP*UP*UP*GP*C)-3'" 3499.114  2   ?        ? ? ? 
3 polymer     man 'Ribonuclease III'                           26147.381 2   3.1.26.3 ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                              24.305    19  ?        ? ? ? 
5 water       nat water                                        18.015    445 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'RNase III' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no AAGGUCAUUCG AAGGUCAUUCG C,D ? 
2 polyribonucleotide no no AGUGGCCUUGC AGUGGCCUUGC E,F ? 
3 'polypeptide(L)'   no no 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   A   n 
1 2   A   n 
1 3   G   n 
1 4   G   n 
1 5   U   n 
1 6   C   n 
1 7   A   n 
1 8   U   n 
1 9   U   n 
1 10  C   n 
1 11  G   n 
2 1   A   n 
2 2   G   n 
2 3   U   n 
2 4   G   n 
2 5   G   n 
2 6   C   n 
2 7   C   n 
2 8   U   n 
2 9   U   n 
2 10  G   n 
2 11  C   n 
3 1   MET n 
3 2   LYS n 
3 3   MET n 
3 4   LEU n 
3 5   GLU n 
3 6   GLN n 
3 7   LEU n 
3 8   GLU n 
3 9   LYS n 
3 10  LYS n 
3 11  LEU n 
3 12  GLY n 
3 13  TYR n 
3 14  THR n 
3 15  PHE n 
3 16  LYS n 
3 17  ASP n 
3 18  LYS n 
3 19  SER n 
3 20  LEU n 
3 21  LEU n 
3 22  GLU n 
3 23  LYS n 
3 24  ALA n 
3 25  LEU n 
3 26  THR n 
3 27  HIS n 
3 28  VAL n 
3 29  SER n 
3 30  TYR n 
3 31  SER n 
3 32  LYS n 
3 33  LYS n 
3 34  GLU n 
3 35  HIS n 
3 36  TYR n 
3 37  GLU n 
3 38  THR n 
3 39  LEU n 
3 40  GLU n 
3 41  PHE n 
3 42  LEU n 
3 43  GLY n 
3 44  ASP n 
3 45  ALA n 
3 46  LEU n 
3 47  VAL n 
3 48  ASN n 
3 49  PHE n 
3 50  PHE n 
3 51  ILE n 
3 52  VAL n 
3 53  ASP n 
3 54  LEU n 
3 55  LEU n 
3 56  VAL n 
3 57  GLN n 
3 58  TYR n 
3 59  SER n 
3 60  PRO n 
3 61  ASN n 
3 62  LYS n 
3 63  ARG n 
3 64  GLU n 
3 65  GLY n 
3 66  PHE n 
3 67  LEU n 
3 68  SER n 
3 69  PRO n 
3 70  LEU n 
3 71  LYS n 
3 72  ALA n 
3 73  TYR n 
3 74  LEU n 
3 75  ILE n 
3 76  SER n 
3 77  GLU n 
3 78  GLU n 
3 79  PHE n 
3 80  PHE n 
3 81  ASN n 
3 82  LEU n 
3 83  LEU n 
3 84  ALA n 
3 85  GLN n 
3 86  LYS n 
3 87  LEU n 
3 88  GLU n 
3 89  LEU n 
3 90  HIS n 
3 91  LYS n 
3 92  PHE n 
3 93  ILE n 
3 94  ARG n 
3 95  ILE n 
3 96  LYS n 
3 97  ARG n 
3 98  GLY n 
3 99  LYS n 
3 100 ILE n 
3 101 ASN n 
3 102 GLU n 
3 103 THR n 
3 104 ILE n 
3 105 ILE n 
3 106 GLY n 
3 107 ASP n 
3 108 VAL n 
3 109 PHE n 
3 110 GLU n 
3 111 ALA n 
3 112 LEU n 
3 113 TRP n 
3 114 ALA n 
3 115 ALA n 
3 116 VAL n 
3 117 TYR n 
3 118 ILE n 
3 119 ASP n 
3 120 SER n 
3 121 GLY n 
3 122 ARG n 
3 123 ASP n 
3 124 ALA n 
3 125 ASN n 
3 126 PHE n 
3 127 THR n 
3 128 ARG n 
3 129 GLU n 
3 130 LEU n 
3 131 PHE n 
3 132 TYR n 
3 133 LYS n 
3 134 LEU n 
3 135 PHE n 
3 136 LYS n 
3 137 GLU n 
3 138 ASP n 
3 139 ILE n 
3 140 LEU n 
3 141 SER n 
3 142 ALA n 
3 143 ILE n 
3 144 LYS n 
3 145 GLU n 
3 146 GLY n 
3 147 ARG n 
3 148 VAL n 
3 149 LYS n 
3 150 LYS n 
3 151 ASP n 
3 152 TYR n 
3 153 LYS n 
3 154 THR n 
3 155 ILE n 
3 156 LEU n 
3 157 GLN n 
3 158 GLU n 
3 159 ILE n 
3 160 THR n 
3 161 GLN n 
3 162 LYS n 
3 163 ARG n 
3 164 TRP n 
3 165 LYS n 
3 166 GLU n 
3 167 ARG n 
3 168 PRO n 
3 169 GLU n 
3 170 TYR n 
3 171 ARG n 
3 172 LEU n 
3 173 ILE n 
3 174 SER n 
3 175 VAL n 
3 176 GLU n 
3 177 GLY n 
3 178 PRO n 
3 179 HIS n 
3 180 HIS n 
3 181 LYS n 
3 182 LYS n 
3 183 LYS n 
3 184 PHE n 
3 185 ILE n 
3 186 VAL n 
3 187 GLU n 
3 188 ALA n 
3 189 LYS n 
3 190 ILE n 
3 191 LYS n 
3 192 GLU n 
3 193 TYR n 
3 194 ARG n 
3 195 THR n 
3 196 LEU n 
3 197 GLY n 
3 198 GLU n 
3 199 GLY n 
3 200 LYS n 
3 201 SER n 
3 202 LYS n 
3 203 LYS n 
3 204 GLU n 
3 205 ALA n 
3 206 GLU n 
3 207 GLN n 
3 208 ARG n 
3 209 ALA n 
3 210 ALA n 
3 211 GLU n 
3 212 GLU n 
3 213 LEU n 
3 214 ILE n 
3 215 LYS n 
3 216 LEU n 
3 217 LEU n 
3 218 GLU n 
3 219 GLU n 
3 220 SER n 
3 221 GLU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 rnc 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHPK1409 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RNC_AQUAE O67082 3 
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEIT
QKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
;
1 ? 
2 PDB 2NUG      2NUG   1 ? ? ? 
3 PDB 2NUG      2NUG   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2NUG A 1 ? 221 ? O67082 1  ? 221 ? 1  221 
2 1 2NUG B 1 ? 221 ? O67082 1  ? 221 ? 1  221 
3 2 2NUG C 1 ? 11  ? 2NUG   2  ? 12  ? 2  12  
4 3 2NUG E 1 ? 11  ? 2NUG   17 ? 27  ? 17 27  
5 2 2NUG D 1 ? 11  ? 2NUG   2  ? 12  ? 2  12  
6 3 2NUG F 1 ? 11  ? 2NUG   17 ? 27  ? 17 27  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2NUG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   51.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.2 M MgCl2 + 3.4 M 1,6 Hexanediol in 0.1 M Tris-Cl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 NaCl       ? ? ? 
1 2 1 'PEG 3350' ? ? ? 
1 3 1 Tris-Cl    ? ? ? 
1 4 1 H2O        ? ? ? 
1 5 2 NaCl       ? ? ? 
1 6 2 'PEG 3350' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-07-03 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2NUG 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   67288 
_reflns.number_all                   67288 
_reflns.percent_possible_obs         89.6 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.2 
_reflns.B_iso_Wilson_estimate        23.2 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   62.2 
_reflns_shell.Rmerge_I_obs           0.231 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        1.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4607 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NUG 
_refine.ls_number_reflns_obs                     67277 
_refine.ls_number_reflns_all                     67277 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               174215.68 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.44 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    89.6 
_refine.ls_R_factor_obs                          0.194 
_refine.ls_R_factor_all                          0.194 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_R_factor_R_free                       0.22 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3425 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.0 
_refine.aniso_B[1][1]                            4.94 
_refine.aniso_B[2][2]                            -2.20 
_refine.aniso_B[3][3]                            -2.74 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.407442 
_refine.solvent_model_param_bsol                 64.6616 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1RC7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2NUG 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           30.00 
_refine_analyze.Luzzati_coordinate_error_free   0.22 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3627 
_refine_hist.pdbx_number_atoms_nucleic_acid   1034 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             445 
_refine_hist.number_atoms_total               5125 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        29.44 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      16.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.95  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.67  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.61  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.72  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             8105 
_refine_ls_shell.R_factor_R_work                  0.27 
_refine_ls_shell.percent_reflns_obs               69.3 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             453 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                8105 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NUG 
_struct.title                     
'Crystal structure of RNase III from Aquifex aeolicus complexed with ds-RNA at 1.7-Angstrom Resolution' 
_struct.pdbx_descriptor           'Ribonuclease III(E.C.3.1.26.3)/RNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NUG 
_struct_keywords.pdbx_keywords   hydrolase/RNA 
_struct_keywords.text            'Ribonuclease III, dsRNA, RNA interference, endonucleolytic cleavage, hydrolase-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET E 3   ? GLY E 12  ? MET A 3   GLY A 12  1 ? 10 
HELX_P HELX_P2  2  ASP E 17  ? THR E 26  ? ASP A 17  THR A 26  1 ? 10 
HELX_P HELX_P3  3  TYR E 36  ? TYR E 58  ? TYR A 36  TYR A 58  1 ? 23 
HELX_P HELX_P4  4  ARG E 63  ? ILE E 75  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER E 76  ? LYS E 86  ? SER A 76  LYS A 86  1 ? 11 
HELX_P HELX_P6  6  LEU E 87  ? PHE E 92  ? LEU A 87  PHE A 92  5 ? 6  
HELX_P HELX_P7  7  ASN E 101 ? SER E 120 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP E 123 ? GLU E 145 ? ASP A 123 GLU A 145 1 ? 23 
HELX_P HELX_P9  9  ASP E 151 ? LYS E 165 ? ASP A 151 LYS A 165 1 ? 15 
HELX_P HELX_P10 10 PRO E 178 ? LYS E 182 ? PRO A 178 LYS A 182 5 ? 5  
HELX_P HELX_P11 11 SER E 201 ? GLU E 218 ? SER A 201 GLU A 218 1 ? 18 
HELX_P HELX_P12 12 MET F 3   ? GLY F 12  ? MET B 3   GLY B 12  1 ? 10 
HELX_P HELX_P13 13 ASP F 17  ? THR F 26  ? ASP B 17  THR B 26  1 ? 10 
HELX_P HELX_P14 14 TYR F 36  ? TYR F 58  ? TYR B 36  TYR B 58  1 ? 23 
HELX_P HELX_P15 15 ARG F 63  ? ILE F 75  ? ARG B 63  ILE B 75  1 ? 13 
HELX_P HELX_P16 16 SER F 76  ? LYS F 86  ? SER B 76  LYS B 86  1 ? 11 
HELX_P HELX_P17 17 LEU F 87  ? PHE F 92  ? LEU B 87  PHE B 92  5 ? 6  
HELX_P HELX_P18 18 ASN F 101 ? SER F 120 ? ASN B 101 SER B 120 1 ? 20 
HELX_P HELX_P19 19 ASP F 123 ? GLU F 145 ? ASP B 123 GLU B 145 1 ? 23 
HELX_P HELX_P20 20 ASP F 151 ? LYS F 165 ? ASP B 151 LYS B 165 1 ? 15 
HELX_P HELX_P21 21 PRO F 178 ? LYS F 182 ? PRO B 178 LYS B 182 5 ? 5  
HELX_P HELX_P22 22 SER F 201 ? GLU F 219 ? SER B 201 GLU B 219 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A G   11  "O3'" ? ? ? 1_555 T  MG  .  MG ? ? C G   12  B MG  507 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc2   metalc ? ? B A   1   OP1   A ? ? 1_555 O  MG  .  MG ? ? E A   17  A MG  502 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc3   metalc ? ? B A   1   OP2   A ? ? 1_555 N  MG  .  MG ? ? E A   17  A MG  501 1_555 ? ? ? ? ? ? ?            2.148 ? 
metalc4   metalc ? ? B A   1   OP2   A ? ? 1_555 O  MG  .  MG ? ? E A   17  A MG  502 1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc5   metalc ? ? B G   2   OP2   A ? ? 1_555 I  MG  .  MG A ? E G   18  E MG  505 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc6   metalc ? ? C G   11  "O3'" ? ? ? 1_555 N  MG  .  MG ? ? D G   12  A MG  501 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc7   metalc ? ? D A   1   OP1   A ? ? 1_555 U  MG  .  MG ? ? F A   17  B MG  508 1_555 ? ? ? ? ? ? ?            2.098 ? 
metalc8   metalc ? ? D A   1   OP2   A ? ? 1_555 U  MG  .  MG ? ? F A   17  B MG  508 1_555 ? ? ? ? ? ? ?            2.192 ? 
metalc9   metalc ? ? D A   1   OP2   A ? ? 1_555 T  MG  .  MG ? ? F A   17  B MG  507 1_555 ? ? ? ? ? ? ?            2.167 ? 
metalc10  metalc ? ? D G   2   OP2   A ? ? 1_555 L  MG  .  MG A ? F G   18  F MG  511 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc11  metalc ? ? E GLU 37  OE1   ? ? ? 1_555 Q  MG  .  MG ? ? A GLU 37  A MG  504 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc12  metalc ? ? E GLU 40  OE1   ? ? ? 1_555 Q  MG  .  MG ? ? A GLU 40  A MG  504 1_555 ? ? ? ? ? ? ?            2.123 ? 
metalc13  metalc ? ? E GLU 40  OE2   ? ? ? 1_555 O  MG  .  MG ? ? A GLU 40  A MG  502 1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc14  metalc ? ? E ASP 44  OD1   ? ? ? 1_555 N  MG  .  MG ? ? A ASP 44  A MG  501 1_555 ? ? ? ? ? ? ?            2.025 ? 
metalc15  metalc ? ? E ASP 107 OD1   ? ? ? 1_555 P  MG  .  MG A ? A ASP 107 A MG  503 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc16  metalc ? ? E GLU 110 OE1   ? ? ? 1_555 O  MG  .  MG ? ? A GLU 110 A MG  502 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc17  metalc ? ? E GLU 110 OE2   ? ? ? 1_555 N  MG  .  MG ? ? A GLU 110 A MG  501 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc18  metalc ? ? F GLU 37  OE1   ? ? ? 1_555 W  MG  .  MG ? ? B GLU 37  B MG  510 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc19  metalc ? ? F GLU 40  OE1   ? ? ? 1_555 W  MG  .  MG ? ? B GLU 40  B MG  510 1_555 ? ? ? ? ? ? ?            2.014 ? 
metalc20  metalc ? ? F GLU 40  OE2   ? ? ? 1_555 U  MG  .  MG ? ? B GLU 40  B MG  508 1_555 ? ? ? ? ? ? ?            1.973 ? 
metalc21  metalc ? ? F ASP 44  OD1   ? ? ? 1_555 T  MG  .  MG ? ? B ASP 44  B MG  507 1_555 ? ? ? ? ? ? ?            2.052 ? 
metalc22  metalc ? ? F ASP 107 OD1   ? ? ? 1_555 V  MG  .  MG ? ? B ASP 107 B MG  509 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc23  metalc ? ? F GLU 110 OE1   ? ? ? 1_555 U  MG  .  MG ? ? B GLU 110 B MG  508 1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc24  metalc ? ? F GLU 110 OE2   ? ? ? 1_555 T  MG  .  MG ? ? B GLU 110 B MG  507 1_555 ? ? ? ? ? ? ?            2.132 ? 
metalc25  metalc ? ? N MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  501 A HOH 518 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc26  metalc ? ? N MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? A MG  501 D HOH 517 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc27  metalc ? ? N MG  .   MG    ? ? ? 1_555 DA HOH .  O  B ? A MG  501 A HOH 519 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc28  metalc ? ? O MG  .   MG    ? ? ? 1_555 DA HOH .  O  B ? A MG  502 A HOH 519 1_555 ? ? ? ? ? ? ?            2.045 ? 
metalc29  metalc ? ? O MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  502 A HOH 520 1_555 ? ? ? ? ? ? ?            2.295 ? 
metalc30  metalc ? ? O MG  .   MG    ? ? ? 1_555 DA HOH .  O  B ? A MG  502 A HOH 531 1_555 ? ? ? ? ? ? ?            2.033 ? 
metalc31  metalc ? ? O MG  .   MG    ? ? ? 1_555 AA HOH .  O  A ? A MG  502 E HOH 506 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc32  metalc ? ? P MG  .   MG    A ? ? 1_555 DA HOH .  O  A ? A MG  503 A HOH 523 1_555 ? ? ? ? ? ? ?            2.215 ? 
metalc33  metalc ? ? P MG  .   MG    A ? ? 1_555 AA HOH .  O  ? ? A MG  503 E HOH 507 1_555 ? ? ? ? ? ? ?            2.217 ? 
metalc34  metalc ? ? P MG  .   MG    A ? ? 1_555 AA HOH .  O  A ? A MG  503 E HOH 506 1_555 ? ? ? ? ? ? ?            2.000 ? 
metalc35  metalc ? ? P MG  .   MG    A ? ? 1_555 DA HOH .  O  ? ? A MG  503 A HOH 521 1_555 ? ? ? ? ? ? ?            2.066 ? 
metalc36  metalc ? ? P MG  .   MG    A ? ? 1_555 DA HOH .  O  ? ? A MG  503 A HOH 522 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc37  metalc ? ? Q MG  .   MG    ? ? ? 1_555 AA HOH .  O  ? ? A MG  504 E HOH 508 1_555 ? ? ? ? ? ? ?            2.098 ? 
metalc38  metalc ? ? Q MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  504 A HOH 525 1_555 ? ? ? ? ? ? ?            2.212 ? 
metalc39  metalc ? ? Q MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  504 A HOH 524 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc40  metalc ? ? Q MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? A MG  504 B HOH 519 1_555 ? ? ? ? ? ? ?            2.140 ? 
metalc41  metalc ? ? I MG  .   MG    A ? ? 1_555 AA HOH .  O  ? ? E MG  505 E HOH 511 1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc42  metalc ? ? I MG  .   MG    A ? ? 1_555 AA HOH .  O  ? ? E MG  505 E HOH 510 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc43  metalc ? ? I MG  .   MG    A ? ? 1_555 AA HOH .  O  ? ? E MG  505 E HOH 512 1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc44  metalc ? ? I MG  .   MG    A ? ? 1_555 AA HOH .  O  ? ? E MG  505 E HOH 509 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc45  metalc ? ? R MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  506 A HOH 529 1_555 ? ? ? ? ? ? ?            2.115 ? 
metalc46  metalc ? ? R MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  506 A HOH 527 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc47  metalc ? ? R MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  506 A HOH 528 1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc48  metalc ? ? R MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  506 A HOH 526 1_555 ? ? ? ? ? ? ?            2.008 ? 
metalc49  metalc ? ? R MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? A MG  506 C HOH 520 1_555 ? ? ? ? ? ? ?            2.102 ? 
metalc50  metalc ? ? R MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? A MG  506 C HOH 521 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc51  metalc ? ? T MG  .   MG    ? ? ? 1_555 Z  HOH .  O  B ? B MG  507 C HOH 523 1_555 ? ? ? ? ? ? ?            2.057 ? 
metalc52  metalc ? ? T MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? B MG  507 C HOH 522 1_555 ? ? ? ? ? ? ?            2.203 ? 
metalc53  metalc ? ? T MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  507 B HOH 520 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc54  metalc ? ? U MG  .   MG    ? ? ? 1_555 EA HOH .  O  B ? B MG  508 B HOH 521 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc55  metalc ? ? U MG  .   MG    ? ? ? 1_555 EA HOH .  O  B ? B MG  508 B HOH 530 1_555 ? ? ? ? ? ? ?            2.116 ? 
metalc56  metalc ? ? U MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? B MG  508 F HOH 514 1_555 ? ? ? ? ? ? ?            2.158 ? 
metalc57  metalc ? ? U MG  .   MG    ? ? ? 1_555 Z  HOH .  O  B ? B MG  508 C HOH 523 1_555 ? ? ? ? ? ? ?            2.173 ? 
metalc58  metalc ? ? V MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  509 B HOH 523 1_555 ? ? ? ? ? ? ?            2.195 ? 
metalc59  metalc ? ? V MG  .   MG    ? ? ? 1_555 EA HOH .  O  B ? B MG  509 B HOH 521 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc60  metalc ? ? V MG  .   MG    ? ? ? 1_555 EA HOH .  O  B ? B MG  509 B HOH 530 1_555 ? ? ? ? ? ? ?            2.007 ? 
metalc61  metalc ? ? V MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  509 B HOH 522 1_555 ? ? ? ? ? ? ?            2.076 ? 
metalc62  metalc ? ? V MG  .   MG    ? ? ? 1_555 EA HOH .  O  A ? B MG  509 B HOH 524 1_555 ? ? ? ? ? ? ?            2.365 ? 
metalc63  metalc ? ? V MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? B MG  509 F HOH 515 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc64  metalc ? ? W MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? B MG  510 A HOH 530 1_555 ? ? ? ? ? ? ?            2.216 ? 
metalc65  metalc ? ? W MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  510 B HOH 525 1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc66  metalc ? ? W MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  510 B HOH 526 1_555 ? ? ? ? ? ? ?            2.214 ? 
metalc67  metalc ? ? W MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? B MG  510 F HOH 516 1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc68  metalc ? ? L MG  .   MG    A ? ? 1_555 CA HOH .  O  ? ? F MG  511 F HOH 520 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc69  metalc ? ? L MG  .   MG    A ? ? 1_555 CA HOH .  O  ? ? F MG  511 F HOH 517 1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc70  metalc ? ? L MG  .   MG    A ? ? 1_555 CA HOH .  O  ? ? F MG  511 F HOH 518 1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc71  metalc ? ? L MG  .   MG    A ? ? 1_555 CA HOH .  O  ? ? F MG  511 F HOH 519 1_555 ? ? ? ? ? ? ?            2.086 ? 
metalc72  metalc ? ? X MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? B MG  512 D HOH 563 1_555 ? ? ? ? ? ? ?            2.085 ? 
metalc73  metalc ? ? X MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? B MG  512 D HOH 519 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc74  metalc ? ? X MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  512 B HOH 528 1_555 ? ? ? ? ? ? ?            2.084 ? 
metalc75  metalc ? ? X MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? B MG  512 D HOH 518 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc76  metalc ? ? X MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  512 B HOH 527 1_555 ? ? ? ? ? ? ?            2.104 ? 
metalc77  metalc ? ? X MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  512 B HOH 529 1_555 ? ? ? ? ? ? ?            2.129 ? 
metalc78  metalc ? ? M MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? F MG  513 F HOH 545 1_555 ? ? ? ? ? ? ?            2.436 ? 
metalc79  metalc ? ? M MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? F MG  513 F HOH 542 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc80  metalc ? ? M MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? F MG  513 F HOH 544 1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc81  metalc ? ? M MG  .   MG    ? ? ? 1_555 CA HOH .  O  ? ? F MG  513 F HOH 543 1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc82  metalc ? ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  514 D HOH 529 1_555 ? ? ? ? ? ? ?            1.966 ? 
metalc83  metalc ? ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  514 D HOH 550 1_555 ? ? ? ? ? ? ?            2.088 ? 
metalc84  metalc ? ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  514 D HOH 551 1_555 ? ? ? ? ? ? ?            2.097 ? 
metalc85  metalc ? ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  514 D HOH 552 1_555 ? ? ? ? ? ? ?            2.290 ? 
metalc86  metalc ? ? J MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  514 D HOH 533 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc87  metalc ? ? G MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  515 C HOH 538 1_555 ? ? ? ? ? ? ?            2.173 ? 
metalc88  metalc ? ? G MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  515 C HOH 559 1_555 ? ? ? ? ? ? ?            2.044 ? 
metalc89  metalc ? ? G MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  515 C HOH 535 1_555 ? ? ? ? ? ? ?            2.136 ? 
metalc90  metalc ? ? G MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  515 C HOH 563 1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc91  metalc ? ? K MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  516 D HOH 531 1_555 ? ? ? ? ? ? ?            2.389 ? 
metalc92  metalc ? ? K MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  516 D HOH 522 1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc93  metalc ? ? K MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  516 D HOH 535 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc94  metalc ? ? K MG  .   MG    ? ? ? 1_555 AA HOH .  O  ? ? D MG  516 E HOH 513 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc95  metalc ? ? K MG  .   MG    ? ? ? 1_555 AA HOH .  O  ? ? D MG  516 E HOH 526 1_555 ? ? ? ? ? ? ?            1.990 ? 
metalc96  metalc ? ? K MG  .   MG    ? ? ? 1_555 BA HOH .  O  ? ? D MG  516 D HOH 562 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc97  metalc ? ? S MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  517 A HOH 632 1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc98  metalc ? ? S MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  517 A HOH 620 1_555 ? ? ? ? ? ? ?            1.934 ? 
metalc99  metalc ? ? S MG  .   MG    ? ? ? 1_555 DA HOH .  O  ? ? A MG  517 A HOH 534 1_555 ? ? ? ? ? ? ?            2.052 ? 
metalc100 metalc ? ? Y MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  518 B HOH 657 1_555 ? ? ? ? ? ? ?            1.964 ? 
metalc101 metalc ? ? Y MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  518 B HOH 561 1_555 ? ? ? ? ? ? ?            2.000 ? 
metalc102 metalc ? ? Y MG  .   MG    ? ? ? 1_555 EA HOH .  O  ? ? B MG  518 B HOH 538 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc103 metalc ? ? H MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  519 C HOH 546 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc104 metalc ? ? H MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  519 C HOH 562 1_555 ? ? ? ? ? ? ?            2.232 ? 
metalc105 metalc ? ? H MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  519 C HOH 530 1_555 ? ? ? ? ? ? ?            2.266 ? 
metalc106 metalc ? ? H MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  519 C HOH 526 1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc107 metalc ? ? H MG  .   MG    ? ? ? 1_555 Z  HOH .  O  ? ? C MG  519 C HOH 540 1_555 ? ? ? ? ? ? ?            2.248 ? 
hydrog1   hydrog ? ? A A   1   N1    ? ? ? 1_555 B  U   9  N3 ? ? C A   2   E U   25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? A A   1   N6    ? ? ? 1_555 B  U   9  O4 ? ? C A   2   E U   25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? A A   2   N1    ? ? ? 1_555 B  U   8  N3 ? ? C A   3   E U   24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? A A   2   N6    ? ? ? 1_555 B  U   8  O4 ? ? C A   3   E U   24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? A G   3   N1    ? ? ? 1_555 B  C   7  N3 ? ? C G   4   E C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? A G   3   N2    ? ? ? 1_555 B  C   7  O2 ? ? C G   4   E C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? A G   3   O6    ? ? ? 1_555 B  C   7  N4 ? ? C G   4   E C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? A G   4   N1    ? ? ? 1_555 B  C   6  N3 ? ? C G   5   E C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? A G   4   N2    ? ? ? 1_555 B  C   6  O2 ? ? C G   5   E C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? A G   4   O6    ? ? ? 1_555 B  C   6  N4 ? ? C G   5   E C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? A U   5   N3    ? ? ? 1_555 B  G   5  O6 ? ? C U   6   E G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog12  hydrog ? ? A U   5   O2    ? ? ? 1_555 B  G   5  N1 ? ? C U   6   E G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog13  hydrog ? ? A C   6   N3    ? ? ? 1_555 B  G   4  N1 ? ? C C   7   E G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? A C   6   N4    ? ? ? 1_555 B  G   4  O6 ? ? C C   7   E G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? A C   6   O2    ? ? ? 1_555 B  G   4  N2 ? ? C C   7   E G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? A A   7   N1    ? ? ? 1_555 B  U   3  N3 ? ? C A   8   E U   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? A A   7   N6    ? ? ? 1_555 B  U   3  O4 ? ? C A   8   E U   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? A U   8   N3    ? ? ? 1_555 B  G   2  O6 A ? C U   9   E G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog19  hydrog ? ? A U   8   O2    ? ? ? 1_555 B  G   2  N1 A ? C U   9   E G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog20  hydrog ? ? A U   9   N3    ? ? ? 1_555 B  A   1  N1 A ? C U   10  E A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? A U   9   O4    ? ? ? 1_555 B  A   1  N6 A ? C U   10  E A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? A C   10  N3    ? ? ? 1_555 C  G   11 N1 ? ? C C   11  D G   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? A C   10  N4    ? ? ? 1_555 C  G   11 O6 ? ? C C   11  D G   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? A C   10  O2    ? ? ? 1_555 C  G   11 N2 ? ? C C   11  D G   12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? A G   11  N1    ? ? ? 1_555 C  C   10 N3 ? ? C G   12  D C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? A G   11  N2    ? ? ? 1_555 C  C   10 O2 ? ? C G   12  D C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? A G   11  O6    ? ? ? 1_555 C  C   10 N4 ? ? C G   12  D C   11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? C A   1   N1    ? ? ? 1_555 D  U   9  N3 ? ? D A   2   F U   25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? C A   1   N6    ? ? ? 1_555 D  U   9  O4 ? ? D A   2   F U   25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? C A   2   N1    ? ? ? 1_555 D  U   8  N3 ? ? D A   3   F U   24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? C A   2   N6    ? ? ? 1_555 D  U   8  O4 ? ? D A   3   F U   24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? C G   3   N1    ? ? ? 1_555 D  C   7  N3 ? ? D G   4   F C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? C G   3   N2    ? ? ? 1_555 D  C   7  O2 ? ? D G   4   F C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? C G   3   O6    ? ? ? 1_555 D  C   7  N4 ? ? D G   4   F C   23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? C G   4   N1    ? ? ? 1_555 D  C   6  N3 ? ? D G   5   F C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? C G   4   N2    ? ? ? 1_555 D  C   6  O2 ? ? D G   5   F C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? C G   4   O6    ? ? ? 1_555 D  C   6  N4 ? ? D G   5   F C   22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? C U   5   N3    ? ? ? 1_555 D  G   5  O6 ? ? D U   6   F G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog39  hydrog ? ? C U   5   O2    ? ? ? 1_555 D  G   5  N1 ? ? D U   6   F G   21  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog40  hydrog ? ? C C   6   N3    ? ? ? 1_555 D  G   4  N1 ? ? D C   7   F G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? C C   6   N4    ? ? ? 1_555 D  G   4  O6 ? ? D C   7   F G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? C C   6   O2    ? ? ? 1_555 D  G   4  N2 ? ? D C   7   F G   20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? C A   7   N1    ? ? ? 1_555 D  U   3  N3 ? ? D A   8   F U   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? C A   7   N6    ? ? ? 1_555 D  U   3  O4 ? ? D A   8   F U   19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? C U   8   N3    ? ? ? 1_555 D  G   2  O6 A ? D U   9   F G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog46  hydrog ? ? C U   8   O2    ? ? ? 1_555 D  G   2  N1 A ? D U   9   F G   18  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog47  hydrog ? ? C U   9   N3    ? ? ? 1_555 D  A   1  N1 A ? D U   10  F A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? C U   9   O4    ? ? ? 1_555 D  A   1  N6 A ? D U   10  F A   17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU E 169 ? GLU E 176 ? GLU A 169 GLU A 176 
A 2 LYS E 183 ? ILE E 190 ? LYS A 183 ILE A 190 
A 3 TYR E 193 ? GLY E 199 ? TYR A 193 GLY A 199 
B 1 GLU F 169 ? GLU F 176 ? GLU B 169 GLU B 176 
B 2 LYS F 183 ? ILE F 190 ? LYS B 183 ILE B 190 
B 3 TYR F 193 ? GLY F 199 ? TYR B 193 GLY B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE E 173 ? N ILE A 173 O ILE E 185 ? O ILE A 185 
A 2 3 N PHE E 184 ? N PHE A 184 O GLY E 199 ? O GLY A 199 
B 1 2 N ILE F 173 ? N ILE B 173 O ILE F 185 ? O ILE B 185 
B 2 3 N PHE F 184 ? N PHE B 184 O GLY F 199 ? O GLY B 199 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 501' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 502' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 503' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 504' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG E 505' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 506' 
AC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG B 507' 
AC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG B 508' 
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG B 509' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 510' 
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG F 511' 
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG B 512' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG F 513' 
BC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG D 514' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG C 515' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG D 516' 
BC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 517' 
BC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG B 518' 
CC1 SOFTWAR  ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 519' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7 ASP E  44  ? ASP A 44  . ? 1_555 ? 
2   AC1 7 GLU E  110 ? GLU A 110 . ? 1_555 ? 
3   AC1 7 HOH DA .   ? HOH A 518 . ? 1_555 ? 
4   AC1 7 HOH DA .   ? HOH A 519 . ? 1_555 ? 
5   AC1 7 G   C  11  ? G   D 12  . ? 1_555 ? 
6   AC1 7 HOH BA .   ? HOH D 517 . ? 1_555 ? 
7   AC1 7 A   B  1   ? A   E 17  . ? 1_555 ? 
8   AC2 8 GLU E  40  ? GLU A 40  . ? 1_555 ? 
9   AC2 8 GLU E  110 ? GLU A 110 . ? 1_555 ? 
10  AC2 8 MG  P  .   ? MG  A 503 . ? 1_555 ? 
11  AC2 8 HOH DA .   ? HOH A 519 . ? 1_555 ? 
12  AC2 8 HOH DA .   ? HOH A 520 . ? 1_555 ? 
13  AC2 8 HOH DA .   ? HOH A 531 . ? 1_555 ? 
14  AC2 8 A   B  1   ? A   E 17  . ? 1_555 ? 
15  AC2 8 HOH AA .   ? HOH E 506 . ? 1_555 ? 
16  AC3 7 ASP E  107 ? ASP A 107 . ? 1_555 ? 
17  AC3 7 MG  O  .   ? MG  A 502 . ? 1_555 ? 
18  AC3 7 HOH DA .   ? HOH A 521 . ? 1_555 ? 
19  AC3 7 HOH DA .   ? HOH A 522 . ? 1_555 ? 
20  AC3 7 HOH DA .   ? HOH A 523 . ? 1_555 ? 
21  AC3 7 HOH AA .   ? HOH E 506 . ? 1_555 ? 
22  AC3 7 HOH AA .   ? HOH E 507 . ? 1_555 ? 
23  AC4 7 GLU E  37  ? GLU A 37  . ? 1_555 ? 
24  AC4 7 GLU E  40  ? GLU A 40  . ? 1_555 ? 
25  AC4 7 HOH DA .   ? HOH A 524 . ? 1_555 ? 
26  AC4 7 HOH DA .   ? HOH A 525 . ? 1_555 ? 
27  AC4 7 HOH EA .   ? HOH B 519 . ? 1_555 ? 
28  AC4 7 G   B  2   ? G   E 18  . ? 1_555 ? 
29  AC4 7 HOH AA .   ? HOH E 508 . ? 1_555 ? 
30  AC5 6 A   B  1   ? A   E 17  . ? 1_555 ? 
31  AC5 6 G   B  2   ? G   E 18  . ? 1_555 ? 
32  AC5 6 HOH AA .   ? HOH E 509 . ? 1_555 ? 
33  AC5 6 HOH AA .   ? HOH E 510 . ? 1_555 ? 
34  AC5 6 HOH AA .   ? HOH E 511 . ? 1_555 ? 
35  AC5 6 HOH AA .   ? HOH E 512 . ? 1_555 ? 
36  AC6 6 HOH DA .   ? HOH A 526 . ? 1_555 ? 
37  AC6 6 HOH DA .   ? HOH A 527 . ? 1_555 ? 
38  AC6 6 HOH DA .   ? HOH A 528 . ? 1_555 ? 
39  AC6 6 HOH DA .   ? HOH A 529 . ? 1_555 ? 
40  AC6 6 HOH Z  .   ? HOH C 520 . ? 1_555 ? 
41  AC6 6 HOH Z  .   ? HOH C 521 . ? 1_555 ? 
42  AC7 7 ASP F  44  ? ASP B 44  . ? 1_555 ? 
43  AC7 7 GLU F  110 ? GLU B 110 . ? 1_555 ? 
44  AC7 7 HOH EA .   ? HOH B 520 . ? 1_555 ? 
45  AC7 7 G   A  11  ? G   C 12  . ? 1_555 ? 
46  AC7 7 HOH Z  .   ? HOH C 522 . ? 1_555 ? 
47  AC7 7 HOH Z  .   ? HOH C 523 . ? 1_555 ? 
48  AC7 7 A   D  1   ? A   F 17  . ? 1_555 ? 
49  AC8 7 GLU F  40  ? GLU B 40  . ? 1_555 ? 
50  AC8 7 GLU F  110 ? GLU B 110 . ? 1_555 ? 
51  AC8 7 HOH EA .   ? HOH B 521 . ? 1_555 ? 
52  AC8 7 HOH EA .   ? HOH B 530 . ? 1_555 ? 
53  AC8 7 HOH Z  .   ? HOH C 523 . ? 1_555 ? 
54  AC8 7 A   D  1   ? A   F 17  . ? 1_555 ? 
55  AC8 7 HOH CA .   ? HOH F 514 . ? 1_555 ? 
56  AC9 7 ASP F  107 ? ASP B 107 . ? 1_555 ? 
57  AC9 7 HOH EA .   ? HOH B 521 . ? 1_555 ? 
58  AC9 7 HOH EA .   ? HOH B 522 . ? 1_555 ? 
59  AC9 7 HOH EA .   ? HOH B 523 . ? 1_555 ? 
60  AC9 7 HOH EA .   ? HOH B 524 . ? 1_555 ? 
61  AC9 7 HOH EA .   ? HOH B 530 . ? 1_555 ? 
62  AC9 7 HOH CA .   ? HOH F 515 . ? 1_555 ? 
63  BC1 6 HOH DA .   ? HOH A 530 . ? 1_555 ? 
64  BC1 6 GLU F  37  ? GLU B 37  . ? 1_555 ? 
65  BC1 6 GLU F  40  ? GLU B 40  . ? 1_555 ? 
66  BC1 6 HOH EA .   ? HOH B 525 . ? 1_555 ? 
67  BC1 6 HOH EA .   ? HOH B 526 . ? 1_555 ? 
68  BC1 6 HOH CA .   ? HOH F 516 . ? 1_555 ? 
69  BC2 6 A   D  1   ? A   F 17  . ? 1_555 ? 
70  BC2 6 G   D  2   ? G   F 18  . ? 1_555 ? 
71  BC2 6 HOH CA .   ? HOH F 517 . ? 1_555 ? 
72  BC2 6 HOH CA .   ? HOH F 518 . ? 1_555 ? 
73  BC2 6 HOH CA .   ? HOH F 519 . ? 1_555 ? 
74  BC2 6 HOH CA .   ? HOH F 520 . ? 1_555 ? 
75  BC3 6 HOH EA .   ? HOH B 527 . ? 1_555 ? 
76  BC3 6 HOH EA .   ? HOH B 528 . ? 1_555 ? 
77  BC3 6 HOH EA .   ? HOH B 529 . ? 1_555 ? 
78  BC3 6 HOH BA .   ? HOH D 518 . ? 1_555 ? 
79  BC3 6 HOH BA .   ? HOH D 519 . ? 1_555 ? 
80  BC3 6 HOH BA .   ? HOH D 563 . ? 1_555 ? 
81  BC4 6 HOH AA .   ? HOH E 522 . ? 1_554 ? 
82  BC4 6 HOH CA .   ? HOH F 542 . ? 1_555 ? 
83  BC4 6 HOH CA .   ? HOH F 543 . ? 1_555 ? 
84  BC4 6 HOH CA .   ? HOH F 544 . ? 1_555 ? 
85  BC4 6 HOH CA .   ? HOH F 545 . ? 1_555 ? 
86  BC4 6 HOH CA .   ? HOH F 552 . ? 1_555 ? 
87  BC5 5 HOH BA .   ? HOH D 529 . ? 1_555 ? 
88  BC5 5 HOH BA .   ? HOH D 533 . ? 1_555 ? 
89  BC5 5 HOH BA .   ? HOH D 550 . ? 1_555 ? 
90  BC5 5 HOH BA .   ? HOH D 551 . ? 1_555 ? 
91  BC5 5 HOH BA .   ? HOH D 552 . ? 1_555 ? 
92  BC6 4 HOH Z  .   ? HOH C 535 . ? 1_555 ? 
93  BC6 4 HOH Z  .   ? HOH C 538 . ? 1_555 ? 
94  BC6 4 HOH Z  .   ? HOH C 559 . ? 1_555 ? 
95  BC6 4 HOH Z  .   ? HOH C 563 . ? 1_555 ? 
96  BC7 6 HOH BA .   ? HOH D 522 . ? 1_555 ? 
97  BC7 6 HOH BA .   ? HOH D 531 . ? 1_555 ? 
98  BC7 6 HOH BA .   ? HOH D 535 . ? 1_555 ? 
99  BC7 6 HOH BA .   ? HOH D 562 . ? 1_555 ? 
100 BC7 6 HOH AA .   ? HOH E 513 . ? 1_555 ? 
101 BC7 6 HOH AA .   ? HOH E 526 . ? 1_555 ? 
102 BC8 5 GLY E  12  ? GLY A 12  . ? 1_555 ? 
103 BC8 5 HOH DA .   ? HOH A 534 . ? 1_555 ? 
104 BC8 5 HOH DA .   ? HOH A 620 . ? 1_555 ? 
105 BC8 5 HOH DA .   ? HOH A 632 . ? 1_555 ? 
106 BC8 5 ARG F  194 ? ARG B 194 . ? 3_546 ? 
107 BC9 3 HOH EA .   ? HOH B 538 . ? 1_555 ? 
108 BC9 3 HOH EA .   ? HOH B 561 . ? 1_555 ? 
109 BC9 3 HOH EA .   ? HOH B 657 . ? 1_555 ? 
110 CC1 6 HOH Z  .   ? HOH C 526 . ? 1_555 ? 
111 CC1 6 HOH Z  .   ? HOH C 530 . ? 1_555 ? 
112 CC1 6 HOH Z  .   ? HOH C 540 . ? 1_555 ? 
113 CC1 6 HOH Z  .   ? HOH C 546 . ? 1_555 ? 
114 CC1 6 HOH Z  .   ? HOH C 562 . ? 1_555 ? 
115 CC1 6 HOH CA .   ? HOH F 551 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NUG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NUG 
_atom_sites.fract_transf_matrix[1][1]   0.010481 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008338 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016983 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  OP3   . A   A  1 1   ? 18.276  37.084 44.259  1.00 68.19  ? 2   A   C OP3   1 
ATOM   2    P  P     . A   A  1 1   ? 18.673  37.430 45.687  1.00 71.52  ? 2   A   C P     1 
ATOM   3    O  OP1   . A   A  1 1   ? 19.968  36.768 46.130  1.00 68.30  ? 2   A   C OP1   1 
ATOM   4    O  OP2   . A   A  1 1   ? 18.658  38.928 45.949  1.00 68.06  ? 2   A   C OP2   1 
ATOM   5    O  "O5'" . A   A  1 1   ? 17.506  36.798 46.635  1.00 62.80  ? 2   A   C "O5'" 1 
ATOM   6    C  "C5'" . A   A  1 1   ? 17.283  35.374 46.703  1.00 48.68  ? 2   A   C "C5'" 1 
ATOM   7    C  "C4'" . A   A  1 1   ? 15.977  35.094 47.409  1.00 41.90  ? 2   A   C "C4'" 1 
ATOM   8    O  "O4'" . A   A  1 1   ? 15.984  35.765 48.696  1.00 37.09  ? 2   A   C "O4'" 1 
ATOM   9    C  "C3'" . A   A  1 1   ? 14.750  35.627 46.684  1.00 40.16  ? 2   A   C "C3'" 1 
ATOM   10   O  "O3'" . A   A  1 1   ? 14.246  34.628 45.806  1.00 37.62  ? 2   A   C "O3'" 1 
ATOM   11   C  "C2'" . A   A  1 1   ? 13.781  35.909 47.824  1.00 38.85  ? 2   A   C "C2'" 1 
ATOM   12   O  "O2'" . A   A  1 1   ? 13.108  34.749 48.266  1.00 43.08  ? 2   A   C "O2'" 1 
ATOM   13   C  "C1'" . A   A  1 1   ? 14.733  36.386 48.922  1.00 37.36  ? 2   A   C "C1'" 1 
ATOM   14   N  N9    . A   A  1 1   ? 14.957  37.831 48.951  1.00 35.70  ? 2   A   C N9    1 
ATOM   15   C  C8    . A   A  1 1   ? 16.139  38.487 48.709  1.00 33.33  ? 2   A   C C8    1 
ATOM   16   N  N7    . A   A  1 1   ? 16.062  39.786 48.853  1.00 28.33  ? 2   A   C N7    1 
ATOM   17   C  C5    . A   A  1 1   ? 14.738  40.004 49.205  1.00 31.69  ? 2   A   C C5    1 
ATOM   18   C  C6    . A   A  1 1   ? 14.024  41.174 49.510  1.00 30.62  ? 2   A   C C6    1 
ATOM   19   N  N6    . A   A  1 1   ? 14.575  42.391 49.526  1.00 29.60  ? 2   A   C N6    1 
ATOM   20   N  N1    . A   A  1 1   ? 12.714  41.051 49.810  1.00 31.93  ? 2   A   C N1    1 
ATOM   21   C  C2    . A   A  1 1   ? 12.170  39.826 49.810  1.00 35.03  ? 2   A   C C2    1 
ATOM   22   N  N3    . A   A  1 1   ? 12.740  38.650 49.550  1.00 32.78  ? 2   A   C N3    1 
ATOM   23   C  C4    . A   A  1 1   ? 14.040  38.810 49.252  1.00 32.51  ? 2   A   C C4    1 
ATOM   24   P  P     . A   A  1 2   ? 13.803  35.020 44.315  1.00 38.34  ? 3   A   C P     1 
ATOM   25   O  OP1   . A   A  1 2   ? 13.564  33.733 43.610  1.00 42.21  ? 3   A   C OP1   1 
ATOM   26   O  OP2   . A   A  1 2   ? 14.763  35.998 43.748  1.00 37.35  ? 3   A   C OP2   1 
ATOM   27   O  "O5'" . A   A  1 2   ? 12.396  35.742 44.502  1.00 37.43  ? 3   A   C "O5'" 1 
ATOM   28   C  "C5'" . A   A  1 2   ? 11.215  34.980 44.734  1.00 35.59  ? 3   A   C "C5'" 1 
ATOM   29   C  "C4'" . A   A  1 2   ? 10.057  35.892 45.057  1.00 37.24  ? 3   A   C "C4'" 1 
ATOM   30   O  "O4'" . A   A  1 2   ? 10.349  36.617 46.284  1.00 36.60  ? 3   A   C "O4'" 1 
ATOM   31   C  "C3'" . A   A  1 2   ? 9.764   36.991 44.047  1.00 36.90  ? 3   A   C "C3'" 1 
ATOM   32   O  "O3'" . A   A  1 2   ? 8.986   36.513 42.947  1.00 34.78  ? 3   A   C "O3'" 1 
ATOM   33   C  "C2'" . A   A  1 2   ? 8.996   37.990 44.904  1.00 34.11  ? 3   A   C "C2'" 1 
ATOM   34   O  "O2'" . A   A  1 2   ? 7.662   37.585 45.132  1.00 35.93  ? 3   A   C "O2'" 1 
ATOM   35   C  "C1'" . A   A  1 2   ? 9.777   37.916 46.218  1.00 36.01  ? 3   A   C "C1'" 1 
ATOM   36   N  N9    . A   A  1 2   ? 10.859  38.900 46.278  1.00 33.32  ? 3   A   C N9    1 
ATOM   37   C  C8    . A   A  1 2   ? 12.202  38.693 46.080  1.00 31.16  ? 3   A   C C8    1 
ATOM   38   N  N7    . A   A  1 2   ? 12.923  39.783 46.178  1.00 31.66  ? 3   A   C N7    1 
ATOM   39   C  C5    . A   A  1 2   ? 11.994  40.773 46.467  1.00 30.15  ? 3   A   C C5    1 
ATOM   40   C  C6    . A   A  1 2   ? 12.122  42.157 46.686  1.00 30.71  ? 3   A   C C6    1 
ATOM   41   N  N6    . A   A  1 2   ? 13.288  42.811 46.642  1.00 31.64  ? 3   A   C N6    1 
ATOM   42   N  N1    . A   A  1 2   ? 10.999  42.858 46.952  1.00 31.66  ? 3   A   C N1    1 
ATOM   43   C  C2    . A   A  1 2   ? 9.829   42.205 46.987  1.00 32.10  ? 3   A   C C2    1 
ATOM   44   N  N3    . A   A  1 2   ? 9.581   40.910 46.794  1.00 32.29  ? 3   A   C N3    1 
ATOM   45   C  C4    . A   A  1 2   ? 10.720  40.243 46.536  1.00 30.60  ? 3   A   C C4    1 
ATOM   46   P  P     . G   A  1 3   ? 9.040   37.284 41.535  1.00 36.96  ? 4   G   C P     1 
ATOM   47   O  OP1   . G   A  1 3   ? 8.258   36.488 40.545  1.00 38.34  ? 4   G   C OP1   1 
ATOM   48   O  OP2   . G   A  1 3   ? 10.450  37.644 41.238  1.00 36.70  ? 4   G   C OP2   1 
ATOM   49   O  "O5'" . G   A  1 3   ? 8.244   38.636 41.803  1.00 32.10  ? 4   G   C "O5'" 1 
ATOM   50   C  "C5'" . G   A  1 3   ? 6.833   38.620 41.978  1.00 30.96  ? 4   G   C "C5'" 1 
ATOM   51   C  "C4'" . G   A  1 3   ? 6.316   40.019 42.195  1.00 32.35  ? 4   G   C "C4'" 1 
ATOM   52   O  "O4'" . G   A  1 3   ? 6.821   40.540 43.457  1.00 30.04  ? 4   G   C "O4'" 1 
ATOM   53   C  "C3'" . G   A  1 3   ? 6.769   41.066 41.194  1.00 32.34  ? 4   G   C "C3'" 1 
ATOM   54   O  "O3'" . G   A  1 3   ? 6.051   40.991 39.968  1.00 34.48  ? 4   G   C "O3'" 1 
ATOM   55   C  "C2'" . G   A  1 3   ? 6.467   42.342 41.967  1.00 30.04  ? 4   G   C "C2'" 1 
ATOM   56   O  "O2'" . G   A  1 3   ? 5.083   42.606 42.032  1.00 30.60  ? 4   G   C "O2'" 1 
ATOM   57   C  "C1'" . G   A  1 3   ? 6.969   41.953 43.358  1.00 31.16  ? 4   G   C "C1'" 1 
ATOM   58   N  N9    . G   A  1 3   ? 8.383   42.283 43.495  1.00 25.60  ? 4   G   C N9    1 
ATOM   59   C  C8    . G   A  1 3   ? 9.452   41.430 43.360  1.00 30.27  ? 4   G   C C8    1 
ATOM   60   N  N7    . G   A  1 3   ? 10.604  42.029 43.503  1.00 27.61  ? 4   G   C N7    1 
ATOM   61   C  C5    . G   A  1 3   ? 10.273  43.354 43.756  1.00 23.95  ? 4   G   C C5    1 
ATOM   62   C  C6    . G   A  1 3   ? 11.103  44.478 43.999  1.00 21.77  ? 4   G   C C6    1 
ATOM   63   O  O6    . G   A  1 3   ? 12.340  44.532 44.035  1.00 27.78  ? 4   G   C O6    1 
ATOM   64   N  N1    . G   A  1 3   ? 10.355  45.630 44.213  1.00 25.18  ? 4   G   C N1    1 
ATOM   65   C  C2    . G   A  1 3   ? 8.984   45.696 44.188  1.00 29.64  ? 4   G   C C2    1 
ATOM   66   N  N2    . G   A  1 3   ? 8.444   46.907 44.397  1.00 31.08  ? 4   G   C N2    1 
ATOM   67   N  N3    . G   A  1 3   ? 8.199   44.655 43.967  1.00 26.87  ? 4   G   C N3    1 
ATOM   68   C  C4    . G   A  1 3   ? 8.906   43.524 43.761  1.00 26.77  ? 4   G   C C4    1 
ATOM   69   P  P     . G   A  1 4   ? 6.763   41.465 38.604  1.00 37.30  ? 5   G   C P     1 
ATOM   70   O  OP1   . G   A  1 4   ? 5.820   41.156 37.502  1.00 37.17  ? 5   G   C OP1   1 
ATOM   71   O  OP2   . G   A  1 4   ? 8.146   40.932 38.558  1.00 35.22  ? 5   G   C OP2   1 
ATOM   72   O  "O5'" . G   A  1 4   ? 6.861   43.047 38.753  1.00 32.56  ? 5   G   C "O5'" 1 
ATOM   73   C  "C5'" . G   A  1 4   ? 5.685   43.828 38.897  1.00 31.40  ? 5   G   C "C5'" 1 
ATOM   74   C  "C4'" . G   A  1 4   ? 6.038   45.247 39.255  1.00 29.19  ? 5   G   C "C4'" 1 
ATOM   75   O  "O4'" . G   A  1 4   ? 6.768   45.264 40.515  1.00 29.74  ? 5   G   C "O4'" 1 
ATOM   76   C  "C3'" . G   A  1 4   ? 6.981   45.973 38.312  1.00 26.82  ? 5   G   C "C3'" 1 
ATOM   77   O  "O3'" . G   A  1 4   ? 6.304   46.454 37.157  1.00 27.62  ? 5   G   C "O3'" 1 
ATOM   78   C  "C2'" . G   A  1 4   ? 7.447   47.115 39.204  1.00 28.47  ? 5   G   C "C2'" 1 
ATOM   79   O  "O2'" . G   A  1 4   ? 6.447   48.099 39.358  1.00 29.05  ? 5   G   C "O2'" 1 
ATOM   80   C  "C1'" . G   A  1 4   ? 7.643   46.385 40.534  1.00 27.99  ? 5   G   C "C1'" 1 
ATOM   81   N  N9    . G   A  1 4   ? 9.016   45.911 40.662  1.00 25.81  ? 5   G   C N9    1 
ATOM   82   C  C8    . G   A  1 4   ? 9.479   44.625 40.522  1.00 26.51  ? 5   G   C C8    1 
ATOM   83   N  N7    . G   A  1 4   ? 10.776  44.531 40.651  1.00 27.16  ? 5   G   C N7    1 
ATOM   84   C  C5    . G   A  1 4   ? 11.191  45.832 40.900  1.00 25.72  ? 5   G   C C5    1 
ATOM   85   C  C6    . G   A  1 4   ? 12.493  46.360 41.114  1.00 27.29  ? 5   G   C C6    1 
ATOM   86   O  O6    . G   A  1 4   ? 13.574  45.765 41.114  1.00 25.38  ? 5   G   C O6    1 
ATOM   87   N  N1    . G   A  1 4   ? 12.458  47.734 41.334  1.00 25.58  ? 5   G   C N1    1 
ATOM   88   C  C2    . G   A  1 4   ? 11.319  48.504 41.336  1.00 26.88  ? 5   G   C C2    1 
ATOM   89   N  N2    . G   A  1 4   ? 11.487  49.813 41.562  1.00 24.36  ? 5   G   C N2    1 
ATOM   90   N  N3    . G   A  1 4   ? 10.105  48.026 41.130  1.00 26.07  ? 5   G   C N3    1 
ATOM   91   C  C4    . G   A  1 4   ? 10.115  46.693 40.922  1.00 25.90  ? 5   G   C C4    1 
ATOM   92   P  P     . U   A  1 5   ? 7.123   46.694 35.790  1.00 25.57  ? 6   U   C P     1 
ATOM   93   O  OP1   . U   A  1 5   ? 6.147   47.108 34.754  1.00 26.96  ? 6   U   C OP1   1 
ATOM   94   O  OP2   . U   A  1 5   ? 8.001   45.524 35.544  1.00 28.60  ? 6   U   C OP2   1 
ATOM   95   O  "O5'" . U   A  1 5   ? 8.073   47.929 36.116  1.00 31.52  ? 6   U   C "O5'" 1 
ATOM   96   C  "C5'" . U   A  1 5   ? 7.538   49.194 36.482  1.00 28.05  ? 6   U   C "C5'" 1 
ATOM   97   C  "C4'" . U   A  1 5   ? 8.660   50.139 36.826  1.00 25.12  ? 6   U   C "C4'" 1 
ATOM   98   O  "O4'" . U   A  1 5   ? 9.376   49.625 37.981  1.00 25.45  ? 6   U   C "O4'" 1 
ATOM   99   C  "C3'" . U   A  1 5   ? 9.740   50.255 35.764  1.00 25.88  ? 6   U   C "C3'" 1 
ATOM   100  O  "O3'" . U   A  1 5   ? 9.366   51.169 34.746  1.00 25.13  ? 6   U   C "O3'" 1 
ATOM   101  C  "C2'" . U   A  1 5   ? 10.924  50.750 36.580  1.00 29.55  ? 6   U   C "C2'" 1 
ATOM   102  O  "O2'" . U   A  1 5   ? 10.827  52.126 36.891  1.00 28.60  ? 6   U   C "O2'" 1 
ATOM   103  C  "C1'" . U   A  1 5   ? 10.758  49.927 37.858  1.00 28.22  ? 6   U   C "C1'" 1 
ATOM   104  N  N1    . U   A  1 5   ? 11.510  48.664 37.826  1.00 26.19  ? 6   U   C N1    1 
ATOM   105  C  C2    . U   A  1 5   ? 12.868  48.724 38.084  1.00 25.15  ? 6   U   C C2    1 
ATOM   106  O  O2    . U   A  1 5   ? 13.451  49.770 38.304  1.00 25.78  ? 6   U   C O2    1 
ATOM   107  N  N3    . U   A  1 5   ? 13.517  47.514 38.069  1.00 23.64  ? 6   U   C N3    1 
ATOM   108  C  C4    . U   A  1 5   ? 12.963  46.278 37.821  1.00 26.07  ? 6   U   C C4    1 
ATOM   109  O  O4    . U   A  1 5   ? 13.670  45.275 37.902  1.00 29.29  ? 6   U   C O4    1 
ATOM   110  C  C5    . U   A  1 5   ? 11.555  46.298 37.544  1.00 25.47  ? 6   U   C C5    1 
ATOM   111  C  C6    . U   A  1 5   ? 10.894  47.464 37.557  1.00 23.90  ? 6   U   C C6    1 
ATOM   112  P  P     . C   A  1 6   ? 9.889   50.940 33.243  1.00 27.07  ? 7   C   C P     1 
ATOM   113  O  OP1   . C   A  1 6   ? 9.112   51.850 32.371  1.00 29.04  ? 7   C   C OP1   1 
ATOM   114  O  OP2   . C   A  1 6   ? 9.919   49.487 32.946  1.00 23.58  ? 7   C   C OP2   1 
ATOM   115  O  "O5'" . C   A  1 6   ? 11.391  51.472 33.290  1.00 25.32  ? 7   C   C "O5'" 1 
ATOM   116  C  "C5'" . C   A  1 6   ? 11.651  52.856 33.486  1.00 25.97  ? 7   C   C "C5'" 1 
ATOM   117  C  "C4'" . C   A  1 6   ? 13.121  53.088 33.732  1.00 25.69  ? 7   C   C "C4'" 1 
ATOM   118  O  "O4'" . C   A  1 6   ? 13.519  52.402 34.949  1.00 24.81  ? 7   C   C "O4'" 1 
ATOM   119  C  "C3'" . C   A  1 6   ? 14.076  52.531 32.692  1.00 25.01  ? 7   C   C "C3'" 1 
ATOM   120  O  "O3'" . C   A  1 6   ? 14.167  53.375 31.549  1.00 26.28  ? 7   C   C "O3'" 1 
ATOM   121  C  "C2'" . C   A  1 6   ? 15.374  52.506 33.483  1.00 22.42  ? 7   C   C "C2'" 1 
ATOM   122  O  "O2'" . C   A  1 6   ? 15.883  53.813 33.670  1.00 24.06  ? 7   C   C "O2'" 1 
ATOM   123  C  "C1'" . C   A  1 6   ? 14.873  51.988 34.833  1.00 25.65  ? 7   C   C "C1'" 1 
ATOM   124  N  N1    . C   A  1 6   ? 14.926  50.521 34.922  1.00 25.15  ? 7   C   C N1    1 
ATOM   125  C  C2    . C   A  1 6   ? 16.133  49.920 35.287  1.00 20.14  ? 7   C   C C2    1 
ATOM   126  O  O2    . C   A  1 6   ? 17.122  50.643 35.502  1.00 24.08  ? 7   C   C O2    1 
ATOM   127  N  N3    . C   A  1 6   ? 16.198  48.571 35.391  1.00 23.62  ? 7   C   C N3    1 
ATOM   128  C  C4    . C   A  1 6   ? 15.116  47.829 35.142  1.00 20.54  ? 7   C   C C4    1 
ATOM   129  N  N4    . C   A  1 6   ? 15.222  46.501 35.284  1.00 21.16  ? 7   C   C N4    1 
ATOM   130  C  C5    . C   A  1 6   ? 13.875  48.414 34.747  1.00 20.98  ? 7   C   C C5    1 
ATOM   131  C  C6    . C   A  1 6   ? 13.824  49.754 34.654  1.00 24.35  ? 7   C   C C6    1 
ATOM   132  P  P     . A   A  1 7   ? 14.438  52.726 30.100  1.00 32.82  ? 8   A   C P     1 
ATOM   133  O  OP1   . A   A  1 7   ? 14.484  53.840 29.123  1.00 39.69  ? 8   A   C OP1   1 
ATOM   134  O  OP2   . A   A  1 7   ? 13.492  51.605 29.890  1.00 32.92  ? 8   A   C OP2   1 
ATOM   135  O  "O5'" . A   A  1 7   ? 15.894  52.080 30.217  1.00 32.03  ? 8   A   C "O5'" 1 
ATOM   136  C  "C5'" . A   A  1 7   ? 17.031  52.907 30.388  1.00 31.73  ? 8   A   C "C5'" 1 
ATOM   137  C  "C4'" . A   A  1 7   ? 18.255  52.090 30.740  1.00 25.91  ? 8   A   C "C4'" 1 
ATOM   138  O  "O4'" . A   A  1 7   ? 18.030  51.331 31.960  1.00 25.93  ? 8   A   C "O4'" 1 
ATOM   139  C  "C3'" . A   A  1 7   ? 18.724  51.009 29.781  1.00 23.75  ? 8   A   C "C3'" 1 
ATOM   140  O  "O3'" . A   A  1 7   ? 19.381  51.573 28.652  1.00 24.07  ? 8   A   C "O3'" 1 
ATOM   141  C  "C2'" . A   A  1 7   ? 19.711  50.270 30.677  1.00 23.63  ? 8   A   C "C2'" 1 
ATOM   142  O  "O2'" . A   A  1 7   ? 20.890  51.032 30.874  1.00 21.53  ? 8   A   C "O2'" 1 
ATOM   143  C  "C1'" . A   A  1 7   ? 18.946  50.245 32.002  1.00 24.17  ? 8   A   C "C1'" 1 
ATOM   144  N  N9    . A   A  1 7   ? 18.210  48.994 32.200  1.00 22.38  ? 8   A   C N9    1 
ATOM   145  C  C8    . A   A  1 7   ? 16.881  48.722 31.983  1.00 25.16  ? 8   A   C C8    1 
ATOM   146  N  N7    . A   A  1 7   ? 16.547  47.476 32.243  1.00 24.52  ? 8   A   C N7    1 
ATOM   147  C  C5    . A   A  1 7   ? 17.738  46.892 32.664  1.00 19.31  ? 8   A   C C5    1 
ATOM   148  C  C6    . A   A  1 7   ? 18.061  45.585 33.089  1.00 23.18  ? 8   A   C C6    1 
ATOM   149  N  N6    . A   A  1 7   ? 17.175  44.587 33.163  1.00 22.55  ? 8   A   C N6    1 
ATOM   150  N  N1    . A   A  1 7   ? 19.342  45.336 33.441  1.00 20.19  ? 8   A   C N1    1 
ATOM   151  C  C2    . A   A  1 7   ? 20.233  46.337 33.365  1.00 26.27  ? 8   A   C C2    1 
ATOM   152  N  N3    . A   A  1 7   ? 20.051  47.604 32.982  1.00 19.90  ? 8   A   C N3    1 
ATOM   153  C  C4    . A   A  1 7   ? 18.768  47.817 32.643  1.00 21.52  ? 8   A   C C4    1 
ATOM   154  P  P     . U   A  1 8   ? 19.514  50.723 27.290  1.00 24.71  ? 9   U   C P     1 
ATOM   155  O  OP1   . U   A  1 8   ? 20.056  51.634 26.249  1.00 25.13  ? 9   U   C OP1   1 
ATOM   156  O  OP2   . U   A  1 8   ? 18.255  49.979 27.033  1.00 26.01  ? 9   U   C OP2   1 
ATOM   157  O  "O5'" . U   A  1 8   ? 20.622  49.633 27.622  1.00 21.64  ? 9   U   C "O5'" 1 
ATOM   158  C  "C5'" . U   A  1 8   ? 21.957  50.020 27.913  1.00 22.56  ? 9   U   C "C5'" 1 
ATOM   159  C  "C4'" . U   A  1 8   ? 22.759  48.820 28.345  1.00 20.19  ? 9   U   C "C4'" 1 
ATOM   160  O  "O4'" . U   A  1 8   ? 22.242  48.313 29.607  1.00 20.35  ? 9   U   C "O4'" 1 
ATOM   161  C  "C3'" . U   A  1 8   ? 22.663  47.608 27.439  1.00 18.96  ? 9   U   C "C3'" 1 
ATOM   162  O  "O3'" . U   A  1 8   ? 23.450  47.746 26.267  1.00 18.59  ? 9   U   C "O3'" 1 
ATOM   163  C  "C2'" . U   A  1 8   ? 23.151  46.517 28.376  1.00 16.78  ? 9   U   C "C2'" 1 
ATOM   164  O  "O2'" . U   A  1 8   ? 24.545  46.607 28.622  1.00 21.05  ? 9   U   C "O2'" 1 
ATOM   165  C  "C1'" . U   A  1 8   ? 22.393  46.897 29.649  1.00 19.93  ? 9   U   C "C1'" 1 
ATOM   166  N  N1    . U   A  1 8   ? 21.048  46.297 29.684  1.00 18.49  ? 9   U   C N1    1 
ATOM   167  C  C2    . U   A  1 8   ? 20.928  45.013 30.189  1.00 21.87  ? 9   U   C C2    1 
ATOM   168  O  O2    . U   A  1 8   ? 21.882  44.374 30.591  1.00 22.19  ? 9   U   C O2    1 
ATOM   169  N  N3    . U   A  1 8   ? 19.647  44.510 30.202  1.00 19.04  ? 9   U   C N3    1 
ATOM   170  C  C4    . U   A  1 8   ? 18.503  45.148 29.761  1.00 22.38  ? 9   U   C C4    1 
ATOM   171  O  O4    . U   A  1 8   ? 17.413  44.579 29.860  1.00 23.64  ? 9   U   C O4    1 
ATOM   172  C  C5    . U   A  1 8   ? 18.714  46.467 29.247  1.00 22.26  ? 9   U   C C5    1 
ATOM   173  C  C6    . U   A  1 8   ? 19.950  46.984 29.230  1.00 21.58  ? 9   U   C C6    1 
ATOM   174  P  P     . U   A  1 9   ? 23.030  46.944 24.937  1.00 20.99  ? 10  U   C P     1 
ATOM   175  O  OP1   . U   A  1 9   ? 23.671  47.631 23.791  1.00 19.47  ? 10  U   C OP1   1 
ATOM   176  O  OP2   . U   A  1 9   ? 21.551  46.746 24.944  1.00 21.54  ? 10  U   C OP2   1 
ATOM   177  O  "O5'" . U   A  1 9   ? 23.695  45.510 25.129  1.00 20.11  ? 10  U   C "O5'" 1 
ATOM   178  C  "C5'" . U   A  1 9   ? 25.084  45.379 25.408  1.00 21.18  ? 10  U   C "C5'" 1 
ATOM   179  C  "C4'" . U   A  1 9   ? 25.381  43.995 25.932  1.00 19.28  ? 10  U   C "C4'" 1 
ATOM   180  O  "O4'" . U   A  1 9   ? 24.706  43.804 27.202  1.00 18.79  ? 10  U   C "O4'" 1 
ATOM   181  C  "C3'" . U   A  1 9   ? 24.872  42.842 25.082  1.00 19.03  ? 10  U   C "C3'" 1 
ATOM   182  O  "O3'" . U   A  1 9   ? 25.769  42.581 24.013  1.00 19.62  ? 10  U   C "O3'" 1 
ATOM   183  C  "C2'" . U   A  1 9   ? 24.848  41.709 26.102  1.00 13.77  ? 10  U   C "C2'" 1 
ATOM   184  O  "O2'" . U   A  1 9   ? 26.148  41.214 26.386  1.00 19.29  ? 10  U   C "O2'" 1 
ATOM   185  C  "C1'" . U   A  1 9   ? 24.317  42.442 27.333  1.00 19.56  ? 10  U   C "C1'" 1 
ATOM   186  N  N1    . U   A  1 9   ? 22.851  42.389 27.439  1.00 18.13  ? 10  U   C N1    1 
ATOM   187  C  C2    . U   A  1 9   ? 22.294  41.282 28.054  1.00 22.62  ? 10  U   C C2    1 
ATOM   188  O  O2    . U   A  1 9   ? 22.959  40.356 28.480  1.00 21.01  ? 10  U   C O2    1 
ATOM   189  N  N3    . U   A  1 9   ? 20.925  41.294 28.144  1.00 17.17  ? 10  U   C N3    1 
ATOM   190  C  C4    . U   A  1 9   ? 20.071  42.271 27.675  1.00 23.20  ? 10  U   C C4    1 
ATOM   191  O  O4    . U   A  1 9   ? 18.855  42.147 27.854  1.00 24.39  ? 10  U   C O4    1 
ATOM   192  C  C5    . U   A  1 9   ? 20.720  43.376 27.035  1.00 20.06  ? 10  U   C C5    1 
ATOM   193  C  C6    . U   A  1 9   ? 22.058  43.398 26.945  1.00 19.87  ? 10  U   C C6    1 
ATOM   194  P  P     . C   A  1 10  ? 25.228  41.914 22.657  1.00 18.83  ? 11  C   C P     1 
ATOM   195  O  OP1   . C   A  1 10  ? 26.334  41.950 21.675  1.00 19.94  ? 11  C   C OP1   1 
ATOM   196  O  OP2   . C   A  1 10  ? 23.909  42.515 22.302  1.00 21.12  ? 11  C   C OP2   1 
ATOM   197  O  "O5'" . C   A  1 10  ? 24.946  40.401 23.066  1.00 18.68  ? 11  C   C "O5'" 1 
ATOM   198  C  "C5'" . C   A  1 10  ? 26.013  39.514 23.382  1.00 19.91  ? 11  C   C "C5'" 1 
ATOM   199  C  "C4'" . C   A  1 10  ? 25.466  38.158 23.754  1.00 17.34  ? 11  C   C "C4'" 1 
ATOM   200  O  "O4'" . C   A  1 10  ? 24.690  38.270 24.980  1.00 17.16  ? 11  C   C "O4'" 1 
ATOM   201  C  "C3'" . C   A  1 10  ? 24.473  37.569 22.769  1.00 16.77  ? 11  C   C "C3'" 1 
ATOM   202  O  "O3'" . C   A  1 10  ? 25.125  36.967 21.660  1.00 16.91  ? 11  C   C "O3'" 1 
ATOM   203  C  "C2'" . C   A  1 10  ? 23.744  36.555 23.640  1.00 12.72  ? 11  C   C "C2'" 1 
ATOM   204  O  "O2'" . C   A  1 10  ? 24.482  35.361 23.837  1.00 17.03  ? 11  C   C "O2'" 1 
ATOM   205  C  "C1'" . C   A  1 10  ? 23.620  37.334 24.952  1.00 17.67  ? 11  C   C "C1'" 1 
ATOM   206  N  N1    . C   A  1 10  ? 22.345  38.073 25.016  1.00 16.57  ? 11  C   C N1    1 
ATOM   207  C  C2    . C   A  1 10  ? 21.212  37.396 25.460  1.00 17.38  ? 11  C   C C2    1 
ATOM   208  O  O2    . C   A  1 10  ? 21.324  36.209 25.805  1.00 17.45  ? 11  C   C O2    1 
ATOM   209  N  N3    . C   A  1 10  ? 20.025  38.040 25.502  1.00 18.03  ? 11  C   C N3    1 
ATOM   210  C  C4    . C   A  1 10  ? 19.945  39.314 25.120  1.00 17.96  ? 11  C   C C4    1 
ATOM   211  N  N4    . C   A  1 10  ? 18.747  39.903 25.164  1.00 18.75  ? 11  C   C N4    1 
ATOM   212  C  C5    . C   A  1 10  ? 21.091  40.041 24.670  1.00 19.71  ? 11  C   C C5    1 
ATOM   213  C  C6    . C   A  1 10  ? 22.263  39.384 24.636  1.00 14.71  ? 11  C   C C6    1 
ATOM   214  P  P     . G   A  1 11  ? 24.360  36.864 20.253  1.00 16.82  ? 12  G   C P     1 
ATOM   215  O  OP1   . G   A  1 11  ? 25.324  36.336 19.259  1.00 19.57  ? 12  G   C OP1   1 
ATOM   216  O  OP2   . G   A  1 11  ? 23.653  38.141 19.976  1.00 18.74  ? 12  G   C OP2   1 
ATOM   217  O  "O5'" . G   A  1 11  ? 23.262  35.741 20.514  1.00 16.97  ? 12  G   C "O5'" 1 
ATOM   218  C  "C5'" . G   A  1 11  ? 23.651  34.410 20.834  1.00 15.81  ? 12  G   C "C5'" 1 
ATOM   219  C  "C4'" . G   A  1 11  ? 22.431  33.562 21.103  1.00 17.47  ? 12  G   C "C4'" 1 
ATOM   220  O  "O4'" . G   A  1 11  ? 21.733  34.089 22.260  1.00 16.36  ? 12  G   C "O4'" 1 
ATOM   221  C  "C3'" . G   A  1 11  ? 21.367  33.571 20.018  1.00 18.77  ? 12  G   C "C3'" 1 
ATOM   222  O  "O3'" . G   A  1 11  ? 21.713  32.777 18.880  1.00 16.71  ? 12  G   C "O3'" 1 
ATOM   223  C  "C2'" . G   A  1 11  ? 20.138  33.111 20.794  1.00 17.40  ? 12  G   C "C2'" 1 
ATOM   224  O  "O2'" . G   A  1 11  ? 20.145  31.720 21.041  1.00 18.68  ? 12  G   C "O2'" 1 
ATOM   225  C  "C1'" . G   A  1 11  ? 20.339  33.845 22.121  1.00 16.52  ? 12  G   C "C1'" 1 
ATOM   226  N  N9    . G   A  1 11  ? 19.642  35.125 22.187  1.00 14.51  ? 12  G   C N9    1 
ATOM   227  C  C8    . G   A  1 11  ? 20.183  36.384 22.065  1.00 16.43  ? 12  G   C C8    1 
ATOM   228  N  N7    . G   A  1 11  ? 19.298  37.336 22.191  1.00 17.07  ? 12  G   C N7    1 
ATOM   229  C  C5    . G   A  1 11  ? 18.101  36.665 22.407  1.00 13.49  ? 12  G   C C5    1 
ATOM   230  C  C6    . G   A  1 11  ? 16.792  37.165 22.618  1.00 18.48  ? 12  G   C C6    1 
ATOM   231  O  O6    . G   A  1 11  ? 16.418  38.344 22.680  1.00 18.13  ? 12  G   C O6    1 
ATOM   232  N  N1    . G   A  1 11  ? 15.869  36.132 22.768  1.00 17.37  ? 12  G   C N1    1 
ATOM   233  C  C2    . G   A  1 11  ? 16.167  34.792 22.727  1.00 16.78  ? 12  G   C C2    1 
ATOM   234  N  N2    . G   A  1 11  ? 15.135  33.946 22.868  1.00 15.71  ? 12  G   C N2    1 
ATOM   235  N  N3    . G   A  1 11  ? 17.390  34.315 22.552  1.00 14.90  ? 12  G   C N3    1 
ATOM   236  C  C4    . G   A  1 11  ? 18.297  35.300 22.397  1.00 13.30  ? 12  G   C C4    1 
ATOM   237  O  OP3   A A   B  2 1   ? 13.819  32.580 31.786  0.35 20.35  ? 17  A   E OP3   1 
ATOM   238  O  OP3   B A   B  2 1   ? 13.268  32.671 31.664  0.65 21.17  ? 17  A   E OP3   1 
ATOM   239  P  P     A A   B  2 1   ? 14.903  31.599 32.168  0.35 16.91  ? 17  A   E P     1 
ATOM   240  P  P     B A   B  2 1   ? 14.328  33.741 31.849  0.65 21.39  ? 17  A   E P     1 
ATOM   241  O  OP1   A A   B  2 1   ? 15.487  31.577 33.528  0.35 20.00  ? 17  A   E OP1   1 
ATOM   242  O  OP1   B A   B  2 1   ? 13.888  35.087 31.282  0.65 16.97  ? 17  A   E OP1   1 
ATOM   243  O  OP2   A A   B  2 1   ? 14.397  30.252 31.829  0.35 24.85  ? 17  A   E OP2   1 
ATOM   244  O  OP2   B A   B  2 1   ? 14.803  33.848 33.293  0.65 22.97  ? 17  A   E OP2   1 
ATOM   245  O  "O5'" A A   B  2 1   ? 16.086  32.021 31.160  0.35 17.31  ? 17  A   E "O5'" 1 
ATOM   246  O  "O5'" B A   B  2 1   ? 15.620  33.303 30.956  0.65 19.63  ? 17  A   E "O5'" 1 
ATOM   247  C  "C5'" A A   B  2 1   ? 17.136  31.120 30.930  0.35 19.24  ? 17  A   E "C5'" 1 
ATOM   248  C  "C5'" B A   B  2 1   ? 16.330  32.072 31.214  0.65 18.17  ? 17  A   E "C5'" 1 
ATOM   249  C  "C4'" A A   B  2 1   ? 18.462  31.855 30.931  0.35 21.13  ? 17  A   E "C4'" 1 
ATOM   250  C  "C4'" B A   B  2 1   ? 17.820  32.307 31.071  0.65 20.03  ? 17  A   E "C4'" 1 
ATOM   251  O  "O4'" A A   B  2 1   ? 18.630  32.557 29.658  0.35 26.79  ? 17  A   E "O4'" 1 
ATOM   252  O  "O4'" B A   B  2 1   ? 18.123  32.806 29.736  0.65 17.52  ? 17  A   E "O4'" 1 
ATOM   253  C  "C3'" A A   B  2 1   ? 18.674  32.951 31.990  0.35 30.74  ? 17  A   E "C3'" 1 
ATOM   254  C  "C3'" B A   B  2 1   ? 18.379  33.376 31.992  0.65 20.14  ? 17  A   E "C3'" 1 
ATOM   255  O  "O3'" A A   B  2 1   ? 18.914  32.486 33.328  0.35 39.67  ? 17  A   E "O3'" 1 
ATOM   256  O  "O3'" B A   B  2 1   ? 18.554  32.893 33.317  0.65 26.21  ? 17  A   E "O3'" 1 
ATOM   257  C  "C2'" A A   B  2 1   ? 19.810  33.747 31.385  0.35 29.40  ? 17  A   E "C2'" 1 
ATOM   258  C  "C2'" B A   B  2 1   ? 19.648  33.778 31.253  0.65 22.81  ? 17  A   E "C2'" 1 
ATOM   259  O  "O2'" A A   B  2 1   ? 21.058  33.082 31.486  0.35 34.15  ? 17  A   E "O2'" 1 
ATOM   260  O  "O2'" B A   B  2 1   ? 20.664  32.802 31.301  0.65 20.31  ? 17  A   E "O2'" 1 
ATOM   261  C  "C1'" A A   B  2 1   ? 19.418  33.722 29.899  0.35 28.15  ? 17  A   E "C1'" 1 
ATOM   262  C  "C1'" B A   B  2 1   ? 19.123  33.823 29.818  0.65 20.73  ? 17  A   E "C1'" 1 
ATOM   263  N  N9    A A   B  2 1   ? 18.647  34.920 29.581  0.35 28.41  ? 17  A   E N9    1 
ATOM   264  N  N9    B A   B  2 1   ? 18.486  35.108 29.561  0.65 14.44  ? 17  A   E N9    1 
ATOM   265  C  C8    A A   B  2 1   ? 17.300  35.186 29.539  0.35 29.22  ? 17  A   E C8    1 
ATOM   266  C  C8    B A   B  2 1   ? 17.143  35.406 29.520  0.65 12.90  ? 17  A   E C8    1 
ATOM   267  N  N7    A A   B  2 1   ? 17.024  36.448 29.268  0.35 31.55  ? 17  A   E N7    1 
ATOM   268  N  N7    B A   B  2 1   ? 16.888  36.676 29.315  0.65 14.00  ? 17  A   E N7    1 
ATOM   269  C  C5    A A   B  2 1   ? 18.258  37.039 29.138  0.35 30.11  ? 17  A   E C5    1 
ATOM   270  C  C5    B A   B  2 1   ? 18.147  37.260 29.208  0.65 13.54  ? 17  A   E C5    1 
ATOM   271  C  C6    A A   B  2 1   ? 18.632  38.352 28.872  0.35 32.76  ? 17  A   E C6    1 
ATOM   272  C  C6    B A   B  2 1   ? 18.561  38.587 28.999  0.65 20.25  ? 17  A   E C6    1 
ATOM   273  N  N6    A A   B  2 1   ? 17.736  39.351 28.733  0.35 34.46  ? 17  A   E N6    1 
ATOM   274  N  N6    B A   B  2 1   ? 17.711  39.609 28.864  0.65 18.76  ? 17  A   E N6    1 
ATOM   275  N  N1    A A   B  2 1   ? 19.952  38.612 28.753  0.35 33.18  ? 17  A   E N1    1 
ATOM   276  N  N1    B A   B  2 1   ? 19.887  38.827 28.937  0.65 18.39  ? 17  A   E N1    1 
ATOM   277  C  C2    A A   B  2 1   ? 20.817  37.603 28.912  0.35 34.08  ? 17  A   E C2    1 
ATOM   278  C  C2    B A   B  2 1   ? 20.737  37.807 29.090  0.65 20.89  ? 17  A   E C2    1 
ATOM   279  N  N3    A A   B  2 1   ? 20.569  36.323 29.160  0.35 31.70  ? 17  A   E N3    1 
ATOM   280  N  N3    B A   B  2 1   ? 20.466  36.506 29.295  0.65 20.36  ? 17  A   E N3    1 
ATOM   281  C  C4    A A   B  2 1   ? 19.262  36.109 29.280  0.35 29.31  ? 17  A   E C4    1 
ATOM   282  C  C4    B A   B  2 1   ? 19.139  36.306 29.344  0.65 12.89  ? 17  A   E C4    1 
ATOM   283  P  P     A G   B  2 2   ? 18.516  33.433 34.594  0.35 47.92  ? 18  G   E P     1 
ATOM   284  P  P     B G   B  2 2   ? 18.399  33.893 34.569  0.65 27.08  ? 18  G   E P     1 
ATOM   285  O  OP1   A G   B  2 2   ? 18.722  32.629 35.813  0.35 48.83  ? 18  G   E OP1   1 
ATOM   286  O  OP1   B G   B  2 2   ? 18.487  33.086 35.811  0.65 30.97  ? 18  G   E OP1   1 
ATOM   287  O  OP2   A G   B  2 2   ? 17.206  34.098 34.401  0.35 48.09  ? 18  G   E OP2   1 
ATOM   288  O  OP2   B G   B  2 2   ? 17.276  34.857 34.391  0.65 26.70  ? 18  G   E OP2   1 
ATOM   289  O  "O5'" A G   B  2 2   ? 19.653  34.541 34.549  0.35 47.30  ? 18  G   E "O5'" 1 
ATOM   290  O  "O5'" B G   B  2 2   ? 19.692  34.813 34.494  0.65 24.97  ? 18  G   E "O5'" 1 
ATOM   291  C  "C5'" A G   B  2 2   ? 20.978  34.088 34.601  0.35 48.41  ? 18  G   E "C5'" 1 
ATOM   292  C  "C5'" B G   B  2 2   ? 20.968  34.227 34.614  0.65 20.79  ? 18  G   E "C5'" 1 
ATOM   293  C  "C4'" A G   B  2 2   ? 21.980  35.195 34.453  0.35 47.35  ? 18  G   E "C4'" 1 
ATOM   294  C  "C4'" B G   B  2 2   ? 22.030  35.271 34.418  0.65 24.87  ? 18  G   E "C4'" 1 
ATOM   295  O  "O4'" A G   B  2 2   ? 21.913  35.710 33.102  0.35 48.52  ? 18  G   E "O4'" 1 
ATOM   296  O  "O4'" B G   B  2 2   ? 21.923  35.829 33.080  0.65 21.39  ? 18  G   E "O4'" 1 
ATOM   297  C  "C3'" A G   B  2 2   ? 21.877  36.426 35.345  0.35 44.08  ? 18  G   E "C3'" 1 
ATOM   298  C  "C3'" B G   B  2 2   ? 21.957  36.504 35.300  0.65 20.99  ? 18  G   E "C3'" 1 
ATOM   299  O  "O3'" A G   B  2 2   ? 22.367  36.190 36.675  0.35 34.53  ? 18  G   E "O3'" 1 
ATOM   300  O  "O3'" B G   B  2 2   ? 22.408  36.193 36.617  0.65 21.91  ? 18  G   E "O3'" 1 
ATOM   301  C  "C2'" A G   B  2 2   ? 22.722  37.419 34.551  0.35 45.52  ? 18  G   E "C2'" 1 
ATOM   302  C  "C2'" B G   B  2 2   ? 22.891  37.427 34.535  0.65 17.33  ? 18  G   E "C2'" 1 
ATOM   303  O  "O2'" A G   B  2 2   ? 24.105  37.262 34.593  0.35 48.71  ? 18  G   E "O2'" 1 
ATOM   304  O  "O2'" B G   B  2 2   ? 24.230  37.010 34.682  0.65 15.72  ? 18  G   E "O2'" 1 
ATOM   305  C  "C1'" A G   B  2 2   ? 22.371  37.047 33.117  0.35 46.83  ? 18  G   E "C1'" 1 
ATOM   306  C  "C1'" B G   B  2 2   ? 22.459  37.146 33.092  0.65 18.47  ? 18  G   E "C1'" 1 
ATOM   307  N  N9    A G   B  2 2   ? 21.327  37.955 32.687  0.35 45.62  ? 18  G   E N9    1 
ATOM   308  N  N9    B G   B  2 2   ? 21.423  38.079 32.666  0.65 19.62  ? 18  G   E N9    1 
ATOM   309  C  C8    A G   B  2 2   ? 19.960  37.796 32.645  0.35 44.04  ? 18  G   E C8    1 
ATOM   310  C  C8    B G   B  2 2   ? 20.062  37.889 32.657  0.65 17.13  ? 18  G   E C8    1 
ATOM   311  N  N7    A G   B  2 2   ? 19.316  38.856 32.251  0.35 42.99  ? 18  G   E N7    1 
ATOM   312  N  N7    B G   B  2 2   ? 19.400  38.956 32.287  0.65 16.01  ? 18  G   E N7    1 
ATOM   313  C  C5    A G   B  2 2   ? 20.307  39.781 31.998  0.35 43.20  ? 18  G   E C5    1 
ATOM   314  C  C5    B G   B  2 2   ? 20.387  39.889 32.011  0.65 17.04  ? 18  G   E C5    1 
ATOM   315  C  C6    A G   B  2 2   ? 20.219  41.120 31.534  0.35 43.46  ? 18  G   E C6    1 
ATOM   316  C  C6    B G   B  2 2   ? 20.282  41.233 31.578  0.65 16.49  ? 18  G   E C6    1 
ATOM   317  O  O6    A G   B  2 2   ? 19.217  41.779 31.266  0.35 43.10  ? 18  G   E O6    1 
ATOM   318  O  O6    B G   B  2 2   ? 19.270  41.899 31.354  0.65 19.51  ? 18  G   E O6    1 
ATOM   319  N  N1    A G   B  2 2   ? 21.477  41.699 31.405  0.35 43.29  ? 18  G   E N1    1 
ATOM   320  N  N1    B G   B  2 2   ? 21.540  41.828 31.431  0.65 18.68  ? 18  G   E N1    1 
ATOM   321  C  C2    A G   B  2 2   ? 22.661  41.079 31.680  0.35 44.96  ? 18  G   E C2    1 
ATOM   322  C  C2    B G   B  2 2   ? 22.738  41.203 31.657  0.65 20.28  ? 18  G   E C2    1 
ATOM   323  N  N2    A G   B  2 2   ? 23.747  41.818 31.464  0.35 45.40  ? 18  G   E N2    1 
ATOM   324  N  N2    B G   B  2 2   ? 23.845  41.929 31.429  0.65 20.99  ? 18  G   E N2    1 
ATOM   325  N  N3    A G   B  2 2   ? 22.762  39.833 32.123  0.35 43.68  ? 18  G   E N3    1 
ATOM   326  N  N3    B G   B  2 2   ? 22.846  39.945 32.068  0.65 17.05  ? 18  G   E N3    1 
ATOM   327  C  C4    A G   B  2 2   ? 21.558  39.246 32.254  0.35 44.20  ? 18  G   E C4    1 
ATOM   328  C  C4    B G   B  2 2   ? 21.639  39.360 32.228  0.65 16.11  ? 18  G   E C4    1 
ATOM   329  P  P     . U   B  2 3   ? 21.918  37.074 37.875  1.00 27.00  ? 19  U   E P     1 
ATOM   330  O  OP1   . U   B  2 3   ? 22.465  36.463 39.116  1.00 25.80  ? 19  U   E OP1   1 
ATOM   331  O  OP2   . U   B  2 3   ? 20.461  37.294 37.750  1.00 25.22  ? 19  U   E OP2   1 
ATOM   332  O  "O5'" . U   B  2 3   ? 22.630  38.476 37.645  1.00 24.26  ? 19  U   E "O5'" 1 
ATOM   333  C  "C5'" . U   B  2 3   ? 24.037  38.546 37.480  1.00 24.03  ? 19  U   E "C5'" 1 
ATOM   334  C  "C4'" . U   B  2 3   ? 24.430  39.921 37.010  1.00 20.32  ? 19  U   E "C4'" 1 
ATOM   335  O  "O4'" . U   B  2 3   ? 23.885  40.160 35.683  1.00 23.08  ? 19  U   E "O4'" 1 
ATOM   336  C  "C3'" . U   B  2 3   ? 23.874  41.072 37.825  1.00 24.84  ? 19  U   E "C3'" 1 
ATOM   337  O  "O3'" . U   B  2 3   ? 24.638  41.269 39.007  1.00 24.53  ? 19  U   E "O3'" 1 
ATOM   338  C  "C2'" . U   B  2 3   ? 24.034  42.217 36.838  1.00 21.44  ? 19  U   E "C2'" 1 
ATOM   339  O  "O2'" . U   B  2 3   ? 25.394  42.575 36.700  1.00 28.27  ? 19  U   E "O2'" 1 
ATOM   340  C  "C1'" . U   B  2 3   ? 23.586  41.540 35.540  1.00 26.64  ? 19  U   E "C1'" 1 
ATOM   341  N  N1    . U   B  2 3   ? 22.141  41.679 35.309  1.00 21.48  ? 19  U   E N1    1 
ATOM   342  C  C2    . U   B  2 3   ? 21.702  42.857 34.744  1.00 23.40  ? 19  U   E C2    1 
ATOM   343  O  O2    . U   B  2 3   ? 22.460  43.757 34.434  1.00 22.37  ? 19  U   E O2    1 
ATOM   344  N  N3    . U   B  2 3   ? 20.344  42.941 34.555  1.00 23.45  ? 19  U   E N3    1 
ATOM   345  C  C4    . U   B  2 3   ? 19.401  41.982 34.868  1.00 22.18  ? 19  U   E C4    1 
ATOM   346  O  O4    . U   B  2 3   ? 18.210  42.203 34.632  1.00 24.62  ? 19  U   E O4    1 
ATOM   347  C  C5    . U   B  2 3   ? 19.935  40.788 35.448  1.00 21.01  ? 19  U   E C5    1 
ATOM   348  C  C6    . U   B  2 3   ? 21.255  40.679 35.645  1.00 21.33  ? 19  U   E C6    1 
ATOM   349  P  P     . G   B  2 4   ? 23.930  41.856 40.324  1.00 28.97  ? 20  G   E P     1 
ATOM   350  O  OP1   . G   B  2 4   ? 24.850  41.566 41.456  1.00 30.23  ? 20  G   E OP1   1 
ATOM   351  O  OP2   . G   B  2 4   ? 22.521  41.413 40.396  1.00 29.16  ? 20  G   E OP2   1 
ATOM   352  O  "O5'" . G   B  2 4   ? 23.933  43.430 40.083  1.00 25.53  ? 20  G   E "O5'" 1 
ATOM   353  C  "C5'" . G   B  2 4   ? 25.163  44.137 39.979  1.00 26.06  ? 20  G   E "C5'" 1 
ATOM   354  C  "C4'" . G   B  2 4   ? 24.923  45.529 39.448  1.00 22.95  ? 20  G   E "C4'" 1 
ATOM   355  O  "O4'" . G   B  2 4   ? 24.342  45.451 38.116  1.00 22.38  ? 20  G   E "O4'" 1 
ATOM   356  C  "C3'" . G   B  2 4   ? 23.919  46.369 40.215  1.00 25.99  ? 20  G   E "C3'" 1 
ATOM   357  O  "O3'" . G   B  2 4   ? 24.510  46.948 41.372  1.00 26.88  ? 20  G   E "O3'" 1 
ATOM   358  C  "C2'" . G   B  2 4   ? 23.556  47.416 39.174  1.00 23.48  ? 20  G   E "C2'" 1 
ATOM   359  O  "O2'" . G   B  2 4   ? 24.605  48.346 38.988  1.00 21.01  ? 20  G   E "O2'" 1 
ATOM   360  C  "C1'" . G   B  2 4   ? 23.467  46.551 37.918  1.00 23.55  ? 20  G   E "C1'" 1 
ATOM   361  N  N9    . G   B  2 4   ? 22.125  46.033 37.689  1.00 20.89  ? 20  G   E N9    1 
ATOM   362  C  C8    . G   B  2 4   ? 21.672  44.762 37.945  1.00 26.50  ? 20  G   E C8    1 
ATOM   363  N  N7    . G   B  2 4   ? 20.420  44.590 37.617  1.00 21.75  ? 20  G   E N7    1 
ATOM   364  C  C5    . G   B  2 4   ? 20.023  45.822 37.117  1.00 21.93  ? 20  G   E C5    1 
ATOM   365  C  C6    . G   B  2 4   ? 18.772  46.242 36.603  1.00 21.09  ? 20  G   E C6    1 
ATOM   366  O  O6    . G   B  2 4   ? 17.733  45.580 36.468  1.00 21.86  ? 20  G   E O6    1 
ATOM   367  N  N1    . G   B  2 4   ? 18.801  47.580 36.218  1.00 19.47  ? 20  G   E N1    1 
ATOM   368  C  C2    . G   B  2 4   ? 19.897  48.406 36.312  1.00 21.42  ? 20  G   E C2    1 
ATOM   369  N  N2    . G   B  2 4   ? 19.726  49.675 35.903  1.00 19.72  ? 20  G   E N2    1 
ATOM   370  N  N3    . G   B  2 4   ? 21.073  48.019 36.777  1.00 22.18  ? 20  G   E N3    1 
ATOM   371  C  C4    . G   B  2 4   ? 21.063  46.725 37.161  1.00 21.49  ? 20  G   E C4    1 
ATOM   372  P  P     . G   B  2 5   ? 23.588  47.293 42.641  1.00 29.13  ? 21  G   E P     1 
ATOM   373  O  OP1   . G   B  2 5   ? 24.501  47.591 43.771  1.00 31.52  ? 21  G   E OP1   1 
ATOM   374  O  OP2   . G   B  2 5   ? 22.549  46.245 42.794  1.00 29.71  ? 21  G   E OP2   1 
ATOM   375  O  "O5'" . G   B  2 5   ? 22.843  48.632 42.226  1.00 25.27  ? 21  G   E "O5'" 1 
ATOM   376  C  "C5'" . G   B  2 5   ? 23.557  49.853 42.099  1.00 27.88  ? 21  G   E "C5'" 1 
ATOM   377  C  "C4'" . G   B  2 5   ? 22.629  50.945 41.636  1.00 25.25  ? 21  G   E "C4'" 1 
ATOM   378  O  "O4'" . G   B  2 5   ? 22.134  50.625 40.307  1.00 26.48  ? 21  G   E "O4'" 1 
ATOM   379  C  "C3'" . G   B  2 5   ? 21.357  51.124 42.443  1.00 30.09  ? 21  G   E "C3'" 1 
ATOM   380  O  "O3'" . G   B  2 5   ? 21.588  51.872 43.631  1.00 30.42  ? 21  G   E "O3'" 1 
ATOM   381  C  "C2'" . G   B  2 5   ? 20.485  51.878 41.449  1.00 25.57  ? 21  G   E "C2'" 1 
ATOM   382  O  "O2'" . G   B  2 5   ? 20.879  53.230 41.317  1.00 29.33  ? 21  G   E "O2'" 1 
ATOM   383  C  "C1'" . G   B  2 5   ? 20.819  51.137 40.154  1.00 27.16  ? 21  G   E "C1'" 1 
ATOM   384  N  N9    . G   B  2 5   ? 19.911  50.018 39.925  1.00 23.83  ? 21  G   E N9    1 
ATOM   385  C  C8    . G   B  2 5   ? 20.163  48.683 40.129  1.00 26.58  ? 21  G   E C8    1 
ATOM   386  N  N7    . G   B  2 5   ? 19.138  47.921 39.855  1.00 26.52  ? 21  G   E N7    1 
ATOM   387  C  C5    . G   B  2 5   ? 18.154  48.808 39.436  1.00 25.48  ? 21  G   E C5    1 
ATOM   388  C  C6    . G   B  2 5   ? 16.819  48.569 39.009  1.00 27.30  ? 21  G   E C6    1 
ATOM   389  O  O6    . G   B  2 5   ? 16.227  47.488 38.904  1.00 25.78  ? 21  G   E O6    1 
ATOM   390  N  N1    . G   B  2 5   ? 16.163  49.754 38.691  1.00 24.73  ? 21  G   E N1    1 
ATOM   391  C  C2    . G   B  2 5   ? 16.717  51.008 38.770  1.00 29.05  ? 21  G   E C2    1 
ATOM   392  N  N2    . G   B  2 5   ? 15.920  52.030 38.437  1.00 29.34  ? 21  G   E N2    1 
ATOM   393  N  N3    . G   B  2 5   ? 17.964  51.243 39.153  1.00 26.40  ? 21  G   E N3    1 
ATOM   394  C  C4    . G   B  2 5   ? 18.618  50.105 39.472  1.00 24.39  ? 21  G   E C4    1 
ATOM   395  P  P     . C   B  2 6   ? 20.682  51.594 44.931  1.00 31.48  ? 22  C   E P     1 
ATOM   396  O  OP1   . C   B  2 6   ? 21.191  52.484 46.008  1.00 33.10  ? 22  C   E OP1   1 
ATOM   397  O  OP2   . C   B  2 6   ? 20.611  50.130 45.161  1.00 29.59  ? 22  C   E OP2   1 
ATOM   398  O  "O5'" . C   B  2 6   ? 19.238  52.109 44.509  1.00 29.57  ? 22  C   E "O5'" 1 
ATOM   399  C  "C5'" . C   B  2 6   ? 19.019  53.485 44.213  1.00 29.96  ? 22  C   E "C5'" 1 
ATOM   400  C  "C4'" . C   B  2 6   ? 17.600  53.701 43.756  1.00 33.98  ? 22  C   E "C4'" 1 
ATOM   401  O  "O4'" . C   B  2 6   ? 17.381  53.005 42.497  1.00 30.82  ? 22  C   E "O4'" 1 
ATOM   402  C  "C3'" . C   B  2 6   ? 16.528  53.130 44.668  1.00 37.25  ? 22  C   E "C3'" 1 
ATOM   403  O  "O3'" . C   B  2 6   ? 16.267  53.989 45.772  1.00 35.52  ? 22  C   E "O3'" 1 
ATOM   404  C  "C2'" . C   B  2 6   ? 15.348  53.026 43.713  1.00 34.74  ? 22  C   E "C2'" 1 
ATOM   405  O  "O2'" . C   B  2 6   ? 14.759  54.281 43.447  1.00 35.46  ? 22  C   E "O2'" 1 
ATOM   406  C  "C1'" . C   B  2 6   ? 16.045  52.526 42.446  1.00 34.39  ? 22  C   E "C1'" 1 
ATOM   407  N  N1    . C   B  2 6   ? 16.081  51.055 42.380  1.00 27.34  ? 22  C   E N1    1 
ATOM   408  C  C2    . C   B  2 6   ? 14.931  50.374 41.971  1.00 30.93  ? 22  C   E C2    1 
ATOM   409  O  O2    . C   B  2 6   ? 13.926  51.031 41.665  1.00 30.32  ? 22  C   E O2    1 
ATOM   410  N  N3    . C   B  2 6   ? 14.944  49.022 41.920  1.00 27.20  ? 22  C   E N3    1 
ATOM   411  C  C4    . C   B  2 6   ? 16.049  48.354 42.257  1.00 32.05  ? 22  C   E C4    1 
ATOM   412  N  N4    . C   B  2 6   ? 16.017  47.021 42.190  1.00 27.51  ? 22  C   E N4    1 
ATOM   413  C  C5    . C   B  2 6   ? 17.237  49.023 42.677  1.00 29.13  ? 22  C   E C5    1 
ATOM   414  C  C6    . C   B  2 6   ? 17.209  50.363 42.719  1.00 29.13  ? 22  C   E C6    1 
ATOM   415  P  P     . C   B  2 7   ? 15.766  53.360 47.164  1.00 39.75  ? 23  C   E P     1 
ATOM   416  O  OP1   . C   B  2 7   ? 15.805  54.450 48.175  1.00 40.87  ? 23  C   E OP1   1 
ATOM   417  O  OP2   . C   B  2 7   ? 16.506  52.098 47.420  1.00 36.03  ? 23  C   E OP2   1 
ATOM   418  O  "O5'" . C   B  2 7   ? 14.243  52.996 46.885  1.00 34.99  ? 23  C   E "O5'" 1 
ATOM   419  C  "C5'" . C   B  2 7   ? 13.280  54.024 46.683  1.00 37.02  ? 23  C   E "C5'" 1 
ATOM   420  C  "C4'" . C   B  2 7   ? 11.917  53.426 46.428  1.00 36.78  ? 23  C   E "C4'" 1 
ATOM   421  O  "O4'" . C   B  2 7   ? 11.931  52.687 45.176  1.00 34.64  ? 23  C   E "O4'" 1 
ATOM   422  C  "C3'" . C   B  2 7   ? 11.430  52.401 47.440  1.00 37.73  ? 23  C   E "C3'" 1 
ATOM   423  O  "O3'" . C   B  2 7   ? 10.886  53.021 48.601  1.00 36.88  ? 23  C   E "O3'" 1 
ATOM   424  C  "C2'" . C   B  2 7   ? 10.361  51.678 46.635  1.00 36.01  ? 23  C   E "C2'" 1 
ATOM   425  O  "O2'" . C   B  2 7   ? 9.177   52.437 46.511  1.00 33.73  ? 23  C   E "O2'" 1 
ATOM   426  C  "C1'" . C   B  2 7   ? 11.039  51.586 45.267  1.00 34.45  ? 23  C   E "C1'" 1 
ATOM   427  N  N1    . C   B  2 7   ? 11.814  50.344 45.127  1.00 30.41  ? 23  C   E N1    1 
ATOM   428  C  C2    . C   B  2 7   ? 11.131  49.160 44.834  1.00 27.60  ? 23  C   E C2    1 
ATOM   429  O  O2    . C   B  2 7   ? 9.896   49.195 44.702  1.00 30.05  ? 23  C   E O2    1 
ATOM   430  N  N3    . C   B  2 7   ? 11.828  48.010 44.703  1.00 30.27  ? 23  C   E N3    1 
ATOM   431  C  C4    . C   B  2 7   ? 13.153  48.011 44.856  1.00 28.35  ? 23  C   E C4    1 
ATOM   432  N  N4    . C   B  2 7   ? 13.797  46.849 44.718  1.00 29.18  ? 23  C   E N4    1 
ATOM   433  C  C5    . C   B  2 7   ? 13.876  49.203 45.157  1.00 31.44  ? 23  C   E C5    1 
ATOM   434  C  C6    . C   B  2 7   ? 13.172  50.337 45.281  1.00 29.56  ? 23  C   E C6    1 
ATOM   435  P  P     . U   B  2 8   ? 10.977  52.271 50.021  1.00 41.76  ? 24  U   E P     1 
ATOM   436  O  OP1   . U   B  2 8   ? 10.458  53.222 51.041  1.00 45.70  ? 24  U   E OP1   1 
ATOM   437  O  OP2   . U   B  2 8   ? 12.332  51.691 50.186  1.00 37.29  ? 24  U   E OP2   1 
ATOM   438  O  "O5'" . U   B  2 8   ? 9.938   51.071 49.898  1.00 36.80  ? 24  U   E "O5'" 1 
ATOM   439  C  "C5'" . U   B  2 8   ? 8.566   51.327 49.632  1.00 37.14  ? 24  U   E "C5'" 1 
ATOM   440  C  "C4'" . U   B  2 8   ? 7.843   50.042 49.313  1.00 35.50  ? 24  U   E "C4'" 1 
ATOM   441  O  "O4'" . U   B  2 8   ? 8.404   49.454 48.108  1.00 35.36  ? 24  U   E "O4'" 1 
ATOM   442  C  "C3'" . U   B  2 8   ? 7.976   48.928 50.336  1.00 35.89  ? 24  U   E "C3'" 1 
ATOM   443  O  "O3'" . U   B  2 8   ? 7.085   49.119 51.430  1.00 42.86  ? 24  U   E "O3'" 1 
ATOM   444  C  "C2'" . U   B  2 8   ? 7.600   47.711 49.503  1.00 34.68  ? 24  U   E "C2'" 1 
ATOM   445  O  "O2'" . U   B  2 8   ? 6.206   47.623 49.294  1.00 35.95  ? 24  U   E "O2'" 1 
ATOM   446  C  "C1'" . U   B  2 8   ? 8.280   48.042 48.173  1.00 31.53  ? 24  U   E "C1'" 1 
ATOM   447  N  N1    . U   B  2 8   ? 9.614   47.439 48.040  1.00 27.79  ? 24  U   E N1    1 
ATOM   448  C  C2    . U   B  2 8   ? 9.667   46.095 47.719  1.00 30.92  ? 24  U   E C2    1 
ATOM   449  O  O2    . U   B  2 8   ? 8.669   45.415 47.574  1.00 30.60  ? 24  U   E O2    1 
ATOM   450  N  N3    . U   B  2 8   ? 10.928  45.578 47.581  1.00 28.53  ? 24  U   E N3    1 
ATOM   451  C  C4    . U   B  2 8   ? 12.119  46.248 47.735  1.00 29.34  ? 24  U   E C4    1 
ATOM   452  O  O4    . U   B  2 8   ? 13.175  45.643 47.553  1.00 31.43  ? 24  U   E O4    1 
ATOM   453  C  C5    . U   B  2 8   ? 11.988  47.634 48.083  1.00 28.69  ? 24  U   E C5    1 
ATOM   454  C  C6    . U   B  2 8   ? 10.766  48.169 48.218  1.00 28.83  ? 24  U   E C6    1 
ATOM   455  P  P     . U   B  2 9   ? 7.503   48.602 52.896  1.00 42.63  ? 25  U   E P     1 
ATOM   456  O  OP1   . U   B  2 9   ? 6.507   49.148 53.853  1.00 46.26  ? 25  U   E OP1   1 
ATOM   457  O  OP2   . U   B  2 9   ? 8.947   48.880 53.100  1.00 35.60  ? 25  U   E OP2   1 
ATOM   458  O  "O5'" . U   B  2 9   ? 7.303   47.024 52.824  1.00 43.59  ? 25  U   E "O5'" 1 
ATOM   459  C  "C5'" . U   B  2 9   ? 6.015   46.467 52.591  1.00 40.97  ? 25  U   E "C5'" 1 
ATOM   460  C  "C4'" . U   B  2 9   ? 6.134   45.018 52.179  1.00 42.62  ? 25  U   E "C4'" 1 
ATOM   461  O  "O4'" . U   B  2 9   ? 6.929   44.932 50.966  1.00 38.71  ? 25  U   E "O4'" 1 
ATOM   462  C  "C3'" . U   B  2 9   ? 6.868   44.099 53.141  1.00 41.20  ? 25  U   E "C3'" 1 
ATOM   463  O  "O3'" . U   B  2 9   ? 6.022   43.661 54.196  1.00 44.97  ? 25  U   E "O3'" 1 
ATOM   464  C  "C2'" . U   B  2 9   ? 7.256   42.947 52.225  1.00 42.62  ? 25  U   E "C2'" 1 
ATOM   465  O  "O2'" . U   B  2 9   ? 6.173   42.078 51.961  1.00 40.18  ? 25  U   E "O2'" 1 
ATOM   466  C  "C1'" . U   B  2 9   ? 7.631   43.699 50.948  1.00 38.25  ? 25  U   E "C1'" 1 
ATOM   467  N  N1    . U   B  2 9   ? 9.071   43.977 50.866  1.00 33.70  ? 25  U   E N1    1 
ATOM   468  C  C2    . U   B  2 9   ? 9.889   42.941 50.466  1.00 33.50  ? 25  U   E C2    1 
ATOM   469  O  O2    . U   B  2 9   ? 9.458   41.836 50.180  1.00 36.95  ? 25  U   E O2    1 
ATOM   470  N  N3    . U   B  2 9   ? 11.226  43.245 50.413  1.00 28.76  ? 25  U   E N3    1 
ATOM   471  C  C4    . U   B  2 9   ? 11.815  44.458 50.712  1.00 32.59  ? 25  U   E C4    1 
ATOM   472  O  O4    . U   B  2 9   ? 13.037  44.581 50.603  1.00 30.84  ? 25  U   E O4    1 
ATOM   473  C  C5    . U   B  2 9   ? 10.900  45.481 51.117  1.00 30.80  ? 25  U   E C5    1 
ATOM   474  C  C6    . U   B  2 9   ? 9.591   45.212 51.178  1.00 31.05  ? 25  U   E C6    1 
ATOM   475  P  P     . G   B  2 10  ? 6.674   43.125 55.565  1.00 46.66  ? 26  G   E P     1 
ATOM   476  O  OP1   . G   B  2 10  ? 5.558   42.729 56.459  1.00 50.34  ? 26  G   E OP1   1 
ATOM   477  O  OP2   . G   B  2 10  ? 7.679   44.110 56.038  1.00 45.32  ? 26  G   E OP2   1 
ATOM   478  O  "O5'" . G   B  2 10  ? 7.455   41.810 55.128  1.00 46.17  ? 26  G   E "O5'" 1 
ATOM   479  C  "C5'" . G   B  2 10  ? 6.752   40.646 54.705  1.00 45.99  ? 26  G   E "C5'" 1 
ATOM   480  C  "C4'" . G   B  2 10  ? 7.724   39.520 54.452  1.00 47.25  ? 26  G   E "C4'" 1 
ATOM   481  O  "O4'" . G   B  2 10  ? 8.573   39.861 53.322  1.00 44.47  ? 26  G   E "O4'" 1 
ATOM   482  C  "C3'" . G   B  2 10  ? 8.703   39.253 55.583  1.00 49.11  ? 26  G   E "C3'" 1 
ATOM   483  O  "O3'" . G   B  2 10  ? 8.123   38.413 56.574  1.00 57.26  ? 26  G   E "O3'" 1 
ATOM   484  C  "C2'" . G   B  2 10  ? 9.854   38.574 54.854  1.00 43.56  ? 26  G   E "C2'" 1 
ATOM   485  O  "O2'" . G   B  2 10  ? 9.590   37.214 54.576  1.00 45.15  ? 26  G   E "O2'" 1 
ATOM   486  C  "C1'" . G   B  2 10  ? 9.880   39.357 53.540  1.00 40.76  ? 26  G   E "C1'" 1 
ATOM   487  N  N9    . G   B  2 10  ? 10.809  40.482 53.543  1.00 34.05  ? 26  G   E N9    1 
ATOM   488  C  C8    . G   B  2 10  ? 10.517  41.797 53.817  1.00 32.37  ? 26  G   E C8    1 
ATOM   489  N  N7    . G   B  2 10  ? 11.552  42.585 53.712  1.00 32.55  ? 26  G   E N7    1 
ATOM   490  C  C5    . G   B  2 10  ? 12.592  41.738 53.353  1.00 33.65  ? 26  G   E C5    1 
ATOM   491  C  C6    . G   B  2 10  ? 13.954  42.019 53.088  1.00 34.43  ? 26  G   E C6    1 
ATOM   492  O  O6    . G   B  2 10  ? 14.533  43.114 53.104  1.00 34.43  ? 26  G   E O6    1 
ATOM   493  N  N1    . G   B  2 10  ? 14.663  40.863 52.771  1.00 35.07  ? 26  G   E N1    1 
ATOM   494  C  C2    . G   B  2 10  ? 14.127  39.600 52.708  1.00 36.02  ? 26  G   E C2    1 
ATOM   495  N  N2    . G   B  2 10  ? 14.976  38.609 52.389  1.00 39.08  ? 26  G   E N2    1 
ATOM   496  N  N3    . G   B  2 10  ? 12.854  39.327 52.942  1.00 36.30  ? 26  G   E N3    1 
ATOM   497  C  C4    . G   B  2 10  ? 12.151  40.434 53.256  1.00 34.19  ? 26  G   E C4    1 
ATOM   498  P  P     . C   B  2 11  ? 8.509   38.623 58.121  1.00 62.64  ? 27  C   E P     1 
ATOM   499  O  OP1   . C   B  2 11  ? 7.643   37.714 58.913  1.00 68.01  ? 27  C   E OP1   1 
ATOM   500  O  OP2   . C   B  2 11  ? 8.515   40.078 58.422  1.00 63.43  ? 27  C   E OP2   1 
ATOM   501  O  "O5'" . C   B  2 11  ? 10.005  38.087 58.213  1.00 63.77  ? 27  C   E "O5'" 1 
ATOM   502  C  "C5'" . C   B  2 11  ? 10.283  36.697 58.100  1.00 69.58  ? 27  C   E "C5'" 1 
ATOM   503  C  "C4'" . C   B  2 11  ? 11.772  36.460 58.078  1.00 72.05  ? 27  C   E "C4'" 1 
ATOM   504  O  "O4'" . C   B  2 11  ? 12.344  37.062 56.888  1.00 68.02  ? 27  C   E "O4'" 1 
ATOM   505  C  "C3'" . C   B  2 11  ? 12.565  37.102 59.202  1.00 75.59  ? 27  C   E "C3'" 1 
ATOM   506  O  "O3'" . C   B  2 11  ? 12.419  36.453 60.469  1.00 82.82  ? 27  C   E "O3'" 1 
ATOM   507  C  "C2'" . C   B  2 11  ? 13.972  37.106 58.621  1.00 72.95  ? 27  C   E "C2'" 1 
ATOM   508  O  "O2'" . C   B  2 11  ? 14.597  35.841 58.711  1.00 79.02  ? 27  C   E "O2'" 1 
ATOM   509  C  "C1'" . C   B  2 11  ? 13.687  37.437 57.151  1.00 64.92  ? 27  C   E "C1'" 1 
ATOM   510  N  N1    . C   B  2 11  ? 13.843  38.869 56.851  1.00 50.97  ? 27  C   E N1    1 
ATOM   511  C  C2    . C   B  2 11  ? 15.048  39.307 56.302  1.00 44.39  ? 27  C   E C2    1 
ATOM   512  O  O2    . C   B  2 11  ? 15.929  38.472 56.052  1.00 43.57  ? 27  C   E O2    1 
ATOM   513  N  N3    . C   B  2 11  ? 15.223  40.623 56.055  1.00 37.64  ? 27  C   E N3    1 
ATOM   514  C  C4    . C   B  2 11  ? 14.248  41.489 56.329  1.00 38.16  ? 27  C   E C4    1 
ATOM   515  N  N4    . C   B  2 11  ? 14.474  42.781 56.075  1.00 39.68  ? 27  C   E N4    1 
ATOM   516  C  C5    . C   B  2 11  ? 12.999  41.070 56.875  1.00 39.89  ? 27  C   E C5    1 
ATOM   517  C  C6    . C   B  2 11  ? 12.840  39.761 57.117  1.00 43.88  ? 27  C   E C6    1 
ATOM   518  O  OP3   . A   C  1 1   ? 15.036  39.524 4.075   1.00 42.75  ? 2   A   D OP3   1 
ATOM   519  P  P     . A   C  1 1   ? 15.120  38.005 4.009   1.00 46.01  ? 2   A   D P     1 
ATOM   520  O  OP1   . A   C  1 1   ? 15.680  37.388 5.282   1.00 42.89  ? 2   A   D OP1   1 
ATOM   521  O  OP2   . A   C  1 1   ? 13.823  37.348 3.557   1.00 45.26  ? 2   A   D OP2   1 
ATOM   522  O  "O5'" . A   C  1 1   ? 16.204  37.695 2.833   1.00 42.99  ? 2   A   D "O5'" 1 
ATOM   523  C  "C5'" . A   C  1 1   ? 16.626  36.351 2.534   1.00 38.48  ? 2   A   D "C5'" 1 
ATOM   524  C  "C4'" . A   C  1 1   ? 17.876  36.392 1.693   1.00 37.50  ? 2   A   D "C4'" 1 
ATOM   525  O  "O4'" . A   C  1 1   ? 17.568  37.035 0.430   1.00 36.34  ? 2   A   D "O4'" 1 
ATOM   526  C  "C3'" . A   C  1 1   ? 18.988  37.225 2.312   1.00 33.72  ? 2   A   D "C3'" 1 
ATOM   527  O  "O3'" . A   C  1 1   ? 19.811  36.395 3.122   1.00 34.86  ? 2   A   D "O3'" 1 
ATOM   528  C  "C2'" . A   C  1 1   ? 19.736  37.755 1.093   1.00 35.35  ? 2   A   D "C2'" 1 
ATOM   529  O  "O2'" . A   C  1 1   ? 20.676  36.841 0.570   1.00 32.47  ? 2   A   D "O2'" 1 
ATOM   530  C  "C1'" . A   C  1 1   ? 18.594  37.948 0.093   1.00 34.32  ? 2   A   D "C1'" 1 
ATOM   531  N  N9    . A   C  1 1   ? 18.005  39.283 0.087   1.00 31.88  ? 2   A   D N9    1 
ATOM   532  C  C8    . A   C  1 1   ? 16.699  39.607 0.362   1.00 28.35  ? 2   A   D C8    1 
ATOM   533  N  N7    . A   C  1 1   ? 16.432  40.882 0.230   1.00 30.48  ? 2   A   D N7    1 
ATOM   534  C  C5    . A   C  1 1   ? 17.646  41.439 -0.145  1.00 30.16  ? 2   A   D C5    1 
ATOM   535  C  C6    . A   C  1 1   ? 18.025  42.756 -0.448  1.00 30.92  ? 2   A   D C6    1 
ATOM   536  N  N6    . A   C  1 1   ? 17.182  43.790 -0.432  1.00 31.83  ? 2   A   D N6    1 
ATOM   537  N  N1    . A   C  1 1   ? 19.315  42.978 -0.778  1.00 30.78  ? 2   A   D N1    1 
ATOM   538  C  C2    . A   C  1 1   ? 20.157  41.938 -0.805  1.00 29.07  ? 2   A   D C2    1 
ATOM   539  N  N3    . A   C  1 1   ? 19.919  40.653 -0.548  1.00 28.32  ? 2   A   D N3    1 
ATOM   540  C  C4    . A   C  1 1   ? 18.628  40.468 -0.221  1.00 27.55  ? 2   A   D C4    1 
ATOM   541  P  P     . A   C  1 2   ? 20.128  36.819 4.640   1.00 33.09  ? 3   A   D P     1 
ATOM   542  O  OP1   . A   C  1 2   ? 20.819  35.656 5.253   1.00 31.63  ? 3   A   D OP1   1 
ATOM   543  O  OP2   . A   C  1 2   ? 18.891  37.352 5.257   1.00 33.55  ? 3   A   D OP2   1 
ATOM   544  O  "O5'" . A   C  1 2   ? 21.201  37.986 4.493   1.00 32.44  ? 3   A   D "O5'" 1 
ATOM   545  C  "C5'" . A   C  1 2   ? 22.549  37.674 4.151   1.00 33.07  ? 3   A   D "C5'" 1 
ATOM   546  C  "C4'" . A   C  1 2   ? 23.323  38.928 3.839   1.00 32.73  ? 3   A   D "C4'" 1 
ATOM   547  O  "O4'" . A   C  1 2   ? 22.808  39.543 2.629   1.00 32.17  ? 3   A   D "O4'" 1 
ATOM   548  C  "C3'" . A   C  1 2   ? 23.217  40.035 4.868   1.00 30.48  ? 3   A   D "C3'" 1 
ATOM   549  O  "O3'" . A   C  1 2   ? 24.081  39.810 5.960   1.00 29.93  ? 3   A   D "O3'" 1 
ATOM   550  C  "C2'" . A   C  1 2   ? 23.630  41.245 4.051   1.00 30.75  ? 3   A   D "C2'" 1 
ATOM   551  O  "O2'" . A   C  1 2   ? 25.028  41.304 3.834   1.00 30.47  ? 3   A   D "O2'" 1 
ATOM   552  C  "C1'" . A   C  1 2   ? 22.902  40.955 2.740   1.00 28.72  ? 3   A   D "C1'" 1 
ATOM   553  N  N9    . A   C  1 2   ? 21.544  41.489 2.766   1.00 28.54  ? 3   A   D N9    1 
ATOM   554  C  C8    . A   C  1 2   ? 20.378  40.819 3.042   1.00 28.27  ? 3   A   D C8    1 
ATOM   555  N  N7    . A   C  1 2   ? 19.310  41.577 2.992   1.00 26.88  ? 3   A   D N7    1 
ATOM   556  C  C5    . A   C  1 2   ? 19.807  42.829 2.659   1.00 26.63  ? 3   A   D C5    1 
ATOM   557  C  C6    . A   C  1 2   ? 19.183  44.065 2.453   1.00 24.56  ? 3   A   D C6    1 
ATOM   558  N  N6    . A   C  1 2   ? 17.865  44.252 2.549   1.00 26.77  ? 3   A   D N6    1 
ATOM   559  N  N1    . A   C  1 2   ? 19.968  45.119 2.139   1.00 28.33  ? 3   A   D N1    1 
ATOM   560  C  C2    . A   C  1 2   ? 21.290  44.928 2.039   1.00 24.77  ? 3   A   D C2    1 
ATOM   561  N  N3    . A   C  1 2   ? 21.994  43.812 2.206   1.00 28.76  ? 3   A   D N3    1 
ATOM   562  C  C4    . A   C  1 2   ? 21.182  42.788 2.518   1.00 26.36  ? 3   A   D C4    1 
ATOM   563  P  P     . G   C  1 3   ? 23.745  40.479 7.375   1.00 33.52  ? 4   G   D P     1 
ATOM   564  O  OP1   . G   C  1 3   ? 24.746  39.936 8.325   1.00 32.54  ? 4   G   D OP1   1 
ATOM   565  O  OP2   . G   C  1 3   ? 22.294  40.326 7.653   1.00 33.20  ? 4   G   D OP2   1 
ATOM   566  O  "O5'" . G   C  1 3   ? 24.044  42.022 7.138   1.00 29.16  ? 4   G   D "O5'" 1 
ATOM   567  C  "C5'" . G   C  1 3   ? 25.375  42.473 6.947   1.00 28.14  ? 4   G   D "C5'" 1 
ATOM   568  C  "C4'" . G   C  1 3   ? 25.402  43.971 6.783   1.00 30.31  ? 4   G   D "C4'" 1 
ATOM   569  O  "O4'" . G   C  1 3   ? 24.752  44.346 5.535   1.00 31.94  ? 4   G   D "O4'" 1 
ATOM   570  C  "C3'" . G   C  1 3   ? 24.635  44.775 7.817   1.00 28.83  ? 4   G   D "C3'" 1 
ATOM   571  O  "O3'" . G   C  1 3   ? 25.340  44.896 9.045   1.00 28.57  ? 4   G   D "O3'" 1 
ATOM   572  C  "C2'" . G   C  1 3   ? 24.493  46.106 7.092   1.00 26.51  ? 4   G   D "C2'" 1 
ATOM   573  O  "O2'" . G   C  1 3   ? 25.717  46.816 7.044   1.00 27.89  ? 4   G   D "O2'" 1 
ATOM   574  C  "C1'" . G   C  1 3   ? 24.140  45.620 5.685   1.00 26.77  ? 4   G   D "C1'" 1 
ATOM   575  N  N9    . G   C  1 3   ? 22.697  45.463 5.545   1.00 26.45  ? 4   G   D N9    1 
ATOM   576  C  C8    . G   C  1 3   ? 21.969  44.303 5.642   1.00 26.78  ? 4   G   D C8    1 
ATOM   577  N  N7    . G   C  1 3   ? 20.685  44.493 5.508   1.00 28.65  ? 4   G   D N7    1 
ATOM   578  C  C5    . G   C  1 3   ? 20.559  45.859 5.301   1.00 26.14  ? 4   G   D C5    1 
ATOM   579  C  C6    . G   C  1 3   ? 19.406  46.654 5.093   1.00 26.64  ? 4   G   D C6    1 
ATOM   580  O  O6    . G   C  1 3   ? 18.224  46.298 5.045   1.00 28.71  ? 4   G   D O6    1 
ATOM   581  N  N1    . G   C  1 3   ? 19.733  47.996 4.933   1.00 28.88  ? 4   G   D N1    1 
ATOM   582  C  C2    . G   C  1 3   ? 21.004  48.508 4.968   1.00 25.54  ? 4   G   D C2    1 
ATOM   583  N  N2    . G   C  1 3   ? 21.116  49.834 4.805   1.00 31.38  ? 4   G   D N2    1 
ATOM   584  N  N3    . G   C  1 3   ? 22.089  47.776 5.153   1.00 27.93  ? 4   G   D N3    1 
ATOM   585  C  C4    . G   C  1 3   ? 21.792  46.470 5.314   1.00 25.40  ? 4   G   D C4    1 
ATOM   586  P  P     . G   C  1 4   ? 24.516  45.062 10.417  1.00 29.81  ? 5   G   D P     1 
ATOM   587  O  OP1   . G   C  1 4   ? 25.517  45.050 11.514  1.00 34.58  ? 5   G   D OP1   1 
ATOM   588  O  OP2   . G   C  1 4   ? 23.379  44.108 10.449  1.00 30.19  ? 5   G   D OP2   1 
ATOM   589  O  "O5'" . G   C  1 4   ? 23.900  46.524 10.310  1.00 29.18  ? 5   G   D "O5'" 1 
ATOM   590  C  "C5'" . G   C  1 4   ? 24.751  47.651 10.217  1.00 26.40  ? 5   G   D "C5'" 1 
ATOM   591  C  "C4'" . G   C  1 4   ? 23.950  48.890 9.904   1.00 25.57  ? 5   G   D "C4'" 1 
ATOM   592  O  "O4'" . G   C  1 4   ? 23.255  48.716 8.638   1.00 29.51  ? 5   G   D "O4'" 1 
ATOM   593  C  "C3'" . G   C  1 4   ? 22.823  49.227 10.863  1.00 24.72  ? 5   G   D "C3'" 1 
ATOM   594  O  "O3'" . G   C  1 4   ? 23.307  49.868 12.037  1.00 24.09  ? 5   G   D "O3'" 1 
ATOM   595  C  "C2'" . G   C  1 4   ? 21.996  50.179 10.010  1.00 25.59  ? 5   G   D "C2'" 1 
ATOM   596  O  "O2'" . G   C  1 4   ? 22.612  51.443 9.890   1.00 23.86  ? 5   G   D "O2'" 1 
ATOM   597  C  "C1'" . G   C  1 4   ? 22.051  49.475 8.654   1.00 28.40  ? 5   G   D "C1'" 1 
ATOM   598  N  N9    . G   C  1 4   ? 20.915  48.574 8.494   1.00 24.77  ? 5   G   D N9    1 
ATOM   599  C  C8    . G   C  1 4   ? 20.904  47.203 8.575   1.00 26.01  ? 5   G   D C8    1 
ATOM   600  N  N7    . G   C  1 4   ? 19.710  46.693 8.429   1.00 24.53  ? 5   G   D N7    1 
ATOM   601  C  C5    . G   C  1 4   ? 18.888  47.794 8.234   1.00 24.66  ? 5   G   D C5    1 
ATOM   602  C  C6    . G   C  1 4   ? 17.485  47.872 8.031   1.00 22.03  ? 5   G   D C6    1 
ATOM   603  O  O6    . G   C  1 4   ? 16.658  46.955 7.999   1.00 30.04  ? 5   G   D O6    1 
ATOM   604  N  N1    . G   C  1 4   ? 17.067  49.188 7.864   1.00 22.87  ? 5   G   D N1    1 
ATOM   605  C  C2    . G   C  1 4   ? 17.887  50.289 7.901   1.00 24.11  ? 5   G   D C2    1 
ATOM   606  N  N2    . G   C  1 4   ? 17.299  51.484 7.717   1.00 25.11  ? 5   G   D N2    1 
ATOM   607  N  N3    . G   C  1 4   ? 19.189  50.230 8.103   1.00 26.20  ? 5   G   D N3    1 
ATOM   608  C  C4    . G   C  1 4   ? 19.619  48.959 8.258   1.00 27.08  ? 5   G   D C4    1 
ATOM   609  P  P     . U   C  1 5   ? 22.464  49.764 13.399  1.00 26.85  ? 6   U   D P     1 
ATOM   610  O  OP1   . U   C  1 5   ? 23.247  50.437 14.468  1.00 29.69  ? 6   U   D OP1   1 
ATOM   611  O  OP2   . U   C  1 5   ? 22.032  48.356 13.578  1.00 28.06  ? 6   U   D OP2   1 
ATOM   612  O  "O5'" . U   C  1 5   ? 21.158  50.620 13.112  1.00 26.80  ? 6   U   D "O5'" 1 
ATOM   613  C  "C5'" . U   C  1 5   ? 21.236  52.005 12.815  1.00 24.47  ? 6   U   D "C5'" 1 
ATOM   614  C  "C4'" . U   C  1 5   ? 19.862  52.535 12.499  1.00 27.60  ? 6   U   D "C4'" 1 
ATOM   615  O  "O4'" . U   C  1 5   ? 19.350  51.857 11.318  1.00 28.37  ? 6   U   D "O4'" 1 
ATOM   616  C  "C3'" . U   C  1 5   ? 18.811  52.239 13.555  1.00 29.21  ? 6   U   D "C3'" 1 
ATOM   617  O  "O3'" . U   C  1 5   ? 18.867  53.184 14.609  1.00 26.26  ? 6   U   D "O3'" 1 
ATOM   618  C  "C2'" . U   C  1 5   ? 17.523  52.343 12.750  1.00 29.75  ? 6   U   D "C2'" 1 
ATOM   619  O  "O2'" . U   C  1 5   ? 17.149  53.683 12.494  1.00 29.25  ? 6   U   D "O2'" 1 
ATOM   620  C  "C1'" . U   C  1 5   ? 17.947  51.677 11.442  1.00 26.53  ? 6   U   D "C1'" 1 
ATOM   621  N  N1    . U   C  1 5   ? 17.656  50.236 11.416  1.00 28.30  ? 6   U   D N1    1 
ATOM   622  C  C2    . U   C  1 5   ? 16.353  49.857 11.152  1.00 26.17  ? 6   U   D C2    1 
ATOM   623  O  O2    . U   C  1 5   ? 15.460  50.664 10.966  1.00 27.13  ? 6   U   D O2    1 
ATOM   624  N  N3    . U   C  1 5   ? 16.135  48.502 11.116  1.00 23.65  ? 6   U   D N3    1 
ATOM   625  C  C4    . U   C  1 5   ? 17.068  47.507 11.320  1.00 29.57  ? 6   U   D C4    1 
ATOM   626  O  O4    . U   C  1 5   ? 16.730  46.329 11.201  1.00 28.30  ? 6   U   D O4    1 
ATOM   627  C  C5    . U   C  1 5   ? 18.392  47.978 11.603  1.00 28.38  ? 6   U   D C5    1 
ATOM   628  C  C6    . U   C  1 5   ? 18.634  49.295 11.641  1.00 25.39  ? 6   U   D C6    1 
ATOM   629  P  P     . C   C  1 6   ? 18.436  52.742 16.092  1.00 25.23  ? 7   C   D P     1 
ATOM   630  O  OP1   . C   C  1 6   ? 18.860  53.830 17.001  1.00 24.74  ? 7   C   D OP1   1 
ATOM   631  O  OP2   . C   C  1 6   ? 18.890  51.350 16.346  1.00 23.11  ? 7   C   D OP2   1 
ATOM   632  O  "O5'" . C   C  1 6   ? 16.845  52.749 16.039  1.00 26.77  ? 7   C   D "O5'" 1 
ATOM   633  C  "C5'" . C   C  1 6   ? 16.142  53.977 15.906  1.00 26.70  ? 7   C   D "C5'" 1 
ATOM   634  C  "C4'" . C   C  1 6   ? 14.677  53.722 15.659  1.00 24.63  ? 7   C   D "C4'" 1 
ATOM   635  O  "O4'" . C   C  1 6   ? 14.516  52.993 14.410  1.00 24.23  ? 7   C   D "O4'" 1 
ATOM   636  C  "C3'" . C   C  1 6   ? 13.965  52.839 16.668  1.00 23.66  ? 7   C   D "C3'" 1 
ATOM   637  O  "O3'" . C   C  1 6   ? 13.604  53.557 17.844  1.00 31.04  ? 7   C   D "O3'" 1 
ATOM   638  C  "C2'" . C   C  1 6   ? 12.742  52.423 15.866  1.00 24.37  ? 7   C   D "C2'" 1 
ATOM   639  O  "O2'" . C   C  1 6   ? 11.825  53.494 15.728  1.00 24.08  ? 7   C   D "O2'" 1 
ATOM   640  C  "C1'" . C   C  1 6   ? 13.378  52.147 14.504  1.00 26.72  ? 7   C   D "C1'" 1 
ATOM   641  N  N1    . C   C  1 6   ? 13.816  50.746 14.363  1.00 24.97  ? 7   C   D N1    1 
ATOM   642  C  C2    . C   C  1 6   ? 12.876  49.794 13.962  1.00 21.80  ? 7   C   D C2    1 
ATOM   643  O  O2    . C   C  1 6   ? 11.707  50.155 13.764  1.00 24.30  ? 7   C   D O2    1 
ATOM   644  N  N3    . C   C  1 6   ? 13.260  48.507 13.804  1.00 21.04  ? 7   C   D N3    1 
ATOM   645  C  C4    . C   C  1 6   ? 14.525  48.154 14.036  1.00 22.85  ? 7   C   D C4    1 
ATOM   646  N  N4    . C   C  1 6   ? 14.859  46.875 13.845  1.00 22.75  ? 7   C   D N4    1 
ATOM   647  C  C5    . C   C  1 6   ? 15.505  49.100 14.467  1.00 23.62  ? 7   C   D C5    1 
ATOM   648  C  C6    . C   C  1 6   ? 15.110  50.375 14.615  1.00 23.08  ? 7   C   D C6    1 
ATOM   649  P  P     . A   C  1 7   ? 13.569  52.798 19.264  1.00 34.22  ? 8   A   D P     1 
ATOM   650  O  OP1   . A   C  1 7   ? 13.165  53.799 20.281  1.00 41.68  ? 8   A   D OP1   1 
ATOM   651  O  OP2   . A   C  1 7   ? 14.829  52.036 19.444  1.00 33.86  ? 8   A   D OP2   1 
ATOM   652  O  "O5'" . A   C  1 7   ? 12.406  51.716 19.112  1.00 31.44  ? 8   A   D "O5'" 1 
ATOM   653  C  "C5'" . A   C  1 7   ? 11.061  52.130 18.967  1.00 33.43  ? 8   A   D "C5'" 1 
ATOM   654  C  "C4'" . A   C  1 7   ? 10.175  50.969 18.567  1.00 27.06  ? 8   A   D "C4'" 1 
ATOM   655  O  "O4'" . A   C  1 7   ? 10.631  50.375 17.320  1.00 26.65  ? 8   A   D "O4'" 1 
ATOM   656  C  "C3'" . A   C  1 7   ? 10.089  49.760 19.482  1.00 24.60  ? 8   A   D "C3'" 1 
ATOM   657  O  "O3'" . A   C  1 7   ? 9.289   50.038 20.625  1.00 25.14  ? 8   A   D "O3'" 1 
ATOM   658  C  "C2'" . A   C  1 7   ? 9.404   48.768 18.550  1.00 22.88  ? 8   A   D "C2'" 1 
ATOM   659  O  "O2'" . A   C  1 7   ? 8.035   49.084 18.374  1.00 26.64  ? 8   A   D "O2'" 1 
ATOM   660  C  "C1'" . A   C  1 7   ? 10.127  49.050 17.231  1.00 24.46  ? 8   A   D "C1'" 1 
ATOM   661  N  N9    . A   C  1 7   ? 11.233  48.118 16.995  1.00 23.61  ? 8   A   D N9    1 
ATOM   662  C  C8    . A   C  1 7   ? 12.580  48.291 17.215  1.00 25.73  ? 8   A   D C8    1 
ATOM   663  N  N7    . A   C  1 7   ? 13.303  47.239 16.907  1.00 22.94  ? 8   A   D N7    1 
ATOM   664  C  C5    . A   C  1 7   ? 12.371  46.315 16.450  1.00 22.35  ? 8   A   D C5    1 
ATOM   665  C  C6    . A   C  1 7   ? 12.498  44.997 15.971  1.00 23.98  ? 8   A   D C6    1 
ATOM   666  N  N6    . A   C  1 7   ? 13.666  44.355 15.868  1.00 23.40  ? 8   A   D N6    1 
ATOM   667  N  N1    . A   C  1 7   ? 11.369  44.351 15.598  1.00 24.62  ? 8   A   D N1    1 
ATOM   668  C  C2    . A   C  1 7   ? 10.198  44.995 15.707  1.00 27.06  ? 8   A   D C2    1 
ATOM   669  N  N3    . A   C  1 7   ? 9.951   46.230 16.143  1.00 22.06  ? 8   A   D N3    1 
ATOM   670  C  C4    . A   C  1 7   ? 11.094  46.844 16.501  1.00 21.08  ? 8   A   D C4    1 
ATOM   671  P  P     . U   C  1 8   ? 9.436   49.132 21.950  1.00 26.47  ? 9   U   D P     1 
ATOM   672  O  OP1   . U   C  1 8   ? 8.631   49.769 23.020  1.00 26.22  ? 9   U   D OP1   1 
ATOM   673  O  OP2   . U   C  1 8   ? 10.872  48.837 22.184  1.00 29.48  ? 9   U   D OP2   1 
ATOM   674  O  "O5'" . U   C  1 8   ? 8.753   47.753 21.554  1.00 23.59  ? 9   U   D "O5'" 1 
ATOM   675  C  "C5'" . U   C  1 8   ? 7.369   47.687 21.257  1.00 24.01  ? 9   U   D "C5'" 1 
ATOM   676  C  "C4'" . U   C  1 8   ? 7.010   46.306 20.777  1.00 22.06  ? 9   U   D "C4'" 1 
ATOM   677  O  "O4'" . U   C  1 8   ? 7.657   46.043 19.502  1.00 21.18  ? 9   U   D "O4'" 1 
ATOM   678  C  "C3'" . U   C  1 8   ? 7.504   45.162 21.643  1.00 22.72  ? 9   U   D "C3'" 1 
ATOM   679  O  "O3'" . U   C  1 8   ? 6.716   44.977 22.805  1.00 21.33  ? 9   U   D "O3'" 1 
ATOM   680  C  "C2'" . U   C  1 8   ? 7.407   44.007 20.663  1.00 22.25  ? 9   U   D "C2'" 1 
ATOM   681  O  "O2'" . U   C  1 8   ? 6.063   43.637 20.410  1.00 23.34  ? 9   U   D "O2'" 1 
ATOM   682  C  "C1'" . U   C  1 8   ? 7.987   44.662 19.411  1.00 22.87  ? 9   U   D "C1'" 1 
ATOM   683  N  N1    . U   C  1 8   ? 9.455   44.540 19.363  1.00 19.75  ? 9   U   D N1    1 
ATOM   684  C  C2    . U   C  1 8   ? 9.992   43.391 18.811  1.00 23.99  ? 9   U   D C2    1 
ATOM   685  O  O2    . U   C  1 8   ? 9.308   42.484 18.371  1.00 22.91  ? 9   U   D O2    1 
ATOM   686  N  N3    . U   C  1 8   ? 11.365  43.341 18.795  1.00 23.80  ? 9   U   D N3    1 
ATOM   687  C  C4    . U   C  1 8   ? 12.236  44.304 19.267  1.00 24.51  ? 9   U   D C4    1 
ATOM   688  O  O4    . U   C  1 8   ? 13.451  44.127 19.158  1.00 24.45  ? 9   U   D O4    1 
ATOM   689  C  C5    . U   C  1 8   ? 11.603  45.460 19.826  1.00 24.28  ? 9   U   D C5    1 
ATOM   690  C  C6    . U   C  1 8   ? 10.267  45.536 19.853  1.00 25.09  ? 9   U   D C6    1 
ATOM   691  P  P     . U   C  1 9   ? 7.381   44.317 24.112  1.00 22.88  ? 10  U   D P     1 
ATOM   692  O  OP1   . U   C  1 9   ? 6.554   44.705 25.286  1.00 23.40  ? 10  U   D OP1   1 
ATOM   693  O  OP2   . U   C  1 9   ? 8.842   44.614 24.113  1.00 21.41  ? 10  U   D OP2   1 
ATOM   694  O  "O5'" . U   C  1 9   ? 7.231   42.750 23.869  1.00 19.54  ? 10  U   D "O5'" 1 
ATOM   695  C  "C5'" . U   C  1 9   ? 5.961   42.174 23.577  1.00 23.11  ? 10  U   D "C5'" 1 
ATOM   696  C  "C4'" . U   C  1 9   ? 6.137   40.794 22.995  1.00 21.21  ? 10  U   D "C4'" 1 
ATOM   697  O  "O4'" . U   C  1 9   ? 6.837   40.885 21.725  1.00 25.52  ? 10  U   D "O4'" 1 
ATOM   698  C  "C3'" . U   C  1 9   ? 6.998   39.843 23.809  1.00 22.54  ? 10  U   D "C3'" 1 
ATOM   699  O  "O3'" . U   C  1 9   ? 6.238   39.252 24.854  1.00 23.74  ? 10  U   D "O3'" 1 
ATOM   700  C  "C2'" . U   C  1 9   ? 7.396   38.823 22.752  1.00 19.28  ? 10  U   D "C2'" 1 
ATOM   701  O  "O2'" . U   C  1 9   ? 6.332   37.939 22.446  1.00 20.90  ? 10  U   D "O2'" 1 
ATOM   702  C  "C1'" . U   C  1 9   ? 7.653   39.735 21.550  1.00 25.88  ? 10  U   D "C1'" 1 
ATOM   703  N  N1    . U   C  1 9   ? 9.056   40.172 21.458  1.00 19.57  ? 10  U   D N1    1 
ATOM   704  C  C2    . U   C  1 9   ? 9.939   39.343 20.789  1.00 24.10  ? 10  U   D C2    1 
ATOM   705  O  O2    . U   C  1 9   ? 9.607   38.273 20.307  1.00 21.74  ? 10  U   D O2    1 
ATOM   706  N  N3    . U   C  1 9   ? 11.226  39.808 20.712  1.00 21.13  ? 10  U   D N3    1 
ATOM   707  C  C4    . U   C  1 9   ? 11.718  40.985 21.233  1.00 23.27  ? 10  U   D C4    1 
ATOM   708  O  O4    . U   C  1 9   ? 12.906  41.272 21.056  1.00 23.15  ? 10  U   D O4    1 
ATOM   709  C  C5    . U   C  1 9   ? 10.749  41.784 21.926  1.00 19.56  ? 10  U   D C5    1 
ATOM   710  C  C6    . U   C  1 9   ? 9.479   41.358 22.011  1.00 20.64  ? 10  U   D C6    1 
ATOM   711  P  P     . C   C  1 10  ? 6.974   38.751 26.193  1.00 22.31  ? 11  C   D P     1 
ATOM   712  O  OP1   . C   C  1 10  ? 5.919   38.388 27.157  1.00 20.32  ? 11  C   D OP1   1 
ATOM   713  O  OP2   . C   C  1 10  ? 8.016   39.740 26.582  1.00 21.65  ? 11  C   D OP2   1 
ATOM   714  O  "O5'" . C   C  1 10  ? 7.732   37.428 25.738  1.00 19.43  ? 11  C   D "O5'" 1 
ATOM   715  C  "C5'" . C   C  1 10  ? 7.014   36.255 25.376  1.00 16.22  ? 11  C   D "C5'" 1 
ATOM   716  C  "C4'" . C   C  1 10  ? 7.983   35.176 24.956  1.00 17.62  ? 11  C   D "C4'" 1 
ATOM   717  O  "O4'" . C   C  1 10  ? 8.676   35.602 23.752  1.00 18.12  ? 11  C   D "O4'" 1 
ATOM   718  C  "C3'" . C   C  1 10  ? 9.121   34.916 25.928  1.00 19.45  ? 11  C   D "C3'" 1 
ATOM   719  O  "O3'" . C   C  1 10  ? 8.718   34.088 27.010  1.00 18.59  ? 11  C   D "O3'" 1 
ATOM   720  C  "C2'" . C   C  1 10  ? 10.145  34.242 25.024  1.00 19.10  ? 11  C   D "C2'" 1 
ATOM   721  O  "O2'" . C   C  1 10  ? 9.845   32.886 24.759  1.00 17.19  ? 11  C   D "O2'" 1 
ATOM   722  C  "C1'" . C   C  1 10  ? 9.993   35.066 23.745  1.00 22.46  ? 11  C   D "C1'" 1 
ATOM   723  N  N1    . C   C  1 10  ? 10.954  36.176 23.713  1.00 17.25  ? 11  C   D N1    1 
ATOM   724  C  C2    . C   C  1 10  ? 12.243  35.923 23.248  1.00 19.22  ? 11  C   D C2    1 
ATOM   725  O  O2    . C   C  1 10  ? 12.520  34.775 22.866  1.00 17.55  ? 11  C   D O2    1 
ATOM   726  N  N3    . C   C  1 10  ? 13.150  36.928 23.230  1.00 18.42  ? 11  C   D N3    1 
ATOM   727  C  C4    . C   C  1 10  ? 12.807  38.143 23.664  1.00 17.37  ? 11  C   D C4    1 
ATOM   728  N  N4    . C   C  1 10  ? 13.739  39.107 23.645  1.00 20.89  ? 11  C   D N4    1 
ATOM   729  C  C5    . C   C  1 10  ? 11.492  38.430 24.141  1.00 17.47  ? 11  C   D C5    1 
ATOM   730  C  C6    . C   C  1 10  ? 10.606  37.426 24.144  1.00 16.86  ? 11  C   D C6    1 
ATOM   731  P  P     . G   C  1 11  ? 9.495   34.188 28.418  1.00 19.72  ? 12  G   D P     1 
ATOM   732  O  OP1   . G   C  1 11  ? 8.758   33.339 29.384  1.00 19.42  ? 12  G   D OP1   1 
ATOM   733  O  OP2   . G   C  1 11  ? 9.742   35.616 28.742  1.00 16.71  ? 12  G   D OP2   1 
ATOM   734  O  "O5'" . G   C  1 11  ? 10.898  33.497 28.112  1.00 17.30  ? 12  G   D "O5'" 1 
ATOM   735  C  "C5'" . G   C  1 11  ? 10.962  32.123 27.747  1.00 15.06  ? 12  G   D "C5'" 1 
ATOM   736  C  "C4'" . G   C  1 11  ? 12.390  31.730 27.456  1.00 16.54  ? 12  G   D "C4'" 1 
ATOM   737  O  "O4'" . G   C  1 11  ? 12.876  32.494 26.326  1.00 19.47  ? 12  G   D "O4'" 1 
ATOM   738  C  "C3'" . G   C  1 11  ? 13.387  32.053 28.556  1.00 19.12  ? 12  G   D "C3'" 1 
ATOM   739  O  "O3'" . G   C  1 11  ? 13.305  31.140 29.653  1.00 17.83  ? 12  G   D "O3'" 1 
ATOM   740  C  "C2'" . G   C  1 11  ? 14.702  32.062 27.789  1.00 17.44  ? 12  G   D "C2'" 1 
ATOM   741  O  "O2'" . G   C  1 11  ? 15.154  30.751 27.500  1.00 16.02  ? 12  G   D "O2'" 1 
ATOM   742  C  "C1'" . G   C  1 11  ? 14.267  32.734 26.484  1.00 18.75  ? 12  G   D "C1'" 1 
ATOM   743  N  N9    . G   C  1 11  ? 14.493  34.174 26.467  1.00 15.41  ? 12  G   D N9    1 
ATOM   744  C  C8    . G   C  1 11  ? 13.567  35.177 26.625  1.00 15.96  ? 12  G   D C8    1 
ATOM   745  N  N7    . G   C  1 11  ? 14.089  36.373 26.537  1.00 16.92  ? 12  G   D N7    1 
ATOM   746  C  C5    . G   C  1 11  ? 15.440  36.141 26.309  1.00 14.42  ? 12  G   D C5    1 
ATOM   747  C  C6    . G   C  1 11  ? 16.518  37.051 26.122  1.00 17.55  ? 12  G   D C6    1 
ATOM   748  O  O6    . G   C  1 11  ? 16.492  38.283 26.100  1.00 19.16  ? 12  G   D O6    1 
ATOM   749  N  N1    . G   C  1 11  ? 17.725  36.383 25.942  1.00 13.58  ? 12  G   D N1    1 
ATOM   750  C  C2    . G   C  1 11  ? 17.881  35.019 25.939  1.00 16.53  ? 12  G   D C2    1 
ATOM   751  N  N2    . G   C  1 11  ? 19.138  34.560 25.778  1.00 14.91  ? 12  G   D N2    1 
ATOM   752  N  N3    . G   C  1 11  ? 16.886  34.163 26.092  1.00 14.55  ? 12  G   D N3    1 
ATOM   753  C  C4    . G   C  1 11  ? 15.704  34.790 26.274  1.00 17.13  ? 12  G   D C4    1 
ATOM   754  O  OP3   A A   D  2 1   ? 20.805  33.845 17.150  0.25 17.47  ? 17  A   F OP3   1 
ATOM   755  O  OP3   B A   D  2 1   ? 21.251  34.358 17.021  0.75 22.53  ? 17  A   F OP3   1 
ATOM   756  P  P     A A   D  2 1   ? 20.071  32.670 16.350  0.25 10.71  ? 17  A   F P     1 
ATOM   757  P  P     B A   D  2 1   ? 19.927  35.082 16.898  0.75 24.38  ? 17  A   F P     1 
ATOM   758  O  OP1   A A   D  2 1   ? 19.516  32.529 14.995  0.25 12.58  ? 17  A   F OP1   1 
ATOM   759  O  OP1   B A   D  2 1   ? 19.870  36.481 17.497  0.75 24.27  ? 17  A   F OP1   1 
ATOM   760  O  OP2   A A   D  2 1   ? 21.051  31.589 16.615  0.25 19.62  ? 17  A   F OP2   1 
ATOM   761  O  OP2   B A   D  2 1   ? 19.584  35.066 15.417  0.75 26.69  ? 17  A   F OP2   1 
ATOM   762  O  "O5'" A A   D  2 1   ? 18.806  32.857 17.408  0.25 16.00  ? 17  A   F "O5'" 1 
ATOM   763  O  "O5'" B A   D  2 1   ? 18.787  34.225 17.692  0.75 24.12  ? 17  A   F "O5'" 1 
ATOM   764  C  "C5'" A A   D  2 1   ? 18.089  31.647 17.690  0.25 17.88  ? 17  A   F "C5'" 1 
ATOM   765  C  "C5'" B A   D  2 1   ? 18.491  32.865 17.350  0.75 23.47  ? 17  A   F "C5'" 1 
ATOM   766  C  "C4'" A A   D  2 1   ? 16.611  31.848 17.610  0.25 20.92  ? 17  A   F "C4'" 1 
ATOM   767  C  "C4'" B A   D  2 1   ? 17.014  32.583 17.487  0.75 24.27  ? 17  A   F "C4'" 1 
ATOM   768  O  "O4'" A A   D  2 1   ? 16.203  32.389 18.892  0.25 21.82  ? 17  A   F "O4'" 1 
ATOM   769  O  "O4'" B A   D  2 1   ? 16.569  32.905 18.836  0.75 20.92  ? 17  A   F "O4'" 1 
ATOM   770  C  "C3'" A A   D  2 1   ? 15.982  32.769 16.584  0.25 25.65  ? 17  A   F "C3'" 1 
ATOM   771  C  "C3'" B A   D  2 1   ? 16.127  33.440 16.599  0.75 22.78  ? 17  A   F "C3'" 1 
ATOM   772  O  "O3'" A A   D  2 1   ? 15.836  32.279 15.233  0.25 35.45  ? 17  A   F "O3'" 1 
ATOM   773  O  "O3'" B A   D  2 1   ? 16.126  32.969 15.257  0.75 29.69  ? 17  A   F "O3'" 1 
ATOM   774  C  "C2'" A A   D  2 1   ? 14.646  33.095 17.249  0.25 24.57  ? 17  A   F "C2'" 1 
ATOM   775  C  "C2'" B A   D  2 1   ? 14.801  33.367 17.343  0.75 23.19  ? 17  A   F "C2'" 1 
ATOM   776  O  "O2'" A A   D  2 1   ? 13.653  32.089 17.150  0.25 30.36  ? 17  A   F "O2'" 1 
ATOM   777  O  "O2'" B A   D  2 1   ? 14.237  32.072 17.250  0.75 23.94  ? 17  A   F "O2'" 1 
ATOM   778  C  "C1'" A A   D  2 1   ? 15.059  33.199 18.718  0.25 23.54  ? 17  A   F "C1'" 1 
ATOM   779  C  "C1'" B A   D  2 1   ? 15.290  33.528 18.783  0.75 22.15  ? 17  A   F "C1'" 1 
ATOM   780  N  N9    A A   D  2 1   ? 15.422  34.608 19.048  0.25 21.17  ? 17  A   F N9    1 
ATOM   781  N  N9    B A   D  2 1   ? 15.461  34.944 19.093  0.75 19.74  ? 17  A   F N9    1 
ATOM   782  C  C8    A A   D  2 1   ? 16.612  35.347 19.124  0.25 22.27  ? 17  A   F C8    1 
ATOM   783  C  C8    B A   D  2 1   ? 16.635  35.653 19.166  0.75 21.40  ? 17  A   F C8    1 
ATOM   784  N  N7    A A   D  2 1   ? 16.430  36.613 19.390  0.25 24.19  ? 17  A   F N7    1 
ATOM   785  N  N7    B A   D  2 1   ? 16.458  36.932 19.412  0.75 22.97  ? 17  A   F N7    1 
ATOM   786  C  C5    A A   D  2 1   ? 15.050  36.731 19.502  0.25 22.40  ? 17  A   F C5    1 
ATOM   787  C  C5    B A   D  2 1   ? 15.083  37.059 19.533  0.75 20.31  ? 17  A   F C5    1 
ATOM   788  C  C6    A A   D  2 1   ? 14.218  37.828 19.757  0.25 25.57  ? 17  A   F C6    1 
ATOM   789  C  C6    B A   D  2 1   ? 14.258  38.172 19.787  0.75 24.61  ? 17  A   F C6    1 
ATOM   790  N  N6    A A   D  2 1   ? 14.701  39.064 19.963  0.25 26.15  ? 17  A   F N6    1 
ATOM   791  N  N6    B A   D  2 1   ? 14.719  39.416 19.966  0.75 21.59  ? 17  A   F N6    1 
ATOM   792  N  N1    A A   D  2 1   ? 12.890  37.611 19.832  0.25 24.65  ? 17  A   F N1    1 
ATOM   793  N  N1    B A   D  2 1   ? 12.920  37.969 19.843  0.75 22.25  ? 17  A   F N1    1 
ATOM   794  C  C2    A A   D  2 1   ? 12.437  36.356 19.643  0.25 26.11  ? 17  A   F C2    1 
ATOM   795  C  C2    B A   D  2 1   ? 12.459  36.722 19.645  0.75 23.94  ? 17  A   F C2    1 
ATOM   796  N  N3    A A   D  2 1   ? 13.122  35.250 19.389  0.25 21.99  ? 17  A   F N3    1 
ATOM   797  N  N3    B A   D  2 1   ? 13.133  35.605 19.386  0.75 20.91  ? 17  A   F N3    1 
ATOM   798  C  C4    A A   D  2 1   ? 14.438  35.509 19.321  0.25 22.97  ? 17  A   F C4    1 
ATOM   799  C  C4    B A   D  2 1   ? 14.459  35.844 19.347  0.75 17.83  ? 17  A   F C4    1 
ATOM   800  P  P     A G   D  2 2   ? 15.974  33.401 14.007  0.25 41.86  ? 18  G   F P     1 
ATOM   801  P  P     B G   D  2 2   ? 15.929  34.019 14.047  0.75 31.61  ? 18  G   F P     1 
ATOM   802  O  OP1   A G   D  2 2   ? 15.895  32.579 12.780  0.25 43.83  ? 18  G   F OP1   1 
ATOM   803  O  OP1   B G   D  2 2   ? 16.113  33.280 12.773  0.75 32.44  ? 18  G   F OP1   1 
ATOM   804  O  OP2   A G   D  2 2   ? 17.060  34.477 14.041  0.25 44.33  ? 18  G   F OP2   1 
ATOM   805  O  OP2   B G   D  2 2   ? 16.706  35.257 14.298  0.75 26.94  ? 18  G   F OP2   1 
ATOM   806  O  "O5'" A G   D  2 2   ? 14.561  34.147 14.149  0.25 43.61  ? 18  G   F "O5'" 1 
ATOM   807  O  "O5'" B G   D  2 2   ? 14.405  34.439 14.168  0.75 28.71  ? 18  G   F "O5'" 1 
ATOM   808  C  "C5'" A G   D  2 2   ? 13.446  33.267 13.941  0.25 43.86  ? 18  G   F "C5'" 1 
ATOM   809  C  "C5'" B G   D  2 2   ? 13.394  33.486 13.984  0.75 24.33  ? 18  G   F "C5'" 1 
ATOM   810  C  "C4'" A G   D  2 2   ? 12.126  33.921 14.171  0.25 43.99  ? 18  G   F "C4'" 1 
ATOM   811  C  "C4'" B G   D  2 2   ? 12.055  34.102 14.209  0.75 23.72  ? 18  G   F "C4'" 1 
ATOM   812  O  "O4'" A G   D  2 2   ? 12.077  34.428 15.521  0.25 45.33  ? 18  G   F "O4'" 1 
ATOM   813  O  "O4'" B G   D  2 2   ? 11.966  34.625 15.564  0.75 23.57  ? 18  G   F "O4'" 1 
ATOM   814  C  "C3'" A G   D  2 2   ? 11.803  35.142 13.326  0.25 41.58  ? 18  G   F "C3'" 1 
ATOM   815  C  "C3'" B G   D  2 2   ? 11.726  35.318 13.369  0.75 22.09  ? 18  G   F "C3'" 1 
ATOM   816  O  "O3'" A G   D  2 2   ? 11.412  34.818 12.021  0.25 34.61  ? 18  G   F "O3'" 1 
ATOM   817  O  "O3'" B G   D  2 2   ? 11.361  34.940 12.047  0.75 26.34  ? 18  G   F "O3'" 1 
ATOM   818  C  "C2'" A G   D  2 2   ? 10.727  35.819 14.148  0.25 43.68  ? 18  G   F "C2'" 1 
ATOM   819  C  "C2'" B G   D  2 2   ? 10.538  35.853 14.155  0.75 23.83  ? 18  G   F "C2'" 1 
ATOM   820  O  "O2'" A G   D  2 2   ? 9.462   35.220 13.986  0.25 45.87  ? 18  G   F "O2'" 1 
ATOM   821  O  "O2'" B G   D  2 2   ? 9.389   35.043 13.988  0.75 24.58  ? 18  G   F "O2'" 1 
ATOM   822  C  "C1'" A G   D  2 2   ? 11.159  35.496 15.564  0.25 44.66  ? 18  G   F "C1'" 1 
ATOM   823  C  "C1'" B G   D  2 2   ? 11.036  35.687 15.593  0.75 22.67  ? 18  G   F "C1'" 1 
ATOM   824  N  N9    A G   D  2 2   ? 11.835  36.708 16.045  0.25 44.32  ? 18  G   F N9    1 
ATOM   825  N  N9    B G   D  2 2   ? 11.702  36.897 16.066  0.75 21.36  ? 18  G   F N9    1 
ATOM   826  C  C8    A G   D  2 2   ? 13.185  36.989 16.087  0.25 43.20  ? 18  G   F C8    1 
ATOM   827  C  C8    B G   D  2 2   ? 13.050  37.163 16.078  0.75 21.70  ? 18  G   F C8    1 
ATOM   828  N  N7    A G   D  2 2   ? 13.440  38.201 16.520  0.25 43.15  ? 18  G   F N7    1 
ATOM   829  N  N7    B G   D  2 2   ? 13.331  38.362 16.505  0.75 20.30  ? 18  G   F N7    1 
ATOM   830  C  C5    A G   D  2 2   ? 12.194  38.740 16.799  0.25 43.28  ? 18  G   F C5    1 
ATOM   831  C  C5    B G   D  2 2   ? 12.089  38.918 16.802  0.75 18.81  ? 18  G   F C5    1 
ATOM   832  C  C6    A G   D  2 2   ? 11.832  40.012 17.315  0.25 43.89  ? 18  G   F C6    1 
ATOM   833  C  C6    B G   D  2 2   ? 11.745  40.205 17.291  0.75 20.08  ? 18  G   F C6    1 
ATOM   834  O  O6    A G   D  2 2   ? 12.562  40.960 17.624  0.25 44.52  ? 18  G   F O6    1 
ATOM   835  O  O6    B G   D  2 2   ? 12.499  41.144 17.563  0.75 19.91  ? 18  G   F O6    1 
ATOM   836  N  N1    A G   D  2 2   ? 10.451  40.130 17.459  0.25 44.53  ? 18  G   F N1    1 
ATOM   837  N  N1    B G   D  2 2   ? 10.375  40.327 17.464  0.75 22.70  ? 18  G   F N1    1 
ATOM   838  C  C2    A G   D  2 2   ? 9.534   39.157 17.145  0.25 45.54  ? 18  G   F C2    1 
ATOM   839  C  C2    B G   D  2 2   ? 9.448   39.353 17.196  0.75 23.71  ? 18  G   F C2    1 
ATOM   840  N  N2    A G   D  2 2   ? 8.257   39.469 17.376  0.25 45.92  ? 18  G   F N2    1 
ATOM   841  N  N2    B G   D  2 2   ? 8.158   39.673 17.443  0.75 26.37  ? 18  G   F N2    1 
ATOM   842  N  N3    A G   D  2 2   ? 9.859   37.976 16.654  0.25 44.81  ? 18  G   F N3    1 
ATOM   843  N  N3    B G   D  2 2   ? 9.750   38.163 16.727  0.75 21.79  ? 18  G   F N3    1 
ATOM   844  C  C4    A G   D  2 2   ? 11.194  37.836 16.509  0.25 43.92  ? 18  G   F C4    1 
ATOM   845  C  C4    B G   D  2 2   ? 11.082  38.011 16.558  0.75 18.84  ? 18  G   F C4    1 
ATOM   846  P  P     . U   D  2 3   ? 11.616  35.870 10.840  1.00 28.73  ? 19  U   F P     1 
ATOM   847  O  OP1   . U   D  2 3   ? 11.292  35.153 9.579   1.00 27.92  ? 19  U   F OP1   1 
ATOM   848  O  OP2   . U   D  2 3   ? 12.933  36.556 10.983  1.00 25.26  ? 19  U   F OP2   1 
ATOM   849  O  "O5'" . U   D  2 3   ? 10.492  36.952 11.115  1.00 27.84  ? 19  U   F "O5'" 1 
ATOM   850  C  "C5'" . U   D  2 3   ? 9.141   36.554 11.260  1.00 27.76  ? 19  U   F "C5'" 1 
ATOM   851  C  "C4'" . U   D  2 3   ? 8.323   37.700 11.783  1.00 26.68  ? 19  U   F "C4'" 1 
ATOM   852  O  "O4'" . U   D  2 3   ? 8.769   38.056 13.120  1.00 30.03  ? 19  U   F "O4'" 1 
ATOM   853  C  "C3'" . U   D  2 3   ? 8.466   39.000 11.017  1.00 29.20  ? 19  U   F "C3'" 1 
ATOM   854  O  "O3'" . U   D  2 3   ? 7.677   38.976 9.839   1.00 33.37  ? 19  U   F "O3'" 1 
ATOM   855  C  "C2'" . U   D  2 3   ? 7.948   39.995 12.044  1.00 29.57  ? 19  U   F "C2'" 1 
ATOM   856  O  "O2'" . U   D  2 3   ? 6.544   39.909 12.185  1.00 33.59  ? 19  U   F "O2'" 1 
ATOM   857  C  "C1'" . U   D  2 3   ? 8.598   39.452 13.318  1.00 29.70  ? 19  U   F "C1'" 1 
ATOM   858  N  N1    . U   D  2 3   ? 9.916   40.051 13.570  1.00 21.60  ? 19  U   F N1    1 
ATOM   859  C  C2    . U   D  2 3   ? 9.948   41.288 14.183  1.00 21.13  ? 19  U   F C2    1 
ATOM   860  O  O2    . U   D  2 3   ? 8.944   41.883 14.527  1.00 21.78  ? 19  U   F O2    1 
ATOM   861  N  N3    . U   D  2 3   ? 11.204  41.803 14.384  1.00 24.37  ? 19  U   F N3    1 
ATOM   862  C  C4    . U   D  2 3   ? 12.405  41.217 14.051  1.00 22.95  ? 19  U   F C4    1 
ATOM   863  O  O4    . U   D  2 3   ? 13.454  41.803 14.315  1.00 27.26  ? 19  U   F O4    1 
ATOM   864  C  C5    . U   D  2 3   ? 12.291  39.935 13.426  1.00 20.43  ? 19  U   F C5    1 
ATOM   865  C  C6    . U   D  2 3   ? 11.079  39.409 13.208  1.00 22.42  ? 19  U   F C6    1 
ATOM   866  P  P     . G   D  2 4   ? 8.148   39.810 8.551   1.00 31.99  ? 20  G   F P     1 
ATOM   867  O  OP1   . G   D  2 4   ? 7.370   39.283 7.401   1.00 37.89  ? 20  G   F OP1   1 
ATOM   868  O  OP2   . G   D  2 4   ? 9.631   39.846 8.479   1.00 35.25  ? 20  G   F OP2   1 
ATOM   869  O  "O5'" . G   D  2 4   ? 7.636   41.287 8.852   1.00 30.12  ? 20  G   F "O5'" 1 
ATOM   870  C  "C5'" . G   D  2 4   ? 6.246   41.555 8.963   1.00 29.29  ? 20  G   F "C5'" 1 
ATOM   871  C  "C4'" . G   D  2 4   ? 6.020   42.925 9.547   1.00 26.11  ? 20  G   F "C4'" 1 
ATOM   872  O  "O4'" . G   D  2 4   ? 6.588   42.990 10.884  1.00 26.45  ? 20  G   F "O4'" 1 
ATOM   873  C  "C3'" . G   D  2 4   ? 6.692   44.080 8.826   1.00 25.25  ? 20  G   F "C3'" 1 
ATOM   874  O  "O3'" . G   D  2 4   ? 5.941   44.484 7.688   1.00 27.39  ? 20  G   F "O3'" 1 
ATOM   875  C  "C2'" . G   D  2 4   ? 6.684   45.143 9.912   1.00 26.85  ? 20  G   F "C2'" 1 
ATOM   876  O  "O2'" . G   D  2 4   ? 5.385   45.668 10.102  1.00 24.85  ? 20  G   F "O2'" 1 
ATOM   877  C  "C1'" . G   D  2 4   ? 7.052   44.306 11.138  1.00 27.48  ? 20  G   F "C1'" 1 
ATOM   878  N  N9    . G   D  2 4   ? 8.492   44.248 11.368  1.00 25.82  ? 20  G   F N9    1 
ATOM   879  C  C8    . G   D  2 4   ? 9.338   43.207 11.073  1.00 28.28  ? 20  G   F C8    1 
ATOM   880  N  N7    . G   D  2 4   ? 10.578  43.446 11.400  1.00 24.19  ? 20  G   F N7    1 
ATOM   881  C  C5    . G   D  2 4   ? 10.550  44.721 11.947  1.00 23.95  ? 20  G   F C5    1 
ATOM   882  C  C6    . G   D  2 4   ? 11.595  45.514 12.482  1.00 24.10  ? 20  G   F C6    1 
ATOM   883  O  O6    . G   D  2 4   ? 12.790  45.231 12.599  1.00 24.40  ? 20  G   F O6    1 
ATOM   884  N  N1    . G   D  2 4   ? 11.129  46.753 12.912  1.00 22.00  ? 20  G   F N1    1 
ATOM   885  C  C2    . G   D  2 4   ? 9.820   47.173 12.842  1.00 24.92  ? 20  G   F C2    1 
ATOM   886  N  N2    . G   D  2 4   ? 9.563   48.410 13.300  1.00 25.50  ? 20  G   F N2    1 
ATOM   887  N  N3    . G   D  2 4   ? 8.836   46.437 12.358  1.00 23.87  ? 20  G   F N3    1 
ATOM   888  C  C4    . G   D  2 4   ? 9.269   45.232 11.929  1.00 24.24  ? 20  G   F C4    1 
ATOM   889  P  P     . G   D  2 5   ? 6.695   45.158 6.440   1.00 30.79  ? 21  G   F P     1 
ATOM   890  O  OP1   . G   D  2 5   ? 5.726   45.184 5.314   1.00 35.92  ? 21  G   F OP1   1 
ATOM   891  O  OP2   . G   D  2 5   ? 8.013   44.514 6.255   1.00 31.57  ? 21  G   F OP2   1 
ATOM   892  O  "O5'" . G   D  2 5   ? 6.962   46.652 6.913   1.00 30.77  ? 21  G   F "O5'" 1 
ATOM   893  C  "C5'" . G   D  2 5   ? 5.883   47.561 7.081   1.00 32.10  ? 21  G   F "C5'" 1 
ATOM   894  C  "C4'" . G   D  2 5   ? 6.393   48.880 7.599   1.00 31.39  ? 21  G   F "C4'" 1 
ATOM   895  O  "O4'" . G   D  2 5   ? 6.962   48.694 8.925   1.00 31.31  ? 21  G   F "O4'" 1 
ATOM   896  C  "C3'" . G   D  2 5   ? 7.536   49.497 6.812   1.00 32.76  ? 21  G   F "C3'" 1 
ATOM   897  O  "O3'" . G   D  2 5   ? 7.070   50.173 5.650   1.00 34.29  ? 21  G   F "O3'" 1 
ATOM   898  C  "C2'" . G   D  2 5   ? 8.120   50.454 7.839   1.00 30.85  ? 21  G   F "C2'" 1 
ATOM   899  O  "O2'" . G   D  2 5   ? 7.321   51.609 8.012   1.00 35.97  ? 21  G   F "O2'" 1 
ATOM   900  C  "C1'" . G   D  2 5   ? 8.044   49.598 9.106   1.00 32.63  ? 21  G   F "C1'" 1 
ATOM   901  N  N9    . G   D  2 5   ? 9.268   48.827 9.305   1.00 31.61  ? 21  G   F N9    1 
ATOM   902  C  C8    . G   D  2 5   ? 9.467   47.490 9.054   1.00 31.29  ? 21  G   F C8    1 
ATOM   903  N  N7    . G   D  2 5   ? 10.687  47.097 9.314   1.00 29.02  ? 21  G   F N7    1 
ATOM   904  C  C5    . G   D  2 5   ? 11.328  48.242 9.767   1.00 27.55  ? 21  G   F C5    1 
ATOM   905  C  C6    . G   D  2 5   ? 12.666  48.440 10.192  1.00 28.32  ? 21  G   F C6    1 
ATOM   906  O  O6    . G   D  2 5   ? 13.579  47.613 10.268  1.00 28.54  ? 21  G   F O6    1 
ATOM   907  N  N1    . G   D  2 5   ? 12.898  49.763 10.555  1.00 26.00  ? 21  G   F N1    1 
ATOM   908  C  C2    . G   D  2 5   ? 11.964  50.766 10.518  1.00 27.90  ? 21  G   F C2    1 
ATOM   909  N  N2    . G   D  2 5   ? 12.385  51.982 10.895  1.00 32.87  ? 21  G   F N2    1 
ATOM   910  N  N3    . G   D  2 5   ? 10.709  50.593 10.135  1.00 29.30  ? 21  G   F N3    1 
ATOM   911  C  C4    . G   D  2 5   ? 10.464  49.317 9.771   1.00 27.41  ? 21  G   F C4    1 
ATOM   912  P  P     . C   D  2 6   ? 8.008   50.254 4.348   1.00 36.76  ? 22  C   F P     1 
ATOM   913  O  OP1   . C   D  2 6   ? 7.225   50.963 3.300   1.00 43.53  ? 22  C   F OP1   1 
ATOM   914  O  OP2   . C   D  2 6   ? 8.561   48.911 4.062   1.00 36.17  ? 22  C   F OP2   1 
ATOM   915  O  "O5'" . C   D  2 6   ? 9.204   51.203 4.797   1.00 36.48  ? 22  C   F "O5'" 1 
ATOM   916  C  "C5'" . C   D  2 6   ? 8.960   52.558 5.149   1.00 37.65  ? 22  C   F "C5'" 1 
ATOM   917  C  "C4'" . C   D  2 6   ? 10.234  53.213 5.622   1.00 36.84  ? 22  C   F "C4'" 1 
ATOM   918  O  "O4'" . C   D  2 6   ? 10.676  52.586 6.858   1.00 39.74  ? 22  C   F "O4'" 1 
ATOM   919  C  "C3'" . C   D  2 6   ? 11.429  53.062 4.699   1.00 43.80  ? 22  C   F "C3'" 1 
ATOM   920  O  "O3'" . C   D  2 6   ? 11.391  54.003 3.632   1.00 42.61  ? 22  C   F "O3'" 1 
ATOM   921  C  "C2'" . C   D  2 6   ? 12.584  53.315 5.658   1.00 38.69  ? 22  C   F "C2'" 1 
ATOM   922  O  "O2'" . C   D  2 6   ? 12.736  54.684 5.969   1.00 40.38  ? 22  C   F "O2'" 1 
ATOM   923  C  "C1'" . C   D  2 6   ? 12.096  52.568 6.901   1.00 38.28  ? 22  C   F "C1'" 1 
ATOM   924  N  N1    . C   D  2 6   ? 12.543  51.166 6.912   1.00 32.39  ? 22  C   F N1    1 
ATOM   925  C  C2    . C   D  2 6   ? 13.856  50.885 7.305   1.00 34.40  ? 22  C   F C2    1 
ATOM   926  O  O2    . C   D  2 6   ? 14.594  51.821 7.642   1.00 33.37  ? 22  C   F O2    1 
ATOM   927  N  N3    . C   D  2 6   ? 14.285  49.603 7.309   1.00 29.93  ? 22  C   F N3    1 
ATOM   928  C  C4    . C   D  2 6   ? 13.458  48.622 6.943   1.00 29.33  ? 22  C   F C4    1 
ATOM   929  N  N4    . C   D  2 6   ? 13.927  47.372 6.963   1.00 29.89  ? 22  C   F N4    1 
ATOM   930  C  C5    . C   D  2 6   ? 12.114  48.879 6.542   1.00 29.22  ? 22  C   F C5    1 
ATOM   931  C  C6    . C   D  2 6   ? 11.702  50.154 6.543   1.00 31.82  ? 22  C   F C6    1 
ATOM   932  P  P     . C   D  2 7   ? 12.064  53.628 2.220   1.00 46.93  ? 23  C   F P     1 
ATOM   933  O  OP1   . C   D  2 7   ? 11.663  54.682 1.252   1.00 44.68  ? 23  C   F OP1   1 
ATOM   934  O  OP2   . C   D  2 7   ? 11.786  52.205 1.908   1.00 43.88  ? 23  C   F OP2   1 
ATOM   935  O  "O5'" . C   D  2 7   ? 13.626  53.775 2.493   1.00 40.94  ? 23  C   F "O5'" 1 
ATOM   936  C  "C5'" . C   D  2 7   ? 14.196  55.051 2.750   1.00 41.29  ? 23  C   F "C5'" 1 
ATOM   937  C  "C4'" . C   D  2 7   ? 15.679  54.926 3.000   1.00 40.97  ? 23  C   F "C4'" 1 
ATOM   938  O  "O4'" . C   D  2 7   ? 15.911  54.173 4.223   1.00 40.15  ? 23  C   F "O4'" 1 
ATOM   939  C  "C3'" . C   D  2 7   ? 16.474  54.161 1.956   1.00 41.47  ? 23  C   F "C3'" 1 
ATOM   940  O  "O3'" . C   D  2 7   ? 16.783  54.970 0.828   1.00 42.50  ? 23  C   F "O3'" 1 
ATOM   941  C  "C2'" . C   D  2 7   ? 17.724  53.797 2.743   1.00 39.17  ? 23  C   F "C2'" 1 
ATOM   942  O  "O2'" . C   D  2 7   ? 18.594  54.899 2.907   1.00 38.45  ? 23  C   F "O2'" 1 
ATOM   943  C  "C1'" . C   D  2 7   ? 17.117  53.432 4.099   1.00 34.38  ? 23  C   F "C1'" 1 
ATOM   944  N  N1    . C   D  2 7   ? 16.796  51.999 4.187   1.00 33.38  ? 23  C   F N1    1 
ATOM   945  C  C2    . C   D  2 7   ? 17.832  51.098 4.435   1.00 32.81  ? 23  C   F C2    1 
ATOM   946  O  O2    . C   D  2 7   ? 18.984  51.536 4.577   1.00 33.01  ? 23  C   F O2    1 
ATOM   947  N  N3    . C   D  2 7   ? 17.558  49.778 4.515   1.00 30.71  ? 23  C   F N3    1 
ATOM   948  C  C4    . C   D  2 7   ? 16.306  49.347 4.359   1.00 28.79  ? 23  C   F C4    1 
ATOM   949  N  N4    . C   D  2 7   ? 16.082  48.033 4.453   1.00 32.78  ? 23  C   F N4    1 
ATOM   950  C  C5    . C   D  2 7   ? 15.227  50.244 4.102   1.00 33.38  ? 23  C   F C5    1 
ATOM   951  C  C6    . C   D  2 7   ? 15.515  51.549 4.025   1.00 30.93  ? 23  C   F C6    1 
ATOM   952  P  P     . U   D  2 8   ? 16.932  54.287 -0.620  1.00 42.74  ? 24  U   F P     1 
ATOM   953  O  OP1   . U   D  2 8   ? 17.102  55.391 -1.602  1.00 49.71  ? 24  U   F OP1   1 
ATOM   954  O  OP2   . U   D  2 8   ? 15.842  53.301 -0.812  1.00 37.80  ? 24  U   F OP2   1 
ATOM   955  O  "O5'" . U   D  2 8   ? 18.308  53.492 -0.533  1.00 40.89  ? 24  U   F "O5'" 1 
ATOM   956  C  "C5'" . U   D  2 8   ? 19.523  54.174 -0.248  1.00 38.35  ? 24  U   F "C5'" 1 
ATOM   957  C  "C4'" . U   D  2 8   ? 20.629  53.185 0.029   1.00 39.26  ? 24  U   F "C4'" 1 
ATOM   958  O  "O4'" . U   D  2 8   ? 20.291  52.395 1.202   1.00 37.66  ? 24  U   F "O4'" 1 
ATOM   959  C  "C3'" . U   D  2 8   ? 20.870  52.130 -1.036  1.00 38.24  ? 24  U   F "C3'" 1 
ATOM   960  O  "O3'" . U   D  2 8   ? 21.647  52.639 -2.112  1.00 40.76  ? 24  U   F "O3'" 1 
ATOM   961  C  "C2'" . U   D  2 8   ? 21.626  51.070 -0.246  1.00 35.85  ? 24  U   F "C2'" 1 
ATOM   962  O  "O2'" . U   D  2 8   ? 22.973  51.429 -0.019  1.00 36.45  ? 24  U   F "O2'" 1 
ATOM   963  C  "C1'" . U   D  2 8   ? 20.878  51.108 1.087   1.00 35.24  ? 24  U   F "C1'" 1 
ATOM   964  N  N1    . U   D  2 8   ? 19.821  50.091 1.186   1.00 32.83  ? 24  U   F N1    1 
ATOM   965  C  C2    . U   D  2 8   ? 20.216  48.794 1.454   1.00 31.15  ? 24  U   F C2    1 
ATOM   966  O  O2    . U   D  2 8   ? 21.385  48.473 1.583   1.00 34.77  ? 24  U   F O2    1 
ATOM   967  N  N3    . U   D  2 8   ? 19.196  47.884 1.561   1.00 30.02  ? 24  U   F N3    1 
ATOM   968  C  C4    . U   D  2 8   ? 17.849  48.128 1.420   1.00 30.40  ? 24  U   F C4    1 
ATOM   969  O  O4    . U   D  2 8   ? 17.053  47.200 1.560   1.00 33.40  ? 24  U   F O4    1 
ATOM   970  C  C5    . U   D  2 8   ? 17.516  49.493 1.128   1.00 32.86  ? 24  U   F C5    1 
ATOM   971  C  C6    . U   D  2 8   ? 18.493  50.407 1.025   1.00 33.89  ? 24  U   F C6    1 
ATOM   972  P  P     . U   D  2 9   ? 21.416  52.067 -3.597  1.00 43.07  ? 25  U   F P     1 
ATOM   973  O  OP1   . U   D  2 9   ? 22.170  52.949 -4.524  1.00 47.27  ? 25  U   F OP1   1 
ATOM   974  O  OP2   . U   D  2 9   ? 19.961  51.852 -3.800  1.00 37.61  ? 25  U   F OP2   1 
ATOM   975  O  "O5'" . U   D  2 9   ? 22.126  50.644 -3.581  1.00 42.64  ? 25  U   F "O5'" 1 
ATOM   976  C  "C5'" . U   D  2 9   ? 23.526  50.536 -3.365  1.00 44.40  ? 25  U   F "C5'" 1 
ATOM   977  C  "C4'" . U   D  2 9   ? 23.894  49.117 -3.006  1.00 43.82  ? 25  U   F "C4'" 1 
ATOM   978  O  "O4'" . U   D  2 9   ? 23.183  48.727 -1.801  1.00 42.43  ? 25  U   F "O4'" 1 
ATOM   979  C  "C3'" . U   D  2 9   ? 23.498  48.044 -4.007  1.00 39.99  ? 25  U   F "C3'" 1 
ATOM   980  O  "O3'" . U   D  2 9   ? 24.441  47.948 -5.066  1.00 47.21  ? 25  U   F "O3'" 1 
ATOM   981  C  "C2'" . U   D  2 9   ? 23.516  46.796 -3.137  1.00 43.28  ? 25  U   F "C2'" 1 
ATOM   982  O  "O2'" . U   D  2 9   ? 24.825  46.321 -2.890  1.00 45.84  ? 25  U   F "O2'" 1 
ATOM   983  C  "C1'" . U   D  2 9   ? 22.920  47.334 -1.837  1.00 38.60  ? 25  U   F "C1'" 1 
ATOM   984  N  N1    . U   D  2 9   ? 21.468  47.121 -1.759  1.00 35.41  ? 25  U   F N1    1 
ATOM   985  C  C2    . U   D  2 9   ? 21.039  45.860 -1.404  1.00 33.43  ? 25  U   F C2    1 
ATOM   986  O  O2    . U   D  2 9   ? 21.811  44.950 -1.156  1.00 35.39  ? 25  U   F O2    1 
ATOM   987  N  N3    . U   D  2 9   ? 19.677  45.702 -1.349  1.00 32.05  ? 25  U   F N3    1 
ATOM   988  C  C4    . U   D  2 9   ? 18.721  46.660 -1.606  1.00 32.35  ? 25  U   F C4    1 
ATOM   989  O  O4    . U   D  2 9   ? 17.528  46.368 -1.490  1.00 32.58  ? 25  U   F O4    1 
ATOM   990  C  C5    . U   D  2 9   ? 19.244  47.943 -1.967  1.00 32.57  ? 25  U   F C5    1 
ATOM   991  C  C6    . U   D  2 9   ? 20.569  48.125 -2.030  1.00 33.09  ? 25  U   F C6    1 
ATOM   992  P  P     . G   D  2 10  ? 24.004  47.278 -6.459  1.00 47.54  ? 26  G   F P     1 
ATOM   993  O  OP1   . G   D  2 10  ? 25.150  47.423 -7.392  1.00 52.77  ? 26  G   F OP1   1 
ATOM   994  O  OP2   . G   D  2 10  ? 22.671  47.809 -6.842  1.00 47.27  ? 26  G   F OP2   1 
ATOM   995  O  "O5'" . G   D  2 10  ? 23.839  45.733 -6.111  1.00 45.49  ? 26  G   F "O5'" 1 
ATOM   996  C  "C5'" . G   D  2 10  ? 24.962  44.949 -5.715  1.00 49.82  ? 26  G   F "C5'" 1 
ATOM   997  C  "C4'" . G   D  2 10  ? 24.540  43.520 -5.464  1.00 51.58  ? 26  G   F "C4'" 1 
ATOM   998  O  "O4'" . G   D  2 10  ? 23.635  43.474 -4.331  1.00 47.77  ? 26  G   F "O4'" 1 
ATOM   999  C  "C3'" . G   D  2 10  ? 23.760  42.864 -6.592  1.00 52.64  ? 26  G   F "C3'" 1 
ATOM   1000 O  "O3'" . G   D  2 10  ? 24.651  42.321 -7.559  1.00 60.08  ? 26  G   F "O3'" 1 
ATOM   1001 C  "C2'" . G   D  2 10  ? 22.995  41.768 -5.861  1.00 50.22  ? 26  G   F "C2'" 1 
ATOM   1002 O  "O2'" . G   D  2 10  ? 23.784  40.624 -5.613  1.00 46.52  ? 26  G   F "O2'" 1 
ATOM   1003 C  "C1'" . G   D  2 10  ? 22.673  42.454 -4.532  1.00 43.51  ? 26  G   F "C1'" 1 
ATOM   1004 N  N9    . G   D  2 10  ? 21.350  43.064 -4.487  1.00 39.63  ? 26  G   F N9    1 
ATOM   1005 C  C8    . G   D  2 10  ? 21.039  44.387 -4.686  1.00 36.75  ? 26  G   F C8    1 
ATOM   1006 N  N7    . G   D  2 10  ? 19.769  44.642 -4.534  1.00 37.79  ? 26  G   F N7    1 
ATOM   1007 C  C5    . G   D  2 10  ? 19.207  43.411 -4.224  1.00 34.52  ? 26  G   F C5    1 
ATOM   1008 C  C6    . G   D  2 10  ? 17.866  43.064 -3.936  1.00 33.02  ? 26  G   F C6    1 
ATOM   1009 O  O6    . G   D  2 10  ? 16.877  43.801 -3.881  1.00 32.96  ? 26  G   F O6    1 
ATOM   1010 N  N1    . G   D  2 10  ? 17.732  41.700 -3.687  1.00 35.15  ? 26  G   F N1    1 
ATOM   1011 C  C2    . G   D  2 10  ? 18.759  40.790 -3.704  1.00 38.27  ? 26  G   F C2    1 
ATOM   1012 N  N2    . G   D  2 10  ? 18.429  39.516 -3.438  1.00 38.35  ? 26  G   F N2    1 
ATOM   1013 N  N3    . G   D  2 10  ? 20.019  41.105 -3.962  1.00 39.40  ? 26  G   F N3    1 
ATOM   1014 C  C4    . G   D  2 10  ? 20.167  42.424 -4.210  1.00 35.49  ? 26  G   F C4    1 
ATOM   1015 P  P     . C   D  2 11  ? 24.223  42.292 -9.107  1.00 64.41  ? 27  C   F P     1 
ATOM   1016 O  OP1   . C   D  2 11  ? 25.432  41.900 -9.877  1.00 64.47  ? 27  C   F OP1   1 
ATOM   1017 O  OP2   . C   D  2 11  ? 23.526  43.565 -9.430  1.00 62.76  ? 27  C   F OP2   1 
ATOM   1018 O  "O5'" . C   D  2 11  ? 23.168  41.102 -9.192  1.00 60.42  ? 27  C   F "O5'" 1 
ATOM   1019 C  "C5'" . C   D  2 11  ? 23.589  39.750 -9.053  1.00 64.24  ? 27  C   F "C5'" 1 
ATOM   1020 C  "C4'" . C   D  2 11  ? 22.394  38.832 -8.978  1.00 66.17  ? 27  C   F "C4'" 1 
ATOM   1021 O  "O4'" . C   D  2 11  ? 21.618  39.144 -7.793  1.00 61.79  ? 27  C   F "O4'" 1 
ATOM   1022 C  "C3'" . C   D  2 11  ? 21.387  38.954 -10.109 1.00 69.51  ? 27  C   F "C3'" 1 
ATOM   1023 O  "O3'" . C   D  2 11  ? 21.804  38.202 -11.244 1.00 75.44  ? 27  C   F "O3'" 1 
ATOM   1024 C  "C2'" . C   D  2 11  ? 20.135  38.357 -9.479  1.00 66.26  ? 27  C   F "C2'" 1 
ATOM   1025 O  "O2'" . C   D  2 11  ? 20.140  36.944 -9.502  1.00 68.94  ? 27  C   F "O2'" 1 
ATOM   1026 C  "C1'" . C   D  2 11  ? 20.252  38.850 -8.033  1.00 60.24  ? 27  C   F "C1'" 1 
ATOM   1027 N  N1    . C   D  2 11  ? 19.456  40.058 -7.759  1.00 51.17  ? 27  C   F N1    1 
ATOM   1028 C  C2    . C   D  2 11  ? 18.158  39.903 -7.268  1.00 46.54  ? 27  C   F C2    1 
ATOM   1029 O  O2    . C   D  2 11  ? 17.730  38.759 -7.062  1.00 47.31  ? 27  C   F O2    1 
ATOM   1030 N  N3    . C   D  2 11  ? 17.405  41.000 -7.029  1.00 43.07  ? 27  C   F N3    1 
ATOM   1031 C  C4    . C   D  2 11  ? 17.903  42.215 -7.263  1.00 43.32  ? 27  C   F C4    1 
ATOM   1032 N  N4    . C   D  2 11  ? 17.116  43.268 -7.028  1.00 36.82  ? 27  C   F N4    1 
ATOM   1033 C  C5    . C   D  2 11  ? 19.229  42.405 -7.753  1.00 44.36  ? 27  C   F C5    1 
ATOM   1034 C  C6    . C   D  2 11  ? 19.964  41.307 -7.985  1.00 49.29  ? 27  C   F C6    1 
ATOM   1035 N  N     . MET E  3 3   ? 5.689   13.763 49.569  1.00 53.23  ? 3   MET A N     1 
ATOM   1036 C  CA    . MET E  3 3   ? 6.816   12.785 49.534  1.00 53.26  ? 3   MET A CA    1 
ATOM   1037 C  C     . MET E  3 3   ? 7.337   12.612 48.110  1.00 49.11  ? 3   MET A C     1 
ATOM   1038 O  O     . MET E  3 3   ? 6.561   12.568 47.156  1.00 48.92  ? 3   MET A O     1 
ATOM   1039 C  CB    . MET E  3 3   ? 6.359   11.433 50.086  1.00 57.23  ? 3   MET A CB    1 
ATOM   1040 C  CG    . MET E  3 3   ? 7.475   10.409 50.230  1.00 68.75  ? 3   MET A CG    1 
ATOM   1041 S  SD    . MET E  3 3   ? 6.898   8.832  50.892  1.00 78.09  ? 3   MET A SD    1 
ATOM   1042 C  CE    . MET E  3 3   ? 7.022   9.135  52.654  1.00 78.96  ? 3   MET A CE    1 
ATOM   1043 N  N     . LEU E  3 4   ? 8.656   12.504 47.984  1.00 45.24  ? 4   LEU A N     1 
ATOM   1044 C  CA    . LEU E  3 4   ? 9.322   12.352 46.695  1.00 42.43  ? 4   LEU A CA    1 
ATOM   1045 C  C     . LEU E  3 4   ? 8.844   11.178 45.843  1.00 39.81  ? 4   LEU A C     1 
ATOM   1046 O  O     . LEU E  3 4   ? 8.816   11.272 44.617  1.00 37.59  ? 4   LEU A O     1 
ATOM   1047 C  CB    . LEU E  3 4   ? 10.834  12.227 46.905  1.00 44.13  ? 4   LEU A CB    1 
ATOM   1048 C  CG    . LEU E  3 4   ? 11.564  13.391 47.580  1.00 45.91  ? 4   LEU A CG    1 
ATOM   1049 C  CD1   . LEU E  3 4   ? 13.034  13.037 47.749  1.00 47.64  ? 4   LEU A CD1   1 
ATOM   1050 C  CD2   . LEU E  3 4   ? 11.413  14.654 46.747  1.00 49.27  ? 4   LEU A CD2   1 
ATOM   1051 N  N     . GLU E  3 5   ? 8.481   10.070 46.482  1.00 35.29  ? 5   GLU A N     1 
ATOM   1052 C  CA    . GLU E  3 5   ? 8.031   8.891  45.748  1.00 36.26  ? 5   GLU A CA    1 
ATOM   1053 C  C     . GLU E  3 5   ? 6.803   9.177  44.894  1.00 33.13  ? 5   GLU A C     1 
ATOM   1054 O  O     . GLU E  3 5   ? 6.661   8.640  43.794  1.00 29.80  ? 5   GLU A O     1 
ATOM   1055 C  CB    . GLU E  3 5   ? 7.706   7.750  46.718  1.00 45.27  ? 5   GLU A CB    1 
ATOM   1056 C  CG    . GLU E  3 5   ? 8.902   7.158  47.433  1.00 57.78  ? 5   GLU A CG    1 
ATOM   1057 C  CD    . GLU E  3 5   ? 8.500   6.061  48.403  1.00 67.04  ? 5   GLU A CD    1 
ATOM   1058 O  OE1   . GLU E  3 5   ? 7.797   5.120  47.977  1.00 67.49  ? 5   GLU A OE1   1 
ATOM   1059 O  OE2   . GLU E  3 5   ? 8.886   6.139  49.590  1.00 69.95  ? 5   GLU A OE2   1 
ATOM   1060 N  N     . GLN E  3 6   ? 5.911   10.014 45.410  1.00 32.10  ? 6   GLN A N     1 
ATOM   1061 C  CA    . GLN E  3 6   ? 4.699   10.358 44.682  1.00 32.77  ? 6   GLN A CA    1 
ATOM   1062 C  C     . GLN E  3 6   ? 5.031   11.131 43.409  1.00 31.47  ? 6   GLN A C     1 
ATOM   1063 O  O     . GLN E  3 6   ? 4.391   10.946 42.373  1.00 29.36  ? 6   GLN A O     1 
ATOM   1064 C  CB    . GLN E  3 6   ? 3.763   11.179 45.568  1.00 38.13  ? 6   GLN A CB    1 
ATOM   1065 C  CG    . GLN E  3 6   ? 3.186   10.385 46.730  1.00 54.43  ? 6   GLN A CG    1 
ATOM   1066 C  CD    . GLN E  3 6   ? 2.501   9.109  46.269  1.00 62.65  ? 6   GLN A CD    1 
ATOM   1067 O  OE1   . GLN E  3 6   ? 1.529   9.150  45.513  1.00 65.90  ? 6   GLN A OE1   1 
ATOM   1068 N  NE2   . GLN E  3 6   ? 3.010   7.968  46.721  1.00 66.97  ? 6   GLN A NE2   1 
ATOM   1069 N  N     . LEU E  3 7   ? 6.031   12.002 43.486  1.00 27.48  ? 7   LEU A N     1 
ATOM   1070 C  CA    . LEU E  3 7   ? 6.428   12.768 42.308  1.00 26.82  ? 7   LEU A CA    1 
ATOM   1071 C  C     . LEU E  3 7   ? 7.104   11.846 41.292  1.00 25.56  ? 7   LEU A C     1 
ATOM   1072 O  O     . LEU E  3 7   ? 6.882   11.958 40.086  1.00 25.42  ? 7   LEU A O     1 
ATOM   1073 C  CB    . LEU E  3 7   ? 7.381   13.900 42.698  1.00 24.94  ? 7   LEU A CB    1 
ATOM   1074 C  CG    . LEU E  3 7   ? 7.963   14.699 41.526  1.00 24.63  ? 7   LEU A CG    1 
ATOM   1075 C  CD1   . LEU E  3 7   ? 6.837   15.218 40.643  1.00 28.23  ? 7   LEU A CD1   1 
ATOM   1076 C  CD2   . LEU E  3 7   ? 8.802   15.849 42.068  1.00 26.18  ? 7   LEU A CD2   1 
ATOM   1077 N  N     . GLU E  3 8   ? 7.934   10.930 41.780  1.00 26.62  ? 8   GLU A N     1 
ATOM   1078 C  CA    . GLU E  3 8   ? 8.614   10.000 40.886  1.00 25.79  ? 8   GLU A CA    1 
ATOM   1079 C  C     . GLU E  3 8   ? 7.575   9.169  40.141  1.00 25.47  ? 8   GLU A C     1 
ATOM   1080 O  O     . GLU E  3 8   ? 7.755   8.837  38.970  1.00 25.13  ? 8   GLU A O     1 
ATOM   1081 C  CB    . GLU E  3 8   ? 9.546   9.069  41.670  1.00 28.21  ? 8   GLU A CB    1 
ATOM   1082 C  CG    . GLU E  3 8   ? 10.706  9.766  42.361  1.00 25.62  ? 8   GLU A CG    1 
ATOM   1083 C  CD    . GLU E  3 8   ? 11.583  8.795  43.127  1.00 32.93  ? 8   GLU A CD    1 
ATOM   1084 O  OE1   . GLU E  3 8   ? 11.024  7.943  43.850  1.00 35.55  ? 8   GLU A OE1   1 
ATOM   1085 O  OE2   . GLU E  3 8   ? 12.824  8.885  43.018  1.00 27.29  ? 8   GLU A OE2   1 
ATOM   1086 N  N     . LYS E  3 9   ? 6.485   8.836  40.823  1.00 28.61  ? 9   LYS A N     1 
ATOM   1087 C  CA    . LYS E  3 9   ? 5.424   8.051  40.202  1.00 28.68  ? 9   LYS A CA    1 
ATOM   1088 C  C     . LYS E  3 9   ? 4.752   8.850  39.084  1.00 25.58  ? 9   LYS A C     1 
ATOM   1089 O  O     . LYS E  3 9   ? 4.434   8.303  38.028  1.00 28.73  ? 9   LYS A O     1 
ATOM   1090 C  CB    . LYS E  3 9   ? 4.387   7.635  41.250  1.00 28.89  ? 9   LYS A CB    1 
ATOM   1091 C  CG    . LYS E  3 9   ? 3.313   6.705  40.699  1.00 38.74  ? 9   LYS A CG    1 
ATOM   1092 C  CD    . LYS E  3 9   ? 2.376   6.216  41.791  1.00 48.81  ? 9   LYS A CD    1 
ATOM   1093 C  CE    . LYS E  3 9   ? 1.341   5.248  41.231  1.00 53.24  ? 9   LYS A CE    1 
ATOM   1094 N  NZ    . LYS E  3 9   ? 0.451   4.709  42.298  1.00 57.82  ? 9   LYS A NZ    1 
ATOM   1095 N  N     . LYS E  3 10  ? 4.535   10.142 39.319  1.00 25.28  ? 10  LYS A N     1 
ATOM   1096 C  CA    . LYS E  3 10  ? 3.912   11.002 38.313  1.00 25.33  ? 10  LYS A CA    1 
ATOM   1097 C  C     . LYS E  3 10  ? 4.845   11.185 37.121  1.00 27.17  ? 10  LYS A C     1 
ATOM   1098 O  O     . LYS E  3 10  ? 4.401   11.242 35.975  1.00 26.74  ? 10  LYS A O     1 
ATOM   1099 C  CB    . LYS E  3 10  ? 3.588   12.375 38.903  1.00 26.22  ? 10  LYS A CB    1 
ATOM   1100 C  CG    . LYS E  3 10  ? 2.457   12.393 39.921  1.00 31.95  ? 10  LYS A CG    1 
ATOM   1101 C  CD    . LYS E  3 10  ? 2.262   13.800 40.470  1.00 29.45  ? 10  LYS A CD    1 
ATOM   1102 C  CE    . LYS E  3 10  ? 1.174   13.854 41.531  1.00 35.92  ? 10  LYS A CE    1 
ATOM   1103 N  NZ    . LYS E  3 10  ? -0.159  13.522 40.963  1.00 40.78  ? 10  LYS A NZ    1 
ATOM   1104 N  N     . LEU E  3 11  ? 6.140   11.288 37.404  1.00 24.63  ? 11  LEU A N     1 
ATOM   1105 C  CA    . LEU E  3 11  ? 7.152   11.469 36.363  1.00 27.10  ? 11  LEU A CA    1 
ATOM   1106 C  C     . LEU E  3 11  ? 7.406   10.194 35.576  1.00 28.20  ? 11  LEU A C     1 
ATOM   1107 O  O     . LEU E  3 11  ? 7.728   10.239 34.390  1.00 30.78  ? 11  LEU A O     1 
ATOM   1108 C  CB    . LEU E  3 11  ? 8.476   11.922 36.988  1.00 28.30  ? 11  LEU A CB    1 
ATOM   1109 C  CG    . LEU E  3 11  ? 8.604   13.371 37.448  1.00 35.19  ? 11  LEU A CG    1 
ATOM   1110 C  CD1   . LEU E  3 11  ? 9.910   13.550 38.209  1.00 36.89  ? 11  LEU A CD1   1 
ATOM   1111 C  CD2   . LEU E  3 11  ? 8.557   14.292 36.237  1.00 37.75  ? 11  LEU A CD2   1 
ATOM   1112 N  N     . GLY E  3 12  ? 7.267   9.058  36.247  1.00 26.07  ? 12  GLY A N     1 
ATOM   1113 C  CA    . GLY E  3 12  ? 7.525   7.787  35.599  1.00 27.48  ? 12  GLY A CA    1 
ATOM   1114 C  C     . GLY E  3 12  ? 9.022   7.521  35.632  1.00 28.11  ? 12  GLY A C     1 
ATOM   1115 O  O     . GLY E  3 12  ? 9.558   6.806  34.785  1.00 24.54  ? 12  GLY A O     1 
ATOM   1116 N  N     . TYR E  3 13  ? 9.701   8.107  36.615  1.00 23.00  ? 13  TYR A N     1 
ATOM   1117 C  CA    . TYR E  3 13  ? 11.143  7.924  36.763  1.00 22.41  ? 13  TYR A CA    1 
ATOM   1118 C  C     . TYR E  3 13  ? 11.551  7.904  38.225  1.00 23.81  ? 13  TYR A C     1 
ATOM   1119 O  O     . TYR E  3 13  ? 11.133  8.754  39.009  1.00 26.00  ? 13  TYR A O     1 
ATOM   1120 C  CB    . TYR E  3 13  ? 11.919  9.041  36.050  1.00 21.04  ? 13  TYR A CB    1 
ATOM   1121 C  CG    . TYR E  3 13  ? 13.434  8.935  36.196  1.00 20.39  ? 13  TYR A CG    1 
ATOM   1122 C  CD1   . TYR E  3 13  ? 14.164  7.966  35.495  1.00 17.58  ? 13  TYR A CD1   1 
ATOM   1123 C  CD2   . TYR E  3 13  ? 14.132  9.795  37.045  1.00 21.70  ? 13  TYR A CD2   1 
ATOM   1124 C  CE1   . TYR E  3 13  ? 15.560  7.862  35.642  1.00 21.95  ? 13  TYR A CE1   1 
ATOM   1125 C  CE2   . TYR E  3 13  ? 15.517  9.698  37.200  1.00 22.98  ? 13  TYR A CE2   1 
ATOM   1126 C  CZ    . TYR E  3 13  ? 16.226  8.730  36.499  1.00 24.77  ? 13  TYR A CZ    1 
ATOM   1127 O  OH    . TYR E  3 13  ? 17.594  8.632  36.675  1.00 21.71  ? 13  TYR A OH    1 
ATOM   1128 N  N     . THR E  3 14  ? 12.380  6.928  38.585  1.00 23.17  ? 14  THR A N     1 
ATOM   1129 C  CA    . THR E  3 14  ? 12.865  6.802  39.952  1.00 22.87  ? 14  THR A CA    1 
ATOM   1130 C  C     . THR E  3 14  ? 14.317  7.257  39.992  1.00 23.64  ? 14  THR A C     1 
ATOM   1131 O  O     . THR E  3 14  ? 15.155  6.746  39.249  1.00 22.38  ? 14  THR A O     1 
ATOM   1132 C  CB    . THR E  3 14  ? 12.775  5.341  40.442  1.00 23.07  ? 14  THR A CB    1 
ATOM   1133 O  OG1   . THR E  3 14  ? 11.401  4.939  40.475  1.00 25.52  ? 14  THR A OG1   1 
ATOM   1134 C  CG2   . THR E  3 14  ? 13.373  5.202  41.836  1.00 20.88  ? 14  THR A CG2   1 
ATOM   1135 N  N     . PHE E  3 15  ? 14.611  8.225  40.853  1.00 23.44  ? 15  PHE A N     1 
ATOM   1136 C  CA    . PHE E  3 15  ? 15.969  8.740  40.966  1.00 24.96  ? 15  PHE A CA    1 
ATOM   1137 C  C     . PHE E  3 15  ? 16.916  7.800  41.693  1.00 24.37  ? 15  PHE A C     1 
ATOM   1138 O  O     . PHE E  3 15  ? 16.516  7.081  42.606  1.00 23.66  ? 15  PHE A O     1 
ATOM   1139 C  CB    . PHE E  3 15  ? 15.983  10.084 41.701  1.00 23.12  ? 15  PHE A CB    1 
ATOM   1140 C  CG    . PHE E  3 15  ? 15.661  11.260 40.827  1.00 17.61  ? 15  PHE A CG    1 
ATOM   1141 C  CD1   . PHE E  3 15  ? 14.376  11.444 40.326  1.00 23.10  ? 15  PHE A CD1   1 
ATOM   1142 C  CD2   . PHE E  3 15  ? 16.652  12.182 40.493  1.00 22.11  ? 15  PHE A CD2   1 
ATOM   1143 C  CE1   . PHE E  3 15  ? 14.080  12.530 39.503  1.00 20.39  ? 15  PHE A CE1   1 
ATOM   1144 C  CE2   . PHE E  3 15  ? 16.373  13.271 39.670  1.00 19.92  ? 15  PHE A CE2   1 
ATOM   1145 C  CZ    . PHE E  3 15  ? 15.079  13.447 39.172  1.00 21.63  ? 15  PHE A CZ    1 
ATOM   1146 N  N     . LYS E  3 16  ? 18.178  7.807  41.273  1.00 20.43  ? 16  LYS A N     1 
ATOM   1147 C  CA    . LYS E  3 16  ? 19.195  7.005  41.935  1.00 21.98  ? 16  LYS A CA    1 
ATOM   1148 C  C     . LYS E  3 16  ? 19.705  7.886  43.074  1.00 27.42  ? 16  LYS A C     1 
ATOM   1149 O  O     . LYS E  3 16  ? 19.890  7.424  44.197  1.00 25.54  ? 16  LYS A O     1 
ATOM   1150 C  CB    . LYS E  3 16  ? 20.341  6.666  40.976  1.00 24.80  ? 16  LYS A CB    1 
ATOM   1151 C  CG    . LYS E  3 16  ? 21.533  5.965  41.642  1.00 30.24  ? 16  LYS A CG    1 
ATOM   1152 C  CD    . LYS E  3 16  ? 22.590  5.591  40.611  1.00 27.43  ? 16  LYS A CD    1 
ATOM   1153 C  CE    . LYS E  3 16  ? 23.895  5.124  41.259  1.00 32.95  ? 16  LYS A CE    1 
ATOM   1154 N  NZ    . LYS E  3 16  ? 23.773  3.839  42.004  1.00 31.33  ? 16  LYS A NZ    1 
ATOM   1155 N  N     . ASP E  3 17  ? 19.926  9.164  42.772  1.00 27.78  ? 17  ASP A N     1 
ATOM   1156 C  CA    . ASP E  3 17  ? 20.400  10.127 43.768  1.00 25.46  ? 17  ASP A CA    1 
ATOM   1157 C  C     . ASP E  3 17  ? 19.226  11.022 44.161  1.00 26.61  ? 17  ASP A C     1 
ATOM   1158 O  O     . ASP E  3 17  ? 18.931  12.009 43.484  1.00 26.52  ? 17  ASP A O     1 
ATOM   1159 C  CB    . ASP E  3 17  ? 21.535  10.983 43.184  1.00 26.48  ? 17  ASP A CB    1 
ATOM   1160 C  CG    . ASP E  3 17  ? 22.084  12.002 44.178  1.00 23.96  ? 17  ASP A CG    1 
ATOM   1161 O  OD1   . ASP E  3 17  ? 21.516  12.138 45.280  1.00 26.69  ? 17  ASP A OD1   1 
ATOM   1162 O  OD2   . ASP E  3 17  ? 23.089  12.672 43.852  1.00 29.33  ? 17  ASP A OD2   1 
ATOM   1163 N  N     . LYS E  3 18  ? 18.561  10.673 45.257  1.00 27.73  ? 18  LYS A N     1 
ATOM   1164 C  CA    . LYS E  3 18  ? 17.409  11.431 45.732  1.00 28.25  ? 18  LYS A CA    1 
ATOM   1165 C  C     . LYS E  3 18  ? 17.736  12.892 46.038  1.00 28.68  ? 18  LYS A C     1 
ATOM   1166 O  O     . LYS E  3 18  ? 16.856  13.748 45.981  1.00 28.13  ? 18  LYS A O     1 
ATOM   1167 C  CB    . LYS E  3 18  ? 16.826  10.773 46.987  1.00 30.00  ? 18  LYS A CB    1 
ATOM   1168 C  CG    . LYS E  3 18  ? 16.519  9.287  46.836  1.00 33.01  ? 18  LYS A CG    1 
ATOM   1169 C  CD    . LYS E  3 18  ? 15.519  9.016  45.718  1.00 31.81  ? 18  LYS A CD    1 
ATOM   1170 C  CE    . LYS E  3 18  ? 15.250  7.518  45.583  1.00 37.03  ? 18  LYS A CE    1 
ATOM   1171 N  NZ    . LYS E  3 18  ? 14.384  7.186  44.413  1.00 31.85  ? 18  LYS A NZ    1 
ATOM   1172 N  N     . SER E  3 19  ? 18.994  13.180 46.355  1.00 30.03  ? 19  SER A N     1 
ATOM   1173 C  CA    . SER E  3 19  ? 19.383  14.550 46.684  1.00 31.54  ? 19  SER A CA    1 
ATOM   1174 C  C     . SER E  3 19  ? 19.292  15.468 45.470  1.00 31.72  ? 19  SER A C     1 
ATOM   1175 O  O     . SER E  3 19  ? 19.125  16.680 45.606  1.00 28.92  ? 19  SER A O     1 
ATOM   1176 C  CB    . SER E  3 19  ? 20.803  14.585 47.261  1.00 33.37  ? 19  SER A CB    1 
ATOM   1177 O  OG    . SER E  3 19  ? 21.778  14.474 46.240  1.00 39.01  ? 19  SER A OG    1 
ATOM   1178 N  N     . LEU E  3 20  ? 19.400  14.880 44.283  1.00 30.19  ? 20  LEU A N     1 
ATOM   1179 C  CA    . LEU E  3 20  ? 19.323  15.630 43.040  1.00 27.75  ? 20  LEU A CA    1 
ATOM   1180 C  C     . LEU E  3 20  ? 17.881  16.103 42.849  1.00 25.12  ? 20  LEU A C     1 
ATOM   1181 O  O     . LEU E  3 20  ? 17.634  17.247 42.470  1.00 24.49  ? 20  LEU A O     1 
ATOM   1182 C  CB    . LEU E  3 20  ? 19.763  14.723 41.893  1.00 31.93  ? 20  LEU A CB    1 
ATOM   1183 C  CG    . LEU E  3 20  ? 20.443  15.304 40.660  1.00 34.91  ? 20  LEU A CG    1 
ATOM   1184 C  CD1   . LEU E  3 20  ? 21.434  16.404 41.047  1.00 30.32  ? 20  LEU A CD1   1 
ATOM   1185 C  CD2   . LEU E  3 20  ? 21.148  14.160 39.935  1.00 28.33  ? 20  LEU A CD2   1 
ATOM   1186 N  N     . LEU E  3 21  ? 16.928  15.217 43.122  1.00 21.88  ? 21  LEU A N     1 
ATOM   1187 C  CA    . LEU E  3 21  ? 15.520  15.562 43.003  1.00 21.83  ? 21  LEU A CA    1 
ATOM   1188 C  C     . LEU E  3 21  ? 15.167  16.608 44.060  1.00 21.57  ? 21  LEU A C     1 
ATOM   1189 O  O     . LEU E  3 21  ? 14.464  17.576 43.776  1.00 23.96  ? 21  LEU A O     1 
ATOM   1190 C  CB    . LEU E  3 21  ? 14.652  14.308 43.179  1.00 24.12  ? 21  LEU A CB    1 
ATOM   1191 C  CG    . LEU E  3 21  ? 13.134  14.511 43.193  1.00 27.68  ? 21  LEU A CG    1 
ATOM   1192 C  CD1   . LEU E  3 21  ? 12.686  15.204 41.914  1.00 23.81  ? 21  LEU A CD1   1 
ATOM   1193 C  CD2   . LEU E  3 21  ? 12.448  13.158 43.340  1.00 27.84  ? 21  LEU A CD2   1 
ATOM   1194 N  N     . GLU E  3 22  ? 15.668  16.415 45.279  1.00 24.89  ? 22  GLU A N     1 
ATOM   1195 C  CA    . GLU E  3 22  ? 15.405  17.355 46.367  1.00 26.31  ? 22  GLU A CA    1 
ATOM   1196 C  C     . GLU E  3 22  ? 15.914  18.749 46.019  1.00 22.64  ? 22  GLU A C     1 
ATOM   1197 O  O     . GLU E  3 22  ? 15.239  19.745 46.273  1.00 25.62  ? 22  GLU A O     1 
ATOM   1198 C  CB    . GLU E  3 22  ? 16.077  16.891 47.665  1.00 32.18  ? 22  GLU A CB    1 
ATOM   1199 C  CG    . GLU E  3 22  ? 15.503  15.614 48.250  1.00 44.29  ? 22  GLU A CG    1 
ATOM   1200 C  CD    . GLU E  3 22  ? 16.059  15.312 49.630  1.00 57.20  ? 22  GLU A CD    1 
ATOM   1201 O  OE1   . GLU E  3 22  ? 17.276  15.048 49.744  1.00 62.18  ? 22  GLU A OE1   1 
ATOM   1202 O  OE2   . GLU E  3 22  ? 15.276  15.345 50.603  1.00 62.09  ? 22  GLU A OE2   1 
ATOM   1203 N  N     . LYS E  3 23  ? 17.104  18.812 45.435  1.00 24.48  ? 23  LYS A N     1 
ATOM   1204 C  CA    . LYS E  3 23  ? 17.703  20.086 45.046  1.00 25.48  ? 23  LYS A CA    1 
ATOM   1205 C  C     . LYS E  3 23  ? 16.812  20.819 44.040  1.00 22.74  ? 23  LYS A C     1 
ATOM   1206 O  O     . LYS E  3 23  ? 16.583  22.022 44.161  1.00 20.38  ? 23  LYS A O     1 
ATOM   1207 C  CB    . LYS E  3 23  ? 19.088  19.835 44.436  1.00 29.64  ? 23  LYS A CB    1 
ATOM   1208 C  CG    . LYS E  3 23  ? 20.013  21.028 44.453  1.00 42.86  ? 23  LYS A CG    1 
ATOM   1209 C  CD    . LYS E  3 23  ? 21.400  20.649 43.952  1.00 49.82  ? 23  LYS A CD    1 
ATOM   1210 C  CE    . LYS E  3 23  ? 22.355  21.828 44.025  1.00 55.71  ? 23  LYS A CE    1 
ATOM   1211 N  NZ    . LYS E  3 23  ? 23.707  21.479 43.506  1.00 59.18  ? 23  LYS A NZ    1 
ATOM   1212 N  N     . ALA E  3 24  ? 16.308  20.085 43.051  1.00 19.89  ? 24  ALA A N     1 
ATOM   1213 C  CA    . ALA E  3 24  ? 15.450  20.666 42.021  1.00 19.46  ? 24  ALA A CA    1 
ATOM   1214 C  C     . ALA E  3 24  ? 14.161  21.263 42.582  1.00 24.01  ? 24  ALA A C     1 
ATOM   1215 O  O     . ALA E  3 24  ? 13.597  22.193 42.005  1.00 20.70  ? 24  ALA A O     1 
ATOM   1216 C  CB    . ALA E  3 24  ? 15.110  19.601 40.970  1.00 22.44  ? 24  ALA A CB    1 
ATOM   1217 N  N     . LEU E  3 25  ? 13.700  20.728 43.708  1.00 19.71  ? 25  LEU A N     1 
ATOM   1218 C  CA    . LEU E  3 25  ? 12.459  21.194 44.329  1.00 22.36  ? 25  LEU A CA    1 
ATOM   1219 C  C     . LEU E  3 25  ? 12.664  22.254 45.414  1.00 23.24  ? 25  LEU A C     1 
ATOM   1220 O  O     . LEU E  3 25  ? 11.698  22.827 45.916  1.00 25.12  ? 25  LEU A O     1 
ATOM   1221 C  CB    . LEU E  3 25  ? 11.723  20.011 44.959  1.00 23.05  ? 25  LEU A CB    1 
ATOM   1222 C  CG    . LEU E  3 25  ? 11.327  18.846 44.050  1.00 24.54  ? 25  LEU A CG    1 
ATOM   1223 C  CD1   . LEU E  3 25  ? 10.834  17.680 44.907  1.00 27.66  ? 25  LEU A CD1   1 
ATOM   1224 C  CD2   . LEU E  3 25  ? 10.256  19.293 43.072  1.00 25.23  ? 25  LEU A CD2   1 
ATOM   1225 N  N     . THR E  3 26  ? 13.917  22.525 45.757  1.00 22.59  ? 26  THR A N     1 
ATOM   1226 C  CA    . THR E  3 26  ? 14.226  23.472 46.830  1.00 24.88  ? 26  THR A CA    1 
ATOM   1227 C  C     . THR E  3 26  ? 14.618  24.893 46.432  1.00 23.08  ? 26  THR A C     1 
ATOM   1228 O  O     . THR E  3 26  ? 15.594  25.101 45.714  1.00 23.16  ? 26  THR A O     1 
ATOM   1229 C  CB    . THR E  3 26  ? 15.347  22.902 47.713  1.00 26.85  ? 26  THR A CB    1 
ATOM   1230 O  OG1   . THR E  3 26  ? 14.996  21.573 48.123  1.00 27.14  ? 26  THR A OG1   1 
ATOM   1231 C  CG2   . THR E  3 26  ? 15.560  23.780 48.943  1.00 26.19  ? 26  THR A CG2   1 
ATOM   1232 N  N     . HIS E  3 27  ? 13.864  25.869 46.933  1.00 23.25  ? 27  HIS A N     1 
ATOM   1233 C  CA    . HIS E  3 27  ? 14.131  27.277 46.654  1.00 24.42  ? 27  HIS A CA    1 
ATOM   1234 C  C     . HIS E  3 27  ? 15.311  27.753 47.513  1.00 28.84  ? 27  HIS A C     1 
ATOM   1235 O  O     . HIS E  3 27  ? 15.477  27.316 48.654  1.00 23.72  ? 27  HIS A O     1 
ATOM   1236 C  CB    . HIS E  3 27  ? 12.872  28.109 46.949  1.00 23.71  ? 27  HIS A CB    1 
ATOM   1237 C  CG    . HIS E  3 27  ? 13.001  29.554 46.579  1.00 29.30  ? 27  HIS A CG    1 
ATOM   1238 N  ND1   . HIS E  3 27  ? 13.327  30.531 47.495  1.00 28.54  ? 27  HIS A ND1   1 
ATOM   1239 C  CD2   . HIS E  3 27  ? 12.883  30.183 45.386  1.00 29.90  ? 27  HIS A CD2   1 
ATOM   1240 C  CE1   . HIS E  3 27  ? 13.407  31.699 46.881  1.00 33.10  ? 27  HIS A CE1   1 
ATOM   1241 N  NE2   . HIS E  3 27  ? 13.144  31.515 45.600  1.00 30.28  ? 27  HIS A NE2   1 
ATOM   1242 N  N     . VAL E  3 28  ? 16.123  28.649 46.957  1.00 26.15  ? 28  VAL A N     1 
ATOM   1243 C  CA    . VAL E  3 28  ? 17.304  29.164 47.644  1.00 31.49  ? 28  VAL A CA    1 
ATOM   1244 C  C     . VAL E  3 28  ? 16.997  29.807 48.997  1.00 37.41  ? 28  VAL A C     1 
ATOM   1245 O  O     . VAL E  3 28  ? 17.844  29.809 49.892  1.00 32.55  ? 28  VAL A O     1 
ATOM   1246 C  CB    . VAL E  3 28  ? 18.073  30.181 46.744  1.00 27.51  ? 28  VAL A CB    1 
ATOM   1247 C  CG1   . VAL E  3 28  ? 17.223  31.419 46.503  1.00 28.36  ? 28  VAL A CG1   1 
ATOM   1248 C  CG2   . VAL E  3 28  ? 19.404  30.554 47.384  1.00 30.54  ? 28  VAL A CG2   1 
ATOM   1249 N  N     . SER E  3 29  ? 15.788  30.338 49.155  1.00 39.39  ? 29  SER A N     1 
ATOM   1250 C  CA    . SER E  3 29  ? 15.405  30.969 50.414  1.00 43.88  ? 29  SER A CA    1 
ATOM   1251 C  C     . SER E  3 29  ? 15.215  29.903 51.484  1.00 44.98  ? 29  SER A C     1 
ATOM   1252 O  O     . SER E  3 29  ? 15.197  30.200 52.679  1.00 51.81  ? 29  SER A O     1 
ATOM   1253 C  CB    . SER E  3 29  ? 14.102  31.754 50.244  1.00 45.01  ? 29  SER A CB    1 
ATOM   1254 O  OG    . SER E  3 29  ? 13.001  30.881 50.059  1.00 44.84  ? 29  SER A OG    1 
ATOM   1255 N  N     . TYR E  3 30  ? 15.083  28.658 51.041  1.00 44.76  ? 30  TYR A N     1 
ATOM   1256 C  CA    . TYR E  3 30  ? 14.876  27.537 51.941  1.00 41.76  ? 30  TYR A CA    1 
ATOM   1257 C  C     . TYR E  3 30  ? 16.200  26.861 52.272  1.00 41.55  ? 30  TYR A C     1 
ATOM   1258 O  O     . TYR E  3 30  ? 16.367  26.292 53.351  1.00 41.85  ? 30  TYR A O     1 
ATOM   1259 C  CB    . TYR E  3 30  ? 13.926  26.536 51.290  1.00 47.02  ? 30  TYR A CB    1 
ATOM   1260 C  CG    . TYR E  3 30  ? 13.073  25.777 52.268  1.00 45.29  ? 30  TYR A CG    1 
ATOM   1261 C  CD1   . TYR E  3 30  ? 12.158  26.441 53.084  1.00 48.86  ? 30  TYR A CD1   1 
ATOM   1262 C  CD2   . TYR E  3 30  ? 13.167  24.392 52.372  1.00 50.92  ? 30  TYR A CD2   1 
ATOM   1263 C  CE1   . TYR E  3 30  ? 11.355  25.742 53.979  1.00 52.78  ? 30  TYR A CE1   1 
ATOM   1264 C  CE2   . TYR E  3 30  ? 12.371  23.685 53.259  1.00 52.76  ? 30  TYR A CE2   1 
ATOM   1265 C  CZ    . TYR E  3 30  ? 11.469  24.363 54.062  1.00 55.14  ? 30  TYR A CZ    1 
ATOM   1266 O  OH    . TYR E  3 30  ? 10.689  23.660 54.952  1.00 61.90  ? 30  TYR A OH    1 
ATOM   1267 N  N     . SER E  3 31  ? 17.141  26.935 51.333  1.00 35.41  ? 31  SER A N     1 
ATOM   1268 C  CA    . SER E  3 31  ? 18.461  26.340 51.505  1.00 31.21  ? 31  SER A CA    1 
ATOM   1269 C  C     . SER E  3 31  ? 19.468  27.019 50.583  1.00 36.70  ? 31  SER A C     1 
ATOM   1270 O  O     . SER E  3 31  ? 19.288  27.041 49.366  1.00 33.38  ? 31  SER A O     1 
ATOM   1271 C  CB    . SER E  3 31  ? 18.413  24.847 51.187  1.00 35.96  ? 31  SER A CB    1 
ATOM   1272 O  OG    . SER E  3 31  ? 19.715  24.291 51.214  1.00 35.01  ? 31  SER A OG    1 
ATOM   1273 N  N     . LYS E  3 32  ? 20.532  27.563 51.163  1.00 33.86  ? 32  LYS A N     1 
ATOM   1274 C  CA    . LYS E  3 32  ? 21.554  28.247 50.383  1.00 40.11  ? 32  LYS A CA    1 
ATOM   1275 C  C     . LYS E  3 32  ? 22.613  27.290 49.859  1.00 42.62  ? 32  LYS A C     1 
ATOM   1276 O  O     . LYS E  3 32  ? 23.445  27.668 49.035  1.00 46.63  ? 32  LYS A O     1 
ATOM   1277 C  CB    . LYS E  3 32  ? 22.231  29.334 51.224  1.00 43.10  ? 32  LYS A CB    1 
ATOM   1278 C  CG    . LYS E  3 32  ? 21.294  30.431 51.705  1.00 50.17  ? 32  LYS A CG    1 
ATOM   1279 C  CD    . LYS E  3 32  ? 20.685  31.195 50.541  1.00 54.84  ? 32  LYS A CD    1 
ATOM   1280 C  CE    . LYS E  3 32  ? 19.717  32.261 51.026  1.00 55.72  ? 32  LYS A CE    1 
ATOM   1281 N  NZ    . LYS E  3 32  ? 19.045  32.958 49.894  1.00 60.17  ? 32  LYS A NZ    1 
ATOM   1282 N  N     . LYS E  3 33  ? 22.587  26.052 50.338  1.00 47.17  ? 33  LYS A N     1 
ATOM   1283 C  CA    . LYS E  3 33  ? 23.561  25.061 49.898  1.00 49.95  ? 33  LYS A CA    1 
ATOM   1284 C  C     . LYS E  3 33  ? 23.027  24.238 48.735  1.00 47.84  ? 33  LYS A C     1 
ATOM   1285 O  O     . LYS E  3 33  ? 23.651  24.165 47.677  1.00 50.19  ? 33  LYS A O     1 
ATOM   1286 C  CB    . LYS E  3 33  ? 23.944  24.124 51.049  1.00 56.21  ? 33  LYS A CB    1 
ATOM   1287 C  CG    . LYS E  3 33  ? 24.877  22.990 50.629  1.00 64.19  ? 33  LYS A CG    1 
ATOM   1288 C  CD    . LYS E  3 33  ? 25.298  22.112 51.801  1.00 68.92  ? 33  LYS A CD    1 
ATOM   1289 C  CE    . LYS E  3 33  ? 26.250  22.840 52.737  1.00 74.51  ? 33  LYS A CE    1 
ATOM   1290 N  NZ    . LYS E  3 33  ? 26.734  21.963 53.840  1.00 75.24  ? 33  LYS A NZ    1 
ATOM   1291 N  N     . GLU E  3 34  ? 21.869  23.622 48.936  1.00 45.56  ? 34  GLU A N     1 
ATOM   1292 C  CA    . GLU E  3 34  ? 21.262  22.794 47.908  1.00 42.74  ? 34  GLU A CA    1 
ATOM   1293 C  C     . GLU E  3 34  ? 19.921  23.332 47.429  1.00 37.85  ? 34  GLU A C     1 
ATOM   1294 O  O     . GLU E  3 34  ? 18.877  23.050 48.013  1.00 34.70  ? 34  GLU A O     1 
ATOM   1295 C  CB    . GLU E  3 34  ? 21.098  21.364 48.423  1.00 52.05  ? 34  GLU A CB    1 
ATOM   1296 C  CG    . GLU E  3 34  ? 22.418  20.696 48.778  1.00 66.31  ? 34  GLU A CG    1 
ATOM   1297 C  CD    . GLU E  3 34  ? 22.251  19.245 49.184  1.00 77.19  ? 34  GLU A CD    1 
ATOM   1298 O  OE1   . GLU E  3 34  ? 21.738  18.453 48.365  1.00 81.76  ? 34  GLU A OE1   1 
ATOM   1299 O  OE2   . GLU E  3 34  ? 22.633  18.898 50.321  1.00 84.53  ? 34  GLU A OE2   1 
ATOM   1300 N  N     . HIS E  3 35  ? 19.963  24.116 46.358  1.00 27.76  ? 35  HIS A N     1 
ATOM   1301 C  CA    . HIS E  3 35  ? 18.755  24.684 45.782  1.00 25.61  ? 35  HIS A CA    1 
ATOM   1302 C  C     . HIS E  3 35  ? 18.768  24.433 44.275  1.00 23.54  ? 35  HIS A C     1 
ATOM   1303 O  O     . HIS E  3 35  ? 19.742  23.906 43.737  1.00 23.13  ? 35  HIS A O     1 
ATOM   1304 C  CB    . HIS E  3 35  ? 18.649  26.179 46.116  1.00 24.54  ? 35  HIS A CB    1 
ATOM   1305 C  CG    . HIS E  3 35  ? 19.857  26.972 45.737  1.00 28.73  ? 35  HIS A CG    1 
ATOM   1306 N  ND1   . HIS E  3 35  ? 20.134  27.330 44.436  1.00 28.20  ? 35  HIS A ND1   1 
ATOM   1307 C  CD2   . HIS E  3 35  ? 20.878  27.453 46.486  1.00 31.06  ? 35  HIS A CD2   1 
ATOM   1308 C  CE1   . HIS E  3 35  ? 21.274  27.998 44.399  1.00 36.72  ? 35  HIS A CE1   1 
ATOM   1309 N  NE2   . HIS E  3 35  ? 21.746  28.085 45.630  1.00 31.34  ? 35  HIS A NE2   1 
ATOM   1310 N  N     . TYR E  3 36  ? 17.696  24.822 43.600  1.00 21.97  ? 36  TYR A N     1 
ATOM   1311 C  CA    . TYR E  3 36  ? 17.546  24.560 42.170  1.00 20.82  ? 36  TYR A CA    1 
ATOM   1312 C  C     . TYR E  3 36  ? 18.130  25.534 41.149  1.00 20.34  ? 36  TYR A C     1 
ATOM   1313 O  O     . TYR E  3 36  ? 18.044  25.268 39.955  1.00 20.68  ? 36  TYR A O     1 
ATOM   1314 C  CB    . TYR E  3 36  ? 16.050  24.394 41.857  1.00 18.76  ? 36  TYR A CB    1 
ATOM   1315 C  CG    . TYR E  3 36  ? 15.227  25.676 41.976  1.00 22.45  ? 36  TYR A CG    1 
ATOM   1316 C  CD1   . TYR E  3 36  ? 15.482  26.775 41.150  1.00 24.21  ? 36  TYR A CD1   1 
ATOM   1317 C  CD2   . TYR E  3 36  ? 14.172  25.773 42.887  1.00 25.90  ? 36  TYR A CD2   1 
ATOM   1318 C  CE1   . TYR E  3 36  ? 14.710  27.938 41.223  1.00 25.26  ? 36  TYR A CE1   1 
ATOM   1319 C  CE2   . TYR E  3 36  ? 13.387  26.937 42.967  1.00 25.55  ? 36  TYR A CE2   1 
ATOM   1320 C  CZ    . TYR E  3 36  ? 13.665  28.011 42.131  1.00 30.39  ? 36  TYR A CZ    1 
ATOM   1321 O  OH    . TYR E  3 36  ? 12.900  29.156 42.195  1.00 35.53  ? 36  TYR A OH    1 
ATOM   1322 N  N     . GLU E  3 37  ? 18.732  26.636 41.588  1.00 19.41  ? 37  GLU A N     1 
ATOM   1323 C  CA    . GLU E  3 37  ? 19.215  27.633 40.627  1.00 20.34  ? 37  GLU A CA    1 
ATOM   1324 C  C     . GLU E  3 37  ? 20.138  27.177 39.497  1.00 21.55  ? 37  GLU A C     1 
ATOM   1325 O  O     . GLU E  3 37  ? 19.968  27.621 38.355  1.00 21.55  ? 37  GLU A O     1 
ATOM   1326 C  CB    . GLU E  3 37  ? 19.848  28.819 41.360  1.00 20.28  ? 37  GLU A CB    1 
ATOM   1327 C  CG    . GLU E  3 37  ? 18.896  29.576 42.308  1.00 25.61  ? 37  GLU A CG    1 
ATOM   1328 C  CD    . GLU E  3 37  ? 17.671  30.178 41.622  1.00 32.52  ? 37  GLU A CD    1 
ATOM   1329 O  OE1   . GLU E  3 37  ? 17.638  30.248 40.374  1.00 32.46  ? 37  GLU A OE1   1 
ATOM   1330 O  OE2   . GLU E  3 37  ? 16.733  30.594 42.341  1.00 32.89  ? 37  GLU A OE2   1 
ATOM   1331 N  N     . THR E  3 38  ? 21.107  26.309 39.785  1.00 17.72  ? 38  THR A N     1 
ATOM   1332 C  CA    . THR E  3 38  ? 22.010  25.852 38.733  1.00 19.01  ? 38  THR A CA    1 
ATOM   1333 C  C     . THR E  3 38  ? 21.322  24.836 37.821  1.00 21.64  ? 38  THR A C     1 
ATOM   1334 O  O     . THR E  3 38  ? 21.534  24.830 36.604  1.00 18.25  ? 38  THR A O     1 
ATOM   1335 C  CB    . THR E  3 38  ? 23.290  25.240 39.327  1.00 24.29  ? 38  THR A CB    1 
ATOM   1336 O  OG1   . THR E  3 38  ? 23.959  26.232 40.118  1.00 25.36  ? 38  THR A OG1   1 
ATOM   1337 C  CG2   . THR E  3 38  ? 24.226  24.780 38.215  1.00 27.82  ? 38  THR A CG2   1 
ATOM   1338 N  N     . LEU E  3 39  ? 20.509  23.970 38.413  1.00 16.38  ? 39  LEU A N     1 
ATOM   1339 C  CA    . LEU E  3 39  ? 19.763  22.986 37.634  1.00 19.49  ? 39  LEU A CA    1 
ATOM   1340 C  C     . LEU E  3 39  ? 18.793  23.725 36.705  1.00 18.10  ? 39  LEU A C     1 
ATOM   1341 O  O     . LEU E  3 39  ? 18.565  23.309 35.569  1.00 17.07  ? 39  LEU A O     1 
ATOM   1342 C  CB    . LEU E  3 39  ? 18.978  22.056 38.565  1.00 17.14  ? 39  LEU A CB    1 
ATOM   1343 C  CG    . LEU E  3 39  ? 19.809  21.044 39.363  1.00 17.93  ? 39  LEU A CG    1 
ATOM   1344 C  CD1   . LEU E  3 39  ? 18.937  20.392 40.439  1.00 15.76  ? 39  LEU A CD1   1 
ATOM   1345 C  CD2   . LEU E  3 39  ? 20.383  19.992 38.414  1.00 21.72  ? 39  LEU A CD2   1 
ATOM   1346 N  N     . GLU E  3 40  ? 18.228  24.828 37.189  1.00 17.94  ? 40  GLU A N     1 
ATOM   1347 C  CA    . GLU E  3 40  ? 17.286  25.607 36.382  1.00 18.28  ? 40  GLU A CA    1 
ATOM   1348 C  C     . GLU E  3 40  ? 17.981  26.171 35.146  1.00 14.86  ? 40  GLU A C     1 
ATOM   1349 O  O     . GLU E  3 40  ? 17.417  26.200 34.047  1.00 16.69  ? 40  GLU A O     1 
ATOM   1350 C  CB    . GLU E  3 40  ? 16.711  26.764 37.197  1.00 17.57  ? 40  GLU A CB    1 
ATOM   1351 C  CG    . GLU E  3 40  ? 15.637  27.538 36.456  1.00 18.30  ? 40  GLU A CG    1 
ATOM   1352 C  CD    . GLU E  3 40  ? 15.691  29.022 36.760  1.00 18.04  ? 40  GLU A CD    1 
ATOM   1353 O  OE1   . GLU E  3 40  ? 15.893  29.378 37.933  1.00 20.02  ? 40  GLU A OE1   1 
ATOM   1354 O  OE2   . GLU E  3 40  ? 15.528  29.829 35.827  1.00 21.25  ? 40  GLU A OE2   1 
ATOM   1355 N  N     . PHE E  3 41  ? 19.209  26.634 35.338  1.00 16.38  ? 41  PHE A N     1 
ATOM   1356 C  CA    . PHE E  3 41  ? 20.004  27.184 34.247  1.00 18.80  ? 41  PHE A CA    1 
ATOM   1357 C  C     . PHE E  3 41  ? 20.170  26.118 33.160  1.00 16.97  ? 41  PHE A C     1 
ATOM   1358 O  O     . PHE E  3 41  ? 19.972  26.380 31.969  1.00 17.03  ? 41  PHE A O     1 
ATOM   1359 C  CB    . PHE E  3 41  ? 21.357  27.621 34.810  1.00 18.43  ? 41  PHE A CB    1 
ATOM   1360 C  CG    . PHE E  3 41  ? 22.303  28.165 33.786  1.00 20.24  ? 41  PHE A CG    1 
ATOM   1361 C  CD1   . PHE E  3 41  ? 22.053  29.382 33.160  1.00 21.40  ? 41  PHE A CD1   1 
ATOM   1362 C  CD2   . PHE E  3 41  ? 23.478  27.480 33.483  1.00 22.10  ? 41  PHE A CD2   1 
ATOM   1363 C  CE1   . PHE E  3 41  ? 22.968  29.911 32.249  1.00 23.38  ? 41  PHE A CE1   1 
ATOM   1364 C  CE2   . PHE E  3 41  ? 24.392  28.000 32.578  1.00 18.44  ? 41  PHE A CE2   1 
ATOM   1365 C  CZ    . PHE E  3 41  ? 24.139  29.216 31.961  1.00 20.25  ? 41  PHE A CZ    1 
ATOM   1366 N  N     . LEU E  3 42  ? 20.528  24.905 33.572  1.00 17.14  ? 42  LEU A N     1 
ATOM   1367 C  CA    . LEU E  3 42  ? 20.697  23.807 32.628  1.00 15.04  ? 42  LEU A CA    1 
ATOM   1368 C  C     . LEU E  3 42  ? 19.350  23.360 32.050  1.00 15.15  ? 42  LEU A C     1 
ATOM   1369 O  O     . LEU E  3 42  ? 19.239  23.080 30.851  1.00 16.45  ? 42  LEU A O     1 
ATOM   1370 C  CB    . LEU E  3 42  ? 21.363  22.617 33.324  1.00 14.60  ? 42  LEU A CB    1 
ATOM   1371 C  CG    . LEU E  3 42  ? 21.424  21.309 32.526  1.00 14.61  ? 42  LEU A CG    1 
ATOM   1372 C  CD1   . LEU E  3 42  ? 22.174  21.530 31.216  1.00 17.54  ? 42  LEU A CD1   1 
ATOM   1373 C  CD2   . LEU E  3 42  ? 22.110  20.237 33.365  1.00 19.93  ? 42  LEU A CD2   1 
ATOM   1374 N  N     . GLY E  3 43  ? 18.338  23.295 32.916  1.00 15.40  ? 43  GLY A N     1 
ATOM   1375 C  CA    . GLY E  3 43  ? 17.010  22.859 32.509  1.00 14.28  ? 43  GLY A CA    1 
ATOM   1376 C  C     . GLY E  3 43  ? 16.384  23.714 31.424  1.00 15.62  ? 43  GLY A C     1 
ATOM   1377 O  O     . GLY E  3 43  ? 15.693  23.207 30.535  1.00 15.55  ? 43  GLY A O     1 
ATOM   1378 N  N     . ASP E  3 44  ? 16.600  25.022 31.511  1.00 14.53  ? 44  ASP A N     1 
ATOM   1379 C  CA    . ASP E  3 44  ? 16.083  25.936 30.505  1.00 13.81  ? 44  ASP A CA    1 
ATOM   1380 C  C     . ASP E  3 44  ? 16.611  25.531 29.123  1.00 16.89  ? 44  ASP A C     1 
ATOM   1381 O  O     . ASP E  3 44  ? 15.846  25.411 28.171  1.00 15.08  ? 44  ASP A O     1 
ATOM   1382 C  CB    . ASP E  3 44  ? 16.517  27.371 30.832  1.00 15.68  ? 44  ASP A CB    1 
ATOM   1383 C  CG    . ASP E  3 44  ? 16.285  28.329 29.682  1.00 20.05  ? 44  ASP A CG    1 
ATOM   1384 O  OD1   . ASP E  3 44  ? 15.134  28.765 29.472  1.00 14.47  ? 44  ASP A OD1   1 
ATOM   1385 O  OD2   . ASP E  3 44  ? 17.264  28.645 28.975  1.00 20.36  ? 44  ASP A OD2   1 
ATOM   1386 N  N     . ALA E  3 45  ? 17.921  25.306 29.014  1.00 15.05  ? 45  ALA A N     1 
ATOM   1387 C  CA    . ALA E  3 45  ? 18.507  24.932 27.729  1.00 15.43  ? 45  ALA A CA    1 
ATOM   1388 C  C     . ALA E  3 45  ? 18.058  23.553 27.263  1.00 14.00  ? 45  ALA A C     1 
ATOM   1389 O  O     . ALA E  3 45  ? 17.840  23.335 26.073  1.00 16.05  ? 45  ALA A O     1 
ATOM   1390 C  CB    . ALA E  3 45  ? 20.043  24.981 27.808  1.00 16.17  ? 45  ALA A CB    1 
ATOM   1391 N  N     . LEU E  3 46  ? 17.930  22.626 28.201  1.00 13.91  ? 46  LEU A N     1 
ATOM   1392 C  CA    . LEU E  3 46  ? 17.508  21.270 27.889  1.00 13.18  ? 46  LEU A CA    1 
ATOM   1393 C  C     . LEU E  3 46  ? 16.062  21.225 27.383  1.00 13.50  ? 46  LEU A C     1 
ATOM   1394 O  O     . LEU E  3 46  ? 15.781  20.685 26.312  1.00 16.34  ? 46  LEU A O     1 
ATOM   1395 C  CB    . LEU E  3 46  ? 17.641  20.404 29.139  1.00 17.47  ? 46  LEU A CB    1 
ATOM   1396 C  CG    . LEU E  3 46  ? 17.284  18.924 29.016  1.00 21.62  ? 46  LEU A CG    1 
ATOM   1397 C  CD1   . LEU E  3 46  ? 18.406  18.175 28.282  1.00 23.31  ? 46  LEU A CD1   1 
ATOM   1398 C  CD2   . LEU E  3 46  ? 17.101  18.341 30.417  1.00 25.68  ? 46  LEU A CD2   1 
ATOM   1399 N  N     . VAL E  3 47  ? 15.144  21.797 28.155  1.00 14.20  ? 47  VAL A N     1 
ATOM   1400 C  CA    . VAL E  3 47  ? 13.741  21.789 27.755  1.00 15.12  ? 47  VAL A CA    1 
ATOM   1401 C  C     . VAL E  3 47  ? 13.518  22.616 26.487  1.00 16.53  ? 47  VAL A C     1 
ATOM   1402 O  O     . VAL E  3 47  ? 12.721  22.231 25.632  1.00 17.30  ? 47  VAL A O     1 
ATOM   1403 C  CB    . VAL E  3 47  ? 12.831  22.289 28.908  1.00 15.62  ? 47  VAL A CB    1 
ATOM   1404 C  CG1   . VAL E  3 47  ? 11.367  22.334 28.450  1.00 20.15  ? 47  VAL A CG1   1 
ATOM   1405 C  CG2   . VAL E  3 47  ? 12.958  21.342 30.111  1.00 18.77  ? 47  VAL A CG2   1 
ATOM   1406 N  N     . ASN E  3 48  ? 14.219  23.744 26.343  1.00 13.52  ? 48  ASN A N     1 
ATOM   1407 C  CA    . ASN E  3 48  ? 14.065  24.538 25.124  1.00 12.59  ? 48  ASN A CA    1 
ATOM   1408 C  C     . ASN E  3 48  ? 14.405  23.655 23.926  1.00 17.10  ? 48  ASN A C     1 
ATOM   1409 O  O     . ASN E  3 48  ? 13.720  23.688 22.909  1.00 16.55  ? 48  ASN A O     1 
ATOM   1410 C  CB    . ASN E  3 48  ? 14.986  25.767 25.133  1.00 14.44  ? 48  ASN A CB    1 
ATOM   1411 C  CG    . ASN E  3 48  ? 14.489  26.855 26.063  1.00 19.81  ? 48  ASN A CG    1 
ATOM   1412 O  OD1   . ASN E  3 48  ? 13.434  26.716 26.689  1.00 17.77  ? 48  ASN A OD1   1 
ATOM   1413 N  ND2   . ASN E  3 48  ? 15.243  27.952 26.154  1.00 19.71  ? 48  ASN A ND2   1 
ATOM   1414 N  N     . PHE E  3 49  ? 15.470  22.868 24.052  1.00 14.79  ? 49  PHE A N     1 
ATOM   1415 C  CA    . PHE E  3 49  ? 15.867  21.949 22.989  1.00 14.40  ? 49  PHE A CA    1 
ATOM   1416 C  C     . PHE E  3 49  ? 14.763  20.904 22.721  1.00 16.06  ? 49  PHE A C     1 
ATOM   1417 O  O     . PHE E  3 49  ? 14.432  20.634 21.560  1.00 17.33  ? 49  PHE A O     1 
ATOM   1418 C  CB    . PHE E  3 49  ? 17.190  21.258 23.370  1.00 16.26  ? 49  PHE A CB    1 
ATOM   1419 C  CG    . PHE E  3 49  ? 17.437  19.963 22.644  1.00 17.53  ? 49  PHE A CG    1 
ATOM   1420 C  CD1   . PHE E  3 49  ? 17.451  19.915 21.254  1.00 21.41  ? 49  PHE A CD1   1 
ATOM   1421 C  CD2   . PHE E  3 49  ? 17.638  18.791 23.358  1.00 24.17  ? 49  PHE A CD2   1 
ATOM   1422 C  CE1   . PHE E  3 49  ? 17.659  18.709 20.584  1.00 23.17  ? 49  PHE A CE1   1 
ATOM   1423 C  CE2   . PHE E  3 49  ? 17.847  17.579 22.698  1.00 21.51  ? 49  PHE A CE2   1 
ATOM   1424 C  CZ    . PHE E  3 49  ? 17.856  17.543 21.309  1.00 23.18  ? 49  PHE A CZ    1 
ATOM   1425 N  N     . PHE E  3 50  ? 14.193  20.325 23.777  1.00 18.06  ? 50  PHE A N     1 
ATOM   1426 C  CA    . PHE E  3 50  ? 13.128  19.325 23.601  1.00 15.84  ? 50  PHE A CA    1 
ATOM   1427 C  C     . PHE E  3 50  ? 11.969  19.904 22.799  1.00 17.67  ? 50  PHE A C     1 
ATOM   1428 O  O     . PHE E  3 50  ? 11.449  19.257 21.890  1.00 17.43  ? 50  PHE A O     1 
ATOM   1429 C  CB    . PHE E  3 50  ? 12.546  18.848 24.937  1.00 17.63  ? 50  PHE A CB    1 
ATOM   1430 C  CG    . PHE E  3 50  ? 13.509  18.088 25.810  1.00 15.79  ? 50  PHE A CG    1 
ATOM   1431 C  CD1   . PHE E  3 50  ? 14.713  17.607 25.312  1.00 19.73  ? 50  PHE A CD1   1 
ATOM   1432 C  CD2   . PHE E  3 50  ? 13.194  17.859 27.148  1.00 14.57  ? 50  PHE A CD2   1 
ATOM   1433 C  CE1   . PHE E  3 50  ? 15.590  16.912 26.134  1.00 14.83  ? 50  PHE A CE1   1 
ATOM   1434 C  CE2   . PHE E  3 50  ? 14.067  17.161 27.983  1.00 17.80  ? 50  PHE A CE2   1 
ATOM   1435 C  CZ    . PHE E  3 50  ? 15.268  16.687 27.471  1.00 15.09  ? 50  PHE A CZ    1 
ATOM   1436 N  N     . ILE E  3 51  ? 11.556  21.119 23.155  1.00 17.88  ? 51  ILE A N     1 
ATOM   1437 C  CA    . ILE E  3 51  ? 10.442  21.785 22.479  1.00 17.55  ? 51  ILE A CA    1 
ATOM   1438 C  C     . ILE E  3 51  ? 10.762  22.127 21.025  1.00 19.03  ? 51  ILE A C     1 
ATOM   1439 O  O     . ILE E  3 51  ? 9.967   21.855 20.122  1.00 19.11  ? 51  ILE A O     1 
ATOM   1440 C  CB    . ILE E  3 51  ? 10.027  23.096 23.219  1.00 19.15  ? 51  ILE A CB    1 
ATOM   1441 C  CG1   . ILE E  3 51  ? 9.507   22.770 24.623  1.00 22.86  ? 51  ILE A CG1   1 
ATOM   1442 C  CG2   . ILE E  3 51  ? 8.954   23.840 22.425  1.00 20.77  ? 51  ILE A CG2   1 
ATOM   1443 C  CD1   . ILE E  3 51  ? 8.375   21.798 24.645  1.00 32.28  ? 51  ILE A CD1   1 
ATOM   1444 N  N     . VAL E  3 52  ? 11.921  22.734 20.793  1.00 14.13  ? 52  VAL A N     1 
ATOM   1445 C  CA    . VAL E  3 52  ? 12.302  23.095 19.438  1.00 16.27  ? 52  VAL A CA    1 
ATOM   1446 C  C     . VAL E  3 52  ? 12.394  21.859 18.545  1.00 18.50  ? 52  VAL A C     1 
ATOM   1447 O  O     . VAL E  3 52  ? 11.962  21.883 17.388  1.00 18.68  ? 52  VAL A O     1 
ATOM   1448 C  CB    . VAL E  3 52  ? 13.654  23.854 19.425  1.00 17.76  ? 52  VAL A CB    1 
ATOM   1449 C  CG1   . VAL E  3 52  ? 14.189  23.956 18.005  1.00 18.39  ? 52  VAL A CG1   1 
ATOM   1450 C  CG2   . VAL E  3 52  ? 13.461  25.256 20.012  1.00 16.80  ? 52  VAL A CG2   1 
ATOM   1451 N  N     . ASP E  3 53  ? 12.944  20.774 19.081  1.00 18.74  ? 53  ASP A N     1 
ATOM   1452 C  CA    . ASP E  3 53  ? 13.084  19.553 18.298  1.00 19.45  ? 53  ASP A CA    1 
ATOM   1453 C  C     . ASP E  3 53  ? 11.710  19.009 17.932  1.00 19.04  ? 53  ASP A C     1 
ATOM   1454 O  O     . ASP E  3 53  ? 11.477  18.584 16.797  1.00 20.35  ? 53  ASP A O     1 
ATOM   1455 C  CB    . ASP E  3 53  ? 13.882  18.504 19.077  1.00 20.14  ? 53  ASP A CB    1 
ATOM   1456 C  CG    . ASP E  3 53  ? 14.314  17.342 18.203  1.00 24.05  ? 53  ASP A CG    1 
ATOM   1457 O  OD1   . ASP E  3 53  ? 14.552  17.562 16.994  1.00 24.95  ? 53  ASP A OD1   1 
ATOM   1458 O  OD2   . ASP E  3 53  ? 14.432  16.218 18.725  1.00 23.87  ? 53  ASP A OD2   1 
ATOM   1459 N  N     . LEU E  3 54  ? 10.788  19.045 18.886  1.00 17.88  ? 54  LEU A N     1 
ATOM   1460 C  CA    . LEU E  3 54  ? 9.440   18.545 18.619  1.00 17.53  ? 54  LEU A CA    1 
ATOM   1461 C  C     . LEU E  3 54  ? 8.768   19.388 17.537  1.00 21.14  ? 54  LEU A C     1 
ATOM   1462 O  O     . LEU E  3 54  ? 8.101   18.855 16.653  1.00 19.89  ? 54  LEU A O     1 
ATOM   1463 C  CB    . LEU E  3 54  ? 8.595   18.558 19.899  1.00 18.21  ? 54  LEU A CB    1 
ATOM   1464 C  CG    . LEU E  3 54  ? 7.181   17.966 19.793  1.00 23.76  ? 54  LEU A CG    1 
ATOM   1465 C  CD1   . LEU E  3 54  ? 7.264   16.498 19.391  1.00 26.50  ? 54  LEU A CD1   1 
ATOM   1466 C  CD2   . LEU E  3 54  ? 6.469   18.099 21.133  1.00 21.39  ? 54  LEU A CD2   1 
ATOM   1467 N  N     . LEU E  3 55  ? 8.951   20.703 17.596  1.00 18.79  ? 55  LEU A N     1 
ATOM   1468 C  CA    . LEU E  3 55  ? 8.346   21.582 16.600  1.00 21.16  ? 55  LEU A CA    1 
ATOM   1469 C  C     . LEU E  3 55  ? 8.874   21.284 15.200  1.00 23.95  ? 55  LEU A C     1 
ATOM   1470 O  O     . LEU E  3 55  ? 8.104   21.164 14.244  1.00 19.37  ? 55  LEU A O     1 
ATOM   1471 C  CB    . LEU E  3 55  ? 8.612   23.050 16.950  1.00 20.89  ? 55  LEU A CB    1 
ATOM   1472 C  CG    . LEU E  3 55  ? 7.919   23.607 18.194  1.00 25.04  ? 55  LEU A CG    1 
ATOM   1473 C  CD1   . LEU E  3 55  ? 8.422   25.026 18.453  1.00 20.35  ? 55  LEU A CD1   1 
ATOM   1474 C  CD2   . LEU E  3 55  ? 6.398   23.594 17.997  1.00 27.76  ? 55  LEU A CD2   1 
ATOM   1475 N  N     . VAL E  3 56  ? 10.189  21.161 15.075  1.00 19.90  ? 56  VAL A N     1 
ATOM   1476 C  CA    . VAL E  3 56  ? 10.786  20.885 13.774  1.00 19.48  ? 56  VAL A CA    1 
ATOM   1477 C  C     . VAL E  3 56  ? 10.426  19.492 13.264  1.00 23.45  ? 56  VAL A C     1 
ATOM   1478 O  O     . VAL E  3 56  ? 10.201  19.303 12.064  1.00 26.08  ? 56  VAL A O     1 
ATOM   1479 C  CB    . VAL E  3 56  ? 12.312  21.028 13.830  1.00 23.65  ? 56  VAL A CB    1 
ATOM   1480 C  CG1   . VAL E  3 56  ? 12.928  20.604 12.500  1.00 22.72  ? 56  VAL A CG1   1 
ATOM   1481 C  CG2   . VAL E  3 56  ? 12.670  22.471 14.159  1.00 20.26  ? 56  VAL A CG2   1 
ATOM   1482 N  N     . GLN E  3 57  ? 10.363  18.523 14.171  1.00 23.09  ? 57  GLN A N     1 
ATOM   1483 C  CA    . GLN E  3 57  ? 10.018  17.155 13.792  1.00 25.89  ? 57  GLN A CA    1 
ATOM   1484 C  C     . GLN E  3 57  ? 8.649   17.071 13.118  1.00 28.67  ? 57  GLN A C     1 
ATOM   1485 O  O     . GLN E  3 57  ? 8.473   16.339 12.146  1.00 29.41  ? 57  GLN A O     1 
ATOM   1486 C  CB    . GLN E  3 57  ? 10.003  16.244 15.014  1.00 26.60  ? 57  GLN A CB    1 
ATOM   1487 C  CG    . GLN E  3 57  ? 11.022  15.128 14.963  1.00 42.53  ? 57  GLN A CG    1 
ATOM   1488 C  CD    . GLN E  3 57  ? 10.642  13.955 15.845  1.00 44.91  ? 57  GLN A CD    1 
ATOM   1489 O  OE1   . GLN E  3 57  ? 10.310  14.123 17.018  1.00 45.73  ? 57  GLN A OE1   1 
ATOM   1490 N  NE2   . GLN E  3 57  ? 10.694  12.754 15.282  1.00 42.26  ? 57  GLN A NE2   1 
ATOM   1491 N  N     . TYR E  3 58  ? 7.678   17.813 13.640  1.00 26.03  ? 58  TYR A N     1 
ATOM   1492 C  CA    . TYR E  3 58  ? 6.329   17.784 13.082  1.00 33.42  ? 58  TYR A CA    1 
ATOM   1493 C  C     . TYR E  3 58  ? 6.020   18.837 12.025  1.00 39.13  ? 58  TYR A C     1 
ATOM   1494 O  O     . TYR E  3 58  ? 4.884   18.938 11.554  1.00 40.53  ? 58  TYR A O     1 
ATOM   1495 C  CB    . TYR E  3 58  ? 5.303   17.851 14.211  1.00 34.08  ? 58  TYR A CB    1 
ATOM   1496 C  CG    . TYR E  3 58  ? 5.204   16.481 14.817  1.00 40.58  ? 58  TYR A CG    1 
ATOM   1497 C  CD1   . TYR E  3 58  ? 4.268   15.559 14.348  1.00 40.30  ? 58  TYR A CD1   1 
ATOM   1498 C  CD2   . TYR E  3 58  ? 6.048   16.092 15.858  1.00 39.21  ? 58  TYR A CD2   1 
ATOM   1499 C  CE1   . TYR E  3 58  ? 4.180   14.285 14.891  1.00 42.94  ? 58  TYR A CE1   1 
ATOM   1500 C  CE2   . TYR E  3 58  ? 5.969   14.818 16.408  1.00 39.69  ? 58  TYR A CE2   1 
ATOM   1501 C  CZ    . TYR E  3 58  ? 5.034   13.919 15.916  1.00 44.31  ? 58  TYR A CZ    1 
ATOM   1502 O  OH    . TYR E  3 58  ? 4.960   12.647 16.432  1.00 45.94  ? 58  TYR A OH    1 
ATOM   1503 N  N     . SER E  3 59  ? 7.036   19.609 11.650  1.00 36.86  ? 59  SER A N     1 
ATOM   1504 C  CA    . SER E  3 59  ? 6.909   20.643 10.625  1.00 37.40  ? 59  SER A CA    1 
ATOM   1505 C  C     . SER E  3 59  ? 8.300   20.869 10.032  1.00 39.84  ? 59  SER A C     1 
ATOM   1506 O  O     . SER E  3 59  ? 8.815   21.988 10.024  1.00 32.97  ? 59  SER A O     1 
ATOM   1507 C  CB    . SER E  3 59  ? 6.389   21.947 11.234  1.00 38.85  ? 59  SER A CB    1 
ATOM   1508 O  OG    . SER E  3 59  ? 5.087   21.781 11.761  1.00 38.08  ? 59  SER A OG    1 
ATOM   1509 N  N     . PRO E  3 60  ? 8.924   19.796 9.521   1.00 39.81  ? 60  PRO A N     1 
ATOM   1510 C  CA    . PRO E  3 60  ? 10.261  19.832 8.923   1.00 41.63  ? 60  PRO A CA    1 
ATOM   1511 C  C     . PRO E  3 60  ? 10.442  20.852 7.806   1.00 46.05  ? 60  PRO A C     1 
ATOM   1512 O  O     . PRO E  3 60  ? 11.543  21.363 7.596   1.00 46.96  ? 60  PRO A O     1 
ATOM   1513 C  CB    . PRO E  3 60  ? 10.447  18.405 8.407   1.00 43.91  ? 60  PRO A CB    1 
ATOM   1514 C  CG    . PRO E  3 60  ? 9.580   17.594 9.306   1.00 44.42  ? 60  PRO A CG    1 
ATOM   1515 C  CD    . PRO E  3 60  ? 8.349   18.445 9.412   1.00 41.17  ? 60  PRO A CD    1 
ATOM   1516 N  N     . ASN E  3 61  ? 9.363   21.145 7.087   1.00 48.14  ? 61  ASN A N     1 
ATOM   1517 C  CA    . ASN E  3 61  ? 9.438   22.082 5.973   1.00 47.48  ? 61  ASN A CA    1 
ATOM   1518 C  C     . ASN E  3 61  ? 8.917   23.480 6.277   1.00 44.18  ? 61  ASN A C     1 
ATOM   1519 O  O     . ASN E  3 61  ? 8.738   24.287 5.365   1.00 43.32  ? 61  ASN A O     1 
ATOM   1520 C  CB    . ASN E  3 61  ? 8.701   21.505 4.764   1.00 54.50  ? 61  ASN A CB    1 
ATOM   1521 C  CG    . ASN E  3 61  ? 9.245   20.151 4.350   1.00 60.83  ? 61  ASN A CG    1 
ATOM   1522 O  OD1   . ASN E  3 61  ? 10.428  20.014 4.036   1.00 62.32  ? 61  ASN A OD1   1 
ATOM   1523 N  ND2   . ASN E  3 61  ? 8.382   19.140 4.353   1.00 64.62  ? 61  ASN A ND2   1 
ATOM   1524 N  N     . LYS E  3 62  ? 8.676   23.771 7.552   1.00 39.33  ? 62  LYS A N     1 
ATOM   1525 C  CA    . LYS E  3 62  ? 8.194   25.091 7.939   1.00 33.84  ? 62  LYS A CA    1 
ATOM   1526 C  C     . LYS E  3 62  ? 9.369   25.987 8.324   1.00 32.65  ? 62  LYS A C     1 
ATOM   1527 O  O     . LYS E  3 62  ? 10.352  25.526 8.909   1.00 29.74  ? 62  LYS A O     1 
ATOM   1528 C  CB    . LYS E  3 62  ? 7.210   24.986 9.106   1.00 32.54  ? 62  LYS A CB    1 
ATOM   1529 C  CG    . LYS E  3 62  ? 5.918   24.250 8.766   1.00 41.84  ? 62  LYS A CG    1 
ATOM   1530 C  CD    . LYS E  3 62  ? 5.212   24.839 7.544   1.00 45.86  ? 62  LYS A CD    1 
ATOM   1531 C  CE    . LYS E  3 62  ? 4.849   26.310 7.726   1.00 48.20  ? 62  LYS A CE    1 
ATOM   1532 N  NZ    . LYS E  3 62  ? 6.038   27.213 7.698   1.00 47.44  ? 62  LYS A NZ    1 
ATOM   1533 N  N     . ARG E  3 63  ? 9.258   27.269 7.994   1.00 30.79  ? 63  ARG A N     1 
ATOM   1534 C  CA    . ARG E  3 63  ? 10.319  28.225 8.284   1.00 31.36  ? 63  ARG A CA    1 
ATOM   1535 C  C     . ARG E  3 63  ? 10.360  28.683 9.739   1.00 31.19  ? 63  ARG A C     1 
ATOM   1536 O  O     . ARG E  3 63  ? 9.428   28.453 10.514  1.00 26.37  ? 63  ARG A O     1 
ATOM   1537 C  CB    . ARG E  3 63  ? 10.199  29.441 7.359   1.00 35.46  ? 63  ARG A CB    1 
ATOM   1538 C  CG    . ARG E  3 63  ? 10.506  29.146 5.888   1.00 35.44  ? 63  ARG A CG    1 
ATOM   1539 C  CD    . ARG E  3 63  ? 11.954  28.712 5.692   1.00 38.06  ? 63  ARG A CD    1 
ATOM   1540 N  NE    . ARG E  3 63  ? 12.902  29.775 6.022   1.00 35.24  ? 63  ARG A NE    1 
ATOM   1541 C  CZ    . ARG E  3 63  ? 13.104  30.859 5.280   1.00 43.90  ? 63  ARG A CZ    1 
ATOM   1542 N  NH1   . ARG E  3 63  ? 12.428  31.034 4.151   1.00 46.27  ? 63  ARG A NH1   1 
ATOM   1543 N  NH2   . ARG E  3 63  ? 13.980  31.777 5.670   1.00 44.50  ? 63  ARG A NH2   1 
ATOM   1544 N  N     . GLU E  3 64  ? 11.465  29.330 10.095  1.00 26.93  ? 64  GLU A N     1 
ATOM   1545 C  CA    . GLU E  3 64  ? 11.680  29.839 11.441  1.00 27.83  ? 64  GLU A CA    1 
ATOM   1546 C  C     . GLU E  3 64  ? 10.612  30.861 11.831  1.00 25.27  ? 64  GLU A C     1 
ATOM   1547 O  O     . GLU E  3 64  ? 10.269  30.999 13.007  1.00 24.83  ? 64  GLU A O     1 
ATOM   1548 C  CB    . GLU E  3 64  ? 13.073  30.478 11.542  1.00 26.53  ? 64  GLU A CB    1 
ATOM   1549 C  CG    . GLU E  3 64  ? 13.289  31.673 10.602  1.00 31.12  ? 64  GLU A CG    1 
ATOM   1550 C  CD    . GLU E  3 64  ? 13.764  31.273 9.211   1.00 33.33  ? 64  GLU A CD    1 
ATOM   1551 O  OE1   . GLU E  3 64  ? 13.400  30.176 8.737   1.00 30.48  ? 64  GLU A OE1   1 
ATOM   1552 O  OE2   . GLU E  3 64  ? 14.495  32.070 8.582   1.00 32.18  ? 64  GLU A OE2   1 
ATOM   1553 N  N     . GLY E  3 65  ? 10.088  31.574 10.837  1.00 24.23  ? 65  GLY A N     1 
ATOM   1554 C  CA    . GLY E  3 65  ? 9.067   32.577 11.086  1.00 23.49  ? 65  GLY A CA    1 
ATOM   1555 C  C     . GLY E  3 65  ? 7.738   31.980 11.507  1.00 24.12  ? 65  GLY A C     1 
ATOM   1556 O  O     . GLY E  3 65  ? 6.894   32.660 12.085  1.00 26.52  ? 65  GLY A O     1 
ATOM   1557 N  N     . PHE E  3 66  ? 7.544   30.703 11.206  1.00 27.09  ? 66  PHE A N     1 
ATOM   1558 C  CA    . PHE E  3 66  ? 6.317   30.011 11.577  1.00 27.28  ? 66  PHE A CA    1 
ATOM   1559 C  C     . PHE E  3 66  ? 6.516   29.300 12.914  1.00 27.43  ? 66  PHE A C     1 
ATOM   1560 O  O     . PHE E  3 66  ? 5.670   29.368 13.808  1.00 26.65  ? 66  PHE A O     1 
ATOM   1561 C  CB    . PHE E  3 66  ? 5.957   28.980 10.504  1.00 32.32  ? 66  PHE A CB    1 
ATOM   1562 C  CG    . PHE E  3 66  ? 4.851   28.048 10.908  1.00 38.72  ? 66  PHE A CG    1 
ATOM   1563 C  CD1   . PHE E  3 66  ? 3.533   28.487 10.956  1.00 45.99  ? 66  PHE A CD1   1 
ATOM   1564 C  CD2   . PHE E  3 66  ? 5.130   26.732 11.260  1.00 39.51  ? 66  PHE A CD2   1 
ATOM   1565 C  CE1   . PHE E  3 66  ? 2.507   27.628 11.350  1.00 47.58  ? 66  PHE A CE1   1 
ATOM   1566 C  CE2   . PHE E  3 66  ? 4.112   25.865 11.656  1.00 44.57  ? 66  PHE A CE2   1 
ATOM   1567 C  CZ    . PHE E  3 66  ? 2.800   26.314 11.700  1.00 46.91  ? 66  PHE A CZ    1 
ATOM   1568 N  N     . LEU E  3 67  ? 7.657   28.631 13.043  1.00 21.49  ? 67  LEU A N     1 
ATOM   1569 C  CA    . LEU E  3 67  ? 7.985   27.868 14.239  1.00 21.35  ? 67  LEU A CA    1 
ATOM   1570 C  C     . LEU E  3 67  ? 8.406   28.670 15.466  1.00 21.54  ? 67  LEU A C     1 
ATOM   1571 O  O     . LEU E  3 67  ? 8.082   28.292 16.591  1.00 21.83  ? 67  LEU A O     1 
ATOM   1572 C  CB    . LEU E  3 67  ? 9.086   26.854 13.910  1.00 22.87  ? 67  LEU A CB    1 
ATOM   1573 C  CG    . LEU E  3 67  ? 8.748   25.832 12.816  1.00 23.39  ? 67  LEU A CG    1 
ATOM   1574 C  CD1   . LEU E  3 67  ? 9.966   24.981 12.515  1.00 32.00  ? 67  LEU A CD1   1 
ATOM   1575 C  CD2   . LEU E  3 67  ? 7.578   24.964 13.260  1.00 31.88  ? 67  LEU A CD2   1 
ATOM   1576 N  N     . SER E  3 68  ? 9.124   29.770 15.265  1.00 22.20  ? 68  SER A N     1 
ATOM   1577 C  CA    . SER E  3 68  ? 9.592   30.547 16.409  1.00 24.39  ? 68  SER A CA    1 
ATOM   1578 C  C     . SER E  3 68  ? 8.479   31.151 17.260  1.00 23.24  ? 68  SER A C     1 
ATOM   1579 O  O     . SER E  3 68  ? 8.583   31.175 18.483  1.00 22.27  ? 68  SER A O     1 
ATOM   1580 C  CB    . SER E  3 68  ? 10.565  31.634 15.956  1.00 26.56  ? 68  SER A CB    1 
ATOM   1581 O  OG    . SER E  3 68  ? 11.385  32.043 17.040  1.00 32.22  ? 68  SER A OG    1 
ATOM   1582 N  N     . PRO E  3 69  ? 7.403   31.658 16.630  1.00 24.01  ? 69  PRO A N     1 
ATOM   1583 C  CA    . PRO E  3 69  ? 6.314   32.235 17.426  1.00 23.41  ? 69  PRO A CA    1 
ATOM   1584 C  C     . PRO E  3 69  ? 5.701   31.164 18.332  1.00 22.87  ? 69  PRO A C     1 
ATOM   1585 O  O     . PRO E  3 69  ? 5.289   31.447 19.456  1.00 24.38  ? 69  PRO A O     1 
ATOM   1586 C  CB    . PRO E  3 69  ? 5.334   32.724 16.359  1.00 28.86  ? 69  PRO A CB    1 
ATOM   1587 C  CG    . PRO E  3 69  ? 6.260   33.131 15.240  1.00 29.53  ? 69  PRO A CG    1 
ATOM   1588 C  CD    . PRO E  3 69  ? 7.234   31.977 15.200  1.00 25.29  ? 69  PRO A CD    1 
ATOM   1589 N  N     . LEU E  3 70  ? 5.639   29.932 17.829  1.00 21.69  ? 70  LEU A N     1 
ATOM   1590 C  CA    . LEU E  3 70  ? 5.106   28.818 18.604  1.00 19.59  ? 70  LEU A CA    1 
ATOM   1591 C  C     . LEU E  3 70  ? 6.060   28.528 19.764  1.00 18.46  ? 70  LEU A C     1 
ATOM   1592 O  O     . LEU E  3 70  ? 5.646   28.393 20.912  1.00 18.81  ? 70  LEU A O     1 
ATOM   1593 C  CB    . LEU E  3 70  ? 4.973   27.569 17.720  1.00 21.41  ? 70  LEU A CB    1 
ATOM   1594 C  CG    . LEU E  3 70  ? 3.923   27.657 16.610  1.00 25.01  ? 70  LEU A CG    1 
ATOM   1595 C  CD1   . LEU E  3 70  ? 3.924   26.370 15.786  1.00 28.55  ? 70  LEU A CD1   1 
ATOM   1596 C  CD2   . LEU E  3 70  ? 2.558   27.897 17.237  1.00 28.26  ? 70  LEU A CD2   1 
ATOM   1597 N  N     . LYS E  3 71  ? 7.345   28.431 19.443  1.00 20.19  ? 71  LYS A N     1 
ATOM   1598 C  CA    . LYS E  3 71  ? 8.376   28.180 20.441  1.00 16.86  ? 71  LYS A CA    1 
ATOM   1599 C  C     . LYS E  3 71  ? 8.328   29.231 21.547  1.00 17.08  ? 71  LYS A C     1 
ATOM   1600 O  O     . LYS E  3 71  ? 8.403   28.903 22.727  1.00 17.33  ? 71  LYS A O     1 
ATOM   1601 C  CB    . LYS E  3 71  ? 9.767   28.215 19.776  1.00 20.19  ? 71  LYS A CB    1 
ATOM   1602 C  CG    . LYS E  3 71  ? 10.950  28.272 20.753  1.00 21.97  ? 71  LYS A CG    1 
ATOM   1603 C  CD    . LYS E  3 71  ? 12.239  28.655 20.022  1.00 26.05  ? 71  LYS A CD    1 
ATOM   1604 C  CE    . LYS E  3 71  ? 13.425  28.751 20.968  1.00 38.20  ? 71  LYS A CE    1 
ATOM   1605 N  NZ    . LYS E  3 71  ? 14.664  29.204 20.265  1.00 41.27  ? 71  LYS A NZ    1 
ATOM   1606 N  N     . ALA E  3 72  ? 8.202   30.494 21.148  1.00 18.53  ? 72  ALA A N     1 
ATOM   1607 C  CA    . ALA E  3 72  ? 8.185   31.613 22.087  1.00 18.94  ? 72  ALA A CA    1 
ATOM   1608 C  C     . ALA E  3 72  ? 7.167   31.442 23.203  1.00 19.08  ? 72  ALA A C     1 
ATOM   1609 O  O     . ALA E  3 72  ? 7.403   31.865 24.336  1.00 18.75  ? 72  ALA A O     1 
ATOM   1610 C  CB    . ALA E  3 72  ? 7.938   32.928 21.329  1.00 17.93  ? 72  ALA A CB    1 
ATOM   1611 N  N     . TYR E  3 73  ? 6.033   30.825 22.884  1.00 18.69  ? 73  TYR A N     1 
ATOM   1612 C  CA    . TYR E  3 73  ? 5.017   30.595 23.897  1.00 17.63  ? 73  TYR A CA    1 
ATOM   1613 C  C     . TYR E  3 73  ? 5.251   29.271 24.629  1.00 16.77  ? 73  TYR A C     1 
ATOM   1614 O  O     . TYR E  3 73  ? 5.128   29.199 25.851  1.00 20.14  ? 73  TYR A O     1 
ATOM   1615 C  CB    . TYR E  3 73  ? 3.617   30.571 23.271  1.00 18.88  ? 73  TYR A CB    1 
ATOM   1616 C  CG    . TYR E  3 73  ? 2.647   30.227 24.363  1.00 16.07  ? 73  TYR A CG    1 
ATOM   1617 C  CD1   . TYR E  3 73  ? 2.442   31.103 25.428  1.00 20.87  ? 73  TYR A CD1   1 
ATOM   1618 C  CD2   . TYR E  3 73  ? 1.938   29.027 24.346  1.00 22.22  ? 73  TYR A CD2   1 
ATOM   1619 C  CE1   . TYR E  3 73  ? 1.566   30.789 26.460  1.00 24.11  ? 73  TYR A CE1   1 
ATOM   1620 C  CE2   . TYR E  3 73  ? 1.055   28.703 25.375  1.00 23.19  ? 73  TYR A CE2   1 
ATOM   1621 C  CZ    . TYR E  3 73  ? 0.879   29.584 26.428  1.00 26.75  ? 73  TYR A CZ    1 
ATOM   1622 O  OH    . TYR E  3 73  ? 0.043   29.248 27.470  1.00 28.45  ? 73  TYR A OH    1 
ATOM   1623 N  N     . LEU E  3 74  ? 5.606   28.237 23.874  1.00 16.58  ? 74  LEU A N     1 
ATOM   1624 C  CA    . LEU E  3 74  ? 5.814   26.911 24.441  1.00 16.80  ? 74  LEU A CA    1 
ATOM   1625 C  C     . LEU E  3 74  ? 6.996   26.756 25.401  1.00 19.82  ? 74  LEU A C     1 
ATOM   1626 O  O     . LEU E  3 74  ? 7.049   25.785 26.160  1.00 21.18  ? 74  LEU A O     1 
ATOM   1627 C  CB    . LEU E  3 74  ? 5.890   25.885 23.308  1.00 15.92  ? 74  LEU A CB    1 
ATOM   1628 C  CG    . LEU E  3 74  ? 4.592   25.811 22.489  1.00 20.81  ? 74  LEU A CG    1 
ATOM   1629 C  CD1   . LEU E  3 74  ? 4.817   24.997 21.225  1.00 21.22  ? 74  LEU A CD1   1 
ATOM   1630 C  CD2   . LEU E  3 74  ? 3.480   25.201 23.342  1.00 21.06  ? 74  LEU A CD2   1 
ATOM   1631 N  N     . ILE E  3 75  ? 7.938   27.695 25.380  1.00 16.27  ? 75  ILE A N     1 
ATOM   1632 C  CA    . ILE E  3 75  ? 9.064   27.616 26.314  1.00 17.35  ? 75  ILE A CA    1 
ATOM   1633 C  C     . ILE E  3 75  ? 8.899   28.701 27.380  1.00 19.57  ? 75  ILE A C     1 
ATOM   1634 O  O     . ILE E  3 75  ? 9.795   28.932 28.195  1.00 18.56  ? 75  ILE A O     1 
ATOM   1635 C  CB    . ILE E  3 75  ? 10.440  27.815 25.606  1.00 16.70  ? 75  ILE A CB    1 
ATOM   1636 C  CG1   . ILE E  3 75  ? 10.531  29.225 25.022  1.00 19.58  ? 75  ILE A CG1   1 
ATOM   1637 C  CG2   . ILE E  3 75  ? 10.641  26.743 24.528  1.00 14.92  ? 75  ILE A CG2   1 
ATOM   1638 C  CD1   . ILE E  3 75  ? 11.916  29.580 24.491  1.00 26.96  ? 75  ILE A CD1   1 
ATOM   1639 N  N     . SER E  3 76  ? 7.740   29.357 27.378  1.00 17.37  ? 76  SER A N     1 
ATOM   1640 C  CA    . SER E  3 76  ? 7.465   30.427 28.334  1.00 17.32  ? 76  SER A CA    1 
ATOM   1641 C  C     . SER E  3 76  ? 7.110   29.918 29.720  1.00 16.33  ? 76  SER A C     1 
ATOM   1642 O  O     . SER E  3 76  ? 6.635   28.794 29.894  1.00 18.18  ? 76  SER A O     1 
ATOM   1643 C  CB    . SER E  3 76  ? 6.319   31.319 27.829  1.00 19.96  ? 76  SER A CB    1 
ATOM   1644 O  OG    . SER E  3 76  ? 5.064   30.657 27.947  1.00 17.64  ? 76  SER A OG    1 
ATOM   1645 N  N     . GLU E  3 77  ? 7.340   30.768 30.713  1.00 20.01  ? 77  GLU A N     1 
ATOM   1646 C  CA    . GLU E  3 77  ? 7.030   30.441 32.094  1.00 18.03  ? 77  GLU A CA    1 
ATOM   1647 C  C     . GLU E  3 77  ? 5.551   30.069 32.204  1.00 21.38  ? 77  GLU A C     1 
ATOM   1648 O  O     . GLU E  3 77  ? 5.190   29.131 32.915  1.00 22.28  ? 77  GLU A O     1 
ATOM   1649 C  CB    . GLU E  3 77  ? 7.337   31.652 32.979  1.00 21.96  ? 77  GLU A CB    1 
ATOM   1650 C  CG    . GLU E  3 77  ? 6.740   31.592 34.360  1.00 23.08  ? 77  GLU A CG    1 
ATOM   1651 C  CD    . GLU E  3 77  ? 6.976   32.873 35.132  1.00 31.58  ? 77  GLU A CD    1 
ATOM   1652 O  OE1   . GLU E  3 77  ? 8.119   33.099 35.573  1.00 25.99  ? 77  GLU A OE1   1 
ATOM   1653 O  OE2   . GLU E  3 77  ? 6.018   33.657 35.282  1.00 28.85  ? 77  GLU A OE2   1 
ATOM   1654 N  N     . GLU E  3 78  ? 4.698   30.802 31.496  1.00 20.99  ? 78  GLU A N     1 
ATOM   1655 C  CA    . GLU E  3 78  ? 3.269   30.513 31.557  1.00 22.03  ? 78  GLU A CA    1 
ATOM   1656 C  C     . GLU E  3 78  ? 2.954   29.100 31.095  1.00 20.35  ? 78  GLU A C     1 
ATOM   1657 O  O     . GLU E  3 78  ? 2.224   28.374 31.768  1.00 20.00  ? 78  GLU A O     1 
ATOM   1658 C  CB    . GLU E  3 78  ? 2.448   31.486 30.713  1.00 26.10  ? 78  GLU A CB    1 
ATOM   1659 C  CG    . GLU E  3 78  ? 0.961   31.144 30.775  1.00 36.49  ? 78  GLU A CG    1 
ATOM   1660 C  CD    . GLU E  3 78  ? 0.101   32.045 29.921  1.00 39.19  ? 78  GLU A CD    1 
ATOM   1661 O  OE1   . GLU E  3 78  ? 0.063   33.262 30.198  1.00 45.50  ? 78  GLU A OE1   1 
ATOM   1662 O  OE2   . GLU E  3 78  ? -0.536  31.529 28.975  1.00 34.23  ? 78  GLU A OE2   1 
ATOM   1663 N  N     . PHE E  3 79  ? 3.496   28.701 29.948  1.00 18.98  ? 79  PHE A N     1 
ATOM   1664 C  CA    . PHE E  3 79  ? 3.207   27.365 29.465  1.00 18.16  ? 79  PHE A CA    1 
ATOM   1665 C  C     . PHE E  3 79  ? 3.797   26.298 30.386  1.00 20.24  ? 79  PHE A C     1 
ATOM   1666 O  O     . PHE E  3 79  ? 3.184   25.252 30.606  1.00 19.37  ? 79  PHE A O     1 
ATOM   1667 C  CB    . PHE E  3 79  ? 3.712   27.167 28.036  1.00 16.36  ? 79  PHE A CB    1 
ATOM   1668 C  CG    . PHE E  3 79  ? 3.158   25.929 27.388  1.00 18.38  ? 79  PHE A CG    1 
ATOM   1669 C  CD1   . PHE E  3 79  ? 1.788   25.808 27.172  1.00 16.58  ? 79  PHE A CD1   1 
ATOM   1670 C  CD2   . PHE E  3 79  ? 3.981   24.860 27.066  1.00 20.52  ? 79  PHE A CD2   1 
ATOM   1671 C  CE1   . PHE E  3 79  ? 1.248   24.632 26.648  1.00 20.08  ? 79  PHE A CE1   1 
ATOM   1672 C  CE2   . PHE E  3 79  ? 3.450   23.679 26.543  1.00 20.59  ? 79  PHE A CE2   1 
ATOM   1673 C  CZ    . PHE E  3 79  ? 2.079   23.567 26.335  1.00 22.45  ? 79  PHE A CZ    1 
ATOM   1674 N  N     . PHE E  3 80  ? 4.982   26.554 30.937  1.00 19.28  ? 80  PHE A N     1 
ATOM   1675 C  CA    . PHE E  3 80  ? 5.584   25.575 31.839  1.00 19.42  ? 80  PHE A CA    1 
ATOM   1676 C  C     . PHE E  3 80  ? 4.714   25.387 33.080  1.00 20.88  ? 80  PHE A C     1 
ATOM   1677 O  O     . PHE E  3 80  ? 4.663   24.300 33.643  1.00 18.38  ? 80  PHE A O     1 
ATOM   1678 C  CB    . PHE E  3 80  ? 7.005   25.998 32.248  1.00 16.53  ? 80  PHE A CB    1 
ATOM   1679 C  CG    . PHE E  3 80  ? 8.042   25.818 31.160  1.00 19.44  ? 80  PHE A CG    1 
ATOM   1680 C  CD1   . PHE E  3 80  ? 7.723   25.183 29.960  1.00 17.21  ? 80  PHE A CD1   1 
ATOM   1681 C  CD2   . PHE E  3 80  ? 9.351   26.276 31.348  1.00 17.78  ? 80  PHE A CD2   1 
ATOM   1682 C  CE1   . PHE E  3 80  ? 8.693   25.002 28.960  1.00 20.64  ? 80  PHE A CE1   1 
ATOM   1683 C  CE2   . PHE E  3 80  ? 10.321  26.104 30.365  1.00 18.41  ? 80  PHE A CE2   1 
ATOM   1684 C  CZ    . PHE E  3 80  ? 9.995   25.465 29.164  1.00 17.90  ? 80  PHE A CZ    1 
ATOM   1685 N  N     . ASN E  3 81  ? 4.034   26.445 33.514  1.00 18.08  ? 81  ASN A N     1 
ATOM   1686 C  CA    . ASN E  3 81  ? 3.157   26.323 34.674  1.00 21.66  ? 81  ASN A CA    1 
ATOM   1687 C  C     . ASN E  3 81  ? 1.992   25.398 34.327  1.00 21.21  ? 81  ASN A C     1 
ATOM   1688 O  O     . ASN E  3 81  ? 1.529   24.632 35.167  1.00 22.70  ? 81  ASN A O     1 
ATOM   1689 C  CB    . ASN E  3 81  ? 2.633   27.698 35.111  1.00 19.44  ? 81  ASN A CB    1 
ATOM   1690 C  CG    . ASN E  3 81  ? 3.499   28.337 36.185  1.00 21.74  ? 81  ASN A CG    1 
ATOM   1691 O  OD1   . ASN E  3 81  ? 3.128   28.367 37.360  1.00 23.51  ? 81  ASN A OD1   1 
ATOM   1692 N  ND2   . ASN E  3 81  ? 4.666   28.841 35.788  1.00 21.57  ? 81  ASN A ND2   1 
ATOM   1693 N  N     . LEU E  3 82  ? 1.531   25.462 33.084  1.00 19.08  ? 82  LEU A N     1 
ATOM   1694 C  CA    . LEU E  3 82  ? 0.425   24.608 32.656  1.00 21.02  ? 82  LEU A CA    1 
ATOM   1695 C  C     . LEU E  3 82  ? 0.882   23.146 32.618  1.00 23.96  ? 82  LEU A C     1 
ATOM   1696 O  O     . LEU E  3 82  ? 0.161   22.252 33.060  1.00 22.58  ? 82  LEU A O     1 
ATOM   1697 C  CB    . LEU E  3 82  ? -0.084  25.063 31.287  1.00 17.95  ? 82  LEU A CB    1 
ATOM   1698 C  CG    . LEU E  3 82  ? -0.721  26.462 31.268  1.00 21.62  ? 82  LEU A CG    1 
ATOM   1699 C  CD1   . LEU E  3 82  ? -1.013  26.895 29.834  1.00 23.56  ? 82  LEU A CD1   1 
ATOM   1700 C  CD2   . LEU E  3 82  ? -2.011  26.437 32.096  1.00 23.27  ? 82  LEU A CD2   1 
ATOM   1701 N  N     . LEU E  3 83  ? 2.086   22.904 32.108  1.00 22.61  ? 83  LEU A N     1 
ATOM   1702 C  CA    . LEU E  3 83  ? 2.608   21.542 32.052  1.00 20.76  ? 83  LEU A CA    1 
ATOM   1703 C  C     . LEU E  3 83  ? 2.861   21.022 33.464  1.00 21.32  ? 83  LEU A C     1 
ATOM   1704 O  O     . LEU E  3 83  ? 2.629   19.846 33.756  1.00 25.94  ? 83  LEU A O     1 
ATOM   1705 C  CB    . LEU E  3 83  ? 3.915   21.496 31.247  1.00 22.33  ? 83  LEU A CB    1 
ATOM   1706 C  CG    . LEU E  3 83  ? 3.855   21.855 29.758  1.00 19.69  ? 83  LEU A CG    1 
ATOM   1707 C  CD1   . LEU E  3 83  ? 5.238   21.697 29.139  1.00 19.21  ? 83  LEU A CD1   1 
ATOM   1708 C  CD2   . LEU E  3 83  ? 2.855   20.945 29.043  1.00 21.46  ? 83  LEU A CD2   1 
ATOM   1709 N  N     . ALA E  3 84  ? 3.329   21.904 34.342  1.00 24.07  ? 84  ALA A N     1 
ATOM   1710 C  CA    . ALA E  3 84  ? 3.630   21.527 35.723  1.00 25.69  ? 84  ALA A CA    1 
ATOM   1711 C  C     . ALA E  3 84  ? 2.398   21.050 36.487  1.00 29.99  ? 84  ALA A C     1 
ATOM   1712 O  O     . ALA E  3 84  ? 2.503   20.208 37.378  1.00 25.36  ? 84  ALA A O     1 
ATOM   1713 C  CB    . ALA E  3 84  ? 4.271   22.701 36.459  1.00 24.40  ? 84  ALA A CB    1 
ATOM   1714 N  N     . GLN E  3 85  ? 1.234   21.595 36.143  1.00 33.93  ? 85  GLN A N     1 
ATOM   1715 C  CA    . GLN E  3 85  ? -0.005  21.210 36.808  1.00 38.70  ? 85  GLN A CA    1 
ATOM   1716 C  C     . GLN E  3 85  ? -0.207  19.703 36.748  1.00 39.68  ? 85  GLN A C     1 
ATOM   1717 O  O     . GLN E  3 85  ? -0.656  19.091 37.716  1.00 42.24  ? 85  GLN A O     1 
ATOM   1718 C  CB    . GLN E  3 85  ? -1.204  21.913 36.164  1.00 46.01  ? 85  GLN A CB    1 
ATOM   1719 C  CG    . GLN E  3 85  ? -1.269  23.408 36.432  1.00 57.74  ? 85  GLN A CG    1 
ATOM   1720 C  CD    . GLN E  3 85  ? -2.533  24.044 35.879  1.00 64.71  ? 85  GLN A CD    1 
ATOM   1721 O  OE1   . GLN E  3 85  ? -3.645  23.619 36.196  1.00 67.61  ? 85  GLN A OE1   1 
ATOM   1722 N  NE2   . GLN E  3 85  ? -2.369  25.068 35.051  1.00 68.86  ? 85  GLN A NE2   1 
ATOM   1723 N  N     . LYS E  3 86  ? 0.134   19.109 35.609  1.00 38.22  ? 86  LYS A N     1 
ATOM   1724 C  CA    . LYS E  3 86  ? -0.009  17.672 35.424  1.00 42.29  ? 86  LYS A CA    1 
ATOM   1725 C  C     . LYS E  3 86  ? 0.799   16.896 36.456  1.00 43.02  ? 86  LYS A C     1 
ATOM   1726 O  O     . LYS E  3 86  ? 0.521   15.726 36.719  1.00 47.03  ? 86  LYS A O     1 
ATOM   1727 C  CB    . LYS E  3 86  ? 0.434   17.263 34.013  1.00 45.60  ? 86  LYS A CB    1 
ATOM   1728 C  CG    . LYS E  3 86  ? 0.585   15.754 33.836  1.00 51.48  ? 86  LYS A CG    1 
ATOM   1729 C  CD    . LYS E  3 86  ? 0.868   15.350 32.397  1.00 48.47  ? 86  LYS A CD    1 
ATOM   1730 C  CE    . LYS E  3 86  ? -0.335  15.602 31.508  1.00 52.09  ? 86  LYS A CE    1 
ATOM   1731 N  NZ    . LYS E  3 86  ? -0.198  14.930 30.189  1.00 51.36  ? 86  LYS A NZ    1 
ATOM   1732 N  N     . LEU E  3 87  ? 1.798   17.549 37.042  1.00 34.84  ? 87  LEU A N     1 
ATOM   1733 C  CA    . LEU E  3 87  ? 2.638   16.908 38.044  1.00 32.72  ? 87  LEU A CA    1 
ATOM   1734 C  C     . LEU E  3 87  ? 2.323   17.412 39.451  1.00 28.39  ? 87  LEU A C     1 
ATOM   1735 O  O     . LEU E  3 87  ? 2.956   16.985 40.417  1.00 27.91  ? 87  LEU A O     1 
ATOM   1736 C  CB    . LEU E  3 87  ? 4.116   17.172 37.740  1.00 31.77  ? 87  LEU A CB    1 
ATOM   1737 C  CG    . LEU E  3 87  ? 4.665   16.686 36.398  1.00 31.17  ? 87  LEU A CG    1 
ATOM   1738 C  CD1   . LEU E  3 87  ? 6.080   17.204 36.216  1.00 29.78  ? 87  LEU A CD1   1 
ATOM   1739 C  CD2   . LEU E  3 87  ? 4.632   15.164 36.339  1.00 34.28  ? 87  LEU A CD2   1 
ATOM   1740 N  N     . GLU E  3 88  ? 1.344   18.310 39.563  1.00 29.63  ? 88  GLU A N     1 
ATOM   1741 C  CA    . GLU E  3 88  ? 0.979   18.892 40.858  1.00 29.27  ? 88  GLU A CA    1 
ATOM   1742 C  C     . GLU E  3 88  ? 2.281   19.337 41.503  1.00 29.46  ? 88  GLU A C     1 
ATOM   1743 O  O     . GLU E  3 88  ? 2.456   19.261 42.716  1.00 25.50  ? 88  GLU A O     1 
ATOM   1744 C  CB    . GLU E  3 88  ? 0.301   17.859 41.759  1.00 33.90  ? 88  GLU A CB    1 
ATOM   1745 C  CG    . GLU E  3 88  ? -0.930  17.210 41.158  1.00 37.60  ? 88  GLU A CG    1 
ATOM   1746 C  CD    . GLU E  3 88  ? -1.723  16.435 42.191  1.00 43.18  ? 88  GLU A CD    1 
ATOM   1747 O  OE1   . GLU E  3 88  ? -2.377  17.078 43.037  1.00 45.32  ? 88  GLU A OE1   1 
ATOM   1748 O  OE2   . GLU E  3 88  ? -1.682  15.188 42.166  1.00 44.59  ? 88  GLU A OE2   1 
ATOM   1749 N  N     . LEU E  3 89  ? 3.195   19.803 40.662  1.00 31.87  ? 89  LEU A N     1 
ATOM   1750 C  CA    . LEU E  3 89  ? 4.511   20.230 41.102  1.00 32.78  ? 89  LEU A CA    1 
ATOM   1751 C  C     . LEU E  3 89  ? 4.495   21.134 42.332  1.00 33.09  ? 89  LEU A C     1 
ATOM   1752 O  O     . LEU E  3 89  ? 5.342   21.001 43.217  1.00 31.06  ? 89  LEU A O     1 
ATOM   1753 C  CB    . LEU E  3 89  ? 5.232   20.920 39.936  1.00 28.32  ? 89  LEU A CB    1 
ATOM   1754 C  CG    . LEU E  3 89  ? 6.750   21.050 40.035  1.00 36.24  ? 89  LEU A CG    1 
ATOM   1755 C  CD1   . LEU E  3 89  ? 7.360   19.691 40.327  1.00 32.21  ? 89  LEU A CD1   1 
ATOM   1756 C  CD2   . LEU E  3 89  ? 7.297   21.626 38.737  1.00 31.04  ? 89  LEU A CD2   1 
ATOM   1757 N  N     . HIS E  3 90  ? 3.524   22.038 42.404  1.00 32.74  ? 90  HIS A N     1 
ATOM   1758 C  CA    . HIS E  3 90  ? 3.445   22.961 43.532  1.00 35.92  ? 90  HIS A CA    1 
ATOM   1759 C  C     . HIS E  3 90  ? 3.432   22.289 44.906  1.00 37.96  ? 90  HIS A C     1 
ATOM   1760 O  O     . HIS E  3 90  ? 3.909   22.867 45.881  1.00 38.30  ? 90  HIS A O     1 
ATOM   1761 C  CB    . HIS E  3 90  ? 2.212   23.862 43.399  1.00 41.22  ? 90  HIS A CB    1 
ATOM   1762 C  CG    . HIS E  3 90  ? 0.913   23.128 43.511  1.00 47.84  ? 90  HIS A CG    1 
ATOM   1763 N  ND1   . HIS E  3 90  ? 0.480   22.233 42.557  1.00 50.78  ? 90  HIS A ND1   1 
ATOM   1764 C  CD2   . HIS E  3 90  ? -0.038  23.141 44.475  1.00 50.23  ? 90  HIS A CD2   1 
ATOM   1765 C  CE1   . HIS E  3 90  ? -0.683  21.725 42.928  1.00 55.69  ? 90  HIS A CE1   1 
ATOM   1766 N  NE2   . HIS E  3 90  ? -1.018  22.260 44.089  1.00 55.35  ? 90  HIS A NE2   1 
ATOM   1767 N  N     . LYS E  3 91  ? 2.900   21.073 44.994  1.00 39.29  ? 91  LYS A N     1 
ATOM   1768 C  CA    . LYS E  3 91  ? 2.838   20.387 46.281  1.00 39.47  ? 91  LYS A CA    1 
ATOM   1769 C  C     . LYS E  3 91  ? 4.141   19.719 46.717  1.00 38.53  ? 91  LYS A C     1 
ATOM   1770 O  O     . LYS E  3 91  ? 4.225   19.186 47.821  1.00 36.18  ? 91  LYS A O     1 
ATOM   1771 C  CB    . LYS E  3 91  ? 1.712   19.348 46.284  1.00 49.28  ? 91  LYS A CB    1 
ATOM   1772 C  CG    . LYS E  3 91  ? 1.928   18.170 45.352  1.00 63.17  ? 91  LYS A CG    1 
ATOM   1773 C  CD    . LYS E  3 91  ? 0.856   17.104 45.552  1.00 71.21  ? 91  LYS A CD    1 
ATOM   1774 C  CE    . LYS E  3 91  ? -0.542  17.658 45.317  1.00 77.63  ? 91  LYS A CE    1 
ATOM   1775 N  NZ    . LYS E  3 91  ? -1.594  16.623 45.521  1.00 82.78  ? 91  LYS A NZ    1 
ATOM   1776 N  N     . PHE E  3 92  ? 5.159   19.758 45.865  1.00 32.11  ? 92  PHE A N     1 
ATOM   1777 C  CA    . PHE E  3 92  ? 6.441   19.131 46.188  1.00 31.73  ? 92  PHE A CA    1 
ATOM   1778 C  C     . PHE E  3 92  ? 7.564   20.138 46.411  1.00 29.11  ? 92  PHE A C     1 
ATOM   1779 O  O     . PHE E  3 92  ? 8.645   19.779 46.876  1.00 30.40  ? 92  PHE A O     1 
ATOM   1780 C  CB    . PHE E  3 92  ? 6.846   18.178 45.058  1.00 29.41  ? 92  PHE A CB    1 
ATOM   1781 C  CG    . PHE E  3 92  ? 5.854   17.082 44.809  1.00 27.85  ? 92  PHE A CG    1 
ATOM   1782 C  CD1   . PHE E  3 92  ? 5.768   15.994 45.672  1.00 29.89  ? 92  PHE A CD1   1 
ATOM   1783 C  CD2   . PHE E  3 92  ? 4.979   17.153 43.727  1.00 26.76  ? 92  PHE A CD2   1 
ATOM   1784 C  CE1   . PHE E  3 92  ? 4.822   14.990 45.465  1.00 26.66  ? 92  PHE A CE1   1 
ATOM   1785 C  CE2   . PHE E  3 92  ? 4.033   16.159 43.511  1.00 27.45  ? 92  PHE A CE2   1 
ATOM   1786 C  CZ    . PHE E  3 92  ? 3.953   15.072 44.383  1.00 30.74  ? 92  PHE A CZ    1 
ATOM   1787 N  N     . ILE E  3 93  ? 7.303   21.394 46.076  1.00 29.77  ? 93  ILE A N     1 
ATOM   1788 C  CA    . ILE E  3 93  ? 8.303   22.445 46.211  1.00 26.73  ? 93  ILE A CA    1 
ATOM   1789 C  C     . ILE E  3 93  ? 8.613   22.788 47.665  1.00 32.11  ? 93  ILE A C     1 
ATOM   1790 O  O     . ILE E  3 93  ? 7.708   22.997 48.475  1.00 28.84  ? 93  ILE A O     1 
ATOM   1791 C  CB    . ILE E  3 93  ? 7.849   23.713 45.460  1.00 28.21  ? 93  ILE A CB    1 
ATOM   1792 C  CG1   . ILE E  3 93  ? 7.726   23.395 43.967  1.00 26.43  ? 93  ILE A CG1   1 
ATOM   1793 C  CG2   . ILE E  3 93  ? 8.828   24.856 45.702  1.00 25.54  ? 93  ILE A CG2   1 
ATOM   1794 C  CD1   . ILE E  3 93  ? 7.097   24.502 43.142  1.00 24.92  ? 93  ILE A CD1   1 
ATOM   1795 N  N     . ARG E  3 94  ? 9.901   22.831 47.988  1.00 26.98  ? 94  ARG A N     1 
ATOM   1796 C  CA    . ARG E  3 94  ? 10.337  23.153 49.339  1.00 30.95  ? 94  ARG A CA    1 
ATOM   1797 C  C     . ARG E  3 94  ? 10.648  24.637 49.430  1.00 29.31  ? 94  ARG A C     1 
ATOM   1798 O  O     . ARG E  3 94  ? 11.682  25.110 48.955  1.00 28.17  ? 94  ARG A O     1 
ATOM   1799 C  CB    . ARG E  3 94  ? 11.556  22.311 49.708  1.00 30.61  ? 94  ARG A CB    1 
ATOM   1800 C  CG    . ARG E  3 94  ? 11.249  20.821 49.716  1.00 38.51  ? 94  ARG A CG    1 
ATOM   1801 C  CD    . ARG E  3 94  ? 12.470  19.977 50.004  1.00 48.89  ? 94  ARG A CD    1 
ATOM   1802 N  NE    . ARG E  3 94  ? 12.140  18.554 49.998  1.00 56.73  ? 94  ARG A NE    1 
ATOM   1803 C  CZ    . ARG E  3 94  ? 13.012  17.582 50.251  1.00 61.87  ? 94  ARG A CZ    1 
ATOM   1804 N  NH1   . ARG E  3 94  ? 14.274  17.878 50.529  1.00 61.79  ? 94  ARG A NH1   1 
ATOM   1805 N  NH2   . ARG E  3 94  ? 12.620  16.313 50.230  1.00 60.71  ? 94  ARG A NH2   1 
ATOM   1806 N  N     . ILE E  3 95  ? 9.719   25.365 50.033  1.00 33.16  ? 95  ILE A N     1 
ATOM   1807 C  CA    . ILE E  3 95  ? 9.830   26.804 50.200  1.00 34.01  ? 95  ILE A CA    1 
ATOM   1808 C  C     . ILE E  3 95  ? 8.780   27.197 51.235  1.00 39.46  ? 95  ILE A C     1 
ATOM   1809 O  O     . ILE E  3 95  ? 7.798   26.476 51.428  1.00 37.72  ? 95  ILE A O     1 
ATOM   1810 C  CB    . ILE E  3 95  ? 9.542   27.523 48.871  1.00 32.26  ? 95  ILE A CB    1 
ATOM   1811 C  CG1   . ILE E  3 95  ? 9.833   29.016 49.004  1.00 33.32  ? 95  ILE A CG1   1 
ATOM   1812 C  CG2   . ILE E  3 95  ? 8.093   27.292 48.461  1.00 32.84  ? 95  ILE A CG2   1 
ATOM   1813 C  CD1   . ILE E  3 95  ? 9.670   29.782 47.704  1.00 35.24  ? 95  ILE A CD1   1 
ATOM   1814 N  N     . LYS E  3 96  ? 8.986   28.329 51.899  1.00 42.87  ? 96  LYS A N     1 
ATOM   1815 C  CA    . LYS E  3 96  ? 8.050   28.790 52.917  1.00 54.13  ? 96  LYS A CA    1 
ATOM   1816 C  C     . LYS E  3 96  ? 6.615   28.768 52.401  1.00 56.09  ? 96  LYS A C     1 
ATOM   1817 O  O     . LYS E  3 96  ? 6.344   29.145 51.260  1.00 54.06  ? 96  LYS A O     1 
ATOM   1818 C  CB    . LYS E  3 96  ? 8.420   30.203 53.374  1.00 57.51  ? 96  LYS A CB    1 
ATOM   1819 C  CG    . LYS E  3 96  ? 7.664   30.671 54.607  1.00 69.18  ? 96  LYS A CG    1 
ATOM   1820 C  CD    . LYS E  3 96  ? 8.296   31.922 55.200  1.00 76.57  ? 96  LYS A CD    1 
ATOM   1821 C  CE    . LYS E  3 96  ? 7.656   32.286 56.532  1.00 81.71  ? 96  LYS A CE    1 
ATOM   1822 N  NZ    . LYS E  3 96  ? 8.335   33.440 57.185  1.00 83.64  ? 96  LYS A NZ    1 
ATOM   1823 N  N     . ARG E  3 97  ? 5.701   28.314 53.251  1.00 61.58  ? 97  ARG A N     1 
ATOM   1824 C  CA    . ARG E  3 97  ? 4.292   28.235 52.889  1.00 64.91  ? 97  ARG A CA    1 
ATOM   1825 C  C     . ARG E  3 97  ? 3.757   29.587 52.423  1.00 63.59  ? 97  ARG A C     1 
ATOM   1826 O  O     . ARG E  3 97  ? 3.958   30.608 53.082  1.00 63.56  ? 97  ARG A O     1 
ATOM   1827 C  CB    . ARG E  3 97  ? 3.482   27.700 54.081  1.00 72.77  ? 97  ARG A CB    1 
ATOM   1828 C  CG    . ARG E  3 97  ? 2.181   28.435 54.391  1.00 83.09  ? 97  ARG A CG    1 
ATOM   1829 C  CD    . ARG E  3 97  ? 2.430   29.648 55.278  1.00 89.81  ? 97  ARG A CD    1 
ATOM   1830 N  NE    . ARG E  3 97  ? 1.196   30.358 55.603  1.00 96.13  ? 97  ARG A NE    1 
ATOM   1831 C  CZ    . ARG E  3 97  ? 1.137   31.440 56.374  1.00 97.98  ? 97  ARG A CZ    1 
ATOM   1832 N  NH1   . ARG E  3 97  ? 2.245   31.941 56.904  1.00 98.64  ? 97  ARG A NH1   1 
ATOM   1833 N  NH2   . ARG E  3 97  ? -0.030  32.021 56.616  1.00 99.65  ? 97  ARG A NH2   1 
ATOM   1834 N  N     . GLY E  3 98  ? 3.092   29.583 51.270  1.00 61.53  ? 98  GLY A N     1 
ATOM   1835 C  CA    . GLY E  3 98  ? 2.529   30.807 50.725  1.00 56.31  ? 98  GLY A CA    1 
ATOM   1836 C  C     . GLY E  3 98  ? 3.491   31.651 49.905  1.00 53.62  ? 98  GLY A C     1 
ATOM   1837 O  O     . GLY E  3 98  ? 3.129   32.733 49.444  1.00 49.76  ? 98  GLY A O     1 
ATOM   1838 N  N     . LYS E  3 99  ? 4.712   31.162 49.710  1.00 50.92  ? 99  LYS A N     1 
ATOM   1839 C  CA    . LYS E  3 99  ? 5.710   31.905 48.949  1.00 48.62  ? 99  LYS A CA    1 
ATOM   1840 C  C     . LYS E  3 99  ? 5.780   31.457 47.488  1.00 45.37  ? 99  LYS A C     1 
ATOM   1841 O  O     . LYS E  3 99  ? 6.447   32.086 46.667  1.00 44.47  ? 99  LYS A O     1 
ATOM   1842 C  CB    . LYS E  3 99  ? 7.083   31.744 49.608  1.00 52.62  ? 99  LYS A CB    1 
ATOM   1843 C  CG    . LYS E  3 99  ? 8.111   32.778 49.184  1.00 59.42  ? 99  LYS A CG    1 
ATOM   1844 C  CD    . LYS E  3 99  ? 9.435   32.566 49.906  1.00 64.02  ? 99  LYS A CD    1 
ATOM   1845 C  CE    . LYS E  3 99  ? 10.383  33.730 49.667  1.00 65.70  ? 99  LYS A CE    1 
ATOM   1846 N  NZ    . LYS E  3 99  ? 10.597  33.981 48.217  1.00 67.60  ? 99  LYS A NZ    1 
ATOM   1847 N  N     . ILE E  3 100 ? 5.082   30.373 47.166  1.00 39.96  ? 100 ILE A N     1 
ATOM   1848 C  CA    . ILE E  3 100 ? 5.074   29.840 45.807  1.00 36.76  ? 100 ILE A CA    1 
ATOM   1849 C  C     . ILE E  3 100 ? 4.274   30.704 44.833  1.00 38.23  ? 100 ILE A C     1 
ATOM   1850 O  O     . ILE E  3 100 ? 3.155   31.114 45.133  1.00 39.69  ? 100 ILE A O     1 
ATOM   1851 C  CB    . ILE E  3 100 ? 4.474   28.407 45.773  1.00 43.04  ? 100 ILE A CB    1 
ATOM   1852 C  CG1   . ILE E  3 100 ? 5.323   27.462 46.628  1.00 46.98  ? 100 ILE A CG1   1 
ATOM   1853 C  CG2   . ILE E  3 100 ? 4.398   27.901 44.336  1.00 39.58  ? 100 ILE A CG2   1 
ATOM   1854 C  CD1   . ILE E  3 100 ? 4.782   26.050 46.716  1.00 49.15  ? 100 ILE A CD1   1 
ATOM   1855 N  N     . ASN E  3 101 ? 4.862   30.987 43.673  1.00 32.62  ? 101 ASN A N     1 
ATOM   1856 C  CA    . ASN E  3 101 ? 4.189   31.758 42.631  1.00 30.95  ? 101 ASN A CA    1 
ATOM   1857 C  C     . ASN E  3 101 ? 4.558   31.143 41.286  1.00 26.46  ? 101 ASN A C     1 
ATOM   1858 O  O     . ASN E  3 101 ? 5.280   30.150 41.243  1.00 28.09  ? 101 ASN A O     1 
ATOM   1859 C  CB    . ASN E  3 101 ? 4.577   33.246 42.672  1.00 29.17  ? 101 ASN A CB    1 
ATOM   1860 C  CG    . ASN E  3 101 ? 6.075   33.472 42.637  1.00 33.80  ? 101 ASN A CG    1 
ATOM   1861 O  OD1   . ASN E  3 101 ? 6.810   32.766 41.953  1.00 31.29  ? 101 ASN A OD1   1 
ATOM   1862 N  ND2   . ASN E  3 101 ? 6.532   34.483 43.368  1.00 35.41  ? 101 ASN A ND2   1 
ATOM   1863 N  N     . GLU E  3 102 ? 4.067   31.723 40.194  1.00 26.25  ? 102 GLU A N     1 
ATOM   1864 C  CA    . GLU E  3 102 ? 4.337   31.172 38.869  1.00 25.42  ? 102 GLU A CA    1 
ATOM   1865 C  C     . GLU E  3 102 ? 5.813   31.170 38.483  1.00 24.65  ? 102 GLU A C     1 
ATOM   1866 O  O     . GLU E  3 102 ? 6.266   30.291 37.750  1.00 21.70  ? 102 GLU A O     1 
ATOM   1867 C  CB    . GLU E  3 102 ? 3.509   31.905 37.812  1.00 30.14  ? 102 GLU A CB    1 
ATOM   1868 C  CG    . GLU E  3 102 ? 2.010   31.844 38.085  1.00 35.78  ? 102 GLU A CG    1 
ATOM   1869 C  CD    . GLU E  3 102 ? 1.170   32.208 36.879  1.00 43.01  ? 102 GLU A CD    1 
ATOM   1870 O  OE1   . GLU E  3 102 ? 1.653   32.970 36.017  1.00 39.14  ? 102 GLU A OE1   1 
ATOM   1871 O  OE2   . GLU E  3 102 ? 0.014   31.739 36.800  1.00 51.94  ? 102 GLU A OE2   1 
ATOM   1872 N  N     . THR E  3 103 ? 6.562   32.147 38.980  1.00 20.98  ? 103 THR A N     1 
ATOM   1873 C  CA    . THR E  3 103 ? 7.986   32.225 38.684  1.00 22.20  ? 103 THR A CA    1 
ATOM   1874 C  C     . THR E  3 103 ? 8.687   30.999 39.261  1.00 23.77  ? 103 THR A C     1 
ATOM   1875 O  O     . THR E  3 103 ? 9.473   30.338 38.581  1.00 22.78  ? 103 THR A O     1 
ATOM   1876 C  CB    . THR E  3 103 ? 8.615   33.481 39.314  1.00 28.21  ? 103 THR A CB    1 
ATOM   1877 O  OG1   . THR E  3 103 ? 8.014   34.653 38.749  1.00 29.48  ? 103 THR A OG1   1 
ATOM   1878 C  CG2   . THR E  3 103 ? 10.117  33.503 39.071  1.00 28.65  ? 103 THR A CG2   1 
ATOM   1879 N  N     . ILE E  3 104 ? 8.391   30.704 40.523  1.00 21.08  ? 104 ILE A N     1 
ATOM   1880 C  CA    . ILE E  3 104 ? 8.986   29.568 41.216  1.00 21.02  ? 104 ILE A CA    1 
ATOM   1881 C  C     . ILE E  3 104 ? 8.614   28.252 40.544  1.00 22.44  ? 104 ILE A C     1 
ATOM   1882 O  O     . ILE E  3 104 ? 9.470   27.404 40.308  1.00 20.65  ? 104 ILE A O     1 
ATOM   1883 C  CB    . ILE E  3 104 ? 8.527   29.512 42.693  1.00 28.32  ? 104 ILE A CB    1 
ATOM   1884 C  CG1   . ILE E  3 104 ? 8.919   30.810 43.412  1.00 31.94  ? 104 ILE A CG1   1 
ATOM   1885 C  CG2   . ILE E  3 104 ? 9.130   28.290 43.387  1.00 26.51  ? 104 ILE A CG2   1 
ATOM   1886 C  CD1   . ILE E  3 104 ? 10.381  31.166 43.296  1.00 39.57  ? 104 ILE A CD1   1 
ATOM   1887 N  N     . ILE E  3 105 ? 7.330   28.078 40.246  1.00 18.86  ? 105 ILE A N     1 
ATOM   1888 C  CA    . ILE E  3 105 ? 6.880   26.850 39.595  1.00 22.23  ? 105 ILE A CA    1 
ATOM   1889 C  C     . ILE E  3 105 ? 7.573   26.649 38.244  1.00 19.03  ? 105 ILE A C     1 
ATOM   1890 O  O     . ILE E  3 105 ? 7.975   25.534 37.902  1.00 20.52  ? 105 ILE A O     1 
ATOM   1891 C  CB    . ILE E  3 105 ? 5.348   26.862 39.386  1.00 21.68  ? 105 ILE A CB    1 
ATOM   1892 C  CG1   . ILE E  3 105 ? 4.645   26.757 40.745  1.00 25.57  ? 105 ILE A CG1   1 
ATOM   1893 C  CG2   . ILE E  3 105 ? 4.928   25.707 38.481  1.00 21.40  ? 105 ILE A CG2   1 
ATOM   1894 C  CD1   . ILE E  3 105 ? 3.134   26.876 40.667  1.00 32.36  ? 105 ILE A CD1   1 
ATOM   1895 N  N     . GLY E  3 106 ? 7.712   27.731 37.485  1.00 16.72  ? 106 GLY A N     1 
ATOM   1896 C  CA    . GLY E  3 106 ? 8.358   27.642 36.188  1.00 17.35  ? 106 GLY A CA    1 
ATOM   1897 C  C     . GLY E  3 106 ? 9.826   27.282 36.317  1.00 18.59  ? 106 GLY A C     1 
ATOM   1898 O  O     . GLY E  3 106 ? 10.359  26.522 35.505  1.00 18.09  ? 106 GLY A O     1 
ATOM   1899 N  N     . ASP E  3 107 ? 10.484  27.817 37.341  1.00 16.65  ? 107 ASP A N     1 
ATOM   1900 C  CA    . ASP E  3 107 ? 11.905  27.534 37.542  1.00 17.69  ? 107 ASP A CA    1 
ATOM   1901 C  C     . ASP E  3 107 ? 12.117  26.096 37.994  1.00 21.29  ? 107 ASP A C     1 
ATOM   1902 O  O     . ASP E  3 107 ? 13.041  25.431 37.532  1.00 16.86  ? 107 ASP A O     1 
ATOM   1903 C  CB    . ASP E  3 107 ? 12.519  28.501 38.562  1.00 17.61  ? 107 ASP A CB    1 
ATOM   1904 C  CG    . ASP E  3 107 ? 12.560  29.935 38.056  1.00 23.46  ? 107 ASP A CG    1 
ATOM   1905 O  OD1   . ASP E  3 107 ? 12.486  30.136 36.827  1.00 28.03  ? 107 ASP A OD1   1 
ATOM   1906 O  OD2   . ASP E  3 107 ? 12.686  30.854 38.887  1.00 30.42  ? 107 ASP A OD2   1 
ATOM   1907 N  N     . VAL E  3 108 ? 11.259  25.615 38.890  1.00 17.40  ? 108 VAL A N     1 
ATOM   1908 C  CA    . VAL E  3 108 ? 11.369  24.243 39.376  1.00 17.56  ? 108 VAL A CA    1 
ATOM   1909 C  C     . VAL E  3 108 ? 11.109  23.252 38.244  1.00 19.94  ? 108 VAL A C     1 
ATOM   1910 O  O     . VAL E  3 108 ? 11.745  22.199 38.174  1.00 20.00  ? 108 VAL A O     1 
ATOM   1911 C  CB    . VAL E  3 108 ? 10.384  23.982 40.542  1.00 19.73  ? 108 VAL A CB    1 
ATOM   1912 C  CG1   . VAL E  3 108 ? 10.351  22.491 40.886  1.00 17.83  ? 108 VAL A CG1   1 
ATOM   1913 C  CG2   . VAL E  3 108 ? 10.824  24.782 41.769  1.00 17.48  ? 108 VAL A CG2   1 
ATOM   1914 N  N     . PHE E  3 109 ? 10.179  23.588 37.356  1.00 18.88  ? 109 PHE A N     1 
ATOM   1915 C  CA    . PHE E  3 109 ? 9.874   22.718 36.227  1.00 18.53  ? 109 PHE A CA    1 
ATOM   1916 C  C     . PHE E  3 109 ? 11.144  22.505 35.398  1.00 16.48  ? 109 PHE A C     1 
ATOM   1917 O  O     . PHE E  3 109 ? 11.484  21.380 35.036  1.00 15.96  ? 109 PHE A O     1 
ATOM   1918 C  CB    . PHE E  3 109 ? 8.792   23.342 35.346  1.00 17.70  ? 109 PHE A CB    1 
ATOM   1919 C  CG    . PHE E  3 109 ? 8.365   22.466 34.198  1.00 19.36  ? 109 PHE A CG    1 
ATOM   1920 C  CD1   . PHE E  3 109 ? 7.529   21.374 34.411  1.00 24.54  ? 109 PHE A CD1   1 
ATOM   1921 C  CD2   . PHE E  3 109 ? 8.800   22.736 32.903  1.00 14.99  ? 109 PHE A CD2   1 
ATOM   1922 C  CE1   . PHE E  3 109 ? 7.130   20.566 33.344  1.00 16.78  ? 109 PHE A CE1   1 
ATOM   1923 C  CE2   . PHE E  3 109 ? 8.410   21.937 31.834  1.00 17.22  ? 109 PHE A CE2   1 
ATOM   1924 C  CZ    . PHE E  3 109 ? 7.570   20.848 32.059  1.00 16.17  ? 109 PHE A CZ    1 
ATOM   1925 N  N     . GLU E  3 110 ? 11.851  23.590 35.098  1.00 14.93  ? 110 GLU A N     1 
ATOM   1926 C  CA    . GLU E  3 110 ? 13.082  23.462 34.326  1.00 13.87  ? 110 GLU A CA    1 
ATOM   1927 C  C     . GLU E  3 110 ? 14.139  22.678 35.107  1.00 16.07  ? 110 GLU A C     1 
ATOM   1928 O  O     . GLU E  3 110 ? 14.803  21.797 34.555  1.00 17.77  ? 110 GLU A O     1 
ATOM   1929 C  CB    . GLU E  3 110 ? 13.624  24.846 33.947  1.00 16.38  ? 110 GLU A CB    1 
ATOM   1930 C  CG    . GLU E  3 110 ? 12.730  25.581 32.952  1.00 18.71  ? 110 GLU A CG    1 
ATOM   1931 C  CD    . GLU E  3 110 ? 13.267  26.944 32.577  1.00 21.62  ? 110 GLU A CD    1 
ATOM   1932 O  OE1   . GLU E  3 110 ? 13.781  27.638 33.476  1.00 22.84  ? 110 GLU A OE1   1 
ATOM   1933 O  OE2   . GLU E  3 110 ? 13.167  27.321 31.388  1.00 17.92  ? 110 GLU A OE2   1 
ATOM   1934 N  N     . ALA E  3 111 ? 14.285  22.985 36.393  1.00 15.34  ? 111 ALA A N     1 
ATOM   1935 C  CA    . ALA E  3 111 ? 15.281  22.305 37.225  1.00 17.72  ? 111 ALA A CA    1 
ATOM   1936 C  C     . ALA E  3 111 ? 15.011  20.808 37.332  1.00 19.09  ? 111 ALA A C     1 
ATOM   1937 O  O     . ALA E  3 111 ? 15.937  19.998 37.355  1.00 15.82  ? 111 ALA A O     1 
ATOM   1938 C  CB    . ALA E  3 111 ? 15.310  22.919 38.625  1.00 17.22  ? 111 ALA A CB    1 
ATOM   1939 N  N     . LEU E  3 112 ? 13.735  20.451 37.416  1.00 15.89  ? 112 LEU A N     1 
ATOM   1940 C  CA    . LEU E  3 112 ? 13.342  19.053 37.531  1.00 17.73  ? 112 LEU A CA    1 
ATOM   1941 C  C     . LEU E  3 112 ? 13.843  18.248 36.340  1.00 17.89  ? 112 LEU A C     1 
ATOM   1942 O  O     . LEU E  3 112 ? 14.334  17.128 36.493  1.00 17.30  ? 112 LEU A O     1 
ATOM   1943 C  CB    . LEU E  3 112 ? 11.816  18.947 37.620  1.00 19.98  ? 112 LEU A CB    1 
ATOM   1944 C  CG    . LEU E  3 112 ? 11.267  17.537 37.849  1.00 26.57  ? 112 LEU A CG    1 
ATOM   1945 C  CD1   . LEU E  3 112 ? 11.859  16.968 39.135  1.00 25.60  ? 112 LEU A CD1   1 
ATOM   1946 C  CD2   . LEU E  3 112 ? 9.747   17.590 37.948  1.00 29.65  ? 112 LEU A CD2   1 
ATOM   1947 N  N     . TRP E  3 113 ? 13.726  18.818 35.146  1.00 17.49  ? 113 TRP A N     1 
ATOM   1948 C  CA    . TRP E  3 113 ? 14.178  18.108 33.963  1.00 18.56  ? 113 TRP A CA    1 
ATOM   1949 C  C     . TRP E  3 113 ? 15.695  18.006 33.878  1.00 17.99  ? 113 TRP A C     1 
ATOM   1950 O  O     . TRP E  3 113 ? 16.223  17.010 33.379  1.00 15.40  ? 113 TRP A O     1 
ATOM   1951 C  CB    . TRP E  3 113 ? 13.558  18.737 32.711  1.00 16.90  ? 113 TRP A CB    1 
ATOM   1952 C  CG    . TRP E  3 113 ? 12.121  18.329 32.674  1.00 16.93  ? 113 TRP A CG    1 
ATOM   1953 C  CD1   . TRP E  3 113 ? 11.028  19.092 32.985  1.00 17.35  ? 113 TRP A CD1   1 
ATOM   1954 C  CD2   . TRP E  3 113 ? 11.622  17.017 32.378  1.00 19.87  ? 113 TRP A CD2   1 
ATOM   1955 N  NE1   . TRP E  3 113 ? 9.878   18.329 32.912  1.00 19.24  ? 113 TRP A NE1   1 
ATOM   1956 C  CE2   . TRP E  3 113 ? 10.217  17.053 32.543  1.00 18.55  ? 113 TRP A CE2   1 
ATOM   1957 C  CE3   . TRP E  3 113 ? 12.229  15.809 31.996  1.00 20.42  ? 113 TRP A CE3   1 
ATOM   1958 C  CZ2   . TRP E  3 113 ? 9.405   15.925 32.339  1.00 21.66  ? 113 TRP A CZ2   1 
ATOM   1959 C  CZ3   . TRP E  3 113 ? 11.418  14.684 31.790  1.00 20.49  ? 113 TRP A CZ3   1 
ATOM   1960 C  CH2   . TRP E  3 113 ? 10.023  14.755 31.964  1.00 21.45  ? 113 TRP A CH2   1 
ATOM   1961 N  N     . ALA E  3 114 ? 16.397  19.017 34.381  1.00 16.28  ? 114 ALA A N     1 
ATOM   1962 C  CA    . ALA E  3 114 ? 17.858  18.970 34.395  1.00 16.36  ? 114 ALA A CA    1 
ATOM   1963 C  C     . ALA E  3 114 ? 18.259  17.871 35.384  1.00 16.77  ? 114 ALA A C     1 
ATOM   1964 O  O     . ALA E  3 114 ? 19.252  17.174 35.181  1.00 18.97  ? 114 ALA A O     1 
ATOM   1965 C  CB    . ALA E  3 114 ? 18.438  20.315 34.853  1.00 17.69  ? 114 ALA A CB    1 
ATOM   1966 N  N     . ALA E  3 115 ? 17.482  17.733 36.456  1.00 17.95  ? 115 ALA A N     1 
ATOM   1967 C  CA    . ALA E  3 115 ? 17.753  16.721 37.479  1.00 17.20  ? 115 ALA A CA    1 
ATOM   1968 C  C     . ALA E  3 115 ? 17.606  15.306 36.921  1.00 18.31  ? 115 ALA A C     1 
ATOM   1969 O  O     . ALA E  3 115 ? 18.416  14.427 37.216  1.00 17.51  ? 115 ALA A O     1 
ATOM   1970 C  CB    . ALA E  3 115 ? 16.824  16.916 38.668  1.00 19.25  ? 115 ALA A CB    1 
ATOM   1971 N  N     . VAL E  3 116 ? 16.561  15.082 36.130  1.00 18.51  ? 116 VAL A N     1 
ATOM   1972 C  CA    . VAL E  3 116 ? 16.353  13.769 35.522  1.00 18.47  ? 116 VAL A CA    1 
ATOM   1973 C  C     . VAL E  3 116 ? 17.508  13.503 34.554  1.00 19.46  ? 116 VAL A C     1 
ATOM   1974 O  O     . VAL E  3 116 ? 18.084  12.410 34.519  1.00 16.19  ? 116 VAL A O     1 
ATOM   1975 C  CB    . VAL E  3 116 ? 15.016  13.718 34.740  1.00 20.36  ? 116 VAL A CB    1 
ATOM   1976 C  CG1   . VAL E  3 116 ? 14.918  12.424 33.944  1.00 18.22  ? 116 VAL A CG1   1 
ATOM   1977 C  CG2   . VAL E  3 116 ? 13.847  13.815 35.705  1.00 18.93  ? 116 VAL A CG2   1 
ATOM   1978 N  N     . TYR E  3 117 ? 17.842  14.515 33.767  1.00 17.47  ? 117 TYR A N     1 
ATOM   1979 C  CA    . TYR E  3 117 ? 18.922  14.400 32.800  1.00 18.77  ? 117 TYR A CA    1 
ATOM   1980 C  C     . TYR E  3 117 ? 20.223  14.000 33.491  1.00 22.06  ? 117 TYR A C     1 
ATOM   1981 O  O     . TYR E  3 117 ? 20.887  13.046 33.078  1.00 16.38  ? 117 TYR A O     1 
ATOM   1982 C  CB    . TYR E  3 117 ? 19.088  15.736 32.064  1.00 18.17  ? 117 TYR A CB    1 
ATOM   1983 C  CG    . TYR E  3 117 ? 20.312  15.832 31.180  1.00 16.45  ? 117 TYR A CG    1 
ATOM   1984 C  CD1   . TYR E  3 117 ? 20.480  14.987 30.086  1.00 16.93  ? 117 TYR A CD1   1 
ATOM   1985 C  CD2   . TYR E  3 117 ? 21.301  16.783 31.436  1.00 19.89  ? 117 TYR A CD2   1 
ATOM   1986 C  CE1   . TYR E  3 117 ? 21.605  15.085 29.265  1.00 18.13  ? 117 TYR A CE1   1 
ATOM   1987 C  CE2   . TYR E  3 117 ? 22.430  16.891 30.623  1.00 16.88  ? 117 TYR A CE2   1 
ATOM   1988 C  CZ    . TYR E  3 117 ? 22.573  16.038 29.540  1.00 20.42  ? 117 TYR A CZ    1 
ATOM   1989 O  OH    . TYR E  3 117 ? 23.683  16.135 28.730  1.00 20.76  ? 117 TYR A OH    1 
ATOM   1990 N  N     . ILE E  3 118 ? 20.582  14.712 34.553  1.00 18.56  ? 118 ILE A N     1 
ATOM   1991 C  CA    . ILE E  3 118 ? 21.817  14.399 35.265  1.00 16.29  ? 118 ILE A CA    1 
ATOM   1992 C  C     . ILE E  3 118 ? 21.760  13.034 35.952  1.00 18.87  ? 118 ILE A C     1 
ATOM   1993 O  O     . ILE E  3 118 ? 22.679  12.227 35.814  1.00 18.76  ? 118 ILE A O     1 
ATOM   1994 C  CB    . ILE E  3 118 ? 22.147  15.509 36.295  1.00 18.54  ? 118 ILE A CB    1 
ATOM   1995 C  CG1   . ILE E  3 118 ? 22.480  16.804 35.541  1.00 18.21  ? 118 ILE A CG1   1 
ATOM   1996 C  CG2   . ILE E  3 118 ? 23.335  15.096 37.174  1.00 20.88  ? 118 ILE A CG2   1 
ATOM   1997 C  CD1   . ILE E  3 118 ? 22.749  18.002 36.446  1.00 24.26  ? 118 ILE A CD1   1 
ATOM   1998 N  N     . ASP E  3 119 ? 20.665  12.763 36.652  1.00 16.79  ? 119 ASP A N     1 
ATOM   1999 C  CA    . ASP E  3 119 ? 20.531  11.502 37.366  1.00 21.42  ? 119 ASP A CA    1 
ATOM   2000 C  C     . ASP E  3 119 ? 20.558  10.284 36.457  1.00 20.63  ? 119 ASP A C     1 
ATOM   2001 O  O     . ASP E  3 119 ? 21.012  9.209  36.865  1.00 21.36  ? 119 ASP A O     1 
ATOM   2002 C  CB    . ASP E  3 119 ? 19.248  11.480 38.192  1.00 19.14  ? 119 ASP A CB    1 
ATOM   2003 C  CG    . ASP E  3 119 ? 19.247  10.358 39.215  1.00 26.67  ? 119 ASP A CG    1 
ATOM   2004 O  OD1   . ASP E  3 119 ? 20.054  10.433 40.166  1.00 24.96  ? 119 ASP A OD1   1 
ATOM   2005 O  OD2   . ASP E  3 119 ? 18.454  9.405  39.061  1.00 22.18  ? 119 ASP A OD2   1 
ATOM   2006 N  N     . SER E  3 120 ? 20.087  10.447 35.227  1.00 17.49  ? 120 SER A N     1 
ATOM   2007 C  CA    . SER E  3 120 ? 20.062  9.338  34.277  1.00 20.90  ? 120 SER A CA    1 
ATOM   2008 C  C     . SER E  3 120 ? 21.435  9.095  33.653  1.00 24.33  ? 120 SER A C     1 
ATOM   2009 O  O     . SER E  3 120 ? 21.584  8.232  32.785  1.00 25.73  ? 120 SER A O     1 
ATOM   2010 C  CB    . SER E  3 120 ? 19.048  9.621  33.166  1.00 21.17  ? 120 SER A CB    1 
ATOM   2011 O  OG    . SER E  3 120 ? 19.489  10.688 32.337  1.00 23.70  ? 120 SER A OG    1 
ATOM   2012 N  N     . GLY E  3 121 ? 22.434  9.851  34.098  1.00 22.44  ? 121 GLY A N     1 
ATOM   2013 C  CA    . GLY E  3 121 ? 23.771  9.714  33.542  1.00 22.95  ? 121 GLY A CA    1 
ATOM   2014 C  C     . GLY E  3 121 ? 23.910  10.612 32.324  1.00 23.00  ? 121 GLY A C     1 
ATOM   2015 O  O     . GLY E  3 121 ? 24.615  10.286 31.367  1.00 22.73  ? 121 GLY A O     1 
ATOM   2016 N  N     . ARG E  3 122 ? 23.237  11.761 32.372  1.00 18.29  ? 122 ARG A N     1 
ATOM   2017 C  CA    . ARG E  3 122 ? 23.242  12.715 31.270  1.00 18.39  ? 122 ARG A CA    1 
ATOM   2018 C  C     . ARG E  3 122 ? 22.795  12.050 29.979  1.00 19.25  ? 122 ARG A C     1 
ATOM   2019 O  O     . ARG E  3 122 ? 23.440  12.162 28.939  1.00 19.59  ? 122 ARG A O     1 
ATOM   2020 C  CB    . ARG E  3 122 ? 24.630  13.364 31.100  1.00 21.20  ? 122 ARG A CB    1 
ATOM   2021 C  CG    . ARG E  3 122 ? 24.872  14.496 32.104  1.00 23.23  ? 122 ARG A CG    1 
ATOM   2022 C  CD    . ARG E  3 122 ? 26.096  15.346 31.746  1.00 25.37  ? 122 ARG A CD    1 
ATOM   2023 N  NE    . ARG E  3 122 ? 26.038  16.671 32.363  1.00 26.88  ? 122 ARG A NE    1 
ATOM   2024 C  CZ    . ARG E  3 122 ? 26.196  16.915 33.662  1.00 35.52  ? 122 ARG A CZ    1 
ATOM   2025 N  NH1   . ARG E  3 122 ? 26.435  15.922 34.508  1.00 38.36  ? 122 ARG A NH1   1 
ATOM   2026 N  NH2   . ARG E  3 122 ? 26.102  18.158 34.118  1.00 37.44  ? 122 ARG A NH2   1 
ATOM   2027 N  N     . ASP E  3 123 ? 21.667  11.351 30.062  1.00 19.62  ? 123 ASP A N     1 
ATOM   2028 C  CA    . ASP E  3 123 ? 21.104  10.671 28.909  1.00 18.29  ? 123 ASP A CA    1 
ATOM   2029 C  C     . ASP E  3 123 ? 20.079  11.618 28.295  1.00 20.61  ? 123 ASP A C     1 
ATOM   2030 O  O     . ASP E  3 123 ? 18.917  11.622 28.699  1.00 18.37  ? 123 ASP A O     1 
ATOM   2031 C  CB    . ASP E  3 123 ? 20.408  9.382  29.347  1.00 21.07  ? 123 ASP A CB    1 
ATOM   2032 C  CG    . ASP E  3 123 ? 20.033  8.499  28.177  1.00 22.04  ? 123 ASP A CG    1 
ATOM   2033 O  OD1   . ASP E  3 123 ? 19.853  9.028  27.053  1.00 18.12  ? 123 ASP A OD1   1 
ATOM   2034 O  OD2   . ASP E  3 123 ? 19.911  7.275  28.389  1.00 23.99  ? 123 ASP A OD2   1 
ATOM   2035 N  N     . ALA E  3 124 ? 20.515  12.421 27.328  1.00 17.91  ? 124 ALA A N     1 
ATOM   2036 C  CA    . ALA E  3 124 ? 19.633  13.380 26.680  1.00 19.36  ? 124 ALA A CA    1 
ATOM   2037 C  C     . ALA E  3 124 ? 18.495  12.691 25.926  1.00 21.89  ? 124 ALA A C     1 
ATOM   2038 O  O     . ALA E  3 124 ? 17.357  13.154 25.959  1.00 19.40  ? 124 ALA A O     1 
ATOM   2039 C  CB    . ALA E  3 124 ? 20.440  14.273 25.729  1.00 16.46  ? 124 ALA A CB    1 
ATOM   2040 N  N     . ASN E  3 125 ? 18.793  11.582 25.252  1.00 21.22  ? 125 ASN A N     1 
ATOM   2041 C  CA    . ASN E  3 125 ? 17.759  10.869 24.500  1.00 22.61  ? 125 ASN A CA    1 
ATOM   2042 C  C     . ASN E  3 125 ? 16.673  10.348 25.429  1.00 16.54  ? 125 ASN A C     1 
ATOM   2043 O  O     . ASN E  3 125 ? 15.482  10.480 25.143  1.00 20.13  ? 125 ASN A O     1 
ATOM   2044 C  CB    . ASN E  3 125 ? 18.356  9.690  23.721  1.00 22.45  ? 125 ASN A CB    1 
ATOM   2045 C  CG    . ASN E  3 125 ? 19.429  10.114 22.741  1.00 27.66  ? 125 ASN A CG    1 
ATOM   2046 O  OD1   . ASN E  3 125 ? 19.395  11.220 22.202  1.00 28.73  ? 125 ASN A OD1   1 
ATOM   2047 N  ND2   . ASN E  3 125 ? 20.383  9.221  22.488  1.00 29.27  ? 125 ASN A ND2   1 
ATOM   2048 N  N     . PHE E  3 126 ? 17.088  9.744  26.539  1.00 15.39  ? 126 PHE A N     1 
ATOM   2049 C  CA    . PHE E  3 126 ? 16.140  9.207  27.507  1.00 19.57  ? 126 PHE A CA    1 
ATOM   2050 C  C     . PHE E  3 126 ? 15.251  10.306 28.070  1.00 18.93  ? 126 PHE A C     1 
ATOM   2051 O  O     . PHE E  3 126 ? 14.030  10.177 28.126  1.00 18.90  ? 126 PHE A O     1 
ATOM   2052 C  CB    . PHE E  3 126 ? 16.862  8.556  28.691  1.00 19.50  ? 126 PHE A CB    1 
ATOM   2053 C  CG    . PHE E  3 126 ? 15.945  8.233  29.838  1.00 16.28  ? 126 PHE A CG    1 
ATOM   2054 C  CD1   . PHE E  3 126 ? 15.075  7.145  29.763  1.00 22.49  ? 126 PHE A CD1   1 
ATOM   2055 C  CD2   . PHE E  3 126 ? 15.892  9.057  30.958  1.00 20.42  ? 126 PHE A CD2   1 
ATOM   2056 C  CE1   . PHE E  3 126 ? 14.160  6.886  30.789  1.00 25.87  ? 126 PHE A CE1   1 
ATOM   2057 C  CE2   . PHE E  3 126 ? 14.984  8.811  31.987  1.00 25.75  ? 126 PHE A CE2   1 
ATOM   2058 C  CZ    . PHE E  3 126 ? 14.115  7.725  31.904  1.00 23.68  ? 126 PHE A CZ    1 
ATOM   2059 N  N     . THR E  3 127 ? 15.881  11.385 28.509  1.00 16.76  ? 127 THR A N     1 
ATOM   2060 C  CA    . THR E  3 127 ? 15.140  12.482 29.114  1.00 16.67  ? 127 THR A CA    1 
ATOM   2061 C  C     . THR E  3 127 ? 14.172  13.137 28.129  1.00 15.48  ? 127 THR A C     1 
ATOM   2062 O  O     . THR E  3 127 ? 13.050  13.491 28.501  1.00 16.58  ? 127 THR A O     1 
ATOM   2063 C  CB    . THR E  3 127 ? 16.113  13.521 29.698  1.00 19.01  ? 127 THR A CB    1 
ATOM   2064 O  OG1   . THR E  3 127 ? 17.084  12.842 30.506  1.00 18.74  ? 127 THR A OG1   1 
ATOM   2065 C  CG2   . THR E  3 127 ? 15.366  14.525 30.565  1.00 16.71  ? 127 THR A CG2   1 
ATOM   2066 N  N     . ARG E  3 128 ? 14.596  13.284 26.877  1.00 16.67  ? 128 ARG A N     1 
ATOM   2067 C  CA    . ARG E  3 128 ? 13.742  13.879 25.852  1.00 17.81  ? 128 ARG A CA    1 
ATOM   2068 C  C     . ARG E  3 128 ? 12.498  13.015 25.648  1.00 19.64  ? 128 ARG A C     1 
ATOM   2069 O  O     . ARG E  3 128 ? 11.372  13.523 25.585  1.00 19.95  ? 128 ARG A O     1 
ATOM   2070 C  CB    . ARG E  3 128 ? 14.501  13.991 24.526  1.00 19.92  ? 128 ARG A CB    1 
ATOM   2071 C  CG    . ARG E  3 128 ? 13.695  14.575 23.361  1.00 16.72  ? 128 ARG A CG    1 
ATOM   2072 C  CD    . ARG E  3 128 ? 14.409  14.292 22.036  1.00 18.97  ? 128 ARG A CD    1 
ATOM   2073 N  NE    . ARG E  3 128 ? 14.371  12.861 21.742  1.00 20.62  ? 128 ARG A NE    1 
ATOM   2074 C  CZ    . ARG E  3 128 ? 15.315  12.194 21.085  1.00 27.23  ? 128 ARG A CZ    1 
ATOM   2075 N  NH1   . ARG E  3 128 ? 16.397  12.819 20.635  1.00 23.22  ? 128 ARG A NH1   1 
ATOM   2076 N  NH2   . ARG E  3 128 ? 15.178  10.888 20.889  1.00 25.52  ? 128 ARG A NH2   1 
ATOM   2077 N  N     . GLU E  3 129 ? 12.695  11.705 25.559  1.00 16.40  ? 129 GLU A N     1 
ATOM   2078 C  CA    . GLU E  3 129 ? 11.558  10.816 25.345  1.00 19.87  ? 129 GLU A CA    1 
ATOM   2079 C  C     . GLU E  3 129 ? 10.635  10.737 26.558  1.00 19.24  ? 129 GLU A C     1 
ATOM   2080 O  O     . GLU E  3 129 ? 9.422   10.562 26.408  1.00 22.71  ? 129 GLU A O     1 
ATOM   2081 C  CB    . GLU E  3 129 ? 12.048  9.419  24.929  1.00 17.99  ? 129 GLU A CB    1 
ATOM   2082 C  CG    . GLU E  3 129 ? 12.693  9.390  23.538  1.00 20.38  ? 129 GLU A CG    1 
ATOM   2083 C  CD    . GLU E  3 129 ? 11.831  10.056 22.474  1.00 28.97  ? 129 GLU A CD    1 
ATOM   2084 O  OE1   . GLU E  3 129 ? 10.616  9.772  22.434  1.00 30.65  ? 129 GLU A OE1   1 
ATOM   2085 O  OE2   . GLU E  3 129 ? 12.365  10.857 21.670  1.00 26.80  ? 129 GLU A OE2   1 
ATOM   2086 N  N     . LEU E  3 130 ? 11.189  10.866 27.761  1.00 20.31  ? 130 LEU A N     1 
ATOM   2087 C  CA    . LEU E  3 130 ? 10.355  10.835 28.956  1.00 18.49  ? 130 LEU A CA    1 
ATOM   2088 C  C     . LEU E  3 130 ? 9.507   12.114 28.961  1.00 22.18  ? 130 LEU A C     1 
ATOM   2089 O  O     . LEU E  3 130 ? 8.317   12.088 29.299  1.00 20.38  ? 130 LEU A O     1 
ATOM   2090 C  CB    . LEU E  3 130 ? 11.206  10.780 30.227  1.00 18.31  ? 130 LEU A CB    1 
ATOM   2091 C  CG    . LEU E  3 130 ? 10.402  10.688 31.533  1.00 25.43  ? 130 LEU A CG    1 
ATOM   2092 C  CD1   . LEU E  3 130 ? 9.694   9.337  31.603  1.00 23.87  ? 130 LEU A CD1   1 
ATOM   2093 C  CD2   . LEU E  3 130 ? 11.327  10.863 32.734  1.00 25.40  ? 130 LEU A CD2   1 
ATOM   2094 N  N     . PHE E  3 131 ? 10.131  13.230 28.585  1.00 17.27  ? 131 PHE A N     1 
ATOM   2095 C  CA    . PHE E  3 131 ? 9.436   14.518 28.528  1.00 20.34  ? 131 PHE A CA    1 
ATOM   2096 C  C     . PHE E  3 131 ? 8.289   14.414 27.519  1.00 18.52  ? 131 PHE A C     1 
ATOM   2097 O  O     . PHE E  3 131 ? 7.179   14.879 27.778  1.00 19.38  ? 131 PHE A O     1 
ATOM   2098 C  CB    . PHE E  3 131 ? 10.407  15.625 28.096  1.00 18.48  ? 131 PHE A CB    1 
ATOM   2099 C  CG    . PHE E  3 131 ? 9.787   17.006 28.038  1.00 14.52  ? 131 PHE A CG    1 
ATOM   2100 C  CD1   . PHE E  3 131 ? 9.774   17.828 29.160  1.00 14.24  ? 131 PHE A CD1   1 
ATOM   2101 C  CD2   . PHE E  3 131 ? 9.244   17.484 26.851  1.00 16.91  ? 131 PHE A CD2   1 
ATOM   2102 C  CE1   . PHE E  3 131 ? 9.228   19.125 29.100  1.00 18.27  ? 131 PHE A CE1   1 
ATOM   2103 C  CE2   . PHE E  3 131 ? 8.695   18.773 26.774  1.00 19.95  ? 131 PHE A CE2   1 
ATOM   2104 C  CZ    . PHE E  3 131 ? 8.689   19.592 27.902  1.00 18.84  ? 131 PHE A CZ    1 
ATOM   2105 N  N     . TYR E  3 132 ? 8.555   13.796 26.372  1.00 16.49  ? 132 TYR A N     1 
ATOM   2106 C  CA    . TYR E  3 132 ? 7.514   13.641 25.357  1.00 17.51  ? 132 TYR A CA    1 
ATOM   2107 C  C     . TYR E  3 132 ? 6.415   12.684 25.816  1.00 21.78  ? 132 TYR A C     1 
ATOM   2108 O  O     . TYR E  3 132 ? 5.235   12.889 25.517  1.00 19.94  ? 132 TYR A O     1 
ATOM   2109 C  CB    . TYR E  3 132 ? 8.095   13.119 24.043  1.00 19.05  ? 132 TYR A CB    1 
ATOM   2110 C  CG    . TYR E  3 132 ? 9.020   14.074 23.319  1.00 19.29  ? 132 TYR A CG    1 
ATOM   2111 C  CD1   . TYR E  3 132 ? 8.982   15.449 23.567  1.00 17.09  ? 132 TYR A CD1   1 
ATOM   2112 C  CD2   . TYR E  3 132 ? 9.902   13.604 22.348  1.00 18.95  ? 132 TYR A CD2   1 
ATOM   2113 C  CE1   . TYR E  3 132 ? 9.799   16.322 22.867  1.00 18.74  ? 132 TYR A CE1   1 
ATOM   2114 C  CE2   . TYR E  3 132 ? 10.719  14.470 21.638  1.00 20.96  ? 132 TYR A CE2   1 
ATOM   2115 C  CZ    . TYR E  3 132 ? 10.664  15.830 21.904  1.00 18.11  ? 132 TYR A CZ    1 
ATOM   2116 O  OH    . TYR E  3 132 ? 11.482  16.691 21.214  1.00 17.53  ? 132 TYR A OH    1 
ATOM   2117 N  N     . LYS E  3 133 ? 6.798   11.625 26.523  1.00 19.33  ? 133 LYS A N     1 
ATOM   2118 C  CA    . LYS E  3 133 ? 5.807   10.667 27.003  1.00 22.89  ? 133 LYS A CA    1 
ATOM   2119 C  C     . LYS E  3 133 ? 4.758   11.419 27.813  1.00 25.17  ? 133 LYS A C     1 
ATOM   2120 O  O     . LYS E  3 133 ? 3.559   11.159 27.707  1.00 25.27  ? 133 LYS A O     1 
ATOM   2121 C  CB    . LYS E  3 133 ? 6.472   9.604  27.881  1.00 27.42  ? 133 LYS A CB    1 
ATOM   2122 C  CG    . LYS E  3 133 ? 5.502   8.579  28.452  1.00 36.39  ? 133 LYS A CG    1 
ATOM   2123 C  CD    . LYS E  3 133 ? 6.222   7.545  29.310  1.00 40.36  ? 133 LYS A CD    1 
ATOM   2124 C  CE    . LYS E  3 133 ? 5.244   6.521  29.870  1.00 49.46  ? 133 LYS A CE    1 
ATOM   2125 N  NZ    . LYS E  3 133 ? 4.524   5.797  28.784  1.00 42.36  ? 133 LYS A NZ    1 
ATOM   2126 N  N     . LEU E  3 134 ? 5.224   12.375 28.609  1.00 19.69  ? 134 LEU A N     1 
ATOM   2127 C  CA    . LEU E  3 134 ? 4.349   13.167 29.455  1.00 19.46  ? 134 LEU A CA    1 
ATOM   2128 C  C     . LEU E  3 134 ? 3.662   14.353 28.791  1.00 23.89  ? 134 LEU A C     1 
ATOM   2129 O  O     . LEU E  3 134 ? 2.480   14.599 29.038  1.00 24.19  ? 134 LEU A O     1 
ATOM   2130 C  CB    . LEU E  3 134 ? 5.131   13.699 30.666  1.00 25.34  ? 134 LEU A CB    1 
ATOM   2131 C  CG    . LEU E  3 134 ? 5.588   12.708 31.739  1.00 24.90  ? 134 LEU A CG    1 
ATOM   2132 C  CD1   . LEU E  3 134 ? 6.500   13.409 32.736  1.00 25.83  ? 134 LEU A CD1   1 
ATOM   2133 C  CD2   . LEU E  3 134 ? 4.372   12.124 32.441  1.00 31.39  ? 134 LEU A CD2   1 
ATOM   2134 N  N     . PHE E  3 135 ? 4.383   15.070 27.931  1.00 20.72  ? 135 PHE A N     1 
ATOM   2135 C  CA    . PHE E  3 135 ? 3.836   16.292 27.345  1.00 21.33  ? 135 PHE A CA    1 
ATOM   2136 C  C     . PHE E  3 135 ? 3.700   16.450 25.830  1.00 22.72  ? 135 PHE A C     1 
ATOM   2137 O  O     . PHE E  3 135 ? 3.128   17.441 25.364  1.00 23.32  ? 135 PHE A O     1 
ATOM   2138 C  CB    . PHE E  3 135 ? 4.650   17.479 27.871  1.00 19.17  ? 135 PHE A CB    1 
ATOM   2139 C  CG    . PHE E  3 135 ? 4.818   17.494 29.364  1.00 22.14  ? 135 PHE A CG    1 
ATOM   2140 C  CD1   . PHE E  3 135 ? 3.715   17.593 30.207  1.00 19.83  ? 135 PHE A CD1   1 
ATOM   2141 C  CD2   . PHE E  3 135 ? 6.089   17.433 29.932  1.00 21.32  ? 135 PHE A CD2   1 
ATOM   2142 C  CE1   . PHE E  3 135 ? 3.879   17.635 31.598  1.00 20.63  ? 135 PHE A CE1   1 
ATOM   2143 C  CE2   . PHE E  3 135 ? 6.260   17.474 31.317  1.00 18.74  ? 135 PHE A CE2   1 
ATOM   2144 C  CZ    . PHE E  3 135 ? 5.157   17.576 32.151  1.00 18.51  ? 135 PHE A CZ    1 
ATOM   2145 N  N     . LYS E  3 136 ? 4.224   15.511 25.055  1.00 19.39  ? 136 LYS A N     1 
ATOM   2146 C  CA    . LYS E  3 136 ? 4.146   15.642 23.609  1.00 19.57  ? 136 LYS A CA    1 
ATOM   2147 C  C     . LYS E  3 136 ? 2.725   15.896 23.101  1.00 22.00  ? 136 LYS A C     1 
ATOM   2148 O  O     . LYS E  3 136 ? 2.490   16.830 22.337  1.00 22.74  ? 136 LYS A O     1 
ATOM   2149 C  CB    . LYS E  3 136 ? 4.709   14.394 22.931  1.00 19.76  ? 136 LYS A CB    1 
ATOM   2150 C  CG    . LYS E  3 136 ? 4.571   14.424 21.420  1.00 23.94  ? 136 LYS A CG    1 
ATOM   2151 C  CD    . LYS E  3 136 ? 5.230   13.213 20.800  1.00 27.69  ? 136 LYS A CD    1 
ATOM   2152 C  CE    . LYS E  3 136 ? 5.110   13.235 19.294  1.00 37.31  ? 136 LYS A CE    1 
ATOM   2153 N  NZ    . LYS E  3 136 ? 5.808   12.070 18.675  1.00 42.86  ? 136 LYS A NZ    1 
ATOM   2154 N  N     . GLU E  3 137 ? 1.778   15.060 23.512  1.00 21.84  ? 137 GLU A N     1 
ATOM   2155 C  CA    . GLU E  3 137 ? 0.401   15.245 23.062  1.00 25.01  ? 137 GLU A CA    1 
ATOM   2156 C  C     . GLU E  3 137 ? -0.204  16.554 23.565  1.00 25.37  ? 137 GLU A C     1 
ATOM   2157 O  O     . GLU E  3 137 ? -0.963  17.205 22.844  1.00 27.07  ? 137 GLU A O     1 
ATOM   2158 C  CB    . GLU E  3 137 ? -0.465  14.053 23.483  1.00 29.80  ? 137 GLU A CB    1 
ATOM   2159 C  CG    . GLU E  3 137 ? -0.148  12.764 22.732  1.00 39.35  ? 137 GLU A CG    1 
ATOM   2160 C  CD    . GLU E  3 137 ? -0.228  12.923 21.217  1.00 50.26  ? 137 GLU A CD    1 
ATOM   2161 O  OE1   . GLU E  3 137 ? -1.260  13.426 20.720  1.00 56.20  ? 137 GLU A OE1   1 
ATOM   2162 O  OE2   . GLU E  3 137 ? 0.738   12.539 20.522  1.00 48.54  ? 137 GLU A OE2   1 
ATOM   2163 N  N     . ASP E  3 138 ? 0.128   16.949 24.791  1.00 22.66  ? 138 ASP A N     1 
ATOM   2164 C  CA    . ASP E  3 138 ? -0.384  18.204 25.336  1.00 27.86  ? 138 ASP A CA    1 
ATOM   2165 C  C     . ASP E  3 138 ? 0.100   19.393 24.504  1.00 29.40  ? 138 ASP A C     1 
ATOM   2166 O  O     . ASP E  3 138 ? -0.656  20.328 24.236  1.00 25.49  ? 138 ASP A O     1 
ATOM   2167 C  CB    . ASP E  3 138 ? 0.071   18.403 26.785  1.00 27.16  ? 138 ASP A CB    1 
ATOM   2168 C  CG    . ASP E  3 138 ? -0.534  17.388 27.736  1.00 39.73  ? 138 ASP A CG    1 
ATOM   2169 O  OD1   . ASP E  3 138 ? -1.736  17.079 27.592  1.00 39.28  ? 138 ASP A OD1   1 
ATOM   2170 O  OD2   . ASP E  3 138 ? 0.189   16.914 28.638  1.00 33.60  ? 138 ASP A OD2   1 
ATOM   2171 N  N     . ILE E  3 139 ? 1.371   19.359 24.115  1.00 22.60  ? 139 ILE A N     1 
ATOM   2172 C  CA    . ILE E  3 139 ? 1.960   20.430 23.317  1.00 22.21  ? 139 ILE A CA    1 
ATOM   2173 C  C     . ILE E  3 139 ? 1.326   20.494 21.928  1.00 21.24  ? 139 ILE A C     1 
ATOM   2174 O  O     . ILE E  3 139 ? 0.888   21.554 21.481  1.00 22.24  ? 139 ILE A O     1 
ATOM   2175 C  CB    . ILE E  3 139 ? 3.490   20.228 23.168  1.00 21.50  ? 139 ILE A CB    1 
ATOM   2176 C  CG1   . ILE E  3 139 ? 4.163   20.395 24.532  1.00 21.80  ? 139 ILE A CG1   1 
ATOM   2177 C  CG2   . ILE E  3 139 ? 4.066   21.231 22.168  1.00 24.51  ? 139 ILE A CG2   1 
ATOM   2178 C  CD1   . ILE E  3 139 ? 5.616   19.941 24.561  1.00 22.42  ? 139 ILE A CD1   1 
ATOM   2179 N  N     . LEU E  3 140 ? 1.279   19.359 21.245  1.00 21.05  ? 140 LEU A N     1 
ATOM   2180 C  CA    . LEU E  3 140 ? 0.692   19.322 19.912  1.00 26.91  ? 140 LEU A CA    1 
ATOM   2181 C  C     . LEU E  3 140 ? -0.778  19.726 19.931  1.00 26.38  ? 140 LEU A C     1 
ATOM   2182 O  O     . LEU E  3 140 ? -1.244  20.419 19.027  1.00 28.07  ? 140 LEU A O     1 
ATOM   2183 C  CB    . LEU E  3 140 ? 0.845   17.928 19.299  1.00 24.80  ? 140 LEU A CB    1 
ATOM   2184 C  CG    . LEU E  3 140 ? 2.298   17.520 19.016  1.00 26.86  ? 140 LEU A CG    1 
ATOM   2185 C  CD1   . LEU E  3 140 ? 2.345   16.116 18.448  1.00 25.99  ? 140 LEU A CD1   1 
ATOM   2186 C  CD2   . LEU E  3 140 ? 2.920   18.508 18.042  1.00 31.34  ? 140 LEU A CD2   1 
ATOM   2187 N  N     . SER E  3 141 ? -1.504  19.306 20.963  1.00 26.42  ? 141 SER A N     1 
ATOM   2188 C  CA    . SER E  3 141 ? -2.921  19.637 21.064  1.00 27.98  ? 141 SER A CA    1 
ATOM   2189 C  C     . SER E  3 141 ? -3.125  21.127 21.333  1.00 28.37  ? 141 SER A C     1 
ATOM   2190 O  O     . SER E  3 141 ? -4.056  21.742 20.803  1.00 29.18  ? 141 SER A O     1 
ATOM   2191 C  CB    . SER E  3 141 ? -3.586  18.814 22.172  1.00 31.00  ? 141 SER A CB    1 
ATOM   2192 O  OG    . SER E  3 141 ? -3.069  19.156 23.446  1.00 42.45  ? 141 SER A OG    1 
ATOM   2193 N  N     . ALA E  3 142 ? -2.263  21.708 22.161  1.00 25.66  ? 142 ALA A N     1 
ATOM   2194 C  CA    . ALA E  3 142 ? -2.370  23.129 22.463  1.00 27.16  ? 142 ALA A CA    1 
ATOM   2195 C  C     . ALA E  3 142 ? -2.223  23.907 21.164  1.00 27.07  ? 142 ALA A C     1 
ATOM   2196 O  O     . ALA E  3 142 ? -2.885  24.925 20.957  1.00 26.10  ? 142 ALA A O     1 
ATOM   2197 C  CB    . ALA E  3 142 ? -1.282  23.551 23.452  1.00 27.37  ? 142 ALA A CB    1 
ATOM   2198 N  N     . ILE E  3 143 ? -1.350  23.419 20.287  1.00 27.11  ? 143 ILE A N     1 
ATOM   2199 C  CA    . ILE E  3 143 ? -1.116  24.078 19.009  1.00 27.20  ? 143 ILE A CA    1 
ATOM   2200 C  C     . ILE E  3 143 ? -2.333  23.934 18.105  1.00 29.62  ? 143 ILE A C     1 
ATOM   2201 O  O     . ILE E  3 143 ? -2.895  24.924 17.645  1.00 32.16  ? 143 ILE A O     1 
ATOM   2202 C  CB    . ILE E  3 143 ? 0.104   23.482 18.273  1.00 26.23  ? 143 ILE A CB    1 
ATOM   2203 C  CG1   . ILE E  3 143 ? 1.384   23.748 19.077  1.00 25.53  ? 143 ILE A CG1   1 
ATOM   2204 C  CG2   . ILE E  3 143 ? 0.223   24.100 16.878  1.00 26.11  ? 143 ILE A CG2   1 
ATOM   2205 C  CD1   . ILE E  3 143 ? 2.619   23.046 18.511  1.00 23.42  ? 143 ILE A CD1   1 
ATOM   2206 N  N     . LYS E  3 144 ? -2.739  22.691 17.868  1.00 29.65  ? 144 LYS A N     1 
ATOM   2207 C  CA    . LYS E  3 144 ? -3.876  22.404 16.996  1.00 30.66  ? 144 LYS A CA    1 
ATOM   2208 C  C     . LYS E  3 144 ? -5.197  23.010 17.460  1.00 30.22  ? 144 LYS A C     1 
ATOM   2209 O  O     . LYS E  3 144 ? -6.007  23.431 16.638  1.00 34.36  ? 144 LYS A O     1 
ATOM   2210 C  CB    . LYS E  3 144 ? -4.038  20.890 16.834  1.00 27.66  ? 144 LYS A CB    1 
ATOM   2211 C  CG    . LYS E  3 144 ? -2.835  20.203 16.194  1.00 40.60  ? 144 LYS A CG    1 
ATOM   2212 C  CD    . LYS E  3 144 ? -3.032  18.697 16.092  1.00 46.06  ? 144 LYS A CD    1 
ATOM   2213 C  CE    . LYS E  3 144 ? -4.233  18.348 15.219  1.00 54.42  ? 144 LYS A CE    1 
ATOM   2214 N  NZ    . LYS E  3 144 ? -4.080  18.859 13.825  1.00 60.35  ? 144 LYS A NZ    1 
ATOM   2215 N  N     . GLU E  3 145 ? -5.412  23.059 18.770  1.00 28.60  ? 145 GLU A N     1 
ATOM   2216 C  CA    . GLU E  3 145 ? -6.655  23.597 19.315  1.00 32.55  ? 145 GLU A CA    1 
ATOM   2217 C  C     . GLU E  3 145 ? -6.652  25.101 19.589  1.00 34.19  ? 145 GLU A C     1 
ATOM   2218 O  O     . GLU E  3 145 ? -7.553  25.622 20.251  1.00 33.30  ? 145 GLU A O     1 
ATOM   2219 C  CB    . GLU E  3 145 ? -7.031  22.820 20.577  1.00 30.96  ? 145 GLU A CB    1 
ATOM   2220 C  CG    . GLU E  3 145 ? -7.452  21.387 20.280  1.00 36.39  ? 145 GLU A CG    1 
ATOM   2221 C  CD    . GLU E  3 145 ? -7.630  20.544 21.525  1.00 45.53  ? 145 GLU A CD    1 
ATOM   2222 O  OE1   . GLU E  3 145 ? -8.145  21.064 22.537  1.00 50.58  ? 145 GLU A OE1   1 
ATOM   2223 O  OE2   . GLU E  3 145 ? -7.265  19.349 21.485  1.00 50.73  ? 145 GLU A OE2   1 
ATOM   2224 N  N     . GLY E  3 146 ? -5.634  25.790 19.081  1.00 31.84  ? 146 GLY A N     1 
ATOM   2225 C  CA    . GLY E  3 146 ? -5.540  27.234 19.244  1.00 32.59  ? 146 GLY A CA    1 
ATOM   2226 C  C     . GLY E  3 146 ? -5.286  27.810 20.628  1.00 33.82  ? 146 GLY A C     1 
ATOM   2227 O  O     . GLY E  3 146 ? -5.689  28.940 20.899  1.00 34.96  ? 146 GLY A O     1 
ATOM   2228 N  N     . ARG E  3 147 ? -4.619  27.065 21.505  1.00 26.36  ? 147 ARG A N     1 
ATOM   2229 C  CA    . ARG E  3 147 ? -4.346  27.576 22.846  1.00 26.44  ? 147 ARG A CA    1 
ATOM   2230 C  C     . ARG E  3 147 ? -2.995  28.275 22.971  1.00 29.10  ? 147 ARG A C     1 
ATOM   2231 O  O     . ARG E  3 147 ? -2.600  28.686 24.066  1.00 31.66  ? 147 ARG A O     1 
ATOM   2232 C  CB    . ARG E  3 147 ? -4.452  26.457 23.883  1.00 28.70  ? 147 ARG A CB    1 
ATOM   2233 C  CG    . ARG E  3 147 ? -5.888  26.018 24.158  1.00 33.58  ? 147 ARG A CG    1 
ATOM   2234 C  CD    . ARG E  3 147 ? -5.963  25.126 25.388  1.00 34.15  ? 147 ARG A CD    1 
ATOM   2235 N  NE    . ARG E  3 147 ? -5.325  23.830 25.176  1.00 38.00  ? 147 ARG A NE    1 
ATOM   2236 C  CZ    . ARG E  3 147 ? -5.841  22.859 24.427  1.00 42.85  ? 147 ARG A CZ    1 
ATOM   2237 N  NH1   . ARG E  3 147 ? -7.006  23.040 23.818  1.00 41.08  ? 147 ARG A NH1   1 
ATOM   2238 N  NH2   . ARG E  3 147 ? -5.199  21.705 24.291  1.00 36.85  ? 147 ARG A NH2   1 
ATOM   2239 N  N     . VAL E  3 148 ? -2.284  28.410 21.857  1.00 21.92  ? 148 VAL A N     1 
ATOM   2240 C  CA    . VAL E  3 148 ? -1.002  29.105 21.885  1.00 24.91  ? 148 VAL A CA    1 
ATOM   2241 C  C     . VAL E  3 148 ? -1.343  30.590 21.941  1.00 27.41  ? 148 VAL A C     1 
ATOM   2242 O  O     . VAL E  3 148 ? -2.075  31.099 21.089  1.00 28.12  ? 148 VAL A O     1 
ATOM   2243 C  CB    . VAL E  3 148 ? -0.162  28.810 20.621  1.00 24.52  ? 148 VAL A CB    1 
ATOM   2244 C  CG1   . VAL E  3 148 ? 1.045   29.739 20.567  1.00 27.51  ? 148 VAL A CG1   1 
ATOM   2245 C  CG2   . VAL E  3 148 ? 0.298   27.354 20.633  1.00 27.82  ? 148 VAL A CG2   1 
ATOM   2246 N  N     . LYS E  3 149 ? -0.828  31.290 22.944  1.00 26.15  ? 149 LYS A N     1 
ATOM   2247 C  CA    . LYS E  3 149 ? -1.137  32.703 23.065  1.00 29.59  ? 149 LYS A CA    1 
ATOM   2248 C  C     . LYS E  3 149 ? -0.497  33.567 21.993  1.00 32.16  ? 149 LYS A C     1 
ATOM   2249 O  O     . LYS E  3 149 ? 0.610   33.294 21.522  1.00 27.86  ? 149 LYS A O     1 
ATOM   2250 C  CB    . LYS E  3 149 ? -0.784  33.207 24.465  1.00 32.14  ? 149 LYS A CB    1 
ATOM   2251 C  CG    . LYS E  3 149 ? -1.713  32.603 25.511  1.00 41.84  ? 149 LYS A CG    1 
ATOM   2252 C  CD    . LYS E  3 149 ? -1.672  33.318 26.842  1.00 47.27  ? 149 LYS A CD    1 
ATOM   2253 C  CE    . LYS E  3 149 ? -2.773  32.787 27.752  1.00 44.46  ? 149 LYS A CE    1 
ATOM   2254 N  NZ    . LYS E  3 149 ? -2.768  33.444 29.088  1.00 44.25  ? 149 LYS A NZ    1 
ATOM   2255 N  N     . LYS E  3 150 ? -1.226  34.606 21.599  1.00 32.36  ? 150 LYS A N     1 
ATOM   2256 C  CA    . LYS E  3 150 ? -0.771  35.527 20.568  1.00 33.23  ? 150 LYS A CA    1 
ATOM   2257 C  C     . LYS E  3 150 ? 0.022   36.680 21.169  1.00 28.97  ? 150 LYS A C     1 
ATOM   2258 O  O     . LYS E  3 150 ? -0.182  37.052 22.323  1.00 27.65  ? 150 LYS A O     1 
ATOM   2259 C  CB    . LYS E  3 150 ? -1.972  36.096 19.805  1.00 38.30  ? 150 LYS A CB    1 
ATOM   2260 C  CG    . LYS E  3 150 ? -2.950  35.049 19.290  1.00 48.92  ? 150 LYS A CG    1 
ATOM   2261 C  CD    . LYS E  3 150 ? -2.273  34.060 18.358  1.00 58.52  ? 150 LYS A CD    1 
ATOM   2262 C  CE    . LYS E  3 150 ? -3.241  32.969 17.929  1.00 64.81  ? 150 LYS A CE    1 
ATOM   2263 N  NZ    . LYS E  3 150 ? -3.797  32.231 19.101  1.00 68.30  ? 150 LYS A NZ    1 
ATOM   2264 N  N     . ASP E  3 151 ? 0.929   37.232 20.369  1.00 27.36  ? 151 ASP A N     1 
ATOM   2265 C  CA    . ASP E  3 151 ? 1.754   38.362 20.768  1.00 23.39  ? 151 ASP A CA    1 
ATOM   2266 C  C     . ASP E  3 151 ? 1.025   39.597 20.230  1.00 22.86  ? 151 ASP A C     1 
ATOM   2267 O  O     . ASP E  3 151 ? 1.302   40.068 19.132  1.00 26.42  ? 151 ASP A O     1 
ATOM   2268 C  CB    . ASP E  3 151 ? 3.132   38.210 20.135  1.00 24.35  ? 151 ASP A CB    1 
ATOM   2269 C  CG    . ASP E  3 151 ? 4.021   39.409 20.361  1.00 24.22  ? 151 ASP A CG    1 
ATOM   2270 O  OD1   . ASP E  3 151 ? 3.612   40.345 21.081  1.00 27.23  ? 151 ASP A OD1   1 
ATOM   2271 O  OD2   . ASP E  3 151 ? 5.138   39.404 19.805  1.00 28.73  ? 151 ASP A OD2   1 
ATOM   2272 N  N     . TYR E  3 152 ? 0.084   40.108 21.016  1.00 29.57  ? 152 TYR A N     1 
ATOM   2273 C  CA    . TYR E  3 152 ? -0.718  41.252 20.602  1.00 31.04  ? 152 TYR A CA    1 
ATOM   2274 C  C     . TYR E  3 152 ? 0.025   42.557 20.338  1.00 28.04  ? 152 TYR A C     1 
ATOM   2275 O  O     . TYR E  3 152 ? -0.352  43.301 19.437  1.00 25.47  ? 152 TYR A O     1 
ATOM   2276 C  CB    . TYR E  3 152 ? -1.848  41.477 21.607  1.00 33.14  ? 152 TYR A CB    1 
ATOM   2277 C  CG    . TYR E  3 152 ? -2.781  40.291 21.700  1.00 43.60  ? 152 TYR A CG    1 
ATOM   2278 C  CD1   . TYR E  3 152 ? -3.487  39.847 20.580  1.00 49.33  ? 152 TYR A CD1   1 
ATOM   2279 C  CD2   . TYR E  3 152 ? -2.943  39.598 22.898  1.00 43.89  ? 152 TYR A CD2   1 
ATOM   2280 C  CE1   . TYR E  3 152 ? -4.334  38.741 20.652  1.00 50.99  ? 152 TYR A CE1   1 
ATOM   2281 C  CE2   . TYR E  3 152 ? -3.787  38.491 22.981  1.00 49.98  ? 152 TYR A CE2   1 
ATOM   2282 C  CZ    . TYR E  3 152 ? -4.479  38.070 21.855  1.00 51.50  ? 152 TYR A CZ    1 
ATOM   2283 O  OH    . TYR E  3 152 ? -5.319  36.985 21.936  1.00 54.84  ? 152 TYR A OH    1 
ATOM   2284 N  N     . LYS E  3 153 ? 1.075   42.846 21.099  1.00 28.75  ? 153 LYS A N     1 
ATOM   2285 C  CA    . LYS E  3 153 ? 1.810   44.081 20.858  1.00 27.23  ? 153 LYS A CA    1 
ATOM   2286 C  C     . LYS E  3 153 ? 2.474   44.048 19.484  1.00 27.45  ? 153 LYS A C     1 
ATOM   2287 O  O     . LYS E  3 153 ? 2.449   45.039 18.754  1.00 26.78  ? 153 LYS A O     1 
ATOM   2288 C  CB    . LYS E  3 153 ? 2.851   44.325 21.962  1.00 22.01  ? 153 LYS A CB    1 
ATOM   2289 C  CG    . LYS E  3 153 ? 2.225   44.702 23.306  1.00 21.16  ? 153 LYS A CG    1 
ATOM   2290 C  CD    . LYS E  3 153 ? 3.257   45.129 24.351  1.00 22.64  ? 153 LYS A CD    1 
ATOM   2291 C  CE    . LYS E  3 153 ? 3.932   46.451 23.979  1.00 22.19  ? 153 LYS A CE    1 
ATOM   2292 N  NZ    . LYS E  3 153 ? 4.943   46.849 24.999  1.00 21.13  ? 153 LYS A NZ    1 
ATOM   2293 N  N     . THR E  3 154 ? 3.057   42.909 19.119  1.00 25.31  ? 154 THR A N     1 
ATOM   2294 C  CA    . THR E  3 154 ? 3.707   42.794 17.818  1.00 23.59  ? 154 THR A CA    1 
ATOM   2295 C  C     . THR E  3 154 ? 2.669   42.788 16.698  1.00 29.35  ? 154 THR A C     1 
ATOM   2296 O  O     . THR E  3 154 ? 2.831   43.479 15.691  1.00 27.58  ? 154 THR A O     1 
ATOM   2297 C  CB    . THR E  3 154 ? 4.557   41.511 17.719  1.00 27.64  ? 154 THR A CB    1 
ATOM   2298 O  OG1   . THR E  3 154 ? 5.597   41.557 18.703  1.00 27.38  ? 154 THR A OG1   1 
ATOM   2299 C  CG2   . THR E  3 154 ? 5.182   41.382 16.335  1.00 26.64  ? 154 THR A CG2   1 
ATOM   2300 N  N     . ILE E  3 155 ? 1.608   42.006 16.872  1.00 25.64  ? 155 ILE A N     1 
ATOM   2301 C  CA    . ILE E  3 155 ? 0.553   41.944 15.866  1.00 26.14  ? 155 ILE A CA    1 
ATOM   2302 C  C     . ILE E  3 155 ? -0.012  43.340 15.621  1.00 24.06  ? 155 ILE A C     1 
ATOM   2303 O  O     . ILE E  3 155 ? -0.203  43.748 14.477  1.00 27.67  ? 155 ILE A O     1 
ATOM   2304 C  CB    . ILE E  3 155 ? -0.605  41.010 16.306  1.00 29.52  ? 155 ILE A CB    1 
ATOM   2305 C  CG1   . ILE E  3 155 ? -0.131  39.555 16.301  1.00 28.40  ? 155 ILE A CG1   1 
ATOM   2306 C  CG2   . ILE E  3 155 ? -1.796  41.166 15.362  1.00 30.05  ? 155 ILE A CG2   1 
ATOM   2307 C  CD1   . ILE E  3 155 ? -1.163  38.572 16.845  1.00 32.54  ? 155 ILE A CD1   1 
ATOM   2308 N  N     . LEU E  3 156 ? -0.264  44.074 16.698  1.00 23.27  ? 156 LEU A N     1 
ATOM   2309 C  CA    . LEU E  3 156 ? -0.814  45.418 16.575  1.00 29.22  ? 156 LEU A CA    1 
ATOM   2310 C  C     . LEU E  3 156 ? 0.073   46.367 15.773  1.00 32.08  ? 156 LEU A C     1 
ATOM   2311 O  O     . LEU E  3 156 ? -0.418  47.075 14.888  1.00 28.44  ? 156 LEU A O     1 
ATOM   2312 C  CB    . LEU E  3 156 ? -1.079  46.019 17.956  1.00 30.63  ? 156 LEU A CB    1 
ATOM   2313 C  CG    . LEU E  3 156 ? -1.600  47.461 17.963  1.00 30.93  ? 156 LEU A CG    1 
ATOM   2314 C  CD1   . LEU E  3 156 ? -2.964  47.529 17.268  1.00 30.41  ? 156 LEU A CD1   1 
ATOM   2315 C  CD2   . LEU E  3 156 ? -1.714  47.948 19.398  1.00 28.65  ? 156 LEU A CD2   1 
ATOM   2316 N  N     . GLN E  3 157 ? 1.373   46.403 16.059  1.00 25.36  ? 157 GLN A N     1 
ATOM   2317 C  CA    . GLN E  3 157 ? 2.214   47.324 15.304  1.00 26.78  ? 157 GLN A CA    1 
ATOM   2318 C  C     . GLN E  3 157 ? 2.361   46.909 13.848  1.00 28.25  ? 157 GLN A C     1 
ATOM   2319 O  O     . GLN E  3 157 ? 2.661   47.737 12.992  1.00 28.70  ? 157 GLN A O     1 
ATOM   2320 C  CB    . GLN E  3 157 ? 3.594   47.518 15.955  1.00 27.45  ? 157 GLN A CB    1 
ATOM   2321 C  CG    . GLN E  3 157 ? 4.524   46.329 15.964  1.00 25.16  ? 157 GLN A CG    1 
ATOM   2322 C  CD    . GLN E  3 157 ? 5.958   46.757 16.267  1.00 32.09  ? 157 GLN A CD    1 
ATOM   2323 O  OE1   . GLN E  3 157 ? 6.183   47.753 16.957  1.00 30.75  ? 157 GLN A OE1   1 
ATOM   2324 N  NE2   . GLN E  3 157 ? 6.928   46.004 15.761  1.00 26.48  ? 157 GLN A NE2   1 
ATOM   2325 N  N     . GLU E  3 158 ? 2.145   45.632 13.554  1.00 25.09  ? 158 GLU A N     1 
ATOM   2326 C  CA    . GLU E  3 158 ? 2.230   45.190 12.172  1.00 27.29  ? 158 GLU A CA    1 
ATOM   2327 C  C     . GLU E  3 158 ? 0.979   45.680 11.446  1.00 31.45  ? 158 GLU A C     1 
ATOM   2328 O  O     . GLU E  3 158 ? 1.031   46.043 10.271  1.00 32.68  ? 158 GLU A O     1 
ATOM   2329 C  CB    . GLU E  3 158 ? 2.352   43.668 12.102  1.00 31.44  ? 158 GLU A CB    1 
ATOM   2330 C  CG    . GLU E  3 158 ? 3.787   43.198 12.337  1.00 33.48  ? 158 GLU A CG    1 
ATOM   2331 C  CD    . GLU E  3 158 ? 3.922   41.695 12.449  1.00 39.03  ? 158 GLU A CD    1 
ATOM   2332 O  OE1   . GLU E  3 158 ? 3.317   40.969 11.631  1.00 38.32  ? 158 GLU A OE1   1 
ATOM   2333 O  OE2   . GLU E  3 158 ? 4.652   41.239 13.353  1.00 43.70  ? 158 GLU A OE2   1 
ATOM   2334 N  N     . ILE E  3 159 ? -0.142  45.706 12.160  1.00 29.52  ? 159 ILE A N     1 
ATOM   2335 C  CA    . ILE E  3 159 ? -1.390  46.184 11.578  1.00 30.32  ? 159 ILE A CA    1 
ATOM   2336 C  C     . ILE E  3 159 ? -1.277  47.684 11.303  1.00 34.12  ? 159 ILE A C     1 
ATOM   2337 O  O     . ILE E  3 159 ? -1.583  48.147 10.203  1.00 33.71  ? 159 ILE A O     1 
ATOM   2338 C  CB    . ILE E  3 159 ? -2.581  45.956 12.529  1.00 33.70  ? 159 ILE A CB    1 
ATOM   2339 C  CG1   . ILE E  3 159 ? -2.919  44.466 12.598  1.00 31.15  ? 159 ILE A CG1   1 
ATOM   2340 C  CG2   . ILE E  3 159 ? -3.792  46.762 12.056  1.00 36.92  ? 159 ILE A CG2   1 
ATOM   2341 C  CD1   . ILE E  3 159 ? -3.958  44.130 13.652  1.00 31.60  ? 159 ILE A CD1   1 
ATOM   2342 N  N     . THR E  3 160 ? -0.825  48.442 12.300  1.00 30.62  ? 160 THR A N     1 
ATOM   2343 C  CA    . THR E  3 160 ? -0.699  49.888 12.144  1.00 30.71  ? 160 THR A CA    1 
ATOM   2344 C  C     . THR E  3 160 ? 0.412   50.303 11.181  1.00 33.55  ? 160 THR A C     1 
ATOM   2345 O  O     . THR E  3 160 ? 0.286   51.308 10.477  1.00 34.41  ? 160 THR A O     1 
ATOM   2346 C  CB    . THR E  3 160 ? -0.471  50.601 13.507  1.00 31.36  ? 160 THR A CB    1 
ATOM   2347 O  OG1   . THR E  3 160 ? 0.785   50.198 14.072  1.00 30.88  ? 160 THR A OG1   1 
ATOM   2348 C  CG2   . THR E  3 160 ? -1.594  50.259 14.476  1.00 29.79  ? 160 THR A CG2   1 
ATOM   2349 N  N     . GLN E  3 161 ? 1.500   49.541 11.142  1.00 31.53  ? 161 GLN A N     1 
ATOM   2350 C  CA    . GLN E  3 161 ? 2.597   49.875 10.240  1.00 32.85  ? 161 GLN A CA    1 
ATOM   2351 C  C     . GLN E  3 161 ? 2.224   49.585 8.787   1.00 36.41  ? 161 GLN A C     1 
ATOM   2352 O  O     . GLN E  3 161 ? 2.682   50.273 7.873   1.00 36.14  ? 161 GLN A O     1 
ATOM   2353 C  CB    . GLN E  3 161 ? 3.878   49.115 10.638  1.00 31.65  ? 161 GLN A CB    1 
ATOM   2354 C  CG    . GLN E  3 161 ? 4.582   49.720 11.865  1.00 28.04  ? 161 GLN A CG    1 
ATOM   2355 C  CD    . GLN E  3 161 ? 5.904   49.035 12.230  1.00 34.54  ? 161 GLN A CD    1 
ATOM   2356 O  OE1   . GLN E  3 161 ? 6.819   49.681 12.734  1.00 30.98  ? 161 GLN A OE1   1 
ATOM   2357 N  NE2   . GLN E  3 161 ? 5.997   47.729 11.991  1.00 28.40  ? 161 GLN A NE2   1 
ATOM   2358 N  N     . LYS E  3 162 ? 1.387   48.578 8.571   1.00 34.99  ? 162 LYS A N     1 
ATOM   2359 C  CA    . LYS E  3 162 ? 0.963   48.239 7.219   1.00 42.70  ? 162 LYS A CA    1 
ATOM   2360 C  C     . LYS E  3 162 ? -0.028  49.281 6.713   1.00 45.99  ? 162 LYS A C     1 
ATOM   2361 O  O     . LYS E  3 162 ? 0.045   49.721 5.566   1.00 48.48  ? 162 LYS A O     1 
ATOM   2362 C  CB    . LYS E  3 162 ? 0.296   46.864 7.195   1.00 44.17  ? 162 LYS A CB    1 
ATOM   2363 C  CG    . LYS E  3 162 ? -0.316  46.505 5.847   1.00 53.44  ? 162 LYS A CG    1 
ATOM   2364 C  CD    . LYS E  3 162 ? -1.132  45.224 5.925   1.00 60.56  ? 162 LYS A CD    1 
ATOM   2365 C  CE    . LYS E  3 162 ? -1.819  44.921 4.598   1.00 66.27  ? 162 LYS A CE    1 
ATOM   2366 N  NZ    . LYS E  3 162 ? -2.659  43.690 4.665   1.00 69.08  ? 162 LYS A NZ    1 
ATOM   2367 N  N     . ARG E  3 163 ? -0.946  49.678 7.584   1.00 44.79  ? 163 ARG A N     1 
ATOM   2368 C  CA    . ARG E  3 163 ? -1.976  50.645 7.229   1.00 50.61  ? 163 ARG A CA    1 
ATOM   2369 C  C     . ARG E  3 163 ? -1.510  52.100 7.198   1.00 50.46  ? 163 ARG A C     1 
ATOM   2370 O  O     . ARG E  3 163 ? -1.838  52.837 6.267   1.00 50.04  ? 163 ARG A O     1 
ATOM   2371 C  CB    . ARG E  3 163 ? -3.159  50.515 8.194   1.00 53.15  ? 163 ARG A CB    1 
ATOM   2372 C  CG    . ARG E  3 163 ? -4.357  51.376 7.827   1.00 65.12  ? 163 ARG A CG    1 
ATOM   2373 C  CD    . ARG E  3 163 ? -5.486  51.224 8.837   1.00 72.57  ? 163 ARG A CD    1 
ATOM   2374 N  NE    . ARG E  3 163 ? -5.922  49.837 8.981   1.00 79.61  ? 163 ARG A NE    1 
ATOM   2375 C  CZ    . ARG E  3 163 ? -6.926  49.446 9.761   1.00 83.31  ? 163 ARG A CZ    1 
ATOM   2376 N  NH1   . ARG E  3 163 ? -7.606  50.338 10.469  1.00 84.48  ? 163 ARG A NH1   1 
ATOM   2377 N  NH2   . ARG E  3 163 ? -7.250  48.161 9.835   1.00 83.56  ? 163 ARG A NH2   1 
ATOM   2378 N  N     . TRP E  3 164 ? -0.742  52.511 8.205   1.00 47.04  ? 164 TRP A N     1 
ATOM   2379 C  CA    . TRP E  3 164 ? -0.280  53.897 8.297   1.00 45.62  ? 164 TRP A CA    1 
ATOM   2380 C  C     . TRP E  3 164 ? 1.228   54.106 8.373   1.00 45.09  ? 164 TRP A C     1 
ATOM   2381 O  O     . TRP E  3 164 ? 1.684   55.247 8.455   1.00 46.61  ? 164 TRP A O     1 
ATOM   2382 C  CB    . TRP E  3 164 ? -0.892  54.573 9.528   1.00 46.22  ? 164 TRP A CB    1 
ATOM   2383 C  CG    . TRP E  3 164 ? -2.381  54.673 9.524   1.00 48.94  ? 164 TRP A CG    1 
ATOM   2384 C  CD1   . TRP E  3 164 ? -3.152  55.410 8.672   1.00 50.84  ? 164 TRP A CD1   1 
ATOM   2385 C  CD2   . TRP E  3 164 ? -3.284  54.046 10.442  1.00 49.32  ? 164 TRP A CD2   1 
ATOM   2386 N  NE1   . TRP E  3 164 ? -4.479  55.286 9.005   1.00 50.40  ? 164 TRP A NE1   1 
ATOM   2387 C  CE2   . TRP E  3 164 ? -4.589  54.454 10.087  1.00 50.03  ? 164 TRP A CE2   1 
ATOM   2388 C  CE3   . TRP E  3 164 ? -3.117  53.179 11.531  1.00 48.25  ? 164 TRP A CE3   1 
ATOM   2389 C  CZ2   . TRP E  3 164 ? -5.724  54.024 10.784  1.00 47.72  ? 164 TRP A CZ2   1 
ATOM   2390 C  CZ3   . TRP E  3 164 ? -4.248  52.751 12.225  1.00 47.20  ? 164 TRP A CZ3   1 
ATOM   2391 C  CH2   . TRP E  3 164 ? -5.535  53.176 11.846  1.00 50.21  ? 164 TRP A CH2   1 
ATOM   2392 N  N     . LYS E  3 165 ? 2.005   53.028 8.358   1.00 45.60  ? 165 LYS A N     1 
ATOM   2393 C  CA    . LYS E  3 165 ? 3.456   53.165 8.461   1.00 42.46  ? 165 LYS A CA    1 
ATOM   2394 C  C     . LYS E  3 165 ? 3.795   53.858 9.779   1.00 42.96  ? 165 LYS A C     1 
ATOM   2395 O  O     . LYS E  3 165 ? 4.765   54.613 9.871   1.00 40.72  ? 165 LYS A O     1 
ATOM   2396 C  CB    . LYS E  3 165 ? 4.006   53.982 7.285   1.00 45.76  ? 165 LYS A CB    1 
ATOM   2397 C  CG    . LYS E  3 165 ? 4.507   53.148 6.113   1.00 48.00  ? 165 LYS A CG    1 
ATOM   2398 C  CD    . LYS E  3 165 ? 3.496   52.095 5.694   1.00 57.20  ? 165 LYS A CD    1 
ATOM   2399 C  CE    . LYS E  3 165 ? 4.086   51.142 4.664   1.00 57.33  ? 165 LYS A CE    1 
ATOM   2400 N  NZ    . LYS E  3 165 ? 3.215   49.955 4.456   1.00 54.15  ? 165 LYS A NZ    1 
ATOM   2401 N  N     . GLU E  3 166 ? 2.974   53.606 10.794  1.00 40.62  ? 166 GLU A N     1 
ATOM   2402 C  CA    . GLU E  3 166 ? 3.177   54.186 12.115  1.00 42.27  ? 166 GLU A CA    1 
ATOM   2403 C  C     . GLU E  3 166 ? 2.999   53.115 13.180  1.00 40.42  ? 166 GLU A C     1 
ATOM   2404 O  O     . GLU E  3 166 ? 2.334   52.108 12.952  1.00 36.55  ? 166 GLU A O     1 
ATOM   2405 C  CB    . GLU E  3 166 ? 2.183   55.316 12.379  1.00 45.17  ? 166 GLU A CB    1 
ATOM   2406 C  CG    . GLU E  3 166 ? 2.368   56.537 11.495  1.00 59.28  ? 166 GLU A CG    1 
ATOM   2407 C  CD    . GLU E  3 166 ? 1.499   57.702 11.933  1.00 63.39  ? 166 GLU A CD    1 
ATOM   2408 O  OE1   . GLU E  3 166 ? 0.265   57.526 12.022  1.00 67.86  ? 166 GLU A OE1   1 
ATOM   2409 O  OE2   . GLU E  3 166 ? 2.050   58.793 12.188  1.00 70.07  ? 166 GLU A OE2   1 
ATOM   2410 N  N     . ARG E  3 167 ? 3.600   53.340 14.342  1.00 38.24  ? 167 ARG A N     1 
ATOM   2411 C  CA    . ARG E  3 167 ? 3.498   52.399 15.450  1.00 36.27  ? 167 ARG A CA    1 
ATOM   2412 C  C     . ARG E  3 167 ? 2.587   52.978 16.524  1.00 35.49  ? 167 ARG A C     1 
ATOM   2413 O  O     . ARG E  3 167 ? 2.470   54.193 16.664  1.00 34.16  ? 167 ARG A O     1 
ATOM   2414 C  CB    . ARG E  3 167 ? 4.885   52.122 16.043  1.00 36.80  ? 167 ARG A CB    1 
ATOM   2415 C  CG    . ARG E  3 167 ? 5.834   51.435 15.077  1.00 39.59  ? 167 ARG A CG    1 
ATOM   2416 C  CD    . ARG E  3 167 ? 7.224   51.198 15.671  1.00 44.94  ? 167 ARG A CD    1 
ATOM   2417 N  NE    . ARG E  3 167 ? 7.971   52.434 15.910  1.00 49.80  ? 167 ARG A NE    1 
ATOM   2418 C  CZ    . ARG E  3 167 ? 7.912   53.152 17.029  1.00 50.63  ? 167 ARG A CZ    1 
ATOM   2419 N  NH1   . ARG E  3 167 ? 7.137   52.765 18.035  1.00 50.08  ? 167 ARG A NH1   1 
ATOM   2420 N  NH2   . ARG E  3 167 ? 8.638   54.256 17.148  1.00 49.27  ? 167 ARG A NH2   1 
ATOM   2421 N  N     . PRO E  3 168 ? 1.915   52.108 17.292  1.00 35.01  ? 168 PRO A N     1 
ATOM   2422 C  CA    . PRO E  3 168 ? 1.023   52.586 18.349  1.00 33.35  ? 168 PRO A CA    1 
ATOM   2423 C  C     . PRO E  3 168 ? 1.818   53.186 19.501  1.00 33.40  ? 168 PRO A C     1 
ATOM   2424 O  O     . PRO E  3 168 ? 3.025   52.975 19.617  1.00 32.74  ? 168 PRO A O     1 
ATOM   2425 C  CB    . PRO E  3 168 ? 0.270   51.325 18.755  1.00 36.54  ? 168 PRO A CB    1 
ATOM   2426 C  CG    . PRO E  3 168 ? 1.300   50.259 18.561  1.00 31.95  ? 168 PRO A CG    1 
ATOM   2427 C  CD    . PRO E  3 168 ? 1.909   50.636 17.227  1.00 33.62  ? 168 PRO A CD    1 
ATOM   2428 N  N     . GLU E  3 169 ? 1.131   53.940 20.347  1.00 31.77  ? 169 GLU A N     1 
ATOM   2429 C  CA    . GLU E  3 169 ? 1.759   54.571 21.494  1.00 37.84  ? 169 GLU A CA    1 
ATOM   2430 C  C     . GLU E  3 169 ? 1.073   54.075 22.758  1.00 37.20  ? 169 GLU A C     1 
ATOM   2431 O  O     . GLU E  3 169 ? -0.133  53.821 22.759  1.00 36.37  ? 169 GLU A O     1 
ATOM   2432 C  CB    . GLU E  3 169 ? 1.623   56.093 21.392  1.00 43.31  ? 169 GLU A CB    1 
ATOM   2433 C  CG    . GLU E  3 169 ? 2.263   56.856 22.538  1.00 55.30  ? 169 GLU A CG    1 
ATOM   2434 C  CD    . GLU E  3 169 ? 3.734   56.531 22.702  1.00 64.29  ? 169 GLU A CD    1 
ATOM   2435 O  OE1   . GLU E  3 169 ? 4.492   56.684 21.720  1.00 65.48  ? 169 GLU A OE1   1 
ATOM   2436 O  OE2   . GLU E  3 169 ? 4.132   56.125 23.815  1.00 69.08  ? 169 GLU A OE2   1 
ATOM   2437 N  N     . TYR E  3 170 ? 1.847   53.930 23.827  1.00 34.60  ? 170 TYR A N     1 
ATOM   2438 C  CA    . TYR E  3 170 ? 1.320   53.467 25.103  1.00 34.97  ? 170 TYR A CA    1 
ATOM   2439 C  C     . TYR E  3 170 ? 1.679   54.486 26.179  1.00 37.53  ? 170 TYR A C     1 
ATOM   2440 O  O     . TYR E  3 170 ? 2.774   55.050 26.166  1.00 42.19  ? 170 TYR A O     1 
ATOM   2441 C  CB    . TYR E  3 170 ? 1.936   52.106 25.478  1.00 31.26  ? 170 TYR A CB    1 
ATOM   2442 C  CG    . TYR E  3 170 ? 1.680   50.978 24.492  1.00 29.97  ? 170 TYR A CG    1 
ATOM   2443 C  CD1   . TYR E  3 170 ? 0.534   50.187 24.583  1.00 30.53  ? 170 TYR A CD1   1 
ATOM   2444 C  CD2   . TYR E  3 170 ? 2.594   50.695 23.475  1.00 27.75  ? 170 TYR A CD2   1 
ATOM   2445 C  CE1   . TYR E  3 170 ? 0.306   49.139 23.684  1.00 29.13  ? 170 TYR A CE1   1 
ATOM   2446 C  CE2   . TYR E  3 170 ? 2.375   49.654 22.573  1.00 29.27  ? 170 TYR A CE2   1 
ATOM   2447 C  CZ    . TYR E  3 170 ? 1.228   48.880 22.685  1.00 28.82  ? 170 TYR A CZ    1 
ATOM   2448 O  OH    . TYR E  3 170 ? 1.011   47.849 21.799  1.00 26.98  ? 170 TYR A OH    1 
ATOM   2449 N  N     . ARG E  3 171 ? 0.754   54.732 27.100  1.00 40.71  ? 171 ARG A N     1 
ATOM   2450 C  CA    . ARG E  3 171 ? 1.019   55.658 28.189  1.00 42.99  ? 171 ARG A CA    1 
ATOM   2451 C  C     . ARG E  3 171 ? 0.340   55.160 29.452  1.00 40.07  ? 171 ARG A C     1 
ATOM   2452 O  O     . ARG E  3 171 ? -0.693  54.490 29.396  1.00 38.97  ? 171 ARG A O     1 
ATOM   2453 C  CB    . ARG E  3 171 ? 0.542   57.074 27.847  1.00 51.23  ? 171 ARG A CB    1 
ATOM   2454 C  CG    . ARG E  3 171 ? -0.957  57.291 27.868  1.00 61.76  ? 171 ARG A CG    1 
ATOM   2455 C  CD    . ARG E  3 171 ? -1.249  58.780 28.033  1.00 72.24  ? 171 ARG A CD    1 
ATOM   2456 N  NE    . ARG E  3 171 ? -2.675  59.087 28.023  1.00 79.18  ? 171 ARG A NE    1 
ATOM   2457 C  CZ    . ARG E  3 171 ? -3.437  59.057 26.936  1.00 84.02  ? 171 ARG A CZ    1 
ATOM   2458 N  NH1   . ARG E  3 171 ? -2.909  58.732 25.762  1.00 85.98  ? 171 ARG A NH1   1 
ATOM   2459 N  NH2   . ARG E  3 171 ? -4.727  59.352 27.021  1.00 85.79  ? 171 ARG A NH2   1 
ATOM   2460 N  N     . LEU E  3 172 ? 0.939   55.476 30.592  1.00 39.94  ? 172 LEU A N     1 
ATOM   2461 C  CA    . LEU E  3 172 ? 0.409   55.055 31.876  1.00 41.18  ? 172 LEU A CA    1 
ATOM   2462 C  C     . LEU E  3 172 ? -0.756  55.946 32.284  1.00 44.84  ? 172 LEU A C     1 
ATOM   2463 O  O     . LEU E  3 172 ? -0.664  57.171 32.209  1.00 46.76  ? 172 LEU A O     1 
ATOM   2464 C  CB    . LEU E  3 172 ? 1.515   55.123 32.929  1.00 43.30  ? 172 LEU A CB    1 
ATOM   2465 C  CG    . LEU E  3 172 ? 1.206   54.636 34.343  1.00 42.14  ? 172 LEU A CG    1 
ATOM   2466 C  CD1   . LEU E  3 172 ? 0.731   53.188 34.310  1.00 41.78  ? 172 LEU A CD1   1 
ATOM   2467 C  CD2   . LEU E  3 172 ? 2.462   54.771 35.192  1.00 45.32  ? 172 LEU A CD2   1 
ATOM   2468 N  N     . ILE E  3 173 ? -1.855  55.330 32.703  1.00 43.33  ? 173 ILE A N     1 
ATOM   2469 C  CA    . ILE E  3 173 ? -3.015  56.094 33.132  1.00 47.31  ? 173 ILE A CA    1 
ATOM   2470 C  C     . ILE E  3 173 ? -3.092  56.127 34.651  1.00 47.78  ? 173 ILE A C     1 
ATOM   2471 O  O     . ILE E  3 173 ? -3.365  57.173 35.239  1.00 52.11  ? 173 ILE A O     1 
ATOM   2472 C  CB    . ILE E  3 173 ? -4.310  55.511 32.546  1.00 45.33  ? 173 ILE A CB    1 
ATOM   2473 C  CG1   . ILE E  3 173 ? -4.344  55.801 31.044  1.00 47.48  ? 173 ILE A CG1   1 
ATOM   2474 C  CG2   . ILE E  3 173 ? -5.526  56.099 33.252  1.00 46.48  ? 173 ILE A CG2   1 
ATOM   2475 C  CD1   . ILE E  3 173 ? -5.655  55.493 30.387  1.00 49.70  ? 173 ILE A CD1   1 
ATOM   2476 N  N     . SER E  3 174 ? -2.834  54.989 35.286  1.00 47.44  ? 174 SER A N     1 
ATOM   2477 C  CA    . SER E  3 174 ? -2.869  54.921 36.741  1.00 47.20  ? 174 SER A CA    1 
ATOM   2478 C  C     . SER E  3 174 ? -2.115  53.713 37.285  1.00 49.12  ? 174 SER A C     1 
ATOM   2479 O  O     . SER E  3 174 ? -1.931  52.712 36.592  1.00 44.91  ? 174 SER A O     1 
ATOM   2480 C  CB    . SER E  3 174 ? -4.315  54.871 37.234  1.00 47.60  ? 174 SER A CB    1 
ATOM   2481 O  OG    . SER E  3 174 ? -4.943  53.664 36.841  1.00 46.20  ? 174 SER A OG    1 
ATOM   2482 N  N     . VAL E  3 175 ? -1.684  53.829 38.537  1.00 49.31  ? 175 VAL A N     1 
ATOM   2483 C  CA    . VAL E  3 175 ? -0.959  52.775 39.237  1.00 52.33  ? 175 VAL A CA    1 
ATOM   2484 C  C     . VAL E  3 175 ? -1.493  52.764 40.663  1.00 54.28  ? 175 VAL A C     1 
ATOM   2485 O  O     . VAL E  3 175 ? -1.566  53.812 41.303  1.00 57.40  ? 175 VAL A O     1 
ATOM   2486 C  CB    . VAL E  3 175 ? 0.557   53.064 39.288  1.00 48.71  ? 175 VAL A CB    1 
ATOM   2487 C  CG1   . VAL E  3 175 ? 1.278   51.930 40.005  1.00 49.40  ? 175 VAL A CG1   1 
ATOM   2488 C  CG2   . VAL E  3 175 ? 1.103   53.236 37.885  1.00 52.03  ? 175 VAL A CG2   1 
ATOM   2489 N  N     . GLU E  3 176 ? -1.860  51.590 41.164  1.00 56.19  ? 176 GLU A N     1 
ATOM   2490 C  CA    . GLU E  3 176 ? -2.402  51.491 42.514  1.00 58.45  ? 176 GLU A CA    1 
ATOM   2491 C  C     . GLU E  3 176 ? -1.927  50.239 43.245  1.00 56.12  ? 176 GLU A C     1 
ATOM   2492 O  O     . GLU E  3 176 ? -1.297  49.363 42.652  1.00 52.80  ? 176 GLU A O     1 
ATOM   2493 C  CB    . GLU E  3 176 ? -3.932  51.498 42.441  1.00 64.16  ? 176 GLU A CB    1 
ATOM   2494 C  CG    . GLU E  3 176 ? -4.503  52.697 41.693  1.00 74.89  ? 176 GLU A CG    1 
ATOM   2495 C  CD    . GLU E  3 176 ? -5.974  52.539 41.357  1.00 81.04  ? 176 GLU A CD    1 
ATOM   2496 O  OE1   . GLU E  3 176 ? -6.318  51.595 40.615  1.00 83.40  ? 176 GLU A OE1   1 
ATOM   2497 O  OE2   . GLU E  3 176 ? -6.786  53.362 41.833  1.00 84.02  ? 176 GLU A OE2   1 
ATOM   2498 N  N     . GLY E  3 177 ? -2.235  50.168 44.539  1.00 52.98  ? 177 GLY A N     1 
ATOM   2499 C  CA    . GLY E  3 177 ? -1.850  49.024 45.345  1.00 48.18  ? 177 GLY A CA    1 
ATOM   2500 C  C     . GLY E  3 177 ? -0.464  49.155 45.944  1.00 45.25  ? 177 GLY A C     1 
ATOM   2501 O  O     . GLY E  3 177 ? 0.252   50.109 45.637  1.00 46.29  ? 177 GLY A O     1 
ATOM   2502 N  N     . PRO E  3 178 ? -0.058  48.219 46.818  1.00 45.45  ? 178 PRO A N     1 
ATOM   2503 C  CA    . PRO E  3 178 ? 1.270   48.266 47.439  1.00 42.68  ? 178 PRO A CA    1 
ATOM   2504 C  C     . PRO E  3 178 ? 2.337   48.230 46.344  1.00 43.56  ? 178 PRO A C     1 
ATOM   2505 O  O     . PRO E  3 178 ? 2.082   47.729 45.249  1.00 42.20  ? 178 PRO A O     1 
ATOM   2506 C  CB    . PRO E  3 178 ? 1.287   47.011 48.304  1.00 43.03  ? 178 PRO A CB    1 
ATOM   2507 C  CG    . PRO E  3 178 ? -0.147  46.844 48.679  1.00 45.93  ? 178 PRO A CG    1 
ATOM   2508 C  CD    . PRO E  3 178 ? -0.853  47.110 47.373  1.00 44.75  ? 178 PRO A CD    1 
ATOM   2509 N  N     . HIS E  3 179 ? 3.524   48.757 46.634  1.00 42.54  ? 179 HIS A N     1 
ATOM   2510 C  CA    . HIS E  3 179 ? 4.593   48.777 45.642  1.00 44.97  ? 179 HIS A CA    1 
ATOM   2511 C  C     . HIS E  3 179 ? 5.038   47.391 45.190  1.00 42.65  ? 179 HIS A C     1 
ATOM   2512 O  O     . HIS E  3 179 ? 5.506   47.223 44.063  1.00 44.74  ? 179 HIS A O     1 
ATOM   2513 C  CB    . HIS E  3 179 ? 5.798   49.566 46.168  1.00 45.14  ? 179 HIS A CB    1 
ATOM   2514 C  CG    . HIS E  3 179 ? 5.570   51.045 46.230  1.00 47.94  ? 179 HIS A CG    1 
ATOM   2515 N  ND1   . HIS E  3 179 ? 6.581   51.945 46.488  1.00 49.91  ? 179 HIS A ND1   1 
ATOM   2516 C  CD2   . HIS E  3 179 ? 4.444   51.782 46.067  1.00 48.21  ? 179 HIS A CD2   1 
ATOM   2517 C  CE1   . HIS E  3 179 ? 6.090   53.172 46.481  1.00 48.88  ? 179 HIS A CE1   1 
ATOM   2518 N  NE2   . HIS E  3 179 ? 4.795   53.101 46.228  1.00 49.39  ? 179 HIS A NE2   1 
ATOM   2519 N  N     . HIS E  3 180 ? 4.887   46.401 46.063  1.00 43.20  ? 180 HIS A N     1 
ATOM   2520 C  CA    . HIS E  3 180 ? 5.275   45.032 45.737  1.00 41.61  ? 180 HIS A CA    1 
ATOM   2521 C  C     . HIS E  3 180 ? 4.105   44.254 45.143  1.00 41.88  ? 180 HIS A C     1 
ATOM   2522 O  O     . HIS E  3 180 ? 4.212   43.055 44.887  1.00 40.31  ? 180 HIS A O     1 
ATOM   2523 C  CB    . HIS E  3 180 ? 5.784   44.314 46.989  1.00 43.27  ? 180 HIS A CB    1 
ATOM   2524 C  CG    . HIS E  3 180 ? 4.796   44.285 48.114  1.00 48.10  ? 180 HIS A CG    1 
ATOM   2525 N  ND1   . HIS E  3 180 ? 4.446   45.411 48.827  1.00 49.87  ? 180 HIS A ND1   1 
ATOM   2526 C  CD2   . HIS E  3 180 ? 4.079   43.266 48.644  1.00 45.96  ? 180 HIS A CD2   1 
ATOM   2527 C  CE1   . HIS E  3 180 ? 3.556   45.087 49.749  1.00 47.06  ? 180 HIS A CE1   1 
ATOM   2528 N  NE2   . HIS E  3 180 ? 3.316   43.791 49.658  1.00 47.40  ? 180 HIS A NE2   1 
ATOM   2529 N  N     . LYS E  3 181 ? 2.986   44.941 44.936  1.00 38.36  ? 181 LYS A N     1 
ATOM   2530 C  CA    . LYS E  3 181 ? 1.796   44.320 44.366  1.00 43.81  ? 181 LYS A CA    1 
ATOM   2531 C  C     . LYS E  3 181 ? 1.008   45.375 43.595  1.00 40.00  ? 181 LYS A C     1 
ATOM   2532 O  O     . LYS E  3 181 ? -0.199  45.525 43.777  1.00 37.54  ? 181 LYS A O     1 
ATOM   2533 C  CB    . LYS E  3 181 ? 0.923   43.726 45.477  1.00 50.76  ? 181 LYS A CB    1 
ATOM   2534 C  CG    . LYS E  3 181 ? -0.227  42.863 44.972  1.00 62.64  ? 181 LYS A CG    1 
ATOM   2535 C  CD    . LYS E  3 181 ? -1.189  42.489 46.094  1.00 72.83  ? 181 LYS A CD    1 
ATOM   2536 C  CE    . LYS E  3 181 ? -0.502  41.691 47.191  1.00 76.60  ? 181 LYS A CE    1 
ATOM   2537 N  NZ    . LYS E  3 181 ? -1.450  41.339 48.285  1.00 81.18  ? 181 LYS A NZ    1 
ATOM   2538 N  N     . LYS E  3 182 ? 1.702   46.103 42.725  1.00 38.30  ? 182 LYS A N     1 
ATOM   2539 C  CA    . LYS E  3 182 ? 1.073   47.156 41.938  1.00 37.54  ? 182 LYS A CA    1 
ATOM   2540 C  C     . LYS E  3 182 ? 0.155   46.641 40.840  1.00 39.40  ? 182 LYS A C     1 
ATOM   2541 O  O     . LYS E  3 182 ? 0.301   45.519 40.354  1.00 39.64  ? 182 LYS A O     1 
ATOM   2542 C  CB    . LYS E  3 182 ? 2.137   48.059 41.300  1.00 36.44  ? 182 LYS A CB    1 
ATOM   2543 C  CG    . LYS E  3 182 ? 2.997   48.828 42.286  1.00 41.19  ? 182 LYS A CG    1 
ATOM   2544 C  CD    . LYS E  3 182 ? 3.894   49.835 41.574  1.00 40.73  ? 182 LYS A CD    1 
ATOM   2545 C  CE    . LYS E  3 182 ? 4.763   50.589 42.568  1.00 46.18  ? 182 LYS A CE    1 
ATOM   2546 N  NZ    . LYS E  3 182 ? 5.665   51.576 41.913  1.00 51.17  ? 182 LYS A NZ    1 
ATOM   2547 N  N     . LYS E  3 183 ? -0.796  47.487 40.460  1.00 39.66  ? 183 LYS A N     1 
ATOM   2548 C  CA    . LYS E  3 183 ? -1.744  47.188 39.400  1.00 41.27  ? 183 LYS A CA    1 
ATOM   2549 C  C     . LYS E  3 183 ? -1.653  48.382 38.456  1.00 40.28  ? 183 LYS A C     1 
ATOM   2550 O  O     . LYS E  3 183 ? -1.868  49.524 38.872  1.00 37.87  ? 183 LYS A O     1 
ATOM   2551 C  CB    . LYS E  3 183 ? -3.161  47.072 39.966  1.00 48.38  ? 183 LYS A CB    1 
ATOM   2552 C  CG    . LYS E  3 183 ? -3.296  46.056 41.089  1.00 60.44  ? 183 LYS A CG    1 
ATOM   2553 C  CD    . LYS E  3 183 ? -4.713  46.027 41.643  1.00 70.69  ? 183 LYS A CD    1 
ATOM   2554 C  CE    . LYS E  3 183 ? -4.834  45.049 42.801  1.00 76.06  ? 183 LYS A CE    1 
ATOM   2555 N  NZ    . LYS E  3 183 ? -3.918  45.403 43.921  1.00 81.81  ? 183 LYS A NZ    1 
ATOM   2556 N  N     . PHE E  3 184 ? -1.321  48.125 37.194  1.00 37.41  ? 184 PHE A N     1 
ATOM   2557 C  CA    . PHE E  3 184 ? -1.188  49.197 36.216  1.00 31.87  ? 184 PHE A CA    1 
ATOM   2558 C  C     . PHE E  3 184 ? -2.345  49.261 35.233  1.00 32.43  ? 184 PHE A C     1 
ATOM   2559 O  O     . PHE E  3 184 ? -2.912  48.242 34.853  1.00 33.47  ? 184 PHE A O     1 
ATOM   2560 C  CB    . PHE E  3 184 ? 0.107   49.040 35.398  1.00 35.79  ? 184 PHE A CB    1 
ATOM   2561 C  CG    . PHE E  3 184 ? 1.363   48.974 36.225  1.00 31.11  ? 184 PHE A CG    1 
ATOM   2562 C  CD1   . PHE E  3 184 ? 1.715   47.802 36.888  1.00 31.13  ? 184 PHE A CD1   1 
ATOM   2563 C  CD2   . PHE E  3 184 ? 2.204   50.080 36.325  1.00 32.65  ? 184 PHE A CD2   1 
ATOM   2564 C  CE1   . PHE E  3 184 ? 2.887   47.733 37.636  1.00 32.18  ? 184 PHE A CE1   1 
ATOM   2565 C  CE2   . PHE E  3 184 ? 3.380   50.021 37.074  1.00 33.31  ? 184 PHE A CE2   1 
ATOM   2566 C  CZ    . PHE E  3 184 ? 3.722   48.843 37.730  1.00 31.90  ? 184 PHE A CZ    1 
ATOM   2567 N  N     . ILE E  3 185 ? -2.686  50.476 34.826  1.00 31.28  ? 185 ILE A N     1 
ATOM   2568 C  CA    . ILE E  3 185 ? -3.724  50.689 33.833  1.00 36.26  ? 185 ILE A CA    1 
ATOM   2569 C  C     . ILE E  3 185 ? -3.045  51.553 32.788  1.00 31.40  ? 185 ILE A C     1 
ATOM   2570 O  O     . ILE E  3 185 ? -2.551  52.640 33.094  1.00 34.06  ? 185 ILE A O     1 
ATOM   2571 C  CB    . ILE E  3 185 ? -4.938  51.439 34.400  1.00 38.70  ? 185 ILE A CB    1 
ATOM   2572 C  CG1   . ILE E  3 185 ? -5.607  50.595 35.487  1.00 39.74  ? 185 ILE A CG1   1 
ATOM   2573 C  CG2   . ILE E  3 185 ? -5.925  51.739 33.274  1.00 38.10  ? 185 ILE A CG2   1 
ATOM   2574 C  CD1   . ILE E  3 185 ? -6.840  51.243 36.096  1.00 44.91  ? 185 ILE A CD1   1 
ATOM   2575 N  N     . VAL E  3 186 ? -2.994  51.061 31.560  1.00 31.47  ? 186 VAL A N     1 
ATOM   2576 C  CA    . VAL E  3 186 ? -2.351  51.797 30.485  1.00 34.41  ? 186 VAL A CA    1 
ATOM   2577 C  C     . VAL E  3 186 ? -3.292  51.987 29.313  1.00 35.60  ? 186 VAL A C     1 
ATOM   2578 O  O     . VAL E  3 186 ? -4.291  51.278 29.178  1.00 36.66  ? 186 VAL A O     1 
ATOM   2579 C  CB    . VAL E  3 186 ? -1.090  51.067 29.965  1.00 34.85  ? 186 VAL A CB    1 
ATOM   2580 C  CG1   . VAL E  3 186 ? -0.117  50.819 31.109  1.00 34.01  ? 186 VAL A CG1   1 
ATOM   2581 C  CG2   . VAL E  3 186 ? -1.487  49.758 29.309  1.00 35.76  ? 186 VAL A CG2   1 
ATOM   2582 N  N     . GLU E  3 187 ? -2.959  52.948 28.461  1.00 35.17  ? 187 GLU A N     1 
ATOM   2583 C  CA    . GLU E  3 187 ? -3.764  53.220 27.286  1.00 35.70  ? 187 GLU A CA    1 
ATOM   2584 C  C     . GLU E  3 187 ? -2.940  53.002 26.027  1.00 35.44  ? 187 GLU A C     1 
ATOM   2585 O  O     . GLU E  3 187 ? -1.791  53.435 25.938  1.00 34.43  ? 187 GLU A O     1 
ATOM   2586 C  CB    . GLU E  3 187 ? -4.286  54.659 27.296  1.00 37.33  ? 187 GLU A CB    1 
ATOM   2587 C  CG    . GLU E  3 187 ? -5.314  54.929 26.200  1.00 44.95  ? 187 GLU A CG    1 
ATOM   2588 C  CD    . GLU E  3 187 ? -5.690  56.395 26.080  1.00 50.62  ? 187 GLU A CD    1 
ATOM   2589 O  OE1   . GLU E  3 187 ? -4.875  57.175 25.548  1.00 50.16  ? 187 GLU A OE1   1 
ATOM   2590 O  OE2   . GLU E  3 187 ? -6.798  56.767 26.521  1.00 53.46  ? 187 GLU A OE2   1 
ATOM   2591 N  N     . ALA E  3 188 ? -3.538  52.319 25.061  1.00 33.90  ? 188 ALA A N     1 
ATOM   2592 C  CA    . ALA E  3 188 ? -2.895  52.056 23.779  1.00 36.11  ? 188 ALA A CA    1 
ATOM   2593 C  C     . ALA E  3 188 ? -3.576  52.979 22.780  1.00 36.65  ? 188 ALA A C     1 
ATOM   2594 O  O     . ALA E  3 188 ? -4.786  53.178 22.855  1.00 40.76  ? 188 ALA A O     1 
ATOM   2595 C  CB    . ALA E  3 188 ? -3.107  50.600 23.373  1.00 30.25  ? 188 ALA A CB    1 
ATOM   2596 N  N     . LYS E  3 189 ? -2.819  53.537 21.843  1.00 39.77  ? 189 LYS A N     1 
ATOM   2597 C  CA    . LYS E  3 189 ? -3.420  54.436 20.867  1.00 43.48  ? 189 LYS A CA    1 
ATOM   2598 C  C     . LYS E  3 189 ? -2.766  54.421 19.493  1.00 42.45  ? 189 LYS A C     1 
ATOM   2599 O  O     . LYS E  3 189 ? -1.562  54.216 19.355  1.00 40.33  ? 189 LYS A O     1 
ATOM   2600 C  CB    . LYS E  3 189 ? -3.412  55.866 21.415  1.00 49.75  ? 189 LYS A CB    1 
ATOM   2601 C  CG    . LYS E  3 189 ? -4.015  56.901 20.478  1.00 58.64  ? 189 LYS A CG    1 
ATOM   2602 C  CD    . LYS E  3 189 ? -3.799  58.308 21.007  1.00 66.89  ? 189 LYS A CD    1 
ATOM   2603 C  CE    . LYS E  3 189 ? -4.318  59.351 20.031  1.00 72.75  ? 189 LYS A CE    1 
ATOM   2604 N  NZ    . LYS E  3 189 ? -4.069  60.734 20.521  1.00 79.02  ? 189 LYS A NZ    1 
ATOM   2605 N  N     . ILE E  3 190 ? -3.594  54.635 18.478  1.00 41.86  ? 190 ILE A N     1 
ATOM   2606 C  CA    . ILE E  3 190 ? -3.150  54.709 17.095  1.00 42.26  ? 190 ILE A CA    1 
ATOM   2607 C  C     . ILE E  3 190 ? -4.182  55.597 16.411  1.00 42.91  ? 190 ILE A C     1 
ATOM   2608 O  O     . ILE E  3 190 ? -5.382  55.329 16.478  1.00 40.19  ? 190 ILE A O     1 
ATOM   2609 C  CB    . ILE E  3 190 ? -3.111  53.325 16.419  1.00 37.49  ? 190 ILE A CB    1 
ATOM   2610 C  CG1   . ILE E  3 190 ? -2.557  53.471 15.003  1.00 39.26  ? 190 ILE A CG1   1 
ATOM   2611 C  CG2   . ILE E  3 190 ? -4.500  52.701 16.395  1.00 41.82  ? 190 ILE A CG2   1 
ATOM   2612 C  CD1   . ILE E  3 190 ? -1.176  54.097 14.955  1.00 39.89  ? 190 ILE A CD1   1 
ATOM   2613 N  N     . LYS E  3 191 ? -3.717  56.659 15.767  1.00 44.57  ? 191 LYS A N     1 
ATOM   2614 C  CA    . LYS E  3 191 ? -4.624  57.596 15.118  1.00 50.91  ? 191 LYS A CA    1 
ATOM   2615 C  C     . LYS E  3 191 ? -5.616  58.074 16.173  1.00 53.30  ? 191 LYS A C     1 
ATOM   2616 O  O     . LYS E  3 191 ? -5.210  58.503 17.251  1.00 55.02  ? 191 LYS A O     1 
ATOM   2617 C  CB    . LYS E  3 191 ? -5.355  56.928 13.951  1.00 47.91  ? 191 LYS A CB    1 
ATOM   2618 C  CG    . LYS E  3 191 ? -4.444  56.609 12.777  1.00 52.10  ? 191 LYS A CG    1 
ATOM   2619 C  CD    . LYS E  3 191 ? -3.699  57.856 12.315  1.00 54.22  ? 191 LYS A CD    1 
ATOM   2620 C  CE    . LYS E  3 191 ? -2.743  57.547 11.178  1.00 57.20  ? 191 LYS A CE    1 
ATOM   2621 N  NZ    . LYS E  3 191 ? -1.959  58.744 10.765  1.00 61.19  ? 191 LYS A NZ    1 
ATOM   2622 N  N     . GLU E  3 192 ? -6.910  57.983 15.887  1.00 58.25  ? 192 GLU A N     1 
ATOM   2623 C  CA    . GLU E  3 192 ? -7.915  58.436 16.844  1.00 62.06  ? 192 GLU A CA    1 
ATOM   2624 C  C     . GLU E  3 192 ? -8.489  57.310 17.709  1.00 59.95  ? 192 GLU A C     1 
ATOM   2625 O  O     . GLU E  3 192 ? -9.427  57.528 18.476  1.00 60.29  ? 192 GLU A O     1 
ATOM   2626 C  CB    . GLU E  3 192 ? -9.048  59.154 16.100  1.00 69.68  ? 192 GLU A CB    1 
ATOM   2627 C  CG    . GLU E  3 192 ? -10.035 59.886 17.001  1.00 83.01  ? 192 GLU A CG    1 
ATOM   2628 C  CD    . GLU E  3 192 ? -11.115 60.613 16.219  1.00 91.18  ? 192 GLU A CD    1 
ATOM   2629 O  OE1   . GLU E  3 192 ? -10.772 61.498 15.406  1.00 94.53  ? 192 GLU A OE1   1 
ATOM   2630 O  OE2   . GLU E  3 192 ? -12.309 60.301 16.418  1.00 95.84  ? 192 GLU A OE2   1 
ATOM   2631 N  N     . TYR E  3 193 ? -7.921  56.112 17.597  1.00 57.43  ? 193 TYR A N     1 
ATOM   2632 C  CA    . TYR E  3 193 ? -8.390  54.956 18.367  1.00 57.33  ? 193 TYR A CA    1 
ATOM   2633 C  C     . TYR E  3 193 ? -7.602  54.792 19.667  1.00 55.40  ? 193 TYR A C     1 
ATOM   2634 O  O     . TYR E  3 193 ? -6.371  54.802 19.655  1.00 51.60  ? 193 TYR A O     1 
ATOM   2635 C  CB    . TYR E  3 193 ? -8.244  53.679 17.536  1.00 58.46  ? 193 TYR A CB    1 
ATOM   2636 C  CG    . TYR E  3 193 ? -8.921  53.729 16.186  1.00 60.07  ? 193 TYR A CG    1 
ATOM   2637 C  CD1   . TYR E  3 193 ? -10.305 53.606 16.070  1.00 63.65  ? 193 TYR A CD1   1 
ATOM   2638 C  CD2   . TYR E  3 193 ? -8.174  53.899 15.022  1.00 63.19  ? 193 TYR A CD2   1 
ATOM   2639 C  CE1   . TYR E  3 193 ? -10.929 53.649 14.824  1.00 64.56  ? 193 TYR A CE1   1 
ATOM   2640 C  CE2   . TYR E  3 193 ? -8.786  53.945 13.772  1.00 65.69  ? 193 TYR A CE2   1 
ATOM   2641 C  CZ    . TYR E  3 193 ? -10.162 53.819 13.680  1.00 67.31  ? 193 TYR A CZ    1 
ATOM   2642 O  OH    . TYR E  3 193 ? -10.766 53.860 12.445  1.00 68.10  ? 193 TYR A OH    1 
ATOM   2643 N  N     . ARG E  3 194 ? -8.315  54.620 20.777  1.00 53.66  ? 194 ARG A N     1 
ATOM   2644 C  CA    . ARG E  3 194 ? -7.686  54.463 22.089  1.00 53.89  ? 194 ARG A CA    1 
ATOM   2645 C  C     . ARG E  3 194 ? -8.364  53.348 22.883  1.00 51.70  ? 194 ARG A C     1 
ATOM   2646 O  O     . ARG E  3 194 ? -9.585  53.195 22.827  1.00 49.75  ? 194 ARG A O     1 
ATOM   2647 C  CB    . ARG E  3 194 ? -7.817  55.762 22.887  1.00 57.78  ? 194 ARG A CB    1 
ATOM   2648 C  CG    . ARG E  3 194 ? -7.509  57.026 22.108  1.00 67.16  ? 194 ARG A CG    1 
ATOM   2649 C  CD    . ARG E  3 194 ? -8.245  58.211 22.716  1.00 74.21  ? 194 ARG A CD    1 
ATOM   2650 N  NE    . ARG E  3 194 ? -8.050  59.441 21.954  1.00 81.04  ? 194 ARG A NE    1 
ATOM   2651 C  CZ    . ARG E  3 194 ? -6.924  60.147 21.949  1.00 83.53  ? 194 ARG A CZ    1 
ATOM   2652 N  NH1   . ARG E  3 194 ? -5.887  59.747 22.671  1.00 85.98  ? 194 ARG A NH1   1 
ATOM   2653 N  NH2   . ARG E  3 194 ? -6.836  61.252 21.222  1.00 84.69  ? 194 ARG A NH2   1 
ATOM   2654 N  N     . THR E  3 195 ? -7.573  52.578 23.626  1.00 46.81  ? 195 THR A N     1 
ATOM   2655 C  CA    . THR E  3 195 ? -8.108  51.496 24.448  1.00 42.76  ? 195 THR A CA    1 
ATOM   2656 C  C     . THR E  3 195 ? -7.337  51.401 25.761  1.00 41.72  ? 195 THR A C     1 
ATOM   2657 O  O     . THR E  3 195 ? -6.237  51.937 25.886  1.00 40.44  ? 195 THR A O     1 
ATOM   2658 C  CB    . THR E  3 195 ? -8.026  50.121 23.732  1.00 45.76  ? 195 THR A CB    1 
ATOM   2659 O  OG1   . THR E  3 195 ? -6.655  49.787 23.471  1.00 43.21  ? 195 THR A OG1   1 
ATOM   2660 C  CG2   . THR E  3 195 ? -8.798  50.155 22.424  1.00 43.19  ? 195 THR A CG2   1 
ATOM   2661 N  N     . LEU E  3 196 ? -7.923  50.715 26.735  1.00 39.83  ? 196 LEU A N     1 
ATOM   2662 C  CA    . LEU E  3 196 ? -7.298  50.546 28.039  1.00 38.75  ? 196 LEU A CA    1 
ATOM   2663 C  C     . LEU E  3 196 ? -6.963  49.090 28.315  1.00 37.04  ? 196 LEU A C     1 
ATOM   2664 O  O     . LEU E  3 196 ? -7.581  48.180 27.762  1.00 37.71  ? 196 LEU A O     1 
ATOM   2665 C  CB    . LEU E  3 196 ? -8.226  51.051 29.145  1.00 38.53  ? 196 LEU A CB    1 
ATOM   2666 C  CG    . LEU E  3 196 ? -8.659  52.514 29.079  1.00 42.59  ? 196 LEU A CG    1 
ATOM   2667 C  CD1   . LEU E  3 196 ? -9.495  52.852 30.303  1.00 41.92  ? 196 LEU A CD1   1 
ATOM   2668 C  CD2   . LEU E  3 196 ? -7.436  53.401 29.012  1.00 39.24  ? 196 LEU A CD2   1 
ATOM   2669 N  N     . GLY E  3 197 ? -5.986  48.885 29.190  1.00 33.98  ? 197 GLY A N     1 
ATOM   2670 C  CA    . GLY E  3 197 ? -5.571  47.548 29.564  1.00 35.39  ? 197 GLY A CA    1 
ATOM   2671 C  C     . GLY E  3 197 ? -5.016  47.600 30.972  1.00 31.49  ? 197 GLY A C     1 
ATOM   2672 O  O     . GLY E  3 197 ? -4.476  48.625 31.384  1.00 35.41  ? 197 GLY A O     1 
ATOM   2673 N  N     . GLU E  3 198 ? -5.152  46.507 31.715  1.00 33.84  ? 198 GLU A N     1 
ATOM   2674 C  CA    . GLU E  3 198 ? -4.655  46.453 33.085  1.00 38.96  ? 198 GLU A CA    1 
ATOM   2675 C  C     . GLU E  3 198 ? -3.794  45.212 33.293  1.00 38.35  ? 198 GLU A C     1 
ATOM   2676 O  O     . GLU E  3 198 ? -3.961  44.214 32.594  1.00 38.77  ? 198 GLU A O     1 
ATOM   2677 C  CB    . GLU E  3 198 ? -5.833  46.442 34.065  1.00 48.53  ? 198 GLU A CB    1 
ATOM   2678 C  CG    . GLU E  3 198 ? -5.445  46.296 35.525  1.00 62.45  ? 198 GLU A CG    1 
ATOM   2679 C  CD    . GLU E  3 198 ? -6.647  46.340 36.452  1.00 74.50  ? 198 GLU A CD    1 
ATOM   2680 O  OE1   . GLU E  3 198 ? -7.580  45.531 36.257  1.00 79.18  ? 198 GLU A OE1   1 
ATOM   2681 O  OE2   . GLU E  3 198 ? -6.657  47.180 37.377  1.00 79.07  ? 198 GLU A OE2   1 
ATOM   2682 N  N     . GLY E  3 199 ? -2.876  45.281 34.256  1.00 33.85  ? 199 GLY A N     1 
ATOM   2683 C  CA    . GLY E  3 199 ? -2.002  44.154 34.529  1.00 38.07  ? 199 GLY A CA    1 
ATOM   2684 C  C     . GLY E  3 199 ? -1.081  44.374 35.717  1.00 35.01  ? 199 GLY A C     1 
ATOM   2685 O  O     . GLY E  3 199 ? -1.097  45.440 36.336  1.00 35.32  ? 199 GLY A O     1 
ATOM   2686 N  N     . LYS E  3 200 ? -0.268  43.366 36.030  1.00 32.77  ? 200 LYS A N     1 
ATOM   2687 C  CA    . LYS E  3 200 ? 0.662   43.437 37.158  1.00 33.41  ? 200 LYS A CA    1 
ATOM   2688 C  C     . LYS E  3 200 ? 1.997   44.076 36.779  1.00 31.03  ? 200 LYS A C     1 
ATOM   2689 O  O     . LYS E  3 200 ? 2.878   44.246 37.617  1.00 27.94  ? 200 LYS A O     1 
ATOM   2690 C  CB    . LYS E  3 200 ? 0.903   42.036 37.723  1.00 38.84  ? 200 LYS A CB    1 
ATOM   2691 C  CG    . LYS E  3 200 ? -0.376  41.310 38.113  1.00 52.57  ? 200 LYS A CG    1 
ATOM   2692 C  CD    . LYS E  3 200 ? -0.092  39.907 38.627  1.00 59.65  ? 200 LYS A CD    1 
ATOM   2693 C  CE    . LYS E  3 200 ? -1.383  39.141 38.877  1.00 65.45  ? 200 LYS A CE    1 
ATOM   2694 N  NZ    . LYS E  3 200 ? -2.264  39.835 39.858  1.00 68.86  ? 200 LYS A NZ    1 
ATOM   2695 N  N     . SER E  3 201 ? 2.145   44.407 35.504  1.00 29.51  ? 201 SER A N     1 
ATOM   2696 C  CA    . SER E  3 201 ? 3.353   45.055 35.011  1.00 29.37  ? 201 SER A CA    1 
ATOM   2697 C  C     . SER E  3 201 ? 2.891   45.935 33.865  1.00 27.05  ? 201 SER A C     1 
ATOM   2698 O  O     . SER E  3 201 ? 1.803   45.725 33.327  1.00 29.30  ? 201 SER A O     1 
ATOM   2699 C  CB    . SER E  3 201 ? 4.370   44.019 34.504  1.00 27.14  ? 201 SER A CB    1 
ATOM   2700 O  OG    . SER E  3 201 ? 3.918   43.389 33.318  1.00 27.90  ? 201 SER A OG    1 
ATOM   2701 N  N     . LYS E  3 202 ? 3.694   46.923 33.490  1.00 27.85  ? 202 LYS A N     1 
ATOM   2702 C  CA    . LYS E  3 202 ? 3.292   47.780 32.390  1.00 25.94  ? 202 LYS A CA    1 
ATOM   2703 C  C     . LYS E  3 202 ? 3.193   46.996 31.093  1.00 26.15  ? 202 LYS A C     1 
ATOM   2704 O  O     . LYS E  3 202 ? 2.270   47.210 30.312  1.00 24.50  ? 202 LYS A O     1 
ATOM   2705 C  CB    . LYS E  3 202 ? 4.244   48.968 32.251  1.00 32.61  ? 202 LYS A CB    1 
ATOM   2706 C  CG    . LYS E  3 202 ? 4.079   49.951 33.402  1.00 31.51  ? 202 LYS A CG    1 
ATOM   2707 C  CD    . LYS E  3 202 ? 4.583   51.341 33.068  1.00 41.16  ? 202 LYS A CD    1 
ATOM   2708 C  CE    . LYS E  3 202 ? 6.071   51.366 32.811  1.00 36.83  ? 202 LYS A CE    1 
ATOM   2709 N  NZ    . LYS E  3 202 ? 6.622   52.720 33.114  1.00 40.76  ? 202 LYS A NZ    1 
ATOM   2710 N  N     . LYS E  3 203 ? 4.122   46.068 30.870  1.00 24.05  ? 203 LYS A N     1 
ATOM   2711 C  CA    . LYS E  3 203 ? 4.086   45.269 29.647  1.00 21.58  ? 203 LYS A CA    1 
ATOM   2712 C  C     . LYS E  3 203 ? 2.804   44.445 29.563  1.00 26.92  ? 203 LYS A C     1 
ATOM   2713 O  O     . LYS E  3 203 ? 2.170   44.374 28.511  1.00 28.16  ? 203 LYS A O     1 
ATOM   2714 C  CB    . LYS E  3 203 ? 5.302   44.335 29.572  1.00 24.08  ? 203 LYS A CB    1 
ATOM   2715 C  CG    . LYS E  3 203 ? 5.343   43.486 28.307  1.00 27.59  ? 203 LYS A CG    1 
ATOM   2716 C  CD    . LYS E  3 203 ? 6.665   42.744 28.151  1.00 27.38  ? 203 LYS A CD    1 
ATOM   2717 C  CE    . LYS E  3 203 ? 6.887   41.748 29.276  1.00 34.56  ? 203 LYS A CE    1 
ATOM   2718 N  NZ    . LYS E  3 203 ? 8.161   41.005 29.083  1.00 36.36  ? 203 LYS A NZ    1 
ATOM   2719 N  N     . GLU E  3 204 ? 2.424   43.815 30.668  1.00 26.15  ? 204 GLU A N     1 
ATOM   2720 C  CA    . GLU E  3 204 ? 1.212   43.005 30.684  1.00 28.34  ? 204 GLU A CA    1 
ATOM   2721 C  C     . GLU E  3 204 ? -0.003  43.882 30.375  1.00 26.89  ? 204 GLU A C     1 
ATOM   2722 O  O     . GLU E  3 204 ? -0.863  43.503 29.582  1.00 28.67  ? 204 GLU A O     1 
ATOM   2723 C  CB    . GLU E  3 204 ? 1.051   42.318 32.047  1.00 33.07  ? 204 GLU A CB    1 
ATOM   2724 C  CG    . GLU E  3 204 ? -0.242  41.526 32.214  1.00 44.52  ? 204 GLU A CG    1 
ATOM   2725 C  CD    . GLU E  3 204 ? -0.268  40.713 33.504  1.00 47.77  ? 204 GLU A CD    1 
ATOM   2726 O  OE1   . GLU E  3 204 ? 0.483   39.721 33.598  1.00 51.58  ? 204 GLU A OE1   1 
ATOM   2727 O  OE2   . GLU E  3 204 ? -1.031  41.069 34.426  1.00 43.72  ? 204 GLU A OE2   1 
ATOM   2728 N  N     . ALA E  3 205 ? -0.064  45.059 30.991  1.00 27.14  ? 205 ALA A N     1 
ATOM   2729 C  CA    . ALA E  3 205 ? -1.172  45.979 30.748  1.00 28.85  ? 205 ALA A CA    1 
ATOM   2730 C  C     . ALA E  3 205 ? -1.196  46.418 29.280  1.00 27.49  ? 205 ALA A C     1 
ATOM   2731 O  O     . ALA E  3 205 ? -2.262  46.567 28.681  1.00 28.60  ? 205 ALA A O     1 
ATOM   2732 C  CB    . ALA E  3 205 ? -1.053  47.197 31.661  1.00 28.47  ? 205 ALA A CB    1 
ATOM   2733 N  N     . GLU E  3 206 ? -0.015  46.618 28.700  1.00 24.33  ? 206 GLU A N     1 
ATOM   2734 C  CA    . GLU E  3 206 ? 0.084   47.030 27.308  1.00 22.66  ? 206 GLU A CA    1 
ATOM   2735 C  C     . GLU E  3 206 ? -0.368  45.918 26.370  1.00 25.03  ? 206 GLU A C     1 
ATOM   2736 O  O     . GLU E  3 206 ? -0.982  46.179 25.338  1.00 25.27  ? 206 GLU A O     1 
ATOM   2737 C  CB    . GLU E  3 206 ? 1.526   47.452 26.990  1.00 24.76  ? 206 GLU A CB    1 
ATOM   2738 C  CG    . GLU E  3 206 ? 1.988   48.634 27.832  1.00 23.60  ? 206 GLU A CG    1 
ATOM   2739 C  CD    . GLU E  3 206 ? 3.478   48.903 27.729  1.00 27.34  ? 206 GLU A CD    1 
ATOM   2740 O  OE1   . GLU E  3 206 ? 4.242   47.960 27.422  1.00 22.69  ? 206 GLU A OE1   1 
ATOM   2741 O  OE2   . GLU E  3 206 ? 3.884   50.059 27.979  1.00 28.52  ? 206 GLU A OE2   1 
ATOM   2742 N  N     . GLN E  3 207 ? -0.062  44.674 26.726  1.00 25.63  ? 207 GLN A N     1 
ATOM   2743 C  CA    . GLN E  3 207 ? -0.461  43.542 25.899  1.00 25.88  ? 207 GLN A CA    1 
ATOM   2744 C  C     . GLN E  3 207 ? -1.979  43.423 25.896  1.00 28.95  ? 207 GLN A C     1 
ATOM   2745 O  O     . GLN E  3 207 ? -2.585  43.095 24.875  1.00 30.22  ? 207 GLN A O     1 
ATOM   2746 C  CB    . GLN E  3 207 ? 0.179   42.249 26.428  1.00 26.74  ? 207 GLN A CB    1 
ATOM   2747 C  CG    . GLN E  3 207 ? 1.701   42.249 26.295  1.00 26.84  ? 207 GLN A CG    1 
ATOM   2748 C  CD    . GLN E  3 207 ? 2.361   41.019 26.898  1.00 31.40  ? 207 GLN A CD    1 
ATOM   2749 O  OE1   . GLN E  3 207 ? 2.139   40.687 28.062  1.00 33.09  ? 207 GLN A OE1   1 
ATOM   2750 N  NE2   . GLN E  3 207 ? 3.193   40.349 26.110  1.00 32.70  ? 207 GLN A NE2   1 
ATOM   2751 N  N     . ARG E  3 208 ? -2.588  43.704 27.043  1.00 28.94  ? 208 ARG A N     1 
ATOM   2752 C  CA    . ARG E  3 208 ? -4.041  43.638 27.173  1.00 36.56  ? 208 ARG A CA    1 
ATOM   2753 C  C     . ARG E  3 208 ? -4.700  44.752 26.366  1.00 35.40  ? 208 ARG A C     1 
ATOM   2754 O  O     . ARG E  3 208 ? -5.706  44.532 25.693  1.00 35.34  ? 208 ARG A O     1 
ATOM   2755 C  CB    . ARG E  3 208 ? -4.452  43.764 28.641  1.00 37.56  ? 208 ARG A CB    1 
ATOM   2756 C  CG    . ARG E  3 208 ? -5.356  42.644 29.111  1.00 53.12  ? 208 ARG A CG    1 
ATOM   2757 C  CD    . ARG E  3 208 ? -4.570  41.544 29.802  1.00 54.63  ? 208 ARG A CD    1 
ATOM   2758 N  NE    . ARG E  3 208 ? -4.476  41.774 31.241  1.00 59.98  ? 208 ARG A NE    1 
ATOM   2759 C  CZ    . ARG E  3 208 ? -3.862  40.959 32.092  1.00 60.99  ? 208 ARG A CZ    1 
ATOM   2760 N  NH1   . ARG E  3 208 ? -3.277  39.854 31.650  1.00 63.72  ? 208 ARG A NH1   1 
ATOM   2761 N  NH2   . ARG E  3 208 ? -3.845  41.241 33.387  1.00 63.05  ? 208 ARG A NH2   1 
ATOM   2762 N  N     . ALA E  3 209 ? -4.126  45.950 26.437  1.00 35.13  ? 209 ALA A N     1 
ATOM   2763 C  CA    . ALA E  3 209 ? -4.651  47.099 25.709  1.00 32.52  ? 209 ALA A CA    1 
ATOM   2764 C  C     . ALA E  3 209 ? -4.506  46.876 24.209  1.00 34.08  ? 209 ALA A C     1 
ATOM   2765 O  O     . ALA E  3 209 ? -5.403  47.205 23.430  1.00 32.47  ? 209 ALA A O     1 
ATOM   2766 C  CB    . ALA E  3 209 ? -3.912  48.368 26.128  1.00 35.08  ? 209 ALA A CB    1 
ATOM   2767 N  N     . ALA E  3 210 ? -3.371  46.315 23.803  1.00 27.14  ? 210 ALA A N     1 
ATOM   2768 C  CA    . ALA E  3 210 ? -3.136  46.046 22.389  1.00 30.81  ? 210 ALA A CA    1 
ATOM   2769 C  C     . ALA E  3 210 ? -4.172  45.043 21.877  1.00 30.06  ? 210 ALA A C     1 
ATOM   2770 O  O     . ALA E  3 210 ? -4.696  45.188 20.775  1.00 29.15  ? 210 ALA A O     1 
ATOM   2771 C  CB    . ALA E  3 210 ? -1.719  45.500 22.184  1.00 26.83  ? 210 ALA A CB    1 
ATOM   2772 N  N     . GLU E  3 211 ? -4.463  44.029 22.684  1.00 36.70  ? 211 GLU A N     1 
ATOM   2773 C  CA    . GLU E  3 211 ? -5.439  43.013 22.307  1.00 39.91  ? 211 GLU A CA    1 
ATOM   2774 C  C     . GLU E  3 211 ? -6.795  43.659 22.025  1.00 40.21  ? 211 GLU A C     1 
ATOM   2775 O  O     . GLU E  3 211 ? -7.503  43.261 21.102  1.00 41.14  ? 211 GLU A O     1 
ATOM   2776 C  CB    . GLU E  3 211 ? -5.581  41.977 23.425  1.00 44.02  ? 211 GLU A CB    1 
ATOM   2777 C  CG    . GLU E  3 211 ? -6.629  40.905 23.154  1.00 49.43  ? 211 GLU A CG    1 
ATOM   2778 C  CD    . GLU E  3 211 ? -6.749  39.910 24.291  1.00 55.38  ? 211 GLU A CD    1 
ATOM   2779 O  OE1   . GLU E  3 211 ? -6.977  40.343 25.441  1.00 60.87  ? 211 GLU A OE1   1 
ATOM   2780 O  OE2   . GLU E  3 211 ? -6.619  38.694 24.037  1.00 59.42  ? 211 GLU A OE2   1 
ATOM   2781 N  N     . GLU E  3 212 ? -7.146  44.662 22.824  1.00 43.56  ? 212 GLU A N     1 
ATOM   2782 C  CA    . GLU E  3 212 ? -8.411  45.370 22.660  1.00 45.76  ? 212 GLU A CA    1 
ATOM   2783 C  C     . GLU E  3 212 ? -8.374  46.310 21.464  1.00 45.86  ? 212 GLU A C     1 
ATOM   2784 O  O     . GLU E  3 212 ? -9.326  46.377 20.684  1.00 46.45  ? 212 GLU A O     1 
ATOM   2785 C  CB    . GLU E  3 212 ? -8.736  46.163 23.926  1.00 51.32  ? 212 GLU A CB    1 
ATOM   2786 C  CG    . GLU E  3 212 ? -9.098  45.291 25.113  1.00 61.61  ? 212 GLU A CG    1 
ATOM   2787 C  CD    . GLU E  3 212 ? -10.364 44.493 24.870  1.00 66.90  ? 212 GLU A CD    1 
ATOM   2788 O  OE1   . GLU E  3 212 ? -11.439 45.114 24.737  1.00 67.51  ? 212 GLU A OE1   1 
ATOM   2789 O  OE2   . GLU E  3 212 ? -10.283 43.249 24.804  1.00 71.57  ? 212 GLU A OE2   1 
ATOM   2790 N  N     . LEU E  3 213 ? -7.273  47.038 21.319  1.00 40.59  ? 213 LEU A N     1 
ATOM   2791 C  CA    . LEU E  3 213 ? -7.137  47.971 20.212  1.00 37.55  ? 213 LEU A CA    1 
ATOM   2792 C  C     . LEU E  3 213 ? -7.265  47.254 18.875  1.00 39.74  ? 213 LEU A C     1 
ATOM   2793 O  O     . LEU E  3 213 ? -7.849  47.790 17.934  1.00 38.84  ? 213 LEU A O     1 
ATOM   2794 C  CB    . LEU E  3 213 ? -5.793  48.700 20.290  1.00 37.91  ? 213 LEU A CB    1 
ATOM   2795 C  CG    . LEU E  3 213 ? -5.534  49.766 19.222  1.00 39.74  ? 213 LEU A CG    1 
ATOM   2796 C  CD1   . LEU E  3 213 ? -6.713  50.734 19.141  1.00 40.07  ? 213 LEU A CD1   1 
ATOM   2797 C  CD2   . LEU E  3 213 ? -4.257  50.510 19.561  1.00 39.57  ? 213 LEU A CD2   1 
ATOM   2798 N  N     . ILE E  3 214 ? -6.719  46.043 18.790  1.00 35.23  ? 214 ILE A N     1 
ATOM   2799 C  CA    . ILE E  3 214 ? -6.795  45.263 17.562  1.00 39.06  ? 214 ILE A CA    1 
ATOM   2800 C  C     . ILE E  3 214 ? -8.263  45.021 17.218  1.00 46.35  ? 214 ILE A C     1 
ATOM   2801 O  O     . ILE E  3 214 ? -8.691  45.248 16.085  1.00 47.38  ? 214 ILE A O     1 
ATOM   2802 C  CB    . ILE E  3 214 ? -6.079  43.902 17.716  1.00 37.82  ? 214 ILE A CB    1 
ATOM   2803 C  CG1   . ILE E  3 214 ? -4.566  44.123 17.829  1.00 35.27  ? 214 ILE A CG1   1 
ATOM   2804 C  CG2   . ILE E  3 214 ? -6.389  43.003 16.530  1.00 33.74  ? 214 ILE A CG2   1 
ATOM   2805 C  CD1   . ILE E  3 214 ? -3.779  42.851 18.052  1.00 33.20  ? 214 ILE A CD1   1 
ATOM   2806 N  N     . LYS E  3 215 ? -9.029  44.564 18.204  1.00 50.05  ? 215 LYS A N     1 
ATOM   2807 C  CA    . LYS E  3 215 ? -10.452 44.300 18.009  1.00 57.13  ? 215 LYS A CA    1 
ATOM   2808 C  C     . LYS E  3 215 ? -11.172 45.560 17.540  1.00 57.50  ? 215 LYS A C     1 
ATOM   2809 O  O     . LYS E  3 215 ? -11.992 45.511 16.623  1.00 61.02  ? 215 LYS A O     1 
ATOM   2810 C  CB    . LYS E  3 215 ? -11.085 43.807 19.313  1.00 60.17  ? 215 LYS A CB    1 
ATOM   2811 C  CG    . LYS E  3 215 ? -10.613 42.433 19.762  1.00 65.77  ? 215 LYS A CG    1 
ATOM   2812 C  CD    . LYS E  3 215 ? -11.329 41.987 21.032  1.00 69.96  ? 215 LYS A CD    1 
ATOM   2813 C  CE    . LYS E  3 215 ? -12.836 41.907 20.824  1.00 73.82  ? 215 LYS A CE    1 
ATOM   2814 N  NZ    . LYS E  3 215 ? -13.558 41.481 22.056  1.00 73.27  ? 215 LYS A NZ    1 
ATOM   2815 N  N     . LEU E  3 216 ? -10.860 46.686 18.174  1.00 56.06  ? 216 LEU A N     1 
ATOM   2816 C  CA    . LEU E  3 216 ? -11.472 47.961 17.823  1.00 54.62  ? 216 LEU A CA    1 
ATOM   2817 C  C     . LEU E  3 216 ? -11.218 48.306 16.359  1.00 58.30  ? 216 LEU A C     1 
ATOM   2818 O  O     . LEU E  3 216 ? -12.133 48.715 15.641  1.00 59.15  ? 216 LEU A O     1 
ATOM   2819 C  CB    . LEU E  3 216 ? -10.925 49.076 18.721  1.00 49.68  ? 216 LEU A CB    1 
ATOM   2820 C  CG    . LEU E  3 216 ? -11.440 50.496 18.462  1.00 46.36  ? 216 LEU A CG    1 
ATOM   2821 C  CD1   . LEU E  3 216 ? -12.957 50.524 18.577  1.00 44.73  ? 216 LEU A CD1   1 
ATOM   2822 C  CD2   . LEU E  3 216 ? -10.815 51.459 19.461  1.00 42.93  ? 216 LEU A CD2   1 
ATOM   2823 N  N     . LEU E  3 217 ? -9.974  48.140 15.917  1.00 58.38  ? 217 LEU A N     1 
ATOM   2824 C  CA    . LEU E  3 217 ? -9.613  48.437 14.535  1.00 61.58  ? 217 LEU A CA    1 
ATOM   2825 C  C     . LEU E  3 217 ? -10.400 47.563 13.567  1.00 64.75  ? 217 LEU A C     1 
ATOM   2826 O  O     . LEU E  3 217 ? -10.530 47.889 12.386  1.00 64.79  ? 217 LEU A O     1 
ATOM   2827 C  CB    . LEU E  3 217 ? -8.112  48.222 14.320  1.00 58.05  ? 217 LEU A CB    1 
ATOM   2828 C  CG    . LEU E  3 217 ? -7.183  49.168 15.083  1.00 59.33  ? 217 LEU A CG    1 
ATOM   2829 C  CD1   . LEU E  3 217 ? -5.732  48.779 14.842  1.00 57.70  ? 217 LEU A CD1   1 
ATOM   2830 C  CD2   . LEU E  3 217 ? -7.435  50.597 14.630  1.00 56.50  ? 217 LEU A CD2   1 
ATOM   2831 N  N     . GLU E  3 218 ? -10.925 46.453 14.074  1.00 69.37  ? 218 GLU A N     1 
ATOM   2832 C  CA    . GLU E  3 218 ? -11.702 45.530 13.258  1.00 75.59  ? 218 GLU A CA    1 
ATOM   2833 C  C     . GLU E  3 218 ? -13.197 45.783 13.442  1.00 77.52  ? 218 GLU A C     1 
ATOM   2834 O  O     . GLU E  3 218 ? -13.910 44.838 13.838  1.00 78.62  ? 218 GLU A O     1 
ATOM   2835 C  CB    . GLU E  3 218 ? -11.368 44.086 13.642  1.00 78.62  ? 218 GLU A CB    1 
ATOM   2836 C  CG    . GLU E  3 218 ? -9.885  43.760 13.591  1.00 85.73  ? 218 GLU A CG    1 
ATOM   2837 C  CD    . GLU E  3 218 ? -9.592  42.314 13.943  1.00 88.98  ? 218 GLU A CD    1 
ATOM   2838 O  OE1   . GLU E  3 218 ? -10.009 41.871 15.034  1.00 90.57  ? 218 GLU A OE1   1 
ATOM   2839 O  OE2   . GLU E  3 218 ? -8.943  41.622 13.130  1.00 90.18  ? 218 GLU A OE2   1 
ATOM   2840 N  N     . MET F  3 3   ? 33.843  16.981 -2.427  1.00 62.45  ? 3   MET B N     1 
ATOM   2841 C  CA    . MET F  3 3   ? 34.450  17.916 -1.438  1.00 61.31  ? 3   MET B CA    1 
ATOM   2842 C  C     . MET F  3 3   ? 33.800  17.765 -0.065  1.00 57.44  ? 3   MET B C     1 
ATOM   2843 O  O     . MET F  3 3   ? 34.426  18.038 0.960   1.00 55.65  ? 3   MET B O     1 
ATOM   2844 C  CB    . MET F  3 3   ? 34.306  19.361 -1.923  1.00 66.34  ? 3   MET B CB    1 
ATOM   2845 C  CG    . MET F  3 3   ? 34.942  20.390 -1.003  1.00 73.85  ? 3   MET B CG    1 
ATOM   2846 S  SD    . MET F  3 3   ? 34.858  22.061 -1.675  1.00 82.21  ? 3   MET B SD    1 
ATOM   2847 C  CE    . MET F  3 3   ? 33.230  22.569 -1.119  1.00 82.93  ? 3   MET B CE    1 
ATOM   2848 N  N     . LEU F  3 4   ? 32.542  17.334 -0.048  1.00 51.19  ? 4   LEU B N     1 
ATOM   2849 C  CA    . LEU F  3 4   ? 31.833  17.141 1.209   1.00 47.79  ? 4   LEU B CA    1 
ATOM   2850 C  C     . LEU F  3 4   ? 32.600  16.150 2.074   1.00 46.36  ? 4   LEU B C     1 
ATOM   2851 O  O     . LEU F  3 4   ? 32.645  16.283 3.295   1.00 38.39  ? 4   LEU B O     1 
ATOM   2852 C  CB    . LEU F  3 4   ? 30.418  16.610 0.958   1.00 50.15  ? 4   LEU B CB    1 
ATOM   2853 C  CG    . LEU F  3 4   ? 29.445  17.505 0.187   1.00 52.11  ? 4   LEU B CG    1 
ATOM   2854 C  CD1   . LEU F  3 4   ? 28.094  16.810 0.096   1.00 52.67  ? 4   LEU B CD1   1 
ATOM   2855 C  CD2   . LEU F  3 4   ? 29.303  18.854 0.884   1.00 48.71  ? 4   LEU B CD2   1 
ATOM   2856 N  N     . GLU F  3 5   ? 33.208  15.157 1.429   1.00 41.78  ? 5   GLU B N     1 
ATOM   2857 C  CA    . GLU F  3 5   ? 33.975  14.144 2.142   1.00 41.54  ? 5   GLU B CA    1 
ATOM   2858 C  C     . GLU F  3 5   ? 35.065  14.778 2.995   1.00 37.94  ? 5   GLU B C     1 
ATOM   2859 O  O     . GLU F  3 5   ? 35.394  14.274 4.067   1.00 38.29  ? 5   GLU B O     1 
ATOM   2860 C  CB    . GLU F  3 5   ? 34.592  13.147 1.154   1.00 47.45  ? 5   GLU B CB    1 
ATOM   2861 C  CG    . GLU F  3 5   ? 33.562  12.364 0.353   1.00 62.83  ? 5   GLU B CG    1 
ATOM   2862 C  CD    . GLU F  3 5   ? 34.187  11.312 -0.544  1.00 71.11  ? 5   GLU B CD    1 
ATOM   2863 O  OE1   . GLU F  3 5   ? 35.019  11.676 -1.402  1.00 78.44  ? 5   GLU B OE1   1 
ATOM   2864 O  OE2   . GLU F  3 5   ? 33.844  10.121 -0.392  1.00 74.79  ? 5   GLU B OE2   1 
ATOM   2865 N  N     . GLN F  3 6   ? 35.623  15.888 2.524   1.00 38.65  ? 6   GLN B N     1 
ATOM   2866 C  CA    . GLN F  3 6   ? 36.669  16.573 3.273   1.00 39.93  ? 6   GLN B CA    1 
ATOM   2867 C  C     . GLN F  3 6   ? 36.107  17.152 4.573   1.00 38.65  ? 6   GLN B C     1 
ATOM   2868 O  O     . GLN F  3 6   ? 36.781  17.151 5.602   1.00 34.35  ? 6   GLN B O     1 
ATOM   2869 C  CB    . GLN F  3 6   ? 37.286  17.688 2.425   1.00 42.95  ? 6   GLN B CB    1 
ATOM   2870 C  CG    . GLN F  3 6   ? 38.438  18.408 3.105   1.00 59.34  ? 6   GLN B CG    1 
ATOM   2871 C  CD    . GLN F  3 6   ? 39.176  19.352 2.173   1.00 64.45  ? 6   GLN B CD    1 
ATOM   2872 O  OE1   . GLN F  3 6   ? 40.090  20.065 2.590   1.00 66.87  ? 6   GLN B OE1   1 
ATOM   2873 N  NE2   . GLN F  3 6   ? 38.785  19.357 0.902   1.00 69.39  ? 6   GLN B NE2   1 
ATOM   2874 N  N     . LEU F  3 7   ? 34.874  17.647 4.524   1.00 37.13  ? 7   LEU B N     1 
ATOM   2875 C  CA    . LEU F  3 7   ? 34.250  18.204 5.719   1.00 34.93  ? 7   LEU B CA    1 
ATOM   2876 C  C     . LEU F  3 7   ? 33.917  17.079 6.693   1.00 31.58  ? 7   LEU B C     1 
ATOM   2877 O  O     . LEU F  3 7   ? 34.104  17.217 7.902   1.00 30.41  ? 7   LEU B O     1 
ATOM   2878 C  CB    . LEU F  3 7   ? 32.981  18.979 5.351   1.00 35.02  ? 7   LEU B CB    1 
ATOM   2879 C  CG    . LEU F  3 7   ? 32.175  19.583 6.509   1.00 34.81  ? 7   LEU B CG    1 
ATOM   2880 C  CD1   . LEU F  3 7   ? 33.091  20.347 7.464   1.00 29.35  ? 7   LEU B CD1   1 
ATOM   2881 C  CD2   . LEU F  3 7   ? 31.098  20.500 5.937   1.00 30.46  ? 7   LEU B CD2   1 
ATOM   2882 N  N     . GLU F  3 8   ? 33.426  15.964 6.165   1.00 30.53  ? 8   GLU B N     1 
ATOM   2883 C  CA    . GLU F  3 8   ? 33.090  14.823 7.005   1.00 33.94  ? 8   GLU B CA    1 
ATOM   2884 C  C     . GLU F  3 8   ? 34.341  14.347 7.733   1.00 34.99  ? 8   GLU B C     1 
ATOM   2885 O  O     . GLU F  3 8   ? 34.279  13.923 8.887   1.00 34.12  ? 8   GLU B O     1 
ATOM   2886 C  CB    . GLU F  3 8   ? 32.515  13.691 6.157   1.00 34.42  ? 8   GLU B CB    1 
ATOM   2887 C  CG    . GLU F  3 8   ? 31.209  14.034 5.469   1.00 36.98  ? 8   GLU B CG    1 
ATOM   2888 C  CD    . GLU F  3 8   ? 30.720  12.910 4.575   1.00 41.14  ? 8   GLU B CD    1 
ATOM   2889 O  OE1   . GLU F  3 8   ? 31.484  12.502 3.675   1.00 42.99  ? 8   GLU B OE1   1 
ATOM   2890 O  OE2   . GLU F  3 8   ? 29.580  12.437 4.768   1.00 39.26  ? 8   GLU B OE2   1 
ATOM   2891 N  N     . LYS F  3 9   ? 35.484  14.422 7.057   1.00 35.92  ? 9   LYS B N     1 
ATOM   2892 C  CA    . LYS F  3 9   ? 36.736  13.998 7.667   1.00 37.04  ? 9   LYS B CA    1 
ATOM   2893 C  C     . LYS F  3 9   ? 37.104  14.927 8.819   1.00 37.03  ? 9   LYS B C     1 
ATOM   2894 O  O     . LYS F  3 9   ? 37.580  14.476 9.860   1.00 40.80  ? 9   LYS B O     1 
ATOM   2895 C  CB    . LYS F  3 9   ? 37.865  13.986 6.631   1.00 42.32  ? 9   LYS B CB    1 
ATOM   2896 C  CG    . LYS F  3 9   ? 39.193  13.488 7.187   1.00 46.13  ? 9   LYS B CG    1 
ATOM   2897 C  CD    . LYS F  3 9   ? 40.262  13.406 6.106   1.00 53.16  ? 9   LYS B CD    1 
ATOM   2898 C  CE    . LYS F  3 9   ? 41.578  12.894 6.674   1.00 57.13  ? 9   LYS B CE    1 
ATOM   2899 N  NZ    . LYS F  3 9   ? 42.638  12.787 5.632   1.00 59.73  ? 9   LYS B NZ    1 
ATOM   2900 N  N     . LYS F  3 10  ? 36.888  16.225 8.633   1.00 34.98  ? 10  LYS B N     1 
ATOM   2901 C  CA    . LYS F  3 10  ? 37.194  17.197 9.678   1.00 37.87  ? 10  LYS B CA    1 
ATOM   2902 C  C     . LYS F  3 10  ? 36.253  17.015 10.866  1.00 38.07  ? 10  LYS B C     1 
ATOM   2903 O  O     . LYS F  3 10  ? 36.659  17.157 12.019  1.00 38.78  ? 10  LYS B O     1 
ATOM   2904 C  CB    . LYS F  3 10  ? 37.067  18.626 9.139   1.00 37.78  ? 10  LYS B CB    1 
ATOM   2905 C  CG    . LYS F  3 10  ? 38.124  19.020 8.115   1.00 41.34  ? 10  LYS B CG    1 
ATOM   2906 C  CD    . LYS F  3 10  ? 37.941  20.465 7.668   1.00 39.60  ? 10  LYS B CD    1 
ATOM   2907 C  CE    . LYS F  3 10  ? 39.008  20.883 6.669   1.00 46.77  ? 10  LYS B CE    1 
ATOM   2908 N  NZ    . LYS F  3 10  ? 40.376  20.803 7.259   1.00 46.32  ? 10  LYS B NZ    1 
ATOM   2909 N  N     . LEU F  3 11  ? 34.994  16.700 10.575  1.00 37.93  ? 11  LEU B N     1 
ATOM   2910 C  CA    . LEU F  3 11  ? 33.986  16.495 11.613  1.00 38.35  ? 11  LEU B CA    1 
ATOM   2911 C  C     . LEU F  3 11  ? 34.171  15.174 12.342  1.00 40.20  ? 11  LEU B C     1 
ATOM   2912 O  O     . LEU F  3 11  ? 33.868  15.063 13.532  1.00 38.86  ? 11  LEU B O     1 
ATOM   2913 C  CB    . LEU F  3 11  ? 32.581  16.516 11.008  1.00 39.80  ? 11  LEU B CB    1 
ATOM   2914 C  CG    . LEU F  3 11  ? 31.886  17.855 10.783  1.00 42.46  ? 11  LEU B CG    1 
ATOM   2915 C  CD1   . LEU F  3 11  ? 30.595  17.629 10.008  1.00 43.05  ? 11  LEU B CD1   1 
ATOM   2916 C  CD2   . LEU F  3 11  ? 31.597  18.512 12.128  1.00 42.12  ? 11  LEU B CD2   1 
ATOM   2917 N  N     . GLY F  3 12  ? 34.668  14.173 11.623  1.00 37.36  ? 12  GLY B N     1 
ATOM   2918 C  CA    . GLY F  3 12  ? 34.847  12.863 12.218  1.00 36.02  ? 12  GLY B CA    1 
ATOM   2919 C  C     . GLY F  3 12  ? 33.520  12.131 12.162  1.00 32.68  ? 12  GLY B C     1 
ATOM   2920 O  O     . GLY F  3 12  ? 33.237  11.257 12.984  1.00 37.43  ? 12  GLY B O     1 
ATOM   2921 N  N     . TYR F  3 13  ? 32.703  12.494 11.179  1.00 31.84  ? 13  TYR B N     1 
ATOM   2922 C  CA    . TYR F  3 13  ? 31.391  11.891 11.010  1.00 30.61  ? 13  TYR B CA    1 
ATOM   2923 C  C     . TYR F  3 13  ? 31.012  11.773 9.539   1.00 33.82  ? 13  TYR B C     1 
ATOM   2924 O  O     . TYR F  3 13  ? 31.134  12.738 8.779   1.00 32.24  ? 13  TYR B O     1 
ATOM   2925 C  CB    . TYR F  3 13  ? 30.343  12.740 11.729  1.00 33.14  ? 13  TYR B CB    1 
ATOM   2926 C  CG    . TYR F  3 13  ? 28.943  12.198 11.604  1.00 28.16  ? 13  TYR B CG    1 
ATOM   2927 C  CD1   . TYR F  3 13  ? 28.542  11.086 12.340  1.00 29.35  ? 13  TYR B CD1   1 
ATOM   2928 C  CD2   . TYR F  3 13  ? 28.027  12.777 10.727  1.00 30.05  ? 13  TYR B CD2   1 
ATOM   2929 C  CE1   . TYR F  3 13  ? 27.261  10.563 12.209  1.00 26.02  ? 13  TYR B CE1   1 
ATOM   2930 C  CE2   . TYR F  3 13  ? 26.744  12.259 10.586  1.00 27.98  ? 13  TYR B CE2   1 
ATOM   2931 C  CZ    . TYR F  3 13  ? 26.369  11.151 11.334  1.00 29.57  ? 13  TYR B CZ    1 
ATOM   2932 O  OH    . TYR F  3 13  ? 25.093  10.640 11.216  1.00 29.86  ? 13  TYR B OH    1 
ATOM   2933 N  N     . THR F  3 14  ? 30.544  10.593 9.143   1.00 32.55  ? 14  THR B N     1 
ATOM   2934 C  CA    . THR F  3 14  ? 30.122  10.361 7.767   1.00 31.84  ? 14  THR B CA    1 
ATOM   2935 C  C     . THR F  3 14  ? 28.600  10.330 7.728   1.00 30.71  ? 14  THR B C     1 
ATOM   2936 O  O     . THR F  3 14  ? 27.972  9.551  8.447   1.00 33.73  ? 14  THR B O     1 
ATOM   2937 C  CB    . THR F  3 14  ? 30.663  9.015  7.231   1.00 33.41  ? 14  THR B CB    1 
ATOM   2938 O  OG1   . THR F  3 14  ? 32.096  9.033  7.246   1.00 37.13  ? 14  THR B OG1   1 
ATOM   2939 C  CG2   . THR F  3 14  ? 30.175  8.772  5.817   1.00 32.47  ? 14  THR B CG2   1 
ATOM   2940 N  N     . PHE F  3 15  ? 28.011  11.178 6.893   1.00 31.39  ? 15  PHE B N     1 
ATOM   2941 C  CA    . PHE F  3 15  ? 26.559  11.248 6.771   1.00 32.63  ? 15  PHE B CA    1 
ATOM   2942 C  C     . PHE F  3 15  ? 25.965  10.067 6.005   1.00 37.63  ? 15  PHE B C     1 
ATOM   2943 O  O     . PHE F  3 15  ? 26.578  9.545  5.070   1.00 36.54  ? 15  PHE B O     1 
ATOM   2944 C  CB    . PHE F  3 15  ? 26.145  12.541 6.057   1.00 27.87  ? 15  PHE B CB    1 
ATOM   2945 C  CG    . PHE F  3 15  ? 26.067  13.750 6.960   1.00 27.75  ? 15  PHE B CG    1 
ATOM   2946 C  CD1   . PHE F  3 15  ? 27.217  14.310 7.505   1.00 26.59  ? 15  PHE B CD1   1 
ATOM   2947 C  CD2   . PHE F  3 15  ? 24.835  14.320 7.267   1.00 29.53  ? 15  PHE B CD2   1 
ATOM   2948 C  CE1   . PHE F  3 15  ? 27.144  15.425 8.347   1.00 28.72  ? 15  PHE B CE1   1 
ATOM   2949 C  CE2   . PHE F  3 15  ? 24.749  15.435 8.108   1.00 26.84  ? 15  PHE B CE2   1 
ATOM   2950 C  CZ    . PHE F  3 15  ? 25.907  15.986 8.648   1.00 26.28  ? 15  PHE B CZ    1 
ATOM   2951 N  N     . LYS F  3 16  ? 24.770  9.653  6.410   1.00 38.74  ? 16  LYS B N     1 
ATOM   2952 C  CA    . LYS F  3 16  ? 24.069  8.575  5.731   1.00 39.33  ? 16  LYS B CA    1 
ATOM   2953 C  C     . LYS F  3 16  ? 23.300  9.260  4.606   1.00 41.55  ? 16  LYS B C     1 
ATOM   2954 O  O     . LYS F  3 16  ? 23.275  8.787  3.466   1.00 40.08  ? 16  LYS B O     1 
ATOM   2955 C  CB    . LYS F  3 16  ? 23.099  7.876  6.687   1.00 44.32  ? 16  LYS B CB    1 
ATOM   2956 C  CG    . LYS F  3 16  ? 22.333  6.731  6.043   1.00 57.62  ? 16  LYS B CG    1 
ATOM   2957 C  CD    . LYS F  3 16  ? 21.455  5.996  7.043   1.00 64.47  ? 16  LYS B CD    1 
ATOM   2958 C  CE    . LYS F  3 16  ? 20.763  4.809  6.385   1.00 68.26  ? 16  LYS B CE    1 
ATOM   2959 N  NZ    . LYS F  3 16  ? 19.952  4.020  7.355   1.00 72.63  ? 16  LYS B NZ    1 
ATOM   2960 N  N     . ASP F  3 17  ? 22.681  10.390 4.938   1.00 31.75  ? 17  ASP B N     1 
ATOM   2961 C  CA    . ASP F  3 17  ? 21.928  11.169 3.967   1.00 37.42  ? 17  ASP B CA    1 
ATOM   2962 C  C     . ASP F  3 17  ? 22.724  12.428 3.635   1.00 40.88  ? 17  ASP B C     1 
ATOM   2963 O  O     . ASP F  3 17  ? 22.669  13.425 4.358   1.00 39.15  ? 17  ASP B O     1 
ATOM   2964 C  CB    . ASP F  3 17  ? 20.552  11.535 4.528   1.00 36.04  ? 17  ASP B CB    1 
ATOM   2965 C  CG    . ASP F  3 17  ? 19.738  12.374 3.569   1.00 41.09  ? 17  ASP B CG    1 
ATOM   2966 O  OD1   . ASP F  3 17  ? 20.130  12.480 2.388   1.00 46.00  ? 17  ASP B OD1   1 
ATOM   2967 O  OD2   . ASP F  3 17  ? 18.700  12.925 3.991   1.00 48.13  ? 17  ASP B OD2   1 
ATOM   2968 N  N     . LYS F  3 18  ? 23.473  12.365 2.539   1.00 40.18  ? 18  LYS B N     1 
ATOM   2969 C  CA    . LYS F  3 18  ? 24.301  13.479 2.097   1.00 39.57  ? 18  LYS B CA    1 
ATOM   2970 C  C     . LYS F  3 18  ? 23.515  14.764 1.851   1.00 38.03  ? 18  LYS B C     1 
ATOM   2971 O  O     . LYS F  3 18  ? 24.067  15.859 1.959   1.00 39.66  ? 18  LYS B O     1 
ATOM   2972 C  CB    . LYS F  3 18  ? 25.057  13.090 0.821   1.00 40.72  ? 18  LYS B CB    1 
ATOM   2973 C  CG    . LYS F  3 18  ? 26.519  12.704 1.030   1.00 40.08  ? 18  LYS B CG    1 
ATOM   2974 C  CD    . LYS F  3 18  ? 26.699  11.573 2.024   1.00 41.85  ? 18  LYS B CD    1 
ATOM   2975 C  CE    . LYS F  3 18  ? 28.174  11.221 2.165   1.00 41.56  ? 18  LYS B CE    1 
ATOM   2976 N  NZ    . LYS F  3 18  ? 28.436  10.234 3.243   1.00 37.77  ? 18  LYS B NZ    1 
ATOM   2977 N  N     . SER F  3 19  ? 22.233  14.635 1.524   1.00 36.14  ? 19  SER B N     1 
ATOM   2978 C  CA    . SER F  3 19  ? 21.399  15.803 1.253   1.00 37.54  ? 19  SER B CA    1 
ATOM   2979 C  C     . SER F  3 19  ? 21.198  16.651 2.507   1.00 37.58  ? 19  SER B C     1 
ATOM   2980 O  O     . SER F  3 19  ? 20.954  17.852 2.417   1.00 37.30  ? 19  SER B O     1 
ATOM   2981 C  CB    . SER F  3 19  ? 20.033  15.376 0.709   1.00 39.78  ? 19  SER B CB    1 
ATOM   2982 O  OG    . SER F  3 19  ? 19.223  14.828 1.733   1.00 41.96  ? 19  SER B OG    1 
ATOM   2983 N  N     . LEU F  3 20  ? 21.283  16.014 3.672   1.00 34.48  ? 20  LEU B N     1 
ATOM   2984 C  CA    . LEU F  3 20  ? 21.131  16.723 4.939   1.00 36.38  ? 20  LEU B CA    1 
ATOM   2985 C  C     . LEU F  3 20  ? 22.334  17.634 5.141   1.00 31.17  ? 20  LEU B C     1 
ATOM   2986 O  O     . LEU F  3 20  ? 22.189  18.783 5.552   1.00 30.54  ? 20  LEU B O     1 
ATOM   2987 C  CB    . LEU F  3 20  ? 21.045  15.745 6.113   1.00 39.22  ? 20  LEU B CB    1 
ATOM   2988 C  CG    . LEU F  3 20  ? 19.674  15.232 6.554   1.00 43.01  ? 20  LEU B CG    1 
ATOM   2989 C  CD1   . LEU F  3 20  ? 19.861  14.259 7.708   1.00 37.02  ? 20  LEU B CD1   1 
ATOM   2990 C  CD2   . LEU F  3 20  ? 18.789  16.398 6.985   1.00 41.19  ? 20  LEU B CD2   1 
ATOM   2991 N  N     . LEU F  3 21  ? 23.524  17.113 4.859   1.00 30.96  ? 21  LEU B N     1 
ATOM   2992 C  CA    . LEU F  3 21  ? 24.741  17.905 5.002   1.00 31.79  ? 21  LEU B CA    1 
ATOM   2993 C  C     . LEU F  3 21  ? 24.730  19.043 3.990   1.00 32.86  ? 21  LEU B C     1 
ATOM   2994 O  O     . LEU F  3 21  ? 25.085  20.181 4.309   1.00 28.16  ? 21  LEU B O     1 
ATOM   2995 C  CB    . LEU F  3 21  ? 25.984  17.033 4.792   1.00 30.31  ? 21  LEU B CB    1 
ATOM   2996 C  CG    . LEU F  3 21  ? 27.340  17.750 4.810   1.00 37.92  ? 21  LEU B CG    1 
ATOM   2997 C  CD1   . LEU F  3 21  ? 27.502  18.537 6.106   1.00 38.30  ? 21  LEU B CD1   1 
ATOM   2998 C  CD2   . LEU F  3 21  ? 28.458  16.726 4.665   1.00 39.67  ? 21  LEU B CD2   1 
ATOM   2999 N  N     . GLU F  3 22  ? 24.312  18.737 2.767   1.00 31.09  ? 22  GLU B N     1 
ATOM   3000 C  CA    . GLU F  3 22  ? 24.251  19.744 1.716   1.00 31.38  ? 22  GLU B CA    1 
ATOM   3001 C  C     . GLU F  3 22  ? 23.314  20.879 2.116   1.00 30.39  ? 22  GLU B C     1 
ATOM   3002 O  O     . GLU F  3 22  ? 23.626  22.049 1.910   1.00 27.20  ? 22  GLU B O     1 
ATOM   3003 C  CB    . GLU F  3 22  ? 23.775  19.109 0.405   1.00 37.44  ? 22  GLU B CB    1 
ATOM   3004 C  CG    . GLU F  3 22  ? 24.714  18.038 -0.132  1.00 46.57  ? 22  GLU B CG    1 
ATOM   3005 C  CD    . GLU F  3 22  ? 24.308  17.534 -1.508  1.00 54.98  ? 22  GLU B CD    1 
ATOM   3006 O  OE1   . GLU F  3 22  ? 23.200  16.970 -1.640  1.00 57.05  ? 22  GLU B OE1   1 
ATOM   3007 O  OE2   . GLU F  3 22  ? 25.100  17.707 -2.458  1.00 56.36  ? 22  GLU B OE2   1 
ATOM   3008 N  N     . LYS F  3 23  ? 22.166  20.525 2.692   1.00 28.62  ? 23  LYS B N     1 
ATOM   3009 C  CA    . LYS F  3 23  ? 21.191  21.519 3.134   1.00 31.43  ? 23  LYS B CA    1 
ATOM   3010 C  C     . LYS F  3 23  ? 21.796  22.473 4.160   1.00 26.79  ? 23  LYS B C     1 
ATOM   3011 O  O     . LYS F  3 23  ? 21.617  23.687 4.077   1.00 28.46  ? 23  LYS B O     1 
ATOM   3012 C  CB    . LYS F  3 23  ? 19.971  20.849 3.777   1.00 36.43  ? 23  LYS B CB    1 
ATOM   3013 C  CG    . LYS F  3 23  ? 18.944  20.284 2.814   1.00 46.70  ? 23  LYS B CG    1 
ATOM   3014 C  CD    . LYS F  3 23  ? 17.644  19.999 3.559   1.00 55.00  ? 23  LYS B CD    1 
ATOM   3015 C  CE    . LYS F  3 23  ? 16.583  19.398 2.650   1.00 60.84  ? 23  LYS B CE    1 
ATOM   3016 N  NZ    . LYS F  3 23  ? 16.973  18.052 2.153   1.00 66.25  ? 23  LYS B NZ    1 
ATOM   3017 N  N     . ALA F  3 24  ? 22.505  21.912 5.133   1.00 27.76  ? 24  ALA B N     1 
ATOM   3018 C  CA    . ALA F  3 24  ? 23.120  22.711 6.189   1.00 28.53  ? 24  ALA B CA    1 
ATOM   3019 C  C     . ALA F  3 24  ? 24.151  23.700 5.663   1.00 27.63  ? 24  ALA B C     1 
ATOM   3020 O  O     . ALA F  3 24  ? 24.384  24.740 6.271   1.00 25.87  ? 24  ALA B O     1 
ATOM   3021 C  CB    . ALA F  3 24  ? 23.760  21.800 7.223   1.00 24.29  ? 24  ALA B CB    1 
ATOM   3022 N  N     . LEU F  3 25  ? 24.760  23.382 4.525   1.00 23.65  ? 25  LEU B N     1 
ATOM   3023 C  CA    . LEU F  3 25  ? 25.783  24.248 3.944   1.00 24.90  ? 25  LEU B CA    1 
ATOM   3024 C  C     . LEU F  3 25  ? 25.254  25.223 2.896   1.00 23.03  ? 25  LEU B C     1 
ATOM   3025 O  O     . LEU F  3 25  ? 25.991  26.094 2.429   1.00 26.39  ? 25  LEU B O     1 
ATOM   3026 C  CB    . LEU F  3 25  ? 26.880  23.383 3.312   1.00 23.70  ? 25  LEU B CB    1 
ATOM   3027 C  CG    . LEU F  3 25  ? 27.596  22.396 4.234   1.00 29.68  ? 25  LEU B CG    1 
ATOM   3028 C  CD1   . LEU F  3 25  ? 28.356  21.371 3.404   1.00 27.84  ? 25  LEU B CD1   1 
ATOM   3029 C  CD2   . LEU F  3 25  ? 28.530  23.155 5.166   1.00 28.29  ? 25  LEU B CD2   1 
ATOM   3030 N  N     . THR F  3 26  ? 23.977  25.100 2.548   1.00 22.89  ? 26  THR B N     1 
ATOM   3031 C  CA    . THR F  3 26  ? 23.391  25.942 1.510   1.00 24.38  ? 26  THR B CA    1 
ATOM   3032 C  C     . THR F  3 26  ? 22.539  27.125 1.957   1.00 26.96  ? 26  THR B C     1 
ATOM   3033 O  O     . THR F  3 26  ? 21.540  26.962 2.658   1.00 24.06  ? 26  THR B O     1 
ATOM   3034 C  CB    . THR F  3 26  ? 22.546  25.079 0.550   1.00 29.19  ? 26  THR B CB    1 
ATOM   3035 O  OG1   . THR F  3 26  ? 23.328  23.957 0.120   1.00 30.48  ? 26  THR B OG1   1 
ATOM   3036 C  CG2   . THR F  3 26  ? 22.116  25.889 -0.666  1.00 27.19  ? 26  THR B CG2   1 
ATOM   3037 N  N     . HIS F  3 27  ? 22.931  28.316 1.517   1.00 26.95  ? 27  HIS B N     1 
ATOM   3038 C  CA    . HIS F  3 27  ? 22.205  29.536 1.845   1.00 27.74  ? 27  HIS B CA    1 
ATOM   3039 C  C     . HIS F  3 27  ? 20.951  29.645 0.975   1.00 31.39  ? 27  HIS B C     1 
ATOM   3040 O  O     . HIS F  3 27  ? 20.950  29.237 -0.190  1.00 33.37  ? 27  HIS B O     1 
ATOM   3041 C  CB    . HIS F  3 27  ? 23.117  30.749 1.649   1.00 30.14  ? 27  HIS B CB    1 
ATOM   3042 C  CG    . HIS F  3 27  ? 22.506  32.043 2.087   1.00 33.18  ? 27  HIS B CG    1 
ATOM   3043 N  ND1   . HIS F  3 27  ? 21.885  32.908 1.211   1.00 27.68  ? 27  HIS B ND1   1 
ATOM   3044 C  CD2   . HIS F  3 27  ? 22.419  32.619 3.309   1.00 31.92  ? 27  HIS B CD2   1 
ATOM   3045 C  CE1   . HIS F  3 27  ? 21.445  33.963 1.874   1.00 34.70  ? 27  HIS B CE1   1 
ATOM   3046 N  NE2   . HIS F  3 27  ? 21.756  33.812 3.149   1.00 34.39  ? 27  HIS B NE2   1 
ATOM   3047 N  N     . VAL F  3 28  ? 19.885  30.190 1.553   1.00 29.47  ? 28  VAL B N     1 
ATOM   3048 C  CA    . VAL F  3 28  ? 18.606  30.335 0.863   1.00 31.53  ? 28  VAL B CA    1 
ATOM   3049 C  C     . VAL F  3 28  ? 18.687  31.090 -0.465  1.00 34.76  ? 28  VAL B C     1 
ATOM   3050 O  O     . VAL F  3 28  ? 17.875  30.859 -1.364  1.00 37.26  ? 28  VAL B O     1 
ATOM   3051 C  CB    . VAL F  3 28  ? 17.568  31.036 1.778   1.00 35.69  ? 28  VAL B CB    1 
ATOM   3052 C  CG1   . VAL F  3 28  ? 17.966  32.492 2.005   1.00 29.58  ? 28  VAL B CG1   1 
ATOM   3053 C  CG2   . VAL F  3 28  ? 16.177  30.945 1.161   1.00 36.38  ? 28  VAL B CG2   1 
ATOM   3054 N  N     . SER F  3 29  ? 19.661  31.986 -0.593  1.00 31.78  ? 29  SER B N     1 
ATOM   3055 C  CA    . SER F  3 29  ? 19.817  32.755 -1.823  1.00 32.77  ? 29  SER B CA    1 
ATOM   3056 C  C     . SER F  3 29  ? 20.343  31.854 -2.934  1.00 36.41  ? 29  SER B C     1 
ATOM   3057 O  O     . SER F  3 29  ? 20.270  32.193 -4.117  1.00 33.67  ? 29  SER B O     1 
ATOM   3058 C  CB    . SER F  3 29  ? 20.796  33.913 -1.611  1.00 36.29  ? 29  SER B CB    1 
ATOM   3059 O  OG    . SER F  3 29  ? 22.115  33.437 -1.405  1.00 33.39  ? 29  SER B OG    1 
ATOM   3060 N  N     . TYR F  3 30  ? 20.872  30.701 -2.537  1.00 33.23  ? 30  TYR B N     1 
ATOM   3061 C  CA    . TYR F  3 30  ? 21.438  29.737 -3.472  1.00 34.63  ? 30  TYR B CA    1 
ATOM   3062 C  C     . TYR F  3 30  ? 20.400  28.684 -3.847  1.00 37.94  ? 30  TYR B C     1 
ATOM   3063 O  O     . TYR F  3 30  ? 20.420  28.140 -4.954  1.00 35.17  ? 30  TYR B O     1 
ATOM   3064 C  CB    . TYR F  3 30  ? 22.667  29.082 -2.831  1.00 35.86  ? 30  TYR B CB    1 
ATOM   3065 C  CG    . TYR F  3 30  ? 23.480  28.189 -3.740  1.00 39.09  ? 30  TYR B CG    1 
ATOM   3066 C  CD1   . TYR F  3 30  ? 23.060  26.894 -4.044  1.00 42.80  ? 30  TYR B CD1   1 
ATOM   3067 C  CD2   . TYR F  3 30  ? 24.686  28.633 -4.278  1.00 44.26  ? 30  TYR B CD2   1 
ATOM   3068 C  CE1   . TYR F  3 30  ? 23.826  26.062 -4.858  1.00 47.48  ? 30  TYR B CE1   1 
ATOM   3069 C  CE2   . TYR F  3 30  ? 25.457  27.814 -5.091  1.00 48.45  ? 30  TYR B CE2   1 
ATOM   3070 C  CZ    . TYR F  3 30  ? 25.023  26.530 -5.376  1.00 50.90  ? 30  TYR B CZ    1 
ATOM   3071 O  OH    . TYR F  3 30  ? 25.794  25.718 -6.175  1.00 57.73  ? 30  TYR B OH    1 
ATOM   3072 N  N     . SER F  3 31  ? 19.495  28.403 -2.915  1.00 35.24  ? 31  SER B N     1 
ATOM   3073 C  CA    . SER F  3 31  ? 18.434  27.428 -3.133  1.00 37.99  ? 31  SER B CA    1 
ATOM   3074 C  C     . SER F  3 31  ? 17.269  27.708 -2.195  1.00 45.14  ? 31  SER B C     1 
ATOM   3075 O  O     . SER F  3 31  ? 17.439  27.749 -0.975  1.00 40.54  ? 31  SER B O     1 
ATOM   3076 C  CB    . SER F  3 31  ? 18.957  26.013 -2.896  1.00 34.28  ? 31  SER B CB    1 
ATOM   3077 O  OG    . SER F  3 31  ? 17.919  25.061 -3.046  1.00 44.72  ? 31  SER B OG    1 
ATOM   3078 N  N     . LYS F  3 32  ? 16.084  27.897 -2.763  1.00 49.44  ? 32  LYS B N     1 
ATOM   3079 C  CA    . LYS F  3 32  ? 14.910  28.183 -1.957  1.00 57.15  ? 32  LYS B CA    1 
ATOM   3080 C  C     . LYS F  3 32  ? 14.192  26.918 -1.505  1.00 60.28  ? 32  LYS B C     1 
ATOM   3081 O  O     . LYS F  3 32  ? 13.267  26.976 -0.694  1.00 63.90  ? 32  LYS B O     1 
ATOM   3082 C  CB    . LYS F  3 32  ? 13.972  29.107 -2.732  1.00 59.44  ? 32  LYS B CB    1 
ATOM   3083 C  CG    . LYS F  3 32  ? 14.656  30.405 -3.142  1.00 63.05  ? 32  LYS B CG    1 
ATOM   3084 C  CD    . LYS F  3 32  ? 13.719  31.363 -3.849  1.00 68.28  ? 32  LYS B CD    1 
ATOM   3085 C  CE    . LYS F  3 32  ? 14.468  32.608 -4.304  1.00 67.98  ? 32  LYS B CE    1 
ATOM   3086 N  NZ    . LYS F  3 32  ? 15.155  33.289 -3.171  1.00 70.41  ? 32  LYS B NZ    1 
ATOM   3087 N  N     . LYS F  3 33  ? 14.634  25.773 -2.013  1.00 62.81  ? 33  LYS B N     1 
ATOM   3088 C  CA    . LYS F  3 33  ? 14.032  24.499 -1.640  1.00 65.41  ? 33  LYS B CA    1 
ATOM   3089 C  C     . LYS F  3 33  ? 14.803  23.854 -0.498  1.00 63.30  ? 33  LYS B C     1 
ATOM   3090 O  O     . LYS F  3 33  ? 14.237  23.544 0.550   1.00 63.09  ? 33  LYS B O     1 
ATOM   3091 C  CB    . LYS F  3 33  ? 14.015  23.539 -2.829  1.00 70.08  ? 33  LYS B CB    1 
ATOM   3092 C  CG    . LYS F  3 33  ? 13.353  22.202 -2.519  1.00 78.97  ? 33  LYS B CG    1 
ATOM   3093 C  CD    . LYS F  3 33  ? 13.349  21.278 -3.727  1.00 85.88  ? 33  LYS B CD    1 
ATOM   3094 C  CE    . LYS F  3 33  ? 12.567  20.004 -3.445  1.00 89.50  ? 33  LYS B CE    1 
ATOM   3095 N  NZ    . LYS F  3 33  ? 12.484  19.124 -4.646  1.00 93.29  ? 33  LYS B NZ    1 
ATOM   3096 N  N     . GLU F  3 34  ? 16.099  23.652 -0.710  1.00 58.91  ? 34  GLU B N     1 
ATOM   3097 C  CA    . GLU F  3 34  ? 16.941  23.031 0.298   1.00 54.29  ? 34  GLU B CA    1 
ATOM   3098 C  C     . GLU F  3 34  ? 18.030  23.963 0.814   1.00 46.87  ? 34  GLU B C     1 
ATOM   3099 O  O     . GLU F  3 34  ? 19.110  24.068 0.231   1.00 39.37  ? 34  GLU B O     1 
ATOM   3100 C  CB    . GLU F  3 34  ? 17.565  21.754 -0.264  1.00 61.50  ? 34  GLU B CB    1 
ATOM   3101 C  CG    . GLU F  3 34  ? 16.538  20.709 -0.666  1.00 75.05  ? 34  GLU B CG    1 
ATOM   3102 C  CD    . GLU F  3 34  ? 17.174  19.428 -1.162  1.00 83.46  ? 34  GLU B CD    1 
ATOM   3103 O  OE1   . GLU F  3 34  ? 17.936  19.485 -2.150  1.00 90.00  ? 34  GLU B OE1   1 
ATOM   3104 O  OE2   . GLU F  3 34  ? 16.910  18.363 -0.566  1.00 88.08  ? 34  GLU B OE2   1 
ATOM   3105 N  N     . HIS F  3 35  ? 17.728  24.644 1.913   1.00 39.56  ? 35  HIS B N     1 
ATOM   3106 C  CA    . HIS F  3 35  ? 18.670  25.563 2.535   1.00 31.54  ? 35  HIS B CA    1 
ATOM   3107 C  C     . HIS F  3 35  ? 18.759  25.236 4.024   1.00 31.29  ? 35  HIS B C     1 
ATOM   3108 O  O     . HIS F  3 35  ? 18.032  24.377 4.519   1.00 27.87  ? 35  HIS B O     1 
ATOM   3109 C  CB    . HIS F  3 35  ? 18.226  27.010 2.325   1.00 33.98  ? 35  HIS B CB    1 
ATOM   3110 C  CG    . HIS F  3 35  ? 16.807  27.270 2.719   1.00 41.16  ? 35  HIS B CG    1 
ATOM   3111 N  ND1   . HIS F  3 35  ? 15.736  26.888 1.939   1.00 43.96  ? 35  HIS B ND1   1 
ATOM   3112 C  CD2   . HIS F  3 35  ? 16.282  27.869 3.812   1.00 37.34  ? 35  HIS B CD2   1 
ATOM   3113 C  CE1   . HIS F  3 35  ? 14.612  27.245 2.535   1.00 41.65  ? 35  HIS B CE1   1 
ATOM   3114 N  NE2   . HIS F  3 35  ? 14.916  27.842 3.673   1.00 45.18  ? 35  HIS B NE2   1 
ATOM   3115 N  N     . TYR F  3 36  ? 19.628  25.944 4.737   1.00 26.40  ? 36  TYR B N     1 
ATOM   3116 C  CA    . TYR F  3 36  ? 19.861  25.673 6.154   1.00 23.61  ? 36  TYR B CA    1 
ATOM   3117 C  C     . TYR F  3 36  ? 18.994  26.359 7.202   1.00 25.38  ? 36  TYR B C     1 
ATOM   3118 O  O     . TYR F  3 36  ? 19.167  26.093 8.390   1.00 22.20  ? 36  TYR B O     1 
ATOM   3119 C  CB    . TYR F  3 36  ? 21.323  25.985 6.482   1.00 20.36  ? 36  TYR B CB    1 
ATOM   3120 C  CG    . TYR F  3 36  ? 21.677  27.462 6.430   1.00 23.76  ? 36  TYR B CG    1 
ATOM   3121 C  CD1   . TYR F  3 36  ? 21.102  28.376 7.321   1.00 22.28  ? 36  TYR B CD1   1 
ATOM   3122 C  CD2   . TYR F  3 36  ? 22.623  27.938 5.523   1.00 23.19  ? 36  TYR B CD2   1 
ATOM   3123 C  CE1   . TYR F  3 36  ? 21.465  29.721 7.314   1.00 24.12  ? 36  TYR B CE1   1 
ATOM   3124 C  CE2   . TYR F  3 36  ? 22.994  29.281 5.506   1.00 25.31  ? 36  TYR B CE2   1 
ATOM   3125 C  CZ    . TYR F  3 36  ? 22.413  30.165 6.405   1.00 26.95  ? 36  TYR B CZ    1 
ATOM   3126 O  OH    . TYR F  3 36  ? 22.786  31.486 6.405   1.00 29.50  ? 36  TYR B OH    1 
ATOM   3127 N  N     . GLU F  3 37  ? 18.068  27.220 6.792   1.00 23.79  ? 37  GLU B N     1 
ATOM   3128 C  CA    . GLU F  3 37  ? 17.265  27.965 7.768   1.00 25.61  ? 37  GLU B CA    1 
ATOM   3129 C  C     . GLU F  3 37  ? 16.557  27.190 8.884   1.00 25.46  ? 37  GLU B C     1 
ATOM   3130 O  O     . GLU F  3 37  ? 16.579  27.616 10.040  1.00 21.82  ? 37  GLU B O     1 
ATOM   3131 C  CB    . GLU F  3 37  ? 16.244  28.851 7.047   1.00 27.85  ? 37  GLU B CB    1 
ATOM   3132 C  CG    . GLU F  3 37  ? 16.850  29.965 6.181   1.00 31.31  ? 37  GLU B CG    1 
ATOM   3133 C  CD    . GLU F  3 37  ? 17.852  30.841 6.919   1.00 39.28  ? 37  GLU B CD    1 
ATOM   3134 O  OE1   . GLU F  3 37  ? 17.942  30.749 8.162   1.00 30.50  ? 37  GLU B OE1   1 
ATOM   3135 O  OE2   . GLU F  3 37  ? 18.548  31.633 6.246   1.00 36.99  ? 37  GLU B OE2   1 
ATOM   3136 N  N     . THR F  3 38  ? 15.923  26.067 8.560   1.00 22.90  ? 38  THR B N     1 
ATOM   3137 C  CA    . THR F  3 38  ? 15.221  25.300 9.581   1.00 24.44  ? 38  THR B CA    1 
ATOM   3138 C  C     . THR F  3 38  ? 16.202  24.532 10.456  1.00 24.80  ? 38  THR B C     1 
ATOM   3139 O  O     . THR F  3 38  ? 16.007  24.419 11.663  1.00 21.19  ? 38  THR B O     1 
ATOM   3140 C  CB    . THR F  3 38  ? 14.199  24.336 8.952   1.00 28.47  ? 38  THR B CB    1 
ATOM   3141 O  OG1   . THR F  3 38  ? 13.214  25.099 8.247   1.00 31.10  ? 38  THR B OG1   1 
ATOM   3142 C  CG2   . THR F  3 38  ? 13.499  23.518 10.025  1.00 27.20  ? 38  THR B CG2   1 
ATOM   3143 N  N     . LEU F  3 39  ? 17.258  24.005 9.845   1.00 21.39  ? 39  LEU B N     1 
ATOM   3144 C  CA    . LEU F  3 39  ? 18.279  23.287 10.596  1.00 20.91  ? 39  LEU B CA    1 
ATOM   3145 C  C     . LEU F  3 39  ? 18.961  24.267 11.559  1.00 18.98  ? 39  LEU B C     1 
ATOM   3146 O  O     . LEU F  3 39  ? 19.331  23.896 12.671  1.00 19.98  ? 39  LEU B O     1 
ATOM   3147 C  CB    . LEU F  3 39  ? 19.316  22.683 9.636   1.00 18.78  ? 39  LEU B CB    1 
ATOM   3148 C  CG    . LEU F  3 39  ? 18.839  21.507 8.777   1.00 25.98  ? 39  LEU B CG    1 
ATOM   3149 C  CD1   . LEU F  3 39  ? 19.892  21.180 7.720   1.00 23.02  ? 39  LEU B CD1   1 
ATOM   3150 C  CD2   . LEU F  3 39  ? 18.580  20.293 9.668   1.00 22.51  ? 39  LEU B CD2   1 
ATOM   3151 N  N     . GLU F  3 40  ? 19.120  25.518 11.129  1.00 17.87  ? 40  GLU B N     1 
ATOM   3152 C  CA    . GLU F  3 40  ? 19.756  26.536 11.969  1.00 17.78  ? 40  GLU B CA    1 
ATOM   3153 C  C     . GLU F  3 40  ? 18.918  26.788 13.224  1.00 19.74  ? 40  GLU B C     1 
ATOM   3154 O  O     . GLU F  3 40  ? 19.446  26.941 14.329  1.00 19.12  ? 40  GLU B O     1 
ATOM   3155 C  CB    . GLU F  3 40  ? 19.908  27.845 11.198  1.00 21.72  ? 40  GLU B CB    1 
ATOM   3156 C  CG    . GLU F  3 40  ? 20.692  28.897 11.961  1.00 21.70  ? 40  GLU B CG    1 
ATOM   3157 C  CD    . GLU F  3 40  ? 20.153  30.293 11.746  1.00 23.94  ? 40  GLU B CD    1 
ATOM   3158 O  OE1   . GLU F  3 40  ? 19.819  30.627 10.595  1.00 22.32  ? 40  GLU B OE1   1 
ATOM   3159 O  OE2   . GLU F  3 40  ? 20.065  31.059 12.729  1.00 23.87  ? 40  GLU B OE2   1 
ATOM   3160 N  N     . PHE F  3 41  ? 17.604  26.841 13.037  1.00 19.87  ? 41  PHE B N     1 
ATOM   3161 C  CA    . PHE F  3 41  ? 16.657  27.042 14.135  1.00 17.56  ? 41  PHE B CA    1 
ATOM   3162 C  C     . PHE F  3 41  ? 16.858  25.938 15.183  1.00 20.49  ? 41  PHE B C     1 
ATOM   3163 O  O     . PHE F  3 41  ? 16.957  26.210 16.383  1.00 19.08  ? 41  PHE B O     1 
ATOM   3164 C  CB    . PHE F  3 41  ? 15.232  27.005 13.559  1.00 18.71  ? 41  PHE B CB    1 
ATOM   3165 C  CG    . PHE F  3 41  ? 14.138  27.155 14.582  1.00 21.29  ? 41  PHE B CG    1 
ATOM   3166 C  CD1   . PHE F  3 41  ? 13.990  28.336 15.304  1.00 23.11  ? 41  PHE B CD1   1 
ATOM   3167 C  CD2   . PHE F  3 41  ? 13.230  26.120 14.794  1.00 19.62  ? 41  PHE B CD2   1 
ATOM   3168 C  CE1   . PHE F  3 41  ? 12.950  28.486 16.224  1.00 23.19  ? 41  PHE B CE1   1 
ATOM   3169 C  CE2   . PHE F  3 41  ? 12.185  26.260 15.711  1.00 21.61  ? 41  PHE B CE2   1 
ATOM   3170 C  CZ    . PHE F  3 41  ? 12.046  27.444 16.426  1.00 24.47  ? 41  PHE B CZ    1 
ATOM   3171 N  N     . LEU F  3 42  ? 16.922  24.689 14.725  1.00 17.45  ? 42  LEU B N     1 
ATOM   3172 C  CA    . LEU F  3 42  ? 17.121  23.553 15.617  1.00 17.34  ? 42  LEU B CA    1 
ATOM   3173 C  C     . LEU F  3 42  ? 18.540  23.549 16.195  1.00 16.81  ? 42  LEU B C     1 
ATOM   3174 O  O     . LEU F  3 42  ? 18.723  23.289 17.382  1.00 17.26  ? 42  LEU B O     1 
ATOM   3175 C  CB    . LEU F  3 42  ? 16.877  22.235 14.860  1.00 16.07  ? 42  LEU B CB    1 
ATOM   3176 C  CG    . LEU F  3 42  ? 17.171  20.931 15.609  1.00 19.03  ? 42  LEU B CG    1 
ATOM   3177 C  CD1   . LEU F  3 42  ? 16.295  20.844 16.856  1.00 19.78  ? 42  LEU B CD1   1 
ATOM   3178 C  CD2   . LEU F  3 42  ? 16.910  19.732 14.691  1.00 21.13  ? 42  LEU B CD2   1 
ATOM   3179 N  N     . GLY F  3 43  ? 19.521  23.845 15.344  1.00 16.98  ? 43  GLY B N     1 
ATOM   3180 C  CA    . GLY F  3 43  ? 20.919  23.859 15.750  1.00 18.15  ? 43  GLY B CA    1 
ATOM   3181 C  C     . GLY F  3 43  ? 21.238  24.827 16.869  1.00 17.63  ? 43  GLY B C     1 
ATOM   3182 O  O     . GLY F  3 43  ? 22.078  24.543 17.728  1.00 19.20  ? 43  GLY B O     1 
ATOM   3183 N  N     . ASP F  3 44  ? 20.586  25.983 16.851  1.00 15.58  ? 44  ASP B N     1 
ATOM   3184 C  CA    . ASP F  3 44  ? 20.793  26.984 17.891  1.00 17.53  ? 44  ASP B CA    1 
ATOM   3185 C  C     . ASP F  3 44  ? 20.420  26.378 19.248  1.00 19.28  ? 44  ASP B C     1 
ATOM   3186 O  O     . ASP F  3 44  ? 21.175  26.478 20.216  1.00 15.19  ? 44  ASP B O     1 
ATOM   3187 C  CB    . ASP F  3 44  ? 19.921  28.213 17.605  1.00 17.40  ? 44  ASP B CB    1 
ATOM   3188 C  CG    . ASP F  3 44  ? 19.828  29.158 18.791  1.00 24.43  ? 44  ASP B CG    1 
ATOM   3189 O  OD1   . ASP F  3 44  ? 20.792  29.909 19.055  1.00 17.60  ? 44  ASP B OD1   1 
ATOM   3190 O  OD2   . ASP F  3 44  ? 18.780  29.144 19.467  1.00 21.30  ? 44  ASP B OD2   1 
ATOM   3191 N  N     . ALA F  3 45  ? 19.259  25.733 19.317  1.00 15.00  ? 45  ALA B N     1 
ATOM   3192 C  CA    . ALA F  3 45  ? 18.813  25.137 20.574  1.00 17.93  ? 45  ALA B CA    1 
ATOM   3193 C  C     . ALA F  3 45  ? 19.704  23.971 20.994  1.00 14.85  ? 45  ALA B C     1 
ATOM   3194 O  O     . ALA F  3 45  ? 20.000  23.802 22.170  1.00 13.98  ? 45  ALA B O     1 
ATOM   3195 C  CB    . ALA F  3 45  ? 17.357  24.666 20.452  1.00 17.25  ? 45  ALA B CB    1 
ATOM   3196 N  N     . LEU F  3 46  ? 20.123  23.171 20.023  1.00 16.06  ? 46  LEU B N     1 
ATOM   3197 C  CA    . LEU F  3 46  ? 20.973  22.016 20.290  1.00 17.38  ? 46  LEU B CA    1 
ATOM   3198 C  C     . LEU F  3 46  ? 22.345  22.426 20.820  1.00 14.79  ? 46  LEU B C     1 
ATOM   3199 O  O     . LEU F  3 46  ? 22.771  21.968 21.881  1.00 14.92  ? 46  LEU B O     1 
ATOM   3200 C  CB    . LEU F  3 46  ? 21.147  21.200 19.007  1.00 18.67  ? 46  LEU B CB    1 
ATOM   3201 C  CG    . LEU F  3 46  ? 21.947  19.904 19.100  1.00 24.97  ? 46  LEU B CG    1 
ATOM   3202 C  CD1   . LEU F  3 46  ? 21.143  18.851 19.871  1.00 23.20  ? 46  LEU B CD1   1 
ATOM   3203 C  CD2   . LEU F  3 46  ? 22.262  19.408 17.691  1.00 24.98  ? 46  LEU B CD2   1 
ATOM   3204 N  N     . VAL F  3 47  ? 23.031  23.294 20.082  1.00 17.96  ? 47  VAL B N     1 
ATOM   3205 C  CA    . VAL F  3 47  ? 24.360  23.735 20.496  1.00 20.25  ? 47  VAL B CA    1 
ATOM   3206 C  C     . VAL F  3 47  ? 24.307  24.519 21.808  1.00 17.77  ? 47  VAL B C     1 
ATOM   3207 O  O     . VAL F  3 47  ? 25.192  24.381 22.655  1.00 17.57  ? 47  VAL B O     1 
ATOM   3208 C  CB    . VAL F  3 47  ? 25.021  24.579 19.388  1.00 21.22  ? 47  VAL B CB    1 
ATOM   3209 C  CG1   . VAL F  3 47  ? 26.385  25.094 19.851  1.00 25.32  ? 47  VAL B CG1   1 
ATOM   3210 C  CG2   . VAL F  3 47  ? 25.177  23.727 18.126  1.00 23.86  ? 47  VAL B CG2   1 
ATOM   3211 N  N     . ASN F  3 48  ? 23.278  25.346 21.984  1.00 17.04  ? 48  ASN B N     1 
ATOM   3212 C  CA    . ASN F  3 48  ? 23.164  26.097 23.228  1.00 15.57  ? 48  ASN B CA    1 
ATOM   3213 C  C     . ASN F  3 48  ? 23.131  25.109 24.383  1.00 16.88  ? 48  ASN B C     1 
ATOM   3214 O  O     . ASN F  3 48  ? 23.785  25.313 25.404  1.00 16.68  ? 48  ASN B O     1 
ATOM   3215 C  CB    . ASN F  3 48  ? 21.900  26.964 23.231  1.00 16.71  ? 48  ASN B CB    1 
ATOM   3216 C  CG    . ASN F  3 48  ? 22.038  28.186 22.347  1.00 20.14  ? 48  ASN B CG    1 
ATOM   3217 O  OD1   . ASN F  3 48  ? 23.076  28.397 21.713  1.00 17.47  ? 48  ASN B OD1   1 
ATOM   3218 N  ND2   . ASN F  3 48  ? 20.988  29.000 22.294  1.00 17.95  ? 48  ASN B ND2   1 
ATOM   3219 N  N     . PHE F  3 49  ? 22.372  24.030 24.218  1.00 14.45  ? 49  PHE B N     1 
ATOM   3220 C  CA    . PHE F  3 49  ? 22.297  22.998 25.242  1.00 15.36  ? 49  PHE B CA    1 
ATOM   3221 C  C     . PHE F  3 49  ? 23.682  22.368 25.476  1.00 17.72  ? 49  PHE B C     1 
ATOM   3222 O  O     . PHE F  3 49  ? 24.098  22.197 26.620  1.00 17.56  ? 49  PHE B O     1 
ATOM   3223 C  CB    . PHE F  3 49  ? 21.279  21.920 24.828  1.00 15.88  ? 49  PHE B CB    1 
ATOM   3224 C  CG    . PHE F  3 49  ? 21.480  20.591 25.507  1.00 16.88  ? 49  PHE B CG    1 
ATOM   3225 C  CD1   . PHE F  3 49  ? 21.447  20.488 26.898  1.00 19.26  ? 49  PHE B CD1   1 
ATOM   3226 C  CD2   . PHE F  3 49  ? 21.709  19.446 24.753  1.00 23.22  ? 49  PHE B CD2   1 
ATOM   3227 C  CE1   . PHE F  3 49  ? 21.643  19.255 27.528  1.00 21.00  ? 49  PHE B CE1   1 
ATOM   3228 C  CE2   . PHE F  3 49  ? 21.906  18.209 25.368  1.00 21.64  ? 49  PHE B CE2   1 
ATOM   3229 C  CZ    . PHE F  3 49  ? 21.873  18.114 26.759  1.00 19.10  ? 49  PHE B CZ    1 
ATOM   3230 N  N     . PHE F  3 50  ? 24.397  22.036 24.402  1.00 17.50  ? 50  PHE B N     1 
ATOM   3231 C  CA    . PHE F  3 50  ? 25.728  21.431 24.557  1.00 19.89  ? 50  PHE B CA    1 
ATOM   3232 C  C     . PHE F  3 50  ? 26.645  22.320 25.397  1.00 19.22  ? 50  PHE B C     1 
ATOM   3233 O  O     . PHE F  3 50  ? 27.352  21.841 26.290  1.00 19.88  ? 50  PHE B O     1 
ATOM   3234 C  CB    . PHE F  3 50  ? 26.411  21.206 23.196  1.00 17.16  ? 50  PHE B CB    1 
ATOM   3235 C  CG    . PHE F  3 50  ? 25.728  20.193 22.308  1.00 15.60  ? 50  PHE B CG    1 
ATOM   3236 C  CD1   . PHE F  3 50  ? 24.773  19.318 22.812  1.00 18.33  ? 50  PHE B CD1   1 
ATOM   3237 C  CD2   . PHE F  3 50  ? 26.075  20.104 20.960  1.00 16.68  ? 50  PHE B CD2   1 
ATOM   3238 C  CE1   . PHE F  3 50  ? 24.172  18.363 21.981  1.00 19.32  ? 50  PHE B CE1   1 
ATOM   3239 C  CE2   . PHE F  3 50  ? 25.485  19.158 20.127  1.00 19.71  ? 50  PHE B CE2   1 
ATOM   3240 C  CZ    . PHE F  3 50  ? 24.529  18.285 20.641  1.00 21.86  ? 50  PHE B CZ    1 
ATOM   3241 N  N     . ILE F  3 51  ? 26.627  23.616 25.105  1.00 17.34  ? 51  ILE B N     1 
ATOM   3242 C  CA    . ILE F  3 51  ? 27.481  24.564 25.812  1.00 16.03  ? 51  ILE B CA    1 
ATOM   3243 C  C     . ILE F  3 51  ? 27.065  24.753 27.263  1.00 17.17  ? 51  ILE B C     1 
ATOM   3244 O  O     . ILE F  3 51  ? 27.902  24.718 28.163  1.00 16.84  ? 51  ILE B O     1 
ATOM   3245 C  CB    . ILE F  3 51  ? 27.517  25.911 25.065  1.00 18.61  ? 51  ILE B CB    1 
ATOM   3246 C  CG1   . ILE F  3 51  ? 28.195  25.698 23.705  1.00 20.99  ? 51  ILE B CG1   1 
ATOM   3247 C  CG2   . ILE F  3 51  ? 28.272  26.967 25.898  1.00 18.06  ? 51  ILE B CG2   1 
ATOM   3248 C  CD1   . ILE F  3 51  ? 28.252  26.916 22.833  1.00 31.07  ? 51  ILE B CD1   1 
ATOM   3249 N  N     . VAL F  3 52  ? 25.770  24.940 27.501  1.00 14.11  ? 52  VAL B N     1 
ATOM   3250 C  CA    . VAL F  3 52  ? 25.298  25.107 28.872  1.00 14.86  ? 52  VAL B CA    1 
ATOM   3251 C  C     . VAL F  3 52  ? 25.601  23.869 29.715  1.00 14.63  ? 52  VAL B C     1 
ATOM   3252 O  O     . VAL F  3 52  ? 25.981  23.980 30.882  1.00 16.88  ? 52  VAL B O     1 
ATOM   3253 C  CB    . VAL F  3 52  ? 23.777  25.400 28.904  1.00 17.73  ? 52  VAL B CB    1 
ATOM   3254 C  CG1   . VAL F  3 52  ? 23.238  25.279 30.345  1.00 16.98  ? 52  VAL B CG1   1 
ATOM   3255 C  CG2   . VAL F  3 52  ? 23.519  26.805 28.357  1.00 16.83  ? 52  VAL B CG2   1 
ATOM   3256 N  N     . ASP F  3 53  ? 25.446  22.684 29.130  1.00 15.18  ? 53  ASP B N     1 
ATOM   3257 C  CA    . ASP F  3 53  ? 25.712  21.456 29.874  1.00 17.89  ? 53  ASP B CA    1 
ATOM   3258 C  C     . ASP F  3 53  ? 27.192  21.383 30.249  1.00 18.86  ? 53  ASP B C     1 
ATOM   3259 O  O     . ASP F  3 53  ? 27.543  21.015 31.371  1.00 19.58  ? 53  ASP B O     1 
ATOM   3260 C  CB    . ASP F  3 53  ? 25.312  20.224 29.052  1.00 18.56  ? 53  ASP B CB    1 
ATOM   3261 C  CG    . ASP F  3 53  ? 25.328  18.943 29.876  1.00 21.18  ? 53  ASP B CG    1 
ATOM   3262 O  OD1   . ASP F  3 53  ? 25.064  19.008 31.096  1.00 25.94  ? 53  ASP B OD1   1 
ATOM   3263 O  OD2   . ASP F  3 53  ? 25.585  17.868 29.299  1.00 24.93  ? 53  ASP B OD2   1 
ATOM   3264 N  N     . LEU F  3 54  ? 28.050  21.752 29.307  1.00 16.93  ? 54  LEU B N     1 
ATOM   3265 C  CA    . LEU F  3 54  ? 29.487  21.739 29.547  1.00 19.43  ? 54  LEU B CA    1 
ATOM   3266 C  C     . LEU F  3 54  ? 29.840  22.694 30.685  1.00 17.87  ? 54  LEU B C     1 
ATOM   3267 O  O     . LEU F  3 54  ? 30.631  22.360 31.564  1.00 19.46  ? 54  LEU B O     1 
ATOM   3268 C  CB    . LEU F  3 54  ? 30.233  22.146 28.274  1.00 16.09  ? 54  LEU B CB    1 
ATOM   3269 C  CG    . LEU F  3 54  ? 31.758  22.079 28.390  1.00 22.95  ? 54  LEU B CG    1 
ATOM   3270 C  CD1   . LEU F  3 54  ? 32.162  20.657 28.755  1.00 29.41  ? 54  LEU B CD1   1 
ATOM   3271 C  CD2   . LEU F  3 54  ? 32.411  22.491 27.078  1.00 23.90  ? 54  LEU B CD2   1 
ATOM   3272 N  N     . LEU F  3 55  ? 29.251  23.888 30.672  1.00 17.44  ? 55  LEU B N     1 
ATOM   3273 C  CA    . LEU F  3 55  ? 29.518  24.864 31.726  1.00 18.90  ? 55  LEU B CA    1 
ATOM   3274 C  C     . LEU F  3 55  ? 29.118  24.342 33.101  1.00 22.62  ? 55  LEU B C     1 
ATOM   3275 O  O     . LEU F  3 55  ? 29.880  24.454 34.067  1.00 19.81  ? 55  LEU B O     1 
ATOM   3276 C  CB    . LEU F  3 55  ? 28.760  26.166 31.469  1.00 19.10  ? 55  LEU B CB    1 
ATOM   3277 C  CG    . LEU F  3 55  ? 29.214  27.053 30.314  1.00 21.35  ? 55  LEU B CG    1 
ATOM   3278 C  CD1   . LEU F  3 55  ? 28.190  28.164 30.117  1.00 22.34  ? 55  LEU B CD1   1 
ATOM   3279 C  CD2   . LEU F  3 55  ? 30.587  27.634 30.610  1.00 23.62  ? 55  LEU B CD2   1 
ATOM   3280 N  N     . VAL F  3 56  ? 27.916  23.778 33.196  1.00 18.67  ? 56  VAL B N     1 
ATOM   3281 C  CA    . VAL F  3 56  ? 27.429  23.265 34.469  1.00 19.06  ? 56  VAL B CA    1 
ATOM   3282 C  C     . VAL F  3 56  ? 28.246  22.059 34.931  1.00 20.86  ? 56  VAL B C     1 
ATOM   3283 O  O     . VAL F  3 56  ? 28.540  21.917 36.115  1.00 23.77  ? 56  VAL B O     1 
ATOM   3284 C  CB    . VAL F  3 56  ? 25.933  22.870 34.378  1.00 18.87  ? 56  VAL B CB    1 
ATOM   3285 C  CG1   . VAL F  3 56  ? 25.474  22.197 35.672  1.00 20.93  ? 56  VAL B CG1   1 
ATOM   3286 C  CG2   . VAL F  3 56  ? 25.092  24.121 34.112  1.00 20.39  ? 56  VAL B CG2   1 
ATOM   3287 N  N     . GLN F  3 57  ? 28.621  21.205 33.989  1.00 22.26  ? 57  GLN B N     1 
ATOM   3288 C  CA    . GLN F  3 57  ? 29.393  20.014 34.320  1.00 25.04  ? 57  GLN B CA    1 
ATOM   3289 C  C     . GLN F  3 57  ? 30.715  20.356 35.005  1.00 31.89  ? 57  GLN B C     1 
ATOM   3290 O  O     . GLN F  3 57  ? 31.112  19.693 35.963  1.00 32.51  ? 57  GLN B O     1 
ATOM   3291 C  CB    . GLN F  3 57  ? 29.665  19.196 33.054  1.00 28.35  ? 57  GLN B CB    1 
ATOM   3292 C  CG    . GLN F  3 57  ? 30.092  17.763 33.323  1.00 43.16  ? 57  GLN B CG    1 
ATOM   3293 C  CD    . GLN F  3 57  ? 30.430  17.005 32.053  1.00 48.19  ? 57  GLN B CD    1 
ATOM   3294 O  OE1   . GLN F  3 57  ? 29.673  17.025 31.083  1.00 50.65  ? 57  GLN B OE1   1 
ATOM   3295 N  NE2   . GLN F  3 57  ? 31.571  16.324 32.057  1.00 58.65  ? 57  GLN B NE2   1 
ATOM   3296 N  N     . TYR F  3 58  ? 31.390  21.396 34.528  1.00 28.65  ? 58  TYR B N     1 
ATOM   3297 C  CA    . TYR F  3 58  ? 32.670  21.774 35.115  1.00 37.75  ? 58  TYR B CA    1 
ATOM   3298 C  C     . TYR F  3 58  ? 32.631  22.851 36.196  1.00 40.83  ? 58  TYR B C     1 
ATOM   3299 O  O     . TYR F  3 58  ? 33.673  23.307 36.670  1.00 46.44  ? 58  TYR B O     1 
ATOM   3300 C  CB    . TYR F  3 58  ? 33.674  22.144 33.962  1.00 35.68  ? 58  TYR B CB    1 
ATOM   3301 C  CG    . TYR F  3 58  ? 34.046  20.841 33.330  1.00 39.64  ? 58  TYR B CG    1 
ATOM   3302 C  CD1   . TYR F  3 58  ? 35.095  20.076 33.839  1.00 44.35  ? 58  TYR B CD1   1 
ATOM   3303 C  CD2   . TYR F  3 58  ? 33.366  20.360 32.211  1.00 39.21  ? 58  TYR B CD2   1 
ATOM   3304 C  CE1   . TYR F  3 58  ? 35.450  18.865 33.262  1.00 44.58  ? 58  TYR B CE1   1 
ATOM   3305 C  CE2   . TYR F  3 58  ? 33.714  19.143 31.625  1.00 43.47  ? 58  TYR B CE2   1 
ATOM   3306 C  CZ    . TYR F  3 58  ? 34.756  18.401 32.161  1.00 45.95  ? 58  TYR B CZ    1 
ATOM   3307 O  OH    . TYR F  3 58  ? 35.098  17.188 31.612  1.00 47.05  ? 58  TYR B OH    1 
ATOM   3308 N  N     . SER F  3 59  ? 31.420  23.229 36.598  1.00 37.86  ? 59  SER B N     1 
ATOM   3309 C  CA    . SER F  3 59  ? 31.206  24.216 37.657  1.00 36.75  ? 59  SER B CA    1 
ATOM   3310 C  C     . SER F  3 59  ? 29.816  23.947 38.239  1.00 40.79  ? 59  SER B C     1 
ATOM   3311 O  O     . SER F  3 59  ? 28.968  24.836 38.289  1.00 33.68  ? 59  SER B O     1 
ATOM   3312 C  CB    . SER F  3 59  ? 31.268  25.640 37.094  1.00 38.67  ? 59  SER B CB    1 
ATOM   3313 O  OG    . SER F  3 59  ? 32.548  25.931 36.558  1.00 36.46  ? 59  SER B OG    1 
ATOM   3314 N  N     . PRO F  3 60  ? 29.573  22.706 38.692  1.00 41.16  ? 60  PRO B N     1 
ATOM   3315 C  CA    . PRO F  3 60  ? 28.282  22.310 39.265  1.00 44.97  ? 60  PRO B CA    1 
ATOM   3316 C  C     . PRO F  3 60  ? 27.788  23.146 40.439  1.00 48.34  ? 60  PRO B C     1 
ATOM   3317 O  O     . PRO F  3 60  ? 26.581  23.254 40.664  1.00 47.14  ? 60  PRO B O     1 
ATOM   3318 C  CB    . PRO F  3 60  ? 28.507  20.845 39.644  1.00 46.21  ? 60  PRO B CB    1 
ATOM   3319 C  CG    . PRO F  3 60  ? 29.972  20.793 39.938  1.00 46.28  ? 60  PRO B CG    1 
ATOM   3320 C  CD    . PRO F  3 60  ? 30.551  21.611 38.810  1.00 42.04  ? 60  PRO B CD    1 
ATOM   3321 N  N     . ASN F  3 61  ? 28.716  23.748 41.174  1.00 51.63  ? 61  ASN B N     1 
ATOM   3322 C  CA    . ASN F  3 61  ? 28.365  24.551 42.340  1.00 52.73  ? 61  ASN B CA    1 
ATOM   3323 C  C     . ASN F  3 61  ? 28.379  26.058 42.088  1.00 48.52  ? 61  ASN B C     1 
ATOM   3324 O  O     . ASN F  3 61  ? 28.281  26.846 43.029  1.00 44.13  ? 61  ASN B O     1 
ATOM   3325 C  CB    . ASN F  3 61  ? 29.322  24.217 43.488  1.00 60.31  ? 61  ASN B CB    1 
ATOM   3326 C  CG    . ASN F  3 61  ? 29.316  22.740 43.842  1.00 68.35  ? 61  ASN B CG    1 
ATOM   3327 O  OD1   . ASN F  3 61  ? 30.183  22.262 44.576  1.00 71.78  ? 61  ASN B OD1   1 
ATOM   3328 N  ND2   . ASN F  3 61  ? 28.332  22.010 43.326  1.00 69.40  ? 61  ASN B ND2   1 
ATOM   3329 N  N     . LYS F  3 62  ? 28.506  26.459 40.825  1.00 45.00  ? 62  LYS B N     1 
ATOM   3330 C  CA    . LYS F  3 62  ? 28.530  27.877 40.483  1.00 36.66  ? 62  LYS B CA    1 
ATOM   3331 C  C     . LYS F  3 62  ? 27.129  28.365 40.122  1.00 36.05  ? 62  LYS B C     1 
ATOM   3332 O  O     . LYS F  3 62  ? 26.343  27.641 39.503  1.00 30.19  ? 62  LYS B O     1 
ATOM   3333 C  CB    . LYS F  3 62  ? 29.486  28.128 39.312  1.00 39.68  ? 62  LYS B CB    1 
ATOM   3334 C  CG    . LYS F  3 62  ? 30.926  27.713 39.578  1.00 44.82  ? 62  LYS B CG    1 
ATOM   3335 C  CD    . LYS F  3 62  ? 31.548  28.454 40.755  1.00 50.23  ? 62  LYS B CD    1 
ATOM   3336 C  CE    . LYS F  3 62  ? 31.645  29.952 40.505  1.00 51.38  ? 62  LYS B CE    1 
ATOM   3337 N  NZ    . LYS F  3 62  ? 30.308  30.606 40.471  1.00 57.16  ? 62  LYS B NZ    1 
ATOM   3338 N  N     . ARG F  3 63  ? 26.826  29.599 40.507  1.00 31.22  ? 63  ARG B N     1 
ATOM   3339 C  CA    . ARG F  3 63  ? 25.520  30.183 40.246  1.00 33.11  ? 63  ARG B CA    1 
ATOM   3340 C  C     . ARG F  3 63  ? 25.327  30.640 38.807  1.00 25.31  ? 63  ARG B C     1 
ATOM   3341 O  O     . ARG F  3 63  ? 26.281  30.747 38.029  1.00 22.06  ? 63  ARG B O     1 
ATOM   3342 C  CB    . ARG F  3 63  ? 25.271  31.356 41.201  1.00 39.47  ? 63  ARG B CB    1 
ATOM   3343 C  CG    . ARG F  3 63  ? 25.045  30.937 42.654  1.00 45.60  ? 63  ARG B CG    1 
ATOM   3344 C  CD    . ARG F  3 63  ? 23.795  30.066 42.793  1.00 45.59  ? 63  ARG B CD    1 
ATOM   3345 N  NE    . ARG F  3 63  ? 22.567  30.812 42.521  1.00 43.52  ? 63  ARG B NE    1 
ATOM   3346 C  CZ    . ARG F  3 63  ? 22.003  31.669 43.369  1.00 47.15  ? 63  ARG B CZ    1 
ATOM   3347 N  NH1   . ARG F  3 63  ? 22.551  31.895 44.559  1.00 42.51  ? 63  ARG B NH1   1 
ATOM   3348 N  NH2   . ARG F  3 63  ? 20.891  32.307 43.027  1.00 39.67  ? 63  ARG B NH2   1 
ATOM   3349 N  N     . GLU F  3 64  ? 24.072  30.907 38.469  1.00 24.73  ? 64  GLU B N     1 
ATOM   3350 C  CA    . GLU F  3 64  ? 23.685  31.354 37.143  1.00 24.24  ? 64  GLU B CA    1 
ATOM   3351 C  C     . GLU F  3 64  ? 24.348  32.691 36.792  1.00 24.46  ? 64  GLU B C     1 
ATOM   3352 O  O     . GLU F  3 64  ? 24.609  32.976 35.621  1.00 21.06  ? 64  GLU B O     1 
ATOM   3353 C  CB    . GLU F  3 64  ? 22.158  31.480 37.081  1.00 23.99  ? 64  GLU B CB    1 
ATOM   3354 C  CG    . GLU F  3 64  ? 21.577  32.499 38.054  1.00 28.79  ? 64  GLU B CG    1 
ATOM   3355 C  CD    . GLU F  3 64  ? 21.346  31.951 39.457  1.00 35.91  ? 64  GLU B CD    1 
ATOM   3356 O  OE1   . GLU F  3 64  ? 22.017  30.973 39.852  1.00 37.34  ? 64  GLU B OE1   1 
ATOM   3357 O  OE2   . GLU F  3 64  ? 20.494  32.519 40.175  1.00 29.22  ? 64  GLU B OE2   1 
ATOM   3358 N  N     . GLY F  3 65  ? 24.621  33.502 37.812  1.00 22.01  ? 65  GLY B N     1 
ATOM   3359 C  CA    . GLY F  3 65  ? 25.252  34.796 37.598  1.00 21.93  ? 65  GLY B CA    1 
ATOM   3360 C  C     . GLY F  3 65  ? 26.706  34.686 37.182  1.00 26.39  ? 65  GLY B C     1 
ATOM   3361 O  O     . GLY F  3 65  ? 27.284  35.629 36.637  1.00 25.58  ? 65  GLY B O     1 
ATOM   3362 N  N     . PHE F  3 66  ? 27.312  33.535 37.452  1.00 25.19  ? 66  PHE B N     1 
ATOM   3363 C  CA    . PHE F  3 66  ? 28.697  33.309 37.063  1.00 24.38  ? 66  PHE B CA    1 
ATOM   3364 C  C     . PHE F  3 66  ? 28.741  32.618 35.702  1.00 24.34  ? 66  PHE B C     1 
ATOM   3365 O  O     . PHE F  3 66  ? 29.519  32.997 34.823  1.00 23.65  ? 66  PHE B O     1 
ATOM   3366 C  CB    . PHE F  3 66  ? 29.414  32.429 38.092  1.00 25.90  ? 66  PHE B CB    1 
ATOM   3367 C  CG    . PHE F  3 66  ? 30.817  32.071 37.699  1.00 35.98  ? 66  PHE B CG    1 
ATOM   3368 C  CD1   . PHE F  3 66  ? 31.850  32.994 37.837  1.00 41.16  ? 66  PHE B CD1   1 
ATOM   3369 C  CD2   . PHE F  3 66  ? 31.105  30.820 37.163  1.00 35.50  ? 66  PHE B CD2   1 
ATOM   3370 C  CE1   . PHE F  3 66  ? 33.149  32.676 37.446  1.00 44.01  ? 66  PHE B CE1   1 
ATOM   3371 C  CE2   . PHE F  3 66  ? 32.400  30.491 36.769  1.00 40.12  ? 66  PHE B CE2   1 
ATOM   3372 C  CZ    . PHE F  3 66  ? 33.424  31.422 36.911  1.00 41.29  ? 66  PHE B CZ    1 
ATOM   3373 N  N     . LEU F  3 67  ? 27.888  31.610 35.532  1.00 20.06  ? 67  LEU B N     1 
ATOM   3374 C  CA    . LEU F  3 67  ? 27.842  30.838 34.299  1.00 18.98  ? 67  LEU B CA    1 
ATOM   3375 C  C     . LEU F  3 67  ? 27.159  31.496 33.102  1.00 21.38  ? 67  LEU B C     1 
ATOM   3376 O  O     . LEU F  3 67  ? 27.570  31.278 31.960  1.00 20.18  ? 67  LEU B O     1 
ATOM   3377 C  CB    . LEU F  3 67  ? 27.177  29.484 34.555  1.00 21.44  ? 67  LEU B CB    1 
ATOM   3378 C  CG    . LEU F  3 67  ? 27.865  28.542 35.545  1.00 22.26  ? 67  LEU B CG    1 
ATOM   3379 C  CD1   . LEU F  3 67  ? 27.069  27.257 35.664  1.00 26.38  ? 67  LEU B CD1   1 
ATOM   3380 C  CD2   . LEU F  3 67  ? 29.284  28.249 35.071  1.00 27.94  ? 67  LEU B CD2   1 
ATOM   3381 N  N     . SER F  3 68  ? 26.130  32.303 33.338  1.00 20.20  ? 68  SER B N     1 
ATOM   3382 C  CA    . SER F  3 68  ? 25.441  32.904 32.205  1.00 21.12  ? 68  SER B CA    1 
ATOM   3383 C  C     . SER F  3 68  ? 26.277  33.893 31.400  1.00 21.39  ? 68  SER B C     1 
ATOM   3384 O  O     . SER F  3 68  ? 26.147  33.955 30.180  1.00 19.92  ? 68  SER B O     1 
ATOM   3385 C  CB    . SER F  3 68  ? 24.130  33.546 32.639  1.00 25.48  ? 68  SER B CB    1 
ATOM   3386 O  OG    . SER F  3 68  ? 23.262  33.640 31.524  1.00 27.68  ? 68  SER B OG    1 
ATOM   3387 N  N     . PRO F  3 69  ? 27.134  34.690 32.064  1.00 21.52  ? 69  PRO B N     1 
ATOM   3388 C  CA    . PRO F  3 69  ? 27.951  35.632 31.289  1.00 22.12  ? 69  PRO B CA    1 
ATOM   3389 C  C     . PRO F  3 69  ? 28.884  34.856 30.360  1.00 21.67  ? 69  PRO B C     1 
ATOM   3390 O  O     . PRO F  3 69  ? 29.178  35.304 29.249  1.00 21.76  ? 69  PRO B O     1 
ATOM   3391 C  CB    . PRO F  3 69  ? 28.716  36.401 32.370  1.00 25.11  ? 69  PRO B CB    1 
ATOM   3392 C  CG    . PRO F  3 69  ? 27.742  36.429 33.492  1.00 25.19  ? 69  PRO B CG    1 
ATOM   3393 C  CD    . PRO F  3 69  ? 27.205  35.004 33.500  1.00 21.95  ? 69  PRO B CD    1 
ATOM   3394 N  N     . LEU F  3 70  ? 29.352  33.696 30.819  1.00 18.42  ? 70  LEU B N     1 
ATOM   3395 C  CA    . LEU F  3 70  ? 30.229  32.868 30.000  1.00 21.82  ? 70  LEU B CA    1 
ATOM   3396 C  C     . LEU F  3 70  ? 29.412  32.318 28.830  1.00 19.93  ? 70  LEU B C     1 
ATOM   3397 O  O     . LEU F  3 70  ? 29.837  32.377 27.678  1.00 18.51  ? 70  LEU B O     1 
ATOM   3398 C  CB    . LEU F  3 70  ? 30.810  31.721 30.830  1.00 21.76  ? 70  LEU B CB    1 
ATOM   3399 C  CG    . LEU F  3 70  ? 31.654  32.162 32.032  1.00 22.72  ? 70  LEU B CG    1 
ATOM   3400 C  CD1   . LEU F  3 70  ? 32.058  30.940 32.858  1.00 23.68  ? 70  LEU B CD1   1 
ATOM   3401 C  CD2   . LEU F  3 70  ? 32.890  32.917 31.543  1.00 29.90  ? 70  LEU B CD2   1 
ATOM   3402 N  N     . LYS F  3 71  ? 28.228  31.796 29.134  1.00 19.64  ? 71  LYS B N     1 
ATOM   3403 C  CA    . LYS F  3 71  ? 27.343  31.254 28.106  1.00 16.98  ? 71  LYS B CA    1 
ATOM   3404 C  C     . LYS F  3 71  ? 27.045  32.301 27.040  1.00 16.78  ? 71  LYS B C     1 
ATOM   3405 O  O     . LYS F  3 71  ? 27.073  32.001 25.845  1.00 17.69  ? 71  LYS B O     1 
ATOM   3406 C  CB    . LYS F  3 71  ? 26.014  30.800 28.725  1.00 19.10  ? 71  LYS B CB    1 
ATOM   3407 C  CG    . LYS F  3 71  ? 24.898  30.497 27.709  1.00 18.44  ? 71  LYS B CG    1 
ATOM   3408 C  CD    . LYS F  3 71  ? 23.546  30.479 28.418  1.00 24.66  ? 71  LYS B CD    1 
ATOM   3409 C  CE    . LYS F  3 71  ? 22.385  30.232 27.475  1.00 34.39  ? 71  LYS B CE    1 
ATOM   3410 N  NZ    . LYS F  3 71  ? 21.089  30.286 28.218  1.00 37.07  ? 71  LYS B NZ    1 
ATOM   3411 N  N     . ALA F  3 72  ? 26.762  33.528 27.482  1.00 16.59  ? 72  ALA B N     1 
ATOM   3412 C  CA    . ALA F  3 72  ? 26.424  34.618 26.576  1.00 16.84  ? 72  ALA B CA    1 
ATOM   3413 C  C     . ALA F  3 72  ? 27.453  34.822 25.475  1.00 20.20  ? 72  ALA B C     1 
ATOM   3414 O  O     . ALA F  3 72  ? 27.105  35.182 24.355  1.00 17.44  ? 72  ALA B O     1 
ATOM   3415 C  CB    . ALA F  3 72  ? 26.223  35.923 27.362  1.00 16.91  ? 72  ALA B CB    1 
ATOM   3416 N  N     . TYR F  3 73  ? 28.725  34.595 25.791  1.00 16.81  ? 73  TYR B N     1 
ATOM   3417 C  CA    . TYR F  3 73  ? 29.786  34.734 24.795  1.00 17.39  ? 73  TYR B CA    1 
ATOM   3418 C  C     . TYR F  3 73  ? 29.961  33.435 24.011  1.00 13.70  ? 73  TYR B C     1 
ATOM   3419 O  O     . TYR F  3 73  ? 30.087  33.447 22.792  1.00 17.02  ? 73  TYR B O     1 
ATOM   3420 C  CB    . TYR F  3 73  ? 31.128  35.074 25.467  1.00 17.22  ? 73  TYR B CB    1 
ATOM   3421 C  CG    . TYR F  3 73  ? 32.319  34.979 24.526  1.00 19.42  ? 73  TYR B CG    1 
ATOM   3422 C  CD1   . TYR F  3 73  ? 32.471  35.875 23.467  1.00 21.45  ? 73  TYR B CD1   1 
ATOM   3423 C  CD2   . TYR F  3 73  ? 33.272  33.964 24.673  1.00 23.85  ? 73  TYR B CD2   1 
ATOM   3424 C  CE1   . TYR F  3 73  ? 33.540  35.763 22.570  1.00 22.85  ? 73  TYR B CE1   1 
ATOM   3425 C  CE2   . TYR F  3 73  ? 34.348  33.842 23.779  1.00 22.95  ? 73  TYR B CE2   1 
ATOM   3426 C  CZ    . TYR F  3 73  ? 34.470  34.746 22.732  1.00 20.16  ? 73  TYR B CZ    1 
ATOM   3427 O  OH    . TYR F  3 73  ? 35.514  34.640 21.842  1.00 24.40  ? 73  TYR B OH    1 
ATOM   3428 N  N     . LEU F  3 74  ? 29.960  32.316 24.726  1.00 15.39  ? 74  LEU B N     1 
ATOM   3429 C  CA    . LEU F  3 74  ? 30.170  31.012 24.111  1.00 16.63  ? 74  LEU B CA    1 
ATOM   3430 C  C     . LEU F  3 74  ? 29.101  30.543 23.126  1.00 20.50  ? 74  LEU B C     1 
ATOM   3431 O  O     . LEU F  3 74  ? 29.361  29.649 22.316  1.00 22.09  ? 74  LEU B O     1 
ATOM   3432 C  CB    . LEU F  3 74  ? 30.375  29.958 25.197  1.00 17.42  ? 74  LEU B CB    1 
ATOM   3433 C  CG    . LEU F  3 74  ? 31.601  30.232 26.077  1.00 20.08  ? 74  LEU B CG    1 
ATOM   3434 C  CD1   . LEU F  3 74  ? 31.589  29.295 27.282  1.00 19.02  ? 74  LEU B CD1   1 
ATOM   3435 C  CD2   . LEU F  3 74  ? 32.880  30.055 25.244  1.00 21.37  ? 74  LEU B CD2   1 
ATOM   3436 N  N     . ILE F  3 75  ? 27.906  31.125 23.181  1.00 16.00  ? 75  ILE B N     1 
ATOM   3437 C  CA    . ILE F  3 75  ? 26.873  30.728 22.224  1.00 15.36  ? 75  ILE B CA    1 
ATOM   3438 C  C     . ILE F  3 75  ? 26.677  31.844 21.199  1.00 19.95  ? 75  ILE B C     1 
ATOM   3439 O  O     . ILE F  3 75  ? 25.758  31.793 20.385  1.00 18.37  ? 75  ILE B O     1 
ATOM   3440 C  CB    . ILE F  3 75  ? 25.501  30.422 22.909  1.00 15.05  ? 75  ILE B CB    1 
ATOM   3441 C  CG1   . ILE F  3 75  ? 24.875  31.706 23.467  1.00 19.02  ? 75  ILE B CG1   1 
ATOM   3442 C  CG2   . ILE F  3 75  ? 25.693  29.382 24.002  1.00 17.26  ? 75  ILE B CG2   1 
ATOM   3443 C  CD1   . ILE F  3 75  ? 23.412  31.535 23.928  1.00 18.39  ? 75  ILE B CD1   1 
ATOM   3444 N  N     . SER F  3 76  ? 27.558  32.845 21.234  1.00 16.78  ? 76  SER B N     1 
ATOM   3445 C  CA    . SER F  3 76  ? 27.457  33.973 20.316  1.00 16.42  ? 76  SER B CA    1 
ATOM   3446 C  C     . SER F  3 76  ? 27.993  33.658 18.930  1.00 20.65  ? 76  SER B C     1 
ATOM   3447 O  O     . SER F  3 76  ? 28.826  32.766 18.743  1.00 21.39  ? 76  SER B O     1 
ATOM   3448 C  CB    . SER F  3 76  ? 28.204  35.199 20.865  1.00 21.79  ? 76  SER B CB    1 
ATOM   3449 O  OG    . SER F  3 76  ? 29.617  35.041 20.772  1.00 18.27  ? 76  SER B OG    1 
ATOM   3450 N  N     . GLU F  3 77  ? 27.510  34.422 17.960  1.00 19.21  ? 77  GLU B N     1 
ATOM   3451 C  CA    . GLU F  3 77  ? 27.917  34.277 16.575  1.00 21.40  ? 77  GLU B CA    1 
ATOM   3452 C  C     . GLU F  3 77  ? 29.430  34.414 16.476  1.00 20.80  ? 77  GLU B C     1 
ATOM   3453 O  O     . GLU F  3 77  ? 30.089  33.680 15.739  1.00 22.05  ? 77  GLU B O     1 
ATOM   3454 C  CB    . GLU F  3 77  ? 27.245  35.364 15.747  1.00 27.30  ? 77  GLU B CB    1 
ATOM   3455 C  CG    . GLU F  3 77  ? 27.796  35.538 14.359  1.00 26.58  ? 77  GLU B CG    1 
ATOM   3456 C  CD    . GLU F  3 77  ? 27.171  36.726 13.670  1.00 31.35  ? 77  GLU B CD    1 
ATOM   3457 O  OE1   . GLU F  3 77  ? 25.969  36.653 13.342  1.00 26.35  ? 77  GLU B OE1   1 
ATOM   3458 O  OE2   . GLU F  3 77  ? 27.874  37.738 13.470  1.00 35.45  ? 77  GLU B OE2   1 
ATOM   3459 N  N     . GLU F  3 78  ? 29.975  35.365 17.225  1.00 20.37  ? 78  GLU B N     1 
ATOM   3460 C  CA    . GLU F  3 78  ? 31.413  35.591 17.222  1.00 23.21  ? 78  GLU B CA    1 
ATOM   3461 C  C     . GLU F  3 78  ? 32.183  34.331 17.613  1.00 23.27  ? 78  GLU B C     1 
ATOM   3462 O  O     . GLU F  3 78  ? 33.116  33.925 16.917  1.00 20.88  ? 78  GLU B O     1 
ATOM   3463 C  CB    . GLU F  3 78  ? 31.755  36.730 18.189  1.00 32.16  ? 78  GLU B CB    1 
ATOM   3464 C  CG    . GLU F  3 78  ? 33.147  37.297 18.022  1.00 42.06  ? 78  GLU B CG    1 
ATOM   3465 C  CD    . GLU F  3 78  ? 33.428  38.425 18.996  1.00 53.01  ? 78  GLU B CD    1 
ATOM   3466 O  OE1   . GLU F  3 78  ? 32.611  39.369 19.061  1.00 56.62  ? 78  GLU B OE1   1 
ATOM   3467 O  OE2   . GLU F  3 78  ? 34.464  38.368 19.693  1.00 55.09  ? 78  GLU B OE2   1 
ATOM   3468 N  N     . PHE F  3 79  ? 31.799  33.703 18.723  1.00 19.59  ? 79  PHE B N     1 
ATOM   3469 C  CA    . PHE F  3 79  ? 32.514  32.507 19.148  1.00 23.07  ? 79  PHE B CA    1 
ATOM   3470 C  C     . PHE F  3 79  ? 32.307  31.357 18.163  1.00 24.15  ? 79  PHE B C     1 
ATOM   3471 O  O     . PHE F  3 79  ? 33.235  30.590 17.892  1.00 21.65  ? 79  PHE B O     1 
ATOM   3472 C  CB    . PHE F  3 79  ? 32.090  32.069 20.556  1.00 20.28  ? 79  PHE B CB    1 
ATOM   3473 C  CG    . PHE F  3 79  ? 32.995  31.019 21.155  1.00 23.40  ? 79  PHE B CG    1 
ATOM   3474 C  CD1   . PHE F  3 79  ? 34.319  31.319 21.458  1.00 22.94  ? 79  PHE B CD1   1 
ATOM   3475 C  CD2   . PHE F  3 79  ? 32.535  29.724 21.378  1.00 18.83  ? 79  PHE B CD2   1 
ATOM   3476 C  CE1   . PHE F  3 79  ? 35.176  30.344 21.974  1.00 25.04  ? 79  PHE B CE1   1 
ATOM   3477 C  CE2   . PHE F  3 79  ? 33.382  28.740 21.892  1.00 21.62  ? 79  PHE B CE2   1 
ATOM   3478 C  CZ    . PHE F  3 79  ? 34.704  29.052 22.191  1.00 22.81  ? 79  PHE B CZ    1 
ATOM   3479 N  N     . PHE F  3 80  ? 31.099  31.231 17.620  1.00 22.64  ? 80  PHE B N     1 
ATOM   3480 C  CA    . PHE F  3 80  ? 30.844  30.158 16.665  1.00 21.44  ? 80  PHE B CA    1 
ATOM   3481 C  C     . PHE F  3 80  ? 31.741  30.307 15.440  1.00 24.68  ? 80  PHE B C     1 
ATOM   3482 O  O     . PHE F  3 80  ? 32.154  29.312 14.846  1.00 22.56  ? 80  PHE B O     1 
ATOM   3483 C  CB    . PHE F  3 80  ? 29.374  30.140 16.236  1.00 18.89  ? 80  PHE B CB    1 
ATOM   3484 C  CG    . PHE F  3 80  ? 28.443  29.596 17.286  1.00 19.63  ? 80  PHE B CG    1 
ATOM   3485 C  CD1   . PHE F  3 80  ? 28.937  29.060 18.473  1.00 20.26  ? 80  PHE B CD1   1 
ATOM   3486 C  CD2   . PHE F  3 80  ? 27.066  29.606 17.078  1.00 19.48  ? 80  PHE B CD2   1 
ATOM   3487 C  CE1   . PHE F  3 80  ? 28.078  28.540 19.434  1.00 19.75  ? 80  PHE B CE1   1 
ATOM   3488 C  CE2   . PHE F  3 80  ? 26.198  29.090 18.034  1.00 19.64  ? 80  PHE B CE2   1 
ATOM   3489 C  CZ    . PHE F  3 80  ? 26.703  28.555 19.215  1.00 20.13  ? 80  PHE B CZ    1 
ATOM   3490 N  N     . ASN F  3 81  ? 32.046  31.545 15.061  1.00 24.03  ? 81  ASN B N     1 
ATOM   3491 C  CA    . ASN F  3 81  ? 32.922  31.777 13.914  1.00 26.86  ? 81  ASN B CA    1 
ATOM   3492 C  C     . ASN F  3 81  ? 34.318  31.257 14.237  1.00 28.40  ? 81  ASN B C     1 
ATOM   3493 O  O     . ASN F  3 81  ? 35.008  30.725 13.372  1.00 29.56  ? 81  ASN B O     1 
ATOM   3494 C  CB    . ASN F  3 81  ? 32.992  33.269 13.572  1.00 23.44  ? 81  ASN B CB    1 
ATOM   3495 C  CG    . ASN F  3 81  ? 31.960  33.675 12.541  1.00 29.03  ? 81  ASN B CG    1 
ATOM   3496 O  OD1   . ASN F  3 81  ? 32.266  33.796 11.354  1.00 26.82  ? 81  ASN B OD1   1 
ATOM   3497 N  ND2   . ASN F  3 81  ? 30.723  33.870 12.985  1.00 23.63  ? 81  ASN B ND2   1 
ATOM   3498 N  N     . LEU F  3 82  ? 34.736  31.414 15.488  1.00 26.24  ? 82  LEU B N     1 
ATOM   3499 C  CA    . LEU F  3 82  ? 36.049  30.931 15.895  1.00 27.58  ? 82  LEU B CA    1 
ATOM   3500 C  C     . LEU F  3 82  ? 36.083  29.406 15.858  1.00 31.47  ? 82  LEU B C     1 
ATOM   3501 O  O     . LEU F  3 82  ? 37.054  28.811 15.384  1.00 28.29  ? 82  LEU B O     1 
ATOM   3502 C  CB    . LEU F  3 82  ? 36.407  31.427 17.301  1.00 27.09  ? 82  LEU B CB    1 
ATOM   3503 C  CG    . LEU F  3 82  ? 36.637  32.938 17.435  1.00 34.35  ? 82  LEU B CG    1 
ATOM   3504 C  CD1   . LEU F  3 82  ? 37.019  33.266 18.869  1.00 33.91  ? 82  LEU B CD1   1 
ATOM   3505 C  CD2   . LEU F  3 82  ? 37.737  33.389 16.472  1.00 32.44  ? 82  LEU B CD2   1 
ATOM   3506 N  N     . LEU F  3 83  ? 35.025  28.765 16.351  1.00 26.89  ? 83  LEU B N     1 
ATOM   3507 C  CA    . LEU F  3 83  ? 34.980  27.305 16.340  1.00 27.35  ? 83  LEU B CA    1 
ATOM   3508 C  C     . LEU F  3 83  ? 34.903  26.786 14.908  1.00 25.92  ? 83  LEU B C     1 
ATOM   3509 O  O     . LEU F  3 83  ? 35.493  25.755 14.579  1.00 25.15  ? 83  LEU B O     1 
ATOM   3510 C  CB    . LEU F  3 83  ? 33.771  26.781 17.127  1.00 24.69  ? 83  LEU B CB    1 
ATOM   3511 C  CG    . LEU F  3 83  ? 33.703  27.050 18.632  1.00 27.26  ? 83  LEU B CG    1 
ATOM   3512 C  CD1   . LEU F  3 83  ? 32.455  26.364 19.207  1.00 25.63  ? 83  LEU B CD1   1 
ATOM   3513 C  CD2   . LEU F  3 83  ? 34.961  26.529 19.316  1.00 25.70  ? 83  LEU B CD2   1 
ATOM   3514 N  N     . ALA F  3 84  ? 34.178  27.505 14.057  1.00 25.59  ? 84  ALA B N     1 
ATOM   3515 C  CA    . ALA F  3 84  ? 34.016  27.102 12.665  1.00 27.68  ? 84  ALA B CA    1 
ATOM   3516 C  C     . ALA F  3 84  ? 35.334  27.097 11.893  1.00 31.07  ? 84  ALA B C     1 
ATOM   3517 O  O     . ALA F  3 84  ? 35.506  26.314 10.959  1.00 29.53  ? 84  ALA B O     1 
ATOM   3518 C  CB    . ALA F  3 84  ? 33.011  28.012 11.966  1.00 21.99  ? 84  ALA B CB    1 
ATOM   3519 N  N     . GLN F  3 85  ? 36.258  27.971 12.280  1.00 32.49  ? 85  GLN B N     1 
ATOM   3520 C  CA    . GLN F  3 85  ? 37.552  28.048 11.609  1.00 39.73  ? 85  GLN B CA    1 
ATOM   3521 C  C     . GLN F  3 85  ? 38.238  26.689 11.614  1.00 40.61  ? 85  GLN B C     1 
ATOM   3522 O  O     . GLN F  3 85  ? 38.867  26.293 10.633  1.00 42.35  ? 85  GLN B O     1 
ATOM   3523 C  CB    . GLN F  3 85  ? 38.451  29.078 12.300  1.00 40.48  ? 85  GLN B CB    1 
ATOM   3524 C  CG    . GLN F  3 85  ? 37.975  30.513 12.161  1.00 48.09  ? 85  GLN B CG    1 
ATOM   3525 C  CD    . GLN F  3 85  ? 38.840  31.494 12.935  1.00 53.81  ? 85  GLN B CD    1 
ATOM   3526 O  OE1   . GLN F  3 85  ? 38.592  32.700 12.926  1.00 54.30  ? 85  GLN B OE1   1 
ATOM   3527 N  NE2   . GLN F  3 85  ? 39.861  30.979 13.611  1.00 53.71  ? 85  GLN B NE2   1 
ATOM   3528 N  N     . LYS F  3 86  ? 38.101  25.976 12.725  1.00 38.93  ? 86  LYS B N     1 
ATOM   3529 C  CA    . LYS F  3 86  ? 38.702  24.659 12.880  1.00 41.58  ? 86  LYS B CA    1 
ATOM   3530 C  C     . LYS F  3 86  ? 38.199  23.699 11.807  1.00 41.57  ? 86  LYS B C     1 
ATOM   3531 O  O     . LYS F  3 86  ? 38.842  22.695 11.510  1.00 42.82  ? 86  LYS B O     1 
ATOM   3532 C  CB    . LYS F  3 86  ? 38.373  24.115 14.273  1.00 43.51  ? 86  LYS B CB    1 
ATOM   3533 C  CG    . LYS F  3 86  ? 39.125  22.860 14.669  1.00 50.69  ? 86  LYS B CG    1 
ATOM   3534 C  CD    . LYS F  3 86  ? 38.954  22.596 16.157  1.00 54.41  ? 86  LYS B CD    1 
ATOM   3535 C  CE    . LYS F  3 86  ? 39.808  21.431 16.625  1.00 58.44  ? 86  LYS B CE    1 
ATOM   3536 N  NZ    . LYS F  3 86  ? 39.772  21.295 18.107  1.00 57.38  ? 86  LYS B NZ    1 
ATOM   3537 N  N     . LEU F  3 87  ? 37.047  24.018 11.225  1.00 37.61  ? 87  LEU B N     1 
ATOM   3538 C  CA    . LEU F  3 87  ? 36.452  23.181 10.190  1.00 36.18  ? 87  LEU B CA    1 
ATOM   3539 C  C     . LEU F  3 87  ? 36.599  23.808 8.805   1.00 36.89  ? 87  LEU B C     1 
ATOM   3540 O  O     . LEU F  3 87  ? 36.150  23.230 7.811   1.00 35.90  ? 87  LEU B O     1 
ATOM   3541 C  CB    . LEU F  3 87  ? 34.960  22.966 10.482  1.00 30.60  ? 87  LEU B CB    1 
ATOM   3542 C  CG    . LEU F  3 87  ? 34.569  22.363 11.836  1.00 34.11  ? 87  LEU B CG    1 
ATOM   3543 C  CD1   . LEU F  3 87  ? 33.055  22.436 12.003  1.00 32.72  ? 87  LEU B CD1   1 
ATOM   3544 C  CD2   . LEU F  3 87  ? 35.051  20.918 11.927  1.00 34.18  ? 87  LEU B CD2   1 
ATOM   3545 N  N     . GLU F  3 88  ? 37.222  24.984 8.740   1.00 34.52  ? 88  GLU B N     1 
ATOM   3546 C  CA    . GLU F  3 88  ? 37.385  25.689 7.472   1.00 36.16  ? 88  GLU B CA    1 
ATOM   3547 C  C     . GLU F  3 88  ? 36.013  25.717 6.818   1.00 35.60  ? 88  GLU B C     1 
ATOM   3548 O  O     . GLU F  3 88  ? 35.880  25.652 5.594   1.00 32.20  ? 88  GLU B O     1 
ATOM   3549 C  CB    . GLU F  3 88  ? 38.381  24.954 6.566   1.00 41.27  ? 88  GLU B CB    1 
ATOM   3550 C  CG    . GLU F  3 88  ? 39.797  24.901 7.119   1.00 47.85  ? 88  GLU B CG    1 
ATOM   3551 C  CD    . GLU F  3 88  ? 40.805  24.404 6.098   1.00 51.99  ? 88  GLU B CD    1 
ATOM   3552 O  OE1   . GLU F  3 88  ? 40.681  23.248 5.646   1.00 53.73  ? 88  GLU B OE1   1 
ATOM   3553 O  OE2   . GLU F  3 88  ? 41.722  25.175 5.747   1.00 57.94  ? 88  GLU B OE2   1 
ATOM   3554 N  N     . LEU F  3 89  ? 34.993  25.816 7.663   1.00 34.43  ? 89  LEU B N     1 
ATOM   3555 C  CA    . LEU F  3 89  ? 33.607  25.814 7.226   1.00 34.76  ? 89  LEU B CA    1 
ATOM   3556 C  C     . LEU F  3 89  ? 33.324  26.717 6.031   1.00 34.13  ? 89  LEU B C     1 
ATOM   3557 O  O     . LEU F  3 89  ? 32.569  26.341 5.132   1.00 32.62  ? 89  LEU B O     1 
ATOM   3558 C  CB    . LEU F  3 89  ? 32.701  26.189 8.407   1.00 31.69  ? 89  LEU B CB    1 
ATOM   3559 C  CG    . LEU F  3 89  ? 31.208  25.890 8.260   1.00 37.11  ? 89  LEU B CG    1 
ATOM   3560 C  CD1   . LEU F  3 89  ? 31.013  24.413 7.943   1.00 35.24  ? 89  LEU B CD1   1 
ATOM   3561 C  CD2   . LEU F  3 89  ? 30.479  26.259 9.549   1.00 35.10  ? 89  LEU B CD2   1 
ATOM   3562 N  N     . HIS F  3 90  ? 33.943  27.893 6.005   1.00 32.00  ? 90  HIS B N     1 
ATOM   3563 C  CA    . HIS F  3 90  ? 33.723  28.837 4.915   1.00 37.52  ? 90  HIS B CA    1 
ATOM   3564 C  C     . HIS F  3 90  ? 33.953  28.264 3.515   1.00 37.85  ? 90  HIS B C     1 
ATOM   3565 O  O     . HIS F  3 90  ? 33.317  28.695 2.556   1.00 41.01  ? 90  HIS B O     1 
ATOM   3566 C  CB    . HIS F  3 90  ? 34.604  30.076 5.100   1.00 40.54  ? 90  HIS B CB    1 
ATOM   3567 C  CG    . HIS F  3 90  ? 36.072  29.786 5.077   1.00 44.15  ? 90  HIS B CG    1 
ATOM   3568 N  ND1   . HIS F  3 90  ? 36.718  29.126 6.100   1.00 45.40  ? 90  HIS B ND1   1 
ATOM   3569 C  CD2   . HIS F  3 90  ? 37.019  30.059 4.148   1.00 45.14  ? 90  HIS B CD2   1 
ATOM   3570 C  CE1   . HIS F  3 90  ? 37.999  29.006 5.804   1.00 46.08  ? 90  HIS B CE1   1 
ATOM   3571 N  NE2   . HIS F  3 90  ? 38.208  29.563 4.625   1.00 44.18  ? 90  HIS B NE2   1 
ATOM   3572 N  N     . LYS F  3 91  ? 34.852  27.292 3.399   1.00 39.74  ? 91  LYS B N     1 
ATOM   3573 C  CA    . LYS F  3 91  ? 35.168  26.684 2.106   1.00 39.37  ? 91  LYS B CA    1 
ATOM   3574 C  C     . LYS F  3 91  ? 34.128  25.682 1.604   1.00 40.29  ? 91  LYS B C     1 
ATOM   3575 O  O     . LYS F  3 91  ? 34.210  25.219 0.467   1.00 37.24  ? 91  LYS B O     1 
ATOM   3576 C  CB    . LYS F  3 91  ? 36.520  25.966 2.182   1.00 43.04  ? 91  LYS B CB    1 
ATOM   3577 C  CG    . LYS F  3 91  ? 37.710  26.841 2.533   1.00 51.39  ? 91  LYS B CG    1 
ATOM   3578 C  CD    . LYS F  3 91  ? 38.993  26.016 2.523   1.00 57.21  ? 91  LYS B CD    1 
ATOM   3579 C  CE    . LYS F  3 91  ? 40.213  26.857 2.872   1.00 62.90  ? 91  LYS B CE    1 
ATOM   3580 N  NZ    . LYS F  3 91  ? 40.147  27.389 4.261   1.00 69.11  ? 91  LYS B NZ    1 
ATOM   3581 N  N     . PHE F  3 92  ? 33.158  25.341 2.445   1.00 36.83  ? 92  PHE B N     1 
ATOM   3582 C  CA    . PHE F  3 92  ? 32.143  24.362 2.064   1.00 33.52  ? 92  PHE B CA    1 
ATOM   3583 C  C     . PHE F  3 92  ? 30.753  24.952 1.879   1.00 32.94  ? 92  PHE B C     1 
ATOM   3584 O  O     . PHE F  3 92  ? 29.843  24.279 1.387   1.00 34.52  ? 92  PHE B O     1 
ATOM   3585 C  CB    . PHE F  3 92  ? 32.089  23.258 3.118   1.00 34.63  ? 92  PHE B CB    1 
ATOM   3586 C  CG    . PHE F  3 92  ? 33.400  22.562 3.327   1.00 32.25  ? 92  PHE B CG    1 
ATOM   3587 C  CD1   . PHE F  3 92  ? 33.856  21.620 2.410   1.00 35.14  ? 92  PHE B CD1   1 
ATOM   3588 C  CD2   . PHE F  3 92  ? 34.197  22.871 4.421   1.00 30.30  ? 92  PHE B CD2   1 
ATOM   3589 C  CE1   . PHE F  3 92  ? 35.090  20.996 2.581   1.00 36.93  ? 92  PHE B CE1   1 
ATOM   3590 C  CE2   . PHE F  3 92  ? 35.435  22.254 4.602   1.00 34.34  ? 92  PHE B CE2   1 
ATOM   3591 C  CZ    . PHE F  3 92  ? 35.881  21.315 3.679   1.00 33.38  ? 92  PHE B CZ    1 
ATOM   3592 N  N     . ILE F  3 93  ? 30.588  26.211 2.267   1.00 29.48  ? 93  ILE B N     1 
ATOM   3593 C  CA    . ILE F  3 93  ? 29.295  26.871 2.158   1.00 31.23  ? 93  ILE B CA    1 
ATOM   3594 C  C     . ILE F  3 93  ? 28.890  27.158 0.714   1.00 32.92  ? 93  ILE B C     1 
ATOM   3595 O  O     . ILE F  3 93  ? 29.671  27.694 -0.073  1.00 30.29  ? 93  ILE B O     1 
ATOM   3596 C  CB    . ILE F  3 93  ? 29.286  28.189 2.971   1.00 29.43  ? 93  ILE B CB    1 
ATOM   3597 C  CG1   . ILE F  3 93  ? 29.508  27.873 4.455   1.00 28.73  ? 93  ILE B CG1   1 
ATOM   3598 C  CG2   . ILE F  3 93  ? 27.966  28.913 2.778   1.00 29.37  ? 93  ILE B CG2   1 
ATOM   3599 C  CD1   . ILE F  3 93  ? 29.592  29.102 5.359   1.00 30.04  ? 93  ILE B CD1   1 
ATOM   3600 N  N     . ARG F  3 94  ? 27.661  26.787 0.371   1.00 30.63  ? 94  ARG B N     1 
ATOM   3601 C  CA    . ARG F  3 94  ? 27.152  27.011 -0.973  1.00 35.41  ? 94  ARG B CA    1 
ATOM   3602 C  C     . ARG F  3 94  ? 26.365  28.310 -1.007  1.00 33.98  ? 94  ARG B C     1 
ATOM   3603 O  O     . ARG F  3 94  ? 25.233  28.398 -0.523  1.00 31.18  ? 94  ARG B O     1 
ATOM   3604 C  CB    . ARG F  3 94  ? 26.288  25.829 -1.415  1.00 35.88  ? 94  ARG B CB    1 
ATOM   3605 C  CG    . ARG F  3 94  ? 27.092  24.548 -1.546  1.00 42.93  ? 94  ARG B CG    1 
ATOM   3606 C  CD    . ARG F  3 94  ? 26.219  23.342 -1.820  1.00 51.11  ? 94  ARG B CD    1 
ATOM   3607 N  NE    . ARG F  3 94  ? 27.019  22.124 -1.923  1.00 55.15  ? 94  ARG B NE    1 
ATOM   3608 C  CZ    . ARG F  3 94  ? 26.514  20.910 -2.121  1.00 61.39  ? 94  ARG B CZ    1 
ATOM   3609 N  NH1   . ARG F  3 94  ? 25.203  20.743 -2.239  1.00 58.79  ? 94  ARG B NH1   1 
ATOM   3610 N  NH2   . ARG F  3 94  ? 27.323  19.861 -2.207  1.00 61.91  ? 94  ARG B NH2   1 
ATOM   3611 N  N     . ILE F  3 95  ? 27.002  29.327 -1.572  1.00 35.61  ? 95  ILE B N     1 
ATOM   3612 C  CA    . ILE F  3 95  ? 26.424  30.652 -1.683  1.00 39.48  ? 95  ILE B CA    1 
ATOM   3613 C  C     . ILE F  3 95  ? 27.288  31.404 -2.695  1.00 44.07  ? 95  ILE B C     1 
ATOM   3614 O  O     . ILE F  3 95  ? 28.449  31.050 -2.904  1.00 43.29  ? 95  ILE B O     1 
ATOM   3615 C  CB    . ILE F  3 95  ? 26.467  31.372 -0.315  1.00 38.05  ? 95  ILE B CB    1 
ATOM   3616 C  CG1   . ILE F  3 95  ? 25.684  32.684 -0.372  1.00 38.17  ? 95  ILE B CG1   1 
ATOM   3617 C  CG2   . ILE F  3 95  ? 27.908  31.623 0.087   1.00 36.77  ? 95  ILE B CG2   1 
ATOM   3618 C  CD1   . ILE F  3 95  ? 25.573  33.387 0.973   1.00 36.27  ? 95  ILE B CD1   1 
ATOM   3619 N  N     . LYS F  3 96  ? 26.725  32.430 -3.321  1.00 48.05  ? 96  LYS B N     1 
ATOM   3620 C  CA    . LYS F  3 96  ? 27.465  33.207 -4.309  1.00 54.00  ? 96  LYS B CA    1 
ATOM   3621 C  C     . LYS F  3 96  ? 28.826  33.636 -3.772  1.00 55.71  ? 96  LYS B C     1 
ATOM   3622 O  O     . LYS F  3 96  ? 28.955  34.037 -2.614  1.00 52.80  ? 96  LYS B O     1 
ATOM   3623 C  CB    . LYS F  3 96  ? 26.664  34.441 -4.727  1.00 58.48  ? 96  LYS B CB    1 
ATOM   3624 C  CG    . LYS F  3 96  ? 27.334  35.263 -5.816  1.00 66.81  ? 96  LYS B CG    1 
ATOM   3625 C  CD    . LYS F  3 96  ? 26.477  36.451 -6.224  1.00 74.24  ? 96  LYS B CD    1 
ATOM   3626 C  CE    . LYS F  3 96  ? 27.134  37.245 -7.342  1.00 77.59  ? 96  LYS B CE    1 
ATOM   3627 N  NZ    . LYS F  3 96  ? 26.299  38.402 -7.768  1.00 81.88  ? 96  LYS B NZ    1 
ATOM   3628 N  N     . ARG F  3 97  ? 29.839  33.547 -4.626  1.00 58.63  ? 97  ARG B N     1 
ATOM   3629 C  CA    . ARG F  3 97  ? 31.199  33.916 -4.259  1.00 63.33  ? 97  ARG B CA    1 
ATOM   3630 C  C     . ARG F  3 97  ? 31.256  35.344 -3.723  1.00 61.57  ? 97  ARG B C     1 
ATOM   3631 O  O     . ARG F  3 97  ? 30.734  36.269 -4.346  1.00 62.27  ? 97  ARG B O     1 
ATOM   3632 C  CB    . ARG F  3 97  ? 32.111  33.793 -5.482  1.00 71.21  ? 97  ARG B CB    1 
ATOM   3633 C  CG    . ARG F  3 97  ? 31.927  32.500 -6.263  1.00 81.47  ? 97  ARG B CG    1 
ATOM   3634 C  CD    . ARG F  3 97  ? 32.711  32.526 -7.566  1.00 90.43  ? 97  ARG B CD    1 
ATOM   3635 N  NE    . ARG F  3 97  ? 32.415  31.372 -8.411  1.00 95.96  ? 97  ARG B NE    1 
ATOM   3636 C  CZ    . ARG F  3 97  ? 32.945  31.171 -9.615  1.00 99.49  ? 97  ARG B CZ    1 
ATOM   3637 N  NH1   . ARG F  3 97  ? 33.803  32.047 -10.121 1.00 99.92  ? 97  ARG B NH1   1 
ATOM   3638 N  NH2   . ARG F  3 97  ? 32.614  30.094 -10.316 1.00 100.24 ? 97  ARG B NH2   1 
ATOM   3639 N  N     . GLY F  3 98  ? 31.886  35.513 -2.563  1.00 59.44  ? 98  GLY B N     1 
ATOM   3640 C  CA    . GLY F  3 98  ? 32.013  36.831 -1.965  1.00 55.32  ? 98  GLY B CA    1 
ATOM   3641 C  C     . GLY F  3 98  ? 30.832  37.281 -1.125  1.00 53.37  ? 98  GLY B C     1 
ATOM   3642 O  O     . GLY F  3 98  ? 30.822  38.402 -0.617  1.00 53.42  ? 98  GLY B O     1 
ATOM   3643 N  N     . LYS F  3 99  ? 29.836  36.415 -0.968  1.00 50.13  ? 99  LYS B N     1 
ATOM   3644 C  CA    . LYS F  3 99  ? 28.655  36.760 -0.183  1.00 48.32  ? 99  LYS B CA    1 
ATOM   3645 C  C     . LYS F  3 99  ? 28.732  36.253 1.252   1.00 44.29  ? 99  LYS B C     1 
ATOM   3646 O  O     . LYS F  3 99  ? 27.891  36.592 2.084   1.00 46.49  ? 99  LYS B O     1 
ATOM   3647 C  CB    . LYS F  3 99  ? 27.394  36.206 -0.850  1.00 49.60  ? 99  LYS B CB    1 
ATOM   3648 C  CG    . LYS F  3 99  ? 27.065  36.853 -2.186  1.00 57.56  ? 99  LYS B CG    1 
ATOM   3649 C  CD    . LYS F  3 99  ? 26.852  38.351 -2.034  1.00 58.92  ? 99  LYS B CD    1 
ATOM   3650 C  CE    . LYS F  3 99  ? 26.600  39.017 -3.376  1.00 62.20  ? 99  LYS B CE    1 
ATOM   3651 N  NZ    . LYS F  3 99  ? 26.436  40.490 -3.233  1.00 62.72  ? 99  LYS B NZ    1 
ATOM   3652 N  N     . ILE F  3 100 ? 29.745  35.448 1.541   1.00 39.61  ? 100 ILE B N     1 
ATOM   3653 C  CA    . ILE F  3 100 ? 29.913  34.895 2.878   1.00 37.92  ? 100 ILE B CA    1 
ATOM   3654 C  C     . ILE F  3 100 ? 30.400  35.927 3.890   1.00 36.32  ? 100 ILE B C     1 
ATOM   3655 O  O     . ILE F  3 100 ? 31.327  36.690 3.617   1.00 37.74  ? 100 ILE B O     1 
ATOM   3656 C  CB    . ILE F  3 100 ? 30.912  33.718 2.866   1.00 40.96  ? 100 ILE B CB    1 
ATOM   3657 C  CG1   . ILE F  3 100 ? 30.386  32.603 1.958   1.00 40.71  ? 100 ILE B CG1   1 
ATOM   3658 C  CG2   . ILE F  3 100 ? 31.134  33.200 4.281   1.00 40.94  ? 100 ILE B CG2   1 
ATOM   3659 C  CD1   . ILE F  3 100 ? 31.347  31.445 1.776   1.00 42.94  ? 100 ILE B CD1   1 
ATOM   3660 N  N     . ASN F  3 101 ? 29.757  35.954 5.054   1.00 30.10  ? 101 ASN B N     1 
ATOM   3661 C  CA    . ASN F  3 101 ? 30.154  36.855 6.132   1.00 26.64  ? 101 ASN B CA    1 
ATOM   3662 C  C     . ASN F  3 101 ? 29.993  36.105 7.455   1.00 28.84  ? 101 ASN B C     1 
ATOM   3663 O  O     . ASN F  3 101 ? 29.633  34.926 7.459   1.00 24.40  ? 101 ASN B O     1 
ATOM   3664 C  CB    . ASN F  3 101 ? 29.327  38.152 6.128   1.00 29.91  ? 101 ASN B CB    1 
ATOM   3665 C  CG    . ASN F  3 101 ? 27.848  37.911 6.319   1.00 30.47  ? 101 ASN B CG    1 
ATOM   3666 O  OD1   . ASN F  3 101 ? 27.440  36.957 6.978   1.00 30.56  ? 101 ASN B OD1   1 
ATOM   3667 N  ND2   . ASN F  3 101 ? 27.031  38.794 5.755   1.00 34.90  ? 101 ASN B ND2   1 
ATOM   3668 N  N     . GLU F  3 102 ? 30.268  36.780 8.567   1.00 28.54  ? 102 GLU B N     1 
ATOM   3669 C  CA    . GLU F  3 102 ? 30.190  36.164 9.891   1.00 30.10  ? 102 GLU B CA    1 
ATOM   3670 C  C     . GLU F  3 102 ? 28.805  35.628 10.242  1.00 28.13  ? 102 GLU B C     1 
ATOM   3671 O  O     . GLU F  3 102 ? 28.675  34.616 10.935  1.00 24.14  ? 102 GLU B O     1 
ATOM   3672 C  CB    . GLU F  3 102 ? 30.617  37.171 10.963  1.00 32.88  ? 102 GLU B CB    1 
ATOM   3673 C  CG    . GLU F  3 102 ? 31.819  38.028 10.582  1.00 49.44  ? 102 GLU B CG    1 
ATOM   3674 C  CD    . GLU F  3 102 ? 31.471  39.092 9.549   1.00 54.64  ? 102 GLU B CD    1 
ATOM   3675 O  OE1   . GLU F  3 102 ? 30.623  39.958 9.854   1.00 61.29  ? 102 GLU B OE1   1 
ATOM   3676 O  OE2   . GLU F  3 102 ? 32.039  39.061 8.436   1.00 54.18  ? 102 GLU B OE2   1 
ATOM   3677 N  N     . THR F  3 103 ? 27.773  36.323 9.783   1.00 25.04  ? 103 THR B N     1 
ATOM   3678 C  CA    . THR F  3 103 ? 26.407  35.906 10.061  1.00 23.98  ? 103 THR B CA    1 
ATOM   3679 C  C     . THR F  3 103 ? 26.142  34.552 9.419   1.00 25.52  ? 103 THR B C     1 
ATOM   3680 O  O     . THR F  3 103 ? 25.608  33.647 10.061  1.00 23.60  ? 103 THR B O     1 
ATOM   3681 C  CB    . THR F  3 103 ? 25.390  36.925 9.514   1.00 32.32  ? 103 THR B CB    1 
ATOM   3682 O  OG1   . THR F  3 103 ? 25.616  38.202 10.126  1.00 33.71  ? 103 THR B OG1   1 
ATOM   3683 C  CG2   . THR F  3 103 ? 23.968  36.468 9.815   1.00 32.29  ? 103 THR B CG2   1 
ATOM   3684 N  N     . ILE F  3 104 ? 26.529  34.421 8.151   1.00 20.69  ? 104 ILE B N     1 
ATOM   3685 C  CA    . ILE F  3 104 ? 26.324  33.183 7.410   1.00 23.47  ? 104 ILE B CA    1 
ATOM   3686 C  C     . ILE F  3 104 ? 27.094  32.028 8.036   1.00 21.36  ? 104 ILE B C     1 
ATOM   3687 O  O     . ILE F  3 104 ? 26.548  30.940 8.228   1.00 20.18  ? 104 ILE B O     1 
ATOM   3688 C  CB    . ILE F  3 104 ? 26.767  33.334 5.935   1.00 27.78  ? 104 ILE B CB    1 
ATOM   3689 C  CG1   . ILE F  3 104 ? 26.080  34.546 5.294   1.00 32.51  ? 104 ILE B CG1   1 
ATOM   3690 C  CG2   . ILE F  3 104 ? 26.436  32.062 5.161   1.00 26.25  ? 104 ILE B CG2   1 
ATOM   3691 C  CD1   . ILE F  3 104 ? 24.569  34.513 5.349   1.00 38.66  ? 104 ILE B CD1   1 
ATOM   3692 N  N     . ILE F  3 105 ? 28.363  32.264 8.354   1.00 21.30  ? 105 ILE B N     1 
ATOM   3693 C  CA    . ILE F  3 105 ? 29.196  31.231 8.960   1.00 21.14  ? 105 ILE B CA    1 
ATOM   3694 C  C     . ILE F  3 105 ? 28.603  30.757 10.290  1.00 22.56  ? 105 ILE B C     1 
ATOM   3695 O  O     . ILE F  3 105 ? 28.582  29.557 10.581  1.00 21.05  ? 105 ILE B O     1 
ATOM   3696 C  CB    . ILE F  3 105 ? 30.632  31.752 9.197   1.00 23.83  ? 105 ILE B CB    1 
ATOM   3697 C  CG1   . ILE F  3 105 ? 31.333  31.949 7.847   1.00 28.83  ? 105 ILE B CG1   1 
ATOM   3698 C  CG2   . ILE F  3 105 ? 31.415  30.775 10.079  1.00 24.03  ? 105 ILE B CG2   1 
ATOM   3699 C  CD1   . ILE F  3 105 ? 32.744  32.473 7.958   1.00 33.36  ? 105 ILE B CD1   1 
ATOM   3700 N  N     . GLY F  3 106 ? 28.120  31.703 11.092  1.00 21.83  ? 106 GLY B N     1 
ATOM   3701 C  CA    . GLY F  3 106 ? 27.536  31.349 12.374  1.00 20.76  ? 106 GLY B CA    1 
ATOM   3702 C  C     . GLY F  3 106 ? 26.266  30.536 12.206  1.00 18.96  ? 106 GLY B C     1 
ATOM   3703 O  O     . GLY F  3 106 ? 26.014  29.601 12.971  1.00 20.09  ? 106 GLY B O     1 
ATOM   3704 N  N     . ASP F  3 107 ? 25.466  30.880 11.201  1.00 18.95  ? 107 ASP B N     1 
ATOM   3705 C  CA    . ASP F  3 107 ? 24.220  30.155 10.960  1.00 17.84  ? 107 ASP B CA    1 
ATOM   3706 C  C     . ASP F  3 107 ? 24.498  28.741 10.454  1.00 22.72  ? 107 ASP B C     1 
ATOM   3707 O  O     . ASP F  3 107 ? 23.848  27.785 10.872  1.00 19.84  ? 107 ASP B O     1 
ATOM   3708 C  CB    . ASP F  3 107 ? 23.344  30.891 9.942   1.00 21.79  ? 107 ASP B CB    1 
ATOM   3709 C  CG    . ASP F  3 107 ? 22.794  32.200 10.474  1.00 27.68  ? 107 ASP B CG    1 
ATOM   3710 O  OD1   . ASP F  3 107 ? 22.797  32.395 11.703  1.00 28.83  ? 107 ASP B OD1   1 
ATOM   3711 O  OD2   . ASP F  3 107 ? 22.340  33.028 9.658   1.00 29.59  ? 107 ASP B OD2   1 
ATOM   3712 N  N     . VAL F  3 108 ? 25.465  28.606 9.551   1.00 20.56  ? 108 VAL B N     1 
ATOM   3713 C  CA    . VAL F  3 108 ? 25.805  27.294 9.013   1.00 19.55  ? 108 VAL B CA    1 
ATOM   3714 C  C     . VAL F  3 108 ? 26.370  26.398 10.109  1.00 19.29  ? 108 VAL B C     1 
ATOM   3715 O  O     . VAL F  3 108 ? 26.101  25.196 10.136  1.00 20.79  ? 108 VAL B O     1 
ATOM   3716 C  CB    . VAL F  3 108 ? 26.820  27.413 7.840   1.00 20.34  ? 108 VAL B CB    1 
ATOM   3717 C  CG1   . VAL F  3 108 ? 27.369  26.031 7.461   1.00 19.20  ? 108 VAL B CG1   1 
ATOM   3718 C  CG2   . VAL F  3 108 ? 26.128  28.044 6.642   1.00 24.36  ? 108 VAL B CG2   1 
ATOM   3719 N  N     . PHE F  3 109 ? 27.145  26.983 11.019  1.00 17.20  ? 109 PHE B N     1 
ATOM   3720 C  CA    . PHE F  3 109 ? 27.717  26.215 12.120  1.00 20.32  ? 109 PHE B CA    1 
ATOM   3721 C  C     . PHE F  3 109 ? 26.593  25.559 12.923  1.00 20.49  ? 109 PHE B C     1 
ATOM   3722 O  O     . PHE F  3 109 ? 26.655  24.370 13.245  1.00 19.44  ? 109 PHE B O     1 
ATOM   3723 C  CB    . PHE F  3 109 ? 28.531  27.125 13.041  1.00 18.70  ? 109 PHE B CB    1 
ATOM   3724 C  CG    . PHE F  3 109 ? 29.211  26.394 14.162  1.00 18.43  ? 109 PHE B CG    1 
ATOM   3725 C  CD1   . PHE F  3 109 ? 30.363  25.648 13.925  1.00 19.22  ? 109 PHE B CD1   1 
ATOM   3726 C  CD2   . PHE F  3 109 ? 28.703  26.454 15.457  1.00 19.51  ? 109 PHE B CD2   1 
ATOM   3727 C  CE1   . PHE F  3 109 ? 31.005  24.972 14.962  1.00 21.26  ? 109 PHE B CE1   1 
ATOM   3728 C  CE2   . PHE F  3 109 ? 29.335  25.782 16.509  1.00 24.95  ? 109 PHE B CE2   1 
ATOM   3729 C  CZ    . PHE F  3 109 ? 30.493  25.038 16.261  1.00 21.49  ? 109 PHE B CZ    1 
ATOM   3730 N  N     . GLU F  3 110 ? 25.565  26.334 13.250  1.00 19.26  ? 110 GLU B N     1 
ATOM   3731 C  CA    . GLU F  3 110 ? 24.443  25.786 14.006  1.00 19.83  ? 110 GLU B CA    1 
ATOM   3732 C  C     . GLU F  3 110 ? 23.695  24.734 13.187  1.00 17.35  ? 110 GLU B C     1 
ATOM   3733 O  O     . GLU F  3 110 ? 23.355  23.668 13.697  1.00 18.13  ? 110 GLU B O     1 
ATOM   3734 C  CB    . GLU F  3 110 ? 23.474  26.898 14.415  1.00 21.36  ? 110 GLU B CB    1 
ATOM   3735 C  CG    . GLU F  3 110 ? 24.049  27.858 15.438  1.00 18.41  ? 110 GLU B CG    1 
ATOM   3736 C  CD    . GLU F  3 110 ? 23.062  28.924 15.842  1.00 23.95  ? 110 GLU B CD    1 
ATOM   3737 O  OE1   . GLU F  3 110 ? 22.353  29.426 14.944  1.00 23.11  ? 110 GLU B OE1   1 
ATOM   3738 O  OE2   . GLU F  3 110 ? 23.004  29.260 17.048  1.00 19.82  ? 110 GLU B OE2   1 
ATOM   3739 N  N     . ALA F  3 111 ? 23.452  25.032 11.917  1.00 17.41  ? 111 ALA B N     1 
ATOM   3740 C  CA    . ALA F  3 111 ? 22.741  24.099 11.042  1.00 19.73  ? 111 ALA B CA    1 
ATOM   3741 C  C     . ALA F  3 111 ? 23.496  22.782 10.884  1.00 21.69  ? 111 ALA B C     1 
ATOM   3742 O  O     . ALA F  3 111 ? 22.894  21.709 10.847  1.00 19.07  ? 111 ALA B O     1 
ATOM   3743 C  CB    . ALA F  3 111 ? 22.512  24.738 9.676   1.00 18.29  ? 111 ALA B CB    1 
ATOM   3744 N  N     . LEU F  3 112 ? 24.818  22.865 10.794  1.00 22.06  ? 112 LEU B N     1 
ATOM   3745 C  CA    . LEU F  3 112 ? 25.634  21.668 10.632  1.00 26.17  ? 112 LEU B CA    1 
ATOM   3746 C  C     . LEU F  3 112 ? 25.425  20.702 11.789  1.00 24.50  ? 112 LEU B C     1 
ATOM   3747 O  O     . LEU F  3 112 ? 25.334  19.491 11.588  1.00 25.13  ? 112 LEU B O     1 
ATOM   3748 C  CB    . LEU F  3 112 ? 27.113  22.049 10.527  1.00 24.71  ? 112 LEU B CB    1 
ATOM   3749 C  CG    . LEU F  3 112 ? 28.132  20.914 10.398  1.00 35.99  ? 112 LEU B CG    1 
ATOM   3750 C  CD1   . LEU F  3 112 ? 27.795  20.044 9.193   1.00 34.47  ? 112 LEU B CD1   1 
ATOM   3751 C  CD2   . LEU F  3 112 ? 29.536  21.510 10.257  1.00 35.39  ? 112 LEU B CD2   1 
ATOM   3752 N  N     . TRP F  3 113 ? 25.335  21.227 13.007  1.00 19.73  ? 113 TRP B N     1 
ATOM   3753 C  CA    . TRP F  3 113 ? 25.141  20.355 14.153  1.00 19.16  ? 113 TRP B CA    1 
ATOM   3754 C  C     . TRP F  3 113 ? 23.747  19.761 14.211  1.00 17.39  ? 113 TRP B C     1 
ATOM   3755 O  O     . TRP F  3 113 ? 23.571  18.636 14.671  1.00 20.60  ? 113 TRP B O     1 
ATOM   3756 C  CB    . TRP F  3 113 ? 25.501  21.099 15.496  1.00 18.36  ? 113 TRP B CB    1 
ATOM   3757 C  CG    . TRP F  3 113 ? 26.996  21.158 15.488  1.00 20.31  ? 113 TRP B CG    1 
ATOM   3758 C  CD1   . TRP F  3 113 ? 27.785  22.243 15.229  1.00 22.38  ? 113 TRP B CD1   1 
ATOM   3759 C  CD2   . TRP F  3 113 ? 27.885  20.066 15.742  1.00 21.25  ? 113 TRP B CD2   1 
ATOM   3760 N  NE1   . TRP F  3 113 ? 29.113  21.888 15.293  1.00 23.49  ? 113 TRP B NE1   1 
ATOM   3761 C  CE2   . TRP F  3 113 ? 29.201  20.557 15.607  1.00 23.02  ? 113 TRP B CE2   1 
ATOM   3762 C  CE3   . TRP F  3 113 ? 27.695  18.714 16.064  1.00 24.52  ? 113 TRP B CE3   1 
ATOM   3763 C  CZ2   . TRP F  3 113 ? 30.325  19.744 15.782  1.00 22.99  ? 113 TRP B CZ2   1 
ATOM   3764 C  CZ3   . TRP F  3 113 ? 28.813  17.904 16.238  1.00 19.71  ? 113 TRP B CZ3   1 
ATOM   3765 C  CH2   . TRP F  3 113 ? 30.112  18.424 16.096  1.00 23.68  ? 113 TRP B CH2   1 
ATOM   3766 N  N     . ALA F  3 114 ? 22.758  20.508 13.742  1.00 21.12  ? 114 ALA B N     1 
ATOM   3767 C  CA    . ALA F  3 114 ? 21.399  19.988 13.713  1.00 21.90  ? 114 ALA B CA    1 
ATOM   3768 C  C     . ALA F  3 114 ? 21.375  18.863 12.672  1.00 22.96  ? 114 ALA B C     1 
ATOM   3769 O  O     . ALA F  3 114 ? 20.669  17.874 12.836  1.00 22.31  ? 114 ALA B O     1 
ATOM   3770 C  CB    . ALA F  3 114 ? 20.415  21.090 13.323  1.00 21.52  ? 114 ALA B CB    1 
ATOM   3771 N  N     . ALA F  3 115 ? 22.160  19.024 11.607  1.00 22.36  ? 115 ALA B N     1 
ATOM   3772 C  CA    . ALA F  3 115 ? 22.233  18.020 10.542  1.00 21.68  ? 115 ALA B CA    1 
ATOM   3773 C  C     . ALA F  3 115 ? 22.831  16.711 11.055  1.00 24.18  ? 115 ALA B C     1 
ATOM   3774 O  O     . ALA F  3 115 ? 22.339  15.627 10.732  1.00 22.52  ? 115 ALA B O     1 
ATOM   3775 C  CB    . ALA F  3 115 ? 23.056  18.551 9.371   1.00 25.51  ? 115 ALA B CB    1 
ATOM   3776 N  N     . VAL F  3 116 ? 23.895  16.808 11.846  1.00 24.06  ? 116 VAL B N     1 
ATOM   3777 C  CA    . VAL F  3 116 ? 24.520  15.619 12.410  1.00 23.26  ? 116 VAL B CA    1 
ATOM   3778 C  C     . VAL F  3 116 ? 23.515  14.955 13.343  1.00 26.45  ? 116 VAL B C     1 
ATOM   3779 O  O     . VAL F  3 116 ? 23.325  13.736 13.317  1.00 24.15  ? 116 VAL B O     1 
ATOM   3780 C  CB    . VAL F  3 116 ? 25.784  15.967 13.224  1.00 25.47  ? 116 VAL B CB    1 
ATOM   3781 C  CG1   . VAL F  3 116 ? 26.251  14.750 14.004  1.00 21.77  ? 116 VAL B CG1   1 
ATOM   3782 C  CG2   . VAL F  3 116 ? 26.894  16.441 12.286  1.00 25.17  ? 116 VAL B CG2   1 
ATOM   3783 N  N     . TYR F  3 117 ? 22.863  15.772 14.163  1.00 21.15  ? 117 TYR B N     1 
ATOM   3784 C  CA    . TYR F  3 117 ? 21.877  15.268 15.110  1.00 23.13  ? 117 TYR B CA    1 
ATOM   3785 C  C     . TYR F  3 117 ? 20.789  14.483 14.386  1.00 21.54  ? 117 TYR B C     1 
ATOM   3786 O  O     . TYR F  3 117 ? 20.479  13.352 14.757  1.00 23.10  ? 117 TYR B O     1 
ATOM   3787 C  CB    . TYR F  3 117 ? 21.256  16.437 15.896  1.00 21.59  ? 117 TYR B CB    1 
ATOM   3788 C  CG    . TYR F  3 117 ? 20.052  16.075 16.753  1.00 19.95  ? 117 TYR B CG    1 
ATOM   3789 C  CD1   . TYR F  3 117 ? 20.156  15.153 17.800  1.00 20.72  ? 117 TYR B CD1   1 
ATOM   3790 C  CD2   . TYR F  3 117 ? 18.812  16.683 16.530  1.00 21.40  ? 117 TYR B CD2   1 
ATOM   3791 C  CE1   . TYR F  3 117 ? 19.052  14.844 18.606  1.00 20.16  ? 117 TYR B CE1   1 
ATOM   3792 C  CE2   . TYR F  3 117 ? 17.708  16.387 17.326  1.00 20.21  ? 117 TYR B CE2   1 
ATOM   3793 C  CZ    . TYR F  3 117 ? 17.832  15.469 18.359  1.00 22.76  ? 117 TYR B CZ    1 
ATOM   3794 O  OH    . TYR F  3 117 ? 16.739  15.184 19.143  1.00 21.24  ? 117 TYR B OH    1 
ATOM   3795 N  N     . ILE F  3 118 ? 20.211  15.074 13.348  1.00 21.79  ? 118 ILE B N     1 
ATOM   3796 C  CA    . ILE F  3 118 ? 19.151  14.395 12.615  1.00 22.65  ? 118 ILE B CA    1 
ATOM   3797 C  C     . ILE F  3 118 ? 19.660  13.161 11.876  1.00 26.79  ? 118 ILE B C     1 
ATOM   3798 O  O     . ILE F  3 118 ? 19.049  12.094 11.949  1.00 23.79  ? 118 ILE B O     1 
ATOM   3799 C  CB    . ILE F  3 118 ? 18.464  15.344 11.610  1.00 24.30  ? 118 ILE B CB    1 
ATOM   3800 C  CG1   . ILE F  3 118 ? 17.719  16.442 12.375  1.00 23.63  ? 118 ILE B CG1   1 
ATOM   3801 C  CG2   . ILE F  3 118 ? 17.481  14.557 10.722  1.00 26.12  ? 118 ILE B CG2   1 
ATOM   3802 C  CD1   . ILE F  3 118 ? 17.048  17.470 11.487  1.00 29.93  ? 118 ILE B CD1   1 
ATOM   3803 N  N     . ASP F  3 119 ? 20.784  13.303 11.182  1.00 26.29  ? 119 ASP B N     1 
ATOM   3804 C  CA    . ASP F  3 119 ? 21.347  12.192 10.422  1.00 25.93  ? 119 ASP B CA    1 
ATOM   3805 C  C     . ASP F  3 119 ? 21.706  10.990 11.287  1.00 28.42  ? 119 ASP B C     1 
ATOM   3806 O  O     . ASP F  3 119 ? 21.643  9.846  10.828  1.00 28.85  ? 119 ASP B O     1 
ATOM   3807 C  CB    . ASP F  3 119 ? 22.597  12.641 9.663   1.00 22.31  ? 119 ASP B CB    1 
ATOM   3808 C  CG    . ASP F  3 119 ? 23.070  11.594 8.662   1.00 28.91  ? 119 ASP B CG    1 
ATOM   3809 O  OD1   . ASP F  3 119 ? 22.346  11.365 7.674   1.00 32.08  ? 119 ASP B OD1   1 
ATOM   3810 O  OD2   . ASP F  3 119 ? 24.149  11.000 8.868   1.00 26.38  ? 119 ASP B OD2   1 
ATOM   3811 N  N     . SER F  3 120 ? 22.085  11.245 12.536  1.00 24.79  ? 120 SER B N     1 
ATOM   3812 C  CA    . SER F  3 120 ? 22.466  10.174 13.447  1.00 25.36  ? 120 SER B CA    1 
ATOM   3813 C  C     . SER F  3 120 ? 21.242  9.478  14.023  1.00 24.69  ? 120 SER B C     1 
ATOM   3814 O  O     . SER F  3 120 ? 21.372  8.595  14.870  1.00 27.04  ? 120 SER B O     1 
ATOM   3815 C  CB    . SER F  3 120 ? 23.304  10.730 14.604  1.00 24.81  ? 120 SER B CB    1 
ATOM   3816 O  OG    . SER F  3 120 ? 22.485  11.459 15.508  1.00 28.01  ? 120 SER B OG    1 
ATOM   3817 N  N     . GLY F  3 121 ? 20.060  9.881  13.560  1.00 24.79  ? 121 GLY B N     1 
ATOM   3818 C  CA    . GLY F  3 121 ? 18.821  9.307  14.061  1.00 25.52  ? 121 GLY B CA    1 
ATOM   3819 C  C     . GLY F  3 121 ? 18.374  10.032 15.321  1.00 27.96  ? 121 GLY B C     1 
ATOM   3820 O  O     . GLY F  3 121 ? 17.755  9.452  16.218  1.00 26.21  ? 121 GLY B O     1 
ATOM   3821 N  N     . ARG F  3 122 ? 18.690  11.320 15.382  1.00 26.58  ? 122 ARG B N     1 
ATOM   3822 C  CA    . ARG F  3 122 ? 18.357  12.147 16.535  1.00 25.09  ? 122 ARG B CA    1 
ATOM   3823 C  C     . ARG F  3 122 ? 18.972  11.596 17.815  1.00 27.51  ? 122 ARG B C     1 
ATOM   3824 O  O     . ARG F  3 122 ? 18.316  11.479 18.854  1.00 25.09  ? 122 ARG B O     1 
ATOM   3825 C  CB    . ARG F  3 122 ? 16.835  12.302 16.674  1.00 23.54  ? 122 ARG B CB    1 
ATOM   3826 C  CG    . ARG F  3 122 ? 16.255  13.353 15.718  1.00 22.68  ? 122 ARG B CG    1 
ATOM   3827 C  CD    . ARG F  3 122 ? 14.805  13.688 16.065  1.00 29.95  ? 122 ARG B CD    1 
ATOM   3828 N  NE    . ARG F  3 122 ? 14.386  14.981 15.529  1.00 31.91  ? 122 ARG B NE    1 
ATOM   3829 C  CZ    . ARG F  3 122 ? 14.078  15.216 14.257  1.00 39.33  ? 122 ARG B CZ    1 
ATOM   3830 N  NH1   . ARG F  3 122 ? 14.134  14.241 13.360  1.00 39.50  ? 122 ARG B NH1   1 
ATOM   3831 N  NH2   . ARG F  3 122 ? 13.710  16.435 13.884  1.00 36.76  ? 122 ARG B NH2   1 
ATOM   3832 N  N     . ASP F  3 123 ? 20.252  11.244 17.726  1.00 24.62  ? 123 ASP B N     1 
ATOM   3833 C  CA    . ASP F  3 123 ? 20.982  10.741 18.880  1.00 25.48  ? 123 ASP B CA    1 
ATOM   3834 C  C     . ASP F  3 123 ? 21.655  11.966 19.482  1.00 24.14  ? 123 ASP B C     1 
ATOM   3835 O  O     . ASP F  3 123 ? 22.734  12.364 19.041  1.00 22.47  ? 123 ASP B O     1 
ATOM   3836 C  CB    . ASP F  3 123 ? 22.052  9.735  18.452  1.00 24.45  ? 123 ASP B CB    1 
ATOM   3837 C  CG    . ASP F  3 123 ? 22.661  8.994  19.631  1.00 29.63  ? 123 ASP B CG    1 
ATOM   3838 O  OD1   . ASP F  3 123 ? 22.685  9.552  20.748  1.00 23.42  ? 123 ASP B OD1   1 
ATOM   3839 O  OD2   . ASP F  3 123 ? 23.127  7.852  19.439  1.00 31.42  ? 123 ASP B OD2   1 
ATOM   3840 N  N     . ALA F  3 124 ? 21.012  12.569 20.476  1.00 23.66  ? 124 ALA B N     1 
ATOM   3841 C  CA    . ALA F  3 124 ? 21.558  13.760 21.118  1.00 22.49  ? 124 ALA B CA    1 
ATOM   3842 C  C     . ALA F  3 124 ? 22.835  13.457 21.902  1.00 21.20  ? 124 ALA B C     1 
ATOM   3843 O  O     . ALA F  3 124 ? 23.747  14.285 21.954  1.00 23.78  ? 124 ALA B O     1 
ATOM   3844 C  CB    . ALA F  3 124 ? 20.510  14.382 22.036  1.00 20.53  ? 124 ALA B CB    1 
ATOM   3845 N  N     . ASN F  3 125 ? 22.898  12.278 22.516  1.00 20.30  ? 125 ASN B N     1 
ATOM   3846 C  CA    . ASN F  3 125 ? 24.079  11.893 23.290  1.00 24.29  ? 125 ASN B CA    1 
ATOM   3847 C  C     . ASN F  3 125 ? 25.299  11.799 22.387  1.00 22.19  ? 125 ASN B C     1 
ATOM   3848 O  O     . ASN F  3 125 ? 26.356  12.359 22.687  1.00 22.61  ? 125 ASN B O     1 
ATOM   3849 C  CB    . ASN F  3 125 ? 23.865  10.544 23.981  1.00 24.86  ? 125 ASN B CB    1 
ATOM   3850 C  CG    . ASN F  3 125 ? 22.761  10.590 25.019  1.00 30.88  ? 125 ASN B CG    1 
ATOM   3851 O  OD1   . ASN F  3 125 ? 22.518  11.630 25.635  1.00 27.75  ? 125 ASN B OD1   1 
ATOM   3852 N  ND2   . ASN F  3 125 ? 22.100  9.456  25.233  1.00 23.40  ? 125 ASN B ND2   1 
ATOM   3853 N  N     . PHE F  3 126 ? 25.146  11.085 21.281  1.00 22.50  ? 126 PHE B N     1 
ATOM   3854 C  CA    . PHE F  3 126 ? 26.238  10.928 20.329  1.00 23.98  ? 126 PHE B CA    1 
ATOM   3855 C  C     . PHE F  3 126 ? 26.672  12.277 19.760  1.00 26.62  ? 126 PHE B C     1 
ATOM   3856 O  O     . PHE F  3 126 ? 27.867  12.592 19.725  1.00 24.57  ? 126 PHE B O     1 
ATOM   3857 C  CB    . PHE F  3 126 ? 25.819  10.021 19.172  1.00 27.00  ? 126 PHE B CB    1 
ATOM   3858 C  CG    . PHE F  3 126 ? 26.781  10.045 18.020  1.00 32.26  ? 126 PHE B CG    1 
ATOM   3859 C  CD1   . PHE F  3 126 ? 27.976  9.335  18.078  1.00 35.22  ? 126 PHE B CD1   1 
ATOM   3860 C  CD2   . PHE F  3 126 ? 26.523  10.832 16.901  1.00 30.49  ? 126 PHE B CD2   1 
ATOM   3861 C  CE1   . PHE F  3 126 ? 28.903  9.411  17.039  1.00 36.87  ? 126 PHE B CE1   1 
ATOM   3862 C  CE2   . PHE F  3 126 ? 27.445  10.915 15.858  1.00 33.15  ? 126 PHE B CE2   1 
ATOM   3863 C  CZ    . PHE F  3 126 ? 28.635  10.204 15.929  1.00 35.12  ? 126 PHE B CZ    1 
ATOM   3864 N  N     . THR F  3 127 ? 25.705  13.072 19.310  1.00 22.16  ? 127 THR B N     1 
ATOM   3865 C  CA    . THR F  3 127 ? 26.030  14.371 18.728  1.00 21.70  ? 127 THR B CA    1 
ATOM   3866 C  C     . THR F  3 127 ? 26.714  15.276 19.753  1.00 21.06  ? 127 THR B C     1 
ATOM   3867 O  O     . THR F  3 127 ? 27.638  16.019 19.413  1.00 20.71  ? 127 THR B O     1 
ATOM   3868 C  CB    . THR F  3 127 ? 24.766  15.069 18.155  1.00 23.65  ? 127 THR B CB    1 
ATOM   3869 O  OG1   . THR F  3 127 ? 24.088  14.177 17.256  1.00 22.60  ? 127 THR B OG1   1 
ATOM   3870 C  CG2   . THR F  3 127 ? 25.155  16.314 17.369  1.00 19.14  ? 127 THR B CG2   1 
ATOM   3871 N  N     . ARG F  3 128 ? 26.268  15.213 21.005  1.00 19.55  ? 128 ARG B N     1 
ATOM   3872 C  CA    . ARG F  3 128 ? 26.871  16.028 22.060  1.00 24.05  ? 128 ARG B CA    1 
ATOM   3873 C  C     . ARG F  3 128 ? 28.349  15.660 22.213  1.00 24.63  ? 128 ARG B C     1 
ATOM   3874 O  O     . ARG F  3 128 ? 29.217  16.532 22.282  1.00 21.11  ? 128 ARG B O     1 
ATOM   3875 C  CB    . ARG F  3 128 ? 26.155  15.802 23.394  1.00 20.92  ? 128 ARG B CB    1 
ATOM   3876 C  CG    . ARG F  3 128 ? 26.698  16.647 24.554  1.00 21.18  ? 128 ARG B CG    1 
ATOM   3877 C  CD    . ARG F  3 128 ? 26.190  16.118 25.890  1.00 22.71  ? 128 ARG B CD    1 
ATOM   3878 N  NE    . ARG F  3 128 ? 26.660  14.750 26.102  1.00 23.18  ? 128 ARG B NE    1 
ATOM   3879 C  CZ    . ARG F  3 128 ? 25.961  13.795 26.705  1.00 32.75  ? 128 ARG B CZ    1 
ATOM   3880 N  NH1   . ARG F  3 128 ? 24.745  14.048 27.171  1.00 25.67  ? 128 ARG B NH1   1 
ATOM   3881 N  NH2   . ARG F  3 128 ? 26.473  12.575 26.819  1.00 27.47  ? 128 ARG B NH2   1 
ATOM   3882 N  N     . GLU F  3 129 ? 28.632  14.364 22.257  1.00 22.82  ? 129 GLU B N     1 
ATOM   3883 C  CA    . GLU F  3 129 ? 30.010  13.908 22.409  1.00 26.56  ? 129 GLU B CA    1 
ATOM   3884 C  C     . GLU F  3 129 ? 30.883  14.213 21.189  1.00 24.52  ? 129 GLU B C     1 
ATOM   3885 O  O     . GLU F  3 129 ? 32.086  14.437 21.332  1.00 26.51  ? 129 GLU B O     1 
ATOM   3886 C  CB    . GLU F  3 129 ? 30.044  12.410 22.729  1.00 27.23  ? 129 GLU B CB    1 
ATOM   3887 C  CG    . GLU F  3 129 ? 29.398  12.046 24.069  1.00 30.47  ? 129 GLU B CG    1 
ATOM   3888 C  CD    . GLU F  3 129 ? 29.935  12.866 25.236  1.00 35.40  ? 129 GLU B CD    1 
ATOM   3889 O  OE1   . GLU F  3 129 ? 31.175  12.974 25.378  1.00 35.96  ? 129 GLU B OE1   1 
ATOM   3890 O  OE2   . GLU F  3 129 ? 29.117  13.398 26.022  1.00 30.43  ? 129 GLU B OE2   1 
ATOM   3891 N  N     . LEU F  3 130 ? 30.292  14.224 19.997  1.00 24.42  ? 130 LEU B N     1 
ATOM   3892 C  CA    . LEU F  3 130 ? 31.054  14.538 18.787  1.00 24.95  ? 130 LEU B CA    1 
ATOM   3893 C  C     . LEU F  3 130 ? 31.447  16.012 18.871  1.00 25.66  ? 130 LEU B C     1 
ATOM   3894 O  O     . LEU F  3 130 ? 32.563  16.400 18.524  1.00 22.38  ? 130 LEU B O     1 
ATOM   3895 C  CB    . LEU F  3 130 ? 30.210  14.308 17.531  1.00 27.68  ? 130 LEU B CB    1 
ATOM   3896 C  CG    . LEU F  3 130 ? 30.930  14.595 16.209  1.00 27.60  ? 130 LEU B CG    1 
ATOM   3897 C  CD1   . LEU F  3 130 ? 32.036  13.559 16.003  1.00 33.54  ? 130 LEU B CD1   1 
ATOM   3898 C  CD2   . LEU F  3 130 ? 29.943  14.558 15.050  1.00 29.79  ? 130 LEU B CD2   1 
ATOM   3899 N  N     . PHE F  3 131 ? 30.510  16.831 19.336  1.00 19.60  ? 131 PHE B N     1 
ATOM   3900 C  CA    . PHE F  3 131 ? 30.750  18.261 19.490  1.00 20.84  ? 131 PHE B CA    1 
ATOM   3901 C  C     . PHE F  3 131 ? 31.877  18.474 20.507  1.00 20.19  ? 131 PHE B C     1 
ATOM   3902 O  O     . PHE F  3 131 ? 32.781  19.284 20.287  1.00 23.24  ? 131 PHE B O     1 
ATOM   3903 C  CB    . PHE F  3 131 ? 29.467  18.948 19.976  1.00 21.16  ? 131 PHE B CB    1 
ATOM   3904 C  CG    . PHE F  3 131 ? 29.574  20.443 20.090  1.00 18.93  ? 131 PHE B CG    1 
ATOM   3905 C  CD1   . PHE F  3 131 ? 29.354  21.256 18.983  1.00 19.92  ? 131 PHE B CD1   1 
ATOM   3906 C  CD2   . PHE F  3 131 ? 29.874  21.037 21.311  1.00 20.24  ? 131 PHE B CD2   1 
ATOM   3907 C  CE1   . PHE F  3 131 ? 29.431  22.644 19.091  1.00 20.22  ? 131 PHE B CE1   1 
ATOM   3908 C  CE2   . PHE F  3 131 ? 29.956  22.430 21.433  1.00 19.68  ? 131 PHE B CE2   1 
ATOM   3909 C  CZ    . PHE F  3 131 ? 29.733  23.230 20.322  1.00 20.28  ? 131 PHE B CZ    1 
ATOM   3910 N  N     . TYR F  3 132 ? 31.825  17.744 21.616  1.00 17.80  ? 132 TYR B N     1 
ATOM   3911 C  CA    . TYR F  3 132 ? 32.851  17.875 22.647  1.00 19.37  ? 132 TYR B CA    1 
ATOM   3912 C  C     . TYR F  3 132 ? 34.211  17.379 22.164  1.00 24.90  ? 132 TYR B C     1 
ATOM   3913 O  O     . TYR F  3 132 ? 35.246  17.964 22.491  1.00 21.59  ? 132 TYR B O     1 
ATOM   3914 C  CB    . TYR F  3 132 ? 32.465  17.102 23.911  1.00 23.02  ? 132 TYR B CB    1 
ATOM   3915 C  CG    . TYR F  3 132 ? 31.308  17.694 24.692  1.00 23.63  ? 132 TYR B CG    1 
ATOM   3916 C  CD1   . TYR F  3 132 ? 30.902  19.017 24.489  1.00 19.21  ? 132 TYR B CD1   1 
ATOM   3917 C  CD2   . TYR F  3 132 ? 30.629  16.933 25.647  1.00 24.55  ? 132 TYR B CD2   1 
ATOM   3918 C  CE1   . TYR F  3 132 ? 29.837  19.567 25.222  1.00 23.18  ? 132 TYR B CE1   1 
ATOM   3919 C  CE2   . TYR F  3 132 ? 29.569  17.475 26.386  1.00 24.01  ? 132 TYR B CE2   1 
ATOM   3920 C  CZ    . TYR F  3 132 ? 29.180  18.791 26.166  1.00 24.80  ? 132 TYR B CZ    1 
ATOM   3921 O  OH    . TYR F  3 132 ? 28.136  19.331 26.894  1.00 22.50  ? 132 TYR B OH    1 
ATOM   3922 N  N     . LYS F  3 133 ? 34.212  16.291 21.404  1.00 23.96  ? 133 LYS B N     1 
ATOM   3923 C  CA    . LYS F  3 133 ? 35.465  15.749 20.894  1.00 27.95  ? 133 LYS B CA    1 
ATOM   3924 C  C     . LYS F  3 133 ? 36.194  16.847 20.122  1.00 29.96  ? 133 LYS B C     1 
ATOM   3925 O  O     . LYS F  3 133 ? 37.418  16.990 20.204  1.00 27.66  ? 133 LYS B O     1 
ATOM   3926 C  CB    . LYS F  3 133 ? 35.185  14.560 19.969  1.00 29.76  ? 133 LYS B CB    1 
ATOM   3927 C  CG    . LYS F  3 133 ? 36.428  13.917 19.370  1.00 37.90  ? 133 LYS B CG    1 
ATOM   3928 C  CD    . LYS F  3 133 ? 37.223  13.159 20.420  1.00 49.09  ? 133 LYS B CD    1 
ATOM   3929 C  CE    . LYS F  3 133 ? 38.515  12.600 19.837  1.00 53.92  ? 133 LYS B CE    1 
ATOM   3930 N  NZ    . LYS F  3 133 ? 38.267  11.764 18.628  1.00 56.92  ? 133 LYS B NZ    1 
ATOM   3931 N  N     . LEU F  3 134 ? 35.426  17.643 19.388  1.00 24.83  ? 134 LEU B N     1 
ATOM   3932 C  CA    . LEU F  3 134 ? 35.996  18.713 18.589  1.00 26.38  ? 134 LEU B CA    1 
ATOM   3933 C  C     . LEU F  3 134 ? 36.236  20.029 19.327  1.00 29.26  ? 134 LEU B C     1 
ATOM   3934 O  O     . LEU F  3 134 ? 37.241  20.701 19.106  1.00 28.26  ? 134 LEU B O     1 
ATOM   3935 C  CB    . LEU F  3 134 ? 35.094  18.988 17.379  1.00 29.70  ? 134 LEU B CB    1 
ATOM   3936 C  CG    . LEU F  3 134 ? 34.889  17.865 16.356  1.00 29.67  ? 134 LEU B CG    1 
ATOM   3937 C  CD1   . LEU F  3 134 ? 33.786  18.205 15.354  1.00 29.00  ? 134 LEU B CD1   1 
ATOM   3938 C  CD2   . LEU F  3 134 ? 36.205  17.548 15.650  1.00 37.54  ? 134 LEU B CD2   1 
ATOM   3939 N  N     . PHE F  3 135 ? 35.300  20.385 20.223  1.00 24.53  ? 135 PHE B N     1 
ATOM   3940 C  CA    . PHE F  3 135 ? 35.389  21.712 20.862  1.00 19.40  ? 135 PHE B CA    1 
ATOM   3941 C  C     . PHE F  3 135 ? 35.458  21.843 22.380  1.00 19.53  ? 135 PHE B C     1 
ATOM   3942 O  O     . PHE F  3 135 ? 35.651  22.951 22.878  1.00 22.27  ? 135 PHE B O     1 
ATOM   3943 C  CB    . PHE F  3 135 ? 34.225  22.577 20.366  1.00 17.51  ? 135 PHE B CB    1 
ATOM   3944 C  CG    . PHE F  3 135 ? 34.100  22.620 18.872  1.00 23.05  ? 135 PHE B CG    1 
ATOM   3945 C  CD1   . PHE F  3 135 ? 35.136  23.122 18.088  1.00 23.88  ? 135 PHE B CD1   1 
ATOM   3946 C  CD2   . PHE F  3 135 ? 32.950  22.154 18.242  1.00 24.78  ? 135 PHE B CD2   1 
ATOM   3947 C  CE1   . PHE F  3 135 ? 35.031  23.161 16.698  1.00 23.42  ? 135 PHE B CE1   1 
ATOM   3948 C  CE2   . PHE F  3 135 ? 32.833  22.189 16.848  1.00 25.44  ? 135 PHE B CE2   1 
ATOM   3949 C  CZ    . PHE F  3 135 ? 33.878  22.694 16.076  1.00 30.29  ? 135 PHE B CZ    1 
ATOM   3950 N  N     . LYS F  3 136 ? 35.298  20.751 23.120  1.00 21.53  ? 136 LYS B N     1 
ATOM   3951 C  CA    . LYS F  3 136 ? 35.329  20.834 24.578  1.00 20.12  ? 136 LYS B CA    1 
ATOM   3952 C  C     . LYS F  3 136 ? 36.568  21.530 25.144  1.00 27.57  ? 136 LYS B C     1 
ATOM   3953 O  O     . LYS F  3 136 ? 36.459  22.448 25.962  1.00 21.94  ? 136 LYS B O     1 
ATOM   3954 C  CB    . LYS F  3 136 ? 35.207  19.435 25.184  1.00 20.69  ? 136 LYS B CB    1 
ATOM   3955 C  CG    . LYS F  3 136 ? 35.302  19.391 26.699  1.00 22.58  ? 136 LYS B CG    1 
ATOM   3956 C  CD    . LYS F  3 136 ? 35.003  17.991 27.198  1.00 28.56  ? 136 LYS B CD    1 
ATOM   3957 C  CE    . LYS F  3 136 ? 35.134  17.881 28.702  1.00 35.92  ? 136 LYS B CE    1 
ATOM   3958 N  NZ    . LYS F  3 136 ? 34.796  16.516 29.193  1.00 41.04  ? 136 LYS B NZ    1 
ATOM   3959 N  N     . GLU F  3 137 ? 37.750  21.098 24.720  1.00 27.51  ? 137 GLU B N     1 
ATOM   3960 C  CA    . GLU F  3 137 ? 38.972  21.713 25.225  1.00 29.63  ? 137 GLU B CA    1 
ATOM   3961 C  C     . GLU F  3 137 ? 39.083  23.176 24.810  1.00 26.29  ? 137 GLU B C     1 
ATOM   3962 O  O     . GLU F  3 137 ? 39.544  24.010 25.589  1.00 26.20  ? 137 GLU B O     1 
ATOM   3963 C  CB    . GLU F  3 137 ? 40.199  20.928 24.760  1.00 33.99  ? 137 GLU B CB    1 
ATOM   3964 C  CG    . GLU F  3 137 ? 40.309  19.541 25.389  1.00 48.23  ? 137 GLU B CG    1 
ATOM   3965 C  CD    . GLU F  3 137 ? 40.245  19.577 26.911  1.00 54.89  ? 137 GLU B CD    1 
ATOM   3966 O  OE1   . GLU F  3 137 ? 41.023  20.339 27.526  1.00 59.74  ? 137 GLU B OE1   1 
ATOM   3967 O  OE2   . GLU F  3 137 ? 39.420  18.840 27.494  1.00 51.47  ? 137 GLU B OE2   1 
ATOM   3968 N  N     . ASP F  3 138 ? 38.656  23.490 23.589  1.00 24.02  ? 138 ASP B N     1 
ATOM   3969 C  CA    . ASP F  3 138 ? 38.689  24.867 23.105  1.00 28.70  ? 138 ASP B CA    1 
ATOM   3970 C  C     . ASP F  3 138 ? 37.832  25.762 23.999  1.00 27.23  ? 138 ASP B C     1 
ATOM   3971 O  O     . ASP F  3 138 ? 38.216  26.885 24.341  1.00 23.18  ? 138 ASP B O     1 
ATOM   3972 C  CB    . ASP F  3 138 ? 38.158  24.953 21.667  1.00 30.16  ? 138 ASP B CB    1 
ATOM   3973 C  CG    . ASP F  3 138 ? 39.072  24.279 20.659  1.00 38.91  ? 138 ASP B CG    1 
ATOM   3974 O  OD1   . ASP F  3 138 ? 40.301  24.493 20.727  1.00 38.47  ? 138 ASP B OD1   1 
ATOM   3975 O  OD2   . ASP F  3 138 ? 38.558  23.547 19.788  1.00 32.27  ? 138 ASP B OD2   1 
ATOM   3976 N  N     . ILE F  3 139 ? 36.660  25.262 24.373  1.00 23.20  ? 139 ILE B N     1 
ATOM   3977 C  CA    . ILE F  3 139 ? 35.750  26.024 25.219  1.00 20.97  ? 139 ILE B CA    1 
ATOM   3978 C  C     . ILE F  3 139 ? 36.264  26.193 26.643  1.00 19.06  ? 139 ILE B C     1 
ATOM   3979 O  O     . ILE F  3 139 ? 36.272  27.302 27.181  1.00 20.85  ? 139 ILE B O     1 
ATOM   3980 C  CB    . ILE F  3 139 ? 34.350  25.359 25.273  1.00 21.98  ? 139 ILE B CB    1 
ATOM   3981 C  CG1   . ILE F  3 139 ? 33.696  25.426 23.891  1.00 24.07  ? 139 ILE B CG1   1 
ATOM   3982 C  CG2   . ILE F  3 139 ? 33.481  26.051 26.329  1.00 20.45  ? 139 ILE B CG2   1 
ATOM   3983 C  CD1   . ILE F  3 139 ? 32.491  24.515 23.726  1.00 25.13  ? 139 ILE B CD1   1 
ATOM   3984 N  N     . LEU F  3 140 ? 36.690  25.099 27.258  1.00 17.84  ? 140 LEU B N     1 
ATOM   3985 C  CA    . LEU F  3 140 ? 37.178  25.170 28.626  1.00 21.58  ? 140 LEU B CA    1 
ATOM   3986 C  C     . LEU F  3 140 ? 38.456  26.003 28.730  1.00 21.18  ? 140 LEU B C     1 
ATOM   3987 O  O     . LEU F  3 140 ? 38.668  26.702 29.720  1.00 20.90  ? 140 LEU B O     1 
ATOM   3988 C  CB    . LEU F  3 140 ? 37.417  23.759 29.179  1.00 20.98  ? 140 LEU B CB    1 
ATOM   3989 C  CG    . LEU F  3 140 ? 36.172  22.873 29.313  1.00 22.91  ? 140 LEU B CG    1 
ATOM   3990 C  CD1   . LEU F  3 140 ? 36.569  21.525 29.897  1.00 22.87  ? 140 LEU B CD1   1 
ATOM   3991 C  CD2   . LEU F  3 140 ? 35.141  23.554 30.205  1.00 23.79  ? 140 LEU B CD2   1 
ATOM   3992 N  N     . SER F  3 141 ? 39.301  25.940 27.707  1.00 22.36  ? 141 SER B N     1 
ATOM   3993 C  CA    . SER F  3 141 ? 40.540  26.714 27.743  1.00 25.24  ? 141 SER B CA    1 
ATOM   3994 C  C     . SER F  3 141 ? 40.212  28.201 27.623  1.00 22.13  ? 141 SER B C     1 
ATOM   3995 O  O     . SER F  3 141 ? 40.792  29.033 28.319  1.00 24.47  ? 141 SER B O     1 
ATOM   3996 C  CB    . SER F  3 141 ? 41.481  26.282 26.612  1.00 24.56  ? 141 SER B CB    1 
ATOM   3997 O  OG    . SER F  3 141 ? 40.927  26.570 25.343  1.00 38.37  ? 141 SER B OG    1 
ATOM   3998 N  N     . ALA F  3 142 ? 39.272  28.536 26.746  1.00 23.66  ? 142 ALA B N     1 
ATOM   3999 C  CA    . ALA F  3 142 ? 38.880  29.928 26.571  1.00 21.28  ? 142 ALA B CA    1 
ATOM   4000 C  C     . ALA F  3 142 ? 38.417  30.523 27.899  1.00 21.13  ? 142 ALA B C     1 
ATOM   4001 O  O     . ALA F  3 142 ? 38.759  31.657 28.241  1.00 22.09  ? 142 ALA B O     1 
ATOM   4002 C  CB    . ALA F  3 142 ? 37.770  30.031 25.535  1.00 22.31  ? 142 ALA B CB    1 
ATOM   4003 N  N     . ILE F  3 143 ? 37.642  29.748 28.652  1.00 20.47  ? 143 ILE B N     1 
ATOM   4004 C  CA    . ILE F  3 143 ? 37.124  30.203 29.936  1.00 21.57  ? 143 ILE B CA    1 
ATOM   4005 C  C     . ILE F  3 143 ? 38.231  30.393 30.972  1.00 24.63  ? 143 ILE B C     1 
ATOM   4006 O  O     . ILE F  3 143 ? 38.336  31.442 31.604  1.00 23.31  ? 143 ILE B O     1 
ATOM   4007 C  CB    . ILE F  3 143 ? 36.109  29.193 30.505  1.00 24.54  ? 143 ILE B CB    1 
ATOM   4008 C  CG1   . ILE F  3 143 ? 34.892  29.104 29.578  1.00 22.31  ? 143 ILE B CG1   1 
ATOM   4009 C  CG2   . ILE F  3 143 ? 35.680  29.610 31.909  1.00 23.29  ? 143 ILE B CG2   1 
ATOM   4010 C  CD1   . ILE F  3 143 ? 34.009  27.905 29.862  1.00 28.08  ? 143 ILE B CD1   1 
ATOM   4011 N  N     . LYS F  3 144 ? 39.053  29.365 31.140  1.00 22.31  ? 144 LYS B N     1 
ATOM   4012 C  CA    . LYS F  3 144 ? 40.128  29.410 32.121  1.00 24.62  ? 144 LYS B CA    1 
ATOM   4013 C  C     . LYS F  3 144 ? 41.141  30.513 31.860  1.00 23.93  ? 144 LYS B C     1 
ATOM   4014 O  O     . LYS F  3 144 ? 41.668  31.113 32.801  1.00 23.90  ? 144 LYS B O     1 
ATOM   4015 C  CB    . LYS F  3 144 ? 40.839  28.056 32.173  1.00 27.98  ? 144 LYS B CB    1 
ATOM   4016 C  CG    . LYS F  3 144 ? 39.964  26.927 32.707  1.00 34.61  ? 144 LYS B CG    1 
ATOM   4017 C  CD    . LYS F  3 144 ? 40.707  25.595 32.732  1.00 44.45  ? 144 LYS B CD    1 
ATOM   4018 C  CE    . LYS F  3 144 ? 41.090  25.144 31.330  1.00 50.04  ? 144 LYS B CE    1 
ATOM   4019 N  NZ    . LYS F  3 144 ? 41.738  23.802 31.333  1.00 58.53  ? 144 LYS B NZ    1 
ATOM   4020 N  N     . GLU F  3 145 ? 41.392  30.796 30.586  1.00 21.96  ? 145 GLU B N     1 
ATOM   4021 C  CA    . GLU F  3 145 ? 42.371  31.811 30.213  1.00 23.57  ? 145 GLU B CA    1 
ATOM   4022 C  C     . GLU F  3 145 ? 41.818  33.230 30.116  1.00 26.02  ? 145 GLU B C     1 
ATOM   4023 O  O     . GLU F  3 145 ? 42.561  34.178 29.864  1.00 27.53  ? 145 GLU B O     1 
ATOM   4024 C  CB    . GLU F  3 145 ? 43.029  31.404 28.896  1.00 25.50  ? 145 GLU B CB    1 
ATOM   4025 C  CG    . GLU F  3 145 ? 43.901  30.171 29.041  1.00 24.58  ? 145 GLU B CG    1 
ATOM   4026 C  CD    . GLU F  3 145 ? 44.189  29.484 27.727  1.00 31.56  ? 145 GLU B CD    1 
ATOM   4027 O  OE1   . GLU F  3 145 ? 44.228  30.167 26.683  1.00 25.41  ? 145 GLU B OE1   1 
ATOM   4028 O  OE2   . GLU F  3 145 ? 44.387  28.250 27.743  1.00 37.35  ? 145 GLU B OE2   1 
ATOM   4029 N  N     . GLY F  3 146 ? 40.518  33.376 30.333  1.00 23.08  ? 146 GLY B N     1 
ATOM   4030 C  CA    . GLY F  3 146 ? 39.912  34.691 30.262  1.00 27.10  ? 146 GLY B CA    1 
ATOM   4031 C  C     . GLY F  3 146 ? 39.729  35.186 28.840  1.00 24.82  ? 146 GLY B C     1 
ATOM   4032 O  O     . GLY F  3 146 ? 39.590  36.390 28.614  1.00 27.66  ? 146 GLY B O     1 
ATOM   4033 N  N     . ARG F  3 147 ? 39.739  34.270 27.878  1.00 22.44  ? 147 ARG B N     1 
ATOM   4034 C  CA    . ARG F  3 147 ? 39.554  34.644 26.475  1.00 16.84  ? 147 ARG B CA    1 
ATOM   4035 C  C     . ARG F  3 147 ? 38.061  34.640 26.158  1.00 23.83  ? 147 ARG B C     1 
ATOM   4036 O  O     . ARG F  3 147 ? 37.579  33.904 25.292  1.00 24.59  ? 147 ARG B O     1 
ATOM   4037 C  CB    . ARG F  3 147 ? 40.310  33.685 25.549  1.00 22.45  ? 147 ARG B CB    1 
ATOM   4038 C  CG    . ARG F  3 147 ? 41.817  33.961 25.546  1.00 26.94  ? 147 ARG B CG    1 
ATOM   4039 C  CD    . ARG F  3 147 ? 42.592  33.081 24.577  1.00 28.91  ? 147 ARG B CD    1 
ATOM   4040 N  NE    . ARG F  3 147 ? 42.609  31.682 24.991  1.00 25.69  ? 147 ARG B NE    1 
ATOM   4041 C  CZ    . ARG F  3 147 ? 41.860  30.733 24.442  1.00 29.78  ? 147 ARG B CZ    1 
ATOM   4042 N  NH1   . ARG F  3 147 ? 41.028  31.033 23.451  1.00 27.04  ? 147 ARG B NH1   1 
ATOM   4043 N  NH2   . ARG F  3 147 ? 41.955  29.479 24.875  1.00 24.50  ? 147 ARG B NH2   1 
ATOM   4044 N  N     . VAL F  3 148 ? 37.351  35.478 26.900  1.00 21.89  ? 148 VAL B N     1 
ATOM   4045 C  CA    . VAL F  3 148 ? 35.911  35.648 26.775  1.00 25.29  ? 148 VAL B CA    1 
ATOM   4046 C  C     . VAL F  3 148 ? 35.673  37.145 26.587  1.00 26.31  ? 148 VAL B C     1 
ATOM   4047 O  O     . VAL F  3 148 ? 36.184  37.964 27.354  1.00 25.56  ? 148 VAL B O     1 
ATOM   4048 C  CB    . VAL F  3 148 ? 35.192  35.168 28.060  1.00 24.36  ? 148 VAL B CB    1 
ATOM   4049 C  CG1   . VAL F  3 148 ? 33.708  35.541 28.011  1.00 28.11  ? 148 VAL B CG1   1 
ATOM   4050 C  CG2   . VAL F  3 148 ? 35.352  33.663 28.211  1.00 26.61  ? 148 VAL B CG2   1 
ATOM   4051 N  N     . LYS F  3 149 ? 34.920  37.501 25.554  1.00 23.19  ? 149 LYS B N     1 
ATOM   4052 C  CA    . LYS F  3 149 ? 34.631  38.900 25.275  1.00 24.67  ? 149 LYS B CA    1 
ATOM   4053 C  C     . LYS F  3 149 ? 33.938  39.574 26.459  1.00 26.18  ? 149 LYS B C     1 
ATOM   4054 O  O     . LYS F  3 149 ? 32.925  39.086 26.961  1.00 26.97  ? 149 LYS B O     1 
ATOM   4055 C  CB    . LYS F  3 149 ? 33.749  39.011 24.031  1.00 27.21  ? 149 LYS B CB    1 
ATOM   4056 C  CG    . LYS F  3 149 ? 33.473  40.438 23.580  1.00 33.80  ? 149 LYS B CG    1 
ATOM   4057 C  CD    . LYS F  3 149 ? 32.583  40.450 22.347  1.00 37.68  ? 149 LYS B CD    1 
ATOM   4058 C  CE    . LYS F  3 149 ? 32.218  41.866 21.928  1.00 43.62  ? 149 LYS B CE    1 
ATOM   4059 N  NZ    . LYS F  3 149 ? 31.300  41.866 20.751  1.00 41.83  ? 149 LYS B NZ    1 
ATOM   4060 N  N     . LYS F  3 150 ? 34.489  40.698 26.904  1.00 25.39  ? 150 LYS B N     1 
ATOM   4061 C  CA    . LYS F  3 150 ? 33.901  41.431 28.017  1.00 27.49  ? 150 LYS B CA    1 
ATOM   4062 C  C     . LYS F  3 150 ? 32.763  42.309 27.506  1.00 25.94  ? 150 LYS B C     1 
ATOM   4063 O  O     . LYS F  3 150 ? 32.815  42.824 26.390  1.00 25.54  ? 150 LYS B O     1 
ATOM   4064 C  CB    . LYS F  3 150 ? 34.952  42.313 28.697  1.00 38.40  ? 150 LYS B CB    1 
ATOM   4065 C  CG    . LYS F  3 150 ? 36.103  41.548 29.320  1.00 45.68  ? 150 LYS B CG    1 
ATOM   4066 C  CD    . LYS F  3 150 ? 37.107  42.496 29.954  1.00 55.89  ? 150 LYS B CD    1 
ATOM   4067 C  CE    . LYS F  3 150 ? 38.282  41.739 30.553  1.00 60.83  ? 150 LYS B CE    1 
ATOM   4068 N  NZ    . LYS F  3 150 ? 39.298  42.660 31.137  1.00 65.04  ? 150 LYS B NZ    1 
ATOM   4069 N  N     . ASP F  3 151 ? 31.744  42.470 28.338  1.00 24.88  ? 151 ASP B N     1 
ATOM   4070 C  CA    . ASP F  3 151 ? 30.574  43.281 28.012  1.00 23.41  ? 151 ASP B CA    1 
ATOM   4071 C  C     . ASP F  3 151 ? 30.826  44.670 28.603  1.00 21.78  ? 151 ASP B C     1 
ATOM   4072 O  O     . ASP F  3 151 ? 30.411  44.962 29.717  1.00 23.00  ? 151 ASP B O     1 
ATOM   4073 C  CB    . ASP F  3 151 ? 29.333  42.645 28.646  1.00 24.04  ? 151 ASP B CB    1 
ATOM   4074 C  CG    . ASP F  3 151 ? 28.063  43.437 28.399  1.00 24.08  ? 151 ASP B CG    1 
ATOM   4075 O  OD1   . ASP F  3 151 ? 28.133  44.526 27.794  1.00 26.19  ? 151 ASP B OD1   1 
ATOM   4076 O  OD2   . ASP F  3 151 ? 26.990  42.965 28.831  1.00 26.71  ? 151 ASP B OD2   1 
ATOM   4077 N  N     . TYR F  3 152 ? 31.503  45.521 27.841  1.00 22.70  ? 152 TYR B N     1 
ATOM   4078 C  CA    . TYR F  3 152 ? 31.849  46.859 28.313  1.00 22.60  ? 152 TYR B CA    1 
ATOM   4079 C  C     . TYR F  3 152 ? 30.682  47.776 28.648  1.00 22.52  ? 152 TYR B C     1 
ATOM   4080 O  O     . TYR F  3 152 ? 30.766  48.553 29.598  1.00 20.68  ? 152 TYR B O     1 
ATOM   4081 C  CB    . TYR F  3 152 ? 32.772  47.536 27.301  1.00 21.62  ? 152 TYR B CB    1 
ATOM   4082 C  CG    . TYR F  3 152 ? 34.076  46.789 27.123  1.00 27.53  ? 152 TYR B CG    1 
ATOM   4083 C  CD1   . TYR F  3 152 ? 34.993  46.696 28.168  1.00 33.41  ? 152 TYR B CD1   1 
ATOM   4084 C  CD2   . TYR F  3 152 ? 34.374  46.141 25.924  1.00 27.91  ? 152 TYR B CD2   1 
ATOM   4085 C  CE1   . TYR F  3 152 ? 36.175  45.971 28.027  1.00 34.98  ? 152 TYR B CE1   1 
ATOM   4086 C  CE2   . TYR F  3 152 ? 35.553  45.412 25.773  1.00 33.03  ? 152 TYR B CE2   1 
ATOM   4087 C  CZ    . TYR F  3 152 ? 36.446  45.332 26.827  1.00 33.92  ? 152 TYR B CZ    1 
ATOM   4088 O  OH    . TYR F  3 152 ? 37.609  44.605 26.691  1.00 40.59  ? 152 TYR B OH    1 
ATOM   4089 N  N     . LYS F  3 153 ? 29.595  47.703 27.886  1.00 21.37  ? 153 LYS B N     1 
ATOM   4090 C  CA    . LYS F  3 153 ? 28.461  48.565 28.193  1.00 21.23  ? 153 LYS B CA    1 
ATOM   4091 C  C     . LYS F  3 153 ? 27.863  48.217 29.546  1.00 19.81  ? 153 LYS B C     1 
ATOM   4092 O  O     . LYS F  3 153 ? 27.527  49.106 30.325  1.00 19.58  ? 153 LYS B O     1 
ATOM   4093 C  CB    . LYS F  3 153 ? 27.391  48.491 27.093  1.00 19.05  ? 153 LYS B CB    1 
ATOM   4094 C  CG    . LYS F  3 153 ? 27.801  49.212 25.808  1.00 20.82  ? 153 LYS B CG    1 
ATOM   4095 C  CD    . LYS F  3 153 ? 26.675  49.265 24.779  1.00 20.68  ? 153 LYS B CD    1 
ATOM   4096 C  CE    . LYS F  3 153 ? 25.549  50.206 25.216  1.00 19.23  ? 153 LYS B CE    1 
ATOM   4097 N  NZ    . LYS F  3 153 ? 24.461  50.253 24.192  1.00 17.57  ? 153 LYS B NZ    1 
ATOM   4098 N  N     . THR F  3 154 ? 27.733  46.926 29.842  1.00 19.26  ? 154 THR B N     1 
ATOM   4099 C  CA    . THR F  3 154 ? 27.175  46.521 31.122  1.00 21.20  ? 154 THR B CA    1 
ATOM   4100 C  C     . THR F  3 154 ? 28.153  46.819 32.258  1.00 20.65  ? 154 THR B C     1 
ATOM   4101 O  O     . THR F  3 154 ? 27.760  47.332 33.304  1.00 21.61  ? 154 THR B O     1 
ATOM   4102 C  CB    . THR F  3 154 ? 26.808  45.020 31.118  1.00 24.16  ? 154 THR B CB    1 
ATOM   4103 O  OG1   . THR F  3 154 ? 25.819  44.784 30.105  1.00 22.45  ? 154 THR B OG1   1 
ATOM   4104 C  CG2   . THR F  3 154 ? 26.241  44.599 32.462  1.00 26.18  ? 154 THR B CG2   1 
ATOM   4105 N  N     . ILE F  3 155 ? 29.426  46.503 32.049  1.00 17.66  ? 155 ILE B N     1 
ATOM   4106 C  CA    . ILE F  3 155 ? 30.440  46.764 33.064  1.00 20.29  ? 155 ILE B CA    1 
ATOM   4107 C  C     . ILE F  3 155 ? 30.459  48.255 33.407  1.00 22.26  ? 155 ILE B C     1 
ATOM   4108 O  O     . ILE F  3 155 ? 30.475  48.632 34.580  1.00 21.23  ? 155 ILE B O     1 
ATOM   4109 C  CB    . ILE F  3 155 ? 31.829  46.338 32.565  1.00 24.78  ? 155 ILE B CB    1 
ATOM   4110 C  CG1   . ILE F  3 155 ? 31.875  44.810 32.448  1.00 25.88  ? 155 ILE B CG1   1 
ATOM   4111 C  CG2   . ILE F  3 155 ? 32.919  46.863 33.509  1.00 22.46  ? 155 ILE B CG2   1 
ATOM   4112 C  CD1   . ILE F  3 155 ? 33.142  44.271 31.806  1.00 27.27  ? 155 ILE B CD1   1 
ATOM   4113 N  N     . LEU F  3 156 ? 30.439  49.093 32.374  1.00 22.89  ? 156 LEU B N     1 
ATOM   4114 C  CA    . LEU F  3 156 ? 30.451  50.539 32.575  1.00 20.72  ? 156 LEU B CA    1 
ATOM   4115 C  C     . LEU F  3 156 ? 29.278  51.042 33.415  1.00 22.63  ? 156 LEU B C     1 
ATOM   4116 O  O     . LEU F  3 156 ? 29.479  51.812 34.352  1.00 20.73  ? 156 LEU B O     1 
ATOM   4117 C  CB    . LEU F  3 156 ? 30.456  51.272 31.229  1.00 19.43  ? 156 LEU B CB    1 
ATOM   4118 C  CG    . LEU F  3 156 ? 30.268  52.795 31.319  1.00 21.40  ? 156 LEU B CG    1 
ATOM   4119 C  CD1   . LEU F  3 156 ? 31.439  53.415 32.091  1.00 21.79  ? 156 LEU B CD1   1 
ATOM   4120 C  CD2   . LEU F  3 156 ? 30.171  53.385 29.924  1.00 21.75  ? 156 LEU B CD2   1 
ATOM   4121 N  N     . GLN F  3 157 ? 28.053  50.625 33.101  1.00 22.38  ? 157 GLN B N     1 
ATOM   4122 C  CA    . GLN F  3 157 ? 26.939  51.131 33.892  1.00 20.82  ? 157 GLN B CA    1 
ATOM   4123 C  C     . GLN F  3 157 ? 26.947  50.607 35.320  1.00 21.24  ? 157 GLN B C     1 
ATOM   4124 O  O     . GLN F  3 157 ? 26.365  51.220 36.213  1.00 21.03  ? 157 GLN B O     1 
ATOM   4125 C  CB    . GLN F  3 157 ? 25.578  50.883 33.213  1.00 23.30  ? 157 GLN B CB    1 
ATOM   4126 C  CG    . GLN F  3 157 ? 25.067  49.466 33.148  1.00 22.47  ? 157 GLN B CG    1 
ATOM   4127 C  CD    . GLN F  3 157 ? 23.560  49.437 32.902  1.00 24.82  ? 157 GLN B CD    1 
ATOM   4128 O  OE1   . GLN F  3 157 ? 23.000  50.364 32.302  1.00 20.50  ? 157 GLN B OE1   1 
ATOM   4129 N  NE2   . GLN F  3 157 ? 22.900  48.374 33.356  1.00 24.52  ? 157 GLN B NE2   1 
ATOM   4130 N  N     . GLU F  3 158 ? 27.616  49.484 35.554  1.00 21.50  ? 158 GLU B N     1 
ATOM   4131 C  CA    . GLU F  3 158 ? 27.691  48.984 36.918  1.00 20.57  ? 158 GLU B CA    1 
ATOM   4132 C  C     . GLU F  3 158 ? 28.697  49.842 37.688  1.00 19.48  ? 158 GLU B C     1 
ATOM   4133 O  O     . GLU F  3 158 ? 28.529  50.097 38.880  1.00 20.07  ? 158 GLU B O     1 
ATOM   4134 C  CB    . GLU F  3 158 ? 28.063  47.500 36.922  1.00 23.52  ? 158 GLU B CB    1 
ATOM   4135 C  CG    . GLU F  3 158 ? 26.844  46.643 36.556  1.00 25.84  ? 158 GLU B CG    1 
ATOM   4136 C  CD    . GLU F  3 158 ? 27.137  45.162 36.415  1.00 34.79  ? 158 GLU B CD    1 
ATOM   4137 O  OE1   . GLU F  3 158 ? 28.001  44.643 37.150  1.00 34.01  ? 158 GLU B OE1   1 
ATOM   4138 O  OE2   . GLU F  3 158 ? 26.478  44.513 35.575  1.00 29.32  ? 158 GLU B OE2   1 
ATOM   4139 N  N     . ILE F  3 159 ? 29.729  50.306 36.994  1.00 22.67  ? 159 ILE B N     1 
ATOM   4140 C  CA    . ILE F  3 159 ? 30.721  51.170 37.624  1.00 23.37  ? 159 ILE B CA    1 
ATOM   4141 C  C     . ILE F  3 159 ? 30.083  52.516 37.972  1.00 22.93  ? 159 ILE B C     1 
ATOM   4142 O  O     . ILE F  3 159 ? 30.212  52.999 39.100  1.00 23.03  ? 159 ILE B O     1 
ATOM   4143 C  CB    . ILE F  3 159 ? 31.935  51.389 36.693  1.00 22.48  ? 159 ILE B CB    1 
ATOM   4144 C  CG1   . ILE F  3 159 ? 32.780  50.110 36.649  1.00 22.62  ? 159 ILE B CG1   1 
ATOM   4145 C  CG2   . ILE F  3 159 ? 32.776  52.575 37.178  1.00 24.60  ? 159 ILE B CG2   1 
ATOM   4146 C  CD1   . ILE F  3 159 ? 33.880  50.132 35.603  1.00 23.53  ? 159 ILE B CD1   1 
ATOM   4147 N  N     . THR F  3 160 ? 29.381  53.110 37.014  1.00 20.58  ? 160 THR B N     1 
ATOM   4148 C  CA    . THR F  3 160 ? 28.743  54.405 37.245  1.00 20.94  ? 160 THR B CA    1 
ATOM   4149 C  C     . THR F  3 160 ? 27.556  54.332 38.205  1.00 25.73  ? 160 THR B C     1 
ATOM   4150 O  O     . THR F  3 160 ? 27.310  55.272 38.963  1.00 24.90  ? 160 THR B O     1 
ATOM   4151 C  CB    . THR F  3 160 ? 28.288  55.055 35.914  1.00 23.44  ? 160 THR B CB    1 
ATOM   4152 O  OG1   . THR F  3 160 ? 27.223  54.294 35.332  1.00 20.03  ? 160 THR B OG1   1 
ATOM   4153 C  CG2   . THR F  3 160 ? 29.452  55.112 34.935  1.00 18.37  ? 160 THR B CG2   1 
ATOM   4154 N  N     . GLN F  3 161 ? 26.820  53.224 38.189  1.00 21.88  ? 161 GLN B N     1 
ATOM   4155 C  CA    . GLN F  3 161 ? 25.683  53.099 39.093  1.00 23.27  ? 161 GLN B CA    1 
ATOM   4156 C  C     . GLN F  3 161 ? 26.136  52.885 40.531  1.00 27.78  ? 161 GLN B C     1 
ATOM   4157 O  O     . GLN F  3 161 ? 25.466  53.316 41.470  1.00 29.54  ? 161 GLN B O     1 
ATOM   4158 C  CB    . GLN F  3 161 ? 24.756  51.964 38.646  1.00 28.66  ? 161 GLN B CB    1 
ATOM   4159 C  CG    . GLN F  3 161 ? 23.770  52.410 37.574  1.00 26.02  ? 161 GLN B CG    1 
ATOM   4160 C  CD    . GLN F  3 161 ? 22.810  51.316 37.146  1.00 26.54  ? 161 GLN B CD    1 
ATOM   4161 O  OE1   . GLN F  3 161 ? 21.685  51.596 36.738  1.00 23.36  ? 161 GLN B OE1   1 
ATOM   4162 N  NE2   . GLN F  3 161 ? 23.253  50.068 37.223  1.00 23.37  ? 161 GLN B NE2   1 
ATOM   4163 N  N     . LYS F  3 162 ? 27.279  52.232 40.708  1.00 26.61  ? 162 LYS B N     1 
ATOM   4164 C  CA    . LYS F  3 162 ? 27.790  52.003 42.051  1.00 29.82  ? 162 LYS B CA    1 
ATOM   4165 C  C     . LYS F  3 162 ? 28.347  53.305 42.619  1.00 31.43  ? 162 LYS B C     1 
ATOM   4166 O  O     . LYS F  3 162 ? 28.127  53.631 43.784  1.00 31.22  ? 162 LYS B O     1 
ATOM   4167 C  CB    . LYS F  3 162 ? 28.897  50.942 42.048  1.00 37.72  ? 162 LYS B CB    1 
ATOM   4168 C  CG    . LYS F  3 162 ? 29.424  50.630 43.449  1.00 42.43  ? 162 LYS B CG    1 
ATOM   4169 C  CD    . LYS F  3 162 ? 30.479  49.538 43.454  1.00 52.58  ? 162 LYS B CD    1 
ATOM   4170 C  CE    . LYS F  3 162 ? 31.768  49.997 42.797  1.00 58.36  ? 162 LYS B CE    1 
ATOM   4171 N  NZ    . LYS F  3 162 ? 32.846  48.980 42.954  1.00 63.42  ? 162 LYS B NZ    1 
ATOM   4172 N  N     . ARG F  3 163 ? 29.052  54.053 41.780  1.00 28.37  ? 163 ARG B N     1 
ATOM   4173 C  CA    . ARG F  3 163 ? 29.660  55.304 42.205  1.00 34.41  ? 163 ARG B CA    1 
ATOM   4174 C  C     . ARG F  3 163 ? 28.697  56.487 42.306  1.00 34.60  ? 163 ARG B C     1 
ATOM   4175 O  O     . ARG F  3 163 ? 28.745  57.240 43.282  1.00 33.46  ? 163 ARG B O     1 
ATOM   4176 C  CB    . ARG F  3 163 ? 30.809  55.654 41.257  1.00 37.98  ? 163 ARG B CB    1 
ATOM   4177 C  CG    . ARG F  3 163 ? 31.722  56.768 41.739  1.00 49.21  ? 163 ARG B CG    1 
ATOM   4178 C  CD    . ARG F  3 163 ? 32.939  56.879 40.830  1.00 56.22  ? 163 ARG B CD    1 
ATOM   4179 N  NE    . ARG F  3 163 ? 33.598  55.586 40.653  1.00 61.56  ? 163 ARG B NE    1 
ATOM   4180 C  CZ    . ARG F  3 163 ? 34.664  55.381 39.883  1.00 63.22  ? 163 ARG B CZ    1 
ATOM   4181 N  NH1   . ARG F  3 163 ? 35.206  56.386 39.208  1.00 61.02  ? 163 ARG B NH1   1 
ATOM   4182 N  NH2   . ARG F  3 163 ? 35.188  54.166 39.787  1.00 61.01  ? 163 ARG B NH2   1 
ATOM   4183 N  N     . TRP F  3 164 ? 27.816  56.639 41.320  1.00 27.11  ? 164 TRP B N     1 
ATOM   4184 C  CA    . TRP F  3 164 ? 26.892  57.772 41.301  1.00 25.97  ? 164 TRP B CA    1 
ATOM   4185 C  C     . TRP F  3 164 ? 25.402  57.434 41.189  1.00 24.54  ? 164 TRP B C     1 
ATOM   4186 O  O     . TRP F  3 164 ? 24.562  58.336 41.152  1.00 27.55  ? 164 TRP B O     1 
ATOM   4187 C  CB    . TRP F  3 164 ? 27.285  58.701 40.150  1.00 25.49  ? 164 TRP B CB    1 
ATOM   4188 C  CG    . TRP F  3 164 ? 28.700  59.210 40.243  1.00 32.19  ? 164 TRP B CG    1 
ATOM   4189 C  CD1   . TRP F  3 164 ? 29.215  60.022 41.215  1.00 35.29  ? 164 TRP B CD1   1 
ATOM   4190 C  CD2   . TRP F  3 164 ? 29.771  58.965 39.320  1.00 30.95  ? 164 TRP B CD2   1 
ATOM   4191 N  NE1   . TRP F  3 164 ? 30.535  60.301 40.954  1.00 36.48  ? 164 TRP B NE1   1 
ATOM   4192 C  CE2   . TRP F  3 164 ? 30.903  59.666 39.797  1.00 33.11  ? 164 TRP B CE2   1 
ATOM   4193 C  CE3   . TRP F  3 164 ? 29.885  58.223 38.137  1.00 25.23  ? 164 TRP B CE3   1 
ATOM   4194 C  CZ2   . TRP F  3 164 ? 32.134  59.649 39.129  1.00 33.53  ? 164 TRP B CZ2   1 
ATOM   4195 C  CZ3   . TRP F  3 164 ? 31.111  58.207 37.470  1.00 29.30  ? 164 TRP B CZ3   1 
ATOM   4196 C  CH2   . TRP F  3 164 ? 32.219  58.917 37.970  1.00 35.85  ? 164 TRP B CH2   1 
ATOM   4197 N  N     . LYS F  3 165 ? 25.072  56.148 41.139  1.00 26.47  ? 165 LYS B N     1 
ATOM   4198 C  CA    . LYS F  3 165 ? 23.681  55.720 40.999  1.00 27.21  ? 165 LYS B CA    1 
ATOM   4199 C  C     . LYS F  3 165 ? 23.096  56.337 39.733  1.00 29.52  ? 165 LYS B C     1 
ATOM   4200 O  O     . LYS F  3 165 ? 21.926  56.715 39.678  1.00 26.96  ? 165 LYS B O     1 
ATOM   4201 C  CB    . LYS F  3 165 ? 22.862  56.125 42.226  1.00 30.50  ? 165 LYS B CB    1 
ATOM   4202 C  CG    . LYS F  3 165 ? 23.378  55.506 43.513  1.00 37.04  ? 165 LYS B CG    1 
ATOM   4203 C  CD    . LYS F  3 165 ? 22.445  55.753 44.683  1.00 40.24  ? 165 LYS B CD    1 
ATOM   4204 C  CE    . LYS F  3 165 ? 23.091  55.304 45.986  1.00 45.49  ? 165 LYS B CE    1 
ATOM   4205 N  NZ    . LYS F  3 165 ? 23.556  53.890 45.916  1.00 43.33  ? 165 LYS B NZ    1 
ATOM   4206 N  N     . GLU F  3 166 ? 23.939  56.437 38.712  1.00 28.73  ? 166 GLU B N     1 
ATOM   4207 C  CA    . GLU F  3 166 ? 23.546  56.995 37.430  1.00 26.91  ? 166 GLU B CA    1 
ATOM   4208 C  C     . GLU F  3 166 ? 24.093  56.119 36.315  1.00 26.74  ? 166 GLU B C     1 
ATOM   4209 O  O     . GLU F  3 166 ? 25.082  55.411 36.498  1.00 25.42  ? 166 GLU B O     1 
ATOM   4210 C  CB    . GLU F  3 166 ? 24.101  58.415 37.272  1.00 27.77  ? 166 GLU B CB    1 
ATOM   4211 C  CG    . GLU F  3 166 ? 23.366  59.469 38.086  1.00 33.94  ? 166 GLU B CG    1 
ATOM   4212 C  CD    . GLU F  3 166 ? 24.105  60.793 38.119  1.00 43.53  ? 166 GLU B CD    1 
ATOM   4213 O  OE1   . GLU F  3 166 ? 24.577  61.243 37.053  1.00 39.88  ? 166 GLU B OE1   1 
ATOM   4214 O  OE2   . GLU F  3 166 ? 24.209  61.388 39.213  1.00 51.82  ? 166 GLU B OE2   1 
ATOM   4215 N  N     . ARG F  3 167 ? 23.443  56.173 35.162  1.00 22.04  ? 167 ARG B N     1 
ATOM   4216 C  CA    . ARG F  3 167 ? 23.871  55.393 34.012  1.00 25.17  ? 167 ARG B CA    1 
ATOM   4217 C  C     . ARG F  3 167 ? 24.495  56.317 32.976  1.00 25.53  ? 167 ARG B C     1 
ATOM   4218 O  O     . ARG F  3 167 ? 24.160  57.500 32.905  1.00 23.07  ? 167 ARG B O     1 
ATOM   4219 C  CB    . ARG F  3 167 ? 22.674  54.653 33.417  1.00 24.27  ? 167 ARG B CB    1 
ATOM   4220 C  CG    . ARG F  3 167 ? 22.168  53.523 34.310  1.00 28.10  ? 167 ARG B CG    1 
ATOM   4221 C  CD    . ARG F  3 167 ? 20.858  52.941 33.811  1.00 27.50  ? 167 ARG B CD    1 
ATOM   4222 N  NE    . ARG F  3 167 ? 19.719  53.817 34.083  1.00 34.26  ? 167 ARG B NE    1 
ATOM   4223 C  CZ    . ARG F  3 167 ? 19.208  54.035 35.294  1.00 41.99  ? 167 ARG B CZ    1 
ATOM   4224 N  NH1   . ARG F  3 167 ? 19.729  53.443 36.363  1.00 38.94  ? 167 ARG B NH1   1 
ATOM   4225 N  NH2   . ARG F  3 167 ? 18.170  54.847 35.438  1.00 45.15  ? 167 ARG B NH2   1 
ATOM   4226 N  N     . PRO F  3 168 ? 25.430  55.793 32.172  1.00 24.05  ? 168 PRO B N     1 
ATOM   4227 C  CA    . PRO F  3 168 ? 26.080  56.608 31.144  1.00 21.75  ? 168 PRO B CA    1 
ATOM   4228 C  C     . PRO F  3 168 ? 25.114  56.940 30.017  1.00 25.14  ? 168 PRO B C     1 
ATOM   4229 O  O     . PRO F  3 168 ? 24.070  56.304 29.871  1.00 25.13  ? 168 PRO B O     1 
ATOM   4230 C  CB    . PRO F  3 168 ? 27.216  55.712 30.667  1.00 22.85  ? 168 PRO B CB    1 
ATOM   4231 C  CG    . PRO F  3 168 ? 26.629  54.330 30.819  1.00 23.88  ? 168 PRO B CG    1 
ATOM   4232 C  CD    . PRO F  3 168 ? 25.958  54.415 32.170  1.00 20.71  ? 168 PRO B CD    1 
ATOM   4233 N  N     . GLU F  3 169 ? 25.466  57.938 29.221  1.00 21.40  ? 169 GLU B N     1 
ATOM   4234 C  CA    . GLU F  3 169 ? 24.641  58.326 28.093  1.00 26.96  ? 169 GLU B CA    1 
ATOM   4235 C  C     . GLU F  3 169 ? 25.465  58.218 26.818  1.00 23.73  ? 169 GLU B C     1 
ATOM   4236 O  O     . GLU F  3 169 ? 26.682  58.413 26.828  1.00 24.44  ? 169 GLU B O     1 
ATOM   4237 C  CB    . GLU F  3 169 ? 24.108  59.746 28.286  1.00 28.38  ? 169 GLU B CB    1 
ATOM   4238 C  CG    . GLU F  3 169 ? 23.209  59.866 29.502  1.00 38.03  ? 169 GLU B CG    1 
ATOM   4239 C  CD    . GLU F  3 169 ? 22.697  61.273 29.719  1.00 47.38  ? 169 GLU B CD    1 
ATOM   4240 O  OE1   . GLU F  3 169 ? 21.963  61.781 28.844  1.00 47.53  ? 169 GLU B OE1   1 
ATOM   4241 O  OE2   . GLU F  3 169 ? 23.031  61.870 30.767  1.00 46.94  ? 169 GLU B OE2   1 
ATOM   4242 N  N     . TYR F  3 170 ? 24.792  57.879 25.726  1.00 18.93  ? 170 TYR B N     1 
ATOM   4243 C  CA    . TYR F  3 170 ? 25.442  57.726 24.435  1.00 19.80  ? 170 TYR B CA    1 
ATOM   4244 C  C     . TYR F  3 170 ? 24.743  58.601 23.414  1.00 23.69  ? 170 TYR B C     1 
ATOM   4245 O  O     . TYR F  3 170 ? 23.521  58.735 23.438  1.00 23.14  ? 170 TYR B O     1 
ATOM   4246 C  CB    . TYR F  3 170 ? 25.335  56.280 23.954  1.00 21.14  ? 170 TYR B CB    1 
ATOM   4247 C  CG    . TYR F  3 170 ? 25.977  55.283 24.872  1.00 17.84  ? 170 TYR B CG    1 
ATOM   4248 C  CD1   . TYR F  3 170 ? 27.342  55.000 24.783  1.00 19.48  ? 170 TYR B CD1   1 
ATOM   4249 C  CD2   . TYR F  3 170 ? 25.224  54.622 25.841  1.00 22.55  ? 170 TYR B CD2   1 
ATOM   4250 C  CE1   . TYR F  3 170 ? 27.937  54.076 25.639  1.00 20.12  ? 170 TYR B CE1   1 
ATOM   4251 C  CE2   . TYR F  3 170 ? 25.808  53.700 26.699  1.00 21.61  ? 170 TYR B CE2   1 
ATOM   4252 C  CZ    . TYR F  3 170 ? 27.162  53.431 26.590  1.00 21.27  ? 170 TYR B CZ    1 
ATOM   4253 O  OH    . TYR F  3 170 ? 27.733  52.513 27.434  1.00 22.52  ? 170 TYR B OH    1 
ATOM   4254 N  N     . ARG F  3 171 ? 25.512  59.196 22.513  1.00 19.79  ? 171 ARG B N     1 
ATOM   4255 C  CA    . ARG F  3 171 ? 24.921  60.001 21.457  1.00 23.15  ? 171 ARG B CA    1 
ATOM   4256 C  C     . ARG F  3 171 ? 25.729  59.829 20.188  1.00 22.76  ? 171 ARG B C     1 
ATOM   4257 O  O     . ARG F  3 171 ? 26.929  59.546 20.230  1.00 22.03  ? 171 ARG B O     1 
ATOM   4258 C  CB    . ARG F  3 171 ? 24.859  61.484 21.830  1.00 24.67  ? 171 ARG B CB    1 
ATOM   4259 C  CG    . ARG F  3 171 ? 26.203  62.157 21.948  1.00 27.13  ? 171 ARG B CG    1 
ATOM   4260 C  CD    . ARG F  3 171 ? 26.042  63.669 22.008  1.00 24.29  ? 171 ARG B CD    1 
ATOM   4261 N  NE    . ARG F  3 171 ? 27.315  64.309 22.308  1.00 24.28  ? 171 ARG B NE    1 
ATOM   4262 C  CZ    . ARG F  3 171 ? 27.559  65.600 22.120  1.00 30.84  ? 171 ARG B CZ    1 
ATOM   4263 N  NH1   . ARG F  3 171 ? 26.609  66.385 21.630  1.00 25.25  ? 171 ARG B NH1   1 
ATOM   4264 N  NH2   . ARG F  3 171 ? 28.753  66.099 22.419  1.00 24.36  ? 171 ARG B NH2   1 
ATOM   4265 N  N     . LEU F  3 172 ? 25.059  59.989 19.056  1.00 21.19  ? 172 LEU B N     1 
ATOM   4266 C  CA    . LEU F  3 172 ? 25.710  59.850 17.764  1.00 24.36  ? 172 LEU B CA    1 
ATOM   4267 C  C     . LEU F  3 172 ? 26.469  61.127 17.420  1.00 26.75  ? 172 LEU B C     1 
ATOM   4268 O  O     . LEU F  3 172 ? 25.936  62.231 17.551  1.00 25.69  ? 172 LEU B O     1 
ATOM   4269 C  CB    . LEU F  3 172 ? 24.668  59.562 16.682  1.00 26.10  ? 172 LEU B CB    1 
ATOM   4270 C  CG    . LEU F  3 172 ? 25.195  59.327 15.264  1.00 28.82  ? 172 LEU B CG    1 
ATOM   4271 C  CD1   . LEU F  3 172 ? 26.120  58.119 15.239  1.00 25.02  ? 172 LEU B CD1   1 
ATOM   4272 C  CD2   . LEU F  3 172 ? 24.015  59.115 14.323  1.00 36.72  ? 172 LEU B CD2   1 
ATOM   4273 N  N     . ILE F  3 173 ? 27.719  60.978 16.998  1.00 25.22  ? 173 ILE B N     1 
ATOM   4274 C  CA    . ILE F  3 173 ? 28.527  62.137 16.625  1.00 25.81  ? 173 ILE B CA    1 
ATOM   4275 C  C     . ILE F  3 173 ? 28.558  62.272 15.110  1.00 28.01  ? 173 ILE B C     1 
ATOM   4276 O  O     . ILE F  3 173 ? 28.410  63.370 14.579  1.00 27.02  ? 173 ILE B O     1 
ATOM   4277 C  CB    . ILE F  3 173 ? 29.977  62.026 17.150  1.00 27.46  ? 173 ILE B CB    1 
ATOM   4278 C  CG1   . ILE F  3 173 ? 29.981  62.074 18.678  1.00 23.40  ? 173 ILE B CG1   1 
ATOM   4279 C  CG2   . ILE F  3 173 ? 30.838  63.151 16.567  1.00 26.43  ? 173 ILE B CG2   1 
ATOM   4280 C  CD1   . ILE F  3 173 ? 29.356  63.331 19.273  1.00 30.39  ? 173 ILE B CD1   1 
ATOM   4281 N  N     . SER F  3 174 ? 28.744  61.155 14.413  1.00 27.92  ? 174 SER B N     1 
ATOM   4282 C  CA    . SER F  3 174 ? 28.773  61.180 12.958  1.00 29.50  ? 174 SER B CA    1 
ATOM   4283 C  C     . SER F  3 174 ? 28.533  59.808 12.341  1.00 32.67  ? 174 SER B C     1 
ATOM   4284 O  O     . SER F  3 174 ? 28.745  58.772 12.978  1.00 29.96  ? 174 SER B O     1 
ATOM   4285 C  CB    . SER F  3 174 ? 30.112  61.740 12.457  1.00 32.02  ? 174 SER B CB    1 
ATOM   4286 O  OG    . SER F  3 174 ? 31.198  60.911 12.833  1.00 36.63  ? 174 SER B OG    1 
ATOM   4287 N  N     . VAL F  3 175 ? 28.074  59.822 11.095  1.00 30.08  ? 175 VAL B N     1 
ATOM   4288 C  CA    . VAL F  3 175 ? 27.810  58.608 10.336  1.00 37.08  ? 175 VAL B CA    1 
ATOM   4289 C  C     . VAL F  3 175 ? 28.280  58.874 8.911   1.00 42.11  ? 175 VAL B C     1 
ATOM   4290 O  O     . VAL F  3 175 ? 27.950  59.909 8.333   1.00 43.84  ? 175 VAL B O     1 
ATOM   4291 C  CB    . VAL F  3 175 ? 26.309  58.266 10.299  1.00 36.38  ? 175 VAL B CB    1 
ATOM   4292 C  CG1   . VAL F  3 175 ? 26.090  56.977 9.513   1.00 40.27  ? 175 VAL B CG1   1 
ATOM   4293 C  CG2   . VAL F  3 175 ? 25.773  58.118 11.705  1.00 41.07  ? 175 VAL B CG2   1 
ATOM   4294 N  N     . GLU F  3 176 ? 29.058  57.955 8.351   1.00 40.75  ? 176 GLU B N     1 
ATOM   4295 C  CA    . GLU F  3 176 ? 29.547  58.132 6.989   1.00 43.91  ? 176 GLU B CA    1 
ATOM   4296 C  C     . GLU F  3 176 ? 29.582  56.828 6.205   1.00 42.75  ? 176 GLU B C     1 
ATOM   4297 O  O     . GLU F  3 176 ? 29.337  55.753 6.754   1.00 34.18  ? 176 GLU B O     1 
ATOM   4298 C  CB    . GLU F  3 176 ? 30.941  58.764 6.998   1.00 50.33  ? 176 GLU B CB    1 
ATOM   4299 C  CG    . GLU F  3 176 ? 32.025  57.906 7.619   1.00 61.65  ? 176 GLU B CG    1 
ATOM   4300 C  CD    . GLU F  3 176 ? 33.395  58.555 7.529   1.00 71.05  ? 176 GLU B CD    1 
ATOM   4301 O  OE1   . GLU F  3 176 ? 33.560  59.673 8.062   1.00 75.43  ? 176 GLU B OE1   1 
ATOM   4302 O  OE2   . GLU F  3 176 ? 34.305  57.950 6.923   1.00 73.30  ? 176 GLU B OE2   1 
ATOM   4303 N  N     . GLY F  3 177 ? 29.884  56.941 4.913   1.00 40.02  ? 177 GLY B N     1 
ATOM   4304 C  CA    . GLY F  3 177 ? 29.952  55.775 4.049   1.00 38.95  ? 177 GLY B CA    1 
ATOM   4305 C  C     . GLY F  3 177 ? 28.611  55.414 3.440   1.00 36.88  ? 177 GLY B C     1 
ATOM   4306 O  O     . GLY F  3 177 ? 27.596  56.015 3.785   1.00 36.14  ? 177 GLY B O     1 
ATOM   4307 N  N     . PRO F  3 178 ? 28.574  54.439 2.514   1.00 35.94  ? 178 PRO B N     1 
ATOM   4308 C  CA    . PRO F  3 178 ? 27.326  54.012 1.870   1.00 36.63  ? 178 PRO B CA    1 
ATOM   4309 C  C     . PRO F  3 178 ? 26.346  53.540 2.945   1.00 38.84  ? 178 PRO B C     1 
ATOM   4310 O  O     . PRO F  3 178 ? 26.769  53.103 4.013   1.00 40.29  ? 178 PRO B O     1 
ATOM   4311 C  CB    . PRO F  3 178 ? 27.778  52.860 0.972   1.00 36.38  ? 178 PRO B CB    1 
ATOM   4312 C  CG    . PRO F  3 178 ? 29.193  53.224 0.638   1.00 39.70  ? 178 PRO B CG    1 
ATOM   4313 C  CD    . PRO F  3 178 ? 29.726  53.702 1.967   1.00 37.15  ? 178 PRO B CD    1 
ATOM   4314 N  N     . HIS F  3 179 ? 25.049  53.616 2.665   1.00 36.28  ? 179 HIS B N     1 
ATOM   4315 C  CA    . HIS F  3 179 ? 24.049  53.198 3.641   1.00 39.15  ? 179 HIS B CA    1 
ATOM   4316 C  C     . HIS F  3 179 ? 24.145  51.724 4.022   1.00 39.47  ? 179 HIS B C     1 
ATOM   4317 O  O     . HIS F  3 179 ? 23.783  51.344 5.134   1.00 37.98  ? 179 HIS B O     1 
ATOM   4318 C  CB    . HIS F  3 179 ? 22.642  53.511 3.126   1.00 39.96  ? 179 HIS B CB    1 
ATOM   4319 C  CG    . HIS F  3 179 ? 22.344  54.976 3.052   1.00 45.51  ? 179 HIS B CG    1 
ATOM   4320 N  ND1   . HIS F  3 179 ? 21.095  55.468 2.742   1.00 48.63  ? 179 HIS B ND1   1 
ATOM   4321 C  CD2   . HIS F  3 179 ? 23.135  56.057 3.253   1.00 46.08  ? 179 HIS B CD2   1 
ATOM   4322 C  CE1   . HIS F  3 179 ? 21.129  56.788 2.756   1.00 49.93  ? 179 HIS B CE1   1 
ATOM   4323 N  NE2   . HIS F  3 179 ? 22.355  57.171 3.064   1.00 46.60  ? 179 HIS B NE2   1 
ATOM   4324 N  N     . HIS F  3 180 ? 24.636  50.895 3.107   1.00 36.81  ? 180 HIS B N     1 
ATOM   4325 C  CA    . HIS F  3 180 ? 24.769  49.470 3.392   1.00 36.57  ? 180 HIS B CA    1 
ATOM   4326 C  C     . HIS F  3 180 ? 26.153  49.146 3.942   1.00 37.89  ? 180 HIS B C     1 
ATOM   4327 O  O     . HIS F  3 180 ? 26.495  47.983 4.134   1.00 35.20  ? 180 HIS B O     1 
ATOM   4328 C  CB    . HIS F  3 180 ? 24.505  48.638 2.136   1.00 35.35  ? 180 HIS B CB    1 
ATOM   4329 C  CG    . HIS F  3 180 ? 25.399  48.984 0.989   1.00 37.46  ? 180 HIS B CG    1 
ATOM   4330 N  ND1   . HIS F  3 180 ? 25.296  50.172 0.299   1.00 37.15  ? 180 HIS B ND1   1 
ATOM   4331 C  CD2   . HIS F  3 180 ? 26.429  48.310 0.427   1.00 39.67  ? 180 HIS B CD2   1 
ATOM   4332 C  CE1   . HIS F  3 180 ? 26.225  50.215 -0.639  1.00 38.69  ? 180 HIS B CE1   1 
ATOM   4333 N  NE2   . HIS F  3 180 ? 26.927  49.098 -0.582  1.00 39.16  ? 180 HIS B NE2   1 
ATOM   4334 N  N     . LYS F  3 181 ? 26.945  50.183 4.195   1.00 35.99  ? 181 LYS B N     1 
ATOM   4335 C  CA    . LYS F  3 181 ? 28.286  50.006 4.735   1.00 38.80  ? 181 LYS B CA    1 
ATOM   4336 C  C     . LYS F  3 181 ? 28.648  51.235 5.570   1.00 37.84  ? 181 LYS B C     1 
ATOM   4337 O  O     . LYS F  3 181 ? 29.719  51.817 5.414   1.00 36.00  ? 181 LYS B O     1 
ATOM   4338 C  CB    . LYS F  3 181 ? 29.289  49.816 3.592   1.00 47.81  ? 181 LYS B CB    1 
ATOM   4339 C  CG    . LYS F  3 181 ? 30.683  49.406 4.039   1.00 60.92  ? 181 LYS B CG    1 
ATOM   4340 C  CD    . LYS F  3 181 ? 31.573  49.054 2.853   1.00 71.20  ? 181 LYS B CD    1 
ATOM   4341 C  CE    . LYS F  3 181 ? 31.797  50.249 1.936   1.00 78.13  ? 181 LYS B CE    1 
ATOM   4342 N  NZ    . LYS F  3 181 ? 32.646  49.898 0.763   1.00 81.51  ? 181 LYS B NZ    1 
ATOM   4343 N  N     . LYS F  3 182 ? 27.741  51.618 6.463   1.00 34.67  ? 182 LYS B N     1 
ATOM   4344 C  CA    . LYS F  3 182 ? 27.945  52.783 7.316   1.00 34.34  ? 182 LYS B CA    1 
ATOM   4345 C  C     . LYS F  3 182 ? 28.990  52.588 8.403   1.00 31.36  ? 182 LYS B C     1 
ATOM   4346 O  O     . LYS F  3 182 ? 29.266  51.470 8.833   1.00 29.20  ? 182 LYS B O     1 
ATOM   4347 C  CB    . LYS F  3 182 ? 26.629  53.188 7.983   1.00 33.35  ? 182 LYS B CB    1 
ATOM   4348 C  CG    . LYS F  3 182 ? 25.571  53.698 7.027   1.00 41.14  ? 182 LYS B CG    1 
ATOM   4349 C  CD    . LYS F  3 182 ? 24.319  54.109 7.778   1.00 42.78  ? 182 LYS B CD    1 
ATOM   4350 C  CE    . LYS F  3 182 ? 23.265  54.652 6.831   1.00 47.23  ? 182 LYS B CE    1 
ATOM   4351 N  NZ    . LYS F  3 182 ? 22.033  55.062 7.557   1.00 51.78  ? 182 LYS B NZ    1 
ATOM   4352 N  N     . LYS F  3 183 ? 29.574  53.701 8.832   1.00 27.49  ? 183 LYS B N     1 
ATOM   4353 C  CA    . LYS F  3 183 ? 30.559  53.710 9.901   1.00 32.85  ? 183 LYS B CA    1 
ATOM   4354 C  C     . LYS F  3 183 ? 30.039  54.743 10.892  1.00 30.91  ? 183 LYS B C     1 
ATOM   4355 O  O     . LYS F  3 183 ? 29.802  55.894 10.522  1.00 29.32  ? 183 LYS B O     1 
ATOM   4356 C  CB    . LYS F  3 183 ? 31.935  54.141 9.390   1.00 40.65  ? 183 LYS B CB    1 
ATOM   4357 C  CG    . LYS F  3 183 ? 33.008  54.140 10.472  1.00 52.19  ? 183 LYS B CG    1 
ATOM   4358 C  CD    . LYS F  3 183 ? 34.309  54.765 9.988   1.00 64.96  ? 183 LYS B CD    1 
ATOM   4359 C  CE    . LYS F  3 183 ? 34.136  56.249 9.698   1.00 70.46  ? 183 LYS B CE    1 
ATOM   4360 N  NZ    . LYS F  3 183 ? 35.393  56.880 9.208   1.00 76.92  ? 183 LYS B NZ    1 
ATOM   4361 N  N     . PHE F  3 184 ? 29.848  54.329 12.139  1.00 26.30  ? 184 PHE B N     1 
ATOM   4362 C  CA    . PHE F  3 184 ? 29.334  55.229 13.164  1.00 25.27  ? 184 PHE B CA    1 
ATOM   4363 C  C     . PHE F  3 184 ? 30.389  55.662 14.162  1.00 26.23  ? 184 PHE B C     1 
ATOM   4364 O  O     . PHE F  3 184 ? 31.292  54.901 14.499  1.00 25.89  ? 184 PHE B O     1 
ATOM   4365 C  CB    . PHE F  3 184 ? 28.205  54.566 13.964  1.00 27.85  ? 184 PHE B CB    1 
ATOM   4366 C  CG    . PHE F  3 184 ? 27.045  54.109 13.133  1.00 25.67  ? 184 PHE B CG    1 
ATOM   4367 C  CD1   . PHE F  3 184 ? 27.092  52.889 12.460  1.00 27.69  ? 184 PHE B CD1   1 
ATOM   4368 C  CD2   . PHE F  3 184 ? 25.902  54.894 13.025  1.00 24.26  ? 184 PHE B CD2   1 
ATOM   4369 C  CE1   . PHE F  3 184 ? 26.016  52.459 11.694  1.00 23.83  ? 184 PHE B CE1   1 
ATOM   4370 C  CE2   . PHE F  3 184 ? 24.818  54.474 12.260  1.00 28.09  ? 184 PHE B CE2   1 
ATOM   4371 C  CZ    . PHE F  3 184 ? 24.874  53.254 11.593  1.00 28.40  ? 184 PHE B CZ    1 
ATOM   4372 N  N     . ILE F  3 185 ? 30.275  56.899 14.625  1.00 22.15  ? 185 ILE B N     1 
ATOM   4373 C  CA    . ILE F  3 185 ? 31.167  57.408 15.653  1.00 21.00  ? 185 ILE B CA    1 
ATOM   4374 C  C     . ILE F  3 185 ? 30.210  57.909 16.724  1.00 17.98  ? 185 ILE B C     1 
ATOM   4375 O  O     . ILE F  3 185 ? 29.354  58.752 16.456  1.00 20.99  ? 185 ILE B O     1 
ATOM   4376 C  CB    . ILE F  3 185 ? 32.056  58.576 15.164  1.00 27.32  ? 185 ILE B CB    1 
ATOM   4377 C  CG1   . ILE F  3 185 ? 33.074  58.064 14.137  1.00 29.78  ? 185 ILE B CG1   1 
ATOM   4378 C  CG2   . ILE F  3 185 ? 32.786  59.192 16.362  1.00 25.56  ? 185 ILE B CG2   1 
ATOM   4379 C  CD1   . ILE F  3 185 ? 34.023  59.130 13.609  1.00 35.36  ? 185 ILE B CD1   1 
ATOM   4380 N  N     . VAL F  3 186 ? 30.343  57.367 17.927  1.00 19.28  ? 186 VAL B N     1 
ATOM   4381 C  CA    . VAL F  3 186 ? 29.474  57.739 19.031  1.00 20.67  ? 186 VAL B CA    1 
ATOM   4382 C  C     . VAL F  3 186 ? 30.287  58.226 20.217  1.00 21.51  ? 186 VAL B C     1 
ATOM   4383 O  O     . VAL F  3 186 ? 31.485  57.952 20.325  1.00 25.94  ? 186 VAL B O     1 
ATOM   4384 C  CB    . VAL F  3 186 ? 28.627  56.536 19.505  1.00 25.01  ? 186 VAL B CB    1 
ATOM   4385 C  CG1   . VAL F  3 186 ? 27.831  55.966 18.346  1.00 22.92  ? 186 VAL B CG1   1 
ATOM   4386 C  CG2   . VAL F  3 186 ? 29.536  55.474 20.099  1.00 27.09  ? 186 VAL B CG2   1 
ATOM   4387 N  N     . GLU F  3 187 ? 29.614  58.927 21.116  1.00 19.22  ? 187 GLU B N     1 
ATOM   4388 C  CA    . GLU F  3 187 ? 30.244  59.462 22.307  1.00 20.69  ? 187 GLU B CA    1 
ATOM   4389 C  C     . GLU F  3 187 ? 29.581  58.877 23.547  1.00 19.32  ? 187 GLU B C     1 
ATOM   4390 O  O     . GLU F  3 187 ? 28.353  58.834 23.635  1.00 21.95  ? 187 GLU B O     1 
ATOM   4391 C  CB    . GLU F  3 187 ? 30.081  60.981 22.316  1.00 19.91  ? 187 GLU B CB    1 
ATOM   4392 C  CG    . GLU F  3 187 ? 30.697  61.678 23.502  1.00 22.38  ? 187 GLU B CG    1 
ATOM   4393 C  CD    . GLU F  3 187 ? 30.141  63.082 23.662  1.00 25.87  ? 187 GLU B CD    1 
ATOM   4394 O  OE1   . GLU F  3 187 ? 29.004  63.215 24.163  1.00 25.07  ? 187 GLU B OE1   1 
ATOM   4395 O  OE2   . GLU F  3 187 ? 30.829  64.043 23.267  1.00 27.64  ? 187 GLU B OE2   1 
ATOM   4396 N  N     . ALA F  3 188 ? 30.392  58.422 24.495  1.00 17.45  ? 188 ALA B N     1 
ATOM   4397 C  CA    . ALA F  3 188 ? 29.871  57.879 25.744  1.00 19.74  ? 188 ALA B CA    1 
ATOM   4398 C  C     . ALA F  3 188 ? 30.183  58.923 26.804  1.00 20.42  ? 188 ALA B C     1 
ATOM   4399 O  O     . ALA F  3 188 ? 31.237  59.550 26.755  1.00 23.26  ? 188 ALA B O     1 
ATOM   4400 C  CB    . ALA F  3 188 ? 30.558  56.565 26.085  1.00 17.42  ? 188 ALA B CB    1 
ATOM   4401 N  N     . LYS F  3 189 ? 29.274  59.121 27.754  1.00 19.44  ? 189 LYS B N     1 
ATOM   4402 C  CA    . LYS F  3 189 ? 29.525  60.109 28.804  1.00 21.53  ? 189 LYS B CA    1 
ATOM   4403 C  C     . LYS F  3 189 ? 28.944  59.754 30.167  1.00 22.49  ? 189 LYS B C     1 
ATOM   4404 O  O     . LYS F  3 189 ? 27.908  59.092 30.277  1.00 20.69  ? 189 LYS B O     1 
ATOM   4405 C  CB    . LYS F  3 189 ? 28.966  61.482 28.395  1.00 24.15  ? 189 LYS B CB    1 
ATOM   4406 C  CG    . LYS F  3 189 ? 27.449  61.584 28.496  1.00 29.85  ? 189 LYS B CG    1 
ATOM   4407 C  CD    . LYS F  3 189 ? 26.938  63.010 28.262  1.00 30.54  ? 189 LYS B CD    1 
ATOM   4408 C  CE    . LYS F  3 189 ? 25.409  63.059 28.342  1.00 34.94  ? 189 LYS B CE    1 
ATOM   4409 N  NZ    . LYS F  3 189 ? 24.862  64.450 28.218  1.00 36.90  ? 189 LYS B NZ    1 
ATOM   4410 N  N     . ILE F  3 190 ? 29.640  60.195 31.207  1.00 18.95  ? 190 ILE B N     1 
ATOM   4411 C  CA    . ILE F  3 190 ? 29.192  60.031 32.580  1.00 18.20  ? 190 ILE B CA    1 
ATOM   4412 C  C     . ILE F  3 190 ? 29.840  61.196 33.323  1.00 23.08  ? 190 ILE B C     1 
ATOM   4413 O  O     . ILE F  3 190 ? 31.054  61.390 33.248  1.00 21.23  ? 190 ILE B O     1 
ATOM   4414 C  CB    . ILE F  3 190 ? 29.613  58.673 33.201  1.00 22.70  ? 190 ILE B CB    1 
ATOM   4415 C  CG1   . ILE F  3 190 ? 28.952  58.516 34.574  1.00 20.64  ? 190 ILE B CG1   1 
ATOM   4416 C  CG2   . ILE F  3 190 ? 31.125  58.574 33.319  1.00 18.30  ? 190 ILE B CG2   1 
ATOM   4417 C  CD1   . ILE F  3 190 ? 27.435  58.314 34.511  1.00 24.44  ? 190 ILE B CD1   1 
ATOM   4418 N  N     . LYS F  3 191 ? 29.025  61.979 34.019  1.00 22.32  ? 191 LYS B N     1 
ATOM   4419 C  CA    . LYS F  3 191 ? 29.524  63.156 34.726  1.00 23.68  ? 191 LYS B CA    1 
ATOM   4420 C  C     . LYS F  3 191 ? 30.269  64.015 33.710  1.00 24.29  ? 191 LYS B C     1 
ATOM   4421 O  O     . LYS F  3 191 ? 29.730  64.306 32.644  1.00 26.99  ? 191 LYS B O     1 
ATOM   4422 C  CB    . LYS F  3 191 ? 30.447  62.758 35.886  1.00 22.78  ? 191 LYS B CB    1 
ATOM   4423 C  CG    . LYS F  3 191 ? 29.736  62.017 37.012  1.00 25.81  ? 191 LYS B CG    1 
ATOM   4424 C  CD    . LYS F  3 191 ? 28.531  62.803 37.513  1.00 33.88  ? 191 LYS B CD    1 
ATOM   4425 C  CE    . LYS F  3 191 ? 27.819  62.083 38.647  1.00 39.89  ? 191 LYS B CE    1 
ATOM   4426 N  NZ    . LYS F  3 191 ? 26.614  62.830 39.108  1.00 41.63  ? 191 LYS B NZ    1 
ATOM   4427 N  N     . GLU F  3 192 ? 31.505  64.404 34.012  1.00 23.72  ? 192 GLU B N     1 
ATOM   4428 C  CA    . GLU F  3 192 ? 32.260  65.241 33.081  1.00 25.77  ? 192 GLU B CA    1 
ATOM   4429 C  C     . GLU F  3 192 ? 33.210  64.461 32.174  1.00 26.52  ? 192 GLU B C     1 
ATOM   4430 O  O     . GLU F  3 192 ? 34.007  65.059 31.455  1.00 23.55  ? 192 GLU B O     1 
ATOM   4431 C  CB    . GLU F  3 192 ? 33.065  66.299 33.841  1.00 27.23  ? 192 GLU B CB    1 
ATOM   4432 C  CG    . GLU F  3 192 ? 32.278  67.113 34.861  1.00 35.79  ? 192 GLU B CG    1 
ATOM   4433 C  CD    . GLU F  3 192 ? 31.933  66.319 36.113  1.00 45.00  ? 192 GLU B CD    1 
ATOM   4434 O  OE1   . GLU F  3 192 ? 32.700  65.394 36.465  1.00 38.31  ? 192 GLU B OE1   1 
ATOM   4435 O  OE2   . GLU F  3 192 ? 30.904  66.632 36.752  1.00 45.15  ? 192 GLU B OE2   1 
ATOM   4436 N  N     . TYR F  3 193 ? 33.120  63.134 32.200  1.00 26.25  ? 193 TYR B N     1 
ATOM   4437 C  CA    . TYR F  3 193 ? 33.990  62.285 31.381  1.00 23.16  ? 193 TYR B CA    1 
ATOM   4438 C  C     . TYR F  3 193 ? 33.309  61.887 30.073  1.00 26.90  ? 193 TYR B C     1 
ATOM   4439 O  O     . TYR F  3 193 ? 32.164  61.435 30.078  1.00 25.21  ? 193 TYR B O     1 
ATOM   4440 C  CB    . TYR F  3 193 ? 34.363  61.030 32.175  1.00 26.93  ? 193 TYR B CB    1 
ATOM   4441 C  CG    . TYR F  3 193 ? 34.955  61.345 33.532  1.00 30.74  ? 193 TYR B CG    1 
ATOM   4442 C  CD1   . TYR F  3 193 ? 36.303  61.685 33.666  1.00 35.13  ? 193 TYR B CD1   1 
ATOM   4443 C  CD2   . TYR F  3 193 ? 34.154  61.356 34.677  1.00 26.99  ? 193 TYR B CD2   1 
ATOM   4444 C  CE1   . TYR F  3 193 ? 36.841  62.032 34.911  1.00 35.74  ? 193 TYR B CE1   1 
ATOM   4445 C  CE2   . TYR F  3 193 ? 34.681  61.703 35.926  1.00 28.59  ? 193 TYR B CE2   1 
ATOM   4446 C  CZ    . TYR F  3 193 ? 36.023  62.040 36.033  1.00 35.91  ? 193 TYR B CZ    1 
ATOM   4447 O  OH    . TYR F  3 193 ? 36.541  62.398 37.256  1.00 40.18  ? 193 TYR B OH    1 
ATOM   4448 N  N     . ARG F  3 194 ? 34.011  62.060 28.957  1.00 22.47  ? 194 ARG B N     1 
ATOM   4449 C  CA    . ARG F  3 194 ? 33.468  61.704 27.652  1.00 23.93  ? 194 ARG B CA    1 
ATOM   4450 C  C     . ARG F  3 194 ? 34.515  61.006 26.795  1.00 25.44  ? 194 ARG B C     1 
ATOM   4451 O  O     . ARG F  3 194 ? 35.701  61.335 26.853  1.00 23.61  ? 194 ARG B O     1 
ATOM   4452 C  CB    . ARG F  3 194 ? 32.932  62.942 26.915  1.00 27.26  ? 194 ARG B CB    1 
ATOM   4453 C  CG    . ARG F  3 194 ? 31.749  63.608 27.618  1.00 24.76  ? 194 ARG B CG    1 
ATOM   4454 C  CD    . ARG F  3 194 ? 30.961  64.545 26.706  1.00 28.70  ? 194 ARG B CD    1 
ATOM   4455 N  NE    . ARG F  3 194 ? 29.917  65.256 27.450  1.00 24.98  ? 194 ARG B NE    1 
ATOM   4456 C  CZ    . ARG F  3 194 ? 28.826  65.782 26.902  1.00 27.30  ? 194 ARG B CZ    1 
ATOM   4457 N  NH1   . ARG F  3 194 ? 28.620  65.683 25.597  1.00 25.74  ? 194 ARG B NH1   1 
ATOM   4458 N  NH2   . ARG F  3 194 ? 27.935  66.404 27.663  1.00 23.89  ? 194 ARG B NH2   1 
ATOM   4459 N  N     . THR F  3 195 ? 34.067  60.033 26.006  1.00 19.77  ? 195 THR B N     1 
ATOM   4460 C  CA    . THR F  3 195 ? 34.962  59.286 25.127  1.00 23.37  ? 195 THR B CA    1 
ATOM   4461 C  C     . THR F  3 195 ? 34.269  58.983 23.805  1.00 25.29  ? 195 THR B C     1 
ATOM   4462 O  O     . THR F  3 195 ? 33.045  59.075 23.702  1.00 24.81  ? 195 THR B O     1 
ATOM   4463 C  CB    . THR F  3 195 ? 35.366  57.941 25.752  1.00 27.48  ? 195 THR B CB    1 
ATOM   4464 O  OG1   . THR F  3 195 ? 34.183  57.181 26.037  1.00 24.87  ? 195 THR B OG1   1 
ATOM   4465 C  CG2   . THR F  3 195 ? 36.150  58.159 27.034  1.00 23.85  ? 195 THR B CG2   1 
ATOM   4466 N  N     . LEU F  3 196 ? 35.055  58.617 22.799  1.00 20.53  ? 196 LEU B N     1 
ATOM   4467 C  CA    . LEU F  3 196 ? 34.502  58.283 21.495  1.00 24.51  ? 196 LEU B CA    1 
ATOM   4468 C  C     . LEU F  3 196 ? 34.750  56.828 21.141  1.00 24.73  ? 196 LEU B C     1 
ATOM   4469 O  O     . LEU F  3 196 ? 35.671  56.198 21.656  1.00 24.57  ? 196 LEU B O     1 
ATOM   4470 C  CB    . LEU F  3 196 ? 35.107  59.161 20.401  1.00 22.58  ? 196 LEU B CB    1 
ATOM   4471 C  CG    . LEU F  3 196 ? 34.924  60.676 20.493  1.00 22.01  ? 196 LEU B CG    1 
ATOM   4472 C  CD1   . LEU F  3 196 ? 35.519  61.319 19.239  1.00 25.28  ? 196 LEU B CD1   1 
ATOM   4473 C  CD2   . LEU F  3 196 ? 33.450  61.016 20.614  1.00 22.80  ? 196 LEU B CD2   1 
ATOM   4474 N  N     . GLY F  3 197 ? 33.913  56.312 20.249  1.00 24.58  ? 197 GLY B N     1 
ATOM   4475 C  CA    . GLY F  3 197 ? 34.039  54.942 19.792  1.00 25.06  ? 197 GLY B CA    1 
ATOM   4476 C  C     . GLY F  3 197 ? 33.494  54.860 18.382  1.00 25.86  ? 197 GLY B C     1 
ATOM   4477 O  O     . GLY F  3 197 ? 32.614  55.640 18.011  1.00 22.87  ? 197 GLY B O     1 
ATOM   4478 N  N     . GLU F  3 198 ? 34.017  53.934 17.583  1.00 25.34  ? 198 GLU B N     1 
ATOM   4479 C  CA    . GLU F  3 198 ? 33.537  53.779 16.215  1.00 28.08  ? 198 GLU B CA    1 
ATOM   4480 C  C     . GLU F  3 198 ? 33.205  52.320 15.927  1.00 25.36  ? 198 GLU B C     1 
ATOM   4481 O  O     . GLU F  3 198 ? 33.728  51.420 16.584  1.00 25.14  ? 198 GLU B O     1 
ATOM   4482 C  CB    . GLU F  3 198 ? 34.576  54.293 15.215  1.00 33.34  ? 198 GLU B CB    1 
ATOM   4483 C  CG    . GLU F  3 198 ? 35.904  53.571 15.246  1.00 45.01  ? 198 GLU B CG    1 
ATOM   4484 C  CD    . GLU F  3 198 ? 36.852  54.077 14.172  1.00 53.04  ? 198 GLU B CD    1 
ATOM   4485 O  OE1   . GLU F  3 198 ? 37.156  55.289 14.168  1.00 57.16  ? 198 GLU B OE1   1 
ATOM   4486 O  OE2   . GLU F  3 198 ? 37.290  53.265 13.330  1.00 55.54  ? 198 GLU B OE2   1 
ATOM   4487 N  N     . GLY F  3 199 ? 32.331  52.095 14.951  1.00 26.88  ? 199 GLY B N     1 
ATOM   4488 C  CA    . GLY F  3 199 ? 31.938  50.738 14.607  1.00 30.83  ? 199 GLY B CA    1 
ATOM   4489 C  C     . GLY F  3 199 ? 30.995  50.669 13.419  1.00 32.34  ? 199 GLY B C     1 
ATOM   4490 O  O     . GLY F  3 199 ? 30.618  51.699 12.855  1.00 25.83  ? 199 GLY B O     1 
ATOM   4491 N  N     . LYS F  3 200 ? 30.607  49.451 13.044  1.00 28.68  ? 200 LYS B N     1 
ATOM   4492 C  CA    . LYS F  3 200 ? 29.711  49.235 11.911  1.00 31.21  ? 200 LYS B CA    1 
ATOM   4493 C  C     . LYS F  3 200 ? 28.236  49.315 12.300  1.00 27.50  ? 200 LYS B C     1 
ATOM   4494 O  O     . LYS F  3 200 ? 27.351  49.179 11.457  1.00 27.54  ? 200 LYS B O     1 
ATOM   4495 C  CB    . LYS F  3 200 ? 30.000  47.879 11.259  1.00 39.30  ? 200 LYS B CB    1 
ATOM   4496 C  CG    . LYS F  3 200 ? 29.707  46.686 12.151  1.00 54.15  ? 200 LYS B CG    1 
ATOM   4497 C  CD    . LYS F  3 200 ? 29.897  45.378 11.399  1.00 67.27  ? 200 LYS B CD    1 
ATOM   4498 C  CE    . LYS F  3 200 ? 29.563  44.182 12.277  1.00 73.67  ? 200 LYS B CE    1 
ATOM   4499 N  NZ    . LYS F  3 200 ? 29.693  42.897 11.534  1.00 80.52  ? 200 LYS B NZ    1 
ATOM   4500 N  N     . SER F  3 201 ? 27.979  49.519 13.585  1.00 26.40  ? 201 SER B N     1 
ATOM   4501 C  CA    . SER F  3 201 ? 26.619  49.658 14.090  1.00 22.56  ? 201 SER B CA    1 
ATOM   4502 C  C     . SER F  3 201 ? 26.725  50.578 15.294  1.00 21.26  ? 201 SER B C     1 
ATOM   4503 O  O     . SER F  3 201 ? 27.811  50.745 15.848  1.00 21.91  ? 201 SER B O     1 
ATOM   4504 C  CB    . SER F  3 201 ? 26.050  48.304 14.526  1.00 22.54  ? 201 SER B CB    1 
ATOM   4505 O  OG    . SER F  3 201 ? 26.709  47.816 15.686  1.00 23.92  ? 201 SER B OG    1 
ATOM   4506 N  N     . LYS F  3 202 ? 25.613  51.177 15.700  1.00 20.13  ? 202 LYS B N     1 
ATOM   4507 C  CA    . LYS F  3 202 ? 25.645  52.063 16.856  1.00 22.47  ? 202 LYS B CA    1 
ATOM   4508 C  C     . LYS F  3 202 ? 26.069  51.290 18.096  1.00 23.56  ? 202 LYS B C     1 
ATOM   4509 O  O     . LYS F  3 202 ? 26.865  51.777 18.893  1.00 22.28  ? 202 LYS B O     1 
ATOM   4510 C  CB    . LYS F  3 202 ? 24.270  52.674 17.118  1.00 21.81  ? 202 LYS B CB    1 
ATOM   4511 C  CG    . LYS F  3 202 ? 23.762  53.627 16.053  1.00 30.35  ? 202 LYS B CG    1 
ATOM   4512 C  CD    . LYS F  3 202 ? 22.392  54.138 16.478  1.00 28.56  ? 202 LYS B CD    1 
ATOM   4513 C  CE    . LYS F  3 202 ? 21.847  55.176 15.528  1.00 34.57  ? 202 LYS B CE    1 
ATOM   4514 N  NZ    . LYS F  3 202 ? 20.611  55.773 16.094  1.00 29.57  ? 202 LYS B NZ    1 
ATOM   4515 N  N     . LYS F  3 203 ? 25.532  50.082 18.264  1.00 21.93  ? 203 LYS B N     1 
ATOM   4516 C  CA    . LYS F  3 203 ? 25.876  49.284 19.435  1.00 21.43  ? 203 LYS B CA    1 
ATOM   4517 C  C     . LYS F  3 203 ? 27.364  48.988 19.505  1.00 19.66  ? 203 LYS B C     1 
ATOM   4518 O  O     . LYS F  3 203 ? 27.976  49.089 20.569  1.00 24.15  ? 203 LYS B O     1 
ATOM   4519 C  CB    . LYS F  3 203 ? 25.098  47.962 19.448  1.00 23.21  ? 203 LYS B CB    1 
ATOM   4520 C  CG    . LYS F  3 203 ? 25.418  47.103 20.669  1.00 23.16  ? 203 LYS B CG    1 
ATOM   4521 C  CD    . LYS F  3 203 ? 24.417  45.968 20.848  1.00 27.67  ? 203 LYS B CD    1 
ATOM   4522 C  CE    . LYS F  3 203 ? 24.445  44.997 19.689  1.00 29.68  ? 203 LYS B CE    1 
ATOM   4523 N  NZ    . LYS F  3 203 ? 23.507  43.858 19.930  1.00 28.82  ? 203 LYS B NZ    1 
ATOM   4524 N  N     . GLU F  3 204 ? 27.948  48.610 18.375  1.00 20.07  ? 204 GLU B N     1 
ATOM   4525 C  CA    . GLU F  3 204 ? 29.371  48.304 18.346  1.00 22.83  ? 204 GLU B CA    1 
ATOM   4526 C  C     . GLU F  3 204 ? 30.183  49.546 18.712  1.00 23.79  ? 204 GLU B C     1 
ATOM   4527 O  O     . GLU F  3 204 ? 31.140  49.470 19.482  1.00 20.64  ? 204 GLU B O     1 
ATOM   4528 C  CB    . GLU F  3 204 ? 29.770  47.790 16.962  1.00 26.90  ? 204 GLU B CB    1 
ATOM   4529 C  CG    . GLU F  3 204 ? 31.265  47.604 16.780  1.00 36.08  ? 204 GLU B CG    1 
ATOM   4530 C  CD    . GLU F  3 204 ? 31.602  46.868 15.497  1.00 43.58  ? 204 GLU B CD    1 
ATOM   4531 O  OE1   . GLU F  3 204 ? 31.331  45.650 15.426  1.00 48.32  ? 204 GLU B OE1   1 
ATOM   4532 O  OE2   . GLU F  3 204 ? 32.129  47.505 14.560  1.00 40.01  ? 204 GLU B OE2   1 
ATOM   4533 N  N     . ALA F  3 205 ? 29.795  50.693 18.167  1.00 21.67  ? 205 ALA B N     1 
ATOM   4534 C  CA    . ALA F  3 205 ? 30.505  51.934 18.469  1.00 21.74  ? 205 ALA B CA    1 
ATOM   4535 C  C     . ALA F  3 205 ? 30.372  52.273 19.954  1.00 23.53  ? 205 ALA B C     1 
ATOM   4536 O  O     . ALA F  3 205 ? 31.314  52.763 20.576  1.00 19.61  ? 205 ALA B O     1 
ATOM   4537 C  CB    . ALA F  3 205 ? 29.955  53.074 17.620  1.00 19.04  ? 205 ALA B CB    1 
ATOM   4538 N  N     . GLU F  3 206 ? 29.197  52.014 20.517  1.00 19.47  ? 206 GLU B N     1 
ATOM   4539 C  CA    . GLU F  3 206 ? 28.953  52.295 21.921  1.00 18.74  ? 206 GLU B CA    1 
ATOM   4540 C  C     . GLU F  3 206 ? 29.791  51.377 22.793  1.00 20.14  ? 206 GLU B C     1 
ATOM   4541 O  O     . GLU F  3 206 ? 30.284  51.784 23.840  1.00 16.82  ? 206 GLU B O     1 
ATOM   4542 C  CB    . GLU F  3 206 ? 27.455  52.149 22.228  1.00 19.98  ? 206 GLU B CB    1 
ATOM   4543 C  CG    . GLU F  3 206 ? 26.609  53.158 21.443  1.00 18.37  ? 206 GLU B CG    1 
ATOM   4544 C  CD    . GLU F  3 206 ? 25.111  52.900 21.509  1.00 25.69  ? 206 GLU B CD    1 
ATOM   4545 O  OE1   . GLU F  3 206 ? 24.703  51.743 21.744  1.00 23.04  ? 206 GLU B OE1   1 
ATOM   4546 O  OE2   . GLU F  3 206 ? 24.337  53.862 21.297  1.00 24.70  ? 206 GLU B OE2   1 
ATOM   4547 N  N     . GLN F  3 207 ? 29.964  50.132 22.363  1.00 20.14  ? 207 GLN B N     1 
ATOM   4548 C  CA    . GLN F  3 207 ? 30.774  49.200 23.131  1.00 21.50  ? 207 GLN B CA    1 
ATOM   4549 C  C     . GLN F  3 207 ? 32.215  49.700 23.174  1.00 18.38  ? 207 GLN B C     1 
ATOM   4550 O  O     . GLN F  3 207 ? 32.871  49.638 24.214  1.00 21.25  ? 207 GLN B O     1 
ATOM   4551 C  CB    . GLN F  3 207 ? 30.710  47.802 22.507  1.00 22.76  ? 207 GLN B CB    1 
ATOM   4552 C  CG    . GLN F  3 207 ? 29.436  47.059 22.861  1.00 23.94  ? 207 GLN B CG    1 
ATOM   4553 C  CD    . GLN F  3 207 ? 29.450  46.532 24.287  1.00 34.66  ? 207 GLN B CD    1 
ATOM   4554 O  OE1   . GLN F  3 207 ? 30.165  47.049 25.145  1.00 40.61  ? 207 GLN B OE1   1 
ATOM   4555 N  NE2   . GLN F  3 207 ? 28.647  45.506 24.550  1.00 37.08  ? 207 GLN B NE2   1 
ATOM   4556 N  N     . ARG F  3 208 ? 32.702  50.202 22.044  1.00 20.69  ? 208 ARG B N     1 
ATOM   4557 C  CA    . ARG F  3 208 ? 34.063  50.722 21.985  1.00 22.05  ? 208 ARG B CA    1 
ATOM   4558 C  C     . ARG F  3 208 ? 34.187  51.997 22.819  1.00 23.84  ? 208 ARG B C     1 
ATOM   4559 O  O     . ARG F  3 208 ? 35.177  52.198 23.522  1.00 22.19  ? 208 ARG B O     1 
ATOM   4560 C  CB    . ARG F  3 208 ? 34.473  50.990 20.534  1.00 25.15  ? 208 ARG B CB    1 
ATOM   4561 C  CG    . ARG F  3 208 ? 34.626  49.713 19.709  1.00 30.61  ? 208 ARG B CG    1 
ATOM   4562 C  CD    . ARG F  3 208 ? 35.555  49.911 18.528  1.00 39.96  ? 208 ARG B CD    1 
ATOM   4563 N  NE    . ARG F  3 208 ? 35.871  48.645 17.870  1.00 45.39  ? 208 ARG B NE    1 
ATOM   4564 C  CZ    . ARG F  3 208 ? 35.150  48.099 16.897  1.00 47.28  ? 208 ARG B CZ    1 
ATOM   4565 N  NH1   . ARG F  3 208 ? 34.061  48.709 16.450  1.00 41.35  ? 208 ARG B NH1   1 
ATOM   4566 N  NH2   . ARG F  3 208 ? 35.515  46.934 16.375  1.00 47.31  ? 208 ARG B NH2   1 
ATOM   4567 N  N     . ALA F  3 209 ? 33.180  52.857 22.748  1.00 19.33  ? 209 ALA B N     1 
ATOM   4568 C  CA    . ALA F  3 209 ? 33.210  54.089 23.525  1.00 22.30  ? 209 ALA B CA    1 
ATOM   4569 C  C     . ALA F  3 209 ? 33.159  53.766 25.020  1.00 22.62  ? 209 ALA B C     1 
ATOM   4570 O  O     . ALA F  3 209 ? 33.826  54.418 25.830  1.00 20.18  ? 209 ALA B O     1 
ATOM   4571 C  CB    . ALA F  3 209 ? 32.037  54.986 23.130  1.00 21.18  ? 209 ALA B CB    1 
ATOM   4572 N  N     . ALA F  3 210 ? 32.377  52.749 25.383  1.00 18.37  ? 210 ALA B N     1 
ATOM   4573 C  CA    . ALA F  3 210 ? 32.249  52.345 26.777  1.00 16.79  ? 210 ALA B CA    1 
ATOM   4574 C  C     . ALA F  3 210 ? 33.577  51.808 27.308  1.00 19.49  ? 210 ALA B C     1 
ATOM   4575 O  O     . ALA F  3 210 ? 33.966  52.099 28.441  1.00 19.45  ? 210 ALA B O     1 
ATOM   4576 C  CB    . ALA F  3 210 ? 31.161  51.277 26.920  1.00 17.58  ? 210 ALA B CB    1 
ATOM   4577 N  N     . GLU F  3 211 ? 34.261  51.013 26.492  1.00 22.77  ? 211 GLU B N     1 
ATOM   4578 C  CA    . GLU F  3 211 ? 35.547  50.456 26.894  1.00 23.45  ? 211 GLU B CA    1 
ATOM   4579 C  C     . GLU F  3 211 ? 36.535  51.592 27.184  1.00 26.41  ? 211 GLU B C     1 
ATOM   4580 O  O     . GLU F  3 211 ? 37.250  51.563 28.186  1.00 24.23  ? 211 GLU B O     1 
ATOM   4581 C  CB    . GLU F  3 211 ? 36.097  49.543 25.792  1.00 24.28  ? 211 GLU B CB    1 
ATOM   4582 C  CG    . GLU F  3 211 ? 37.508  49.033 26.060  1.00 30.38  ? 211 GLU B CG    1 
ATOM   4583 C  CD    . GLU F  3 211 ? 37.975  48.029 25.022  1.00 37.96  ? 211 GLU B CD    1 
ATOM   4584 O  OE1   . GLU F  3 211 ? 37.592  48.163 23.841  1.00 38.70  ? 211 GLU B OE1   1 
ATOM   4585 O  OE2   . GLU F  3 211 ? 38.740  47.111 25.386  1.00 46.94  ? 211 GLU B OE2   1 
ATOM   4586 N  N     . GLU F  3 212 ? 36.566  52.591 26.307  1.00 25.99  ? 212 GLU B N     1 
ATOM   4587 C  CA    . GLU F  3 212 ? 37.459  53.734 26.489  1.00 25.20  ? 212 GLU B CA    1 
ATOM   4588 C  C     . GLU F  3 212 ? 37.090  54.525 27.736  1.00 25.30  ? 212 GLU B C     1 
ATOM   4589 O  O     . GLU F  3 212 ? 37.967  55.003 28.459  1.00 24.84  ? 212 GLU B O     1 
ATOM   4590 C  CB    . GLU F  3 212 ? 37.404  54.645 25.260  1.00 30.90  ? 212 GLU B CB    1 
ATOM   4591 C  CG    . GLU F  3 212 ? 38.175  54.103 24.075  1.00 38.84  ? 212 GLU B CG    1 
ATOM   4592 C  CD    . GLU F  3 212 ? 39.670  54.326 24.217  1.00 46.40  ? 212 GLU B CD    1 
ATOM   4593 O  OE1   . GLU F  3 212 ? 40.192  54.182 25.343  1.00 45.34  ? 212 GLU B OE1   1 
ATOM   4594 O  OE2   . GLU F  3 212 ? 40.325  54.640 23.201  1.00 53.92  ? 212 GLU B OE2   1 
ATOM   4595 N  N     . LEU F  3 213 ? 35.792  54.653 27.999  1.00 20.19  ? 213 LEU B N     1 
ATOM   4596 C  CA    . LEU F  3 213 ? 35.341  55.401 29.169  1.00 20.39  ? 213 LEU B CA    1 
ATOM   4597 C  C     . LEU F  3 213 ? 35.712  54.673 30.457  1.00 24.06  ? 213 LEU B C     1 
ATOM   4598 O  O     . LEU F  3 213 ? 36.059  55.302 31.457  1.00 22.48  ? 213 LEU B O     1 
ATOM   4599 C  CB    . LEU F  3 213 ? 33.824  55.638 29.100  1.00 22.18  ? 213 LEU B CB    1 
ATOM   4600 C  CG    . LEU F  3 213 ? 33.207  56.528 30.187  1.00 23.51  ? 213 LEU B CG    1 
ATOM   4601 C  CD1   . LEU F  3 213 ? 34.006  57.823 30.331  1.00 26.10  ? 213 LEU B CD1   1 
ATOM   4602 C  CD2   . LEU F  3 213 ? 31.759  56.840 29.820  1.00 21.53  ? 213 LEU B CD2   1 
ATOM   4603 N  N     . ILE F  3 214 ? 35.642  53.345 30.445  1.00 21.09  ? 214 ILE B N     1 
ATOM   4604 C  CA    . ILE F  3 214 ? 36.014  52.597 31.636  1.00 22.58  ? 214 ILE B CA    1 
ATOM   4605 C  C     . ILE F  3 214 ? 37.480  52.899 31.941  1.00 25.44  ? 214 ILE B C     1 
ATOM   4606 O  O     . ILE F  3 214 ? 37.855  53.105 33.095  1.00 25.69  ? 214 ILE B O     1 
ATOM   4607 C  CB    . ILE F  3 214 ? 35.845  51.081 31.429  1.00 21.06  ? 214 ILE B CB    1 
ATOM   4608 C  CG1   . ILE F  3 214 ? 34.357  50.736 31.323  1.00 24.40  ? 214 ILE B CG1   1 
ATOM   4609 C  CG2   . ILE F  3 214 ? 36.483  50.318 32.592  1.00 22.72  ? 214 ILE B CG2   1 
ATOM   4610 C  CD1   . ILE F  3 214 ? 34.102  49.317 30.824  1.00 24.13  ? 214 ILE B CD1   1 
ATOM   4611 N  N     . LYS F  3 215 ? 38.304  52.931 30.899  1.00 27.60  ? 215 LYS B N     1 
ATOM   4612 C  CA    . LYS F  3 215 ? 39.726  53.216 31.077  1.00 33.46  ? 215 LYS B CA    1 
ATOM   4613 C  C     . LYS F  3 215 ? 39.927  54.628 31.613  1.00 35.52  ? 215 LYS B C     1 
ATOM   4614 O  O     . LYS F  3 215 ? 40.739  54.849 32.514  1.00 34.43  ? 215 LYS B O     1 
ATOM   4615 C  CB    . LYS F  3 215 ? 40.473  53.065 29.752  1.00 34.18  ? 215 LYS B CB    1 
ATOM   4616 C  CG    . LYS F  3 215 ? 40.366  51.678 29.138  1.00 45.94  ? 215 LYS B CG    1 
ATOM   4617 C  CD    . LYS F  3 215 ? 41.083  51.614 27.799  1.00 48.73  ? 215 LYS B CD    1 
ATOM   4618 C  CE    . LYS F  3 215 ? 40.986  50.227 27.182  1.00 52.34  ? 215 LYS B CE    1 
ATOM   4619 N  NZ    . LYS F  3 215 ? 41.676  50.156 25.863  1.00 53.15  ? 215 LYS B NZ    1 
ATOM   4620 N  N     . LEU F  3 216 ? 39.185  55.582 31.058  1.00 31.04  ? 216 LEU B N     1 
ATOM   4621 C  CA    . LEU F  3 216 ? 39.292  56.971 31.484  1.00 32.71  ? 216 LEU B CA    1 
ATOM   4622 C  C     . LEU F  3 216 ? 38.967  57.098 32.964  1.00 33.75  ? 216 LEU B C     1 
ATOM   4623 O  O     . LEU F  3 216 ? 39.655  57.809 33.695  1.00 36.52  ? 216 LEU B O     1 
ATOM   4624 C  CB    . LEU F  3 216 ? 38.353  57.860 30.662  1.00 34.34  ? 216 LEU B CB    1 
ATOM   4625 C  CG    . LEU F  3 216 ? 38.355  59.357 30.995  1.00 36.94  ? 216 LEU B CG    1 
ATOM   4626 C  CD1   . LEU F  3 216 ? 39.754  59.929 30.801  1.00 37.94  ? 216 LEU B CD1   1 
ATOM   4627 C  CD2   . LEU F  3 216 ? 37.358  60.083 30.101  1.00 32.51  ? 216 LEU B CD2   1 
ATOM   4628 N  N     . LEU F  3 217 ? 37.929  56.399 33.413  1.00 28.24  ? 217 LEU B N     1 
ATOM   4629 C  CA    . LEU F  3 217 ? 37.546  56.460 34.818  1.00 30.94  ? 217 LEU B CA    1 
ATOM   4630 C  C     . LEU F  3 217 ? 38.620  55.845 35.710  1.00 36.74  ? 217 LEU B C     1 
ATOM   4631 O  O     . LEU F  3 217 ? 38.961  56.404 36.749  1.00 41.71  ? 217 LEU B O     1 
ATOM   4632 C  CB    . LEU F  3 217 ? 36.208  55.749 35.040  1.00 29.42  ? 217 LEU B CB    1 
ATOM   4633 C  CG    . LEU F  3 217 ? 34.999  56.432 34.384  1.00 28.52  ? 217 LEU B CG    1 
ATOM   4634 C  CD1   . LEU F  3 217 ? 33.751  55.595 34.609  1.00 31.46  ? 217 LEU B CD1   1 
ATOM   4635 C  CD2   . LEU F  3 217 ? 34.816  57.829 34.968  1.00 31.58  ? 217 LEU B CD2   1 
ATOM   4636 N  N     . GLU F  3 218 ? 39.160  54.700 35.302  1.00 37.82  ? 218 GLU B N     1 
ATOM   4637 C  CA    . GLU F  3 218 ? 40.196  54.033 36.087  1.00 47.32  ? 218 GLU B CA    1 
ATOM   4638 C  C     . GLU F  3 218 ? 41.466  54.880 36.166  1.00 50.46  ? 218 GLU B C     1 
ATOM   4639 O  O     . GLU F  3 218 ? 42.149  54.893 37.190  1.00 53.63  ? 218 GLU B O     1 
ATOM   4640 C  CB    . GLU F  3 218 ? 40.527  52.664 35.483  1.00 49.63  ? 218 GLU B CB    1 
ATOM   4641 C  CG    . GLU F  3 218 ? 39.331  51.732 35.372  1.00 52.63  ? 218 GLU B CG    1 
ATOM   4642 C  CD    . GLU F  3 218 ? 39.699  50.362 34.832  1.00 57.86  ? 218 GLU B CD    1 
ATOM   4643 O  OE1   . GLU F  3 218 ? 40.354  50.293 33.769  1.00 56.50  ? 218 GLU B OE1   1 
ATOM   4644 O  OE2   . GLU F  3 218 ? 39.324  49.353 35.468  1.00 57.08  ? 218 GLU B OE2   1 
ATOM   4645 N  N     . GLU F  3 219 ? 41.776  55.588 35.083  1.00 54.15  ? 219 GLU B N     1 
ATOM   4646 C  CA    . GLU F  3 219 ? 42.964  56.433 35.041  1.00 57.64  ? 219 GLU B CA    1 
ATOM   4647 C  C     . GLU F  3 219 ? 42.735  57.766 35.747  1.00 59.25  ? 219 GLU B C     1 
ATOM   4648 O  O     . GLU F  3 219 ? 43.640  58.599 35.828  1.00 59.96  ? 219 GLU B O     1 
ATOM   4649 C  CB    . GLU F  3 219 ? 43.381  56.690 33.591  1.00 59.98  ? 219 GLU B CB    1 
ATOM   4650 C  CG    . GLU F  3 219 ? 43.699  55.430 32.804  1.00 67.63  ? 219 GLU B CG    1 
ATOM   4651 C  CD    . GLU F  3 219 ? 44.264  55.730 31.427  1.00 70.58  ? 219 GLU B CD    1 
ATOM   4652 O  OE1   . GLU F  3 219 ? 43.599  56.446 30.646  1.00 71.02  ? 219 GLU B OE1   1 
ATOM   4653 O  OE2   . GLU F  3 219 ? 45.374  55.245 31.124  1.00 73.73  ? 219 GLU B OE2   1 
ATOM   4654 N  N     . SER F  3 220 ? 41.524  57.963 36.259  1.00 59.12  ? 220 SER B N     1 
ATOM   4655 C  CA    . SER F  3 220 ? 41.177  59.198 36.954  1.00 61.58  ? 220 SER B CA    1 
ATOM   4656 C  C     . SER F  3 220 ? 41.061  58.998 38.462  1.00 62.78  ? 220 SER B C     1 
ATOM   4657 O  O     . SER F  3 220 ? 41.685  59.787 39.202  1.00 66.83  ? 220 SER B O     1 
ATOM   4658 C  CB    . SER F  3 220 ? 39.865  59.761 36.403  1.00 59.49  ? 220 SER B CB    1 
ATOM   4659 O  OG    . SER F  3 220 ? 39.999  60.099 35.033  1.00 58.68  ? 220 SER B OG    1 
HETATM 4660 MG MG    . MG  G  4 .   ? 14.114  41.727 41.194  1.00 75.87  ? 515 MG  C MG    1 
HETATM 4661 MG MG    . MG  H  4 .   ? 18.519  41.694 21.737  1.00 64.75  ? 519 MG  C MG    1 
HETATM 4662 MG MG    A MG  I  4 .   ? 15.209  35.242 34.546  0.65 22.57  ? 505 MG  E MG    1 
HETATM 4663 MG MG    . MG  J  4 .   ? 17.683  43.233 7.691   1.00 52.09  ? 514 MG  D MG    1 
HETATM 4664 MG MG    . MG  K  4 .   ? 13.355  40.762 27.315  1.00 57.43  ? 516 MG  D MG    1 
HETATM 4665 MG MG    A MG  L  4 .   ? 18.494  36.304 14.314  0.75 25.93  ? 511 MG  F MG    1 
HETATM 4666 MG MG    . MG  M  4 .   ? 15.086  46.843 -5.006  1.00 53.68  ? 513 MG  F MG    1 
HETATM 4667 MG MG    . MG  N  4 .   ? 13.342  29.104 30.351  1.00 18.22  ? 501 MG  A MG    1 
HETATM 4668 MG MG    . MG  O  4 .   ? 14.830  29.491 33.947  0.35 15.90  ? 502 MG  A MG    1 
HETATM 4669 MG MG    A MG  P  4 .   ? 11.828  31.089 35.106  0.65 24.98  ? 503 MG  A MG    1 
HETATM 4670 MG MG    . MG  Q  4 .   ? 16.950  31.093 38.603  1.00 26.79  ? 504 MG  A MG    1 
HETATM 4671 MG MG    . MG  R  4 .   ? 7.850   49.514 29.167  1.00 32.06  ? 506 MG  A MG    1 
HETATM 4672 MG MG    . MG  S  4 .   ? 11.920  4.006  34.646  1.00 76.14  ? 517 MG  A MG    1 
HETATM 4673 MG MG    . MG  T  4 .   ? 22.360  30.928 18.210  1.00 16.28  ? 507 MG  B MG    1 
HETATM 4674 MG MG    . MG  U  4 .   ? 20.688  30.837 14.588  0.25 17.27  ? 508 MG  B MG    1 
HETATM 4675 MG MG    . MG  V  4 .   ? 22.985  33.537 13.520  0.75 28.68  ? 509 MG  B MG    1 
HETATM 4676 MG MG    . MG  W  4 .   ? 18.340  31.832 9.948   1.00 28.40  ? 510 MG  B MG    1 
HETATM 4677 MG MG    . MG  X  4 .   ? 20.742  51.751 20.039  1.00 27.51  ? 512 MG  B MG    1 
HETATM 4678 MG MG    . MG  Y  4 .   ? 22.322  57.262 19.542  1.00 55.92  ? 518 MG  B MG    1 
HETATM 4679 O  O     . HOH Z  5 .   ? 8.924   51.207 29.800  1.00 32.93  ? 520 HOH C O     1 
HETATM 4680 O  O     . HOH Z  5 .   ? 7.865   48.714 31.110  1.00 28.03  ? 521 HOH C O     1 
HETATM 4681 O  O     . HOH Z  5 .   ? 24.157  32.052 17.608  1.00 19.78  ? 522 HOH C O     1 
HETATM 4682 O  O     B HOH Z  5 .   ? 21.274  31.519 16.566  0.75 18.77  ? 523 HOH C O     1 
HETATM 4683 O  O     . HOH Z  5 .   ? 24.353  34.627 17.346  1.00 25.48  ? 524 HOH C O     1 
HETATM 4684 O  O     . HOH Z  5 .   ? 22.496  40.475 20.840  1.00 20.82  ? 525 HOH C O     1 
HETATM 4685 O  O     . HOH Z  5 .   ? 19.851  39.917 21.498  1.00 25.78  ? 526 HOH C O     1 
HETATM 4686 O  O     . HOH Z  5 .   ? 6.876   46.297 32.259  1.00 25.90  ? 527 HOH C O     1 
HETATM 4687 O  O     . HOH Z  5 .   ? 22.515  52.025 25.092  1.00 28.34  ? 528 HOH C O     1 
HETATM 4688 O  O     . HOH Z  5 .   ? 21.806  48.461 21.776  1.00 29.29  ? 529 HOH C O     1 
HETATM 4689 O  O     . HOH Z  5 .   ? 16.791  41.041 23.049  1.00 32.59  ? 530 HOH C O     1 
HETATM 4690 O  O     . HOH Z  5 .   ? 10.493  46.852 34.062  1.00 35.02  ? 531 HOH C O     1 
HETATM 4691 O  O     . HOH Z  5 .   ? 16.332  42.226 30.700  1.00 32.56  ? 532 HOH C O     1 
HETATM 4692 O  O     . HOH Z  5 .   ? 22.931  34.025 26.673  1.00 32.27  ? 533 HOH C O     1 
HETATM 4693 O  O     . HOH Z  5 .   ? 17.597  45.194 24.990  1.00 58.17  ? 534 HOH C O     1 
HETATM 4694 O  O     . HOH Z  5 .   ? 12.997  40.945 42.838  1.00 42.80  ? 535 HOH C O     1 
HETATM 4695 O  O     . HOH Z  5 .   ? 11.887  48.776 31.271  1.00 38.58  ? 536 HOH C O     1 
HETATM 4696 O  O     . HOH Z  5 .   ? 12.712  45.065 34.222  1.00 35.57  ? 537 HOH C O     1 
HETATM 4697 O  O     . HOH Z  5 .   ? 12.278  42.230 40.147  1.00 41.29  ? 538 HOH C O     1 
HETATM 4698 O  O     . HOH Z  5 .   ? 26.457  39.216 28.594  1.00 32.11  ? 539 HOH C O     1 
HETATM 4699 O  O     . HOH Z  5 .   ? 18.774  42.687 23.738  1.00 35.49  ? 540 HOH C O     1 
HETATM 4700 O  O     . HOH Z  5 .   ? 16.709  43.215 26.443  1.00 40.38  ? 541 HOH C O     1 
HETATM 4701 O  O     . HOH Z  5 .   ? 13.086  53.280 37.938  1.00 38.60  ? 542 HOH C O     1 
HETATM 4702 O  O     . HOH Z  5 .   ? 10.241  40.178 39.834  1.00 47.72  ? 543 HOH C O     1 
HETATM 4703 O  O     . HOH Z  5 .   ? 2.962   41.433 40.976  1.00 39.31  ? 544 HOH C O     1 
HETATM 4704 O  O     . HOH Z  5 .   ? 24.842  37.741 30.207  1.00 40.17  ? 545 HOH C O     1 
HETATM 4705 O  O     . HOH Z  5 .   ? 19.833  42.598 20.014  1.00 36.89  ? 546 HOH C O     1 
HETATM 4706 O  O     . HOH Z  5 .   ? 28.815  41.606 25.373  1.00 32.68  ? 547 HOH C O     1 
HETATM 4707 O  O     . HOH Z  5 .   ? 8.360   43.108 34.890  1.00 44.34  ? 548 HOH C O     1 
HETATM 4708 O  O     . HOH Z  5 .   ? 19.005  47.401 25.468  1.00 38.29  ? 549 HOH C O     1 
HETATM 4709 O  O     . HOH Z  5 .   ? 14.221  43.931 32.243  1.00 44.02  ? 550 HOH C O     1 
HETATM 4710 O  O     . HOH Z  5 .   ? 11.193  52.331 28.997  1.00 44.05  ? 551 HOH C O     1 
HETATM 4711 O  O     . HOH Z  5 .   ? 10.022  42.367 36.900  1.00 43.86  ? 552 HOH C O     1 
HETATM 4712 O  O     . HOH Z  5 .   ? 7.835   49.456 41.229  1.00 50.12  ? 553 HOH C O     1 
HETATM 4713 O  O     . HOH Z  5 .   ? 6.822   40.227 47.138  1.00 50.15  ? 554 HOH C O     1 
HETATM 4714 O  O     . HOH Z  5 .   ? 19.903  37.866 42.010  1.00 67.64  ? 555 HOH C O     1 
HETATM 4715 O  O     . HOH Z  5 .   ? 20.583  54.518 28.034  1.00 55.57  ? 556 HOH C O     1 
HETATM 4716 O  O     . HOH Z  5 .   ? 19.995  40.962 45.385  1.00 62.76  ? 557 HOH C O     1 
HETATM 4717 O  O     . HOH Z  5 .   ? 12.752  38.103 42.569  1.00 50.88  ? 558 HOH C O     1 
HETATM 4718 O  O     . HOH Z  5 .   ? 14.964  43.186 40.043  1.00 50.83  ? 559 HOH C O     1 
HETATM 4719 O  O     . HOH Z  5 .   ? 14.136  46.435 31.531  1.00 40.34  ? 560 HOH C O     1 
HETATM 4720 O  O     . HOH Z  5 .   ? 21.344  43.828 23.254  1.00 51.30  ? 561 HOH C O     1 
HETATM 4721 O  O     . HOH Z  5 .   ? 17.116  40.108 21.030  1.00 39.96  ? 562 HOH C O     1 
HETATM 4722 O  O     . HOH Z  5 .   ? 14.471  43.462 42.618  1.00 53.70  ? 563 HOH C O     1 
HETATM 4723 O  O     . HOH Z  5 .   ? 16.181  41.588 45.364  1.00 67.06  ? 564 HOH C O     1 
HETATM 4724 O  O     . HOH Z  5 .   ? 20.495  35.822 43.538  1.00 53.71  ? 565 HOH C O     1 
HETATM 4725 O  O     . HOH Z  5 .   ? 20.191  34.408 47.168  1.00 71.17  ? 566 HOH C O     1 
HETATM 4726 O  O     . HOH Z  5 .   ? 8.245   43.837 32.046  1.00 53.51  ? 567 HOH C O     1 
HETATM 4727 O  O     . HOH Z  5 .   ? 14.420  55.389 36.704  1.00 45.13  ? 568 HOH C O     1 
HETATM 4728 O  O     . HOH Z  5 .   ? 14.367  31.989 41.970  1.00 48.12  ? 569 HOH C O     1 
HETATM 4729 O  O     A HOH AA 5 .   ? 13.723  31.153 34.471  0.65 19.68  ? 506 HOH E O     1 
HETATM 4730 O  O     . HOH AA 5 .   ? 11.242  32.678 33.676  1.00 29.76  ? 507 HOH E O     1 
HETATM 4731 O  O     . HOH AA 5 .   ? 16.464  31.990 36.770  1.00 26.23  ? 508 HOH E O     1 
HETATM 4732 O  O     . HOH AA 5 .   ? 15.807  36.750 35.838  1.00 31.97  ? 509 HOH E O     1 
HETATM 4733 O  O     . HOH AA 5 .   ? 13.211  35.893 34.868  1.00 38.36  ? 510 HOH E O     1 
HETATM 4734 O  O     . HOH AA 5 .   ? 15.490  36.517 32.819  1.00 33.52  ? 511 HOH E O     1 
HETATM 4735 O  O     . HOH AA 5 .   ? 14.909  34.139 36.210  1.00 33.11  ? 512 HOH E O     1 
HETATM 4736 O  O     . HOH AA 5 .   ? 13.477  39.618 29.264  1.00 49.74  ? 513 HOH E O     1 
HETATM 4737 O  O     . HOH AA 5 .   ? 23.864  45.945 34.788  1.00 24.17  ? 514 HOH E O     1 
HETATM 4738 O  O     . HOH AA 5 .   ? 14.601  37.757 29.932  1.00 29.20  ? 515 HOH E O     1 
HETATM 4739 O  O     . HOH AA 5 .   ? 23.087  35.511 29.560  1.00 26.07  ? 516 HOH E O     1 
HETATM 4740 O  O     . HOH AA 5 .   ? 19.121  30.352 35.085  1.00 25.48  ? 517 HOH E O     1 
HETATM 4741 O  O     . HOH AA 5 .   ? 23.581  34.208 40.402  1.00 32.65  ? 518 HOH E O     1 
HETATM 4742 O  O     . HOH AA 5 .   ? 16.656  39.228 32.497  1.00 38.74  ? 519 HOH E O     1 
HETATM 4743 O  O     . HOH AA 5 .   ? 16.662  44.820 39.202  1.00 42.68  ? 520 HOH E O     1 
HETATM 4744 O  O     . HOH AA 5 .   ? 26.758  48.765 40.556  1.00 31.52  ? 521 HOH E O     1 
HETATM 4745 O  O     . HOH AA 5 .   ? 13.675  45.392 54.148  1.00 40.84  ? 522 HOH E O     1 
HETATM 4746 O  O     . HOH AA 5 .   ? 18.998  42.506 38.522  1.00 35.44  ? 523 HOH E O     1 
HETATM 4747 O  O     . HOH AA 5 .   ? 11.555  35.353 36.819  1.00 39.59  ? 524 HOH E O     1 
HETATM 4748 O  O     . HOH AA 5 .   ? 20.159  47.583 43.914  1.00 35.56  ? 525 HOH E O     1 
HETATM 4749 O  O     . HOH AA 5 .   ? 11.885  41.198 28.583  1.00 34.97  ? 526 HOH E O     1 
HETATM 4750 O  O     . HOH AA 5 .   ? 16.829  55.037 38.426  1.00 46.02  ? 527 HOH E O     1 
HETATM 4751 O  O     . HOH AA 5 .   ? 16.639  47.038 45.685  1.00 37.24  ? 528 HOH E O     1 
HETATM 4752 O  O     . HOH AA 5 .   ? 16.818  43.047 37.238  1.00 53.54  ? 529 HOH E O     1 
HETATM 4753 O  O     . HOH AA 5 .   ? 11.551  35.991 30.895  1.00 37.72  ? 530 HOH E O     1 
HETATM 4754 O  O     . HOH AA 5 .   ? 25.322  38.904 32.815  1.00 40.33  ? 531 HOH E O     1 
HETATM 4755 O  O     . HOH AA 5 .   ? 17.739  49.797 46.341  1.00 40.03  ? 532 HOH E O     1 
HETATM 4756 O  O     . HOH AA 5 .   ? 9.880   35.058 33.008  1.00 60.53  ? 533 HOH E O     1 
HETATM 4757 O  O     . HOH AA 5 .   ? 11.994  49.117 51.977  1.00 46.33  ? 534 HOH E O     1 
HETATM 4758 O  O     . HOH AA 5 .   ? 14.757  40.266 31.158  1.00 49.51  ? 535 HOH E O     1 
HETATM 4759 O  O     . HOH AA 5 .   ? 25.643  34.925 41.979  1.00 58.57  ? 536 HOH E O     1 
HETATM 4760 O  O     . HOH AA 5 .   ? 27.824  41.493 40.415  1.00 67.26  ? 537 HOH E O     1 
HETATM 4761 O  O     . HOH AA 5 .   ? 27.172  40.580 34.206  1.00 48.35  ? 538 HOH E O     1 
HETATM 4762 O  O     . HOH AA 5 .   ? 18.696  45.344 40.709  1.00 47.64  ? 539 HOH E O     1 
HETATM 4763 O  O     . HOH AA 5 .   ? 19.603  43.029 41.457  1.00 57.23  ? 540 HOH E O     1 
HETATM 4764 O  O     . HOH AA 5 .   ? 14.486  50.326 48.654  1.00 46.62  ? 541 HOH E O     1 
HETATM 4765 O  O     . HOH AA 5 .   ? 15.801  48.264 49.836  1.00 58.87  ? 542 HOH E O     1 
HETATM 4766 O  O     . HOH AA 5 .   ? 3.331   42.457 52.788  1.00 62.79  ? 543 HOH E O     1 
HETATM 4767 O  O     . HOH AA 5 .   ? 22.559  43.968 44.462  1.00 59.89  ? 544 HOH E O     1 
HETATM 4768 O  O     . HOH AA 5 .   ? 20.927  44.410 46.685  1.00 62.90  ? 545 HOH E O     1 
HETATM 4769 O  O     . HOH AA 5 .   ? 26.203  43.554 43.262  1.00 56.26  ? 546 HOH E O     1 
HETATM 4770 O  O     . HOH AA 5 .   ? 13.319  34.178 60.558  1.00 48.15  ? 547 HOH E O     1 
HETATM 4771 O  O     . HOH BA 5 .   ? 11.148  29.620 30.907  1.00 19.74  ? 517 HOH D O     1 
HETATM 4772 O  O     . HOH BA 5 .   ? 19.179  53.008 19.507  1.00 27.13  ? 518 HOH D O     1 
HETATM 4773 O  O     . HOH BA 5 .   ? 19.307  50.118 20.489  1.00 33.91  ? 519 HOH D O     1 
HETATM 4774 O  O     . HOH BA 5 .   ? 10.344  32.017 31.254  1.00 23.46  ? 520 HOH D O     1 
HETATM 4775 O  O     . HOH BA 5 .   ? 23.028  49.282 16.896  1.00 26.73  ? 521 HOH D O     1 
HETATM 4776 O  O     . HOH BA 5 .   ? 12.691  38.625 27.240  1.00 25.44  ? 522 HOH D O     1 
HETATM 4777 O  O     . HOH BA 5 .   ? 17.636  46.398 14.682  1.00 34.18  ? 523 HOH D O     1 
HETATM 4778 O  O     . HOH BA 5 .   ? 8.013   45.891 27.312  1.00 32.93  ? 524 HOH D O     1 
HETATM 4779 O  O     . HOH BA 5 .   ? 10.025  38.191 27.949  1.00 24.27  ? 525 HOH D O     1 
HETATM 4780 O  O     . HOH BA 5 .   ? 19.358  48.670 15.256  1.00 33.72  ? 526 HOH D O     1 
HETATM 4781 O  O     . HOH BA 5 .   ? 19.941  40.277 6.465   1.00 38.52  ? 527 HOH D O     1 
HETATM 4782 O  O     . HOH BA 5 .   ? 11.805  32.303 21.948  1.00 32.92  ? 528 HOH D O     1 
HETATM 4783 O  O     . HOH BA 5 .   ? 18.992  42.609 6.363   1.00 38.05  ? 529 HOH D O     1 
HETATM 4784 O  O     . HOH BA 5 .   ? 15.230  42.264 18.165  1.00 26.81  ? 530 HOH D O     1 
HETATM 4785 O  O     . HOH BA 5 .   ? 12.742  41.658 25.187  1.00 33.68  ? 531 HOH D O     1 
HETATM 4786 O  O     . HOH BA 5 .   ? 10.954  45.949 23.362  1.00 37.58  ? 532 HOH D O     1 
HETATM 4787 O  O     . HOH BA 5 .   ? 19.268  44.082 8.788   1.00 34.01  ? 533 HOH D O     1 
HETATM 4788 O  O     . HOH BA 5 .   ? 26.161  39.573 1.859   1.00 59.78  ? 534 HOH D O     1 
HETATM 4789 O  O     . HOH BA 5 .   ? 15.232  41.041 25.822  1.00 40.52  ? 535 HOH D O     1 
HETATM 4790 O  O     . HOH BA 5 .   ? 10.207  42.182 25.764  1.00 45.11  ? 536 HOH D O     1 
HETATM 4791 O  O     . HOH BA 5 .   ? 6.670   36.061 20.359  1.00 37.78  ? 537 HOH D O     1 
HETATM 4792 O  O     . HOH BA 5 .   ? 14.558  53.953 11.327  1.00 38.28  ? 538 HOH D O     1 
HETATM 4793 O  O     . HOH BA 5 .   ? 28.473  46.548 7.992   1.00 39.76  ? 539 HOH D O     1 
HETATM 4794 O  O     . HOH BA 5 .   ? 23.671  37.273 0.314   1.00 45.18  ? 540 HOH D O     1 
HETATM 4795 O  O     . HOH BA 5 .   ? 13.774  35.257 5.416   1.00 48.43  ? 541 HOH D O     1 
HETATM 4796 O  O     . HOH BA 5 .   ? 8.394   34.812 18.126  1.00 43.59  ? 542 HOH D O     1 
HETATM 4797 O  O     . HOH BA 5 .   ? 22.184  46.791 17.299  1.00 41.44  ? 543 HOH D O     1 
HETATM 4798 O  O     . HOH BA 5 .   ? 16.924  39.615 6.397   1.00 51.11  ? 544 HOH D O     1 
HETATM 4799 O  O     . HOH BA 5 .   ? 15.909  47.155 17.881  1.00 44.40  ? 545 HOH D O     1 
HETATM 4800 O  O     . HOH BA 5 .   ? 5.567   36.261 28.995  1.00 66.11  ? 546 HOH D O     1 
HETATM 4801 O  O     . HOH BA 5 .   ? 7.275   35.042 30.919  1.00 57.81  ? 547 HOH D O     1 
HETATM 4802 O  O     . HOH BA 5 .   ? 6.435   51.809 21.919  1.00 44.18  ? 548 HOH D O     1 
HETATM 4803 O  O     . HOH BA 5 .   ? 22.146  35.527 7.615   1.00 55.61  ? 549 HOH D O     1 
HETATM 4804 O  O     . HOH BA 5 .   ? 16.849  44.647 6.401   1.00 58.11  ? 550 HOH D O     1 
HETATM 4805 O  O     . HOH BA 5 .   ? 18.357  41.541 8.730   1.00 50.79  ? 551 HOH D O     1 
HETATM 4806 O  O     . HOH BA 5 .   ? 16.238  44.239 9.156   1.00 43.24  ? 552 HOH D O     1 
HETATM 4807 O  O     . HOH BA 5 .   ? 11.609  56.028 17.316  1.00 54.52  ? 553 HOH D O     1 
HETATM 4808 O  O     . HOH BA 5 .   ? 13.623  48.232 20.996  1.00 46.34  ? 554 HOH D O     1 
HETATM 4809 O  O     . HOH BA 5 .   ? 15.314  45.910 20.253  1.00 51.76  ? 555 HOH D O     1 
HETATM 4810 O  O     . HOH BA 5 .   ? 17.507  31.291 24.300  1.00 62.08  ? 556 HOH D O     1 
HETATM 4811 O  O     . HOH BA 5 .   ? 3.754   37.366 23.382  1.00 40.37  ? 557 HOH D O     1 
HETATM 4812 O  O     . HOH BA 5 .   ? 28.761  40.173 2.262   1.00 61.37  ? 558 HOH D O     1 
HETATM 4813 O  O     . HOH BA 5 .   ? 27.030  43.183 3.524   1.00 54.62  ? 559 HOH D O     1 
HETATM 4814 O  O     . HOH BA 5 .   ? 9.266   35.717 20.303  1.00 49.00  ? 560 HOH D O     1 
HETATM 4815 O  O     . HOH BA 5 .   ? 14.579  43.079 22.546  1.00 56.20  ? 561 HOH D O     1 
HETATM 4816 O  O     . HOH BA 5 .   ? 15.173  39.659 27.650  1.00 42.59  ? 562 HOH D O     1 
HETATM 4817 O  O     . HOH BA 5 .   ? 20.981  51.065 18.085  1.00 24.43  ? 563 HOH D O     1 
HETATM 4818 O  O     . HOH BA 5 .   ? 16.603  44.430 16.467  1.00 53.31  ? 564 HOH D O     1 
HETATM 4819 O  O     . HOH BA 5 .   ? 17.878  49.334 22.586  1.00 67.81  ? 565 HOH D O     1 
HETATM 4820 O  O     . HOH BA 5 .   ? 21.569  42.887 9.115   1.00 40.67  ? 566 HOH D O     1 
HETATM 4821 O  O     . HOH CA 5 .   ? 18.810  29.854 14.994  1.00 22.06  ? 514 HOH F O     1 
HETATM 4822 O  O     . HOH CA 5 .   ? 22.942  35.149 15.115  1.00 30.39  ? 515 HOH F O     1 
HETATM 4823 O  O     . HOH CA 5 .   ? 18.373  32.825 11.948  1.00 24.60  ? 516 HOH F O     1 
HETATM 4824 O  O     . HOH CA 5 .   ? 17.440  37.713 12.975  1.00 33.90  ? 517 HOH F O     1 
HETATM 4825 O  O     . HOH CA 5 .   ? 20.143  37.687 13.955  1.00 30.74  ? 518 HOH F O     1 
HETATM 4826 O  O     . HOH CA 5 .   ? 17.852  37.431 15.948  1.00 31.45  ? 519 HOH F O     1 
HETATM 4827 O  O     . HOH CA 5 .   ? 19.354  35.283 12.424  1.00 31.25  ? 520 HOH F O     1 
HETATM 4828 O  O     . HOH CA 5 .   ? 6.772   43.497 14.140  1.00 23.37  ? 521 HOH F O     1 
HETATM 4829 O  O     . HOH CA 5 .   ? 15.862  39.279 16.323  1.00 33.10  ? 522 HOH F O     1 
HETATM 4830 O  O     . HOH CA 5 .   ? 13.745  45.026 9.726   1.00 40.98  ? 523 HOH F O     1 
HETATM 4831 O  O     . HOH CA 5 .   ? 18.418  38.426 18.855  1.00 32.08  ? 524 HOH F O     1 
HETATM 4832 O  O     . HOH CA 5 .   ? 12.486  42.026 10.151  1.00 37.53  ? 525 HOH F O     1 
HETATM 4833 O  O     . HOH CA 5 .   ? 7.817   36.257 15.679  1.00 34.35  ? 526 HOH F O     1 
HETATM 4834 O  O     . HOH CA 5 .   ? 11.116  33.591 19.163  1.00 34.21  ? 527 HOH F O     1 
HETATM 4835 O  O     . HOH CA 5 .   ? 13.415  47.431 3.489   1.00 40.12  ? 528 HOH F O     1 
HETATM 4836 O  O     . HOH CA 5 .   ? 10.873  32.650 8.190   1.00 36.15  ? 529 HOH F O     1 
HETATM 4837 O  O     . HOH CA 5 .   ? 24.043  54.235 -0.233  1.00 40.37  ? 530 HOH F O     1 
HETATM 4838 O  O     . HOH CA 5 .   ? 21.646  38.168 18.104  1.00 36.13  ? 531 HOH F O     1 
HETATM 4839 O  O     . HOH CA 5 .   ? 22.639  37.751 15.297  1.00 49.64  ? 532 HOH F O     1 
HETATM 4840 O  O     . HOH CA 5 .   ? 5.615   37.413 14.429  1.00 39.77  ? 533 HOH F O     1 
HETATM 4841 O  O     . HOH CA 5 .   ? 9.979   36.095 7.489   1.00 52.78  ? 534 HOH F O     1 
HETATM 4842 O  O     . HOH CA 5 .   ? 22.480  40.220 -13.147 1.00 57.66  ? 535 HOH F O     1 
HETATM 4843 O  O     . HOH CA 5 .   ? 16.301  30.305 13.451  1.00 28.21  ? 536 HOH F O     1 
HETATM 4844 O  O     . HOH CA 5 .   ? 12.165  43.946 8.012   1.00 48.09  ? 537 HOH F O     1 
HETATM 4845 O  O     . HOH CA 5 .   ? 11.283  49.482 3.056   1.00 51.94  ? 538 HOH F O     1 
HETATM 4846 O  O     . HOH CA 5 .   ? 8.608   53.432 9.480   1.00 60.96  ? 539 HOH F O     1 
HETATM 4847 O  O     . HOH CA 5 .   ? 10.708  54.662 10.774  1.00 50.04  ? 540 HOH F O     1 
HETATM 4848 O  O     . HOH CA 5 .   ? 17.977  45.857 -7.945  1.00 47.78  ? 541 HOH F O     1 
HETATM 4849 O  O     . HOH CA 5 .   ? 16.987  46.041 -5.083  1.00 55.47  ? 542 HOH F O     1 
HETATM 4850 O  O     . HOH CA 5 .   ? 16.163  48.623 -5.454  1.00 59.67  ? 543 HOH F O     1 
HETATM 4851 O  O     . HOH CA 5 .   ? 13.406  48.088 -4.947  1.00 52.82  ? 544 HOH F O     1 
HETATM 4852 O  O     . HOH CA 5 .   ? 14.620  46.488 -7.371  1.00 46.56  ? 545 HOH F O     1 
HETATM 4853 O  O     . HOH CA 5 .   ? 14.724  43.579 11.929  1.00 52.10  ? 546 HOH F O     1 
HETATM 4854 O  O     . HOH CA 5 .   ? 13.411  34.731 8.055   1.00 40.58  ? 547 HOH F O     1 
HETATM 4855 O  O     . HOH CA 5 .   ? 5.876   36.089 9.285   1.00 51.16  ? 548 HOH F O     1 
HETATM 4856 O  O     . HOH CA 5 .   ? 3.771   37.335 16.149  1.00 48.09  ? 549 HOH F O     1 
HETATM 4857 O  O     . HOH CA 5 .   ? 18.831  49.233 -5.477  1.00 50.04  ? 550 HOH F O     1 
HETATM 4858 O  O     . HOH CA 5 .   ? 18.568  40.674 19.333  1.00 45.93  ? 551 HOH F O     1 
HETATM 4859 O  O     . HOH CA 5 .   ? 15.412  47.381 -2.517  1.00 50.79  ? 552 HOH F O     1 
HETATM 4860 O  O     . HOH DA 5 .   ? 12.385  28.327 28.673  1.00 17.86  ? 518 HOH A O     1 
HETATM 4861 O  O     B HOH DA 5 .   ? 14.121  29.915 32.076  0.65 21.49  ? 519 HOH A O     1 
HETATM 4862 O  O     . HOH DA 5 .   ? 17.065  29.142 33.561  1.00 22.46  ? 520 HOH A O     1 
HETATM 4863 O  O     . HOH DA 5 .   ? 9.914   30.978 35.876  1.00 22.68  ? 521 HOH A O     1 
HETATM 4864 O  O     . HOH DA 5 .   ? 12.416  32.782 36.598  1.00 33.39  ? 522 HOH A O     1 
HETATM 4865 O  O     A HOH DA 5 .   ? 11.220  29.380 33.834  0.65 18.97  ? 523 HOH A O     1 
HETATM 4866 O  O     . HOH DA 5 .   ? 15.071  31.781 39.532  1.00 23.67  ? 524 HOH A O     1 
HETATM 4867 O  O     . HOH DA 5 .   ? 18.776  30.233 37.698  1.00 26.66  ? 525 HOH A O     1 
HETATM 4868 O  O     . HOH DA 5 .   ? 6.167   50.525 29.589  1.00 29.06  ? 526 HOH A O     1 
HETATM 4869 O  O     . HOH DA 5 .   ? 6.714   47.916 28.632  1.00 28.46  ? 527 HOH A O     1 
HETATM 4870 O  O     . HOH DA 5 .   ? 9.713   48.277 28.757  1.00 33.80  ? 528 HOH A O     1 
HETATM 4871 O  O     . HOH DA 5 .   ? 8.072   50.268 27.204  1.00 29.10  ? 529 HOH A O     1 
HETATM 4872 O  O     . HOH DA 5 .   ? 16.766  33.239 9.276   1.00 29.69  ? 530 HOH A O     1 
HETATM 4873 O  O     B HOH DA 5 .   ? 12.891  29.744 34.505  0.35 15.83  ? 531 HOH A O     1 
HETATM 4874 O  O     . HOH DA 5 .   ? 10.006  5.806  42.927  1.00 46.03  ? 532 HOH A O     1 
HETATM 4875 O  O     . HOH DA 5 .   ? 15.117  4.503  37.637  1.00 27.35  ? 533 HOH A O     1 
HETATM 4876 O  O     . HOH DA 5 .   ? 12.783  4.684  36.380  1.00 32.20  ? 534 HOH A O     1 
HETATM 4877 O  O     . HOH DA 5 .   ? 19.909  28.226 29.757  1.00 21.98  ? 535 HOH A O     1 
HETATM 4878 O  O     . HOH DA 5 .   ? 20.922  23.757 41.332  1.00 22.55  ? 536 HOH A O     1 
HETATM 4879 O  O     . HOH DA 5 .   ? 5.981   37.430 18.043  1.00 30.84  ? 537 HOH A O     1 
HETATM 4880 O  O     . HOH DA 5 .   ? 16.443  27.854 18.604  1.00 23.77  ? 538 HOH A O     1 
HETATM 4881 O  O     . HOH DA 5 .   ? 0.862   14.842 26.811  1.00 26.34  ? 539 HOH A O     1 
HETATM 4882 O  O     . HOH DA 5 .   ? 6.414   20.715 7.077   1.00 29.29  ? 540 HOH A O     1 
HETATM 4883 O  O     . HOH DA 5 .   ? 16.102  28.865 44.151  1.00 26.63  ? 541 HOH A O     1 
HETATM 4884 O  O     . HOH DA 5 .   ? 2.380   12.600 25.176  1.00 27.07  ? 542 HOH A O     1 
HETATM 4885 O  O     . HOH DA 5 .   ? 5.221   33.461 30.473  1.00 30.85  ? 543 HOH A O     1 
HETATM 4886 O  O     . HOH DA 5 .   ? 6.098   49.257 24.225  1.00 29.80  ? 544 HOH A O     1 
HETATM 4887 O  O     . HOH DA 5 .   ? 4.622   45.348 42.428  1.00 37.33  ? 545 HOH A O     1 
HETATM 4888 O  O     . HOH DA 5 .   ? 24.289  12.475 41.387  1.00 32.85  ? 546 HOH A O     1 
HETATM 4889 O  O     . HOH DA 5 .   ? 22.827  10.536 39.974  1.00 27.81  ? 547 HOH A O     1 
HETATM 4890 O  O     . HOH DA 5 .   ? 3.020   52.474 29.143  1.00 33.75  ? 548 HOH A O     1 
HETATM 4891 O  O     . HOH DA 5 .   ? 8.289   9.251  24.237  1.00 32.11  ? 549 HOH A O     1 
HETATM 4892 O  O     . HOH DA 5 .   ? 5.259   21.346 14.315  1.00 34.22  ? 550 HOH A O     1 
HETATM 4893 O  O     . HOH DA 5 .   ? 20.125  8.911  47.264  1.00 32.83  ? 551 HOH A O     1 
HETATM 4894 O  O     . HOH DA 5 .   ? 8.520   12.801 18.871  1.00 36.68  ? 552 HOH A O     1 
HETATM 4895 O  O     . HOH DA 5 .   ? 3.078   45.570 8.639   1.00 31.07  ? 553 HOH A O     1 
HETATM 4896 O  O     . HOH DA 5 .   ? 21.981  5.490  28.230  1.00 31.58  ? 554 HOH A O     1 
HETATM 4897 O  O     . HOH DA 5 .   ? 26.776  18.429 36.949  1.00 35.50  ? 555 HOH A O     1 
HETATM 4898 O  O     . HOH DA 5 .   ? 1.887   22.670 39.822  1.00 33.95  ? 556 HOH A O     1 
HETATM 4899 O  O     . HOH DA 5 .   ? 2.976   47.328 20.080  1.00 33.56  ? 557 HOH A O     1 
HETATM 4900 O  O     . HOH DA 5 .   ? 1.670   35.649 17.759  1.00 40.40  ? 558 HOH A O     1 
HETATM 4901 O  O     . HOH DA 5 .   ? 12.476  7.642  27.820  1.00 29.20  ? 559 HOH A O     1 
HETATM 4902 O  O     . HOH DA 5 .   ? 3.612   56.548 30.079  1.00 42.62  ? 560 HOH A O     1 
HETATM 4903 O  O     . HOH DA 5 .   ? 4.501   33.920 20.411  1.00 39.19  ? 561 HOH A O     1 
HETATM 4904 O  O     . HOH DA 5 .   ? 4.656   48.964 18.928  1.00 28.71  ? 562 HOH A O     1 
HETATM 4905 O  O     . HOH DA 5 .   ? 3.282   21.901 9.736   1.00 47.05  ? 563 HOH A O     1 
HETATM 4906 O  O     . HOH DA 5 .   ? 5.645   51.061 26.228  1.00 31.36  ? 564 HOH A O     1 
HETATM 4907 O  O     . HOH DA 5 .   ? 15.426  20.355 50.527  1.00 37.62  ? 565 HOH A O     1 
HETATM 4908 O  O     . HOH DA 5 .   ? 7.765   52.063 12.698  1.00 40.58  ? 566 HOH A O     1 
HETATM 4909 O  O     . HOH DA 5 .   ? 26.152  2.571  42.919  1.00 48.63  ? 567 HOH A O     1 
HETATM 4910 O  O     . HOH DA 5 .   ? 3.693   33.235 27.568  1.00 34.31  ? 568 HOH A O     1 
HETATM 4911 O  O     . HOH DA 5 .   ? 2.520   44.118 40.251  1.00 34.02  ? 569 HOH A O     1 
HETATM 4912 O  O     . HOH DA 5 .   ? 1.969   33.845 40.434  1.00 39.90  ? 570 HOH A O     1 
HETATM 4913 O  O     . HOH DA 5 .   ? -2.994  20.721 25.481  1.00 35.50  ? 571 HOH A O     1 
HETATM 4914 O  O     . HOH DA 5 .   ? 19.429  6.754  25.527  1.00 44.69  ? 572 HOH A O     1 
HETATM 4915 O  O     . HOH DA 5 .   ? 3.154   30.269 13.726  1.00 37.48  ? 573 HOH A O     1 
HETATM 4916 O  O     . HOH DA 5 .   ? 3.545   33.039 34.345  1.00 33.74  ? 574 HOH A O     1 
HETATM 4917 O  O     . HOH DA 5 .   ? -4.060  34.810 23.295  1.00 33.10  ? 575 HOH A O     1 
HETATM 4918 O  O     . HOH DA 5 .   ? 5.121   51.341 19.932  1.00 42.72  ? 576 HOH A O     1 
HETATM 4919 O  O     . HOH DA 5 .   ? -2.505  27.582 18.837  1.00 39.39  ? 577 HOH A O     1 
HETATM 4920 O  O     . HOH DA 5 .   ? 12.453  14.318 18.575  1.00 34.07  ? 578 HOH A O     1 
HETATM 4921 O  O     . HOH DA 5 .   ? -7.414  44.472 30.704  1.00 41.78  ? 579 HOH A O     1 
HETATM 4922 O  O     . HOH DA 5 .   ? 25.298  12.255 35.419  1.00 37.12  ? 580 HOH A O     1 
HETATM 4923 O  O     . HOH DA 5 .   ? 0.010   32.357 34.081  1.00 37.65  ? 581 HOH A O     1 
HETATM 4924 O  O     . HOH DA 5 .   ? 9.827   7.266  27.982  1.00 39.69  ? 582 HOH A O     1 
HETATM 4925 O  O     . HOH DA 5 .   ? 2.391   21.062 14.792  1.00 47.63  ? 583 HOH A O     1 
HETATM 4926 O  O     . HOH DA 5 .   ? -2.210  27.900 26.612  1.00 31.37  ? 584 HOH A O     1 
HETATM 4927 O  O     . HOH DA 5 .   ? 11.584  11.797 19.302  1.00 37.88  ? 585 HOH A O     1 
HETATM 4928 O  O     . HOH DA 5 .   ? 19.583  6.297  22.894  1.00 39.21  ? 586 HOH A O     1 
HETATM 4929 O  O     . HOH DA 5 .   ? -4.230  51.488 38.325  1.00 53.12  ? 587 HOH A O     1 
HETATM 4930 O  O     . HOH DA 5 .   ? 25.115  18.969 38.978  1.00 48.75  ? 588 HOH A O     1 
HETATM 4931 O  O     . HOH DA 5 .   ? 6.221   35.004 11.734  1.00 43.76  ? 589 HOH A O     1 
HETATM 4932 O  O     . HOH DA 5 .   ? 1.769   11.781 35.195  1.00 43.74  ? 590 HOH A O     1 
HETATM 4933 O  O     . HOH DA 5 .   ? 25.778  10.173 37.113  1.00 40.26  ? 591 HOH A O     1 
HETATM 4934 O  O     . HOH DA 5 .   ? 1.330   24.658 37.931  1.00 40.05  ? 592 HOH A O     1 
HETATM 4935 O  O     . HOH DA 5 .   ? -2.624  22.949 33.347  1.00 37.44  ? 593 HOH A O     1 
HETATM 4936 O  O     . HOH DA 5 .   ? 10.367  14.938 10.783  1.00 45.53  ? 594 HOH A O     1 
HETATM 4937 O  O     . HOH DA 5 .   ? 2.490   40.995 8.972   1.00 52.55  ? 595 HOH A O     1 
HETATM 4938 O  O     . HOH DA 5 .   ? 24.520  8.862  39.076  1.00 59.82  ? 596 HOH A O     1 
HETATM 4939 O  O     . HOH DA 5 .   ? 11.253  29.878 51.953  1.00 43.26  ? 597 HOH A O     1 
HETATM 4940 O  O     . HOH DA 5 .   ? 19.367  22.619 54.012  1.00 38.46  ? 598 HOH A O     1 
HETATM 4941 O  O     . HOH DA 5 .   ? 11.812  28.485 2.220   1.00 50.74  ? 599 HOH A O     1 
HETATM 4942 O  O     . HOH DA 5 .   ? 2.202   33.589 19.160  1.00 57.03  ? 600 HOH A O     1 
HETATM 4943 O  O     . HOH DA 5 .   ? 3.424   34.669 22.588  1.00 53.16  ? 601 HOH A O     1 
HETATM 4944 O  O     . HOH DA 5 .   ? 8.566   35.626 36.242  1.00 68.01  ? 602 HOH A O     1 
HETATM 4945 O  O     . HOH DA 5 .   ? 0.006   34.654 33.072  1.00 70.42  ? 603 HOH A O     1 
HETATM 4946 O  O     . HOH DA 5 .   ? -1.000  35.842 30.941  1.00 47.73  ? 604 HOH A O     1 
HETATM 4947 O  O     . HOH DA 5 .   ? 0.888   27.420 38.341  1.00 39.67  ? 605 HOH A O     1 
HETATM 4948 O  O     . HOH DA 5 .   ? -1.247  28.981 35.152  1.00 47.18  ? 606 HOH A O     1 
HETATM 4949 O  O     . HOH DA 5 .   ? 5.332   25.209 50.509  1.00 43.10  ? 607 HOH A O     1 
HETATM 4950 O  O     . HOH DA 5 .   ? 8.929   10.425 20.247  1.00 36.39  ? 608 HOH A O     1 
HETATM 4951 O  O     . HOH DA 5 .   ? 6.188   10.282 23.012  1.00 45.90  ? 609 HOH A O     1 
HETATM 4952 O  O     . HOH DA 5 .   ? -4.182  18.384 26.419  1.00 56.08  ? 610 HOH A O     1 
HETATM 4953 O  O     . HOH DA 5 .   ? -5.165  32.049 23.249  1.00 46.80  ? 611 HOH A O     1 
HETATM 4954 O  O     . HOH DA 5 .   ? -7.612  30.555 19.141  1.00 57.57  ? 612 HOH A O     1 
HETATM 4955 O  O     . HOH DA 5 .   ? 0.379   39.208 23.988  1.00 38.88  ? 613 HOH A O     1 
HETATM 4956 O  O     . HOH DA 5 .   ? 2.451   40.888 23.179  1.00 30.50  ? 614 HOH A O     1 
HETATM 4957 O  O     . HOH DA 5 .   ? 4.882   53.796 23.267  1.00 44.74  ? 615 HOH A O     1 
HETATM 4958 O  O     . HOH DA 5 .   ? 5.907   53.894 25.739  1.00 45.23  ? 616 HOH A O     1 
HETATM 4959 O  O     . HOH DA 5 .   ? -1.545  56.410 24.479  1.00 44.90  ? 617 HOH A O     1 
HETATM 4960 O  O     . HOH DA 5 .   ? 16.508  9.218  19.124  1.00 52.69  ? 618 HOH A O     1 
HETATM 4961 O  O     . HOH DA 5 .   ? 10.362  47.348 26.184  1.00 52.09  ? 619 HOH A O     1 
HETATM 4962 O  O     . HOH DA 5 .   ? 11.645  2.388  35.669  1.00 42.21  ? 620 HOH A O     1 
HETATM 4963 O  O     . HOH DA 5 .   ? 23.196  16.355 44.582  1.00 56.70  ? 621 HOH A O     1 
HETATM 4964 O  O     . HOH DA 5 .   ? 17.880  27.597 24.370  1.00 40.63  ? 622 HOH A O     1 
HETATM 4965 O  O     . HOH DA 5 .   ? 13.515  18.708 15.063  1.00 69.35  ? 623 HOH A O     1 
HETATM 4966 O  O     . HOH DA 5 .   ? 15.290  30.189 23.277  1.00 52.24  ? 624 HOH A O     1 
HETATM 4967 O  O     . HOH DA 5 .   ? -0.224  29.474 32.943  1.00 46.03  ? 625 HOH A O     1 
HETATM 4968 O  O     . HOH DA 5 .   ? -0.866  26.699 36.354  1.00 65.92  ? 626 HOH A O     1 
HETATM 4969 O  O     . HOH DA 5 .   ? 5.320   55.501 14.522  1.00 47.21  ? 627 HOH A O     1 
HETATM 4970 O  O     . HOH DA 5 .   ? 9.782   52.457 14.009  1.00 44.16  ? 628 HOH A O     1 
HETATM 4971 O  O     . HOH DA 5 .   ? 5.887   53.183 29.543  1.00 51.76  ? 629 HOH A O     1 
HETATM 4972 O  O     . HOH DA 5 .   ? 4.935   5.836  37.224  1.00 49.87  ? 630 HOH A O     1 
HETATM 4973 O  O     . HOH DA 5 .   ? 10.211  4.315  37.912  1.00 40.49  ? 631 HOH A O     1 
HETATM 4974 O  O     . HOH DA 5 .   ? 11.897  5.648  33.350  1.00 47.80  ? 632 HOH A O     1 
HETATM 4975 O  O     . HOH DA 5 .   ? 9.281   17.912 49.006  1.00 46.48  ? 633 HOH A O     1 
HETATM 4976 O  O     . HOH DA 5 .   ? 6.519   51.664 39.182  1.00 47.23  ? 634 HOH A O     1 
HETATM 4977 O  O     . HOH DA 5 .   ? 6.605   54.123 36.075  1.00 58.39  ? 635 HOH A O     1 
HETATM 4978 O  O     . HOH EA 5 .   ? 17.993  32.875 39.165  1.00 28.88  ? 519 HOH B O     1 
HETATM 4979 O  O     . HOH EA 5 .   ? 23.424  30.387 19.866  1.00 14.43  ? 520 HOH B O     1 
HETATM 4980 O  O     B HOH EA 5 .   ? 20.917  33.043 14.169  0.75 26.06  ? 521 HOH B O     1 
HETATM 4981 O  O     . HOH EA 5 .   ? 24.856  34.056 12.786  1.00 24.71  ? 522 HOH B O     1 
HETATM 4982 O  O     . HOH EA 5 .   ? 22.050  35.051 12.235  1.00 32.80  ? 523 HOH B O     1 
HETATM 4983 O  O     A HOH EA 5 .   ? 24.263  31.971 14.748  0.75 27.39  ? 524 HOH B O     1 
HETATM 4984 O  O     . HOH EA 5 .   ? 19.645  33.164 9.150   1.00 26.31  ? 525 HOH B O     1 
HETATM 4985 O  O     . HOH EA 5 .   ? 16.862  30.332 10.631  1.00 27.44  ? 526 HOH B O     1 
HETATM 4986 O  O     . HOH EA 5 .   ? 21.980  53.445 19.879  1.00 27.33  ? 527 HOH B O     1 
HETATM 4987 O  O     . HOH EA 5 .   ? 22.459  50.714 20.604  1.00 21.57  ? 528 HOH B O     1 
HETATM 4988 O  O     . HOH EA 5 .   ? 20.354  52.387 22.033  1.00 28.40  ? 529 HOH B O     1 
HETATM 4989 O  O     B HOH EA 5 .   ? 22.557  31.636 14.000  0.25 14.51  ? 530 HOH B O     1 
HETATM 4990 O  O     . HOH EA 5 .   ? 24.028  52.029 30.287  1.00 23.19  ? 531 HOH B O     1 
HETATM 4991 O  O     . HOH EA 5 .   ? 26.242  51.080 28.959  1.00 26.95  ? 532 HOH B O     1 
HETATM 4992 O  O     . HOH EA 5 .   ? 18.593  25.084 24.040  1.00 19.79  ? 533 HOH B O     1 
HETATM 4993 O  O     . HOH EA 5 .   ? 22.225  61.286 19.164  1.00 25.01  ? 534 HOH B O     1 
HETATM 4994 O  O     . HOH EA 5 .   ? 31.606  41.052 30.815  1.00 28.22  ? 535 HOH B O     1 
HETATM 4995 O  O     . HOH EA 5 .   ? 22.166  53.926 23.278  1.00 28.18  ? 536 HOH B O     1 
HETATM 4996 O  O     . HOH EA 5 .   ? 16.813  23.737 6.910   1.00 22.02  ? 537 HOH B O     1 
HETATM 4997 O  O     . HOH EA 5 .   ? 24.433  56.463 20.348  1.00 29.95  ? 538 HOH B O     1 
HETATM 4998 O  O     . HOH EA 5 .   ? 37.620  33.054 22.620  1.00 25.86  ? 539 HOH B O     1 
HETATM 4999 O  O     . HOH EA 5 .   ? 25.419  65.352 25.473  1.00 26.84  ? 540 HOH B O     1 
HETATM 5000 O  O     . HOH EA 5 .   ? 26.757  40.890 30.530  1.00 27.90  ? 541 HOH B O     1 
HETATM 5001 O  O     . HOH EA 5 .   ? 37.896  18.754 22.843  1.00 25.68  ? 542 HOH B O     1 
HETATM 5002 O  O     . HOH EA 5 .   ? 27.408  61.235 25.320  1.00 27.30  ? 543 HOH B O     1 
HETATM 5003 O  O     . HOH EA 5 .   ? 25.454  49.748 6.806   1.00 33.90  ? 544 HOH B O     1 
HETATM 5004 O  O     . HOH EA 5 .   ? 35.390  29.104 8.657   1.00 32.82  ? 545 HOH B O     1 
HETATM 5005 O  O     . HOH EA 5 .   ? 31.820  24.330 41.118  1.00 31.13  ? 546 HOH B O     1 
HETATM 5006 O  O     . HOH EA 5 .   ? 29.784  65.286 30.370  1.00 30.63  ? 547 HOH B O     1 
HETATM 5007 O  O     . HOH EA 5 .   ? 22.595  54.106 29.695  1.00 30.15  ? 548 HOH B O     1 
HETATM 5008 O  O     . HOH EA 5 .   ? 31.446  34.971 34.828  1.00 37.54  ? 549 HOH B O     1 
HETATM 5009 O  O     . HOH EA 5 .   ? 27.782  49.233 8.781   1.00 31.23  ? 550 HOH B O     1 
HETATM 5010 O  O     . HOH EA 5 .   ? 36.858  53.036 18.515  1.00 27.75  ? 551 HOH B O     1 
HETATM 5011 O  O     . HOH EA 5 .   ? 40.117  28.196 23.021  1.00 33.01  ? 552 HOH B O     1 
HETATM 5012 O  O     . HOH EA 5 .   ? 38.618  21.172 21.639  1.00 26.79  ? 553 HOH B O     1 
HETATM 5013 O  O     . HOH EA 5 .   ? 27.322  38.224 36.770  1.00 32.84  ? 554 HOH B O     1 
HETATM 5014 O  O     . HOH EA 5 .   ? 28.338  37.594 18.436  1.00 36.08  ? 555 HOH B O     1 
HETATM 5015 O  O     . HOH EA 5 .   ? 19.786  30.136 4.408   1.00 31.55  ? 556 HOH B O     1 
HETATM 5016 O  O     . HOH EA 5 .   ? 31.584  44.551 24.772  1.00 36.94  ? 557 HOH B O     1 
HETATM 5017 O  O     . HOH EA 5 .   ? 37.011  41.796 25.593  1.00 30.65  ? 558 HOH B O     1 
HETATM 5018 O  O     . HOH EA 5 .   ? 27.079  62.446 10.413  1.00 39.15  ? 559 HOH B O     1 
HETATM 5019 O  O     . HOH EA 5 .   ? 18.492  55.313 32.297  1.00 42.47  ? 560 HOH B O     1 
HETATM 5020 O  O     . HOH EA 5 .   ? 20.901  55.870 19.751  1.00 35.03  ? 561 HOH B O     1 
HETATM 5021 O  O     . HOH EA 5 .   ? 29.191  37.990 28.395  1.00 40.12  ? 562 HOH B O     1 
HETATM 5022 O  O     . HOH EA 5 .   ? 16.268  11.202 12.054  1.00 36.94  ? 563 HOH B O     1 
HETATM 5023 O  O     . HOH EA 5 .   ? 45.346  28.772 24.594  1.00 41.31  ? 564 HOH B O     1 
HETATM 5024 O  O     . HOH EA 5 .   ? 21.804  57.427 26.184  1.00 32.15  ? 565 HOH B O     1 
HETATM 5025 O  O     . HOH EA 5 .   ? 23.326  22.631 -2.138  1.00 36.79  ? 566 HOH B O     1 
HETATM 5026 O  O     . HOH EA 5 .   ? 24.674  60.171 32.797  1.00 39.88  ? 567 HOH B O     1 
HETATM 5027 O  O     . HOH EA 5 .   ? 36.229  63.904 29.281  1.00 39.15  ? 568 HOH B O     1 
HETATM 5028 O  O     . HOH EA 5 .   ? 45.379  26.556 26.024  1.00 41.73  ? 569 HOH B O     1 
HETATM 5029 O  O     . HOH EA 5 .   ? 29.642  65.381 13.568  1.00 31.90  ? 570 HOH B O     1 
HETATM 5030 O  O     . HOH EA 5 .   ? 30.375  37.972 14.590  1.00 44.14  ? 571 HOH B O     1 
HETATM 5031 O  O     . HOH EA 5 .   ? 34.917  47.532 22.922  1.00 39.68  ? 572 HOH B O     1 
HETATM 5032 O  O     . HOH EA 5 .   ? 44.612  34.734 31.700  1.00 37.36  ? 573 HOH B O     1 
HETATM 5033 O  O     . HOH EA 5 .   ? 37.857  59.037 22.975  1.00 40.72  ? 574 HOH B O     1 
HETATM 5034 O  O     . HOH EA 5 .   ? 24.130  67.274 28.129  1.00 32.36  ? 575 HOH B O     1 
HETATM 5035 O  O     . HOH EA 5 .   ? 34.870  35.783 15.566  1.00 33.50  ? 576 HOH B O     1 
HETATM 5036 O  O     . HOH EA 5 .   ? 29.937  39.175 26.160  1.00 42.79  ? 577 HOH B O     1 
HETATM 5037 O  O     . HOH EA 5 .   ? 23.663  66.109 21.303  1.00 36.86  ? 578 HOH B O     1 
HETATM 5038 O  O     . HOH EA 5 .   ? 32.249  63.830 39.313  1.00 46.90  ? 579 HOH B O     1 
HETATM 5039 O  O     . HOH EA 5 .   ? 25.004  62.580 25.265  1.00 29.26  ? 580 HOH B O     1 
HETATM 5040 O  O     . HOH EA 5 .   ? 40.339  33.695 21.774  1.00 33.57  ? 581 HOH B O     1 
HETATM 5041 O  O     . HOH EA 5 .   ? 34.817  34.616 10.511  1.00 44.85  ? 582 HOH B O     1 
HETATM 5042 O  O     . HOH EA 5 .   ? 27.013  63.675 32.075  1.00 41.83  ? 583 HOH B O     1 
HETATM 5043 O  O     . HOH EA 5 .   ? 27.913  16.669 29.325  1.00 40.94  ? 584 HOH B O     1 
HETATM 5044 O  O     . HOH EA 5 .   ? 21.386  56.578 23.593  1.00 32.16  ? 585 HOH B O     1 
HETATM 5045 O  O     . HOH EA 5 .   ? 32.803  37.362 13.719  1.00 44.54  ? 586 HOH B O     1 
HETATM 5046 O  O     . HOH EA 5 .   ? 23.986  8.426  28.272  1.00 46.03  ? 587 HOH B O     1 
HETATM 5047 O  O     . HOH EA 5 .   ? 13.167  16.522 10.846  1.00 47.75  ? 588 HOH B O     1 
HETATM 5048 O  O     . HOH EA 5 .   ? 21.267  57.970 35.021  1.00 34.71  ? 589 HOH B O     1 
HETATM 5049 O  O     . HOH EA 5 .   ? 28.712  31.519 42.200  1.00 34.96  ? 590 HOH B O     1 
HETATM 5050 O  O     . HOH EA 5 .   ? 23.328  66.477 24.135  1.00 43.14  ? 591 HOH B O     1 
HETATM 5051 O  O     . HOH EA 5 .   ? 20.149  35.334 40.589  1.00 49.84  ? 592 HOH B O     1 
HETATM 5052 O  O     . HOH EA 5 .   ? 38.565  49.161 29.407  1.00 40.80  ? 593 HOH B O     1 
HETATM 5053 O  O     . HOH EA 5 .   ? 30.340  37.735 21.331  1.00 40.40  ? 594 HOH B O     1 
HETATM 5054 O  O     . HOH EA 5 .   ? 29.497  14.479 28.621  1.00 42.86  ? 595 HOH B O     1 
HETATM 5055 O  O     . HOH EA 5 .   ? 42.223  25.718 22.102  1.00 56.62  ? 596 HOH B O     1 
HETATM 5056 O  O     . HOH EA 5 .   ? 33.293  45.282 22.789  1.00 46.41  ? 597 HOH B O     1 
HETATM 5057 O  O     . HOH EA 5 .   ? 36.349  35.220 13.399  1.00 51.41  ? 598 HOH B O     1 
HETATM 5058 O  O     . HOH EA 5 .   ? 43.377  36.557 28.231  1.00 41.07  ? 599 HOH B O     1 
HETATM 5059 O  O     . HOH EA 5 .   ? 25.665  10.612 28.438  1.00 43.43  ? 600 HOH B O     1 
HETATM 5060 O  O     . HOH EA 5 .   ? 33.381  13.524 23.639  1.00 40.10  ? 601 HOH B O     1 
HETATM 5061 O  O     . HOH EA 5 .   ? 33.467  49.903 40.301  1.00 43.93  ? 602 HOH B O     1 
HETATM 5062 O  O     . HOH EA 5 .   ? 32.643  14.118 27.662  1.00 42.52  ? 603 HOH B O     1 
HETATM 5063 O  O     . HOH EA 5 .   ? 18.603  30.866 27.101  1.00 43.51  ? 604 HOH B O     1 
HETATM 5064 O  O     . HOH EA 5 .   ? 15.287  21.476 6.452   1.00 45.88  ? 605 HOH B O     1 
HETATM 5065 O  O     . HOH EA 5 .   ? 17.473  15.847 3.456   1.00 54.65  ? 606 HOH B O     1 
HETATM 5066 O  O     . HOH EA 5 .   ? 29.252  41.812 22.614  1.00 44.63  ? 607 HOH B O     1 
HETATM 5067 O  O     . HOH EA 5 .   ? 19.848  10.185 7.713   1.00 44.48  ? 608 HOH B O     1 
HETATM 5068 O  O     . HOH EA 5 .   ? 37.131  53.379 38.295  1.00 51.26  ? 609 HOH B O     1 
HETATM 5069 O  O     . HOH EA 5 .   ? 31.460  9.341  13.763  1.00 47.69  ? 610 HOH B O     1 
HETATM 5070 O  O     . HOH EA 5 .   ? 31.955  16.298 29.054  1.00 43.68  ? 611 HOH B O     1 
HETATM 5071 O  O     . HOH EA 5 .   ? 22.152  63.905 20.755  1.00 40.12  ? 612 HOH B O     1 
HETATM 5072 O  O     . HOH EA 5 .   ? 25.274  52.563 44.286  1.00 43.08  ? 613 HOH B O     1 
HETATM 5073 O  O     . HOH EA 5 .   ? 27.640  39.770 9.106   1.00 44.41  ? 614 HOH B O     1 
HETATM 5074 O  O     . HOH EA 5 .   ? 13.203  24.079 5.246   1.00 49.34  ? 615 HOH B O     1 
HETATM 5075 O  O     . HOH EA 5 .   ? 15.203  23.285 3.222   1.00 51.92  ? 616 HOH B O     1 
HETATM 5076 O  O     . HOH EA 5 .   ? 15.723  18.962 7.101   1.00 58.42  ? 617 HOH B O     1 
HETATM 5077 O  O     . HOH EA 5 .   ? 23.112  6.932  24.087  1.00 43.87  ? 618 HOH B O     1 
HETATM 5078 O  O     . HOH EA 5 .   ? 46.059  37.505 30.642  1.00 50.39  ? 619 HOH B O     1 
HETATM 5079 O  O     . HOH EA 5 .   ? 46.229  39.364 28.752  1.00 58.74  ? 620 HOH B O     1 
HETATM 5080 O  O     . HOH EA 5 .   ? 38.994  18.863 12.485  1.00 58.95  ? 621 HOH B O     1 
HETATM 5081 O  O     . HOH EA 5 .   ? 30.729  8.454  10.959  1.00 40.42  ? 622 HOH B O     1 
HETATM 5082 O  O     . HOH EA 5 .   ? 33.118  10.336 4.838   1.00 47.35  ? 623 HOH B O     1 
HETATM 5083 O  O     . HOH EA 5 .   ? 28.059  7.518  10.290  1.00 50.78  ? 624 HOH B O     1 
HETATM 5084 O  O     . HOH EA 5 .   ? 17.492  29.677 21.825  1.00 50.82  ? 625 HOH B O     1 
HETATM 5085 O  O     . HOH EA 5 .   ? 32.330  25.426 34.184  1.00 46.33  ? 626 HOH B O     1 
HETATM 5086 O  O     . HOH EA 5 .   ? 29.526  17.639 37.030  1.00 46.89  ? 627 HOH B O     1 
HETATM 5087 O  O     . HOH EA 5 .   ? 22.460  61.492 24.815  1.00 50.88  ? 628 HOH B O     1 
HETATM 5088 O  O     . HOH EA 5 .   ? 26.292  61.819 34.352  1.00 39.42  ? 629 HOH B O     1 
HETATM 5089 O  O     . HOH EA 5 .   ? 30.474  66.582 39.310  1.00 57.14  ? 630 HOH B O     1 
HETATM 5090 O  O     . HOH EA 5 .   ? 20.711  40.651 17.934  1.00 32.47  ? 631 HOH B O     1 
HETATM 5091 O  O     . HOH EA 5 .   ? 22.682  42.383 17.742  1.00 51.89  ? 632 HOH B O     1 
HETATM 5092 O  O     . HOH EA 5 .   ? 14.204  18.351 9.029   1.00 58.12  ? 633 HOH B O     1 
HETATM 5093 O  O     . HOH EA 5 .   ? 31.196  8.688  2.431   1.00 54.94  ? 634 HOH B O     1 
HETATM 5094 O  O     . HOH EA 5 .   ? 25.232  7.959  11.227  1.00 44.76  ? 635 HOH B O     1 
HETATM 5095 O  O     . HOH EA 5 .   ? 23.997  32.524 -3.465  1.00 56.32  ? 636 HOH B O     1 
HETATM 5096 O  O     . HOH EA 5 .   ? 17.488  34.617 6.134   1.00 51.40  ? 637 HOH B O     1 
HETATM 5097 O  O     . HOH EA 5 .   ? 34.321  25.311 38.432  1.00 60.50  ? 638 HOH B O     1 
HETATM 5098 O  O     . HOH EA 5 .   ? 30.491  37.237 37.214  1.00 60.57  ? 639 HOH B O     1 
HETATM 5099 O  O     . HOH EA 5 .   ? 27.852  39.284 39.017  1.00 49.00  ? 640 HOH B O     1 
HETATM 5100 O  O     . HOH EA 5 .   ? 27.797  42.248 37.990  1.00 45.75  ? 641 HOH B O     1 
HETATM 5101 O  O     . HOH EA 5 .   ? 33.927  37.487 31.382  1.00 55.29  ? 642 HOH B O     1 
HETATM 5102 O  O     . HOH EA 5 .   ? 36.908  33.570 32.413  1.00 48.72  ? 643 HOH B O     1 
HETATM 5103 O  O     . HOH EA 5 .   ? 36.974  36.141 31.951  1.00 55.96  ? 644 HOH B O     1 
HETATM 5104 O  O     . HOH EA 5 .   ? 39.099  30.166 20.866  1.00 59.05  ? 645 HOH B O     1 
HETATM 5105 O  O     . HOH EA 5 .   ? 38.836  28.353 18.880  1.00 51.17  ? 646 HOH B O     1 
HETATM 5106 O  O     . HOH EA 5 .   ? 39.358  26.542 17.023  1.00 67.46  ? 647 HOH B O     1 
HETATM 5107 O  O     . HOH EA 5 .   ? 31.015  16.459 -3.309  1.00 61.94  ? 648 HOH B O     1 
HETATM 5108 O  O     . HOH EA 5 .   ? 29.402  28.969 -5.011  1.00 47.04  ? 649 HOH B O     1 
HETATM 5109 O  O     . HOH EA 5 .   ? 30.079  22.286 -0.936  1.00 52.04  ? 650 HOH B O     1 
HETATM 5110 O  O     . HOH EA 5 .   ? 23.026  34.228 -5.808  1.00 49.27  ? 651 HOH B O     1 
HETATM 5111 O  O     . HOH EA 5 .   ? 39.818  18.701 19.144  1.00 43.52  ? 652 HOH B O     1 
HETATM 5112 O  O     . HOH EA 5 .   ? 41.862  20.833 21.207  1.00 53.39  ? 653 HOH B O     1 
HETATM 5113 O  O     . HOH EA 5 .   ? 31.894  47.677 39.428  1.00 51.14  ? 654 HOH B O     1 
HETATM 5114 O  O     . HOH EA 5 .   ? 32.393  61.523 42.814  1.00 52.54  ? 655 HOH B O     1 
HETATM 5115 O  O     . HOH EA 5 .   ? 22.478  60.712 35.110  1.00 52.03  ? 656 HOH B O     1 
HETATM 5116 O  O     . HOH EA 5 .   ? 21.661  57.782 17.767  1.00 37.54  ? 657 HOH B O     1 
HETATM 5117 O  O     . HOH EA 5 .   ? 29.631  59.629 3.753   1.00 52.63  ? 658 HOH B O     1 
HETATM 5118 O  O     . HOH EA 5 .   ? 32.003  50.705 9.415   1.00 57.30  ? 659 HOH B O     1 
HETATM 5119 O  O     . HOH EA 5 .   ? 28.068  44.435 22.179  1.00 41.42  ? 660 HOH B O     1 
HETATM 5120 O  O     . HOH EA 5 .   ? 22.827  10.168 0.895   1.00 51.69  ? 661 HOH B O     1 
HETATM 5121 O  O     . HOH EA 5 .   ? 27.110  39.654 11.903  1.00 52.35  ? 662 HOH B O     1 
HETATM 5122 O  O     . HOH EA 5 .   ? 21.481  54.399 10.029  1.00 45.79  ? 663 HOH B O     1 
HETATM 5123 O  O     . HOH EA 5 .   ? 21.517  56.089 11.836  1.00 42.76  ? 664 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   A   1   2   2   A   ADE C . n 
A 1 2   A   2   3   3   A   ADE C . n 
A 1 3   G   3   4   4   G   GUA C . n 
A 1 4   G   4   5   5   G   GUA C . n 
A 1 5   U   5   6   6   U   URI C . n 
A 1 6   C   6   7   7   C   CYT C . n 
A 1 7   A   7   8   8   A   ADE C . n 
A 1 8   U   8   9   9   U   URI C . n 
A 1 9   U   9   10  10  U   URI C . n 
A 1 10  C   10  11  11  C   CYT C . n 
A 1 11  G   11  12  12  G   GUA C . n 
B 2 1   A   1   17  17  A   ADE E . n 
B 2 2   G   2   18  18  G   GUA E . n 
B 2 3   U   3   19  19  U   URI E . n 
B 2 4   G   4   20  20  G   GUA E . n 
B 2 5   G   5   21  21  G   GUA E . n 
B 2 6   C   6   22  22  C   CYT E . n 
B 2 7   C   7   23  23  C   CYT E . n 
B 2 8   U   8   24  24  U   URI E . n 
B 2 9   U   9   25  25  U   URI E . n 
B 2 10  G   10  26  26  G   GUA E . n 
B 2 11  C   11  27  27  C   CYT E . n 
C 1 1   A   1   2   2   A   ADE D . n 
C 1 2   A   2   3   3   A   ADE D . n 
C 1 3   G   3   4   4   G   GUA D . n 
C 1 4   G   4   5   5   G   GUA D . n 
C 1 5   U   5   6   6   U   URI D . n 
C 1 6   C   6   7   7   C   CYT D . n 
C 1 7   A   7   8   8   A   ADE D . n 
C 1 8   U   8   9   9   U   URI D . n 
C 1 9   U   9   10  10  U   URI D . n 
C 1 10  C   10  11  11  C   CYT D . n 
C 1 11  G   11  12  12  G   GUA D . n 
D 2 1   A   1   17  17  A   ADE F . n 
D 2 2   G   2   18  18  G   GUA F . n 
D 2 3   U   3   19  19  U   URI F . n 
D 2 4   G   4   20  20  G   GUA F . n 
D 2 5   G   5   21  21  G   GUA F . n 
D 2 6   C   6   22  22  C   CYT F . n 
D 2 7   C   7   23  23  C   CYT F . n 
D 2 8   U   8   24  24  U   URI F . n 
D 2 9   U   9   25  25  U   URI F . n 
D 2 10  G   10  26  26  G   GUA F . n 
D 2 11  C   11  27  27  C   CYT F . n 
E 3 1   MET 1   1   ?   ?   ?   A . n 
E 3 2   LYS 2   2   ?   ?   ?   A . n 
E 3 3   MET 3   3   3   MET MET A . n 
E 3 4   LEU 4   4   4   LEU LEU A . n 
E 3 5   GLU 5   5   5   GLU GLU A . n 
E 3 6   GLN 6   6   6   GLN GLN A . n 
E 3 7   LEU 7   7   7   LEU LEU A . n 
E 3 8   GLU 8   8   8   GLU GLU A . n 
E 3 9   LYS 9   9   9   LYS LYS A . n 
E 3 10  LYS 10  10  10  LYS LYS A . n 
E 3 11  LEU 11  11  11  LEU LEU A . n 
E 3 12  GLY 12  12  12  GLY GLY A . n 
E 3 13  TYR 13  13  13  TYR TYR A . n 
E 3 14  THR 14  14  14  THR THR A . n 
E 3 15  PHE 15  15  15  PHE PHE A . n 
E 3 16  LYS 16  16  16  LYS LYS A . n 
E 3 17  ASP 17  17  17  ASP ASP A . n 
E 3 18  LYS 18  18  18  LYS LYS A . n 
E 3 19  SER 19  19  19  SER SER A . n 
E 3 20  LEU 20  20  20  LEU LEU A . n 
E 3 21  LEU 21  21  21  LEU LEU A . n 
E 3 22  GLU 22  22  22  GLU GLU A . n 
E 3 23  LYS 23  23  23  LYS LYS A . n 
E 3 24  ALA 24  24  24  ALA ALA A . n 
E 3 25  LEU 25  25  25  LEU LEU A . n 
E 3 26  THR 26  26  26  THR THR A . n 
E 3 27  HIS 27  27  27  HIS HIS A . n 
E 3 28  VAL 28  28  28  VAL VAL A . n 
E 3 29  SER 29  29  29  SER SER A . n 
E 3 30  TYR 30  30  30  TYR TYR A . n 
E 3 31  SER 31  31  31  SER SER A . n 
E 3 32  LYS 32  32  32  LYS LYS A . n 
E 3 33  LYS 33  33  33  LYS LYS A . n 
E 3 34  GLU 34  34  34  GLU GLU A . n 
E 3 35  HIS 35  35  35  HIS HIS A . n 
E 3 36  TYR 36  36  36  TYR TYR A . n 
E 3 37  GLU 37  37  37  GLU GLU A . n 
E 3 38  THR 38  38  38  THR THR A . n 
E 3 39  LEU 39  39  39  LEU LEU A . n 
E 3 40  GLU 40  40  40  GLU GLU A . n 
E 3 41  PHE 41  41  41  PHE PHE A . n 
E 3 42  LEU 42  42  42  LEU LEU A . n 
E 3 43  GLY 43  43  43  GLY GLY A . n 
E 3 44  ASP 44  44  44  ASP ASP A . n 
E 3 45  ALA 45  45  45  ALA ALA A . n 
E 3 46  LEU 46  46  46  LEU LEU A . n 
E 3 47  VAL 47  47  47  VAL VAL A . n 
E 3 48  ASN 48  48  48  ASN ASN A . n 
E 3 49  PHE 49  49  49  PHE PHE A . n 
E 3 50  PHE 50  50  50  PHE PHE A . n 
E 3 51  ILE 51  51  51  ILE ILE A . n 
E 3 52  VAL 52  52  52  VAL VAL A . n 
E 3 53  ASP 53  53  53  ASP ASP A . n 
E 3 54  LEU 54  54  54  LEU LEU A . n 
E 3 55  LEU 55  55  55  LEU LEU A . n 
E 3 56  VAL 56  56  56  VAL VAL A . n 
E 3 57  GLN 57  57  57  GLN GLN A . n 
E 3 58  TYR 58  58  58  TYR TYR A . n 
E 3 59  SER 59  59  59  SER SER A . n 
E 3 60  PRO 60  60  60  PRO PRO A . n 
E 3 61  ASN 61  61  61  ASN ASN A . n 
E 3 62  LYS 62  62  62  LYS LYS A . n 
E 3 63  ARG 63  63  63  ARG ARG A . n 
E 3 64  GLU 64  64  64  GLU GLU A . n 
E 3 65  GLY 65  65  65  GLY GLY A . n 
E 3 66  PHE 66  66  66  PHE PHE A . n 
E 3 67  LEU 67  67  67  LEU LEU A . n 
E 3 68  SER 68  68  68  SER SER A . n 
E 3 69  PRO 69  69  69  PRO PRO A . n 
E 3 70  LEU 70  70  70  LEU LEU A . n 
E 3 71  LYS 71  71  71  LYS LYS A . n 
E 3 72  ALA 72  72  72  ALA ALA A . n 
E 3 73  TYR 73  73  73  TYR TYR A . n 
E 3 74  LEU 74  74  74  LEU LEU A . n 
E 3 75  ILE 75  75  75  ILE ILE A . n 
E 3 76  SER 76  76  76  SER SER A . n 
E 3 77  GLU 77  77  77  GLU GLU A . n 
E 3 78  GLU 78  78  78  GLU GLU A . n 
E 3 79  PHE 79  79  79  PHE PHE A . n 
E 3 80  PHE 80  80  80  PHE PHE A . n 
E 3 81  ASN 81  81  81  ASN ASN A . n 
E 3 82  LEU 82  82  82  LEU LEU A . n 
E 3 83  LEU 83  83  83  LEU LEU A . n 
E 3 84  ALA 84  84  84  ALA ALA A . n 
E 3 85  GLN 85  85  85  GLN GLN A . n 
E 3 86  LYS 86  86  86  LYS LYS A . n 
E 3 87  LEU 87  87  87  LEU LEU A . n 
E 3 88  GLU 88  88  88  GLU GLU A . n 
E 3 89  LEU 89  89  89  LEU LEU A . n 
E 3 90  HIS 90  90  90  HIS HIS A . n 
E 3 91  LYS 91  91  91  LYS LYS A . n 
E 3 92  PHE 92  92  92  PHE PHE A . n 
E 3 93  ILE 93  93  93  ILE ILE A . n 
E 3 94  ARG 94  94  94  ARG ARG A . n 
E 3 95  ILE 95  95  95  ILE ILE A . n 
E 3 96  LYS 96  96  96  LYS LYS A . n 
E 3 97  ARG 97  97  97  ARG ARG A . n 
E 3 98  GLY 98  98  98  GLY GLY A . n 
E 3 99  LYS 99  99  99  LYS LYS A . n 
E 3 100 ILE 100 100 100 ILE ILE A . n 
E 3 101 ASN 101 101 101 ASN ASN A . n 
E 3 102 GLU 102 102 102 GLU GLU A . n 
E 3 103 THR 103 103 103 THR THR A . n 
E 3 104 ILE 104 104 104 ILE ILE A . n 
E 3 105 ILE 105 105 105 ILE ILE A . n 
E 3 106 GLY 106 106 106 GLY GLY A . n 
E 3 107 ASP 107 107 107 ASP ASP A . n 
E 3 108 VAL 108 108 108 VAL VAL A . n 
E 3 109 PHE 109 109 109 PHE PHE A . n 
E 3 110 GLU 110 110 110 GLU GLU A . n 
E 3 111 ALA 111 111 111 ALA ALA A . n 
E 3 112 LEU 112 112 112 LEU LEU A . n 
E 3 113 TRP 113 113 113 TRP TRP A . n 
E 3 114 ALA 114 114 114 ALA ALA A . n 
E 3 115 ALA 115 115 115 ALA ALA A . n 
E 3 116 VAL 116 116 116 VAL VAL A . n 
E 3 117 TYR 117 117 117 TYR TYR A . n 
E 3 118 ILE 118 118 118 ILE ILE A . n 
E 3 119 ASP 119 119 119 ASP ASP A . n 
E 3 120 SER 120 120 120 SER SER A . n 
E 3 121 GLY 121 121 121 GLY GLY A . n 
E 3 122 ARG 122 122 122 ARG ARG A . n 
E 3 123 ASP 123 123 123 ASP ASP A . n 
E 3 124 ALA 124 124 124 ALA ALA A . n 
E 3 125 ASN 125 125 125 ASN ASN A . n 
E 3 126 PHE 126 126 126 PHE PHE A . n 
E 3 127 THR 127 127 127 THR THR A . n 
E 3 128 ARG 128 128 128 ARG ARG A . n 
E 3 129 GLU 129 129 129 GLU GLU A . n 
E 3 130 LEU 130 130 130 LEU LEU A . n 
E 3 131 PHE 131 131 131 PHE PHE A . n 
E 3 132 TYR 132 132 132 TYR TYR A . n 
E 3 133 LYS 133 133 133 LYS LYS A . n 
E 3 134 LEU 134 134 134 LEU LEU A . n 
E 3 135 PHE 135 135 135 PHE PHE A . n 
E 3 136 LYS 136 136 136 LYS LYS A . n 
E 3 137 GLU 137 137 137 GLU GLU A . n 
E 3 138 ASP 138 138 138 ASP ASP A . n 
E 3 139 ILE 139 139 139 ILE ILE A . n 
E 3 140 LEU 140 140 140 LEU LEU A . n 
E 3 141 SER 141 141 141 SER SER A . n 
E 3 142 ALA 142 142 142 ALA ALA A . n 
E 3 143 ILE 143 143 143 ILE ILE A . n 
E 3 144 LYS 144 144 144 LYS LYS A . n 
E 3 145 GLU 145 145 145 GLU GLU A . n 
E 3 146 GLY 146 146 146 GLY GLY A . n 
E 3 147 ARG 147 147 147 ARG ARG A . n 
E 3 148 VAL 148 148 148 VAL VAL A . n 
E 3 149 LYS 149 149 149 LYS LYS A . n 
E 3 150 LYS 150 150 150 LYS LYS A . n 
E 3 151 ASP 151 151 151 ASP ASP A . n 
E 3 152 TYR 152 152 152 TYR TYR A . n 
E 3 153 LYS 153 153 153 LYS LYS A . n 
E 3 154 THR 154 154 154 THR THR A . n 
E 3 155 ILE 155 155 155 ILE ILE A . n 
E 3 156 LEU 156 156 156 LEU LEU A . n 
E 3 157 GLN 157 157 157 GLN GLN A . n 
E 3 158 GLU 158 158 158 GLU GLU A . n 
E 3 159 ILE 159 159 159 ILE ILE A . n 
E 3 160 THR 160 160 160 THR THR A . n 
E 3 161 GLN 161 161 161 GLN GLN A . n 
E 3 162 LYS 162 162 162 LYS LYS A . n 
E 3 163 ARG 163 163 163 ARG ARG A . n 
E 3 164 TRP 164 164 164 TRP TRP A . n 
E 3 165 LYS 165 165 165 LYS LYS A . n 
E 3 166 GLU 166 166 166 GLU GLU A . n 
E 3 167 ARG 167 167 167 ARG ARG A . n 
E 3 168 PRO 168 168 168 PRO PRO A . n 
E 3 169 GLU 169 169 169 GLU GLU A . n 
E 3 170 TYR 170 170 170 TYR TYR A . n 
E 3 171 ARG 171 171 171 ARG ARG A . n 
E 3 172 LEU 172 172 172 LEU LEU A . n 
E 3 173 ILE 173 173 173 ILE ILE A . n 
E 3 174 SER 174 174 174 SER SER A . n 
E 3 175 VAL 175 175 175 VAL VAL A . n 
E 3 176 GLU 176 176 176 GLU GLU A . n 
E 3 177 GLY 177 177 177 GLY GLY A . n 
E 3 178 PRO 178 178 178 PRO PRO A . n 
E 3 179 HIS 179 179 179 HIS HIS A . n 
E 3 180 HIS 180 180 180 HIS HIS A . n 
E 3 181 LYS 181 181 181 LYS LYS A . n 
E 3 182 LYS 182 182 182 LYS LYS A . n 
E 3 183 LYS 183 183 183 LYS LYS A . n 
E 3 184 PHE 184 184 184 PHE PHE A . n 
E 3 185 ILE 185 185 185 ILE ILE A . n 
E 3 186 VAL 186 186 186 VAL VAL A . n 
E 3 187 GLU 187 187 187 GLU GLU A . n 
E 3 188 ALA 188 188 188 ALA ALA A . n 
E 3 189 LYS 189 189 189 LYS LYS A . n 
E 3 190 ILE 190 190 190 ILE ILE A . n 
E 3 191 LYS 191 191 191 LYS LYS A . n 
E 3 192 GLU 192 192 192 GLU GLU A . n 
E 3 193 TYR 193 193 193 TYR TYR A . n 
E 3 194 ARG 194 194 194 ARG ARG A . n 
E 3 195 THR 195 195 195 THR THR A . n 
E 3 196 LEU 196 196 196 LEU LEU A . n 
E 3 197 GLY 197 197 197 GLY GLY A . n 
E 3 198 GLU 198 198 198 GLU GLU A . n 
E 3 199 GLY 199 199 199 GLY GLY A . n 
E 3 200 LYS 200 200 200 LYS LYS A . n 
E 3 201 SER 201 201 201 SER SER A . n 
E 3 202 LYS 202 202 202 LYS LYS A . n 
E 3 203 LYS 203 203 203 LYS LYS A . n 
E 3 204 GLU 204 204 204 GLU GLU A . n 
E 3 205 ALA 205 205 205 ALA ALA A . n 
E 3 206 GLU 206 206 206 GLU GLU A . n 
E 3 207 GLN 207 207 207 GLN GLN A . n 
E 3 208 ARG 208 208 208 ARG ARG A . n 
E 3 209 ALA 209 209 209 ALA ALA A . n 
E 3 210 ALA 210 210 210 ALA ALA A . n 
E 3 211 GLU 211 211 211 GLU GLU A . n 
E 3 212 GLU 212 212 212 GLU GLU A . n 
E 3 213 LEU 213 213 213 LEU LEU A . n 
E 3 214 ILE 214 214 214 ILE ILE A . n 
E 3 215 LYS 215 215 215 LYS LYS A . n 
E 3 216 LEU 216 216 216 LEU LEU A . n 
E 3 217 LEU 217 217 217 LEU LEU A . n 
E 3 218 GLU 218 218 218 GLU GLU A . n 
E 3 219 GLU 219 219 ?   ?   ?   A . n 
E 3 220 SER 220 220 ?   ?   ?   A . n 
E 3 221 GLU 221 221 ?   ?   ?   A . n 
F 3 1   MET 1   1   ?   ?   ?   B . n 
F 3 2   LYS 2   2   ?   ?   ?   B . n 
F 3 3   MET 3   3   3   MET MET B . n 
F 3 4   LEU 4   4   4   LEU LEU B . n 
F 3 5   GLU 5   5   5   GLU GLU B . n 
F 3 6   GLN 6   6   6   GLN GLN B . n 
F 3 7   LEU 7   7   7   LEU LEU B . n 
F 3 8   GLU 8   8   8   GLU GLU B . n 
F 3 9   LYS 9   9   9   LYS LYS B . n 
F 3 10  LYS 10  10  10  LYS LYS B . n 
F 3 11  LEU 11  11  11  LEU LEU B . n 
F 3 12  GLY 12  12  12  GLY GLY B . n 
F 3 13  TYR 13  13  13  TYR TYR B . n 
F 3 14  THR 14  14  14  THR THR B . n 
F 3 15  PHE 15  15  15  PHE PHE B . n 
F 3 16  LYS 16  16  16  LYS LYS B . n 
F 3 17  ASP 17  17  17  ASP ASP B . n 
F 3 18  LYS 18  18  18  LYS LYS B . n 
F 3 19  SER 19  19  19  SER SER B . n 
F 3 20  LEU 20  20  20  LEU LEU B . n 
F 3 21  LEU 21  21  21  LEU LEU B . n 
F 3 22  GLU 22  22  22  GLU GLU B . n 
F 3 23  LYS 23  23  23  LYS LYS B . n 
F 3 24  ALA 24  24  24  ALA ALA B . n 
F 3 25  LEU 25  25  25  LEU LEU B . n 
F 3 26  THR 26  26  26  THR THR B . n 
F 3 27  HIS 27  27  27  HIS HIS B . n 
F 3 28  VAL 28  28  28  VAL VAL B . n 
F 3 29  SER 29  29  29  SER SER B . n 
F 3 30  TYR 30  30  30  TYR TYR B . n 
F 3 31  SER 31  31  31  SER SER B . n 
F 3 32  LYS 32  32  32  LYS LYS B . n 
F 3 33  LYS 33  33  33  LYS LYS B . n 
F 3 34  GLU 34  34  34  GLU GLU B . n 
F 3 35  HIS 35  35  35  HIS HIS B . n 
F 3 36  TYR 36  36  36  TYR TYR B . n 
F 3 37  GLU 37  37  37  GLU GLU B . n 
F 3 38  THR 38  38  38  THR THR B . n 
F 3 39  LEU 39  39  39  LEU LEU B . n 
F 3 40  GLU 40  40  40  GLU GLU B . n 
F 3 41  PHE 41  41  41  PHE PHE B . n 
F 3 42  LEU 42  42  42  LEU LEU B . n 
F 3 43  GLY 43  43  43  GLY GLY B . n 
F 3 44  ASP 44  44  44  ASP ASP B . n 
F 3 45  ALA 45  45  45  ALA ALA B . n 
F 3 46  LEU 46  46  46  LEU LEU B . n 
F 3 47  VAL 47  47  47  VAL VAL B . n 
F 3 48  ASN 48  48  48  ASN ASN B . n 
F 3 49  PHE 49  49  49  PHE PHE B . n 
F 3 50  PHE 50  50  50  PHE PHE B . n 
F 3 51  ILE 51  51  51  ILE ILE B . n 
F 3 52  VAL 52  52  52  VAL VAL B . n 
F 3 53  ASP 53  53  53  ASP ASP B . n 
F 3 54  LEU 54  54  54  LEU LEU B . n 
F 3 55  LEU 55  55  55  LEU LEU B . n 
F 3 56  VAL 56  56  56  VAL VAL B . n 
F 3 57  GLN 57  57  57  GLN GLN B . n 
F 3 58  TYR 58  58  58  TYR TYR B . n 
F 3 59  SER 59  59  59  SER SER B . n 
F 3 60  PRO 60  60  60  PRO PRO B . n 
F 3 61  ASN 61  61  61  ASN ASN B . n 
F 3 62  LYS 62  62  62  LYS LYS B . n 
F 3 63  ARG 63  63  63  ARG ARG B . n 
F 3 64  GLU 64  64  64  GLU GLU B . n 
F 3 65  GLY 65  65  65  GLY GLY B . n 
F 3 66  PHE 66  66  66  PHE PHE B . n 
F 3 67  LEU 67  67  67  LEU LEU B . n 
F 3 68  SER 68  68  68  SER SER B . n 
F 3 69  PRO 69  69  69  PRO PRO B . n 
F 3 70  LEU 70  70  70  LEU LEU B . n 
F 3 71  LYS 71  71  71  LYS LYS B . n 
F 3 72  ALA 72  72  72  ALA ALA B . n 
F 3 73  TYR 73  73  73  TYR TYR B . n 
F 3 74  LEU 74  74  74  LEU LEU B . n 
F 3 75  ILE 75  75  75  ILE ILE B . n 
F 3 76  SER 76  76  76  SER SER B . n 
F 3 77  GLU 77  77  77  GLU GLU B . n 
F 3 78  GLU 78  78  78  GLU GLU B . n 
F 3 79  PHE 79  79  79  PHE PHE B . n 
F 3 80  PHE 80  80  80  PHE PHE B . n 
F 3 81  ASN 81  81  81  ASN ASN B . n 
F 3 82  LEU 82  82  82  LEU LEU B . n 
F 3 83  LEU 83  83  83  LEU LEU B . n 
F 3 84  ALA 84  84  84  ALA ALA B . n 
F 3 85  GLN 85  85  85  GLN GLN B . n 
F 3 86  LYS 86  86  86  LYS LYS B . n 
F 3 87  LEU 87  87  87  LEU LEU B . n 
F 3 88  GLU 88  88  88  GLU GLU B . n 
F 3 89  LEU 89  89  89  LEU LEU B . n 
F 3 90  HIS 90  90  90  HIS HIS B . n 
F 3 91  LYS 91  91  91  LYS LYS B . n 
F 3 92  PHE 92  92  92  PHE PHE B . n 
F 3 93  ILE 93  93  93  ILE ILE B . n 
F 3 94  ARG 94  94  94  ARG ARG B . n 
F 3 95  ILE 95  95  95  ILE ILE B . n 
F 3 96  LYS 96  96  96  LYS LYS B . n 
F 3 97  ARG 97  97  97  ARG ARG B . n 
F 3 98  GLY 98  98  98  GLY GLY B . n 
F 3 99  LYS 99  99  99  LYS LYS B . n 
F 3 100 ILE 100 100 100 ILE ILE B . n 
F 3 101 ASN 101 101 101 ASN ASN B . n 
F 3 102 GLU 102 102 102 GLU GLU B . n 
F 3 103 THR 103 103 103 THR THR B . n 
F 3 104 ILE 104 104 104 ILE ILE B . n 
F 3 105 ILE 105 105 105 ILE ILE B . n 
F 3 106 GLY 106 106 106 GLY GLY B . n 
F 3 107 ASP 107 107 107 ASP ASP B . n 
F 3 108 VAL 108 108 108 VAL VAL B . n 
F 3 109 PHE 109 109 109 PHE PHE B . n 
F 3 110 GLU 110 110 110 GLU GLU B . n 
F 3 111 ALA 111 111 111 ALA ALA B . n 
F 3 112 LEU 112 112 112 LEU LEU B . n 
F 3 113 TRP 113 113 113 TRP TRP B . n 
F 3 114 ALA 114 114 114 ALA ALA B . n 
F 3 115 ALA 115 115 115 ALA ALA B . n 
F 3 116 VAL 116 116 116 VAL VAL B . n 
F 3 117 TYR 117 117 117 TYR TYR B . n 
F 3 118 ILE 118 118 118 ILE ILE B . n 
F 3 119 ASP 119 119 119 ASP ASP B . n 
F 3 120 SER 120 120 120 SER SER B . n 
F 3 121 GLY 121 121 121 GLY GLY B . n 
F 3 122 ARG 122 122 122 ARG ARG B . n 
F 3 123 ASP 123 123 123 ASP ASP B . n 
F 3 124 ALA 124 124 124 ALA ALA B . n 
F 3 125 ASN 125 125 125 ASN ASN B . n 
F 3 126 PHE 126 126 126 PHE PHE B . n 
F 3 127 THR 127 127 127 THR THR B . n 
F 3 128 ARG 128 128 128 ARG ARG B . n 
F 3 129 GLU 129 129 129 GLU GLU B . n 
F 3 130 LEU 130 130 130 LEU LEU B . n 
F 3 131 PHE 131 131 131 PHE PHE B . n 
F 3 132 TYR 132 132 132 TYR TYR B . n 
F 3 133 LYS 133 133 133 LYS LYS B . n 
F 3 134 LEU 134 134 134 LEU LEU B . n 
F 3 135 PHE 135 135 135 PHE PHE B . n 
F 3 136 LYS 136 136 136 LYS LYS B . n 
F 3 137 GLU 137 137 137 GLU GLU B . n 
F 3 138 ASP 138 138 138 ASP ASP B . n 
F 3 139 ILE 139 139 139 ILE ILE B . n 
F 3 140 LEU 140 140 140 LEU LEU B . n 
F 3 141 SER 141 141 141 SER SER B . n 
F 3 142 ALA 142 142 142 ALA ALA B . n 
F 3 143 ILE 143 143 143 ILE ILE B . n 
F 3 144 LYS 144 144 144 LYS LYS B . n 
F 3 145 GLU 145 145 145 GLU GLU B . n 
F 3 146 GLY 146 146 146 GLY GLY B . n 
F 3 147 ARG 147 147 147 ARG ARG B . n 
F 3 148 VAL 148 148 148 VAL VAL B . n 
F 3 149 LYS 149 149 149 LYS LYS B . n 
F 3 150 LYS 150 150 150 LYS LYS B . n 
F 3 151 ASP 151 151 151 ASP ASP B . n 
F 3 152 TYR 152 152 152 TYR TYR B . n 
F 3 153 LYS 153 153 153 LYS LYS B . n 
F 3 154 THR 154 154 154 THR THR B . n 
F 3 155 ILE 155 155 155 ILE ILE B . n 
F 3 156 LEU 156 156 156 LEU LEU B . n 
F 3 157 GLN 157 157 157 GLN GLN B . n 
F 3 158 GLU 158 158 158 GLU GLU B . n 
F 3 159 ILE 159 159 159 ILE ILE B . n 
F 3 160 THR 160 160 160 THR THR B . n 
F 3 161 GLN 161 161 161 GLN GLN B . n 
F 3 162 LYS 162 162 162 LYS LYS B . n 
F 3 163 ARG 163 163 163 ARG ARG B . n 
F 3 164 TRP 164 164 164 TRP TRP B . n 
F 3 165 LYS 165 165 165 LYS LYS B . n 
F 3 166 GLU 166 166 166 GLU GLU B . n 
F 3 167 ARG 167 167 167 ARG ARG B . n 
F 3 168 PRO 168 168 168 PRO PRO B . n 
F 3 169 GLU 169 169 169 GLU GLU B . n 
F 3 170 TYR 170 170 170 TYR TYR B . n 
F 3 171 ARG 171 171 171 ARG ARG B . n 
F 3 172 LEU 172 172 172 LEU LEU B . n 
F 3 173 ILE 173 173 173 ILE ILE B . n 
F 3 174 SER 174 174 174 SER SER B . n 
F 3 175 VAL 175 175 175 VAL VAL B . n 
F 3 176 GLU 176 176 176 GLU GLU B . n 
F 3 177 GLY 177 177 177 GLY GLY B . n 
F 3 178 PRO 178 178 178 PRO PRO B . n 
F 3 179 HIS 179 179 179 HIS HIS B . n 
F 3 180 HIS 180 180 180 HIS HIS B . n 
F 3 181 LYS 181 181 181 LYS LYS B . n 
F 3 182 LYS 182 182 182 LYS LYS B . n 
F 3 183 LYS 183 183 183 LYS LYS B . n 
F 3 184 PHE 184 184 184 PHE PHE B . n 
F 3 185 ILE 185 185 185 ILE ILE B . n 
F 3 186 VAL 186 186 186 VAL VAL B . n 
F 3 187 GLU 187 187 187 GLU GLU B . n 
F 3 188 ALA 188 188 188 ALA ALA B . n 
F 3 189 LYS 189 189 189 LYS LYS B . n 
F 3 190 ILE 190 190 190 ILE ILE B . n 
F 3 191 LYS 191 191 191 LYS LYS B . n 
F 3 192 GLU 192 192 192 GLU GLU B . n 
F 3 193 TYR 193 193 193 TYR TYR B . n 
F 3 194 ARG 194 194 194 ARG ARG B . n 
F 3 195 THR 195 195 195 THR THR B . n 
F 3 196 LEU 196 196 196 LEU LEU B . n 
F 3 197 GLY 197 197 197 GLY GLY B . n 
F 3 198 GLU 198 198 198 GLU GLU B . n 
F 3 199 GLY 199 199 199 GLY GLY B . n 
F 3 200 LYS 200 200 200 LYS LYS B . n 
F 3 201 SER 201 201 201 SER SER B . n 
F 3 202 LYS 202 202 202 LYS LYS B . n 
F 3 203 LYS 203 203 203 LYS LYS B . n 
F 3 204 GLU 204 204 204 GLU GLU B . n 
F 3 205 ALA 205 205 205 ALA ALA B . n 
F 3 206 GLU 206 206 206 GLU GLU B . n 
F 3 207 GLN 207 207 207 GLN GLN B . n 
F 3 208 ARG 208 208 208 ARG ARG B . n 
F 3 209 ALA 209 209 209 ALA ALA B . n 
F 3 210 ALA 210 210 210 ALA ALA B . n 
F 3 211 GLU 211 211 211 GLU GLU B . n 
F 3 212 GLU 212 212 212 GLU GLU B . n 
F 3 213 LEU 213 213 213 LEU LEU B . n 
F 3 214 ILE 214 214 214 ILE ILE B . n 
F 3 215 LYS 215 215 215 LYS LYS B . n 
F 3 216 LEU 216 216 216 LEU LEU B . n 
F 3 217 LEU 217 217 217 LEU LEU B . n 
F 3 218 GLU 218 218 218 GLU GLU B . n 
F 3 219 GLU 219 219 219 GLU GLU B . n 
F 3 220 SER 220 220 220 SER SER B . n 
F 3 221 GLU 221 221 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  4 MG  1   515 15  MG  MG2 C . 
H  4 MG  1   519 19  MG  MG2 C . 
I  4 MG  1   505 5   MG  MG2 E . 
J  4 MG  1   514 14  MG  MG2 D . 
K  4 MG  1   516 16  MG  MG2 D . 
L  4 MG  1   511 11  MG  MG2 F . 
M  4 MG  1   513 13  MG  MG2 F . 
N  4 MG  1   501 1   MG  MG2 A . 
O  4 MG  1   502 2   MG  MG2 A . 
P  4 MG  1   503 3   MG  MG2 A . 
Q  4 MG  1   504 4   MG  MG2 A . 
R  4 MG  1   506 6   MG  MG2 A . 
S  4 MG  1   517 17  MG  MG2 A . 
T  4 MG  1   507 7   MG  MG2 B . 
U  4 MG  1   508 8   MG  MG2 B . 
V  4 MG  1   509 9   MG  MG2 B . 
W  4 MG  1   510 10  MG  MG2 B . 
X  4 MG  1   512 12  MG  MG2 B . 
Y  4 MG  1   518 18  MG  MG2 B . 
Z  5 HOH 1   520 18  HOH HOH C . 
Z  5 HOH 2   521 23  HOH HOH C . 
Z  5 HOH 3   522 24  HOH HOH C . 
Z  5 HOH 4   523 26  HOH HOH C . 
Z  5 HOH 5   524 54  HOH HOH C . 
Z  5 HOH 6   525 56  HOH HOH C . 
Z  5 HOH 7   526 72  HOH HOH C . 
Z  5 HOH 8   527 73  HOH HOH C . 
Z  5 HOH 9   528 75  HOH HOH C . 
Z  5 HOH 10  529 80  HOH HOH C . 
Z  5 HOH 11  530 111 HOH HOH C . 
Z  5 HOH 12  531 125 HOH HOH C . 
Z  5 HOH 13  532 128 HOH HOH C . 
Z  5 HOH 14  533 129 HOH HOH C . 
Z  5 HOH 15  534 134 HOH HOH C . 
Z  5 HOH 16  535 143 HOH HOH C . 
Z  5 HOH 17  536 146 HOH HOH C . 
Z  5 HOH 18  537 157 HOH HOH C . 
Z  5 HOH 19  538 183 HOH HOH C . 
Z  5 HOH 20  539 192 HOH HOH C . 
Z  5 HOH 21  540 193 HOH HOH C . 
Z  5 HOH 22  541 195 HOH HOH C . 
Z  5 HOH 23  542 212 HOH HOH C . 
Z  5 HOH 24  543 216 HOH HOH C . 
Z  5 HOH 25  544 220 HOH HOH C . 
Z  5 HOH 26  545 221 HOH HOH C . 
Z  5 HOH 27  546 223 HOH HOH C . 
Z  5 HOH 28  547 228 HOH HOH C . 
Z  5 HOH 29  548 243 HOH HOH C . 
Z  5 HOH 30  549 248 HOH HOH C . 
Z  5 HOH 31  550 258 HOH HOH C . 
Z  5 HOH 32  551 268 HOH HOH C . 
Z  5 HOH 33  552 270 HOH HOH C . 
Z  5 HOH 34  553 275 HOH HOH C . 
Z  5 HOH 35  554 278 HOH HOH C . 
Z  5 HOH 36  555 302 HOH HOH C . 
Z  5 HOH 37  556 327 HOH HOH C . 
Z  5 HOH 38  557 332 HOH HOH C . 
Z  5 HOH 39  558 334 HOH HOH C . 
Z  5 HOH 40  559 335 HOH HOH C . 
Z  5 HOH 41  560 337 HOH HOH C . 
Z  5 HOH 42  561 338 HOH HOH C . 
Z  5 HOH 43  562 341 HOH HOH C . 
Z  5 HOH 44  563 350 HOH HOH C . 
Z  5 HOH 45  564 355 HOH HOH C . 
Z  5 HOH 46  565 364 HOH HOH C . 
Z  5 HOH 47  566 412 HOH HOH C . 
Z  5 HOH 48  567 413 HOH HOH C . 
Z  5 HOH 49  568 414 HOH HOH C . 
Z  5 HOH 50  569 444 HOH HOH C . 
AA 5 HOH 1   506 5   HOH HOH E . 
AA 5 HOH 2   507 8   HOH HOH E . 
AA 5 HOH 3   508 10  HOH HOH E . 
AA 5 HOH 4   509 14  HOH HOH E . 
AA 5 HOH 5   510 15  HOH HOH E . 
AA 5 HOH 6   511 16  HOH HOH E . 
AA 5 HOH 7   512 17  HOH HOH E . 
AA 5 HOH 8   513 46  HOH HOH E . 
AA 5 HOH 9   514 62  HOH HOH E . 
AA 5 HOH 10  515 85  HOH HOH E . 
AA 5 HOH 11  516 89  HOH HOH E . 
AA 5 HOH 12  517 93  HOH HOH E . 
AA 5 HOH 13  518 115 HOH HOH E . 
AA 5 HOH 14  519 119 HOH HOH E . 
AA 5 HOH 15  520 126 HOH HOH E . 
AA 5 HOH 16  521 137 HOH HOH E . 
AA 5 HOH 17  522 169 HOH HOH E . 
AA 5 HOH 18  523 190 HOH HOH E . 
AA 5 HOH 19  524 199 HOH HOH E . 
AA 5 HOH 20  525 204 HOH HOH E . 
AA 5 HOH 21  526 211 HOH HOH E . 
AA 5 HOH 22  527 237 HOH HOH E . 
AA 5 HOH 23  528 241 HOH HOH E . 
AA 5 HOH 24  529 251 HOH HOH E . 
AA 5 HOH 25  530 254 HOH HOH E . 
AA 5 HOH 26  531 261 HOH HOH E . 
AA 5 HOH 27  532 280 HOH HOH E . 
AA 5 HOH 28  533 298 HOH HOH E . 
AA 5 HOH 29  534 349 HOH HOH E . 
AA 5 HOH 30  535 363 HOH HOH E . 
AA 5 HOH 31  536 386 HOH HOH E . 
AA 5 HOH 32  537 390 HOH HOH E . 
AA 5 HOH 33  538 391 HOH HOH E . 
AA 5 HOH 34  539 417 HOH HOH E . 
AA 5 HOH 35  540 418 HOH HOH E . 
AA 5 HOH 36  541 419 HOH HOH E . 
AA 5 HOH 37  542 420 HOH HOH E . 
AA 5 HOH 38  543 421 HOH HOH E . 
AA 5 HOH 39  544 433 HOH HOH E . 
AA 5 HOH 40  545 434 HOH HOH E . 
AA 5 HOH 41  546 435 HOH HOH E . 
AA 5 HOH 42  547 445 HOH HOH E . 
BA 5 HOH 1   517 1   HOH HOH D . 
BA 5 HOH 2   518 41  HOH HOH D . 
BA 5 HOH 3   519 44  HOH HOH D . 
BA 5 HOH 4   520 61  HOH HOH D . 
BA 5 HOH 5   521 68  HOH HOH D . 
BA 5 HOH 6   522 78  HOH HOH D . 
BA 5 HOH 7   523 81  HOH HOH D . 
BA 5 HOH 8   524 87  HOH HOH D . 
BA 5 HOH 9   525 95  HOH HOH D . 
BA 5 HOH 10  526 110 HOH HOH D . 
BA 5 HOH 11  527 130 HOH HOH D . 
BA 5 HOH 12  528 136 HOH HOH D . 
BA 5 HOH 13  529 138 HOH HOH D . 
BA 5 HOH 14  530 142 HOH HOH D . 
BA 5 HOH 15  531 158 HOH HOH D . 
BA 5 HOH 16  532 167 HOH HOH D . 
BA 5 HOH 17  533 171 HOH HOH D . 
BA 5 HOH 18  534 173 HOH HOH D . 
BA 5 HOH 19  535 178 HOH HOH D . 
BA 5 HOH 20  536 182 HOH HOH D . 
BA 5 HOH 21  537 194 HOH HOH D . 
BA 5 HOH 22  538 196 HOH HOH D . 
BA 5 HOH 23  539 231 HOH HOH D . 
BA 5 HOH 24  540 240 HOH HOH D . 
BA 5 HOH 25  541 257 HOH HOH D . 
BA 5 HOH 26  542 260 HOH HOH D . 
BA 5 HOH 27  543 279 HOH HOH D . 
BA 5 HOH 28  544 281 HOH HOH D . 
BA 5 HOH 29  545 283 HOH HOH D . 
BA 5 HOH 30  546 296 HOH HOH D . 
BA 5 HOH 31  547 297 HOH HOH D . 
BA 5 HOH 32  548 316 HOH HOH D . 
BA 5 HOH 33  549 354 HOH HOH D . 
BA 5 HOH 34  550 356 HOH HOH D . 
BA 5 HOH 35  551 357 HOH HOH D . 
BA 5 HOH 36  552 358 HOH HOH D . 
BA 5 HOH 37  553 360 HOH HOH D . 
BA 5 HOH 38  554 361 HOH HOH D . 
BA 5 HOH 39  555 362 HOH HOH D . 
BA 5 HOH 40  556 374 HOH HOH D . 
BA 5 HOH 41  557 377 HOH HOH D . 
BA 5 HOH 42  558 402 HOH HOH D . 
BA 5 HOH 43  559 403 HOH HOH D . 
BA 5 HOH 44  560 416 HOH HOH D . 
BA 5 HOH 45  561 423 HOH HOH D . 
BA 5 HOH 46  562 424 HOH HOH D . 
BA 5 HOH 47  563 426 HOH HOH D . 
BA 5 HOH 48  564 436 HOH HOH D . 
BA 5 HOH 49  565 437 HOH HOH D . 
BA 5 HOH 50  566 440 HOH HOH D . 
CA 5 HOH 1   514 27  HOH HOH F . 
CA 5 HOH 2   515 31  HOH HOH F . 
CA 5 HOH 3   516 33  HOH HOH F . 
CA 5 HOH 4   517 37  HOH HOH F . 
CA 5 HOH 5   518 38  HOH HOH F . 
CA 5 HOH 6   519 39  HOH HOH F . 
CA 5 HOH 7   520 40  HOH HOH F . 
CA 5 HOH 8   521 71  HOH HOH F . 
CA 5 HOH 9   522 92  HOH HOH F . 
CA 5 HOH 10  523 116 HOH HOH F . 
CA 5 HOH 11  524 122 HOH HOH F . 
CA 5 HOH 12  525 139 HOH HOH F . 
CA 5 HOH 13  526 155 HOH HOH F . 
CA 5 HOH 14  527 162 HOH HOH F . 
CA 5 HOH 15  528 191 HOH HOH F . 
CA 5 HOH 16  529 201 HOH HOH F . 
CA 5 HOH 17  530 229 HOH HOH F . 
CA 5 HOH 18  531 232 HOH HOH F . 
CA 5 HOH 19  532 233 HOH HOH F . 
CA 5 HOH 20  533 273 HOH HOH F . 
CA 5 HOH 21  534 293 HOH HOH F . 
CA 5 HOH 22  535 333 HOH HOH F . 
CA 5 HOH 23  536 342 HOH HOH F . 
CA 5 HOH 24  537 343 HOH HOH F . 
CA 5 HOH 25  538 344 HOH HOH F . 
CA 5 HOH 26  539 345 HOH HOH F . 
CA 5 HOH 27  540 346 HOH HOH F . 
CA 5 HOH 28  541 347 HOH HOH F . 
CA 5 HOH 29  542 348 HOH HOH F . 
CA 5 HOH 30  543 351 HOH HOH F . 
CA 5 HOH 31  544 352 HOH HOH F . 
CA 5 HOH 32  545 353 HOH HOH F . 
CA 5 HOH 33  546 359 HOH HOH F . 
CA 5 HOH 34  547 370 HOH HOH F . 
CA 5 HOH 35  548 371 HOH HOH F . 
CA 5 HOH 36  549 372 HOH HOH F . 
CA 5 HOH 37  550 415 HOH HOH F . 
CA 5 HOH 38  551 422 HOH HOH F . 
CA 5 HOH 39  552 441 HOH HOH F . 
DA 5 HOH 1   518 2   HOH HOH A . 
DA 5 HOH 2   519 3   HOH HOH A . 
DA 5 HOH 3   520 4   HOH HOH A . 
DA 5 HOH 4   521 6   HOH HOH A . 
DA 5 HOH 5   522 7   HOH HOH A . 
DA 5 HOH 6   523 9   HOH HOH A . 
DA 5 HOH 7   524 11  HOH HOH A . 
DA 5 HOH 8   525 13  HOH HOH A . 
DA 5 HOH 9   526 19  HOH HOH A . 
DA 5 HOH 10  527 20  HOH HOH A . 
DA 5 HOH 11  528 21  HOH HOH A . 
DA 5 HOH 12  529 22  HOH HOH A . 
DA 5 HOH 13  530 35  HOH HOH A . 
DA 5 HOH 14  531 47  HOH HOH A . 
DA 5 HOH 15  532 49  HOH HOH A . 
DA 5 HOH 16  533 50  HOH HOH A . 
DA 5 HOH 17  534 51  HOH HOH A . 
DA 5 HOH 18  535 52  HOH HOH A . 
DA 5 HOH 19  536 53  HOH HOH A . 
DA 5 HOH 20  537 59  HOH HOH A . 
DA 5 HOH 21  538 63  HOH HOH A . 
DA 5 HOH 22  539 69  HOH HOH A . 
DA 5 HOH 23  540 70  HOH HOH A . 
DA 5 HOH 24  541 76  HOH HOH A . 
DA 5 HOH 25  542 79  HOH HOH A . 
DA 5 HOH 26  543 83  HOH HOH A . 
DA 5 HOH 27  544 88  HOH HOH A . 
DA 5 HOH 28  545 90  HOH HOH A . 
DA 5 HOH 29  546 97  HOH HOH A . 
DA 5 HOH 30  547 99  HOH HOH A . 
DA 5 HOH 31  548 100 HOH HOH A . 
DA 5 HOH 32  549 101 HOH HOH A . 
DA 5 HOH 33  550 102 HOH HOH A . 
DA 5 HOH 34  551 104 HOH HOH A . 
DA 5 HOH 35  552 107 HOH HOH A . 
DA 5 HOH 36  553 109 HOH HOH A . 
DA 5 HOH 37  554 112 HOH HOH A . 
DA 5 HOH 38  555 114 HOH HOH A . 
DA 5 HOH 39  556 120 HOH HOH A . 
DA 5 HOH 40  557 121 HOH HOH A . 
DA 5 HOH 41  558 123 HOH HOH A . 
DA 5 HOH 42  559 135 HOH HOH A . 
DA 5 HOH 43  560 140 HOH HOH A . 
DA 5 HOH 44  561 141 HOH HOH A . 
DA 5 HOH 45  562 150 HOH HOH A . 
DA 5 HOH 46  563 151 HOH HOH A . 
DA 5 HOH 47  564 152 HOH HOH A . 
DA 5 HOH 48  565 153 HOH HOH A . 
DA 5 HOH 49  566 154 HOH HOH A . 
DA 5 HOH 50  567 159 HOH HOH A . 
DA 5 HOH 51  568 160 HOH HOH A . 
DA 5 HOH 52  569 161 HOH HOH A . 
DA 5 HOH 53  570 165 HOH HOH A . 
DA 5 HOH 54  571 172 HOH HOH A . 
DA 5 HOH 55  572 174 HOH HOH A . 
DA 5 HOH 56  573 176 HOH HOH A . 
DA 5 HOH 57  574 179 HOH HOH A . 
DA 5 HOH 58  575 180 HOH HOH A . 
DA 5 HOH 59  576 184 HOH HOH A . 
DA 5 HOH 60  577 185 HOH HOH A . 
DA 5 HOH 61  578 197 HOH HOH A . 
DA 5 HOH 62  579 202 HOH HOH A . 
DA 5 HOH 63  580 203 HOH HOH A . 
DA 5 HOH 64  581 205 HOH HOH A . 
DA 5 HOH 65  582 208 HOH HOH A . 
DA 5 HOH 66  583 209 HOH HOH A . 
DA 5 HOH 67  584 210 HOH HOH A . 
DA 5 HOH 68  585 217 HOH HOH A . 
DA 5 HOH 69  586 227 HOH HOH A . 
DA 5 HOH 70  587 230 HOH HOH A . 
DA 5 HOH 71  588 235 HOH HOH A . 
DA 5 HOH 72  589 238 HOH HOH A . 
DA 5 HOH 73  590 242 HOH HOH A . 
DA 5 HOH 74  591 244 HOH HOH A . 
DA 5 HOH 75  592 246 HOH HOH A . 
DA 5 HOH 76  593 266 HOH HOH A . 
DA 5 HOH 77  594 267 HOH HOH A . 
DA 5 HOH 78  595 282 HOH HOH A . 
DA 5 HOH 79  596 286 HOH HOH A . 
DA 5 HOH 80  597 287 HOH HOH A . 
DA 5 HOH 81  598 288 HOH HOH A . 
DA 5 HOH 82  599 292 HOH HOH A . 
DA 5 HOH 83  600 294 HOH HOH A . 
DA 5 HOH 84  601 295 HOH HOH A . 
DA 5 HOH 85  602 299 HOH HOH A . 
DA 5 HOH 86  603 300 HOH HOH A . 
DA 5 HOH 87  604 301 HOH HOH A . 
DA 5 HOH 88  605 303 HOH HOH A . 
DA 5 HOH 89  606 304 HOH HOH A . 
DA 5 HOH 90  607 305 HOH HOH A . 
DA 5 HOH 91  608 307 HOH HOH A . 
DA 5 HOH 92  609 308 HOH HOH A . 
DA 5 HOH 93  610 309 HOH HOH A . 
DA 5 HOH 94  611 312 HOH HOH A . 
DA 5 HOH 95  612 313 HOH HOH A . 
DA 5 HOH 96  613 314 HOH HOH A . 
DA 5 HOH 97  614 315 HOH HOH A . 
DA 5 HOH 98  615 317 HOH HOH A . 
DA 5 HOH 99  616 318 HOH HOH A . 
DA 5 HOH 100 617 319 HOH HOH A . 
DA 5 HOH 101 618 331 HOH HOH A . 
DA 5 HOH 102 619 336 HOH HOH A . 
DA 5 HOH 103 620 365 HOH HOH A . 
DA 5 HOH 104 621 366 HOH HOH A . 
DA 5 HOH 105 622 367 HOH HOH A . 
DA 5 HOH 106 623 368 HOH HOH A . 
DA 5 HOH 107 624 373 HOH HOH A . 
DA 5 HOH 108 625 375 HOH HOH A . 
DA 5 HOH 109 626 376 HOH HOH A . 
DA 5 HOH 110 627 378 HOH HOH A . 
DA 5 HOH 111 628 379 HOH HOH A . 
DA 5 HOH 112 629 380 HOH HOH A . 
DA 5 HOH 113 630 427 HOH HOH A . 
DA 5 HOH 114 631 428 HOH HOH A . 
DA 5 HOH 115 632 429 HOH HOH A . 
DA 5 HOH 116 633 430 HOH HOH A . 
DA 5 HOH 117 634 442 HOH HOH A . 
DA 5 HOH 118 635 443 HOH HOH A . 
EA 5 HOH 1   519 12  HOH HOH B . 
EA 5 HOH 2   520 25  HOH HOH B . 
EA 5 HOH 3   521 28  HOH HOH B . 
EA 5 HOH 4   522 29  HOH HOH B . 
EA 5 HOH 5   523 30  HOH HOH B . 
EA 5 HOH 6   524 32  HOH HOH B . 
EA 5 HOH 7   525 34  HOH HOH B . 
EA 5 HOH 8   526 36  HOH HOH B . 
EA 5 HOH 9   527 42  HOH HOH B . 
EA 5 HOH 10  528 43  HOH HOH B . 
EA 5 HOH 11  529 45  HOH HOH B . 
EA 5 HOH 12  530 48  HOH HOH B . 
EA 5 HOH 13  531 55  HOH HOH B . 
EA 5 HOH 14  532 57  HOH HOH B . 
EA 5 HOH 15  533 58  HOH HOH B . 
EA 5 HOH 16  534 60  HOH HOH B . 
EA 5 HOH 17  535 64  HOH HOH B . 
EA 5 HOH 18  536 65  HOH HOH B . 
EA 5 HOH 19  537 66  HOH HOH B . 
EA 5 HOH 20  538 67  HOH HOH B . 
EA 5 HOH 21  539 74  HOH HOH B . 
EA 5 HOH 22  540 77  HOH HOH B . 
EA 5 HOH 23  541 82  HOH HOH B . 
EA 5 HOH 24  542 84  HOH HOH B . 
EA 5 HOH 25  543 86  HOH HOH B . 
EA 5 HOH 26  544 91  HOH HOH B . 
EA 5 HOH 27  545 94  HOH HOH B . 
EA 5 HOH 28  546 96  HOH HOH B . 
EA 5 HOH 29  547 98  HOH HOH B . 
EA 5 HOH 30  548 103 HOH HOH B . 
EA 5 HOH 31  549 105 HOH HOH B . 
EA 5 HOH 32  550 106 HOH HOH B . 
EA 5 HOH 33  551 108 HOH HOH B . 
EA 5 HOH 34  552 113 HOH HOH B . 
EA 5 HOH 35  553 117 HOH HOH B . 
EA 5 HOH 36  554 118 HOH HOH B . 
EA 5 HOH 37  555 124 HOH HOH B . 
EA 5 HOH 38  556 127 HOH HOH B . 
EA 5 HOH 39  557 131 HOH HOH B . 
EA 5 HOH 40  558 132 HOH HOH B . 
EA 5 HOH 41  559 133 HOH HOH B . 
EA 5 HOH 42  560 144 HOH HOH B . 
EA 5 HOH 43  561 145 HOH HOH B . 
EA 5 HOH 44  562 147 HOH HOH B . 
EA 5 HOH 45  563 148 HOH HOH B . 
EA 5 HOH 46  564 149 HOH HOH B . 
EA 5 HOH 47  565 156 HOH HOH B . 
EA 5 HOH 48  566 163 HOH HOH B . 
EA 5 HOH 49  567 164 HOH HOH B . 
EA 5 HOH 50  568 166 HOH HOH B . 
EA 5 HOH 51  569 168 HOH HOH B . 
EA 5 HOH 52  570 170 HOH HOH B . 
EA 5 HOH 53  571 175 HOH HOH B . 
EA 5 HOH 54  572 177 HOH HOH B . 
EA 5 HOH 55  573 181 HOH HOH B . 
EA 5 HOH 56  574 186 HOH HOH B . 
EA 5 HOH 57  575 187 HOH HOH B . 
EA 5 HOH 58  576 188 HOH HOH B . 
EA 5 HOH 59  577 189 HOH HOH B . 
EA 5 HOH 60  578 198 HOH HOH B . 
EA 5 HOH 61  579 200 HOH HOH B . 
EA 5 HOH 62  580 206 HOH HOH B . 
EA 5 HOH 63  581 207 HOH HOH B . 
EA 5 HOH 64  582 213 HOH HOH B . 
EA 5 HOH 65  583 214 HOH HOH B . 
EA 5 HOH 66  584 215 HOH HOH B . 
EA 5 HOH 67  585 218 HOH HOH B . 
EA 5 HOH 68  586 219 HOH HOH B . 
EA 5 HOH 69  587 222 HOH HOH B . 
EA 5 HOH 70  588 224 HOH HOH B . 
EA 5 HOH 71  589 225 HOH HOH B . 
EA 5 HOH 72  590 226 HOH HOH B . 
EA 5 HOH 73  591 234 HOH HOH B . 
EA 5 HOH 74  592 236 HOH HOH B . 
EA 5 HOH 75  593 239 HOH HOH B . 
EA 5 HOH 76  594 245 HOH HOH B . 
EA 5 HOH 77  595 247 HOH HOH B . 
EA 5 HOH 78  596 249 HOH HOH B . 
EA 5 HOH 79  597 250 HOH HOH B . 
EA 5 HOH 80  598 252 HOH HOH B . 
EA 5 HOH 81  599 253 HOH HOH B . 
EA 5 HOH 82  600 255 HOH HOH B . 
EA 5 HOH 83  601 256 HOH HOH B . 
EA 5 HOH 84  602 259 HOH HOH B . 
EA 5 HOH 85  603 262 HOH HOH B . 
EA 5 HOH 86  604 263 HOH HOH B . 
EA 5 HOH 87  605 264 HOH HOH B . 
EA 5 HOH 88  606 265 HOH HOH B . 
EA 5 HOH 89  607 269 HOH HOH B . 
EA 5 HOH 90  608 271 HOH HOH B . 
EA 5 HOH 91  609 272 HOH HOH B . 
EA 5 HOH 92  610 274 HOH HOH B . 
EA 5 HOH 93  611 276 HOH HOH B . 
EA 5 HOH 94  612 277 HOH HOH B . 
EA 5 HOH 95  613 284 HOH HOH B . 
EA 5 HOH 96  614 285 HOH HOH B . 
EA 5 HOH 97  615 289 HOH HOH B . 
EA 5 HOH 98  616 290 HOH HOH B . 
EA 5 HOH 99  617 291 HOH HOH B . 
EA 5 HOH 100 618 306 HOH HOH B . 
EA 5 HOH 101 619 310 HOH HOH B . 
EA 5 HOH 102 620 311 HOH HOH B . 
EA 5 HOH 103 621 320 HOH HOH B . 
EA 5 HOH 104 622 321 HOH HOH B . 
EA 5 HOH 105 623 322 HOH HOH B . 
EA 5 HOH 106 624 323 HOH HOH B . 
EA 5 HOH 107 625 324 HOH HOH B . 
EA 5 HOH 108 626 325 HOH HOH B . 
EA 5 HOH 109 627 326 HOH HOH B . 
EA 5 HOH 110 628 328 HOH HOH B . 
EA 5 HOH 111 629 329 HOH HOH B . 
EA 5 HOH 112 630 330 HOH HOH B . 
EA 5 HOH 113 631 339 HOH HOH B . 
EA 5 HOH 114 632 340 HOH HOH B . 
EA 5 HOH 115 633 369 HOH HOH B . 
EA 5 HOH 116 634 381 HOH HOH B . 
EA 5 HOH 117 635 382 HOH HOH B . 
EA 5 HOH 118 636 383 HOH HOH B . 
EA 5 HOH 119 637 384 HOH HOH B . 
EA 5 HOH 120 638 385 HOH HOH B . 
EA 5 HOH 121 639 387 HOH HOH B . 
EA 5 HOH 122 640 388 HOH HOH B . 
EA 5 HOH 123 641 389 HOH HOH B . 
EA 5 HOH 124 642 392 HOH HOH B . 
EA 5 HOH 125 643 393 HOH HOH B . 
EA 5 HOH 126 644 394 HOH HOH B . 
EA 5 HOH 127 645 395 HOH HOH B . 
EA 5 HOH 128 646 396 HOH HOH B . 
EA 5 HOH 129 647 397 HOH HOH B . 
EA 5 HOH 130 648 398 HOH HOH B . 
EA 5 HOH 131 649 399 HOH HOH B . 
EA 5 HOH 132 650 400 HOH HOH B . 
EA 5 HOH 133 651 401 HOH HOH B . 
EA 5 HOH 134 652 404 HOH HOH B . 
EA 5 HOH 135 653 405 HOH HOH B . 
EA 5 HOH 136 654 406 HOH HOH B . 
EA 5 HOH 137 655 407 HOH HOH B . 
EA 5 HOH 138 656 408 HOH HOH B . 
EA 5 HOH 139 657 409 HOH HOH B . 
EA 5 HOH 140 658 410 HOH HOH B . 
EA 5 HOH 141 659 411 HOH HOH B . 
EA 5 HOH 142 660 425 HOH HOH B . 
EA 5 HOH 143 661 431 HOH HOH B . 
EA 5 HOH 144 662 432 HOH HOH B . 
EA 5 HOH 145 663 438 HOH HOH B . 
EA 5 HOH 146 664 439 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OP2   A D  A   1   ? F A   17  ? 1_555 77.1  ? 
2   "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 94.1  ? 
3   OP2   A D  A   1   ? F A   17  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 89.6  ? 
4   "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 165.8 ? 
5   OP2   A D  A   1   ? F A   17  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 91.1  ? 
6   OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 93.8  ? 
7   "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 80.6  ? 
8   OP2   A D  A   1   ? F A   17  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 5.8   ? 
9   OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 93.9  ? 
10  OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 87.1  ? 
11  "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? Z  HOH .   ? C HOH 522 ? 1_555 83.6  ? 
12  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? Z  HOH .   ? C HOH 522 ? 1_555 97.8  ? 
13  OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? Z  HOH .   ? C HOH 522 ? 1_555 171.5 ? 
14  OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? Z  HOH .   ? C HOH 522 ? 1_555 90.2  ? 
15  O     B Z  HOH .   ? C HOH 523 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? Z  HOH .   ? C HOH 522 ? 1_555 93.8  ? 
16  "O3'" ? A  G   11  ? C G   12  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 97.9  ? 
17  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 173.2 ? 
18  OD1   ? F  ASP 44  ? B ASP 44  ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 86.1  ? 
19  OE2   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 94.4  ? 
20  O     B Z  HOH .   ? C HOH 523 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 178.5 ? 
21  O     ? Z  HOH .   ? C HOH 522 ? 1_555 MG ? T MG . ? B MG 507 ? 1_555 O     ? EA HOH .   ? B HOH 520 ? 1_555 86.1  ? 
22  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OP2   A B  A   1   ? E A   17  ? 1_555 64.6  ? 
23  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 85.2  ? 
24  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 149.8 ? 
25  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 153.8 ? 
26  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 89.5  ? 
27  OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 120.4 ? 
28  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 74.7  ? 
29  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 11.6  ? 
30  OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 158.5 ? 
31  OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 79.2  ? 
32  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     ? DA HOH .   ? A HOH 520 ? 1_555 79.8  ? 
33  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     ? DA HOH .   ? A HOH 520 ? 1_555 94.5  ? 
34  OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     ? DA HOH .   ? A HOH 520 ? 1_555 81.2  ? 
35  OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     ? DA HOH .   ? A HOH 520 ? 1_555 107.6 ? 
36  O     B DA HOH .   ? A HOH 519 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     ? DA HOH .   ? A HOH 520 ? 1_555 102.4 ? 
37  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 102.5 ? 
38  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 91.8  ? 
39  OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 93.0  ? 
40  OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 72.9  ? 
41  O     B DA HOH .   ? A HOH 519 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 84.0  ? 
42  O     ? DA HOH .   ? A HOH 520 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     B DA HOH .   ? A HOH 531 ? 1_555 173.6 ? 
43  OP1   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 56.8  ? 
44  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 82.3  ? 
45  OE2   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 79.4  ? 
46  OE1   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 118.7 ? 
47  O     B DA HOH .   ? A HOH 519 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 83.1  ? 
48  O     ? DA HOH .   ? A HOH 520 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 133.4 ? 
49  O     B DA HOH .   ? A HOH 531 ? 1_555 MG ? O MG . ? A MG 502 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 47.1  ? 
50  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 "O3'" ? C  G   11  ? D G   12  ? 1_555 74.1  ? 
51  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 87.3  ? 
52  "O3'" ? C  G   11  ? D G   12  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 91.9  ? 
53  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 99.0  ? 
54  "O3'" ? C  G   11  ? D G   12  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 167.3 ? 
55  OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 98.5  ? 
56  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? DA HOH .   ? A HOH 518 ? 1_555 168.4 ? 
57  "O3'" ? C  G   11  ? D G   12  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? DA HOH .   ? A HOH 518 ? 1_555 94.8  ? 
58  OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? DA HOH .   ? A HOH 518 ? 1_555 89.7  ? 
59  OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? DA HOH .   ? A HOH 518 ? 1_555 92.5  ? 
60  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? BA HOH .   ? D HOH 517 ? 1_555 100.4 ? 
61  "O3'" ? C  G   11  ? D G   12  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? BA HOH .   ? D HOH 517 ? 1_555 81.4  ? 
62  OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? BA HOH .   ? D HOH 517 ? 1_555 167.9 ? 
63  OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? BA HOH .   ? D HOH 517 ? 1_555 89.5  ? 
64  O     ? DA HOH .   ? A HOH 518 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     ? BA HOH .   ? D HOH 517 ? 1_555 80.9  ? 
65  OP2   A B  A   1   ? E A   17  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 13.5  ? 
66  "O3'" ? C  G   11  ? D G   12  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 84.6  ? 
67  OD1   ? E  ASP 44  ? A ASP 44  ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 95.4  ? 
68  OE2   ? E  GLU 110 ? A GLU 110 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 87.2  ? 
69  O     ? DA HOH .   ? A HOH 518 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 174.9 ? 
70  O     ? BA HOH .   ? D HOH 517 ? 1_555 MG ? N MG . ? A MG 501 ? 1_555 O     B DA HOH .   ? A HOH 519 ? 1_555 94.0  ? 
71  OP2   A B  G   2   ? E G   18  ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 511 ? 1_555 97.4  ? 
72  OP2   A B  G   2   ? E G   18  ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 510 ? 1_555 167.2 ? 
73  O     ? AA HOH .   ? E HOH 511 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 510 ? 1_555 93.6  ? 
74  OP2   A B  G   2   ? E G   18  ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 512 ? 1_555 84.8  ? 
75  O     ? AA HOH .   ? E HOH 511 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 512 ? 1_555 176.9 ? 
76  O     ? AA HOH .   ? E HOH 510 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 512 ? 1_555 84.4  ? 
77  OP2   A B  G   2   ? E G   18  ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 509 ? 1_555 98.6  ? 
78  O     ? AA HOH .   ? E HOH 511 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 509 ? 1_555 91.8  ? 
79  O     ? AA HOH .   ? E HOH 510 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 509 ? 1_555 87.4  ? 
80  O     ? AA HOH .   ? E HOH 512 ? 1_555 MG A I MG . ? E MG 505 ? 1_555 O     ? AA HOH .   ? E HOH 509 ? 1_555 85.8  ? 
81  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OP2   A D  A   1   ? F A   17  ? 1_555 68.7  ? 
82  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 85.2  ? 
83  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 152.2 ? 
84  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 154.7 ? 
85  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 86.9  ? 
86  OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 117.5 ? 
87  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 45.9  ? 
88  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 79.6  ? 
89  OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 75.4  ? 
90  OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 125.2 ? 
91  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 104.1 ? 
92  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 88.9  ? 
93  OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 88.5  ? 
94  OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 67.7  ? 
95  O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 59.3  ? 
96  OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 81.1  ? 
97  OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 97.3  ? 
98  OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 87.3  ? 
99  OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 109.5 ? 
100 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 124.6 ? 
101 O     B EA HOH .   ? B HOH 530 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     ? CA HOH .   ? F HOH 514 ? 1_555 173.1 ? 
102 OP1   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 73.8  ? 
103 OP2   A D  A   1   ? F A   17  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 6.3   ? 
104 OE2   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 155.2 ? 
105 OE1   ? F  GLU 110 ? B GLU 110 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 81.4  ? 
106 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 80.5  ? 
107 O     B EA HOH .   ? B HOH 530 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 84.0  ? 
108 O     ? CA HOH .   ? F HOH 514 ? 1_555 MG ? U MG . ? B MG 508 ? 1_555 O     B Z  HOH .   ? C HOH 523 ? 1_555 101.9 ? 
109 OP2   A D  G   2   ? F G   18  ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 520 ? 1_555 77.8  ? 
110 OP2   A D  G   2   ? F G   18  ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 517 ? 1_555 97.7  ? 
111 O     ? CA HOH .   ? F HOH 520 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 517 ? 1_555 87.9  ? 
112 OP2   A D  G   2   ? F G   18  ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 518 ? 1_555 160.0 ? 
113 O     ? CA HOH .   ? F HOH 520 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 518 ? 1_555 82.2  ? 
114 O     ? CA HOH .   ? F HOH 517 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 518 ? 1_555 81.8  ? 
115 OP2   A D  G   2   ? F G   18  ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 519 ? 1_555 109.0 ? 
116 O     ? CA HOH .   ? F HOH 520 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 519 ? 1_555 173.0 ? 
117 O     ? CA HOH .   ? F HOH 517 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 519 ? 1_555 89.0  ? 
118 O     ? CA HOH .   ? F HOH 518 ? 1_555 MG A L MG . ? F MG 511 ? 1_555 O     ? CA HOH .   ? F HOH 519 ? 1_555 91.1  ? 
119 OE1   ? E  GLU 37  ? A GLU 37  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 OE1   ? E  GLU 40  ? A GLU 40  ? 1_555 96.0  ? 
120 OE1   ? E  GLU 37  ? A GLU 37  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? AA HOH .   ? E HOH 508 ? 1_555 174.0 ? 
121 OE1   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? AA HOH .   ? E HOH 508 ? 1_555 87.4  ? 
122 OE1   ? E  GLU 37  ? A GLU 37  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 525 ? 1_555 85.3  ? 
123 OE1   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 525 ? 1_555 88.2  ? 
124 O     ? AA HOH .   ? E HOH 508 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 525 ? 1_555 90.0  ? 
125 OE1   ? E  GLU 37  ? A GLU 37  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 524 ? 1_555 92.9  ? 
126 OE1   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 524 ? 1_555 87.8  ? 
127 O     ? AA HOH .   ? E HOH 508 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 524 ? 1_555 92.1  ? 
128 O     ? DA HOH .   ? A HOH 525 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? DA HOH .   ? A HOH 524 ? 1_555 175.3 ? 
129 OE1   ? E  GLU 37  ? A GLU 37  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? EA HOH .   ? B HOH 519 ? 1_555 87.3  ? 
130 OE1   ? E  GLU 40  ? A GLU 40  ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? EA HOH .   ? B HOH 519 ? 1_555 176.6 ? 
131 O     ? AA HOH .   ? E HOH 508 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? EA HOH .   ? B HOH 519 ? 1_555 89.2  ? 
132 O     ? DA HOH .   ? A HOH 525 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? EA HOH .   ? B HOH 519 ? 1_555 91.7  ? 
133 O     ? DA HOH .   ? A HOH 524 ? 1_555 MG ? Q MG . ? A MG 504 ? 1_555 O     ? EA HOH .   ? B HOH 519 ? 1_555 92.6  ? 
134 OD1   ? E  ASP 107 ? A ASP 107 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     A DA HOH .   ? A HOH 523 ? 1_555 102.1 ? 
135 OD1   ? E  ASP 107 ? A ASP 107 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? AA HOH .   ? E HOH 507 ? 1_555 161.5 ? 
136 O     A DA HOH .   ? A HOH 523 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? AA HOH .   ? E HOH 507 ? 1_555 96.3  ? 
137 OD1   ? E  ASP 107 ? A ASP 107 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 88.7  ? 
138 O     A DA HOH .   ? A HOH 523 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 95.9  ? 
139 O     ? AA HOH .   ? E HOH 507 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     A AA HOH .   ? E HOH 506 ? 1_555 91.3  ? 
140 OD1   ? E  ASP 107 ? A ASP 107 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 521 ? 1_555 87.7  ? 
141 O     A DA HOH .   ? A HOH 523 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 521 ? 1_555 85.3  ? 
142 O     ? AA HOH .   ? E HOH 507 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 521 ? 1_555 92.0  ? 
143 O     A AA HOH .   ? E HOH 506 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 521 ? 1_555 176.4 ? 
144 OD1   ? E  ASP 107 ? A ASP 107 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 522 ? 1_555 73.9  ? 
145 O     A DA HOH .   ? A HOH 523 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 522 ? 1_555 175.3 ? 
146 O     ? AA HOH .   ? E HOH 507 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 522 ? 1_555 87.6  ? 
147 O     A AA HOH .   ? E HOH 506 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 522 ? 1_555 86.6  ? 
148 O     ? DA HOH .   ? A HOH 521 ? 1_555 MG A P MG . ? A MG 503 ? 1_555 O     ? DA HOH .   ? A HOH 522 ? 1_555 92.0  ? 
149 OE1   ? F  GLU 37  ? B GLU 37  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 OE1   ? F  GLU 40  ? B GLU 40  ? 1_555 95.9  ? 
150 OE1   ? F  GLU 37  ? B GLU 37  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? DA HOH .   ? A HOH 530 ? 1_555 86.3  ? 
151 OE1   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? DA HOH .   ? A HOH 530 ? 1_555 177.3 ? 
152 OE1   ? F  GLU 37  ? B GLU 37  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 525 ? 1_555 97.1  ? 
153 OE1   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 525 ? 1_555 92.7  ? 
154 O     ? DA HOH .   ? A HOH 530 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 525 ? 1_555 85.5  ? 
155 OE1   ? F  GLU 37  ? B GLU 37  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 526 ? 1_555 77.8  ? 
156 OE1   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 526 ? 1_555 89.2  ? 
157 O     ? DA HOH .   ? A HOH 530 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 526 ? 1_555 92.8  ? 
158 O     ? EA HOH .   ? B HOH 525 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? EA HOH .   ? B HOH 526 ? 1_555 174.8 ? 
159 OE1   ? F  GLU 37  ? B GLU 37  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? CA HOH .   ? F HOH 516 ? 1_555 169.0 ? 
160 OE1   ? F  GLU 40  ? B GLU 40  ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? CA HOH .   ? F HOH 516 ? 1_555 88.1  ? 
161 O     ? DA HOH .   ? A HOH 530 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? CA HOH .   ? F HOH 516 ? 1_555 90.0  ? 
162 O     ? EA HOH .   ? B HOH 525 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? CA HOH .   ? F HOH 516 ? 1_555 92.9  ? 
163 O     ? EA HOH .   ? B HOH 526 ? 1_555 MG ? W MG . ? B MG 510 ? 1_555 O     ? CA HOH .   ? F HOH 516 ? 1_555 92.0  ? 
164 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? EA HOH .   ? B HOH 523 ? 1_555 80.5  ? 
165 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 92.7  ? 
166 O     ? EA HOH .   ? B HOH 523 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     B EA HOH .   ? B HOH 521 ? 1_555 85.9  ? 
167 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 71.4  ? 
168 O     ? EA HOH .   ? B HOH 523 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 134.6 ? 
169 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     B EA HOH .   ? B HOH 530 ? 1_555 61.4  ? 
170 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? EA HOH .   ? B HOH 522 ? 1_555 85.0  ? 
171 O     ? EA HOH .   ? B HOH 523 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? EA HOH .   ? B HOH 522 ? 1_555 90.3  ? 
172 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? EA HOH .   ? B HOH 522 ? 1_555 175.8 ? 
173 O     B EA HOH .   ? B HOH 530 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? EA HOH .   ? B HOH 522 ? 1_555 120.9 ? 
174 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     A EA HOH .   ? B HOH 524 ? 1_555 97.7  ? 
175 O     ? EA HOH .   ? B HOH 523 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     A EA HOH .   ? B HOH 524 ? 1_555 172.3 ? 
176 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     A EA HOH .   ? B HOH 524 ? 1_555 101.8 ? 
177 O     B EA HOH .   ? B HOH 530 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     A EA HOH .   ? B HOH 524 ? 1_555 50.5  ? 
178 O     ? EA HOH .   ? B HOH 522 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     A EA HOH .   ? B HOH 524 ? 1_555 82.1  ? 
179 OD1   ? F  ASP 107 ? B ASP 107 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 165.5 ? 
180 O     ? EA HOH .   ? B HOH 523 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 85.0  ? 
181 O     B EA HOH .   ? B HOH 521 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 86.3  ? 
182 O     B EA HOH .   ? B HOH 530 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 120.1 ? 
183 O     ? EA HOH .   ? B HOH 522 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 95.1  ? 
184 O     A EA HOH .   ? B HOH 524 ? 1_555 MG ? V MG . ? B MG 509 ? 1_555 O     ? CA HOH .   ? F HOH 515 ? 1_555 96.6  ? 
185 O     ? DA HOH .   ? A HOH 529 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 527 ? 1_555 95.4  ? 
186 O     ? DA HOH .   ? A HOH 529 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 528 ? 1_555 86.6  ? 
187 O     ? DA HOH .   ? A HOH 527 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 528 ? 1_555 89.0  ? 
188 O     ? DA HOH .   ? A HOH 529 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 526 ? 1_555 95.9  ? 
189 O     ? DA HOH .   ? A HOH 527 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 526 ? 1_555 89.0  ? 
190 O     ? DA HOH .   ? A HOH 528 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? DA HOH .   ? A HOH 526 ? 1_555 176.9 ? 
191 O     ? DA HOH .   ? A HOH 529 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 520 ? 1_555 86.5  ? 
192 O     ? DA HOH .   ? A HOH 527 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 520 ? 1_555 176.3 ? 
193 O     ? DA HOH .   ? A HOH 528 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 520 ? 1_555 94.2  ? 
194 O     ? DA HOH .   ? A HOH 526 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 520 ? 1_555 87.7  ? 
195 O     ? DA HOH .   ? A HOH 529 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 521 ? 1_555 173.4 ? 
196 O     ? DA HOH .   ? A HOH 527 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 521 ? 1_555 87.0  ? 
197 O     ? DA HOH .   ? A HOH 528 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 521 ? 1_555 87.3  ? 
198 O     ? DA HOH .   ? A HOH 526 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 521 ? 1_555 90.2  ? 
199 O     ? Z  HOH .   ? C HOH 520 ? 1_555 MG ? R MG . ? A MG 506 ? 1_555 O     ? Z  HOH .   ? C HOH 521 ? 1_555 91.4  ? 
200 O     ? BA HOH .   ? D HOH 563 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? BA HOH .   ? D HOH 519 ? 1_555 91.3  ? 
201 O     ? BA HOH .   ? D HOH 563 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 528 ? 1_555 89.8  ? 
202 O     ? BA HOH .   ? D HOH 519 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 528 ? 1_555 96.4  ? 
203 O     ? BA HOH .   ? D HOH 563 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? BA HOH .   ? D HOH 518 ? 1_555 92.6  ? 
204 O     ? BA HOH .   ? D HOH 519 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? BA HOH .   ? D HOH 518 ? 1_555 90.6  ? 
205 O     ? EA HOH .   ? B HOH 528 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? BA HOH .   ? D HOH 518 ? 1_555 172.5 ? 
206 O     ? BA HOH .   ? D HOH 563 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 527 ? 1_555 97.2  ? 
207 O     ? BA HOH .   ? D HOH 519 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 527 ? 1_555 171.1 ? 
208 O     ? EA HOH .   ? B HOH 528 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 527 ? 1_555 86.4  ? 
209 O     ? BA HOH .   ? D HOH 518 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 527 ? 1_555 86.3  ? 
210 O     ? BA HOH .   ? D HOH 563 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 529 ? 1_555 175.8 ? 
211 O     ? BA HOH .   ? D HOH 519 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 529 ? 1_555 85.0  ? 
212 O     ? EA HOH .   ? B HOH 528 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 529 ? 1_555 92.6  ? 
213 O     ? BA HOH .   ? D HOH 518 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 529 ? 1_555 85.5  ? 
214 O     ? EA HOH .   ? B HOH 527 ? 1_555 MG ? X MG . ? B MG 512 ? 1_555 O     ? EA HOH .   ? B HOH 529 ? 1_555 86.4  ? 
215 O     ? CA HOH .   ? F HOH 545 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 542 ? 1_555 94.8  ? 
216 O     ? CA HOH .   ? F HOH 545 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 544 ? 1_555 87.7  ? 
217 O     ? CA HOH .   ? F HOH 542 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 544 ? 1_555 166.3 ? 
218 O     ? CA HOH .   ? F HOH 545 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 543 ? 1_555 90.8  ? 
219 O     ? CA HOH .   ? F HOH 542 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 543 ? 1_555 81.4  ? 
220 O     ? CA HOH .   ? F HOH 544 ? 1_555 MG ? M MG . ? F MG 513 ? 1_555 O     ? CA HOH .   ? F HOH 543 ? 1_555 85.1  ? 
221 O     ? BA HOH .   ? D HOH 529 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 550 ? 1_555 93.6  ? 
222 O     ? BA HOH .   ? D HOH 529 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 551 ? 1_555 82.2  ? 
223 O     ? BA HOH .   ? D HOH 550 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 551 ? 1_555 168.8 ? 
224 O     ? BA HOH .   ? D HOH 529 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 552 ? 1_555 172.4 ? 
225 O     ? BA HOH .   ? D HOH 550 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 552 ? 1_555 81.1  ? 
226 O     ? BA HOH .   ? D HOH 551 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 552 ? 1_555 103.9 ? 
227 O     ? BA HOH .   ? D HOH 529 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 533 ? 1_555 88.8  ? 
228 O     ? BA HOH .   ? D HOH 550 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 533 ? 1_555 110.5 ? 
229 O     ? BA HOH .   ? D HOH 551 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 533 ? 1_555 79.9  ? 
230 O     ? BA HOH .   ? D HOH 552 ? 1_555 MG ? J MG . ? D MG 514 ? 1_555 O     ? BA HOH .   ? D HOH 533 ? 1_555 88.0  ? 
231 O     ? Z  HOH .   ? C HOH 538 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 559 ? 1_555 85.1  ? 
232 O     ? Z  HOH .   ? C HOH 538 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 535 ? 1_555 90.8  ? 
233 O     ? Z  HOH .   ? C HOH 559 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 535 ? 1_555 155.8 ? 
234 O     ? Z  HOH .   ? C HOH 538 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 563 ? 1_555 104.9 ? 
235 O     ? Z  HOH .   ? C HOH 559 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 563 ? 1_555 75.1  ? 
236 O     ? Z  HOH .   ? C HOH 535 ? 1_555 MG ? G MG . ? C MG 515 ? 1_555 O     ? Z  HOH .   ? C HOH 563 ? 1_555 83.1  ? 
237 O     ? BA HOH .   ? D HOH 531 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 522 ? 1_555 104.6 ? 
238 O     ? BA HOH .   ? D HOH 531 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 535 ? 1_555 66.8  ? 
239 O     ? BA HOH .   ? D HOH 522 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 535 ? 1_555 108.7 ? 
240 O     ? BA HOH .   ? D HOH 531 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 513 ? 1_555 166.1 ? 
241 O     ? BA HOH .   ? D HOH 522 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 513 ? 1_555 64.0  ? 
242 O     ? BA HOH .   ? D HOH 535 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 513 ? 1_555 123.3 ? 
243 O     ? BA HOH .   ? D HOH 531 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 526 ? 1_555 107.2 ? 
244 O     ? BA HOH .   ? D HOH 522 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 526 ? 1_555 90.7  ? 
245 O     ? BA HOH .   ? D HOH 535 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 526 ? 1_555 160.6 ? 
246 O     ? AA HOH .   ? E HOH 513 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? AA HOH .   ? E HOH 526 ? 1_555 66.5  ? 
247 O     ? BA HOH .   ? D HOH 531 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 562 ? 1_555 123.2 ? 
248 O     ? BA HOH .   ? D HOH 522 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 562 ? 1_555 76.5  ? 
249 O     ? BA HOH .   ? D HOH 535 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 562 ? 1_555 59.9  ? 
250 O     ? AA HOH .   ? E HOH 513 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 562 ? 1_555 64.0  ? 
251 O     ? AA HOH .   ? E HOH 526 ? 1_555 MG ? K MG . ? D MG 516 ? 1_555 O     ? BA HOH .   ? D HOH 562 ? 1_555 129.6 ? 
252 O     ? DA HOH .   ? A HOH 632 ? 1_555 MG ? S MG . ? A MG 517 ? 1_555 O     ? DA HOH .   ? A HOH 620 ? 1_555 169.4 ? 
253 O     ? DA HOH .   ? A HOH 632 ? 1_555 MG ? S MG . ? A MG 517 ? 1_555 O     ? DA HOH .   ? A HOH 534 ? 1_555 105.6 ? 
254 O     ? DA HOH .   ? A HOH 620 ? 1_555 MG ? S MG . ? A MG 517 ? 1_555 O     ? DA HOH .   ? A HOH 534 ? 1_555 83.6  ? 
255 O     ? EA HOH .   ? B HOH 657 ? 1_555 MG ? Y MG . ? B MG 518 ? 1_555 O     ? EA HOH .   ? B HOH 561 ? 1_555 92.3  ? 
256 O     ? EA HOH .   ? B HOH 657 ? 1_555 MG ? Y MG . ? B MG 518 ? 1_555 O     ? EA HOH .   ? B HOH 538 ? 1_555 133.5 ? 
257 O     ? EA HOH .   ? B HOH 561 ? 1_555 MG ? Y MG . ? B MG 518 ? 1_555 O     ? EA HOH .   ? B HOH 538 ? 1_555 111.0 ? 
258 O     ? Z  HOH .   ? C HOH 546 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 562 ? 1_555 113.1 ? 
259 O     ? Z  HOH .   ? C HOH 546 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 530 ? 1_555 164.3 ? 
260 O     ? Z  HOH .   ? C HOH 562 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 530 ? 1_555 60.0  ? 
261 O     ? Z  HOH .   ? C HOH 546 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 526 ? 1_555 83.9  ? 
262 O     ? Z  HOH .   ? C HOH 562 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 526 ? 1_555 77.0  ? 
263 O     ? Z  HOH .   ? C HOH 530 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 526 ? 1_555 106.7 ? 
264 O     ? Z  HOH .   ? C HOH 546 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 540 ? 1_555 114.8 ? 
265 O     ? Z  HOH .   ? C HOH 562 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 540 ? 1_555 131.8 ? 
266 O     ? Z  HOH .   ? C HOH 530 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 540 ? 1_555 72.4  ? 
267 O     ? Z  HOH .   ? C HOH 526 ? 1_555 MG ? H MG . ? C MG 519 ? 1_555 O     ? Z  HOH .   ? C HOH 540 ? 1_555 112.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.0 ? 1 
MAR345   'data collection' .   ? 2 
HKL-2000 'data reduction'  .   ? 3 
HKL-2000 'data scaling'    .   ? 4 
PHASER   phasing           .   ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C A 2  ? ? OP3   C A 2  ? ? 1.522 1.607 -0.085 0.012 N 
2 1 P E A 17 ? A OP3   E A 17 ? A 1.511 1.607 -0.096 0.012 N 
3 1 P E A 17 ? B OP3   E A 17 ? B 1.517 1.607 -0.090 0.012 N 
4 1 P D A 2  ? ? OP3   D A 2  ? ? 1.523 1.607 -0.084 0.012 N 
5 1 P F A 17 ? B OP3   F A 17 ? B 1.514 1.607 -0.093 0.012 N 
6 1 P F A 17 ? A "O5'" F A 17 ? A 1.660 1.593 0.067  0.010 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 OP1   E A 17 ? A P     E A 17 ? A OP2   E A 17 ? A 109.40 119.60 -10.20 1.50 N 
2 1 OP1   F A 17 ? A P     F A 17 ? A OP2   F A 17 ? A 110.12 119.60 -9.48  1.50 N 
3 1 "O5'" F A 17 ? A P     F A 17 ? A OP2   F A 17 ? A 118.16 110.70 7.46   1.20 N 
4 1 "O3'" F A 17 ? A P     F G 18 ? A OP2   F G 18 ? A 121.05 110.50 10.55  1.10 Y 
5 1 N9    F G 18 ? A "C1'" F G 18 ? A "C2'" F G 18 ? A 105.15 112.00 -6.85  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 59  ? ? -155.30 56.21   
2 1 LYS A 181 ? ? -150.53 50.02   
3 1 LYS A 191 ? ? 55.32   -127.95 
4 1 SER B 59  ? ? -155.98 55.38   
5 1 LYS B 181 ? ? -150.69 49.30   
6 1 LYS B 191 ? ? 54.65   -128.33 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? E MET 1   
2 1 Y 1 A LYS 2   ? E LYS 2   
3 1 Y 1 A GLU 219 ? E GLU 219 
4 1 Y 1 A SER 220 ? E SER 220 
5 1 Y 1 A GLU 221 ? E GLU 221 
6 1 Y 1 B MET 1   ? F MET 1   
7 1 Y 1 B LYS 2   ? F LYS 2   
8 1 Y 1 B GLU 221 ? F GLU 221 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2NUG 'a-form double helix'  
2NUG 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A A 1  1_555 B U 9  1_555 -0.166 -0.239 -0.015 -2.386  -12.961 1.878  1  C_A2:U25_E  C 2  ? E 25 ? 20 1 
1 A A 2  1_555 B U 8  1_555 -0.001 -0.128 0.071  -2.934  -7.249  2.720  2  C_A3:U24_E  C 3  ? E 24 ? 20 1 
1 A G 3  1_555 B C 7  1_555 -0.162 -0.189 -0.028 -1.047  -5.059  -0.334 3  C_G4:C23_E  C 4  ? E 23 ? 19 1 
1 A G 4  1_555 B C 6  1_555 -0.207 -0.146 -0.042 -5.629  -12.546 1.621  4  C_G5:C22_E  C 5  ? E 22 ? 19 1 
1 A U 5  1_555 B G 5  1_555 2.059  -0.512 0.116  -8.594  -10.830 0.234  5  C_U6:G21_E  C 6  ? E 21 ? 28 1 
1 A C 6  1_555 B G 4  1_555 0.343  -0.147 0.106  -7.950  -9.932  0.343  6  C_C7:G20_E  C 7  ? E 20 ? 19 1 
1 A A 7  1_555 B U 3  1_555 0.119  -0.088 0.099  -4.854  -9.146  1.693  7  C_A8:U19_E  C 8  ? E 19 ? 20 1 
1 A U 8  1_555 B G 2  1_555 2.033  -0.402 -0.030 2.363   -5.581  1.316  8  C_U9:G18_E  C 9  ? E 18 ? 28 1 
1 A U 9  1_555 B A 1  1_555 0.228  -0.033 -0.558 15.008  -7.407  3.697  9  C_U10:A17_E C 10 ? E 17 ? 20 1 
1 A C 10 1_555 C G 11 1_555 0.266  -0.146 -0.213 8.825   -14.022 2.070  10 C_C11:G12_D C 11 ? D 12 ? 19 1 
1 A G 11 1_555 C C 10 1_555 -0.272 -0.146 -0.245 -9.110  -14.273 2.192  11 C_G12:C11_D C 12 ? D 11 ? 19 1 
1 D A 1  1_555 C U 9  1_555 -0.367 -0.069 -0.383 -17.997 -8.114  2.013  12 F_A17:U10_D F 17 ? D 10 ? 20 1 
1 D G 2  1_555 C U 8  1_555 -2.134 -0.456 -0.009 -2.366  -5.596  1.211  13 F_G18:U9_D  F 18 ? D 9  ? 28 1 
1 D U 3  1_555 C A 7  1_555 -0.121 -0.088 0.098  4.558   -8.787  1.857  14 F_U19:A8_D  F 19 ? D 8  ? 20 1 
1 D G 4  1_555 C C 6  1_555 -0.347 -0.154 0.108  7.534   -9.906  0.368  15 F_G20:C7_D  F 20 ? D 7  ? 19 1 
1 D G 5  1_555 C U 5  1_555 -2.050 -0.511 0.117  8.658   -10.540 0.169  16 F_G21:U6_D  F 21 ? D 6  ? 28 1 
1 D C 6  1_555 C G 4  1_555 0.214  -0.144 -0.049 5.699   -12.078 1.640  17 F_C22:G5_D  F 22 ? D 5  ? 19 1 
1 D C 7  1_555 C G 3  1_555 0.153  -0.191 -0.022 0.720   -4.984  -0.444 18 F_C23:G4_D  F 23 ? D 4  ? 19 1 
1 D U 8  1_555 C A 2  1_555 -0.109 0.035  0.110  0.544   -10.173 4.919  19 F_U24:A3_D  F 24 ? D 3  ? 20 1 
1 D U 9  1_555 C A 1  1_555 0.537  -0.302 0.049  0.313   -14.127 -2.232 20 F_U25:A2_D  F 25 ? D 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A A 1  1_555 B U 9  1_555 A A 2  1_555 B U 8  1_555 -0.478 -1.267 3.211 -2.204 5.740  35.624 -2.818 0.473  3.001 9.297  3.570  
36.133 1  CC_A2A3:U24U25_EE   C 2  ? E 25 ? C 3  ? E 24 ? 
1 A A 2  1_555 B U 8  1_555 A G 3  1_555 B C 7  1_555 -0.544 -1.814 3.166 -0.155 7.662  29.678 -4.797 1.002  2.629 14.652 0.297  
30.630 2  CC_A3G4:C23U24_EE   C 3  ? E 24 ? C 4  ? E 23 ? 
1 A G 3  1_555 B C 7  1_555 A G 4  1_555 B C 6  1_555 0.642  -1.914 3.352 1.004  9.595  30.032 -5.208 -1.005 2.649 17.942 -1.878 
31.509 3  CC_G4G5:C22C23_EE   C 4  ? E 23 ? C 5  ? E 22 ? 
1 A G 4  1_555 B C 6  1_555 A U 5  1_555 B G 5  1_555 -0.011 -1.598 3.367 1.114  5.229  41.274 -2.803 0.134  3.149 7.380  -1.572 
41.604 4  CC_G5U6:G21C22_EE   C 5  ? E 22 ? C 6  ? E 21 ? 
1 A U 5  1_555 B G 5  1_555 A C 6  1_555 B G 4  1_555 0.162  -1.601 3.065 4.911  9.545  28.072 -4.789 0.561  2.398 18.829 -9.688 
30.016 5  CC_U6C7:G20G21_EE   C 6  ? E 21 ? C 7  ? E 20 ? 
1 A C 6  1_555 B G 4  1_555 A A 7  1_555 B U 3  1_555 0.805  -1.674 3.125 2.406  11.211 26.540 -5.520 -1.150 2.305 23.098 -4.957 
28.870 6  CC_C7A8:U19G20_EE   C 7  ? E 20 ? C 8  ? E 19 ? 
1 A A 7  1_555 B U 3  1_555 A U 8  1_555 B G 2  1_555 -0.305 -1.308 3.258 0.825  3.429  37.155 -2.487 0.583  3.122 5.367  -1.291 
37.316 7  CC_A8U9:G18U19_EE   C 8  ? E 19 ? C 9  ? E 18 ? 
1 A U 8  1_555 B G 2  1_555 A U 9  1_555 B A 1  1_555 -0.279 -1.961 3.031 2.150  8.168  18.049 -8.726 1.610  1.923 24.380 -6.417 
19.913 8  CC_U9U10:A17G18_EE  C 9  ? E 18 ? C 10 ? E 17 ? 
1 A U 9  1_555 B A 1  1_555 A C 10 1_555 C G 11 1_555 -0.127 -1.840 3.451 -2.117 13.084 33.242 -4.809 -0.086 2.571 21.822 3.531  
35.718 9  CC_U10C11:G12A17_DE C 10 ? E 17 ? C 11 ? D 12 ? 
1 A C 10 1_555 C G 11 1_555 A G 11 1_555 C C 10 1_555 0.010  -1.835 3.727 0.174  15.532 29.200 -5.890 0.012  2.464 28.414 -0.318 
32.994 10 CC_C11G12:C11G12_DD C 11 ? D 12 ? C 12 ? D 11 ? 
1 A G 11 1_555 C C 10 1_555 D A 1  1_555 C U 9  1_555 0.114  -1.896 3.562 1.095  13.234 32.490 -5.105 -0.027 2.617 22.516 -1.863 
35.032 11 CF_G12A17:U10C11_DD C 12 ? D 11 ? F 17 ? D 10 ? 
1 D A 1  1_555 C U 9  1_555 D G 2  1_555 C U 8  1_555 0.333  -1.998 2.910 -1.496 7.894  18.687 -8.385 -1.459 1.884 22.984 4.355  
20.327 12 FF_A17G18:U9U10_DD  F 17 ? D 10 ? F 18 ? D 9  ? 
1 D G 2  1_555 C U 8  1_555 D U 3  1_555 C A 7  1_555 0.360  -1.307 3.249 -0.748 3.522  37.333 -2.482 -0.655 3.110 5.486  1.165  
37.500 13 FF_G18U19:A8U9_DD   F 18 ? D 9  ? F 19 ? D 8  ? 
1 D U 3  1_555 C A 7  1_555 D G 4  1_555 C C 6  1_555 -0.805 -1.672 3.123 -2.479 11.158 26.467 -5.527 1.139  2.307 23.052 5.122  
28.789 14 FF_U19G20:C7A8_DD   F 19 ? D 8  ? F 20 ? D 7  ? 
1 D G 4  1_555 C C 6  1_555 D G 5  1_555 C U 5  1_555 -0.161 -1.615 3.048 -5.043 9.569  28.188 -4.779 -0.572 2.378 18.794 9.906  
30.153 15 FF_G20G21:U6C7_DD   F 20 ? D 7  ? F 21 ? D 6  ? 
1 D G 5  1_555 C U 5  1_555 D C 6  1_555 C G 4  1_555 0.003  -1.612 3.376 -1.067 5.180  41.274 -2.820 -0.118 3.159 7.313  1.507  
41.597 16 FF_G21C22:G5U6_DD   F 21 ? D 6  ? F 22 ? D 5  ? 
1 D C 6  1_555 C G 4  1_555 D C 7  1_555 C G 3  1_555 -0.647 -1.926 3.355 -1.066 9.617  29.933 -5.252 1.007  2.645 18.035 1.999  
31.424 17 FF_C22C23:G4G5_DD   F 22 ? D 5  ? F 23 ? D 4  ? 
1 D C 7  1_555 C G 3  1_555 D U 8  1_555 C A 2  1_555 0.586  -1.858 3.159 0.916  9.215  28.621 -5.252 -0.964 2.471 18.052 -1.795 
30.052 18 FF_C23U24:A3G4_DD   F 23 ? D 4  ? F 24 ? D 3  ? 
1 D U 8  1_555 C A 2  1_555 D U 9  1_555 C A 1  1_555 0.194  -1.143 3.217 1.309  5.602  38.640 -2.359 -0.139 3.033 8.410  -1.966 
39.050 19 FF_U24U25:A2A3_DD   F 24 ? D 3  ? F 25 ? D 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
#