data_2NVT
# 
_entry.id   2NVT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NVT         
NDB   PH0033       
RCSB  RCSB040363   
WWPDB D_1000040363 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SFO . unspecified 
PDB 1R9T . unspecified 
PDB 1R9S . unspecified 
PDB 2E2H . unspecified 
PDB 2E2I . unspecified 
PDB 2E2J . unspecified 
PDB 2NVQ . unspecified 
PDB 2NVS . unspecified 
PDB 2NVX . unspecified 
PDB 2NVY . unspecified 
PDB 2NVZ . unspecified 
# 
_pdbx_database_status.entry_id                        2NVT 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, D.'       1 
'Bushnell, D.A.' 2 
'Westover, K.D.' 3 
'Kaplan, C.D.'   4 
'Kornberg, R.D.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            127 
_citation.page_first                941 
_citation.page_last                 954 
_citation.year                      2006 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17129781 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2006.11.023 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, D.'       1 
primary 'Bushnell, D.A.' 2 
primary 'Westover, K.D.' 3 
primary 'Kaplan, C.D.'   4 
primary 'Kornberg, R.D.' 5 
# 
_cell.length_a           170.872 
_cell.length_b           222.824 
_cell.length_c           195.802 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.39 
_cell.angle_gamma        90.00 
_cell.entry_id           2NVT 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         2NVT 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn "5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'"                                   3223.028   1 ?       ? ? ? 
2  polymer     syn "5'-D(P*CP*AP*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*TP*T)-3'" 6389.133   1 ?       ? ? ? 
3  polymer     syn "5'-D(*GP*TP*AP*CP*TP*TP*G)-3'"                                            2128.421   1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II largest subunit'                           191821.578 1 2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II 140 kDa polypeptide'                       138937.297 1 2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II 45 kDa polypeptide'                        35330.457  1 2.7.7.6 ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide'           25117.094  1 2.7.7.6 ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide'           17931.834  1 2.7.7.6 ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide'         16525.363  1 2.7.7.6 ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit 9'                                 14308.161  1 2.7.7.6 ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I/II/III subunit 10'                         8290.732   1 2.7.7.6 ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II 13.6 kDa polypeptide'                      13633.493  1 2.7.7.6 ? ? ? 
13 polymer     nat 'DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide'          7729.969   1 2.7.7.6 ? ? ? 
14 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER'                             521.208    1 ?       ? ? ? 
15 non-polymer syn 'ZINC ION'                                                                 65.409     8 ?       ? ? ? 
16 non-polymer syn 'MAGNESIUM ION'                                                            24.305     2 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4  'RNA polymerase II subunit 1, B220'                                                   
5  'B150, RNA polymerase II subunit 2'                                                   
6  B44.5                                                                                 
7  ABC27                                                                                 
8  ABC23                                                                                 
9  ABC14.4                                                                               
10 'DNA-directed RNA polymerase II 14.2 kDa polypeptide, B12.6'                          
11 'DNA- directed RNA polymerases I, II, and III 8.3 kDa polypeptide, ABC10- beta, ABC8' 
12 B13.6                                                                                 
13 ABC10-alpha                                                                           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide      no no AAGACCAGGC AAGACCAGGC R ? 
2  polydeoxyribonucleotide no no 
;(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DA)(DC)(DG)(DC)(DC)(DT)(DG)(DG)(DT)(DC)(DT)
(DT)
;
CAAGTACTTACGCCTGGTCTT T ? 
3  polydeoxyribonucleotide no no '(DG)(DT)(DA)(DC)(DT)(DT)(DG)' GTACTTG N ? 
4  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
5  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
6  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
7  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
8  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
9  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
10 'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
11 'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
12 'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
13 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    A   n 
1  3    G   n 
1  4    A   n 
1  5    C   n 
1  6    C   n 
1  7    A   n 
1  8    G   n 
1  9    G   n 
1  10   C   n 
2  1    DC  n 
2  2    DA  n 
2  3    DA  n 
2  4    DG  n 
2  5    DT  n 
2  6    DA  n 
2  7    DC  n 
2  8    DT  n 
2  9    DT  n 
2  10   DA  n 
2  11   DC  n 
2  12   DG  n 
2  13   DC  n 
2  14   DC  n 
2  15   DT  n 
2  16   DG  n 
2  17   DG  n 
2  18   DT  n 
2  19   DC  n 
2  20   DT  n 
2  21   DT  n 
3  1    DG  n 
3  2    DT  n 
3  3    DA  n 
3  4    DC  n 
3  5    DT  n 
3  6    DT  n 
3  7    DG  n 
4  1    MET n 
4  2    VAL n 
4  3    GLY n 
4  4    GLN n 
4  5    GLN n 
4  6    TYR n 
4  7    SER n 
4  8    SER n 
4  9    ALA n 
4  10   PRO n 
4  11   LEU n 
4  12   ARG n 
4  13   THR n 
4  14   VAL n 
4  15   LYS n 
4  16   GLU n 
4  17   VAL n 
4  18   GLN n 
4  19   PHE n 
4  20   GLY n 
4  21   LEU n 
4  22   PHE n 
4  23   SER n 
4  24   PRO n 
4  25   GLU n 
4  26   GLU n 
4  27   VAL n 
4  28   ARG n 
4  29   ALA n 
4  30   ILE n 
4  31   SER n 
4  32   VAL n 
4  33   ALA n 
4  34   LYS n 
4  35   ILE n 
4  36   ARG n 
4  37   PHE n 
4  38   PRO n 
4  39   GLU n 
4  40   THR n 
4  41   MET n 
4  42   ASP n 
4  43   GLU n 
4  44   THR n 
4  45   GLN n 
4  46   THR n 
4  47   ARG n 
4  48   ALA n 
4  49   LYS n 
4  50   ILE n 
4  51   GLY n 
4  52   GLY n 
4  53   LEU n 
4  54   ASN n 
4  55   ASP n 
4  56   PRO n 
4  57   ARG n 
4  58   LEU n 
4  59   GLY n 
4  60   SER n 
4  61   ILE n 
4  62   ASP n 
4  63   ARG n 
4  64   ASN n 
4  65   LEU n 
4  66   LYS n 
4  67   CYS n 
4  68   GLN n 
4  69   THR n 
4  70   CYS n 
4  71   GLN n 
4  72   GLU n 
4  73   GLY n 
4  74   MET n 
4  75   ASN n 
4  76   GLU n 
4  77   CYS n 
4  78   PRO n 
4  79   GLY n 
4  80   HIS n 
4  81   PHE n 
4  82   GLY n 
4  83   HIS n 
4  84   ILE n 
4  85   ASP n 
4  86   LEU n 
4  87   ALA n 
4  88   LYS n 
4  89   PRO n 
4  90   VAL n 
4  91   PHE n 
4  92   HIS n 
4  93   VAL n 
4  94   GLY n 
4  95   PHE n 
4  96   ILE n 
4  97   ALA n 
4  98   LYS n 
4  99   ILE n 
4  100  LYS n 
4  101  LYS n 
4  102  VAL n 
4  103  CYS n 
4  104  GLU n 
4  105  CYS n 
4  106  VAL n 
4  107  CYS n 
4  108  MET n 
4  109  HIS n 
4  110  CYS n 
4  111  GLY n 
4  112  LYS n 
4  113  LEU n 
4  114  LEU n 
4  115  LEU n 
4  116  ASP n 
4  117  GLU n 
4  118  HIS n 
4  119  ASN n 
4  120  GLU n 
4  121  LEU n 
4  122  MET n 
4  123  ARG n 
4  124  GLN n 
4  125  ALA n 
4  126  LEU n 
4  127  ALA n 
4  128  ILE n 
4  129  LYS n 
4  130  ASP n 
4  131  SER n 
4  132  LYS n 
4  133  LYS n 
4  134  ARG n 
4  135  PHE n 
4  136  ALA n 
4  137  ALA n 
4  138  ILE n 
4  139  TRP n 
4  140  THR n 
4  141  LEU n 
4  142  CYS n 
4  143  LYS n 
4  144  THR n 
4  145  LYS n 
4  146  MET n 
4  147  VAL n 
4  148  CYS n 
4  149  GLU n 
4  150  THR n 
4  151  ASP n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  GLU n 
4  156  ASP n 
4  157  ASP n 
4  158  PRO n 
4  159  THR n 
4  160  GLN n 
4  161  LEU n 
4  162  VAL n 
4  163  SER n 
4  164  ARG n 
4  165  GLY n 
4  166  GLY n 
4  167  CYS n 
4  168  GLY n 
4  169  ASN n 
4  170  THR n 
4  171  GLN n 
4  172  PRO n 
4  173  THR n 
4  174  ILE n 
4  175  ARG n 
4  176  LYS n 
4  177  ASP n 
4  178  GLY n 
4  179  LEU n 
4  180  LYS n 
4  181  LEU n 
4  182  VAL n 
4  183  GLY n 
4  184  SER n 
4  185  TRP n 
4  186  LYS n 
4  187  LYS n 
4  188  ASP n 
4  189  ARG n 
4  190  ALA n 
4  191  THR n 
4  192  GLY n 
4  193  ASP n 
4  194  ALA n 
4  195  ASP n 
4  196  GLU n 
4  197  PRO n 
4  198  GLU n 
4  199  LEU n 
4  200  ARG n 
4  201  VAL n 
4  202  LEU n 
4  203  SER n 
4  204  THR n 
4  205  GLU n 
4  206  GLU n 
4  207  ILE n 
4  208  LEU n 
4  209  ASN n 
4  210  ILE n 
4  211  PHE n 
4  212  LYS n 
4  213  HIS n 
4  214  ILE n 
4  215  SER n 
4  216  VAL n 
4  217  LYS n 
4  218  ASP n 
4  219  PHE n 
4  220  THR n 
4  221  SER n 
4  222  LEU n 
4  223  GLY n 
4  224  PHE n 
4  225  ASN n 
4  226  GLU n 
4  227  VAL n 
4  228  PHE n 
4  229  SER n 
4  230  ARG n 
4  231  PRO n 
4  232  GLU n 
4  233  TRP n 
4  234  MET n 
4  235  ILE n 
4  236  LEU n 
4  237  THR n 
4  238  CYS n 
4  239  LEU n 
4  240  PRO n 
4  241  VAL n 
4  242  PRO n 
4  243  PRO n 
4  244  PRO n 
4  245  PRO n 
4  246  VAL n 
4  247  ARG n 
4  248  PRO n 
4  249  SER n 
4  250  ILE n 
4  251  SER n 
4  252  PHE n 
4  253  ASN n 
4  254  GLU n 
4  255  SER n 
4  256  GLN n 
4  257  ARG n 
4  258  GLY n 
4  259  GLU n 
4  260  ASP n 
4  261  ASP n 
4  262  LEU n 
4  263  THR n 
4  264  PHE n 
4  265  LYS n 
4  266  LEU n 
4  267  ALA n 
4  268  ASP n 
4  269  ILE n 
4  270  LEU n 
4  271  LYS n 
4  272  ALA n 
4  273  ASN n 
4  274  ILE n 
4  275  SER n 
4  276  LEU n 
4  277  GLU n 
4  278  THR n 
4  279  LEU n 
4  280  GLU n 
4  281  HIS n 
4  282  ASN n 
4  283  GLY n 
4  284  ALA n 
4  285  PRO n 
4  286  HIS n 
4  287  HIS n 
4  288  ALA n 
4  289  ILE n 
4  290  GLU n 
4  291  GLU n 
4  292  ALA n 
4  293  GLU n 
4  294  SER n 
4  295  LEU n 
4  296  LEU n 
4  297  GLN n 
4  298  PHE n 
4  299  HIS n 
4  300  VAL n 
4  301  ALA n 
4  302  THR n 
4  303  TYR n 
4  304  MET n 
4  305  ASP n 
4  306  ASN n 
4  307  ASP n 
4  308  ILE n 
4  309  ALA n 
4  310  GLY n 
4  311  GLN n 
4  312  PRO n 
4  313  GLN n 
4  314  ALA n 
4  315  LEU n 
4  316  GLN n 
4  317  LYS n 
4  318  SER n 
4  319  GLY n 
4  320  ARG n 
4  321  PRO n 
4  322  VAL n 
4  323  LYS n 
4  324  SER n 
4  325  ILE n 
4  326  ARG n 
4  327  ALA n 
4  328  ARG n 
4  329  LEU n 
4  330  LYS n 
4  331  GLY n 
4  332  LYS n 
4  333  GLU n 
4  334  GLY n 
4  335  ARG n 
4  336  ILE n 
4  337  ARG n 
4  338  GLY n 
4  339  ASN n 
4  340  LEU n 
4  341  MET n 
4  342  GLY n 
4  343  LYS n 
4  344  ARG n 
4  345  VAL n 
4  346  ASP n 
4  347  PHE n 
4  348  SER n 
4  349  ALA n 
4  350  ARG n 
4  351  THR n 
4  352  VAL n 
4  353  ILE n 
4  354  SER n 
4  355  GLY n 
4  356  ASP n 
4  357  PRO n 
4  358  ASN n 
4  359  LEU n 
4  360  GLU n 
4  361  LEU n 
4  362  ASP n 
4  363  GLN n 
4  364  VAL n 
4  365  GLY n 
4  366  VAL n 
4  367  PRO n 
4  368  LYS n 
4  369  SER n 
4  370  ILE n 
4  371  ALA n 
4  372  LYS n 
4  373  THR n 
4  374  LEU n 
4  375  THR n 
4  376  TYR n 
4  377  PRO n 
4  378  GLU n 
4  379  VAL n 
4  380  VAL n 
4  381  THR n 
4  382  PRO n 
4  383  TYR n 
4  384  ASN n 
4  385  ILE n 
4  386  ASP n 
4  387  ARG n 
4  388  LEU n 
4  389  THR n 
4  390  GLN n 
4  391  LEU n 
4  392  VAL n 
4  393  ARG n 
4  394  ASN n 
4  395  GLY n 
4  396  PRO n 
4  397  ASN n 
4  398  GLU n 
4  399  HIS n 
4  400  PRO n 
4  401  GLY n 
4  402  ALA n 
4  403  LYS n 
4  404  TYR n 
4  405  VAL n 
4  406  ILE n 
4  407  ARG n 
4  408  ASP n 
4  409  SER n 
4  410  GLY n 
4  411  ASP n 
4  412  ARG n 
4  413  ILE n 
4  414  ASP n 
4  415  LEU n 
4  416  ARG n 
4  417  TYR n 
4  418  SER n 
4  419  LYS n 
4  420  ARG n 
4  421  ALA n 
4  422  GLY n 
4  423  ASP n 
4  424  ILE n 
4  425  GLN n 
4  426  LEU n 
4  427  GLN n 
4  428  TYR n 
4  429  GLY n 
4  430  TRP n 
4  431  LYS n 
4  432  VAL n 
4  433  GLU n 
4  434  ARG n 
4  435  HIS n 
4  436  ILE n 
4  437  MET n 
4  438  ASP n 
4  439  ASN n 
4  440  ASP n 
4  441  PRO n 
4  442  VAL n 
4  443  LEU n 
4  444  PHE n 
4  445  ASN n 
4  446  ARG n 
4  447  GLN n 
4  448  PRO n 
4  449  SER n 
4  450  LEU n 
4  451  HIS n 
4  452  LYS n 
4  453  MET n 
4  454  SER n 
4  455  MET n 
4  456  MET n 
4  457  ALA n 
4  458  HIS n 
4  459  ARG n 
4  460  VAL n 
4  461  LYS n 
4  462  VAL n 
4  463  ILE n 
4  464  PRO n 
4  465  TYR n 
4  466  SER n 
4  467  THR n 
4  468  PHE n 
4  469  ARG n 
4  470  LEU n 
4  471  ASN n 
4  472  LEU n 
4  473  SER n 
4  474  VAL n 
4  475  THR n 
4  476  SER n 
4  477  PRO n 
4  478  TYR n 
4  479  ASN n 
4  480  ALA n 
4  481  ASP n 
4  482  PHE n 
4  483  ASP n 
4  484  GLY n 
4  485  ASP n 
4  486  GLU n 
4  487  MET n 
4  488  ASN n 
4  489  LEU n 
4  490  HIS n 
4  491  VAL n 
4  492  PRO n 
4  493  GLN n 
4  494  SER n 
4  495  GLU n 
4  496  GLU n 
4  497  THR n 
4  498  ARG n 
4  499  ALA n 
4  500  GLU n 
4  501  LEU n 
4  502  SER n 
4  503  GLN n 
4  504  LEU n 
4  505  CYS n 
4  506  ALA n 
4  507  VAL n 
4  508  PRO n 
4  509  LEU n 
4  510  GLN n 
4  511  ILE n 
4  512  VAL n 
4  513  SER n 
4  514  PRO n 
4  515  GLN n 
4  516  SER n 
4  517  ASN n 
4  518  LYS n 
4  519  PRO n 
4  520  CYS n 
4  521  MET n 
4  522  GLY n 
4  523  ILE n 
4  524  VAL n 
4  525  GLN n 
4  526  ASP n 
4  527  THR n 
4  528  LEU n 
4  529  CYS n 
4  530  GLY n 
4  531  ILE n 
4  532  ARG n 
4  533  LYS n 
4  534  LEU n 
4  535  THR n 
4  536  LEU n 
4  537  ARG n 
4  538  ASP n 
4  539  THR n 
4  540  PHE n 
4  541  ILE n 
4  542  GLU n 
4  543  LEU n 
4  544  ASP n 
4  545  GLN n 
4  546  VAL n 
4  547  LEU n 
4  548  ASN n 
4  549  MET n 
4  550  LEU n 
4  551  TYR n 
4  552  TRP n 
4  553  VAL n 
4  554  PRO n 
4  555  ASP n 
4  556  TRP n 
4  557  ASP n 
4  558  GLY n 
4  559  VAL n 
4  560  ILE n 
4  561  PRO n 
4  562  THR n 
4  563  PRO n 
4  564  ALA n 
4  565  ILE n 
4  566  ILE n 
4  567  LYS n 
4  568  PRO n 
4  569  LYS n 
4  570  PRO n 
4  571  LEU n 
4  572  TRP n 
4  573  SER n 
4  574  GLY n 
4  575  LYS n 
4  576  GLN n 
4  577  ILE n 
4  578  LEU n 
4  579  SER n 
4  580  VAL n 
4  581  ALA n 
4  582  ILE n 
4  583  PRO n 
4  584  ASN n 
4  585  GLY n 
4  586  ILE n 
4  587  HIS n 
4  588  LEU n 
4  589  GLN n 
4  590  ARG n 
4  591  PHE n 
4  592  ASP n 
4  593  GLU n 
4  594  GLY n 
4  595  THR n 
4  596  THR n 
4  597  LEU n 
4  598  LEU n 
4  599  SER n 
4  600  PRO n 
4  601  LYS n 
4  602  ASP n 
4  603  ASN n 
4  604  GLY n 
4  605  MET n 
4  606  LEU n 
4  607  ILE n 
4  608  ILE n 
4  609  ASP n 
4  610  GLY n 
4  611  GLN n 
4  612  ILE n 
4  613  ILE n 
4  614  PHE n 
4  615  GLY n 
4  616  VAL n 
4  617  VAL n 
4  618  GLU n 
4  619  LYS n 
4  620  LYS n 
4  621  THR n 
4  622  VAL n 
4  623  GLY n 
4  624  SER n 
4  625  SER n 
4  626  ASN n 
4  627  GLY n 
4  628  GLY n 
4  629  LEU n 
4  630  ILE n 
4  631  HIS n 
4  632  VAL n 
4  633  VAL n 
4  634  THR n 
4  635  ARG n 
4  636  GLU n 
4  637  LYS n 
4  638  GLY n 
4  639  PRO n 
4  640  GLN n 
4  641  VAL n 
4  642  CYS n 
4  643  ALA n 
4  644  LYS n 
4  645  LEU n 
4  646  PHE n 
4  647  GLY n 
4  648  ASN n 
4  649  ILE n 
4  650  GLN n 
4  651  LYS n 
4  652  VAL n 
4  653  VAL n 
4  654  ASN n 
4  655  PHE n 
4  656  TRP n 
4  657  LEU n 
4  658  LEU n 
4  659  HIS n 
4  660  ASN n 
4  661  GLY n 
4  662  PHE n 
4  663  SER n 
4  664  THR n 
4  665  GLY n 
4  666  ILE n 
4  667  GLY n 
4  668  ASP n 
4  669  THR n 
4  670  ILE n 
4  671  ALA n 
4  672  ASP n 
4  673  GLY n 
4  674  PRO n 
4  675  THR n 
4  676  MET n 
4  677  ARG n 
4  678  GLU n 
4  679  ILE n 
4  680  THR n 
4  681  GLU n 
4  682  THR n 
4  683  ILE n 
4  684  ALA n 
4  685  GLU n 
4  686  ALA n 
4  687  LYS n 
4  688  LYS n 
4  689  LYS n 
4  690  VAL n 
4  691  LEU n 
4  692  ASP n 
4  693  VAL n 
4  694  THR n 
4  695  LYS n 
4  696  GLU n 
4  697  ALA n 
4  698  GLN n 
4  699  ALA n 
4  700  ASN n 
4  701  LEU n 
4  702  LEU n 
4  703  THR n 
4  704  ALA n 
4  705  LYS n 
4  706  HIS n 
4  707  GLY n 
4  708  MET n 
4  709  THR n 
4  710  LEU n 
4  711  ARG n 
4  712  GLU n 
4  713  SER n 
4  714  PHE n 
4  715  GLU n 
4  716  ASP n 
4  717  ASN n 
4  718  VAL n 
4  719  VAL n 
4  720  ARG n 
4  721  PHE n 
4  722  LEU n 
4  723  ASN n 
4  724  GLU n 
4  725  ALA n 
4  726  ARG n 
4  727  ASP n 
4  728  LYS n 
4  729  ALA n 
4  730  GLY n 
4  731  ARG n 
4  732  LEU n 
4  733  ALA n 
4  734  GLU n 
4  735  VAL n 
4  736  ASN n 
4  737  LEU n 
4  738  LYS n 
4  739  ASP n 
4  740  LEU n 
4  741  ASN n 
4  742  ASN n 
4  743  VAL n 
4  744  LYS n 
4  745  GLN n 
4  746  MET n 
4  747  VAL n 
4  748  MET n 
4  749  ALA n 
4  750  GLY n 
4  751  SER n 
4  752  LYS n 
4  753  GLY n 
4  754  SER n 
4  755  PHE n 
4  756  ILE n 
4  757  ASN n 
4  758  ILE n 
4  759  ALA n 
4  760  GLN n 
4  761  MET n 
4  762  SER n 
4  763  ALA n 
4  764  CYS n 
4  765  VAL n 
4  766  GLY n 
4  767  GLN n 
4  768  GLN n 
4  769  SER n 
4  770  VAL n 
4  771  GLU n 
4  772  GLY n 
4  773  LYS n 
4  774  ARG n 
4  775  ILE n 
4  776  ALA n 
4  777  PHE n 
4  778  GLY n 
4  779  PHE n 
4  780  VAL n 
4  781  ASP n 
4  782  ARG n 
4  783  THR n 
4  784  LEU n 
4  785  PRO n 
4  786  HIS n 
4  787  PHE n 
4  788  SER n 
4  789  LYS n 
4  790  ASP n 
4  791  ASP n 
4  792  TYR n 
4  793  SER n 
4  794  PRO n 
4  795  GLU n 
4  796  SER n 
4  797  LYS n 
4  798  GLY n 
4  799  PHE n 
4  800  VAL n 
4  801  GLU n 
4  802  ASN n 
4  803  SER n 
4  804  TYR n 
4  805  LEU n 
4  806  ARG n 
4  807  GLY n 
4  808  LEU n 
4  809  THR n 
4  810  PRO n 
4  811  GLN n 
4  812  GLU n 
4  813  PHE n 
4  814  PHE n 
4  815  PHE n 
4  816  HIS n 
4  817  ALA n 
4  818  MET n 
4  819  GLY n 
4  820  GLY n 
4  821  ARG n 
4  822  GLU n 
4  823  GLY n 
4  824  LEU n 
4  825  ILE n 
4  826  ASP n 
4  827  THR n 
4  828  ALA n 
4  829  VAL n 
4  830  LYS n 
4  831  THR n 
4  832  ALA n 
4  833  GLU n 
4  834  THR n 
4  835  GLY n 
4  836  TYR n 
4  837  ILE n 
4  838  GLN n 
4  839  ARG n 
4  840  ARG n 
4  841  LEU n 
4  842  VAL n 
4  843  LYS n 
4  844  ALA n 
4  845  LEU n 
4  846  GLU n 
4  847  ASP n 
4  848  ILE n 
4  849  MET n 
4  850  VAL n 
4  851  HIS n 
4  852  TYR n 
4  853  ASP n 
4  854  ASN n 
4  855  THR n 
4  856  THR n 
4  857  ARG n 
4  858  ASN n 
4  859  SER n 
4  860  LEU n 
4  861  GLY n 
4  862  ASN n 
4  863  VAL n 
4  864  ILE n 
4  865  GLN n 
4  866  PHE n 
4  867  ILE n 
4  868  TYR n 
4  869  GLY n 
4  870  GLU n 
4  871  ASP n 
4  872  GLY n 
4  873  MET n 
4  874  ASP n 
4  875  ALA n 
4  876  ALA n 
4  877  HIS n 
4  878  ILE n 
4  879  GLU n 
4  880  LYS n 
4  881  GLN n 
4  882  SER n 
4  883  LEU n 
4  884  ASP n 
4  885  THR n 
4  886  ILE n 
4  887  GLY n 
4  888  GLY n 
4  889  SER n 
4  890  ASP n 
4  891  ALA n 
4  892  ALA n 
4  893  PHE n 
4  894  GLU n 
4  895  LYS n 
4  896  ARG n 
4  897  TYR n 
4  898  ARG n 
4  899  VAL n 
4  900  ASP n 
4  901  LEU n 
4  902  LEU n 
4  903  ASN n 
4  904  THR n 
4  905  ASP n 
4  906  HIS n 
4  907  THR n 
4  908  LEU n 
4  909  ASP n 
4  910  PRO n 
4  911  SER n 
4  912  LEU n 
4  913  LEU n 
4  914  GLU n 
4  915  SER n 
4  916  GLY n 
4  917  SER n 
4  918  GLU n 
4  919  ILE n 
4  920  LEU n 
4  921  GLY n 
4  922  ASP n 
4  923  LEU n 
4  924  LYS n 
4  925  LEU n 
4  926  GLN n 
4  927  VAL n 
4  928  LEU n 
4  929  LEU n 
4  930  ASP n 
4  931  GLU n 
4  932  GLU n 
4  933  TYR n 
4  934  LYS n 
4  935  GLN n 
4  936  LEU n 
4  937  VAL n 
4  938  LYS n 
4  939  ASP n 
4  940  ARG n 
4  941  LYS n 
4  942  PHE n 
4  943  LEU n 
4  944  ARG n 
4  945  GLU n 
4  946  VAL n 
4  947  PHE n 
4  948  VAL n 
4  949  ASP n 
4  950  GLY n 
4  951  GLU n 
4  952  ALA n 
4  953  ASN n 
4  954  TRP n 
4  955  PRO n 
4  956  LEU n 
4  957  PRO n 
4  958  VAL n 
4  959  ASN n 
4  960  ILE n 
4  961  ARG n 
4  962  ARG n 
4  963  ILE n 
4  964  ILE n 
4  965  GLN n 
4  966  ASN n 
4  967  ALA n 
4  968  GLN n 
4  969  GLN n 
4  970  THR n 
4  971  PHE n 
4  972  HIS n 
4  973  ILE n 
4  974  ASP n 
4  975  HIS n 
4  976  THR n 
4  977  LYS n 
4  978  PRO n 
4  979  SER n 
4  980  ASP n 
4  981  LEU n 
4  982  THR n 
4  983  ILE n 
4  984  LYS n 
4  985  ASP n 
4  986  ILE n 
4  987  VAL n 
4  988  LEU n 
4  989  GLY n 
4  990  VAL n 
4  991  LYS n 
4  992  ASP n 
4  993  LEU n 
4  994  GLN n 
4  995  GLU n 
4  996  ASN n 
4  997  LEU n 
4  998  LEU n 
4  999  VAL n 
4  1000 LEU n 
4  1001 ARG n 
4  1002 GLY n 
4  1003 LYS n 
4  1004 ASN n 
4  1005 GLU n 
4  1006 ILE n 
4  1007 ILE n 
4  1008 GLN n 
4  1009 ASN n 
4  1010 ALA n 
4  1011 GLN n 
4  1012 ARG n 
4  1013 ASP n 
4  1014 ALA n 
4  1015 VAL n 
4  1016 THR n 
4  1017 LEU n 
4  1018 PHE n 
4  1019 CYS n 
4  1020 CYS n 
4  1021 LEU n 
4  1022 LEU n 
4  1023 ARG n 
4  1024 SER n 
4  1025 ARG n 
4  1026 LEU n 
4  1027 ALA n 
4  1028 THR n 
4  1029 ARG n 
4  1030 ARG n 
4  1031 VAL n 
4  1032 LEU n 
4  1033 GLN n 
4  1034 GLU n 
4  1035 TYR n 
4  1036 ARG n 
4  1037 LEU n 
4  1038 THR n 
4  1039 LYS n 
4  1040 GLN n 
4  1041 ALA n 
4  1042 PHE n 
4  1043 ASP n 
4  1044 TRP n 
4  1045 VAL n 
4  1046 LEU n 
4  1047 SER n 
4  1048 ASN n 
4  1049 ILE n 
4  1050 GLU n 
4  1051 ALA n 
4  1052 GLN n 
4  1053 PHE n 
4  1054 LEU n 
4  1055 ARG n 
4  1056 SER n 
4  1057 VAL n 
4  1058 VAL n 
4  1059 HIS n 
4  1060 PRO n 
4  1061 GLY n 
4  1062 GLU n 
4  1063 MET n 
4  1064 VAL n 
4  1065 GLY n 
4  1066 VAL n 
4  1067 LEU n 
4  1068 ALA n 
4  1069 ALA n 
4  1070 GLN n 
4  1071 SER n 
4  1072 ILE n 
4  1073 GLY n 
4  1074 GLU n 
4  1075 PRO n 
4  1076 ALA n 
4  1077 THR n 
4  1078 GLN n 
4  1079 MET n 
4  1080 THR n 
4  1081 LEU n 
4  1082 ASN n 
4  1083 THR n 
4  1084 PHE n 
4  1085 HIS n 
4  1086 PHE n 
4  1087 ALA n 
4  1088 GLY n 
4  1089 VAL n 
4  1090 ALA n 
4  1091 SER n 
4  1092 LYS n 
4  1093 LYS n 
4  1094 VAL n 
4  1095 THR n 
4  1096 SER n 
4  1097 GLY n 
4  1098 VAL n 
4  1099 PRO n 
4  1100 ARG n 
4  1101 LEU n 
4  1102 LYS n 
4  1103 GLU n 
4  1104 ILE n 
4  1105 LEU n 
4  1106 ASN n 
4  1107 VAL n 
4  1108 ALA n 
4  1109 LYS n 
4  1110 ASN n 
4  1111 MET n 
4  1112 LYS n 
4  1113 THR n 
4  1114 PRO n 
4  1115 SER n 
4  1116 LEU n 
4  1117 THR n 
4  1118 VAL n 
4  1119 TYR n 
4  1120 LEU n 
4  1121 GLU n 
4  1122 PRO n 
4  1123 GLY n 
4  1124 HIS n 
4  1125 ALA n 
4  1126 ALA n 
4  1127 ASP n 
4  1128 GLN n 
4  1129 GLU n 
4  1130 GLN n 
4  1131 ALA n 
4  1132 LYS n 
4  1133 LEU n 
4  1134 ILE n 
4  1135 ARG n 
4  1136 SER n 
4  1137 ALA n 
4  1138 ILE n 
4  1139 GLU n 
4  1140 HIS n 
4  1141 THR n 
4  1142 THR n 
4  1143 LEU n 
4  1144 LYS n 
4  1145 SER n 
4  1146 VAL n 
4  1147 THR n 
4  1148 ILE n 
4  1149 ALA n 
4  1150 SER n 
4  1151 GLU n 
4  1152 ILE n 
4  1153 TYR n 
4  1154 TYR n 
4  1155 ASP n 
4  1156 PRO n 
4  1157 ASP n 
4  1158 PRO n 
4  1159 ARG n 
4  1160 SER n 
4  1161 THR n 
4  1162 VAL n 
4  1163 ILE n 
4  1164 PRO n 
4  1165 GLU n 
4  1166 ASP n 
4  1167 GLU n 
4  1168 GLU n 
4  1169 ILE n 
4  1170 ILE n 
4  1171 GLN n 
4  1172 LEU n 
4  1173 HIS n 
4  1174 PHE n 
4  1175 SER n 
4  1176 LEU n 
4  1177 LEU n 
4  1178 ASP n 
4  1179 GLU n 
4  1180 GLU n 
4  1181 ALA n 
4  1182 GLU n 
4  1183 GLN n 
4  1184 SER n 
4  1185 PHE n 
4  1186 ASP n 
4  1187 GLN n 
4  1188 GLN n 
4  1189 SER n 
4  1190 PRO n 
4  1191 TRP n 
4  1192 LEU n 
4  1193 LEU n 
4  1194 ARG n 
4  1195 LEU n 
4  1196 GLU n 
4  1197 LEU n 
4  1198 ASP n 
4  1199 ARG n 
4  1200 ALA n 
4  1201 ALA n 
4  1202 MET n 
4  1203 ASN n 
4  1204 ASP n 
4  1205 LYS n 
4  1206 ASP n 
4  1207 LEU n 
4  1208 THR n 
4  1209 MET n 
4  1210 GLY n 
4  1211 GLN n 
4  1212 VAL n 
4  1213 GLY n 
4  1214 GLU n 
4  1215 ARG n 
4  1216 ILE n 
4  1217 LYS n 
4  1218 GLN n 
4  1219 THR n 
4  1220 PHE n 
4  1221 LYS n 
4  1222 ASN n 
4  1223 ASP n 
4  1224 LEU n 
4  1225 PHE n 
4  1226 VAL n 
4  1227 ILE n 
4  1228 TRP n 
4  1229 SER n 
4  1230 GLU n 
4  1231 ASP n 
4  1232 ASN n 
4  1233 ASP n 
4  1234 GLU n 
4  1235 LYS n 
4  1236 LEU n 
4  1237 ILE n 
4  1238 ILE n 
4  1239 ARG n 
4  1240 CYS n 
4  1241 ARG n 
4  1242 VAL n 
4  1243 VAL n 
4  1244 ARG n 
4  1245 PRO n 
4  1246 LYS n 
4  1247 SER n 
4  1248 LEU n 
4  1249 ASP n 
4  1250 ALA n 
4  1251 GLU n 
4  1252 THR n 
4  1253 GLU n 
4  1254 ALA n 
4  1255 GLU n 
4  1256 GLU n 
4  1257 ASP n 
4  1258 HIS n 
4  1259 MET n 
4  1260 LEU n 
4  1261 LYS n 
4  1262 LYS n 
4  1263 ILE n 
4  1264 GLU n 
4  1265 ASN n 
4  1266 THR n 
4  1267 MET n 
4  1268 LEU n 
4  1269 GLU n 
4  1270 ASN n 
4  1271 ILE n 
4  1272 THR n 
4  1273 LEU n 
4  1274 ARG n 
4  1275 GLY n 
4  1276 VAL n 
4  1277 GLU n 
4  1278 ASN n 
4  1279 ILE n 
4  1280 GLU n 
4  1281 ARG n 
4  1282 VAL n 
4  1283 VAL n 
4  1284 MET n 
4  1285 MET n 
4  1286 LYS n 
4  1287 TYR n 
4  1288 ASP n 
4  1289 ARG n 
4  1290 LYS n 
4  1291 VAL n 
4  1292 PRO n 
4  1293 SER n 
4  1294 PRO n 
4  1295 THR n 
4  1296 GLY n 
4  1297 GLU n 
4  1298 TYR n 
4  1299 VAL n 
4  1300 LYS n 
4  1301 GLU n 
4  1302 PRO n 
4  1303 GLU n 
4  1304 TRP n 
4  1305 VAL n 
4  1306 LEU n 
4  1307 GLU n 
4  1308 THR n 
4  1309 ASP n 
4  1310 GLY n 
4  1311 VAL n 
4  1312 ASN n 
4  1313 LEU n 
4  1314 SER n 
4  1315 GLU n 
4  1316 VAL n 
4  1317 MET n 
4  1318 THR n 
4  1319 VAL n 
4  1320 PRO n 
4  1321 GLY n 
4  1322 ILE n 
4  1323 ASP n 
4  1324 PRO n 
4  1325 THR n 
4  1326 ARG n 
4  1327 ILE n 
4  1328 TYR n 
4  1329 THR n 
4  1330 ASN n 
4  1331 SER n 
4  1332 PHE n 
4  1333 ILE n 
4  1334 ASP n 
4  1335 ILE n 
4  1336 MET n 
4  1337 GLU n 
4  1338 VAL n 
4  1339 LEU n 
4  1340 GLY n 
4  1341 ILE n 
4  1342 GLU n 
4  1343 ALA n 
4  1344 GLY n 
4  1345 ARG n 
4  1346 ALA n 
4  1347 ALA n 
4  1348 LEU n 
4  1349 TYR n 
4  1350 LYS n 
4  1351 GLU n 
4  1352 VAL n 
4  1353 TYR n 
4  1354 ASN n 
4  1355 VAL n 
4  1356 ILE n 
4  1357 ALA n 
4  1358 SER n 
4  1359 ASP n 
4  1360 GLY n 
4  1361 SER n 
4  1362 TYR n 
4  1363 VAL n 
4  1364 ASN n 
4  1365 TYR n 
4  1366 ARG n 
4  1367 HIS n 
4  1368 MET n 
4  1369 ALA n 
4  1370 LEU n 
4  1371 LEU n 
4  1372 VAL n 
4  1373 ASP n 
4  1374 VAL n 
4  1375 MET n 
4  1376 THR n 
4  1377 THR n 
4  1378 GLN n 
4  1379 GLY n 
4  1380 GLY n 
4  1381 LEU n 
4  1382 THR n 
4  1383 SER n 
4  1384 VAL n 
4  1385 THR n 
4  1386 ARG n 
4  1387 HIS n 
4  1388 GLY n 
4  1389 PHE n 
4  1390 ASN n 
4  1391 ARG n 
4  1392 SER n 
4  1393 ASN n 
4  1394 THR n 
4  1395 GLY n 
4  1396 ALA n 
4  1397 LEU n 
4  1398 MET n 
4  1399 ARG n 
4  1400 CYS n 
4  1401 SER n 
4  1402 PHE n 
4  1403 GLU n 
4  1404 GLU n 
4  1405 THR n 
4  1406 VAL n 
4  1407 GLU n 
4  1408 ILE n 
4  1409 LEU n 
4  1410 PHE n 
4  1411 GLU n 
4  1412 ALA n 
4  1413 GLY n 
4  1414 ALA n 
4  1415 SER n 
4  1416 ALA n 
4  1417 GLU n 
4  1418 LEU n 
4  1419 ASP n 
4  1420 ASP n 
4  1421 CYS n 
4  1422 ARG n 
4  1423 GLY n 
4  1424 VAL n 
4  1425 SER n 
4  1426 GLU n 
4  1427 ASN n 
4  1428 VAL n 
4  1429 ILE n 
4  1430 LEU n 
4  1431 GLY n 
4  1432 GLN n 
4  1433 MET n 
4  1434 ALA n 
4  1435 PRO n 
4  1436 ILE n 
4  1437 GLY n 
4  1438 THR n 
4  1439 GLY n 
4  1440 ALA n 
4  1441 PHE n 
4  1442 ASP n 
4  1443 VAL n 
4  1444 MET n 
4  1445 ILE n 
4  1446 ASP n 
4  1447 GLU n 
4  1448 GLU n 
4  1449 SER n 
4  1450 LEU n 
4  1451 VAL n 
4  1452 LYS n 
4  1453 TYR n 
4  1454 MET n 
4  1455 PRO n 
4  1456 GLU n 
4  1457 GLN n 
4  1458 LYS n 
4  1459 ILE n 
4  1460 THR n 
4  1461 GLU n 
4  1462 ILE n 
4  1463 GLU n 
4  1464 ASP n 
4  1465 GLY n 
4  1466 GLN n 
4  1467 ASP n 
4  1468 GLY n 
4  1469 GLY n 
4  1470 VAL n 
4  1471 THR n 
4  1472 PRO n 
4  1473 TYR n 
4  1474 SER n 
4  1475 ASN n 
4  1476 GLU n 
4  1477 SER n 
4  1478 GLY n 
4  1479 LEU n 
4  1480 VAL n 
4  1481 ASN n 
4  1482 ALA n 
4  1483 ASP n 
4  1484 LEU n 
4  1485 ASP n 
4  1486 VAL n 
4  1487 LYS n 
4  1488 ASP n 
4  1489 GLU n 
4  1490 LEU n 
4  1491 MET n 
4  1492 PHE n 
4  1493 SER n 
4  1494 PRO n 
4  1495 LEU n 
4  1496 VAL n 
4  1497 ASP n 
4  1498 SER n 
4  1499 GLY n 
4  1500 SER n 
4  1501 ASN n 
4  1502 ASP n 
4  1503 ALA n 
4  1504 MET n 
4  1505 ALA n 
4  1506 GLY n 
4  1507 GLY n 
4  1508 PHE n 
4  1509 THR n 
4  1510 ALA n 
4  1511 TYR n 
4  1512 GLY n 
4  1513 GLY n 
4  1514 ALA n 
4  1515 ASP n 
4  1516 TYR n 
4  1517 GLY n 
4  1518 GLU n 
4  1519 ALA n 
4  1520 THR n 
4  1521 SER n 
4  1522 PRO n 
4  1523 PHE n 
4  1524 GLY n 
4  1525 ALA n 
4  1526 TYR n 
4  1527 GLY n 
4  1528 GLU n 
4  1529 ALA n 
4  1530 PRO n 
4  1531 THR n 
4  1532 SER n 
4  1533 PRO n 
4  1534 GLY n 
4  1535 PHE n 
4  1536 GLY n 
4  1537 VAL n 
4  1538 SER n 
4  1539 SER n 
4  1540 PRO n 
4  1541 GLY n 
4  1542 PHE n 
4  1543 SER n 
4  1544 PRO n 
4  1545 THR n 
4  1546 SER n 
4  1547 PRO n 
4  1548 THR n 
4  1549 TYR n 
4  1550 SER n 
4  1551 PRO n 
4  1552 THR n 
4  1553 SER n 
4  1554 PRO n 
4  1555 ALA n 
4  1556 TYR n 
4  1557 SER n 
4  1558 PRO n 
4  1559 THR n 
4  1560 SER n 
4  1561 PRO n 
4  1562 SER n 
4  1563 TYR n 
4  1564 SER n 
4  1565 PRO n 
4  1566 THR n 
4  1567 SER n 
4  1568 PRO n 
4  1569 SER n 
4  1570 TYR n 
4  1571 SER n 
4  1572 PRO n 
4  1573 THR n 
4  1574 SER n 
4  1575 PRO n 
4  1576 SER n 
4  1577 TYR n 
4  1578 SER n 
4  1579 PRO n 
4  1580 THR n 
4  1581 SER n 
4  1582 PRO n 
4  1583 SER n 
4  1584 TYR n 
4  1585 SER n 
4  1586 PRO n 
4  1587 THR n 
4  1588 SER n 
4  1589 PRO n 
4  1590 SER n 
4  1591 TYR n 
4  1592 SER n 
4  1593 PRO n 
4  1594 THR n 
4  1595 SER n 
4  1596 PRO n 
4  1597 SER n 
4  1598 TYR n 
4  1599 SER n 
4  1600 PRO n 
4  1601 THR n 
4  1602 SER n 
4  1603 PRO n 
4  1604 SER n 
4  1605 TYR n 
4  1606 SER n 
4  1607 PRO n 
4  1608 THR n 
4  1609 SER n 
4  1610 PRO n 
4  1611 SER n 
4  1612 TYR n 
4  1613 SER n 
4  1614 PRO n 
4  1615 THR n 
4  1616 SER n 
4  1617 PRO n 
4  1618 SER n 
4  1619 TYR n 
4  1620 SER n 
4  1621 PRO n 
4  1622 THR n 
4  1623 SER n 
4  1624 PRO n 
4  1625 SER n 
4  1626 TYR n 
4  1627 SER n 
4  1628 PRO n 
4  1629 THR n 
4  1630 SER n 
4  1631 PRO n 
4  1632 SER n 
4  1633 TYR n 
4  1634 SER n 
4  1635 PRO n 
4  1636 THR n 
4  1637 SER n 
4  1638 PRO n 
4  1639 SER n 
4  1640 TYR n 
4  1641 SER n 
4  1642 PRO n 
4  1643 THR n 
4  1644 SER n 
4  1645 PRO n 
4  1646 SER n 
4  1647 TYR n 
4  1648 SER n 
4  1649 PRO n 
4  1650 THR n 
4  1651 SER n 
4  1652 PRO n 
4  1653 SER n 
4  1654 TYR n 
4  1655 SER n 
4  1656 PRO n 
4  1657 THR n 
4  1658 SER n 
4  1659 PRO n 
4  1660 ALA n 
4  1661 TYR n 
4  1662 SER n 
4  1663 PRO n 
4  1664 THR n 
4  1665 SER n 
4  1666 PRO n 
4  1667 SER n 
4  1668 TYR n 
4  1669 SER n 
4  1670 PRO n 
4  1671 THR n 
4  1672 SER n 
4  1673 PRO n 
4  1674 SER n 
4  1675 TYR n 
4  1676 SER n 
4  1677 PRO n 
4  1678 THR n 
4  1679 SER n 
4  1680 PRO n 
4  1681 SER n 
4  1682 TYR n 
4  1683 SER n 
4  1684 PRO n 
4  1685 THR n 
4  1686 SER n 
4  1687 PRO n 
4  1688 SER n 
4  1689 TYR n 
4  1690 SER n 
4  1691 PRO n 
4  1692 THR n 
4  1693 SER n 
4  1694 PRO n 
4  1695 ASN n 
4  1696 TYR n 
4  1697 SER n 
4  1698 PRO n 
4  1699 THR n 
4  1700 SER n 
4  1701 PRO n 
4  1702 SER n 
4  1703 TYR n 
4  1704 SER n 
4  1705 PRO n 
4  1706 THR n 
4  1707 SER n 
4  1708 PRO n 
4  1709 GLY n 
4  1710 TYR n 
4  1711 SER n 
4  1712 PRO n 
4  1713 GLY n 
4  1714 SER n 
4  1715 PRO n 
4  1716 ALA n 
4  1717 TYR n 
4  1718 SER n 
4  1719 PRO n 
4  1720 LYS n 
4  1721 GLN n 
4  1722 ASP n 
4  1723 GLU n 
4  1724 GLN n 
4  1725 LYS n 
4  1726 HIS n 
4  1727 ASN n 
4  1728 GLU n 
4  1729 ASN n 
4  1730 GLU n 
4  1731 ASN n 
4  1732 SER n 
4  1733 ARG n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    LEU n 
5  5    ALA n 
5  6    ASN n 
5  7    SER n 
5  8    GLU n 
5  9    LYS n 
5  10   TYR n 
5  11   TYR n 
5  12   ASP n 
5  13   GLU n 
5  14   ASP n 
5  15   PRO n 
5  16   TYR n 
5  17   GLY n 
5  18   PHE n 
5  19   GLU n 
5  20   ASP n 
5  21   GLU n 
5  22   SER n 
5  23   ALA n 
5  24   PRO n 
5  25   ILE n 
5  26   THR n 
5  27   ALA n 
5  28   GLU n 
5  29   ASP n 
5  30   SER n 
5  31   TRP n 
5  32   ALA n 
5  33   VAL n 
5  34   ILE n 
5  35   SER n 
5  36   ALA n 
5  37   PHE n 
5  38   PHE n 
5  39   ARG n 
5  40   GLU n 
5  41   LYS n 
5  42   GLY n 
5  43   LEU n 
5  44   VAL n 
5  45   SER n 
5  46   GLN n 
5  47   GLN n 
5  48   LEU n 
5  49   ASP n 
5  50   SER n 
5  51   PHE n 
5  52   ASN n 
5  53   GLN n 
5  54   PHE n 
5  55   VAL n 
5  56   ASP n 
5  57   TYR n 
5  58   THR n 
5  59   LEU n 
5  60   GLN n 
5  61   ASP n 
5  62   ILE n 
5  63   ILE n 
5  64   CYS n 
5  65   GLU n 
5  66   ASP n 
5  67   SER n 
5  68   THR n 
5  69   LEU n 
5  70   ILE n 
5  71   LEU n 
5  72   GLU n 
5  73   GLN n 
5  74   LEU n 
5  75   ALA n 
5  76   GLN n 
5  77   HIS n 
5  78   THR n 
5  79   THR n 
5  80   GLU n 
5  81   SER n 
5  82   ASP n 
5  83   ASN n 
5  84   ILE n 
5  85   SER n 
5  86   ARG n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ILE n 
5  91   SER n 
5  92   PHE n 
5  93   GLY n 
5  94   LYS n 
5  95   ILE n 
5  96   TYR n 
5  97   VAL n 
5  98   THR n 
5  99   LYS n 
5  100  PRO n 
5  101  MET n 
5  102  VAL n 
5  103  ASN n 
5  104  GLU n 
5  105  SER n 
5  106  ASP n 
5  107  GLY n 
5  108  VAL n 
5  109  THR n 
5  110  HIS n 
5  111  ALA n 
5  112  LEU n 
5  113  TYR n 
5  114  PRO n 
5  115  GLN n 
5  116  GLU n 
5  117  ALA n 
5  118  ARG n 
5  119  LEU n 
5  120  ARG n 
5  121  ASN n 
5  122  LEU n 
5  123  THR n 
5  124  TYR n 
5  125  SER n 
5  126  SER n 
5  127  GLY n 
5  128  LEU n 
5  129  PHE n 
5  130  VAL n 
5  131  ASP n 
5  132  VAL n 
5  133  LYS n 
5  134  LYS n 
5  135  ARG n 
5  136  THR n 
5  137  TYR n 
5  138  GLU n 
5  139  ALA n 
5  140  ILE n 
5  141  ASP n 
5  142  VAL n 
5  143  PRO n 
5  144  GLY n 
5  145  ARG n 
5  146  GLU n 
5  147  LEU n 
5  148  LYS n 
5  149  TYR n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  ALA n 
5  154  GLU n 
5  155  GLU n 
5  156  SER n 
5  157  GLU n 
5  158  ASP n 
5  159  ASP n 
5  160  SER n 
5  161  GLU n 
5  162  SER n 
5  163  GLY n 
5  164  LYS n 
5  165  VAL n 
5  166  PHE n 
5  167  ILE n 
5  168  GLY n 
5  169  ARG n 
5  170  LEU n 
5  171  PRO n 
5  172  ILE n 
5  173  MET n 
5  174  LEU n 
5  175  ARG n 
5  176  SER n 
5  177  LYS n 
5  178  ASN n 
5  179  CYS n 
5  180  TYR n 
5  181  LEU n 
5  182  SER n 
5  183  GLU n 
5  184  ALA n 
5  185  THR n 
5  186  GLU n 
5  187  SER n 
5  188  ASP n 
5  189  LEU n 
5  190  TYR n 
5  191  LYS n 
5  192  LEU n 
5  193  LYS n 
5  194  GLU n 
5  195  CYS n 
5  196  PRO n 
5  197  PHE n 
5  198  ASP n 
5  199  MET n 
5  200  GLY n 
5  201  GLY n 
5  202  TYR n 
5  203  PHE n 
5  204  ILE n 
5  205  ILE n 
5  206  ASN n 
5  207  GLY n 
5  208  SER n 
5  209  GLU n 
5  210  LYS n 
5  211  VAL n 
5  212  LEU n 
5  213  ILE n 
5  214  ALA n 
5  215  GLN n 
5  216  GLU n 
5  217  ARG n 
5  218  SER n 
5  219  ALA n 
5  220  GLY n 
5  221  ASN n 
5  222  ILE n 
5  223  VAL n 
5  224  GLN n 
5  225  VAL n 
5  226  PHE n 
5  227  LYS n 
5  228  LYS n 
5  229  ALA n 
5  230  ALA n 
5  231  PRO n 
5  232  SER n 
5  233  PRO n 
5  234  ILE n 
5  235  SER n 
5  236  HIS n 
5  237  VAL n 
5  238  ALA n 
5  239  GLU n 
5  240  ILE n 
5  241  ARG n 
5  242  SER n 
5  243  ALA n 
5  244  LEU n 
5  245  GLU n 
5  246  LYS n 
5  247  GLY n 
5  248  SER n 
5  249  ARG n 
5  250  PHE n 
5  251  ILE n 
5  252  SER n 
5  253  THR n 
5  254  LEU n 
5  255  GLN n 
5  256  VAL n 
5  257  LYS n 
5  258  LEU n 
5  259  TYR n 
5  260  GLY n 
5  261  ARG n 
5  262  GLU n 
5  263  GLY n 
5  264  SER n 
5  265  SER n 
5  266  ALA n 
5  267  ARG n 
5  268  THR n 
5  269  ILE n 
5  270  LYS n 
5  271  ALA n 
5  272  THR n 
5  273  LEU n 
5  274  PRO n 
5  275  TYR n 
5  276  ILE n 
5  277  LYS n 
5  278  GLN n 
5  279  ASP n 
5  280  ILE n 
5  281  PRO n 
5  282  ILE n 
5  283  VAL n 
5  284  ILE n 
5  285  ILE n 
5  286  PHE n 
5  287  ARG n 
5  288  ALA n 
5  289  LEU n 
5  290  GLY n 
5  291  ILE n 
5  292  ILE n 
5  293  PRO n 
5  294  ASP n 
5  295  GLY n 
5  296  GLU n 
5  297  ILE n 
5  298  LEU n 
5  299  GLU n 
5  300  HIS n 
5  301  ILE n 
5  302  CYS n 
5  303  TYR n 
5  304  ASP n 
5  305  VAL n 
5  306  ASN n 
5  307  ASP n 
5  308  TRP n 
5  309  GLN n 
5  310  MET n 
5  311  LEU n 
5  312  GLU n 
5  313  MET n 
5  314  LEU n 
5  315  LYS n 
5  316  PRO n 
5  317  CYS n 
5  318  VAL n 
5  319  GLU n 
5  320  ASP n 
5  321  GLY n 
5  322  PHE n 
5  323  VAL n 
5  324  ILE n 
5  325  GLN n 
5  326  ASP n 
5  327  ARG n 
5  328  GLU n 
5  329  THR n 
5  330  ALA n 
5  331  LEU n 
5  332  ASP n 
5  333  PHE n 
5  334  ILE n 
5  335  GLY n 
5  336  ARG n 
5  337  ARG n 
5  338  GLY n 
5  339  THR n 
5  340  ALA n 
5  341  LEU n 
5  342  GLY n 
5  343  ILE n 
5  344  LYS n 
5  345  LYS n 
5  346  GLU n 
5  347  LYS n 
5  348  ARG n 
5  349  ILE n 
5  350  GLN n 
5  351  TYR n 
5  352  ALA n 
5  353  LYS n 
5  354  ASP n 
5  355  ILE n 
5  356  LEU n 
5  357  GLN n 
5  358  LYS n 
5  359  GLU n 
5  360  PHE n 
5  361  LEU n 
5  362  PRO n 
5  363  HIS n 
5  364  ILE n 
5  365  THR n 
5  366  GLN n 
5  367  LEU n 
5  368  GLU n 
5  369  GLY n 
5  370  PHE n 
5  371  GLU n 
5  372  SER n 
5  373  ARG n 
5  374  LYS n 
5  375  ALA n 
5  376  PHE n 
5  377  PHE n 
5  378  LEU n 
5  379  GLY n 
5  380  TYR n 
5  381  MET n 
5  382  ILE n 
5  383  ASN n 
5  384  ARG n 
5  385  LEU n 
5  386  LEU n 
5  387  LEU n 
5  388  CYS n 
5  389  ALA n 
5  390  LEU n 
5  391  ASP n 
5  392  ARG n 
5  393  LYS n 
5  394  ASP n 
5  395  GLN n 
5  396  ASP n 
5  397  ASP n 
5  398  ARG n 
5  399  ASP n 
5  400  HIS n 
5  401  PHE n 
5  402  GLY n 
5  403  LYS n 
5  404  LYS n 
5  405  ARG n 
5  406  LEU n 
5  407  ASP n 
5  408  LEU n 
5  409  ALA n 
5  410  GLY n 
5  411  PRO n 
5  412  LEU n 
5  413  LEU n 
5  414  ALA n 
5  415  GLN n 
5  416  LEU n 
5  417  PHE n 
5  418  LYS n 
5  419  THR n 
5  420  LEU n 
5  421  PHE n 
5  422  LYS n 
5  423  LYS n 
5  424  LEU n 
5  425  THR n 
5  426  LYS n 
5  427  ASP n 
5  428  ILE n 
5  429  PHE n 
5  430  ARG n 
5  431  TYR n 
5  432  MET n 
5  433  GLN n 
5  434  ARG n 
5  435  THR n 
5  436  VAL n 
5  437  GLU n 
5  438  GLU n 
5  439  ALA n 
5  440  HIS n 
5  441  ASP n 
5  442  PHE n 
5  443  ASN n 
5  444  MET n 
5  445  LYS n 
5  446  LEU n 
5  447  ALA n 
5  448  ILE n 
5  449  ASN n 
5  450  ALA n 
5  451  LYS n 
5  452  THR n 
5  453  ILE n 
5  454  THR n 
5  455  SER n 
5  456  GLY n 
5  457  LEU n 
5  458  LYS n 
5  459  TYR n 
5  460  ALA n 
5  461  LEU n 
5  462  ALA n 
5  463  THR n 
5  464  GLY n 
5  465  ASN n 
5  466  TRP n 
5  467  GLY n 
5  468  GLU n 
5  469  GLN n 
5  470  LYS n 
5  471  LYS n 
5  472  ALA n 
5  473  MET n 
5  474  SER n 
5  475  SER n 
5  476  ARG n 
5  477  ALA n 
5  478  GLY n 
5  479  VAL n 
5  480  SER n 
5  481  GLN n 
5  482  VAL n 
5  483  LEU n 
5  484  ASN n 
5  485  ARG n 
5  486  TYR n 
5  487  THR n 
5  488  TYR n 
5  489  SER n 
5  490  SER n 
5  491  THR n 
5  492  LEU n 
5  493  SER n 
5  494  HIS n 
5  495  LEU n 
5  496  ARG n 
5  497  ARG n 
5  498  THR n 
5  499  ASN n 
5  500  THR n 
5  501  PRO n 
5  502  ILE n 
5  503  GLY n 
5  504  ARG n 
5  505  ASP n 
5  506  GLY n 
5  507  LYS n 
5  508  LEU n 
5  509  ALA n 
5  510  LYS n 
5  511  PRO n 
5  512  ARG n 
5  513  GLN n 
5  514  LEU n 
5  515  HIS n 
5  516  ASN n 
5  517  THR n 
5  518  HIS n 
5  519  TRP n 
5  520  GLY n 
5  521  LEU n 
5  522  VAL n 
5  523  CYS n 
5  524  PRO n 
5  525  ALA n 
5  526  GLU n 
5  527  THR n 
5  528  PRO n 
5  529  GLU n 
5  530  GLY n 
5  531  GLN n 
5  532  ALA n 
5  533  CYS n 
5  534  GLY n 
5  535  LEU n 
5  536  VAL n 
5  537  LYS n 
5  538  ASN n 
5  539  LEU n 
5  540  SER n 
5  541  LEU n 
5  542  MET n 
5  543  SER n 
5  544  CYS n 
5  545  ILE n 
5  546  SER n 
5  547  VAL n 
5  548  GLY n 
5  549  THR n 
5  550  ASP n 
5  551  PRO n 
5  552  MET n 
5  553  PRO n 
5  554  ILE n 
5  555  ILE n 
5  556  THR n 
5  557  PHE n 
5  558  LEU n 
5  559  SER n 
5  560  GLU n 
5  561  TRP n 
5  562  GLY n 
5  563  MET n 
5  564  GLU n 
5  565  PRO n 
5  566  LEU n 
5  567  GLU n 
5  568  ASP n 
5  569  TYR n 
5  570  VAL n 
5  571  PRO n 
5  572  HIS n 
5  573  GLN n 
5  574  SER n 
5  575  PRO n 
5  576  ASP n 
5  577  ALA n 
5  578  THR n 
5  579  ARG n 
5  580  VAL n 
5  581  PHE n 
5  582  VAL n 
5  583  ASN n 
5  584  GLY n 
5  585  VAL n 
5  586  TRP n 
5  587  HIS n 
5  588  GLY n 
5  589  VAL n 
5  590  HIS n 
5  591  ARG n 
5  592  ASN n 
5  593  PRO n 
5  594  ALA n 
5  595  ARG n 
5  596  LEU n 
5  597  MET n 
5  598  GLU n 
5  599  THR n 
5  600  LEU n 
5  601  ARG n 
5  602  THR n 
5  603  LEU n 
5  604  ARG n 
5  605  ARG n 
5  606  LYS n 
5  607  GLY n 
5  608  ASP n 
5  609  ILE n 
5  610  ASN n 
5  611  PRO n 
5  612  GLU n 
5  613  VAL n 
5  614  SER n 
5  615  MET n 
5  616  ILE n 
5  617  ARG n 
5  618  ASP n 
5  619  ILE n 
5  620  ARG n 
5  621  GLU n 
5  622  LYS n 
5  623  GLU n 
5  624  LEU n 
5  625  LYS n 
5  626  ILE n 
5  627  PHE n 
5  628  THR n 
5  629  ASP n 
5  630  ALA n 
5  631  GLY n 
5  632  ARG n 
5  633  VAL n 
5  634  TYR n 
5  635  ARG n 
5  636  PRO n 
5  637  LEU n 
5  638  PHE n 
5  639  ILE n 
5  640  VAL n 
5  641  GLU n 
5  642  ASP n 
5  643  ASP n 
5  644  GLU n 
5  645  SER n 
5  646  LEU n 
5  647  GLY n 
5  648  HIS n 
5  649  LYS n 
5  650  GLU n 
5  651  LEU n 
5  652  LYS n 
5  653  VAL n 
5  654  ARG n 
5  655  LYS n 
5  656  GLY n 
5  657  HIS n 
5  658  ILE n 
5  659  ALA n 
5  660  LYS n 
5  661  LEU n 
5  662  MET n 
5  663  ALA n 
5  664  THR n 
5  665  GLU n 
5  666  TYR n 
5  667  GLN n 
5  668  ASP n 
5  669  ILE n 
5  670  GLU n 
5  671  GLY n 
5  672  GLY n 
5  673  PHE n 
5  674  GLU n 
5  675  ASP n 
5  676  VAL n 
5  677  GLU n 
5  678  GLU n 
5  679  TYR n 
5  680  THR n 
5  681  TRP n 
5  682  SER n 
5  683  SER n 
5  684  LEU n 
5  685  LEU n 
5  686  ASN n 
5  687  GLU n 
5  688  GLY n 
5  689  LEU n 
5  690  VAL n 
5  691  GLU n 
5  692  TYR n 
5  693  ILE n 
5  694  ASP n 
5  695  ALA n 
5  696  GLU n 
5  697  GLU n 
5  698  GLU n 
5  699  GLU n 
5  700  SER n 
5  701  ILE n 
5  702  LEU n 
5  703  ILE n 
5  704  ALA n 
5  705  MET n 
5  706  GLN n 
5  707  PRO n 
5  708  GLU n 
5  709  ASP n 
5  710  LEU n 
5  711  GLU n 
5  712  PRO n 
5  713  ALA n 
5  714  GLU n 
5  715  ALA n 
5  716  ASN n 
5  717  GLU n 
5  718  GLU n 
5  719  ASN n 
5  720  ASP n 
5  721  LEU n 
5  722  ASP n 
5  723  VAL n 
5  724  ASP n 
5  725  PRO n 
5  726  ALA n 
5  727  LYS n 
5  728  ARG n 
5  729  ILE n 
5  730  ARG n 
5  731  VAL n 
5  732  SER n 
5  733  HIS n 
5  734  HIS n 
5  735  ALA n 
5  736  THR n 
5  737  THR n 
5  738  PHE n 
5  739  THR n 
5  740  HIS n 
5  741  CYS n 
5  742  GLU n 
5  743  ILE n 
5  744  HIS n 
5  745  PRO n 
5  746  SER n 
5  747  MET n 
5  748  ILE n 
5  749  LEU n 
5  750  GLY n 
5  751  VAL n 
5  752  ALA n 
5  753  ALA n 
5  754  SER n 
5  755  ILE n 
5  756  ILE n 
5  757  PRO n 
5  758  PHE n 
5  759  PRO n 
5  760  ASP n 
5  761  HIS n 
5  762  ASN n 
5  763  GLN n 
5  764  SER n 
5  765  PRO n 
5  766  ARG n 
5  767  ASN n 
5  768  THR n 
5  769  TYR n 
5  770  GLN n 
5  771  SER n 
5  772  ALA n 
5  773  MET n 
5  774  GLY n 
5  775  LYS n 
5  776  GLN n 
5  777  ALA n 
5  778  MET n 
5  779  GLY n 
5  780  VAL n 
5  781  PHE n 
5  782  LEU n 
5  783  THR n 
5  784  ASN n 
5  785  TYR n 
5  786  ASN n 
5  787  VAL n 
5  788  ARG n 
5  789  MET n 
5  790  ASP n 
5  791  THR n 
5  792  MET n 
5  793  ALA n 
5  794  ASN n 
5  795  ILE n 
5  796  LEU n 
5  797  TYR n 
5  798  TYR n 
5  799  PRO n 
5  800  GLN n 
5  801  LYS n 
5  802  PRO n 
5  803  LEU n 
5  804  GLY n 
5  805  THR n 
5  806  THR n 
5  807  ARG n 
5  808  ALA n 
5  809  MET n 
5  810  GLU n 
5  811  TYR n 
5  812  LEU n 
5  813  LYS n 
5  814  PHE n 
5  815  ARG n 
5  816  GLU n 
5  817  LEU n 
5  818  PRO n 
5  819  ALA n 
5  820  GLY n 
5  821  GLN n 
5  822  ASN n 
5  823  ALA n 
5  824  ILE n 
5  825  VAL n 
5  826  ALA n 
5  827  ILE n 
5  828  ALA n 
5  829  CYS n 
5  830  TYR n 
5  831  SER n 
5  832  GLY n 
5  833  TYR n 
5  834  ASN n 
5  835  GLN n 
5  836  GLU n 
5  837  ASP n 
5  838  SER n 
5  839  MET n 
5  840  ILE n 
5  841  MET n 
5  842  ASN n 
5  843  GLN n 
5  844  SER n 
5  845  SER n 
5  846  ILE n 
5  847  ASP n 
5  848  ARG n 
5  849  GLY n 
5  850  LEU n 
5  851  PHE n 
5  852  ARG n 
5  853  SER n 
5  854  LEU n 
5  855  PHE n 
5  856  PHE n 
5  857  ARG n 
5  858  SER n 
5  859  TYR n 
5  860  MET n 
5  861  ASP n 
5  862  GLN n 
5  863  GLU n 
5  864  LYS n 
5  865  LYS n 
5  866  TYR n 
5  867  GLY n 
5  868  MET n 
5  869  SER n 
5  870  ILE n 
5  871  THR n 
5  872  GLU n 
5  873  THR n 
5  874  PHE n 
5  875  GLU n 
5  876  LYS n 
5  877  PRO n 
5  878  GLN n 
5  879  ARG n 
5  880  THR n 
5  881  ASN n 
5  882  THR n 
5  883  LEU n 
5  884  ARG n 
5  885  MET n 
5  886  LYS n 
5  887  HIS n 
5  888  GLY n 
5  889  THR n 
5  890  TYR n 
5  891  ASP n 
5  892  LYS n 
5  893  LEU n 
5  894  ASP n 
5  895  ASP n 
5  896  ASP n 
5  897  GLY n 
5  898  LEU n 
5  899  ILE n 
5  900  ALA n 
5  901  PRO n 
5  902  GLY n 
5  903  VAL n 
5  904  ARG n 
5  905  VAL n 
5  906  SER n 
5  907  GLY n 
5  908  GLU n 
5  909  ASP n 
5  910  VAL n 
5  911  ILE n 
5  912  ILE n 
5  913  GLY n 
5  914  LYS n 
5  915  THR n 
5  916  THR n 
5  917  PRO n 
5  918  ILE n 
5  919  SER n 
5  920  PRO n 
5  921  ASP n 
5  922  GLU n 
5  923  GLU n 
5  924  GLU n 
5  925  LEU n 
5  926  GLY n 
5  927  GLN n 
5  928  ARG n 
5  929  THR n 
5  930  ALA n 
5  931  TYR n 
5  932  HIS n 
5  933  SER n 
5  934  LYS n 
5  935  ARG n 
5  936  ASP n 
5  937  ALA n 
5  938  SER n 
5  939  THR n 
5  940  PRO n 
5  941  LEU n 
5  942  ARG n 
5  943  SER n 
5  944  THR n 
5  945  GLU n 
5  946  ASN n 
5  947  GLY n 
5  948  ILE n 
5  949  VAL n 
5  950  ASP n 
5  951  GLN n 
5  952  VAL n 
5  953  LEU n 
5  954  VAL n 
5  955  THR n 
5  956  THR n 
5  957  ASN n 
5  958  GLN n 
5  959  ASP n 
5  960  GLY n 
5  961  LEU n 
5  962  LYS n 
5  963  PHE n 
5  964  VAL n 
5  965  LYS n 
5  966  VAL n 
5  967  ARG n 
5  968  VAL n 
5  969  ARG n 
5  970  THR n 
5  971  THR n 
5  972  LYS n 
5  973  ILE n 
5  974  PRO n 
5  975  GLN n 
5  976  ILE n 
5  977  GLY n 
5  978  ASP n 
5  979  LYS n 
5  980  PHE n 
5  981  ALA n 
5  982  SER n 
5  983  ARG n 
5  984  HIS n 
5  985  GLY n 
5  986  GLN n 
5  987  LYS n 
5  988  GLY n 
5  989  THR n 
5  990  ILE n 
5  991  GLY n 
5  992  ILE n 
5  993  THR n 
5  994  TYR n 
5  995  ARG n 
5  996  ARG n 
5  997  GLU n 
5  998  ASP n 
5  999  MET n 
5  1000 PRO n 
5  1001 PHE n 
5  1002 THR n 
5  1003 ALA n 
5  1004 GLU n 
5  1005 GLY n 
5  1006 ILE n 
5  1007 VAL n 
5  1008 PRO n 
5  1009 ASP n 
5  1010 LEU n 
5  1011 ILE n 
5  1012 ILE n 
5  1013 ASN n 
5  1014 PRO n 
5  1015 HIS n 
5  1016 ALA n 
5  1017 ILE n 
5  1018 PRO n 
5  1019 SER n 
5  1020 ARG n 
5  1021 MET n 
5  1022 THR n 
5  1023 VAL n 
5  1024 ALA n 
5  1025 HIS n 
5  1026 LEU n 
5  1027 ILE n 
5  1028 GLU n 
5  1029 CYS n 
5  1030 LEU n 
5  1031 LEU n 
5  1032 SER n 
5  1033 LYS n 
5  1034 VAL n 
5  1035 ALA n 
5  1036 ALA n 
5  1037 LEU n 
5  1038 SER n 
5  1039 GLY n 
5  1040 ASN n 
5  1041 GLU n 
5  1042 GLY n 
5  1043 ASP n 
5  1044 ALA n 
5  1045 SER n 
5  1046 PRO n 
5  1047 PHE n 
5  1048 THR n 
5  1049 ASP n 
5  1050 ILE n 
5  1051 THR n 
5  1052 VAL n 
5  1053 GLU n 
5  1054 GLY n 
5  1055 ILE n 
5  1056 SER n 
5  1057 LYS n 
5  1058 LEU n 
5  1059 LEU n 
5  1060 ARG n 
5  1061 GLU n 
5  1062 HIS n 
5  1063 GLY n 
5  1064 TYR n 
5  1065 GLN n 
5  1066 SER n 
5  1067 ARG n 
5  1068 GLY n 
5  1069 PHE n 
5  1070 GLU n 
5  1071 VAL n 
5  1072 MET n 
5  1073 TYR n 
5  1074 ASN n 
5  1075 GLY n 
5  1076 HIS n 
5  1077 THR n 
5  1078 GLY n 
5  1079 LYS n 
5  1080 LYS n 
5  1081 LEU n 
5  1082 MET n 
5  1083 ALA n 
5  1084 GLN n 
5  1085 ILE n 
5  1086 PHE n 
5  1087 PHE n 
5  1088 GLY n 
5  1089 PRO n 
5  1090 THR n 
5  1091 TYR n 
5  1092 TYR n 
5  1093 GLN n 
5  1094 ARG n 
5  1095 LEU n 
5  1096 ARG n 
5  1097 HIS n 
5  1098 MET n 
5  1099 VAL n 
5  1100 ASP n 
5  1101 ASP n 
5  1102 LYS n 
5  1103 ILE n 
5  1104 HIS n 
5  1105 ALA n 
5  1106 ARG n 
5  1107 ALA n 
5  1108 ARG n 
5  1109 GLY n 
5  1110 PRO n 
5  1111 MET n 
5  1112 GLN n 
5  1113 VAL n 
5  1114 LEU n 
5  1115 THR n 
5  1116 ARG n 
5  1117 GLN n 
5  1118 PRO n 
5  1119 VAL n 
5  1120 GLU n 
5  1121 GLY n 
5  1122 ARG n 
5  1123 SER n 
5  1124 ARG n 
5  1125 ASP n 
5  1126 GLY n 
5  1127 GLY n 
5  1128 LEU n 
5  1129 ARG n 
5  1130 PHE n 
5  1131 GLY n 
5  1132 GLU n 
5  1133 MET n 
5  1134 GLU n 
5  1135 ARG n 
5  1136 ASP n 
5  1137 CYS n 
5  1138 MET n 
5  1139 ILE n 
5  1140 ALA n 
5  1141 HIS n 
5  1142 GLY n 
5  1143 ALA n 
5  1144 ALA n 
5  1145 SER n 
5  1146 PHE n 
5  1147 LEU n 
5  1148 LYS n 
5  1149 GLU n 
5  1150 ARG n 
5  1151 LEU n 
5  1152 MET n 
5  1153 GLU n 
5  1154 ALA n 
5  1155 SER n 
5  1156 ASP n 
5  1157 ALA n 
5  1158 PHE n 
5  1159 ARG n 
5  1160 VAL n 
5  1161 HIS n 
5  1162 ILE n 
5  1163 CYS n 
5  1164 GLY n 
5  1165 ILE n 
5  1166 CYS n 
5  1167 GLY n 
5  1168 LEU n 
5  1169 MET n 
5  1170 THR n 
5  1171 VAL n 
5  1172 ILE n 
5  1173 ALA n 
5  1174 LYS n 
5  1175 LEU n 
5  1176 ASN n 
5  1177 HIS n 
5  1178 ASN n 
5  1179 GLN n 
5  1180 PHE n 
5  1181 GLU n 
5  1182 CYS n 
5  1183 LYS n 
5  1184 GLY n 
5  1185 CYS n 
5  1186 ASP n 
5  1187 ASN n 
5  1188 LYS n 
5  1189 ILE n 
5  1190 ASP n 
5  1191 ILE n 
5  1192 TYR n 
5  1193 GLN n 
5  1194 ILE n 
5  1195 HIS n 
5  1196 ILE n 
5  1197 PRO n 
5  1198 TYR n 
5  1199 ALA n 
5  1200 ALA n 
5  1201 LYS n 
5  1202 LEU n 
5  1203 LEU n 
5  1204 PHE n 
5  1205 GLN n 
5  1206 GLU n 
5  1207 LEU n 
5  1208 MET n 
5  1209 ALA n 
5  1210 MET n 
5  1211 ASN n 
5  1212 ILE n 
5  1213 THR n 
5  1214 PRO n 
5  1215 ARG n 
5  1216 LEU n 
5  1217 TYR n 
5  1218 THR n 
5  1219 ASP n 
5  1220 ARG n 
5  1221 SER n 
5  1222 ARG n 
5  1223 ASP n 
5  1224 PHE n 
6  1    MET n 
6  2    SER n 
6  3    GLU n 
6  4    GLU n 
6  5    GLY n 
6  6    PRO n 
6  7    GLN n 
6  8    VAL n 
6  9    LYS n 
6  10   ILE n 
6  11   ARG n 
6  12   GLU n 
6  13   ALA n 
6  14   SER n 
6  15   LYS n 
6  16   ASP n 
6  17   ASN n 
6  18   VAL n 
6  19   ASP n 
6  20   PHE n 
6  21   ILE n 
6  22   LEU n 
6  23   SER n 
6  24   ASN n 
6  25   VAL n 
6  26   ASP n 
6  27   LEU n 
6  28   ALA n 
6  29   MET n 
6  30   ALA n 
6  31   ASN n 
6  32   SER n 
6  33   LEU n 
6  34   ARG n 
6  35   ARG n 
6  36   VAL n 
6  37   MET n 
6  38   ILE n 
6  39   ALA n 
6  40   GLU n 
6  41   ILE n 
6  42   PRO n 
6  43   THR n 
6  44   LEU n 
6  45   ALA n 
6  46   ILE n 
6  47   ASP n 
6  48   SER n 
6  49   VAL n 
6  50   GLU n 
6  51   VAL n 
6  52   GLU n 
6  53   THR n 
6  54   ASN n 
6  55   THR n 
6  56   THR n 
6  57   VAL n 
6  58   LEU n 
6  59   ALA n 
6  60   ASP n 
6  61   GLU n 
6  62   PHE n 
6  63   ILE n 
6  64   ALA n 
6  65   HIS n 
6  66   ARG n 
6  67   LEU n 
6  68   GLY n 
6  69   LEU n 
6  70   ILE n 
6  71   PRO n 
6  72   LEU n 
6  73   GLN n 
6  74   SER n 
6  75   MET n 
6  76   ASP n 
6  77   ILE n 
6  78   GLU n 
6  79   GLN n 
6  80   LEU n 
6  81   GLU n 
6  82   TYR n 
6  83   SER n 
6  84   ARG n 
6  85   ASP n 
6  86   CYS n 
6  87   PHE n 
6  88   CYS n 
6  89   GLU n 
6  90   ASP n 
6  91   HIS n 
6  92   CYS n 
6  93   ASP n 
6  94   LYS n 
6  95   CYS n 
6  96   SER n 
6  97   VAL n 
6  98   VAL n 
6  99   LEU n 
6  100  THR n 
6  101  LEU n 
6  102  GLN n 
6  103  ALA n 
6  104  PHE n 
6  105  GLY n 
6  106  GLU n 
6  107  SER n 
6  108  GLU n 
6  109  SER n 
6  110  THR n 
6  111  THR n 
6  112  ASN n 
6  113  VAL n 
6  114  TYR n 
6  115  SER n 
6  116  LYS n 
6  117  ASP n 
6  118  LEU n 
6  119  VAL n 
6  120  ILE n 
6  121  VAL n 
6  122  SER n 
6  123  ASN n 
6  124  LEU n 
6  125  MET n 
6  126  GLY n 
6  127  ARG n 
6  128  ASN n 
6  129  ILE n 
6  130  GLY n 
6  131  HIS n 
6  132  PRO n 
6  133  ILE n 
6  134  ILE n 
6  135  GLN n 
6  136  ASP n 
6  137  LYS n 
6  138  GLU n 
6  139  GLY n 
6  140  ASN n 
6  141  GLY n 
6  142  VAL n 
6  143  LEU n 
6  144  ILE n 
6  145  CYS n 
6  146  LYS n 
6  147  LEU n 
6  148  ARG n 
6  149  LYS n 
6  150  GLY n 
6  151  GLN n 
6  152  GLU n 
6  153  LEU n 
6  154  LYS n 
6  155  LEU n 
6  156  THR n 
6  157  CYS n 
6  158  VAL n 
6  159  ALA n 
6  160  LYS n 
6  161  LYS n 
6  162  GLY n 
6  163  ILE n 
6  164  ALA n 
6  165  LYS n 
6  166  GLU n 
6  167  HIS n 
6  168  ALA n 
6  169  LYS n 
6  170  TRP n 
6  171  GLY n 
6  172  PRO n 
6  173  ALA n 
6  174  ALA n 
6  175  ALA n 
6  176  ILE n 
6  177  GLU n 
6  178  PHE n 
6  179  GLU n 
6  180  TYR n 
6  181  ASP n 
6  182  PRO n 
6  183  TRP n 
6  184  ASN n 
6  185  LYS n 
6  186  LEU n 
6  187  LYS n 
6  188  HIS n 
6  189  THR n 
6  190  ASP n 
6  191  TYR n 
6  192  TRP n 
6  193  TYR n 
6  194  GLU n 
6  195  GLN n 
6  196  ASP n 
6  197  SER n 
6  198  ALA n 
6  199  LYS n 
6  200  GLU n 
6  201  TRP n 
6  202  PRO n 
6  203  GLN n 
6  204  SER n 
6  205  LYS n 
6  206  ASN n 
6  207  CYS n 
6  208  GLU n 
6  209  TYR n 
6  210  GLU n 
6  211  ASP n 
6  212  PRO n 
6  213  PRO n 
6  214  ASN n 
6  215  GLU n 
6  216  GLY n 
6  217  ASP n 
6  218  PRO n 
6  219  PHE n 
6  220  ASP n 
6  221  TYR n 
6  222  LYS n 
6  223  ALA n 
6  224  GLN n 
6  225  ALA n 
6  226  ASP n 
6  227  THR n 
6  228  PHE n 
6  229  TYR n 
6  230  MET n 
6  231  ASN n 
6  232  VAL n 
6  233  GLU n 
6  234  SER n 
6  235  VAL n 
6  236  GLY n 
6  237  SER n 
6  238  ILE n 
6  239  PRO n 
6  240  VAL n 
6  241  ASP n 
6  242  GLN n 
6  243  VAL n 
6  244  VAL n 
6  245  VAL n 
6  246  ARG n 
6  247  GLY n 
6  248  ILE n 
6  249  ASP n 
6  250  THR n 
6  251  LEU n 
6  252  GLN n 
6  253  LYS n 
6  254  LYS n 
6  255  VAL n 
6  256  ALA n 
6  257  SER n 
6  258  ILE n 
6  259  LEU n 
6  260  LEU n 
6  261  ALA n 
6  262  LEU n 
6  263  THR n 
6  264  GLN n 
6  265  MET n 
6  266  ASP n 
6  267  GLN n 
6  268  ASP n 
6  269  LYS n 
6  270  VAL n 
6  271  ASN n 
6  272  PHE n 
6  273  ALA n 
6  274  SER n 
6  275  GLY n 
6  276  ASP n 
6  277  ASN n 
6  278  ASN n 
6  279  THR n 
6  280  ALA n 
6  281  SER n 
6  282  ASN n 
6  283  MET n 
6  284  LEU n 
6  285  GLY n 
6  286  SER n 
6  287  ASN n 
6  288  GLU n 
6  289  ASP n 
6  290  VAL n 
6  291  MET n 
6  292  MET n 
6  293  THR n 
6  294  GLY n 
6  295  ALA n 
6  296  GLU n 
6  297  GLN n 
6  298  ASP n 
6  299  PRO n 
6  300  TYR n 
6  301  SER n 
6  302  ASN n 
6  303  ALA n 
6  304  SER n 
6  305  GLN n 
6  306  MET n 
6  307  GLY n 
6  308  ASN n 
6  309  THR n 
6  310  GLY n 
6  311  SER n 
6  312  GLY n 
6  313  GLY n 
6  314  TYR n 
6  315  ASP n 
6  316  ASN n 
6  317  ALA n 
6  318  TRP n 
7  1    MET n 
7  2    ASP n 
7  3    GLN n 
7  4    GLU n 
7  5    ASN n 
7  6    GLU n 
7  7    ARG n 
7  8    ASN n 
7  9    ILE n 
7  10   SER n 
7  11   ARG n 
7  12   LEU n 
7  13   TRP n 
7  14   ARG n 
7  15   ALA n 
7  16   PHE n 
7  17   ARG n 
7  18   THR n 
7  19   VAL n 
7  20   LYS n 
7  21   GLU n 
7  22   MET n 
7  23   VAL n 
7  24   LYS n 
7  25   ASP n 
7  26   ARG n 
7  27   GLY n 
7  28   TYR n 
7  29   PHE n 
7  30   ILE n 
7  31   THR n 
7  32   GLN n 
7  33   GLU n 
7  34   GLU n 
7  35   VAL n 
7  36   GLU n 
7  37   LEU n 
7  38   PRO n 
7  39   LEU n 
7  40   GLU n 
7  41   ASP n 
7  42   PHE n 
7  43   LYS n 
7  44   ALA n 
7  45   LYS n 
7  46   TYR n 
7  47   CYS n 
7  48   ASP n 
7  49   SER n 
7  50   MET n 
7  51   GLY n 
7  52   ARG n 
7  53   PRO n 
7  54   GLN n 
7  55   ARG n 
7  56   LYS n 
7  57   MET n 
7  58   MET n 
7  59   SER n 
7  60   PHE n 
7  61   GLN n 
7  62   ALA n 
7  63   ASN n 
7  64   PRO n 
7  65   THR n 
7  66   GLU n 
7  67   GLU n 
7  68   SER n 
7  69   ILE n 
7  70   SER n 
7  71   LYS n 
7  72   PHE n 
7  73   PRO n 
7  74   ASP n 
7  75   MET n 
7  76   GLY n 
7  77   SER n 
7  78   LEU n 
7  79   TRP n 
7  80   VAL n 
7  81   GLU n 
7  82   PHE n 
7  83   CYS n 
7  84   ASP n 
7  85   GLU n 
7  86   PRO n 
7  87   SER n 
7  88   VAL n 
7  89   GLY n 
7  90   VAL n 
7  91   LYS n 
7  92   THR n 
7  93   MET n 
7  94   LYS n 
7  95   THR n 
7  96   PHE n 
7  97   VAL n 
7  98   ILE n 
7  99   HIS n 
7  100  ILE n 
7  101  GLN n 
7  102  GLU n 
7  103  LYS n 
7  104  ASN n 
7  105  PHE n 
7  106  GLN n 
7  107  THR n 
7  108  GLY n 
7  109  ILE n 
7  110  PHE n 
7  111  VAL n 
7  112  TYR n 
7  113  GLN n 
7  114  ASN n 
7  115  ASN n 
7  116  ILE n 
7  117  THR n 
7  118  PRO n 
7  119  SER n 
7  120  ALA n 
7  121  MET n 
7  122  LYS n 
7  123  LEU n 
7  124  VAL n 
7  125  PRO n 
7  126  SER n 
7  127  ILE n 
7  128  PRO n 
7  129  PRO n 
7  130  ALA n 
7  131  THR n 
7  132  ILE n 
7  133  GLU n 
7  134  THR n 
7  135  PHE n 
7  136  ASN n 
7  137  GLU n 
7  138  ALA n 
7  139  ALA n 
7  140  LEU n 
7  141  VAL n 
7  142  VAL n 
7  143  ASN n 
7  144  ILE n 
7  145  THR n 
7  146  HIS n 
7  147  HIS n 
7  148  GLU n 
7  149  LEU n 
7  150  VAL n 
7  151  PRO n 
7  152  LYS n 
7  153  HIS n 
7  154  ILE n 
7  155  ARG n 
7  156  LEU n 
7  157  SER n 
7  158  SER n 
7  159  ASP n 
7  160  GLU n 
7  161  LYS n 
7  162  ARG n 
7  163  GLU n 
7  164  LEU n 
7  165  LEU n 
7  166  LYS n 
7  167  ARG n 
7  168  TYR n 
7  169  ARG n 
7  170  LEU n 
7  171  LYS n 
7  172  GLU n 
7  173  SER n 
7  174  GLN n 
7  175  LEU n 
7  176  PRO n 
7  177  ARG n 
7  178  ILE n 
7  179  GLN n 
7  180  ARG n 
7  181  ALA n 
7  182  ASP n 
7  183  PRO n 
7  184  VAL n 
7  185  ALA n 
7  186  LEU n 
7  187  TYR n 
7  188  LEU n 
7  189  GLY n 
7  190  LEU n 
7  191  LYS n 
7  192  ARG n 
7  193  GLY n 
7  194  GLU n 
7  195  VAL n 
7  196  VAL n 
7  197  LYS n 
7  198  ILE n 
7  199  ILE n 
7  200  ARG n 
7  201  LYS n 
7  202  SER n 
7  203  GLU n 
7  204  THR n 
7  205  SER n 
7  206  GLY n 
7  207  ARG n 
7  208  TYR n 
7  209  ALA n 
7  210  SER n 
7  211  TYR n 
7  212  ARG n 
7  213  ILE n 
7  214  CYS n 
7  215  MET n 
8  1    MET n 
8  2    SER n 
8  3    ASP n 
8  4    TYR n 
8  5    GLU n 
8  6    GLU n 
8  7    ALA n 
8  8    PHE n 
8  9    ASN n 
8  10   ASP n 
8  11   GLY n 
8  12   ASN n 
8  13   GLU n 
8  14   ASN n 
8  15   PHE n 
8  16   GLU n 
8  17   ASP n 
8  18   PHE n 
8  19   ASP n 
8  20   VAL n 
8  21   GLU n 
8  22   HIS n 
8  23   PHE n 
8  24   SER n 
8  25   ASP n 
8  26   GLU n 
8  27   GLU n 
8  28   THR n 
8  29   TYR n 
8  30   GLU n 
8  31   GLU n 
8  32   LYS n 
8  33   PRO n 
8  34   GLN n 
8  35   PHE n 
8  36   LYS n 
8  37   ASP n 
8  38   GLY n 
8  39   GLU n 
8  40   THR n 
8  41   THR n 
8  42   ASP n 
8  43   ALA n 
8  44   ASN n 
8  45   GLY n 
8  46   LYS n 
8  47   THR n 
8  48   ILE n 
8  49   VAL n 
8  50   THR n 
8  51   GLY n 
8  52   GLY n 
8  53   ASN n 
8  54   GLY n 
8  55   PRO n 
8  56   GLU n 
8  57   ASP n 
8  58   PHE n 
8  59   GLN n 
8  60   GLN n 
8  61   HIS n 
8  62   GLU n 
8  63   GLN n 
8  64   ILE n 
8  65   ARG n 
8  66   ARG n 
8  67   LYS n 
8  68   THR n 
8  69   LEU n 
8  70   LYS n 
8  71   GLU n 
8  72   LYS n 
8  73   ALA n 
8  74   ILE n 
8  75   PRO n 
8  76   LYS n 
8  77   ASP n 
8  78   GLN n 
8  79   ARG n 
8  80   ALA n 
8  81   THR n 
8  82   THR n 
8  83   PRO n 
8  84   TYR n 
8  85   MET n 
8  86   THR n 
8  87   LYS n 
8  88   TYR n 
8  89   GLU n 
8  90   ARG n 
8  91   ALA n 
8  92   ARG n 
8  93   ILE n 
8  94   LEU n 
8  95   GLY n 
8  96   THR n 
8  97   ARG n 
8  98   ALA n 
8  99   LEU n 
8  100  GLN n 
8  101  ILE n 
8  102  SER n 
8  103  MET n 
8  104  ASN n 
8  105  ALA n 
8  106  PRO n 
8  107  VAL n 
8  108  PHE n 
8  109  VAL n 
8  110  ASP n 
8  111  LEU n 
8  112  GLU n 
8  113  GLY n 
8  114  GLU n 
8  115  THR n 
8  116  ASP n 
8  117  PRO n 
8  118  LEU n 
8  119  ARG n 
8  120  ILE n 
8  121  ALA n 
8  122  MET n 
8  123  LYS n 
8  124  GLU n 
8  125  LEU n 
8  126  ALA n 
8  127  GLU n 
8  128  LYS n 
8  129  LYS n 
8  130  ILE n 
8  131  PRO n 
8  132  LEU n 
8  133  VAL n 
8  134  ILE n 
8  135  ARG n 
8  136  ARG n 
8  137  TYR n 
8  138  LEU n 
8  139  PRO n 
8  140  ASP n 
8  141  GLY n 
8  142  SER n 
8  143  PHE n 
8  144  GLU n 
8  145  ASP n 
8  146  TRP n 
8  147  SER n 
8  148  VAL n 
8  149  GLU n 
8  150  GLU n 
8  151  LEU n 
8  152  ILE n 
8  153  VAL n 
8  154  ASP n 
8  155  LEU n 
9  1    MET n 
9  2    SER n 
9  3    ASN n 
9  4    THR n 
9  5    LEU n 
9  6    PHE n 
9  7    ASP n 
9  8    ASP n 
9  9    ILE n 
9  10   PHE n 
9  11   GLN n 
9  12   VAL n 
9  13   SER n 
9  14   GLU n 
9  15   VAL n 
9  16   ASP n 
9  17   PRO n 
9  18   GLY n 
9  19   ARG n 
9  20   TYR n 
9  21   ASN n 
9  22   LYS n 
9  23   VAL n 
9  24   CYS n 
9  25   ARG n 
9  26   ILE n 
9  27   GLU n 
9  28   ALA n 
9  29   ALA n 
9  30   SER n 
9  31   THR n 
9  32   THR n 
9  33   GLN n 
9  34   ASP n 
9  35   GLN n 
9  36   CYS n 
9  37   LYS n 
9  38   LEU n 
9  39   THR n 
9  40   LEU n 
9  41   ASP n 
9  42   ILE n 
9  43   ASN n 
9  44   VAL n 
9  45   GLU n 
9  46   LEU n 
9  47   PHE n 
9  48   PRO n 
9  49   VAL n 
9  50   ALA n 
9  51   ALA n 
9  52   GLN n 
9  53   ASP n 
9  54   SER n 
9  55   LEU n 
9  56   THR n 
9  57   VAL n 
9  58   THR n 
9  59   ILE n 
9  60   ALA n 
9  61   SER n 
9  62   SER n 
9  63   LEU n 
9  64   ASN n 
9  65   LEU n 
9  66   GLU n 
9  67   ASP n 
9  68   THR n 
9  69   PRO n 
9  70   ALA n 
9  71   ASN n 
9  72   ASP n 
9  73   SER n 
9  74   SER n 
9  75   ALA n 
9  76   THR n 
9  77   ARG n 
9  78   SER n 
9  79   TRP n 
9  80   ARG n 
9  81   PRO n 
9  82   PRO n 
9  83   GLN n 
9  84   ALA n 
9  85   GLY n 
9  86   ASP n 
9  87   ARG n 
9  88   SER n 
9  89   LEU n 
9  90   ALA n 
9  91   ASP n 
9  92   ASP n 
9  93   TYR n 
9  94   ASP n 
9  95   TYR n 
9  96   VAL n 
9  97   MET n 
9  98   TYR n 
9  99   GLY n 
9  100  THR n 
9  101  ALA n 
9  102  TYR n 
9  103  LYS n 
9  104  PHE n 
9  105  GLU n 
9  106  GLU n 
9  107  VAL n 
9  108  SER n 
9  109  LYS n 
9  110  ASP n 
9  111  LEU n 
9  112  ILE n 
9  113  ALA n 
9  114  VAL n 
9  115  TYR n 
9  116  TYR n 
9  117  SER n 
9  118  PHE n 
9  119  GLY n 
9  120  GLY n 
9  121  LEU n 
9  122  LEU n 
9  123  MET n 
9  124  ARG n 
9  125  LEU n 
9  126  GLU n 
9  127  GLY n 
9  128  ASN n 
9  129  TYR n 
9  130  ARG n 
9  131  ASN n 
9  132  LEU n 
9  133  ASN n 
9  134  ASN n 
9  135  LEU n 
9  136  LYS n 
9  137  GLN n 
9  138  GLU n 
9  139  ASN n 
9  140  ALA n 
9  141  TYR n 
9  142  LEU n 
9  143  LEU n 
9  144  ILE n 
9  145  ARG n 
9  146  ARG n 
10 1    MET n 
10 2    THR n 
10 3    THR n 
10 4    PHE n 
10 5    ARG n 
10 6    PHE n 
10 7    CYS n 
10 8    ARG n 
10 9    ASP n 
10 10   CYS n 
10 11   ASN n 
10 12   ASN n 
10 13   MET n 
10 14   LEU n 
10 15   TYR n 
10 16   PRO n 
10 17   ARG n 
10 18   GLU n 
10 19   ASP n 
10 20   LYS n 
10 21   GLU n 
10 22   ASN n 
10 23   ASN n 
10 24   ARG n 
10 25   LEU n 
10 26   LEU n 
10 27   PHE n 
10 28   GLU n 
10 29   CYS n 
10 30   ARG n 
10 31   THR n 
10 32   CYS n 
10 33   SER n 
10 34   TYR n 
10 35   VAL n 
10 36   GLU n 
10 37   GLU n 
10 38   ALA n 
10 39   GLY n 
10 40   SER n 
10 41   PRO n 
10 42   LEU n 
10 43   VAL n 
10 44   TYR n 
10 45   ARG n 
10 46   HIS n 
10 47   GLU n 
10 48   LEU n 
10 49   ILE n 
10 50   THR n 
10 51   ASN n 
10 52   ILE n 
10 53   GLY n 
10 54   GLU n 
10 55   THR n 
10 56   ALA n 
10 57   GLY n 
10 58   VAL n 
10 59   VAL n 
10 60   GLN n 
10 61   ASP n 
10 62   ILE n 
10 63   GLY n 
10 64   SER n 
10 65   ASP n 
10 66   PRO n 
10 67   THR n 
10 68   LEU n 
10 69   PRO n 
10 70   ARG n 
10 71   SER n 
10 72   ASP n 
10 73   ARG n 
10 74   GLU n 
10 75   CYS n 
10 76   PRO n 
10 77   LYS n 
10 78   CYS n 
10 79   HIS n 
10 80   SER n 
10 81   ARG n 
10 82   GLU n 
10 83   ASN n 
10 84   VAL n 
10 85   PHE n 
10 86   PHE n 
10 87   GLN n 
10 88   SER n 
10 89   GLN n 
10 90   GLN n 
10 91   ARG n 
10 92   ARG n 
10 93   LYS n 
10 94   ASP n 
10 95   THR n 
10 96   SER n 
10 97   MET n 
10 98   VAL n 
10 99   LEU n 
10 100  PHE n 
10 101  PHE n 
10 102  VAL n 
10 103  CYS n 
10 104  LEU n 
10 105  SER n 
10 106  CYS n 
10 107  SER n 
10 108  HIS n 
10 109  ILE n 
10 110  PHE n 
10 111  THR n 
10 112  SER n 
10 113  ASP n 
10 114  GLN n 
10 115  LYS n 
10 116  ASN n 
10 117  LYS n 
10 118  ARG n 
10 119  THR n 
10 120  GLN n 
10 121  PHE n 
10 122  SER n 
11 1    MET n 
11 2    ILE n 
11 3    VAL n 
11 4    PRO n 
11 5    VAL n 
11 6    ARG n 
11 7    CYS n 
11 8    PHE n 
11 9    SER n 
11 10   CYS n 
11 11   GLY n 
11 12   LYS n 
11 13   VAL n 
11 14   VAL n 
11 15   GLY n 
11 16   ASP n 
11 17   LYS n 
11 18   TRP n 
11 19   GLU n 
11 20   SER n 
11 21   TYR n 
11 22   LEU n 
11 23   ASN n 
11 24   LEU n 
11 25   LEU n 
11 26   GLN n 
11 27   GLU n 
11 28   ASP n 
11 29   GLU n 
11 30   LEU n 
11 31   ASP n 
11 32   GLU n 
11 33   GLY n 
11 34   THR n 
11 35   ALA n 
11 36   LEU n 
11 37   SER n 
11 38   ARG n 
11 39   LEU n 
11 40   GLY n 
11 41   LEU n 
11 42   LYS n 
11 43   ARG n 
11 44   TYR n 
11 45   CYS n 
11 46   CYS n 
11 47   ARG n 
11 48   ARG n 
11 49   MET n 
11 50   ILE n 
11 51   LEU n 
11 52   THR n 
11 53   HIS n 
11 54   VAL n 
11 55   ASP n 
11 56   LEU n 
11 57   ILE n 
11 58   GLU n 
11 59   LYS n 
11 60   PHE n 
11 61   LEU n 
11 62   ARG n 
11 63   TYR n 
11 64   ASN n 
11 65   PRO n 
11 66   LEU n 
11 67   GLU n 
11 68   LYS n 
11 69   ARG n 
11 70   ASP n 
12 1    MET n 
12 2    ASN n 
12 3    ALA n 
12 4    PRO n 
12 5    ASP n 
12 6    ARG n 
12 7    PHE n 
12 8    GLU n 
12 9    LEU n 
12 10   PHE n 
12 11   LEU n 
12 12   LEU n 
12 13   GLY n 
12 14   GLU n 
12 15   GLY n 
12 16   GLU n 
12 17   SER n 
12 18   LYS n 
12 19   LEU n 
12 20   LYS n 
12 21   ILE n 
12 22   ASP n 
12 23   PRO n 
12 24   ASP n 
12 25   THR n 
12 26   LYS n 
12 27   ALA n 
12 28   PRO n 
12 29   ASN n 
12 30   ALA n 
12 31   VAL n 
12 32   VAL n 
12 33   ILE n 
12 34   THR n 
12 35   PHE n 
12 36   GLU n 
12 37   LYS n 
12 38   GLU n 
12 39   ASP n 
12 40   HIS n 
12 41   THR n 
12 42   LEU n 
12 43   GLY n 
12 44   ASN n 
12 45   LEU n 
12 46   ILE n 
12 47   ARG n 
12 48   ALA n 
12 49   GLU n 
12 50   LEU n 
12 51   LEU n 
12 52   ASN n 
12 53   ASP n 
12 54   ARG n 
12 55   LYS n 
12 56   VAL n 
12 57   LEU n 
12 58   PHE n 
12 59   ALA n 
12 60   ALA n 
12 61   TYR n 
12 62   LYS n 
12 63   VAL n 
12 64   GLU n 
12 65   HIS n 
12 66   PRO n 
12 67   PHE n 
12 68   PHE n 
12 69   ALA n 
12 70   ARG n 
12 71   PHE n 
12 72   LYS n 
12 73   LEU n 
12 74   ARG n 
12 75   ILE n 
12 76   GLN n 
12 77   THR n 
12 78   THR n 
12 79   GLU n 
12 80   GLY n 
12 81   TYR n 
12 82   ASP n 
12 83   PRO n 
12 84   LYS n 
12 85   ASP n 
12 86   ALA n 
12 87   LEU n 
12 88   LYS n 
12 89   ASN n 
12 90   ALA n 
12 91   CYS n 
12 92   ASN n 
12 93   SER n 
12 94   ILE n 
12 95   ILE n 
12 96   ASN n 
12 97   LYS n 
12 98   LEU n 
12 99   GLY n 
12 100  ALA n 
12 101  LEU n 
12 102  LYS n 
12 103  THR n 
12 104  ASN n 
12 105  PHE n 
12 106  GLU n 
12 107  THR n 
12 108  GLU n 
12 109  TRP n 
12 110  ASN n 
12 111  LEU n 
12 112  GLN n 
12 113  THR n 
12 114  LEU n 
12 115  ALA n 
12 116  ALA n 
12 117  ASP n 
12 118  ASP n 
12 119  ALA n 
12 120  PHE n 
13 1    MET n 
13 2    SER n 
13 3    ARG n 
13 4    GLU n 
13 5    GLY n 
13 6    PHE n 
13 7    GLN n 
13 8    ILE n 
13 9    PRO n 
13 10   THR n 
13 11   ASN n 
13 12   LEU n 
13 13   ASP n 
13 14   ALA n 
13 15   ALA n 
13 16   ALA n 
13 17   ALA n 
13 18   GLY n 
13 19   THR n 
13 20   SER n 
13 21   GLN n 
13 22   ALA n 
13 23   ARG n 
13 24   THR n 
13 25   ALA n 
13 26   THR n 
13 27   LEU n 
13 28   LYS n 
13 29   TYR n 
13 30   ILE n 
13 31   CYS n 
13 32   ALA n 
13 33   GLU n 
13 34   CYS n 
13 35   SER n 
13 36   SER n 
13 37   LYS n 
13 38   LEU n 
13 39   SER n 
13 40   LEU n 
13 41   SER n 
13 42   ARG n 
13 43   THR n 
13 44   ASP n 
13 45   ALA n 
13 46   VAL n 
13 47   ARG n 
13 48   CYS n 
13 49   LYS n 
13 50   ASP n 
13 51   CYS n 
13 52   GLY n 
13 53   HIS n 
13 54   ARG n 
13 55   ILE n 
13 56   LEU n 
13 57   LEU n 
13 58   LYS n 
13 59   ALA n 
13 60   ARG n 
13 61   THR n 
13 62   LYS n 
13 63   ARG n 
13 64   LEU n 
13 65   VAL n 
13 66   GLN n 
13 67   PHE n 
13 68   GLU n 
13 69   ALA n 
13 70   ARG n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 4  1 ? ? 
2  UNP RPB2_YEAST  P08518 5  1 ? ? 
3  UNP RPB3_YEAST  P16370 6  1 ? ? 
4  UNP RPB5_YEAST  P20434 7  1 ? ? 
5  UNP RPB6_YEAST  P20435 8  1 ? ? 
6  UNP RPB8_YEAST  P20436 9  1 ? ? 
7  UNP RPB9_YEAST  P27999 10 1 ? ? 
8  UNP RPAB5_YEAST P22139 11 1 ? ? 
9  UNP RPB11_YEAST P38902 12 1 ? ? 
10 UNP RPAB4_YEAST P40422 13 1 ? ? 
11 PDB 2NVT        2NVT   1  ? ? ? 
12 PDB 2NVT        2NVT   2  ? ? ? 
13 PDB 2NVT        2NVT   3  ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  2NVT A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  2NVT B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  2NVT C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  2NVT E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  2NVT F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  2NVT H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  2NVT I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  2NVT J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  2NVT K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 2NVT L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 2NVT R 1 ? 10   ? 2NVT   1 ? 10   ? 1 10   
12 12 2NVT T 1 ? 21   ? 2NVT   8 ? 28   ? 8 28   
13 13 2NVT N 1 ? 7    ? 2NVT   1 ? 7    ? 1 7    
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                   ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                        ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                    ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                       ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"           ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"            ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"           ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                   ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                   ? 'C10 H14 N5 O8 P'   363.221 
G2P non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' ? 'C11 H18 N5 O13 P3' 521.208 
GLN 'L-peptide linking' y GLUTAMINE                                      ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                     ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                     ? 'Zn 2'              65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          2NVT 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.87 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'200mM NH4OAc, 150mM Mg(OAc)2, 50mM Hepes, pH 7.0, 5% PEG6000, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 NH4OAc     ? ? ? 
1 2 1 'Mg(OAc)2' ? ? ? 
1 3 1 Hepes      ? ? ? 
1 4 1 PEG6000    ? ? ? 
1 5 2 NH4OAc     ? ? ? 
1 6 2 'Mg(OAc)2' ? ? ? 
1 7 2 Hepes      ? ? ? 
1 8 2 PEG6000    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
# 
_reflns.entry_id                     2NVT 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            3.36 
_reflns.d_resolution_low             40 
_reflns.number_all                   ? 
_reflns.number_obs                   95301 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.125 
_reflns.pdbx_netI_over_sigmaI        8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.36 
_reflns_shell.d_res_low              3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   94.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_Rsym_value        0.541 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NVT 
_refine.ls_number_reflns_obs                     93705 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            3.36 
_refine.ls_R_factor_obs                          0.23223 
_refine.ls_R_factor_R_work                       0.22957 
_refine.ls_R_factor_R_free                       0.28289 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4911 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.902 
_refine.B_iso_mean                               124.679 
_refine.aniso_B[1][1]                            2.28 
_refine.aniso_B[2][2]                            -5.27 
_refine.aniso_B[3][3]                            -2.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -11.94 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.548 
_refine.overall_SU_ML                            0.500 
_refine.overall_SU_B                             70.123 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1SFO 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28345 
_refine_hist.pdbx_number_atoms_nucleic_acid   781 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29168 
_refine_hist.d_res_high                       3.36 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 30119 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.822  2.016  ? 40897 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.986  5.000  ? 3545  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       40.177 24.033 ? 1344  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       23.330 15.000 ? 5281  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.865 15.000 ? 223   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.118  0.200  ? 4595  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 22152 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.271  0.200  ? 15279 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.320  0.200  ? 20005 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.200  0.200  ? 1030  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.076  0.200  ? 1     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.281  0.200  ? 66    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.450  0.200  ? 5     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.647  1.500  ? 18229 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.155  2.000  ? 28782 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.307  3.000  ? 13594 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.230  4.500  ? 12115 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.360 
_refine_ls_shell.d_res_low                        3.448 
_refine_ls_shell.number_reflns_R_work             4862 
_refine_ls_shell.R_factor_R_work                  0.395 
_refine_ls_shell.percent_reflns_obs               68.00 
_refine_ls_shell.R_factor_R_free                  0.417 
_refine_ls_shell.number_reflns_R_free             249 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NVT 
_struct.title                     'RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase II largest subunit (E.C.2.7.7.6)/DNA-directed RNA polymerase II 140 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerase II 45 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerase II 14.2 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerase II 13.6 kDa polypeptide (E.C.2.7.7.6)/DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide (E.C.2.7.7.6)/DNA/RNA
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NVT 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION,TRANSFERASE/DNA-RNA HYBRID' 
_struct_keywords.text            
'TRANSCRIPTION, MRNA, MULTIPROTEIN COMPLEX, MOLECULAR MACHINE, DNA, TRANSFERASE-DNA-RNA HYBRID COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 15 ? 
Q N N 16 ? 
R N N 16 ? 
S N N 15 ? 
T N N 15 ? 
U N N 15 ? 
V N N 15 ? 
W N N 15 ? 
X N N 15 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER D 23   ? SER D 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE D 95   ? GLU D 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   3   ARG D 123  ? ILE D 128  ? ARG A 123  ILE A 128  1 ? 6  
HELX_P HELX_P4   4   LYS D 132  ? LEU D 141  ? LYS A 132  LEU A 141  1 ? 10 
HELX_P HELX_P5   5   THR D 204  ? LYS D 212  ? THR A 204  LYS A 212  1 ? 9  
HELX_P HELX_P6   6   PHE D 219  ? GLY D 223  ? PHE A 219  GLY A 223  5 ? 5  
HELX_P HELX_P7   7   ARG D 230  ? TRP D 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   PRO D 243  ? ARG D 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   PHE D 264  ? ILE D 269  ? PHE A 264  ILE A 269  1 ? 6  
HELX_P HELX_P10  10  ILE D 269  ? LEU D 279  ? ILE A 269  LEU A 279  1 ? 11 
HELX_P HELX_P11  11  GLU D 293  ? ASP D 305  ? GLU A 293  ASP A 305  1 ? 13 
HELX_P HELX_P12  12  LYS D 323  ? LYS D 330  ? LYS A 323  LYS A 330  1 ? 8  
HELX_P HELX_P13  13  GLY D 334  ? LEU D 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P14  14  LYS D 368  ? LYS D 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P15  15  ASN D 384  ? ASN D 394  ? ASN A 384  ASN A 394  1 ? 11 
HELX_P HELX_P16  16  HIS D 451  ? MET D 455  ? HIS A 451  MET A 455  5 ? 5  
HELX_P HELX_P17  17  ASN D 471  ? SER D 473  ? ASN A 471  SER A 473  5 ? 3  
HELX_P HELX_P18  18  VAL D 474  ? ASN D 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P19  19  ARG D 498  ? GLN D 503  ? ARG A 498  GLN A 503  1 ? 6  
HELX_P HELX_P20  20  VAL D 507  ? ILE D 511  ? VAL A 507  ILE A 511  5 ? 5  
HELX_P HELX_P21  21  SER D 513  ? ASN D 517  ? SER A 513  ASN A 517  5 ? 5  
HELX_P HELX_P22  22  VAL D 524  ? LEU D 536  ? VAL A 524  LEU A 536  1 ? 13 
HELX_P HELX_P23  23  LEU D 543  ? VAL D 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P24  24  GLY D 574  ? VAL D 580  ? GLY A 574  VAL A 580  1 ? 7  
HELX_P HELX_P25  25  GLU D 618  ? GLY D 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P26  26  GLY D 628  ? GLY D 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P27  27  PRO D 639  ? HIS D 659  ? PRO A 639  HIS A 659  1 ? 21 
HELX_P HELX_P28  28  GLY D 665  ? ILE D 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P29  29  ASP D 672  ? ALA D 697  ? ASP A 672  ALA A 697  1 ? 26 
HELX_P HELX_P30  30  THR D 709  ? ASN D 736  ? THR A 709  ASN A 736  1 ? 28 
HELX_P HELX_P31  31  ASN D 741  ? GLY D 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P32  32  SER D 754  ? ALA D 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P33  33  SER D 793  ? GLY D 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P34  34  THR D 809  ? GLU D 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P35  35  ILE D 867  ? ASP D 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P36  36  SER D 889  ? ARG D 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P37  37  SER D 915  ? LEU D 920  ? SER A 915  LEU A 920  1 ? 6  
HELX_P HELX_P38  38  ASP D 922  ? PHE D 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P39  39  ASN D 959  ? PHE D 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P40  40  THR D 982  ? GLN D 994  ? THR A 982  GLN A 994  1 ? 13 
HELX_P HELX_P41  41  ASN D 1004 ? LEU D 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P42  42  ALA D 1027 ? GLU D 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P43  43  THR D 1038 ? ARG D 1055 ? THR A 1038 ARG A 1055 1 ? 18 
HELX_P HELX_P44  44  MET D 1063 ? GLN D 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P45  45  GLY D 1097 ? VAL D 1107 ? GLY A 1097 VAL A 1107 1 ? 11 
HELX_P HELX_P46  46  ASP D 1127 ? ALA D 1137 ? ASP A 1127 ALA A 1137 1 ? 11 
HELX_P HELX_P47  47  LEU D 1143 ? SER D 1145 ? LEU A 1143 SER A 1145 5 ? 3  
HELX_P HELX_P48  48  GLU D 1167 ? LEU D 1172 ? GLU A 1167 LEU A 1172 1 ? 6  
HELX_P HELX_P49  49  ALA D 1200 ? LYS D 1205 ? ALA A 1200 LYS A 1205 1 ? 6  
HELX_P HELX_P50  50  THR D 1208 ? GLN D 1218 ? THR A 1208 GLN A 1218 1 ? 11 
HELX_P HELX_P51  51  GLU D 1255 ? ILE D 1271 ? GLU A 1255 ILE A 1271 1 ? 17 
HELX_P HELX_P52  52  ASN D 1312 ? VAL D 1316 ? ASN A 1312 VAL A 1316 5 ? 5  
HELX_P HELX_P53  53  SER D 1331 ? GLY D 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P54  54  GLY D 1340 ? ASP D 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P55  55  ASN D 1364 ? GLN D 1378 ? ASN A 1364 GLN A 1378 1 ? 15 
HELX_P HELX_P56  56  GLY D 1388 ? SER D 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P57  57  GLY D 1395 ? SER D 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P58  58  GLU D 1404 ? SER D 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P59  59  GLY D 1423 ? LEU D 1430 ? GLY A 1423 LEU A 1430 1 ? 8  
HELX_P HELX_P60  60  ILE D 1436 ? ALA D 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P61  61  THR E 26   ? GLU E 28   ? THR B 26   GLU B 28   5 ? 3  
HELX_P HELX_P62  62  ASP E 29   ? GLU E 40   ? ASP B 29   GLU B 40   1 ? 12 
HELX_P HELX_P63  63  VAL E 44   ? TYR E 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P64  64  TYR E 57   ? GLU E 65   ? TYR B 57   GLU B 65   1 ? 9  
HELX_P HELX_P65  65  TYR E 113  ? ARG E 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P66  66  TYR E 180  ? ALA E 184  ? TYR B 180  ALA B 184  5 ? 5  
HELX_P HELX_P67  67  THR E 185  ? LEU E 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P68  68  PRO E 281  ? GLY E 290  ? PRO B 281  GLY B 290  1 ? 10 
HELX_P HELX_P69  69  PRO E 293  ? LEU E 298  ? PRO B 293  LEU B 298  1 ? 6  
HELX_P HELX_P70  70  GLU E 299  ? ILE E 301  ? GLU B 299  ILE B 301  5 ? 3  
HELX_P HELX_P71  71  ASP E 307  ? GLY E 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P72  72  ASP E 326  ? ILE E 334  ? ASP B 326  ILE B 334  1 ? 9  
HELX_P HELX_P73  73  LYS E 347  ? LEU E 356  ? LYS B 347  LEU B 356  1 ? 10 
HELX_P HELX_P74  74  GLU E 371  ? LEU E 390  ? GLU B 371  LEU B 390  1 ? 20 
HELX_P HELX_P75  75  HIS E 400  ? GLY E 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P76  76  LEU E 408  ? THR E 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P77  77  ALA E 450  ? THR E 463  ? ALA B 450  THR B 463  1 ? 14 
HELX_P HELX_P78  78  MET E 473  ? ALA E 477  ? MET B 473  ALA B 477  5 ? 5  
HELX_P HELX_P79  79  THR E 487  ? LEU E 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P80  80  HIS E 515  ? TRP E 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P81  81  PRO E 551  ? SER E 559  ? PRO B 551  SER B 559  1 ? 9  
HELX_P HELX_P82  82  PRO E 565  ? TYR E 569  ? PRO B 565  TYR B 569  5 ? 5  
HELX_P HELX_P83  83  VAL E 570  ? SER E 574  ? VAL B 570  SER B 574  5 ? 5  
HELX_P HELX_P84  84  ASN E 592  ? ARG E 605  ? ASN B 592  ARG B 605  1 ? 14 
HELX_P HELX_P85  85  ARG E 654  ? GLN E 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P86  86  TRP E 681  ? GLU E 687  ? TRP B 681  GLU B 687  1 ? 7  
HELX_P HELX_P87  87  ALA E 695  ? GLU E 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P88  88  HIS E 744  ? LEU E 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P89  89  VAL E 751  ? ILE E 756  ? VAL B 751  ILE B 756  5 ? 6  
HELX_P HELX_P90  90  GLN E 763  ? GLY E 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P91  91  ASN E 784  ? ARG E 788  ? ASN B 784  ARG B 788  5 ? 5  
HELX_P HELX_P92  92  ALA E 808  ? LYS E 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P93  93  GLN E 843  ? GLY E 849  ? GLN B 843  GLY B 849  1 ? 7  
HELX_P HELX_P94  94  THR E 1022 ? GLY E 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P95  95  THR E 1051 ? HIS E 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P96  96  MET E 1098 ? LYS E 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P97  97  GLY E 1121 ? ASP E 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P98  98  GLY E 1131 ? GLY E 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P99  99  ALA E 1143 ? ARG E 1150 ? ALA B 1143 ARG B 1150 1 ? 8  
HELX_P HELX_P100 100 PRO E 1197 ? ASN E 1211 ? PRO B 1197 ASN B 1211 1 ? 15 
HELX_P HELX_P101 101 ASP F 26   ? GLU F 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P102 102 ALA F 59   ? LEU F 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P103 103 ASP F 76   ? LEU F 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P104 104 ASP F 196  ? TRP F 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P105 105 SER F 204  ? GLU F 208  ? SER C 204  GLU C 208  5 ? 5  
HELX_P HELX_P106 106 PRO F 239  ? ASP F 266  ? PRO C 239  ASP C 266  1 ? 28 
HELX_P HELX_P107 107 ASN G 5    ? GLY G 27   ? ASN E 5    GLY E 27   1 ? 23 
HELX_P HELX_P108 108 THR G 31   ? GLU G 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P109 109 PRO G 38   ? TYR G 46   ? PRO E 38   TYR E 46   1 ? 9  
HELX_P HELX_P110 110 GLN G 54   ? MET G 58   ? GLN E 54   MET E 58   5 ? 5  
HELX_P HELX_P111 111 THR G 65   ? PHE G 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P112 112 PHE G 96   ? ASN G 104  ? PHE E 96   ASN E 104  1 ? 9  
HELX_P HELX_P113 113 ALA G 120  ? VAL G 124  ? ALA E 120  VAL E 124  5 ? 5  
HELX_P HELX_P114 114 GLU G 137  ? VAL G 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P115 115 ASN G 143  ? HIS G 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P116 116 SER G 157  ? TYR G 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P117 117 LYS G 171  ? LEU G 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P118 118 VAL G 184  ? GLY G 189  ? VAL E 184  GLY E 189  1 ? 6  
HELX_P HELX_P119 119 THR H 86   ? SER H 102  ? THR F 86   SER F 102  1 ? 17 
HELX_P HELX_P120 120 ASP H 116  ? LYS H 128  ? ASP F 116  LYS F 128  1 ? 13 
HELX_P HELX_P121 121 ASP J 61   ? ASP J 65   ? ASP I 61   ASP I 65   5 ? 5  
HELX_P HELX_P122 122 VAL K 14   ? ASP K 16   ? VAL J 14   ASP J 16   5 ? 3  
HELX_P HELX_P123 123 LYS K 17   ? GLU K 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P124 124 ASP K 31   ? LEU K 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P125 125 CYS K 46   ? THR K 52   ? CYS J 46   THR J 52   1 ? 7  
HELX_P HELX_P126 126 LEU K 56   ? LEU K 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P127 127 LEU L 42   ? LEU L 51   ? LEU K 42   LEU K 51   1 ? 10 
HELX_P HELX_P128 128 ASP L 82   ? ASN L 110  ? ASP K 82   ASN K 110  1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 67   SG    ? ? ? 1_555 D CYS 77 SG ? ? A CYS 67   A CYS 77   1_555 ? ? ? ? ? ? ?               2.599 ? 
disulf2  disulf ? ? F CYS 86   SG    ? ? ? 1_555 F CYS 88 SG ? ? C CYS 86   C CYS 88   1_555 ? ? ? ? ? ? ?               2.913 ? 
disulf3  disulf ? ? K CYS 10   SG    ? ? ? 1_555 K CYS 46 SG ? ? J CYS 10   J CYS 46   1_555 ? ? ? ? ? ? ?               2.919 ? 
disulf4  disulf ? ? M CYS 31   SG    ? ? ? 1_555 M CYS 34 SG ? ? L CYS 31   L CYS 34   1_555 ? ? ? ? ? ? ?               2.734 ? 
metalc1  metalc ? ? A C   10   "O3'" ? ? ? 1_555 R MG  .  MG ? ? R C   10   A MG  2003 1_555 ? ? ? ? ? ? ?               2.294 ? 
metalc2  metalc ? ? D CYS 67   SG    ? ? ? 1_555 P ZN  .  ZN ? ? A CYS 67   A ZN  1735 1_555 ? ? ? ? ? ? ?               2.331 ? 
metalc3  metalc ? ? D CYS 70   SG    ? ? ? 1_555 P ZN  .  ZN ? ? A CYS 70   A ZN  1735 1_555 ? ? ? ? ? ? ?               2.325 ? 
metalc4  metalc ? ? D CYS 77   SG    ? ? ? 1_555 P ZN  .  ZN ? ? A CYS 77   A ZN  1735 1_555 ? ? ? ? ? ? ?               2.342 ? 
metalc5  metalc ? ? D CYS 107  SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 107  A ZN  1734 1_555 ? ? ? ? ? ? ?               2.362 ? 
metalc6  metalc ? ? D CYS 110  SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 110  A ZN  1734 1_555 ? ? ? ? ? ? ?               2.375 ? 
metalc7  metalc ? ? D CYS 148  SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 148  A ZN  1734 1_555 ? ? ? ? ? ? ?               2.369 ? 
metalc8  metalc ? ? D CYS 167  SG    ? ? ? 1_555 O ZN  .  ZN ? ? A CYS 167  A ZN  1734 1_555 ? ? ? ? ? ? ?               2.379 ? 
metalc9  metalc ? ? D ASP 481  OD1   ? ? ? 1_555 R MG  .  MG ? ? A ASP 481  A MG  2003 1_555 ? ? ? ? ? ? ?               1.914 ? 
metalc10 metalc ? ? D ASP 481  OD2   ? ? ? 1_555 Q MG  .  MG ? ? A ASP 481  A MG  2002 1_555 ? ? ? ? ? ? ?               2.386 ? 
metalc11 metalc ? ? D ASP 483  OD2   ? ? ? 1_555 R MG  .  MG ? ? A ASP 483  A MG  2003 1_555 ? ? ? ? ? ? ?               2.274 ? 
metalc12 metalc ? ? E CYS 1163 SG    ? ? ? 1_555 S ZN  .  ZN ? ? B CYS 1163 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.345 ? 
metalc13 metalc ? ? E CYS 1166 SG    ? ? ? 1_555 S ZN  .  ZN ? ? B CYS 1166 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.338 ? 
metalc14 metalc ? ? E CYS 1182 SG    ? ? ? 1_555 S ZN  .  ZN ? ? B CYS 1182 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.376 ? 
metalc15 metalc ? ? E CYS 1185 SG    ? ? ? 1_555 S ZN  .  ZN ? ? B CYS 1185 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.368 ? 
metalc16 metalc ? ? F CYS 86   SG    ? ? ? 1_555 T ZN  .  ZN ? ? C CYS 86   C ZN  319  1_555 ? ? ? ? ? ? ?               2.330 ? 
metalc17 metalc ? ? F CYS 88   SG    ? ? ? 1_555 T ZN  .  ZN ? ? C CYS 88   C ZN  319  1_555 ? ? ? ? ? ? ?               2.317 ? 
metalc18 metalc ? ? F CYS 92   SG    ? ? ? 1_555 T ZN  .  ZN ? ? C CYS 92   C ZN  319  1_555 ? ? ? ? ? ? ?               2.362 ? 
metalc19 metalc ? ? F CYS 95   SG    ? ? ? 1_555 T ZN  .  ZN ? ? C CYS 95   C ZN  319  1_555 ? ? ? ? ? ? ?               2.338 ? 
metalc20 metalc ? ? J CYS 7    SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 7    I ZN  203  1_555 ? ? ? ? ? ? ?               2.321 ? 
metalc21 metalc ? ? J CYS 10   SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 10   I ZN  203  1_555 ? ? ? ? ? ? ?               2.314 ? 
metalc22 metalc ? ? J CYS 29   SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 29   I ZN  203  1_555 ? ? ? ? ? ? ?               2.342 ? 
metalc23 metalc ? ? J CYS 32   SG    ? ? ? 1_555 U ZN  .  ZN ? ? I CYS 32   I ZN  203  1_555 ? ? ? ? ? ? ?               2.362 ? 
metalc24 metalc ? ? J CYS 75   SG    ? ? ? 1_555 V ZN  .  ZN ? ? I CYS 75   I ZN  204  1_555 ? ? ? ? ? ? ?               2.354 ? 
metalc25 metalc ? ? J CYS 78   SG    ? ? ? 1_555 V ZN  .  ZN ? ? I CYS 78   I ZN  204  1_555 ? ? ? ? ? ? ?               2.348 ? 
metalc26 metalc ? ? J CYS 103  SG    ? ? ? 1_555 V ZN  .  ZN ? ? I CYS 103  I ZN  204  1_555 ? ? ? ? ? ? ?               2.342 ? 
metalc27 metalc ? ? J CYS 106  SG    ? ? ? 1_555 V ZN  .  ZN ? ? I CYS 106  I ZN  204  1_555 ? ? ? ? ? ? ?               2.353 ? 
metalc28 metalc ? ? K CYS 7    SG    ? ? ? 1_555 W ZN  .  ZN ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?               2.387 ? 
metalc29 metalc ? ? K CYS 10   SG    ? ? ? 1_555 W ZN  .  ZN ? ? J CYS 10   J ZN  101  1_555 ? ? ? ? ? ? ?               2.337 ? 
metalc30 metalc ? ? K CYS 45   SG    ? ? ? 1_555 W ZN  .  ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?               2.353 ? 
metalc31 metalc ? ? K CYS 46   SG    ? ? ? 1_555 W ZN  .  ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?               2.301 ? 
metalc32 metalc ? ? M CYS 31   SG    ? ? ? 1_555 X ZN  .  ZN ? ? L CYS 31   L ZN  105  1_555 ? ? ? ? ? ? ?               2.345 ? 
metalc33 metalc ? ? M CYS 34   SG    ? ? ? 1_555 X ZN  .  ZN ? ? L CYS 34   L ZN  105  1_555 ? ? ? ? ? ? ?               2.353 ? 
metalc34 metalc ? ? M CYS 48   SG    ? ? ? 1_555 X ZN  .  ZN ? ? L CYS 48   L ZN  105  1_555 ? ? ? ? ? ? ?               2.335 ? 
metalc35 metalc ? ? M CYS 51   SG    ? ? ? 1_555 X ZN  .  ZN ? ? L CYS 51   L ZN  105  1_555 ? ? ? ? ? ? ?               2.352 ? 
hydrog1  hydrog ? ? A A   2    N1    ? ? ? 1_555 B DT  20 N3 ? ? R A   2    T DT  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? A A   2    N6    ? ? ? 1_555 B DT  20 O4 ? ? R A   2    T DT  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? A G   3    O6    ? ? ? 1_555 B DC  19 N4 ? ? R G   3    T DC  26   1_555 ? ? ? ? ? ? 'G-DC PAIR'     ?     ? 
hydrog4  hydrog ? ? A A   4    N1    ? ? ? 1_555 B DT  18 N3 ? ? R A   4    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? A A   4    N6    ? ? ? 1_555 B DT  18 O4 ? ? R A   4    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? A C   5    N3    ? ? ? 1_555 B DG  17 N1 ? ? R C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? A C   5    N4    ? ? ? 1_555 B DG  17 O6 ? ? R C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? A C   5    O2    ? ? ? 1_555 B DG  17 N2 ? ? R C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? A C   6    N3    ? ? ? 1_555 B DG  16 N1 ? ? R C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? A C   6    N4    ? ? ? 1_555 B DG  16 O6 ? ? R C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? A C   6    O2    ? ? ? 1_555 B DG  16 N2 ? ? R C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? A C   6    O2    ? ? ? 1_555 B DG  17 N2 ? ? R C   6    T DG  24   1_555 ? ? ? ? ? ? 'C-DG PAIR'     ?     ? 
hydrog13 hydrog ? ? A A   7    N1    ? ? ? 1_555 B DT  15 N3 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? A A   7    N6    ? ? ? 1_555 B DT  15 O4 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? A G   8    N1    ? ? ? 1_555 B DC  14 N3 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? A G   8    N2    ? ? ? 1_555 B DC  14 O2 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? A G   8    O6    ? ? ? 1_555 B DC  14 N4 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? A G   9    N1    ? ? ? 1_555 B DC  13 N3 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? A G   9    N2    ? ? ? 1_555 B DC  13 O2 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? A G   9    O6    ? ? ? 1_555 B DC  13 N4 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? A C   10   N3    ? ? ? 1_555 B DG  12 N1 ? ? R C   10   T DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? A C   10   N4    ? ? ? 1_555 B DG  12 O6 ? ? R C   10   T DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? A C   10   O2    ? ? ? 1_555 B DG  12 N2 ? ? R C   10   T DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? B DA  2    N1    ? ? ? 1_555 C DT  6  N3 ? ? T DA  9    N DT  6    1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog25 hydrog ? ? B DA  2    N3    ? ? ? 1_555 C DG  7  N2 ? ? T DA  9    N DG  7    1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog26 hydrog ? ? B DA  3    N1    ? ? ? 1_555 C DT  5  N3 ? ? T DA  10   N DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? B DA  3    N6    ? ? ? 1_555 C DT  5  O4 ? ? T DA  10   N DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 48   D . ? ALA 48   A LYS 49   D ? LYS 49   A 1 3.18   
2  ASP 116  D . ? ASP 116  A GLU 117  D ? GLU 117  A 1 -5.84  
3  ASP 218  D . ? ASP 218  A PHE 219  D ? PHE 219  A 1 26.15  
4  PHE 298  D . ? PHE 298  A HIS 299  D ? HIS 299  A 1 23.68  
5  ARG 320  D . ? ARG 320  A PRO 321  D ? PRO 321  A 1 -1.77  
6  MET 341  D . ? MET 341  A GLY 342  D ? GLY 342  A 1 -21.79 
7  GLN 447  D . ? GLN 447  A PRO 448  D ? PRO 448  A 1 4.59   
8  GLY 1123 D . ? GLY 1123 A HIS 1124 D ? HIS 1124 A 1 17.14  
9  SER 1175 D . ? SER 1175 A LEU 1176 D ? LEU 1176 A 1 -1.28  
10 ASP 1446 D . ? ASP 1446 A GLU 1447 D ? GLU 1447 A 1 14.02  
11 GLU 1448 D . ? GLU 1448 A SER 1449 D ? SER 1449 A 1 2.21   
12 SER 1449 D . ? SER 1449 A LEU 1450 D ? LEU 1450 A 1 3.60   
13 GLY 263  E . ? GLY 263  B SER 264  E ? SER 264  B 1 0.71   
14 SER 264  E . ? SER 264  B SER 265  E ? SER 265  B 1 -2.65  
15 LYS 345  E . ? LYS 345  B GLU 346  E ? GLU 346  B 1 -7.83  
16 GLY 647  E . ? GLY 647  B HIS 648  E ? HIS 648  B 1 -1.36  
17 GLU 863  E . ? GLU 863  B LYS 864  E ? LYS 864  B 1 9.72   
18 TYR 866  E . ? TYR 866  B GLY 867  E ? GLY 867  B 1 5.58   
19 LYS 886  E . ? LYS 886  B HIS 887  E ? HIS 887  B 1 -21.20 
20 HIS 887  E . ? HIS 887  B GLY 888  E ? GLY 888  B 1 -9.92  
21 ASN 214  F . ? ASN 214  C GLU 215  F ? GLU 215  C 1 -6.81  
22 GLU 215  F . ? GLU 215  C GLY 216  F ? GLY 216  C 1 -1.53  
23 GLY 51   G . ? GLY 51   E ARG 52   G ? ARG 52   E 1 10.14  
24 ALA 130  G . ? ALA 130  E THR 131  G ? THR 131  E 1 7.24   
25 GLU 71   H . ? GLU 71   F LYS 72   H ? LYS 72   F 1 -12.77 
26 SER 2    I . ? SER 2    H ASN 3    I ? ASN 3    H 1 -1.79  
27 PRO 82   I . ? PRO 82   H GLN 83   I ? GLN 83   H 1 -21.55 
28 ILE 52   J . ? ILE 52   I GLY 53   J ? GLY 53   I 1 -28.67 
29 LYS 117  J . ? LYS 117  I ARG 118  J ? ARG 118  I 1 4.34   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 6 ? 
G  ? 2 ? 
H  ? 3 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 2 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 3 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 3 ? 
V  ? 4 ? 
W  ? 3 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 5 ? 
AA ? 6 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 4 ? 
AH ? 2 ? 
AI ? 5 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 2 ? 
AM ? 4 ? 
AN ? 9 ? 
AO ? 3 ? 
AP ? 3 ? 
AQ ? 4 ? 
AR ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
G  1 2 ? parallel      
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? parallel      
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? parallel      
Y  1 2 ? anti-parallel 
Y  2 3 ? parallel      
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? parallel      
AL 1 2 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AN 5 6 ? anti-parallel 
AN 6 7 ? anti-parallel 
AN 7 8 ? anti-parallel 
AN 8 9 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLU D 16   ? VAL D 17   ? GLU A 16   VAL A 17   
A  2 LEU E 1216 ? TYR E 1217 ? LEU B 1216 TYR B 1217 
B  1 GLY D 82   ? ILE D 84   ? GLY A 82   ILE A 84   
B  2 LEU D 239  ? VAL D 241  ? LEU A 239  VAL A 241  
C  1 VAL D 90   ? PHE D 91   ? VAL A 90   PHE A 91   
C  2 ILE D 235  ? LEU D 236  ? ILE A 235  LEU A 236  
D  1 LYS D 176  ? ASP D 177  ? LYS A 176  ASP A 177  
D  2 LYS D 180  ? LEU D 181  ? LYS A 180  LEU A 181  
E  1 ARG D 344  ? VAL D 345  ? ARG A 344  VAL A 345  
E  2 LEU E 1128 ? ARG E 1129 ? LEU B 1128 ARG B 1129 
F  1 GLN D 363  ? PRO D 367  ? GLN A 363  PRO A 367  
F  2 ALA D 457  ? ILE D 463  ? ALA A 457  ILE A 463  
F  3 VAL D 442  ? ASN D 445  ? VAL A 442  ASN A 445  
F  4 MET D 487  ? HIS D 490  ? MET A 487  HIS A 490  
F  5 SER D 348  ? THR D 351  ? SER A 348  THR A 351  
F  6 HIS E 1104 ? ARG E 1106 ? HIS B 1104 ARG B 1106 
G  1 ILE D 353  ? GLY D 355  ? ILE A 353  GLY A 355  
G  2 PHE D 468  ? LEU D 470  ? PHE A 468  LEU A 470  
H  1 THR D 375  ? VAL D 379  ? THR A 375  VAL A 379  
H  2 LYS D 431  ? HIS D 435  ? LYS A 431  HIS A 435  
H  3 ALA D 402  ? ILE D 406  ? ALA A 402  ILE A 406  
I  1 PHE D 540  ? GLU D 542  ? PHE A 540  GLU A 542  
I  2 LEU D 571  ? SER D 573  ? LEU A 571  SER A 573  
J  1 LEU D 588  ? GLN D 589  ? LEU A 588  GLN A 589  
J  2 LEU D 606  ? ILE D 607  ? LEU A 606  ILE A 607  
J  3 ILE D 612  ? PHE D 614  ? ILE A 612  PHE A 614  
K  1 GLY D 766  ? GLN D 767  ? GLY A 766  GLN A 767  
K  2 PHE D 799  ? VAL D 800  ? PHE A 799  VAL A 800  
L  1 MET D 849  ? VAL D 850  ? MET A 849  VAL A 850  
L  2 THR D 856  ? ARG D 857  ? THR A 856  ARG A 857  
M  1 ILE D 878  ? SER D 882  ? ILE A 878  SER A 882  
M  2 ASN D 953  ? PRO D 957  ? ASN A 953  PRO A 957  
N  1 VAL D 1282 ? TYR D 1287 ? VAL A 1282 TYR A 1287 
N  2 GLU D 1303 ? THR D 1308 ? GLU A 1303 THR A 1308 
N  3 LEU D 1116 ? TYR D 1119 ? LEU A 1116 TYR A 1119 
N  4 TYR D 1328 ? THR D 1329 ? TYR A 1328 THR A 1329 
O  1 LEU D 1224 ? TRP D 1228 ? LEU A 1224 TRP A 1228 
O  2 LEU D 1236 ? VAL D 1242 ? LEU A 1236 VAL A 1242 
O  3 TRP D 1191 ? LEU D 1197 ? TRP A 1191 LEU A 1197 
O  4 THR D 1147 ? TYR D 1154 ? THR A 1147 TYR A 1154 
O  5 LEU J 42   ? ARG J 45   ? LEU I 42   ARG I 45   
P  1 LYS D 1290 ? PRO D 1292 ? LYS A 1290 PRO A 1292 
P  2 TYR D 1298 ? LYS D 1300 ? TYR A 1298 LYS A 1300 
Q  1 ASP D 1442 ? ILE D 1445 ? ASP A 1442 ILE A 1445 
Q  2 LEU H 132  ? TYR H 137  ? LEU F 132  TYR F 137  
Q  3 PHE H 143  ? SER H 147  ? PHE F 143  SER F 147  
R  1 ILE E 90   ? VAL E 97   ? ILE B 90   VAL B 97   
R  2 SER E 125  ? LYS E 134  ? SER B 125  LYS B 134  
R  3 PHE E 166  ? PRO E 171  ? PHE B 166  PRO B 171  
S  1 VAL E 102  ? ASN E 103  ? VAL B 102  ASN B 103  
S  2 THR E 109  ? HIS E 110  ? THR B 109  HIS B 110  
T  1 PHE E 203  ? ILE E 204  ? PHE B 203  ILE B 204  
T  2 GLU E 209  ? VAL E 211  ? GLU B 209  VAL B 211  
T  3 GLN E 481  ? VAL E 482  ? GLN B 481  VAL B 482  
U  1 LYS E 404  ? ASP E 407  ? LYS B 404  ASP B 407  
U  2 ALA E 214  ? SER E 218  ? ALA B 214  SER B 218  
U  3 THR E 498  ? ASN E 499  ? THR B 498  ASN B 499  
V  1 VAL E 223  ? LYS E 227  ? VAL B 223  LYS B 227  
V  2 ILE E 234  ? ILE E 240  ? ILE B 234  ILE B 240  
V  3 LEU E 254  ? TYR E 259  ? LEU B 254  TYR B 259  
V  4 ILE E 269  ? THR E 272  ? ILE B 269  THR B 272  
W  1 CYS E 544  ? ILE E 545  ? CYS B 544  ILE B 545  
W  2 VAL E 633  ? ASP E 642  ? VAL B 633  ASP B 642  
W  3 VAL E 690  ? ASP E 694  ? VAL B 690  ASP B 694  
X  1 LYS E 649  ? LEU E 651  ? LYS B 649  LEU B 651  
X  2 VAL E 633  ? ASP E 642  ? VAL B 633  ASP B 642  
X  3 HIS E 740  ? CYS E 741  ? HIS B 740  CYS B 741  
X  4 ILE E 703  ? ALA E 704  ? ILE B 703  ALA B 704  
Y  1 VAL E 585  ? HIS E 590  ? VAL B 585  HIS B 590  
Y  2 THR E 578  ? VAL E 582  ? THR B 578  VAL B 582  
Y  3 GLU E 623  ? PHE E 627  ? GLU B 623  PHE B 627  
Y  4 SER E 614  ? ASP E 618  ? SER B 614  ASP B 618  
Z  1 ALA E 793  ? LEU E 796  ? ALA B 793  LEU B 796  
Z  2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
Z  3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
Z  4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
Z  5 ARG E 904  ? SER E 906  ? ARG B 904  SER B 906  
AA 1 ILE E 992  ? TYR E 994  ? ILE B 992  TYR B 994  
AA 2 ILE E 840  ? ASN E 842  ? ILE B 840  ASN B 842  
AA 3 LEU E 1010 ? ILE E 1012 ? LEU B 1010 ILE B 1012 
AA 4 ILE E 824  ? ILE E 827  ? ILE B 824  ILE B 827  
AA 5 ILE E 1085 ? PRO E 1089 ? ILE B 1085 PRO B 1089 
AA 6 PHE E 1069 ? GLU E 1070 ? PHE B 1069 GLU B 1070 
AB 1 VAL E 910  ? ILE E 912  ? VAL B 910  ILE B 912  
AB 2 THR E 939  ? PRO E 940  ? THR B 939  PRO B 940  
AC 1 THR E 915  ? PRO E 917  ? THR B 915  PRO B 917  
AC 2 LYS E 934  ? ASP E 936  ? LYS B 934  ASP B 936  
AD 1 PHE E 980  ? SER E 982  ? PHE B 980  SER B 982  
AD 2 TYR E 1092 ? ARG E 1094 ? TYR B 1092 ARG B 1094 
AE 1 PHE E 1001 ? THR E 1002 ? PHE B 1001 THR B 1002 
AE 2 MET E 1072 ? TYR E 1073 ? MET B 1072 TYR B 1073 
AF 1 PHE E 1158 ? CYS E 1163 ? PHE B 1158 CYS B 1163 
AF 2 ILE E 1191 ? ILE E 1196 ? ILE B 1191 ILE B 1196 
AG 1 GLN F 7    ? ALA F 13   ? GLN C 7    ALA C 13   
AG 2 ASN F 17   ? SER F 23   ? ASN C 17   SER C 23   
AG 3 PHE F 228  ? GLU F 233  ? PHE C 228  GLU C 233  
AG 4 ILE F 176  ? GLU F 179  ? ILE C 176  GLU C 179  
AH 1 THR F 43   ? ALA F 45   ? THR C 43   ALA C 45   
AH 2 LYS F 160  ? GLY F 162  ? LYS C 160  GLY C 162  
AI 1 VAL F 119  ? ILE F 120  ? VAL C 119  ILE C 120  
AI 2 LEU F 99   ? PHE F 104  ? LEU C 99   PHE C 104  
AI 3 GLU F 152  ? CYS F 157  ? GLU C 152  CYS C 157  
AI 4 SER F 48   ? ASN F 54   ? SER C 48   ASN C 54   
AI 5 VAL M 65   ? GLU M 68   ? VAL L 65   GLU L 68   
AJ 1 THR F 111  ? VAL F 113  ? THR C 111  VAL C 113  
AJ 2 CYS F 145  ? LEU F 147  ? CYS C 145  LEU C 147  
AK 1 GLN G 61   ? ALA G 62   ? GLN E 61   ALA E 62   
AK 2 LEU G 78   ? PHE G 82   ? LEU E 78   PHE E 82   
AK 3 THR G 107  ? TYR G 112  ? THR E 107  TYR E 112  
AK 4 ILE G 132  ? ASN G 136  ? ILE E 132  ASN E 136  
AL 1 SER G 87   ? VAL G 88   ? SER E 87   VAL E 88   
AL 2 ASN G 115  ? ILE G 116  ? ASN E 115  ILE E 116  
AM 1 LYS G 152  ? ARG G 155  ? LYS E 152  ARG E 155  
AM 2 VAL G 195  ? SER G 202  ? VAL E 195  SER E 202  
AM 3 GLY G 206  ? CYS G 214  ? GLY E 206  CYS E 214  
AM 4 ARG G 177  ? ILE G 178  ? ARG E 177  ILE E 178  
AN 1 TYR I 95   ? TYR I 98   ? TYR H 95   TYR H 98   
AN 2 TYR I 141  ? ARG I 145  ? TYR H 141  ARG H 145  
AN 3 THR I 56   ? ILE I 59   ? THR H 56   ILE H 59   
AN 4 PHE I 6    ? ASP I 16   ? PHE H 6    ASP H 16   
AN 5 CYS I 24   ? SER I 30   ? CYS H 24   SER H 30   
AN 6 LYS I 37   ? ILE I 42   ? LYS H 37   ILE H 42   
AN 7 LEU I 121  ? GLY I 127  ? LEU H 121  GLY H 127  
AN 8 ILE I 112  ? PHE I 118  ? ILE H 112  PHE H 118  
AN 9 THR I 100  ? GLU I 106  ? THR H 100  GLU H 106  
AO 1 TYR J 15   ? GLU J 18   ? TYR I 15   GLU I 18   
AO 2 LEU J 25   ? GLU J 28   ? LEU I 25   GLU I 28   
AO 3 VAL J 35   ? GLU J 37   ? VAL I 35   GLU I 37   
AP 1 ASN J 83   ? GLN J 87   ? ASN I 83   GLN I 87   
AP 2 LEU J 99   ? CYS J 103  ? LEU I 99   CYS I 103  
AP 3 ILE J 109  ? THR J 111  ? ILE I 109  THR I 111  
AQ 1 LEU L 19   ? PRO L 23   ? LEU K 19   PRO K 23   
AQ 2 ALA L 30   ? PHE L 35   ? ALA K 30   PHE K 35   
AQ 3 LYS L 72   ? THR L 77   ? LYS K 72   THR K 77   
AQ 4 VAL L 56   ? LYS L 62   ? VAL K 56   LYS K 62   
AR 1 TYR M 29   ? ILE M 30   ? TYR L 29   ILE L 30   
AR 2 LYS M 37   ? LEU M 38   ? LYS L 37   LEU L 38   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N GLU D 16   ? N GLU A 16   O TYR E 1217 ? O TYR B 1217 
B  1 2 N GLY D 82   ? N GLY A 82   O VAL D 241  ? O VAL A 241  
C  1 2 N VAL D 90   ? N VAL A 90   O LEU D 236  ? O LEU A 236  
D  1 2 N ASP D 177  ? N ASP A 177  O LYS D 180  ? O LYS A 180  
E  1 2 N VAL D 345  ? N VAL A 345  O LEU E 1128 ? O LEU B 1128 
F  1 2 N VAL D 366  ? N VAL A 366  O ILE D 463  ? O ILE A 463  
F  2 3 O HIS D 458  ? O HIS A 458  N VAL D 442  ? N VAL A 442  
F  3 4 N LEU D 443  ? N LEU A 443  O HIS D 490  ? O HIS A 490  
F  4 5 O MET D 487  ? O MET A 487  N THR D 351  ? N THR A 351  
F  5 6 N SER D 348  ? N SER A 348  O ARG E 1106 ? O ARG B 1106 
G  1 2 N SER D 354  ? N SER A 354  O PHE D 468  ? O PHE A 468  
H  1 2 N GLU D 378  ? N GLU A 378  O VAL D 432  ? O VAL A 432  
H  2 3 O LYS D 431  ? O LYS A 431  N ILE D 406  ? N ILE A 406  
I  1 2 N ILE D 541  ? N ILE A 541  O TRP D 572  ? O TRP A 572  
J  1 2 N LEU D 588  ? N LEU A 588  O ILE D 607  ? O ILE A 607  
J  2 3 N LEU D 606  ? N LEU A 606  O ILE D 613  ? O ILE A 613  
K  1 2 N GLY D 766  ? N GLY A 766  O VAL D 800  ? O VAL A 800  
L  1 2 N MET D 849  ? N MET A 849  O ARG D 857  ? O ARG A 857  
M  1 2 N GLU D 879  ? N GLU A 879  O LEU D 956  ? O LEU A 956  
N  1 2 N VAL D 1283 ? N VAL A 1283 O GLU D 1307 ? O GLU A 1307 
N  2 3 O LEU D 1306 ? O LEU A 1306 N VAL D 1118 ? N VAL A 1118 
N  3 4 N THR D 1117 ? N THR A 1117 O TYR D 1328 ? O TYR A 1328 
O  1 2 N ILE D 1227 ? N ILE A 1227 O ARG D 1239 ? O ARG A 1239 
O  2 3 O LEU D 1236 ? O LEU A 1236 N LEU D 1197 ? N LEU A 1197 
O  3 4 O GLU D 1196 ? O GLU A 1196 N ILE D 1148 ? N ILE A 1148 
O  4 5 N ILE D 1152 ? N ILE A 1152 O TYR J 44   ? O TYR I 44   
P  1 2 N VAL D 1291 ? N VAL A 1291 O VAL D 1299 ? O VAL A 1299 
Q  1 2 N MET D 1444 ? N MET A 1444 O VAL H 133  ? O VAL F 133  
Q  2 3 N ILE H 134  ? N ILE F 134  O TRP H 146  ? O TRP F 146  
R  1 2 N TYR E 96   ? N TYR B 96   O PHE E 129  ? O PHE B 129  
R  2 3 N LEU E 128  ? N LEU B 128  O GLY E 168  ? O GLY B 168  
S  1 2 N VAL E 102  ? N VAL B 102  O HIS E 110  ? O HIS B 110  
T  1 2 N PHE E 203  ? N PHE B 203  O LYS E 210  ? O LYS B 210  
T  2 3 N VAL E 211  ? N VAL B 211  O GLN E 481  ? O GLN B 481  
U  1 2 O ASP E 407  ? O ASP B 407  N GLN E 215  ? N GLN B 215  
U  2 3 N GLU E 216  ? N GLU B 216  O ASN E 499  ? O ASN B 499  
V  1 2 N GLN E 224  ? N GLN B 224  O GLU E 239  ? O GLU B 239  
V  2 3 N ALA E 238  ? N ALA B 238  O VAL E 256  ? O VAL B 256  
V  3 4 N GLN E 255  ? N GLN B 255  O THR E 272  ? O THR B 272  
W  1 2 N CYS E 544  ? N CYS B 544  O TYR E 634  ? O TYR B 634  
W  2 3 N LEU E 637  ? N LEU B 637  O GLU E 691  ? O GLU B 691  
X  1 2 O GLU E 650  ? O GLU B 650  N GLU E 641  ? N GLU B 641  
X  2 3 N PHE E 638  ? N PHE B 638  O CYS E 741  ? O CYS B 741  
X  3 4 O HIS E 740  ? O HIS B 740  N ALA E 704  ? N ALA B 704  
Y  1 2 O HIS E 590  ? O HIS B 590  N THR E 578  ? N THR B 578  
Y  2 3 N PHE E 581  ? N PHE B 581  O LEU E 624  ? O LEU B 624  
Y  3 4 O PHE E 627  ? O PHE B 627  N SER E 614  ? N SER B 614  
Z  1 2 N ILE E 795  ? N ILE B 795  O LEU E 854  ? O LEU B 854  
Z  2 3 N SER E 853  ? N SER B 853  O LYS E 972  ? O LYS B 972  
Z  3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
Z  4 5 O GLY E 947  ? O GLY B 947  N VAL E 905  ? N VAL B 905  
AA 1 2 O ILE E 992  ? O ILE B 992  N MET E 841  ? N MET B 841  
AA 2 3 N ILE E 840  ? N ILE B 840  O ILE E 1011 ? O ILE B 1011 
AA 3 4 O LEU E 1010 ? O LEU B 1010 N ALA E 826  ? N ALA B 826  
AA 4 5 N VAL E 825  ? N VAL B 825  O GLY E 1088 ? O GLY B 1088 
AA 5 6 O ILE E 1085 ? O ILE B 1085 N GLU E 1070 ? N GLU B 1070 
AB 1 2 N ILE E 912  ? N ILE B 912  O THR E 939  ? O THR B 939  
AC 1 2 N THR E 916  ? N THR B 916  O ARG E 935  ? O ARG B 935  
AD 1 2 N ALA E 981  ? N ALA B 981  O GLN E 1093 ? O GLN B 1093 
AE 1 2 N PHE E 1001 ? N PHE B 1001 O TYR E 1073 ? O TYR B 1073 
AF 1 2 N ILE E 1162 ? N ILE B 1162 O TYR E 1192 ? O TYR B 1192 
AG 1 2 N GLU F 12   ? N GLU C 12   O ASP F 19   ? O ASP C 19   
AG 2 3 N PHE F 20   ? N PHE C 20   O MET F 230  ? O MET C 230  
AG 3 4 O ASN F 231  ? O ASN C 231  N GLU F 177  ? N GLU C 177  
AH 1 2 N THR F 43   ? N THR C 43   O GLY F 162  ? O GLY C 162  
AI 1 2 O VAL F 119  ? O VAL C 119  N THR F 100  ? N THR C 100  
AI 2 3 N LEU F 99   ? N LEU C 99   O CYS F 157  ? O CYS C 157  
AI 3 4 O LYS F 154  ? O LYS C 154  N THR F 53   ? N THR C 53   
AI 4 5 N VAL F 49   ? N VAL C 49   O PHE M 67   ? O PHE L 67   
AJ 1 2 N THR F 111  ? N THR C 111  O LEU F 147  ? O LEU C 147  
AK 1 2 N ALA G 62   ? N ALA E 62   O LEU G 78   ? O LEU E 78   
AK 2 3 N GLU G 81   ? N GLU E 81   O ILE G 109  ? O ILE E 109  
AK 3 4 N GLY G 108  ? N GLY E 108  O GLU G 133  ? O GLU E 133  
AL 1 2 N VAL G 88   ? N VAL E 88   O ASN G 115  ? O ASN E 115  
AM 1 2 N ILE G 154  ? N ILE E 154  O LYS G 197  ? O LYS E 197  
AM 2 3 N ILE G 198  ? N ILE E 198  O SER G 210  ? O SER E 210  
AM 3 4 O ILE G 213  ? O ILE E 213  N ILE G 178  ? N ILE E 178  
AN 1 2 N TYR I 95   ? N TYR H 95   O ILE I 144  ? O ILE H 144  
AN 2 3 O LEU I 143  ? O LEU H 143  N THR I 58   ? N THR H 58   
AN 3 4 O VAL I 57   ? O VAL H 57   N ASP I 8    ? N ASP H 8    
AN 4 5 N GLN I 11   ? N GLN H 11   O ALA I 29   ? O ALA H 29   
AN 5 6 N ALA I 28   ? N ALA H 28   O LEU I 38   ? O LEU H 38   
AN 6 7 N THR I 39   ? N THR H 39   O ARG I 124  ? O ARG H 124  
AN 7 8 O LEU I 121  ? O LEU H 121  N PHE I 118  ? N PHE H 118  
AN 8 9 O ALA I 113  ? O ALA H 113  N GLU I 105  ? N GLU H 105  
AO 1 2 N TYR J 15   ? N TYR I 15   O GLU J 28   ? O GLU I 28   
AO 2 3 N PHE J 27   ? N PHE I 27   O GLU J 36   ? O GLU I 36   
AP 1 2 N VAL J 84   ? N VAL I 84   O VAL J 102  ? O VAL I 102  
AP 2 3 N PHE J 101  ? N PHE I 101  O PHE J 110  ? O PHE I 110  
AQ 1 2 N ASP L 22   ? N ASP K 22   O VAL L 32   ? O VAL K 32   
AQ 2 3 N ILE L 33   ? N ILE K 33   O LEU L 73   ? O LEU K 73   
AQ 3 4 O ARG L 74   ? O ARG K 74   N ALA L 60   ? N ALA K 60   
AR 1 2 N TYR M 29   ? N TYR L 29   O LEU M 38   ? O LEU L 38   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1734'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 1735'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1307'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 319'   
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 203'   
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 204'   
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN J 101'   
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN L 105'   
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 2002'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 2003'  
BC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE G2P T 3000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS D 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4  CYS D 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4  CYS D 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4  CYS D 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 5  CYS D 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 5  GLN D 68   ? GLN A 68   . ? 1_555 ? 
7  AC2 5  CYS D 70   ? CYS A 70   . ? 1_555 ? 
8  AC2 5  CYS D 77   ? CYS A 77   . ? 1_555 ? 
9  AC2 5  HIS D 80   ? HIS A 80   . ? 1_555 ? 
10 AC3 4  CYS E 1163 ? CYS B 1163 . ? 1_555 ? 
11 AC3 4  CYS E 1166 ? CYS B 1166 . ? 1_555 ? 
12 AC3 4  CYS E 1182 ? CYS B 1182 . ? 1_555 ? 
13 AC3 4  CYS E 1185 ? CYS B 1185 . ? 1_555 ? 
14 AC4 4  CYS F 86   ? CYS C 86   . ? 1_555 ? 
15 AC4 4  CYS F 88   ? CYS C 88   . ? 1_555 ? 
16 AC4 4  CYS F 92   ? CYS C 92   . ? 1_555 ? 
17 AC4 4  CYS F 95   ? CYS C 95   . ? 1_555 ? 
18 AC5 4  CYS J 7    ? CYS I 7    . ? 1_555 ? 
19 AC5 4  CYS J 10   ? CYS I 10   . ? 1_555 ? 
20 AC5 4  CYS J 29   ? CYS I 29   . ? 1_555 ? 
21 AC5 4  CYS J 32   ? CYS I 32   . ? 1_555 ? 
22 AC6 4  CYS J 75   ? CYS I 75   . ? 1_555 ? 
23 AC6 4  CYS J 78   ? CYS I 78   . ? 1_555 ? 
24 AC6 4  CYS J 103  ? CYS I 103  . ? 1_555 ? 
25 AC6 4  CYS J 106  ? CYS I 106  . ? 1_555 ? 
26 AC7 4  CYS K 7    ? CYS J 7    . ? 1_555 ? 
27 AC7 4  CYS K 10   ? CYS J 10   . ? 1_555 ? 
28 AC7 4  CYS K 45   ? CYS J 45   . ? 1_555 ? 
29 AC7 4  CYS K 46   ? CYS J 46   . ? 1_555 ? 
30 AC8 4  CYS M 31   ? CYS L 31   . ? 1_555 ? 
31 AC8 4  CYS M 34   ? CYS L 34   . ? 1_555 ? 
32 AC8 4  CYS M 48   ? CYS L 48   . ? 1_555 ? 
33 AC8 4  CYS M 51   ? CYS L 51   . ? 1_555 ? 
34 AC9 2  ASP D 481  ? ASP A 481  . ? 1_555 ? 
35 AC9 2  G2P N .    ? G2P T 3000 . ? 1_555 ? 
36 BC1 5  ASP D 481  ? ASP A 481  . ? 1_555 ? 
37 BC1 5  ASP D 483  ? ASP A 483  . ? 1_555 ? 
38 BC1 5  ASP D 485  ? ASP A 485  . ? 1_555 ? 
39 BC1 5  C   A 10   ? C   R 10   . ? 1_555 ? 
40 BC1 5  G2P N .    ? G2P T 3000 . ? 1_555 ? 
41 BC2 10 ARG D 446  ? ARG A 446  . ? 1_555 ? 
42 BC2 10 PRO D 448  ? PRO A 448  . ? 1_555 ? 
43 BC2 10 ASN D 479  ? ASN A 479  . ? 1_555 ? 
44 BC2 10 ASP D 483  ? ASP A 483  . ? 1_555 ? 
45 BC2 10 MG  Q .    ? MG  A 2002 . ? 1_555 ? 
46 BC2 10 MG  R .    ? MG  A 2003 . ? 1_555 ? 
47 BC2 10 TYR E 769  ? TYR B 769  . ? 1_555 ? 
48 BC2 10 C   A 10   ? C   R 10   . ? 1_555 ? 
49 BC2 10 DC  B 11   ? DC  T 18   . ? 1_555 ? 
50 BC2 10 DG  B 12   ? DG  T 19   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NVT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NVT 
_atom_sites.fract_transf_matrix[1][1]   0.005852 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001286 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004488 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005229 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . A   A 1  1    ? 19.279  -28.772  25.755  1.00 174.95 ? 1    A   R "O5'" 1 
ATOM   2     C  "C5'" . A   A 1  1    ? 19.699  -27.476  25.337  1.00 176.67 ? 1    A   R "C5'" 1 
ATOM   3     C  "C4'" . A   A 1  1    ? 21.185  -27.458  24.974  1.00 177.69 ? 1    A   R "C4'" 1 
ATOM   4     O  "O4'" . A   A 1  1    ? 21.461  -26.445  23.962  1.00 178.36 ? 1    A   R "O4'" 1 
ATOM   5     C  "C3'" . A   A 1  1    ? 22.133  -27.167  26.139  1.00 177.71 ? 1    A   R "C3'" 1 
ATOM   6     O  "O3'" . A   A 1  1    ? 22.897  -28.330  26.423  1.00 176.39 ? 1    A   R "O3'" 1 
ATOM   7     C  "C2'" . A   A 1  1    ? 23.041  -26.043  25.639  1.00 178.43 ? 1    A   R "C2'" 1 
ATOM   8     O  "O2'" . A   A 1  1    ? 24.271  -26.526  25.139  1.00 178.92 ? 1    A   R "O2'" 1 
ATOM   9     C  "C1'" . A   A 1  1    ? 22.247  -25.399  24.504  1.00 179.48 ? 1    A   R "C1'" 1 
ATOM   10    N  N9    . A   A 1  1    ? 21.373  -24.303  24.939  1.00 180.04 ? 1    A   R N9    1 
ATOM   11    C  C8    . A   A 1  1    ? 20.021  -24.207  24.741  1.00 180.33 ? 1    A   R C8    1 
ATOM   12    N  N7    . A   A 1  1    ? 19.470  -23.128  25.235  1.00 180.34 ? 1    A   R N7    1 
ATOM   13    C  C5    . A   A 1  1    ? 20.536  -22.458  25.799  1.00 180.24 ? 1    A   R C5    1 
ATOM   14    C  C6    . A   A 1  1    ? 20.612  -21.232  26.485  1.00 180.10 ? 1    A   R C6    1 
ATOM   15    N  N6    . A   A 1  1    ? 19.543  -20.465  26.710  1.00 180.12 ? 1    A   R N6    1 
ATOM   16    N  N1    . A   A 1  1    ? 21.824  -20.829  26.926  1.00 180.29 ? 1    A   R N1    1 
ATOM   17    C  C2    . A   A 1  1    ? 22.890  -21.612  26.694  1.00 180.40 ? 1    A   R C2    1 
ATOM   18    N  N3    . A   A 1  1    ? 22.938  -22.784  26.056  1.00 180.52 ? 1    A   R N3    1 
ATOM   19    C  C4    . A   A 1  1    ? 21.718  -23.160  25.629  1.00 180.28 ? 1    A   R C4    1 
ATOM   20    P  P     . A   A 1  2    ? 22.492  -29.338  27.598  1.00 175.94 ? 2    A   R P     1 
ATOM   21    O  OP1   . A   A 1  2    ? 23.520  -30.403  27.546  1.00 175.84 ? 2    A   R OP1   1 
ATOM   22    O  OP2   . A   A 1  2    ? 21.044  -29.667  27.544  1.00 175.63 ? 2    A   R OP2   1 
ATOM   23    O  "O5'" . A   A 1  2    ? 22.742  -28.471  28.909  1.00 174.69 ? 2    A   R "O5'" 1 
ATOM   24    C  "C5'" . A   A 1  2    ? 24.071  -28.198  29.242  1.00 173.26 ? 2    A   R "C5'" 1 
ATOM   25    C  "C4'" . A   A 1  2    ? 24.168  -26.859  29.919  1.00 172.26 ? 2    A   R "C4'" 1 
ATOM   26    O  "O4'" . A   A 1  2    ? 23.607  -25.811  29.096  1.00 172.01 ? 2    A   R "O4'" 1 
ATOM   27    C  "C3'" . A   A 1  2    ? 23.372  -26.700  31.200  1.00 171.65 ? 2    A   R "C3'" 1 
ATOM   28    O  "O3'" . A   A 1  2    ? 23.881  -27.520  32.253  1.00 170.17 ? 2    A   R "O3'" 1 
ATOM   29    C  "C2'" . A   A 1  2    ? 23.668  -25.218  31.388  1.00 172.45 ? 2    A   R "C2'" 1 
ATOM   30    O  "O2'" . A   A 1  2    ? 24.980  -24.939  31.841  1.00 172.90 ? 2    A   R "O2'" 1 
ATOM   31    C  "C1'" . A   A 1  2    ? 23.491  -24.698  29.962  1.00 172.84 ? 2    A   R "C1'" 1 
ATOM   32    N  N9    . A   A 1  2    ? 22.189  -24.054  29.847  1.00 173.25 ? 2    A   R N9    1 
ATOM   33    C  C8    . A   A 1  2    ? 20.966  -24.644  29.678  1.00 173.27 ? 2    A   R C8    1 
ATOM   34    N  N7    . A   A 1  2    ? 19.976  -23.784  29.636  1.00 173.35 ? 2    A   R N7    1 
ATOM   35    C  C5    . A   A 1  2    ? 20.587  -22.548  29.798  1.00 173.36 ? 2    A   R C5    1 
ATOM   36    C  C6    . A   A 1  2    ? 20.096  -21.221  29.849  1.00 173.13 ? 2    A   R C6    1 
ATOM   37    N  N6    . A   A 1  2    ? 18.807  -20.906  29.725  1.00 173.15 ? 2    A   R N6    1 
ATOM   38    N  N1    . A   A 1  2    ? 20.981  -20.216  30.028  1.00 173.16 ? 2    A   R N1    1 
ATOM   39    C  C2    . A   A 1  2    ? 22.282  -20.518  30.151  1.00 173.33 ? 2    A   R C2    1 
ATOM   40    N  N3    . A   A 1  2    ? 22.862  -21.721  30.120  1.00 173.36 ? 2    A   R N3    1 
ATOM   41    C  C4    . A   A 1  2    ? 21.954  -22.702  29.940  1.00 173.40 ? 2    A   R C4    1 
ATOM   42    P  P     . G   A 1  3    ? 23.095  -27.689  33.644  1.00 169.36 ? 3    G   R P     1 
ATOM   43    O  OP1   . G   A 1  3    ? 23.819  -28.642  34.515  1.00 169.57 ? 3    G   R OP1   1 
ATOM   44    O  OP2   . G   A 1  3    ? 21.687  -28.009  33.321  1.00 170.19 ? 3    G   R OP2   1 
ATOM   45    O  "O5'" . G   A 1  3    ? 23.219  -26.233  34.298  1.00 167.37 ? 3    G   R "O5'" 1 
ATOM   46    C  "C5'" . G   A 1  3    ? 24.192  -26.022  35.295  1.00 165.62 ? 3    G   R "C5'" 1 
ATOM   47    C  "C4'" . G   A 1  3    ? 24.376  -24.556  35.611  1.00 164.67 ? 3    G   R "C4'" 1 
ATOM   48    O  "O4'" . G   A 1  3    ? 24.255  -23.722  34.430  1.00 164.57 ? 3    G   R "O4'" 1 
ATOM   49    C  "C3'" . G   A 1  3    ? 23.334  -23.989  36.550  1.00 163.89 ? 3    G   R "C3'" 1 
ATOM   50    O  "O3'" . G   A 1  3    ? 23.589  -24.413  37.872  1.00 163.40 ? 3    G   R "O3'" 1 
ATOM   51    C  "C2'" . G   A 1  3    ? 23.593  -22.506  36.329  1.00 164.09 ? 3    G   R "C2'" 1 
ATOM   52    O  "O2'" . G   A 1  3    ? 24.798  -22.067  36.925  1.00 164.14 ? 3    G   R "O2'" 1 
ATOM   53    C  "C1'" . G   A 1  3    ? 23.671  -22.479  34.797  1.00 164.33 ? 3    G   R "C1'" 1 
ATOM   54    N  N9    . G   A 1  3    ? 22.340  -22.337  34.174  1.00 164.57 ? 3    G   R N9    1 
ATOM   55    C  C8    . G   A 1  3    ? 21.651  -23.267  33.416  1.00 164.24 ? 3    G   R C8    1 
ATOM   56    N  N7    . G   A 1  3    ? 20.475  -22.871  33.006  1.00 164.01 ? 3    G   R N7    1 
ATOM   57    C  C5    . G   A 1  3    ? 20.363  -21.588  33.521  1.00 164.20 ? 3    G   R C5    1 
ATOM   58    C  C6    . G   A 1  3    ? 19.302  -20.659  33.413  1.00 164.02 ? 3    G   R C6    1 
ATOM   59    O  O6    . G   A 1  3    ? 18.232  -20.815  32.817  1.00 164.03 ? 3    G   R O6    1 
ATOM   60    N  N1    . G   A 1  3    ? 19.575  -19.465  34.092  1.00 164.21 ? 3    G   R N1    1 
ATOM   61    C  C2    . G   A 1  3    ? 20.742  -19.202  34.791  1.00 164.25 ? 3    G   R C2    1 
ATOM   62    N  N2    . G   A 1  3    ? 20.849  -18.002  35.379  1.00 164.23 ? 3    G   R N2    1 
ATOM   63    N  N3    . G   A 1  3    ? 21.749  -20.064  34.898  1.00 164.41 ? 3    G   R N3    1 
ATOM   64    C  C4    . G   A 1  3    ? 21.496  -21.238  34.243  1.00 164.69 ? 3    G   R C4    1 
ATOM   65    P  P     . A   A 1  4    ? 22.368  -24.975  38.745  1.00 163.18 ? 4    A   R P     1 
ATOM   66    O  OP1   . A   A 1  4    ? 22.880  -25.756  39.895  1.00 164.26 ? 4    A   R OP1   1 
ATOM   67    O  OP2   . A   A 1  4    ? 21.456  -25.680  37.817  1.00 162.65 ? 4    A   R OP2   1 
ATOM   68    O  "O5'" . A   A 1  4    ? 21.712  -23.610  39.306  1.00 161.03 ? 4    A   R "O5'" 1 
ATOM   69    C  "C5'" . A   A 1  4    ? 22.459  -22.626  40.056  1.00 157.20 ? 4    A   R "C5'" 1 
ATOM   70    C  "C4'" . A   A 1  4    ? 21.807  -21.251  39.969  1.00 154.61 ? 4    A   R "C4'" 1 
ATOM   71    O  "O4'" . A   A 1  4    ? 21.640  -20.870  38.582  1.00 154.53 ? 4    A   R "O4'" 1 
ATOM   72    C  "C3'" . A   A 1  4    ? 20.389  -21.127  40.507  1.00 152.50 ? 4    A   R "C3'" 1 
ATOM   73    O  "O3'" . A   A 1  4    ? 20.391  -20.938  41.899  1.00 150.04 ? 4    A   R "O3'" 1 
ATOM   74    C  "C2'" . A   A 1  4    ? 19.836  -19.916  39.769  1.00 152.96 ? 4    A   R "C2'" 1 
ATOM   75    O  "O2'" . A   A 1  4    ? 20.353  -18.697  40.254  1.00 152.51 ? 4    A   R "O2'" 1 
ATOM   76    C  "C1'" . A   A 1  4    ? 20.395  -20.199  38.381  1.00 154.16 ? 4    A   R "C1'" 1 
ATOM   77    N  N9    . A   A 1  4    ? 19.542  -20.965  37.442  1.00 154.54 ? 4    A   R N9    1 
ATOM   78    C  C8    . A   A 1  4    ? 19.918  -22.090  36.751  1.00 154.53 ? 4    A   R C8    1 
ATOM   79    N  N7    . A   A 1  4    ? 19.008  -22.597  35.951  1.00 154.19 ? 4    A   R N7    1 
ATOM   80    C  C5    . A   A 1  4    ? 17.940  -21.742  36.115  1.00 154.47 ? 4    A   R C5    1 
ATOM   81    C  C6    . A   A 1  4    ? 16.656  -21.742  35.537  1.00 154.35 ? 4    A   R C6    1 
ATOM   82    N  N6    . A   A 1  4    ? 16.266  -22.664  34.658  1.00 154.39 ? 4    A   R N6    1 
ATOM   83    N  N1    . A   A 1  4    ? 15.796  -20.767  35.898  1.00 154.30 ? 4    A   R N1    1 
ATOM   84    C  C2    . A   A 1  4    ? 16.214  -19.847  36.782  1.00 154.49 ? 4    A   R C2    1 
ATOM   85    N  N3    . A   A 1  4    ? 17.402  -19.741  37.395  1.00 154.78 ? 4    A   R N3    1 
ATOM   86    C  C4    . A   A 1  4    ? 18.242  -20.726  37.017  1.00 154.62 ? 4    A   R C4    1 
ATOM   87    P  P     . C   A 1  5    ? 19.692  -22.101  42.751  1.00 148.35 ? 5    C   R P     1 
ATOM   88    O  OP1   . C   A 1  5    ? 20.140  -22.047  44.168  1.00 149.00 ? 5    C   R OP1   1 
ATOM   89    O  OP2   . C   A 1  5    ? 19.905  -23.344  41.964  1.00 148.35 ? 5    C   R OP2   1 
ATOM   90    O  "O5'" . C   A 1  5    ? 18.143  -21.677  42.742  1.00 143.98 ? 5    C   R "O5'" 1 
ATOM   91    C  "C5'" . C   A 1  5    ? 17.719  -20.616  43.591  1.00 137.38 ? 5    C   R "C5'" 1 
ATOM   92    C  "C4'" . C   A 1  5    ? 16.663  -19.725  42.962  1.00 132.57 ? 5    C   R "C4'" 1 
ATOM   93    O  "O4'" . C   A 1  5    ? 16.835  -19.581  41.521  1.00 131.43 ? 5    C   R "O4'" 1 
ATOM   94    C  "C3'" . C   A 1  5    ? 15.254  -20.239  43.183  1.00 129.73 ? 5    C   R "C3'" 1 
ATOM   95    O  "O3'" . C   A 1  5    ? 14.732  -19.731  44.419  1.00 126.54 ? 5    C   R "O3'" 1 
ATOM   96    C  "C2'" . C   A 1  5    ? 14.528  -19.645  41.986  1.00 129.82 ? 5    C   R "C2'" 1 
ATOM   97    O  "O2'" . C   A 1  5    ? 14.060  -18.342  42.250  1.00 129.41 ? 5    C   R "O2'" 1 
ATOM   98    C  "C1'" . C   A 1  5    ? 15.581  -19.659  40.869  1.00 130.28 ? 5    C   R "C1'" 1 
ATOM   99    N  N1    . C   A 1  5    ? 15.536  -20.901  39.975  1.00 130.52 ? 5    C   R N1    1 
ATOM   100   C  C2    . C   A 1  5    ? 14.328  -21.420  39.453  1.00 130.66 ? 5    C   R C2    1 
ATOM   101   O  O2    . C   A 1  5    ? 13.248  -20.875  39.697  1.00 131.18 ? 5    C   R O2    1 
ATOM   102   N  N3    . C   A 1  5    ? 14.337  -22.527  38.672  1.00 130.13 ? 5    C   R N3    1 
ATOM   103   C  C4    . C   A 1  5    ? 15.478  -23.134  38.389  1.00 129.96 ? 5    C   R C4    1 
ATOM   104   N  N4    . C   A 1  5    ? 15.423  -24.219  37.618  1.00 129.99 ? 5    C   R N4    1 
ATOM   105   C  C5    . C   A 1  5    ? 16.714  -22.651  38.900  1.00 130.33 ? 5    C   R C5    1 
ATOM   106   C  C6    . C   A 1  5    ? 16.695  -21.554  39.674  1.00 130.48 ? 5    C   R C6    1 
ATOM   107   P  P     . C   A 1  6    ? 13.948  -20.689  45.449  1.00 124.98 ? 6    C   R P     1 
ATOM   108   O  OP1   . C   A 1  6    ? 13.831  -20.022  46.770  1.00 122.52 ? 6    C   R OP1   1 
ATOM   109   O  OP2   . C   A 1  6    ? 14.506  -22.068  45.358  1.00 125.65 ? 6    C   R OP2   1 
ATOM   110   O  "O5'" . C   A 1  6    ? 12.518  -20.779  44.746  1.00 123.34 ? 6    C   R "O5'" 1 
ATOM   111   C  "C5'" . C   A 1  6    ? 11.645  -19.663  44.767  1.00 120.54 ? 6    C   R "C5'" 1 
ATOM   112   C  "C4'" . C   A 1  6    ? 10.571  -19.784  43.707  1.00 117.60 ? 6    C   R "C4'" 1 
ATOM   113   O  "O4'" . C   A 1  6    ? 11.209  -20.150  42.472  1.00 117.55 ? 6    C   R "O4'" 1 
ATOM   114   C  "C3'" . C   A 1  6    ? 9.574   -20.907  43.893  1.00 114.93 ? 6    C   R "C3'" 1 
ATOM   115   O  "O3'" . C   A 1  6    ? 8.593   -20.532  44.834  1.00 111.34 ? 6    C   R "O3'" 1 
ATOM   116   C  "C2'" . C   A 1  6    ? 9.001   -21.006  42.496  1.00 115.19 ? 6    C   R "C2'" 1 
ATOM   117   O  "O2'" . C   A 1  6    ? 8.112   -19.939  42.249  1.00 114.11 ? 6    C   R "O2'" 1 
ATOM   118   C  "C1'" . C   A 1  6    ? 10.257  -20.794  41.664  1.00 116.45 ? 6    C   R "C1'" 1 
ATOM   119   N  N1    . C   A 1  6    ? 10.899  -22.003  41.127  1.00 116.43 ? 6    C   R N1    1 
ATOM   120   C  C2    . C   A 1  6    ? 10.479  -22.451  39.877  1.00 117.01 ? 6    C   R C2    1 
ATOM   121   O  O2    . C   A 1  6    ? 9.575   -21.832  39.294  1.00 117.23 ? 6    C   R O2    1 
ATOM   122   N  N3    . C   A 1  6    ? 11.068  -23.558  39.353  1.00 117.41 ? 6    C   R N3    1 
ATOM   123   C  C4    . C   A 1  6    ? 12.023  -24.193  40.025  1.00 117.02 ? 6    C   R C4    1 
ATOM   124   N  N4    . C   A 1  6    ? 12.547  -25.261  39.445  1.00 117.08 ? 6    C   R N4    1 
ATOM   125   C  C5    . C   A 1  6    ? 12.484  -23.751  41.298  1.00 117.48 ? 6    C   R C5    1 
ATOM   126   C  C6    . C   A 1  6    ? 11.896  -22.654  41.804  1.00 117.29 ? 6    C   R C6    1 
ATOM   127   P  P     . A   A 1  7    ? 8.242   -21.633  45.940  1.00 109.19 ? 7    A   R P     1 
ATOM   128   O  OP1   . A   A 1  7    ? 7.494   -20.959  47.027  1.00 107.36 ? 7    A   R OP1   1 
ATOM   129   O  OP2   . A   A 1  7    ? 9.445   -22.476  46.185  1.00 107.50 ? 7    A   R OP2   1 
ATOM   130   O  "O5'" . A   A 1  7    ? 7.237   -22.568  45.122  1.00 110.23 ? 7    A   R "O5'" 1 
ATOM   131   C  "C5'" . A   A 1  7    ? 5.960   -22.060  44.729  1.00 110.23 ? 7    A   R "C5'" 1 
ATOM   132   C  "C4'" . A   A 1  7    ? 5.331   -22.714  43.501  1.00 108.92 ? 7    A   R "C4'" 1 
ATOM   133   O  "O4'" . A   A 1  7    ? 6.217   -22.778  42.351  1.00 108.80 ? 7    A   R "O4'" 1 
ATOM   134   C  "C3'" . A   A 1  7    ? 4.864   -24.136  43.667  1.00 107.73 ? 7    A   R "C3'" 1 
ATOM   135   O  "O3'" . A   A 1  7    ? 3.659   -24.119  44.436  1.00 107.30 ? 7    A   R "O3'" 1 
ATOM   136   C  "C2'" . A   A 1  7    ? 4.568   -24.391  42.209  1.00 107.94 ? 7    A   R "C2'" 1 
ATOM   137   O  "O2'" . A   A 1  7    ? 3.417   -23.631  41.901  1.00 106.57 ? 7    A   R "O2'" 1 
ATOM   138   C  "C1'" . A   A 1  7    ? 5.792   -23.814  41.508  1.00 108.61 ? 7    A   R "C1'" 1 
ATOM   139   N  N9    . A   A 1  7    ? 6.981   -24.639  41.393  1.00 109.13 ? 7    A   R N9    1 
ATOM   140   C  C8    . A   A 1  7    ? 8.188   -24.386  41.997  1.00 109.62 ? 7    A   R C8    1 
ATOM   141   N  N7    . A   A 1  7    ? 9.153   -25.245  41.733  1.00 109.58 ? 7    A   R N7    1 
ATOM   142   C  C5    . A   A 1  7    ? 8.527   -26.132  40.882  1.00 109.87 ? 7    A   R C5    1 
ATOM   143   C  C6    . A   A 1  7    ? 9.003   -27.287  40.248  1.00 108.52 ? 7    A   R C6    1 
ATOM   144   N  N6    . A   A 1  7    ? 10.235  -27.677  40.429  1.00 109.57 ? 7    A   R N6    1 
ATOM   145   N  N1    . A   A 1  7    ? 8.200   -28.010  39.462  1.00 108.47 ? 7    A   R N1    1 
ATOM   146   C  C2    . A   A 1  7    ? 6.951   -27.538  39.314  1.00 110.68 ? 7    A   R C2    1 
ATOM   147   N  N3    . A   A 1  7    ? 6.343   -26.448  39.855  1.00 111.43 ? 7    A   R N3    1 
ATOM   148   C  C4    . A   A 1  7    ? 7.196   -25.779  40.655  1.00 110.59 ? 7    A   R C4    1 
ATOM   149   P  P     . G   A 1  8    ? 3.453   -25.156  45.657  1.00 108.01 ? 8    G   R P     1 
ATOM   150   O  OP1   . G   A 1  8    ? 2.439   -24.628  46.614  1.00 105.91 ? 8    G   R OP1   1 
ATOM   151   O  OP2   . G   A 1  8    ? 4.811   -25.491  46.165  1.00 109.15 ? 8    G   R OP2   1 
ATOM   152   O  "O5'" . G   A 1  8    ? 2.987   -26.541  44.960  1.00 107.42 ? 8    G   R "O5'" 1 
ATOM   153   C  "C5'" . G   A 1  8    ? 2.388   -26.733  43.654  1.00 106.89 ? 8    G   R "C5'" 1 
ATOM   154   C  "C4'" . G   A 1  8    ? 3.019   -27.840  42.813  1.00 106.43 ? 8    G   R "C4'" 1 
ATOM   155   O  "O4'" . G   A 1  8    ? 4.413   -27.614  42.531  1.00 106.47 ? 8    G   R "O4'" 1 
ATOM   156   C  "C3'" . G   A 1  8    ? 3.133   -29.224  43.412  1.00 106.51 ? 8    G   R "C3'" 1 
ATOM   157   O  "O3'" . G   A 1  8    ? 1.823   -29.793  43.595  1.00 104.82 ? 8    G   R "O3'" 1 
ATOM   158   C  "C2'" . G   A 1  8    ? 3.889   -29.846  42.269  1.00 106.64 ? 8    G   R "C2'" 1 
ATOM   159   O  "O2'" . G   A 1  8    ? 3.040   -30.073  41.192  1.00 108.57 ? 8    G   R "O2'" 1 
ATOM   160   C  "C1'" . G   A 1  8    ? 4.761   -28.718  41.776  1.00 109.81 ? 8    G   R "C1'" 1 
ATOM   161   N  N9    . G   A 1  8    ? 6.090   -29.119  42.090  1.00 111.49 ? 8    G   R N9    1 
ATOM   162   C  C8    . G   A 1  8    ? 6.919   -28.635  43.057  1.00 112.52 ? 8    G   R C8    1 
ATOM   163   N  N7    . G   A 1  8    ? 8.060   -29.278  43.090  1.00 113.05 ? 8    G   R N7    1 
ATOM   164   C  C5    . G   A 1  8    ? 7.966   -30.238  42.080  1.00 113.03 ? 8    G   R C5    1 
ATOM   165   C  C6    . G   A 1  8    ? 8.860   -31.252  41.622  1.00 113.41 ? 8    G   R C6    1 
ATOM   166   O  O6    . G   A 1  8    ? 10.004  -31.511  42.026  1.00 113.51 ? 8    G   R O6    1 
ATOM   167   N  N1    . G   A 1  8    ? 8.352   -32.032  40.583  1.00 112.16 ? 8    G   R N1    1 
ATOM   168   C  C2    . G   A 1  8    ? 7.118   -31.844  40.059  1.00 111.79 ? 8    G   R C2    1 
ATOM   169   N  N2    . G   A 1  8    ? 6.752   -32.647  39.071  1.00 111.89 ? 8    G   R N2    1 
ATOM   170   N  N3    . G   A 1  8    ? 6.289   -30.911  40.465  1.00 113.18 ? 8    G   R N3    1 
ATOM   171   C  C4    . G   A 1  8    ? 6.756   -30.148  41.473  1.00 112.53 ? 8    G   R C4    1 
ATOM   172   P  P     . G   A 1  9    ? 1.440   -30.916  44.711  1.00 103.02 ? 9    G   R P     1 
ATOM   173   O  OP1   . G   A 1  9    ? 0.001   -30.673  45.000  1.00 101.78 ? 9    G   R OP1   1 
ATOM   174   O  OP2   . G   A 1  9    ? 2.227   -30.836  45.959  1.00 104.46 ? 9    G   R OP2   1 
ATOM   175   O  "O5'" . G   A 1  9    ? 1.889   -32.296  43.977  1.00 95.85  ? 9    G   R "O5'" 1 
ATOM   176   C  "C5'" . G   A 1  9    ? 1.459   -32.507  42.665  1.00 91.48  ? 9    G   R "C5'" 1 
ATOM   177   C  "C4'" . G   A 1  9    ? 1.960   -33.801  42.066  1.00 90.86  ? 9    G   R "C4'" 1 
ATOM   178   O  "O4'" . G   A 1  9    ? 3.211   -33.696  41.288  1.00 91.65  ? 9    G   R "O4'" 1 
ATOM   179   C  "C3'" . G   A 1  9    ? 2.136   -34.892  43.102  1.00 85.89  ? 9    G   R "C3'" 1 
ATOM   180   O  "O3'" . G   A 1  9    ? 0.860   -35.528  43.274  1.00 75.49  ? 9    G   R "O3'" 1 
ATOM   181   C  "C2'" . G   A 1  9    ? 3.234   -35.779  42.482  1.00 86.16  ? 9    G   R "C2'" 1 
ATOM   182   O  "O2'" . G   A 1  9    ? 2.731   -36.885  41.763  1.00 81.62  ? 9    G   R "O2'" 1 
ATOM   183   C  "C1'" . G   A 1  9    ? 4.006   -34.826  41.570  1.00 92.78  ? 9    G   R "C1'" 1 
ATOM   184   N  N9    . G   A 1  9    ? 5.245   -34.414  42.225  1.00 95.26  ? 9    G   R N9    1 
ATOM   185   C  C8    . G   A 1  9    ? 5.549   -33.278  42.954  1.00 96.69  ? 9    G   R C8    1 
ATOM   186   N  N7    . G   A 1  9    ? 6.799   -33.244  43.393  1.00 96.52  ? 9    G   R N7    1 
ATOM   187   C  C5    . G   A 1  9    ? 7.342   -34.436  42.932  1.00 96.29  ? 9    G   R C5    1 
ATOM   188   C  C6    . G   A 1  9    ? 8.628   -35.014  43.078  1.00 96.40  ? 9    G   R C6    1 
ATOM   189   O  O6    . G   A 1  9    ? 9.621   -34.548  43.651  1.00 97.01  ? 9    G   R O6    1 
ATOM   190   N  N1    . G   A 1  9    ? 8.750   -36.264  42.470  1.00 94.90  ? 9    G   R N1    1 
ATOM   191   C  C2    . G   A 1  9    ? 7.757   -36.856  41.765  1.00 94.49  ? 9    G   R C2    1 
ATOM   192   N  N2    . G   A 1  9    ? 8.008   -38.023  41.208  1.00 94.98  ? 9    G   R N2    1 
ATOM   193   N  N3    . G   A 1  9    ? 6.572   -36.334  41.594  1.00 96.64  ? 9    G   R N3    1 
ATOM   194   C  C4    . G   A 1  9    ? 6.409   -35.145  42.218  1.00 96.47  ? 9    G   R C4    1 
ATOM   195   P  P     . C   A 1  10   ? 0.526   -36.294  44.645  1.00 71.63  ? 10   C   R P     1 
ATOM   196   O  OP1   . C   A 1  10   ? -0.676  -35.693  45.294  1.00 76.37  ? 10   C   R OP1   1 
ATOM   197   O  OP2   . C   A 1  10   ? 1.615   -36.449  45.637  1.00 72.95  ? 10   C   R OP2   1 
ATOM   198   O  "O5'" . C   A 1  10   ? 0.387   -37.787  44.205  1.00 67.99  ? 10   C   R "O5'" 1 
ATOM   199   C  "C5'" . C   A 1  10   ? 1.079   -38.548  45.169  1.00 68.20  ? 10   C   R "C5'" 1 
ATOM   200   C  "C4'" . C   A 1  10   ? 1.893   -39.683  44.644  1.00 73.19  ? 10   C   R "C4'" 1 
ATOM   201   O  "O4'" . C   A 1  10   ? 3.069   -39.338  43.770  1.00 78.67  ? 10   C   R "O4'" 1 
ATOM   202   C  "C3'" . C   A 1  10   ? 2.414   -40.313  45.893  1.00 73.11  ? 10   C   R "C3'" 1 
ATOM   203   O  "O3'" . C   A 1  10   ? 1.413   -41.231  46.173  1.00 71.57  ? 10   C   R "O3'" 1 
ATOM   204   C  "C2'" . C   A 1  10   ? 3.706   -40.981  45.378  1.00 77.48  ? 10   C   R "C2'" 1 
ATOM   205   O  "O2'" . C   A 1  10   ? 3.541   -42.415  45.240  1.00 73.86  ? 10   C   R "O2'" 1 
ATOM   206   C  "C1'" . C   A 1  10   ? 4.224   -40.080  44.156  1.00 78.41  ? 10   C   R "C1'" 1 
ATOM   207   N  N1    . C   A 1  10   ? 5.130   -39.025  44.628  1.00 78.16  ? 10   C   R N1    1 
ATOM   208   C  C2    . C   A 1  10   ? 6.342   -39.305  45.294  1.00 78.91  ? 10   C   R C2    1 
ATOM   209   O  O2    . C   A 1  10   ? 6.629   -40.521  45.331  1.00 79.56  ? 10   C   R O2    1 
ATOM   210   N  N3    . C   A 1  10   ? 7.127   -38.255  45.816  1.00 79.21  ? 10   C   R N3    1 
ATOM   211   C  C4    . C   A 1  10   ? 6.683   -36.955  45.660  1.00 81.79  ? 10   C   R C4    1 
ATOM   212   N  N4    . C   A 1  10   ? 7.336   -35.849  46.098  1.00 80.62  ? 10   C   R N4    1 
ATOM   213   C  C5    . C   A 1  10   ? 5.430   -36.676  45.001  1.00 82.08  ? 10   C   R C5    1 
ATOM   214   C  C6    . C   A 1  10   ? 4.713   -37.722  44.522  1.00 80.92  ? 10   C   R C6    1 
ATOM   215   P  P     . DC  B 2  1    ? 45.053  -36.337  81.927  1.00 211.68 ? 8    DC  T P     1 
ATOM   216   O  OP1   . DC  B 2  1    ? 45.505  -37.609  82.533  1.00 211.74 ? 8    DC  T OP1   1 
ATOM   217   O  OP2   . DC  B 2  1    ? 44.988  -36.215  80.449  1.00 211.79 ? 8    DC  T OP2   1 
ATOM   218   O  "O5'" . DC  B 2  1    ? 43.592  -35.987  82.490  1.00 212.32 ? 8    DC  T "O5'" 1 
ATOM   219   C  "C5'" . DC  B 2  1    ? 43.227  -34.652  82.841  1.00 213.25 ? 8    DC  T "C5'" 1 
ATOM   220   C  "C4'" . DC  B 2  1    ? 42.645  -33.879  81.667  1.00 213.96 ? 8    DC  T "C4'" 1 
ATOM   221   O  "O4'" . DC  B 2  1    ? 43.679  -33.379  80.795  1.00 214.03 ? 8    DC  T "O4'" 1 
ATOM   222   C  "C3'" . DC  B 2  1    ? 41.706  -34.640  80.737  1.00 214.52 ? 8    DC  T "C3'" 1 
ATOM   223   O  "O3'" . DC  B 2  1    ? 40.364  -34.613  81.252  1.00 215.66 ? 8    DC  T "O3'" 1 
ATOM   224   C  "C2'" . DC  B 2  1    ? 41.842  -33.930  79.386  1.00 214.31 ? 8    DC  T "C2'" 1 
ATOM   225   C  "C1'" . DC  B 2  1    ? 43.081  -33.045  79.557  1.00 214.12 ? 8    DC  T "C1'" 1 
ATOM   226   N  N1    . DC  B 2  1    ? 44.147  -33.184  78.506  1.00 214.11 ? 8    DC  T N1    1 
ATOM   227   C  C2    . DC  B 2  1    ? 44.920  -32.062  78.142  1.00 214.11 ? 8    DC  T C2    1 
ATOM   228   O  O2    . DC  B 2  1    ? 44.715  -30.961  78.677  1.00 214.05 ? 8    DC  T O2    1 
ATOM   229   N  N3    . DC  B 2  1    ? 45.885  -32.214  77.195  1.00 214.08 ? 8    DC  T N3    1 
ATOM   230   C  C4    . DC  B 2  1    ? 46.095  -33.412  76.632  1.00 214.06 ? 8    DC  T C4    1 
ATOM   231   N  N4    . DC  B 2  1    ? 47.055  -33.509  75.708  1.00 214.00 ? 8    DC  T N4    1 
ATOM   232   C  C5    . DC  B 2  1    ? 45.327  -34.564  76.987  1.00 214.04 ? 8    DC  T C5    1 
ATOM   233   C  C6    . DC  B 2  1    ? 44.377  -34.405  77.920  1.00 214.07 ? 8    DC  T C6    1 
ATOM   234   P  P     . DA  B 2  2    ? 39.645  -33.352  81.979  1.00 216.56 ? 9    DA  T P     1 
ATOM   235   O  OP1   . DA  B 2  2    ? 39.444  -33.730  83.427  1.00 216.56 ? 9    DA  T OP1   1 
ATOM   236   O  OP2   . DA  B 2  2    ? 38.455  -33.002  81.121  1.00 216.75 ? 9    DA  T OP2   1 
ATOM   237   O  "O5'" . DA  B 2  2    ? 40.686  -32.122  81.923  1.00 216.95 ? 9    DA  T "O5'" 1 
ATOM   238   C  "C5'" . DA  B 2  2    ? 40.484  -30.981  82.756  1.00 217.59 ? 9    DA  T "C5'" 1 
ATOM   239   C  "C4'" . DA  B 2  2    ? 40.117  -29.757  81.925  1.00 218.14 ? 9    DA  T "C4'" 1 
ATOM   240   O  "O4'" . DA  B 2  2    ? 40.554  -29.912  80.548  1.00 217.93 ? 9    DA  T "O4'" 1 
ATOM   241   C  "C3'" . DA  B 2  2    ? 38.633  -29.410  81.839  1.00 218.73 ? 9    DA  T "C3'" 1 
ATOM   242   O  "O3'" . DA  B 2  2    ? 38.572  -27.986  81.854  1.00 220.24 ? 9    DA  T "O3'" 1 
ATOM   243   C  "C2'" . DA  B 2  2    ? 38.222  -30.006  80.492  1.00 218.14 ? 9    DA  T "C2'" 1 
ATOM   244   C  "C1'" . DA  B 2  2    ? 39.463  -29.666  79.675  1.00 217.51 ? 9    DA  T "C1'" 1 
ATOM   245   N  N9    . DA  B 2  2    ? 39.691  -30.455  78.469  1.00 217.29 ? 9    DA  T N9    1 
ATOM   246   C  C8    . DA  B 2  2    ? 38.941  -31.475  77.948  1.00 217.18 ? 9    DA  T C8    1 
ATOM   247   N  N7    . DA  B 2  2    ? 39.438  -31.980  76.844  1.00 217.09 ? 9    DA  T N7    1 
ATOM   248   C  C5    . DA  B 2  2    ? 40.590  -31.238  76.635  1.00 217.13 ? 9    DA  T C5    1 
ATOM   249   C  C6    . DA  B 2  2    ? 41.582  -31.266  75.633  1.00 217.24 ? 9    DA  T C6    1 
ATOM   250   N  N6    . DA  B 2  2    ? 41.551  -32.124  74.609  1.00 217.31 ? 9    DA  T N6    1 
ATOM   251   N  N1    . DA  B 2  2    ? 42.604  -30.383  75.725  1.00 217.18 ? 9    DA  T N1    1 
ATOM   252   C  C2    . DA  B 2  2    ? 42.637  -29.522  76.749  1.00 217.10 ? 9    DA  T C2    1 
ATOM   253   N  N3    . DA  B 2  2    ? 41.765  -29.402  77.746  1.00 217.08 ? 9    DA  T N3    1 
ATOM   254   C  C4    . DA  B 2  2    ? 40.762  -30.294  77.627  1.00 217.11 ? 9    DA  T C4    1 
ATOM   255   P  P     . DA  B 2  3    ? 37.287  -27.128  81.433  1.00 221.51 ? 10   DA  T P     1 
ATOM   256   O  OP1   . DA  B 2  3    ? 36.286  -27.259  82.516  1.00 221.51 ? 10   DA  T OP1   1 
ATOM   257   O  OP2   . DA  B 2  3    ? 36.905  -27.468  80.044  1.00 221.65 ? 10   DA  T OP2   1 
ATOM   258   O  "O5'" . DA  B 2  3    ? 37.878  -25.635  81.421  1.00 222.63 ? 10   DA  T "O5'" 1 
ATOM   259   C  "C5'" . DA  B 2  3    ? 39.157  -25.337  80.835  1.00 224.26 ? 10   DA  T "C5'" 1 
ATOM   260   C  "C4'" . DA  B 2  3    ? 39.069  -24.781  79.416  1.00 225.59 ? 10   DA  T "C4'" 1 
ATOM   261   O  "O4'" . DA  B 2  3    ? 39.521  -25.775  78.456  1.00 226.08 ? 10   DA  T "O4'" 1 
ATOM   262   C  "C3'" . DA  B 2  3    ? 37.688  -24.322  78.930  1.00 226.20 ? 10   DA  T "C3'" 1 
ATOM   263   O  "O3'" . DA  B 2  3    ? 37.694  -22.904  78.719  1.00 226.82 ? 10   DA  T "O3'" 1 
ATOM   264   C  "C2'" . DA  B 2  3    ? 37.449  -25.114  77.640  1.00 226.25 ? 10   DA  T "C2'" 1 
ATOM   265   C  "C1'" . DA  B 2  3    ? 38.861  -25.516  77.234  1.00 226.30 ? 10   DA  T "C1'" 1 
ATOM   266   N  N9    . DA  B 2  3    ? 38.910  -26.697  76.373  1.00 226.34 ? 10   DA  T N9    1 
ATOM   267   C  C8    . DA  B 2  3    ? 38.392  -27.937  76.635  1.00 226.38 ? 10   DA  T C8    1 
ATOM   268   N  N7    . DA  B 2  3    ? 38.583  -28.806  75.674  1.00 226.41 ? 10   DA  T N7    1 
ATOM   269   C  C5    . DA  B 2  3    ? 39.275  -28.088  74.713  1.00 226.39 ? 10   DA  T C5    1 
ATOM   270   C  C6    . DA  B 2  3    ? 39.781  -28.439  73.443  1.00 226.38 ? 10   DA  T C6    1 
ATOM   271   N  N6    . DA  B 2  3    ? 39.649  -29.660  72.919  1.00 226.39 ? 10   DA  T N6    1 
ATOM   272   N  N1    . DA  B 2  3    ? 40.427  -27.487  72.730  1.00 226.38 ? 10   DA  T N1    1 
ATOM   273   C  C2    . DA  B 2  3    ? 40.553  -26.261  73.258  1.00 226.38 ? 10   DA  T C2    1 
ATOM   274   N  N3    . DA  B 2  3    ? 40.122  -25.817  74.441  1.00 226.42 ? 10   DA  T N3    1 
ATOM   275   C  C4    . DA  B 2  3    ? 39.485  -26.785  75.127  1.00 226.37 ? 10   DA  T C4    1 
ATOM   276   P  P     . DG  B 2  4    ? 36.457  -22.109  78.071  1.00 227.22 ? 11   DG  T P     1 
ATOM   277   O  OP1   . DG  B 2  4    ? 36.539  -20.712  78.549  1.00 227.11 ? 11   DG  T OP1   1 
ATOM   278   O  OP2   . DG  B 2  4    ? 35.212  -22.881  78.296  1.00 227.18 ? 11   DG  T OP2   1 
ATOM   279   O  "O5'" . DG  B 2  4    ? 36.791  -22.141  76.505  1.00 227.83 ? 11   DG  T "O5'" 1 
ATOM   280   C  "C5'" . DG  B 2  4    ? 38.091  -21.795  76.018  1.00 228.75 ? 11   DG  T "C5'" 1 
ATOM   281   C  "C4'" . DG  B 2  4    ? 38.181  -21.979  74.513  1.00 229.60 ? 11   DG  T "C4'" 1 
ATOM   282   O  "O4'" . DG  B 2  4    ? 38.353  -23.386  74.170  1.00 229.66 ? 11   DG  T "O4'" 1 
ATOM   283   C  "C3'" . DG  B 2  4    ? 36.949  -21.507  73.730  1.00 230.28 ? 11   DG  T "C3'" 1 
ATOM   284   O  "O3'" . DG  B 2  4    ? 37.319  -20.612  72.669  1.00 231.52 ? 11   DG  T "O3'" 1 
ATOM   285   C  "C2'" . DG  B 2  4    ? 36.387  -22.815  73.177  1.00 230.05 ? 11   DG  T "C2'" 1 
ATOM   286   C  "C1'" . DG  B 2  4    ? 37.711  -23.526  72.919  1.00 229.58 ? 11   DG  T "C1'" 1 
ATOM   287   N  N9    . DG  B 2  4    ? 37.607  -24.905  72.422  1.00 229.45 ? 11   DG  T N9    1 
ATOM   288   C  C8    . DG  B 2  4    ? 36.963  -25.961  73.025  1.00 229.31 ? 11   DG  T C8    1 
ATOM   289   N  N7    . DG  B 2  4    ? 37.030  -27.064  72.334  1.00 229.34 ? 11   DG  T N7    1 
ATOM   290   C  C5    . DG  B 2  4    ? 37.755  -26.723  71.196  1.00 229.34 ? 11   DG  T C5    1 
ATOM   291   C  C6    . DG  B 2  4    ? 38.146  -27.515  70.083  1.00 229.40 ? 11   DG  T C6    1 
ATOM   292   O  O6    . DG  B 2  4    ? 37.908  -28.713  69.895  1.00 229.37 ? 11   DG  T O6    1 
ATOM   293   N  N1    . DG  B 2  4    ? 38.877  -26.797  69.131  1.00 229.36 ? 11   DG  T N1    1 
ATOM   294   C  C2    . DG  B 2  4    ? 39.198  -25.464  69.242  1.00 229.29 ? 11   DG  T C2    1 
ATOM   295   N  N2    . DG  B 2  4    ? 39.907  -24.936  68.230  1.00 229.24 ? 11   DG  T N2    1 
ATOM   296   N  N3    . DG  B 2  4    ? 38.839  -24.712  70.283  1.00 229.33 ? 11   DG  T N3    1 
ATOM   297   C  C4    . DG  B 2  4    ? 38.118  -25.395  71.225  1.00 229.38 ? 11   DG  T C4    1 
ATOM   298   P  P     . DT  B 2  5    ? 36.394  -19.362  72.272  1.00 232.42 ? 12   DT  T P     1 
ATOM   299   O  OP1   . DT  B 2  5    ? 37.067  -18.167  72.822  1.00 232.53 ? 12   DT  T OP1   1 
ATOM   300   O  OP2   . DT  B 2  5    ? 35.000  -19.681  72.669  1.00 232.41 ? 12   DT  T OP2   1 
ATOM   301   O  "O5'" . DT  B 2  5    ? 36.422  -19.277  70.666  1.00 233.07 ? 12   DT  T "O5'" 1 
ATOM   302   C  "C5'" . DT  B 2  5    ? 37.627  -19.213  69.900  1.00 234.07 ? 12   DT  T "C5'" 1 
ATOM   303   C  "C4'" . DT  B 2  5    ? 37.655  -20.320  68.852  1.00 235.11 ? 12   DT  T "C4'" 1 
ATOM   304   O  "O4'" . DT  B 2  5    ? 37.107  -21.557  69.395  1.00 235.60 ? 12   DT  T "O4'" 1 
ATOM   305   C  "C3'" . DT  B 2  5    ? 36.881  -20.070  67.559  1.00 235.69 ? 12   DT  T "C3'" 1 
ATOM   306   O  "O3'" . DT  B 2  5    ? 37.706  -20.571  66.480  1.00 236.63 ? 12   DT  T "O3'" 1 
ATOM   307   C  "C2'" . DT  B 2  5    ? 35.573  -20.844  67.791  1.00 235.72 ? 12   DT  T "C2'" 1 
ATOM   308   C  "C1'" . DT  B 2  5    ? 36.095  -22.073  68.539  1.00 235.57 ? 12   DT  T "C1'" 1 
ATOM   309   N  N1    . DT  B 2  5    ? 35.098  -22.941  69.332  1.00 235.48 ? 12   DT  T N1    1 
ATOM   310   C  C2    . DT  B 2  5    ? 35.008  -24.307  69.070  1.00 235.34 ? 12   DT  T C2    1 
ATOM   311   O  O2    . DT  B 2  5    ? 35.669  -24.892  68.225  1.00 235.20 ? 12   DT  T O2    1 
ATOM   312   N  N3    . DT  B 2  5    ? 34.093  -24.985  69.849  1.00 235.32 ? 12   DT  T N3    1 
ATOM   313   C  C4    . DT  B 2  5    ? 33.274  -24.469  70.845  1.00 235.29 ? 12   DT  T C4    1 
ATOM   314   O  O4    . DT  B 2  5    ? 32.492  -25.178  71.477  1.00 235.28 ? 12   DT  T O4    1 
ATOM   315   C  C5    . DT  B 2  5    ? 33.414  -23.048  71.083  1.00 235.22 ? 12   DT  T C5    1 
ATOM   316   C  C7    . DT  B 2  5    ? 32.741  -22.403  72.267  1.00 234.91 ? 12   DT  T C7    1 
ATOM   317   C  C6    . DT  B 2  5    ? 34.301  -22.371  70.324  1.00 235.42 ? 12   DT  T C6    1 
ATOM   318   P  P     . DA  B 2  6    ? 37.197  -21.004  65.014  1.00 237.27 ? 13   DA  T P     1 
ATOM   319   O  OP1   . DA  B 2  6    ? 38.391  -21.095  64.140  1.00 237.38 ? 13   DA  T OP1   1 
ATOM   320   O  OP2   . DA  B 2  6    ? 36.113  -20.063  64.635  1.00 237.13 ? 13   DA  T OP2   1 
ATOM   321   O  "O5'" . DA  B 2  6    ? 36.579  -22.488  65.209  1.00 237.36 ? 13   DA  T "O5'" 1 
ATOM   322   C  "C5'" . DA  B 2  6    ? 37.355  -23.722  65.310  1.00 236.85 ? 13   DA  T "C5'" 1 
ATOM   323   C  "C4'" . DA  B 2  6    ? 36.713  -24.919  64.595  1.00 236.55 ? 13   DA  T "C4'" 1 
ATOM   324   O  "O4'" . DA  B 2  6    ? 35.680  -25.580  65.399  1.00 236.01 ? 13   DA  T "O4'" 1 
ATOM   325   C  "C3'" . DA  B 2  6    ? 36.034  -24.605  63.252  1.00 236.76 ? 13   DA  T "C3'" 1 
ATOM   326   O  "O3'" . DA  B 2  6    ? 36.381  -25.570  62.228  1.00 237.24 ? 13   DA  T "O3'" 1 
ATOM   327   C  "C2'" . DA  B 2  6    ? 34.561  -24.686  63.635  1.00 236.20 ? 13   DA  T "C2'" 1 
ATOM   328   C  "C1'" . DA  B 2  6    ? 34.651  -25.934  64.489  1.00 235.59 ? 13   DA  T "C1'" 1 
ATOM   329   N  N9    . DA  B 2  6    ? 33.364  -26.305  65.077  1.00 235.45 ? 13   DA  T N9    1 
ATOM   330   C  C8    . DA  B 2  6    ? 32.658  -25.621  66.026  1.00 235.43 ? 13   DA  T C8    1 
ATOM   331   N  N7    . DA  B 2  6    ? 31.519  -26.191  66.349  1.00 235.59 ? 13   DA  T N7    1 
ATOM   332   C  C5    . DA  B 2  6    ? 31.465  -27.324  65.552  1.00 235.48 ? 13   DA  T C5    1 
ATOM   333   C  C6    . DA  B 2  6    ? 30.508  -28.358  65.418  1.00 235.32 ? 13   DA  T C6    1 
ATOM   334   N  N6    . DA  B 2  6    ? 29.376  -28.396  66.126  1.00 235.25 ? 13   DA  T N6    1 
ATOM   335   N  N1    . DA  B 2  6    ? 30.754  -29.350  64.529  1.00 235.27 ? 13   DA  T N1    1 
ATOM   336   C  C2    . DA  B 2  6    ? 31.889  -29.307  63.818  1.00 235.34 ? 13   DA  T C2    1 
ATOM   337   N  N3    . DA  B 2  6    ? 32.857  -28.384  63.854  1.00 235.30 ? 13   DA  T N3    1 
ATOM   338   C  C4    . DA  B 2  6    ? 32.591  -27.407  64.750  1.00 235.46 ? 13   DA  T C4    1 
ATOM   339   P  P     . DC  B 2  7    ? 35.514  -25.823  60.886  1.00 237.25 ? 14   DC  T P     1 
ATOM   340   O  OP1   . DC  B 2  7    ? 36.462  -26.305  59.854  1.00 237.48 ? 14   DC  T OP1   1 
ATOM   341   O  OP2   . DC  B 2  7    ? 34.711  -24.612  60.581  1.00 237.19 ? 14   DC  T OP2   1 
ATOM   342   O  "O5'" . DC  B 2  7    ? 34.519  -27.018  61.316  1.00 236.01 ? 14   DC  T "O5'" 1 
ATOM   343   C  "C5'" . DC  B 2  7    ? 34.559  -28.330  60.721  1.00 234.18 ? 14   DC  T "C5'" 1 
ATOM   344   C  "C4'" . DC  B 2  7    ? 33.332  -28.614  59.856  1.00 232.93 ? 14   DC  T "C4'" 1 
ATOM   345   O  "O4'" . DC  B 2  7    ? 32.125  -28.506  60.649  1.00 233.46 ? 14   DC  T "O4'" 1 
ATOM   346   C  "C3'" . DC  B 2  7    ? 33.154  -27.731  58.616  1.00 231.49 ? 14   DC  T "C3'" 1 
ATOM   347   O  "O3'" . DC  B 2  7    ? 33.314  -28.515  57.411  1.00 228.65 ? 14   DC  T "O3'" 1 
ATOM   348   C  "C2'" . DC  B 2  7    ? 31.759  -27.102  58.738  1.00 232.24 ? 14   DC  T "C2'" 1 
ATOM   349   C  "C1'" . DC  B 2  7    ? 31.198  -27.587  60.085  1.00 233.57 ? 14   DC  T "C1'" 1 
ATOM   350   N  N1    . DC  B 2  7    ? 30.864  -26.540  61.158  1.00 233.99 ? 14   DC  T N1    1 
ATOM   351   C  C2    . DC  B 2  7    ? 29.605  -26.554  61.806  1.00 234.20 ? 14   DC  T C2    1 
ATOM   352   O  O2    . DC  B 2  7    ? 28.751  -27.401  61.501  1.00 234.16 ? 14   DC  T O2    1 
ATOM   353   N  N3    . DC  B 2  7    ? 29.342  -25.619  62.766  1.00 234.33 ? 14   DC  T N3    1 
ATOM   354   C  C4    . DC  B 2  7    ? 30.265  -24.703  63.100  1.00 234.12 ? 14   DC  T C4    1 
ATOM   355   N  N4    . DC  B 2  7    ? 29.959  -23.807  64.049  1.00 234.02 ? 14   DC  T N4    1 
ATOM   356   C  C5    . DC  B 2  7    ? 31.544  -24.673  62.464  1.00 233.98 ? 14   DC  T C5    1 
ATOM   357   C  C6    . DC  B 2  7    ? 31.794  -25.596  61.521  1.00 233.98 ? 14   DC  T C6    1 
ATOM   358   P  P     . DT  B 2  8    ? 34.761  -28.649  56.703  1.00 226.47 ? 15   DT  T P     1 
ATOM   359   O  OP1   . DT  B 2  8    ? 35.677  -29.346  57.641  1.00 226.62 ? 15   DT  T OP1   1 
ATOM   360   O  OP2   . DT  B 2  8    ? 35.126  -27.305  56.192  1.00 226.54 ? 15   DT  T OP2   1 
ATOM   361   O  "O5'" . DT  B 2  8    ? 34.519  -29.582  55.419  1.00 223.18 ? 15   DT  T "O5'" 1 
ATOM   362   C  "C5'" . DT  B 2  8    ? 34.507  -31.012  55.507  1.00 217.76 ? 15   DT  T "C5'" 1 
ATOM   363   C  "C4'" . DT  B 2  8    ? 33.088  -31.555  55.423  1.00 213.74 ? 15   DT  T "C4'" 1 
ATOM   364   O  "O4'" . DT  B 2  8    ? 32.477  -31.529  56.738  1.00 212.80 ? 15   DT  T "O4'" 1 
ATOM   365   C  "C3'" . DT  B 2  8    ? 32.140  -30.773  54.506  1.00 211.10 ? 15   DT  T "C3'" 1 
ATOM   366   O  "O3'" . DT  B 2  8    ? 31.970  -31.459  53.223  1.00 207.33 ? 15   DT  T "O3'" 1 
ATOM   367   C  "C2'" . DT  B 2  8    ? 30.877  -30.538  55.353  1.00 211.28 ? 15   DT  T "C2'" 1 
ATOM   368   C  "C1'" . DT  B 2  8    ? 31.079  -31.487  56.536  1.00 211.53 ? 15   DT  T "C1'" 1 
ATOM   369   N  N1    . DT  B 2  8    ? 30.373  -31.221  57.858  1.00 211.12 ? 15   DT  T N1    1 
ATOM   370   C  C2    . DT  B 2  8    ? 29.259  -30.394  57.976  1.00 210.77 ? 15   DT  T C2    1 
ATOM   371   O  O2    . DT  B 2  8    ? 28.735  -29.779  57.060  1.00 210.46 ? 15   DT  T O2    1 
ATOM   372   N  N3    . DT  B 2  8    ? 28.763  -30.305  59.256  1.00 210.71 ? 15   DT  T N3    1 
ATOM   373   C  C4    . DT  B 2  8    ? 29.235  -30.938  60.399  1.00 210.81 ? 15   DT  T C4    1 
ATOM   374   O  O4    . DT  B 2  8    ? 28.700  -30.775  61.490  1.00 210.98 ? 15   DT  T O4    1 
ATOM   375   C  C5    . DT  B 2  8    ? 30.389  -31.791  60.209  1.00 210.57 ? 15   DT  T C5    1 
ATOM   376   C  C7    . DT  B 2  8    ? 31.036  -32.516  61.361  1.00 210.14 ? 15   DT  T C7    1 
ATOM   377   C  C6    . DT  B 2  8    ? 30.883  -31.884  58.968  1.00 210.81 ? 15   DT  T C6    1 
ATOM   378   P  P     . DT  B 2  9    ? 30.897  -32.614  52.872  1.00 204.23 ? 16   DT  T P     1 
ATOM   379   O  OP1   . DT  B 2  9    ? 30.964  -33.694  53.882  1.00 204.29 ? 16   DT  T OP1   1 
ATOM   380   O  OP2   . DT  B 2  9    ? 31.074  -32.963  51.438  1.00 203.85 ? 16   DT  T OP2   1 
ATOM   381   O  "O5'" . DT  B 2  9    ? 29.521  -31.814  53.085  1.00 201.54 ? 16   DT  T "O5'" 1 
ATOM   382   C  "C5'" . DT  B 2  9    ? 28.229  -32.402  52.958  1.00 196.03 ? 16   DT  T "C5'" 1 
ATOM   383   C  "C4'" . DT  B 2  9    ? 27.807  -33.125  54.218  1.00 191.55 ? 16   DT  T "C4'" 1 
ATOM   384   O  "O4'" . DT  B 2  9    ? 27.728  -32.256  55.370  1.00 190.20 ? 16   DT  T "O4'" 1 
ATOM   385   C  "C3'" . DT  B 2  9    ? 26.410  -33.704  54.207  1.00 189.18 ? 16   DT  T "C3'" 1 
ATOM   386   O  "O3'" . DT  B 2  9    ? 26.285  -34.766  53.253  1.00 186.01 ? 16   DT  T "O3'" 1 
ATOM   387   C  "C2'" . DT  B 2  9    ? 26.396  -34.194  55.650  1.00 189.64 ? 16   DT  T "C2'" 1 
ATOM   388   C  "C1'" . DT  B 2  9    ? 27.182  -33.092  56.377  1.00 190.08 ? 16   DT  T "C1'" 1 
ATOM   389   N  N1    . DT  B 2  9    ? 26.345  -32.327  57.391  1.00 190.48 ? 16   DT  T N1    1 
ATOM   390   C  C2    . DT  B 2  9    ? 26.040  -32.937  58.609  1.00 190.61 ? 16   DT  T C2    1 
ATOM   391   O  O2    . DT  B 2  9    ? 26.410  -34.063  58.932  1.00 190.18 ? 16   DT  T O2    1 
ATOM   392   N  N3    . DT  B 2  9    ? 25.272  -32.166  59.458  1.00 190.42 ? 16   DT  T N3    1 
ATOM   393   C  C4    . DT  B 2  9    ? 24.789  -30.889  59.227  1.00 189.88 ? 16   DT  T C4    1 
ATOM   394   O  O4    . DT  B 2  9    ? 24.116  -30.308  60.066  1.00 190.03 ? 16   DT  T O4    1 
ATOM   395   C  C5    . DT  B 2  9    ? 25.137  -30.309  57.947  1.00 189.77 ? 16   DT  T C5    1 
ATOM   396   C  C7    . DT  B 2  9    ? 24.683  -28.924  57.577  1.00 189.35 ? 16   DT  T C7    1 
ATOM   397   C  C6    . DT  B 2  9    ? 25.884  -31.045  57.104  1.00 190.13 ? 16   DT  T C6    1 
ATOM   398   P  P     . DA  B 2  10   ? 25.337  -34.656  51.961  1.00 182.81 ? 17   DA  T P     1 
ATOM   399   O  OP1   . DA  B 2  10   ? 25.319  -35.950  51.237  1.00 183.40 ? 17   DA  T OP1   1 
ATOM   400   O  OP2   . DA  B 2  10   ? 25.732  -33.438  51.229  1.00 182.63 ? 17   DA  T OP2   1 
ATOM   401   O  "O5'" . DA  B 2  10   ? 23.899  -34.429  52.620  1.00 180.19 ? 17   DA  T "O5'" 1 
ATOM   402   C  "C5'" . DA  B 2  10   ? 23.168  -35.502  53.204  1.00 175.88 ? 17   DA  T "C5'" 1 
ATOM   403   C  "C4'" . DA  B 2  10   ? 22.269  -34.982  54.316  1.00 172.70 ? 17   DA  T "C4'" 1 
ATOM   404   O  "O4'" . DA  B 2  10   ? 23.033  -34.126  55.203  1.00 172.89 ? 17   DA  T "O4'" 1 
ATOM   405   C  "C3'" . DA  B 2  10   ? 21.084  -34.108  53.901  1.00 169.85 ? 17   DA  T "C3'" 1 
ATOM   406   O  "O3'" . DA  B 2  10   ? 19.948  -34.870  53.451  1.00 163.74 ? 17   DA  T "O3'" 1 
ATOM   407   C  "C2'" . DA  B 2  10   ? 20.799  -33.442  55.242  1.00 171.85 ? 17   DA  T "C2'" 1 
ATOM   408   C  "C1'" . DA  B 2  10   ? 22.218  -33.046  55.628  1.00 174.23 ? 17   DA  T "C1'" 1 
ATOM   409   N  N9    . DA  B 2  10   ? 22.647  -31.782  55.010  1.00 174.89 ? 17   DA  T N9    1 
ATOM   410   C  C8    . DA  B 2  10   ? 23.689  -31.591  54.136  1.00 175.30 ? 17   DA  T C8    1 
ATOM   411   N  N7    . DA  B 2  10   ? 23.854  -30.348  53.738  1.00 175.47 ? 17   DA  T N7    1 
ATOM   412   C  C5    . DA  B 2  10   ? 22.842  -29.663  54.395  1.00 175.77 ? 17   DA  T C5    1 
ATOM   413   C  C6    . DA  B 2  10   ? 22.464  -28.296  54.395  1.00 175.50 ? 17   DA  T C6    1 
ATOM   414   N  N6    . DA  B 2  10   ? 23.106  -27.365  53.676  1.00 175.14 ? 17   DA  T N6    1 
ATOM   415   N  N1    . DA  B 2  10   ? 21.395  -27.935  55.162  1.00 175.56 ? 17   DA  T N1    1 
ATOM   416   C  C2    . DA  B 2  10   ? 20.745  -28.873  55.886  1.00 175.54 ? 17   DA  T C2    1 
ATOM   417   N  N3    . DA  B 2  10   ? 21.012  -30.186  55.965  1.00 175.87 ? 17   DA  T N3    1 
ATOM   418   C  C4    . DA  B 2  10   ? 22.081  -30.526  55.189  1.00 175.81 ? 17   DA  T C4    1 
ATOM   419   P  P     . DC  B 2  11   ? 19.207  -34.612  52.042  1.00 157.92 ? 18   DC  T P     1 
ATOM   420   O  OP1   . DC  B 2  11   ? 20.204  -34.794  50.951  1.00 158.69 ? 18   DC  T OP1   1 
ATOM   421   O  OP2   . DC  B 2  11   ? 18.454  -33.330  52.104  1.00 157.05 ? 18   DC  T OP2   1 
ATOM   422   O  "O5'" . DC  B 2  11   ? 18.173  -35.844  52.046  1.00 150.82 ? 18   DC  T "O5'" 1 
ATOM   423   C  "C5'" . DC  B 2  11   ? 18.629  -37.188  52.163  1.00 141.49 ? 18   DC  T "C5'" 1 
ATOM   424   C  "C4'" . DC  B 2  11   ? 17.791  -38.082  51.272  1.00 135.15 ? 18   DC  T "C4'" 1 
ATOM   425   O  "O4'" . DC  B 2  11   ? 16.422  -38.007  51.703  1.00 133.43 ? 18   DC  T "O4'" 1 
ATOM   426   C  "C3'" . DC  B 2  11   ? 17.707  -37.645  49.827  1.00 130.80 ? 18   DC  T "C3'" 1 
ATOM   427   O  "O3'" . DC  B 2  11   ? 18.809  -38.183  49.094  1.00 124.96 ? 18   DC  T "O3'" 1 
ATOM   428   C  "C2'" . DC  B 2  11   ? 16.370  -38.227  49.379  1.00 130.94 ? 18   DC  T "C2'" 1 
ATOM   429   C  "C1'" . DC  B 2  11   ? 15.521  -38.199  50.634  1.00 132.71 ? 18   DC  T "C1'" 1 
ATOM   430   N  N1    . DC  B 2  11   ? 14.461  -37.105  50.745  1.00 133.26 ? 18   DC  T N1    1 
ATOM   431   C  C2    . DC  B 2  11   ? 13.073  -37.376  50.902  1.00 133.02 ? 18   DC  T C2    1 
ATOM   432   O  O2    . DC  B 2  11   ? 12.599  -38.521  50.932  1.00 133.44 ? 18   DC  T O2    1 
ATOM   433   N  N3    . DC  B 2  11   ? 12.216  -36.344  51.010  1.00 132.68 ? 18   DC  T N3    1 
ATOM   434   C  C4    . DC  B 2  11   ? 12.671  -35.098  50.979  1.00 133.25 ? 18   DC  T C4    1 
ATOM   435   N  N4    . DC  B 2  11   ? 11.780  -34.114  51.093  1.00 134.31 ? 18   DC  T N4    1 
ATOM   436   C  C5    . DC  B 2  11   ? 14.044  -34.784  50.828  1.00 133.08 ? 18   DC  T C5    1 
ATOM   437   C  C6    . DC  B 2  11   ? 14.886  -35.809  50.721  1.00 133.29 ? 18   DC  T C6    1 
ATOM   438   P  P     . DG  B 2  12   ? 18.952  -37.684  47.594  1.00 119.97 ? 19   DG  T P     1 
ATOM   439   O  OP1   . DG  B 2  12   ? 20.315  -37.955  47.079  1.00 120.29 ? 19   DG  T OP1   1 
ATOM   440   O  OP2   . DG  B 2  12   ? 18.307  -36.348  47.575  1.00 119.82 ? 19   DG  T OP2   1 
ATOM   441   O  "O5'" . DG  B 2  12   ? 18.015  -38.655  46.757  1.00 118.73 ? 19   DG  T "O5'" 1 
ATOM   442   C  "C5'" . DG  B 2  12   ? 18.216  -40.084  46.723  1.00 115.06 ? 19   DG  T "C5'" 1 
ATOM   443   C  "C4'" . DG  B 2  12   ? 17.075  -40.736  45.959  1.00 110.52 ? 19   DG  T "C4'" 1 
ATOM   444   O  "O4'" . DG  B 2  12   ? 15.900  -40.626  46.796  1.00 107.66 ? 19   DG  T "O4'" 1 
ATOM   445   C  "C3'" . DG  B 2  12   ? 16.812  -39.971  44.670  1.00 108.92 ? 19   DG  T "C3'" 1 
ATOM   446   O  "O3'" . DG  B 2  12   ? 17.451  -40.613  43.570  1.00 110.72 ? 19   DG  T "O3'" 1 
ATOM   447   C  "C2'" . DG  B 2  12   ? 15.322  -40.005  44.551  1.00 107.16 ? 19   DG  T "C2'" 1 
ATOM   448   C  "C1'" . DG  B 2  12   ? 14.818  -40.345  45.964  1.00 106.20 ? 19   DG  T "C1'" 1 
ATOM   449   N  N9    . DG  B 2  12   ? 14.001  -39.219  46.355  1.00 104.86 ? 19   DG  T N9    1 
ATOM   450   C  C8    . DG  B 2  12   ? 14.382  -38.032  46.869  1.00 105.72 ? 19   DG  T C8    1 
ATOM   451   N  N7    . DG  B 2  12   ? 13.385  -37.205  47.029  1.00 106.36 ? 19   DG  T N7    1 
ATOM   452   C  C5    . DG  B 2  12   ? 12.283  -37.888  46.554  1.00 105.13 ? 19   DG  T C5    1 
ATOM   453   C  C6    . DG  B 2  12   ? 10.925  -37.511  46.457  1.00 105.89 ? 19   DG  T C6    1 
ATOM   454   O  O6    . DG  B 2  12   ? 10.408  -36.444  46.804  1.00 106.04 ? 19   DG  T O6    1 
ATOM   455   N  N1    . DG  B 2  12   ? 10.134  -38.507  45.908  1.00 105.34 ? 19   DG  T N1    1 
ATOM   456   C  C2    . DG  B 2  12   ? 10.646  -39.711  45.518  1.00 104.92 ? 19   DG  T C2    1 
ATOM   457   N  N2    . DG  B 2  12   ? 9.826   -40.604  44.989  1.00 105.81 ? 19   DG  T N2    1 
ATOM   458   N  N3    . DG  B 2  12   ? 11.891  -40.066  45.617  1.00 104.04 ? 19   DG  T N3    1 
ATOM   459   C  C4    . DG  B 2  12   ? 12.661  -39.112  46.132  1.00 103.89 ? 19   DG  T C4    1 
ATOM   460   P  P     . DC  B 2  13   ? 17.887  -39.813  42.231  1.00 112.21 ? 20   DC  T P     1 
ATOM   461   O  OP1   . DC  B 2  13   ? 18.943  -40.557  41.490  1.00 109.17 ? 20   DC  T OP1   1 
ATOM   462   O  OP2   . DC  B 2  13   ? 18.209  -38.389  42.507  1.00 112.64 ? 20   DC  T OP2   1 
ATOM   463   O  "O5'" . DC  B 2  13   ? 16.406  -39.843  41.571  1.00 111.85 ? 20   DC  T "O5'" 1 
ATOM   464   C  "C5'" . DC  B 2  13   ? 15.898  -40.925  40.716  1.00 109.06 ? 20   DC  T "C5'" 1 
ATOM   465   C  "C4'" . DC  B 2  13   ? 14.403  -40.787  40.455  1.00 105.88 ? 20   DC  T "C4'" 1 
ATOM   466   O  "O4'" . DC  B 2  13   ? 13.803  -40.380  41.685  1.00 103.20 ? 20   DC  T "O4'" 1 
ATOM   467   C  "C3'" . DC  B 2  13   ? 13.955  -39.622  39.573  1.00 104.85 ? 20   DC  T "C3'" 1 
ATOM   468   O  "O3'" . DC  B 2  13   ? 14.208  -39.833  38.177  1.00 102.40 ? 20   DC  T "O3'" 1 
ATOM   469   C  "C2'" . DC  B 2  13   ? 12.478  -39.501  39.909  1.00 103.38 ? 20   DC  T "C2'" 1 
ATOM   470   C  "C1'" . DC  B 2  13   ? 12.581  -39.759  41.394  1.00 105.31 ? 20   DC  T "C1'" 1 
ATOM   471   N  N1    . DC  B 2  13   ? 12.586  -38.525  42.169  1.00 107.28 ? 20   DC  T N1    1 
ATOM   472   C  C2    . DC  B 2  13   ? 11.376  -38.166  42.861  1.00 109.81 ? 20   DC  T C2    1 
ATOM   473   O  O2    . DC  B 2  13   ? 10.319  -38.860  42.819  1.00 109.26 ? 20   DC  T O2    1 
ATOM   474   N  N3    . DC  B 2  13   ? 11.372  -37.026  43.593  1.00 108.21 ? 20   DC  T N3    1 
ATOM   475   C  C4    . DC  B 2  13   ? 12.481  -36.303  43.639  1.00 107.28 ? 20   DC  T C4    1 
ATOM   476   N  N4    . DC  B 2  13   ? 12.353  -35.221  44.389  1.00 108.17 ? 20   DC  T N4    1 
ATOM   477   C  C5    . DC  B 2  13   ? 13.712  -36.641  42.972  1.00 107.38 ? 20   DC  T C5    1 
ATOM   478   C  C6    . DC  B 2  13   ? 13.728  -37.768  42.252  1.00 106.05 ? 20   DC  T C6    1 
ATOM   479   P  P     . DC  B 2  14   ? 14.736  -38.613  37.283  1.00 99.76  ? 21   DC  T P     1 
ATOM   480   O  OP1   . DC  B 2  14   ? 15.564  -39.308  36.283  1.00 100.09 ? 21   DC  T OP1   1 
ATOM   481   O  OP2   . DC  B 2  14   ? 15.263  -37.468  38.064  1.00 98.01  ? 21   DC  T OP2   1 
ATOM   482   O  "O5'" . DC  B 2  14   ? 13.410  -37.953  36.671  1.00 100.84 ? 21   DC  T "O5'" 1 
ATOM   483   C  "C5'" . DC  B 2  14   ? 12.203  -38.690  36.468  1.00 99.72  ? 21   DC  T "C5'" 1 
ATOM   484   C  "C4'" . DC  B 2  14   ? 10.897  -37.963  36.790  1.00 98.56  ? 21   DC  T "C4'" 1 
ATOM   485   O  "O4'" . DC  B 2  14   ? 10.749  -37.859  38.201  1.00 95.16  ? 21   DC  T "O4'" 1 
ATOM   486   C  "C3'" . DC  B 2  14   ? 10.631  -36.535  36.293  1.00 99.55  ? 21   DC  T "C3'" 1 
ATOM   487   O  "O3'" . DC  B 2  14   ? 10.310  -36.533  34.896  1.00 103.15 ? 21   DC  T "O3'" 1 
ATOM   488   C  "C2'" . DC  B 2  14   ? 9.353   -36.267  37.049  1.00 96.91  ? 21   DC  T "C2'" 1 
ATOM   489   C  "C1'" . DC  B 2  14   ? 9.719   -36.918  38.375  1.00 98.47  ? 21   DC  T "C1'" 1 
ATOM   490   N  N1    . DC  B 2  14   ? 10.287  -35.971  39.305  1.00 100.33 ? 21   DC  T N1    1 
ATOM   491   C  C2    . DC  B 2  14   ? 9.479   -34.975  39.939  1.00 101.25 ? 21   DC  T C2    1 
ATOM   492   O  O2    . DC  B 2  14   ? 8.248   -34.860  39.749  1.00 101.45 ? 21   DC  T O2    1 
ATOM   493   N  N3    . DC  B 2  14   ? 10.097  -34.132  40.796  1.00 100.20 ? 21   DC  T N3    1 
ATOM   494   C  C4    . DC  B 2  14   ? 11.401  -34.283  41.012  1.00 100.66 ? 21   DC  T C4    1 
ATOM   495   N  N4    . DC  B 2  14   ? 11.930  -33.428  41.852  1.00 102.13 ? 21   DC  T N4    1 
ATOM   496   C  C5    . DC  B 2  14   ? 12.243  -35.261  40.395  1.00 101.46 ? 21   DC  T C5    1 
ATOM   497   C  C6    . DC  B 2  14   ? 11.637  -36.094  39.549  1.00 101.03 ? 21   DC  T C6    1 
ATOM   498   P  P     . DT  B 2  15   ? 10.817  -35.501  33.779  1.00 103.15 ? 22   DT  T P     1 
ATOM   499   O  OP1   . DT  B 2  15   ? 11.535  -36.333  32.778  1.00 101.43 ? 22   DT  T OP1   1 
ATOM   500   O  OP2   . DT  B 2  15   ? 11.476  -34.330  34.416  1.00 103.39 ? 22   DT  T OP2   1 
ATOM   501   O  "O5'" . DT  B 2  15   ? 9.436   -34.897  33.244  1.00 103.50 ? 22   DT  T "O5'" 1 
ATOM   502   C  "C5'" . DT  B 2  15   ? 8.190   -35.198  33.884  1.00 104.14 ? 22   DT  T "C5'" 1 
ATOM   503   C  "C4'" . DT  B 2  15   ? 7.222   -34.043  33.955  1.00 103.75 ? 22   DT  T "C4'" 1 
ATOM   504   O  "O4'" . DT  B 2  15   ? 7.405   -33.759  35.327  1.00 104.41 ? 22   DT  T "O4'" 1 
ATOM   505   C  "C3'" . DT  B 2  15   ? 7.521   -32.660  33.373  1.00 105.03 ? 22   DT  T "C3'" 1 
ATOM   506   O  "O3'" . DT  B 2  15   ? 7.063   -32.426  32.071  1.00 107.91 ? 22   DT  T "O3'" 1 
ATOM   507   C  "C2'" . DT  B 2  15   ? 6.688   -31.757  34.255  1.00 104.31 ? 22   DT  T "C2'" 1 
ATOM   508   C  "C1'" . DT  B 2  15   ? 6.975   -32.419  35.583  1.00 105.05 ? 22   DT  T "C1'" 1 
ATOM   509   N  N1    . DT  B 2  15   ? 8.015   -31.766  36.454  1.00 104.96 ? 22   DT  T N1    1 
ATOM   510   C  C2    . DT  B 2  15   ? 7.659   -30.720  37.291  1.00 104.52 ? 22   DT  T C2    1 
ATOM   511   O  O2    . DT  B 2  15   ? 6.531   -30.253  37.345  1.00 102.43 ? 22   DT  T O2    1 
ATOM   512   N  N3    . DT  B 2  15   ? 8.719   -30.264  38.059  1.00 105.98 ? 22   DT  T N3    1 
ATOM   513   C  C4    . DT  B 2  15   ? 10.042  -30.737  38.033  1.00 104.37 ? 22   DT  T C4    1 
ATOM   514   O  O4    . DT  B 2  15   ? 10.981  -30.339  38.722  1.00 104.46 ? 22   DT  T O4    1 
ATOM   515   C  C5    . DT  B 2  15   ? 10.296  -31.837  37.186  1.00 102.60 ? 22   DT  T C5    1 
ATOM   516   C  C7    . DT  B 2  15   ? 11.105  -32.843  37.927  1.00 103.29 ? 22   DT  T C7    1 
ATOM   517   C  C6    . DT  B 2  15   ? 9.309   -32.273  36.416  1.00 103.20 ? 22   DT  T C6    1 
ATOM   518   P  P     . DG  B 2  16   ? 7.748   -31.300  31.130  1.00 110.86 ? 23   DG  T P     1 
ATOM   519   O  OP1   . DG  B 2  16   ? 6.885   -31.353  29.912  1.00 111.27 ? 23   DG  T OP1   1 
ATOM   520   O  OP2   . DG  B 2  16   ? 9.243   -31.465  31.012  1.00 106.98 ? 23   DG  T OP2   1 
ATOM   521   O  "O5'" . DG  B 2  16   ? 7.368   -29.927  31.873  1.00 111.21 ? 23   DG  T "O5'" 1 
ATOM   522   C  "C5'" . DG  B 2  16   ? 6.134   -29.360  31.451  1.00 113.57 ? 23   DG  T "C5'" 1 
ATOM   523   C  "C4'" . DG  B 2  16   ? 5.550   -28.333  32.387  1.00 114.61 ? 23   DG  T "C4'" 1 
ATOM   524   O  "O4'" . DG  B 2  16   ? 5.824   -28.711  33.748  1.00 117.63 ? 23   DG  T "O4'" 1 
ATOM   525   C  "C3'" . DG  B 2  16   ? 6.098   -26.931  32.256  1.00 113.79 ? 23   DG  T "C3'" 1 
ATOM   526   O  "O3'" . DG  B 2  16   ? 5.414   -26.293  31.211  1.00 110.51 ? 23   DG  T "O3'" 1 
ATOM   527   C  "C2'" . DG  B 2  16   ? 5.645   -26.382  33.603  1.00 116.61 ? 23   DG  T "C2'" 1 
ATOM   528   C  "C1'" . DG  B 2  16   ? 5.977   -27.544  34.532  1.00 120.31 ? 23   DG  T "C1'" 1 
ATOM   529   N  N9    . DG  B 2  16   ? 7.346   -27.558  35.058  1.00 121.47 ? 23   DG  T N9    1 
ATOM   530   C  C8    . DG  B 2  16   ? 8.335   -28.477  34.785  1.00 122.26 ? 23   DG  T C8    1 
ATOM   531   N  N7    . DG  B 2  16   ? 9.471   -28.255  35.391  1.00 122.44 ? 23   DG  T N7    1 
ATOM   532   C  C5    . DG  B 2  16   ? 9.211   -27.109  36.115  1.00 121.72 ? 23   DG  T C5    1 
ATOM   533   C  C6    . DG  B 2  16   ? 10.072  -26.405  36.968  1.00 121.65 ? 23   DG  T C6    1 
ATOM   534   O  O6    . DG  B 2  16   ? 11.252  -26.682  37.238  1.00 121.94 ? 23   DG  T O6    1 
ATOM   535   N  N1    . DG  B 2  16   ? 9.429   -25.294  37.503  1.00 121.65 ? 23   DG  T N1    1 
ATOM   536   C  C2    . DG  B 2  16   ? 8.121   -24.935  37.233  1.00 121.76 ? 23   DG  T C2    1 
ATOM   537   N  N2    . DG  B 2  16   ? 7.649   -23.836  37.829  1.00 122.11 ? 23   DG  T N2    1 
ATOM   538   N  N3    . DG  B 2  16   ? 7.300   -25.597  36.444  1.00 121.52 ? 23   DG  T N3    1 
ATOM   539   C  C4    . DG  B 2  16   ? 7.919   -26.668  35.923  1.00 121.36 ? 23   DG  T C4    1 
ATOM   540   P  P     . DG  B 2  17   ? 6.088   -25.206  30.263  1.00 109.68 ? 24   DG  T P     1 
ATOM   541   O  OP1   . DG  B 2  17   ? 5.052   -24.875  29.271  1.00 108.33 ? 24   DG  T OP1   1 
ATOM   542   O  OP2   . DG  B 2  17   ? 7.432   -25.722  29.862  1.00 109.03 ? 24   DG  T OP2   1 
ATOM   543   O  "O5'" . DG  B 2  17   ? 6.295   -23.891  31.158  1.00 109.56 ? 24   DG  T "O5'" 1 
ATOM   544   C  "C5'" . DG  B 2  17   ? 5.247   -23.379  31.996  1.00 111.18 ? 24   DG  T "C5'" 1 
ATOM   545   C  "C4'" . DG  B 2  17   ? 5.721   -22.200  32.835  1.00 111.98 ? 24   DG  T "C4'" 1 
ATOM   546   O  "O4'" . DG  B 2  17   ? 6.513   -22.677  33.949  1.00 110.96 ? 24   DG  T "O4'" 1 
ATOM   547   C  "C3'" . DG  B 2  17   ? 6.596   -21.276  32.002  1.00 112.85 ? 24   DG  T "C3'" 1 
ATOM   548   O  "O3'" . DG  B 2  17   ? 6.133   -19.932  31.981  1.00 113.46 ? 24   DG  T "O3'" 1 
ATOM   549   C  "C2'" . DG  B 2  17   ? 7.992   -21.381  32.595  1.00 112.15 ? 24   DG  T "C2'" 1 
ATOM   550   C  "C1'" . DG  B 2  17   ? 7.765   -22.033  33.939  1.00 111.89 ? 24   DG  T "C1'" 1 
ATOM   551   N  N9    . DG  B 2  17   ? 8.856   -22.960  34.182  1.00 111.78 ? 24   DG  T N9    1 
ATOM   552   C  C8    . DG  B 2  17   ? 9.080   -24.207  33.677  1.00 112.35 ? 24   DG  T C8    1 
ATOM   553   N  N7    . DG  B 2  17   ? 10.184  -24.766  34.108  1.00 112.37 ? 24   DG  T N7    1 
ATOM   554   C  C5    . DG  B 2  17   ? 10.723  -23.813  34.938  1.00 111.53 ? 24   DG  T C5    1 
ATOM   555   C  C6    . DG  B 2  17   ? 11.901  -23.841  35.697  1.00 111.57 ? 24   DG  T C6    1 
ATOM   556   O  O6    . DG  B 2  17   ? 12.742  -24.741  35.779  1.00 111.70 ? 24   DG  T O6    1 
ATOM   557   N  N1    . DG  B 2  17   ? 12.058  -22.660  36.410  1.00 112.03 ? 24   DG  T N1    1 
ATOM   558   C  C2    . DG  B 2  17   ? 11.181  -21.598  36.379  1.00 111.94 ? 24   DG  T C2    1 
ATOM   559   N  N2    . DG  B 2  17   ? 11.473  -20.525  37.113  1.00 112.13 ? 24   DG  T N2    1 
ATOM   560   N  N3    . DG  B 2  17   ? 10.076  -21.567  35.676  1.00 111.75 ? 24   DG  T N3    1 
ATOM   561   C  C4    . DG  B 2  17   ? 9.919   -22.706  34.986  1.00 111.48 ? 24   DG  T C4    1 
ATOM   562   P  P     . DT  B 2  18   ? 6.739   -18.938  30.860  1.00 113.99 ? 25   DT  T P     1 
ATOM   563   O  OP1   . DT  B 2  18   ? 5.660   -18.676  29.886  1.00 114.41 ? 25   DT  T OP1   1 
ATOM   564   O  OP2   . DT  B 2  18   ? 8.052   -19.427  30.354  1.00 112.18 ? 25   DT  T OP2   1 
ATOM   565   O  "O5'" . DT  B 2  18   ? 6.978   -17.596  31.717  1.00 113.92 ? 25   DT  T "O5'" 1 
ATOM   566   C  "C5'" . DT  B 2  18   ? 7.135   -17.617  33.169  1.00 112.78 ? 25   DT  T "C5'" 1 
ATOM   567   C  "C4'" . DT  B 2  18   ? 8.440   -17.018  33.695  1.00 110.86 ? 25   DT  T "C4'" 1 
ATOM   568   O  "O4'" . DT  B 2  18   ? 9.326   -18.067  34.163  1.00 111.18 ? 25   DT  T "O4'" 1 
ATOM   569   C  "C3'" . DT  B 2  18   ? 9.224   -16.209  32.669  1.00 109.94 ? 25   DT  T "C3'" 1 
ATOM   570   O  "O3'" . DT  B 2  18   ? 9.531   -14.940  33.153  1.00 108.12 ? 25   DT  T "O3'" 1 
ATOM   571   C  "C2'" . DT  B 2  18   ? 10.508  -16.981  32.437  1.00 111.15 ? 25   DT  T "C2'" 1 
ATOM   572   C  "C1'" . DT  B 2  18   ? 10.638  -17.772  33.724  1.00 112.94 ? 25   DT  T "C1'" 1 
ATOM   573   N  N1    . DT  B 2  18   ? 11.496  -19.007  33.541  1.00 113.87 ? 25   DT  T N1    1 
ATOM   574   C  C2    . DT  B 2  18   ? 12.604  -19.129  34.354  1.00 113.73 ? 25   DT  T C2    1 
ATOM   575   O  O2    . DT  B 2  18   ? 12.903  -18.319  35.207  1.00 114.67 ? 25   DT  T O2    1 
ATOM   576   N  N3    . DT  B 2  18   ? 13.359  -20.244  34.149  1.00 113.58 ? 25   DT  T N3    1 
ATOM   577   C  C4    . DT  B 2  18   ? 13.119  -21.234  33.223  1.00 114.29 ? 25   DT  T C4    1 
ATOM   578   O  O4    . DT  B 2  18   ? 13.858  -22.204  33.136  1.00 114.77 ? 25   DT  T O4    1 
ATOM   579   C  C5    . DT  B 2  18   ? 11.959  -21.067  32.381  1.00 114.73 ? 25   DT  T C5    1 
ATOM   580   C  C7    . DT  B 2  18   ? 11.536  -22.202  31.488  1.00 114.81 ? 25   DT  T C7    1 
ATOM   581   C  C6    . DT  B 2  18   ? 11.209  -19.964  32.571  1.00 114.50 ? 25   DT  T C6    1 
ATOM   582   P  P     . DC  B 2  19   ? 10.132  -13.871  32.134  1.00 106.73 ? 26   DC  T P     1 
ATOM   583   O  OP1   . DC  B 2  19   ? 9.394   -12.609  32.336  1.00 105.65 ? 26   DC  T OP1   1 
ATOM   584   O  OP2   . DC  B 2  19   ? 10.203  -14.472  30.790  1.00 107.14 ? 26   DC  T OP2   1 
ATOM   585   O  "O5'" . DC  B 2  19   ? 11.643  -13.762  32.616  1.00 107.31 ? 26   DC  T "O5'" 1 
ATOM   586   C  "C5'" . DC  B 2  19   ? 11.970  -13.172  33.862  1.00 108.51 ? 26   DC  T "C5'" 1 
ATOM   587   C  "C4'" . DC  B 2  19   ? 13.426  -13.434  34.172  1.00 109.78 ? 26   DC  T "C4'" 1 
ATOM   588   O  "O4'" . DC  B 2  19   ? 13.633  -14.864  34.092  1.00 109.24 ? 26   DC  T "O4'" 1 
ATOM   589   C  "C3'" . DC  B 2  19   ? 14.387  -12.837  33.151  1.00 111.55 ? 26   DC  T "C3'" 1 
ATOM   590   O  "O3'" . DC  B 2  19   ? 15.158  -11.745  33.660  1.00 114.33 ? 26   DC  T "O3'" 1 
ATOM   591   C  "C2'" . DC  B 2  19   ? 15.292  -13.999  32.748  1.00 110.97 ? 26   DC  T "C2'" 1 
ATOM   592   C  "C1'" . DC  B 2  19   ? 14.986  -15.064  33.776  1.00 109.53 ? 26   DC  T "C1'" 1 
ATOM   593   N  N1    . DC  B 2  19   ? 15.144  -16.383  33.173  1.00 109.16 ? 26   DC  T N1    1 
ATOM   594   C  C2    . DC  B 2  19   ? 16.159  -17.253  33.610  1.00 109.36 ? 26   DC  T C2    1 
ATOM   595   O  O2    . DC  B 2  19   ? 16.928  -16.914  34.525  1.00 108.80 ? 26   DC  T O2    1 
ATOM   596   N  N3    . DC  B 2  19   ? 16.252  -18.472  33.005  1.00 109.87 ? 26   DC  T N3    1 
ATOM   597   C  C4    . DC  B 2  19   ? 15.401  -18.814  32.023  1.00 109.56 ? 26   DC  T C4    1 
ATOM   598   N  N4    . DC  B 2  19   ? 15.519  -20.011  31.445  1.00 108.80 ? 26   DC  T N4    1 
ATOM   599   C  C5    . DC  B 2  19   ? 14.379  -17.928  31.576  1.00 109.97 ? 26   DC  T C5    1 
ATOM   600   C  C6    . DC  B 2  19   ? 14.289  -16.732  32.169  1.00 109.47 ? 26   DC  T C6    1 
ATOM   601   P  P     . DT  B 2  20   ? 16.214  -11.007  32.688  1.00 117.30 ? 27   DT  T P     1 
ATOM   602   O  OP1   . DT  B 2  20   ? 16.514  -9.646   33.207  1.00 116.93 ? 27   DT  T OP1   1 
ATOM   603   O  OP2   . DT  B 2  20   ? 15.723  -11.122  31.292  1.00 117.41 ? 27   DT  T OP2   1 
ATOM   604   O  "O5'" . DT  B 2  20   ? 17.514  -11.935  32.860  1.00 118.33 ? 27   DT  T "O5'" 1 
ATOM   605   C  "C5'" . DT  B 2  20   ? 17.905  -12.491  34.127  1.00 120.69 ? 27   DT  T "C5'" 1 
ATOM   606   C  "C4'" . DT  B 2  20   ? 19.121  -13.383  33.972  1.00 122.60 ? 27   DT  T "C4'" 1 
ATOM   607   O  "O4'" . DT  B 2  20   ? 18.706  -14.675  33.485  1.00 122.75 ? 27   DT  T "O4'" 1 
ATOM   608   C  "C3'" . DT  B 2  20   ? 20.142  -12.868  32.962  1.00 124.33 ? 27   DT  T "C3'" 1 
ATOM   609   O  "O3'" . DT  B 2  20   ? 21.223  -12.245  33.657  1.00 127.21 ? 27   DT  T "O3'" 1 
ATOM   610   C  "C2'" . DT  B 2  20   ? 20.592  -14.095  32.179  1.00 123.65 ? 27   DT  T "C2'" 1 
ATOM   611   C  "C1'" . DT  B 2  20   ? 19.783  -15.237  32.770  1.00 123.07 ? 27   DT  T "C1'" 1 
ATOM   612   N  N1    . DT  B 2  20   ? 19.277  -16.084  31.673  1.00 122.86 ? 27   DT  T N1    1 
ATOM   613   C  C2    . DT  B 2  20   ? 19.707  -17.383  31.570  1.00 122.43 ? 27   DT  T C2    1 
ATOM   614   O  O2    . DT  B 2  20   ? 20.478  -17.911  32.339  1.00 122.75 ? 27   DT  T O2    1 
ATOM   615   N  N3    . DT  B 2  20   ? 19.189  -18.059  30.511  1.00 122.18 ? 27   DT  T N3    1 
ATOM   616   C  C4    . DT  B 2  20   ? 18.306  -17.576  29.574  1.00 122.72 ? 27   DT  T C4    1 
ATOM   617   O  O4    . DT  B 2  20   ? 17.917  -18.304  28.669  1.00 123.15 ? 27   DT  T O4    1 
ATOM   618   C  C5    . DT  B 2  20   ? 17.913  -16.187  29.707  1.00 122.87 ? 27   DT  T C5    1 
ATOM   619   C  C7    . DT  B 2  20   ? 17.753  -15.365  28.455  1.00 122.96 ? 27   DT  T C7    1 
ATOM   620   C  C6    . DT  B 2  20   ? 18.400  -15.537  30.762  1.00 122.96 ? 27   DT  T C6    1 
ATOM   621   P  P     . DT  B 2  21   ? 22.660  -12.015  32.990  1.00 129.03 ? 28   DT  T P     1 
ATOM   622   O  OP1   . DT  B 2  21   ? 23.492  -11.303  33.994  1.00 129.40 ? 28   DT  T OP1   1 
ATOM   623   O  OP2   . DT  B 2  21   ? 22.476  -11.402  31.639  1.00 127.94 ? 28   DT  T OP2   1 
ATOM   624   O  "O5'" . DT  B 2  21   ? 23.142  -13.555  32.891  1.00 129.21 ? 28   DT  T "O5'" 1 
ATOM   625   C  "C5'" . DT  B 2  21   ? 24.506  -13.973  32.970  1.00 129.70 ? 28   DT  T "C5'" 1 
ATOM   626   C  "C4'" . DT  B 2  21   ? 25.079  -14.399  31.614  1.00 130.15 ? 28   DT  T "C4'" 1 
ATOM   627   O  "O4'" . DT  B 2  21   ? 24.277  -15.445  30.984  1.00 130.05 ? 28   DT  T "O4'" 1 
ATOM   628   C  "C3'" . DT  B 2  21   ? 25.214  -13.336  30.512  1.00 129.78 ? 28   DT  T "C3'" 1 
ATOM   629   O  "O3'" . DT  B 2  21   ? 26.316  -12.444  30.745  1.00 128.40 ? 28   DT  T "O3'" 1 
ATOM   630   C  "C2'" . DT  B 2  21   ? 25.413  -14.214  29.267  1.00 129.58 ? 28   DT  T "C2'" 1 
ATOM   631   C  "C1'" . DT  B 2  21   ? 24.694  -15.540  29.620  1.00 128.96 ? 28   DT  T "C1'" 1 
ATOM   632   N  N1    . DT  B 2  21   ? 23.501  -15.879  28.743  1.00 127.97 ? 28   DT  T N1    1 
ATOM   633   C  C2    . DT  B 2  21   ? 22.514  -16.710  29.214  1.00 126.69 ? 28   DT  T C2    1 
ATOM   634   O  O2    . DT  B 2  21   ? 22.541  -17.214  30.313  1.00 126.61 ? 28   DT  T O2    1 
ATOM   635   N  N3    . DT  B 2  21   ? 21.486  -16.926  28.337  1.00 126.63 ? 28   DT  T N3    1 
ATOM   636   C  C4    . DT  B 2  21   ? 21.347  -16.412  27.059  1.00 127.31 ? 28   DT  T C4    1 
ATOM   637   O  O4    . DT  B 2  21   ? 20.381  -16.673  26.355  1.00 127.36 ? 28   DT  T O4    1 
ATOM   638   C  C5    . DT  B 2  21   ? 22.415  -15.547  26.617  1.00 127.45 ? 28   DT  T C5    1 
ATOM   639   C  C7    . DT  B 2  21   ? 22.381  -14.876  25.272  1.00 127.22 ? 28   DT  T C7    1 
ATOM   640   C  C6    . DT  B 2  21   ? 23.422  -15.329  27.471  1.00 128.21 ? 28   DT  T C6    1 
ATOM   641   O  "O5'" . DG  C 3  1    ? 20.809  -31.753  63.154  1.00 247.36 ? 1    DG  N "O5'" 1 
ATOM   642   C  "C5'" . DG  C 3  1    ? 22.078  -31.702  62.498  1.00 247.70 ? 1    DG  N "C5'" 1 
ATOM   643   C  "C4'" . DG  C 3  1    ? 23.179  -31.280  63.461  1.00 247.87 ? 1    DG  N "C4'" 1 
ATOM   644   O  "O4'" . DG  C 3  1    ? 22.583  -30.584  64.595  1.00 248.05 ? 1    DG  N "O4'" 1 
ATOM   645   C  "C3'" . DG  C 3  1    ? 23.998  -32.437  64.042  1.00 247.79 ? 1    DG  N "C3'" 1 
ATOM   646   O  "O3'" . DG  C 3  1    ? 25.440  -32.208  64.008  1.00 247.33 ? 1    DG  N "O3'" 1 
ATOM   647   C  "C2'" . DG  C 3  1    ? 23.439  -32.547  65.464  1.00 247.98 ? 1    DG  N "C2'" 1 
ATOM   648   C  "C1'" . DG  C 3  1    ? 23.167  -31.083  65.782  1.00 247.88 ? 1    DG  N "C1'" 1 
ATOM   649   N  N9    . DG  C 3  1    ? 22.291  -30.882  66.940  1.00 247.80 ? 1    DG  N N9    1 
ATOM   650   C  C8    . DG  C 3  1    ? 20.917  -30.817  66.951  1.00 247.72 ? 1    DG  N C8    1 
ATOM   651   N  N7    . DG  C 3  1    ? 20.419  -30.632  68.144  1.00 247.81 ? 1    DG  N N7    1 
ATOM   652   C  C5    . DG  C 3  1    ? 21.526  -30.573  68.986  1.00 247.81 ? 1    DG  N C5    1 
ATOM   653   C  C6    . DG  C 3  1    ? 21.619  -30.389  70.398  1.00 247.79 ? 1    DG  N C6    1 
ATOM   654   O  O6    . DG  C 3  1    ? 20.702  -30.236  71.220  1.00 247.74 ? 1    DG  N O6    1 
ATOM   655   N  N1    . DG  C 3  1    ? 22.944  -30.391  70.848  1.00 247.75 ? 1    DG  N N1    1 
ATOM   656   C  C2    . DG  C 3  1    ? 24.046  -30.552  70.035  1.00 247.76 ? 1    DG  N C2    1 
ATOM   657   N  N2    . DG  C 3  1    ? 25.250  -30.528  70.628  1.00 247.73 ? 1    DG  N N2    1 
ATOM   658   N  N3    . DG  C 3  1    ? 23.966  -30.727  68.719  1.00 247.77 ? 1    DG  N N3    1 
ATOM   659   C  C4    . DG  C 3  1    ? 22.687  -30.726  68.256  1.00 247.82 ? 1    DG  N C4    1 
ATOM   660   P  P     . DT  C 3  2    ? 26.427  -33.317  64.637  1.00 247.10 ? 2    DT  N P     1 
ATOM   661   O  OP1   . DT  C 3  2    ? 26.040  -34.604  64.008  1.00 247.09 ? 2    DT  N OP1   1 
ATOM   662   O  OP2   . DT  C 3  2    ? 26.372  -33.154  66.109  1.00 246.95 ? 2    DT  N OP2   1 
ATOM   663   O  "O5'" . DT  C 3  2    ? 27.934  -32.985  64.175  1.00 246.52 ? 2    DT  N "O5'" 1 
ATOM   664   C  "C5'" . DT  C 3  2    ? 28.944  -34.034  64.180  1.00 245.08 ? 2    DT  N "C5'" 1 
ATOM   665   C  "C4'" . DT  C 3  2    ? 30.168  -33.796  65.072  1.00 243.98 ? 2    DT  N "C4'" 1 
ATOM   666   O  "O4'" . DT  C 3  2    ? 30.107  -32.469  65.665  1.00 244.01 ? 2    DT  N "O4'" 1 
ATOM   667   C  "C3'" . DT  C 3  2    ? 30.403  -34.798  66.219  1.00 243.18 ? 2    DT  N "C3'" 1 
ATOM   668   O  "O3'" . DT  C 3  2    ? 31.777  -35.307  66.205  1.00 242.06 ? 2    DT  N "O3'" 1 
ATOM   669   C  "C2'" . DT  C 3  2    ? 30.073  -33.979  67.473  1.00 243.48 ? 2    DT  N "C2'" 1 
ATOM   670   C  "C1'" . DT  C 3  2    ? 30.404  -32.545  67.048  1.00 243.95 ? 2    DT  N "C1'" 1 
ATOM   671   N  N1    . DT  C 3  2    ? 29.677  -31.436  67.803  1.00 244.08 ? 2    DT  N N1    1 
ATOM   672   C  C2    . DT  C 3  2    ? 30.356  -30.656  68.733  1.00 244.01 ? 2    DT  N C2    1 
ATOM   673   O  O2    . DT  C 3  2    ? 31.537  -30.792  69.009  1.00 243.89 ? 2    DT  N O2    1 
ATOM   674   N  N3    . DT  C 3  2    ? 29.589  -29.689  69.346  1.00 243.97 ? 2    DT  N N3    1 
ATOM   675   C  C4    . DT  C 3  2    ? 28.244  -29.422  69.136  1.00 243.98 ? 2    DT  N C4    1 
ATOM   676   O  O4    . DT  C 3  2    ? 27.659  -28.526  69.743  1.00 243.90 ? 2    DT  N O4    1 
ATOM   677   C  C5    . DT  C 3  2    ? 27.592  -30.255  68.145  1.00 244.01 ? 2    DT  N C5    1 
ATOM   678   C  C7    . DT  C 3  2    ? 26.425  -29.694  67.388  1.00 243.99 ? 2    DT  N C7    1 
ATOM   679   C  C6    . DT  C 3  2    ? 28.331  -31.210  67.557  1.00 244.11 ? 2    DT  N C6    1 
ATOM   680   P  P     . DA  C 3  3    ? 32.301  -36.686  66.883  1.00 241.02 ? 3    DA  N P     1 
ATOM   681   O  OP1   . DA  C 3  3    ? 31.937  -37.821  66.008  1.00 241.01 ? 3    DA  N OP1   1 
ATOM   682   O  OP2   . DA  C 3  3    ? 31.837  -36.695  68.289  1.00 241.11 ? 3    DA  N OP2   1 
ATOM   683   O  "O5'" . DA  C 3  3    ? 33.909  -36.528  66.888  1.00 239.65 ? 3    DA  N "O5'" 1 
ATOM   684   C  "C5'" . DA  C 3  3    ? 34.820  -37.407  66.185  1.00 237.37 ? 3    DA  N "C5'" 1 
ATOM   685   C  "C4'" . DA  C 3  3    ? 35.609  -36.709  65.071  1.00 235.94 ? 3    DA  N "C4'" 1 
ATOM   686   O  "O4'" . DA  C 3  3    ? 34.961  -35.468  64.666  1.00 236.03 ? 3    DA  N "O4'" 1 
ATOM   687   C  "C3'" . DA  C 3  3    ? 37.064  -36.342  65.376  1.00 234.64 ? 3    DA  N "C3'" 1 
ATOM   688   O  "O3'" . DA  C 3  3    ? 37.909  -36.552  64.230  1.00 232.16 ? 3    DA  N "O3'" 1 
ATOM   689   C  "C2'" . DA  C 3  3    ? 36.971  -34.863  65.723  1.00 235.40 ? 3    DA  N "C2'" 1 
ATOM   690   C  "C1'" . DA  C 3  3    ? 35.822  -34.364  64.858  1.00 236.46 ? 3    DA  N "C1'" 1 
ATOM   691   N  N9    . DA  C 3  3    ? 35.125  -33.305  65.576  1.00 236.75 ? 3    DA  N N9    1 
ATOM   692   C  C8    . DA  C 3  3    ? 34.318  -33.456  66.669  1.00 237.03 ? 3    DA  N C8    1 
ATOM   693   N  N7    . DA  C 3  3    ? 33.831  -32.339  67.147  1.00 237.08 ? 3    DA  N N7    1 
ATOM   694   C  C5    . DA  C 3  3    ? 34.365  -31.380  66.314  1.00 237.04 ? 3    DA  N C5    1 
ATOM   695   C  C6    . DA  C 3  3    ? 34.228  -29.980  66.297  1.00 236.97 ? 3    DA  N C6    1 
ATOM   696   N  N6    . DA  C 3  3    ? 33.475  -29.316  67.181  1.00 236.82 ? 3    DA  N N6    1 
ATOM   697   N  N1    . DA  C 3  3    ? 34.900  -29.302  65.336  1.00 237.07 ? 3    DA  N N1    1 
ATOM   698   C  C2    . DA  C 3  3    ? 35.647  -29.986  64.451  1.00 237.15 ? 3    DA  N C2    1 
ATOM   699   N  N3    . DA  C 3  3    ? 35.847  -31.305  64.371  1.00 237.19 ? 3    DA  N N3    1 
ATOM   700   C  C4    . DA  C 3  3    ? 35.172  -31.951  65.341  1.00 237.01 ? 3    DA  N C4    1 
ATOM   701   P  P     . DC  C 3  4    ? 39.382  -35.916  64.077  1.00 230.08 ? 4    DC  N P     1 
ATOM   702   O  OP1   . DC  C 3  4    ? 40.171  -36.840  63.238  1.00 229.89 ? 4    DC  N OP1   1 
ATOM   703   O  OP2   . DC  C 3  4    ? 39.901  -35.540  65.412  1.00 229.90 ? 4    DC  N OP2   1 
ATOM   704   O  "O5'" . DC  C 3  4    ? 39.124  -34.574  63.242  1.00 228.74 ? 4    DC  N "O5'" 1 
ATOM   705   C  "C5'" . DC  C 3  4    ? 40.224  -33.730  62.896  1.00 226.86 ? 4    DC  N "C5'" 1 
ATOM   706   C  "C4'" . DC  C 3  4    ? 40.211  -32.407  63.653  1.00 225.57 ? 4    DC  N "C4'" 1 
ATOM   707   O  "O4'" . DC  C 3  4    ? 39.162  -32.390  64.651  1.00 224.86 ? 4    DC  N "O4'" 1 
ATOM   708   C  "C3'" . DC  C 3  4    ? 41.459  -32.073  64.464  1.00 225.15 ? 4    DC  N "C3'" 1 
ATOM   709   O  "O3'" . DC  C 3  4    ? 42.502  -31.568  63.619  1.00 225.29 ? 4    DC  N "O3'" 1 
ATOM   710   C  "C2'" . DC  C 3  4    ? 40.930  -30.997  65.414  1.00 224.50 ? 4    DC  N "C2'" 1 
ATOM   711   C  "C1'" . DC  C 3  4    ? 39.461  -31.379  65.598  1.00 223.75 ? 4    DC  N "C1'" 1 
ATOM   712   N  N1    . DC  C 3  4    ? 39.103  -31.851  66.984  1.00 223.17 ? 4    DC  N N1    1 
ATOM   713   C  C2    . DC  C 3  4    ? 38.301  -31.034  67.799  1.00 222.73 ? 4    DC  N C2    1 
ATOM   714   O  O2    . DC  C 3  4    ? 37.906  -29.942  67.373  1.00 222.46 ? 4    DC  N O2    1 
ATOM   715   N  N3    . DC  C 3  4    ? 37.978  -31.468  69.045  1.00 222.65 ? 4    DC  N N3    1 
ATOM   716   C  C4    . DC  C 3  4    ? 38.418  -32.651  69.483  1.00 222.91 ? 4    DC  N C4    1 
ATOM   717   N  N4    . DC  C 3  4    ? 38.069  -33.021  70.719  1.00 222.93 ? 4    DC  N N4    1 
ATOM   718   C  C5    . DC  C 3  4    ? 39.234  -33.502  68.674  1.00 222.64 ? 4    DC  N C5    1 
ATOM   719   C  C6    . DC  C 3  4    ? 39.547  -33.065  67.447  1.00 222.85 ? 4    DC  N C6    1 
ATOM   720   P  P     . DT  C 3  5    ? 44.003  -31.286  64.129  1.00 225.29 ? 5    DT  N P     1 
ATOM   721   O  OP1   . DT  C 3  5    ? 44.925  -31.868  63.128  1.00 225.11 ? 5    DT  N OP1   1 
ATOM   722   O  OP2   . DT  C 3  5    ? 44.114  -31.690  65.548  1.00 225.30 ? 5    DT  N OP2   1 
ATOM   723   O  "O5'" . DT  C 3  5    ? 44.124  -29.689  64.048  1.00 225.69 ? 5    DT  N "O5'" 1 
ATOM   724   C  "C5'" . DT  C 3  5    ? 45.097  -28.967  64.801  1.00 226.27 ? 5    DT  N "C5'" 1 
ATOM   725   C  "C4'" . DT  C 3  5    ? 44.407  -27.923  65.663  1.00 227.01 ? 5    DT  N "C4'" 1 
ATOM   726   O  "O4'" . DT  C 3  5    ? 43.275  -28.538  66.344  1.00 227.19 ? 5    DT  N "O4'" 1 
ATOM   727   C  "C3'" . DT  C 3  5    ? 45.285  -27.270  66.734  1.00 227.49 ? 5    DT  N "C3'" 1 
ATOM   728   O  "O3'" . DT  C 3  5    ? 45.191  -25.828  66.648  1.00 228.13 ? 5    DT  N "O3'" 1 
ATOM   729   C  "C2'" . DT  C 3  5    ? 44.729  -27.846  68.034  1.00 227.58 ? 5    DT  N "C2'" 1 
ATOM   730   C  "C1'" . DT  C 3  5    ? 43.269  -28.129  67.698  1.00 227.52 ? 5    DT  N "C1'" 1 
ATOM   731   N  N1    . DT  C 3  5    ? 42.656  -29.175  68.602  1.00 227.57 ? 5    DT  N N1    1 
ATOM   732   C  C2    . DT  C 3  5    ? 41.819  -28.775  69.632  1.00 227.56 ? 5    DT  N C2    1 
ATOM   733   O  O2    . DT  C 3  5    ? 41.522  -27.612  69.859  1.00 227.51 ? 5    DT  N O2    1 
ATOM   734   N  N3    . DT  C 3  5    ? 41.327  -29.808  70.399  1.00 227.59 ? 5    DT  N N3    1 
ATOM   735   C  C4    . DT  C 3  5    ? 41.575  -31.167  70.256  1.00 227.54 ? 5    DT  N C4    1 
ATOM   736   O  O4    . DT  C 3  5    ? 41.078  -32.008  71.002  1.00 227.51 ? 5    DT  N O4    1 
ATOM   737   C  C5    . DT  C 3  5    ? 42.460  -31.518  69.169  1.00 227.54 ? 5    DT  N C5    1 
ATOM   738   C  C7    . DT  C 3  5    ? 42.879  -32.946  68.958  1.00 227.33 ? 5    DT  N C7    1 
ATOM   739   C  C6    . DT  C 3  5    ? 42.949  -30.519  68.412  1.00 227.65 ? 5    DT  N C6    1 
ATOM   740   P  P     . DT  C 3  6    ? 45.404  -24.789  67.864  1.00 228.53 ? 6    DT  N P     1 
ATOM   741   O  OP1   . DT  C 3  6    ? 45.792  -23.500  67.252  1.00 228.44 ? 6    DT  N OP1   1 
ATOM   742   O  OP2   . DT  C 3  6    ? 46.310  -25.391  68.870  1.00 228.39 ? 6    DT  N OP2   1 
ATOM   743   O  "O5'" . DT  C 3  6    ? 43.932  -24.649  68.504  1.00 229.16 ? 6    DT  N "O5'" 1 
ATOM   744   C  "C5'" . DT  C 3  6    ? 43.399  -23.397  68.976  1.00 229.94 ? 6    DT  N "C5'" 1 
ATOM   745   C  "C4'" . DT  C 3  6    ? 43.436  -23.277  70.497  1.00 230.71 ? 6    DT  N "C4'" 1 
ATOM   746   O  "O4'" . DT  C 3  6    ? 43.029  -24.535  71.112  1.00 231.14 ? 6    DT  N "O4'" 1 
ATOM   747   C  "C3'" . DT  C 3  6    ? 44.806  -22.914  71.091  1.00 230.96 ? 6    DT  N "C3'" 1 
ATOM   748   O  "O3'" . DT  C 3  6    ? 44.768  -21.741  71.930  1.00 230.65 ? 6    DT  N "O3'" 1 
ATOM   749   C  "C2'" . DT  C 3  6    ? 45.191  -24.139  71.917  1.00 231.39 ? 6    DT  N "C2'" 1 
ATOM   750   C  "C1'" . DT  C 3  6    ? 43.835  -24.755  72.258  1.00 231.58 ? 6    DT  N "C1'" 1 
ATOM   751   N  N1    . DT  C 3  6    ? 43.941  -26.221  72.631  1.00 231.73 ? 6    DT  N N1    1 
ATOM   752   C  C2    . DT  C 3  6    ? 43.615  -26.642  73.916  1.00 231.74 ? 6    DT  N C2    1 
ATOM   753   O  O2    . DT  C 3  6    ? 43.209  -25.916  74.810  1.00 231.69 ? 6    DT  N O2    1 
ATOM   754   N  N3    . DT  C 3  6    ? 43.765  -27.989  74.128  1.00 231.78 ? 6    DT  N N3    1 
ATOM   755   C  C4    . DT  C 3  6    ? 44.207  -28.935  73.220  1.00 231.76 ? 6    DT  N C4    1 
ATOM   756   O  O4    . DT  C 3  6    ? 44.308  -30.117  73.528  1.00 231.85 ? 6    DT  N O4    1 
ATOM   757   C  C5    . DT  C 3  6    ? 44.556  -28.441  71.906  1.00 231.68 ? 6    DT  N C5    1 
ATOM   758   C  C7    . DT  C 3  6    ? 45.508  -29.238  71.059  1.00 231.50 ? 6    DT  N C7    1 
ATOM   759   C  C6    . DT  C 3  6    ? 44.398  -27.127  71.682  1.00 231.71 ? 6    DT  N C6    1 
ATOM   760   P  P     . DG  C 3  7    ? 45.976  -20.677  71.984  1.00 230.32 ? 7    DG  N P     1 
ATOM   761   O  OP1   . DG  C 3  7    ? 45.367  -19.380  72.351  1.00 230.44 ? 7    DG  N OP1   1 
ATOM   762   O  OP2   . DG  C 3  7    ? 46.759  -20.790  70.732  1.00 230.19 ? 7    DG  N OP2   1 
ATOM   763   O  "O5'" . DG  C 3  7    ? 46.934  -21.135  73.187  1.00 230.12 ? 7    DG  N "O5'" 1 
ATOM   764   C  "C5'" . DG  C 3  7    ? 47.149  -20.286  74.321  1.00 229.91 ? 7    DG  N "C5'" 1 
ATOM   765   C  "C4'" . DG  C 3  7    ? 46.177  -20.672  75.422  1.00 230.07 ? 7    DG  N "C4'" 1 
ATOM   766   O  "O4'" . DG  C 3  7    ? 45.766  -22.053  75.219  1.00 229.99 ? 7    DG  N "O4'" 1 
ATOM   767   C  "C3'" . DG  C 3  7    ? 46.706  -20.613  76.851  1.00 230.42 ? 7    DG  N "C3'" 1 
ATOM   768   O  "O3'" . DG  C 3  7    ? 45.618  -20.283  77.749  1.00 231.23 ? 7    DG  N "O3'" 1 
ATOM   769   C  "C2'" . DG  C 3  7    ? 47.239  -22.036  77.012  1.00 230.19 ? 7    DG  N "C2'" 1 
ATOM   770   C  "C1'" . DG  C 3  7    ? 46.128  -22.836  76.341  1.00 229.82 ? 7    DG  N "C1'" 1 
ATOM   771   N  N9    . DG  C 3  7    ? 46.497  -24.196  75.930  1.00 229.70 ? 7    DG  N N9    1 
ATOM   772   C  C8    . DG  C 3  7    ? 47.377  -24.549  74.933  1.00 229.67 ? 7    DG  N C8    1 
ATOM   773   N  N7    . DG  C 3  7    ? 47.512  -25.839  74.785  1.00 229.66 ? 7    DG  N N7    1 
ATOM   774   C  C5    . DG  C 3  7    ? 46.669  -26.387  75.744  1.00 229.66 ? 7    DG  N C5    1 
ATOM   775   C  C6    . DG  C 3  7    ? 46.397  -27.747  76.056  1.00 229.69 ? 7    DG  N C6    1 
ATOM   776   O  O6    . DG  C 3  7    ? 46.866  -28.768  75.531  1.00 229.64 ? 7    DG  N O6    1 
ATOM   777   N  N1    . DG  C 3  7    ? 45.478  -27.874  77.100  1.00 229.68 ? 7    DG  N N1    1 
ATOM   778   C  C2    . DG  C 3  7    ? 44.893  -26.815  77.757  1.00 229.65 ? 7    DG  N C2    1 
ATOM   779   N  N2    . DG  C 3  7    ? 44.031  -27.127  78.735  1.00 229.65 ? 7    DG  N N2    1 
ATOM   780   N  N3    . DG  C 3  7    ? 45.138  -25.538  77.473  1.00 229.61 ? 7    DG  N N3    1 
ATOM   781   C  C4    . DG  C 3  7    ? 46.034  -25.390  76.458  1.00 229.64 ? 7    DG  N C4    1 
ATOM   782   N  N     . GLY D 4  3    ? 29.675  -45.659  19.026  1.00 131.01 ? 3    GLY A N     1 
ATOM   783   C  CA    . GLY D 4  3    ? 30.131  -46.706  18.059  1.00 130.96 ? 3    GLY A CA    1 
ATOM   784   C  C     . GLY D 4  3    ? 31.330  -46.249  17.254  1.00 130.87 ? 3    GLY A C     1 
ATOM   785   O  O     . GLY D 4  3    ? 31.178  -45.546  16.248  1.00 130.89 ? 3    GLY A O     1 
ATOM   786   N  N     . GLN D 4  4    ? 32.518  -46.667  17.699  1.00 130.64 ? 4    GLN A N     1 
ATOM   787   C  CA    . GLN D 4  4    ? 33.792  -46.168  17.168  1.00 130.27 ? 4    GLN A CA    1 
ATOM   788   C  C     . GLN D 4  4    ? 34.596  -47.196  16.380  1.00 129.98 ? 4    GLN A C     1 
ATOM   789   O  O     . GLN D 4  4    ? 34.460  -48.393  16.601  1.00 129.88 ? 4    GLN A O     1 
ATOM   790   C  CB    . GLN D 4  4    ? 34.646  -45.552  18.288  1.00 130.20 ? 4    GLN A CB    1 
ATOM   791   C  CG    . GLN D 4  4    ? 34.377  -46.079  19.703  1.00 130.36 ? 4    GLN A CG    1 
ATOM   792   C  CD    . GLN D 4  4    ? 34.845  -45.114  20.799  1.00 130.45 ? 4    GLN A CD    1 
ATOM   793   O  OE1   . GLN D 4  4    ? 35.836  -44.398  20.635  1.00 130.47 ? 4    GLN A OE1   1 
ATOM   794   N  NE2   . GLN D 4  4    ? 34.130  -45.098  21.924  1.00 130.57 ? 4    GLN A NE2   1 
ATOM   795   N  N     . GLN D 4  5    ? 35.429  -46.704  15.462  1.00 129.88 ? 5    GLN A N     1 
ATOM   796   C  CA    . GLN D 4  5    ? 36.252  -47.545  14.590  1.00 129.85 ? 5    GLN A CA    1 
ATOM   797   C  C     . GLN D 4  5    ? 37.167  -48.519  15.333  1.00 129.51 ? 5    GLN A C     1 
ATOM   798   O  O     . GLN D 4  5    ? 37.683  -48.210  16.402  1.00 129.49 ? 5    GLN A O     1 
ATOM   799   C  CB    . GLN D 4  5    ? 37.068  -46.692  13.619  1.00 129.87 ? 5    GLN A CB    1 
ATOM   800   C  CG    . GLN D 4  5    ? 36.588  -46.797  12.170  1.00 131.36 ? 5    GLN A CG    1 
ATOM   801   C  CD    . GLN D 4  5    ? 37.712  -46.588  11.135  1.00 133.46 ? 5    GLN A CD    1 
ATOM   802   O  OE1   . GLN D 4  5    ? 38.866  -46.313  11.493  1.00 134.64 ? 5    GLN A OE1   1 
ATOM   803   N  NE2   . GLN D 4  5    ? 37.370  -46.717  9.844   1.00 133.02 ? 5    GLN A NE2   1 
ATOM   804   N  N     . TYR D 4  6    ? 37.354  -49.694  14.736  1.00 129.28 ? 6    TYR A N     1 
ATOM   805   C  CA    . TYR D 4  6    ? 38.122  -50.795  15.321  1.00 128.97 ? 6    TYR A CA    1 
ATOM   806   C  C     . TYR D 4  6    ? 39.600  -50.473  15.553  1.00 128.50 ? 6    TYR A C     1 
ATOM   807   O  O     . TYR D 4  6    ? 40.273  -49.928  14.678  1.00 128.42 ? 6    TYR A O     1 
ATOM   808   C  CB    . TYR D 4  6    ? 37.986  -52.055  14.439  1.00 129.31 ? 6    TYR A CB    1 
ATOM   809   C  CG    . TYR D 4  6    ? 39.158  -53.028  14.519  1.00 129.44 ? 6    TYR A CG    1 
ATOM   810   C  CD1   . TYR D 4  6    ? 40.110  -53.083  13.498  1.00 129.09 ? 6    TYR A CD1   1 
ATOM   811   C  CD2   . TYR D 4  6    ? 39.307  -53.889  15.615  1.00 129.32 ? 6    TYR A CD2   1 
ATOM   812   C  CE1   . TYR D 4  6    ? 41.174  -53.961  13.569  1.00 129.31 ? 6    TYR A CE1   1 
ATOM   813   C  CE2   . TYR D 4  6    ? 40.368  -54.769  15.695  1.00 129.10 ? 6    TYR A CE2   1 
ATOM   814   C  CZ    . TYR D 4  6    ? 41.298  -54.796  14.671  1.00 129.41 ? 6    TYR A CZ    1 
ATOM   815   O  OH    . TYR D 4  6    ? 42.353  -55.668  14.747  1.00 129.73 ? 6    TYR A OH    1 
ATOM   816   N  N     . SER D 4  7    ? 40.091  -50.840  16.734  1.00 127.93 ? 7    SER A N     1 
ATOM   817   C  CA    . SER D 4  7    ? 41.503  -50.719  17.060  1.00 127.38 ? 7    SER A CA    1 
ATOM   818   C  C     . SER D 4  7    ? 42.150  -52.080  17.216  1.00 127.03 ? 7    SER A C     1 
ATOM   819   O  O     . SER D 4  7    ? 41.595  -52.974  17.860  1.00 127.06 ? 7    SER A O     1 
ATOM   820   C  CB    . SER D 4  7    ? 41.696  -49.929  18.351  1.00 127.41 ? 7    SER A CB    1 
ATOM   821   O  OG    . SER D 4  7    ? 43.074  -49.848  18.680  1.00 127.38 ? 7    SER A OG    1 
ATOM   822   N  N     . SER D 4  8    ? 43.338  -52.226  16.638  1.00 126.57 ? 8    SER A N     1 
ATOM   823   C  CA    . SER D 4  8    ? 44.132  -53.430  16.842  1.00 126.19 ? 8    SER A CA    1 
ATOM   824   C  C     . SER D 4  8    ? 45.012  -53.304  18.093  1.00 125.80 ? 8    SER A C     1 
ATOM   825   O  O     . SER D 4  8    ? 45.996  -54.035  18.251  1.00 125.91 ? 8    SER A O     1 
ATOM   826   C  CB    . SER D 4  8    ? 44.964  -53.776  15.599  1.00 126.17 ? 8    SER A CB    1 
ATOM   827   O  OG    . SER D 4  8    ? 46.095  -52.932  15.477  1.00 126.36 ? 8    SER A OG    1 
ATOM   828   N  N     . ALA D 4  9    ? 44.666  -52.365  18.972  1.00 125.12 ? 9    ALA A N     1 
ATOM   829   C  CA    . ALA D 4  9    ? 45.240  -52.345  20.307  1.00 124.58 ? 9    ALA A CA    1 
ATOM   830   C  C     . ALA D 4  9    ? 44.594  -53.497  21.052  1.00 124.23 ? 9    ALA A C     1 
ATOM   831   O  O     . ALA D 4  9    ? 43.406  -53.749  20.865  1.00 124.55 ? 9    ALA A O     1 
ATOM   832   C  CB    . ALA D 4  9    ? 44.947  -51.037  21.005  1.00 124.60 ? 9    ALA A CB    1 
ATOM   833   N  N     . PRO D 4  10   ? 45.377  -54.244  21.847  1.00 123.79 ? 10   PRO A N     1 
ATOM   834   C  CA    . PRO D 4  10   ? 44.791  -55.211  22.776  1.00 123.36 ? 10   PRO A CA    1 
ATOM   835   C  C     . PRO D 4  10   ? 43.893  -54.543  23.822  1.00 122.84 ? 10   PRO A C     1 
ATOM   836   O  O     . PRO D 4  10   ? 44.165  -53.409  24.245  1.00 122.79 ? 10   PRO A O     1 
ATOM   837   C  CB    . PRO D 4  10   ? 46.018  -55.834  23.441  1.00 123.44 ? 10   PRO A CB    1 
ATOM   838   C  CG    . PRO D 4  10   ? 47.119  -55.648  22.442  1.00 123.66 ? 10   PRO A CG    1 
ATOM   839   C  CD    . PRO D 4  10   ? 46.848  -54.292  21.873  1.00 123.87 ? 10   PRO A CD    1 
ATOM   840   N  N     . LEU D 4  11   ? 42.825  -55.242  24.213  1.00 122.10 ? 11   LEU A N     1 
ATOM   841   C  CA    . LEU D 4  11   ? 41.883  -54.727  25.206  1.00 121.32 ? 11   LEU A CA    1 
ATOM   842   C  C     . LEU D 4  11   ? 41.848  -55.562  26.479  1.00 121.04 ? 11   LEU A C     1 
ATOM   843   O  O     . LEU D 4  11   ? 41.634  -56.770  26.434  1.00 121.00 ? 11   LEU A O     1 
ATOM   844   C  CB    . LEU D 4  11   ? 40.480  -54.585  24.599  1.00 121.27 ? 11   LEU A CB    1 
ATOM   845   C  CG    . LEU D 4  11   ? 39.202  -54.943  25.376  1.00 120.71 ? 11   LEU A CG    1 
ATOM   846   C  CD1   . LEU D 4  11   ? 38.976  -54.143  26.648  1.00 120.37 ? 11   LEU A CD1   1 
ATOM   847   C  CD2   . LEU D 4  11   ? 38.021  -54.787  24.456  1.00 120.88 ? 11   LEU A CD2   1 
ATOM   848   N  N     . ARG D 4  12   ? 42.075  -54.901  27.608  1.00 120.66 ? 12   ARG A N     1 
ATOM   849   C  CA    . ARG D 4  12   ? 41.905  -55.500  28.923  1.00 120.44 ? 12   ARG A CA    1 
ATOM   850   C  C     . ARG D 4  12   ? 41.060  -54.573  29.769  1.00 120.34 ? 12   ARG A C     1 
ATOM   851   O  O     . ARG D 4  12   ? 40.711  -53.474  29.344  1.00 120.23 ? 12   ARG A O     1 
ATOM   852   C  CB    . ARG D 4  12   ? 43.248  -55.723  29.615  1.00 120.37 ? 12   ARG A CB    1 
ATOM   853   C  CG    . ARG D 4  12   ? 43.998  -56.946  29.164  1.00 120.59 ? 12   ARG A CG    1 
ATOM   854   C  CD    . ARG D 4  12   ? 45.127  -56.580  28.213  1.00 121.70 ? 12   ARG A CD    1 
ATOM   855   N  NE    . ARG D 4  12   ? 46.048  -57.700  28.014  1.00 122.49 ? 12   ARG A NE    1 
ATOM   856   C  CZ    . ARG D 4  12   ? 47.044  -58.027  28.840  1.00 123.16 ? 12   ARG A CZ    1 
ATOM   857   N  NH1   . ARG D 4  12   ? 47.279  -57.326  29.952  1.00 123.17 ? 12   ARG A NH1   1 
ATOM   858   N  NH2   . ARG D 4  12   ? 47.812  -59.069  28.556  1.00 123.24 ? 12   ARG A NH2   1 
ATOM   859   N  N     . THR D 4  13   ? 40.745  -55.019  30.977  1.00 120.24 ? 13   THR A N     1 
ATOM   860   C  CA    . THR D 4  13   ? 39.938  -54.236  31.903  1.00 120.40 ? 13   THR A CA    1 
ATOM   861   C  C     . THR D 4  13   ? 40.849  -53.501  32.887  1.00 120.19 ? 13   THR A C     1 
ATOM   862   O  O     . THR D 4  13   ? 42.063  -53.526  32.721  1.00 120.51 ? 13   THR A O     1 
ATOM   863   C  CB    . THR D 4  13   ? 38.954  -55.151  32.632  1.00 120.56 ? 13   THR A CB    1 
ATOM   864   O  OG1   . THR D 4  13   ? 39.659  -56.306  33.105  1.00 120.72 ? 13   THR A OG1   1 
ATOM   865   C  CG2   . THR D 4  13   ? 37.839  -55.613  31.666  1.00 121.15 ? 13   THR A CG2   1 
ATOM   866   N  N     . VAL D 4  14   ? 40.280  -52.829  33.885  1.00 119.82 ? 14   VAL A N     1 
ATOM   867   C  CA    . VAL D 4  14   ? 41.077  -52.170  34.923  1.00 119.71 ? 14   VAL A CA    1 
ATOM   868   C  C     . VAL D 4  14   ? 41.301  -53.127  36.087  1.00 120.15 ? 14   VAL A C     1 
ATOM   869   O  O     . VAL D 4  14   ? 40.475  -54.003  36.319  1.00 120.22 ? 14   VAL A O     1 
ATOM   870   C  CB    . VAL D 4  14   ? 40.416  -50.861  35.390  1.00 119.41 ? 14   VAL A CB    1 
ATOM   871   C  CG1   . VAL D 4  14   ? 40.627  -50.611  36.871  1.00 118.95 ? 14   VAL A CG1   1 
ATOM   872   C  CG2   . VAL D 4  14   ? 40.961  -49.723  34.594  1.00 119.36 ? 14   VAL A CG2   1 
ATOM   873   N  N     . LYS D 4  15   ? 42.415  -52.976  36.805  1.00 120.56 ? 15   LYS A N     1 
ATOM   874   C  CA    . LYS D 4  15   ? 42.736  -53.898  37.883  1.00 121.07 ? 15   LYS A CA    1 
ATOM   875   C  C     . LYS D 4  15   ? 43.207  -53.271  39.175  1.00 121.56 ? 15   LYS A C     1 
ATOM   876   O  O     . LYS D 4  15   ? 42.833  -53.723  40.253  1.00 121.44 ? 15   LYS A O     1 
ATOM   877   C  CB    . LYS D 4  15   ? 43.732  -54.939  37.403  1.00 121.01 ? 15   LYS A CB    1 
ATOM   878   C  CG    . LYS D 4  15   ? 43.078  -56.063  36.630  1.00 122.00 ? 15   LYS A CG    1 
ATOM   879   C  CD    . LYS D 4  15   ? 41.753  -56.501  37.276  1.00 123.80 ? 15   LYS A CD    1 
ATOM   880   C  CE    . LYS D 4  15   ? 41.422  -57.961  36.991  1.00 125.43 ? 15   LYS A CE    1 
ATOM   881   N  NZ    . LYS D 4  15   ? 41.683  -58.356  35.572  1.00 126.37 ? 15   LYS A NZ    1 
ATOM   882   N  N     . GLU D 4  16   ? 44.046  -52.249  39.062  1.00 122.50 ? 16   GLU A N     1 
ATOM   883   C  CA    . GLU D 4  16   ? 44.455  -51.437  40.208  1.00 123.67 ? 16   GLU A CA    1 
ATOM   884   C  C     . GLU D 4  16   ? 44.433  -49.995  39.783  1.00 123.99 ? 16   GLU A C     1 
ATOM   885   O  O     . GLU D 4  16   ? 44.661  -49.686  38.610  1.00 123.91 ? 16   GLU A O     1 
ATOM   886   C  CB    . GLU D 4  16   ? 45.904  -51.694  40.628  1.00 123.75 ? 16   GLU A CB    1 
ATOM   887   C  CG    . GLU D 4  16   ? 46.302  -53.071  41.114  1.00 124.42 ? 16   GLU A CG    1 
ATOM   888   C  CD    . GLU D 4  16   ? 47.819  -53.218  41.092  1.00 124.41 ? 16   GLU A CD    1 
ATOM   889   O  OE1   . GLU D 4  16   ? 48.470  -52.494  40.297  1.00 124.77 ? 16   GLU A OE1   1 
ATOM   890   O  OE2   . GLU D 4  16   ? 48.363  -54.037  41.867  1.00 125.89 ? 16   GLU A OE2   1 
ATOM   891   N  N     . VAL D 4  17   ? 44.213  -49.102  40.737  1.00 124.70 ? 17   VAL A N     1 
ATOM   892   C  CA    . VAL D 4  17   ? 44.403  -47.699  40.438  1.00 125.49 ? 17   VAL A CA    1 
ATOM   893   C  C     . VAL D 4  17   ? 45.444  -47.094  41.353  1.00 126.04 ? 17   VAL A C     1 
ATOM   894   O  O     . VAL D 4  17   ? 45.226  -46.982  42.563  1.00 125.97 ? 17   VAL A O     1 
ATOM   895   C  CB    . VAL D 4  17   ? 43.123  -46.880  40.541  1.00 125.58 ? 17   VAL A CB    1 
ATOM   896   C  CG1   . VAL D 4  17   ? 43.330  -45.588  39.798  1.00 126.08 ? 17   VAL A CG1   1 
ATOM   897   C  CG2   . VAL D 4  17   ? 41.927  -47.631  39.961  1.00 125.61 ? 17   VAL A CG2   1 
ATOM   898   N  N     . GLN D 4  18   ? 46.562  -46.686  40.753  1.00 126.84 ? 18   GLN A N     1 
ATOM   899   C  CA    . GLN D 4  18   ? 47.719  -46.177  41.490  1.00 127.73 ? 18   GLN A CA    1 
ATOM   900   C  C     . GLN D 4  18   ? 47.747  -44.673  41.691  1.00 128.15 ? 18   GLN A C     1 
ATOM   901   O  O     . GLN D 4  18   ? 48.378  -43.955  40.913  1.00 128.33 ? 18   GLN A O     1 
ATOM   902   C  CB    . GLN D 4  18   ? 49.010  -46.606  40.804  1.00 127.81 ? 18   GLN A CB    1 
ATOM   903   C  CG    . GLN D 4  18   ? 49.725  -47.731  41.521  1.00 129.31 ? 18   GLN A CG    1 
ATOM   904   C  CD    . GLN D 4  18   ? 50.301  -47.319  42.872  1.00 130.80 ? 18   GLN A CD    1 
ATOM   905   O  OE1   . GLN D 4  18   ? 49.974  -46.256  43.427  1.00 131.08 ? 18   GLN A OE1   1 
ATOM   906   N  NE2   . GLN D 4  18   ? 51.176  -48.163  43.404  1.00 131.53 ? 18   GLN A NE2   1 
ATOM   907   N  N     . PHE D 4  19   ? 47.092  -44.198  42.748  1.00 128.67 ? 19   PHE A N     1 
ATOM   908   C  CA    . PHE D 4  19   ? 47.040  -42.768  43.018  1.00 129.27 ? 19   PHE A CA    1 
ATOM   909   C  C     . PHE D 4  19   ? 48.420  -42.205  43.286  1.00 129.71 ? 19   PHE A C     1 
ATOM   910   O  O     . PHE D 4  19   ? 49.293  -42.916  43.801  1.00 129.92 ? 19   PHE A O     1 
ATOM   911   C  CB    . PHE D 4  19   ? 46.095  -42.454  44.166  1.00 129.21 ? 19   PHE A CB    1 
ATOM   912   C  CG    . PHE D 4  19   ? 44.655  -42.534  43.782  1.00 129.99 ? 19   PHE A CG    1 
ATOM   913   C  CD1   . PHE D 4  19   ? 43.869  -43.605  44.193  1.00 131.06 ? 19   PHE A CD1   1 
ATOM   914   C  CD2   . PHE D 4  19   ? 44.082  -41.553  42.979  1.00 130.59 ? 19   PHE A CD2   1 
ATOM   915   C  CE1   . PHE D 4  19   ? 42.532  -43.688  43.826  1.00 130.50 ? 19   PHE A CE1   1 
ATOM   916   C  CE2   . PHE D 4  19   ? 42.746  -41.625  42.604  1.00 130.19 ? 19   PHE A CE2   1 
ATOM   917   C  CZ    . PHE D 4  19   ? 41.972  -42.694  43.029  1.00 130.31 ? 19   PHE A CZ    1 
ATOM   918   N  N     . GLY D 4  20   ? 48.606  -40.939  42.909  1.00 129.99 ? 20   GLY A N     1 
ATOM   919   C  CA    . GLY D 4  20   ? 49.901  -40.268  42.976  1.00 130.27 ? 20   GLY A CA    1 
ATOM   920   C  C     . GLY D 4  20   ? 49.820  -38.795  42.637  1.00 130.38 ? 20   GLY A C     1 
ATOM   921   O  O     . GLY D 4  20   ? 48.738  -38.223  42.599  1.00 130.40 ? 20   GLY A O     1 
ATOM   922   N  N     . LEU D 4  21   ? 50.975  -38.184  42.395  1.00 130.68 ? 21   LEU A N     1 
ATOM   923   C  CA    . LEU D 4  21   ? 51.049  -36.775  42.027  1.00 131.03 ? 21   LEU A CA    1 
ATOM   924   C  C     . LEU D 4  21   ? 51.829  -36.599  40.729  1.00 131.71 ? 21   LEU A C     1 
ATOM   925   O  O     . LEU D 4  21   ? 52.395  -37.560  40.208  1.00 131.58 ? 21   LEU A O     1 
ATOM   926   C  CB    . LEU D 4  21   ? 51.687  -35.958  43.149  1.00 130.74 ? 21   LEU A CB    1 
ATOM   927   C  CG    . LEU D 4  21   ? 51.007  -35.963  44.512  1.00 130.07 ? 21   LEU A CG    1 
ATOM   928   C  CD1   . LEU D 4  21   ? 51.830  -35.175  45.517  1.00 129.61 ? 21   LEU A CD1   1 
ATOM   929   C  CD2   . LEU D 4  21   ? 49.620  -35.385  44.389  1.00 129.72 ? 21   LEU A CD2   1 
ATOM   930   N  N     . PHE D 4  22   ? 51.854  -35.369  40.214  1.00 132.69 ? 22   PHE A N     1 
ATOM   931   C  CA    . PHE D 4  22   ? 52.485  -35.070  38.923  1.00 133.72 ? 22   PHE A CA    1 
ATOM   932   C  C     . PHE D 4  22   ? 53.886  -34.487  39.019  1.00 133.86 ? 22   PHE A C     1 
ATOM   933   O  O     . PHE D 4  22   ? 54.117  -33.499  39.723  1.00 133.81 ? 22   PHE A O     1 
ATOM   934   C  CB    . PHE D 4  22   ? 51.627  -34.092  38.112  1.00 134.30 ? 22   PHE A CB    1 
ATOM   935   C  CG    . PHE D 4  22   ? 50.685  -34.752  37.142  1.00 135.46 ? 22   PHE A CG    1 
ATOM   936   C  CD1   . PHE D 4  22   ? 49.307  -34.752  37.382  1.00 135.37 ? 22   PHE A CD1   1 
ATOM   937   C  CD2   . PHE D 4  22   ? 51.179  -35.359  35.971  1.00 135.91 ? 22   PHE A CD2   1 
ATOM   938   C  CE1   . PHE D 4  22   ? 48.438  -35.353  36.487  1.00 135.83 ? 22   PHE A CE1   1 
ATOM   939   C  CE2   . PHE D 4  22   ? 50.321  -35.966  35.064  1.00 135.61 ? 22   PHE A CE2   1 
ATOM   940   C  CZ    . PHE D 4  22   ? 48.943  -35.962  35.321  1.00 135.98 ? 22   PHE A CZ    1 
ATOM   941   N  N     . SER D 4  23   ? 54.804  -35.084  38.268  1.00 134.17 ? 23   SER A N     1 
ATOM   942   C  CA    . SER D 4  23   ? 56.134  -34.520  38.083  1.00 134.63 ? 23   SER A CA    1 
ATOM   943   C  C     . SER D 4  23   ? 56.106  -33.326  37.119  1.00 134.50 ? 23   SER A C     1 
ATOM   944   O  O     . SER D 4  23   ? 55.775  -33.497  35.947  1.00 134.61 ? 23   SER A O     1 
ATOM   945   C  CB    . SER D 4  23   ? 57.084  -35.596  37.549  1.00 134.88 ? 23   SER A CB    1 
ATOM   946   O  OG    . SER D 4  23   ? 58.159  -35.023  36.812  1.00 135.77 ? 23   SER A OG    1 
ATOM   947   N  N     . PRO D 4  24   ? 56.444  -32.115  37.602  1.00 134.35 ? 24   PRO A N     1 
ATOM   948   C  CA    . PRO D 4  24   ? 56.618  -31.022  36.659  1.00 134.36 ? 24   PRO A CA    1 
ATOM   949   C  C     . PRO D 4  24   ? 57.545  -31.407  35.504  1.00 134.45 ? 24   PRO A C     1 
ATOM   950   O  O     . PRO D 4  24   ? 57.486  -30.796  34.434  1.00 134.52 ? 24   PRO A O     1 
ATOM   951   C  CB    . PRO D 4  24   ? 57.236  -29.929  37.522  1.00 134.38 ? 24   PRO A CB    1 
ATOM   952   C  CG    . PRO D 4  24   ? 56.624  -30.166  38.855  1.00 134.45 ? 24   PRO A CG    1 
ATOM   953   C  CD    . PRO D 4  24   ? 56.640  -31.659  38.989  1.00 134.40 ? 24   PRO A CD    1 
ATOM   954   N  N     . GLU D 4  25   ? 58.370  -32.428  35.713  1.00 134.43 ? 25   GLU A N     1 
ATOM   955   C  CA    . GLU D 4  25   ? 59.224  -32.945  34.651  1.00 134.62 ? 25   GLU A CA    1 
ATOM   956   C  C     . GLU D 4  25   ? 58.476  -33.911  33.740  1.00 134.49 ? 25   GLU A C     1 
ATOM   957   O  O     . GLU D 4  25   ? 58.858  -34.096  32.584  1.00 134.60 ? 25   GLU A O     1 
ATOM   958   C  CB    . GLU D 4  25   ? 60.467  -33.602  35.239  1.00 134.75 ? 25   GLU A CB    1 
ATOM   959   C  CG    . GLU D 4  25   ? 61.372  -32.612  35.942  1.00 136.07 ? 25   GLU A CG    1 
ATOM   960   C  CD    . GLU D 4  25   ? 62.233  -33.254  37.008  1.00 137.80 ? 25   GLU A CD    1 
ATOM   961   O  OE1   . GLU D 4  25   ? 63.214  -33.955  36.647  1.00 138.26 ? 25   GLU A OE1   1 
ATOM   962   O  OE2   . GLU D 4  25   ? 61.926  -33.043  38.207  1.00 138.32 ? 25   GLU A OE2   1 
ATOM   963   N  N     . GLU D 4  26   ? 57.415  -34.525  34.263  1.00 134.32 ? 26   GLU A N     1 
ATOM   964   C  CA    . GLU D 4  26   ? 56.538  -35.385  33.466  1.00 134.26 ? 26   GLU A CA    1 
ATOM   965   C  C     . GLU D 4  26   ? 55.571  -34.521  32.654  1.00 133.63 ? 26   GLU A C     1 
ATOM   966   O  O     . GLU D 4  26   ? 55.635  -34.519  31.419  1.00 133.58 ? 26   GLU A O     1 
ATOM   967   C  CB    . GLU D 4  26   ? 55.764  -36.374  34.355  1.00 134.30 ? 26   GLU A CB    1 
ATOM   968   C  CG    . GLU D 4  26   ? 54.992  -37.465  33.572  1.00 135.33 ? 26   GLU A CG    1 
ATOM   969   C  CD    . GLU D 4  26   ? 53.901  -38.191  34.386  1.00 135.16 ? 26   GLU A CD    1 
ATOM   970   O  OE1   . GLU D 4  26   ? 53.257  -37.547  35.255  1.00 136.47 ? 26   GLU A OE1   1 
ATOM   971   O  OE2   . GLU D 4  26   ? 53.680  -39.405  34.132  1.00 135.21 ? 26   GLU A OE2   1 
ATOM   972   N  N     . VAL D 4  27   ? 54.695  -33.792  33.360  1.00 132.99 ? 27   VAL A N     1 
ATOM   973   C  CA    . VAL D 4  27   ? 53.704  -32.879  32.759  1.00 132.20 ? 27   VAL A CA    1 
ATOM   974   C  C     . VAL D 4  27   ? 54.254  -32.256  31.478  1.00 132.19 ? 27   VAL A C     1 
ATOM   975   O  O     . VAL D 4  27   ? 53.596  -32.296  30.431  1.00 132.16 ? 27   VAL A O     1 
ATOM   976   C  CB    . VAL D 4  27   ? 53.275  -31.728  33.733  1.00 131.95 ? 27   VAL A CB    1 
ATOM   977   C  CG1   . VAL D 4  27   ? 52.256  -30.819  33.076  1.00 131.29 ? 27   VAL A CG1   1 
ATOM   978   C  CG2   . VAL D 4  27   ? 52.728  -32.269  35.034  1.00 130.92 ? 27   VAL A CG2   1 
ATOM   979   N  N     . ARG D 4  28   ? 55.469  -31.709  31.586  1.00 131.94 ? 28   ARG A N     1 
ATOM   980   C  CA    . ARG D 4  28   ? 56.154  -31.008  30.501  1.00 131.94 ? 28   ARG A CA    1 
ATOM   981   C  C     . ARG D 4  28   ? 56.540  -31.889  29.307  1.00 131.86 ? 28   ARG A C     1 
ATOM   982   O  O     . ARG D 4  28   ? 56.529  -31.422  28.169  1.00 131.91 ? 28   ARG A O     1 
ATOM   983   C  CB    . ARG D 4  28   ? 57.407  -30.300  31.031  1.00 132.08 ? 28   ARG A CB    1 
ATOM   984   C  CG    . ARG D 4  28   ? 57.311  -28.781  31.160  1.00 132.15 ? 28   ARG A CG    1 
ATOM   985   C  CD    . ARG D 4  28   ? 58.676  -28.139  30.882  1.00 132.13 ? 28   ARG A CD    1 
ATOM   986   N  NE    . ARG D 4  28   ? 58.929  -26.926  31.663  1.00 132.36 ? 28   ARG A NE    1 
ATOM   987   C  CZ    . ARG D 4  28   ? 59.410  -26.907  32.910  1.00 132.61 ? 28   ARG A CZ    1 
ATOM   988   N  NH1   . ARG D 4  28   ? 59.683  -28.038  33.552  1.00 132.60 ? 28   ARG A NH1   1 
ATOM   989   N  NH2   . ARG D 4  28   ? 59.615  -25.749  33.528  1.00 132.47 ? 28   ARG A NH2   1 
ATOM   990   N  N     . ALA D 4  29   ? 56.910  -33.141  29.559  1.00 131.64 ? 29   ALA A N     1 
ATOM   991   C  CA    . ALA D 4  29   ? 57.243  -34.049  28.473  1.00 131.52 ? 29   ALA A CA    1 
ATOM   992   C  C     . ALA D 4  29   ? 55.978  -34.679  27.895  1.00 131.62 ? 29   ALA A C     1 
ATOM   993   O  O     . ALA D 4  29   ? 55.948  -35.050  26.723  1.00 131.61 ? 29   ALA A O     1 
ATOM   994   C  CB    . ALA D 4  29   ? 58.203  -35.112  28.949  1.00 131.43 ? 29   ALA A CB    1 
ATOM   995   N  N     . ILE D 4  30   ? 54.925  -34.756  28.713  1.00 131.81 ? 30   ILE A N     1 
ATOM   996   C  CA    . ILE D 4  30   ? 53.712  -35.533  28.388  1.00 131.77 ? 30   ILE A CA    1 
ATOM   997   C  C     . ILE D 4  30   ? 52.643  -34.832  27.533  1.00 131.81 ? 30   ILE A C     1 
ATOM   998   O  O     . ILE D 4  30   ? 51.913  -35.500  26.792  1.00 131.84 ? 30   ILE A O     1 
ATOM   999   C  CB    . ILE D 4  30   ? 53.069  -36.129  29.666  1.00 131.75 ? 30   ILE A CB    1 
ATOM   1000  C  CG1   . ILE D 4  30   ? 52.532  -37.531  29.374  1.00 131.87 ? 30   ILE A CG1   1 
ATOM   1001  C  CG2   . ILE D 4  30   ? 52.008  -35.190  30.246  1.00 131.11 ? 30   ILE A CG2   1 
ATOM   1002  C  CD1   . ILE D 4  30   ? 52.838  -38.562  30.468  1.00 132.68 ? 30   ILE A CD1   1 
ATOM   1003  N  N     . SER D 4  31   ? 52.555  -33.505  27.644  1.00 131.73 ? 31   SER A N     1 
ATOM   1004  C  CA    . SER D 4  31   ? 51.626  -32.699  26.845  1.00 131.65 ? 31   SER A CA    1 
ATOM   1005  C  C     . SER D 4  31   ? 52.110  -32.503  25.391  1.00 131.73 ? 31   SER A C     1 
ATOM   1006  O  O     . SER D 4  31   ? 53.189  -32.981  25.022  1.00 131.66 ? 31   SER A O     1 
ATOM   1007  C  CB    . SER D 4  31   ? 51.415  -31.343  27.518  1.00 131.62 ? 31   SER A CB    1 
ATOM   1008  O  OG    . SER D 4  31   ? 52.457  -30.438  27.199  1.00 131.27 ? 31   SER A OG    1 
ATOM   1009  N  N     . VAL D 4  32   ? 51.305  -31.815  24.574  1.00 131.66 ? 32   VAL A N     1 
ATOM   1010  C  CA    . VAL D 4  32   ? 51.684  -31.450  23.196  1.00 131.65 ? 32   VAL A CA    1 
ATOM   1011  C  C     . VAL D 4  32   ? 51.506  -29.959  22.969  1.00 131.76 ? 32   VAL A C     1 
ATOM   1012  O  O     . VAL D 4  32   ? 51.601  -29.463  21.842  1.00 131.59 ? 32   VAL A O     1 
ATOM   1013  C  CB    . VAL D 4  32   ? 50.862  -32.206  22.119  1.00 131.62 ? 32   VAL A CB    1 
ATOM   1014  C  CG1   . VAL D 4  32   ? 51.630  -33.412  21.581  1.00 131.55 ? 32   VAL A CG1   1 
ATOM   1015  C  CG2   . VAL D 4  32   ? 49.490  -32.588  22.654  1.00 131.49 ? 32   VAL A CG2   1 
ATOM   1016  N  N     . ALA D 4  33   ? 51.262  -29.248  24.059  1.00 132.13 ? 33   ALA A N     1 
ATOM   1017  C  CA    . ALA D 4  33   ? 50.931  -27.832  23.998  1.00 132.58 ? 33   ALA A CA    1 
ATOM   1018  C  C     . ALA D 4  33   ? 52.122  -26.883  24.189  1.00 132.72 ? 33   ALA A C     1 
ATOM   1019  O  O     . ALA D 4  33   ? 53.257  -27.305  24.429  1.00 132.74 ? 33   ALA A O     1 
ATOM   1020  C  CB    . ALA D 4  33   ? 49.843  -27.521  25.020  1.00 132.54 ? 33   ALA A CB    1 
ATOM   1021  N  N     . LYS D 4  34   ? 51.832  -25.594  24.054  1.00 132.89 ? 34   LYS A N     1 
ATOM   1022  C  CA    . LYS D 4  34   ? 52.721  -24.527  24.483  1.00 132.98 ? 34   LYS A CA    1 
ATOM   1023  C  C     . LYS D 4  34   ? 52.015  -23.780  25.631  1.00 133.01 ? 34   LYS A C     1 
ATOM   1024  O  O     . LYS D 4  34   ? 52.410  -23.887  26.795  1.00 132.82 ? 34   LYS A O     1 
ATOM   1025  C  CB    . LYS D 4  34   ? 53.030  -23.573  23.315  1.00 133.05 ? 34   LYS A CB    1 
ATOM   1026  C  CG    . LYS D 4  34   ? 53.618  -24.218  22.043  1.00 133.00 ? 34   LYS A CG    1 
ATOM   1027  C  CD    . LYS D 4  34   ? 53.734  -23.172  20.921  1.00 132.99 ? 34   LYS A CD    1 
ATOM   1028  C  CE    . LYS D 4  34   ? 54.247  -23.744  19.599  1.00 132.92 ? 34   LYS A CE    1 
ATOM   1029  N  NZ    . LYS D 4  34   ? 55.711  -23.567  19.403  1.00 132.77 ? 34   LYS A NZ    1 
ATOM   1030  N  N     . ILE D 4  35   ? 50.954  -23.050  25.273  1.00 133.13 ? 35   ILE A N     1 
ATOM   1031  C  CA    . ILE D 4  35   ? 50.065  -22.320  26.197  1.00 133.16 ? 35   ILE A CA    1 
ATOM   1032  C  C     . ILE D 4  35   ? 50.660  -21.020  26.709  1.00 133.30 ? 35   ILE A C     1 
ATOM   1033  O  O     . ILE D 4  35   ? 51.306  -20.996  27.758  1.00 133.28 ? 35   ILE A O     1 
ATOM   1034  C  CB    . ILE D 4  35   ? 49.574  -23.180  27.390  1.00 133.07 ? 35   ILE A CB    1 
ATOM   1035  C  CG1   . ILE D 4  35   ? 49.032  -24.535  26.911  1.00 133.07 ? 35   ILE A CG1   1 
ATOM   1036  C  CG2   . ILE D 4  35   ? 48.542  -22.411  28.209  1.00 132.85 ? 35   ILE A CG2   1 
ATOM   1037  C  CD1   . ILE D 4  35   ? 47.924  -24.458  25.867  1.00 132.97 ? 35   ILE A CD1   1 
ATOM   1038  N  N     . ARG D 4  36   ? 50.421  -19.938  25.973  1.00 133.44 ? 36   ARG A N     1 
ATOM   1039  C  CA    . ARG D 4  36   ? 50.994  -18.651  26.334  1.00 133.71 ? 36   ARG A CA    1 
ATOM   1040  C  C     . ARG D 4  36   ? 50.035  -17.487  26.163  1.00 133.91 ? 36   ARG A C     1 
ATOM   1041  O  O     . ARG D 4  36   ? 50.279  -16.410  26.698  1.00 134.02 ? 36   ARG A O     1 
ATOM   1042  C  CB    . ARG D 4  36   ? 52.265  -18.377  25.529  1.00 133.74 ? 36   ARG A CB    1 
ATOM   1043  C  CG    . ARG D 4  36   ? 53.406  -19.350  25.770  1.00 133.77 ? 36   ARG A CG    1 
ATOM   1044  C  CD    . ARG D 4  36   ? 54.297  -19.448  24.554  1.00 134.30 ? 36   ARG A CD    1 
ATOM   1045  N  NE    . ARG D 4  36   ? 53.626  -20.073  23.410  1.00 135.00 ? 36   ARG A NE    1 
ATOM   1046  C  CZ    . ARG D 4  36   ? 52.980  -19.414  22.445  1.00 135.49 ? 36   ARG A CZ    1 
ATOM   1047  N  NH1   . ARG D 4  36   ? 52.889  -18.091  22.471  1.00 135.41 ? 36   ARG A NH1   1 
ATOM   1048  N  NH2   . ARG D 4  36   ? 52.414  -20.081  21.448  1.00 135.76 ? 36   ARG A NH2   1 
ATOM   1049  N  N     . PHE D 4  37   ? 48.957  -17.680  25.416  1.00 134.14 ? 37   PHE A N     1 
ATOM   1050  C  CA    . PHE D 4  37   ? 48.054  -16.566  25.157  1.00 134.49 ? 37   PHE A CA    1 
ATOM   1051  C  C     . PHE D 4  37   ? 46.772  -16.635  25.971  1.00 134.87 ? 37   PHE A C     1 
ATOM   1052  O  O     . PHE D 4  37   ? 46.162  -17.692  26.063  1.00 134.73 ? 37   PHE A O     1 
ATOM   1053  C  CB    . PHE D 4  37   ? 47.771  -16.431  23.668  1.00 134.45 ? 37   PHE A CB    1 
ATOM   1054  C  CG    . PHE D 4  37   ? 48.845  -15.705  22.926  1.00 134.44 ? 37   PHE A CG    1 
ATOM   1055  C  CD1   . PHE D 4  37   ? 50.114  -16.260  22.791  1.00 133.90 ? 37   PHE A CD1   1 
ATOM   1056  C  CD2   . PHE D 4  37   ? 48.593  -14.451  22.372  1.00 134.95 ? 37   PHE A CD2   1 
ATOM   1057  C  CE1   . PHE D 4  37   ? 51.107  -15.580  22.116  1.00 134.16 ? 37   PHE A CE1   1 
ATOM   1058  C  CE2   . PHE D 4  37   ? 49.587  -13.756  21.687  1.00 134.65 ? 37   PHE A CE2   1 
ATOM   1059  C  CZ    . PHE D 4  37   ? 50.845  -14.322  21.559  1.00 134.52 ? 37   PHE A CZ    1 
ATOM   1060  N  N     . PRO D 4  38   ? 46.371  -15.500  26.576  1.00 135.37 ? 38   PRO A N     1 
ATOM   1061  C  CA    . PRO D 4  38   ? 45.221  -15.453  27.482  1.00 135.70 ? 38   PRO A CA    1 
ATOM   1062  C  C     . PRO D 4  38   ? 43.872  -15.546  26.774  1.00 136.12 ? 38   PRO A C     1 
ATOM   1063  O  O     . PRO D 4  38   ? 43.018  -16.305  27.223  1.00 136.12 ? 38   PRO A O     1 
ATOM   1064  C  CB    . PRO D 4  38   ? 45.367  -14.092  28.188  1.00 135.70 ? 38   PRO A CB    1 
ATOM   1065  C  CG    . PRO D 4  38   ? 46.704  -13.535  27.752  1.00 135.65 ? 38   PRO A CG    1 
ATOM   1066  C  CD    . PRO D 4  38   ? 47.006  -14.178  26.439  1.00 135.43 ? 38   PRO A CD    1 
ATOM   1067  N  N     . GLU D 4  39   ? 43.684  -14.793  25.687  1.00 136.77 ? 39   GLU A N     1 
ATOM   1068  C  CA    . GLU D 4  39   ? 42.434  -14.831  24.907  1.00 137.42 ? 39   GLU A CA    1 
ATOM   1069  C  C     . GLU D 4  39   ? 42.121  -16.264  24.498  1.00 137.82 ? 39   GLU A C     1 
ATOM   1070  O  O     . GLU D 4  39   ? 43.027  -17.093  24.389  1.00 137.96 ? 39   GLU A O     1 
ATOM   1071  C  CB    . GLU D 4  39   ? 42.509  -13.955  23.648  1.00 137.43 ? 39   GLU A CB    1 
ATOM   1072  C  CG    . GLU D 4  39   ? 43.352  -12.689  23.764  1.00 137.76 ? 39   GLU A CG    1 
ATOM   1073  C  CD    . GLU D 4  39   ? 44.833  -12.928  23.481  1.00 138.23 ? 39   GLU A CD    1 
ATOM   1074  O  OE1   . GLU D 4  39   ? 45.659  -12.119  23.951  1.00 138.57 ? 39   GLU A OE1   1 
ATOM   1075  O  OE2   . GLU D 4  39   ? 45.177  -13.918  22.795  1.00 138.48 ? 39   GLU A OE2   1 
ATOM   1076  N  N     . THR D 4  40   ? 40.844  -16.555  24.271  1.00 138.29 ? 40   THR A N     1 
ATOM   1077  C  CA    . THR D 4  40   ? 40.422  -17.916  23.951  1.00 138.74 ? 40   THR A CA    1 
ATOM   1078  C  C     . THR D 4  40   ? 40.816  -18.291  22.519  1.00 139.13 ? 40   THR A C     1 
ATOM   1079  O  O     . THR D 4  40   ? 41.997  -18.477  22.224  1.00 139.29 ? 40   THR A O     1 
ATOM   1080  C  CB    . THR D 4  40   ? 38.904  -18.124  24.189  1.00 138.74 ? 40   THR A CB    1 
ATOM   1081  O  OG1   . THR D 4  40   ? 38.533  -17.576  25.461  1.00 138.83 ? 40   THR A OG1   1 
ATOM   1082  C  CG2   . THR D 4  40   ? 38.546  -19.608  24.161  1.00 138.51 ? 40   THR A CG2   1 
ATOM   1083  N  N     . MET D 4  41   ? 39.835  -18.394  21.631  1.00 139.50 ? 41   MET A N     1 
ATOM   1084  C  CA    . MET D 4  41   ? 40.109  -18.862  20.286  1.00 139.78 ? 41   MET A CA    1 
ATOM   1085  C  C     . MET D 4  41   ? 40.058  -17.726  19.266  1.00 139.49 ? 41   MET A C     1 
ATOM   1086  O  O     . MET D 4  41   ? 39.403  -17.851  18.232  1.00 139.52 ? 41   MET A O     1 
ATOM   1087  C  CB    . MET D 4  41   ? 39.195  -20.054  19.908  1.00 140.27 ? 41   MET A CB    1 
ATOM   1088  C  CG    . MET D 4  41   ? 37.846  -19.723  19.231  1.00 141.48 ? 41   MET A CG    1 
ATOM   1089  S  SD    . MET D 4  41   ? 36.409  -19.474  20.321  1.00 144.92 ? 41   MET A SD    1 
ATOM   1090  C  CE    . MET D 4  41   ? 35.170  -18.888  19.144  1.00 142.59 ? 41   MET A CE    1 
ATOM   1091  N  N     . ASP D 4  42   ? 40.754  -16.623  19.536  1.00 139.12 ? 42   ASP A N     1 
ATOM   1092  C  CA    . ASP D 4  42   ? 40.814  -15.571  18.524  1.00 138.89 ? 42   ASP A CA    1 
ATOM   1093  C  C     . ASP D 4  42   ? 42.166  -14.925  18.274  1.00 138.71 ? 42   ASP A C     1 
ATOM   1094  O  O     . ASP D 4  42   ? 42.840  -14.471  19.200  1.00 138.78 ? 42   ASP A O     1 
ATOM   1095  C  CB    . ASP D 4  42   ? 39.740  -14.505  18.732  1.00 138.92 ? 42   ASP A CB    1 
ATOM   1096  C  CG    . ASP D 4  42   ? 39.347  -13.817  17.426  1.00 139.06 ? 42   ASP A CG    1 
ATOM   1097  O  OD1   . ASP D 4  42   ? 39.249  -14.503  16.379  1.00 138.98 ? 42   ASP A OD1   1 
ATOM   1098  O  OD2   . ASP D 4  42   ? 39.135  -12.587  17.440  1.00 139.41 ? 42   ASP A OD2   1 
ATOM   1099  N  N     . GLU D 4  43   ? 42.523  -14.881  16.992  1.00 138.44 ? 43   GLU A N     1 
ATOM   1100  C  CA    . GLU D 4  43   ? 43.685  -14.154  16.479  1.00 138.13 ? 43   GLU A CA    1 
ATOM   1101  C  C     . GLU D 4  43   ? 43.212  -12.987  15.599  1.00 137.97 ? 43   GLU A C     1 
ATOM   1102  O  O     . GLU D 4  43   ? 43.605  -12.863  14.436  1.00 137.84 ? 43   GLU A O     1 
ATOM   1103  C  CB    . GLU D 4  43   ? 44.594  -15.105  15.689  1.00 138.17 ? 43   GLU A CB    1 
ATOM   1104  C  CG    . GLU D 4  43   ? 43.889  -16.328  15.065  1.00 137.58 ? 43   GLU A CG    1 
ATOM   1105  C  CD    . GLU D 4  43   ? 43.116  -16.029  13.776  1.00 136.86 ? 43   GLU A CD    1 
ATOM   1106  O  OE1   . GLU D 4  43   ? 42.286  -15.095  13.749  1.00 136.48 ? 43   GLU A OE1   1 
ATOM   1107  O  OE2   . GLU D 4  43   ? 43.312  -16.764  12.786  1.00 136.46 ? 43   GLU A OE2   1 
ATOM   1108  N  N     . THR D 4  44   ? 42.381  -12.129  16.191  1.00 137.77 ? 44   THR A N     1 
ATOM   1109  C  CA    . THR D 4  44   ? 41.565  -11.125  15.485  1.00 137.61 ? 44   THR A CA    1 
ATOM   1110  C  C     . THR D 4  44   ? 40.533  -11.755  14.530  1.00 137.45 ? 44   THR A C     1 
ATOM   1111  O  O     . THR D 4  44   ? 40.874  -12.282  13.466  1.00 137.44 ? 44   THR A O     1 
ATOM   1112  C  CB    . THR D 4  44   ? 42.389  -9.998   14.781  1.00 137.64 ? 44   THR A CB    1 
ATOM   1113  O  OG1   . THR D 4  44   ? 42.987  -10.501  13.581  1.00 137.72 ? 44   THR A OG1   1 
ATOM   1114  C  CG2   . THR D 4  44   ? 43.468  -9.432   15.708  1.00 137.74 ? 44   THR A CG2   1 
ATOM   1115  N  N     . GLN D 4  45   ? 39.275  -11.704  14.969  1.00 137.22 ? 45   GLN A N     1 
ATOM   1116  C  CA    . GLN D 4  45   ? 38.074  -12.098  14.209  1.00 136.97 ? 45   GLN A CA    1 
ATOM   1117  C  C     . GLN D 4  45   ? 37.925  -13.552  13.706  1.00 136.98 ? 45   GLN A C     1 
ATOM   1118  O  O     . GLN D 4  45   ? 37.033  -14.259  14.175  1.00 136.93 ? 45   GLN A O     1 
ATOM   1119  C  CB    . GLN D 4  45   ? 37.733  -11.072  13.118  1.00 136.94 ? 45   GLN A CB    1 
ATOM   1120  C  CG    . GLN D 4  45   ? 37.034  -9.826   13.667  1.00 136.65 ? 45   GLN A CG    1 
ATOM   1121  C  CD    . GLN D 4  45   ? 36.628  -8.840   12.589  1.00 136.78 ? 45   GLN A CD    1 
ATOM   1122  O  OE1   . GLN D 4  45   ? 36.443  -9.209   11.428  1.00 136.56 ? 45   GLN A OE1   1 
ATOM   1123  N  NE2   . GLN D 4  45   ? 36.480  -7.574   12.972  1.00 136.70 ? 45   GLN A NE2   1 
ATOM   1124  N  N     . THR D 4  46   ? 38.785  -13.988  12.783  1.00 137.00 ? 46   THR A N     1 
ATOM   1125  C  CA    . THR D 4  46   ? 38.589  -15.246  12.015  1.00 137.09 ? 46   THR A CA    1 
ATOM   1126  C  C     . THR D 4  46   ? 38.098  -16.480  12.808  1.00 137.17 ? 46   THR A C     1 
ATOM   1127  O  O     . THR D 4  46   ? 38.136  -16.494  14.039  1.00 137.06 ? 46   THR A O     1 
ATOM   1128  C  CB    . THR D 4  46   ? 39.854  -15.630  11.185  1.00 137.09 ? 46   THR A CB    1 
ATOM   1129  O  OG1   . THR D 4  46   ? 40.783  -16.346  12.006  1.00 137.00 ? 46   THR A OG1   1 
ATOM   1130  C  CG2   . THR D 4  46   ? 40.531  -14.393  10.583  1.00 137.01 ? 46   THR A CG2   1 
ATOM   1131  N  N     . ARG D 4  47   ? 37.648  -17.511  12.084  1.00 137.33 ? 47   ARG A N     1 
ATOM   1132  C  CA    . ARG D 4  47   ? 37.127  -18.757  12.684  1.00 137.52 ? 47   ARG A CA    1 
ATOM   1133  C  C     . ARG D 4  47   ? 38.225  -19.615  13.331  1.00 137.84 ? 47   ARG A C     1 
ATOM   1134  O  O     . ARG D 4  47   ? 38.263  -20.838  13.172  1.00 137.86 ? 47   ARG A O     1 
ATOM   1135  C  CB    . ARG D 4  47   ? 36.318  -19.566  11.650  1.00 137.41 ? 47   ARG A CB    1 
ATOM   1136  C  CG    . ARG D 4  47   ? 37.121  -20.112  10.462  1.00 136.80 ? 47   ARG A CG    1 
ATOM   1137  C  CD    . ARG D 4  47   ? 36.399  -19.868  9.158   1.00 135.57 ? 47   ARG A CD    1 
ATOM   1138  N  NE    . ARG D 4  47   ? 36.383  -18.445  8.824   1.00 134.80 ? 47   ARG A NE    1 
ATOM   1139  C  CZ    . ARG D 4  47   ? 35.470  -17.861  8.056   1.00 134.72 ? 47   ARG A CZ    1 
ATOM   1140  N  NH1   . ARG D 4  47   ? 34.478  -18.572  7.536   1.00 134.79 ? 47   ARG A NH1   1 
ATOM   1141  N  NH2   . ARG D 4  47   ? 35.543  -16.559  7.809   1.00 134.75 ? 47   ARG A NH2   1 
ATOM   1142  N  N     . ALA D 4  48   ? 39.091  -18.949  14.089  1.00 138.20 ? 48   ALA A N     1 
ATOM   1143  C  CA    . ALA D 4  48   ? 40.320  -19.514  14.634  1.00 138.57 ? 48   ALA A CA    1 
ATOM   1144  C  C     . ALA D 4  48   ? 40.920  -18.414  15.515  1.00 138.87 ? 48   ALA A C     1 
ATOM   1145  O  O     . ALA D 4  48   ? 40.785  -17.243  15.148  1.00 139.04 ? 48   ALA A O     1 
ATOM   1146  C  CB    . ALA D 4  48   ? 41.286  -19.849  13.490  1.00 138.54 ? 48   ALA A CB    1 
ATOM   1147  N  N     . LYS D 4  49   ? 41.534  -18.732  16.665  1.00 139.07 ? 49   LYS A N     1 
ATOM   1148  C  CA    . LYS D 4  49   ? 41.770  -20.090  17.185  1.00 139.07 ? 49   LYS A CA    1 
ATOM   1149  C  C     . LYS D 4  49   ? 43.097  -20.099  17.979  1.00 139.15 ? 49   LYS A C     1 
ATOM   1150  O  O     . LYS D 4  49   ? 43.234  -20.727  19.029  1.00 138.90 ? 49   LYS A O     1 
ATOM   1151  C  CB    . LYS D 4  49   ? 41.836  -21.100  16.038  1.00 139.01 ? 49   LYS A CB    1 
ATOM   1152  C  CG    . LYS D 4  49   ? 42.993  -22.079  16.139  1.00 139.02 ? 49   LYS A CG    1 
ATOM   1153  C  CD    . LYS D 4  49   ? 42.587  -23.465  15.666  1.00 139.01 ? 49   LYS A CD    1 
ATOM   1154  C  CE    . LYS D 4  49   ? 42.142  -23.445  14.213  1.00 139.14 ? 49   LYS A CE    1 
ATOM   1155  N  NZ    . LYS D 4  49   ? 40.807  -22.804  14.050  1.00 138.94 ? 49   LYS A NZ    1 
ATOM   1156  N  N     . ILE D 4  50   ? 44.049  -19.371  17.412  1.00 139.48 ? 50   ILE A N     1 
ATOM   1157  C  CA    . ILE D 4  50   ? 45.441  -19.059  17.872  1.00 139.74 ? 50   ILE A CA    1 
ATOM   1158  C  C     . ILE D 4  50   ? 46.351  -20.218  18.316  1.00 139.70 ? 50   ILE A C     1 
ATOM   1159  O  O     . ILE D 4  50   ? 45.879  -21.232  18.827  1.00 139.81 ? 50   ILE A O     1 
ATOM   1160  C  CB    . ILE D 4  50   ? 45.512  -17.937  18.987  1.00 139.87 ? 50   ILE A CB    1 
ATOM   1161  C  CG1   . ILE D 4  50   ? 44.118  -17.439  19.411  1.00 140.09 ? 50   ILE A CG1   1 
ATOM   1162  C  CG2   . ILE D 4  50   ? 46.466  -16.801  18.552  1.00 139.56 ? 50   ILE A CG2   1 
ATOM   1163  C  CD1   . ILE D 4  50   ? 44.037  -16.942  20.851  1.00 139.79 ? 50   ILE A CD1   1 
ATOM   1164  N  N     . GLY D 4  51   ? 47.660  -20.042  18.136  1.00 139.52 ? 51   GLY A N     1 
ATOM   1165  C  CA    . GLY D 4  51   ? 48.639  -20.939  18.742  1.00 139.45 ? 51   GLY A CA    1 
ATOM   1166  C  C     . GLY D 4  51   ? 48.809  -20.657  20.231  1.00 139.55 ? 51   GLY A C     1 
ATOM   1167  O  O     . GLY D 4  51   ? 49.699  -21.213  20.876  1.00 139.57 ? 51   GLY A O     1 
ATOM   1168  N  N     . GLY D 4  52   ? 47.935  -19.815  20.784  1.00 139.58 ? 52   GLY A N     1 
ATOM   1169  C  CA    . GLY D 4  52   ? 48.086  -19.288  22.144  1.00 139.59 ? 52   GLY A CA    1 
ATOM   1170  C  C     . GLY D 4  52   ? 47.456  -20.053  23.297  1.00 139.61 ? 52   GLY A C     1 
ATOM   1171  O  O     . GLY D 4  52   ? 48.156  -20.372  24.262  1.00 139.61 ? 52   GLY A O     1 
ATOM   1172  N  N     . LEU D 4  53   ? 46.138  -20.294  23.215  1.00 139.57 ? 53   LEU A N     1 
ATOM   1173  C  CA    . LEU D 4  53   ? 45.365  -21.162  24.155  1.00 139.72 ? 53   LEU A CA    1 
ATOM   1174  C  C     . LEU D 4  53   ? 44.354  -22.060  23.413  1.00 140.28 ? 53   LEU A C     1 
ATOM   1175  O  O     . LEU D 4  53   ? 44.040  -21.827  22.240  1.00 140.50 ? 53   LEU A O     1 
ATOM   1176  C  CB    . LEU D 4  53   ? 44.642  -20.342  25.256  1.00 139.59 ? 53   LEU A CB    1 
ATOM   1177  C  CG    . LEU D 4  53   ? 43.531  -20.909  26.170  1.00 138.79 ? 53   LEU A CG    1 
ATOM   1178  C  CD1   . LEU D 4  53   ? 44.011  -22.044  27.015  1.00 137.25 ? 53   LEU A CD1   1 
ATOM   1179  C  CD2   . LEU D 4  53   ? 42.959  -19.851  27.073  1.00 138.82 ? 53   LEU A CD2   1 
ATOM   1180  N  N     . ASN D 4  54   ? 43.867  -23.084  24.115  1.00 140.62 ? 54   ASN A N     1 
ATOM   1181  C  CA    . ASN D 4  54   ? 42.828  -24.023  23.653  1.00 141.03 ? 54   ASN A CA    1 
ATOM   1182  C  C     . ASN D 4  54   ? 42.758  -24.455  22.164  1.00 141.18 ? 54   ASN A C     1 
ATOM   1183  O  O     . ASN D 4  54   ? 41.677  -24.619  21.596  1.00 141.05 ? 54   ASN A O     1 
ATOM   1184  C  CB    . ASN D 4  54   ? 41.448  -23.631  24.213  1.00 141.14 ? 54   ASN A CB    1 
ATOM   1185  C  CG    . ASN D 4  54   ? 40.693  -22.666  23.317  1.00 141.75 ? 54   ASN A CG    1 
ATOM   1186  O  OD1   . ASN D 4  54   ? 39.601  -22.982  22.833  1.00 142.39 ? 54   ASN A OD1   1 
ATOM   1187  N  ND2   . ASN D 4  54   ? 41.264  -21.486  23.094  1.00 142.30 ? 54   ASN A ND2   1 
ATOM   1188  N  N     . ASP D 4  55   ? 43.919  -24.635  21.549  1.00 141.64 ? 55   ASP A N     1 
ATOM   1189  C  CA    . ASP D 4  55   ? 44.037  -25.445  20.337  1.00 142.25 ? 55   ASP A CA    1 
ATOM   1190  C  C     . ASP D 4  55   ? 45.436  -26.014  20.139  1.00 142.73 ? 55   ASP A C     1 
ATOM   1191  O  O     . ASP D 4  55   ? 45.546  -27.222  19.960  1.00 142.65 ? 55   ASP A O     1 
ATOM   1192  C  CB    . ASP D 4  55   ? 43.575  -24.730  19.061  1.00 142.36 ? 55   ASP A CB    1 
ATOM   1193  C  CG    . ASP D 4  55   ? 43.833  -25.563  17.795  1.00 142.66 ? 55   ASP A CG    1 
ATOM   1194  O  OD1   . ASP D 4  55   ? 43.666  -26.802  17.820  1.00 142.56 ? 55   ASP A OD1   1 
ATOM   1195  O  OD2   . ASP D 4  55   ? 44.217  -24.977  16.765  1.00 143.31 ? 55   ASP A OD2   1 
ATOM   1196  N  N     . PRO D 4  56   ? 46.496  -25.155  20.204  1.00 143.36 ? 56   PRO A N     1 
ATOM   1197  C  CA    . PRO D 4  56   ? 47.888  -25.371  19.738  1.00 143.74 ? 56   PRO A CA    1 
ATOM   1198  C  C     . PRO D 4  56   ? 48.324  -26.831  19.600  1.00 144.00 ? 56   PRO A C     1 
ATOM   1199  O  O     . PRO D 4  56   ? 49.350  -27.245  20.175  1.00 143.97 ? 56   PRO A O     1 
ATOM   1200  C  CB    . PRO D 4  56   ? 48.732  -24.641  20.800  1.00 143.78 ? 56   PRO A CB    1 
ATOM   1201  C  CG    . PRO D 4  56   ? 47.762  -23.683  21.495  1.00 143.77 ? 56   PRO A CG    1 
ATOM   1202  C  CD    . PRO D 4  56   ? 46.403  -23.832  20.846  1.00 143.44 ? 56   PRO A CD    1 
ATOM   1203  N  N     . ARG D 4  57   ? 47.535  -27.567  18.808  1.00 144.18 ? 57   ARG A N     1 
ATOM   1204  C  CA    . ARG D 4  57   ? 47.653  -29.012  18.591  1.00 144.15 ? 57   ARG A CA    1 
ATOM   1205  C  C     . ARG D 4  57   ? 47.273  -29.866  19.825  1.00 143.77 ? 57   ARG A C     1 
ATOM   1206  O  O     . ARG D 4  57   ? 47.965  -30.836  20.131  1.00 143.99 ? 57   ARG A O     1 
ATOM   1207  C  CB    . ARG D 4  57   ? 49.051  -29.379  18.046  1.00 144.36 ? 57   ARG A CB    1 
ATOM   1208  C  CG    . ARG D 4  57   ? 49.440  -28.708  16.717  1.00 145.30 ? 57   ARG A CG    1 
ATOM   1209  C  CD    . ARG D 4  57   ? 50.962  -28.548  16.601  1.00 147.30 ? 57   ARG A CD    1 
ATOM   1210  N  NE    . ARG D 4  57   ? 51.477  -27.367  17.314  1.00 149.06 ? 57   ARG A NE    1 
ATOM   1211  C  CZ    . ARG D 4  57   ? 51.922  -27.348  18.578  1.00 149.83 ? 57   ARG A CZ    1 
ATOM   1212  N  NH1   . ARG D 4  57   ? 51.927  -28.448  19.333  1.00 149.96 ? 57   ARG A NH1   1 
ATOM   1213  N  NH2   . ARG D 4  57   ? 52.360  -26.209  19.101  1.00 150.07 ? 57   ARG A NH2   1 
ATOM   1214  N  N     . LEU D 4  58   ? 46.182  -29.523  20.520  1.00 143.18 ? 58   LEU A N     1 
ATOM   1215  C  CA    . LEU D 4  58   ? 45.753  -30.298  21.697  1.00 142.64 ? 58   LEU A CA    1 
ATOM   1216  C  C     . LEU D 4  58   ? 44.296  -30.704  21.599  1.00 142.67 ? 58   LEU A C     1 
ATOM   1217  O  O     . LEU D 4  58   ? 43.810  -31.525  22.365  1.00 142.57 ? 58   LEU A O     1 
ATOM   1218  C  CB    . LEU D 4  58   ? 46.041  -29.549  23.006  1.00 142.33 ? 58   LEU A CB    1 
ATOM   1219  C  CG    . LEU D 4  58   ? 44.943  -28.844  23.801  1.00 141.57 ? 58   LEU A CG    1 
ATOM   1220  C  CD1   . LEU D 4  58   ? 45.401  -28.608  25.220  1.00 140.71 ? 58   LEU A CD1   1 
ATOM   1221  C  CD2   . LEU D 4  58   ? 44.574  -27.546  23.168  1.00 141.20 ? 58   LEU A CD2   1 
ATOM   1222  N  N     . GLY D 4  59   ? 43.614  -30.117  20.633  1.00 143.01 ? 59   GLY A N     1 
ATOM   1223  C  CA    . GLY D 4  59   ? 42.232  -30.450  20.327  1.00 143.64 ? 59   GLY A CA    1 
ATOM   1224  C  C     . GLY D 4  59   ? 41.736  -29.510  19.245  1.00 144.03 ? 59   GLY A C     1 
ATOM   1225  O  O     . GLY D 4  59   ? 42.533  -28.772  18.656  1.00 144.17 ? 59   GLY A O     1 
ATOM   1226  N  N     . SER D 4  60   ? 40.434  -29.557  18.962  1.00 144.27 ? 60   SER A N     1 
ATOM   1227  C  CA    . SER D 4  60   ? 39.769  -28.530  18.148  1.00 144.56 ? 60   SER A CA    1 
ATOM   1228  C  C     . SER D 4  60   ? 38.276  -28.493  18.438  1.00 144.50 ? 60   SER A C     1 
ATOM   1229  O  O     . SER D 4  60   ? 37.723  -29.415  19.042  1.00 144.31 ? 60   SER A O     1 
ATOM   1230  C  CB    . SER D 4  60   ? 40.055  -28.679  16.636  1.00 144.72 ? 60   SER A CB    1 
ATOM   1231  O  OG    . SER D 4  60   ? 39.371  -29.774  16.047  1.00 145.18 ? 60   SER A OG    1 
ATOM   1232  N  N     . ILE D 4  61   ? 37.638  -27.421  17.985  1.00 144.58 ? 61   ILE A N     1 
ATOM   1233  C  CA    . ILE D 4  61   ? 36.275  -27.104  18.370  1.00 144.72 ? 61   ILE A CA    1 
ATOM   1234  C  C     . ILE D 4  61   ? 35.344  -26.982  17.156  1.00 145.11 ? 61   ILE A C     1 
ATOM   1235  O  O     . ILE D 4  61   ? 34.803  -25.908  16.892  1.00 145.16 ? 61   ILE A O     1 
ATOM   1236  C  CB    . ILE D 4  61   ? 36.257  -25.805  19.219  1.00 144.64 ? 61   ILE A CB    1 
ATOM   1237  C  CG1   . ILE D 4  61   ? 37.525  -24.975  18.953  1.00 144.32 ? 61   ILE A CG1   1 
ATOM   1238  C  CG2   . ILE D 4  61   ? 36.161  -26.149  20.689  1.00 144.60 ? 61   ILE A CG2   1 
ATOM   1239  C  CD1   . ILE D 4  61   ? 37.539  -23.602  19.601  1.00 144.36 ? 61   ILE A CD1   1 
ATOM   1240  N  N     . ASP D 4  62   ? 35.138  -28.084  16.432  1.00 145.58 ? 62   ASP A N     1 
ATOM   1241  C  CA    . ASP D 4  62   ? 34.447  -28.014  15.136  1.00 146.12 ? 62   ASP A CA    1 
ATOM   1242  C  C     . ASP D 4  62   ? 33.666  -29.258  14.687  1.00 146.49 ? 62   ASP A C     1 
ATOM   1243  O  O     . ASP D 4  62   ? 32.939  -29.196  13.695  1.00 146.49 ? 62   ASP A O     1 
ATOM   1244  C  CB    . ASP D 4  62   ? 35.460  -27.648  14.043  1.00 146.15 ? 62   ASP A CB    1 
ATOM   1245  C  CG    . ASP D 4  62   ? 34.859  -26.778  12.955  1.00 146.52 ? 62   ASP A CG    1 
ATOM   1246  O  OD1   . ASP D 4  62   ? 34.136  -27.306  12.084  1.00 147.00 ? 62   ASP A OD1   1 
ATOM   1247  O  OD2   . ASP D 4  62   ? 35.120  -25.557  12.965  1.00 146.72 ? 62   ASP A OD2   1 
ATOM   1248  N  N     . ARG D 4  63   ? 33.809  -30.374  15.405  1.00 147.07 ? 63   ARG A N     1 
ATOM   1249  C  CA    . ARG D 4  63   ? 33.385  -31.699  14.901  1.00 147.56 ? 63   ARG A CA    1 
ATOM   1250  C  C     . ARG D 4  63   ? 34.029  -31.994  13.536  1.00 147.80 ? 63   ARG A C     1 
ATOM   1251  O  O     . ARG D 4  63   ? 33.374  -32.500  12.611  1.00 147.88 ? 63   ARG A O     1 
ATOM   1252  C  CB    . ARG D 4  63   ? 31.856  -31.831  14.827  1.00 147.61 ? 63   ARG A CB    1 
ATOM   1253  C  CG    . ARG D 4  63   ? 31.160  -31.898  16.168  1.00 148.10 ? 63   ARG A CG    1 
ATOM   1254  C  CD    . ARG D 4  63   ? 29.832  -31.170  16.095  1.00 148.90 ? 63   ARG A CD    1 
ATOM   1255  N  NE    . ARG D 4  63   ? 29.602  -30.340  17.279  1.00 149.13 ? 63   ARG A NE    1 
ATOM   1256  C  CZ    . ARG D 4  63   ? 28.904  -29.206  17.290  1.00 148.50 ? 63   ARG A CZ    1 
ATOM   1257  N  NH1   . ARG D 4  63   ? 28.351  -28.740  16.177  1.00 148.23 ? 63   ARG A NH1   1 
ATOM   1258  N  NH2   . ARG D 4  63   ? 28.763  -28.532  18.423  1.00 148.21 ? 63   ARG A NH2   1 
ATOM   1259  N  N     . ASN D 4  64   ? 35.317  -31.651  13.427  1.00 147.97 ? 64   ASN A N     1 
ATOM   1260  C  CA    . ASN D 4  64   ? 36.125  -31.865  12.219  1.00 147.79 ? 64   ASN A CA    1 
ATOM   1261  C  C     . ASN D 4  64   ? 37.377  -32.718  12.478  1.00 147.87 ? 64   ASN A C     1 
ATOM   1262  O  O     . ASN D 4  64   ? 37.878  -32.779  13.616  1.00 147.71 ? 64   ASN A O     1 
ATOM   1263  C  CB    . ASN D 4  64   ? 36.546  -30.522  11.620  1.00 147.52 ? 64   ASN A CB    1 
ATOM   1264  C  CG    . ASN D 4  64   ? 35.398  -29.764  11.014  1.00 146.79 ? 64   ASN A CG    1 
ATOM   1265  O  OD1   . ASN D 4  64   ? 34.240  -30.164  11.112  1.00 145.56 ? 64   ASN A OD1   1 
ATOM   1266  N  ND2   . ASN D 4  64   ? 35.715  -28.648  10.378  1.00 146.48 ? 64   ASN A ND2   1 
ATOM   1267  N  N     . LEU D 4  65   ? 37.876  -33.360  11.414  1.00 147.86 ? 65   LEU A N     1 
ATOM   1268  C  CA    . LEU D 4  65   ? 39.104  -34.174  11.458  1.00 147.71 ? 65   LEU A CA    1 
ATOM   1269  C  C     . LEU D 4  65   ? 40.349  -33.324  11.816  1.00 147.62 ? 65   LEU A C     1 
ATOM   1270  O  O     . LEU D 4  65   ? 41.463  -33.609  11.364  1.00 147.79 ? 65   LEU A O     1 
ATOM   1271  C  CB    . LEU D 4  65   ? 39.291  -34.977  10.136  1.00 147.70 ? 65   LEU A CB    1 
ATOM   1272  C  CG    . LEU D 4  65   ? 39.661  -34.375  8.753   1.00 147.44 ? 65   LEU A CG    1 
ATOM   1273  C  CD1   . LEU D 4  65   ? 40.249  -35.433  7.806   1.00 146.78 ? 65   LEU A CD1   1 
ATOM   1274  C  CD2   . LEU D 4  65   ? 38.501  -33.648  8.066   1.00 146.74 ? 65   LEU A CD2   1 
ATOM   1275  N  N     . LYS D 4  66   ? 40.148  -32.308  12.662  1.00 147.35 ? 66   LYS A N     1 
ATOM   1276  C  CA    . LYS D 4  66   ? 41.148  -31.260  12.910  1.00 147.04 ? 66   LYS A CA    1 
ATOM   1277  C  C     . LYS D 4  66   ? 41.920  -31.437  14.219  1.00 146.79 ? 66   LYS A C     1 
ATOM   1278  O  O     . LYS D 4  66   ? 42.286  -30.457  14.879  1.00 146.73 ? 66   LYS A O     1 
ATOM   1279  C  CB    . LYS D 4  66   ? 40.500  -29.862  12.867  1.00 147.08 ? 66   LYS A CB    1 
ATOM   1280  C  CG    . LYS D 4  66   ? 39.592  -29.577  11.659  1.00 147.03 ? 66   LYS A CG    1 
ATOM   1281  C  CD    . LYS D 4  66   ? 40.279  -29.787  10.314  1.00 146.50 ? 66   LYS A CD    1 
ATOM   1282  C  CE    . LYS D 4  66   ? 39.256  -30.046  9.224   1.00 146.15 ? 66   LYS A CE    1 
ATOM   1283  N  NZ    . LYS D 4  66   ? 39.897  -30.549  7.967   1.00 146.31 ? 66   LYS A NZ    1 
ATOM   1284  N  N     . CYS D 4  67   ? 42.184  -32.687  14.579  1.00 146.40 ? 67   CYS A N     1 
ATOM   1285  C  CA    . CYS D 4  67   ? 42.910  -32.964  15.801  1.00 146.29 ? 67   CYS A CA    1 
ATOM   1286  C  C     . CYS D 4  67   ? 44.336  -33.441  15.523  1.00 146.35 ? 67   CYS A C     1 
ATOM   1287  O  O     . CYS D 4  67   ? 44.636  -34.627  15.658  1.00 146.40 ? 67   CYS A O     1 
ATOM   1288  C  CB    . CYS D 4  67   ? 42.137  -33.958  16.678  1.00 146.12 ? 67   CYS A CB    1 
ATOM   1289  S  SG    . CYS D 4  67   ? 42.633  -34.015  18.439  1.00 146.06 ? 67   CYS A SG    1 
ATOM   1290  N  N     . GLN D 4  68   ? 45.178  -32.500  15.086  1.00 146.47 ? 68   GLN A N     1 
ATOM   1291  C  CA    . GLN D 4  68   ? 46.657  -32.535  15.225  1.00 146.53 ? 68   GLN A CA    1 
ATOM   1292  C  C     . GLN D 4  68   ? 47.429  -33.877  15.182  1.00 146.57 ? 68   GLN A C     1 
ATOM   1293  O  O     . GLN D 4  68   ? 47.484  -34.609  16.183  1.00 146.52 ? 68   GLN A O     1 
ATOM   1294  C  CB    . GLN D 4  68   ? 47.045  -31.781  16.504  1.00 146.62 ? 68   GLN A CB    1 
ATOM   1295  C  CG    . GLN D 4  68   ? 46.104  -31.998  17.718  1.00 146.70 ? 68   GLN A CG    1 
ATOM   1296  C  CD    . GLN D 4  68   ? 46.430  -33.241  18.558  1.00 146.84 ? 68   GLN A CD    1 
ATOM   1297  O  OE1   . GLN D 4  68   ? 47.063  -33.147  19.609  1.00 146.49 ? 68   GLN A OE1   1 
ATOM   1298  N  NE2   . GLN D 4  68   ? 45.984  -34.405  18.099  1.00 147.23 ? 68   GLN A NE2   1 
ATOM   1299  N  N     . THR D 4  69   ? 48.070  -34.159  14.042  1.00 146.51 ? 69   THR A N     1 
ATOM   1300  C  CA    . THR D 4  69   ? 48.828  -35.429  13.786  1.00 146.37 ? 69   THR A CA    1 
ATOM   1301  C  C     . THR D 4  69   ? 48.049  -36.736  14.097  1.00 146.07 ? 69   THR A C     1 
ATOM   1302  O  O     . THR D 4  69   ? 48.322  -37.787  13.495  1.00 146.12 ? 69   THR A O     1 
ATOM   1303  C  CB    . THR D 4  69   ? 50.265  -35.477  14.451  1.00 146.48 ? 69   THR A CB    1 
ATOM   1304  O  OG1   . THR D 4  69   ? 50.708  -34.161  14.813  1.00 146.57 ? 69   THR A OG1   1 
ATOM   1305  C  CG2   . THR D 4  69   ? 51.294  -36.123  13.499  1.00 146.33 ? 69   THR A CG2   1 
ATOM   1306  N  N     . CYS D 4  70   ? 47.094  -36.645  15.029  1.00 145.23 ? 70   CYS A N     1 
ATOM   1307  C  CA    . CYS D 4  70   ? 46.181  -37.732  15.399  1.00 144.71 ? 70   CYS A CA    1 
ATOM   1308  C  C     . CYS D 4  70   ? 44.967  -37.868  14.456  1.00 144.49 ? 70   CYS A C     1 
ATOM   1309  O  O     . CYS D 4  70   ? 44.448  -38.970  14.273  1.00 144.36 ? 70   CYS A O     1 
ATOM   1310  C  CB    . CYS D 4  70   ? 45.765  -37.562  16.866  1.00 144.46 ? 70   CYS A CB    1 
ATOM   1311  S  SG    . CYS D 4  70   ? 44.024  -37.766  17.282  1.00 144.06 ? 70   CYS A SG    1 
ATOM   1312  N  N     . GLN D 4  71   ? 44.551  -36.755  13.846  1.00 144.36 ? 71   GLN A N     1 
ATOM   1313  C  CA    . GLN D 4  71   ? 43.413  -36.691  12.902  1.00 144.26 ? 71   GLN A CA    1 
ATOM   1314  C  C     . GLN D 4  71   ? 42.061  -36.963  13.550  1.00 144.20 ? 71   GLN A C     1 
ATOM   1315  O  O     . GLN D 4  71   ? 41.269  -36.034  13.738  1.00 144.36 ? 71   GLN A O     1 
ATOM   1316  C  CB    . GLN D 4  71   ? 43.604  -37.607  11.679  1.00 144.32 ? 71   GLN A CB    1 
ATOM   1317  C  CG    . GLN D 4  71   ? 44.479  -37.031  10.581  1.00 144.05 ? 71   GLN A CG    1 
ATOM   1318  C  CD    . GLN D 4  71   ? 45.948  -37.182  10.889  1.00 143.63 ? 71   GLN A CD    1 
ATOM   1319  O  OE1   . GLN D 4  71   ? 46.511  -38.275  10.784  1.00 143.54 ? 71   GLN A OE1   1 
ATOM   1320  N  NE2   . GLN D 4  71   ? 46.581  -36.083  11.278  1.00 143.25 ? 71   GLN A NE2   1 
ATOM   1321  N  N     . GLU D 4  72   ? 41.817  -38.245  13.853  1.00 143.96 ? 72   GLU A N     1 
ATOM   1322  C  CA    . GLU D 4  72   ? 40.621  -38.771  14.559  1.00 143.62 ? 72   GLU A CA    1 
ATOM   1323  C  C     . GLU D 4  72   ? 39.381  -37.885  14.620  1.00 143.17 ? 72   GLU A C     1 
ATOM   1324  O  O     . GLU D 4  72   ? 38.349  -38.217  14.038  1.00 143.24 ? 72   GLU A O     1 
ATOM   1325  C  CB    . GLU D 4  72   ? 40.980  -39.274  15.967  1.00 143.63 ? 72   GLU A CB    1 
ATOM   1326  C  CG    . GLU D 4  72   ? 42.109  -40.323  16.027  1.00 144.04 ? 72   GLU A CG    1 
ATOM   1327  C  CD    . GLU D 4  72   ? 42.055  -41.372  14.919  1.00 144.14 ? 72   GLU A CD    1 
ATOM   1328  O  OE1   . GLU D 4  72   ? 43.121  -41.683  14.343  1.00 143.73 ? 72   GLU A OE1   1 
ATOM   1329  O  OE2   . GLU D 4  72   ? 40.952  -41.883  14.628  1.00 144.83 ? 72   GLU A OE2   1 
ATOM   1330  N  N     . GLY D 4  73   ? 39.481  -36.778  15.346  1.00 142.65 ? 73   GLY A N     1 
ATOM   1331  C  CA    . GLY D 4  73   ? 38.426  -35.790  15.356  1.00 142.19 ? 73   GLY A CA    1 
ATOM   1332  C  C     . GLY D 4  73   ? 37.283  -36.230  16.229  1.00 141.94 ? 73   GLY A C     1 
ATOM   1333  O  O     . GLY D 4  73   ? 37.088  -37.419  16.472  1.00 141.66 ? 73   GLY A O     1 
ATOM   1334  N  N     . MET D 4  74   ? 36.515  -35.243  16.668  1.00 141.91 ? 74   MET A N     1 
ATOM   1335  C  CA    . MET D 4  74   ? 35.516  -35.388  17.716  1.00 141.79 ? 74   MET A CA    1 
ATOM   1336  C  C     . MET D 4  74   ? 34.908  -36.770  17.854  1.00 141.38 ? 74   MET A C     1 
ATOM   1337  O  O     . MET D 4  74   ? 34.692  -37.469  16.855  1.00 141.24 ? 74   MET A O     1 
ATOM   1338  C  CB    . MET D 4  74   ? 34.441  -34.314  17.545  1.00 142.13 ? 74   MET A CB    1 
ATOM   1339  C  CG    . MET D 4  74   ? 34.993  -32.903  17.718  1.00 143.16 ? 74   MET A CG    1 
ATOM   1340  S  SD    . MET D 4  74   ? 35.094  -32.358  19.443  1.00 147.09 ? 74   MET A SD    1 
ATOM   1341  C  CE    . MET D 4  74   ? 36.152  -33.578  20.258  1.00 145.61 ? 74   MET A CE    1 
ATOM   1342  N  N     . ASN D 4  75   ? 34.659  -37.159  19.107  1.00 140.99 ? 75   ASN A N     1 
ATOM   1343  C  CA    . ASN D 4  75   ? 34.093  -38.470  19.449  1.00 140.55 ? 75   ASN A CA    1 
ATOM   1344  C  C     . ASN D 4  75   ? 35.069  -39.603  19.096  1.00 140.04 ? 75   ASN A C     1 
ATOM   1345  O  O     . ASN D 4  75   ? 34.771  -40.480  18.271  1.00 139.87 ? 75   ASN A O     1 
ATOM   1346  C  CB    . ASN D 4  75   ? 32.729  -38.654  18.765  1.00 140.69 ? 75   ASN A CB    1 
ATOM   1347  C  CG    . ASN D 4  75   ? 31.962  -39.836  19.298  1.00 140.88 ? 75   ASN A CG    1 
ATOM   1348  O  OD1   . ASN D 4  75   ? 31.624  -39.898  20.488  1.00 140.75 ? 75   ASN A OD1   1 
ATOM   1349  N  ND2   . ASN D 4  75   ? 31.671  -40.787  18.414  1.00 141.03 ? 75   ASN A ND2   1 
ATOM   1350  N  N     . GLU D 4  76   ? 36.237  -39.552  19.738  1.00 139.37 ? 76   GLU A N     1 
ATOM   1351  C  CA    . GLU D 4  76   ? 37.395  -40.391  19.409  1.00 138.76 ? 76   GLU A CA    1 
ATOM   1352  C  C     . GLU D 4  76   ? 38.671  -39.823  20.044  1.00 137.97 ? 76   GLU A C     1 
ATOM   1353  O  O     . GLU D 4  76   ? 39.377  -40.536  20.750  1.00 138.01 ? 76   GLU A O     1 
ATOM   1354  C  CB    . GLU D 4  76   ? 37.581  -40.497  17.894  1.00 139.07 ? 76   GLU A CB    1 
ATOM   1355  C  CG    . GLU D 4  76   ? 38.650  -41.482  17.448  1.00 140.23 ? 76   GLU A CG    1 
ATOM   1356  C  CD    . GLU D 4  76   ? 38.109  -42.880  17.247  1.00 142.09 ? 76   GLU A CD    1 
ATOM   1357  O  OE1   . GLU D 4  76   ? 37.829  -43.241  16.074  1.00 142.72 ? 76   GLU A OE1   1 
ATOM   1358  O  OE2   . GLU D 4  76   ? 37.955  -43.606  18.259  1.00 142.61 ? 76   GLU A OE2   1 
ATOM   1359  N  N     . CYS D 4  77   ? 38.974  -38.553  19.769  1.00 136.91 ? 77   CYS A N     1 
ATOM   1360  C  CA    . CYS D 4  77   ? 40.085  -37.857  20.407  1.00 136.09 ? 77   CYS A CA    1 
ATOM   1361  C  C     . CYS D 4  77   ? 39.719  -37.677  21.871  1.00 135.59 ? 77   CYS A C     1 
ATOM   1362  O  O     . CYS D 4  77   ? 38.720  -37.013  22.174  1.00 135.69 ? 77   CYS A O     1 
ATOM   1363  C  CB    . CYS D 4  77   ? 40.313  -36.494  19.755  1.00 136.17 ? 77   CYS A CB    1 
ATOM   1364  S  SG    . CYS D 4  77   ? 41.769  -35.582  20.324  1.00 136.45 ? 77   CYS A SG    1 
ATOM   1365  N  N     . PRO D 4  78   ? 40.509  -38.282  22.788  1.00 134.99 ? 78   PRO A N     1 
ATOM   1366  C  CA    . PRO D 4  78   ? 40.261  -38.170  24.232  1.00 134.36 ? 78   PRO A CA    1 
ATOM   1367  C  C     . PRO D 4  78   ? 40.410  -36.724  24.708  1.00 133.84 ? 78   PRO A C     1 
ATOM   1368  O  O     . PRO D 4  78   ? 39.680  -36.276  25.592  1.00 133.46 ? 78   PRO A O     1 
ATOM   1369  C  CB    . PRO D 4  78   ? 41.365  -39.041  24.837  1.00 134.45 ? 78   PRO A CB    1 
ATOM   1370  C  CG    . PRO D 4  78   ? 42.447  -39.079  23.805  1.00 134.25 ? 78   PRO A CG    1 
ATOM   1371  C  CD    . PRO D 4  78   ? 41.706  -39.100  22.506  1.00 134.88 ? 78   PRO A CD    1 
ATOM   1372  N  N     . GLY D 4  79   ? 41.357  -36.016  24.091  1.00 133.46 ? 79   GLY A N     1 
ATOM   1373  C  CA    . GLY D 4  79   ? 41.631  -34.609  24.361  1.00 132.79 ? 79   GLY A CA    1 
ATOM   1374  C  C     . GLY D 4  79   ? 43.009  -34.493  24.970  1.00 132.23 ? 79   GLY A C     1 
ATOM   1375  O  O     . GLY D 4  79   ? 43.144  -34.570  26.190  1.00 132.52 ? 79   GLY A O     1 
ATOM   1376  N  N     . HIS D 4  80   ? 44.030  -34.313  24.135  1.00 131.28 ? 80   HIS A N     1 
ATOM   1377  C  CA    . HIS D 4  80   ? 45.408  -34.343  24.612  1.00 130.35 ? 80   HIS A CA    1 
ATOM   1378  C  C     . HIS D 4  80   ? 45.774  -33.140  25.445  1.00 130.07 ? 80   HIS A C     1 
ATOM   1379  O  O     . HIS D 4  80   ? 45.365  -32.024  25.150  1.00 130.02 ? 80   HIS A O     1 
ATOM   1380  C  CB    . HIS D 4  80   ? 46.345  -34.454  23.449  1.00 130.20 ? 80   HIS A CB    1 
ATOM   1381  C  CG    . HIS D 4  80   ? 45.899  -35.444  22.434  1.00 129.72 ? 80   HIS A CG    1 
ATOM   1382  N  ND1   . HIS D 4  80   ? 46.231  -36.778  22.507  1.00 129.09 ? 80   HIS A ND1   1 
ATOM   1383  C  CD2   . HIS D 4  80   ? 45.134  -35.300  21.328  1.00 129.48 ? 80   HIS A CD2   1 
ATOM   1384  C  CE1   . HIS D 4  80   ? 45.707  -37.411  21.473  1.00 129.35 ? 80   HIS A CE1   1 
ATOM   1385  N  NE2   . HIS D 4  80   ? 45.036  -36.536  20.743  1.00 129.48 ? 80   HIS A NE2   1 
ATOM   1386  N  N     . PHE D 4  81   ? 46.569  -33.387  26.479  1.00 129.83 ? 81   PHE A N     1 
ATOM   1387  C  CA    . PHE D 4  81   ? 46.842  -32.394  27.510  1.00 129.76 ? 81   PHE A CA    1 
ATOM   1388  C  C     . PHE D 4  81   ? 47.792  -31.267  27.128  1.00 130.01 ? 81   PHE A C     1 
ATOM   1389  O  O     . PHE D 4  81   ? 48.512  -31.342  26.118  1.00 130.26 ? 81   PHE A O     1 
ATOM   1390  C  CB    . PHE D 4  81   ? 47.349  -33.082  28.772  1.00 129.48 ? 81   PHE A CB    1 
ATOM   1391  C  CG    . PHE D 4  81   ? 46.292  -33.288  29.793  1.00 129.22 ? 81   PHE A CG    1 
ATOM   1392  C  CD1   . PHE D 4  81   ? 45.556  -34.470  29.822  1.00 128.83 ? 81   PHE A CD1   1 
ATOM   1393  C  CD2   . PHE D 4  81   ? 46.004  -32.285  30.719  1.00 128.92 ? 81   PHE A CD2   1 
ATOM   1394  C  CE1   . PHE D 4  81   ? 44.555  -34.660  30.771  1.00 128.51 ? 81   PHE A CE1   1 
ATOM   1395  C  CE2   . PHE D 4  81   ? 45.003  -32.462  31.676  1.00 128.43 ? 81   PHE A CE2   1 
ATOM   1396  C  CZ    . PHE D 4  81   ? 44.280  -33.652  31.702  1.00 128.80 ? 81   PHE A CZ    1 
ATOM   1397  N  N     . GLY D 4  82   ? 47.774  -30.221  27.957  1.00 129.96 ? 82   GLY A N     1 
ATOM   1398  C  CA    . GLY D 4  82   ? 48.672  -29.076  27.818  1.00 129.83 ? 82   GLY A CA    1 
ATOM   1399  C  C     . GLY D 4  82   ? 49.439  -28.780  29.093  1.00 129.67 ? 82   GLY A C     1 
ATOM   1400  O  O     . GLY D 4  82   ? 49.146  -29.349  30.151  1.00 129.67 ? 82   GLY A O     1 
ATOM   1401  N  N     . HIS D 4  83   ? 50.424  -27.892  28.992  1.00 129.43 ? 83   HIS A N     1 
ATOM   1402  C  CA    . HIS D 4  83   ? 51.198  -27.470  30.153  1.00 129.27 ? 83   HIS A CA    1 
ATOM   1403  C  C     . HIS D 4  83   ? 51.387  -25.975  30.139  1.00 129.04 ? 83   HIS A C     1 
ATOM   1404  O  O     . HIS D 4  83   ? 51.479  -25.363  29.080  1.00 129.06 ? 83   HIS A O     1 
ATOM   1405  C  CB    . HIS D 4  83   ? 52.558  -28.146  30.159  1.00 129.45 ? 83   HIS A CB    1 
ATOM   1406  C  CG    . HIS D 4  83   ? 53.466  -27.682  29.065  1.00 129.87 ? 83   HIS A CG    1 
ATOM   1407  N  ND1   . HIS D 4  83   ? 54.727  -27.183  29.309  1.00 130.14 ? 83   HIS A ND1   1 
ATOM   1408  C  CD2   . HIS D 4  83   ? 53.291  -27.625  27.723  1.00 130.25 ? 83   HIS A CD2   1 
ATOM   1409  C  CE1   . HIS D 4  83   ? 55.296  -26.852  28.163  1.00 130.68 ? 83   HIS A CE1   1 
ATOM   1410  N  NE2   . HIS D 4  83   ? 54.444  -27.108  27.185  1.00 130.61 ? 83   HIS A NE2   1 
ATOM   1411  N  N     . ILE D 4  84   ? 51.447  -25.388  31.323  1.00 128.87 ? 84   ILE A N     1 
ATOM   1412  C  CA    . ILE D 4  84   ? 51.619  -23.952  31.442  1.00 128.86 ? 84   ILE A CA    1 
ATOM   1413  C  C     . ILE D 4  84   ? 52.665  -23.672  32.507  1.00 129.17 ? 84   ILE A C     1 
ATOM   1414  O  O     . ILE D 4  84   ? 52.580  -24.195  33.612  1.00 129.47 ? 84   ILE A O     1 
ATOM   1415  C  CB    . ILE D 4  84   ? 50.278  -23.234  31.733  1.00 128.69 ? 84   ILE A CB    1 
ATOM   1416  C  CG1   . ILE D 4  84   ? 50.401  -21.740  31.451  1.00 128.39 ? 84   ILE A CG1   1 
ATOM   1417  C  CG2   . ILE D 4  84   ? 49.764  -23.523  33.154  1.00 128.26 ? 84   ILE A CG2   1 
ATOM   1418  C  CD1   . ILE D 4  84   ? 49.121  -20.995  31.655  1.00 128.12 ? 84   ILE A CD1   1 
ATOM   1419  N  N     . ASP D 4  85   ? 53.659  -22.859  32.167  1.00 129.48 ? 85   ASP A N     1 
ATOM   1420  C  CA    . ASP D 4  85   ? 54.830  -22.681  33.025  1.00 129.59 ? 85   ASP A CA    1 
ATOM   1421  C  C     . ASP D 4  85   ? 54.690  -21.548  34.028  1.00 129.80 ? 85   ASP A C     1 
ATOM   1422  O  O     . ASP D 4  85   ? 54.481  -20.387  33.664  1.00 129.63 ? 85   ASP A O     1 
ATOM   1423  C  CB    . ASP D 4  85   ? 56.104  -22.557  32.187  1.00 129.43 ? 85   ASP A CB    1 
ATOM   1424  C  CG    . ASP D 4  85   ? 56.570  -23.901  31.640  1.00 129.32 ? 85   ASP A CG    1 
ATOM   1425  O  OD1   . ASP D 4  85   ? 56.603  -24.884  32.416  1.00 128.96 ? 85   ASP A OD1   1 
ATOM   1426  O  OD2   . ASP D 4  85   ? 56.907  -23.975  30.438  1.00 129.37 ? 85   ASP A OD2   1 
ATOM   1427  N  N     . LEU D 4  86   ? 54.807  -21.920  35.299  1.00 130.22 ? 86   LEU A N     1 
ATOM   1428  C  CA    . LEU D 4  86   ? 54.623  -21.012  36.425  1.00 130.79 ? 86   LEU A CA    1 
ATOM   1429  C  C     . LEU D 4  86   ? 55.829  -20.081  36.594  1.00 131.02 ? 86   LEU A C     1 
ATOM   1430  O  O     . LEU D 4  86   ? 56.971  -20.488  36.361  1.00 131.03 ? 86   LEU A O     1 
ATOM   1431  C  CB    . LEU D 4  86   ? 54.430  -21.840  37.700  1.00 130.90 ? 86   LEU A CB    1 
ATOM   1432  C  CG    . LEU D 4  86   ? 53.477  -21.479  38.849  1.00 131.08 ? 86   LEU A CG    1 
ATOM   1433  C  CD1   . LEU D 4  86   ? 53.726  -20.065  39.398  1.00 131.52 ? 86   LEU A CD1   1 
ATOM   1434  C  CD2   . LEU D 4  86   ? 52.020  -21.666  38.435  1.00 130.95 ? 86   LEU A CD2   1 
ATOM   1435  N  N     . ALA D 4  87   ? 55.570  -18.844  37.017  1.00 131.29 ? 87   ALA A N     1 
ATOM   1436  C  CA    . ALA D 4  87   ? 56.625  -17.834  37.166  1.00 131.58 ? 87   ALA A CA    1 
ATOM   1437  C  C     . ALA D 4  87   ? 57.363  -17.892  38.512  1.00 131.72 ? 87   ALA A C     1 
ATOM   1438  O  O     . ALA D 4  87   ? 58.588  -17.723  38.555  1.00 131.86 ? 87   ALA A O     1 
ATOM   1439  C  CB    . ALA D 4  87   ? 56.074  -16.427  36.907  1.00 131.56 ? 87   ALA A CB    1 
ATOM   1440  N  N     . LYS D 4  88   ? 56.621  -18.109  39.600  1.00 131.67 ? 88   LYS A N     1 
ATOM   1441  C  CA    . LYS D 4  88   ? 57.221  -18.283  40.928  1.00 131.63 ? 88   LYS A CA    1 
ATOM   1442  C  C     . LYS D 4  88   ? 56.361  -19.185  41.819  1.00 131.53 ? 88   LYS A C     1 
ATOM   1443  O  O     . LYS D 4  88   ? 55.442  -18.698  42.478  1.00 131.59 ? 88   LYS A O     1 
ATOM   1444  C  CB    . LYS D 4  88   ? 57.536  -16.929  41.605  1.00 131.64 ? 88   LYS A CB    1 
ATOM   1445  C  CG    . LYS D 4  88   ? 58.907  -16.332  41.196  1.00 131.82 ? 88   LYS A CG    1 
ATOM   1446  C  CD    . LYS D 4  88   ? 59.286  -15.056  41.959  1.00 131.89 ? 88   LYS A CD    1 
ATOM   1447  C  CE    . LYS D 4  88   ? 60.225  -15.318  43.148  1.00 132.10 ? 88   LYS A CE    1 
ATOM   1448  N  NZ    . LYS D 4  88   ? 59.540  -15.846  44.373  1.00 132.22 ? 88   LYS A NZ    1 
ATOM   1449  N  N     . PRO D 4  89   ? 56.687  -20.501  41.850  1.00 131.43 ? 89   PRO A N     1 
ATOM   1450  C  CA    . PRO D 4  89   ? 56.037  -21.650  42.500  1.00 131.34 ? 89   PRO A CA    1 
ATOM   1451  C  C     . PRO D 4  89   ? 54.925  -21.394  43.533  1.00 131.01 ? 89   PRO A C     1 
ATOM   1452  O  O     . PRO D 4  89   ? 55.137  -20.667  44.507  1.00 130.97 ? 89   PRO A O     1 
ATOM   1453  C  CB    . PRO D 4  89   ? 57.232  -22.369  43.139  1.00 131.33 ? 89   PRO A CB    1 
ATOM   1454  C  CG    . PRO D 4  89   ? 58.396  -22.077  42.145  1.00 131.30 ? 89   PRO A CG    1 
ATOM   1455  C  CD    . PRO D 4  89   ? 57.924  -20.968  41.198  1.00 131.32 ? 89   PRO A CD    1 
ATOM   1456  N  N     . VAL D 4  90   ? 53.763  -22.012  43.311  1.00 130.57 ? 90   VAL A N     1 
ATOM   1457  C  CA    . VAL D 4  90   ? 52.580  -21.819  44.164  1.00 130.28 ? 90   VAL A CA    1 
ATOM   1458  C  C     . VAL D 4  90   ? 52.178  -23.065  44.957  1.00 130.12 ? 90   VAL A C     1 
ATOM   1459  O  O     . VAL D 4  90   ? 52.402  -24.193  44.522  1.00 129.93 ? 90   VAL A O     1 
ATOM   1460  C  CB    . VAL D 4  90   ? 51.338  -21.355  43.355  1.00 130.20 ? 90   VAL A CB    1 
ATOM   1461  C  CG1   . VAL D 4  90   ? 51.381  -19.863  43.071  1.00 129.70 ? 90   VAL A CG1   1 
ATOM   1462  C  CG2   . VAL D 4  90   ? 51.197  -22.161  42.076  1.00 130.65 ? 90   VAL A CG2   1 
ATOM   1463  N  N     . PHE D 4  91   ? 51.571  -22.839  46.120  1.00 130.04 ? 91   PHE A N     1 
ATOM   1464  C  CA    . PHE D 4  91   ? 50.990  -23.910  46.926  1.00 130.02 ? 91   PHE A CA    1 
ATOM   1465  C  C     . PHE D 4  91   ? 49.784  -24.489  46.199  1.00 129.53 ? 91   PHE A C     1 
ATOM   1466  O  O     . PHE D 4  91   ? 49.181  -23.806  45.368  1.00 129.83 ? 91   PHE A O     1 
ATOM   1467  C  CB    . PHE D 4  91   ? 50.496  -23.377  48.273  1.00 130.60 ? 91   PHE A CB    1 
ATOM   1468  C  CG    . PHE D 4  91   ? 51.581  -22.915  49.202  1.00 131.49 ? 91   PHE A CG    1 
ATOM   1469  C  CD1   . PHE D 4  91   ? 52.614  -23.771  49.586  1.00 132.19 ? 91   PHE A CD1   1 
ATOM   1470  C  CD2   . PHE D 4  91   ? 51.538  -21.624  49.741  1.00 133.21 ? 91   PHE A CD2   1 
ATOM   1471  C  CE1   . PHE D 4  91   ? 53.617  -23.337  50.468  1.00 133.30 ? 91   PHE A CE1   1 
ATOM   1472  C  CE2   . PHE D 4  91   ? 52.535  -21.164  50.634  1.00 134.27 ? 91   PHE A CE2   1 
ATOM   1473  C  CZ    . PHE D 4  91   ? 53.578  -22.024  50.999  1.00 133.48 ? 91   PHE A CZ    1 
ATOM   1474  N  N     . HIS D 4  92   ? 49.411  -25.722  46.542  1.00 128.56 ? 92   HIS A N     1 
ATOM   1475  C  CA    . HIS D 4  92   ? 48.279  -26.399  45.917  1.00 127.50 ? 92   HIS A CA    1 
ATOM   1476  C  C     . HIS D 4  92   ? 47.178  -26.626  46.923  1.00 126.66 ? 92   HIS A C     1 
ATOM   1477  O  O     . HIS D 4  92   ? 47.095  -27.688  47.525  1.00 126.34 ? 92   HIS A O     1 
ATOM   1478  C  CB    . HIS D 4  92   ? 48.728  -27.735  45.345  1.00 127.64 ? 92   HIS A CB    1 
ATOM   1479  C  CG    . HIS D 4  92   ? 47.609  -28.592  44.851  1.00 128.47 ? 92   HIS A CG    1 
ATOM   1480  N  ND1   . HIS D 4  92   ? 47.729  -29.394  43.736  1.00 129.37 ? 92   HIS A ND1   1 
ATOM   1481  C  CD2   . HIS D 4  92   ? 46.350  -28.780  45.318  1.00 129.13 ? 92   HIS A CD2   1 
ATOM   1482  C  CE1   . HIS D 4  92   ? 46.592  -30.040  43.540  1.00 130.24 ? 92   HIS A CE1   1 
ATOM   1483  N  NE2   . HIS D 4  92   ? 45.737  -29.682  44.484  1.00 129.54 ? 92   HIS A NE2   1 
ATOM   1484  N  N     . VAL D 4  93   ? 46.335  -25.616  47.086  1.00 126.00 ? 93   VAL A N     1 
ATOM   1485  C  CA    . VAL D 4  93   ? 45.155  -25.638  47.964  1.00 125.48 ? 93   VAL A CA    1 
ATOM   1486  C  C     . VAL D 4  93   ? 44.900  -26.875  48.827  1.00 125.22 ? 93   VAL A C     1 
ATOM   1487  O  O     . VAL D 4  93   ? 44.744  -26.764  50.045  1.00 125.02 ? 93   VAL A O     1 
ATOM   1488  C  CB    . VAL D 4  93   ? 43.866  -25.329  47.176  1.00 125.51 ? 93   VAL A CB    1 
ATOM   1489  C  CG1   . VAL D 4  93   ? 43.495  -23.857  47.328  1.00 125.51 ? 93   VAL A CG1   1 
ATOM   1490  C  CG2   . VAL D 4  93   ? 43.995  -25.762  45.699  1.00 125.18 ? 93   VAL A CG2   1 
ATOM   1491  N  N     . GLY D 4  94   ? 44.841  -28.043  48.193  1.00 124.98 ? 94   GLY A N     1 
ATOM   1492  C  CA    . GLY D 4  94   ? 44.521  -29.290  48.888  1.00 124.76 ? 94   GLY A CA    1 
ATOM   1493  C  C     . GLY D 4  94   ? 45.640  -29.849  49.747  1.00 124.56 ? 94   GLY A C     1 
ATOM   1494  O  O     . GLY D 4  94   ? 45.430  -30.770  50.532  1.00 124.81 ? 94   GLY A O     1 
ATOM   1495  N  N     . PHE D 4  95   ? 46.835  -29.291  49.606  1.00 124.15 ? 95   PHE A N     1 
ATOM   1496  C  CA    . PHE D 4  95   ? 47.991  -29.780  50.339  1.00 123.54 ? 95   PHE A CA    1 
ATOM   1497  C  C     . PHE D 4  95   ? 48.549  -28.765  51.333  1.00 123.37 ? 95   PHE A C     1 
ATOM   1498  O  O     . PHE D 4  95   ? 49.591  -28.996  51.938  1.00 123.27 ? 95   PHE A O     1 
ATOM   1499  C  CB    . PHE D 4  95   ? 49.079  -30.214  49.356  1.00 123.40 ? 95   PHE A CB    1 
ATOM   1500  C  CG    . PHE D 4  95   ? 48.660  -31.316  48.434  1.00 122.75 ? 95   PHE A CG    1 
ATOM   1501  C  CD1   . PHE D 4  95   ? 48.976  -31.258  47.086  1.00 122.33 ? 95   PHE A CD1   1 
ATOM   1502  C  CD2   . PHE D 4  95   ? 47.948  -32.413  48.913  1.00 122.71 ? 95   PHE A CD2   1 
ATOM   1503  C  CE1   . PHE D 4  95   ? 48.599  -32.282  46.223  1.00 122.39 ? 95   PHE A CE1   1 
ATOM   1504  C  CE2   . PHE D 4  95   ? 47.561  -33.441  48.061  1.00 122.82 ? 95   PHE A CE2   1 
ATOM   1505  C  CZ    . PHE D 4  95   ? 47.888  -33.376  46.712  1.00 122.71 ? 95   PHE A CZ    1 
ATOM   1506  N  N     . ILE D 4  96   ? 47.862  -27.640  51.492  1.00 123.27 ? 96   ILE A N     1 
ATOM   1507  C  CA    . ILE D 4  96   ? 48.278  -26.639  52.463  1.00 123.40 ? 96   ILE A CA    1 
ATOM   1508  C  C     . ILE D 4  96   ? 48.328  -27.278  53.844  1.00 123.50 ? 96   ILE A C     1 
ATOM   1509  O  O     . ILE D 4  96   ? 49.374  -27.270  54.488  1.00 123.70 ? 96   ILE A O     1 
ATOM   1510  C  CB    . ILE D 4  96   ? 47.362  -25.384  52.441  1.00 123.52 ? 96   ILE A CB    1 
ATOM   1511  C  CG1   . ILE D 4  96   ? 47.698  -24.509  51.228  1.00 123.89 ? 96   ILE A CG1   1 
ATOM   1512  C  CG2   . ILE D 4  96   ? 47.475  -24.567  53.743  1.00 122.98 ? 96   ILE A CG2   1 
ATOM   1513  C  CD1   . ILE D 4  96   ? 49.027  -23.758  51.333  1.00 124.06 ? 96   ILE A CD1   1 
ATOM   1514  N  N     . ALA D 4  97   ? 47.212  -27.861  54.275  1.00 123.48 ? 97   ALA A N     1 
ATOM   1515  C  CA    . ALA D 4  97   ? 47.161  -28.575  55.542  1.00 123.39 ? 97   ALA A CA    1 
ATOM   1516  C  C     . ALA D 4  97   ? 48.407  -29.445  55.706  1.00 123.34 ? 97   ALA A C     1 
ATOM   1517  O  O     . ALA D 4  97   ? 49.109  -29.326  56.710  1.00 123.26 ? 97   ALA A O     1 
ATOM   1518  C  CB    . ALA D 4  97   ? 45.885  -29.419  55.629  1.00 123.57 ? 97   ALA A CB    1 
ATOM   1519  N  N     . LYS D 4  98   ? 48.685  -30.275  54.690  1.00 123.38 ? 98   LYS A N     1 
ATOM   1520  C  CA    . LYS D 4  98   ? 49.808  -31.232  54.681  1.00 123.31 ? 98   LYS A CA    1 
ATOM   1521  C  C     . LYS D 4  98   ? 51.141  -30.510  54.633  1.00 123.14 ? 98   LYS A C     1 
ATOM   1522  O  O     . LYS D 4  98   ? 51.937  -30.643  55.555  1.00 123.43 ? 98   LYS A O     1 
ATOM   1523  C  CB    . LYS D 4  98   ? 49.700  -32.223  53.503  1.00 123.49 ? 98   LYS A CB    1 
ATOM   1524  C  CG    . LYS D 4  98   ? 50.245  -33.663  53.744  1.00 123.79 ? 98   LYS A CG    1 
ATOM   1525  C  CD    . LYS D 4  98   ? 49.196  -34.599  54.394  1.00 124.54 ? 98   LYS A CD    1 
ATOM   1526  C  CE    . LYS D 4  98   ? 49.362  -36.060  53.954  1.00 124.78 ? 98   LYS A CE    1 
ATOM   1527  N  NZ    . LYS D 4  98   ? 48.173  -36.902  54.328  1.00 124.57 ? 98   LYS A NZ    1 
ATOM   1528  N  N     . ILE D 4  99   ? 51.378  -29.738  53.573  1.00 122.85 ? 99   ILE A N     1 
ATOM   1529  C  CA    . ILE D 4  99   ? 52.612  -28.961  53.418  1.00 122.59 ? 99   ILE A CA    1 
ATOM   1530  C  C     . ILE D 4  99   ? 53.071  -28.290  54.735  1.00 122.55 ? 99   ILE A C     1 
ATOM   1531  O  O     . ILE D 4  99   ? 54.257  -28.313  55.063  1.00 122.17 ? 99   ILE A O     1 
ATOM   1532  C  CB    . ILE D 4  99   ? 52.460  -27.934  52.275  1.00 122.51 ? 99   ILE A CB    1 
ATOM   1533  C  CG1   . ILE D 4  99   ? 53.710  -27.891  51.406  1.00 122.16 ? 99   ILE A CG1   1 
ATOM   1534  C  CG2   . ILE D 4  99   ? 52.061  -26.574  52.796  1.00 122.75 ? 99   ILE A CG2   1 
ATOM   1535  C  CD1   . ILE D 4  99   ? 53.544  -28.638  50.135  1.00 121.48 ? 99   ILE A CD1   1 
ATOM   1536  N  N     . LYS D 4  100  ? 52.116  -27.727  55.483  1.00 122.75 ? 100  LYS A N     1 
ATOM   1537  C  CA    . LYS D 4  100  ? 52.345  -27.214  56.840  1.00 122.97 ? 100  LYS A CA    1 
ATOM   1538  C  C     . LYS D 4  100  ? 52.668  -28.323  57.832  1.00 123.74 ? 100  LYS A C     1 
ATOM   1539  O  O     . LYS D 4  100  ? 53.668  -28.241  58.540  1.00 124.06 ? 100  LYS A O     1 
ATOM   1540  C  CB    . LYS D 4  100  ? 51.132  -26.444  57.368  1.00 122.55 ? 100  LYS A CB    1 
ATOM   1541  C  CG    . LYS D 4  100  ? 51.216  -26.170  58.858  1.00 120.86 ? 100  LYS A CG    1 
ATOM   1542  C  CD    . LYS D 4  100  ? 49.911  -25.734  59.444  1.00 119.08 ? 100  LYS A CD    1 
ATOM   1543  C  CE    . LYS D 4  100  ? 50.116  -25.276  60.873  1.00 117.97 ? 100  LYS A CE    1 
ATOM   1544  N  NZ    . LYS D 4  100  ? 48.958  -24.508  61.388  1.00 116.99 ? 100  LYS A NZ    1 
ATOM   1545  N  N     . LYS D 4  101  ? 51.809  -29.339  57.908  1.00 124.56 ? 101  LYS A N     1 
ATOM   1546  C  CA    . LYS D 4  101  ? 52.038  -30.472  58.814  1.00 125.31 ? 101  LYS A CA    1 
ATOM   1547  C  C     . LYS D 4  101  ? 53.383  -31.165  58.564  1.00 126.04 ? 101  LYS A C     1 
ATOM   1548  O  O     . LYS D 4  101  ? 54.028  -31.615  59.517  1.00 126.20 ? 101  LYS A O     1 
ATOM   1549  C  CB    . LYS D 4  101  ? 50.881  -31.483  58.775  1.00 125.18 ? 101  LYS A CB    1 
ATOM   1550  C  CG    . LYS D 4  101  ? 49.728  -31.157  59.726  1.00 124.33 ? 101  LYS A CG    1 
ATOM   1551  C  CD    . LYS D 4  101  ? 48.770  -32.322  59.836  1.00 122.86 ? 101  LYS A CD    1 
ATOM   1552  C  CE    . LYS D 4  101  ? 47.516  -31.935  60.588  1.00 122.05 ? 101  LYS A CE    1 
ATOM   1553  N  NZ    . LYS D 4  101  ? 46.463  -32.962  60.375  1.00 121.43 ? 101  LYS A NZ    1 
ATOM   1554  N  N     . VAL D 4  102  ? 53.809  -31.226  57.299  1.00 126.86 ? 102  VAL A N     1 
ATOM   1555  C  CA    . VAL D 4  102  ? 55.144  -31.735  56.960  1.00 127.72 ? 102  VAL A CA    1 
ATOM   1556  C  C     . VAL D 4  102  ? 56.238  -30.763  57.391  1.00 128.52 ? 102  VAL A C     1 
ATOM   1557  O  O     . VAL D 4  102  ? 57.338  -31.189  57.730  1.00 128.74 ? 102  VAL A O     1 
ATOM   1558  C  CB    . VAL D 4  102  ? 55.312  -32.081  55.469  1.00 127.48 ? 102  VAL A CB    1 
ATOM   1559  C  CG1   . VAL D 4  102  ? 56.687  -32.643  55.228  1.00 127.31 ? 102  VAL A CG1   1 
ATOM   1560  C  CG2   . VAL D 4  102  ? 54.308  -33.125  55.056  1.00 127.68 ? 102  VAL A CG2   1 
ATOM   1561  N  N     . CYS D 4  103  ? 55.933  -29.468  57.400  1.00 129.46 ? 103  CYS A N     1 
ATOM   1562  C  CA    . CYS D 4  103  ? 56.905  -28.468  57.854  1.00 130.50 ? 103  CYS A CA    1 
ATOM   1563  C  C     . CYS D 4  103  ? 57.169  -28.479  59.343  1.00 130.50 ? 103  CYS A C     1 
ATOM   1564  O  O     . CYS D 4  103  ? 58.284  -28.214  59.765  1.00 130.42 ? 103  CYS A O     1 
ATOM   1565  C  CB    . CYS D 4  103  ? 56.498  -27.075  57.415  1.00 130.62 ? 103  CYS A CB    1 
ATOM   1566  S  SG    . CYS D 4  103  ? 56.978  -26.769  55.723  1.00 133.78 ? 103  CYS A SG    1 
ATOM   1567  N  N     . GLU D 4  104  ? 56.148  -28.789  60.131  1.00 131.03 ? 104  GLU A N     1 
ATOM   1568  C  CA    . GLU D 4  104  ? 56.320  -28.968  61.569  1.00 131.72 ? 104  GLU A CA    1 
ATOM   1569  C  C     . GLU D 4  104  ? 57.103  -30.248  61.878  1.00 132.12 ? 104  GLU A C     1 
ATOM   1570  O  O     . GLU D 4  104  ? 57.493  -30.492  63.033  1.00 132.12 ? 104  GLU A O     1 
ATOM   1571  C  CB    . GLU D 4  104  ? 54.964  -28.980  62.267  1.00 131.73 ? 104  GLU A CB    1 
ATOM   1572  C  CG    . GLU D 4  104  ? 54.323  -27.612  62.371  1.00 132.09 ? 104  GLU A CG    1 
ATOM   1573  C  CD    . GLU D 4  104  ? 52.817  -27.692  62.490  1.00 132.84 ? 104  GLU A CD    1 
ATOM   1574  O  OE1   . GLU D 4  104  ? 52.150  -27.965  61.462  1.00 133.05 ? 104  GLU A OE1   1 
ATOM   1575  O  OE2   . GLU D 4  104  ? 52.304  -27.476  63.611  1.00 132.88 ? 104  GLU A OE2   1 
ATOM   1576  N  N     . CYS D 4  105  ? 57.335  -31.041  60.826  1.00 132.55 ? 105  CYS A N     1 
ATOM   1577  C  CA    . CYS D 4  105  ? 58.066  -32.312  60.897  1.00 132.89 ? 105  CYS A CA    1 
ATOM   1578  C  C     . CYS D 4  105  ? 59.477  -32.275  60.267  1.00 133.31 ? 105  CYS A C     1 
ATOM   1579  O  O     . CYS D 4  105  ? 60.216  -33.257  60.358  1.00 133.33 ? 105  CYS A O     1 
ATOM   1580  C  CB    . CYS D 4  105  ? 57.237  -33.447  60.258  1.00 132.76 ? 105  CYS A CB    1 
ATOM   1581  S  SG    . CYS D 4  105  ? 55.866  -34.123  61.262  1.00 132.01 ? 105  CYS A SG    1 
ATOM   1582  N  N     . VAL D 4  106  ? 59.850  -31.159  59.639  1.00 133.82 ? 106  VAL A N     1 
ATOM   1583  C  CA    . VAL D 4  106  ? 61.135  -31.066  58.919  1.00 134.49 ? 106  VAL A CA    1 
ATOM   1584  C  C     . VAL D 4  106  ? 62.096  -30.037  59.548  1.00 134.97 ? 106  VAL A C     1 
ATOM   1585  O  O     . VAL D 4  106  ? 61.757  -29.391  60.544  1.00 135.11 ? 106  VAL A O     1 
ATOM   1586  C  CB    . VAL D 4  106  ? 60.916  -30.782  57.396  1.00 134.38 ? 106  VAL A CB    1 
ATOM   1587  C  CG1   . VAL D 4  106  ? 62.238  -30.659  56.649  1.00 134.66 ? 106  VAL A CG1   1 
ATOM   1588  C  CG2   . VAL D 4  106  ? 60.098  -31.884  56.762  1.00 134.50 ? 106  VAL A CG2   1 
ATOM   1589  N  N     . CYS D 4  107  ? 63.299  -29.914  58.982  1.00 135.58 ? 107  CYS A N     1 
ATOM   1590  C  CA    . CYS D 4  107  ? 64.222  -28.851  59.357  1.00 135.71 ? 107  CYS A CA    1 
ATOM   1591  C  C     . CYS D 4  107  ? 64.396  -27.824  58.249  1.00 135.66 ? 107  CYS A C     1 
ATOM   1592  O  O     . CYS D 4  107  ? 64.674  -28.169  57.099  1.00 135.53 ? 107  CYS A O     1 
ATOM   1593  C  CB    . CYS D 4  107  ? 65.587  -29.413  59.751  1.00 136.10 ? 107  CYS A CB    1 
ATOM   1594  S  SG    . CYS D 4  107  ? 66.748  -28.139  60.368  1.00 136.70 ? 107  CYS A SG    1 
ATOM   1595  N  N     . MET D 4  108  ? 64.232  -26.557  58.621  1.00 135.71 ? 108  MET A N     1 
ATOM   1596  C  CA    . MET D 4  108  ? 64.516  -25.430  57.738  1.00 135.77 ? 108  MET A CA    1 
ATOM   1597  C  C     . MET D 4  108  ? 66.020  -25.316  57.541  1.00 135.59 ? 108  MET A C     1 
ATOM   1598  O  O     . MET D 4  108  ? 66.777  -25.372  58.515  1.00 135.68 ? 108  MET A O     1 
ATOM   1599  C  CB    . MET D 4  108  ? 63.960  -24.131  58.334  1.00 135.99 ? 108  MET A CB    1 
ATOM   1600  C  CG    . MET D 4  108  ? 62.472  -24.195  58.676  1.00 136.32 ? 108  MET A CG    1 
ATOM   1601  S  SD    . MET D 4  108  ? 61.500  -25.028  57.394  1.00 137.13 ? 108  MET A SD    1 
ATOM   1602  C  CE    . MET D 4  108  ? 59.836  -24.584  57.897  1.00 136.87 ? 108  MET A CE    1 
ATOM   1603  N  N     . HIS D 4  109  ? 66.435  -25.149  56.283  1.00 135.26 ? 109  HIS A N     1 
ATOM   1604  C  CA    . HIS D 4  109  ? 67.850  -25.192  55.860  1.00 134.91 ? 109  HIS A CA    1 
ATOM   1605  C  C     . HIS D 4  109  ? 68.266  -26.602  55.398  1.00 134.60 ? 109  HIS A C     1 
ATOM   1606  O  O     . HIS D 4  109  ? 68.215  -26.900  54.202  1.00 134.59 ? 109  HIS A O     1 
ATOM   1607  C  CB    . HIS D 4  109  ? 68.822  -24.632  56.925  1.00 134.87 ? 109  HIS A CB    1 
ATOM   1608  C  CG    . HIS D 4  109  ? 68.630  -23.173  57.220  1.00 134.95 ? 109  HIS A CG    1 
ATOM   1609  N  ND1   . HIS D 4  109  ? 69.380  -22.185  56.616  1.00 135.09 ? 109  HIS A ND1   1 
ATOM   1610  C  CD2   . HIS D 4  109  ? 67.777  -22.537  58.061  1.00 134.98 ? 109  HIS A CD2   1 
ATOM   1611  C  CE1   . HIS D 4  109  ? 68.995  -21.004  57.068  1.00 135.15 ? 109  HIS A CE1   1 
ATOM   1612  N  NE2   . HIS D 4  109  ? 68.023  -21.189  57.946  1.00 135.09 ? 109  HIS A NE2   1 
ATOM   1613  N  N     . CYS D 4  110  ? 68.652  -27.462  56.343  1.00 134.15 ? 110  CYS A N     1 
ATOM   1614  C  CA    . CYS D 4  110  ? 69.198  -28.792  56.032  1.00 133.72 ? 110  CYS A CA    1 
ATOM   1615  C  C     . CYS D 4  110  ? 68.185  -29.776  55.430  1.00 132.82 ? 110  CYS A C     1 
ATOM   1616  O  O     . CYS D 4  110  ? 68.518  -30.518  54.505  1.00 132.80 ? 110  CYS A O     1 
ATOM   1617  C  CB    . CYS D 4  110  ? 69.871  -29.405  57.267  1.00 134.15 ? 110  CYS A CB    1 
ATOM   1618  S  SG    . CYS D 4  110  ? 68.731  -30.075  58.531  1.00 135.88 ? 110  CYS A SG    1 
ATOM   1619  N  N     . GLY D 4  111  ? 66.963  -29.783  55.960  1.00 131.79 ? 111  GLY A N     1 
ATOM   1620  C  CA    . GLY D 4  111  ? 65.913  -30.680  55.477  1.00 130.47 ? 111  GLY A CA    1 
ATOM   1621  C  C     . GLY D 4  111  ? 66.183  -32.126  55.839  1.00 129.54 ? 111  GLY A C     1 
ATOM   1622  O  O     . GLY D 4  111  ? 66.786  -32.865  55.064  1.00 129.62 ? 111  GLY A O     1 
ATOM   1623  N  N     . LYS D 4  112  ? 65.734  -32.529  57.023  1.00 128.55 ? 112  LYS A N     1 
ATOM   1624  C  CA    . LYS D 4  112  ? 65.914  -33.901  57.484  1.00 127.43 ? 112  LYS A CA    1 
ATOM   1625  C  C     . LYS D 4  112  ? 65.333  -34.093  58.881  1.00 126.76 ? 112  LYS A C     1 
ATOM   1626  O  O     . LYS D 4  112  ? 65.255  -33.149  59.667  1.00 126.53 ? 112  LYS A O     1 
ATOM   1627  C  CB    . LYS D 4  112  ? 67.396  -34.279  57.474  1.00 127.67 ? 112  LYS A CB    1 
ATOM   1628  C  CG    . LYS D 4  112  ? 67.754  -35.413  58.422  1.00 127.38 ? 112  LYS A CG    1 
ATOM   1629  C  CD    . LYS D 4  112  ? 69.111  -35.185  59.067  1.00 126.85 ? 112  LYS A CD    1 
ATOM   1630  C  CE    . LYS D 4  112  ? 69.632  -36.456  59.718  1.00 125.58 ? 112  LYS A CE    1 
ATOM   1631  N  NZ    . LYS D 4  112  ? 70.678  -36.168  60.739  1.00 125.58 ? 112  LYS A NZ    1 
ATOM   1632  N  N     . LEU D 4  113  ? 64.927  -35.322  59.183  1.00 125.87 ? 113  LEU A N     1 
ATOM   1633  C  CA    . LEU D 4  113  ? 63.977  -35.572  60.261  1.00 125.24 ? 113  LEU A CA    1 
ATOM   1634  C  C     . LEU D 4  113  ? 64.464  -34.970  61.575  1.00 124.87 ? 113  LEU A C     1 
ATOM   1635  O  O     . LEU D 4  113  ? 65.586  -34.471  61.662  1.00 124.69 ? 113  LEU A O     1 
ATOM   1636  C  CB    . LEU D 4  113  ? 63.738  -37.074  60.427  1.00 125.24 ? 113  LEU A CB    1 
ATOM   1637  C  CG    . LEU D 4  113  ? 62.426  -37.618  59.857  1.00 125.07 ? 113  LEU A CG    1 
ATOM   1638  C  CD1   . LEU D 4  113  ? 62.325  -39.119  60.080  1.00 125.39 ? 113  LEU A CD1   1 
ATOM   1639  C  CD2   . LEU D 4  113  ? 61.234  -36.899  60.470  1.00 124.36 ? 113  LEU A CD2   1 
ATOM   1640  N  N     . LEU D 4  114  ? 63.613  -35.021  62.594  1.00 124.64 ? 114  LEU A N     1 
ATOM   1641  C  CA    . LEU D 4  114  ? 63.828  -34.248  63.812  1.00 124.50 ? 114  LEU A CA    1 
ATOM   1642  C  C     . LEU D 4  114  ? 64.005  -35.160  65.020  1.00 124.78 ? 114  LEU A C     1 
ATOM   1643  O  O     . LEU D 4  114  ? 64.517  -34.740  66.058  1.00 124.78 ? 114  LEU A O     1 
ATOM   1644  C  CB    . LEU D 4  114  ? 62.663  -33.284  64.047  1.00 124.26 ? 114  LEU A CB    1 
ATOM   1645  C  CG    . LEU D 4  114  ? 62.596  -32.065  63.124  1.00 123.71 ? 114  LEU A CG    1 
ATOM   1646  C  CD1   . LEU D 4  114  ? 61.842  -30.925  63.793  1.00 123.16 ? 114  LEU A CD1   1 
ATOM   1647  C  CD2   . LEU D 4  114  ? 63.993  -31.622  62.716  1.00 123.11 ? 114  LEU A CD2   1 
ATOM   1648  N  N     . LEU D 4  115  ? 63.578  -36.411  64.879  1.00 125.10 ? 115  LEU A N     1 
ATOM   1649  C  CA    . LEU D 4  115  ? 63.686  -37.384  65.959  1.00 125.42 ? 115  LEU A CA    1 
ATOM   1650  C  C     . LEU D 4  115  ? 64.055  -38.764  65.424  1.00 125.74 ? 115  LEU A C     1 
ATOM   1651  O  O     . LEU D 4  115  ? 63.413  -39.761  65.755  1.00 125.64 ? 115  LEU A O     1 
ATOM   1652  C  CB    . LEU D 4  115  ? 62.376  -37.459  66.746  1.00 125.31 ? 115  LEU A CB    1 
ATOM   1653  C  CG    . LEU D 4  115  ? 62.131  -36.342  67.763  1.00 125.09 ? 115  LEU A CG    1 
ATOM   1654  C  CD1   . LEU D 4  115  ? 60.739  -36.458  68.364  1.00 124.97 ? 115  LEU A CD1   1 
ATOM   1655  C  CD2   . LEU D 4  115  ? 63.193  -36.364  68.851  1.00 124.58 ? 115  LEU A CD2   1 
ATOM   1656  N  N     . ASP D 4  116  ? 65.092  -38.814  64.595  1.00 126.28 ? 116  ASP A N     1 
ATOM   1657  C  CA    . ASP D 4  116  ? 65.976  -39.972  64.542  1.00 126.68 ? 116  ASP A CA    1 
ATOM   1658  C  C     . ASP D 4  116  ? 66.682  -40.189  65.876  1.00 126.61 ? 116  ASP A C     1 
ATOM   1659  O  O     . ASP D 4  116  ? 67.240  -39.256  66.453  1.00 126.63 ? 116  ASP A O     1 
ATOM   1660  C  CB    . ASP D 4  116  ? 67.006  -39.810  63.422  1.00 126.86 ? 116  ASP A CB    1 
ATOM   1661  C  CG    . ASP D 4  116  ? 66.368  -39.471  62.089  1.00 127.64 ? 116  ASP A CG    1 
ATOM   1662  O  OD1   . ASP D 4  116  ? 65.124  -39.520  61.994  1.00 127.76 ? 116  ASP A OD1   1 
ATOM   1663  O  OD2   . ASP D 4  116  ? 67.112  -39.156  61.136  1.00 128.26 ? 116  ASP A OD2   1 
ATOM   1664  N  N     . GLU D 4  117  ? 66.653  -41.426  66.361  1.00 126.61 ? 117  GLU A N     1 
ATOM   1665  C  CA    . GLU D 4  117  ? 65.879  -42.482  65.720  1.00 126.53 ? 117  GLU A CA    1 
ATOM   1666  C  C     . GLU D 4  117  ? 65.781  -43.715  66.612  1.00 126.61 ? 117  GLU A C     1 
ATOM   1667  O  O     . GLU D 4  117  ? 64.767  -44.413  66.615  1.00 126.63 ? 117  GLU A O     1 
ATOM   1668  C  CB    . GLU D 4  117  ? 66.497  -42.857  64.372  1.00 126.46 ? 117  GLU A CB    1 
ATOM   1669  C  CG    . GLU D 4  117  ? 65.522  -43.498  63.398  1.00 126.50 ? 117  GLU A CG    1 
ATOM   1670  C  CD    . GLU D 4  117  ? 65.928  -43.299  61.951  1.00 126.52 ? 117  GLU A CD    1 
ATOM   1671  O  OE1   . GLU D 4  117  ? 67.015  -43.779  61.566  1.00 126.60 ? 117  GLU A OE1   1 
ATOM   1672  O  OE2   . GLU D 4  117  ? 65.161  -42.662  61.199  1.00 125.82 ? 117  GLU A OE2   1 
ATOM   1673  N  N     . HIS D 4  118  ? 66.841  -43.977  67.369  1.00 126.78 ? 118  HIS A N     1 
ATOM   1674  C  CA    . HIS D 4  118  ? 67.200  -43.134  68.504  1.00 126.92 ? 118  HIS A CA    1 
ATOM   1675  C  C     . HIS D 4  118  ? 65.958  -42.580  69.194  1.00 127.03 ? 118  HIS A C     1 
ATOM   1676  O  O     . HIS D 4  118  ? 64.869  -42.573  68.621  1.00 127.05 ? 118  HIS A O     1 
ATOM   1677  C  CB    . HIS D 4  118  ? 68.108  -41.987  68.053  1.00 126.87 ? 118  HIS A CB    1 
ATOM   1678  C  CG    . HIS D 4  118  ? 69.522  -42.403  67.794  1.00 126.79 ? 118  HIS A CG    1 
ATOM   1679  N  ND1   . HIS D 4  118  ? 70.481  -42.439  68.784  1.00 126.79 ? 118  HIS A ND1   1 
ATOM   1680  C  CD2   . HIS D 4  118  ? 70.141  -42.800  66.657  1.00 126.63 ? 118  HIS A CD2   1 
ATOM   1681  C  CE1   . HIS D 4  118  ? 71.629  -42.841  68.269  1.00 126.80 ? 118  HIS A CE1   1 
ATOM   1682  N  NE2   . HIS D 4  118  ? 71.450  -43.066  66.980  1.00 126.66 ? 118  HIS A NE2   1 
ATOM   1683  N  N     . ASN D 4  119  ? 66.131  -42.115  70.427  1.00 127.06 ? 119  ASN A N     1 
ATOM   1684  C  CA    . ASN D 4  119  ? 65.044  -41.503  71.172  1.00 127.16 ? 119  ASN A CA    1 
ATOM   1685  C  C     . ASN D 4  119  ? 63.840  -42.448  71.151  1.00 127.34 ? 119  ASN A C     1 
ATOM   1686  O  O     . ASN D 4  119  ? 63.035  -42.451  70.208  1.00 127.42 ? 119  ASN A O     1 
ATOM   1687  C  CB    . ASN D 4  119  ? 64.748  -40.103  70.606  1.00 127.11 ? 119  ASN A CB    1 
ATOM   1688  C  CG    . ASN D 4  119  ? 63.286  -39.717  70.715  1.00 126.98 ? 119  ASN A CG    1 
ATOM   1689  O  OD1   . ASN D 4  119  ? 62.738  -39.579  71.809  1.00 126.97 ? 119  ASN A OD1   1 
ATOM   1690  N  ND2   . ASN D 4  119  ? 62.647  -39.537  69.569  1.00 126.98 ? 119  ASN A ND2   1 
ATOM   1691  N  N     . GLU D 4  120  ? 63.742  -43.257  72.202  1.00 127.45 ? 120  GLU A N     1 
ATOM   1692  C  CA    . GLU D 4  120  ? 62.883  -44.442  72.216  1.00 127.64 ? 120  GLU A CA    1 
ATOM   1693  C  C     . GLU D 4  120  ? 61.359  -44.189  72.235  1.00 127.75 ? 120  GLU A C     1 
ATOM   1694  O  O     . GLU D 4  120  ? 60.608  -44.928  72.885  1.00 127.87 ? 120  GLU A O     1 
ATOM   1695  C  CB    . GLU D 4  120  ? 63.293  -45.346  73.378  1.00 127.59 ? 120  GLU A CB    1 
ATOM   1696  C  CG    . GLU D 4  120  ? 63.222  -46.823  73.060  1.00 127.82 ? 120  GLU A CG    1 
ATOM   1697  C  CD    . GLU D 4  120  ? 63.266  -47.697  74.300  1.00 128.54 ? 120  GLU A CD    1 
ATOM   1698  O  OE1   . GLU D 4  120  ? 64.107  -47.453  75.200  1.00 128.72 ? 120  GLU A OE1   1 
ATOM   1699  O  OE2   . GLU D 4  120  ? 62.454  -48.643  74.367  1.00 128.79 ? 120  GLU A OE2   1 
ATOM   1700  N  N     . LEU D 4  121  ? 60.906  -43.165  71.510  1.00 127.76 ? 121  LEU A N     1 
ATOM   1701  C  CA    . LEU D 4  121  ? 59.479  -42.877  71.389  1.00 127.79 ? 121  LEU A CA    1 
ATOM   1702  C  C     . LEU D 4  121  ? 59.138  -42.592  69.925  1.00 128.20 ? 121  LEU A C     1 
ATOM   1703  O  O     . LEU D 4  121  ? 57.996  -42.779  69.487  1.00 128.25 ? 121  LEU A O     1 
ATOM   1704  C  CB    . LEU D 4  121  ? 59.078  -41.713  72.301  1.00 127.56 ? 121  LEU A CB    1 
ATOM   1705  C  CG    . LEU D 4  121  ? 57.818  -41.876  73.160  1.00 126.77 ? 121  LEU A CG    1 
ATOM   1706  C  CD1   . LEU D 4  121  ? 57.905  -40.997  74.391  1.00 126.18 ? 121  LEU A CD1   1 
ATOM   1707  C  CD2   . LEU D 4  121  ? 56.567  -41.550  72.380  1.00 126.25 ? 121  LEU A CD2   1 
ATOM   1708  N  N     . MET D 4  122  ? 60.143  -42.144  69.174  1.00 128.56 ? 122  MET A N     1 
ATOM   1709  C  CA    . MET D 4  122  ? 60.052  -42.069  67.720  1.00 128.91 ? 122  MET A CA    1 
ATOM   1710  C  C     . MET D 4  122  ? 60.680  -43.329  67.149  1.00 128.90 ? 122  MET A C     1 
ATOM   1711  O  O     . MET D 4  122  ? 61.376  -43.301  66.130  1.00 128.91 ? 122  MET A O     1 
ATOM   1712  C  CB    . MET D 4  122  ? 60.764  -40.828  67.190  1.00 129.09 ? 122  MET A CB    1 
ATOM   1713  C  CG    . MET D 4  122  ? 60.236  -40.334  65.846  1.00 130.05 ? 122  MET A CG    1 
ATOM   1714  S  SD    . MET D 4  122  ? 58.479  -39.896  65.861  1.00 132.09 ? 122  MET A SD    1 
ATOM   1715  C  CE    . MET D 4  122  ? 58.423  -38.623  67.127  1.00 131.03 ? 122  MET A CE    1 
ATOM   1716  N  N     . ARG D 4  123  ? 60.434  -44.433  67.845  1.00 128.98 ? 123  ARG A N     1 
ATOM   1717  C  CA    . ARG D 4  123  ? 60.924  -45.734  67.449  1.00 128.96 ? 123  ARG A CA    1 
ATOM   1718  C  C     . ARG D 4  123  ? 59.744  -46.612  67.075  1.00 129.20 ? 123  ARG A C     1 
ATOM   1719  O  O     . ARG D 4  123  ? 59.698  -47.128  65.960  1.00 129.23 ? 123  ARG A O     1 
ATOM   1720  C  CB    . ARG D 4  123  ? 61.767  -46.361  68.560  1.00 128.91 ? 123  ARG A CB    1 
ATOM   1721  C  CG    . ARG D 4  123  ? 63.186  -45.797  68.642  1.00 128.73 ? 123  ARG A CG    1 
ATOM   1722  C  CD    . ARG D 4  123  ? 64.095  -46.625  69.547  1.00 128.57 ? 123  ARG A CD    1 
ATOM   1723  N  NE    . ARG D 4  123  ? 64.255  -47.994  69.063  1.00 127.45 ? 123  ARG A NE    1 
ATOM   1724  C  CZ    . ARG D 4  123  ? 63.586  -49.044  69.530  1.00 126.93 ? 123  ARG A CZ    1 
ATOM   1725  N  NH1   . ARG D 4  123  ? 62.702  -48.902  70.508  1.00 126.75 ? 123  ARG A NH1   1 
ATOM   1726  N  NH2   . ARG D 4  123  ? 63.802  -50.244  69.014  1.00 126.49 ? 123  ARG A NH2   1 
ATOM   1727  N  N     . GLN D 4  124  ? 58.785  -46.761  67.992  1.00 129.45 ? 124  GLN A N     1 
ATOM   1728  C  CA    . GLN D 4  124  ? 57.556  -47.523  67.714  1.00 129.75 ? 124  GLN A CA    1 
ATOM   1729  C  C     . GLN D 4  124  ? 56.624  -46.715  66.809  1.00 130.03 ? 124  GLN A C     1 
ATOM   1730  O  O     . GLN D 4  124  ? 55.837  -47.282  66.031  1.00 130.14 ? 124  GLN A O     1 
ATOM   1731  C  CB    . GLN D 4  124  ? 56.811  -47.918  68.996  1.00 129.60 ? 124  GLN A CB    1 
ATOM   1732  C  CG    . GLN D 4  124  ? 57.495  -47.529  70.286  1.00 129.39 ? 124  GLN A CG    1 
ATOM   1733  C  CD    . GLN D 4  124  ? 57.274  -46.071  70.630  1.00 129.10 ? 124  GLN A CD    1 
ATOM   1734  O  OE1   . GLN D 4  124  ? 56.657  -45.324  69.863  1.00 128.33 ? 124  GLN A OE1   1 
ATOM   1735  N  NE2   . GLN D 4  124  ? 57.776  -45.655  71.790  1.00 129.19 ? 124  GLN A NE2   1 
ATOM   1736  N  N     . ALA D 4  125  ? 56.716  -45.390  66.923  1.00 130.16 ? 125  ALA A N     1 
ATOM   1737  C  CA    . ALA D 4  125  ? 55.981  -44.489  66.045  1.00 130.19 ? 125  ALA A CA    1 
ATOM   1738  C  C     . ALA D 4  125  ? 56.537  -44.548  64.620  1.00 130.19 ? 125  ALA A C     1 
ATOM   1739  O  O     . ALA D 4  125  ? 55.771  -44.508  63.664  1.00 130.19 ? 125  ALA A O     1 
ATOM   1740  C  CB    . ALA D 4  125  ? 56.011  -43.069  66.590  1.00 130.20 ? 125  ALA A CB    1 
ATOM   1741  N  N     . LEU D 4  126  ? 57.862  -44.664  64.489  1.00 130.25 ? 126  LEU A N     1 
ATOM   1742  C  CA    . LEU D 4  126  ? 58.528  -44.748  63.179  1.00 130.33 ? 126  LEU A CA    1 
ATOM   1743  C  C     . LEU D 4  126  ? 58.387  -46.133  62.526  1.00 130.54 ? 126  LEU A C     1 
ATOM   1744  O  O     . LEU D 4  126  ? 58.387  -46.247  61.294  1.00 130.59 ? 126  LEU A O     1 
ATOM   1745  C  CB    . LEU D 4  126  ? 60.013  -44.357  63.295  1.00 130.23 ? 126  LEU A CB    1 
ATOM   1746  C  CG    . LEU D 4  126  ? 60.686  -43.563  62.159  1.00 129.87 ? 126  LEU A CG    1 
ATOM   1747  C  CD1   . LEU D 4  126  ? 61.865  -42.758  62.699  1.00 129.06 ? 126  LEU A CD1   1 
ATOM   1748  C  CD2   . LEU D 4  126  ? 61.109  -44.427  60.958  1.00 129.11 ? 126  LEU A CD2   1 
ATOM   1749  N  N     . ALA D 4  127  ? 58.272  -47.174  63.353  1.00 130.76 ? 127  ALA A N     1 
ATOM   1750  C  CA    . ALA D 4  127  ? 58.133  -48.550  62.868  1.00 130.95 ? 127  ALA A CA    1 
ATOM   1751  C  C     . ALA D 4  127  ? 56.731  -48.821  62.335  1.00 131.18 ? 127  ALA A C     1 
ATOM   1752  O  O     . ALA D 4  127  ? 56.588  -49.383  61.246  1.00 131.23 ? 127  ALA A O     1 
ATOM   1753  C  CB    . ALA D 4  127  ? 58.498  -49.554  63.959  1.00 130.84 ? 127  ALA A CB    1 
ATOM   1754  N  N     . ILE D 4  128  ? 55.717  -48.400  63.099  1.00 131.51 ? 128  ILE A N     1 
ATOM   1755  C  CA    . ILE D 4  128  ? 54.294  -48.620  62.767  1.00 131.85 ? 128  ILE A CA    1 
ATOM   1756  C  C     . ILE D 4  128  ? 53.964  -48.407  61.274  1.00 132.29 ? 128  ILE A C     1 
ATOM   1757  O  O     . ILE D 4  128  ? 54.222  -47.341  60.708  1.00 132.15 ? 128  ILE A O     1 
ATOM   1758  C  CB    . ILE D 4  128  ? 53.318  -47.839  63.742  1.00 131.82 ? 128  ILE A CB    1 
ATOM   1759  C  CG1   . ILE D 4  128  ? 51.847  -48.158  63.438  1.00 131.57 ? 128  ILE A CG1   1 
ATOM   1760  C  CG2   . ILE D 4  128  ? 53.579  -46.335  63.737  1.00 131.49 ? 128  ILE A CG2   1 
ATOM   1761  C  CD1   . ILE D 4  128  ? 50.878  -47.731  64.531  1.00 131.59 ? 128  ILE A CD1   1 
ATOM   1762  N  N     . LYS D 4  129  ? 53.421  -49.449  60.647  1.00 132.81 ? 129  LYS A N     1 
ATOM   1763  C  CA    . LYS D 4  129  ? 53.170  -49.442  59.208  1.00 133.45 ? 129  LYS A CA    1 
ATOM   1764  C  C     . LYS D 4  129  ? 51.814  -48.852  58.868  1.00 133.59 ? 129  LYS A C     1 
ATOM   1765  O  O     . LYS D 4  129  ? 50.816  -49.153  59.531  1.00 133.44 ? 129  LYS A O     1 
ATOM   1766  C  CB    . LYS D 4  129  ? 53.293  -50.846  58.616  1.00 133.65 ? 129  LYS A CB    1 
ATOM   1767  C  CG    . LYS D 4  129  ? 54.724  -51.296  58.376  1.00 134.66 ? 129  LYS A CG    1 
ATOM   1768  C  CD    . LYS D 4  129  ? 54.792  -52.347  57.276  1.00 136.18 ? 129  LYS A CD    1 
ATOM   1769  C  CE    . LYS D 4  129  ? 56.232  -52.805  57.038  1.00 137.05 ? 129  LYS A CE    1 
ATOM   1770  N  NZ    . LYS D 4  129  ? 56.376  -53.528  55.736  1.00 137.66 ? 129  LYS A NZ    1 
ATOM   1771  N  N     . ASP D 4  130  ? 51.805  -48.031  57.815  1.00 133.91 ? 130  ASP A N     1 
ATOM   1772  C  CA    . ASP D 4  130  ? 50.650  -47.241  57.373  1.00 134.13 ? 130  ASP A CA    1 
ATOM   1773  C  C     . ASP D 4  130  ? 51.134  -45.892  56.844  1.00 133.99 ? 130  ASP A C     1 
ATOM   1774  O  O     . ASP D 4  130  ? 51.687  -45.079  57.591  1.00 134.04 ? 130  ASP A O     1 
ATOM   1775  C  CB    . ASP D 4  130  ? 49.670  -46.992  58.529  1.00 134.38 ? 130  ASP A CB    1 
ATOM   1776  C  CG    . ASP D 4  130  ? 48.215  -46.965  58.081  1.00 135.52 ? 130  ASP A CG    1 
ATOM   1777  O  OD1   . ASP D 4  130  ? 47.922  -46.509  56.941  1.00 137.13 ? 130  ASP A OD1   1 
ATOM   1778  O  OD2   . ASP D 4  130  ? 47.361  -47.404  58.890  1.00 135.95 ? 130  ASP A OD2   1 
ATOM   1779  N  N     . SER D 4  131  ? 50.920  -45.639  55.560  1.00 133.87 ? 131  SER A N     1 
ATOM   1780  C  CA    . SER D 4  131  ? 51.191  -44.309  55.023  1.00 133.83 ? 131  SER A CA    1 
ATOM   1781  C  C     . SER D 4  131  ? 50.510  -43.192  55.836  1.00 133.61 ? 131  SER A C     1 
ATOM   1782  O  O     . SER D 4  131  ? 50.971  -42.050  55.825  1.00 133.69 ? 131  SER A O     1 
ATOM   1783  C  CB    . SER D 4  131  ? 50.775  -44.214  53.549  1.00 133.93 ? 131  SER A CB    1 
ATOM   1784  O  OG    . SER D 4  131  ? 51.822  -44.687  52.695  1.00 134.18 ? 131  SER A OG    1 
ATOM   1785  N  N     . LYS D 4  132  ? 49.432  -43.531  56.550  1.00 133.18 ? 132  LYS A N     1 
ATOM   1786  C  CA    . LYS D 4  132  ? 48.551  -42.519  57.143  1.00 132.62 ? 132  LYS A CA    1 
ATOM   1787  C  C     . LYS D 4  132  ? 48.522  -42.430  58.673  1.00 132.16 ? 132  LYS A C     1 
ATOM   1788  O  O     . LYS D 4  132  ? 48.571  -41.327  59.210  1.00 132.15 ? 132  LYS A O     1 
ATOM   1789  C  CB    . LYS D 4  132  ? 47.135  -42.617  56.554  1.00 132.65 ? 132  LYS A CB    1 
ATOM   1790  C  CG    . LYS D 4  132  ? 46.963  -41.835  55.244  1.00 132.81 ? 132  LYS A CG    1 
ATOM   1791  C  CD    . LYS D 4  132  ? 45.952  -42.480  54.300  1.00 133.37 ? 132  LYS A CD    1 
ATOM   1792  C  CE    . LYS D 4  132  ? 44.501  -42.061  54.601  1.00 134.20 ? 132  LYS A CE    1 
ATOM   1793  N  NZ    . LYS D 4  132  ? 43.863  -42.738  55.786  1.00 134.32 ? 132  LYS A NZ    1 
ATOM   1794  N  N     . LYS D 4  133  ? 48.437  -43.563  59.372  1.00 131.62 ? 133  LYS A N     1 
ATOM   1795  C  CA    . LYS D 4  133  ? 48.373  -43.548  60.853  1.00 131.01 ? 133  LYS A CA    1 
ATOM   1796  C  C     . LYS D 4  133  ? 49.760  -43.470  61.508  1.00 130.57 ? 133  LYS A C     1 
ATOM   1797  O  O     . LYS D 4  133  ? 49.874  -43.193  62.708  1.00 130.40 ? 133  LYS A O     1 
ATOM   1798  C  CB    . LYS D 4  133  ? 47.548  -44.726  61.420  1.00 130.98 ? 133  LYS A CB    1 
ATOM   1799  C  CG    . LYS D 4  133  ? 46.013  -44.539  61.369  1.00 130.74 ? 133  LYS A CG    1 
ATOM   1800  C  CD    . LYS D 4  133  ? 45.402  -45.096  60.066  1.00 130.11 ? 133  LYS A CD    1 
ATOM   1801  C  CE    . LYS D 4  133  ? 44.274  -44.217  59.510  1.00 129.32 ? 133  LYS A CE    1 
ATOM   1802  N  NZ    . LYS D 4  133  ? 43.831  -44.624  58.143  1.00 128.37 ? 133  LYS A NZ    1 
ATOM   1803  N  N     . ARG D 4  134  ? 50.800  -43.708  60.704  1.00 130.04 ? 134  ARG A N     1 
ATOM   1804  C  CA    . ARG D 4  134  ? 52.198  -43.592  61.137  1.00 129.36 ? 134  ARG A CA    1 
ATOM   1805  C  C     . ARG D 4  134  ? 52.569  -42.127  61.215  1.00 129.02 ? 134  ARG A C     1 
ATOM   1806  O  O     . ARG D 4  134  ? 53.103  -41.663  62.223  1.00 128.88 ? 134  ARG A O     1 
ATOM   1807  C  CB    . ARG D 4  134  ? 53.125  -44.294  60.146  1.00 129.24 ? 134  ARG A CB    1 
ATOM   1808  C  CG    . ARG D 4  134  ? 54.583  -44.249  60.513  1.00 128.61 ? 134  ARG A CG    1 
ATOM   1809  C  CD    . ARG D 4  134  ? 55.446  -44.398  59.291  1.00 128.10 ? 134  ARG A CD    1 
ATOM   1810  N  NE    . ARG D 4  134  ? 55.339  -45.710  58.662  1.00 128.25 ? 134  ARG A NE    1 
ATOM   1811  C  CZ    . ARG D 4  134  ? 55.511  -45.929  57.361  1.00 128.76 ? 134  ARG A CZ    1 
ATOM   1812  N  NH1   . ARG D 4  134  ? 55.785  -44.921  56.543  1.00 128.66 ? 134  ARG A NH1   1 
ATOM   1813  N  NH2   . ARG D 4  134  ? 55.391  -47.155  56.867  1.00 129.14 ? 134  ARG A NH2   1 
ATOM   1814  N  N     . PHE D 4  135  ? 52.287  -41.415  60.127  1.00 128.67 ? 135  PHE A N     1 
ATOM   1815  C  CA    . PHE D 4  135  ? 52.402  -39.961  60.064  1.00 128.32 ? 135  PHE A CA    1 
ATOM   1816  C  C     . PHE D 4  135  ? 51.725  -39.339  61.294  1.00 127.96 ? 135  PHE A C     1 
ATOM   1817  O  O     . PHE D 4  135  ? 52.345  -38.567  62.030  1.00 128.12 ? 135  PHE A O     1 
ATOM   1818  C  CB    . PHE D 4  135  ? 51.770  -39.458  58.755  1.00 128.37 ? 135  PHE A CB    1 
ATOM   1819  C  CG    . PHE D 4  135  ? 51.982  -37.987  58.473  1.00 128.29 ? 135  PHE A CG    1 
ATOM   1820  C  CD1   . PHE D 4  135  ? 52.943  -37.578  57.553  1.00 127.78 ? 135  PHE A CD1   1 
ATOM   1821  C  CD2   . PHE D 4  135  ? 51.185  -37.011  59.093  1.00 128.53 ? 135  PHE A CD2   1 
ATOM   1822  C  CE1   . PHE D 4  135  ? 53.132  -36.220  57.274  1.00 128.25 ? 135  PHE A CE1   1 
ATOM   1823  C  CE2   . PHE D 4  135  ? 51.363  -35.648  58.823  1.00 128.45 ? 135  PHE A CE2   1 
ATOM   1824  C  CZ    . PHE D 4  135  ? 52.341  -35.252  57.912  1.00 128.40 ? 135  PHE A CZ    1 
ATOM   1825  N  N     . ALA D 4  136  ? 50.469  -39.710  61.526  1.00 127.39 ? 136  ALA A N     1 
ATOM   1826  C  CA    . ALA D 4  136  ? 49.701  -39.213  62.661  1.00 126.89 ? 136  ALA A CA    1 
ATOM   1827  C  C     . ALA D 4  136  ? 50.481  -39.312  63.968  1.00 126.50 ? 136  ALA A C     1 
ATOM   1828  O  O     . ALA D 4  136  ? 50.563  -38.346  64.720  1.00 126.29 ? 136  ALA A O     1 
ATOM   1829  C  CB    . ALA D 4  136  ? 48.380  -39.961  62.768  1.00 127.07 ? 136  ALA A CB    1 
ATOM   1830  N  N     . ALA D 4  137  ? 51.065  -40.477  64.223  1.00 126.13 ? 137  ALA A N     1 
ATOM   1831  C  CA    . ALA D 4  137  ? 51.834  -40.686  65.440  1.00 125.91 ? 137  ALA A CA    1 
ATOM   1832  C  C     . ALA D 4  137  ? 53.114  -39.856  65.457  1.00 125.67 ? 137  ALA A C     1 
ATOM   1833  O  O     . ALA D 4  137  ? 53.518  -39.374  66.518  1.00 125.76 ? 137  ALA A O     1 
ATOM   1834  C  CB    . ALA D 4  137  ? 52.148  -42.163  65.630  1.00 126.14 ? 137  ALA A CB    1 
ATOM   1835  N  N     . ILE D 4  138  ? 53.738  -39.692  64.288  1.00 125.16 ? 138  ILE A N     1 
ATOM   1836  C  CA    . ILE D 4  138  ? 54.974  -38.923  64.158  1.00 124.68 ? 138  ILE A CA    1 
ATOM   1837  C  C     . ILE D 4  138  ? 54.742  -37.463  64.530  1.00 124.81 ? 138  ILE A C     1 
ATOM   1838  O  O     . ILE D 4  138  ? 55.327  -36.953  65.485  1.00 124.78 ? 138  ILE A O     1 
ATOM   1839  C  CB    . ILE D 4  138  ? 55.572  -39.038  62.731  1.00 124.49 ? 138  ILE A CB    1 
ATOM   1840  C  CG1   . ILE D 4  138  ? 56.437  -40.290  62.622  1.00 124.22 ? 138  ILE A CG1   1 
ATOM   1841  C  CG2   . ILE D 4  138  ? 56.419  -37.821  62.379  1.00 124.30 ? 138  ILE A CG2   1 
ATOM   1842  C  CD1   . ILE D 4  138  ? 56.899  -40.596  61.205  1.00 124.45 ? 138  ILE A CD1   1 
ATOM   1843  N  N     . TRP D 4  139  ? 53.853  -36.815  63.792  1.00 124.92 ? 139  TRP A N     1 
ATOM   1844  C  CA    . TRP D 4  139  ? 53.672  -35.377  63.871  1.00 125.26 ? 139  TRP A CA    1 
ATOM   1845  C  C     . TRP D 4  139  ? 53.204  -34.839  65.240  1.00 125.68 ? 139  TRP A C     1 
ATOM   1846  O  O     . TRP D 4  139  ? 53.540  -33.711  65.597  1.00 125.61 ? 139  TRP A O     1 
ATOM   1847  C  CB    . TRP D 4  139  ? 52.755  -34.930  62.728  1.00 125.13 ? 139  TRP A CB    1 
ATOM   1848  C  CG    . TRP D 4  139  ? 52.243  -33.551  62.855  1.00 125.01 ? 139  TRP A CG    1 
ATOM   1849  C  CD1   . TRP D 4  139  ? 52.810  -32.421  62.360  1.00 124.91 ? 139  TRP A CD1   1 
ATOM   1850  C  CD2   . TRP D 4  139  ? 51.050  -33.144  63.530  1.00 125.04 ? 139  TRP A CD2   1 
ATOM   1851  N  NE1   . TRP D 4  139  ? 52.046  -31.328  62.684  1.00 124.94 ? 139  TRP A NE1   1 
ATOM   1852  C  CE2   . TRP D 4  139  ? 50.959  -31.747  63.405  1.00 125.18 ? 139  TRP A CE2   1 
ATOM   1853  C  CE3   . TRP D 4  139  ? 50.051  -33.827  64.234  1.00 124.93 ? 139  TRP A CE3   1 
ATOM   1854  C  CZ2   . TRP D 4  139  ? 49.903  -31.016  63.955  1.00 125.45 ? 139  TRP A CZ2   1 
ATOM   1855  C  CZ3   . TRP D 4  139  ? 49.003  -33.101  64.780  1.00 124.86 ? 139  TRP A CZ3   1 
ATOM   1856  C  CH2   . TRP D 4  139  ? 48.936  -31.711  64.636  1.00 125.06 ? 139  TRP A CH2   1 
ATOM   1857  N  N     . THR D 4  140  ? 52.444  -35.631  65.999  1.00 126.34 ? 140  THR A N     1 
ATOM   1858  C  CA    . THR D 4  140  ? 51.961  -35.196  67.320  1.00 127.09 ? 140  THR A CA    1 
ATOM   1859  C  C     . THR D 4  140  ? 53.113  -35.167  68.299  1.00 127.81 ? 140  THR A C     1 
ATOM   1860  O  O     . THR D 4  140  ? 53.178  -34.296  69.169  1.00 127.86 ? 140  THR A O     1 
ATOM   1861  C  CB    . THR D 4  140  ? 50.913  -36.145  67.939  1.00 127.00 ? 140  THR A CB    1 
ATOM   1862  O  OG1   . THR D 4  140  ? 50.600  -37.207  67.032  1.00 127.31 ? 140  THR A OG1   1 
ATOM   1863  C  CG2   . THR D 4  140  ? 49.652  -35.378  68.340  1.00 126.69 ? 140  THR A CG2   1 
ATOM   1864  N  N     . LEU D 4  141  ? 54.008  -36.144  68.156  1.00 128.73 ? 141  LEU A N     1 
ATOM   1865  C  CA    . LEU D 4  141  ? 55.207  -36.251  68.988  1.00 129.64 ? 141  LEU A CA    1 
ATOM   1866  C  C     . LEU D 4  141  ? 56.412  -35.584  68.302  1.00 130.18 ? 141  LEU A C     1 
ATOM   1867  O  O     . LEU D 4  141  ? 57.571  -35.923  68.570  1.00 130.13 ? 141  LEU A O     1 
ATOM   1868  C  CB    . LEU D 4  141  ? 55.502  -37.725  69.318  1.00 129.66 ? 141  LEU A CB    1 
ATOM   1869  C  CG    . LEU D 4  141  ? 54.470  -38.540  70.115  1.00 129.73 ? 141  LEU A CG    1 
ATOM   1870  C  CD1   . LEU D 4  141  ? 54.528  -40.008  69.713  1.00 129.86 ? 141  LEU A CD1   1 
ATOM   1871  C  CD2   . LEU D 4  141  ? 54.640  -38.380  71.628  1.00 129.39 ? 141  LEU A CD2   1 
ATOM   1872  N  N     . CYS D 4  142  ? 56.121  -34.626  67.422  1.00 130.97 ? 142  CYS A N     1 
ATOM   1873  C  CA    . CYS D 4  142  ? 57.157  -33.892  66.707  1.00 131.51 ? 142  CYS A CA    1 
ATOM   1874  C  C     . CYS D 4  142  ? 56.894  -32.386  66.541  1.00 132.05 ? 142  CYS A C     1 
ATOM   1875  O  O     . CYS D 4  142  ? 57.840  -31.605  66.381  1.00 132.20 ? 142  CYS A O     1 
ATOM   1876  C  CB    . CYS D 4  142  ? 57.413  -34.524  65.349  1.00 131.40 ? 142  CYS A CB    1 
ATOM   1877  S  SG    . CYS D 4  142  ? 58.637  -33.616  64.419  1.00 131.40 ? 142  CYS A SG    1 
ATOM   1878  N  N     . LYS D 4  143  ? 55.627  -31.974  66.572  1.00 132.63 ? 143  LYS A N     1 
ATOM   1879  C  CA    . LYS D 4  143  ? 55.305  -30.539  66.555  1.00 133.18 ? 143  LYS A CA    1 
ATOM   1880  C  C     . LYS D 4  143  ? 55.654  -29.817  67.885  1.00 133.71 ? 143  LYS A C     1 
ATOM   1881  O  O     . LYS D 4  143  ? 55.238  -28.676  68.110  1.00 133.83 ? 143  LYS A O     1 
ATOM   1882  C  CB    . LYS D 4  143  ? 53.850  -30.279  66.085  1.00 133.07 ? 143  LYS A CB    1 
ATOM   1883  C  CG    . LYS D 4  143  ? 52.711  -30.833  66.969  1.00 132.65 ? 143  LYS A CG    1 
ATOM   1884  C  CD    . LYS D 4  143  ? 52.165  -29.800  67.971  1.00 131.47 ? 143  LYS A CD    1 
ATOM   1885  C  CE    . LYS D 4  143  ? 51.150  -28.852  67.347  1.00 130.29 ? 143  LYS A CE    1 
ATOM   1886  N  NZ    . LYS D 4  143  ? 49.812  -29.476  67.258  1.00 129.36 ? 143  LYS A NZ    1 
ATOM   1887  N  N     . THR D 4  144  ? 56.435  -30.479  68.744  1.00 134.24 ? 144  THR A N     1 
ATOM   1888  C  CA    . THR D 4  144  ? 56.884  -29.896  70.010  1.00 134.76 ? 144  THR A CA    1 
ATOM   1889  C  C     . THR D 4  144  ? 58.343  -29.435  69.938  1.00 135.29 ? 144  THR A C     1 
ATOM   1890  O  O     . THR D 4  144  ? 58.733  -28.513  70.662  1.00 135.46 ? 144  THR A O     1 
ATOM   1891  C  CB    . THR D 4  144  ? 56.727  -30.885  71.199  1.00 134.70 ? 144  THR A CB    1 
ATOM   1892  O  OG1   . THR D 4  144  ? 55.529  -31.649  71.043  1.00 134.64 ? 144  THR A OG1   1 
ATOM   1893  C  CG2   . THR D 4  144  ? 56.681  -30.142  72.538  1.00 134.67 ? 144  THR A CG2   1 
ATOM   1894  N  N     . LYS D 4  145  ? 59.140  -30.069  69.072  1.00 135.85 ? 145  LYS A N     1 
ATOM   1895  C  CA    . LYS D 4  145  ? 60.593  -29.807  69.013  1.00 136.37 ? 145  LYS A CA    1 
ATOM   1896  C  C     . LYS D 4  145  ? 60.983  -28.455  68.402  1.00 136.93 ? 145  LYS A C     1 
ATOM   1897  O  O     . LYS D 4  145  ? 60.885  -28.253  67.187  1.00 137.06 ? 145  LYS A O     1 
ATOM   1898  C  CB    . LYS D 4  145  ? 61.355  -30.958  68.332  1.00 136.17 ? 145  LYS A CB    1 
ATOM   1899  C  CG    . LYS D 4  145  ? 61.772  -32.087  69.278  1.00 135.53 ? 145  LYS A CG    1 
ATOM   1900  C  CD    . LYS D 4  145  ? 62.692  -31.595  70.391  1.00 134.14 ? 145  LYS A CD    1 
ATOM   1901  C  CE    . LYS D 4  145  ? 62.754  -32.590  71.530  1.00 133.45 ? 145  LYS A CE    1 
ATOM   1902  N  NZ    . LYS D 4  145  ? 63.353  -31.980  72.744  1.00 132.81 ? 145  LYS A NZ    1 
ATOM   1903  N  N     . MET D 4  146  ? 61.446  -27.555  69.270  1.00 137.54 ? 146  MET A N     1 
ATOM   1904  C  CA    . MET D 4  146  ? 61.805  -26.180  68.917  1.00 138.20 ? 146  MET A CA    1 
ATOM   1905  C  C     . MET D 4  146  ? 63.021  -26.100  67.980  1.00 138.67 ? 146  MET A C     1 
ATOM   1906  O  O     . MET D 4  146  ? 62.868  -25.811  66.790  1.00 138.66 ? 146  MET A O     1 
ATOM   1907  C  CB    . MET D 4  146  ? 62.057  -25.351  70.188  1.00 138.24 ? 146  MET A CB    1 
ATOM   1908  C  CG    . MET D 4  146  ? 61.094  -25.624  71.351  1.00 138.55 ? 146  MET A CG    1 
ATOM   1909  S  SD    . MET D 4  146  ? 61.811  -26.515  72.761  1.00 139.15 ? 146  MET A SD    1 
ATOM   1910  C  CE    . MET D 4  146  ? 61.489  -28.235  72.366  1.00 138.93 ? 146  MET A CE    1 
ATOM   1911  N  N     . VAL D 4  147  ? 64.212  -26.365  68.532  1.00 139.27 ? 147  VAL A N     1 
ATOM   1912  C  CA    . VAL D 4  147  ? 65.504  -26.321  67.804  1.00 139.73 ? 147  VAL A CA    1 
ATOM   1913  C  C     . VAL D 4  147  ? 65.822  -27.631  67.032  1.00 140.06 ? 147  VAL A C     1 
ATOM   1914  O  O     . VAL D 4  147  ? 65.106  -28.624  67.177  1.00 140.20 ? 147  VAL A O     1 
ATOM   1915  C  CB    . VAL D 4  147  ? 66.685  -25.915  68.755  1.00 139.70 ? 147  VAL A CB    1 
ATOM   1916  C  CG1   . VAL D 4  147  ? 66.600  -24.430  69.127  1.00 139.65 ? 147  VAL A CG1   1 
ATOM   1917  C  CG2   . VAL D 4  147  ? 66.718  -26.789  70.018  1.00 139.59 ? 147  VAL A CG2   1 
ATOM   1918  N  N     . CYS D 4  148  ? 66.881  -27.632  66.215  1.00 140.47 ? 148  CYS A N     1 
ATOM   1919  C  CA    . CYS D 4  148  ? 67.197  -28.786  65.341  1.00 140.73 ? 148  CYS A CA    1 
ATOM   1920  C  C     . CYS D 4  148  ? 68.046  -29.904  65.993  1.00 140.96 ? 148  CYS A C     1 
ATOM   1921  O  O     . CYS D 4  148  ? 68.103  -31.021  65.467  1.00 140.97 ? 148  CYS A O     1 
ATOM   1922  C  CB    . CYS D 4  148  ? 67.807  -28.317  63.997  1.00 140.73 ? 148  CYS A CB    1 
ATOM   1923  S  SG    . CYS D 4  148  ? 68.407  -29.648  62.877  1.00 140.75 ? 148  CYS A SG    1 
ATOM   1924  N  N     . GLU D 4  149  ? 68.676  -29.600  67.134  1.00 141.28 ? 149  GLU A N     1 
ATOM   1925  C  CA    . GLU D 4  149  ? 69.538  -30.534  67.905  1.00 141.55 ? 149  GLU A CA    1 
ATOM   1926  C  C     . GLU D 4  149  ? 71.037  -30.370  67.664  1.00 141.69 ? 149  GLU A C     1 
ATOM   1927  O  O     . GLU D 4  149  ? 71.499  -30.332  66.520  1.00 141.70 ? 149  GLU A O     1 
ATOM   1928  C  CB    . GLU D 4  149  ? 69.175  -32.007  67.683  1.00 141.53 ? 149  GLU A CB    1 
ATOM   1929  C  CG    . GLU D 4  149  ? 67.943  -32.486  68.412  1.00 141.86 ? 149  GLU A CG    1 
ATOM   1930  C  CD    . GLU D 4  149  ? 67.404  -33.779  67.827  1.00 142.47 ? 149  GLU A CD    1 
ATOM   1931  O  OE1   . GLU D 4  149  ? 68.169  -34.497  67.136  1.00 142.48 ? 149  GLU A OE1   1 
ATOM   1932  O  OE2   . GLU D 4  149  ? 66.211  -34.074  68.060  1.00 142.73 ? 149  GLU A OE2   1 
ATOM   1933  N  N     . THR D 4  150  ? 71.787  -30.290  68.761  1.00 141.86 ? 150  THR A N     1 
ATOM   1934  C  CA    . THR D 4  150  ? 73.237  -30.389  68.716  1.00 142.06 ? 150  THR A CA    1 
ATOM   1935  C  C     . THR D 4  150  ? 73.611  -31.870  68.511  1.00 142.21 ? 150  THR A C     1 
ATOM   1936  O  O     . THR D 4  150  ? 74.009  -32.258  67.408  1.00 142.19 ? 150  THR A O     1 
ATOM   1937  C  CB    . THR D 4  150  ? 73.899  -29.790  69.999  1.00 142.09 ? 150  THR A CB    1 
ATOM   1938  O  OG1   . THR D 4  150  ? 73.267  -28.549  70.339  1.00 142.21 ? 150  THR A OG1   1 
ATOM   1939  C  CG2   . THR D 4  150  ? 75.398  -29.542  69.796  1.00 142.01 ? 150  THR A CG2   1 
ATOM   1940  N  N     . ASP D 4  151  ? 73.442  -32.689  69.558  1.00 142.44 ? 151  ASP A N     1 
ATOM   1941  C  CA    . ASP D 4  151  ? 73.871  -34.108  69.563  1.00 142.62 ? 151  ASP A CA    1 
ATOM   1942  C  C     . ASP D 4  151  ? 72.927  -35.056  70.332  1.00 142.63 ? 151  ASP A C     1 
ATOM   1943  O  O     . ASP D 4  151  ? 72.049  -34.599  71.068  1.00 142.68 ? 151  ASP A O     1 
ATOM   1944  C  CB    . ASP D 4  151  ? 75.293  -34.231  70.131  1.00 142.73 ? 151  ASP A CB    1 
ATOM   1945  C  CG    . ASP D 4  151  ? 76.314  -33.425  69.342  1.00 142.99 ? 151  ASP A CG    1 
ATOM   1946  O  OD1   . ASP D 4  151  ? 76.999  -32.571  69.957  1.00 143.04 ? 151  ASP A OD1   1 
ATOM   1947  O  OD2   . ASP D 4  151  ? 76.423  -33.639  68.109  1.00 143.17 ? 151  ASP A OD2   1 
ATOM   1948  N  N     . VAL D 4  152  ? 73.134  -36.369  70.178  1.00 142.62 ? 152  VAL A N     1 
ATOM   1949  C  CA    . VAL D 4  152  ? 72.203  -37.394  70.705  1.00 142.62 ? 152  VAL A CA    1 
ATOM   1950  C  C     . VAL D 4  152  ? 72.734  -38.183  71.940  1.00 142.60 ? 152  VAL A C     1 
ATOM   1951  O  O     . VAL D 4  152  ? 73.948  -38.226  72.163  1.00 142.49 ? 152  VAL A O     1 
ATOM   1952  C  CB    . VAL D 4  152  ? 71.672  -38.356  69.564  1.00 142.67 ? 152  VAL A CB    1 
ATOM   1953  C  CG1   . VAL D 4  152  ? 70.928  -37.571  68.471  1.00 142.46 ? 152  VAL A CG1   1 
ATOM   1954  C  CG2   . VAL D 4  152  ? 72.788  -39.206  68.963  1.00 142.61 ? 152  VAL A CG2   1 
ATOM   1955  N  N     . PRO D 4  153  ? 71.820  -38.791  72.746  1.00 142.59 ? 153  PRO A N     1 
ATOM   1956  C  CA    . PRO D 4  153  ? 72.128  -39.479  74.020  1.00 142.60 ? 153  PRO A CA    1 
ATOM   1957  C  C     . PRO D 4  153  ? 73.058  -40.707  73.990  1.00 142.66 ? 153  PRO A C     1 
ATOM   1958  O  O     . PRO D 4  153  ? 73.146  -41.415  72.983  1.00 142.68 ? 153  PRO A O     1 
ATOM   1959  C  CB    . PRO D 4  153  ? 70.741  -39.905  74.530  1.00 142.52 ? 153  PRO A CB    1 
ATOM   1960  C  CG    . PRO D 4  153  ? 69.787  -39.010  73.845  1.00 142.47 ? 153  PRO A CG    1 
ATOM   1961  C  CD    . PRO D 4  153  ? 70.367  -38.820  72.485  1.00 142.58 ? 153  PRO A CD    1 
ATOM   1962  N  N     . SER D 4  154  ? 73.719  -40.942  75.129  1.00 142.76 ? 154  SER A N     1 
ATOM   1963  C  CA    . SER D 4  154  ? 74.598  -42.094  75.383  1.00 142.69 ? 154  SER A CA    1 
ATOM   1964  C  C     . SER D 4  154  ? 73.813  -43.419  75.461  1.00 142.71 ? 154  SER A C     1 
ATOM   1965  O  O     . SER D 4  154  ? 74.397  -44.506  75.395  1.00 142.66 ? 154  SER A O     1 
ATOM   1966  C  CB    . SER D 4  154  ? 75.395  -41.849  76.683  1.00 142.58 ? 154  SER A CB    1 
ATOM   1967  O  OG    . SER D 4  154  ? 75.945  -43.044  77.206  1.00 142.30 ? 154  SER A OG    1 
ATOM   1968  N  N     . LEU D 4  161  ? 75.918  -38.665  73.970  1.00 123.94 ? 161  LEU A N     1 
ATOM   1969  C  CA    . LEU D 4  161  ? 77.178  -37.965  74.190  1.00 123.99 ? 161  LEU A CA    1 
ATOM   1970  C  C     . LEU D 4  161  ? 78.059  -38.011  72.946  1.00 124.10 ? 161  LEU A C     1 
ATOM   1971  O  O     . LEU D 4  161  ? 79.253  -37.721  73.009  1.00 124.08 ? 161  LEU A O     1 
ATOM   1972  C  CB    . LEU D 4  161  ? 77.922  -38.566  75.384  1.00 123.92 ? 161  LEU A CB    1 
ATOM   1973  C  CG    . LEU D 4  161  ? 77.131  -38.683  76.688  1.00 123.63 ? 161  LEU A CG    1 
ATOM   1974  C  CD1   . LEU D 4  161  ? 77.797  -39.668  77.635  1.00 123.20 ? 161  LEU A CD1   1 
ATOM   1975  C  CD2   . LEU D 4  161  ? 76.976  -37.321  77.347  1.00 123.28 ? 161  LEU A CD2   1 
ATOM   1976  N  N     . VAL D 4  162  ? 77.461  -38.376  71.817  1.00 124.22 ? 162  VAL A N     1 
ATOM   1977  C  CA    . VAL D 4  162  ? 78.178  -38.366  70.515  1.00 124.31 ? 162  VAL A CA    1 
ATOM   1978  C  C     . VAL D 4  162  ? 77.135  -38.482  69.371  1.00 124.48 ? 162  VAL A C     1 
ATOM   1979  O  O     . VAL D 4  162  ? 76.050  -39.031  69.581  1.00 124.60 ? 162  VAL A O     1 
ATOM   1980  C  CB    . VAL D 4  162  ? 79.255  -39.527  70.423  1.00 124.32 ? 162  VAL A CB    1 
ATOM   1981  C  CG1   . VAL D 4  162  ? 79.495  -39.986  68.984  1.00 124.13 ? 162  VAL A CG1   1 
ATOM   1982  C  CG2   . VAL D 4  162  ? 80.590  -39.126  71.084  1.00 124.02 ? 162  VAL A CG2   1 
ATOM   1983  N  N     . SER D 4  163  ? 77.456  -37.944  68.184  1.00 124.59 ? 163  SER A N     1 
ATOM   1984  C  CA    . SER D 4  163  ? 76.584  -38.003  66.982  1.00 124.65 ? 163  SER A CA    1 
ATOM   1985  C  C     . SER D 4  163  ? 77.385  -37.856  65.676  1.00 124.77 ? 163  SER A C     1 
ATOM   1986  O  O     . SER D 4  163  ? 78.589  -38.103  65.655  1.00 124.85 ? 163  SER A O     1 
ATOM   1987  C  CB    . SER D 4  163  ? 75.515  -36.905  67.030  1.00 124.57 ? 163  SER A CB    1 
ATOM   1988  O  OG    . SER D 4  163  ? 74.708  -37.012  68.184  1.00 124.38 ? 163  SER A OG    1 
ATOM   1989  N  N     . ARG D 4  164  ? 76.705  -37.489  64.587  1.00 124.93 ? 164  ARG A N     1 
ATOM   1990  C  CA    . ARG D 4  164  ? 77.369  -36.953  63.381  1.00 125.01 ? 164  ARG A CA    1 
ATOM   1991  C  C     . ARG D 4  164  ? 76.485  -36.005  62.535  1.00 125.35 ? 164  ARG A C     1 
ATOM   1992  O  O     . ARG D 4  164  ? 76.988  -34.987  62.048  1.00 125.53 ? 164  ARG A O     1 
ATOM   1993  C  CB    . ARG D 4  164  ? 78.050  -38.034  62.511  1.00 124.80 ? 164  ARG A CB    1 
ATOM   1994  C  CG    . ARG D 4  164  ? 77.212  -39.254  62.180  1.00 124.07 ? 164  ARG A CG    1 
ATOM   1995  C  CD    . ARG D 4  164  ? 77.454  -39.716  60.746  1.00 122.87 ? 164  ARG A CD    1 
ATOM   1996  N  NE    . ARG D 4  164  ? 77.009  -38.731  59.756  1.00 122.15 ? 164  ARG A NE    1 
ATOM   1997  C  CZ    . ARG D 4  164  ? 75.735  -38.397  59.524  1.00 121.71 ? 164  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG D 4  164  ? 74.743  -38.951  60.214  1.00 121.34 ? 164  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG D 4  164  ? 75.449  -37.489  58.599  1.00 121.29 ? 164  ARG A NH2   1 
ATOM   2000  N  N     . GLY D 4  165  ? 75.192  -36.332  62.382  1.00 125.47 ? 165  GLY A N     1 
ATOM   2001  C  CA    . GLY D 4  165  ? 74.255  -35.550  61.550  1.00 125.55 ? 165  GLY A CA    1 
ATOM   2002  C  C     . GLY D 4  165  ? 73.271  -34.674  62.313  1.00 125.73 ? 165  GLY A C     1 
ATOM   2003  O  O     . GLY D 4  165  ? 72.728  -35.089  63.334  1.00 125.61 ? 165  GLY A O     1 
ATOM   2004  N  N     . GLY D 4  166  ? 73.037  -33.463  61.804  1.00 126.00 ? 166  GLY A N     1 
ATOM   2005  C  CA    . GLY D 4  166  ? 72.152  -32.483  62.448  1.00 126.57 ? 166  GLY A CA    1 
ATOM   2006  C  C     . GLY D 4  166  ? 72.733  -31.074  62.502  1.00 127.06 ? 166  GLY A C     1 
ATOM   2007  O  O     . GLY D 4  166  ? 73.957  -30.908  62.505  1.00 127.12 ? 166  GLY A O     1 
ATOM   2008  N  N     . CYS D 4  167  ? 71.859  -30.059  62.558  1.00 127.55 ? 167  CYS A N     1 
ATOM   2009  C  CA    . CYS D 4  167  ? 72.267  -28.630  62.520  1.00 128.09 ? 167  CYS A CA    1 
ATOM   2010  C  C     . CYS D 4  167  ? 71.362  -27.637  63.289  1.00 127.56 ? 167  CYS A C     1 
ATOM   2011  O  O     . CYS D 4  167  ? 70.556  -26.921  62.685  1.00 127.59 ? 167  CYS A O     1 
ATOM   2012  C  CB    . CYS D 4  167  ? 72.459  -28.155  61.066  1.00 128.79 ? 167  CYS A CB    1 
ATOM   2013  S  SG    . CYS D 4  167  ? 71.057  -28.330  59.863  1.00 131.36 ? 167  CYS A SG    1 
ATOM   2014  N  N     . GLY D 4  168  ? 71.542  -27.565  64.609  1.00 127.00 ? 168  GLY A N     1 
ATOM   2015  C  CA    . GLY D 4  168  ? 70.634  -26.840  65.523  1.00 126.21 ? 168  GLY A CA    1 
ATOM   2016  C  C     . GLY D 4  168  ? 70.228  -25.395  65.248  1.00 125.61 ? 168  GLY A C     1 
ATOM   2017  O  O     . GLY D 4  168  ? 70.909  -24.466  65.678  1.00 125.62 ? 168  GLY A O     1 
ATOM   2018  N  N     . ASN D 4  169  ? 69.102  -25.210  64.557  1.00 124.98 ? 169  ASN A N     1 
ATOM   2019  C  CA    . ASN D 4  169  ? 68.529  -23.887  64.304  1.00 124.34 ? 169  ASN A CA    1 
ATOM   2020  C  C     . ASN D 4  169  ? 67.173  -23.752  64.979  1.00 124.23 ? 169  ASN A C     1 
ATOM   2021  O  O     . ASN D 4  169  ? 66.375  -24.687  64.920  1.00 124.18 ? 169  ASN A O     1 
ATOM   2022  C  CB    . ASN D 4  169  ? 68.326  -23.665  62.801  1.00 124.17 ? 169  ASN A CB    1 
ATOM   2023  C  CG    . ASN D 4  169  ? 69.580  -23.913  61.985  1.00 123.40 ? 169  ASN A CG    1 
ATOM   2024  O  OD1   . ASN D 4  169  ? 70.688  -23.926  62.509  1.00 122.69 ? 169  ASN A OD1   1 
ATOM   2025  N  ND2   . ASN D 4  169  ? 69.405  -24.107  60.685  1.00 122.68 ? 169  ASN A ND2   1 
ATOM   2026  N  N     . THR D 4  170  ? 66.903  -22.598  65.600  1.00 124.08 ? 170  THR A N     1 
ATOM   2027  C  CA    . THR D 4  170  ? 65.546  -22.280  66.087  1.00 123.92 ? 170  THR A CA    1 
ATOM   2028  C  C     . THR D 4  170  ? 64.564  -22.441  64.911  1.00 123.97 ? 170  THR A C     1 
ATOM   2029  O  O     . THR D 4  170  ? 64.843  -22.008  63.787  1.00 124.02 ? 170  THR A O     1 
ATOM   2030  C  CB    . THR D 4  170  ? 65.428  -20.842  66.704  1.00 123.85 ? 170  THR A CB    1 
ATOM   2031  O  OG1   . THR D 4  170  ? 66.617  -20.506  67.427  1.00 123.23 ? 170  THR A OG1   1 
ATOM   2032  C  CG2   . THR D 4  170  ? 64.235  -20.747  67.651  1.00 123.66 ? 170  THR A CG2   1 
ATOM   2033  N  N     . GLN D 4  171  ? 63.434  -23.094  65.156  1.00 123.93 ? 171  GLN A N     1 
ATOM   2034  C  CA    . GLN D 4  171  ? 62.502  -23.407  64.069  1.00 123.86 ? 171  GLN A CA    1 
ATOM   2035  C  C     . GLN D 4  171  ? 61.104  -22.846  64.326  1.00 123.66 ? 171  GLN A C     1 
ATOM   2036  O  O     . GLN D 4  171  ? 60.581  -22.987  65.435  1.00 123.73 ? 171  GLN A O     1 
ATOM   2037  C  CB    . GLN D 4  171  ? 62.453  -24.910  63.813  1.00 123.89 ? 171  GLN A CB    1 
ATOM   2038  C  CG    . GLN D 4  171  ? 63.724  -25.458  63.203  1.00 124.10 ? 171  GLN A CG    1 
ATOM   2039  C  CD    . GLN D 4  171  ? 63.583  -26.906  62.837  1.00 124.44 ? 171  GLN A CD    1 
ATOM   2040  O  OE1   . GLN D 4  171  ? 62.939  -27.247  61.842  1.00 124.43 ? 171  GLN A OE1   1 
ATOM   2041  N  NE2   . GLN D 4  171  ? 64.175  -27.777  63.644  1.00 124.40 ? 171  GLN A NE2   1 
ATOM   2042  N  N     . PRO D 4  172  ? 60.485  -22.242  63.287  1.00 123.35 ? 172  PRO A N     1 
ATOM   2043  C  CA    . PRO D 4  172  ? 59.348  -21.341  63.481  1.00 122.95 ? 172  PRO A CA    1 
ATOM   2044  C  C     . PRO D 4  172  ? 58.091  -22.057  63.943  1.00 122.51 ? 172  PRO A C     1 
ATOM   2045  O  O     . PRO D 4  172  ? 57.872  -23.213  63.587  1.00 122.41 ? 172  PRO A O     1 
ATOM   2046  C  CB    . PRO D 4  172  ? 59.129  -20.760  62.085  1.00 122.97 ? 172  PRO A CB    1 
ATOM   2047  C  CG    . PRO D 4  172  ? 59.595  -21.835  61.167  1.00 123.24 ? 172  PRO A CG    1 
ATOM   2048  C  CD    . PRO D 4  172  ? 60.797  -22.418  61.855  1.00 123.37 ? 172  PRO A CD    1 
ATOM   2049  N  N     . THR D 4  173  ? 57.285  -21.372  64.745  1.00 122.09 ? 173  THR A N     1 
ATOM   2050  C  CA    . THR D 4  173  ? 55.968  -21.870  65.091  1.00 121.78 ? 173  THR A CA    1 
ATOM   2051  C  C     . THR D 4  173  ? 55.066  -21.437  63.930  1.00 121.68 ? 173  THR A C     1 
ATOM   2052  O  O     . THR D 4  173  ? 54.605  -20.291  63.889  1.00 121.70 ? 173  THR A O     1 
ATOM   2053  C  CB    . THR D 4  173  ? 55.474  -21.310  66.457  1.00 121.75 ? 173  THR A CB    1 
ATOM   2054  O  OG1   . THR D 4  173  ? 56.511  -20.477  67.049  1.00 121.89 ? 173  THR A OG1   1 
ATOM   2055  C  CG2   . THR D 4  173  ? 55.138  -22.467  67.424  1.00 121.44 ? 173  THR A CG2   1 
ATOM   2056  N  N     . ILE D 4  174  ? 54.854  -22.347  62.972  1.00 121.49 ? 174  ILE A N     1 
ATOM   2057  C  CA    . ILE D 4  174  ? 54.185  -22.024  61.700  1.00 121.23 ? 174  ILE A CA    1 
ATOM   2058  C  C     . ILE D 4  174  ? 52.683  -21.858  61.871  1.00 121.60 ? 174  ILE A C     1 
ATOM   2059  O  O     . ILE D 4  174  ? 52.075  -22.526  62.707  1.00 121.62 ? 174  ILE A O     1 
ATOM   2060  C  CB    . ILE D 4  174  ? 54.454  -23.077  60.594  1.00 120.96 ? 174  ILE A CB    1 
ATOM   2061  C  CG1   . ILE D 4  174  ? 55.906  -23.547  60.624  1.00 120.83 ? 174  ILE A CG1   1 
ATOM   2062  C  CG2   . ILE D 4  174  ? 54.135  -22.491  59.230  1.00 120.57 ? 174  ILE A CG2   1 
ATOM   2063  C  CD1   . ILE D 4  174  ? 56.272  -24.518  59.527  1.00 120.88 ? 174  ILE A CD1   1 
ATOM   2064  N  N     . ARG D 4  175  ? 52.094  -20.969  61.071  1.00 122.02 ? 175  ARG A N     1 
ATOM   2065  C  CA    . ARG D 4  175  ? 50.644  -20.723  61.090  1.00 122.62 ? 175  ARG A CA    1 
ATOM   2066  C  C     . ARG D 4  175  ? 50.044  -20.575  59.668  1.00 122.45 ? 175  ARG A C     1 
ATOM   2067  O  O     . ARG D 4  175  ? 50.788  -20.489  58.679  1.00 122.59 ? 175  ARG A O     1 
ATOM   2068  C  CB    . ARG D 4  175  ? 50.348  -19.494  61.953  1.00 122.54 ? 175  ARG A CB    1 
ATOM   2069  C  CG    . ARG D 4  175  ? 49.009  -19.523  62.686  1.00 123.07 ? 175  ARG A CG    1 
ATOM   2070  C  CD    . ARG D 4  175  ? 48.862  -18.300  63.594  1.00 123.57 ? 175  ARG A CD    1 
ATOM   2071  N  NE    . ARG D 4  175  ? 48.995  -17.032  62.861  1.00 125.76 ? 175  ARG A NE    1 
ATOM   2072  C  CZ    . ARG D 4  175  ? 50.014  -16.177  62.981  1.00 126.08 ? 175  ARG A CZ    1 
ATOM   2073  N  NH1   . ARG D 4  175  ? 51.016  -16.429  63.817  1.00 126.37 ? 175  ARG A NH1   1 
ATOM   2074  N  NH2   . ARG D 4  175  ? 50.029  -15.060  62.262  1.00 126.26 ? 175  ARG A NH2   1 
ATOM   2075  N  N     . LYS D 4  176  ? 48.712  -20.570  59.560  1.00 122.16 ? 176  LYS A N     1 
ATOM   2076  C  CA    . LYS D 4  176  ? 48.072  -20.347  58.263  1.00 121.88 ? 176  LYS A CA    1 
ATOM   2077  C  C     . LYS D 4  176  ? 47.548  -18.922  58.142  1.00 121.59 ? 176  LYS A C     1 
ATOM   2078  O  O     . LYS D 4  176  ? 46.952  -18.386  59.081  1.00 121.44 ? 176  LYS A O     1 
ATOM   2079  C  CB    . LYS D 4  176  ? 46.942  -21.351  57.983  1.00 122.08 ? 176  LYS A CB    1 
ATOM   2080  C  CG    . LYS D 4  176  ? 46.716  -21.592  56.484  1.00 122.13 ? 176  LYS A CG    1 
ATOM   2081  C  CD    . LYS D 4  176  ? 45.318  -22.088  56.129  1.00 122.49 ? 176  LYS A CD    1 
ATOM   2082  C  CE    . LYS D 4  176  ? 45.229  -22.347  54.611  1.00 122.95 ? 176  LYS A CE    1 
ATOM   2083  N  NZ    . LYS D 4  176  ? 43.854  -22.614  54.066  1.00 123.50 ? 176  LYS A NZ    1 
ATOM   2084  N  N     . ASP D 4  177  ? 47.791  -18.325  56.976  1.00 121.30 ? 177  ASP A N     1 
ATOM   2085  C  CA    . ASP D 4  177  ? 47.281  -17.003  56.622  1.00 120.99 ? 177  ASP A CA    1 
ATOM   2086  C  C     . ASP D 4  177  ? 46.969  -16.981  55.129  1.00 120.81 ? 177  ASP A C     1 
ATOM   2087  O  O     . ASP D 4  177  ? 47.881  -17.060  54.294  1.00 120.78 ? 177  ASP A O     1 
ATOM   2088  C  CB    . ASP D 4  177  ? 48.306  -15.924  56.974  1.00 120.98 ? 177  ASP A CB    1 
ATOM   2089  C  CG    . ASP D 4  177  ? 47.936  -14.565  56.424  1.00 120.97 ? 177  ASP A CG    1 
ATOM   2090  O  OD1   . ASP D 4  177  ? 47.217  -13.808  57.115  1.00 120.89 ? 177  ASP A OD1   1 
ATOM   2091  O  OD2   . ASP D 4  177  ? 48.383  -14.253  55.301  1.00 121.20 ? 177  ASP A OD2   1 
ATOM   2092  N  N     . GLY D 4  178  ? 45.682  -16.871  54.799  1.00 120.46 ? 178  GLY A N     1 
ATOM   2093  C  CA    . GLY D 4  178  ? 45.238  -16.979  53.419  1.00 120.02 ? 178  GLY A CA    1 
ATOM   2094  C  C     . GLY D 4  178  ? 45.808  -18.256  52.846  1.00 119.76 ? 178  GLY A C     1 
ATOM   2095  O  O     . GLY D 4  178  ? 45.476  -19.342  53.301  1.00 119.77 ? 178  GLY A O     1 
ATOM   2096  N  N     . LEU D 4  179  ? 46.694  -18.124  51.867  1.00 119.60 ? 179  LEU A N     1 
ATOM   2097  C  CA    . LEU D 4  179  ? 47.359  -19.284  51.278  1.00 119.57 ? 179  LEU A CA    1 
ATOM   2098  C  C     . LEU D 4  179  ? 48.847  -19.135  51.483  1.00 119.46 ? 179  LEU A C     1 
ATOM   2099  O  O     . LEU D 4  179  ? 49.644  -19.517  50.620  1.00 119.57 ? 179  LEU A O     1 
ATOM   2100  C  CB    . LEU D 4  179  ? 47.059  -19.391  49.783  1.00 119.59 ? 179  LEU A CB    1 
ATOM   2101  C  CG    . LEU D 4  179  ? 45.654  -18.968  49.354  1.00 119.96 ? 179  LEU A CG    1 
ATOM   2102  C  CD1   . LEU D 4  179  ? 45.671  -18.406  47.945  1.00 119.96 ? 179  LEU A CD1   1 
ATOM   2103  C  CD2   . LEU D 4  179  ? 44.644  -20.110  49.509  1.00 120.20 ? 179  LEU A CD2   1 
ATOM   2104  N  N     . LYS D 4  180  ? 49.209  -18.553  52.625  1.00 119.18 ? 180  LYS A N     1 
ATOM   2105  C  CA    . LYS D 4  180  ? 50.604  -18.310  52.971  1.00 118.82 ? 180  LYS A CA    1 
ATOM   2106  C  C     . LYS D 4  180  ? 50.913  -18.730  54.408  1.00 118.57 ? 180  LYS A C     1 
ATOM   2107  O  O     . LYS D 4  180  ? 50.014  -18.806  55.252  1.00 118.32 ? 180  LYS A O     1 
ATOM   2108  C  CB    . LYS D 4  180  ? 50.969  -16.845  52.715  1.00 118.88 ? 180  LYS A CB    1 
ATOM   2109  C  CG    . LYS D 4  180  ? 51.337  -16.566  51.257  1.00 118.86 ? 180  LYS A CG    1 
ATOM   2110  C  CD    . LYS D 4  180  ? 51.766  -15.123  51.051  1.00 118.48 ? 180  LYS A CD    1 
ATOM   2111  C  CE    . LYS D 4  180  ? 52.165  -14.890  49.607  1.00 118.12 ? 180  LYS A CE    1 
ATOM   2112  N  NZ    . LYS D 4  180  ? 52.348  -13.446  49.332  1.00 117.60 ? 180  LYS A NZ    1 
ATOM   2113  N  N     . LEU D 4  181  ? 52.192  -19.006  54.664  1.00 118.38 ? 181  LEU A N     1 
ATOM   2114  C  CA    . LEU D 4  181  ? 52.652  -19.579  55.935  1.00 118.11 ? 181  LEU A CA    1 
ATOM   2115  C  C     . LEU D 4  181  ? 53.680  -18.730  56.715  1.00 118.09 ? 181  LEU A C     1 
ATOM   2116  O  O     . LEU D 4  181  ? 54.774  -18.435  56.218  1.00 118.02 ? 181  LEU A O     1 
ATOM   2117  C  CB    . LEU D 4  181  ? 53.207  -20.979  55.681  1.00 117.98 ? 181  LEU A CB    1 
ATOM   2118  C  CG    . LEU D 4  181  ? 52.195  -22.029  55.225  1.00 117.30 ? 181  LEU A CG    1 
ATOM   2119  C  CD1   . LEU D 4  181  ? 52.882  -23.057  54.354  1.00 116.43 ? 181  LEU A CD1   1 
ATOM   2120  C  CD2   . LEU D 4  181  ? 51.508  -22.682  56.423  1.00 116.31 ? 181  LEU A CD2   1 
ATOM   2121  N  N     . VAL D 4  182  ? 53.316  -18.371  57.948  1.00 118.07 ? 182  VAL A N     1 
ATOM   2122  C  CA    . VAL D 4  182  ? 54.100  -17.465  58.806  1.00 118.10 ? 182  VAL A CA    1 
ATOM   2123  C  C     . VAL D 4  182  ? 55.349  -18.160  59.409  1.00 118.26 ? 182  VAL A C     1 
ATOM   2124  O  O     . VAL D 4  182  ? 55.989  -18.982  58.738  1.00 118.19 ? 182  VAL A O     1 
ATOM   2125  C  CB    . VAL D 4  182  ? 53.200  -16.811  59.922  1.00 118.04 ? 182  VAL A CB    1 
ATOM   2126  C  CG1   . VAL D 4  182  ? 53.857  -15.560  60.512  1.00 118.02 ? 182  VAL A CG1   1 
ATOM   2127  C  CG2   . VAL D 4  182  ? 51.829  -16.449  59.378  1.00 117.55 ? 182  VAL A CG2   1 
ATOM   2128  N  N     . GLY D 4  183  ? 55.694  -17.817  60.657  1.00 118.40 ? 183  GLY A N     1 
ATOM   2129  C  CA    . GLY D 4  183  ? 56.836  -18.414  61.360  1.00 118.51 ? 183  GLY A CA    1 
ATOM   2130  C  C     . GLY D 4  183  ? 57.452  -17.581  62.474  1.00 118.61 ? 183  GLY A C     1 
ATOM   2131  O  O     . GLY D 4  183  ? 58.406  -16.839  62.243  1.00 118.51 ? 183  GLY A O     1 
ATOM   2132  N  N     . SER D 4  184  ? 56.917  -17.729  63.686  1.00 118.79 ? 184  SER A N     1 
ATOM   2133  C  CA    . SER D 4  184  ? 57.391  -17.005  64.875  1.00 118.89 ? 184  SER A CA    1 
ATOM   2134  C  C     . SER D 4  184  ? 58.780  -17.434  65.320  1.00 119.26 ? 184  SER A C     1 
ATOM   2135  O  O     . SER D 4  184  ? 59.082  -18.623  65.378  1.00 119.21 ? 184  SER A O     1 
ATOM   2136  C  CB    . SER D 4  184  ? 56.409  -17.178  66.040  1.00 118.75 ? 184  SER A CB    1 
ATOM   2137  O  OG    . SER D 4  184  ? 57.060  -17.074  67.295  1.00 117.85 ? 184  SER A OG    1 
ATOM   2138  N  N     . TRP D 4  185  ? 59.613  -16.449  65.644  1.00 119.85 ? 185  TRP A N     1 
ATOM   2139  C  CA    . TRP D 4  185  ? 60.948  -16.703  66.180  1.00 120.36 ? 185  TRP A CA    1 
ATOM   2140  C  C     . TRP D 4  185  ? 61.241  -15.795  67.384  1.00 120.34 ? 185  TRP A C     1 
ATOM   2141  O  O     . TRP D 4  185  ? 61.580  -14.617  67.224  1.00 120.42 ? 185  TRP A O     1 
ATOM   2142  C  CB    . TRP D 4  185  ? 62.036  -16.563  65.087  1.00 120.80 ? 185  TRP A CB    1 
ATOM   2143  C  CG    . TRP D 4  185  ? 62.171  -17.756  64.117  1.00 121.42 ? 185  TRP A CG    1 
ATOM   2144  C  CD1   . TRP D 4  185  ? 62.459  -19.053  64.449  1.00 121.63 ? 185  TRP A CD1   1 
ATOM   2145  C  CD2   . TRP D 4  185  ? 62.058  -17.732  62.674  1.00 122.10 ? 185  TRP A CD2   1 
ATOM   2146  N  NE1   . TRP D 4  185  ? 62.515  -19.836  63.314  1.00 121.82 ? 185  TRP A NE1   1 
ATOM   2147  C  CE2   . TRP D 4  185  ? 62.272  -19.056  62.214  1.00 121.92 ? 185  TRP A CE2   1 
ATOM   2148  C  CE3   . TRP D 4  185  ? 61.788  -16.726  61.731  1.00 122.37 ? 185  TRP A CE3   1 
ATOM   2149  C  CZ2   . TRP D 4  185  ? 62.230  -19.399  60.850  1.00 121.40 ? 185  TRP A CZ2   1 
ATOM   2150  C  CZ3   . TRP D 4  185  ? 61.738  -17.074  60.369  1.00 121.83 ? 185  TRP A CZ3   1 
ATOM   2151  C  CH2   . TRP D 4  185  ? 61.959  -18.400  59.949  1.00 121.46 ? 185  TRP A CH2   1 
ATOM   2152  N  N     . LYS D 4  186  ? 61.049  -16.349  68.582  1.00 120.25 ? 186  LYS A N     1 
ATOM   2153  C  CA    . LYS D 4  186  ? 61.610  -15.810  69.827  1.00 120.27 ? 186  LYS A CA    1 
ATOM   2154  C  C     . LYS D 4  186  ? 61.631  -16.893  70.903  1.00 120.15 ? 186  LYS A C     1 
ATOM   2155  O  O     . LYS D 4  186  ? 61.851  -18.118  70.558  1.00 120.03 ? 186  LYS A O     1 
ATOM   2156  C  CB    . LYS D 4  186  ? 60.869  -14.566  70.338  1.00 120.23 ? 186  LYS A CB    1 
ATOM   2157  C  CG    . LYS D 4  186  ? 61.682  -13.789  71.396  1.00 120.36 ? 186  LYS A CG    1 
ATOM   2158  C  CD    . LYS D 4  186  ? 60.846  -12.789  72.199  1.00 120.47 ? 186  LYS A CD    1 
ATOM   2159  C  CE    . LYS D 4  186  ? 60.888  -11.382  71.606  1.00 120.91 ? 186  LYS A CE    1 
ATOM   2160  N  NZ    . LYS D 4  186  ? 60.155  -11.292  70.307  1.00 121.63 ? 186  LYS A NZ    1 
ATOM   2161  N  N     . LEU D 4  199  ? 58.798  -14.406  63.013  1.00 121.89 ? 199  LEU A N     1 
ATOM   2162  C  CA    . LEU D 4  199  ? 59.359  -13.158  62.506  1.00 121.85 ? 199  LEU A CA    1 
ATOM   2163  C  C     . LEU D 4  199  ? 59.178  -12.970  60.984  1.00 122.01 ? 199  LEU A C     1 
ATOM   2164  O  O     . LEU D 4  199  ? 59.314  -11.847  60.496  1.00 122.19 ? 199  LEU A O     1 
ATOM   2165  C  CB    . LEU D 4  199  ? 60.856  -13.017  62.875  1.00 121.65 ? 199  LEU A CB    1 
ATOM   2166  C  CG    . LEU D 4  199  ? 61.411  -13.128  64.306  1.00 121.03 ? 199  LEU A CG    1 
ATOM   2167  C  CD1   . LEU D 4  199  ? 62.939  -13.091  64.281  1.00 119.98 ? 199  LEU A CD1   1 
ATOM   2168  C  CD2   . LEU D 4  199  ? 60.865  -12.064  65.253  1.00 120.62 ? 199  LEU A CD2   1 
ATOM   2169  N  N     . ARG D 4  200  ? 58.867  -14.038  60.240  1.00 121.96 ? 200  ARG A N     1 
ATOM   2170  C  CA    . ARG D 4  200  ? 58.959  -13.990  58.768  1.00 121.97 ? 200  ARG A CA    1 
ATOM   2171  C  C     . ARG D 4  200  ? 58.029  -14.947  58.022  1.00 122.19 ? 200  ARG A C     1 
ATOM   2172  O  O     . ARG D 4  200  ? 57.880  -16.100  58.427  1.00 122.36 ? 200  ARG A O     1 
ATOM   2173  C  CB    . ARG D 4  200  ? 60.402  -14.284  58.343  1.00 121.88 ? 200  ARG A CB    1 
ATOM   2174  C  CG    . ARG D 4  200  ? 60.749  -13.906  56.914  1.00 121.42 ? 200  ARG A CG    1 
ATOM   2175  C  CD    . ARG D 4  200  ? 61.884  -14.767  56.399  1.00 120.59 ? 200  ARG A CD    1 
ATOM   2176  N  NE    . ARG D 4  200  ? 61.396  -16.006  55.798  1.00 120.02 ? 200  ARG A NE    1 
ATOM   2177  C  CZ    . ARG D 4  200  ? 62.105  -17.128  55.711  1.00 119.51 ? 200  ARG A CZ    1 
ATOM   2178  N  NH1   . ARG D 4  200  ? 63.336  -17.185  56.205  1.00 119.44 ? 200  ARG A NH1   1 
ATOM   2179  N  NH2   . ARG D 4  200  ? 61.577  -18.198  55.139  1.00 118.89 ? 200  ARG A NH2   1 
ATOM   2180  N  N     . VAL D 4  201  ? 57.434  -14.469  56.923  1.00 122.35 ? 201  VAL A N     1 
ATOM   2181  C  CA    . VAL D 4  201  ? 56.655  -15.316  55.991  1.00 122.36 ? 201  VAL A CA    1 
ATOM   2182  C  C     . VAL D 4  201  ? 57.569  -16.125  55.070  1.00 122.43 ? 201  VAL A C     1 
ATOM   2183  O  O     . VAL D 4  201  ? 58.452  -15.571  54.410  1.00 122.39 ? 201  VAL A O     1 
ATOM   2184  C  CB    . VAL D 4  201  ? 55.654  -14.504  55.120  1.00 122.30 ? 201  VAL A CB    1 
ATOM   2185  C  CG1   . VAL D 4  201  ? 54.265  -14.533  55.726  1.00 122.01 ? 201  VAL A CG1   1 
ATOM   2186  C  CG2   . VAL D 4  201  ? 56.141  -13.069  54.905  1.00 122.54 ? 201  VAL A CG2   1 
ATOM   2187  N  N     . LEU D 4  202  ? 57.341  -17.436  55.033  1.00 122.52 ? 202  LEU A N     1 
ATOM   2188  C  CA    . LEU D 4  202  ? 58.215  -18.370  54.323  1.00 122.62 ? 202  LEU A CA    1 
ATOM   2189  C  C     . LEU D 4  202  ? 57.838  -18.460  52.857  1.00 122.73 ? 202  LEU A C     1 
ATOM   2190  O  O     . LEU D 4  202  ? 56.867  -19.126  52.514  1.00 122.80 ? 202  LEU A O     1 
ATOM   2191  C  CB    . LEU D 4  202  ? 58.128  -19.764  54.958  1.00 122.59 ? 202  LEU A CB    1 
ATOM   2192  C  CG    . LEU D 4  202  ? 58.920  -20.153  56.213  1.00 122.44 ? 202  LEU A CG    1 
ATOM   2193  C  CD1   . LEU D 4  202  ? 58.905  -19.093  57.307  1.00 122.26 ? 202  LEU A CD1   1 
ATOM   2194  C  CD2   . LEU D 4  202  ? 58.386  -21.463  56.752  1.00 122.45 ? 202  LEU A CD2   1 
ATOM   2195  N  N     . SER D 4  203  ? 58.607  -17.800  51.994  1.00 123.01 ? 203  SER A N     1 
ATOM   2196  C  CA    . SER D 4  203  ? 58.308  -17.791  50.561  1.00 123.18 ? 203  SER A CA    1 
ATOM   2197  C  C     . SER D 4  203  ? 58.040  -19.189  50.073  1.00 123.22 ? 203  SER A C     1 
ATOM   2198  O  O     . SER D 4  203  ? 58.751  -20.137  50.409  1.00 122.99 ? 203  SER A O     1 
ATOM   2199  C  CB    . SER D 4  203  ? 59.423  -17.161  49.718  1.00 123.34 ? 203  SER A CB    1 
ATOM   2200  O  OG    . SER D 4  203  ? 59.177  -17.359  48.327  1.00 123.23 ? 203  SER A OG    1 
ATOM   2201  N  N     . THR D 4  204  ? 56.987  -19.284  49.281  1.00 123.51 ? 204  THR A N     1 
ATOM   2202  C  CA    . THR D 4  204  ? 56.521  -20.531  48.729  1.00 123.91 ? 204  THR A CA    1 
ATOM   2203  C  C     . THR D 4  204  ? 57.658  -21.260  48.018  1.00 124.27 ? 204  THR A C     1 
ATOM   2204  O  O     . THR D 4  204  ? 57.931  -22.427  48.301  1.00 124.33 ? 204  THR A O     1 
ATOM   2205  C  CB    . THR D 4  204  ? 55.365  -20.260  47.767  1.00 123.88 ? 204  THR A CB    1 
ATOM   2206  O  OG1   . THR D 4  204  ? 54.430  -19.369  48.397  1.00 123.52 ? 204  THR A OG1   1 
ATOM   2207  C  CG2   . THR D 4  204  ? 54.676  -21.560  47.376  1.00 124.04 ? 204  THR A CG2   1 
ATOM   2208  N  N     . GLU D 4  205  ? 58.329  -20.551  47.115  1.00 124.66 ? 205  GLU A N     1 
ATOM   2209  C  CA    . GLU D 4  205  ? 59.482  -21.084  46.399  1.00 125.02 ? 205  GLU A CA    1 
ATOM   2210  C  C     . GLU D 4  205  ? 60.576  -21.544  47.368  1.00 125.01 ? 205  GLU A C     1 
ATOM   2211  O  O     . GLU D 4  205  ? 61.210  -22.581  47.155  1.00 124.94 ? 205  GLU A O     1 
ATOM   2212  C  CB    . GLU D 4  205  ? 60.029  -20.019  45.449  1.00 125.11 ? 205  GLU A CB    1 
ATOM   2213  C  CG    . GLU D 4  205  ? 61.098  -20.500  44.475  1.00 125.05 ? 205  GLU A CG    1 
ATOM   2214  C  CD    . GLU D 4  205  ? 61.477  -19.420  43.478  1.00 125.24 ? 205  GLU A CD    1 
ATOM   2215  O  OE1   . GLU D 4  205  ? 61.624  -18.245  43.892  1.00 125.95 ? 205  GLU A OE1   1 
ATOM   2216  O  OE2   . GLU D 4  205  ? 61.624  -19.741  42.277  1.00 125.54 ? 205  GLU A OE2   1 
ATOM   2217  N  N     . GLU D 4  206  ? 60.767  -20.774  48.440  1.00 125.00 ? 206  GLU A N     1 
ATOM   2218  C  CA    . GLU D 4  206  ? 61.815  -21.030  49.429  1.00 124.98 ? 206  GLU A CA    1 
ATOM   2219  C  C     . GLU D 4  206  ? 61.589  -22.345  50.181  1.00 124.65 ? 206  GLU A C     1 
ATOM   2220  O  O     . GLU D 4  206  ? 62.412  -22.757  50.998  1.00 124.46 ? 206  GLU A O     1 
ATOM   2221  C  CB    . GLU D 4  206  ? 61.913  -19.841  50.396  1.00 125.16 ? 206  GLU A CB    1 
ATOM   2222  C  CG    . GLU D 4  206  ? 63.234  -19.710  51.151  1.00 125.85 ? 206  GLU A CG    1 
ATOM   2223  C  CD    . GLU D 4  206  ? 63.151  -20.222  52.579  1.00 126.76 ? 206  GLU A CD    1 
ATOM   2224  O  OE1   . GLU D 4  206  ? 64.095  -20.922  53.012  1.00 126.87 ? 206  GLU A OE1   1 
ATOM   2225  O  OE2   . GLU D 4  206  ? 62.143  -19.929  53.264  1.00 127.22 ? 206  GLU A OE2   1 
ATOM   2226  N  N     . ILE D 4  207  ? 60.477  -23.006  49.879  1.00 124.42 ? 207  ILE A N     1 
ATOM   2227  C  CA    . ILE D 4  207  ? 60.135  -24.265  50.519  1.00 124.22 ? 207  ILE A CA    1 
ATOM   2228  C  C     . ILE D 4  207  ? 60.257  -25.418  49.535  1.00 124.48 ? 207  ILE A C     1 
ATOM   2229  O  O     . ILE D 4  207  ? 60.442  -26.555  49.946  1.00 124.38 ? 207  ILE A O     1 
ATOM   2230  C  CB    . ILE D 4  207  ? 58.745  -24.209  51.151  1.00 123.94 ? 207  ILE A CB    1 
ATOM   2231  C  CG1   . ILE D 4  207  ? 58.664  -23.004  52.087  1.00 124.21 ? 207  ILE A CG1   1 
ATOM   2232  C  CG2   . ILE D 4  207  ? 58.478  -25.455  51.944  1.00 123.13 ? 207  ILE A CG2   1 
ATOM   2233  C  CD1   . ILE D 4  207  ? 57.268  -22.495  52.329  1.00 125.05 ? 207  ILE A CD1   1 
ATOM   2234  N  N     . LEU D 4  208  ? 60.164  -25.118  48.238  1.00 124.93 ? 208  LEU A N     1 
ATOM   2235  C  CA    . LEU D 4  208  ? 60.508  -26.082  47.182  1.00 125.27 ? 208  LEU A CA    1 
ATOM   2236  C  C     . LEU D 4  208  ? 61.966  -26.495  47.384  1.00 125.61 ? 208  LEU A C     1 
ATOM   2237  O  O     . LEU D 4  208  ? 62.305  -27.679  47.308  1.00 125.40 ? 208  LEU A O     1 
ATOM   2238  C  CB    . LEU D 4  208  ? 60.277  -25.469  45.780  1.00 125.17 ? 208  LEU A CB    1 
ATOM   2239  C  CG    . LEU D 4  208  ? 60.550  -26.120  44.397  1.00 124.95 ? 208  LEU A CG    1 
ATOM   2240  C  CD1   . LEU D 4  208  ? 61.707  -25.456  43.624  1.00 124.46 ? 208  LEU A CD1   1 
ATOM   2241  C  CD2   . LEU D 4  208  ? 60.705  -27.645  44.407  1.00 124.54 ? 208  LEU A CD2   1 
ATOM   2242  N  N     . ASN D 4  209  ? 62.809  -25.503  47.677  1.00 126.14 ? 209  ASN A N     1 
ATOM   2243  C  CA    . ASN D 4  209  ? 64.243  -25.712  47.911  1.00 126.59 ? 209  ASN A CA    1 
ATOM   2244  C  C     . ASN D 4  209  ? 64.467  -26.607  49.124  1.00 126.57 ? 209  ASN A C     1 
ATOM   2245  O  O     . ASN D 4  209  ? 65.288  -27.520  49.076  1.00 126.60 ? 209  ASN A O     1 
ATOM   2246  C  CB    . ASN D 4  209  ? 65.003  -24.376  48.104  1.00 126.77 ? 209  ASN A CB    1 
ATOM   2247  C  CG    . ASN D 4  209  ? 64.448  -23.212  47.242  1.00 127.38 ? 209  ASN A CG    1 
ATOM   2248  O  OD1   . ASN D 4  209  ? 63.811  -23.414  46.197  1.00 128.02 ? 209  ASN A OD1   1 
ATOM   2249  N  ND2   . ASN D 4  209  ? 64.709  -21.983  47.691  1.00 127.35 ? 209  ASN A ND2   1 
ATOM   2250  N  N     . ILE D 4  210  ? 63.723  -26.330  50.199  1.00 126.64 ? 210  ILE A N     1 
ATOM   2251  C  CA    . ILE D 4  210  ? 63.778  -27.107  51.445  1.00 126.63 ? 210  ILE A CA    1 
ATOM   2252  C  C     . ILE D 4  210  ? 63.254  -28.526  51.207  1.00 126.73 ? 210  ILE A C     1 
ATOM   2253  O  O     . ILE D 4  210  ? 63.889  -29.514  51.596  1.00 126.78 ? 210  ILE A O     1 
ATOM   2254  C  CB    . ILE D 4  210  ? 62.980  -26.407  52.607  1.00 126.53 ? 210  ILE A CB    1 
ATOM   2255  C  CG1   . ILE D 4  210  ? 63.475  -24.968  52.849  1.00 126.74 ? 210  ILE A CG1   1 
ATOM   2256  C  CG2   . ILE D 4  210  ? 62.998  -27.236  53.900  1.00 126.01 ? 210  ILE A CG2   1 
ATOM   2257  C  CD1   . ILE D 4  210  ? 64.951  -24.806  53.251  1.00 126.52 ? 210  ILE A CD1   1 
ATOM   2258  N  N     . PHE D 4  211  ? 62.105  -28.621  50.545  1.00 126.74 ? 211  PHE A N     1 
ATOM   2259  C  CA    . PHE D 4  211  ? 61.463  -29.911  50.329  1.00 126.72 ? 211  PHE A CA    1 
ATOM   2260  C  C     . PHE D 4  211  ? 62.142  -30.736  49.258  1.00 126.81 ? 211  PHE A C     1 
ATOM   2261  O  O     . PHE D 4  211  ? 62.083  -31.964  49.303  1.00 127.00 ? 211  PHE A O     1 
ATOM   2262  C  CB    . PHE D 4  211  ? 59.971  -29.757  50.011  1.00 126.65 ? 211  PHE A CB    1 
ATOM   2263  C  CG    . PHE D 4  211  ? 59.086  -29.860  51.214  1.00 126.18 ? 211  PHE A CG    1 
ATOM   2264  C  CD1   . PHE D 4  211  ? 58.472  -31.053  51.533  1.00 125.59 ? 211  PHE A CD1   1 
ATOM   2265  C  CD2   . PHE D 4  211  ? 58.884  -28.762  52.039  1.00 126.09 ? 211  PHE A CD2   1 
ATOM   2266  C  CE1   . PHE D 4  211  ? 57.666  -31.150  52.643  1.00 125.80 ? 211  PHE A CE1   1 
ATOM   2267  C  CE2   . PHE D 4  211  ? 58.081  -28.851  53.154  1.00 125.61 ? 211  PHE A CE2   1 
ATOM   2268  C  CZ    . PHE D 4  211  ? 57.469  -30.043  53.457  1.00 126.07 ? 211  PHE A CZ    1 
ATOM   2269  N  N     . LYS D 4  212  ? 62.785  -30.076  48.296  1.00 126.72 ? 212  LYS A N     1 
ATOM   2270  C  CA    . LYS D 4  212  ? 63.438  -30.816  47.223  1.00 126.70 ? 212  LYS A CA    1 
ATOM   2271  C  C     . LYS D 4  212  ? 64.605  -31.647  47.790  1.00 126.77 ? 212  LYS A C     1 
ATOM   2272  O  O     . LYS D 4  212  ? 65.127  -32.545  47.115  1.00 126.79 ? 212  LYS A O     1 
ATOM   2273  C  CB    . LYS D 4  212  ? 63.868  -29.884  46.083  1.00 126.67 ? 212  LYS A CB    1 
ATOM   2274  C  CG    . LYS D 4  212  ? 63.874  -30.551  44.711  1.00 126.46 ? 212  LYS A CG    1 
ATOM   2275  C  CD    . LYS D 4  212  ? 63.841  -29.530  43.587  1.00 126.12 ? 212  LYS A CD    1 
ATOM   2276  C  CE    . LYS D 4  212  ? 63.924  -30.208  42.231  1.00 125.74 ? 212  LYS A CE    1 
ATOM   2277  N  NZ    . LYS D 4  212  ? 63.567  -29.265  41.142  1.00 125.39 ? 212  LYS A NZ    1 
ATOM   2278  N  N     . HIS D 4  213  ? 64.973  -31.362  49.045  1.00 126.71 ? 213  HIS A N     1 
ATOM   2279  C  CA    . HIS D 4  213  ? 66.022  -32.102  49.753  1.00 126.67 ? 213  HIS A CA    1 
ATOM   2280  C  C     . HIS D 4  213  ? 65.467  -33.289  50.537  1.00 126.51 ? 213  HIS A C     1 
ATOM   2281  O  O     . HIS D 4  213  ? 65.464  -34.415  50.028  1.00 126.55 ? 213  HIS A O     1 
ATOM   2282  C  CB    . HIS D 4  213  ? 66.845  -31.175  50.659  1.00 126.75 ? 213  HIS A CB    1 
ATOM   2283  C  CG    . HIS D 4  213  ? 67.663  -30.165  49.909  1.00 127.22 ? 213  HIS A CG    1 
ATOM   2284  N  ND1   . HIS D 4  213  ? 68.156  -30.394  48.639  1.00 127.53 ? 213  HIS A ND1   1 
ATOM   2285  C  CD2   . HIS D 4  213  ? 68.093  -28.929  50.259  1.00 127.23 ? 213  HIS A CD2   1 
ATOM   2286  C  CE1   . HIS D 4  213  ? 68.839  -29.339  48.235  1.00 127.51 ? 213  HIS A CE1   1 
ATOM   2287  N  NE2   . HIS D 4  213  ? 68.818  -28.437  49.200  1.00 127.57 ? 213  HIS A NE2   1 
ATOM   2288  N  N     . ILE D 4  214  ? 64.991  -33.032  51.759  1.00 126.33 ? 214  ILE A N     1 
ATOM   2289  C  CA    . ILE D 4  214  ? 64.454  -34.078  52.657  1.00 126.00 ? 214  ILE A CA    1 
ATOM   2290  C  C     . ILE D 4  214  ? 65.452  -35.232  52.813  1.00 126.09 ? 214  ILE A C     1 
ATOM   2291  O  O     . ILE D 4  214  ? 66.618  -35.008  53.175  1.00 126.24 ? 214  ILE A O     1 
ATOM   2292  C  CB    . ILE D 4  214  ? 63.052  -34.601  52.201  1.00 125.65 ? 214  ILE A CB    1 
ATOM   2293  C  CG1   . ILE D 4  214  ? 62.059  -33.448  52.043  1.00 125.36 ? 214  ILE A CG1   1 
ATOM   2294  C  CG2   . ILE D 4  214  ? 62.509  -35.631  53.166  1.00 125.12 ? 214  ILE A CG2   1 
ATOM   2295  C  CD1   . ILE D 4  214  ? 61.974  -32.495  53.226  1.00 125.14 ? 214  ILE A CD1   1 
ATOM   2296  N  N     . SER D 4  215  ? 64.994  -36.451  52.528  1.00 125.79 ? 215  SER A N     1 
ATOM   2297  C  CA    . SER D 4  215  ? 65.841  -37.634  52.559  1.00 125.62 ? 215  SER A CA    1 
ATOM   2298  C  C     . SER D 4  215  ? 65.131  -38.749  51.816  1.00 125.20 ? 215  SER A C     1 
ATOM   2299  O  O     . SER D 4  215  ? 63.996  -39.080  52.138  1.00 125.10 ? 215  SER A O     1 
ATOM   2300  C  CB    . SER D 4  215  ? 66.145  -38.044  54.006  1.00 125.79 ? 215  SER A CB    1 
ATOM   2301  O  OG    . SER D 4  215  ? 67.296  -38.873  54.103  1.00 126.38 ? 215  SER A OG    1 
ATOM   2302  N  N     . VAL D 4  216  ? 65.806  -39.317  50.818  1.00 124.86 ? 216  VAL A N     1 
ATOM   2303  C  CA    . VAL D 4  216  ? 65.231  -40.354  49.952  1.00 124.43 ? 216  VAL A CA    1 
ATOM   2304  C  C     . VAL D 4  216  ? 64.329  -41.325  50.745  1.00 124.27 ? 216  VAL A C     1 
ATOM   2305  O  O     . VAL D 4  216  ? 63.262  -41.719  50.264  1.00 123.82 ? 216  VAL A O     1 
ATOM   2306  C  CB    . VAL D 4  216  ? 66.340  -41.100  49.131  1.00 124.42 ? 216  VAL A CB    1 
ATOM   2307  C  CG1   . VAL D 4  216  ? 65.730  -41.831  47.949  1.00 124.18 ? 216  VAL A CG1   1 
ATOM   2308  C  CG2   . VAL D 4  216  ? 67.418  -40.123  48.628  1.00 123.81 ? 216  VAL A CG2   1 
ATOM   2309  N  N     . LYS D 4  217  ? 64.767  -41.671  51.964  1.00 124.31 ? 217  LYS A N     1 
ATOM   2310  C  CA    . LYS D 4  217  ? 64.003  -42.478  52.935  1.00 124.35 ? 217  LYS A CA    1 
ATOM   2311  C  C     . LYS D 4  217  ? 63.685  -41.680  54.200  1.00 124.21 ? 217  LYS A C     1 
ATOM   2312  O  O     . LYS D 4  217  ? 64.463  -41.719  55.154  1.00 124.18 ? 217  LYS A O     1 
ATOM   2313  C  CB    . LYS D 4  217  ? 64.791  -43.737  53.339  1.00 124.34 ? 217  LYS A CB    1 
ATOM   2314  C  CG    . LYS D 4  217  ? 64.579  -44.929  52.419  1.00 124.76 ? 217  LYS A CG    1 
ATOM   2315  C  CD    . LYS D 4  217  ? 64.334  -46.222  53.197  1.00 124.73 ? 217  LYS A CD    1 
ATOM   2316  C  CE    . LYS D 4  217  ? 63.372  -47.134  52.432  1.00 124.74 ? 217  LYS A CE    1 
ATOM   2317  N  NZ    . LYS D 4  217  ? 62.952  -48.325  53.222  1.00 124.62 ? 217  LYS A NZ    1 
ATOM   2318  N  N     . ASP D 4  218  ? 62.547  -40.980  54.222  1.00 124.15 ? 218  ASP A N     1 
ATOM   2319  C  CA    . ASP D 4  218  ? 62.258  -40.021  55.317  1.00 124.17 ? 218  ASP A CA    1 
ATOM   2320  C  C     . ASP D 4  218  ? 60.823  -39.537  55.707  1.00 124.33 ? 218  ASP A C     1 
ATOM   2321  O  O     . ASP D 4  218  ? 60.540  -39.597  56.898  1.00 124.61 ? 218  ASP A O     1 
ATOM   2322  C  CB    . ASP D 4  218  ? 63.211  -38.801  55.275  1.00 124.05 ? 218  ASP A CB    1 
ATOM   2323  C  CG    . ASP D 4  218  ? 64.057  -38.660  56.540  1.00 123.53 ? 218  ASP A CG    1 
ATOM   2324  O  OD1   . ASP D 4  218  ? 64.052  -39.594  57.366  1.00 123.23 ? 218  ASP A OD1   1 
ATOM   2325  O  OD2   . ASP D 4  218  ? 64.724  -37.609  56.709  1.00 122.71 ? 218  ASP A OD2   1 
ATOM   2326  N  N     . PHE D 4  219  ? 59.905  -39.065  54.840  1.00 124.21 ? 219  PHE A N     1 
ATOM   2327  C  CA    . PHE D 4  219  ? 59.707  -39.304  53.404  1.00 124.14 ? 219  PHE A CA    1 
ATOM   2328  C  C     . PHE D 4  219  ? 58.878  -40.580  53.328  1.00 124.12 ? 219  PHE A C     1 
ATOM   2329  O  O     . PHE D 4  219  ? 57.737  -40.591  53.797  1.00 124.27 ? 219  PHE A O     1 
ATOM   2330  C  CB    . PHE D 4  219  ? 60.999  -39.396  52.611  1.00 124.37 ? 219  PHE A CB    1 
ATOM   2331  C  CG    . PHE D 4  219  ? 60.851  -39.088  51.162  1.00 124.44 ? 219  PHE A CG    1 
ATOM   2332  C  CD1   . PHE D 4  219  ? 60.402  -40.052  50.274  1.00 125.27 ? 219  PHE A CD1   1 
ATOM   2333  C  CD2   . PHE D 4  219  ? 61.201  -37.842  50.675  1.00 124.90 ? 219  PHE A CD2   1 
ATOM   2334  C  CE1   . PHE D 4  219  ? 60.284  -39.773  48.926  1.00 125.77 ? 219  PHE A CE1   1 
ATOM   2335  C  CE2   . PHE D 4  219  ? 61.095  -37.553  49.326  1.00 125.26 ? 219  PHE A CE2   1 
ATOM   2336  C  CZ    . PHE D 4  219  ? 60.638  -38.521  48.452  1.00 125.40 ? 219  PHE A CZ    1 
ATOM   2337  N  N     . THR D 4  220  ? 59.451  -41.657  52.787  1.00 123.90 ? 220  THR A N     1 
ATOM   2338  C  CA    . THR D 4  220  ? 58.789  -42.967  52.785  1.00 123.47 ? 220  THR A CA    1 
ATOM   2339  C  C     . THR D 4  220  ? 58.451  -43.389  54.223  1.00 123.16 ? 220  THR A C     1 
ATOM   2340  O  O     . THR D 4  220  ? 57.611  -44.255  54.446  1.00 123.03 ? 220  THR A O     1 
ATOM   2341  C  CB    . THR D 4  220  ? 59.638  -44.067  52.069  1.00 123.51 ? 220  THR A CB    1 
ATOM   2342  O  OG1   . THR D 4  220  ? 60.950  -44.129  52.645  1.00 123.73 ? 220  THR A OG1   1 
ATOM   2343  C  CG2   . THR D 4  220  ? 59.753  -43.794  50.561  1.00 123.23 ? 220  THR A CG2   1 
ATOM   2344  N  N     . SER D 4  221  ? 59.094  -42.745  55.193  1.00 122.89 ? 221  SER A N     1 
ATOM   2345  C  CA    . SER D 4  221  ? 58.850  -43.034  56.599  1.00 122.71 ? 221  SER A CA    1 
ATOM   2346  C  C     . SER D 4  221  ? 57.563  -42.380  57.056  1.00 122.31 ? 221  SER A C     1 
ATOM   2347  O  O     . SER D 4  221  ? 56.914  -42.860  57.978  1.00 122.28 ? 221  SER A O     1 
ATOM   2348  C  CB    . SER D 4  221  ? 60.015  -42.560  57.475  1.00 122.88 ? 221  SER A CB    1 
ATOM   2349  O  OG    . SER D 4  221  ? 61.260  -42.705  56.807  1.00 123.24 ? 221  SER A OG    1 
ATOM   2350  N  N     . LEU D 4  222  ? 57.196  -41.277  56.419  1.00 121.90 ? 222  LEU A N     1 
ATOM   2351  C  CA    . LEU D 4  222  ? 55.917  -40.656  56.728  1.00 121.75 ? 222  LEU A CA    1 
ATOM   2352  C  C     . LEU D 4  222  ? 54.957  -40.646  55.544  1.00 121.72 ? 222  LEU A C     1 
ATOM   2353  O  O     . LEU D 4  222  ? 54.353  -39.625  55.215  1.00 121.54 ? 222  LEU A O     1 
ATOM   2354  C  CB    . LEU D 4  222  ? 56.091  -39.270  57.349  1.00 121.71 ? 222  LEU A CB    1 
ATOM   2355  C  CG    . LEU D 4  222  ? 57.228  -38.353  56.915  1.00 121.23 ? 222  LEU A CG    1 
ATOM   2356  C  CD1   . LEU D 4  222  ? 56.871  -37.648  55.641  1.00 121.19 ? 222  LEU A CD1   1 
ATOM   2357  C  CD2   . LEU D 4  222  ? 57.469  -37.337  58.009  1.00 120.99 ? 222  LEU A CD2   1 
ATOM   2358  N  N     . GLY D 4  223  ? 54.852  -41.814  54.912  1.00 121.81 ? 223  GLY A N     1 
ATOM   2359  C  CA    . GLY D 4  223  ? 53.780  -42.146  53.978  1.00 121.54 ? 223  GLY A CA    1 
ATOM   2360  C  C     . GLY D 4  223  ? 53.788  -41.446  52.648  1.00 121.32 ? 223  GLY A C     1 
ATOM   2361  O  O     . GLY D 4  223  ? 52.737  -41.059  52.149  1.00 121.45 ? 223  GLY A O     1 
ATOM   2362  N  N     . PHE D 4  224  ? 54.972  -41.273  52.082  1.00 121.15 ? 224  PHE A N     1 
ATOM   2363  C  CA    . PHE D 4  224  ? 55.092  -40.788  50.726  1.00 121.20 ? 224  PHE A CA    1 
ATOM   2364  C  C     . PHE D 4  224  ? 55.720  -41.852  49.881  1.00 121.51 ? 224  PHE A C     1 
ATOM   2365  O  O     . PHE D 4  224  ? 56.141  -42.892  50.400  1.00 121.72 ? 224  PHE A O     1 
ATOM   2366  C  CB    . PHE D 4  224  ? 55.952  -39.548  50.683  1.00 121.00 ? 224  PHE A CB    1 
ATOM   2367  C  CG    . PHE D 4  224  ? 55.255  -38.336  51.157  1.00 120.58 ? 224  PHE A CG    1 
ATOM   2368  C  CD1   . PHE D 4  224  ? 55.482  -37.851  52.432  1.00 120.08 ? 224  PHE A CD1   1 
ATOM   2369  C  CD2   . PHE D 4  224  ? 54.354  -37.678  50.335  1.00 120.64 ? 224  PHE A CD2   1 
ATOM   2370  C  CE1   . PHE D 4  224  ? 54.835  -36.710  52.880  1.00 120.40 ? 224  PHE A CE1   1 
ATOM   2371  C  CE2   . PHE D 4  224  ? 53.694  -36.540  50.773  1.00 120.97 ? 224  PHE A CE2   1 
ATOM   2372  C  CZ    . PHE D 4  224  ? 53.934  -36.053  52.049  1.00 120.89 ? 224  PHE A CZ    1 
ATOM   2373  N  N     . ASN D 4  225  ? 55.794  -41.590  48.576  1.00 121.94 ? 225  ASN A N     1 
ATOM   2374  C  CA    . ASN D 4  225  ? 56.409  -42.548  47.683  1.00 122.51 ? 225  ASN A CA    1 
ATOM   2375  C  C     . ASN D 4  225  ? 57.458  -41.923  46.770  1.00 123.10 ? 225  ASN A C     1 
ATOM   2376  O  O     . ASN D 4  225  ? 57.201  -40.946  46.067  1.00 123.08 ? 225  ASN A O     1 
ATOM   2377  C  CB    . ASN D 4  225  ? 55.344  -43.273  46.877  1.00 122.24 ? 225  ASN A CB    1 
ATOM   2378  C  CG    . ASN D 4  225  ? 55.887  -44.472  46.167  1.00 122.06 ? 225  ASN A CG    1 
ATOM   2379  O  OD1   . ASN D 4  225  ? 55.661  -45.603  46.591  1.00 122.18 ? 225  ASN A OD1   1 
ATOM   2380  N  ND2   . ASN D 4  225  ? 56.622  -44.243  45.082  1.00 121.72 ? 225  ASN A ND2   1 
ATOM   2381  N  N     . GLU D 4  226  ? 58.641  -42.520  46.777  1.00 123.98 ? 226  GLU A N     1 
ATOM   2382  C  CA    . GLU D 4  226  ? 59.801  -41.987  46.062  1.00 124.89 ? 226  GLU A CA    1 
ATOM   2383  C  C     . GLU D 4  226  ? 59.609  -41.707  44.544  1.00 125.18 ? 226  GLU A C     1 
ATOM   2384  O  O     . GLU D 4  226  ? 60.355  -40.899  43.973  1.00 125.30 ? 226  GLU A O     1 
ATOM   2385  C  CB    . GLU D 4  226  ? 61.007  -42.902  46.309  1.00 125.00 ? 226  GLU A CB    1 
ATOM   2386  C  CG    . GLU D 4  226  ? 62.351  -42.333  45.884  1.00 125.76 ? 226  GLU A CG    1 
ATOM   2387  C  CD    . GLU D 4  226  ? 63.254  -43.403  45.287  1.00 127.40 ? 226  GLU A CD    1 
ATOM   2388  O  OE1   . GLU D 4  226  ? 62.732  -44.503  44.973  1.00 127.52 ? 226  GLU A OE1   1 
ATOM   2389  O  OE2   . GLU D 4  226  ? 64.477  -43.146  45.124  1.00 127.90 ? 226  GLU A OE2   1 
ATOM   2390  N  N     . VAL D 4  227  ? 58.636  -42.362  43.898  1.00 125.45 ? 227  VAL A N     1 
ATOM   2391  C  CA    . VAL D 4  227  ? 58.374  -42.136  42.454  1.00 125.70 ? 227  VAL A CA    1 
ATOM   2392  C  C     . VAL D 4  227  ? 56.981  -41.551  42.170  1.00 125.84 ? 227  VAL A C     1 
ATOM   2393  O  O     . VAL D 4  227  ? 56.805  -40.788  41.203  1.00 125.84 ? 227  VAL A O     1 
ATOM   2394  C  CB    . VAL D 4  227  ? 58.537  -43.420  41.561  1.00 125.69 ? 227  VAL A CB    1 
ATOM   2395  C  CG1   . VAL D 4  227  ? 59.273  -43.077  40.251  1.00 125.36 ? 227  VAL A CG1   1 
ATOM   2396  C  CG2   . VAL D 4  227  ? 59.239  -44.548  42.303  1.00 125.70 ? 227  VAL A CG2   1 
ATOM   2397  N  N     . PHE D 4  228  ? 56.005  -41.921  43.007  1.00 125.78 ? 228  PHE A N     1 
ATOM   2398  C  CA    . PHE D 4  228  ? 54.590  -41.606  42.768  1.00 125.46 ? 228  PHE A CA    1 
ATOM   2399  C  C     . PHE D 4  228  ? 54.141  -40.314  43.449  1.00 125.54 ? 228  PHE A C     1 
ATOM   2400  O  O     . PHE D 4  228  ? 53.421  -39.531  42.836  1.00 125.64 ? 228  PHE A O     1 
ATOM   2401  C  CB    . PHE D 4  228  ? 53.692  -42.799  43.138  1.00 125.10 ? 228  PHE A CB    1 
ATOM   2402  C  CG    . PHE D 4  228  ? 53.674  -43.905  42.098  1.00 124.73 ? 228  PHE A CG    1 
ATOM   2403  C  CD1   . PHE D 4  228  ? 52.623  -44.817  42.056  1.00 124.35 ? 228  PHE A CD1   1 
ATOM   2404  C  CD2   . PHE D 4  228  ? 54.700  -44.028  41.151  1.00 124.17 ? 228  PHE A CD2   1 
ATOM   2405  C  CE1   . PHE D 4  228  ? 52.596  -45.841  41.094  1.00 123.80 ? 228  PHE A CE1   1 
ATOM   2406  C  CE2   . PHE D 4  228  ? 54.677  -45.041  40.185  1.00 123.74 ? 228  PHE A CE2   1 
ATOM   2407  C  CZ    . PHE D 4  228  ? 53.620  -45.950  40.161  1.00 124.07 ? 228  PHE A CZ    1 
ATOM   2408  N  N     . SER D 4  229  ? 54.572  -40.091  44.695  1.00 125.76 ? 229  SER A N     1 
ATOM   2409  C  CA    . SER D 4  229  ? 54.331  -38.808  45.403  1.00 126.07 ? 229  SER A CA    1 
ATOM   2410  C  C     . SER D 4  229  ? 55.450  -38.318  46.375  1.00 126.43 ? 229  SER A C     1 
ATOM   2411  O  O     . SER D 4  229  ? 55.420  -38.601  47.588  1.00 126.45 ? 229  SER A O     1 
ATOM   2412  C  CB    . SER D 4  229  ? 52.935  -38.763  46.073  1.00 125.91 ? 229  SER A CB    1 
ATOM   2413  O  OG    . SER D 4  229  ? 52.799  -39.712  47.111  1.00 125.21 ? 229  SER A OG    1 
ATOM   2414  N  N     . ARG D 4  230  ? 56.426  -37.589  45.814  1.00 126.65 ? 230  ARG A N     1 
ATOM   2415  C  CA    . ARG D 4  230  ? 57.442  -36.835  46.578  1.00 126.76 ? 230  ARG A CA    1 
ATOM   2416  C  C     . ARG D 4  230  ? 56.875  -35.476  47.031  1.00 126.67 ? 230  ARG A C     1 
ATOM   2417  O  O     . ARG D 4  230  ? 56.223  -34.786  46.239  1.00 126.89 ? 230  ARG A O     1 
ATOM   2418  C  CB    . ARG D 4  230  ? 58.701  -36.580  45.729  1.00 126.81 ? 230  ARG A CB    1 
ATOM   2419  C  CG    . ARG D 4  230  ? 59.516  -37.802  45.337  1.00 127.19 ? 230  ARG A CG    1 
ATOM   2420  C  CD    . ARG D 4  230  ? 60.998  -37.442  45.230  1.00 128.05 ? 230  ARG A CD    1 
ATOM   2421  N  NE    . ARG D 4  230  ? 61.723  -38.343  44.335  1.00 128.76 ? 230  ARG A NE    1 
ATOM   2422  C  CZ    . ARG D 4  230  ? 62.694  -37.959  43.507  1.00 129.21 ? 230  ARG A CZ    1 
ATOM   2423  N  NH1   . ARG D 4  230  ? 63.069  -36.686  43.452  1.00 129.32 ? 230  ARG A NH1   1 
ATOM   2424  N  NH2   . ARG D 4  230  ? 63.288  -38.843  42.718  1.00 129.71 ? 230  ARG A NH2   1 
ATOM   2425  N  N     . PRO D 4  231  ? 57.143  -35.067  48.289  1.00 126.49 ? 231  PRO A N     1 
ATOM   2426  C  CA    . PRO D 4  231  ? 56.568  -33.826  48.841  1.00 126.45 ? 231  PRO A CA    1 
ATOM   2427  C  C     . PRO D 4  231  ? 56.966  -32.554  48.085  1.00 126.47 ? 231  PRO A C     1 
ATOM   2428  O  O     . PRO D 4  231  ? 56.249  -31.553  48.143  1.00 126.34 ? 231  PRO A O     1 
ATOM   2429  C  CB    . PRO D 4  231  ? 57.117  -33.789  50.270  1.00 126.44 ? 231  PRO A CB    1 
ATOM   2430  C  CG    . PRO D 4  231  ? 57.538  -35.181  50.567  1.00 126.44 ? 231  PRO A CG    1 
ATOM   2431  C  CD    . PRO D 4  231  ? 58.004  -35.747  49.270  1.00 126.45 ? 231  PRO A CD    1 
ATOM   2432  N  N     . GLU D 4  232  ? 58.101  -32.608  47.388  1.00 126.58 ? 232  GLU A N     1 
ATOM   2433  C  CA    . GLU D 4  232  ? 58.560  -31.537  46.499  1.00 126.68 ? 232  GLU A CA    1 
ATOM   2434  C  C     . GLU D 4  232  ? 57.589  -31.252  45.344  1.00 126.50 ? 232  GLU A C     1 
ATOM   2435  O  O     . GLU D 4  232  ? 57.718  -30.237  44.656  1.00 126.48 ? 232  GLU A O     1 
ATOM   2436  C  CB    . GLU D 4  232  ? 59.949  -31.880  45.940  1.00 126.78 ? 232  GLU A CB    1 
ATOM   2437  C  CG    . GLU D 4  232  ? 60.057  -33.237  45.210  1.00 127.18 ? 232  GLU A CG    1 
ATOM   2438  C  CD    . GLU D 4  232  ? 61.325  -33.367  44.352  1.00 127.32 ? 232  GLU A CD    1 
ATOM   2439  O  OE1   . GLU D 4  232  ? 62.345  -33.857  44.886  1.00 127.88 ? 232  GLU A OE1   1 
ATOM   2440  O  OE2   . GLU D 4  232  ? 61.305  -32.978  43.152  1.00 127.74 ? 232  GLU A OE2   1 
ATOM   2441  N  N     . TRP D 4  233  ? 56.634  -32.161  45.143  1.00 126.37 ? 233  TRP A N     1 
ATOM   2442  C  CA    . TRP D 4  233  ? 55.624  -32.060  44.092  1.00 126.12 ? 233  TRP A CA    1 
ATOM   2443  C  C     . TRP D 4  233  ? 54.331  -31.457  44.588  1.00 126.36 ? 233  TRP A C     1 
ATOM   2444  O  O     . TRP D 4  233  ? 53.573  -30.905  43.807  1.00 126.37 ? 233  TRP A O     1 
ATOM   2445  C  CB    . TRP D 4  233  ? 55.344  -33.430  43.511  1.00 125.63 ? 233  TRP A CB    1 
ATOM   2446  C  CG    . TRP D 4  233  ? 56.445  -33.899  42.659  1.00 125.43 ? 233  TRP A CG    1 
ATOM   2447  C  CD1   . TRP D 4  233  ? 57.382  -33.124  42.049  1.00 125.35 ? 233  TRP A CD1   1 
ATOM   2448  C  CD2   . TRP D 4  233  ? 56.729  -35.252  42.277  1.00 125.18 ? 233  TRP A CD2   1 
ATOM   2449  N  NE1   . TRP D 4  233  ? 58.240  -33.906  41.321  1.00 125.48 ? 233  TRP A NE1   1 
ATOM   2450  C  CE2   . TRP D 4  233  ? 57.859  -35.218  41.439  1.00 125.13 ? 233  TRP A CE2   1 
ATOM   2451  C  CE3   . TRP D 4  233  ? 56.139  -36.489  42.562  1.00 125.21 ? 233  TRP A CE3   1 
ATOM   2452  C  CZ2   . TRP D 4  233  ? 58.417  -36.377  40.881  1.00 125.15 ? 233  TRP A CZ2   1 
ATOM   2453  C  CZ3   . TRP D 4  233  ? 56.694  -37.639  42.003  1.00 125.30 ? 233  TRP A CZ3   1 
ATOM   2454  C  CH2   . TRP D 4  233  ? 57.820  -37.572  41.173  1.00 125.07 ? 233  TRP A CH2   1 
ATOM   2455  N  N     . MET D 4  234  ? 54.090  -31.571  45.889  1.00 126.75 ? 234  MET A N     1 
ATOM   2456  C  CA    . MET D 4  234  ? 52.955  -30.931  46.541  1.00 127.23 ? 234  MET A CA    1 
ATOM   2457  C  C     . MET D 4  234  ? 52.848  -29.425  46.283  1.00 127.56 ? 234  MET A C     1 
ATOM   2458  O  O     . MET D 4  234  ? 51.792  -28.843  46.510  1.00 127.85 ? 234  MET A O     1 
ATOM   2459  C  CB    . MET D 4  234  ? 53.026  -31.151  48.044  1.00 127.14 ? 234  MET A CB    1 
ATOM   2460  C  CG    . MET D 4  234  ? 52.217  -32.295  48.577  1.00 127.08 ? 234  MET A CG    1 
ATOM   2461  S  SD    . MET D 4  234  ? 51.975  -32.089  50.358  1.00 127.56 ? 234  MET A SD    1 
ATOM   2462  C  CE    . MET D 4  234  ? 53.584  -32.517  51.012  1.00 128.04 ? 234  MET A CE    1 
ATOM   2463  N  N     . ILE D 4  235  ? 53.934  -28.787  45.849  1.00 127.95 ? 235  ILE A N     1 
ATOM   2464  C  CA    . ILE D 4  235  ? 53.898  -27.354  45.512  1.00 128.34 ? 235  ILE A CA    1 
ATOM   2465  C  C     . ILE D 4  235  ? 54.147  -27.119  44.030  1.00 128.57 ? 235  ILE A C     1 
ATOM   2466  O  O     . ILE D 4  235  ? 54.941  -27.817  43.393  1.00 128.51 ? 235  ILE A O     1 
ATOM   2467  C  CB    . ILE D 4  235  ? 54.833  -26.467  46.400  1.00 128.44 ? 235  ILE A CB    1 
ATOM   2468  C  CG1   . ILE D 4  235  ? 56.103  -27.212  46.830  1.00 128.43 ? 235  ILE A CG1   1 
ATOM   2469  C  CG2   . ILE D 4  235  ? 54.090  -25.966  47.624  1.00 128.41 ? 235  ILE A CG2   1 
ATOM   2470  C  CD1   . ILE D 4  235  ? 57.254  -27.080  45.868  1.00 128.47 ? 235  ILE A CD1   1 
ATOM   2471  N  N     . LEU D 4  236  ? 53.465  -26.121  43.488  1.00 129.04 ? 236  LEU A N     1 
ATOM   2472  C  CA    . LEU D 4  236  ? 53.284  -26.068  42.049  1.00 129.60 ? 236  LEU A CA    1 
ATOM   2473  C  C     . LEU D 4  236  ? 54.136  -25.124  41.240  1.00 129.80 ? 236  LEU A C     1 
ATOM   2474  O  O     . LEU D 4  236  ? 54.133  -23.907  41.452  1.00 129.62 ? 236  LEU A O     1 
ATOM   2475  C  CB    . LEU D 4  236  ? 51.807  -25.901  41.695  1.00 129.63 ? 236  LEU A CB    1 
ATOM   2476  C  CG    . LEU D 4  236  ? 51.102  -27.259  41.597  1.00 130.21 ? 236  LEU A CG    1 
ATOM   2477  C  CD1   . LEU D 4  236  ? 49.585  -27.096  41.770  1.00 130.95 ? 236  LEU A CD1   1 
ATOM   2478  C  CD2   . LEU D 4  236  ? 51.477  -28.064  40.304  1.00 129.52 ? 236  LEU A CD2   1 
ATOM   2479  N  N     . THR D 4  237  ? 54.859  -25.722  40.298  1.00 130.19 ? 237  THR A N     1 
ATOM   2480  C  CA    . THR D 4  237  ? 55.456  -24.999  39.191  1.00 130.51 ? 237  THR A CA    1 
ATOM   2481  C  C     . THR D 4  237  ? 54.561  -25.222  37.992  1.00 130.84 ? 237  THR A C     1 
ATOM   2482  O  O     . THR D 4  237  ? 53.468  -24.653  37.893  1.00 130.85 ? 237  THR A O     1 
ATOM   2483  C  CB    . THR D 4  237  ? 56.828  -25.561  38.824  1.00 130.36 ? 237  THR A CB    1 
ATOM   2484  O  OG1   . THR D 4  237  ? 56.802  -26.987  38.973  1.00 129.87 ? 237  THR A OG1   1 
ATOM   2485  C  CG2   . THR D 4  237  ? 57.904  -24.957  39.700  1.00 130.52 ? 237  THR A CG2   1 
ATOM   2486  N  N     . CYS D 4  238  ? 55.040  -26.082  37.099  1.00 131.19 ? 238  CYS A N     1 
ATOM   2487  C  CA    . CYS D 4  238  ? 54.373  -26.405  35.851  1.00 131.09 ? 238  CYS A CA    1 
ATOM   2488  C  C     . CYS D 4  238  ? 52.982  -27.080  36.036  1.00 130.73 ? 238  CYS A C     1 
ATOM   2489  O  O     . CYS D 4  238  ? 52.898  -28.291  36.278  1.00 130.79 ? 238  CYS A O     1 
ATOM   2490  C  CB    . CYS D 4  238  ? 55.325  -27.263  35.012  1.00 131.12 ? 238  CYS A CB    1 
ATOM   2491  S  SG    . CYS D 4  238  ? 54.807  -27.506  33.319  1.00 132.08 ? 238  CYS A SG    1 
ATOM   2492  N  N     . LEU D 4  239  ? 51.915  -26.274  35.915  1.00 130.14 ? 239  LEU A N     1 
ATOM   2493  C  CA    . LEU D 4  239  ? 50.505  -26.703  36.039  1.00 129.79 ? 239  LEU A CA    1 
ATOM   2494  C  C     . LEU D 4  239  ? 49.923  -27.296  34.741  1.00 129.70 ? 239  LEU A C     1 
ATOM   2495  O  O     . LEU D 4  239  ? 50.080  -26.698  33.672  1.00 129.55 ? 239  LEU A O     1 
ATOM   2496  C  CB    . LEU D 4  239  ? 49.634  -25.527  36.548  1.00 129.82 ? 239  LEU A CB    1 
ATOM   2497  C  CG    . LEU D 4  239  ? 48.103  -25.315  36.402  1.00 129.87 ? 239  LEU A CG    1 
ATOM   2498  C  CD1   . LEU D 4  239  ? 47.197  -26.477  36.863  1.00 128.53 ? 239  LEU A CD1   1 
ATOM   2499  C  CD2   . LEU D 4  239  ? 47.698  -24.020  37.115  1.00 129.51 ? 239  LEU A CD2   1 
ATOM   2500  N  N     . PRO D 4  240  ? 49.261  -28.482  34.834  1.00 129.66 ? 240  PRO A N     1 
ATOM   2501  C  CA    . PRO D 4  240  ? 48.603  -29.122  33.683  1.00 129.63 ? 240  PRO A CA    1 
ATOM   2502  C  C     . PRO D 4  240  ? 47.283  -28.464  33.207  1.00 129.80 ? 240  PRO A C     1 
ATOM   2503  O  O     . PRO D 4  240  ? 46.385  -28.120  34.022  1.00 129.77 ? 240  PRO A O     1 
ATOM   2504  C  CB    . PRO D 4  240  ? 48.375  -30.561  34.158  1.00 129.42 ? 240  PRO A CB    1 
ATOM   2505  C  CG    . PRO D 4  240  ? 48.269  -30.456  35.615  1.00 129.41 ? 240  PRO A CG    1 
ATOM   2506  C  CD    . PRO D 4  240  ? 49.145  -29.318  36.047  1.00 129.61 ? 240  PRO A CD    1 
ATOM   2507  N  N     . VAL D 4  241  ? 47.206  -28.335  31.874  1.00 129.65 ? 241  VAL A N     1 
ATOM   2508  C  CA    . VAL D 4  241  ? 46.145  -27.641  31.118  1.00 129.19 ? 241  VAL A CA    1 
ATOM   2509  C  C     . VAL D 4  241  ? 45.181  -28.654  30.441  1.00 128.95 ? 241  VAL A C     1 
ATOM   2510  O  O     . VAL D 4  241  ? 45.545  -29.276  29.424  1.00 129.04 ? 241  VAL A O     1 
ATOM   2511  C  CB    . VAL D 4  241  ? 46.783  -26.689  30.037  1.00 129.07 ? 241  VAL A CB    1 
ATOM   2512  C  CG1   . VAL D 4  241  ? 45.731  -25.869  29.303  1.00 128.74 ? 241  VAL A CG1   1 
ATOM   2513  C  CG2   . VAL D 4  241  ? 47.817  -25.771  30.668  1.00 128.79 ? 241  VAL A CG2   1 
ATOM   2514  N  N     . PRO D 4  242  ? 43.959  -28.830  31.005  1.00 128.40 ? 242  PRO A N     1 
ATOM   2515  C  CA    . PRO D 4  242  ? 43.014  -29.788  30.430  1.00 127.88 ? 242  PRO A CA    1 
ATOM   2516  C  C     . PRO D 4  242  ? 42.438  -29.283  29.117  1.00 127.43 ? 242  PRO A C     1 
ATOM   2517  O  O     . PRO D 4  242  ? 42.085  -28.105  29.016  1.00 127.02 ? 242  PRO A O     1 
ATOM   2518  C  CB    . PRO D 4  242  ? 41.924  -29.910  31.499  1.00 127.74 ? 242  PRO A CB    1 
ATOM   2519  C  CG    . PRO D 4  242  ? 41.969  -28.637  32.233  1.00 128.12 ? 242  PRO A CG    1 
ATOM   2520  C  CD    . PRO D 4  242  ? 43.401  -28.157  32.193  1.00 128.50 ? 242  PRO A CD    1 
ATOM   2521  N  N     . PRO D 4  243  ? 42.332  -30.178  28.118  1.00 127.28 ? 243  PRO A N     1 
ATOM   2522  C  CA    . PRO D 4  243  ? 41.968  -29.836  26.751  1.00 127.24 ? 243  PRO A CA    1 
ATOM   2523  C  C     . PRO D 4  243  ? 40.480  -29.482  26.644  1.00 127.20 ? 243  PRO A C     1 
ATOM   2524  O  O     . PRO D 4  243  ? 39.782  -29.437  27.669  1.00 127.24 ? 243  PRO A O     1 
ATOM   2525  C  CB    . PRO D 4  243  ? 42.286  -31.125  25.983  1.00 126.97 ? 243  PRO A CB    1 
ATOM   2526  C  CG    . PRO D 4  243  ? 42.038  -32.162  26.951  1.00 126.94 ? 243  PRO A CG    1 
ATOM   2527  C  CD    . PRO D 4  243  ? 42.523  -31.630  28.261  1.00 127.31 ? 243  PRO A CD    1 
ATOM   2528  N  N     . PRO D 4  244  ? 39.997  -29.219  25.417  1.00 127.00 ? 244  PRO A N     1 
ATOM   2529  C  CA    . PRO D 4  244  ? 38.595  -28.851  25.282  1.00 127.02 ? 244  PRO A CA    1 
ATOM   2530  C  C     . PRO D 4  244  ? 37.560  -29.818  25.928  1.00 127.10 ? 244  PRO A C     1 
ATOM   2531  O  O     . PRO D 4  244  ? 36.857  -29.385  26.827  1.00 127.15 ? 244  PRO A O     1 
ATOM   2532  C  CB    . PRO D 4  244  ? 38.422  -28.695  23.768  1.00 127.13 ? 244  PRO A CB    1 
ATOM   2533  C  CG    . PRO D 4  244  ? 39.790  -28.384  23.274  1.00 126.82 ? 244  PRO A CG    1 
ATOM   2534  C  CD    . PRO D 4  244  ? 40.689  -29.212  24.115  1.00 126.82 ? 244  PRO A CD    1 
ATOM   2535  N  N     . PRO D 4  245  ? 37.477  -31.102  25.508  1.00 127.17 ? 245  PRO A N     1 
ATOM   2536  C  CA    . PRO D 4  245  ? 36.432  -31.987  26.031  1.00 127.45 ? 245  PRO A CA    1 
ATOM   2537  C  C     . PRO D 4  245  ? 36.185  -32.011  27.549  1.00 127.82 ? 245  PRO A C     1 
ATOM   2538  O  O     . PRO D 4  245  ? 35.300  -32.742  28.005  1.00 127.79 ? 245  PRO A O     1 
ATOM   2539  C  CB    . PRO D 4  245  ? 36.903  -33.366  25.565  1.00 127.51 ? 245  PRO A CB    1 
ATOM   2540  C  CG    . PRO D 4  245  ? 37.537  -33.097  24.276  1.00 127.24 ? 245  PRO A CG    1 
ATOM   2541  C  CD    . PRO D 4  245  ? 38.306  -31.822  24.523  1.00 127.40 ? 245  PRO A CD    1 
ATOM   2542  N  N     . VAL D 4  246  ? 36.943  -31.219  28.308  1.00 128.33 ? 246  VAL A N     1 
ATOM   2543  C  CA    . VAL D 4  246  ? 36.794  -31.122  29.769  1.00 128.74 ? 246  VAL A CA    1 
ATOM   2544  C  C     . VAL D 4  246  ? 36.205  -29.777  30.204  1.00 129.26 ? 246  VAL A C     1 
ATOM   2545  O  O     . VAL D 4  246  ? 36.013  -29.544  31.400  1.00 128.89 ? 246  VAL A O     1 
ATOM   2546  C  CB    . VAL D 4  246  ? 38.157  -31.279  30.496  1.00 128.74 ? 246  VAL A CB    1 
ATOM   2547  C  CG1   . VAL D 4  246  ? 37.948  -31.708  31.944  1.00 128.10 ? 246  VAL A CG1   1 
ATOM   2548  C  CG2   . VAL D 4  246  ? 39.083  -32.255  29.756  1.00 128.60 ? 246  VAL A CG2   1 
ATOM   2549  N  N     . ARG D 4  247  ? 35.943  -28.905  29.224  1.00 130.32 ? 247  ARG A N     1 
ATOM   2550  C  CA    . ARG D 4  247  ? 35.523  -27.500  29.436  1.00 131.34 ? 247  ARG A CA    1 
ATOM   2551  C  C     . ARG D 4  247  ? 35.180  -26.750  28.113  1.00 132.61 ? 247  ARG A C     1 
ATOM   2552  O  O     . ARG D 4  247  ? 35.756  -25.688  27.837  1.00 132.63 ? 247  ARG A O     1 
ATOM   2553  C  CB    . ARG D 4  247  ? 36.623  -26.723  30.175  1.00 131.00 ? 247  ARG A CB    1 
ATOM   2554  C  CG    . ARG D 4  247  ? 37.962  -26.787  29.460  1.00 129.67 ? 247  ARG A CG    1 
ATOM   2555  C  CD    . ARG D 4  247  ? 38.973  -25.777  29.934  1.00 127.40 ? 247  ARG A CD    1 
ATOM   2556  N  NE    . ARG D 4  247  ? 40.181  -25.997  29.157  1.00 126.05 ? 247  ARG A NE    1 
ATOM   2557  C  CZ    . ARG D 4  247  ? 40.543  -25.272  28.108  1.00 125.63 ? 247  ARG A CZ    1 
ATOM   2558  N  NH1   . ARG D 4  247  ? 39.817  -24.238  27.719  1.00 125.15 ? 247  ARG A NH1   1 
ATOM   2559  N  NH2   . ARG D 4  247  ? 41.652  -25.574  27.454  1.00 125.86 ? 247  ARG A NH2   1 
ATOM   2560  N  N     . PRO D 4  248  ? 34.208  -27.263  27.319  1.00 133.80 ? 248  PRO A N     1 
ATOM   2561  C  CA    . PRO D 4  248  ? 34.112  -26.848  25.904  1.00 134.64 ? 248  PRO A CA    1 
ATOM   2562  C  C     . PRO D 4  248  ? 33.406  -25.508  25.654  1.00 135.53 ? 248  PRO A C     1 
ATOM   2563  O  O     . PRO D 4  248  ? 33.434  -24.625  26.509  1.00 135.43 ? 248  PRO A O     1 
ATOM   2564  C  CB    . PRO D 4  248  ? 33.356  -28.017  25.240  1.00 134.66 ? 248  PRO A CB    1 
ATOM   2565  C  CG    . PRO D 4  248  ? 32.966  -28.979  26.390  1.00 134.38 ? 248  PRO A CG    1 
ATOM   2566  C  CD    . PRO D 4  248  ? 33.141  -28.219  27.668  1.00 133.81 ? 248  PRO A CD    1 
ATOM   2567  N  N     . SER D 4  249  ? 32.796  -25.364  24.480  1.00 136.76 ? 249  SER A N     1 
ATOM   2568  C  CA    . SER D 4  249  ? 32.200  -24.093  24.077  1.00 138.44 ? 249  SER A CA    1 
ATOM   2569  C  C     . SER D 4  249  ? 30.678  -24.142  23.789  1.00 139.07 ? 249  SER A C     1 
ATOM   2570  O  O     . SER D 4  249  ? 29.868  -24.027  24.723  1.00 139.01 ? 249  SER A O     1 
ATOM   2571  C  CB    . SER D 4  249  ? 32.994  -23.486  22.913  1.00 137.89 ? 249  SER A CB    1 
ATOM   2572  O  OG    . SER D 4  249  ? 33.680  -24.492  22.190  1.00 137.61 ? 249  SER A OG    1 
ATOM   2573  N  N     . ILE D 4  250  ? 30.314  -24.320  22.508  1.00 140.31 ? 250  ILE A N     1 
ATOM   2574  C  CA    . ILE D 4  250  ? 28.920  -24.199  21.967  1.00 140.86 ? 250  ILE A CA    1 
ATOM   2575  C  C     . ILE D 4  250  ? 28.184  -22.904  22.393  1.00 141.83 ? 250  ILE A C     1 
ATOM   2576  O  O     . ILE D 4  250  ? 27.990  -22.646  23.591  1.00 141.88 ? 250  ILE A O     1 
ATOM   2577  C  CB    . ILE D 4  250  ? 28.034  -25.516  22.167  1.00 141.24 ? 250  ILE A CB    1 
ATOM   2578  C  CG1   . ILE D 4  250  ? 28.598  -26.691  21.335  1.00 141.44 ? 250  ILE A CG1   1 
ATOM   2579  C  CG2   . ILE D 4  250  ? 26.536  -25.268  21.818  1.00 140.66 ? 250  ILE A CG2   1 
ATOM   2580  C  CD1   . ILE D 4  250  ? 28.051  -28.098  21.687  1.00 140.99 ? 250  ILE A CD1   1 
ATOM   2581  N  N     . SER D 4  251  ? 27.787  -22.089  21.415  1.00 142.61 ? 251  SER A N     1 
ATOM   2582  C  CA    . SER D 4  251  ? 27.099  -20.844  21.748  1.00 143.46 ? 251  SER A CA    1 
ATOM   2583  C  C     . SER D 4  251  ? 25.614  -21.054  22.062  1.00 143.99 ? 251  SER A C     1 
ATOM   2584  O  O     . SER D 4  251  ? 25.065  -22.151  21.892  1.00 143.83 ? 251  SER A O     1 
ATOM   2585  C  CB    . SER D 4  251  ? 27.319  -19.749  20.687  1.00 143.43 ? 251  SER A CB    1 
ATOM   2586  O  OG    . SER D 4  251  ? 26.772  -20.101  19.432  1.00 143.62 ? 251  SER A OG    1 
ATOM   2587  N  N     . PHE D 4  252  ? 24.997  -19.983  22.555  1.00 144.88 ? 252  PHE A N     1 
ATOM   2588  C  CA    . PHE D 4  252  ? 23.575  -19.949  22.907  1.00 145.51 ? 252  PHE A CA    1 
ATOM   2589  C  C     . PHE D 4  252  ? 22.658  -19.380  21.782  1.00 145.77 ? 252  PHE A C     1 
ATOM   2590  O  O     . PHE D 4  252  ? 21.460  -19.692  21.738  1.00 145.99 ? 252  PHE A O     1 
ATOM   2591  C  CB    . PHE D 4  252  ? 23.340  -19.232  24.272  1.00 145.57 ? 252  PHE A CB    1 
ATOM   2592  C  CG    . PHE D 4  252  ? 24.546  -18.445  24.815  1.00 145.79 ? 252  PHE A CG    1 
ATOM   2593  C  CD1   . PHE D 4  252  ? 24.894  -17.187  24.286  1.00 145.32 ? 252  PHE A CD1   1 
ATOM   2594  C  CD2   . PHE D 4  252  ? 25.301  -18.950  25.884  1.00 145.40 ? 252  PHE A CD2   1 
ATOM   2595  C  CE1   . PHE D 4  252  ? 25.984  -16.465  24.789  1.00 144.69 ? 252  PHE A CE1   1 
ATOM   2596  C  CE2   . PHE D 4  252  ? 26.391  -18.232  26.393  1.00 145.18 ? 252  PHE A CE2   1 
ATOM   2597  C  CZ    . PHE D 4  252  ? 26.730  -16.986  25.842  1.00 145.10 ? 252  PHE A CZ    1 
ATOM   2598  N  N     . ASN D 4  253  ? 23.226  -18.580  20.871  1.00 145.88 ? 253  ASN A N     1 
ATOM   2599  C  CA    . ASN D 4  253  ? 22.451  -17.895  19.816  1.00 145.85 ? 253  ASN A CA    1 
ATOM   2600  C  C     . ASN D 4  253  ? 22.872  -18.193  18.356  1.00 145.93 ? 253  ASN A C     1 
ATOM   2601  O  O     . ASN D 4  253  ? 22.028  -18.185  17.451  1.00 145.92 ? 253  ASN A O     1 
ATOM   2602  C  CB    . ASN D 4  253  ? 22.402  -16.375  20.078  1.00 145.79 ? 253  ASN A CB    1 
ATOM   2603  C  CG    . ASN D 4  253  ? 23.774  -15.700  19.971  1.00 145.45 ? 253  ASN A CG    1 
ATOM   2604  O  OD1   . ASN D 4  253  ? 23.913  -14.674  19.303  1.00 144.59 ? 253  ASN A OD1   1 
ATOM   2605  N  ND2   . ASN D 4  253  ? 24.785  -16.270  20.634  1.00 145.19 ? 253  ASN A ND2   1 
ATOM   2606  N  N     . GLU D 4  254  ? 24.172  -18.444  18.156  1.00 145.94 ? 254  GLU A N     1 
ATOM   2607  C  CA    . GLU D 4  254  ? 24.810  -18.740  16.843  1.00 145.90 ? 254  GLU A CA    1 
ATOM   2608  C  C     . GLU D 4  254  ? 25.289  -17.524  16.025  1.00 145.73 ? 254  GLU A C     1 
ATOM   2609  O  O     . GLU D 4  254  ? 24.916  -17.326  14.858  1.00 145.64 ? 254  GLU A O     1 
ATOM   2610  C  CB    . GLU D 4  254  ? 24.020  -19.742  15.983  1.00 145.98 ? 254  GLU A CB    1 
ATOM   2611  C  CG    . GLU D 4  254  ? 24.915  -20.558  15.042  1.00 146.53 ? 254  GLU A CG    1 
ATOM   2612  C  CD    . GLU D 4  254  ? 26.111  -21.202  15.760  1.00 147.41 ? 254  GLU A CD    1 
ATOM   2613  O  OE1   . GLU D 4  254  ? 25.917  -22.192  16.507  1.00 147.60 ? 254  GLU A OE1   1 
ATOM   2614  O  OE2   . GLU D 4  254  ? 27.250  -20.719  15.568  1.00 147.89 ? 254  GLU A OE2   1 
ATOM   2615  N  N     . SER D 4  255  ? 26.140  -16.738  16.680  1.00 145.50 ? 255  SER A N     1 
ATOM   2616  C  CA    . SER D 4  255  ? 26.912  -15.655  16.083  1.00 145.11 ? 255  SER A CA    1 
ATOM   2617  C  C     . SER D 4  255  ? 27.796  -15.081  17.196  1.00 144.93 ? 255  SER A C     1 
ATOM   2618  O  O     . SER D 4  255  ? 28.004  -13.868  17.281  1.00 144.86 ? 255  SER A O     1 
ATOM   2619  C  CB    . SER D 4  255  ? 25.997  -14.582  15.496  1.00 145.05 ? 255  SER A CB    1 
ATOM   2620  O  OG    . SER D 4  255  ? 26.682  -13.841  14.508  1.00 144.98 ? 255  SER A OG    1 
ATOM   2621  N  N     . GLN D 4  256  ? 28.307  -15.982  18.043  1.00 144.69 ? 256  GLN A N     1 
ATOM   2622  C  CA    . GLN D 4  256  ? 29.037  -15.645  19.273  1.00 144.42 ? 256  GLN A CA    1 
ATOM   2623  C  C     . GLN D 4  256  ? 29.860  -16.849  19.755  1.00 144.00 ? 256  GLN A C     1 
ATOM   2624  O  O     . GLN D 4  256  ? 29.601  -17.980  19.338  1.00 144.08 ? 256  GLN A O     1 
ATOM   2625  C  CB    . GLN D 4  256  ? 28.049  -15.217  20.372  1.00 144.65 ? 256  GLN A CB    1 
ATOM   2626  C  CG    . GLN D 4  256  ? 28.673  -14.604  21.638  1.00 145.16 ? 256  GLN A CG    1 
ATOM   2627  C  CD    . GLN D 4  256  ? 29.055  -13.132  21.478  1.00 145.58 ? 256  GLN A CD    1 
ATOM   2628  O  OE1   . GLN D 4  256  ? 29.868  -12.771  20.624  1.00 145.62 ? 256  GLN A OE1   1 
ATOM   2629  N  NE2   . GLN D 4  256  ? 28.473  -12.278  22.317  1.00 145.63 ? 256  GLN A NE2   1 
ATOM   2630  N  N     . ARG D 4  257  ? 30.835  -16.591  20.636  1.00 143.36 ? 257  ARG A N     1 
ATOM   2631  C  CA    . ARG D 4  257  ? 31.727  -17.617  21.208  1.00 142.58 ? 257  ARG A CA    1 
ATOM   2632  C  C     . ARG D 4  257  ? 30.981  -18.578  22.114  1.00 141.98 ? 257  ARG A C     1 
ATOM   2633  O  O     . ARG D 4  257  ? 30.872  -19.765  21.811  1.00 141.77 ? 257  ARG A O     1 
ATOM   2634  C  CB    . ARG D 4  257  ? 32.862  -16.973  22.019  1.00 142.62 ? 257  ARG A CB    1 
ATOM   2635  C  CG    . ARG D 4  257  ? 33.736  -16.006  21.243  1.00 142.56 ? 257  ARG A CG    1 
ATOM   2636  C  CD    . ARG D 4  257  ? 34.256  -14.881  22.137  1.00 142.30 ? 257  ARG A CD    1 
ATOM   2637  N  NE    . ARG D 4  257  ? 34.556  -13.678  21.356  1.00 141.66 ? 257  ARG A NE    1 
ATOM   2638  C  CZ    . ARG D 4  257  ? 33.669  -12.733  21.046  1.00 140.88 ? 257  ARG A CZ    1 
ATOM   2639  N  NH1   . ARG D 4  257  ? 32.408  -12.825  21.452  1.00 140.58 ? 257  ARG A NH1   1 
ATOM   2640  N  NH2   . ARG D 4  257  ? 34.045  -11.689  20.326  1.00 140.41 ? 257  ARG A NH2   1 
ATOM   2641  N  N     . GLY D 4  258  ? 30.480  -18.046  23.228  1.00 141.44 ? 258  GLY A N     1 
ATOM   2642  C  CA    . GLY D 4  258  ? 29.804  -18.840  24.257  1.00 140.90 ? 258  GLY A CA    1 
ATOM   2643  C  C     . GLY D 4  258  ? 30.745  -19.681  25.117  1.00 140.37 ? 258  GLY A C     1 
ATOM   2644  O  O     . GLY D 4  258  ? 30.511  -20.887  25.304  1.00 140.52 ? 258  GLY A O     1 
ATOM   2645  N  N     . GLU D 4  259  ? 31.788  -19.044  25.664  1.00 139.44 ? 259  GLU A N     1 
ATOM   2646  C  CA    . GLU D 4  259  ? 32.867  -19.753  26.378  1.00 138.30 ? 259  GLU A CA    1 
ATOM   2647  C  C     . GLU D 4  259  ? 32.540  -20.386  27.733  1.00 137.22 ? 259  GLU A C     1 
ATOM   2648  O  O     . GLU D 4  259  ? 31.510  -20.092  28.332  1.00 137.14 ? 259  GLU A O     1 
ATOM   2649  C  CB    . GLU D 4  259  ? 34.118  -18.882  26.489  1.00 138.49 ? 259  GLU A CB    1 
ATOM   2650  C  CG    . GLU D 4  259  ? 35.205  -19.330  25.531  1.00 139.30 ? 259  GLU A CG    1 
ATOM   2651  C  CD    . GLU D 4  259  ? 35.289  -20.854  25.412  1.00 140.16 ? 259  GLU A CD    1 
ATOM   2652  O  OE1   . GLU D 4  259  ? 35.121  -21.357  24.281  1.00 140.96 ? 259  GLU A OE1   1 
ATOM   2653  O  OE2   . GLU D 4  259  ? 35.498  -21.546  26.439  1.00 139.95 ? 259  GLU A OE2   1 
ATOM   2654  N  N     . ASP D 4  260  ? 33.443  -21.248  28.202  1.00 135.97 ? 260  ASP A N     1 
ATOM   2655  C  CA    . ASP D 4  260  ? 33.254  -22.033  29.430  1.00 134.77 ? 260  ASP A CA    1 
ATOM   2656  C  C     . ASP D 4  260  ? 33.342  -21.196  30.716  1.00 134.15 ? 260  ASP A C     1 
ATOM   2657  O  O     . ASP D 4  260  ? 33.547  -19.982  30.648  1.00 134.24 ? 260  ASP A O     1 
ATOM   2658  C  CB    . ASP D 4  260  ? 34.264  -23.180  29.476  1.00 134.54 ? 260  ASP A CB    1 
ATOM   2659  C  CG    . ASP D 4  260  ? 33.905  -24.221  30.505  1.00 133.89 ? 260  ASP A CG    1 
ATOM   2660  O  OD1   . ASP D 4  260  ? 33.952  -23.925  31.712  1.00 133.01 ? 260  ASP A OD1   1 
ATOM   2661  O  OD2   . ASP D 4  260  ? 33.564  -25.343  30.108  1.00 133.68 ? 260  ASP A OD2   1 
ATOM   2662  N  N     . ASP D 4  261  ? 33.165  -21.843  31.876  1.00 133.08 ? 261  ASP A N     1 
ATOM   2663  C  CA    . ASP D 4  261  ? 33.315  -21.186  33.190  1.00 132.11 ? 261  ASP A CA    1 
ATOM   2664  C  C     . ASP D 4  261  ? 34.704  -21.494  33.740  1.00 130.81 ? 261  ASP A C     1 
ATOM   2665  O  O     . ASP D 4  261  ? 35.142  -20.917  34.734  1.00 130.73 ? 261  ASP A O     1 
ATOM   2666  C  CB    . ASP D 4  261  ? 32.215  -21.638  34.187  1.00 132.50 ? 261  ASP A CB    1 
ATOM   2667  C  CG    . ASP D 4  261  ? 31.685  -20.479  35.091  1.00 133.36 ? 261  ASP A CG    1 
ATOM   2668  O  OD1   . ASP D 4  261  ? 32.504  -19.689  35.629  1.00 134.32 ? 261  ASP A OD1   1 
ATOM   2669  O  OD2   . ASP D 4  261  ? 30.440  -20.368  35.270  1.00 133.49 ? 261  ASP A OD2   1 
ATOM   2670  N  N     . LEU D 4  262  ? 35.401  -22.393  33.069  1.00 129.29 ? 262  LEU A N     1 
ATOM   2671  C  CA    . LEU D 4  262  ? 36.671  -22.857  33.558  1.00 128.12 ? 262  LEU A CA    1 
ATOM   2672  C  C     . LEU D 4  262  ? 37.784  -22.403  32.644  1.00 127.59 ? 262  LEU A C     1 
ATOM   2673  O  O     . LEU D 4  262  ? 38.908  -22.217  33.089  1.00 127.78 ? 262  LEU A O     1 
ATOM   2674  C  CB    . LEU D 4  262  ? 36.661  -24.371  33.655  1.00 128.00 ? 262  LEU A CB    1 
ATOM   2675  C  CG    . LEU D 4  262  ? 37.598  -24.981  34.679  1.00 127.24 ? 262  LEU A CG    1 
ATOM   2676  C  CD1   . LEU D 4  262  ? 36.860  -25.232  35.989  1.00 126.10 ? 262  LEU A CD1   1 
ATOM   2677  C  CD2   . LEU D 4  262  ? 38.148  -26.262  34.095  1.00 126.86 ? 262  LEU A CD2   1 
ATOM   2678  N  N     . THR D 4  263  ? 37.478  -22.228  31.364  1.00 126.79 ? 263  THR A N     1 
ATOM   2679  C  CA    . THR D 4  263  ? 38.443  -21.646  30.437  1.00 126.08 ? 263  THR A CA    1 
ATOM   2680  C  C     . THR D 4  263  ? 38.647  -20.169  30.769  1.00 125.45 ? 263  THR A C     1 
ATOM   2681  O  O     . THR D 4  263  ? 39.589  -19.547  30.285  1.00 125.44 ? 263  THR A O     1 
ATOM   2682  C  CB    . THR D 4  263  ? 38.000  -21.782  28.969  1.00 126.21 ? 263  THR A CB    1 
ATOM   2683  O  OG1   . THR D 4  263  ? 37.551  -23.118  28.722  1.00 126.65 ? 263  THR A OG1   1 
ATOM   2684  C  CG2   . THR D 4  263  ? 39.154  -21.455  28.023  1.00 125.79 ? 263  THR A CG2   1 
ATOM   2685  N  N     . PHE D 4  264  ? 37.753  -19.614  31.587  1.00 124.64 ? 264  PHE A N     1 
ATOM   2686  C  CA    . PHE D 4  264  ? 37.923  -18.263  32.104  1.00 123.83 ? 264  PHE A CA    1 
ATOM   2687  C  C     . PHE D 4  264  ? 38.972  -18.228  33.208  1.00 123.27 ? 264  PHE A C     1 
ATOM   2688  O  O     . PHE D 4  264  ? 39.634  -17.211  33.393  1.00 123.53 ? 264  PHE A O     1 
ATOM   2689  C  CB    . PHE D 4  264  ? 36.601  -17.664  32.607  1.00 123.83 ? 264  PHE A CB    1 
ATOM   2690  C  CG    . PHE D 4  264  ? 35.732  -17.093  31.514  1.00 124.21 ? 264  PHE A CG    1 
ATOM   2691  C  CD1   . PHE D 4  264  ? 34.345  -17.100  31.639  1.00 124.65 ? 264  PHE A CD1   1 
ATOM   2692  C  CD2   . PHE D 4  264  ? 36.296  -16.549  30.356  1.00 124.54 ? 264  PHE A CD2   1 
ATOM   2693  C  CE1   . PHE D 4  264  ? 33.528  -16.571  30.625  1.00 124.72 ? 264  PHE A CE1   1 
ATOM   2694  C  CE2   . PHE D 4  264  ? 35.489  -16.020  29.339  1.00 124.39 ? 264  PHE A CE2   1 
ATOM   2695  C  CZ    . PHE D 4  264  ? 34.103  -16.033  29.475  1.00 124.28 ? 264  PHE A CZ    1 
ATOM   2696  N  N     . LYS D 4  265  ? 39.137  -19.326  33.940  1.00 122.39 ? 265  LYS A N     1 
ATOM   2697  C  CA    . LYS D 4  265  ? 40.128  -19.336  35.006  1.00 121.53 ? 265  LYS A CA    1 
ATOM   2698  C  C     . LYS D 4  265  ? 41.497  -19.507  34.408  1.00 121.10 ? 265  LYS A C     1 
ATOM   2699  O  O     . LYS D 4  265  ? 42.393  -18.742  34.713  1.00 121.18 ? 265  LYS A O     1 
ATOM   2700  C  CB    . LYS D 4  265  ? 39.872  -20.425  36.043  1.00 121.59 ? 265  LYS A CB    1 
ATOM   2701  C  CG    . LYS D 4  265  ? 40.456  -20.081  37.408  1.00 120.91 ? 265  LYS A CG    1 
ATOM   2702  C  CD    . LYS D 4  265  ? 39.366  -19.719  38.402  1.00 119.48 ? 265  LYS A CD    1 
ATOM   2703  C  CE    . LYS D 4  265  ? 39.905  -18.875  39.534  1.00 117.62 ? 265  LYS A CE    1 
ATOM   2704  N  NZ    . LYS D 4  265  ? 39.871  -17.432  39.202  1.00 115.96 ? 265  LYS A NZ    1 
ATOM   2705  N  N     . LEU D 4  266  ? 41.649  -20.497  33.539  1.00 120.62 ? 266  LEU A N     1 
ATOM   2706  C  CA    . LEU D 4  266  ? 42.909  -20.703  32.837  1.00 120.48 ? 266  LEU A CA    1 
ATOM   2707  C  C     . LEU D 4  266  ? 43.341  -19.482  32.008  1.00 120.30 ? 266  LEU A C     1 
ATOM   2708  O  O     . LEU D 4  266  ? 44.467  -19.414  31.521  1.00 120.31 ? 266  LEU A O     1 
ATOM   2709  C  CB    . LEU D 4  266  ? 42.841  -21.962  31.983  1.00 120.54 ? 266  LEU A CB    1 
ATOM   2710  C  CG    . LEU D 4  266  ? 43.015  -23.244  32.793  1.00 120.93 ? 266  LEU A CG    1 
ATOM   2711  C  CD1   . LEU D 4  266  ? 41.895  -24.215  32.487  1.00 122.08 ? 266  LEU A CD1   1 
ATOM   2712  C  CD2   . LEU D 4  266  ? 44.375  -23.875  32.541  1.00 121.29 ? 266  LEU A CD2   1 
ATOM   2713  N  N     . ALA D 4  267  ? 42.441  -18.519  31.855  1.00 119.97 ? 267  ALA A N     1 
ATOM   2714  C  CA    . ALA D 4  267  ? 42.826  -17.213  31.369  1.00 119.65 ? 267  ALA A CA    1 
ATOM   2715  C  C     . ALA D 4  267  ? 43.290  -16.408  32.570  1.00 119.56 ? 267  ALA A C     1 
ATOM   2716  O  O     . ALA D 4  267  ? 44.441  -16.001  32.634  1.00 119.59 ? 267  ALA A O     1 
ATOM   2717  C  CB    . ALA D 4  267  ? 41.665  -16.528  30.671  1.00 119.60 ? 267  ALA A CB    1 
ATOM   2718  N  N     . ASP D 4  268  ? 42.397  -16.226  33.539  1.00 119.50 ? 268  ASP A N     1 
ATOM   2719  C  CA    . ASP D 4  268  ? 42.651  -15.383  34.712  1.00 119.60 ? 268  ASP A CA    1 
ATOM   2720  C  C     . ASP D 4  268  ? 43.888  -15.754  35.531  1.00 119.56 ? 268  ASP A C     1 
ATOM   2721  O  O     . ASP D 4  268  ? 44.358  -14.952  36.336  1.00 119.53 ? 268  ASP A O     1 
ATOM   2722  C  CB    . ASP D 4  268  ? 41.424  -15.354  35.625  1.00 119.74 ? 268  ASP A CB    1 
ATOM   2723  C  CG    . ASP D 4  268  ? 40.511  -14.164  35.357  1.00 120.32 ? 268  ASP A CG    1 
ATOM   2724  O  OD1   . ASP D 4  268  ? 41.006  -13.008  35.350  1.00 120.59 ? 268  ASP A OD1   1 
ATOM   2725  O  OD2   . ASP D 4  268  ? 39.288  -14.389  35.181  1.00 121.04 ? 268  ASP A OD2   1 
ATOM   2726  N  N     . ILE D 4  269  ? 44.400  -16.967  35.345  1.00 119.64 ? 269  ILE A N     1 
ATOM   2727  C  CA    . ILE D 4  269  ? 45.659  -17.345  35.976  1.00 119.61 ? 269  ILE A CA    1 
ATOM   2728  C  C     . ILE D 4  269  ? 46.815  -17.153  35.006  1.00 119.67 ? 269  ILE A C     1 
ATOM   2729  O  O     . ILE D 4  269  ? 47.920  -16.840  35.432  1.00 119.79 ? 269  ILE A O     1 
ATOM   2730  C  CB    . ILE D 4  269  ? 45.652  -18.768  36.629  1.00 119.59 ? 269  ILE A CB    1 
ATOM   2731  C  CG1   . ILE D 4  269  ? 45.374  -19.877  35.610  1.00 119.90 ? 269  ILE A CG1   1 
ATOM   2732  C  CG2   . ILE D 4  269  ? 44.660  -18.839  37.771  1.00 119.24 ? 269  ILE A CG2   1 
ATOM   2733  C  CD1   . ILE D 4  269  ? 46.613  -20.598  35.107  1.00 120.33 ? 269  ILE A CD1   1 
ATOM   2734  N  N     . LEU D 4  270  ? 46.560  -17.310  33.708  1.00 119.81 ? 270  LEU A N     1 
ATOM   2735  C  CA    . LEU D 4  270  ? 47.567  -16.958  32.697  1.00 120.13 ? 270  LEU A CA    1 
ATOM   2736  C  C     . LEU D 4  270  ? 47.678  -15.425  32.507  1.00 120.38 ? 270  LEU A C     1 
ATOM   2737  O  O     . LEU D 4  270  ? 48.713  -14.914  32.056  1.00 120.28 ? 270  LEU A O     1 
ATOM   2738  C  CB    . LEU D 4  270  ? 47.317  -17.691  31.363  1.00 120.08 ? 270  LEU A CB    1 
ATOM   2739  C  CG    . LEU D 4  270  ? 48.428  -17.717  30.288  1.00 119.95 ? 270  LEU A CG    1 
ATOM   2740  C  CD1   . LEU D 4  270  ? 48.384  -18.972  29.412  1.00 119.33 ? 270  LEU A CD1   1 
ATOM   2741  C  CD2   . LEU D 4  270  ? 48.420  -16.456  29.407  1.00 120.23 ? 270  LEU A CD2   1 
ATOM   2742  N  N     . LYS D 4  271  ? 46.619  -14.697  32.861  1.00 120.69 ? 271  LYS A N     1 
ATOM   2743  C  CA    . LYS D 4  271  ? 46.650  -13.238  32.803  1.00 121.02 ? 271  LYS A CA    1 
ATOM   2744  C  C     . LYS D 4  271  ? 47.473  -12.702  33.974  1.00 120.97 ? 271  LYS A C     1 
ATOM   2745  O  O     . LYS D 4  271  ? 48.050  -11.614  33.886  1.00 121.12 ? 271  LYS A O     1 
ATOM   2746  C  CB    . LYS D 4  271  ? 45.235  -12.637  32.779  1.00 120.98 ? 271  LYS A CB    1 
ATOM   2747  C  CG    . LYS D 4  271  ? 45.176  -11.232  32.155  1.00 121.53 ? 271  LYS A CG    1 
ATOM   2748  C  CD    . LYS D 4  271  ? 43.765  -10.617  32.156  1.00 121.46 ? 271  LYS A CD    1 
ATOM   2749  C  CE    . LYS D 4  271  ? 43.107  -10.633  30.770  1.00 121.88 ? 271  LYS A CE    1 
ATOM   2750  N  NZ    . LYS D 4  271  ? 42.363  -11.897  30.464  1.00 121.36 ? 271  LYS A NZ    1 
ATOM   2751  N  N     . ALA D 4  272  ? 47.535  -13.483  35.054  1.00 120.93 ? 272  ALA A N     1 
ATOM   2752  C  CA    . ALA D 4  272  ? 48.391  -13.176  36.204  1.00 120.89 ? 272  ALA A CA    1 
ATOM   2753  C  C     . ALA D 4  272  ? 49.821  -13.698  36.034  1.00 120.85 ? 272  ALA A C     1 
ATOM   2754  O  O     . ALA D 4  272  ? 50.735  -13.201  36.694  1.00 120.91 ? 272  ALA A O     1 
ATOM   2755  C  CB    . ALA D 4  272  ? 47.781  -13.705  37.498  1.00 120.90 ? 272  ALA A CB    1 
ATOM   2756  N  N     . ASN D 4  273  ? 50.004  -14.697  35.164  1.00 120.70 ? 273  ASN A N     1 
ATOM   2757  C  CA    . ASN D 4  273  ? 51.335  -15.249  34.846  1.00 120.55 ? 273  ASN A CA    1 
ATOM   2758  C  C     . ASN D 4  273  ? 52.108  -14.365  33.862  1.00 120.93 ? 273  ASN A C     1 
ATOM   2759  O  O     . ASN D 4  273  ? 53.337  -14.239  33.947  1.00 120.96 ? 273  ASN A O     1 
ATOM   2760  C  CB    . ASN D 4  273  ? 51.223  -16.672  34.296  1.00 120.14 ? 273  ASN A CB    1 
ATOM   2761  C  CG    . ASN D 4  273  ? 52.487  -17.484  34.501  1.00 119.20 ? 273  ASN A CG    1 
ATOM   2762  O  OD1   . ASN D 4  273  ? 52.805  -17.881  35.624  1.00 118.62 ? 273  ASN A OD1   1 
ATOM   2763  N  ND2   . ASN D 4  273  ? 53.202  -17.756  33.414  1.00 117.54 ? 273  ASN A ND2   1 
ATOM   2764  N  N     . ILE D 4  274  ? 51.379  -13.763  32.925  1.00 121.20 ? 274  ILE A N     1 
ATOM   2765  C  CA    . ILE D 4  274  ? 51.941  -12.748  32.050  1.00 121.44 ? 274  ILE A CA    1 
ATOM   2766  C  C     . ILE D 4  274  ? 52.399  -11.558  32.901  1.00 121.78 ? 274  ILE A C     1 
ATOM   2767  O  O     . ILE D 4  274  ? 53.441  -10.961  32.623  1.00 121.91 ? 274  ILE A O     1 
ATOM   2768  C  CB    . ILE D 4  274  ? 50.950  -12.368  30.903  1.00 121.42 ? 274  ILE A CB    1 
ATOM   2769  C  CG1   . ILE D 4  274  ? 51.373  -13.063  29.601  1.00 121.27 ? 274  ILE A CG1   1 
ATOM   2770  C  CG2   . ILE D 4  274  ? 50.842  -10.849  30.709  1.00 121.45 ? 274  ILE A CG2   1 
ATOM   2771  C  CD1   . ILE D 4  274  ? 50.425  -12.867  28.427  1.00 121.36 ? 274  ILE A CD1   1 
ATOM   2772  N  N     . SER D 4  275  ? 51.640  -11.262  33.959  1.00 122.16 ? 275  SER A N     1 
ATOM   2773  C  CA    . SER D 4  275  ? 51.933  -10.157  34.883  1.00 122.55 ? 275  SER A CA    1 
ATOM   2774  C  C     . SER D 4  275  ? 53.295  -10.294  35.588  1.00 122.99 ? 275  SER A C     1 
ATOM   2775  O  O     . SER D 4  275  ? 54.133  -9.385   35.520  1.00 122.94 ? 275  SER A O     1 
ATOM   2776  C  CB    . SER D 4  275  ? 50.798  -10.003  35.906  1.00 122.39 ? 275  SER A CB    1 
ATOM   2777  O  OG    . SER D 4  275  ? 51.094  -9.017   36.879  1.00 121.92 ? 275  SER A OG    1 
ATOM   2778  N  N     . LEU D 4  276  ? 53.510  -11.433  36.249  1.00 123.52 ? 276  LEU A N     1 
ATOM   2779  C  CA    . LEU D 4  276  ? 54.762  -11.698  36.973  1.00 123.99 ? 276  LEU A CA    1 
ATOM   2780  C  C     . LEU D 4  276  ? 55.817  -12.334  36.071  1.00 124.47 ? 276  LEU A C     1 
ATOM   2781  O  O     . LEU D 4  276  ? 56.528  -13.260  36.478  1.00 124.62 ? 276  LEU A O     1 
ATOM   2782  C  CB    . LEU D 4  276  ? 54.516  -12.576  38.209  1.00 123.94 ? 276  LEU A CB    1 
ATOM   2783  C  CG    . LEU D 4  276  ? 54.031  -11.947  39.521  1.00 123.64 ? 276  LEU A CG    1 
ATOM   2784  C  CD1   . LEU D 4  276  ? 52.691  -11.250  39.357  1.00 123.02 ? 276  LEU A CD1   1 
ATOM   2785  C  CD2   . LEU D 4  276  ? 53.941  -13.030  40.573  1.00 123.78 ? 276  LEU A CD2   1 
ATOM   2786  N  N     . GLU D 4  277  ? 55.890  -11.837  34.838  1.00 124.94 ? 277  GLU A N     1 
ATOM   2787  C  CA    . GLU D 4  277  ? 56.956  -12.182  33.906  1.00 125.34 ? 277  GLU A CA    1 
ATOM   2788  C  C     . GLU D 4  277  ? 57.588  -10.903  33.403  1.00 125.36 ? 277  GLU A C     1 
ATOM   2789  O  O     . GLU D 4  277  ? 58.811  -10.816  33.302  1.00 125.37 ? 277  GLU A O     1 
ATOM   2790  C  CB    . GLU D 4  277  ? 56.421  -12.976  32.717  1.00 125.52 ? 277  GLU A CB    1 
ATOM   2791  C  CG    . GLU D 4  277  ? 56.359  -14.476  32.923  1.00 126.26 ? 277  GLU A CG    1 
ATOM   2792  C  CD    . GLU D 4  277  ? 56.328  -15.222  31.604  1.00 127.27 ? 277  GLU A CD    1 
ATOM   2793  O  OE1   . GLU D 4  277  ? 55.283  -15.839  31.289  1.00 127.62 ? 277  GLU A OE1   1 
ATOM   2794  O  OE2   . GLU D 4  277  ? 57.346  -15.172  30.876  1.00 127.60 ? 277  GLU A OE2   1 
ATOM   2795  N  N     . THR D 4  278  ? 56.741  -9.920   33.086  1.00 125.53 ? 278  THR A N     1 
ATOM   2796  C  CA    . THR D 4  278  ? 57.192  -8.607   32.602  1.00 125.65 ? 278  THR A CA    1 
ATOM   2797  C  C     . THR D 4  278  ? 57.378  -7.599   33.759  1.00 125.73 ? 278  THR A C     1 
ATOM   2798  O  O     . THR D 4  278  ? 57.882  -6.488   33.548  1.00 125.87 ? 278  THR A O     1 
ATOM   2799  C  CB    . THR D 4  278  ? 56.266  -8.030   31.479  1.00 125.62 ? 278  THR A CB    1 
ATOM   2800  O  OG1   . THR D 4  278  ? 55.632  -9.098   30.766  1.00 125.57 ? 278  THR A OG1   1 
ATOM   2801  C  CG2   . THR D 4  278  ? 57.067  -7.177   30.490  1.00 125.46 ? 278  THR A CG2   1 
ATOM   2802  N  N     . LEU D 4  279  ? 56.980  -7.990   34.975  1.00 125.61 ? 279  LEU A N     1 
ATOM   2803  C  CA    . LEU D 4  279  ? 57.358  -7.249   36.194  1.00 125.34 ? 279  LEU A CA    1 
ATOM   2804  C  C     . LEU D 4  279  ? 58.732  -7.705   36.732  1.00 125.33 ? 279  LEU A C     1 
ATOM   2805  O  O     . LEU D 4  279  ? 59.098  -7.401   37.874  1.00 125.29 ? 279  LEU A O     1 
ATOM   2806  C  CB    . LEU D 4  279  ? 56.279  -7.369   37.287  1.00 125.16 ? 279  LEU A CB    1 
ATOM   2807  C  CG    . LEU D 4  279  ? 55.052  -6.450   37.298  1.00 124.43 ? 279  LEU A CG    1 
ATOM   2808  C  CD1   . LEU D 4  279  ? 54.213  -6.736   38.528  1.00 123.78 ? 279  LEU A CD1   1 
ATOM   2809  C  CD2   . LEU D 4  279  ? 55.437  -4.981   37.263  1.00 123.76 ? 279  LEU A CD2   1 
ATOM   2810  N  N     . GLU D 4  280  ? 59.482  -8.432   35.897  1.00 125.24 ? 280  GLU A N     1 
ATOM   2811  C  CA    . GLU D 4  280  ? 60.792  -8.985   36.265  1.00 125.13 ? 280  GLU A CA    1 
ATOM   2812  C  C     . GLU D 4  280  ? 61.886  -8.708   35.207  1.00 125.02 ? 280  GLU A C     1 
ATOM   2813  O  O     . GLU D 4  280  ? 62.787  -7.895   35.457  1.00 125.05 ? 280  GLU A O     1 
ATOM   2814  C  CB    . GLU D 4  280  ? 60.673  -10.473  36.641  1.00 125.09 ? 280  GLU A CB    1 
ATOM   2815  C  CG    . GLU D 4  280  ? 60.030  -10.693  38.025  1.00 125.13 ? 280  GLU A CG    1 
ATOM   2816  C  CD    . GLU D 4  280  ? 59.594  -12.130  38.297  1.00 125.18 ? 280  GLU A CD    1 
ATOM   2817  O  OE1   . GLU D 4  280  ? 59.866  -13.017  37.463  1.00 125.48 ? 280  GLU A OE1   1 
ATOM   2818  O  OE2   . GLU D 4  280  ? 58.976  -12.373  39.358  1.00 125.02 ? 280  GLU A OE2   1 
ATOM   2819  N  N     . HIS D 4  281  ? 61.813  -9.347   34.036  1.00 124.78 ? 281  HIS A N     1 
ATOM   2820  C  CA    . HIS D 4  281  ? 62.681  -8.938   32.920  1.00 124.55 ? 281  HIS A CA    1 
ATOM   2821  C  C     . HIS D 4  281  ? 62.142  -7.640   32.299  1.00 124.41 ? 281  HIS A C     1 
ATOM   2822  O  O     . HIS D 4  281  ? 61.958  -7.515   31.076  1.00 124.34 ? 281  HIS A O     1 
ATOM   2823  C  CB    . HIS D 4  281  ? 62.904  -10.052  31.886  1.00 124.57 ? 281  HIS A CB    1 
ATOM   2824  C  CG    . HIS D 4  281  ? 61.643  -10.640  31.337  1.00 124.60 ? 281  HIS A CG    1 
ATOM   2825  N  ND1   . HIS D 4  281  ? 60.789  -9.937   30.512  1.00 124.65 ? 281  HIS A ND1   1 
ATOM   2826  C  CD2   . HIS D 4  281  ? 61.104  -11.875  31.474  1.00 124.46 ? 281  HIS A CD2   1 
ATOM   2827  C  CE1   . HIS D 4  281  ? 59.770  -10.710  30.178  1.00 124.60 ? 281  HIS A CE1   1 
ATOM   2828  N  NE2   . HIS D 4  281  ? 59.937  -11.891  30.748  1.00 124.51 ? 281  HIS A NE2   1 
ATOM   2829  N  N     . ASN D 4  282  ? 61.878  -6.695   33.202  1.00 124.25 ? 282  ASN A N     1 
ATOM   2830  C  CA    . ASN D 4  282  ? 61.432  -5.344   32.908  1.00 124.15 ? 282  ASN A CA    1 
ATOM   2831  C  C     . ASN D 4  282  ? 61.253  -4.614   34.249  1.00 124.16 ? 282  ASN A C     1 
ATOM   2832  O  O     . ASN D 4  282  ? 60.231  -3.949   34.479  1.00 124.21 ? 282  ASN A O     1 
ATOM   2833  C  CB    . ASN D 4  282  ? 60.140  -5.353   32.076  1.00 124.03 ? 282  ASN A CB    1 
ATOM   2834  C  CG    . ASN D 4  282  ? 59.961  -4.092   31.238  1.00 123.92 ? 282  ASN A CG    1 
ATOM   2835  O  OD1   . ASN D 4  282  ? 58.834  -3.700   30.937  1.00 123.61 ? 282  ASN A OD1   1 
ATOM   2836  N  ND2   . ASN D 4  282  ? 61.069  -3.460   30.849  1.00 123.66 ? 282  ASN A ND2   1 
ATOM   2837  N  N     . GLY D 4  283  ? 62.251  -4.791   35.131  1.00 124.15 ? 283  GLY A N     1 
ATOM   2838  C  CA    . GLY D 4  283  ? 62.369  -4.079   36.416  1.00 124.14 ? 283  GLY A CA    1 
ATOM   2839  C  C     . GLY D 4  283  ? 61.183  -4.065   37.367  1.00 124.20 ? 283  GLY A C     1 
ATOM   2840  O  O     . GLY D 4  283  ? 60.133  -3.505   37.050  1.00 124.28 ? 283  GLY A O     1 
ATOM   2841  N  N     . ALA D 4  284  ? 61.363  -4.656   38.549  1.00 124.24 ? 284  ALA A N     1 
ATOM   2842  C  CA    . ALA D 4  284  ? 60.324  -4.672   39.592  1.00 124.37 ? 284  ALA A CA    1 
ATOM   2843  C  C     . ALA D 4  284  ? 60.137  -3.292   40.249  1.00 124.51 ? 284  ALA A C     1 
ATOM   2844  O  O     . ALA D 4  284  ? 61.070  -2.489   40.252  1.00 124.66 ? 284  ALA A O     1 
ATOM   2845  C  CB    . ALA D 4  284  ? 60.658  -5.724   40.648  1.00 124.27 ? 284  ALA A CB    1 
ATOM   2846  N  N     . PRO D 4  285  ? 58.920  -2.987   40.758  1.00 124.62 ? 285  PRO A N     1 
ATOM   2847  C  CA    . PRO D 4  285  ? 58.686  -1.792   41.580  1.00 124.69 ? 285  PRO A CA    1 
ATOM   2848  C  C     . PRO D 4  285  ? 58.524  -2.065   43.101  1.00 124.68 ? 285  PRO A C     1 
ATOM   2849  O  O     . PRO D 4  285  ? 57.395  -2.104   43.607  1.00 124.81 ? 285  PRO A O     1 
ATOM   2850  C  CB    . PRO D 4  285  ? 57.379  -1.246   40.991  1.00 124.68 ? 285  PRO A CB    1 
ATOM   2851  C  CG    . PRO D 4  285  ? 56.669  -2.507   40.391  1.00 124.75 ? 285  PRO A CG    1 
ATOM   2852  C  CD    . PRO D 4  285  ? 57.644  -3.671   40.491  1.00 124.68 ? 285  PRO A CD    1 
ATOM   2853  N  N     . HIS D 4  286  ? 59.649  -2.223   43.808  1.00 124.55 ? 286  HIS A N     1 
ATOM   2854  C  CA    . HIS D 4  286  ? 59.696  -2.560   45.253  1.00 124.29 ? 286  HIS A CA    1 
ATOM   2855  C  C     . HIS D 4  286  ? 58.865  -3.795   45.629  1.00 124.14 ? 286  HIS A C     1 
ATOM   2856  O  O     . HIS D 4  286  ? 59.111  -4.889   45.100  1.00 124.10 ? 286  HIS A O     1 
ATOM   2857  C  CB    . HIS D 4  286  ? 59.369  -1.340   46.134  1.00 124.28 ? 286  HIS A CB    1 
ATOM   2858  C  CG    . HIS D 4  286  ? 60.467  -0.320   46.180  1.00 124.20 ? 286  HIS A CG    1 
ATOM   2859  N  ND1   . HIS D 4  286  ? 61.650  -0.528   46.857  1.00 124.23 ? 286  HIS A ND1   1 
ATOM   2860  C  CD2   . HIS D 4  286  ? 60.563  0.913    45.628  1.00 123.92 ? 286  HIS A CD2   1 
ATOM   2861  C  CE1   . HIS D 4  286  ? 62.428  0.531    46.722  1.00 123.91 ? 286  HIS A CE1   1 
ATOM   2862  N  NE2   . HIS D 4  286  ? 61.792  1.420    45.980  1.00 123.96 ? 286  HIS A NE2   1 
ATOM   2863  N  N     . HIS D 4  287  ? 57.900  -3.640   46.536  1.00 123.92 ? 287  HIS A N     1 
ATOM   2864  C  CA    . HIS D 4  287  ? 57.012  -4.762   46.863  1.00 123.67 ? 287  HIS A CA    1 
ATOM   2865  C  C     . HIS D 4  287  ? 55.494  -4.499   46.707  1.00 123.42 ? 287  HIS A C     1 
ATOM   2866  O  O     . HIS D 4  287  ? 54.676  -4.766   47.596  1.00 123.31 ? 287  HIS A O     1 
ATOM   2867  C  CB    . HIS D 4  287  ? 57.412  -5.444   48.188  1.00 123.73 ? 287  HIS A CB    1 
ATOM   2868  C  CG    . HIS D 4  287  ? 58.545  -6.422   48.044  1.00 123.54 ? 287  HIS A CG    1 
ATOM   2869  N  ND1   . HIS D 4  287  ? 58.640  -7.308   46.989  1.00 122.91 ? 287  HIS A ND1   1 
ATOM   2870  C  CD2   . HIS D 4  287  ? 59.622  -6.663   48.831  1.00 123.41 ? 287  HIS A CD2   1 
ATOM   2871  C  CE1   . HIS D 4  287  ? 59.730  -8.041   47.125  1.00 122.69 ? 287  HIS A CE1   1 
ATOM   2872  N  NE2   . HIS D 4  287  ? 60.342  -7.674   48.237  1.00 123.07 ? 287  HIS A NE2   1 
ATOM   2873  N  N     . ALA D 4  288  ? 55.149  -3.956   45.545  1.00 123.09 ? 288  ALA A N     1 
ATOM   2874  C  CA    . ALA D 4  288  ? 53.812  -4.063   45.017  1.00 122.93 ? 288  ALA A CA    1 
ATOM   2875  C  C     . ALA D 4  288  ? 53.799  -5.314   44.137  1.00 123.09 ? 288  ALA A C     1 
ATOM   2876  O  O     . ALA D 4  288  ? 52.735  -5.764   43.715  1.00 123.38 ? 288  ALA A O     1 
ATOM   2877  C  CB    . ALA D 4  288  ? 53.451  -2.836   44.219  1.00 122.71 ? 288  ALA A CB    1 
ATOM   2878  N  N     . ILE D 4  289  ? 54.986  -5.877   43.875  1.00 123.16 ? 289  ILE A N     1 
ATOM   2879  C  CA    . ILE D 4  289  ? 55.138  -7.176   43.178  1.00 123.13 ? 289  ILE A CA    1 
ATOM   2880  C  C     . ILE D 4  289  ? 54.647  -8.347   44.053  1.00 123.47 ? 289  ILE A C     1 
ATOM   2881  O  O     . ILE D 4  289  ? 54.547  -9.493   43.594  1.00 123.30 ? 289  ILE A O     1 
ATOM   2882  C  CB    . ILE D 4  289  ? 56.614  -7.425   42.720  1.00 123.08 ? 289  ILE A CB    1 
ATOM   2883  C  CG1   . ILE D 4  289  ? 56.674  -8.463   41.589  1.00 122.80 ? 289  ILE A CG1   1 
ATOM   2884  C  CG2   . ILE D 4  289  ? 57.503  -7.821   43.906  1.00 122.96 ? 289  ILE A CG2   1 
ATOM   2885  C  CD1   . ILE D 4  289  ? 58.073  -8.777   41.075  1.00 122.67 ? 289  ILE A CD1   1 
ATOM   2886  N  N     . GLU D 4  290  ? 54.353  -8.034   45.315  1.00 123.87 ? 290  GLU A N     1 
ATOM   2887  C  CA    . GLU D 4  290  ? 53.805  -8.991   46.276  1.00 124.21 ? 290  GLU A CA    1 
ATOM   2888  C  C     . GLU D 4  290  ? 52.273  -9.070   46.185  1.00 124.14 ? 290  GLU A C     1 
ATOM   2889  O  O     . GLU D 4  290  ? 51.705  -10.172  46.142  1.00 124.17 ? 290  GLU A O     1 
ATOM   2890  C  CB    . GLU D 4  290  ? 54.268  -8.647   47.701  1.00 124.31 ? 290  GLU A CB    1 
ATOM   2891  C  CG    . GLU D 4  290  ? 54.357  -9.852   48.653  1.00 125.17 ? 290  GLU A CG    1 
ATOM   2892  C  CD    . GLU D 4  290  ? 55.046  -11.081  48.036  1.00 126.19 ? 290  GLU A CD    1 
ATOM   2893  O  OE1   . GLU D 4  290  ? 54.534  -12.210  48.234  1.00 126.18 ? 290  GLU A OE1   1 
ATOM   2894  O  OE2   . GLU D 4  290  ? 56.089  -10.922  47.354  1.00 126.67 ? 290  GLU A OE2   1 
ATOM   2895  N  N     . GLU D 4  291  ? 51.617  -7.906   46.146  1.00 123.97 ? 291  GLU A N     1 
ATOM   2896  C  CA    . GLU D 4  291  ? 50.208  -7.819   45.765  1.00 123.83 ? 291  GLU A CA    1 
ATOM   2897  C  C     . GLU D 4  291  ? 49.984  -8.433   44.377  1.00 123.85 ? 291  GLU A C     1 
ATOM   2898  O  O     . GLU D 4  291  ? 48.888  -8.348   43.811  1.00 124.24 ? 291  GLU A O     1 
ATOM   2899  C  CB    . GLU D 4  291  ? 49.732  -6.370   45.779  1.00 123.67 ? 291  GLU A CB    1 
ATOM   2900  C  CG    . GLU D 4  291  ? 49.340  -5.863   47.148  1.00 123.83 ? 291  GLU A CG    1 
ATOM   2901  C  CD    . GLU D 4  291  ? 48.495  -4.606   47.070  1.00 124.22 ? 291  GLU A CD    1 
ATOM   2902  O  OE1   . GLU D 4  291  ? 47.426  -4.656   46.423  1.00 123.82 ? 291  GLU A OE1   1 
ATOM   2903  O  OE2   . GLU D 4  291  ? 48.897  -3.570   47.654  1.00 124.39 ? 291  GLU A OE2   1 
ATOM   2904  N  N     . ALA D 4  292  ? 51.035  -9.060   43.848  1.00 123.56 ? 292  ALA A N     1 
ATOM   2905  C  CA    . ALA D 4  292  ? 50.998  -9.754   42.568  1.00 123.21 ? 292  ALA A CA    1 
ATOM   2906  C  C     . ALA D 4  292  ? 51.314  -11.242  42.736  1.00 122.93 ? 292  ALA A C     1 
ATOM   2907  O  O     . ALA D 4  292  ? 50.944  -12.064  41.895  1.00 122.95 ? 292  ALA A O     1 
ATOM   2908  C  CB    . ALA D 4  292  ? 51.969  -9.104   41.597  1.00 123.29 ? 292  ALA A CB    1 
ATOM   2909  N  N     . GLU D 4  293  ? 51.993  -11.585  43.828  1.00 122.55 ? 293  GLU A N     1 
ATOM   2910  C  CA    . GLU D 4  293  ? 52.326  -12.980  44.121  1.00 122.14 ? 293  GLU A CA    1 
ATOM   2911  C  C     . GLU D 4  293  ? 51.086  -13.754  44.523  1.00 121.44 ? 293  GLU A C     1 
ATOM   2912  O  O     . GLU D 4  293  ? 50.766  -14.775  43.923  1.00 121.15 ? 293  GLU A O     1 
ATOM   2913  C  CB    . GLU D 4  293  ? 53.370  -13.076  45.240  1.00 122.47 ? 293  GLU A CB    1 
ATOM   2914  C  CG    . GLU D 4  293  ? 54.736  -12.462  44.920  1.00 123.03 ? 293  GLU A CG    1 
ATOM   2915  C  CD    . GLU D 4  293  ? 55.417  -13.083  43.713  1.00 123.91 ? 293  GLU A CD    1 
ATOM   2916  O  OE1   . GLU D 4  293  ? 55.471  -14.337  43.603  1.00 123.65 ? 293  GLU A OE1   1 
ATOM   2917  O  OE2   . GLU D 4  293  ? 55.904  -12.296  42.874  1.00 124.51 ? 293  GLU A OE2   1 
ATOM   2918  N  N     . SER D 4  294  ? 50.400  -13.242  45.541  1.00 120.87 ? 294  SER A N     1 
ATOM   2919  C  CA    . SER D 4  294  ? 49.174  -13.840  46.065  1.00 120.36 ? 294  SER A CA    1 
ATOM   2920  C  C     . SER D 4  294  ? 48.017  -13.797  45.056  1.00 120.01 ? 294  SER A C     1 
ATOM   2921  O  O     . SER D 4  294  ? 47.153  -14.687  45.058  1.00 120.04 ? 294  SER A O     1 
ATOM   2922  C  CB    . SER D 4  294  ? 48.769  -13.146  47.369  1.00 120.32 ? 294  SER A CB    1 
ATOM   2923  O  OG    . SER D 4  294  ? 48.828  -11.740  47.223  1.00 119.92 ? 294  SER A OG    1 
ATOM   2924  N  N     . LEU D 4  295  ? 48.017  -12.768  44.201  1.00 119.26 ? 295  LEU A N     1 
ATOM   2925  C  CA    . LEU D 4  295  ? 47.003  -12.588  43.144  1.00 118.44 ? 295  LEU A CA    1 
ATOM   2926  C  C     . LEU D 4  295  ? 47.293  -13.453  41.906  1.00 117.62 ? 295  LEU A C     1 
ATOM   2927  O  O     . LEU D 4  295  ? 46.721  -13.235  40.833  1.00 117.33 ? 295  LEU A O     1 
ATOM   2928  C  CB    . LEU D 4  295  ? 46.873  -11.097  42.781  1.00 118.57 ? 295  LEU A CB    1 
ATOM   2929  C  CG    . LEU D 4  295  ? 45.687  -10.508  41.996  1.00 118.94 ? 295  LEU A CG    1 
ATOM   2930  C  CD1   . LEU D 4  295  ? 44.336  -11.236  42.224  1.00 118.12 ? 295  LEU A CD1   1 
ATOM   2931  C  CD2   . LEU D 4  295  ? 45.587  -8.995   42.301  1.00 118.39 ? 295  LEU A CD2   1 
ATOM   2932  N  N     . LEU D 4  296  ? 48.219  -14.402  42.074  1.00 116.72 ? 296  LEU A N     1 
ATOM   2933  C  CA    . LEU D 4  296  ? 48.382  -15.543  41.179  1.00 115.80 ? 296  LEU A CA    1 
ATOM   2934  C  C     . LEU D 4  296  ? 48.323  -16.840  41.980  1.00 115.45 ? 296  LEU A C     1 
ATOM   2935  O  O     . LEU D 4  296  ? 48.092  -17.900  41.400  1.00 115.43 ? 296  LEU A O     1 
ATOM   2936  C  CB    . LEU D 4  296  ? 49.678  -15.472  40.370  1.00 115.61 ? 296  LEU A CB    1 
ATOM   2937  C  CG    . LEU D 4  296  ? 49.895  -16.600  39.345  1.00 115.16 ? 296  LEU A CG    1 
ATOM   2938  C  CD1   . LEU D 4  296  ? 50.730  -16.140  38.189  1.00 115.05 ? 296  LEU A CD1   1 
ATOM   2939  C  CD2   . LEU D 4  296  ? 50.536  -17.839  39.957  1.00 114.80 ? 296  LEU A CD2   1 
ATOM   2940  N  N     . GLN D 4  297  ? 48.537  -16.763  43.298  1.00 115.02 ? 297  GLN A N     1 
ATOM   2941  C  CA    . GLN D 4  297  ? 48.289  -17.912  44.180  1.00 114.68 ? 297  GLN A CA    1 
ATOM   2942  C  C     . GLN D 4  297  ? 46.822  -18.312  44.017  1.00 114.69 ? 297  GLN A C     1 
ATOM   2943  O  O     . GLN D 4  297  ? 46.515  -19.242  43.268  1.00 115.01 ? 297  GLN A O     1 
ATOM   2944  C  CB    . GLN D 4  297  ? 48.628  -17.615  45.642  1.00 114.54 ? 297  GLN A CB    1 
ATOM   2945  C  CG    . GLN D 4  297  ? 48.598  -18.855  46.529  1.00 114.13 ? 297  GLN A CG    1 
ATOM   2946  C  CD    . GLN D 4  297  ? 49.478  -19.977  46.005  1.00 113.74 ? 297  GLN A CD    1 
ATOM   2947  O  OE1   . GLN D 4  297  ? 50.686  -19.966  46.191  1.00 113.95 ? 297  GLN A OE1   1 
ATOM   2948  N  NE2   . GLN D 4  297  ? 48.871  -20.952  45.355  1.00 113.01 ? 297  GLN A NE2   1 
ATOM   2949  N  N     . PHE D 4  298  ? 45.912  -17.617  44.698  1.00 114.25 ? 298  PHE A N     1 
ATOM   2950  C  CA    . PHE D 4  298  ? 44.551  -17.497  44.172  1.00 113.59 ? 298  PHE A CA    1 
ATOM   2951  C  C     . PHE D 4  298  ? 44.716  -16.351  43.174  1.00 113.64 ? 298  PHE A C     1 
ATOM   2952  O  O     . PHE D 4  298  ? 45.110  -15.239  43.561  1.00 113.71 ? 298  PHE A O     1 
ATOM   2953  C  CB    . PHE D 4  298  ? 43.527  -17.231  45.286  1.00 113.16 ? 298  PHE A CB    1 
ATOM   2954  C  CG    . PHE D 4  298  ? 42.629  -16.055  45.043  1.00 111.87 ? 298  PHE A CG    1 
ATOM   2955  C  CD1   . PHE D 4  298  ? 42.808  -14.880  45.764  1.00 111.23 ? 298  PHE A CD1   1 
ATOM   2956  C  CD2   . PHE D 4  298  ? 41.607  -16.120  44.117  1.00 110.16 ? 298  PHE A CD2   1 
ATOM   2957  C  CE1   . PHE D 4  298  ? 41.989  -13.786  45.555  1.00 111.13 ? 298  PHE A CE1   1 
ATOM   2958  C  CE2   . PHE D 4  298  ? 40.789  -15.038  43.902  1.00 109.72 ? 298  PHE A CE2   1 
ATOM   2959  C  CZ    . PHE D 4  298  ? 40.974  -13.868  44.622  1.00 111.03 ? 298  PHE A CZ    1 
ATOM   2960  N  N     . HIS D 4  299  ? 44.448  -16.592  41.891  1.00 113.31 ? 299  HIS A N     1 
ATOM   2961  C  CA    . HIS D 4  299  ? 43.577  -17.642  41.377  1.00 112.81 ? 299  HIS A CA    1 
ATOM   2962  C  C     . HIS D 4  299  ? 44.011  -19.099  41.363  1.00 112.42 ? 299  HIS A C     1 
ATOM   2963  O  O     . HIS D 4  299  ? 43.225  -19.928  41.783  1.00 112.53 ? 299  HIS A O     1 
ATOM   2964  C  CB    . HIS D 4  299  ? 43.145  -17.254  39.974  1.00 113.03 ? 299  HIS A CB    1 
ATOM   2965  C  CG    . HIS D 4  299  ? 42.941  -15.787  39.806  1.00 113.08 ? 299  HIS A CG    1 
ATOM   2966  N  ND1   . HIS D 4  299  ? 43.692  -15.029  38.936  1.00 113.32 ? 299  HIS A ND1   1 
ATOM   2967  C  CD2   . HIS D 4  299  ? 42.094  -14.929  40.425  1.00 112.91 ? 299  HIS A CD2   1 
ATOM   2968  C  CE1   . HIS D 4  299  ? 43.304  -13.767  39.012  1.00 114.25 ? 299  HIS A CE1   1 
ATOM   2969  N  NE2   . HIS D 4  299  ? 42.338  -13.680  39.910  1.00 113.91 ? 299  HIS A NE2   1 
ATOM   2970  N  N     . VAL D 4  300  ? 45.205  -19.427  40.863  1.00 111.80 ? 300  VAL A N     1 
ATOM   2971  C  CA    . VAL D 4  300  ? 45.590  -20.846  40.682  1.00 111.30 ? 300  VAL A CA    1 
ATOM   2972  C  C     . VAL D 4  300  ? 45.108  -21.756  41.800  1.00 110.95 ? 300  VAL A C     1 
ATOM   2973  O  O     . VAL D 4  300  ? 44.818  -22.921  41.572  1.00 110.76 ? 300  VAL A O     1 
ATOM   2974  C  CB    . VAL D 4  300  ? 47.101  -21.047  40.525  1.00 111.37 ? 300  VAL A CB    1 
ATOM   2975  C  CG1   . VAL D 4  300  ? 47.508  -22.447  40.987  1.00 111.27 ? 300  VAL A CG1   1 
ATOM   2976  C  CG2   . VAL D 4  300  ? 47.504  -20.853  39.090  1.00 111.73 ? 300  VAL A CG2   1 
ATOM   2977  N  N     . ALA D 4  301  ? 45.042  -21.215  43.010  1.00 110.85 ? 301  ALA A N     1 
ATOM   2978  C  CA    . ALA D 4  301  ? 44.437  -21.902  44.144  1.00 110.79 ? 301  ALA A CA    1 
ATOM   2979  C  C     . ALA D 4  301  ? 42.973  -22.146  43.847  1.00 110.69 ? 301  ALA A C     1 
ATOM   2980  O  O     . ALA D 4  301  ? 42.590  -23.260  43.493  1.00 110.65 ? 301  ALA A O     1 
ATOM   2981  C  CB    . ALA D 4  301  ? 44.581  -21.070  45.407  1.00 110.78 ? 301  ALA A CB    1 
ATOM   2982  N  N     . THR D 4  302  ? 42.189  -21.068  43.948  1.00 110.76 ? 302  THR A N     1 
ATOM   2983  C  CA    . THR D 4  302  ? 40.726  -21.061  43.779  1.00 110.47 ? 302  THR A CA    1 
ATOM   2984  C  C     . THR D 4  302  ? 40.196  -21.681  42.469  1.00 110.74 ? 302  THR A C     1 
ATOM   2985  O  O     . THR D 4  302  ? 39.014  -22.005  42.380  1.00 110.81 ? 302  THR A O     1 
ATOM   2986  C  CB    . THR D 4  302  ? 40.158  -19.637  43.977  1.00 110.23 ? 302  THR A CB    1 
ATOM   2987  O  OG1   . THR D 4  302  ? 38.828  -19.717  44.484  1.00 109.05 ? 302  THR A OG1   1 
ATOM   2988  C  CG2   . THR D 4  302  ? 40.153  -18.881  42.678  1.00 109.83 ? 302  THR A CG2   1 
ATOM   2989  N  N     . TYR D 4  303  ? 41.074  -21.834  41.472  1.00 110.93 ? 303  TYR A N     1 
ATOM   2990  C  CA    . TYR D 4  303  ? 40.806  -22.601  40.239  1.00 110.94 ? 303  TYR A CA    1 
ATOM   2991  C  C     . TYR D 4  303  ? 40.477  -24.055  40.536  1.00 112.06 ? 303  TYR A C     1 
ATOM   2992  O  O     . TYR D 4  303  ? 39.625  -24.662  39.881  1.00 112.24 ? 303  TYR A O     1 
ATOM   2993  C  CB    . TYR D 4  303  ? 42.044  -22.572  39.336  1.00 109.73 ? 303  TYR A CB    1 
ATOM   2994  C  CG    . TYR D 4  303  ? 42.140  -23.707  38.335  1.00 107.23 ? 303  TYR A CG    1 
ATOM   2995  C  CD1   . TYR D 4  303  ? 41.664  -23.557  37.049  1.00 105.60 ? 303  TYR A CD1   1 
ATOM   2996  C  CD2   . TYR D 4  303  ? 42.732  -24.911  38.675  1.00 104.32 ? 303  TYR A CD2   1 
ATOM   2997  C  CE1   . TYR D 4  303  ? 41.763  -24.566  36.143  1.00 105.05 ? 303  TYR A CE1   1 
ATOM   2998  C  CE2   . TYR D 4  303  ? 42.828  -25.929  37.777  1.00 103.91 ? 303  TYR A CE2   1 
ATOM   2999  C  CZ    . TYR D 4  303  ? 42.343  -25.749  36.509  1.00 105.55 ? 303  TYR A CZ    1 
ATOM   3000  O  OH    . TYR D 4  303  ? 42.429  -26.757  35.586  1.00 106.73 ? 303  TYR A OH    1 
ATOM   3001  N  N     . MET D 4  304  ? 41.207  -24.612  41.500  1.00 113.35 ? 304  MET A N     1 
ATOM   3002  C  CA    . MET D 4  304  ? 41.066  -26.006  41.888  1.00 114.54 ? 304  MET A CA    1 
ATOM   3003  C  C     . MET D 4  304  ? 39.982  -26.164  42.929  1.00 114.93 ? 304  MET A C     1 
ATOM   3004  O  O     . MET D 4  304  ? 39.259  -27.140  42.923  1.00 115.32 ? 304  MET A O     1 
ATOM   3005  C  CB    . MET D 4  304  ? 42.410  -26.580  42.363  1.00 114.38 ? 304  MET A CB    1 
ATOM   3006  C  CG    . MET D 4  304  ? 43.215  -27.153  41.192  1.00 115.01 ? 304  MET A CG    1 
ATOM   3007  S  SD    . MET D 4  304  ? 44.969  -27.445  41.436  1.00 115.37 ? 304  MET A SD    1 
ATOM   3008  C  CE    . MET D 4  304  ? 45.661  -25.789  41.575  1.00 115.45 ? 304  MET A CE    1 
ATOM   3009  N  N     . ASP D 4  305  ? 39.855  -25.178  43.796  1.00 115.60 ? 305  ASP A N     1 
ATOM   3010  C  CA    . ASP D 4  305  ? 38.878  -25.213  44.848  1.00 116.52 ? 305  ASP A CA    1 
ATOM   3011  C  C     . ASP D 4  305  ? 38.478  -23.772  45.071  1.00 117.11 ? 305  ASP A C     1 
ATOM   3012  O  O     . ASP D 4  305  ? 39.315  -22.941  45.415  1.00 117.28 ? 305  ASP A O     1 
ATOM   3013  C  CB    . ASP D 4  305  ? 39.500  -25.832  46.111  1.00 116.66 ? 305  ASP A CB    1 
ATOM   3014  C  CG    . ASP D 4  305  ? 38.543  -25.862  47.320  1.00 117.79 ? 305  ASP A CG    1 
ATOM   3015  O  OD1   . ASP D 4  305  ? 37.303  -25.771  47.156  1.00 119.14 ? 305  ASP A OD1   1 
ATOM   3016  O  OD2   . ASP D 4  305  ? 39.048  -25.992  48.458  1.00 118.19 ? 305  ASP A OD2   1 
ATOM   3017  N  N     . ASN D 4  306  ? 37.208  -23.465  44.839  1.00 117.84 ? 306  ASN A N     1 
ATOM   3018  C  CA    . ASN D 4  306  ? 36.693  -22.160  45.180  1.00 118.49 ? 306  ASN A CA    1 
ATOM   3019  C  C     . ASN D 4  306  ? 35.904  -22.265  46.456  1.00 118.92 ? 306  ASN A C     1 
ATOM   3020  O  O     . ASN D 4  306  ? 34.773  -21.814  46.523  1.00 119.27 ? 306  ASN A O     1 
ATOM   3021  C  CB    . ASN D 4  306  ? 35.812  -21.603  44.072  1.00 118.62 ? 306  ASN A CB    1 
ATOM   3022  C  CG    . ASN D 4  306  ? 35.666  -20.083  44.142  1.00 119.61 ? 306  ASN A CG    1 
ATOM   3023  O  OD1   . ASN D 4  306  ? 35.204  -19.508  45.142  1.00 120.40 ? 306  ASN A OD1   1 
ATOM   3024  N  ND2   . ASN D 4  306  ? 36.049  -19.428  43.061  1.00 120.83 ? 306  ASN A ND2   1 
ATOM   3025  N  N     . ASP D 4  307  ? 36.494  -22.874  47.475  1.00 119.59 ? 307  ASP A N     1 
ATOM   3026  C  CA    . ASP D 4  307  ? 35.849  -22.947  48.784  1.00 120.45 ? 307  ASP A CA    1 
ATOM   3027  C  C     . ASP D 4  307  ? 36.895  -23.037  49.903  1.00 121.04 ? 307  ASP A C     1 
ATOM   3028  O  O     . ASP D 4  307  ? 37.460  -24.114  50.143  1.00 121.42 ? 307  ASP A O     1 
ATOM   3029  C  CB    . ASP D 4  307  ? 34.888  -24.145  48.831  1.00 120.40 ? 307  ASP A CB    1 
ATOM   3030  C  CG    . ASP D 4  307  ? 33.746  -23.952  49.814  1.00 119.83 ? 307  ASP A CG    1 
ATOM   3031  O  OD1   . ASP D 4  307  ? 32.640  -24.432  49.488  1.00 119.25 ? 307  ASP A OD1   1 
ATOM   3032  O  OD2   . ASP D 4  307  ? 33.949  -23.337  50.894  1.00 118.62 ? 307  ASP A OD2   1 
ATOM   3033  N  N     . ILE D 4  308  ? 37.167  -21.911  50.567  1.00 121.24 ? 308  ILE A N     1 
ATOM   3034  C  CA    . ILE D 4  308  ? 38.191  -21.878  51.602  1.00 121.49 ? 308  ILE A CA    1 
ATOM   3035  C  C     . ILE D 4  308  ? 37.666  -21.036  52.756  1.00 122.16 ? 308  ILE A C     1 
ATOM   3036  O  O     . ILE D 4  308  ? 36.460  -20.966  52.956  1.00 122.12 ? 308  ILE A O     1 
ATOM   3037  C  CB    . ILE D 4  308  ? 39.550  -21.378  51.048  1.00 121.27 ? 308  ILE A CB    1 
ATOM   3038  C  CG1   . ILE D 4  308  ? 39.799  -21.953  49.644  1.00 120.60 ? 308  ILE A CG1   1 
ATOM   3039  C  CG2   . ILE D 4  308  ? 40.683  -21.805  51.985  1.00 121.46 ? 308  ILE A CG2   1 
ATOM   3040  C  CD1   . ILE D 4  308  ? 40.684  -21.144  48.728  1.00 119.62 ? 308  ILE A CD1   1 
ATOM   3041  N  N     . ALA D 4  309  ? 38.557  -20.422  53.526  1.00 123.13 ? 309  ALA A N     1 
ATOM   3042  C  CA    . ALA D 4  309  ? 38.148  -19.490  54.563  1.00 124.06 ? 309  ALA A CA    1 
ATOM   3043  C  C     . ALA D 4  309  ? 38.524  -18.053  54.179  1.00 124.85 ? 309  ALA A C     1 
ATOM   3044  O  O     . ALA D 4  309  ? 38.578  -17.170  55.033  1.00 124.89 ? 309  ALA A O     1 
ATOM   3045  C  CB    . ALA D 4  309  ? 38.753  -19.886  55.901  1.00 123.97 ? 309  ALA A CB    1 
ATOM   3046  N  N     . GLY D 4  310  ? 38.772  -17.828  52.888  1.00 125.88 ? 310  GLY A N     1 
ATOM   3047  C  CA    . GLY D 4  310  ? 39.071  -16.493  52.359  1.00 127.20 ? 310  GLY A CA    1 
ATOM   3048  C  C     . GLY D 4  310  ? 37.813  -15.729  51.983  1.00 128.19 ? 310  GLY A C     1 
ATOM   3049  O  O     . GLY D 4  310  ? 36.997  -15.391  52.844  1.00 128.19 ? 310  GLY A O     1 
ATOM   3050  N  N     . GLN D 4  311  ? 37.657  -15.454  50.691  1.00 129.15 ? 311  GLN A N     1 
ATOM   3051  C  CA    . GLN D 4  311  ? 36.469  -14.767  50.185  1.00 130.48 ? 311  GLN A CA    1 
ATOM   3052  C  C     . GLN D 4  311  ? 36.059  -15.282  48.783  1.00 130.80 ? 311  GLN A C     1 
ATOM   3053  O  O     . GLN D 4  311  ? 36.733  -16.161  48.247  1.00 130.87 ? 311  GLN A O     1 
ATOM   3054  C  CB    . GLN D 4  311  ? 36.668  -13.251  50.243  1.00 130.19 ? 311  GLN A CB    1 
ATOM   3055  C  CG    . GLN D 4  311  ? 36.168  -12.635  51.547  1.00 130.79 ? 311  GLN A CG    1 
ATOM   3056  C  CD    . GLN D 4  311  ? 36.679  -11.212  51.782  1.00 131.26 ? 311  GLN A CD    1 
ATOM   3057  O  OE1   . GLN D 4  311  ? 37.826  -10.882  51.446  1.00 132.22 ? 311  GLN A OE1   1 
ATOM   3058  N  NE2   . GLN D 4  311  ? 35.828  -10.365  52.376  1.00 132.01 ? 311  GLN A NE2   1 
ATOM   3059  N  N     . PRO D 4  312  ? 34.955  -14.744  48.195  1.00 131.43 ? 312  PRO A N     1 
ATOM   3060  C  CA    . PRO D 4  312  ? 34.185  -15.385  47.078  1.00 131.63 ? 312  PRO A CA    1 
ATOM   3061  C  C     . PRO D 4  312  ? 34.840  -15.622  45.681  1.00 132.11 ? 312  PRO A C     1 
ATOM   3062  O  O     . PRO D 4  312  ? 35.804  -16.384  45.562  1.00 131.88 ? 312  PRO A O     1 
ATOM   3063  C  CB    . PRO D 4  312  ? 32.941  -14.479  46.949  1.00 131.83 ? 312  PRO A CB    1 
ATOM   3064  C  CG    . PRO D 4  312  ? 33.376  -13.139  47.488  1.00 131.55 ? 312  PRO A CG    1 
ATOM   3065  C  CD    . PRO D 4  312  ? 34.352  -13.448  48.592  1.00 131.40 ? 312  PRO A CD    1 
ATOM   3066  N  N     . GLN D 4  313  ? 34.246  -15.005  44.648  1.00 132.64 ? 313  GLN A N     1 
ATOM   3067  C  CA    . GLN D 4  313  ? 34.711  -15.029  43.247  1.00 133.09 ? 313  GLN A CA    1 
ATOM   3068  C  C     . GLN D 4  313  ? 33.844  -14.134  42.332  1.00 133.30 ? 313  GLN A C     1 
ATOM   3069  O  O     . GLN D 4  313  ? 32.911  -13.476  42.808  1.00 133.10 ? 313  GLN A O     1 
ATOM   3070  C  CB    . GLN D 4  313  ? 34.761  -16.453  42.705  1.00 133.08 ? 313  GLN A CB    1 
ATOM   3071  C  CG    . GLN D 4  313  ? 35.783  -16.630  41.617  1.00 133.73 ? 313  GLN A CG    1 
ATOM   3072  C  CD    . GLN D 4  313  ? 37.203  -16.641  42.145  1.00 134.60 ? 313  GLN A CD    1 
ATOM   3073  O  OE1   . GLN D 4  313  ? 38.162  -16.603  41.369  1.00 135.57 ? 313  GLN A OE1   1 
ATOM   3074  N  NE2   . GLN D 4  313  ? 37.350  -16.707  43.468  1.00 134.40 ? 313  GLN A NE2   1 
ATOM   3075  N  N     . ALA D 4  314  ? 34.132  -14.129  41.027  1.00 133.71 ? 314  ALA A N     1 
ATOM   3076  C  CA    . ALA D 4  314  ? 33.606  -13.073  40.155  1.00 134.23 ? 314  ALA A CA    1 
ATOM   3077  C  C     . ALA D 4  314  ? 32.906  -13.442  38.826  1.00 134.54 ? 314  ALA A C     1 
ATOM   3078  O  O     . ALA D 4  314  ? 32.850  -14.612  38.414  1.00 134.30 ? 314  ALA A O     1 
ATOM   3079  C  CB    . ALA D 4  314  ? 34.694  -11.997  39.916  1.00 134.36 ? 314  ALA A CB    1 
ATOM   3080  N  N     . LEU D 4  315  ? 32.390  -12.377  38.197  1.00 134.98 ? 315  LEU A N     1 
ATOM   3081  C  CA    . LEU D 4  315  ? 31.621  -12.343  36.945  1.00 135.37 ? 315  LEU A CA    1 
ATOM   3082  C  C     . LEU D 4  315  ? 32.209  -13.089  35.741  1.00 135.94 ? 315  LEU A C     1 
ATOM   3083  O  O     . LEU D 4  315  ? 32.373  -14.328  35.759  1.00 135.96 ? 315  LEU A O     1 
ATOM   3084  C  CB    . LEU D 4  315  ? 31.422  -10.874  36.543  1.00 135.04 ? 315  LEU A CB    1 
ATOM   3085  C  CG    . LEU D 4  315  ? 30.045  -10.227  36.590  1.00 134.79 ? 315  LEU A CG    1 
ATOM   3086  C  CD1   . LEU D 4  315  ? 30.149  -8.733   36.884  1.00 134.40 ? 315  LEU A CD1   1 
ATOM   3087  C  CD2   . LEU D 4  315  ? 29.338  -10.483  35.269  1.00 134.69 ? 315  LEU A CD2   1 
ATOM   3088  N  N     . GLN D 4  316  ? 32.511  -12.289  34.707  1.00 136.45 ? 316  GLN A N     1 
ATOM   3089  C  CA    . GLN D 4  316  ? 32.929  -12.711  33.338  1.00 136.81 ? 316  GLN A CA    1 
ATOM   3090  C  C     . GLN D 4  316  ? 31.733  -13.115  32.410  1.00 136.68 ? 316  GLN A C     1 
ATOM   3091  O  O     . GLN D 4  316  ? 31.681  -14.246  31.873  1.00 136.76 ? 316  GLN A O     1 
ATOM   3092  C  CB    . GLN D 4  316  ? 34.129  -13.706  33.343  1.00 136.86 ? 316  GLN A CB    1 
ATOM   3093  C  CG    . GLN D 4  316  ? 35.082  -13.624  32.115  1.00 137.15 ? 316  GLN A CG    1 
ATOM   3094  C  CD    . GLN D 4  316  ? 35.507  -12.200  31.733  1.00 138.06 ? 316  GLN A CD    1 
ATOM   3095  O  OE1   . GLN D 4  316  ? 36.018  -11.442  32.560  1.00 138.48 ? 316  GLN A OE1   1 
ATOM   3096  N  NE2   . GLN D 4  316  ? 35.303  -11.842  30.465  1.00 138.36 ? 316  GLN A NE2   1 
ATOM   3097  N  N     . LYS D 4  317  ? 30.793  -12.165  32.240  1.00 136.12 ? 317  LYS A N     1 
ATOM   3098  C  CA    . LYS D 4  317  ? 29.524  -12.337  31.483  1.00 135.26 ? 317  LYS A CA    1 
ATOM   3099  C  C     . LYS D 4  317  ? 28.757  -13.645  31.741  1.00 134.70 ? 317  LYS A C     1 
ATOM   3100  O  O     . LYS D 4  317  ? 28.182  -14.219  30.816  1.00 134.60 ? 317  LYS A O     1 
ATOM   3101  C  CB    . LYS D 4  317  ? 29.734  -12.122  29.975  1.00 135.21 ? 317  LYS A CB    1 
ATOM   3102  C  CG    . LYS D 4  317  ? 29.345  -10.739  29.492  1.00 134.78 ? 317  LYS A CG    1 
ATOM   3103  C  CD    . LYS D 4  317  ? 30.514  -9.769   29.491  1.00 133.92 ? 317  LYS A CD    1 
ATOM   3104  C  CE    . LYS D 4  317  ? 30.126  -8.500   28.749  1.00 133.45 ? 317  LYS A CE    1 
ATOM   3105  N  NZ    . LYS D 4  317  ? 31.278  -7.863   28.058  1.00 133.48 ? 317  LYS A NZ    1 
ATOM   3106  N  N     . SER D 4  318  ? 28.758  -14.086  33.004  1.00 133.99 ? 318  SER A N     1 
ATOM   3107  C  CA    . SER D 4  318  ? 28.147  -15.355  33.461  1.00 133.20 ? 318  SER A CA    1 
ATOM   3108  C  C     . SER D 4  318  ? 27.962  -15.359  35.003  1.00 132.52 ? 318  SER A C     1 
ATOM   3109  O  O     . SER D 4  318  ? 27.522  -14.349  35.577  1.00 132.48 ? 318  SER A O     1 
ATOM   3110  C  CB    . SER D 4  318  ? 28.948  -16.596  32.985  1.00 133.29 ? 318  SER A CB    1 
ATOM   3111  O  OG    . SER D 4  318  ? 28.447  -17.148  31.772  1.00 132.86 ? 318  SER A OG    1 
ATOM   3112  N  N     . GLY D 4  319  ? 28.323  -16.478  35.656  1.00 131.46 ? 319  GLY A N     1 
ATOM   3113  C  CA    . GLY D 4  319  ? 28.027  -16.722  37.086  1.00 129.76 ? 319  GLY A CA    1 
ATOM   3114  C  C     . GLY D 4  319  ? 29.150  -16.703  38.128  1.00 128.39 ? 319  GLY A C     1 
ATOM   3115  O  O     . GLY D 4  319  ? 30.289  -17.121  37.866  1.00 128.38 ? 319  GLY A O     1 
ATOM   3116  N  N     . ARG D 4  320  ? 28.793  -16.231  39.327  1.00 126.81 ? 320  ARG A N     1 
ATOM   3117  C  CA    . ARG D 4  320  ? 29.710  -16.083  40.462  1.00 125.04 ? 320  ARG A CA    1 
ATOM   3118  C  C     . ARG D 4  320  ? 29.207  -16.839  41.704  1.00 124.02 ? 320  ARG A C     1 
ATOM   3119  O  O     . ARG D 4  320  ? 28.024  -16.753  42.034  1.00 124.18 ? 320  ARG A O     1 
ATOM   3120  C  CB    . ARG D 4  320  ? 29.956  -14.589  40.779  1.00 125.01 ? 320  ARG A CB    1 
ATOM   3121  C  CG    . ARG D 4  320  ? 28.806  -13.781  41.460  1.00 123.61 ? 320  ARG A CG    1 
ATOM   3122  C  CD    . ARG D 4  320  ? 27.753  -13.196  40.498  1.00 121.39 ? 320  ARG A CD    1 
ATOM   3123  N  NE    . ARG D 4  320  ? 28.157  -13.204  39.091  1.00 119.94 ? 320  ARG A NE    1 
ATOM   3124  C  CZ    . ARG D 4  320  ? 27.685  -12.387  38.154  1.00 118.85 ? 320  ARG A CZ    1 
ATOM   3125  N  NH1   . ARG D 4  320  ? 26.794  -11.453  38.457  1.00 118.64 ? 320  ARG A NH1   1 
ATOM   3126  N  NH2   . ARG D 4  320  ? 28.119  -12.497  36.908  1.00 117.73 ? 320  ARG A NH2   1 
ATOM   3127  N  N     . PRO D 4  321  ? 30.094  -17.580  42.399  1.00 122.76 ? 321  PRO A N     1 
ATOM   3128  C  CA    . PRO D 4  321  ? 31.506  -17.806  42.117  1.00 121.82 ? 321  PRO A CA    1 
ATOM   3129  C  C     . PRO D 4  321  ? 31.696  -18.599  40.841  1.00 120.93 ? 321  PRO A C     1 
ATOM   3130  O  O     . PRO D 4  321  ? 30.728  -19.168  40.334  1.00 120.65 ? 321  PRO A O     1 
ATOM   3131  C  CB    . PRO D 4  321  ? 31.971  -18.646  43.316  1.00 121.83 ? 321  PRO A CB    1 
ATOM   3132  C  CG    . PRO D 4  321  ? 30.963  -18.394  44.385  1.00 122.20 ? 321  PRO A CG    1 
ATOM   3133  C  CD    . PRO D 4  321  ? 29.682  -18.269  43.636  1.00 122.63 ? 321  PRO A CD    1 
ATOM   3134  N  N     . VAL D 4  322  ? 32.923  -18.612  40.316  1.00 120.05 ? 322  VAL A N     1 
ATOM   3135  C  CA    . VAL D 4  322  ? 33.272  -19.540  39.239  1.00 119.25 ? 322  VAL A CA    1 
ATOM   3136  C  C     . VAL D 4  322  ? 33.591  -20.861  39.901  1.00 118.79 ? 322  VAL A C     1 
ATOM   3137  O  O     . VAL D 4  322  ? 34.500  -20.945  40.724  1.00 118.60 ? 322  VAL A O     1 
ATOM   3138  C  CB    . VAL D 4  322  ? 34.430  -19.063  38.357  1.00 119.15 ? 322  VAL A CB    1 
ATOM   3139  C  CG1   . VAL D 4  322  ? 34.100  -17.694  37.749  1.00 119.43 ? 322  VAL A CG1   1 
ATOM   3140  C  CG2   . VAL D 4  322  ? 35.736  -19.055  39.127  1.00 118.59 ? 322  VAL A CG2   1 
ATOM   3141  N  N     . LYS D 4  323  ? 32.824  -21.882  39.534  1.00 118.20 ? 323  LYS A N     1 
ATOM   3142  C  CA    . LYS D 4  323  ? 32.562  -23.002  40.435  1.00 117.76 ? 323  LYS A CA    1 
ATOM   3143  C  C     . LYS D 4  323  ? 33.825  -23.793  40.864  1.00 116.91 ? 323  LYS A C     1 
ATOM   3144  O  O     . LYS D 4  323  ? 33.998  -24.080  42.072  1.00 117.08 ? 323  LYS A O     1 
ATOM   3145  C  CB    . LYS D 4  323  ? 31.353  -23.855  39.939  1.00 118.15 ? 323  LYS A CB    1 
ATOM   3146  C  CG    . LYS D 4  323  ? 31.615  -25.198  39.187  1.00 119.27 ? 323  LYS A CG    1 
ATOM   3147  C  CD    . LYS D 4  323  ? 31.772  -25.070  37.665  1.00 120.05 ? 323  LYS A CD    1 
ATOM   3148  C  CE    . LYS D 4  323  ? 33.235  -24.964  37.230  1.00 119.64 ? 323  LYS A CE    1 
ATOM   3149  N  NZ    . LYS D 4  323  ? 33.813  -23.623  37.543  1.00 119.20 ? 323  LYS A NZ    1 
ATOM   3150  N  N     . SER D 4  324  ? 34.696  -24.094  39.891  1.00 115.36 ? 324  SER A N     1 
ATOM   3151  C  CA    . SER D 4  324  ? 36.008  -24.727  40.102  1.00 114.19 ? 324  SER A CA    1 
ATOM   3152  C  C     . SER D 4  324  ? 35.984  -26.229  40.311  1.00 113.19 ? 324  SER A C     1 
ATOM   3153  O  O     . SER D 4  324  ? 35.163  -26.761  41.056  1.00 113.02 ? 324  SER A O     1 
ATOM   3154  C  CB    . SER D 4  324  ? 36.770  -24.090  41.273  1.00 114.51 ? 324  SER A CB    1 
ATOM   3155  O  OG    . SER D 4  324  ? 36.510  -24.773  42.495  1.00 114.93 ? 324  SER A OG    1 
ATOM   3156  N  N     . ILE D 4  325  ? 36.962  -26.887  39.703  1.00 112.10 ? 325  ILE A N     1 
ATOM   3157  C  CA    . ILE D 4  325  ? 37.099  -28.353  39.709  1.00 110.98 ? 325  ILE A CA    1 
ATOM   3158  C  C     . ILE D 4  325  ? 36.592  -29.100  40.971  1.00 110.42 ? 325  ILE A C     1 
ATOM   3159  O  O     . ILE D 4  325  ? 35.950  -30.135  40.857  1.00 110.22 ? 325  ILE A O     1 
ATOM   3160  C  CB    . ILE D 4  325  ? 38.558  -28.756  39.346  1.00 110.67 ? 325  ILE A CB    1 
ATOM   3161  C  CG1   . ILE D 4  325  ? 39.071  -27.882  38.218  1.00 109.35 ? 325  ILE A CG1   1 
ATOM   3162  C  CG2   . ILE D 4  325  ? 38.629  -30.189  38.843  1.00 110.33 ? 325  ILE A CG2   1 
ATOM   3163  C  CD1   . ILE D 4  325  ? 38.900  -28.532  36.878  1.00 107.65 ? 325  ILE A CD1   1 
ATOM   3164  N  N     . ARG D 4  326  ? 36.867  -28.573  42.156  1.00 109.84 ? 326  ARG A N     1 
ATOM   3165  C  CA    . ARG D 4  326  ? 36.485  -29.248  43.382  1.00 109.59 ? 326  ARG A CA    1 
ATOM   3166  C  C     . ARG D 4  326  ? 34.981  -29.454  43.403  1.00 109.71 ? 326  ARG A C     1 
ATOM   3167  O  O     . ARG D 4  326  ? 34.522  -30.585  43.556  1.00 109.65 ? 326  ARG A O     1 
ATOM   3168  C  CB    . ARG D 4  326  ? 36.969  -28.461  44.600  1.00 109.60 ? 326  ARG A CB    1 
ATOM   3169  C  CG    . ARG D 4  326  ? 36.936  -29.202  45.917  1.00 109.25 ? 326  ARG A CG    1 
ATOM   3170  C  CD    . ARG D 4  326  ? 35.805  -28.696  46.766  1.00 109.54 ? 326  ARG A CD    1 
ATOM   3171  N  NE    . ARG D 4  326  ? 35.750  -29.388  48.044  1.00 110.41 ? 326  ARG A NE    1 
ATOM   3172  C  CZ    . ARG D 4  326  ? 35.430  -28.810  49.199  1.00 110.55 ? 326  ARG A CZ    1 
ATOM   3173  N  NH1   . ARG D 4  326  ? 35.158  -27.512  49.245  1.00 110.15 ? 326  ARG A NH1   1 
ATOM   3174  N  NH2   . ARG D 4  326  ? 35.396  -29.529  50.316  1.00 110.32 ? 326  ARG A NH2   1 
ATOM   3175  N  N     . ALA D 4  327  ? 34.225  -28.372  43.203  1.00 109.88 ? 327  ALA A N     1 
ATOM   3176  C  CA    . ALA D 4  327  ? 32.751  -28.425  43.166  1.00 110.09 ? 327  ALA A CA    1 
ATOM   3177  C  C     . ALA D 4  327  ? 32.191  -29.263  42.001  1.00 110.32 ? 327  ALA A C     1 
ATOM   3178  O  O     . ALA D 4  327  ? 31.046  -29.741  42.050  1.00 110.46 ? 327  ALA A O     1 
ATOM   3179  C  CB    . ALA D 4  327  ? 32.152  -27.024  43.168  1.00 109.82 ? 327  ALA A CB    1 
ATOM   3180  N  N     . ARG D 4  328  ? 33.006  -29.458  40.968  1.00 110.51 ? 328  ARG A N     1 
ATOM   3181  C  CA    . ARG D 4  328  ? 32.652  -30.367  39.888  1.00 110.78 ? 328  ARG A CA    1 
ATOM   3182  C  C     . ARG D 4  328  ? 32.469  -31.805  40.362  1.00 110.87 ? 328  ARG A C     1 
ATOM   3183  O  O     . ARG D 4  328  ? 31.794  -32.592  39.699  1.00 111.25 ? 328  ARG A O     1 
ATOM   3184  C  CB    . ARG D 4  328  ? 33.703  -30.346  38.777  1.00 110.69 ? 328  ARG A CB    1 
ATOM   3185  C  CG    . ARG D 4  328  ? 33.533  -29.219  37.835  1.00 110.97 ? 328  ARG A CG    1 
ATOM   3186  C  CD    . ARG D 4  328  ? 33.679  -29.696  36.411  1.00 112.24 ? 328  ARG A CD    1 
ATOM   3187  N  NE    . ARG D 4  328  ? 33.824  -28.541  35.531  1.00 113.55 ? 328  ARG A NE    1 
ATOM   3188  C  CZ    . ARG D 4  328  ? 34.475  -28.548  34.372  1.00 114.23 ? 328  ARG A CZ    1 
ATOM   3189  N  NH1   . ARG D 4  328  ? 35.050  -29.661  33.917  1.00 113.92 ? 328  ARG A NH1   1 
ATOM   3190  N  NH2   . ARG D 4  328  ? 34.557  -27.427  33.668  1.00 114.87 ? 328  ARG A NH2   1 
ATOM   3191  N  N     . LEU D 4  329  ? 33.077  -32.162  41.486  1.00 110.63 ? 329  LEU A N     1 
ATOM   3192  C  CA    . LEU D 4  329  ? 33.096  -33.557  41.863  1.00 110.69 ? 329  LEU A CA    1 
ATOM   3193  C  C     . LEU D 4  329  ? 32.332  -33.835  43.134  1.00 110.99 ? 329  LEU A C     1 
ATOM   3194  O  O     . LEU D 4  329  ? 31.989  -34.985  43.404  1.00 111.17 ? 329  LEU A O     1 
ATOM   3195  C  CB    . LEU D 4  329  ? 34.522  -34.043  42.003  1.00 110.47 ? 329  LEU A CB    1 
ATOM   3196  C  CG    . LEU D 4  329  ? 35.517  -33.586  40.938  1.00 110.90 ? 329  LEU A CG    1 
ATOM   3197  C  CD1   . LEU D 4  329  ? 36.895  -34.015  41.366  1.00 112.79 ? 329  LEU A CD1   1 
ATOM   3198  C  CD2   . LEU D 4  329  ? 35.229  -34.106  39.540  1.00 109.88 ? 329  LEU A CD2   1 
ATOM   3199  N  N     . LYS D 4  330  ? 32.060  -32.784  43.901  1.00 111.14 ? 330  LYS A N     1 
ATOM   3200  C  CA    . LYS D 4  330  ? 31.414  -32.919  45.186  1.00 111.42 ? 330  LYS A CA    1 
ATOM   3201  C  C     . LYS D 4  330  ? 30.072  -33.554  45.025  1.00 112.14 ? 330  LYS A C     1 
ATOM   3202  O  O     . LYS D 4  330  ? 29.313  -33.154  44.160  1.00 112.18 ? 330  LYS A O     1 
ATOM   3203  C  CB    . LYS D 4  330  ? 31.286  -31.576  45.857  1.00 111.21 ? 330  LYS A CB    1 
ATOM   3204  C  CG    . LYS D 4  330  ? 32.339  -31.370  46.915  1.00 111.74 ? 330  LYS A CG    1 
ATOM   3205  C  CD    . LYS D 4  330  ? 31.811  -31.797  48.288  1.00 112.51 ? 330  LYS A CD    1 
ATOM   3206  C  CE    . LYS D 4  330  ? 31.141  -30.618  49.034  1.00 112.03 ? 330  LYS A CE    1 
ATOM   3207  N  NZ    . LYS D 4  330  ? 30.488  -29.586  48.161  1.00 110.06 ? 330  LYS A NZ    1 
ATOM   3208  N  N     . GLY D 4  331  ? 29.807  -34.547  45.879  1.00 113.30 ? 331  GLY A N     1 
ATOM   3209  C  CA    . GLY D 4  331  ? 28.741  -35.549  45.702  1.00 114.19 ? 331  GLY A CA    1 
ATOM   3210  C  C     . GLY D 4  331  ? 27.339  -35.001  45.541  1.00 114.83 ? 331  GLY A C     1 
ATOM   3211  O  O     . GLY D 4  331  ? 27.038  -33.913  46.058  1.00 114.94 ? 331  GLY A O     1 
ATOM   3212  N  N     . LYS D 4  332  ? 26.485  -35.774  44.851  1.00 115.26 ? 332  LYS A N     1 
ATOM   3213  C  CA    . LYS D 4  332  ? 25.141  -35.361  44.430  1.00 115.65 ? 332  LYS A CA    1 
ATOM   3214  C  C     . LYS D 4  332  ? 25.377  -34.345  43.338  1.00 116.32 ? 332  LYS A C     1 
ATOM   3215  O  O     . LYS D 4  332  ? 26.157  -33.422  43.526  1.00 116.96 ? 332  LYS A O     1 
ATOM   3216  C  CB    . LYS D 4  332  ? 24.359  -34.733  45.593  1.00 115.45 ? 332  LYS A CB    1 
ATOM   3217  C  CG    . LYS D 4  332  ? 22.905  -34.500  45.314  1.00 115.39 ? 332  LYS A CG    1 
ATOM   3218  C  CD    . LYS D 4  332  ? 22.086  -35.738  45.663  1.00 116.03 ? 332  LYS A CD    1 
ATOM   3219  C  CE    . LYS D 4  332  ? 20.655  -35.681  45.114  1.00 116.69 ? 332  LYS A CE    1 
ATOM   3220  N  NZ    . LYS D 4  332  ? 19.793  -34.599  45.717  1.00 117.25 ? 332  LYS A NZ    1 
ATOM   3221  N  N     . GLU D 4  333  ? 24.742  -34.502  42.185  1.00 116.99 ? 333  GLU A N     1 
ATOM   3222  C  CA    . GLU D 4  333  ? 24.964  -33.574  41.035  1.00 117.49 ? 333  GLU A CA    1 
ATOM   3223  C  C     . GLU D 4  333  ? 26.408  -33.592  40.519  1.00 117.02 ? 333  GLU A C     1 
ATOM   3224  O  O     . GLU D 4  333  ? 26.649  -33.748  39.330  1.00 117.28 ? 333  GLU A O     1 
ATOM   3225  C  CB    . GLU D 4  333  ? 24.509  -32.133  41.342  1.00 117.77 ? 333  GLU A CB    1 
ATOM   3226  C  CG    . GLU D 4  333  ? 23.221  -32.022  42.220  1.00 120.38 ? 333  GLU A CG    1 
ATOM   3227  C  CD    . GLU D 4  333  ? 21.898  -32.013  41.434  1.00 123.35 ? 333  GLU A CD    1 
ATOM   3228  O  OE1   . GLU D 4  333  ? 21.848  -32.537  40.289  1.00 125.13 ? 333  GLU A OE1   1 
ATOM   3229  O  OE2   . GLU D 4  333  ? 20.897  -31.472  41.977  1.00 124.31 ? 333  GLU A OE2   1 
ATOM   3230  N  N     . GLY D 4  334  ? 27.368  -33.441  41.417  1.00 116.81 ? 334  GLY A N     1 
ATOM   3231  C  CA    . GLY D 4  334  ? 28.764  -33.526  41.047  1.00 116.59 ? 334  GLY A CA    1 
ATOM   3232  C  C     . GLY D 4  334  ? 29.094  -34.906  40.523  1.00 116.56 ? 334  GLY A C     1 
ATOM   3233  O  O     . GLY D 4  334  ? 28.551  -35.902  41.011  1.00 116.59 ? 334  GLY A O     1 
ATOM   3234  N  N     . ARG D 4  335  ? 30.005  -34.931  39.544  1.00 116.47 ? 335  ARG A N     1 
ATOM   3235  C  CA    . ARG D 4  335  ? 30.465  -36.113  38.801  1.00 116.06 ? 335  ARG A CA    1 
ATOM   3236  C  C     . ARG D 4  335  ? 30.323  -37.470  39.459  1.00 116.45 ? 335  ARG A C     1 
ATOM   3237  O  O     . ARG D 4  335  ? 29.524  -38.289  39.009  1.00 116.66 ? 335  ARG A O     1 
ATOM   3238  C  CB    . ARG D 4  335  ? 31.912  -35.938  38.382  1.00 115.54 ? 335  ARG A CB    1 
ATOM   3239  C  CG    . ARG D 4  335  ? 32.246  -36.682  37.115  1.00 114.99 ? 335  ARG A CG    1 
ATOM   3240  C  CD    . ARG D 4  335  ? 32.182  -35.752  35.940  1.00 115.44 ? 335  ARG A CD    1 
ATOM   3241  N  NE    . ARG D 4  335  ? 31.477  -34.520  36.292  1.00 116.52 ? 335  ARG A NE    1 
ATOM   3242  C  CZ    . ARG D 4  335  ? 31.291  -33.495  35.468  1.00 117.70 ? 335  ARG A CZ    1 
ATOM   3243  N  NH1   . ARG D 4  335  ? 31.750  -33.551  34.223  1.00 118.20 ? 335  ARG A NH1   1 
ATOM   3244  N  NH2   . ARG D 4  335  ? 30.646  -32.409  35.887  1.00 118.65 ? 335  ARG A NH2   1 
ATOM   3245  N  N     . ILE D 4  336  ? 31.079  -37.719  40.505  1.00 116.00 ? 336  ILE A N     1 
ATOM   3246  C  CA    . ILE D 4  336  ? 31.112  -39.033  41.135  1.00 116.00 ? 336  ILE A CA    1 
ATOM   3247  C  C     . ILE D 4  336  ? 29.708  -39.510  41.493  1.00 116.00 ? 336  ILE A C     1 
ATOM   3248  O  O     . ILE D 4  336  ? 29.124  -40.407  40.843  1.00 116.05 ? 336  ILE A O     1 
ATOM   3249  C  CB    . ILE D 4  336  ? 31.998  -39.005  42.395  1.00 116.00 ? 336  ILE A CB    1 
ATOM   3250  C  CG1   . ILE D 4  336  ? 31.467  -37.978  43.398  1.00 116.00 ? 336  ILE A CG1   1 
ATOM   3251  C  CG2   . ILE D 4  336  ? 33.441  -38.700  42.026  1.00 116.00 ? 336  ILE A CG2   1 
ATOM   3252  C  CD1   . ILE D 4  336  ? 32.408  -37.709  44.551  1.00 116.00 ? 336  ILE A CD1   1 
ATOM   3253  N  N     . ARG D 4  337  ? 29.218  -38.928  42.556  1.00 115.03 ? 337  ARG A N     1 
ATOM   3254  C  CA    . ARG D 4  337  ? 28.033  -39.412  43.170  1.00 114.29 ? 337  ARG A CA    1 
ATOM   3255  C  C     . ARG D 4  337  ? 26.824  -39.106  42.291  1.00 114.40 ? 337  ARG A C     1 
ATOM   3256  O  O     . ARG D 4  337  ? 25.686  -39.417  42.674  1.00 114.81 ? 337  ARG A O     1 
ATOM   3257  C  CB    . ARG D 4  337  ? 27.905  -38.750  44.532  1.00 113.91 ? 337  ARG A CB    1 
ATOM   3258  C  CG    . ARG D 4  337  ? 26.931  -39.410  45.431  1.00 112.25 ? 337  ARG A CG    1 
ATOM   3259  C  CD    . ARG D 4  337  ? 26.710  -38.553  46.605  1.00 110.71 ? 337  ARG A CD    1 
ATOM   3260  N  NE    . ARG D 4  337  ? 25.416  -38.832  47.202  1.00 110.79 ? 337  ARG A NE    1 
ATOM   3261  C  CZ    . ARG D 4  337  ? 24.885  -38.152  48.215  1.00 111.07 ? 337  ARG A CZ    1 
ATOM   3262  N  NH1   . ARG D 4  337  ? 25.528  -37.123  48.764  1.00 111.07 ? 337  ARG A NH1   1 
ATOM   3263  N  NH2   . ARG D 4  337  ? 23.697  -38.506  48.682  1.00 111.96 ? 337  ARG A NH2   1 
ATOM   3264  N  N     . GLY D 4  338  ? 27.063  -38.520  41.111  1.00 113.88 ? 338  GLY A N     1 
ATOM   3265  C  CA    . GLY D 4  338  ? 25.969  -37.926  40.313  1.00 112.98 ? 338  GLY A CA    1 
ATOM   3266  C  C     . GLY D 4  338  ? 25.909  -38.162  38.801  1.00 112.51 ? 338  GLY A C     1 
ATOM   3267  O  O     . GLY D 4  338  ? 24.861  -37.900  38.181  1.00 112.59 ? 338  GLY A O     1 
ATOM   3268  N  N     . ASN D 4  339  ? 27.009  -38.619  38.183  1.00 110.00 ? 339  ASN A N     1 
ATOM   3269  C  CA    . ASN D 4  339  ? 27.029  -38.959  36.765  1.00 110.00 ? 339  ASN A CA    1 
ATOM   3270  C  C     . ASN D 4  339  ? 27.936  -40.150  36.471  1.00 110.00 ? 339  ASN A C     1 
ATOM   3271  O  O     . ASN D 4  339  ? 28.078  -40.540  35.310  1.00 109.82 ? 339  ASN A O     1 
ATOM   3272  C  CB    . ASN D 4  339  ? 27.458  -37.752  35.929  1.00 110.00 ? 339  ASN A CB    1 
ATOM   3273  C  CG    . ASN D 4  339  ? 26.404  -36.663  35.894  1.00 110.00 ? 339  ASN A CG    1 
ATOM   3274  O  OD1   . ASN D 4  339  ? 25.219  -36.923  36.107  1.00 110.00 ? 339  ASN A OD1   1 
ATOM   3275  N  ND2   . ASN D 4  339  ? 26.831  -35.435  35.626  1.00 110.00 ? 339  ASN A ND2   1 
ATOM   3276  N  N     . LEU D 4  340  ? 28.580  -40.715  37.517  1.00 106.00 ? 340  LEU A N     1 
ATOM   3277  C  CA    . LEU D 4  340  ? 29.372  -41.936  37.422  1.00 106.00 ? 340  LEU A CA    1 
ATOM   3278  C  C     . LEU D 4  340  ? 28.748  -43.064  38.235  1.00 106.00 ? 340  LEU A C     1 
ATOM   3279  O  O     . LEU D 4  340  ? 28.668  -44.216  37.806  1.00 106.20 ? 340  LEU A O     1 
ATOM   3280  C  CB    . LEU D 4  340  ? 30.807  -41.681  37.890  1.00 106.00 ? 340  LEU A CB    1 
ATOM   3281  C  CG    . LEU D 4  340  ? 31.632  -40.707  37.047  1.00 106.00 ? 340  LEU A CG    1 
ATOM   3282  C  CD1   . LEU D 4  340  ? 32.981  -40.444  37.697  1.00 106.00 ? 340  LEU A CD1   1 
ATOM   3283  C  CD2   . LEU D 4  340  ? 31.807  -41.235  35.631  1.00 106.00 ? 340  LEU A CD2   1 
ATOM   3284  N  N     . MET D 4  341  ? 28.127  -42.696  39.414  1.00 104.00 ? 341  MET A N     1 
ATOM   3285  C  CA    . MET D 4  341  ? 27.745  -43.792  40.295  1.00 104.00 ? 341  MET A CA    1 
ATOM   3286  C  C     . MET D 4  341  ? 26.323  -43.612  40.815  1.00 104.00 ? 341  MET A C     1 
ATOM   3287  O  O     . MET D 4  341  ? 26.215  -43.388  42.036  1.00 104.12 ? 341  MET A O     1 
ATOM   3288  C  CB    . MET D 4  341  ? 28.723  -43.904  41.465  1.00 104.00 ? 341  MET A CB    1 
ATOM   3289  C  CG    . MET D 4  341  ? 30.133  -44.303  41.062  1.00 104.00 ? 341  MET A CG    1 
ATOM   3290  S  SD    . MET D 4  341  ? 30.201  -45.927  40.284  1.00 104.00 ? 341  MET A SD    1 
ATOM   3291  C  CE    . MET D 4  341  ? 29.828  -46.987  41.678  1.00 104.00 ? 341  MET A CE    1 
ATOM   3292  N  N     . GLY D 4  342  ? 25.201  -43.789  40.106  1.00 101.70 ? 342  GLY A N     1 
ATOM   3293  C  CA    . GLY D 4  342  ? 25.090  -43.745  38.649  1.00 100.76 ? 342  GLY A CA    1 
ATOM   3294  C  C     . GLY D 4  342  ? 24.362  -42.613  37.861  1.00 99.66  ? 342  GLY A C     1 
ATOM   3295  O  O     . GLY D 4  342  ? 24.393  -41.440  38.230  1.00 98.61  ? 342  GLY A O     1 
ATOM   3296  N  N     . LYS D 4  343  ? 23.646  -43.023  36.766  1.00 99.00  ? 343  LYS A N     1 
ATOM   3297  C  CA    . LYS D 4  343  ? 23.562  -42.235  35.543  1.00 99.00  ? 343  LYS A CA    1 
ATOM   3298  C  C     . LYS D 4  343  ? 22.119  -42.120  35.060  1.00 99.00  ? 343  LYS A C     1 
ATOM   3299  O  O     . LYS D 4  343  ? 21.243  -42.884  35.392  1.00 99.74  ? 343  LYS A O     1 
ATOM   3300  C  CB    . LYS D 4  343  ? 24.434  -42.851  34.448  1.00 99.00  ? 343  LYS A CB    1 
ATOM   3301  C  CG    . LYS D 4  343  ? 25.927  -42.785  34.732  1.00 99.00  ? 343  LYS A CG    1 
ATOM   3302  C  CD    . LYS D 4  343  ? 26.733  -43.399  33.600  1.00 99.00  ? 343  LYS A CD    1 
ATOM   3303  C  CE    . LYS D 4  343  ? 28.223  -43.345  33.889  1.00 99.00  ? 343  LYS A CE    1 
ATOM   3304  N  NZ    . LYS D 4  343  ? 29.025  -43.956  32.793  1.00 99.00  ? 343  LYS A NZ    1 
ATOM   3305  N  N     . ARG D 4  344  ? 21.824  -41.074  34.149  1.00 99.00  ? 344  ARG A N     1 
ATOM   3306  C  CA    . ARG D 4  344  ? 20.675  -41.069  33.251  1.00 99.00  ? 344  ARG A CA    1 
ATOM   3307  C  C     . ARG D 4  344  ? 20.794  -42.167  32.199  1.00 99.00  ? 344  ARG A C     1 
ATOM   3308  O  O     . ARG D 4  344  ? 21.924  -42.460  31.716  1.00 99.62  ? 344  ARG A O     1 
ATOM   3309  C  CB    . ARG D 4  344  ? 20.531  -39.705  32.573  1.00 99.00  ? 344  ARG A CB    1 
ATOM   3310  C  CG    . ARG D 4  344  ? 20.129  -38.583  33.517  1.00 99.00  ? 344  ARG A CG    1 
ATOM   3311  C  CD    . ARG D 4  344  ? 19.767  -37.283  32.818  1.00 99.00  ? 344  ARG A CD    1 
ATOM   3312  N  NE    . ARG D 4  344  ? 20.907  -36.702  32.116  1.00 99.00  ? 344  ARG A NE    1 
ATOM   3313  C  CZ    . ARG D 4  344  ? 21.809  -35.913  32.683  1.00 99.00  ? 344  ARG A CZ    1 
ATOM   3314  N  NH1   . ARG D 4  344  ? 21.709  -35.608  33.970  1.00 99.00  ? 344  ARG A NH1   1 
ATOM   3315  N  NH2   . ARG D 4  344  ? 22.815  -35.428  31.968  1.00 99.00  ? 344  ARG A NH2   1 
ATOM   3316  N  N     . VAL D 4  345  ? 19.712  -42.844  31.792  1.00 98.81  ? 345  VAL A N     1 
ATOM   3317  C  CA    . VAL D 4  345  ? 19.835  -43.986  30.868  1.00 98.40  ? 345  VAL A CA    1 
ATOM   3318  C  C     . VAL D 4  345  ? 18.802  -44.115  29.793  1.00 98.40  ? 345  VAL A C     1 
ATOM   3319  O  O     . VAL D 4  345  ? 17.664  -43.674  29.941  1.00 98.62  ? 345  VAL A O     1 
ATOM   3320  C  CB    . VAL D 4  345  ? 19.815  -45.330  31.581  1.00 98.28  ? 345  VAL A CB    1 
ATOM   3321  C  CG1   . VAL D 4  345  ? 21.055  -45.484  32.410  1.00 99.34  ? 345  VAL A CG1   1 
ATOM   3322  C  CG2   . VAL D 4  345  ? 18.540  -45.505  32.407  1.00 97.54  ? 345  VAL A CG2   1 
ATOM   3323  N  N     . ASP D 4  346  ? 19.220  -44.802  28.736  1.00 98.34  ? 346  ASP A N     1 
ATOM   3324  C  CA    . ASP D 4  346  ? 18.377  -45.132  27.603  1.00 98.45  ? 346  ASP A CA    1 
ATOM   3325  C  C     . ASP D 4  346  ? 17.394  -46.251  27.919  1.00 97.89  ? 346  ASP A C     1 
ATOM   3326  O  O     . ASP D 4  346  ? 17.345  -46.770  29.022  1.00 97.69  ? 346  ASP A O     1 
ATOM   3327  C  CB    . ASP D 4  346  ? 19.234  -45.620  26.425  1.00 98.90  ? 346  ASP A CB    1 
ATOM   3328  C  CG    . ASP D 4  346  ? 20.166  -44.552  25.852  1.00 100.38 ? 346  ASP A CG    1 
ATOM   3329  O  OD1   . ASP D 4  346  ? 19.965  -43.326  26.066  1.00 101.44 ? 346  ASP A OD1   1 
ATOM   3330  O  OD2   . ASP D 4  346  ? 21.107  -44.972  25.134  1.00 102.31 ? 346  ASP A OD2   1 
ATOM   3331  N  N     . PHE D 4  347  ? 16.630  -46.615  26.897  1.00 97.80  ? 347  PHE A N     1 
ATOM   3332  C  CA    . PHE D 4  347  ? 15.754  -47.761  26.894  1.00 96.89  ? 347  PHE A CA    1 
ATOM   3333  C  C     . PHE D 4  347  ? 14.922  -47.794  28.152  1.00 96.04  ? 347  PHE A C     1 
ATOM   3334  O  O     . PHE D 4  347  ? 14.983  -48.746  28.922  1.00 96.66  ? 347  PHE A O     1 
ATOM   3335  C  CB    . PHE D 4  347  ? 16.589  -49.012  26.709  1.00 97.10  ? 347  PHE A CB    1 
ATOM   3336  C  CG    . PHE D 4  347  ? 17.344  -49.038  25.419  1.00 98.22  ? 347  PHE A CG    1 
ATOM   3337  C  CD1   . PHE D 4  347  ? 18.748  -49.062  25.410  1.00 101.56 ? 347  PHE A CD1   1 
ATOM   3338  C  CD2   . PHE D 4  347  ? 16.677  -49.065  24.206  1.00 98.51  ? 347  PHE A CD2   1 
ATOM   3339  C  CE1   . PHE D 4  347  ? 19.520  -49.132  24.173  1.00 100.94 ? 347  PHE A CE1   1 
ATOM   3340  C  CE2   . PHE D 4  347  ? 17.399  -49.123  22.985  1.00 101.38 ? 347  PHE A CE2   1 
ATOM   3341  C  CZ    . PHE D 4  347  ? 18.845  -49.154  22.965  1.00 100.36 ? 347  PHE A CZ    1 
ATOM   3342  N  N     . SER D 4  348  ? 14.161  -46.723  28.377  1.00 94.94  ? 348  SER A N     1 
ATOM   3343  C  CA    . SER D 4  348  ? 13.251  -46.613  29.548  1.00 92.93  ? 348  SER A CA    1 
ATOM   3344  C  C     . SER D 4  348  ? 11.943  -45.898  29.250  1.00 91.87  ? 348  SER A C     1 
ATOM   3345  O  O     . SER D 4  348  ? 11.771  -45.267  28.205  1.00 90.56  ? 348  SER A O     1 
ATOM   3346  C  CB    . SER D 4  348  ? 13.936  -45.913  30.717  1.00 93.01  ? 348  SER A CB    1 
ATOM   3347  O  OG    . SER D 4  348  ? 14.072  -44.517  30.472  1.00 92.64  ? 348  SER A OG    1 
ATOM   3348  N  N     . ALA D 4  349  ? 11.022  -46.017  30.202  1.00 91.86  ? 349  ALA A N     1 
ATOM   3349  C  CA    . ALA D 4  349  ? 9.692   -45.394  30.134  1.00 91.81  ? 349  ALA A CA    1 
ATOM   3350  C  C     . ALA D 4  349  ? 9.371   -44.909  31.469  1.00 91.53  ? 349  ALA A C     1 
ATOM   3351  O  O     . ALA D 4  349  ? 9.924   -45.422  32.444  1.00 91.10  ? 349  ALA A O     1 
ATOM   3352  C  CB    . ALA D 4  349  ? 8.601   -46.419  29.719  1.00 92.03  ? 349  ALA A CB    1 
ATOM   3353  N  N     . ARG D 4  350  ? 8.425   -43.969  31.513  1.00 92.29  ? 350  ARG A N     1 
ATOM   3354  C  CA    . ARG D 4  350  ? 7.633   -43.699  32.754  1.00 92.58  ? 350  ARG A CA    1 
ATOM   3355  C  C     . ARG D 4  350  ? 6.188   -43.532  32.409  1.00 93.30  ? 350  ARG A C     1 
ATOM   3356  O  O     . ARG D 4  350  ? 5.862   -42.933  31.357  1.00 93.65  ? 350  ARG A O     1 
ATOM   3357  C  CB    . ARG D 4  350  ? 8.084   -42.396  33.377  1.00 92.01  ? 350  ARG A CB    1 
ATOM   3358  C  CG    . ARG D 4  350  ? 8.425   -42.531  34.770  1.00 90.18  ? 350  ARG A CG    1 
ATOM   3359  C  CD    . ARG D 4  350  ? 9.277   -41.399  35.178  1.00 91.55  ? 350  ARG A CD    1 
ATOM   3360  N  NE    . ARG D 4  350  ? 8.607   -40.681  36.241  1.00 97.43  ? 350  ARG A NE    1 
ATOM   3361  C  CZ    . ARG D 4  350  ? 8.765   -40.927  37.544  1.00 102.93 ? 350  ARG A CZ    1 
ATOM   3362  N  NH1   . ARG D 4  350  ? 9.626   -41.876  37.973  1.00 104.89 ? 350  ARG A NH1   1 
ATOM   3363  N  NH2   . ARG D 4  350  ? 8.041   -40.230  38.429  1.00 104.26 ? 350  ARG A NH2   1 
ATOM   3364  N  N     . THR D 4  351  ? 5.300   -43.996  33.274  1.00 94.58  ? 351  THR A N     1 
ATOM   3365  C  CA    . THR D 4  351  ? 3.873   -43.482  33.230  1.00 96.35  ? 351  THR A CA    1 
ATOM   3366  C  C     . THR D 4  351  ? 3.148   -43.580  34.525  1.00 96.57  ? 351  THR A C     1 
ATOM   3367  O  O     . THR D 4  351  ? 3.667   -44.142  35.476  1.00 98.51  ? 351  THR A O     1 
ATOM   3368  C  CB    . THR D 4  351  ? 2.999   -44.281  32.288  1.00 96.48  ? 351  THR A CB    1 
ATOM   3369  O  OG1   . THR D 4  351  ? 3.698   -44.439  31.034  1.00 101.57 ? 351  THR A OG1   1 
ATOM   3370  C  CG2   . THR D 4  351  ? 1.697   -43.564  32.066  1.00 93.84  ? 351  THR A CG2   1 
ATOM   3371  N  N     . VAL D 4  352  ? 1.915   -43.114  34.554  1.00 96.53  ? 352  VAL A N     1 
ATOM   3372  C  CA    . VAL D 4  352  ? 1.000   -43.372  35.690  1.00 96.44  ? 352  VAL A CA    1 
ATOM   3373  C  C     . VAL D 4  352  ? 0.596   -44.900  35.904  1.00 96.97  ? 352  VAL A C     1 
ATOM   3374  O  O     . VAL D 4  352  ? 0.125   -45.552  34.961  1.00 97.54  ? 352  VAL A O     1 
ATOM   3375  C  CB    . VAL D 4  352  ? -0.223  -42.532  35.481  1.00 94.43  ? 352  VAL A CB    1 
ATOM   3376  C  CG1   . VAL D 4  352  ? -1.224  -42.934  36.464  1.00 98.41  ? 352  VAL A CG1   1 
ATOM   3377  C  CG2   . VAL D 4  352  ? 0.103   -41.126  35.691  1.00 91.57  ? 352  VAL A CG2   1 
ATOM   3378  N  N     . ILE D 4  353  ? 0.751   -45.478  37.102  1.00 97.51  ? 353  ILE A N     1 
ATOM   3379  C  CA    . ILE D 4  353  ? 0.306   -46.874  37.280  1.00 98.89  ? 353  ILE A CA    1 
ATOM   3380  C  C     . ILE D 4  353  ? -1.179  -46.936  37.484  1.00 101.21 ? 353  ILE A C     1 
ATOM   3381  O  O     . ILE D 4  353  ? -1.793  -45.941  37.960  1.00 102.68 ? 353  ILE A O     1 
ATOM   3382  C  CB    . ILE D 4  353  ? 0.939   -47.634  38.464  1.00 98.85  ? 353  ILE A CB    1 
ATOM   3383  C  CG1   . ILE D 4  353  ? 0.898   -46.811  39.753  1.00 98.12  ? 353  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE D 4  353  ? 2.374   -48.032  38.127  1.00 102.14 ? 353  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE D 4  353  ? 1.205   -47.604  41.008  1.00 95.03  ? 353  ILE A CD1   1 
ATOM   3386  N  N     . SER D 4  354  ? -1.751  -48.103  37.159  1.00 102.80 ? 354  SER A N     1 
ATOM   3387  C  CA    . SER D 4  354  ? -3.190  -48.352  37.225  1.00 104.13 ? 354  SER A CA    1 
ATOM   3388  C  C     . SER D 4  354  ? -3.366  -49.811  37.588  1.00 106.06 ? 354  SER A C     1 
ATOM   3389  O  O     . SER D 4  354  ? -2.616  -50.685  37.077  1.00 106.15 ? 354  SER A O     1 
ATOM   3390  C  CB    . SER D 4  354  ? -3.833  -48.098  35.874  1.00 103.92 ? 354  SER A CB    1 
ATOM   3391  O  OG    . SER D 4  354  ? -4.184  -46.727  35.698  1.00 105.20 ? 354  SER A OG    1 
ATOM   3392  N  N     . GLY D 4  355  ? -4.339  -50.093  38.471  1.00 107.73 ? 355  GLY A N     1 
ATOM   3393  C  CA    . GLY D 4  355  ? -4.473  -51.461  39.019  1.00 109.23 ? 355  GLY A CA    1 
ATOM   3394  C  C     . GLY D 4  355  ? -5.229  -52.377  38.091  1.00 110.17 ? 355  GLY A C     1 
ATOM   3395  O  O     . GLY D 4  355  ? -6.348  -52.003  37.719  1.00 111.31 ? 355  GLY A O     1 
ATOM   3396  N  N     . ASP D 4  356  ? -4.652  -53.539  37.713  1.00 110.35 ? 356  ASP A N     1 
ATOM   3397  C  CA    . ASP D 4  356  ? -5.341  -54.496  36.785  1.00 110.94 ? 356  ASP A CA    1 
ATOM   3398  C  C     . ASP D 4  356  ? -5.643  -55.924  37.237  1.00 110.22 ? 356  ASP A C     1 
ATOM   3399  O  O     . ASP D 4  356  ? -4.897  -56.842  36.898  1.00 108.93 ? 356  ASP A O     1 
ATOM   3400  C  CB    . ASP D 4  356  ? -4.650  -54.583  35.428  1.00 112.14 ? 356  ASP A CB    1 
ATOM   3401  C  CG    . ASP D 4  356  ? -5.549  -55.222  34.338  1.00 116.15 ? 356  ASP A CG    1 
ATOM   3402  O  OD1   . ASP D 4  356  ? -6.807  -55.130  34.445  1.00 120.82 ? 356  ASP A OD1   1 
ATOM   3403  O  OD2   . ASP D 4  356  ? -4.996  -55.805  33.364  1.00 118.29 ? 356  ASP A OD2   1 
ATOM   3404  N  N     . PRO D 4  357  ? -6.797  -56.114  37.916  1.00 110.49 ? 357  PRO A N     1 
ATOM   3405  C  CA    . PRO D 4  357  ? -7.334  -57.338  38.527  1.00 110.93 ? 357  PRO A CA    1 
ATOM   3406  C  C     . PRO D 4  357  ? -7.588  -58.527  37.588  1.00 111.56 ? 357  PRO A C     1 
ATOM   3407  O  O     . PRO D 4  357  ? -8.074  -59.567  38.062  1.00 111.46 ? 357  PRO A O     1 
ATOM   3408  C  CB    . PRO D 4  357  ? -8.678  -56.872  39.070  1.00 110.92 ? 357  PRO A CB    1 
ATOM   3409  C  CG    . PRO D 4  357  ? -9.023  -55.709  38.203  1.00 110.58 ? 357  PRO A CG    1 
ATOM   3410  C  CD    . PRO D 4  357  ? -7.733  -55.004  38.132  1.00 110.24 ? 357  PRO A CD    1 
ATOM   3411  N  N     . ASN D 4  358  ? -7.303  -58.372  36.286  1.00 112.14 ? 358  ASN A N     1 
ATOM   3412  C  CA    . ASN D 4  358  ? -7.355  -59.482  35.315  1.00 112.16 ? 358  ASN A CA    1 
ATOM   3413  C  C     . ASN D 4  358  ? -6.042  -59.633  34.660  1.00 111.62 ? 358  ASN A C     1 
ATOM   3414  O  O     . ASN D 4  358  ? -5.980  -60.206  33.593  1.00 111.66 ? 358  ASN A O     1 
ATOM   3415  C  CB    . ASN D 4  358  ? -8.419  -59.298  34.229  1.00 112.31 ? 358  ASN A CB    1 
ATOM   3416  C  CG    . ASN D 4  358  ? -9.834  -59.610  34.735  1.00 115.46 ? 358  ASN A CG    1 
ATOM   3417  O  OD1   . ASN D 4  358  ? -10.047 -60.533  35.517  1.00 116.84 ? 358  ASN A OD1   1 
ATOM   3418  N  ND2   . ASN D 4  358  ? -10.806 -58.814  34.303  1.00 120.32 ? 358  ASN A ND2   1 
ATOM   3419  N  N     . LEU D 4  359  ? -4.998  -59.108  35.298  1.00 111.45 ? 359  LEU A N     1 
ATOM   3420  C  CA    . LEU D 4  359  ? -3.610  -59.291  34.837  1.00 111.28 ? 359  LEU A CA    1 
ATOM   3421  C  C     . LEU D 4  359  ? -2.874  -60.321  35.706  1.00 111.65 ? 359  LEU A C     1 
ATOM   3422  O  O     . LEU D 4  359  ? -3.352  -60.658  36.824  1.00 111.59 ? 359  LEU A O     1 
ATOM   3423  C  CB    . LEU D 4  359  ? -2.870  -57.975  34.881  1.00 110.71 ? 359  LEU A CB    1 
ATOM   3424  C  CG    . LEU D 4  359  ? -1.841  -57.753  33.817  1.00 108.75 ? 359  LEU A CG    1 
ATOM   3425  C  CD1   . LEU D 4  359  ? -2.505  -57.805  32.489  1.00 107.89 ? 359  LEU A CD1   1 
ATOM   3426  C  CD2   . LEU D 4  359  ? -1.353  -56.371  34.068  1.00 108.35 ? 359  LEU A CD2   1 
ATOM   3427  N  N     . GLU D 4  360  ? -1.739  -60.832  35.206  1.00 111.35 ? 360  GLU A N     1 
ATOM   3428  C  CA    . GLU D 4  360  ? -1.044  -61.903  35.935  1.00 111.39 ? 360  GLU A CA    1 
ATOM   3429  C  C     . GLU D 4  360  ? -0.230  -61.248  37.001  1.00 110.11 ? 360  GLU A C     1 
ATOM   3430  O  O     . GLU D 4  360  ? -0.037  -60.042  36.928  1.00 110.09 ? 360  GLU A O     1 
ATOM   3431  C  CB    . GLU D 4  360  ? -0.177  -62.802  35.033  1.00 112.15 ? 360  GLU A CB    1 
ATOM   3432  C  CG    . GLU D 4  360  ? -0.888  -64.088  34.494  1.00 116.74 ? 360  GLU A CG    1 
ATOM   3433  C  CD    . GLU D 4  360  ? -1.763  -64.860  35.563  1.00 123.70 ? 360  GLU A CD    1 
ATOM   3434  O  OE1   . GLU D 4  360  ? -1.672  -64.586  36.811  1.00 125.59 ? 360  GLU A OE1   1 
ATOM   3435  O  OE2   . GLU D 4  360  ? -2.545  -65.763  35.135  1.00 124.80 ? 360  GLU A OE2   1 
ATOM   3436  N  N     . LEU D 4  361  ? 0.219   -62.005  38.007  1.00 109.02 ? 361  LEU A N     1 
ATOM   3437  C  CA    . LEU D 4  361  ? 0.982   -61.389  39.116  1.00 107.63 ? 361  LEU A CA    1 
ATOM   3438  C  C     . LEU D 4  361  ? 2.231   -60.772  38.585  1.00 107.51 ? 361  LEU A C     1 
ATOM   3439  O  O     . LEU D 4  361  ? 2.490   -59.598  38.789  1.00 108.81 ? 361  LEU A O     1 
ATOM   3440  C  CB    . LEU D 4  361  ? 1.386   -62.372  40.199  1.00 106.66 ? 361  LEU A CB    1 
ATOM   3441  C  CG    . LEU D 4  361  ? 2.167   -61.668  41.301  1.00 104.37 ? 361  LEU A CG    1 
ATOM   3442  C  CD1   . LEU D 4  361  ? 1.277   -60.778  42.157  1.00 102.48 ? 361  LEU A CD1   1 
ATOM   3443  C  CD2   . LEU D 4  361  ? 2.824   -62.689  42.166  1.00 104.87 ? 361  LEU A CD2   1 
ATOM   3444  N  N     . ASP D 4  362  ? 2.978   -61.570  37.859  1.00 106.47 ? 362  ASP A N     1 
ATOM   3445  C  CA    . ASP D 4  362  ? 4.236   -61.166  37.396  1.00 106.07 ? 362  ASP A CA    1 
ATOM   3446  C  C     . ASP D 4  362  ? 4.144   -60.489  36.031  1.00 105.28 ? 362  ASP A C     1 
ATOM   3447  O  O     . ASP D 4  362  ? 5.092   -60.530  35.246  1.00 105.88 ? 362  ASP A O     1 
ATOM   3448  C  CB    . ASP D 4  362  ? 5.133   -62.390  37.375  1.00 106.89 ? 362  ASP A CB    1 
ATOM   3449  C  CG    . ASP D 4  362  ? 4.628   -63.475  36.438  1.00 110.05 ? 362  ASP A CG    1 
ATOM   3450  O  OD1   . ASP D 4  362  ? 5.464   -64.308  36.000  1.00 114.88 ? 362  ASP A OD1   1 
ATOM   3451  O  OD2   . ASP D 4  362  ? 3.412   -63.498  36.127  1.00 113.47 ? 362  ASP A OD2   1 
ATOM   3452  N  N     . GLN D 4  363  ? 3.025   -59.846  35.741  1.00 104.07 ? 363  GLN A N     1 
ATOM   3453  C  CA    . GLN D 4  363  ? 2.931   -59.072  34.513  1.00 103.45 ? 363  GLN A CA    1 
ATOM   3454  C  C     . GLN D 4  363  ? 2.885   -57.574  34.735  1.00 103.60 ? 363  GLN A C     1 
ATOM   3455  O  O     . GLN D 4  363  ? 2.969   -57.110  35.866  1.00 104.02 ? 363  GLN A O     1 
ATOM   3456  C  CB    . GLN D 4  363  ? 1.768   -59.524  33.688  1.00 103.01 ? 363  GLN A CB    1 
ATOM   3457  C  CG    . GLN D 4  363  ? 2.041   -60.813  33.045  1.00 103.98 ? 363  GLN A CG    1 
ATOM   3458  C  CD    . GLN D 4  363  ? 0.956   -61.194  32.089  1.00 106.43 ? 363  GLN A CD    1 
ATOM   3459  O  OE1   . GLN D 4  363  ? -0.195  -61.464  32.505  1.00 105.71 ? 363  GLN A OE1   1 
ATOM   3460  N  NE2   . GLN D 4  363  ? 1.296   -61.218  30.781  1.00 106.35 ? 363  GLN A NE2   1 
ATOM   3461  N  N     . VAL D 4  364  ? 2.711   -56.826  33.650  1.00 103.73 ? 364  VAL A N     1 
ATOM   3462  C  CA    . VAL D 4  364  ? 3.174   -55.432  33.522  1.00 103.56 ? 364  VAL A CA    1 
ATOM   3463  C  C     . VAL D 4  364  ? 2.381   -54.873  32.348  1.00 104.05 ? 364  VAL A C     1 
ATOM   3464  O  O     . VAL D 4  364  ? 2.813   -54.955  31.162  1.00 104.72 ? 364  VAL A O     1 
ATOM   3465  C  CB    . VAL D 4  364  ? 4.771   -55.371  33.207  1.00 103.24 ? 364  VAL A CB    1 
ATOM   3466  C  CG1   . VAL D 4  364  ? 5.074   -55.731  31.789  1.00 100.95 ? 364  VAL A CG1   1 
ATOM   3467  C  CG2   . VAL D 4  364  ? 5.367   -54.013  33.473  1.00 102.44 ? 364  VAL A CG2   1 
ATOM   3468  N  N     . GLY D 4  365  ? 1.198   -54.361  32.629  1.00 103.59 ? 365  GLY A N     1 
ATOM   3469  C  CA    . GLY D 4  365  ? 0.419   -53.810  31.535  1.00 103.57 ? 365  GLY A CA    1 
ATOM   3470  C  C     . GLY D 4  365  ? 1.293   -52.700  31.007  1.00 103.86 ? 365  GLY A C     1 
ATOM   3471  O  O     . GLY D 4  365  ? 1.590   -51.753  31.757  1.00 104.37 ? 365  GLY A O     1 
ATOM   3472  N  N     . VAL D 4  366  ? 1.773   -52.854  29.763  1.00 103.58 ? 366  VAL A N     1 
ATOM   3473  C  CA    . VAL D 4  366  ? 2.545   -51.813  29.050  1.00 102.90 ? 366  VAL A CA    1 
ATOM   3474  C  C     . VAL D 4  366  ? 1.805   -51.220  27.830  1.00 104.33 ? 366  VAL A C     1 
ATOM   3475  O  O     . VAL D 4  366  ? 1.362   -51.940  26.938  1.00 104.69 ? 366  VAL A O     1 
ATOM   3476  C  CB    . VAL D 4  366  ? 3.903   -52.345  28.639  1.00 102.03 ? 366  VAL A CB    1 
ATOM   3477  C  CG1   . VAL D 4  366  ? 4.565   -51.477  27.561  1.00 100.09 ? 366  VAL A CG1   1 
ATOM   3478  C  CG2   . VAL D 4  366  ? 4.761   -52.464  29.852  1.00 100.44 ? 366  VAL A CG2   1 
ATOM   3479  N  N     . PRO D 4  367  ? 1.654   -49.900  27.800  1.00 105.36 ? 367  PRO A N     1 
ATOM   3480  C  CA    . PRO D 4  367  ? 1.154   -49.148  26.665  1.00 106.81 ? 367  PRO A CA    1 
ATOM   3481  C  C     . PRO D 4  367  ? 1.870   -49.443  25.324  1.00 108.74 ? 367  PRO A C     1 
ATOM   3482  O  O     . PRO D 4  367  ? 3.134   -49.557  25.236  1.00 108.64 ? 367  PRO A O     1 
ATOM   3483  C  CB    . PRO D 4  367  ? 1.458   -47.697  27.057  1.00 107.00 ? 367  PRO A CB    1 
ATOM   3484  C  CG    . PRO D 4  367  ? 2.413   -47.759  28.196  1.00 106.02 ? 367  PRO A CG    1 
ATOM   3485  C  CD    . PRO D 4  367  ? 2.016   -49.016  28.910  1.00 105.56 ? 367  PRO A CD    1 
ATOM   3486  N  N     . LYS D 4  368  ? 1.057   -49.520  24.275  1.00 110.24 ? 368  LYS A N     1 
ATOM   3487  C  CA    . LYS D 4  368  ? 1.566   -49.837  22.939  1.00 111.65 ? 368  LYS A CA    1 
ATOM   3488  C  C     . LYS D 4  368  ? 2.504   -48.751  22.351  1.00 111.27 ? 368  LYS A C     1 
ATOM   3489  O  O     . LYS D 4  368  ? 3.409   -49.082  21.602  1.00 111.74 ? 368  LYS A O     1 
ATOM   3490  C  CB    . LYS D 4  368  ? 0.393   -50.177  21.991  1.00 111.65 ? 368  LYS A CB    1 
ATOM   3491  C  CG    . LYS D 4  368  ? 0.770   -50.876  20.677  1.00 112.75 ? 368  LYS A CG    1 
ATOM   3492  C  CD    . LYS D 4  368  ? -0.454  -51.017  19.747  1.00 113.68 ? 368  LYS A CD    1 
ATOM   3493  C  CE    . LYS D 4  368  ? -1.048  -49.616  19.288  1.00 117.64 ? 368  LYS A CE    1 
ATOM   3494  N  NZ    . LYS D 4  368  ? -1.868  -49.584  17.977  1.00 116.39 ? 368  LYS A NZ    1 
ATOM   3495  N  N     . SER D 4  369  ? 2.314   -47.478  22.691  1.00 110.83 ? 369  SER A N     1 
ATOM   3496  C  CA    . SER D 4  369  ? 3.172   -46.434  22.113  1.00 110.89 ? 369  SER A CA    1 
ATOM   3497  C  C     . SER D 4  369  ? 4.620   -46.437  22.674  1.00 110.54 ? 369  SER A C     1 
ATOM   3498  O  O     . SER D 4  369  ? 5.597   -45.982  21.995  1.00 110.26 ? 369  SER A O     1 
ATOM   3499  C  CB    . SER D 4  369  ? 2.555   -45.053  22.298  1.00 111.24 ? 369  SER A CB    1 
ATOM   3500  O  OG    . SER D 4  369  ? 2.987   -44.449  23.514  1.00 113.00 ? 369  SER A OG    1 
ATOM   3501  N  N     . ILE D 4  370  ? 4.727   -46.925  23.918  1.00 109.51 ? 370  ILE A N     1 
ATOM   3502  C  CA    . ILE D 4  370  ? 6.005   -47.178  24.581  1.00 108.51 ? 370  ILE A CA    1 
ATOM   3503  C  C     . ILE D 4  370  ? 6.735   -48.371  23.861  1.00 109.04 ? 370  ILE A C     1 
ATOM   3504  O  O     . ILE D 4  370  ? 7.928   -48.301  23.452  1.00 107.79 ? 370  ILE A O     1 
ATOM   3505  C  CB    . ILE D 4  370  ? 5.772   -47.350  26.115  1.00 107.48 ? 370  ILE A CB    1 
ATOM   3506  C  CG1   . ILE D 4  370  ? 5.884   -46.006  26.802  1.00 106.07 ? 370  ILE A CG1   1 
ATOM   3507  C  CG2   . ILE D 4  370  ? 6.807   -48.174  26.772  1.00 106.59 ? 370  ILE A CG2   1 
ATOM   3508  C  CD1   . ILE D 4  370  ? 5.097   -45.962  28.090  1.00 107.73 ? 370  ILE A CD1   1 
ATOM   3509  N  N     . ALA D 4  371  ? 5.956   -49.438  23.672  1.00 109.56 ? 371  ALA A N     1 
ATOM   3510  C  CA    . ALA D 4  371  ? 6.425   -50.681  23.099  1.00 109.20 ? 371  ALA A CA    1 
ATOM   3511  C  C     . ALA D 4  371  ? 6.664   -50.409  21.672  1.00 108.95 ? 371  ALA A C     1 
ATOM   3512  O  O     . ALA D 4  371  ? 7.254   -51.243  21.010  1.00 109.47 ? 371  ALA A O     1 
ATOM   3513  C  CB    . ALA D 4  371  ? 5.347   -51.757  23.239  1.00 109.75 ? 371  ALA A CB    1 
ATOM   3514  N  N     . LYS D 4  372  ? 6.166   -49.268  21.186  1.00 108.54 ? 372  LYS A N     1 
ATOM   3515  C  CA    . LYS D 4  372  ? 6.509   -48.809  19.839  1.00 108.81 ? 372  LYS A CA    1 
ATOM   3516  C  C     . LYS D 4  372  ? 7.870   -48.090  19.765  1.00 108.47 ? 372  LYS A C     1 
ATOM   3517  O  O     . LYS D 4  372  ? 8.460   -47.961  18.667  1.00 108.72 ? 372  LYS A O     1 
ATOM   3518  C  CB    . LYS D 4  372  ? 5.382   -48.036  19.140  1.00 108.83 ? 372  LYS A CB    1 
ATOM   3519  C  CG    . LYS D 4  372  ? 4.738   -48.819  17.946  1.00 109.11 ? 372  LYS A CG    1 
ATOM   3520  C  CD    . LYS D 4  372  ? 3.512   -48.092  17.322  1.00 109.71 ? 372  LYS A CD    1 
ATOM   3521  C  CE    . LYS D 4  372  ? 2.277   -48.042  18.274  1.00 108.85 ? 372  LYS A CE    1 
ATOM   3522  N  NZ    . LYS D 4  372  ? 1.355   -46.926  17.923  1.00 108.56 ? 372  LYS A NZ    1 
ATOM   3523  N  N     . THR D 4  373  ? 8.380   -47.666  20.934  1.00 107.33 ? 373  THR A N     1 
ATOM   3524  C  CA    . THR D 4  373  ? 9.673   -46.951  21.002  1.00 105.21 ? 373  THR A CA    1 
ATOM   3525  C  C     . THR D 4  373  ? 10.905  -47.722  21.465  1.00 103.23 ? 373  THR A C     1 
ATOM   3526  O  O     . THR D 4  373  ? 11.937  -47.531  20.862  1.00 103.52 ? 373  THR A O     1 
ATOM   3527  C  CB    . THR D 4  373  ? 9.572   -45.612  21.761  1.00 105.72 ? 373  THR A CB    1 
ATOM   3528  O  OG1   . THR D 4  373  ? 8.648   -45.729  22.853  1.00 104.03 ? 373  THR A OG1   1 
ATOM   3529  C  CG2   . THR D 4  373  ? 9.114   -44.509  20.787  1.00 107.01 ? 373  THR A CG2   1 
ATOM   3530  N  N     . LEU D 4  374  ? 10.809  -48.555  22.509  1.00 100.62 ? 374  LEU A N     1 
ATOM   3531  C  CA    . LEU D 4  374  ? 11.961  -49.320  23.043  1.00 98.04  ? 374  LEU A CA    1 
ATOM   3532  C  C     . LEU D 4  374  ? 12.175  -50.585  22.240  1.00 96.79  ? 374  LEU A C     1 
ATOM   3533  O  O     . LEU D 4  374  ? 11.274  -51.080  21.609  1.00 96.34  ? 374  LEU A O     1 
ATOM   3534  C  CB    . LEU D 4  374  ? 11.820  -49.641  24.549  1.00 98.24  ? 374  LEU A CB    1 
ATOM   3535  C  CG    . LEU D 4  374  ? 10.821  -48.898  25.477  1.00 98.42  ? 374  LEU A CG    1 
ATOM   3536  C  CD1   . LEU D 4  374  ? 9.504   -49.613  25.436  1.00 98.03  ? 374  LEU A CD1   1 
ATOM   3537  C  CD2   . LEU D 4  374  ? 11.262  -48.800  26.921  1.00 97.72  ? 374  LEU A CD2   1 
ATOM   3538  N  N     . THR D 4  375  ? 13.379  -51.114  22.248  1.00 96.43  ? 375  THR A N     1 
ATOM   3539  C  CA    . THR D 4  375  ? 13.784  -52.055  21.192  1.00 96.07  ? 375  THR A CA    1 
ATOM   3540  C  C     . THR D 4  375  ? 14.855  -53.021  21.662  1.00 96.21  ? 375  THR A C     1 
ATOM   3541  O  O     . THR D 4  375  ? 15.972  -52.589  21.947  1.00 96.29  ? 375  THR A O     1 
ATOM   3542  C  CB    . THR D 4  375  ? 14.366  -51.320  19.910  1.00 95.66  ? 375  THR A CB    1 
ATOM   3543  O  OG1   . THR D 4  375  ? 15.072  -50.131  20.281  1.00 94.37  ? 375  THR A OG1   1 
ATOM   3544  C  CG2   . THR D 4  375  ? 13.300  -50.937  18.940  1.00 94.57  ? 375  THR A CG2   1 
ATOM   3545  N  N     . TYR D 4  376  ? 14.541  -54.313  21.728  1.00 96.10  ? 376  TYR A N     1 
ATOM   3546  C  CA    . TYR D 4  376  ? 15.580  -55.285  22.022  1.00 96.31  ? 376  TYR A CA    1 
ATOM   3547  C  C     . TYR D 4  376  ? 16.269  -55.701  20.752  1.00 96.87  ? 376  TYR A C     1 
ATOM   3548  O  O     . TYR D 4  376  ? 15.659  -56.256  19.878  1.00 96.65  ? 376  TYR A O     1 
ATOM   3549  C  CB    . TYR D 4  376  ? 15.078  -56.510  22.780  1.00 96.30  ? 376  TYR A CB    1 
ATOM   3550  C  CG    . TYR D 4  376  ? 16.116  -57.599  22.810  1.00 95.69  ? 376  TYR A CG    1 
ATOM   3551  C  CD1   . TYR D 4  376  ? 16.912  -57.811  23.932  1.00 97.20  ? 376  TYR A CD1   1 
ATOM   3552  C  CD2   . TYR D 4  376  ? 16.327  -58.394  21.711  1.00 95.55  ? 376  TYR A CD2   1 
ATOM   3553  C  CE1   . TYR D 4  376  ? 17.906  -58.822  23.955  1.00 97.37  ? 376  TYR A CE1   1 
ATOM   3554  C  CE2   . TYR D 4  376  ? 17.297  -59.394  21.717  1.00 97.61  ? 376  TYR A CE2   1 
ATOM   3555  C  CZ    . TYR D 4  376  ? 18.091  -59.612  22.828  1.00 97.15  ? 376  TYR A CZ    1 
ATOM   3556  O  OH    . TYR D 4  376  ? 19.035  -60.628  22.777  1.00 95.98  ? 376  TYR A OH    1 
ATOM   3557  N  N     . PRO D 4  377  ? 17.559  -55.412  20.650  1.00 98.03  ? 377  PRO A N     1 
ATOM   3558  C  CA    . PRO D 4  377  ? 18.369  -55.720  19.514  1.00 98.94  ? 377  PRO A CA    1 
ATOM   3559  C  C     . PRO D 4  377  ? 18.605  -57.209  19.440  1.00 100.15 ? 377  PRO A C     1 
ATOM   3560  O  O     . PRO D 4  377  ? 19.432  -57.751  20.205  1.00 100.20 ? 377  PRO A O     1 
ATOM   3561  C  CB    . PRO D 4  377  ? 19.682  -55.004  19.841  1.00 99.13  ? 377  PRO A CB    1 
ATOM   3562  C  CG    . PRO D 4  377  ? 19.326  -53.972  20.828  1.00 98.72  ? 377  PRO A CG    1 
ATOM   3563  C  CD    . PRO D 4  377  ? 18.352  -54.710  21.663  1.00 98.43  ? 377  PRO A CD    1 
ATOM   3564  N  N     . GLU D 4  378  ? 17.869  -57.846  18.516  1.00 101.41 ? 378  GLU A N     1 
ATOM   3565  C  CA    . GLU D 4  378  ? 17.848  -59.313  18.293  1.00 102.29 ? 378  GLU A CA    1 
ATOM   3566  C  C     . GLU D 4  378  ? 18.732  -59.765  17.155  1.00 102.75 ? 378  GLU A C     1 
ATOM   3567  O  O     . GLU D 4  378  ? 18.659  -59.233  16.051  1.00 102.54 ? 378  GLU A O     1 
ATOM   3568  C  CB    . GLU D 4  378  ? 16.418  -59.788  18.013  1.00 101.92 ? 378  GLU A CB    1 
ATOM   3569  C  CG    . GLU D 4  378  ? 16.282  -61.279  17.803  1.00 102.75 ? 378  GLU A CG    1 
ATOM   3570  C  CD    . GLU D 4  378  ? 14.946  -61.804  18.290  1.00 104.63 ? 378  GLU A CD    1 
ATOM   3571  O  OE1   . GLU D 4  378  ? 14.538  -62.911  17.835  1.00 104.09 ? 378  GLU A OE1   1 
ATOM   3572  O  OE2   . GLU D 4  378  ? 14.307  -61.093  19.123  1.00 105.07 ? 378  GLU A OE2   1 
ATOM   3573  N  N     . VAL D 4  379  ? 19.551  -60.769  17.407  1.00 103.87 ? 379  VAL A N     1 
ATOM   3574  C  CA    . VAL D 4  379  ? 20.317  -61.317  16.304  1.00 105.45 ? 379  VAL A CA    1 
ATOM   3575  C  C     . VAL D 4  379  ? 19.384  -62.098  15.377  1.00 106.46 ? 379  VAL A C     1 
ATOM   3576  O  O     . VAL D 4  379  ? 18.227  -62.395  15.745  1.00 106.54 ? 379  VAL A O     1 
ATOM   3577  C  CB    . VAL D 4  379  ? 21.491  -62.156  16.777  1.00 105.42 ? 379  VAL A CB    1 
ATOM   3578  C  CG1   . VAL D 4  379  ? 22.587  -62.170  15.713  1.00 104.28 ? 379  VAL A CG1   1 
ATOM   3579  C  CG2   . VAL D 4  379  ? 22.006  -61.577  18.107  1.00 106.71 ? 379  VAL A CG2   1 
ATOM   3580  N  N     . VAL D 4  380  ? 19.870  -62.386  14.166  1.00 107.39 ? 380  VAL A N     1 
ATOM   3581  C  CA    . VAL D 4  380  ? 19.054  -63.080  13.185  1.00 108.06 ? 380  VAL A CA    1 
ATOM   3582  C  C     . VAL D 4  380  ? 19.619  -64.450  12.980  1.00 109.00 ? 380  VAL A C     1 
ATOM   3583  O  O     . VAL D 4  380  ? 20.773  -64.601  12.574  1.00 109.11 ? 380  VAL A O     1 
ATOM   3584  C  CB    . VAL D 4  380  ? 18.876  -62.313  11.871  1.00 107.86 ? 380  VAL A CB    1 
ATOM   3585  C  CG1   . VAL D 4  380  ? 18.454  -63.248  10.762  1.00 107.02 ? 380  VAL A CG1   1 
ATOM   3586  C  CG2   . VAL D 4  380  ? 17.807  -61.243  12.066  1.00 107.54 ? 380  VAL A CG2   1 
ATOM   3587  N  N     . THR D 4  381  ? 18.759  -65.423  13.292  1.00 110.09 ? 381  THR A N     1 
ATOM   3588  C  CA    . THR D 4  381  ? 19.060  -66.849  13.385  1.00 110.94 ? 381  THR A CA    1 
ATOM   3589  C  C     . THR D 4  381  ? 17.949  -67.591  12.640  1.00 111.51 ? 381  THR A C     1 
ATOM   3590  O  O     . THR D 4  381  ? 16.818  -67.126  12.611  1.00 111.61 ? 381  THR A O     1 
ATOM   3591  C  CB    . THR D 4  381  ? 19.067  -67.288  14.868  1.00 110.78 ? 381  THR A CB    1 
ATOM   3592  O  OG1   . THR D 4  381  ? 19.795  -66.336  15.649  1.00 110.80 ? 381  THR A OG1   1 
ATOM   3593  C  CG2   . THR D 4  381  ? 19.720  -68.635  15.043  1.00 111.77 ? 381  THR A CG2   1 
ATOM   3594  N  N     . PRO D 4  382  ? 18.260  -68.738  12.025  1.00 112.26 ? 382  PRO A N     1 
ATOM   3595  C  CA    . PRO D 4  382  ? 17.226  -69.465  11.313  1.00 113.10 ? 382  PRO A CA    1 
ATOM   3596  C  C     . PRO D 4  382  ? 16.034  -69.792  12.187  1.00 114.11 ? 382  PRO A C     1 
ATOM   3597  O  O     . PRO D 4  382  ? 14.951  -70.004  11.668  1.00 114.07 ? 382  PRO A O     1 
ATOM   3598  C  CB    . PRO D 4  382  ? 17.933  -70.744  10.902  1.00 113.23 ? 382  PRO A CB    1 
ATOM   3599  C  CG    . PRO D 4  382  ? 19.138  -70.814  11.792  1.00 112.79 ? 382  PRO A CG    1 
ATOM   3600  C  CD    . PRO D 4  382  ? 19.551  -69.426  11.934  1.00 112.21 ? 382  PRO A CD    1 
ATOM   3601  N  N     . TYR D 4  383  ? 16.224  -69.822  13.500  1.00 115.68 ? 383  TYR A N     1 
ATOM   3602  C  CA    . TYR D 4  383  ? 15.094  -70.008  14.409  1.00 117.74 ? 383  TYR A CA    1 
ATOM   3603  C  C     . TYR D 4  383  ? 14.105  -68.818  14.364  1.00 119.03 ? 383  TYR A C     1 
ATOM   3604  O  O     . TYR D 4  383  ? 12.923  -68.994  14.711  1.00 119.86 ? 383  TYR A O     1 
ATOM   3605  C  CB    . TYR D 4  383  ? 15.513  -70.298  15.884  1.00 118.12 ? 383  TYR A CB    1 
ATOM   3606  C  CG    . TYR D 4  383  ? 16.777  -71.112  16.081  1.00 118.50 ? 383  TYR A CG    1 
ATOM   3607  C  CD1   . TYR D 4  383  ? 17.612  -70.907  17.196  1.00 117.64 ? 383  TYR A CD1   1 
ATOM   3608  C  CD2   . TYR D 4  383  ? 17.155  -72.066  15.138  1.00 120.13 ? 383  TYR A CD2   1 
ATOM   3609  C  CE1   . TYR D 4  383  ? 18.804  -71.638  17.359  1.00 118.25 ? 383  TYR A CE1   1 
ATOM   3610  C  CE2   . TYR D 4  383  ? 18.341  -72.803  15.276  1.00 121.28 ? 383  TYR A CE2   1 
ATOM   3611  C  CZ    . TYR D 4  383  ? 19.170  -72.597  16.379  1.00 120.13 ? 383  TYR A CZ    1 
ATOM   3612  O  OH    . TYR D 4  383  ? 20.330  -73.379  16.441  1.00 118.91 ? 383  TYR A OH    1 
ATOM   3613  N  N     . ASN D 4  384  ? 14.567  -67.623  13.952  1.00 119.94 ? 384  ASN A N     1 
ATOM   3614  C  CA    . ASN D 4  384  ? 13.733  -66.383  14.011  1.00 120.45 ? 384  ASN A CA    1 
ATOM   3615  C  C     . ASN D 4  384  ? 13.397  -65.683  12.678  1.00 121.16 ? 384  ASN A C     1 
ATOM   3616  O  O     . ASN D 4  384  ? 12.370  -64.977  12.580  1.00 121.21 ? 384  ASN A O     1 
ATOM   3617  C  CB    . ASN D 4  384  ? 14.310  -65.361  15.014  1.00 120.22 ? 384  ASN A CB    1 
ATOM   3618  C  CG    . ASN D 4  384  ? 15.795  -65.027  14.755  1.00 119.25 ? 384  ASN A CG    1 
ATOM   3619  O  OD1   . ASN D 4  384  ? 16.181  -64.621  13.658  1.00 116.24 ? 384  ASN A OD1   1 
ATOM   3620  N  ND2   . ASN D 4  384  ? 16.619  -65.169  15.796  1.00 119.65 ? 384  ASN A ND2   1 
ATOM   3621  N  N     . ILE D 4  385  ? 14.242  -65.909  11.665  1.00 121.90 ? 385  ILE A N     1 
ATOM   3622  C  CA    . ILE D 4  385  ? 14.248  -65.101  10.429  1.00 122.50 ? 385  ILE A CA    1 
ATOM   3623  C  C     . ILE D 4  385  ? 12.894  -64.938  9.753   1.00 123.30 ? 385  ILE A C     1 
ATOM   3624  O  O     . ILE D 4  385  ? 12.677  -63.974  9.022   1.00 123.94 ? 385  ILE A O     1 
ATOM   3625  C  CB    . ILE D 4  385  ? 15.395  -65.476  9.412   1.00 122.12 ? 385  ILE A CB    1 
ATOM   3626  C  CG1   . ILE D 4  385  ? 15.172  -64.800  8.062   1.00 120.99 ? 385  ILE A CG1   1 
ATOM   3627  C  CG2   . ILE D 4  385  ? 15.515  -66.961  9.221   1.00 122.62 ? 385  ILE A CG2   1 
ATOM   3628  C  CD1   . ILE D 4  385  ? 16.417  -64.318  7.438   1.00 120.08 ? 385  ILE A CD1   1 
ATOM   3629  N  N     . ASP D 4  386  ? 11.975  -65.858  10.025  1.00 124.06 ? 386  ASP A N     1 
ATOM   3630  C  CA    . ASP D 4  386  ? 10.600  -65.717  9.534   1.00 124.62 ? 386  ASP A CA    1 
ATOM   3631  C  C     . ASP D 4  386  ? 9.847   -64.652  10.312  1.00 124.06 ? 386  ASP A C     1 
ATOM   3632  O  O     . ASP D 4  386  ? 9.493   -63.610  9.751   1.00 123.89 ? 386  ASP A O     1 
ATOM   3633  C  CB    . ASP D 4  386  ? 9.866   -67.064  9.546   1.00 125.17 ? 386  ASP A CB    1 
ATOM   3634  C  CG    . ASP D 4  386  ? 10.546  -68.102  8.643   1.00 127.08 ? 386  ASP A CG    1 
ATOM   3635  O  OD1   . ASP D 4  386  ? 11.791  -68.273  8.747   1.00 127.67 ? 386  ASP A OD1   1 
ATOM   3636  O  OD2   . ASP D 4  386  ? 9.838   -68.733  7.821   1.00 129.40 ? 386  ASP A OD2   1 
ATOM   3637  N  N     . ARG D 4  387  ? 9.653   -64.902  11.605  1.00 123.58 ? 387  ARG A N     1 
ATOM   3638  C  CA    . ARG D 4  387  ? 8.926   -63.990  12.471  1.00 123.46 ? 387  ARG A CA    1 
ATOM   3639  C  C     . ARG D 4  387  ? 9.648   -62.667  12.577  1.00 122.57 ? 387  ARG A C     1 
ATOM   3640  O  O     . ARG D 4  387  ? 9.105   -61.694  13.130  1.00 122.07 ? 387  ARG A O     1 
ATOM   3641  C  CB    . ARG D 4  387  ? 8.782   -64.583  13.859  1.00 124.25 ? 387  ARG A CB    1 
ATOM   3642  C  CG    . ARG D 4  387  ? 7.835   -63.798  14.768  1.00 126.68 ? 387  ARG A CG    1 
ATOM   3643  C  CD    . ARG D 4  387  ? 8.240   -63.949  16.229  1.00 130.00 ? 387  ARG A CD    1 
ATOM   3644  N  NE    . ARG D 4  387  ? 9.627   -63.552  16.446  1.00 132.33 ? 387  ARG A NE    1 
ATOM   3645  C  CZ    . ARG D 4  387  ? 10.166  -63.300  17.636  1.00 134.46 ? 387  ARG A CZ    1 
ATOM   3646  N  NH1   . ARG D 4  387  ? 9.443   -63.402  18.759  1.00 134.19 ? 387  ARG A NH1   1 
ATOM   3647  N  NH2   . ARG D 4  387  ? 11.447  -62.938  17.699  1.00 136.25 ? 387  ARG A NH2   1 
ATOM   3648  N  N     . LEU D 4  388  ? 10.874  -62.641  12.043  1.00 121.57 ? 388  LEU A N     1 
ATOM   3649  C  CA    . LEU D 4  388  ? 11.626  -61.391  11.918  1.00 120.48 ? 388  LEU A CA    1 
ATOM   3650  C  C     . LEU D 4  388  ? 11.462  -60.643  10.584  1.00 119.76 ? 388  LEU A C     1 
ATOM   3651  O  O     . LEU D 4  388  ? 11.366  -59.415  10.594  1.00 119.33 ? 388  LEU A O     1 
ATOM   3652  C  CB    . LEU D 4  388  ? 13.097  -61.541  12.342  1.00 120.35 ? 388  LEU A CB    1 
ATOM   3653  C  CG    . LEU D 4  388  ? 13.419  -61.221  13.821  1.00 119.80 ? 388  LEU A CG    1 
ATOM   3654  C  CD1   . LEU D 4  388  ? 14.863  -61.543  14.160  1.00 120.56 ? 388  LEU A CD1   1 
ATOM   3655  C  CD2   . LEU D 4  388  ? 13.166  -59.780  14.162  1.00 118.70 ? 388  LEU A CD2   1 
ATOM   3656  N  N     . THR D 4  389  ? 11.395  -61.345  9.452   1.00 119.15 ? 389  THR A N     1 
ATOM   3657  C  CA    . THR D 4  389  ? 11.153  -60.624  8.185   1.00 119.06 ? 389  THR A CA    1 
ATOM   3658  C  C     . THR D 4  389  ? 9.736   -60.025  8.221   1.00 119.00 ? 389  THR A C     1 
ATOM   3659  O  O     . THR D 4  389  ? 9.490   -58.911  7.754   1.00 118.66 ? 389  THR A O     1 
ATOM   3660  C  CB    . THR D 4  389  ? 11.449  -61.453  6.871   1.00 118.93 ? 389  THR A CB    1 
ATOM   3661  O  OG1   . THR D 4  389  ? 12.792  -61.956  6.880   1.00 118.07 ? 389  THR A OG1   1 
ATOM   3662  C  CG2   . THR D 4  389  ? 11.298  -60.566  5.628   1.00 118.81 ? 389  THR A CG2   1 
ATOM   3663  N  N     . GLN D 4  390  ? 8.826   -60.790  8.804   1.00 119.29 ? 390  GLN A N     1 
ATOM   3664  C  CA    . GLN D 4  390  ? 7.502   -60.315  9.196   1.00 119.82 ? 390  GLN A CA    1 
ATOM   3665  C  C     . GLN D 4  390  ? 7.598   -59.016  9.975   1.00 119.29 ? 390  GLN A C     1 
ATOM   3666  O  O     . GLN D 4  390  ? 6.978   -58.001  9.646   1.00 119.17 ? 390  GLN A O     1 
ATOM   3667  C  CB    . GLN D 4  390  ? 6.862   -61.365  10.121  1.00 120.36 ? 390  GLN A CB    1 
ATOM   3668  C  CG    . GLN D 4  390  ? 5.395   -61.137  10.435  1.00 122.42 ? 390  GLN A CG    1 
ATOM   3669  C  CD    . GLN D 4  390  ? 4.536   -61.079  9.174   1.00 125.69 ? 390  GLN A CD    1 
ATOM   3670  O  OE1   . GLN D 4  390  ? 4.782   -61.815  8.191   1.00 127.17 ? 390  GLN A OE1   1 
ATOM   3671  N  NE2   . GLN D 4  390  ? 3.523   -60.198  9.188   1.00 126.29 ? 390  GLN A NE2   1 
ATOM   3672  N  N     . LEU D 4  391  ? 8.404   -59.093  11.022  1.00 118.91 ? 391  LEU A N     1 
ATOM   3673  C  CA    . LEU D 4  391  ? 8.526   -58.073  12.025  1.00 118.50 ? 391  LEU A CA    1 
ATOM   3674  C  C     . LEU D 4  391  ? 9.196   -56.798  11.498  1.00 118.36 ? 391  LEU A C     1 
ATOM   3675  O  O     . LEU D 4  391  ? 9.093   -55.750  12.126  1.00 118.32 ? 391  LEU A O     1 
ATOM   3676  C  CB    . LEU D 4  391  ? 9.293   -58.674  13.197  1.00 118.23 ? 391  LEU A CB    1 
ATOM   3677  C  CG    . LEU D 4  391  ? 9.101   -58.193  14.625  1.00 118.44 ? 391  LEU A CG    1 
ATOM   3678  C  CD1   . LEU D 4  391  ? 7.643   -58.066  14.997  1.00 118.76 ? 391  LEU A CD1   1 
ATOM   3679  C  CD2   . LEU D 4  391  ? 9.776   -59.185  15.551  1.00 118.55 ? 391  LEU A CD2   1 
ATOM   3680  N  N     . VAL D 4  392  ? 9.892   -56.873  10.363  1.00 118.27 ? 392  VAL A N     1 
ATOM   3681  C  CA    . VAL D 4  392  ? 10.363  -55.641  9.718   1.00 118.19 ? 392  VAL A CA    1 
ATOM   3682  C  C     . VAL D 4  392  ? 9.153   -54.989  9.061   1.00 118.89 ? 392  VAL A C     1 
ATOM   3683  O  O     . VAL D 4  392  ? 8.804   -53.839  9.357   1.00 118.49 ? 392  VAL A O     1 
ATOM   3684  C  CB    . VAL D 4  392  ? 11.510  -55.857  8.657   1.00 117.71 ? 392  VAL A CB    1 
ATOM   3685  C  CG1   . VAL D 4  392  ? 11.679  -54.626  7.778   1.00 116.24 ? 392  VAL A CG1   1 
ATOM   3686  C  CG2   . VAL D 4  392  ? 12.824  -56.176  9.325   1.00 116.92 ? 392  VAL A CG2   1 
ATOM   3687  N  N     . ARG D 4  393  ? 8.501   -55.760  8.196   1.00 119.73 ? 393  ARG A N     1 
ATOM   3688  C  CA    . ARG D 4  393  ? 7.550   -55.219  7.255   1.00 120.40 ? 393  ARG A CA    1 
ATOM   3689  C  C     . ARG D 4  393  ? 6.563   -54.321  7.942   1.00 120.58 ? 393  ARG A C     1 
ATOM   3690  O  O     . ARG D 4  393  ? 6.292   -53.239  7.436   1.00 120.91 ? 393  ARG A O     1 
ATOM   3691  C  CB    . ARG D 4  393  ? 6.892   -56.315  6.424   1.00 120.60 ? 393  ARG A CB    1 
ATOM   3692  C  CG    . ARG D 4  393  ? 7.919   -56.982  5.509   1.00 122.42 ? 393  ARG A CG    1 
ATOM   3693  C  CD    . ARG D 4  393  ? 7.469   -57.097  4.047   1.00 124.97 ? 393  ARG A CD    1 
ATOM   3694  N  NE    . ARG D 4  393  ? 8.467   -57.836  3.274   1.00 126.38 ? 393  ARG A NE    1 
ATOM   3695  C  CZ    . ARG D 4  393  ? 8.568   -59.169  3.230   1.00 127.54 ? 393  ARG A CZ    1 
ATOM   3696  N  NH1   . ARG D 4  393  ? 7.714   -59.936  3.907   1.00 127.73 ? 393  ARG A NH1   1 
ATOM   3697  N  NH2   . ARG D 4  393  ? 9.527   -59.743  2.501   1.00 127.90 ? 393  ARG A NH2   1 
ATOM   3698  N  N     . ASN D 4  394  ? 6.087   -54.730  9.120   1.00 120.90 ? 394  ASN A N     1 
ATOM   3699  C  CA    . ASN D 4  394  ? 5.179   -53.891  9.949   1.00 121.23 ? 394  ASN A CA    1 
ATOM   3700  C  C     . ASN D 4  394  ? 5.729   -52.492  10.340  1.00 121.44 ? 394  ASN A C     1 
ATOM   3701  O  O     . ASN D 4  394  ? 4.998   -51.656  10.903  1.00 121.25 ? 394  ASN A O     1 
ATOM   3702  C  CB    . ASN D 4  394  ? 4.726   -54.651  11.207  1.00 121.03 ? 394  ASN A CB    1 
ATOM   3703  C  CG    . ASN D 4  394  ? 4.068   -55.972  10.885  1.00 120.92 ? 394  ASN A CG    1 
ATOM   3704  O  OD1   . ASN D 4  394  ? 4.360   -56.594  9.868   1.00 121.80 ? 394  ASN A OD1   1 
ATOM   3705  N  ND2   . ASN D 4  394  ? 3.181   -56.415  11.757  1.00 120.33 ? 394  ASN A ND2   1 
ATOM   3706  N  N     . GLY D 4  395  ? 7.014   -52.256  10.032  1.00 121.67 ? 395  GLY A N     1 
ATOM   3707  C  CA    . GLY D 4  395  ? 7.695   -50.982  10.298  1.00 121.31 ? 395  GLY A CA    1 
ATOM   3708  C  C     . GLY D 4  395  ? 7.467   -50.466  11.709  1.00 120.98 ? 395  GLY A C     1 
ATOM   3709  O  O     . GLY D 4  395  ? 6.916   -51.170  12.563  1.00 120.33 ? 395  GLY A O     1 
ATOM   3710  N  N     . PRO D 4  396  ? 7.903   -49.235  11.969  1.00 120.79 ? 396  PRO A N     1 
ATOM   3711  C  CA    . PRO D 4  396  ? 7.703   -48.679  13.279  1.00 121.06 ? 396  PRO A CA    1 
ATOM   3712  C  C     . PRO D 4  396  ? 6.257   -48.196  13.417  1.00 121.98 ? 396  PRO A C     1 
ATOM   3713  O  O     . PRO D 4  396  ? 5.882   -47.556  14.417  1.00 122.68 ? 396  PRO A O     1 
ATOM   3714  C  CB    . PRO D 4  396  ? 8.663   -47.512  13.295  1.00 120.60 ? 396  PRO A CB    1 
ATOM   3715  C  CG    . PRO D 4  396  ? 8.668   -47.072  11.896  1.00 120.99 ? 396  PRO A CG    1 
ATOM   3716  C  CD    . PRO D 4  396  ? 8.606   -48.308  11.076  1.00 120.63 ? 396  PRO A CD    1 
ATOM   3717  N  N     . ASN D 4  397  ? 5.404   -48.510  12.461  1.00 122.28 ? 397  ASN A N     1 
ATOM   3718  C  CA    . ASN D 4  397  ? 4.075   -48.015  12.678  1.00 122.82 ? 397  ASN A CA    1 
ATOM   3719  C  C     . ASN D 4  397  ? 3.063   -48.968  13.290  1.00 123.06 ? 397  ASN A C     1 
ATOM   3720  O  O     . ASN D 4  397  ? 2.425   -48.624  14.303  1.00 123.94 ? 397  ASN A O     1 
ATOM   3721  C  CB    . ASN D 4  397  ? 3.578   -47.205  11.498  1.00 123.09 ? 397  ASN A CB    1 
ATOM   3722  C  CG    . ASN D 4  397  ? 3.977   -45.747  11.625  1.00 123.94 ? 397  ASN A CG    1 
ATOM   3723  O  OD1   . ASN D 4  397  ? 4.004   -45.005  10.635  1.00 126.63 ? 397  ASN A OD1   1 
ATOM   3724  N  ND2   . ASN D 4  397  ? 4.296   -45.326  12.859  1.00 121.82 ? 397  ASN A ND2   1 
ATOM   3725  N  N     . GLU D 4  398  ? 2.939   -50.160  12.711  1.00 122.43 ? 398  GLU A N     1 
ATOM   3726  C  CA    . GLU D 4  398  ? 2.091   -51.217  13.278  1.00 122.03 ? 398  GLU A CA    1 
ATOM   3727  C  C     . GLU D 4  398  ? 2.724   -51.767  14.565  1.00 120.10 ? 398  GLU A C     1 
ATOM   3728  O  O     . GLU D 4  398  ? 3.929   -51.660  14.714  1.00 119.59 ? 398  GLU A O     1 
ATOM   3729  C  CB    . GLU D 4  398  ? 1.927   -52.345  12.264  1.00 122.22 ? 398  GLU A CB    1 
ATOM   3730  C  CG    . GLU D 4  398  ? 1.091   -52.005  11.028  1.00 123.91 ? 398  GLU A CG    1 
ATOM   3731  C  CD    . GLU D 4  398  ? 0.770   -53.265  10.217  1.00 124.62 ? 398  GLU A CD    1 
ATOM   3732  O  OE1   . GLU D 4  398  ? 1.290   -53.376  9.063   1.00 127.59 ? 398  GLU A OE1   1 
ATOM   3733  O  OE2   . GLU D 4  398  ? 0.021   -54.146  10.756  1.00 127.37 ? 398  GLU A OE2   1 
ATOM   3734  N  N     . HIS D 4  399  ? 1.952   -52.350  15.496  1.00 118.33 ? 399  HIS A N     1 
ATOM   3735  C  CA    . HIS D 4  399  ? 2.625   -52.756  16.738  1.00 116.28 ? 399  HIS A CA    1 
ATOM   3736  C  C     . HIS D 4  399  ? 3.886   -53.609  16.521  1.00 113.95 ? 399  HIS A C     1 
ATOM   3737  O  O     . HIS D 4  399  ? 4.995   -53.107  16.768  1.00 113.93 ? 399  HIS A O     1 
ATOM   3738  C  CB    . HIS D 4  399  ? 1.775   -53.373  17.897  1.00 116.54 ? 399  HIS A CB    1 
ATOM   3739  C  CG    . HIS D 4  399  ? 2.656   -54.029  18.940  1.00 116.45 ? 399  HIS A CG    1 
ATOM   3740  N  ND1   . HIS D 4  399  ? 3.517   -53.305  19.746  1.00 116.20 ? 399  HIS A ND1   1 
ATOM   3741  C  CD2   . HIS D 4  399  ? 2.931   -55.332  19.192  1.00 115.45 ? 399  HIS A CD2   1 
ATOM   3742  C  CE1   . HIS D 4  399  ? 4.231   -54.129  20.492  1.00 114.94 ? 399  HIS A CE1   1 
ATOM   3743  N  NE2   . HIS D 4  399  ? 3.896   -55.364  20.175  1.00 115.23 ? 399  HIS A NE2   1 
ATOM   3744  N  N     . PRO D 4  400  ? 3.715   -54.901  16.171  1.00 111.31 ? 400  PRO A N     1 
ATOM   3745  C  CA    . PRO D 4  400  ? 4.861   -55.794  16.195  1.00 110.26 ? 400  PRO A CA    1 
ATOM   3746  C  C     . PRO D 4  400  ? 5.886   -55.520  15.050  1.00 109.37 ? 400  PRO A C     1 
ATOM   3747  O  O     . PRO D 4  400  ? 5.813   -56.081  13.952  1.00 109.28 ? 400  PRO A O     1 
ATOM   3748  C  CB    . PRO D 4  400  ? 4.206   -57.177  16.159  1.00 110.03 ? 400  PRO A CB    1 
ATOM   3749  C  CG    . PRO D 4  400  ? 2.758   -56.918  16.509  1.00 109.59 ? 400  PRO A CG    1 
ATOM   3750  C  CD    . PRO D 4  400  ? 2.495   -55.637  15.845  1.00 110.63 ? 400  PRO A CD    1 
ATOM   3751  N  N     . GLY D 4  401  ? 6.855   -54.660  15.347  1.00 107.90 ? 401  GLY A N     1 
ATOM   3752  C  CA    . GLY D 4  401  ? 7.546   -53.940  14.321  1.00 106.31 ? 401  GLY A CA    1 
ATOM   3753  C  C     . GLY D 4  401  ? 8.933   -53.644  14.769  1.00 105.66 ? 401  GLY A C     1 
ATOM   3754  O  O     . GLY D 4  401  ? 9.351   -54.114  15.810  1.00 105.10 ? 401  GLY A O     1 
ATOM   3755  N  N     . ALA D 4  402  ? 9.616   -52.816  13.980  1.00 105.67 ? 402  ALA A N     1 
ATOM   3756  C  CA    . ALA D 4  402  ? 11.078  -52.662  13.996  1.00 105.06 ? 402  ALA A CA    1 
ATOM   3757  C  C     . ALA D 4  402  ? 11.601  -51.406  13.239  1.00 104.90 ? 402  ALA A C     1 
ATOM   3758  O  O     . ALA D 4  402  ? 11.183  -51.099  12.106  1.00 104.63 ? 402  ALA A O     1 
ATOM   3759  C  CB    . ALA D 4  402  ? 11.720  -53.924  13.436  1.00 104.58 ? 402  ALA A CB    1 
ATOM   3760  N  N     . LYS D 4  403  ? 12.504  -50.680  13.893  1.00 104.80 ? 403  LYS A N     1 
ATOM   3761  C  CA    . LYS D 4  403  ? 13.296  -49.625  13.256  1.00 105.09 ? 403  LYS A CA    1 
ATOM   3762  C  C     . LYS D 4  403  ? 14.780  -49.938  13.318  1.00 104.87 ? 403  LYS A C     1 
ATOM   3763  O  O     . LYS D 4  403  ? 15.280  -50.506  14.266  1.00 104.49 ? 403  LYS A O     1 
ATOM   3764  C  CB    . LYS D 4  403  ? 13.040  -48.279  13.913  1.00 105.13 ? 403  LYS A CB    1 
ATOM   3765  C  CG    . LYS D 4  403  ? 13.022  -48.327  15.446  1.00 107.08 ? 403  LYS A CG    1 
ATOM   3766  C  CD    . LYS D 4  403  ? 11.676  -48.803  16.062  1.00 108.01 ? 403  LYS A CD    1 
ATOM   3767  C  CE    . LYS D 4  403  ? 10.776  -47.606  16.424  1.00 109.75 ? 403  LYS A CE    1 
ATOM   3768  N  NZ    . LYS D 4  403  ? 11.424  -46.685  17.418  1.00 110.20 ? 403  LYS A NZ    1 
ATOM   3769  N  N     . TYR D 4  404  ? 15.495  -49.525  12.300  1.00 105.59 ? 404  TYR A N     1 
ATOM   3770  C  CA    . TYR D 4  404  ? 16.920  -49.876  12.142  1.00 106.66 ? 404  TYR A CA    1 
ATOM   3771  C  C     . TYR D 4  404  ? 17.160  -51.395  12.093  1.00 106.33 ? 404  TYR A C     1 
ATOM   3772  O  O     . TYR D 4  404  ? 16.543  -52.176  12.828  1.00 105.90 ? 404  TYR A O     1 
ATOM   3773  C  CB    . TYR D 4  404  ? 17.882  -49.173  13.149  1.00 107.40 ? 404  TYR A CB    1 
ATOM   3774  C  CG    . TYR D 4  404  ? 17.404  -47.863  13.761  1.00 107.99 ? 404  TYR A CG    1 
ATOM   3775  C  CD1   . TYR D 4  404  ? 16.331  -47.868  14.700  1.00 108.96 ? 404  TYR A CD1   1 
ATOM   3776  C  CD2   . TYR D 4  404  ? 18.039  -46.631  13.448  1.00 106.33 ? 404  TYR A CD2   1 
ATOM   3777  C  CE1   . TYR D 4  404  ? 15.858  -46.682  15.304  1.00 110.07 ? 404  TYR A CE1   1 
ATOM   3778  C  CE2   . TYR D 4  404  ? 17.592  -45.420  14.045  1.00 108.77 ? 404  TYR A CE2   1 
ATOM   3779  C  CZ    . TYR D 4  404  ? 16.484  -45.456  14.988  1.00 110.52 ? 404  TYR A CZ    1 
ATOM   3780  O  OH    . TYR D 4  404  ? 15.981  -44.317  15.625  1.00 109.16 ? 404  TYR A OH    1 
ATOM   3781  N  N     . VAL D 4  405  ? 18.043  -51.778  11.183  1.00 106.02 ? 405  VAL A N     1 
ATOM   3782  C  CA    . VAL D 4  405  ? 18.376  -53.147  10.963  1.00 106.65 ? 405  VAL A CA    1 
ATOM   3783  C  C     . VAL D 4  405  ? 19.914  -53.114  10.829  1.00 107.80 ? 405  VAL A C     1 
ATOM   3784  O  O     . VAL D 4  405  ? 20.449  -52.587  9.851   1.00 108.64 ? 405  VAL A O     1 
ATOM   3785  C  CB    . VAL D 4  405  ? 17.628  -53.692  9.706   1.00 106.08 ? 405  VAL A CB    1 
ATOM   3786  C  CG1   . VAL D 4  405  ? 18.374  -54.818  9.059   1.00 107.74 ? 405  VAL A CG1   1 
ATOM   3787  C  CG2   . VAL D 4  405  ? 16.293  -54.196  10.058  1.00 104.85 ? 405  VAL A CG2   1 
ATOM   3788  N  N     . ILE D 4  406  ? 20.632  -53.633  11.827  1.00 108.48 ? 406  ILE A N     1 
ATOM   3789  C  CA    . ILE D 4  406  ? 22.075  -53.486  11.862  1.00 108.84 ? 406  ILE A CA    1 
ATOM   3790  C  C     . ILE D 4  406  ? 22.709  -54.627  11.113  1.00 110.12 ? 406  ILE A C     1 
ATOM   3791  O  O     . ILE D 4  406  ? 22.294  -55.771  11.208  1.00 110.07 ? 406  ILE A O     1 
ATOM   3792  C  CB    . ILE D 4  406  ? 22.631  -53.353  13.303  1.00 108.50 ? 406  ILE A CB    1 
ATOM   3793  C  CG1   . ILE D 4  406  ? 21.884  -52.252  14.093  1.00 108.61 ? 406  ILE A CG1   1 
ATOM   3794  C  CG2   . ILE D 4  406  ? 24.127  -52.995  13.302  1.00 107.97 ? 406  ILE A CG2   1 
ATOM   3795  C  CD1   . ILE D 4  406  ? 20.840  -52.721  15.164  1.00 105.54 ? 406  ILE A CD1   1 
ATOM   3796  N  N     . ARG D 4  407  ? 23.718  -54.273  10.343  1.00 112.09 ? 407  ARG A N     1 
ATOM   3797  C  CA    . ARG D 4  407  ? 24.467  -55.197  9.533   1.00 114.10 ? 407  ARG A CA    1 
ATOM   3798  C  C     . ARG D 4  407  ? 25.900  -55.343  10.011  1.00 115.74 ? 407  ARG A C     1 
ATOM   3799  O  O     . ARG D 4  407  ? 26.347  -54.671  10.943  1.00 115.63 ? 407  ARG A O     1 
ATOM   3800  C  CB    . ARG D 4  407  ? 24.535  -54.648  8.116   1.00 114.14 ? 407  ARG A CB    1 
ATOM   3801  C  CG    . ARG D 4  407  ? 23.204  -54.550  7.436   1.00 114.24 ? 407  ARG A CG    1 
ATOM   3802  C  CD    . ARG D 4  407  ? 23.163  -53.411  6.455   1.00 111.97 ? 407  ARG A CD    1 
ATOM   3803  N  NE    . ARG D 4  407  ? 24.137  -53.520  5.389   1.00 109.86 ? 407  ARG A NE    1 
ATOM   3804  C  CZ    . ARG D 4  407  ? 24.204  -52.656  4.389   1.00 110.15 ? 407  ARG A CZ    1 
ATOM   3805  N  NH1   . ARG D 4  407  ? 23.333  -51.660  4.343   1.00 109.47 ? 407  ARG A NH1   1 
ATOM   3806  N  NH2   . ARG D 4  407  ? 25.131  -52.781  3.441   1.00 110.59 ? 407  ARG A NH2   1 
ATOM   3807  N  N     . ASP D 4  408  ? 26.626  -56.220  9.322   1.00 118.03 ? 408  ASP A N     1 
ATOM   3808  C  CA    . ASP D 4  408  ? 28.074  -56.318  9.461   1.00 120.03 ? 408  ASP A CA    1 
ATOM   3809  C  C     . ASP D 4  408  ? 28.718  -55.107  8.771   1.00 121.11 ? 408  ASP A C     1 
ATOM   3810  O  O     . ASP D 4  408  ? 28.062  -54.416  7.945   1.00 121.09 ? 408  ASP A O     1 
ATOM   3811  C  CB    . ASP D 4  408  ? 28.611  -57.661  8.923   1.00 120.28 ? 408  ASP A CB    1 
ATOM   3812  C  CG    . ASP D 4  408  ? 28.318  -57.874  7.431   1.00 121.54 ? 408  ASP A CG    1 
ATOM   3813  O  OD1   . ASP D 4  408  ? 27.144  -57.650  7.008   1.00 121.59 ? 408  ASP A OD1   1 
ATOM   3814  O  OD2   . ASP D 4  408  ? 29.270  -58.282  6.697   1.00 121.99 ? 408  ASP A OD2   1 
ATOM   3815  N  N     . SER D 4  409  ? 30.002  -54.878  9.098   1.00 122.37 ? 409  SER A N     1 
ATOM   3816  C  CA    . SER D 4  409  ? 30.597  -53.535  9.063   1.00 123.29 ? 409  SER A CA    1 
ATOM   3817  C  C     . SER D 4  409  ? 29.508  -52.559  9.573   1.00 123.96 ? 409  SER A C     1 
ATOM   3818  O  O     . SER D 4  409  ? 28.885  -51.806  8.784   1.00 124.20 ? 409  SER A O     1 
ATOM   3819  C  CB    . SER D 4  409  ? 31.165  -53.182  7.680   1.00 123.34 ? 409  SER A CB    1 
ATOM   3820  O  OG    . SER D 4  409  ? 30.486  -53.871  6.642   1.00 123.42 ? 409  SER A OG    1 
ATOM   3821  N  N     . GLY D 4  410  ? 29.263  -52.663  10.897  1.00 124.20 ? 410  GLY A N     1 
ATOM   3822  C  CA    . GLY D 4  410  ? 28.212  -51.956  11.645  1.00 124.07 ? 410  GLY A CA    1 
ATOM   3823  C  C     . GLY D 4  410  ? 27.662  -50.744  10.931  1.00 124.10 ? 410  GLY A C     1 
ATOM   3824  O  O     . GLY D 4  410  ? 28.387  -49.770  10.671  1.00 124.50 ? 410  GLY A O     1 
ATOM   3825  N  N     . ASP D 4  411  ? 26.378  -50.809  10.601  1.00 123.71 ? 411  ASP A N     1 
ATOM   3826  C  CA    . ASP D 4  411  ? 25.748  -49.797  9.761   1.00 123.09 ? 411  ASP A CA    1 
ATOM   3827  C  C     . ASP D 4  411  ? 24.225  -49.738  9.978   1.00 122.53 ? 411  ASP A C     1 
ATOM   3828  O  O     . ASP D 4  411  ? 23.521  -50.738  9.782   1.00 122.68 ? 411  ASP A O     1 
ATOM   3829  C  CB    . ASP D 4  411  ? 26.086  -50.081  8.296   1.00 122.96 ? 411  ASP A CB    1 
ATOM   3830  C  CG    . ASP D 4  411  ? 25.117  -49.442  7.358   1.00 123.26 ? 411  ASP A CG    1 
ATOM   3831  O  OD1   . ASP D 4  411  ? 25.005  -48.198  7.397   1.00 123.48 ? 411  ASP A OD1   1 
ATOM   3832  O  OD2   . ASP D 4  411  ? 24.449  -50.185  6.605   1.00 123.89 ? 411  ASP A OD2   1 
ATOM   3833  N  N     . ARG D 4  412  ? 23.710  -48.580  10.378  1.00 121.54 ? 412  ARG A N     1 
ATOM   3834  C  CA    . ARG D 4  412  ? 22.277  -48.478  10.609  1.00 120.82 ? 412  ARG A CA    1 
ATOM   3835  C  C     . ARG D 4  412  ? 21.447  -48.315  9.339   1.00 119.96 ? 412  ARG A C     1 
ATOM   3836  O  O     . ARG D 4  412  ? 21.869  -47.653  8.391   1.00 119.92 ? 412  ARG A O     1 
ATOM   3837  C  CB    . ARG D 4  412  ? 21.965  -47.381  11.603  1.00 121.15 ? 412  ARG A CB    1 
ATOM   3838  C  CG    . ARG D 4  412  ? 21.598  -47.947  12.924  1.00 122.53 ? 412  ARG A CG    1 
ATOM   3839  C  CD    . ARG D 4  412  ? 21.620  -46.887  14.006  1.00 126.60 ? 412  ARG A CD    1 
ATOM   3840  N  NE    . ARG D 4  412  ? 20.821  -47.318  15.155  1.00 129.67 ? 412  ARG A NE    1 
ATOM   3841  C  CZ    . ARG D 4  412  ? 21.154  -48.315  15.982  1.00 130.17 ? 412  ARG A CZ    1 
ATOM   3842  N  NH1   . ARG D 4  412  ? 22.293  -49.005  15.805  1.00 130.05 ? 412  ARG A NH1   1 
ATOM   3843  N  NH2   . ARG D 4  412  ? 20.338  -48.626  16.985  1.00 128.99 ? 412  ARG A NH2   1 
ATOM   3844  N  N     . ILE D 4  413  ? 20.272  -48.947  9.333   1.00 118.81 ? 413  ILE A N     1 
ATOM   3845  C  CA    . ILE D 4  413  ? 19.341  -48.875  8.210   1.00 117.55 ? 413  ILE A CA    1 
ATOM   3846  C  C     . ILE D 4  413  ? 18.019  -48.413  8.754   1.00 116.96 ? 413  ILE A C     1 
ATOM   3847  O  O     . ILE D 4  413  ? 17.223  -49.242  9.159   1.00 117.16 ? 413  ILE A O     1 
ATOM   3848  C  CB    . ILE D 4  413  ? 19.088  -50.260  7.561   1.00 117.34 ? 413  ILE A CB    1 
ATOM   3849  C  CG1   . ILE D 4  413  ? 20.316  -50.766  6.805   1.00 116.19 ? 413  ILE A CG1   1 
ATOM   3850  C  CG2   . ILE D 4  413  ? 17.888  -50.197  6.611   1.00 117.21 ? 413  ILE A CG2   1 
ATOM   3851  C  CD1   . ILE D 4  413  ? 20.142  -52.178  6.307   1.00 113.82 ? 413  ILE A CD1   1 
ATOM   3852  N  N     . ASP D 4  414  ? 17.767  -47.108  8.745   1.00 116.15 ? 414  ASP A N     1 
ATOM   3853  C  CA    . ASP D 4  414  ? 16.568  -46.559  9.406   1.00 115.59 ? 414  ASP A CA    1 
ATOM   3854  C  C     . ASP D 4  414  ? 15.217  -46.868  8.721   1.00 115.05 ? 414  ASP A C     1 
ATOM   3855  O  O     . ASP D 4  414  ? 14.922  -46.390  7.630   1.00 114.86 ? 414  ASP A O     1 
ATOM   3856  C  CB    . ASP D 4  414  ? 16.734  -45.054  9.630   1.00 115.71 ? 414  ASP A CB    1 
ATOM   3857  C  CG    . ASP D 4  414  ? 15.632  -44.461  10.481  1.00 114.90 ? 414  ASP A CG    1 
ATOM   3858  O  OD1   . ASP D 4  414  ? 14.727  -45.197  10.940  1.00 113.40 ? 414  ASP A OD1   1 
ATOM   3859  O  OD2   . ASP D 4  414  ? 15.682  -43.236  10.677  1.00 114.94 ? 414  ASP A OD2   1 
ATOM   3860  N  N     . LEU D 4  415  ? 14.379  -47.632  9.403   1.00 114.42 ? 415  LEU A N     1 
ATOM   3861  C  CA    . LEU D 4  415  ? 13.185  -48.204  8.774   1.00 113.93 ? 415  LEU A CA    1 
ATOM   3862  C  C     . LEU D 4  415  ? 11.905  -47.344  8.769   1.00 113.73 ? 415  LEU A C     1 
ATOM   3863  O  O     . LEU D 4  415  ? 10.808  -47.853  8.548   1.00 113.77 ? 415  LEU A O     1 
ATOM   3864  C  CB    . LEU D 4  415  ? 12.881  -49.566  9.398   1.00 113.89 ? 415  LEU A CB    1 
ATOM   3865  C  CG    . LEU D 4  415  ? 13.834  -50.702  9.076   1.00 112.34 ? 415  LEU A CG    1 
ATOM   3866  C  CD1   . LEU D 4  415  ? 13.549  -51.850  10.016  1.00 111.25 ? 415  LEU A CD1   1 
ATOM   3867  C  CD2   . LEU D 4  415  ? 13.647  -51.111  7.651   1.00 111.58 ? 415  LEU A CD2   1 
ATOM   3868  N  N     . ARG D 4  416  ? 12.022  -46.054  9.017   1.00 113.19 ? 416  ARG A N     1 
ATOM   3869  C  CA    . ARG D 4  416  ? 10.887  -45.207  8.743   1.00 113.04 ? 416  ARG A CA    1 
ATOM   3870  C  C     . ARG D 4  416  ? 11.159  -44.387  7.503   1.00 112.20 ? 416  ARG A C     1 
ATOM   3871  O  O     . ARG D 4  416  ? 10.248  -43.995  6.800   1.00 112.28 ? 416  ARG A O     1 
ATOM   3872  C  CB    . ARG D 4  416  ? 10.508  -44.343  9.941   1.00 113.91 ? 416  ARG A CB    1 
ATOM   3873  C  CG    . ARG D 4  416  ? 11.543  -44.286  11.031  1.00 116.55 ? 416  ARG A CG    1 
ATOM   3874  C  CD    . ARG D 4  416  ? 11.614  -42.874  11.562  1.00 121.99 ? 416  ARG A CD    1 
ATOM   3875  N  NE    . ARG D 4  416  ? 12.936  -42.582  12.109  1.00 123.82 ? 416  ARG A NE    1 
ATOM   3876  C  CZ    . ARG D 4  416  ? 13.271  -42.842  13.364  1.00 125.64 ? 416  ARG A CZ    1 
ATOM   3877  N  NH1   . ARG D 4  416  ? 12.366  -43.392  14.193  1.00 127.34 ? 416  ARG A NH1   1 
ATOM   3878  N  NH2   . ARG D 4  416  ? 14.495  -42.547  13.790  1.00 124.66 ? 416  ARG A NH2   1 
ATOM   3879  N  N     . TYR D 4  417  ? 12.429  -44.137  7.224   1.00 111.54 ? 417  TYR A N     1 
ATOM   3880  C  CA    . TYR D 4  417  ? 12.823  -43.589  5.934   1.00 110.32 ? 417  TYR A CA    1 
ATOM   3881  C  C     . TYR D 4  417  ? 13.513  -44.727  5.229   1.00 109.37 ? 417  TYR A C     1 
ATOM   3882  O  O     . TYR D 4  417  ? 13.362  -45.880  5.608   1.00 109.33 ? 417  TYR A O     1 
ATOM   3883  C  CB    . TYR D 4  417  ? 13.743  -42.383  6.112   1.00 110.29 ? 417  TYR A CB    1 
ATOM   3884  C  CG    . TYR D 4  417  ? 13.416  -41.534  7.343   1.00 111.45 ? 417  TYR A CG    1 
ATOM   3885  C  CD1   . TYR D 4  417  ? 14.430  -41.122  8.216   1.00 112.74 ? 417  TYR A CD1   1 
ATOM   3886  C  CD2   . TYR D 4  417  ? 12.088  -41.160  7.653   1.00 110.58 ? 417  TYR A CD2   1 
ATOM   3887  C  CE1   . TYR D 4  417  ? 14.128  -40.358  9.353   1.00 112.34 ? 417  TYR A CE1   1 
ATOM   3888  C  CE2   . TYR D 4  417  ? 11.794  -40.406  8.783   1.00 109.33 ? 417  TYR A CE2   1 
ATOM   3889  C  CZ    . TYR D 4  417  ? 12.817  -40.009  9.617   1.00 109.97 ? 417  TYR A CZ    1 
ATOM   3890  O  OH    . TYR D 4  417  ? 12.561  -39.259  10.721  1.00 110.32 ? 417  TYR A OH    1 
ATOM   3891  N  N     . SER D 4  418  ? 14.272  -44.421  4.204   1.00 108.73 ? 418  SER A N     1 
ATOM   3892  C  CA    . SER D 4  418  ? 14.983  -45.447  3.439   1.00 108.22 ? 418  SER A CA    1 
ATOM   3893  C  C     . SER D 4  418  ? 14.066  -46.041  2.414   1.00 107.92 ? 418  SER A C     1 
ATOM   3894  O  O     . SER D 4  418  ? 12.991  -46.581  2.727   1.00 107.60 ? 418  SER A O     1 
ATOM   3895  C  CB    . SER D 4  418  ? 15.582  -46.570  4.302   1.00 108.55 ? 418  SER A CB    1 
ATOM   3896  O  OG    . SER D 4  418  ? 16.649  -47.246  3.637   1.00 107.20 ? 418  SER A OG    1 
ATOM   3897  N  N     . LYS D 4  419  ? 14.540  -45.921  1.181   1.00 107.32 ? 419  LYS A N     1 
ATOM   3898  C  CA    . LYS D 4  419  ? 13.919  -46.460  0.012   1.00 106.50 ? 419  LYS A CA    1 
ATOM   3899  C  C     . LYS D 4  419  ? 13.865  -48.010  0.018   1.00 107.05 ? 419  LYS A C     1 
ATOM   3900  O  O     . LYS D 4  419  ? 13.695  -48.608  -1.042  1.00 107.87 ? 419  LYS A O     1 
ATOM   3901  C  CB    . LYS D 4  419  ? 14.701  -45.931  -1.191  1.00 105.69 ? 419  LYS A CB    1 
ATOM   3902  C  CG    . LYS D 4  419  ? 16.179  -46.138  -1.071  1.00 102.86 ? 419  LYS A CG    1 
ATOM   3903  C  CD    . LYS D 4  419  ? 16.872  -45.999  -2.400  1.00 100.40 ? 419  LYS A CD    1 
ATOM   3904  C  CE    . LYS D 4  419  ? 17.673  -44.715  -2.456  1.00 98.87  ? 419  LYS A CE    1 
ATOM   3905  N  NZ    . LYS D 4  419  ? 18.253  -44.406  -3.793  1.00 95.66  ? 419  LYS A NZ    1 
ATOM   3906  N  N     . ARG D 4  420  ? 13.970  -48.657  1.192   1.00 107.10 ? 420  ARG A N     1 
ATOM   3907  C  CA    . ARG D 4  420  ? 14.163  -50.124  1.279   1.00 106.77 ? 420  ARG A CA    1 
ATOM   3908  C  C     . ARG D 4  420  ? 13.487  -50.817  2.462   1.00 107.52 ? 420  ARG A C     1 
ATOM   3909  O  O     . ARG D 4  420  ? 13.581  -52.027  2.598   1.00 106.95 ? 420  ARG A O     1 
ATOM   3910  C  CB    . ARG D 4  420  ? 15.668  -50.485  1.276   1.00 106.55 ? 420  ARG A CB    1 
ATOM   3911  C  CG    . ARG D 4  420  ? 16.374  -50.458  -0.063  1.00 103.19 ? 420  ARG A CG    1 
ATOM   3912  C  CD    . ARG D 4  420  ? 16.064  -51.691  -0.835  1.00 100.87 ? 420  ARG A CD    1 
ATOM   3913  N  NE    . ARG D 4  420  ? 16.965  -52.795  -0.530  1.00 101.03 ? 420  ARG A NE    1 
ATOM   3914  C  CZ    . ARG D 4  420  ? 17.875  -53.283  -1.385  1.00 102.93 ? 420  ARG A CZ    1 
ATOM   3915  N  NH1   . ARG D 4  420  ? 18.017  -52.764  -2.608  1.00 102.58 ? 420  ARG A NH1   1 
ATOM   3916  N  NH2   . ARG D 4  420  ? 18.659  -54.299  -1.024  1.00 102.99 ? 420  ARG A NH2   1 
ATOM   3917  N  N     . ALA D 4  421  ? 12.816  -50.056  3.318   1.00 109.31 ? 421  ALA A N     1 
ATOM   3918  C  CA    . ALA D 4  421  ? 12.010  -50.635  4.436   1.00 111.31 ? 421  ALA A CA    1 
ATOM   3919  C  C     . ALA D 4  421  ? 10.933  -51.644  3.992   1.00 112.44 ? 421  ALA A C     1 
ATOM   3920  O  O     . ALA D 4  421  ? 10.442  -52.449  4.808   1.00 112.43 ? 421  ALA A O     1 
ATOM   3921  C  CB    . ALA D 4  421  ? 11.362  -49.525  5.300   1.00 111.15 ? 421  ALA A CB    1 
ATOM   3922  N  N     . GLY D 4  422  ? 10.583  -51.567  2.701   1.00 113.73 ? 422  GLY A N     1 
ATOM   3923  C  CA    . GLY D 4  422  ? 9.618   -52.449  2.051   1.00 115.01 ? 422  GLY A CA    1 
ATOM   3924  C  C     . GLY D 4  422  ? 10.266  -53.696  1.483   1.00 115.99 ? 422  GLY A C     1 
ATOM   3925  O  O     . GLY D 4  422  ? 9.735   -54.789  1.648   1.00 116.47 ? 422  GLY A O     1 
ATOM   3926  N  N     . ASP D 4  423  ? 11.409  -53.529  0.816   1.00 116.72 ? 423  ASP A N     1 
ATOM   3927  C  CA    . ASP D 4  423  ? 12.202  -54.634  0.285   1.00 117.41 ? 423  ASP A CA    1 
ATOM   3928  C  C     . ASP D 4  423  ? 12.799  -55.437  1.466   1.00 117.87 ? 423  ASP A C     1 
ATOM   3929  O  O     . ASP D 4  423  ? 12.058  -56.194  2.110   1.00 118.33 ? 423  ASP A O     1 
ATOM   3930  C  CB    . ASP D 4  423  ? 13.245  -54.065  -0.681  1.00 117.48 ? 423  ASP A CB    1 
ATOM   3931  C  CG    . ASP D 4  423  ? 14.360  -55.037  -1.007  1.00 118.56 ? 423  ASP A CG    1 
ATOM   3932  O  OD1   . ASP D 4  423  ? 14.299  -55.650  -2.094  1.00 120.61 ? 423  ASP A OD1   1 
ATOM   3933  O  OD2   . ASP D 4  423  ? 15.312  -55.169  -0.196  1.00 118.49 ? 423  ASP A OD2   1 
ATOM   3934  N  N     . ILE D 4  424  ? 14.106  -55.275  1.747   1.00 118.11 ? 424  ILE A N     1 
ATOM   3935  C  CA    . ILE D 4  424  ? 14.828  -55.819  2.953   1.00 117.71 ? 424  ILE A CA    1 
ATOM   3936  C  C     . ILE D 4  424  ? 15.262  -57.302  2.937   1.00 117.96 ? 424  ILE A C     1 
ATOM   3937  O  O     . ILE D 4  424  ? 14.509  -58.228  3.269   1.00 117.51 ? 424  ILE A O     1 
ATOM   3938  C  CB    . ILE D 4  424  ? 14.163  -55.370  4.314   1.00 117.55 ? 424  ILE A CB    1 
ATOM   3939  C  CG1   . ILE D 4  424  ? 15.226  -54.854  5.282   1.00 116.37 ? 424  ILE A CG1   1 
ATOM   3940  C  CG2   . ILE D 4  424  ? 13.196  -56.434  4.906   1.00 117.16 ? 424  ILE A CG2   1 
ATOM   3941  C  CD1   . ILE D 4  424  ? 15.439  -53.377  5.166   1.00 114.33 ? 424  ILE A CD1   1 
ATOM   3942  N  N     . GLN D 4  425  ? 16.509  -57.511  2.560   1.00 118.58 ? 425  GLN A N     1 
ATOM   3943  C  CA    . GLN D 4  425  ? 17.006  -58.868  2.327   1.00 119.49 ? 425  GLN A CA    1 
ATOM   3944  C  C     . GLN D 4  425  ? 17.868  -59.460  3.463   1.00 119.63 ? 425  GLN A C     1 
ATOM   3945  O  O     . GLN D 4  425  ? 19.098  -59.665  3.248   1.00 119.19 ? 425  GLN A O     1 
ATOM   3946  C  CB    . GLN D 4  425  ? 17.792  -58.895  1.024   1.00 119.73 ? 425  GLN A CB    1 
ATOM   3947  C  CG    . GLN D 4  425  ? 17.043  -58.268  -0.141  1.00 122.53 ? 425  GLN A CG    1 
ATOM   3948  C  CD    . GLN D 4  425  ? 16.155  -59.264  -0.887  1.00 125.87 ? 425  GLN A CD    1 
ATOM   3949  O  OE1   . GLN D 4  425  ? 15.188  -59.812  -0.323  1.00 126.09 ? 425  GLN A OE1   1 
ATOM   3950  N  NE2   . GLN D 4  425  ? 16.477  -59.495  -2.179  1.00 127.00 ? 425  GLN A NE2   1 
ATOM   3951  N  N     . LEU D 4  426  ? 17.216  -59.753  4.620   1.00 119.20 ? 426  LEU A N     1 
ATOM   3952  C  CA    . LEU D 4  426  ? 17.852  -60.252  5.879   1.00 118.90 ? 426  LEU A CA    1 
ATOM   3953  C  C     . LEU D 4  426  ? 18.992  -61.327  5.769   1.00 119.31 ? 426  LEU A C     1 
ATOM   3954  O  O     . LEU D 4  426  ? 19.343  -61.807  4.675   1.00 119.55 ? 426  LEU A O     1 
ATOM   3955  C  CB    . LEU D 4  426  ? 16.778  -60.699  6.881   1.00 118.31 ? 426  LEU A CB    1 
ATOM   3956  C  CG    . LEU D 4  426  ? 16.105  -59.651  7.796   1.00 118.01 ? 426  LEU A CG    1 
ATOM   3957  C  CD1   . LEU D 4  426  ? 14.991  -60.210  8.682   1.00 114.96 ? 426  LEU A CD1   1 
ATOM   3958  C  CD2   . LEU D 4  426  ? 17.106  -58.939  8.673   1.00 118.10 ? 426  LEU A CD2   1 
ATOM   3959  N  N     . GLN D 4  427  ? 19.591  -61.684  6.904   1.00 119.34 ? 427  GLN A N     1 
ATOM   3960  C  CA    . GLN D 4  427  ? 20.698  -62.655  6.932   1.00 119.33 ? 427  GLN A CA    1 
ATOM   3961  C  C     . GLN D 4  427  ? 20.908  -63.126  8.362   1.00 119.24 ? 427  GLN A C     1 
ATOM   3962  O  O     . GLN D 4  427  ? 20.694  -62.356  9.320   1.00 119.50 ? 427  GLN A O     1 
ATOM   3963  C  CB    . GLN D 4  427  ? 22.002  -62.013  6.466   1.00 119.27 ? 427  GLN A CB    1 
ATOM   3964  C  CG    . GLN D 4  427  ? 22.753  -62.803  5.434   1.00 120.36 ? 427  GLN A CG    1 
ATOM   3965  C  CD    . GLN D 4  427  ? 22.633  -62.170  4.058   1.00 121.90 ? 427  GLN A CD    1 
ATOM   3966  O  OE1   . GLN D 4  427  ? 21.965  -61.142  3.898   1.00 122.40 ? 427  GLN A OE1   1 
ATOM   3967  N  NE2   . GLN D 4  427  ? 23.285  -62.772  3.057   1.00 122.05 ? 427  GLN A NE2   1 
ATOM   3968  N  N     . TYR D 4  428  ? 21.326  -64.380  8.525   1.00 118.72 ? 428  TYR A N     1 
ATOM   3969  C  CA    . TYR D 4  428  ? 21.748  -64.833  9.841   1.00 118.00 ? 428  TYR A CA    1 
ATOM   3970  C  C     . TYR D 4  428  ? 23.056  -64.079  10.051  1.00 117.14 ? 428  TYR A C     1 
ATOM   3971  O  O     . TYR D 4  428  ? 23.875  -63.972  9.128   1.00 116.83 ? 428  TYR A O     1 
ATOM   3972  C  CB    . TYR D 4  428  ? 21.928  -66.361  9.936   1.00 118.57 ? 428  TYR A CB    1 
ATOM   3973  C  CG    . TYR D 4  428  ? 21.199  -67.170  8.877   1.00 119.05 ? 428  TYR A CG    1 
ATOM   3974  C  CD1   . TYR D 4  428  ? 21.720  -67.266  7.573   1.00 120.39 ? 428  TYR A CD1   1 
ATOM   3975  C  CD2   . TYR D 4  428  ? 20.009  -67.849  9.172   1.00 118.72 ? 428  TYR A CD2   1 
ATOM   3976  C  CE1   . TYR D 4  428  ? 21.060  -67.998  6.576   1.00 120.91 ? 428  TYR A CE1   1 
ATOM   3977  C  CE2   . TYR D 4  428  ? 19.335  -68.597  8.186   1.00 119.55 ? 428  TYR A CE2   1 
ATOM   3978  C  CZ    . TYR D 4  428  ? 19.870  -68.663  6.885   1.00 120.33 ? 428  TYR A CZ    1 
ATOM   3979  O  OH    . TYR D 4  428  ? 19.248  -69.379  5.875   1.00 120.02 ? 428  TYR A OH    1 
ATOM   3980  N  N     . GLY D 4  429  ? 23.212  -63.509  11.240  1.00 116.19 ? 429  GLY A N     1 
ATOM   3981  C  CA    . GLY D 4  429  ? 24.341  -62.632  11.532  1.00 114.83 ? 429  GLY A CA    1 
ATOM   3982  C  C     . GLY D 4  429  ? 23.992  -61.155  11.708  1.00 113.85 ? 429  GLY A C     1 
ATOM   3983  O  O     . GLY D 4  429  ? 24.778  -60.427  12.330  1.00 113.85 ? 429  GLY A O     1 
ATOM   3984  N  N     . TRP D 4  430  ? 22.841  -60.713  11.158  1.00 112.44 ? 430  TRP A N     1 
ATOM   3985  C  CA    . TRP D 4  430  ? 22.397  -59.304  11.221  1.00 110.82 ? 430  TRP A CA    1 
ATOM   3986  C  C     . TRP D 4  430  ? 21.596  -59.177  12.472  1.00 109.95 ? 430  TRP A C     1 
ATOM   3987  O  O     . TRP D 4  430  ? 21.157  -60.177  13.001  1.00 109.99 ? 430  TRP A O     1 
ATOM   3988  C  CB    . TRP D 4  430  ? 21.539  -58.896  10.009  1.00 110.52 ? 430  TRP A CB    1 
ATOM   3989  C  CG    . TRP D 4  430  ? 22.310  -58.692  8.695   1.00 110.79 ? 430  TRP A CG    1 
ATOM   3990  C  CD1   . TRP D 4  430  ? 23.583  -59.135  8.395   1.00 111.29 ? 430  TRP A CD1   1 
ATOM   3991  C  CD2   . TRP D 4  430  ? 21.833  -58.053  7.498   1.00 110.87 ? 430  TRP A CD2   1 
ATOM   3992  N  NE1   . TRP D 4  430  ? 23.928  -58.794  7.105   1.00 110.87 ? 430  TRP A NE1   1 
ATOM   3993  C  CE2   . TRP D 4  430  ? 22.878  -58.134  6.527   1.00 110.27 ? 430  TRP A CE2   1 
ATOM   3994  C  CE3   . TRP D 4  430  ? 20.636  -57.416  7.151   1.00 110.88 ? 430  TRP A CE3   1 
ATOM   3995  C  CZ2   . TRP D 4  430  ? 22.762  -57.595  5.241   1.00 109.45 ? 430  TRP A CZ2   1 
ATOM   3996  C  CZ3   . TRP D 4  430  ? 20.526  -56.883  5.856   1.00 111.38 ? 430  TRP A CZ3   1 
ATOM   3997  C  CH2   . TRP D 4  430  ? 21.593  -56.981  4.918   1.00 109.95 ? 430  TRP A CH2   1 
ATOM   3998  N  N     . LYS D 4  431  ? 21.443  -57.953  12.958  1.00 109.18 ? 431  LYS A N     1 
ATOM   3999  C  CA    . LYS D 4  431  ? 20.615  -57.645  14.129  1.00 108.73 ? 431  LYS A CA    1 
ATOM   4000  C  C     . LYS D 4  431  ? 19.343  -56.972  13.636  1.00 107.54 ? 431  LYS A C     1 
ATOM   4001  O  O     . LYS D 4  431  ? 19.347  -56.396  12.567  1.00 107.99 ? 431  LYS A O     1 
ATOM   4002  C  CB    . LYS D 4  431  ? 21.363  -56.663  15.053  1.00 109.36 ? 431  LYS A CB    1 
ATOM   4003  C  CG    . LYS D 4  431  ? 21.765  -57.128  16.493  1.00 110.09 ? 431  LYS A CG    1 
ATOM   4004  C  CD    . LYS D 4  431  ? 22.332  -55.923  17.326  1.00 109.41 ? 431  LYS A CD    1 
ATOM   4005  C  CE    . LYS D 4  431  ? 22.411  -56.161  18.851  1.00 110.08 ? 431  LYS A CE    1 
ATOM   4006  N  NZ    . LYS D 4  431  ? 23.280  -57.311  19.306  1.00 111.76 ? 431  LYS A NZ    1 
ATOM   4007  N  N     . VAL D 4  432  ? 18.265  -57.017  14.401  1.00 106.01 ? 432  VAL A N     1 
ATOM   4008  C  CA    . VAL D 4  432  ? 17.056  -56.285  14.046  1.00 104.88 ? 432  VAL A CA    1 
ATOM   4009  C  C     . VAL D 4  432  ? 16.524  -55.724  15.326  1.00 104.77 ? 432  VAL A C     1 
ATOM   4010  O  O     . VAL D 4  432  ? 16.350  -56.461  16.282  1.00 105.16 ? 432  VAL A O     1 
ATOM   4011  C  CB    . VAL D 4  432  ? 15.985  -57.209  13.429  1.00 104.61 ? 432  VAL A CB    1 
ATOM   4012  C  CG1   . VAL D 4  432  ? 14.589  -56.701  13.682  1.00 103.39 ? 432  VAL A CG1   1 
ATOM   4013  C  CG2   . VAL D 4  432  ? 16.206  -57.347  11.949  1.00 105.20 ? 432  VAL A CG2   1 
ATOM   4014  N  N     . GLU D 4  433  ? 16.260  -54.429  15.379  1.00 104.26 ? 433  GLU A N     1 
ATOM   4015  C  CA    . GLU D 4  433  ? 15.770  -53.880  16.620  1.00 103.77 ? 433  GLU A CA    1 
ATOM   4016  C  C     . GLU D 4  433  ? 14.270  -53.965  16.709  1.00 103.34 ? 433  GLU A C     1 
ATOM   4017  O  O     . GLU D 4  433  ? 13.562  -53.021  16.454  1.00 103.31 ? 433  GLU A O     1 
ATOM   4018  C  CB    . GLU D 4  433  ? 16.294  -52.472  16.832  1.00 103.98 ? 433  GLU A CB    1 
ATOM   4019  C  CG    . GLU D 4  433  ? 17.409  -52.421  17.867  1.00 105.32 ? 433  GLU A CG    1 
ATOM   4020  C  CD    . GLU D 4  433  ? 18.142  -51.107  17.853  1.00 107.34 ? 433  GLU A CD    1 
ATOM   4021  O  OE1   . GLU D 4  433  ? 17.832  -50.263  18.722  1.00 108.30 ? 433  GLU A OE1   1 
ATOM   4022  O  OE2   . GLU D 4  433  ? 19.016  -50.919  16.965  1.00 108.13 ? 433  GLU A OE2   1 
ATOM   4023  N  N     . ARG D 4  434  ? 13.776  -55.129  17.069  1.00 103.34 ? 434  ARG A N     1 
ATOM   4024  C  CA    . ARG D 4  434  ? 12.350  -55.307  17.173  1.00 103.82 ? 434  ARG A CA    1 
ATOM   4025  C  C     . ARG D 4  434  ? 11.802  -54.452  18.301  1.00 104.04 ? 434  ARG A C     1 
ATOM   4026  O  O     . ARG D 4  434  ? 12.559  -54.028  19.163  1.00 104.10 ? 434  ARG A O     1 
ATOM   4027  C  CB    . ARG D 4  434  ? 12.001  -56.778  17.389  1.00 103.80 ? 434  ARG A CB    1 
ATOM   4028  C  CG    . ARG D 4  434  ? 12.964  -57.544  18.265  1.00 105.11 ? 434  ARG A CG    1 
ATOM   4029  C  CD    . ARG D 4  434  ? 12.330  -58.796  18.794  1.00 107.60 ? 434  ARG A CD    1 
ATOM   4030  N  NE    . ARG D 4  434  ? 11.441  -58.477  19.906  1.00 112.25 ? 434  ARG A NE    1 
ATOM   4031  C  CZ    . ARG D 4  434  ? 11.622  -58.901  21.159  1.00 114.20 ? 434  ARG A CZ    1 
ATOM   4032  N  NH1   . ARG D 4  434  ? 12.668  -59.694  21.440  1.00 114.24 ? 434  ARG A NH1   1 
ATOM   4033  N  NH2   . ARG D 4  434  ? 10.746  -58.556  22.120  1.00 113.06 ? 434  ARG A NH2   1 
ATOM   4034  N  N     . HIS D 4  435  ? 10.497  -54.184  18.256  1.00 104.44 ? 435  HIS A N     1 
ATOM   4035  C  CA    . HIS D 4  435  ? 9.749   -53.565  19.332  1.00 105.10 ? 435  HIS A CA    1 
ATOM   4036  C  C     . HIS D 4  435  ? 9.736   -54.535  20.452  1.00 105.41 ? 435  HIS A C     1 
ATOM   4037  O  O     . HIS D 4  435  ? 9.752   -55.737  20.236  1.00 105.27 ? 435  HIS A O     1 
ATOM   4038  C  CB    . HIS D 4  435  ? 8.298   -53.369  18.901  1.00 105.67 ? 435  HIS A CB    1 
ATOM   4039  C  CG    . HIS D 4  435  ? 8.073   -52.160  18.039  1.00 108.56 ? 435  HIS A CG    1 
ATOM   4040  N  ND1   . HIS D 4  435  ? 8.719   -51.964  16.831  1.00 110.93 ? 435  HIS A ND1   1 
ATOM   4041  C  CD2   . HIS D 4  435  ? 7.261   -51.090  18.202  1.00 109.59 ? 435  HIS A CD2   1 
ATOM   4042  C  CE1   . HIS D 4  435  ? 8.344   -50.808  16.309  1.00 110.05 ? 435  HIS A CE1   1 
ATOM   4043  N  NE2   . HIS D 4  435  ? 7.466   -50.254  17.128  1.00 110.60 ? 435  HIS A NE2   1 
ATOM   4044  N  N     . ILE D 4  436  ? 9.704   -54.013  21.662  1.00 106.56 ? 436  ILE A N     1 
ATOM   4045  C  CA    . ILE D 4  436  ? 9.392   -54.812  22.856  1.00 108.04 ? 436  ILE A CA    1 
ATOM   4046  C  C     . ILE D 4  436  ? 8.036   -55.464  22.597  1.00 109.01 ? 436  ILE A C     1 
ATOM   4047  O  O     . ILE D 4  436  ? 7.161   -54.841  21.990  1.00 109.46 ? 436  ILE A O     1 
ATOM   4048  C  CB    . ILE D 4  436  ? 9.447   -53.896  24.145  1.00 108.03 ? 436  ILE A CB    1 
ATOM   4049  C  CG1   . ILE D 4  436  ? 10.876  -53.879  24.728  1.00 108.99 ? 436  ILE A CG1   1 
ATOM   4050  C  CG2   . ILE D 4  436  ? 8.453   -54.277  25.245  1.00 107.04 ? 436  ILE A CG2   1 
ATOM   4051  C  CD1   . ILE D 4  436  ? 12.055  -53.463  23.735  1.00 107.33 ? 436  ILE A CD1   1 
ATOM   4052  N  N     . MET D 4  437  ? 7.859   -56.723  22.972  1.00 110.05 ? 437  MET A N     1 
ATOM   4053  C  CA    . MET D 4  437  ? 6.561   -57.371  22.686  1.00 111.69 ? 437  MET A CA    1 
ATOM   4054  C  C     . MET D 4  437  ? 6.128   -58.367  23.731  1.00 111.28 ? 437  MET A C     1 
ATOM   4055  O  O     . MET D 4  437  ? 6.755   -58.501  24.788  1.00 110.93 ? 437  MET A O     1 
ATOM   4056  C  CB    . MET D 4  437  ? 6.461   -57.983  21.266  1.00 111.74 ? 437  MET A CB    1 
ATOM   4057  C  CG    . MET D 4  437  ? 7.778   -58.564  20.656  1.00 113.37 ? 437  MET A CG    1 
ATOM   4058  S  SD    . MET D 4  437  ? 7.506   -59.624  19.183  1.00 114.79 ? 437  MET A SD    1 
ATOM   4059  C  CE    . MET D 4  437  ? 7.433   -61.274  19.983  1.00 114.63 ? 437  MET A CE    1 
ATOM   4060  N  N     . ASP D 4  438  ? 5.048   -59.068  23.434  1.00 111.54 ? 438  ASP A N     1 
ATOM   4061  C  CA    . ASP D 4  438  ? 4.375   -59.751  24.505  1.00 112.53 ? 438  ASP A CA    1 
ATOM   4062  C  C     . ASP D 4  438  ? 5.311   -60.709  25.173  1.00 112.48 ? 438  ASP A C     1 
ATOM   4063  O  O     . ASP D 4  438  ? 6.171   -61.291  24.511  1.00 112.56 ? 438  ASP A O     1 
ATOM   4064  C  CB    . ASP D 4  438  ? 3.104   -60.458  24.023  1.00 113.38 ? 438  ASP A CB    1 
ATOM   4065  C  CG    . ASP D 4  438  ? 1.810   -59.796  24.551  1.00 113.21 ? 438  ASP A CG    1 
ATOM   4066  O  OD1   . ASP D 4  438  ? 1.800   -58.575  24.838  1.00 114.28 ? 438  ASP A OD1   1 
ATOM   4067  O  OD2   . ASP D 4  438  ? 0.799   -60.513  24.659  1.00 112.11 ? 438  ASP A OD2   1 
ATOM   4068  N  N     . ASN D 4  439  ? 5.141   -60.847  26.488  1.00 112.49 ? 439  ASN A N     1 
ATOM   4069  C  CA    . ASN D 4  439  ? 5.925   -61.777  27.282  1.00 112.65 ? 439  ASN A CA    1 
ATOM   4070  C  C     . ASN D 4  439  ? 7.411   -61.528  27.209  1.00 112.61 ? 439  ASN A C     1 
ATOM   4071  O  O     . ASN D 4  439  ? 8.180   -62.314  26.608  1.00 112.61 ? 439  ASN A O     1 
ATOM   4072  C  CB    . ASN D 4  439  ? 5.642   -63.198  26.857  1.00 112.88 ? 439  ASN A CB    1 
ATOM   4073  C  CG    . ASN D 4  439  ? 4.792   -63.898  27.825  1.00 113.85 ? 439  ASN A CG    1 
ATOM   4074  O  OD1   . ASN D 4  439  ? 4.859   -63.629  29.024  1.00 115.63 ? 439  ASN A OD1   1 
ATOM   4075  N  ND2   . ASN D 4  439  ? 3.974   -64.819  27.333  1.00 115.72 ? 439  ASN A ND2   1 
ATOM   4076  N  N     . ASP D 4  440  ? 7.815   -60.418  27.812  1.00 112.29 ? 440  ASP A N     1 
ATOM   4077  C  CA    . ASP D 4  440  ? 9.219   -60.054  27.794  1.00 111.79 ? 440  ASP A CA    1 
ATOM   4078  C  C     . ASP D 4  440  ? 9.818   -59.681  29.178  1.00 111.30 ? 440  ASP A C     1 
ATOM   4079  O  O     . ASP D 4  440  ? 9.085   -59.247  30.118  1.00 110.97 ? 440  ASP A O     1 
ATOM   4080  C  CB    . ASP D 4  440  ? 9.522   -59.035  26.661  1.00 111.66 ? 440  ASP A CB    1 
ATOM   4081  C  CG    . ASP D 4  440  ? 10.405  -59.630  25.563  1.00 111.12 ? 440  ASP A CG    1 
ATOM   4082  O  OD1   . ASP D 4  440  ? 10.154  -59.428  24.347  1.00 110.54 ? 440  ASP A OD1   1 
ATOM   4083  O  OD2   . ASP D 4  440  ? 11.362  -60.324  25.951  1.00 110.22 ? 440  ASP A OD2   1 
ATOM   4084  N  N     . PRO D 4  441  ? 11.150  -59.910  29.315  1.00 110.22 ? 441  PRO A N     1 
ATOM   4085  C  CA    . PRO D 4  441  ? 11.855  -59.535  30.533  1.00 109.19 ? 441  PRO A CA    1 
ATOM   4086  C  C     . PRO D 4  441  ? 11.941  -58.001  30.709  1.00 108.16 ? 441  PRO A C     1 
ATOM   4087  O  O     . PRO D 4  441  ? 12.747  -57.347  30.051  1.00 107.80 ? 441  PRO A O     1 
ATOM   4088  C  CB    . PRO D 4  441  ? 13.252  -60.168  30.320  1.00 109.48 ? 441  PRO A CB    1 
ATOM   4089  C  CG    . PRO D 4  441  ? 13.406  -60.295  28.815  1.00 109.16 ? 441  PRO A CG    1 
ATOM   4090  C  CD    . PRO D 4  441  ? 12.040  -60.569  28.323  1.00 109.53 ? 441  PRO A CD    1 
ATOM   4091  N  N     . VAL D 4  442  ? 11.120  -57.400  31.563  1.00 107.22 ? 442  VAL A N     1 
ATOM   4092  C  CA    . VAL D 4  442  ? 11.430  -55.987  31.902  1.00 106.41 ? 442  VAL A CA    1 
ATOM   4093  C  C     . VAL D 4  442  ? 11.733  -55.747  33.373  1.00 106.26 ? 442  VAL A C     1 
ATOM   4094  O  O     . VAL D 4  442  ? 11.429  -56.597  34.203  1.00 107.19 ? 442  VAL A O     1 
ATOM   4095  C  CB    . VAL D 4  442  ? 10.410  -54.993  31.413  1.00 105.68 ? 442  VAL A CB    1 
ATOM   4096  C  CG1   . VAL D 4  442  ? 10.571  -54.841  29.925  1.00 106.28 ? 442  VAL A CG1   1 
ATOM   4097  C  CG2   . VAL D 4  442  ? 9.058   -55.434  31.801  1.00 104.02 ? 442  VAL A CG2   1 
ATOM   4098  N  N     . LEU D 4  443  ? 12.366  -54.625  33.693  1.00 105.16 ? 443  LEU A N     1 
ATOM   4099  C  CA    . LEU D 4  443  ? 12.753  -54.391  35.050  1.00 104.56 ? 443  LEU A CA    1 
ATOM   4100  C  C     . LEU D 4  443  ? 11.974  -53.219  35.487  1.00 104.80 ? 443  LEU A C     1 
ATOM   4101  O  O     . LEU D 4  443  ? 12.223  -52.101  35.042  1.00 105.09 ? 443  LEU A O     1 
ATOM   4102  C  CB    . LEU D 4  443  ? 14.235  -54.099  35.149  1.00 104.86 ? 443  LEU A CB    1 
ATOM   4103  C  CG    . LEU D 4  443  ? 14.844  -54.262  36.548  1.00 104.46 ? 443  LEU A CG    1 
ATOM   4104  C  CD1   . LEU D 4  443  ? 16.239  -53.564  36.592  1.00 101.01 ? 443  LEU A CD1   1 
ATOM   4105  C  CD2   . LEU D 4  443  ? 13.870  -53.809  37.694  1.00 101.49 ? 443  LEU A CD2   1 
ATOM   4106  N  N     . PHE D 4  444  ? 11.022  -53.488  36.363  1.00 105.14 ? 444  PHE A N     1 
ATOM   4107  C  CA    . PHE D 4  444  ? 9.982   -52.551  36.695  1.00 105.64 ? 444  PHE A CA    1 
ATOM   4108  C  C     . PHE D 4  444  ? 10.238  -52.060  38.088  1.00 105.61 ? 444  PHE A C     1 
ATOM   4109  O  O     . PHE D 4  444  ? 10.142  -52.823  39.052  1.00 106.33 ? 444  PHE A O     1 
ATOM   4110  C  CB    . PHE D 4  444  ? 8.664   -53.274  36.657  1.00 106.22 ? 444  PHE A CB    1 
ATOM   4111  C  CG    . PHE D 4  444  ? 7.456   -52.370  36.655  1.00 108.52 ? 444  PHE A CG    1 
ATOM   4112  C  CD1   . PHE D 4  444  ? 7.355   -51.321  35.757  1.00 109.81 ? 444  PHE A CD1   1 
ATOM   4113  C  CD2   . PHE D 4  444  ? 6.362   -52.638  37.507  1.00 109.38 ? 444  PHE A CD2   1 
ATOM   4114  C  CE1   . PHE D 4  444  ? 6.204   -50.515  35.755  1.00 110.74 ? 444  PHE A CE1   1 
ATOM   4115  C  CE2   . PHE D 4  444  ? 5.210   -51.849  37.501  1.00 108.61 ? 444  PHE A CE2   1 
ATOM   4116  C  CZ    . PHE D 4  444  ? 5.129   -50.783  36.638  1.00 109.00 ? 444  PHE A CZ    1 
ATOM   4117  N  N     . ASN D 4  445  ? 10.558  -50.773  38.169  1.00 105.17 ? 445  ASN A N     1 
ATOM   4118  C  CA    . ASN D 4  445  ? 11.047  -50.068  39.357  1.00 104.18 ? 445  ASN A CA    1 
ATOM   4119  C  C     . ASN D 4  445  ? 9.974   -49.079  39.873  1.00 104.01 ? 445  ASN A C     1 
ATOM   4120  O  O     . ASN D 4  445  ? 8.980   -48.745  39.179  1.00 103.76 ? 445  ASN A O     1 
ATOM   4121  C  CB    . ASN D 4  445  ? 12.352  -49.343  38.932  1.00 103.80 ? 445  ASN A CB    1 
ATOM   4122  C  CG    . ASN D 4  445  ? 13.023  -48.561  40.059  1.00 103.57 ? 445  ASN A CG    1 
ATOM   4123  O  OD1   . ASN D 4  445  ? 13.289  -47.358  39.929  1.00 100.56 ? 445  ASN A OD1   1 
ATOM   4124  N  ND2   . ASN D 4  445  ? 13.335  -49.248  41.158  1.00 104.39 ? 445  ASN A ND2   1 
ATOM   4125  N  N     . ARG D 4  446  ? 10.163  -48.608  41.085  1.00 103.73 ? 446  ARG A N     1 
ATOM   4126  C  CA    . ARG D 4  446  ? 9.337   -47.541  41.567  1.00 104.75 ? 446  ARG A CA    1 
ATOM   4127  C  C     . ARG D 4  446  ? 10.155  -46.882  42.631  1.00 105.95 ? 446  ARG A C     1 
ATOM   4128  O  O     . ARG D 4  446  ? 10.703  -47.592  43.484  1.00 106.13 ? 446  ARG A O     1 
ATOM   4129  C  CB    . ARG D 4  446  ? 8.047   -48.132  42.183  1.00 105.25 ? 446  ARG A CB    1 
ATOM   4130  C  CG    . ARG D 4  446  ? 6.880   -47.155  42.513  1.00 102.58 ? 446  ARG A CG    1 
ATOM   4131  C  CD    . ARG D 4  446  ? 6.991   -46.668  43.911  1.00 99.41  ? 446  ARG A CD    1 
ATOM   4132  N  NE    . ARG D 4  446  ? 5.774   -45.970  44.227  1.00 103.53 ? 446  ARG A NE    1 
ATOM   4133  C  CZ    . ARG D 4  446  ? 5.561   -45.234  45.324  1.00 107.11 ? 446  ARG A CZ    1 
ATOM   4134  N  NH1   . ARG D 4  446  ? 6.525   -45.099  46.225  1.00 110.71 ? 446  ARG A NH1   1 
ATOM   4135  N  NH2   . ARG D 4  446  ? 4.386   -44.609  45.522  1.00 104.83 ? 446  ARG A NH2   1 
ATOM   4136  N  N     . GLN D 4  447  ? 10.270  -45.553  42.605  1.00 107.12 ? 447  GLN A N     1 
ATOM   4137  C  CA    . GLN D 4  447  ? 10.905  -44.874  43.750  1.00 109.24 ? 447  GLN A CA    1 
ATOM   4138  C  C     . GLN D 4  447  ? 9.949   -44.422  44.868  1.00 110.59 ? 447  GLN A C     1 
ATOM   4139  O  O     . GLN D 4  447  ? 8.715   -44.255  44.646  1.00 110.56 ? 447  GLN A O     1 
ATOM   4140  C  CB    . GLN D 4  447  ? 11.811  -43.715  43.379  1.00 108.78 ? 447  GLN A CB    1 
ATOM   4141  C  CG    . GLN D 4  447  ? 12.801  -44.072  42.414  1.00 111.70 ? 447  GLN A CG    1 
ATOM   4142  C  CD    . GLN D 4  447  ? 12.333  -43.769  41.016  1.00 116.62 ? 447  GLN A CD    1 
ATOM   4143  O  OE1   . GLN D 4  447  ? 11.355  -43.033  40.801  1.00 117.71 ? 447  GLN A OE1   1 
ATOM   4144  N  NE2   . GLN D 4  447  ? 13.037  -44.330  40.039  1.00 119.88 ? 447  GLN A NE2   1 
ATOM   4145  N  N     . PRO D 4  448  ? 10.532  -44.230  46.078  1.00 111.66 ? 448  PRO A N     1 
ATOM   4146  C  CA    . PRO D 4  448  ? 12.001  -44.357  46.222  1.00 112.55 ? 448  PRO A CA    1 
ATOM   4147  C  C     . PRO D 4  448  ? 12.421  -45.840  46.334  1.00 113.88 ? 448  PRO A C     1 
ATOM   4148  O  O     . PRO D 4  448  ? 11.779  -46.625  47.032  1.00 114.41 ? 448  PRO A O     1 
ATOM   4149  C  CB    . PRO D 4  448  ? 12.291  -43.587  47.495  1.00 112.37 ? 448  PRO A CB    1 
ATOM   4150  C  CG    . PRO D 4  448  ? 10.971  -43.641  48.277  1.00 112.16 ? 448  PRO A CG    1 
ATOM   4151  C  CD    . PRO D 4  448  ? 9.851   -43.989  47.363  1.00 111.15 ? 448  PRO A CD    1 
ATOM   4152  N  N     . SER D 4  449  ? 13.458  -46.244  45.619  1.00 115.05 ? 449  SER A N     1 
ATOM   4153  C  CA    . SER D 4  449  ? 13.738  -47.675  45.494  1.00 115.71 ? 449  SER A CA    1 
ATOM   4154  C  C     . SER D 4  449  ? 14.602  -48.192  46.653  1.00 116.02 ? 449  SER A C     1 
ATOM   4155  O  O     . SER D 4  449  ? 15.772  -48.503  46.466  1.00 116.26 ? 449  SER A O     1 
ATOM   4156  C  CB    . SER D 4  449  ? 14.411  -47.950  44.135  1.00 116.25 ? 449  SER A CB    1 
ATOM   4157  O  OG    . SER D 4  449  ? 15.473  -47.033  43.879  1.00 115.48 ? 449  SER A OG    1 
ATOM   4158  N  N     . LEU D 4  450  ? 14.023  -48.295  47.843  1.00 116.23 ? 450  LEU A N     1 
ATOM   4159  C  CA    . LEU D 4  450  ? 14.766  -48.658  49.072  1.00 116.61 ? 450  LEU A CA    1 
ATOM   4160  C  C     . LEU D 4  450  ? 14.864  -50.185  49.405  1.00 117.54 ? 450  LEU A C     1 
ATOM   4161  O  O     . LEU D 4  450  ? 14.890  -50.549  50.581  1.00 118.23 ? 450  LEU A O     1 
ATOM   4162  C  CB    . LEU D 4  450  ? 14.164  -47.878  50.257  1.00 116.10 ? 450  LEU A CB    1 
ATOM   4163  C  CG    . LEU D 4  450  ? 12.635  -47.625  50.167  1.00 116.17 ? 450  LEU A CG    1 
ATOM   4164  C  CD1   . LEU D 4  450  ? 11.863  -48.950  50.001  1.00 117.02 ? 450  LEU A CD1   1 
ATOM   4165  C  CD2   . LEU D 4  450  ? 11.985  -46.769  51.294  1.00 114.86 ? 450  LEU A CD2   1 
ATOM   4166  N  N     . HIS D 4  451  ? 14.968  -51.048  48.378  1.00 118.06 ? 451  HIS A N     1 
ATOM   4167  C  CA    . HIS D 4  451  ? 14.643  -52.506  48.435  1.00 117.80 ? 451  HIS A CA    1 
ATOM   4168  C  C     . HIS D 4  451  ? 15.169  -53.265  47.219  1.00 118.10 ? 451  HIS A C     1 
ATOM   4169  O  O     . HIS D 4  451  ? 15.239  -52.710  46.098  1.00 117.57 ? 451  HIS A O     1 
ATOM   4170  C  CB    . HIS D 4  451  ? 13.146  -52.679  48.272  1.00 117.97 ? 451  HIS A CB    1 
ATOM   4171  C  CG    . HIS D 4  451  ? 12.436  -53.083  49.499  1.00 119.16 ? 451  HIS A CG    1 
ATOM   4172  N  ND1   . HIS D 4  451  ? 11.144  -52.687  49.757  1.00 122.30 ? 451  HIS A ND1   1 
ATOM   4173  C  CD2   . HIS D 4  451  ? 12.813  -53.853  50.541  1.00 121.91 ? 451  HIS A CD2   1 
ATOM   4174  C  CE1   . HIS D 4  451  ? 10.744  -53.207  50.904  1.00 123.09 ? 451  HIS A CE1   1 
ATOM   4175  N  NE2   . HIS D 4  451  ? 11.743  -53.911  51.406  1.00 123.45 ? 451  HIS A NE2   1 
ATOM   4176  N  N     . LYS D 4  452  ? 15.448  -54.559  47.385  1.00 118.18 ? 452  LYS A N     1 
ATOM   4177  C  CA    . LYS D 4  452  ? 15.602  -55.393  46.180  1.00 117.93 ? 452  LYS A CA    1 
ATOM   4178  C  C     . LYS D 4  452  ? 14.224  -55.590  45.580  1.00 117.05 ? 452  LYS A C     1 
ATOM   4179  O  O     . LYS D 4  452  ? 14.096  -55.650  44.374  1.00 115.91 ? 452  LYS A O     1 
ATOM   4180  C  CB    . LYS D 4  452  ? 16.375  -56.716  46.393  1.00 118.27 ? 452  LYS A CB    1 
ATOM   4181  C  CG    . LYS D 4  452  ? 16.034  -57.487  47.667  1.00 119.94 ? 452  LYS A CG    1 
ATOM   4182  C  CD    . LYS D 4  452  ? 15.758  -58.992  47.417  1.00 121.09 ? 452  LYS A CD    1 
ATOM   4183  C  CE    . LYS D 4  452  ? 16.973  -59.768  46.939  1.00 120.59 ? 452  LYS A CE    1 
ATOM   4184  N  NZ    . LYS D 4  452  ? 18.163  -59.529  47.810  1.00 121.19 ? 452  LYS A NZ    1 
ATOM   4185  N  N     . MET D 4  453  ? 13.192  -55.624  46.430  1.00 117.17 ? 453  MET A N     1 
ATOM   4186  C  CA    . MET D 4  453  ? 11.795  -55.682  45.939  1.00 117.36 ? 453  MET A CA    1 
ATOM   4187  C  C     . MET D 4  453  ? 11.118  -54.373  45.518  1.00 116.49 ? 453  MET A C     1 
ATOM   4188  O  O     . MET D 4  453  ? 9.915   -54.353  45.349  1.00 116.25 ? 453  MET A O     1 
ATOM   4189  C  CB    . MET D 4  453  ? 10.852  -56.412  46.889  1.00 117.83 ? 453  MET A CB    1 
ATOM   4190  C  CG    . MET D 4  453  ? 11.281  -57.788  47.279  1.00 120.30 ? 453  MET A CG    1 
ATOM   4191  S  SD    . MET D 4  453  ? 12.168  -57.486  48.782  1.00 126.48 ? 453  MET A SD    1 
ATOM   4192  C  CE    . MET D 4  453  ? 10.816  -57.101  49.938  1.00 122.16 ? 453  MET A CE    1 
ATOM   4193  N  N     . SER D 4  454  ? 11.861  -53.294  45.333  1.00 115.64 ? 454  SER A N     1 
ATOM   4194  C  CA    . SER D 4  454  ? 11.305  -52.185  44.597  1.00 114.84 ? 454  SER A CA    1 
ATOM   4195  C  C     . SER D 4  454  ? 11.687  -52.369  43.131  1.00 113.84 ? 454  SER A C     1 
ATOM   4196  O  O     . SER D 4  454  ? 11.229  -51.647  42.246  1.00 113.72 ? 454  SER A O     1 
ATOM   4197  C  CB    . SER D 4  454  ? 11.769  -50.853  45.185  1.00 115.38 ? 454  SER A CB    1 
ATOM   4198  O  OG    . SER D 4  454  ? 10.996  -50.553  46.345  1.00 116.84 ? 454  SER A OG    1 
ATOM   4199  N  N     . MET D 4  455  ? 12.519  -53.371  42.890  1.00 112.82 ? 455  MET A N     1 
ATOM   4200  C  CA    . MET D 4  455  ? 12.869  -53.788  41.545  1.00 111.89 ? 455  MET A CA    1 
ATOM   4201  C  C     . MET D 4  455  ? 12.401  -55.196  41.291  1.00 111.25 ? 455  MET A C     1 
ATOM   4202  O  O     . MET D 4  455  ? 12.334  -56.006  42.209  1.00 111.13 ? 455  MET A O     1 
ATOM   4203  C  CB    . MET D 4  455  ? 14.369  -53.812  41.404  1.00 112.03 ? 455  MET A CB    1 
ATOM   4204  C  CG    . MET D 4  455  ? 14.836  -53.174  40.197  1.00 111.04 ? 455  MET A CG    1 
ATOM   4205  S  SD    . MET D 4  455  ? 15.089  -51.523  40.735  1.00 111.62 ? 455  MET A SD    1 
ATOM   4206  C  CE    . MET D 4  455  ? 16.214  -50.955  39.412  1.00 112.69 ? 455  MET A CE    1 
ATOM   4207  N  N     . MET D 4  456  ? 12.147  -55.524  40.037  1.00 110.52 ? 456  MET A N     1 
ATOM   4208  C  CA    . MET D 4  456  ? 11.614  -56.834  39.735  1.00 110.03 ? 456  MET A CA    1 
ATOM   4209  C  C     . MET D 4  456  ? 11.561  -57.054  38.254  1.00 110.10 ? 456  MET A C     1 
ATOM   4210  O  O     . MET D 4  456  ? 11.326  -56.090  37.527  1.00 111.27 ? 456  MET A O     1 
ATOM   4211  C  CB    . MET D 4  456  ? 10.191  -56.928  40.288  1.00 110.10 ? 456  MET A CB    1 
ATOM   4212  C  CG    . MET D 4  456  ? 10.143  -57.645  41.610  1.00 110.31 ? 456  MET A CG    1 
ATOM   4213  S  SD    . MET D 4  456  ? 8.907   -57.110  42.781  1.00 108.52 ? 456  MET A SD    1 
ATOM   4214  C  CE    . MET D 4  456  ? 9.542   -58.011  44.177  1.00 109.55 ? 456  MET A CE    1 
ATOM   4215  N  N     . ALA D 4  457  ? 11.765  -58.291  37.791  1.00 109.05 ? 457  ALA A N     1 
ATOM   4216  C  CA    . ALA D 4  457  ? 11.264  -58.636  36.469  1.00 108.11 ? 457  ALA A CA    1 
ATOM   4217  C  C     . ALA D 4  457  ? 9.729   -58.764  36.500  1.00 107.78 ? 457  ALA A C     1 
ATOM   4218  O  O     . ALA D 4  457  ? 9.130   -59.382  37.383  1.00 107.39 ? 457  ALA A O     1 
ATOM   4219  C  CB    . ALA D 4  457  ? 11.905  -59.872  35.922  1.00 107.86 ? 457  ALA A CB    1 
ATOM   4220  N  N     . HIS D 4  458  ? 9.102   -58.102  35.549  1.00 107.50 ? 458  HIS A N     1 
ATOM   4221  C  CA    . HIS D 4  458  ? 7.754   -58.438  35.143  1.00 107.12 ? 458  HIS A CA    1 
ATOM   4222  C  C     . HIS D 4  458  ? 7.743   -58.966  33.692  1.00 106.93 ? 458  HIS A C     1 
ATOM   4223  O  O     . HIS D 4  458  ? 8.737   -58.804  32.898  1.00 107.24 ? 458  HIS A O     1 
ATOM   4224  C  CB    . HIS D 4  458  ? 6.838   -57.241  35.281  1.00 106.58 ? 458  HIS A CB    1 
ATOM   4225  C  CG    . HIS D 4  458  ? 6.534   -56.890  36.699  1.00 107.06 ? 458  HIS A CG    1 
ATOM   4226  N  ND1   . HIS D 4  458  ? 5.266   -56.983  37.235  1.00 106.15 ? 458  HIS A ND1   1 
ATOM   4227  C  CD2   . HIS D 4  458  ? 7.331   -56.441  37.696  1.00 107.75 ? 458  HIS A CD2   1 
ATOM   4228  C  CE1   . HIS D 4  458  ? 5.288   -56.590  38.495  1.00 105.61 ? 458  HIS A CE1   1 
ATOM   4229  N  NE2   . HIS D 4  458  ? 6.527   -56.250  38.798  1.00 107.72 ? 458  HIS A NE2   1 
ATOM   4230  N  N     . ARG D 4  459  ? 6.633   -59.627  33.367  1.00 105.31 ? 459  ARG A N     1 
ATOM   4231  C  CA    . ARG D 4  459  ? 6.418   -60.117  32.043  1.00 104.12 ? 459  ARG A CA    1 
ATOM   4232  C  C     . ARG D 4  459  ? 5.637   -59.014  31.378  1.00 103.41 ? 459  ARG A C     1 
ATOM   4233  O  O     . ARG D 4  459  ? 4.907   -58.291  32.064  1.00 103.01 ? 459  ARG A O     1 
ATOM   4234  C  CB    . ARG D 4  459  ? 5.640   -61.422  32.109  1.00 104.45 ? 459  ARG A CB    1 
ATOM   4235  C  CG    . ARG D 4  459  ? 6.496   -62.671  32.437  1.00 104.90 ? 459  ARG A CG    1 
ATOM   4236  C  CD    . ARG D 4  459  ? 5.655   -63.876  32.889  1.00 104.48 ? 459  ARG A CD    1 
ATOM   4237  N  NE    . ARG D 4  459  ? 4.571   -64.150  31.948  1.00 104.90 ? 459  ARG A NE    1 
ATOM   4238  C  CZ    . ARG D 4  459  ? 3.270   -64.125  32.227  1.00 103.76 ? 459  ARG A CZ    1 
ATOM   4239  N  NH1   . ARG D 4  459  ? 2.823   -63.888  33.454  1.00 103.22 ? 459  ARG A NH1   1 
ATOM   4240  N  NH2   . ARG D 4  459  ? 2.409   -64.372  31.256  1.00 104.01 ? 459  ARG A NH2   1 
ATOM   4241  N  N     . VAL D 4  460  ? 5.831   -58.847  30.065  1.00 102.79 ? 460  VAL A N     1 
ATOM   4242  C  CA    . VAL D 4  460  ? 5.267   -57.711  29.309  1.00 101.71 ? 460  VAL A CA    1 
ATOM   4243  C  C     . VAL D 4  460  ? 3.966   -58.080  28.646  1.00 102.04 ? 460  VAL A C     1 
ATOM   4244  O  O     . VAL D 4  460  ? 3.878   -59.022  27.836  1.00 102.02 ? 460  VAL A O     1 
ATOM   4245  C  CB    . VAL D 4  460  ? 6.231   -57.172  28.205  1.00 101.43 ? 460  VAL A CB    1 
ATOM   4246  C  CG1   . VAL D 4  460  ? 5.712   -55.884  27.660  1.00 100.38 ? 460  VAL A CG1   1 
ATOM   4247  C  CG2   . VAL D 4  460  ? 7.611   -56.966  28.724  1.00 98.74  ? 460  VAL A CG2   1 
ATOM   4248  N  N     . LYS D 4  461  ? 2.941   -57.332  28.989  1.00 102.24 ? 461  LYS A N     1 
ATOM   4249  C  CA    . LYS D 4  461  ? 1.658   -57.528  28.318  1.00 102.91 ? 461  LYS A CA    1 
ATOM   4250  C  C     . LYS D 4  461  ? 1.237   -56.203  27.627  1.00 102.47 ? 461  LYS A C     1 
ATOM   4251  O  O     . LYS D 4  461  ? 0.855   -55.241  28.295  1.00 103.30 ? 461  LYS A O     1 
ATOM   4252  C  CB    . LYS D 4  461  ? 0.627   -58.110  29.318  1.00 102.66 ? 461  LYS A CB    1 
ATOM   4253  C  CG    . LYS D 4  461  ? -0.847  -58.165  28.862  1.00 104.58 ? 461  LYS A CG    1 
ATOM   4254  C  CD    . LYS D 4  461  ? -1.039  -58.850  27.516  1.00 107.89 ? 461  LYS A CD    1 
ATOM   4255  C  CE    . LYS D 4  461  ? -2.289  -59.756  27.474  1.00 110.20 ? 461  LYS A CE    1 
ATOM   4256  N  NZ    . LYS D 4  461  ? -2.639  -60.103  26.041  1.00 109.72 ? 461  LYS A NZ    1 
ATOM   4257  N  N     . VAL D 4  462  ? 1.379   -56.125  26.306  1.00 101.69 ? 462  VAL A N     1 
ATOM   4258  C  CA    . VAL D 4  462  ? 1.168   -54.848  25.595  1.00 100.65 ? 462  VAL A CA    1 
ATOM   4259  C  C     . VAL D 4  462  ? -0.311  -54.521  25.654  1.00 100.21 ? 462  VAL A C     1 
ATOM   4260  O  O     . VAL D 4  462  ? -1.132  -55.409  25.474  1.00 100.69 ? 462  VAL A O     1 
ATOM   4261  C  CB    . VAL D 4  462  ? 1.668   -54.873  24.109  1.00 100.42 ? 462  VAL A CB    1 
ATOM   4262  C  CG1   . VAL D 4  462  ? 1.406   -53.545  23.479  1.00 100.02 ? 462  VAL A CG1   1 
ATOM   4263  C  CG2   . VAL D 4  462  ? 3.159   -55.163  24.033  1.00 99.45  ? 462  VAL A CG2   1 
ATOM   4264  N  N     . ILE D 4  463  ? -0.663  -53.272  25.928  1.00 99.51  ? 463  ILE A N     1 
ATOM   4265  C  CA    . ILE D 4  463  ? -2.074  -52.930  26.056  1.00 99.38  ? 463  ILE A CA    1 
ATOM   4266  C  C     . ILE D 4  463  ? -2.451  -51.581  25.409  1.00 99.93  ? 463  ILE A C     1 
ATOM   4267  O  O     . ILE D 4  463  ? -1.549  -50.794  24.987  1.00 100.48 ? 463  ILE A O     1 
ATOM   4268  C  CB    . ILE D 4  463  ? -2.579  -52.990  27.551  1.00 99.08  ? 463  ILE A CB    1 
ATOM   4269  C  CG1   . ILE D 4  463  ? -1.519  -52.574  28.555  1.00 98.68  ? 463  ILE A CG1   1 
ATOM   4270  C  CG2   . ILE D 4  463  ? -3.048  -54.369  27.942  1.00 99.50  ? 463  ILE A CG2   1 
ATOM   4271  C  CD1   . ILE D 4  463  ? -1.431  -51.078  28.730  1.00 101.32 ? 463  ILE A CD1   1 
ATOM   4272  N  N     . PRO D 4  464  ? -3.785  -51.312  25.303  1.00 99.62  ? 464  PRO A N     1 
ATOM   4273  C  CA    . PRO D 4  464  ? -4.319  -49.959  25.017  1.00 99.23  ? 464  PRO A CA    1 
ATOM   4274  C  C     . PRO D 4  464  ? -4.048  -48.994  26.171  1.00 98.32  ? 464  PRO A C     1 
ATOM   4275  O  O     . PRO D 4  464  ? -3.746  -49.455  27.275  1.00 98.42  ? 464  PRO A O     1 
ATOM   4276  C  CB    . PRO D 4  464  ? -5.830  -50.202  24.883  1.00 99.15  ? 464  PRO A CB    1 
ATOM   4277  C  CG    . PRO D 4  464  ? -6.054  -51.434  25.667  1.00 98.55  ? 464  PRO A CG    1 
ATOM   4278  C  CD    . PRO D 4  464  ? -4.878  -52.290  25.408  1.00 99.21  ? 464  PRO A CD    1 
ATOM   4279  N  N     . TYR D 4  465  ? -4.144  -47.694  25.928  1.00 97.28  ? 465  TYR A N     1 
ATOM   4280  C  CA    . TYR D 4  465  ? -4.034  -46.725  27.009  1.00 96.55  ? 465  TYR A CA    1 
ATOM   4281  C  C     . TYR D 4  465  ? -2.579  -46.400  27.334  1.00 93.95  ? 465  TYR A C     1 
ATOM   4282  O  O     . TYR D 4  465  ? -1.742  -47.291  27.482  1.00 93.44  ? 465  TYR A O     1 
ATOM   4283  C  CB    . TYR D 4  465  ? -4.751  -47.236  28.260  1.00 99.13  ? 465  TYR A CB    1 
ATOM   4284  C  CG    . TYR D 4  465  ? -6.208  -47.572  28.037  1.00 100.76 ? 465  TYR A CG    1 
ATOM   4285  C  CD1   . TYR D 4  465  ? -6.746  -48.763  28.507  1.00 103.98 ? 465  TYR A CD1   1 
ATOM   4286  C  CD2   . TYR D 4  465  ? -7.046  -46.699  27.356  1.00 104.22 ? 465  TYR A CD2   1 
ATOM   4287  C  CE1   . TYR D 4  465  ? -8.077  -49.075  28.305  1.00 107.11 ? 465  TYR A CE1   1 
ATOM   4288  C  CE2   . TYR D 4  465  ? -8.379  -47.002  27.150  1.00 106.78 ? 465  TYR A CE2   1 
ATOM   4289  C  CZ    . TYR D 4  465  ? -8.889  -48.191  27.626  1.00 106.79 ? 465  TYR A CZ    1 
ATOM   4290  O  OH    . TYR D 4  465  ? -10.215 -48.497  27.423  1.00 105.40 ? 465  TYR A OH    1 
ATOM   4291  N  N     . SER D 4  466  ? -2.300  -45.108  27.441  1.00 90.52  ? 466  SER A N     1 
ATOM   4292  C  CA    . SER D 4  466  ? -0.999  -44.594  27.840  1.00 88.30  ? 466  SER A CA    1 
ATOM   4293  C  C     . SER D 4  466  ? -0.401  -44.923  29.261  1.00 86.67  ? 466  SER A C     1 
ATOM   4294  O  O     . SER D 4  466  ? 0.356   -44.141  29.830  1.00 83.80  ? 466  SER A O     1 
ATOM   4295  C  CB    . SER D 4  466  ? -1.055  -43.093  27.558  1.00 87.93  ? 466  SER A CB    1 
ATOM   4296  O  OG    . SER D 4  466  ? -2.057  -42.831  26.548  1.00 88.14  ? 466  SER A OG    1 
ATOM   4297  N  N     . THR D 4  467  ? -0.746  -46.099  29.780  1.00 87.00  ? 467  THR A N     1 
ATOM   4298  C  CA    . THR D 4  467  ? -0.560  -46.403  31.197  1.00 89.31  ? 467  THR A CA    1 
ATOM   4299  C  C     . THR D 4  467  ? 0.082   -47.772  31.432  1.00 93.24  ? 467  THR A C     1 
ATOM   4300  O  O     . THR D 4  467  ? -0.072  -48.689  30.626  1.00 94.34  ? 467  THR A O     1 
ATOM   4301  C  CB    . THR D 4  467  ? -1.891  -46.331  31.969  1.00 87.56  ? 467  THR A CB    1 
ATOM   4302  O  OG1   . THR D 4  467  ? -2.462  -47.642  32.065  1.00 83.01  ? 467  THR A OG1   1 
ATOM   4303  C  CG2   . THR D 4  467  ? -2.870  -45.408  31.260  1.00 84.63  ? 467  THR A CG2   1 
ATOM   4304  N  N     . PHE D 4  468  ? 0.802   -47.893  32.544  1.00 96.82  ? 468  PHE A N     1 
ATOM   4305  C  CA    . PHE D 4  468  ? 1.262   -49.199  33.065  1.00 98.99  ? 468  PHE A CA    1 
ATOM   4306  C  C     . PHE D 4  468  ? 0.224   -49.802  34.032  1.00 100.32 ? 468  PHE A C     1 
ATOM   4307  O  O     . PHE D 4  468  ? -0.187  -49.168  35.025  1.00 100.98 ? 468  PHE A O     1 
ATOM   4308  C  CB    . PHE D 4  468  ? 2.543   -49.027  33.868  1.00 98.70  ? 468  PHE A CB    1 
ATOM   4309  C  CG    . PHE D 4  468  ? 3.715   -48.701  33.071  1.00 99.11  ? 468  PHE A CG    1 
ATOM   4310  C  CD1   . PHE D 4  468  ? 4.528   -47.649  33.440  1.00 102.08 ? 468  PHE A CD1   1 
ATOM   4311  C  CD2   . PHE D 4  468  ? 4.062   -49.450  31.978  1.00 99.71  ? 468  PHE A CD2   1 
ATOM   4312  C  CE1   . PHE D 4  468  ? 5.726   -47.337  32.711  1.00 102.19 ? 468  PHE A CE1   1 
ATOM   4313  C  CE2   . PHE D 4  468  ? 5.258   -49.164  31.254  1.00 101.58 ? 468  PHE A CE2   1 
ATOM   4314  C  CZ    . PHE D 4  468  ? 6.085   -48.111  31.620  1.00 100.35 ? 468  PHE A CZ    1 
ATOM   4315  N  N     . ARG D 4  469  ? -0.172  -51.037  33.759  1.00 101.39 ? 469  ARG A N     1 
ATOM   4316  C  CA    . ARG D 4  469  ? -1.045  -51.762  34.667  1.00 102.12 ? 469  ARG A CA    1 
ATOM   4317  C  C     . ARG D 4  469  ? -0.174  -52.778  35.417  1.00 102.92 ? 469  ARG A C     1 
ATOM   4318  O  O     . ARG D 4  469  ? 0.911   -53.190  34.901  1.00 104.01 ? 469  ARG A O     1 
ATOM   4319  C  CB    . ARG D 4  469  ? -2.187  -52.407  33.872  1.00 101.59 ? 469  ARG A CB    1 
ATOM   4320  C  CG    . ARG D 4  469  ? -2.405  -51.722  32.512  1.00 101.39 ? 469  ARG A CG    1 
ATOM   4321  C  CD    . ARG D 4  469  ? -3.804  -51.818  31.972  1.00 99.10  ? 469  ARG A CD    1 
ATOM   4322  N  NE    . ARG D 4  469  ? -4.533  -50.622  32.303  1.00 100.65 ? 469  ARG A NE    1 
ATOM   4323  C  CZ    . ARG D 4  469  ? -5.308  -50.505  33.385  1.00 104.36 ? 469  ARG A CZ    1 
ATOM   4324  N  NH1   . ARG D 4  469  ? -5.466  -51.533  34.222  1.00 104.30 ? 469  ARG A NH1   1 
ATOM   4325  N  NH2   . ARG D 4  469  ? -5.968  -49.362  33.623  1.00 106.89 ? 469  ARG A NH2   1 
ATOM   4326  N  N     . LEU D 4  470  ? -0.590  -53.129  36.636  1.00 102.80 ? 470  LEU A N     1 
ATOM   4327  C  CA    . LEU D 4  470  ? 0.048   -54.227  37.364  1.00 103.03 ? 470  LEU A CA    1 
ATOM   4328  C  C     . LEU D 4  470  ? -0.935  -54.861  38.296  1.00 104.03 ? 470  LEU A C     1 
ATOM   4329  O  O     . LEU D 4  470  ? -1.967  -54.231  38.644  1.00 104.39 ? 470  LEU A O     1 
ATOM   4330  C  CB    . LEU D 4  470  ? 1.287   -53.777  38.125  1.00 102.30 ? 470  LEU A CB    1 
ATOM   4331  C  CG    . LEU D 4  470  ? 1.319   -52.440  38.865  1.00 102.16 ? 470  LEU A CG    1 
ATOM   4332  C  CD1   . LEU D 4  470  ? 0.773   -52.486  40.352  1.00 99.82  ? 470  LEU A CD1   1 
ATOM   4333  C  CD2   . LEU D 4  470  ? 2.742   -51.849  38.770  1.00 97.86  ? 470  LEU A CD2   1 
ATOM   4334  N  N     . ASN D 4  471  ? -0.628  -56.101  38.697  1.00 104.79 ? 471  ASN A N     1 
ATOM   4335  C  CA    . ASN D 4  471  ? -1.569  -56.902  39.527  1.00 105.65 ? 471  ASN A CA    1 
ATOM   4336  C  C     . ASN D 4  471  ? -1.714  -56.196  40.844  1.00 105.62 ? 471  ASN A C     1 
ATOM   4337  O  O     . ASN D 4  471  ? -0.722  -55.747  41.346  1.00 106.79 ? 471  ASN A O     1 
ATOM   4338  C  CB    . ASN D 4  471  ? -0.989  -58.330  39.718  1.00 105.74 ? 471  ASN A CB    1 
ATOM   4339  C  CG    . ASN D 4  471  ? -1.956  -59.291  40.459  1.00 104.41 ? 471  ASN A CG    1 
ATOM   4340  O  OD1   . ASN D 4  471  ? -2.020  -59.243  41.677  1.00 104.77 ? 471  ASN A OD1   1 
ATOM   4341  N  ND2   . ASN D 4  471  ? -2.665  -60.178  39.727  1.00 99.04  ? 471  ASN A ND2   1 
ATOM   4342  N  N     . LEU D 4  472  ? -2.877  -56.059  41.436  1.00 105.71 ? 472  LEU A N     1 
ATOM   4343  C  CA    . LEU D 4  472  ? -2.859  -55.380  42.772  1.00 107.31 ? 472  LEU A CA    1 
ATOM   4344  C  C     . LEU D 4  472  ? -1.788  -55.909  43.768  1.00 108.04 ? 472  LEU A C     1 
ATOM   4345  O  O     . LEU D 4  472  ? -1.258  -55.140  44.567  1.00 108.36 ? 472  LEU A O     1 
ATOM   4346  C  CB    . LEU D 4  472  ? -4.222  -55.411  43.509  1.00 107.40 ? 472  LEU A CB    1 
ATOM   4347  C  CG    . LEU D 4  472  ? -5.513  -55.231  42.707  1.00 107.44 ? 472  LEU A CG    1 
ATOM   4348  C  CD1   . LEU D 4  472  ? -6.513  -56.491  42.812  1.00 104.31 ? 472  LEU A CD1   1 
ATOM   4349  C  CD2   . LEU D 4  472  ? -6.082  -53.829  43.003  1.00 104.24 ? 472  LEU A CD2   1 
ATOM   4350  N  N     . SER D 4  473  ? -1.482  -57.206  43.728  1.00 108.66 ? 473  SER A N     1 
ATOM   4351  C  CA    . SER D 4  473  ? -0.688  -57.850  44.780  1.00 109.59 ? 473  SER A CA    1 
ATOM   4352  C  C     . SER D 4  473  ? 0.837   -57.706  44.583  1.00 110.02 ? 473  SER A C     1 
ATOM   4353  O  O     . SER D 4  473  ? 1.668   -58.393  45.196  1.00 110.48 ? 473  SER A O     1 
ATOM   4354  C  CB    . SER D 4  473  ? -1.111  -59.320  44.939  1.00 109.79 ? 473  SER A CB    1 
ATOM   4355  O  OG    . SER D 4  473  ? -2.212  -59.454  45.839  1.00 111.25 ? 473  SER A OG    1 
ATOM   4356  N  N     . VAL D 4  474  ? 1.211   -56.784  43.726  1.00 110.31 ? 474  VAL A N     1 
ATOM   4357  C  CA    . VAL D 4  474  ? 2.594   -56.432  43.582  1.00 110.44 ? 474  VAL A CA    1 
ATOM   4358  C  C     . VAL D 4  474  ? 2.623   -54.984  44.072  1.00 111.07 ? 474  VAL A C     1 
ATOM   4359  O  O     . VAL D 4  474  ? 3.609   -54.273  43.902  1.00 111.68 ? 474  VAL A O     1 
ATOM   4360  C  CB    . VAL D 4  474  ? 3.050   -56.678  42.121  1.00 110.01 ? 474  VAL A CB    1 
ATOM   4361  C  CG1   . VAL D 4  474  ? 2.459   -55.675  41.169  1.00 109.91 ? 474  VAL A CG1   1 
ATOM   4362  C  CG2   . VAL D 4  474  ? 4.517   -56.735  42.025  1.00 109.85 ? 474  VAL A CG2   1 
ATOM   4363  N  N     . THR D 4  475  ? 1.511   -54.588  44.704  1.00 111.25 ? 475  THR A N     1 
ATOM   4364  C  CA    . THR D 4  475  ? 1.339   -53.297  45.353  1.00 111.45 ? 475  THR A CA    1 
ATOM   4365  C  C     . THR D 4  475  ? 2.232   -53.195  46.582  1.00 112.32 ? 475  THR A C     1 
ATOM   4366  O  O     . THR D 4  475  ? 3.049   -52.298  46.643  1.00 113.00 ? 475  THR A O     1 
ATOM   4367  C  CB    . THR D 4  475  ? -0.150  -53.032  45.752  1.00 111.22 ? 475  THR A CB    1 
ATOM   4368  O  OG1   . THR D 4  475  ? -0.589  -51.780  45.220  1.00 109.83 ? 475  THR A OG1   1 
ATOM   4369  C  CG2   . THR D 4  475  ? -0.366  -53.055  47.286  1.00 110.89 ? 475  THR A CG2   1 
ATOM   4370  N  N     . SER D 4  476  ? 2.103   -54.115  47.539  1.00 113.00 ? 476  SER A N     1 
ATOM   4371  C  CA    . SER D 4  476  ? 2.852   -54.044  48.806  1.00 113.91 ? 476  SER A CA    1 
ATOM   4372  C  C     . SER D 4  476  ? 4.343   -53.745  48.680  1.00 113.52 ? 476  SER A C     1 
ATOM   4373  O  O     . SER D 4  476  ? 4.767   -52.705  49.184  1.00 114.01 ? 476  SER A O     1 
ATOM   4374  C  CB    . SER D 4  476  ? 2.659   -55.298  49.667  1.00 114.52 ? 476  SER A CB    1 
ATOM   4375  O  OG    . SER D 4  476  ? 1.318   -55.390  50.141  1.00 118.03 ? 476  SER A OG    1 
ATOM   4376  N  N     . PRO D 4  477  ? 5.131   -54.613  47.989  1.00 112.87 ? 477  PRO A N     1 
ATOM   4377  C  CA    . PRO D 4  477  ? 6.573   -54.437  47.937  1.00 112.15 ? 477  PRO A CA    1 
ATOM   4378  C  C     . PRO D 4  477  ? 6.976   -53.176  47.213  1.00 112.08 ? 477  PRO A C     1 
ATOM   4379  O  O     . PRO D 4  477  ? 7.898   -52.528  47.662  1.00 112.59 ? 477  PRO A O     1 
ATOM   4380  C  CB    . PRO D 4  477  ? 7.050   -55.656  47.158  1.00 111.82 ? 477  PRO A CB    1 
ATOM   4381  C  CG    . PRO D 4  477  ? 5.963   -55.967  46.283  1.00 112.54 ? 477  PRO A CG    1 
ATOM   4382  C  CD    . PRO D 4  477  ? 4.736   -55.765  47.166  1.00 113.19 ? 477  PRO A CD    1 
ATOM   4383  N  N     . TYR D 4  478  ? 6.310   -52.819  46.110  1.00 112.39 ? 478  TYR A N     1 
ATOM   4384  C  CA    . TYR D 4  478  ? 6.579   -51.533  45.404  1.00 112.35 ? 478  TYR A CA    1 
ATOM   4385  C  C     . TYR D 4  478  ? 6.131   -50.311  46.235  1.00 112.73 ? 478  TYR A C     1 
ATOM   4386  O  O     . TYR D 4  478  ? 6.625   -49.204  46.023  1.00 113.60 ? 478  TYR A O     1 
ATOM   4387  C  CB    . TYR D 4  478  ? 5.907   -51.478  44.007  1.00 111.96 ? 478  TYR A CB    1 
ATOM   4388  C  CG    . TYR D 4  478  ? 6.564   -52.331  42.953  1.00 110.13 ? 478  TYR A CG    1 
ATOM   4389  C  CD1   . TYR D 4  478  ? 5.903   -53.419  42.391  1.00 107.98 ? 478  TYR A CD1   1 
ATOM   4390  C  CD2   . TYR D 4  478  ? 7.849   -52.061  42.543  1.00 110.24 ? 478  TYR A CD2   1 
ATOM   4391  C  CE1   . TYR D 4  478  ? 6.506   -54.208  41.440  1.00 108.76 ? 478  TYR A CE1   1 
ATOM   4392  C  CE2   . TYR D 4  478  ? 8.480   -52.855  41.601  1.00 110.89 ? 478  TYR A CE2   1 
ATOM   4393  C  CZ    . TYR D 4  478  ? 7.812   -53.929  41.049  1.00 110.70 ? 478  TYR A CZ    1 
ATOM   4394  O  OH    . TYR D 4  478  ? 8.477   -54.706  40.113  1.00 110.65 ? 478  TYR A OH    1 
ATOM   4395  N  N     . ASN D 4  479  ? 5.222   -50.535  47.185  1.00 112.12 ? 479  ASN A N     1 
ATOM   4396  C  CA    . ASN D 4  479  ? 4.562   -49.493  47.934  1.00 111.99 ? 479  ASN A CA    1 
ATOM   4397  C  C     . ASN D 4  479  ? 3.926   -48.474  47.033  1.00 111.83 ? 479  ASN A C     1 
ATOM   4398  O  O     . ASN D 4  479  ? 3.958   -47.293  47.344  1.00 111.80 ? 479  ASN A O     1 
ATOM   4399  C  CB    . ASN D 4  479  ? 5.494   -48.822  48.928  1.00 112.33 ? 479  ASN A CB    1 
ATOM   4400  C  CG    . ASN D 4  479  ? 4.763   -47.830  49.888  1.00 115.50 ? 479  ASN A CG    1 
ATOM   4401  O  OD1   . ASN D 4  479  ? 3.578   -47.976  50.245  1.00 116.83 ? 479  ASN A OD1   1 
ATOM   4402  N  ND2   . ASN D 4  479  ? 5.511   -46.820  50.328  1.00 119.73 ? 479  ASN A ND2   1 
ATOM   4403  N  N     . ALA D 4  480  ? 3.349   -48.929  45.915  1.00 111.89 ? 480  ALA A N     1 
ATOM   4404  C  CA    . ALA D 4  480  ? 2.321   -48.139  45.214  1.00 112.09 ? 480  ALA A CA    1 
ATOM   4405  C  C     . ALA D 4  480  ? 0.824   -48.265  45.719  1.00 113.06 ? 480  ALA A C     1 
ATOM   4406  O  O     . ALA D 4  480  ? 0.438   -49.083  46.614  1.00 112.45 ? 480  ALA A O     1 
ATOM   4407  C  CB    . ALA D 4  480  ? 2.402   -48.349  43.740  1.00 110.28 ? 480  ALA A CB    1 
ATOM   4408  N  N     . ASP D 4  481  ? 0.046   -47.328  45.168  1.00 114.25 ? 481  ASP A N     1 
ATOM   4409  C  CA    . ASP D 4  481  ? -1.409  -47.353  44.977  1.00 114.56 ? 481  ASP A CA    1 
ATOM   4410  C  C     . ASP D 4  481  ? -1.586  -46.475  43.721  1.00 114.35 ? 481  ASP A C     1 
ATOM   4411  O  O     . ASP D 4  481  ? -0.594  -46.128  43.038  1.00 114.60 ? 481  ASP A O     1 
ATOM   4412  C  CB    . ASP D 4  481  ? -2.171  -46.761  46.178  1.00 114.83 ? 481  ASP A CB    1 
ATOM   4413  C  CG    . ASP D 4  481  ? -1.578  -45.426  46.677  1.00 117.79 ? 481  ASP A CG    1 
ATOM   4414  O  OD1   . ASP D 4  481  ? -0.749  -44.767  45.965  1.00 116.25 ? 481  ASP A OD1   1 
ATOM   4415  O  OD2   . ASP D 4  481  ? -1.957  -45.032  47.823  1.00 122.80 ? 481  ASP A OD2   1 
ATOM   4416  N  N     . PHE D 4  482  ? -2.819  -46.084  43.413  1.00 113.89 ? 482  PHE A N     1 
ATOM   4417  C  CA    . PHE D 4  482  ? -3.045  -45.266  42.217  1.00 112.53 ? 482  PHE A CA    1 
ATOM   4418  C  C     . PHE D 4  482  ? -3.911  -43.974  42.478  1.00 111.63 ? 482  PHE A C     1 
ATOM   4419  O  O     . PHE D 4  482  ? -4.850  -43.679  41.740  1.00 111.05 ? 482  PHE A O     1 
ATOM   4420  C  CB    . PHE D 4  482  ? -3.499  -46.152  41.045  1.00 112.56 ? 482  PHE A CB    1 
ATOM   4421  C  CG    . PHE D 4  482  ? -3.085  -47.611  41.187  1.00 112.39 ? 482  PHE A CG    1 
ATOM   4422  C  CD1   . PHE D 4  482  ? -3.735  -48.465  42.076  1.00 114.33 ? 482  PHE A CD1   1 
ATOM   4423  C  CD2   . PHE D 4  482  ? -2.058  -48.132  40.430  1.00 114.69 ? 482  PHE A CD2   1 
ATOM   4424  C  CE1   . PHE D 4  482  ? -3.353  -49.795  42.212  1.00 114.92 ? 482  PHE A CE1   1 
ATOM   4425  C  CE2   . PHE D 4  482  ? -1.636  -49.491  40.547  1.00 114.35 ? 482  PHE A CE2   1 
ATOM   4426  C  CZ    . PHE D 4  482  ? -2.283  -50.308  41.442  1.00 114.89 ? 482  PHE A CZ    1 
ATOM   4427  N  N     . ASP D 4  483  ? -3.546  -43.210  43.531  1.00 110.46 ? 483  ASP A N     1 
ATOM   4428  C  CA    . ASP D 4  483  ? -3.673  -41.729  43.525  1.00 109.12 ? 483  ASP A CA    1 
ATOM   4429  C  C     . ASP D 4  483  ? -2.780  -41.196  42.433  1.00 109.01 ? 483  ASP A C     1 
ATOM   4430  O  O     . ASP D 4  483  ? -2.474  -40.011  42.398  1.00 109.37 ? 483  ASP A O     1 
ATOM   4431  C  CB    . ASP D 4  483  ? -3.301  -41.054  44.867  1.00 108.53 ? 483  ASP A CB    1 
ATOM   4432  C  CG    . ASP D 4  483  ? -1.997  -41.568  45.487  1.00 108.36 ? 483  ASP A CG    1 
ATOM   4433  O  OD1   . ASP D 4  483  ? -1.715  -41.178  46.662  1.00 108.46 ? 483  ASP A OD1   1 
ATOM   4434  O  OD2   . ASP D 4  483  ? -1.252  -42.353  44.847  1.00 106.45 ? 483  ASP A OD2   1 
ATOM   4435  N  N     . GLY D 4  484  ? -2.346  -42.117  41.563  1.00 108.63 ? 484  GLY A N     1 
ATOM   4436  C  CA    . GLY D 4  484  ? -1.551  -41.852  40.406  1.00 106.73 ? 484  GLY A CA    1 
ATOM   4437  C  C     . GLY D 4  484  ? -0.194  -41.442  40.852  1.00 106.31 ? 484  GLY A C     1 
ATOM   4438  O  O     . GLY D 4  484  ? 0.134   -40.287  40.756  1.00 105.99 ? 484  GLY A O     1 
ATOM   4439  N  N     . ASP D 4  485  ? 0.555   -42.409  41.382  1.00 106.44 ? 485  ASP A N     1 
ATOM   4440  C  CA    . ASP D 4  485  ? 2.045   -42.480  41.287  1.00 106.32 ? 485  ASP A CA    1 
ATOM   4441  C  C     . ASP D 4  485  ? 2.549   -42.572  39.829  1.00 106.11 ? 485  ASP A C     1 
ATOM   4442  O  O     . ASP D 4  485  ? 1.930   -42.028  38.926  1.00 105.38 ? 485  ASP A O     1 
ATOM   4443  C  CB    . ASP D 4  485  ? 2.622   -43.665  42.104  1.00 106.20 ? 485  ASP A CB    1 
ATOM   4444  C  CG    . ASP D 4  485  ? 1.833   -43.960  43.425  1.00 105.73 ? 485  ASP A CG    1 
ATOM   4445  O  OD1   . ASP D 4  485  ? 1.282   -42.985  44.037  1.00 104.17 ? 485  ASP A OD1   1 
ATOM   4446  O  OD2   . ASP D 4  485  ? 1.783   -45.178  43.814  1.00 102.30 ? 485  ASP A OD2   1 
ATOM   4447  N  N     . GLU D 4  486  ? 3.667   -43.264  39.632  1.00 107.07 ? 486  GLU A N     1 
ATOM   4448  C  CA    . GLU D 4  486  ? 4.394   -43.206  38.370  1.00 108.96 ? 486  GLU A CA    1 
ATOM   4449  C  C     . GLU D 4  486  ? 5.714   -43.965  38.460  1.00 108.97 ? 486  GLU A C     1 
ATOM   4450  O  O     . GLU D 4  486  ? 6.519   -43.725  39.361  1.00 110.60 ? 486  GLU A O     1 
ATOM   4451  C  CB    . GLU D 4  486  ? 4.649   -41.753  37.965  1.00 108.72 ? 486  GLU A CB    1 
ATOM   4452  C  CG    . GLU D 4  486  ? 5.178   -41.587  36.550  1.00 108.06 ? 486  GLU A CG    1 
ATOM   4453  C  CD    . GLU D 4  486  ? 5.393   -40.133  36.175  1.00 111.30 ? 486  GLU A CD    1 
ATOM   4454  O  OE1   . GLU D 4  486  ? 4.661   -39.268  36.700  1.00 116.42 ? 486  GLU A OE1   1 
ATOM   4455  O  OE2   . GLU D 4  486  ? 6.294   -39.856  35.355  1.00 111.28 ? 486  GLU A OE2   1 
ATOM   4456  N  N     . MET D 4  487  ? 5.930   -44.881  37.522  1.00 108.45 ? 487  MET A N     1 
ATOM   4457  C  CA    . MET D 4  487  ? 6.868   -45.981  37.724  1.00 108.30 ? 487  MET A CA    1 
ATOM   4458  C  C     . MET D 4  487  ? 7.756   -46.119  36.513  1.00 107.95 ? 487  MET A C     1 
ATOM   4459  O  O     . MET D 4  487  ? 7.452   -45.571  35.437  1.00 107.70 ? 487  MET A O     1 
ATOM   4460  C  CB    . MET D 4  487  ? 6.091   -47.295  37.943  1.00 109.37 ? 487  MET A CB    1 
ATOM   4461  C  CG    . MET D 4  487  ? 5.115   -47.405  39.183  1.00 108.44 ? 487  MET A CG    1 
ATOM   4462  S  SD    . MET D 4  487  ? 5.333   -49.042  39.940  1.00 108.51 ? 487  MET A SD    1 
ATOM   4463  C  CE    . MET D 4  487  ? 3.904   -49.236  40.908  1.00 110.88 ? 487  MET A CE    1 
ATOM   4464  N  N     . ASN D 4  488  ? 8.845   -46.855  36.650  1.00 107.87 ? 488  ASN A N     1 
ATOM   4465  C  CA    . ASN D 4  488  ? 9.822   -46.931  35.527  1.00 108.64 ? 488  ASN A CA    1 
ATOM   4466  C  C     . ASN D 4  488  ? 9.944   -48.353  34.956  1.00 109.38 ? 488  ASN A C     1 
ATOM   4467  O  O     . ASN D 4  488  ? 9.328   -49.295  35.494  1.00 110.51 ? 488  ASN A O     1 
ATOM   4468  C  CB    . ASN D 4  488  ? 11.217  -46.394  35.929  1.00 108.23 ? 488  ASN A CB    1 
ATOM   4469  C  CG    . ASN D 4  488  ? 11.198  -44.917  36.383  1.00 108.16 ? 488  ASN A CG    1 
ATOM   4470  O  OD1   . ASN D 4  488  ? 10.610  -44.048  35.739  1.00 107.22 ? 488  ASN A OD1   1 
ATOM   4471  N  ND2   . ASN D 4  488  ? 11.861  -44.642  37.492  1.00 107.13 ? 488  ASN A ND2   1 
ATOM   4472  N  N     . LEU D 4  489  ? 10.730  -48.531  33.891  1.00 109.23 ? 489  LEU A N     1 
ATOM   4473  C  CA    . LEU D 4  489  ? 10.892  -49.850  33.279  1.00 109.12 ? 489  LEU A CA    1 
ATOM   4474  C  C     . LEU D 4  489  ? 12.103  -49.769  32.425  1.00 109.28 ? 489  LEU A C     1 
ATOM   4475  O  O     . LEU D 4  489  ? 12.199  -48.878  31.597  1.00 109.31 ? 489  LEU A O     1 
ATOM   4476  C  CB    . LEU D 4  489  ? 9.671   -50.169  32.411  1.00 109.43 ? 489  LEU A CB    1 
ATOM   4477  C  CG    . LEU D 4  489  ? 9.475   -51.398  31.515  1.00 108.99 ? 489  LEU A CG    1 
ATOM   4478  C  CD1   . LEU D 4  489  ? 8.013   -51.812  31.645  1.00 109.29 ? 489  LEU A CD1   1 
ATOM   4479  C  CD2   . LEU D 4  489  ? 9.834   -51.119  30.064  1.00 105.62 ? 489  LEU A CD2   1 
ATOM   4480  N  N     . HIS D 4  490  ? 13.050  -50.669  32.616  1.00 109.66 ? 490  HIS A N     1 
ATOM   4481  C  CA    . HIS D 4  490  ? 14.260  -50.599  31.796  1.00 110.43 ? 490  HIS A CA    1 
ATOM   4482  C  C     . HIS D 4  490  ? 14.344  -51.853  30.952  1.00 110.08 ? 490  HIS A C     1 
ATOM   4483  O  O     . HIS D 4  490  ? 14.136  -52.948  31.442  1.00 110.53 ? 490  HIS A O     1 
ATOM   4484  C  CB    . HIS D 4  490  ? 15.523  -50.381  32.653  1.00 110.63 ? 490  HIS A CB    1 
ATOM   4485  C  CG    . HIS D 4  490  ? 15.429  -49.219  33.609  1.00 113.53 ? 490  HIS A CG    1 
ATOM   4486  N  ND1   . HIS D 4  490  ? 16.406  -48.248  33.696  1.00 114.64 ? 490  HIS A ND1   1 
ATOM   4487  C  CD2   . HIS D 4  490  ? 14.483  -48.885  34.536  1.00 115.04 ? 490  HIS A CD2   1 
ATOM   4488  C  CE1   . HIS D 4  490  ? 16.058  -47.367  34.628  1.00 116.21 ? 490  HIS A CE1   1 
ATOM   4489  N  NE2   . HIS D 4  490  ? 14.900  -47.729  35.155  1.00 114.36 ? 490  HIS A NE2   1 
ATOM   4490  N  N     . VAL D 4  491  ? 14.632  -51.690  29.676  1.00 109.95 ? 491  VAL A N     1 
ATOM   4491  C  CA    . VAL D 4  491  ? 14.733  -52.825  28.782  1.00 110.36 ? 491  VAL A CA    1 
ATOM   4492  C  C     . VAL D 4  491  ? 16.177  -53.355  28.502  1.00 110.72 ? 491  VAL A C     1 
ATOM   4493  O  O     . VAL D 4  491  ? 16.998  -52.683  27.858  1.00 110.34 ? 491  VAL A O     1 
ATOM   4494  C  CB    . VAL D 4  491  ? 13.987  -52.511  27.507  1.00 110.45 ? 491  VAL A CB    1 
ATOM   4495  C  CG1   . VAL D 4  491  ? 14.309  -53.522  26.414  1.00 111.07 ? 491  VAL A CG1   1 
ATOM   4496  C  CG2   . VAL D 4  491  ? 12.515  -52.483  27.808  1.00 110.72 ? 491  VAL A CG2   1 
ATOM   4497  N  N     . PRO D 4  492  ? 16.473  -54.581  28.983  1.00 111.14 ? 492  PRO A N     1 
ATOM   4498  C  CA    . PRO D 4  492  ? 17.771  -55.228  28.785  1.00 111.48 ? 492  PRO A CA    1 
ATOM   4499  C  C     . PRO D 4  492  ? 18.029  -55.415  27.318  1.00 111.93 ? 492  PRO A C     1 
ATOM   4500  O  O     . PRO D 4  492  ? 17.139  -55.859  26.593  1.00 112.16 ? 492  PRO A O     1 
ATOM   4501  C  CB    . PRO D 4  492  ? 17.553  -56.616  29.384  1.00 111.71 ? 492  PRO A CB    1 
ATOM   4502  C  CG    . PRO D 4  492  ? 16.029  -56.814  29.374  1.00 110.92 ? 492  PRO A CG    1 
ATOM   4503  C  CD    . PRO D 4  492  ? 15.549  -55.453  29.738  1.00 111.02 ? 492  PRO A CD    1 
ATOM   4504  N  N     . GLN D 4  493  ? 19.236  -55.104  26.889  1.00 112.23 ? 493  GLN A N     1 
ATOM   4505  C  CA    . GLN D 4  493  ? 19.592  -55.234  25.492  1.00 112.81 ? 493  GLN A CA    1 
ATOM   4506  C  C     . GLN D 4  493  ? 20.501  -56.419  25.274  1.00 113.47 ? 493  GLN A C     1 
ATOM   4507  O  O     . GLN D 4  493  ? 21.193  -56.510  24.244  1.00 113.53 ? 493  GLN A O     1 
ATOM   4508  C  CB    . GLN D 4  493  ? 20.325  -53.993  25.028  1.00 112.91 ? 493  GLN A CB    1 
ATOM   4509  C  CG    . GLN D 4  493  ? 19.675  -52.745  25.434  1.00 112.62 ? 493  GLN A CG    1 
ATOM   4510  C  CD    . GLN D 4  493  ? 18.455  -52.534  24.656  1.00 113.04 ? 493  GLN A CD    1 
ATOM   4511  O  OE1   . GLN D 4  493  ? 18.529  -52.184  23.482  1.00 114.29 ? 493  GLN A OE1   1 
ATOM   4512  N  NE2   . GLN D 4  493  ? 17.300  -52.743  25.285  1.00 113.34 ? 493  GLN A NE2   1 
ATOM   4513  N  N     . SER D 4  494  ? 20.537  -57.323  26.243  1.00 114.04 ? 494  SER A N     1 
ATOM   4514  C  CA    . SER D 4  494  ? 21.295  -58.543  26.016  1.00 114.69 ? 494  SER A CA    1 
ATOM   4515  C  C     . SER D 4  494  ? 20.601  -59.851  26.427  1.00 114.99 ? 494  SER A C     1 
ATOM   4516  O  O     . SER D 4  494  ? 19.624  -59.850  27.213  1.00 114.80 ? 494  SER A O     1 
ATOM   4517  C  CB    . SER D 4  494  ? 22.714  -58.452  26.568  1.00 114.20 ? 494  SER A CB    1 
ATOM   4518  O  OG    . SER D 4  494  ? 23.490  -59.408  25.866  1.00 114.98 ? 494  SER A OG    1 
ATOM   4519  N  N     . GLU D 4  495  ? 21.112  -60.952  25.863  1.00 114.95 ? 495  GLU A N     1 
ATOM   4520  C  CA    . GLU D 4  495  ? 20.556  -62.270  26.126  1.00 115.06 ? 495  GLU A CA    1 
ATOM   4521  C  C     . GLU D 4  495  ? 20.732  -62.736  27.571  1.00 114.95 ? 495  GLU A C     1 
ATOM   4522  O  O     . GLU D 4  495  ? 19.849  -63.434  28.103  1.00 115.15 ? 495  GLU A O     1 
ATOM   4523  C  CB    . GLU D 4  495  ? 21.077  -63.327  25.145  1.00 115.20 ? 495  GLU A CB    1 
ATOM   4524  C  CG    . GLU D 4  495  ? 20.071  -63.739  24.063  1.00 115.60 ? 495  GLU A CG    1 
ATOM   4525  C  CD    . GLU D 4  495  ? 18.621  -63.934  24.567  1.00 116.36 ? 495  GLU A CD    1 
ATOM   4526  O  OE1   . GLU D 4  495  ? 17.699  -63.629  23.756  1.00 115.82 ? 495  GLU A OE1   1 
ATOM   4527  O  OE2   . GLU D 4  495  ? 18.400  -64.387  25.738  1.00 115.16 ? 495  GLU A OE2   1 
ATOM   4528  N  N     . GLU D 4  496  ? 21.854  -62.359  28.194  1.00 114.41 ? 496  GLU A N     1 
ATOM   4529  C  CA    . GLU D 4  496  ? 22.117  -62.754  29.578  1.00 114.06 ? 496  GLU A CA    1 
ATOM   4530  C  C     . GLU D 4  496  ? 21.886  -61.617  30.537  1.00 113.60 ? 496  GLU A C     1 
ATOM   4531  O  O     . GLU D 4  496  ? 22.149  -61.728  31.733  1.00 113.46 ? 496  GLU A O     1 
ATOM   4532  C  CB    . GLU D 4  496  ? 23.515  -63.379  29.757  1.00 114.53 ? 496  GLU A CB    1 
ATOM   4533  C  CG    . GLU D 4  496  ? 24.699  -62.454  29.942  1.00 114.73 ? 496  GLU A CG    1 
ATOM   4534  C  CD    . GLU D 4  496  ? 24.843  -61.542  28.786  1.00 115.79 ? 496  GLU A CD    1 
ATOM   4535  O  OE1   . GLU D 4  496  ? 24.194  -60.473  28.842  1.00 117.32 ? 496  GLU A OE1   1 
ATOM   4536  O  OE2   . GLU D 4  496  ? 25.572  -61.900  27.826  1.00 116.20 ? 496  GLU A OE2   1 
ATOM   4537  N  N     . THR D 4  497  ? 21.399  -60.517  29.989  1.00 113.11 ? 497  THR A N     1 
ATOM   4538  C  CA    . THR D 4  497  ? 20.992  -59.400  30.787  1.00 113.04 ? 497  THR A CA    1 
ATOM   4539  C  C     . THR D 4  497  ? 19.528  -59.614  31.030  1.00 113.19 ? 497  THR A C     1 
ATOM   4540  O  O     . THR D 4  497  ? 18.927  -59.031  31.935  1.00 113.02 ? 497  THR A O     1 
ATOM   4541  C  CB    . THR D 4  497  ? 21.172  -58.121  30.024  1.00 113.25 ? 497  THR A CB    1 
ATOM   4542  O  OG1   . THR D 4  497  ? 22.536  -58.028  29.551  1.00 113.68 ? 497  THR A OG1   1 
ATOM   4543  C  CG2   . THR D 4  497  ? 20.814  -56.940  30.919  1.00 112.63 ? 497  THR A CG2   1 
ATOM   4544  N  N     . ARG D 4  498  ? 18.953  -60.470  30.202  1.00 113.41 ? 498  ARG A N     1 
ATOM   4545  C  CA    . ARG D 4  498  ? 17.545  -60.789  30.317  1.00 113.75 ? 498  ARG A CA    1 
ATOM   4546  C  C     . ARG D 4  498  ? 17.343  -62.148  30.961  1.00 113.77 ? 498  ARG A C     1 
ATOM   4547  O  O     . ARG D 4  498  ? 16.244  -62.456  31.439  1.00 114.33 ? 498  ARG A O     1 
ATOM   4548  C  CB    . ARG D 4  498  ? 16.869  -60.735  28.949  1.00 113.89 ? 498  ARG A CB    1 
ATOM   4549  C  CG    . ARG D 4  498  ? 17.426  -61.709  27.937  1.00 113.50 ? 498  ARG A CG    1 
ATOM   4550  C  CD    . ARG D 4  498  ? 16.373  -62.071  26.933  1.00 113.25 ? 498  ARG A CD    1 
ATOM   4551  N  NE    . ARG D 4  498  ? 16.039  -60.939  26.085  1.00 111.99 ? 498  ARG A NE    1 
ATOM   4552  C  CZ    . ARG D 4  498  ? 15.007  -60.922  25.257  1.00 111.68 ? 498  ARG A CZ    1 
ATOM   4553  N  NH1   . ARG D 4  498  ? 14.206  -61.977  25.191  1.00 111.40 ? 498  ARG A NH1   1 
ATOM   4554  N  NH2   . ARG D 4  498  ? 14.774  -59.849  24.509  1.00 111.64 ? 498  ARG A NH2   1 
ATOM   4555  N  N     . ALA D 4  499  ? 18.395  -62.963  30.930  1.00 113.37 ? 499  ALA A N     1 
ATOM   4556  C  CA    . ALA D 4  499  ? 18.452  -64.200  31.689  1.00 113.16 ? 499  ALA A CA    1 
ATOM   4557  C  C     . ALA D 4  499  ? 18.575  -63.808  33.140  1.00 113.00 ? 499  ALA A C     1 
ATOM   4558  O  O     . ALA D 4  499  ? 17.941  -64.399  34.004  1.00 113.39 ? 499  ALA A O     1 
ATOM   4559  C  CB    . ALA D 4  499  ? 19.669  -65.027  31.281  1.00 113.21 ? 499  ALA A CB    1 
ATOM   4560  N  N     . GLU D 4  500  ? 19.383  -62.782  33.382  1.00 112.53 ? 500  GLU A N     1 
ATOM   4561  C  CA    . GLU D 4  500  ? 19.817  -62.404  34.714  1.00 112.08 ? 500  GLU A CA    1 
ATOM   4562  C  C     . GLU D 4  500  ? 18.759  -61.532  35.276  1.00 111.83 ? 500  GLU A C     1 
ATOM   4563  O  O     . GLU D 4  500  ? 18.756  -61.239  36.466  1.00 112.03 ? 500  GLU A O     1 
ATOM   4564  C  CB    . GLU D 4  500  ? 21.127  -61.641  34.612  1.00 112.15 ? 500  GLU A CB    1 
ATOM   4565  C  CG    . GLU D 4  500  ? 21.704  -61.049  35.875  1.00 111.77 ? 500  GLU A CG    1 
ATOM   4566  C  CD    . GLU D 4  500  ? 22.998  -60.303  35.567  1.00 112.37 ? 500  GLU A CD    1 
ATOM   4567  O  OE1   . GLU D 4  500  ? 23.051  -59.067  35.761  1.00 111.91 ? 500  GLU A OE1   1 
ATOM   4568  O  OE2   . GLU D 4  500  ? 23.954  -60.954  35.084  1.00 112.86 ? 500  GLU A OE2   1 
ATOM   4569  N  N     . LEU D 4  501  ? 17.856  -61.116  34.397  1.00 111.65 ? 501  LEU A N     1 
ATOM   4570  C  CA    . LEU D 4  501  ? 16.689  -60.344  34.799  1.00 111.29 ? 501  LEU A CA    1 
ATOM   4571  C  C     . LEU D 4  501  ? 15.576  -61.261  35.284  1.00 110.61 ? 501  LEU A C     1 
ATOM   4572  O  O     . LEU D 4  501  ? 14.814  -60.883  36.175  1.00 110.50 ? 501  LEU A O     1 
ATOM   4573  C  CB    . LEU D 4  501  ? 16.186  -59.486  33.631  1.00 111.30 ? 501  LEU A CB    1 
ATOM   4574  C  CG    . LEU D 4  501  ? 15.707  -58.059  33.920  1.00 111.47 ? 501  LEU A CG    1 
ATOM   4575  C  CD1   . LEU D 4  501  ? 14.598  -58.006  34.994  1.00 110.05 ? 501  LEU A CD1   1 
ATOM   4576  C  CD2   . LEU D 4  501  ? 16.904  -57.141  34.270  1.00 111.85 ? 501  LEU A CD2   1 
ATOM   4577  N  N     . SER D 4  502  ? 15.504  -62.460  34.708  1.00 110.00 ? 502  SER A N     1 
ATOM   4578  C  CA    . SER D 4  502  ? 14.339  -63.323  34.856  1.00 110.07 ? 502  SER A CA    1 
ATOM   4579  C  C     . SER D 4  502  ? 14.600  -64.568  35.679  1.00 109.84 ? 502  SER A C     1 
ATOM   4580  O  O     . SER D 4  502  ? 13.679  -65.130  36.279  1.00 109.83 ? 502  SER A O     1 
ATOM   4581  C  CB    . SER D 4  502  ? 13.810  -63.724  33.488  1.00 110.34 ? 502  SER A CB    1 
ATOM   4582  O  OG    . SER D 4  502  ? 14.833  -64.296  32.694  1.00 111.29 ? 502  SER A OG    1 
ATOM   4583  N  N     . GLN D 4  503  ? 15.858  -64.991  35.694  1.00 109.36 ? 503  GLN A N     1 
ATOM   4584  C  CA    . GLN D 4  503  ? 16.312  -66.101  36.522  1.00 109.12 ? 503  GLN A CA    1 
ATOM   4585  C  C     . GLN D 4  503  ? 16.683  -65.631  37.920  1.00 108.81 ? 503  GLN A C     1 
ATOM   4586  O  O     . GLN D 4  503  ? 17.068  -66.439  38.777  1.00 108.68 ? 503  GLN A O     1 
ATOM   4587  C  CB    . GLN D 4  503  ? 17.540  -66.752  35.875  1.00 109.45 ? 503  GLN A CB    1 
ATOM   4588  C  CG    . GLN D 4  503  ? 17.255  -67.369  34.551  1.00 110.14 ? 503  GLN A CG    1 
ATOM   4589  C  CD    . GLN D 4  503  ? 15.964  -68.129  34.607  1.00 112.66 ? 503  GLN A CD    1 
ATOM   4590  O  OE1   . GLN D 4  503  ? 14.940  -67.663  34.103  1.00 114.46 ? 503  GLN A OE1   1 
ATOM   4591  N  NE2   . GLN D 4  503  ? 15.983  -69.288  35.270  1.00 113.20 ? 503  GLN A NE2   1 
ATOM   4592  N  N     . LEU D 4  504  ? 16.577  -64.321  38.144  1.00 108.47 ? 504  LEU A N     1 
ATOM   4593  C  CA    . LEU D 4  504  ? 17.097  -63.706  39.365  1.00 108.01 ? 504  LEU A CA    1 
ATOM   4594  C  C     . LEU D 4  504  ? 16.177  -62.771  40.152  1.00 108.10 ? 504  LEU A C     1 
ATOM   4595  O  O     . LEU D 4  504  ? 16.239  -62.781  41.385  1.00 107.85 ? 504  LEU A O     1 
ATOM   4596  C  CB    . LEU D 4  504  ? 18.420  -63.013  39.075  1.00 107.37 ? 504  LEU A CB    1 
ATOM   4597  C  CG    . LEU D 4  504  ? 19.556  -63.888  39.546  1.00 106.35 ? 504  LEU A CG    1 
ATOM   4598  C  CD1   . LEU D 4  504  ? 20.875  -63.320  39.094  1.00 106.00 ? 504  LEU A CD1   1 
ATOM   4599  C  CD2   . LEU D 4  504  ? 19.476  -63.926  41.040  1.00 106.32 ? 504  LEU A CD2   1 
ATOM   4600  N  N     . CYS D 4  505  ? 15.356  -61.983  39.440  1.00 108.20 ? 505  CYS A N     1 
ATOM   4601  C  CA    . CYS D 4  505  ? 14.553  -60.885  40.020  1.00 108.61 ? 505  CYS A CA    1 
ATOM   4602  C  C     . CYS D 4  505  ? 13.095  -60.968  39.646  1.00 107.71 ? 505  CYS A C     1 
ATOM   4603  O  O     . CYS D 4  505  ? 12.289  -60.158  40.094  1.00 108.12 ? 505  CYS A O     1 
ATOM   4604  C  CB    . CYS D 4  505  ? 15.019  -59.494  39.556  1.00 109.08 ? 505  CYS A CB    1 
ATOM   4605  S  SG    . CYS D 4  505  ? 16.591  -59.381  38.673  1.00 113.63 ? 505  CYS A SG    1 
ATOM   4606  N  N     . ALA D 4  506  ? 12.756  -61.917  38.795  1.00 106.65 ? 506  ALA A N     1 
ATOM   4607  C  CA    . ALA D 4  506  ? 11.360  -62.138  38.429  1.00 105.38 ? 506  ALA A CA    1 
ATOM   4608  C  C     . ALA D 4  506  ? 10.384  -62.107  39.613  1.00 103.79 ? 506  ALA A C     1 
ATOM   4609  O  O     . ALA D 4  506  ? 10.628  -62.720  40.628  1.00 102.55 ? 506  ALA A O     1 
ATOM   4610  C  CB    . ALA D 4  506  ? 11.247  -63.436  37.649  1.00 105.96 ? 506  ALA A CB    1 
ATOM   4611  N  N     . VAL D 4  507  ? 9.286   -61.392  39.455  1.00 103.23 ? 507  VAL A N     1 
ATOM   4612  C  CA    . VAL D 4  507  ? 8.351   -61.170  40.562  1.00 104.52 ? 507  VAL A CA    1 
ATOM   4613  C  C     . VAL D 4  507  ? 8.049   -62.364  41.481  1.00 105.10 ? 507  VAL A C     1 
ATOM   4614  O  O     . VAL D 4  507  ? 7.959   -62.182  42.702  1.00 105.82 ? 507  VAL A O     1 
ATOM   4615  C  CB    . VAL D 4  507  ? 6.990   -60.464  40.120  1.00 104.83 ? 507  VAL A CB    1 
ATOM   4616  C  CG1   . VAL D 4  507  ? 5.838   -60.622  41.150  1.00 103.12 ? 507  VAL A CG1   1 
ATOM   4617  C  CG2   . VAL D 4  507  ? 7.218   -59.004  39.868  1.00 105.56 ? 507  VAL A CG2   1 
ATOM   4618  N  N     . PRO D 4  508  ? 7.862   -63.578  40.926  1.00 105.04 ? 508  PRO A N     1 
ATOM   4619  C  CA    . PRO D 4  508  ? 7.519   -64.641  41.868  1.00 104.43 ? 508  PRO A CA    1 
ATOM   4620  C  C     . PRO D 4  508  ? 8.688   -64.990  42.740  1.00 104.16 ? 508  PRO A C     1 
ATOM   4621  O  O     . PRO D 4  508  ? 8.564   -64.891  43.947  1.00 103.73 ? 508  PRO A O     1 
ATOM   4622  C  CB    . PRO D 4  508  ? 7.153   -65.811  40.971  1.00 104.51 ? 508  PRO A CB    1 
ATOM   4623  C  CG    . PRO D 4  508  ? 6.907   -65.178  39.620  1.00 105.58 ? 508  PRO A CG    1 
ATOM   4624  C  CD    . PRO D 4  508  ? 7.892   -64.073  39.543  1.00 105.22 ? 508  PRO A CD    1 
ATOM   4625  N  N     . LEU D 4  509  ? 9.828   -65.354  42.151  1.00 104.64 ? 509  LEU A N     1 
ATOM   4626  C  CA    . LEU D 4  509  ? 10.995  -65.740  42.961  1.00 105.08 ? 509  LEU A CA    1 
ATOM   4627  C  C     . LEU D 4  509  ? 11.503  -64.551  43.785  1.00 105.50 ? 509  LEU A C     1 
ATOM   4628  O  O     . LEU D 4  509  ? 12.712  -64.297  43.896  1.00 105.82 ? 509  LEU A O     1 
ATOM   4629  C  CB    . LEU D 4  509  ? 12.092  -66.455  42.140  1.00 104.83 ? 509  LEU A CB    1 
ATOM   4630  C  CG    . LEU D 4  509  ? 12.931  -65.904  40.976  1.00 105.31 ? 509  LEU A CG    1 
ATOM   4631  C  CD1   . LEU D 4  509  ? 14.345  -65.522  41.407  1.00 106.22 ? 509  LEU A CD1   1 
ATOM   4632  C  CD2   . LEU D 4  509  ? 13.036  -66.967  39.893  1.00 106.58 ? 509  LEU A CD2   1 
ATOM   4633  N  N     . GLN D 4  510  ? 10.542  -63.830  44.374  1.00 105.57 ? 510  GLN A N     1 
ATOM   4634  C  CA    . GLN D 4  510  ? 10.797  -62.609  45.139  1.00 105.36 ? 510  GLN A CA    1 
ATOM   4635  C  C     . GLN D 4  510  ? 9.767   -62.460  46.180  1.00 104.88 ? 510  GLN A C     1 
ATOM   4636  O  O     . GLN D 4  510  ? 9.869   -61.523  46.959  1.00 104.55 ? 510  GLN A O     1 
ATOM   4637  C  CB    . GLN D 4  510  ? 10.747  -61.352  44.256  1.00 105.55 ? 510  GLN A CB    1 
ATOM   4638  C  CG    . GLN D 4  510  ? 12.046  -61.074  43.491  1.00 105.85 ? 510  GLN A CG    1 
ATOM   4639  C  CD    . GLN D 4  510  ? 13.113  -60.701  44.439  1.00 106.02 ? 510  GLN A CD    1 
ATOM   4640  O  OE1   . GLN D 4  510  ? 12.799  -60.281  45.557  1.00 108.93 ? 510  GLN A OE1   1 
ATOM   4641  N  NE2   . GLN D 4  510  ? 14.373  -60.849  44.042  1.00 104.10 ? 510  GLN A NE2   1 
ATOM   4642  N  N     . ILE D 4  511  ? 8.794   -63.388  46.162  1.00 105.29 ? 511  ILE A N     1 
ATOM   4643  C  CA    . ILE D 4  511  ? 7.526   -63.341  46.949  1.00 105.35 ? 511  ILE A CA    1 
ATOM   4644  C  C     . ILE D 4  511  ? 7.854   -63.456  48.415  1.00 106.53 ? 511  ILE A C     1 
ATOM   4645  O  O     . ILE D 4  511  ? 7.406   -62.639  49.228  1.00 105.76 ? 511  ILE A O     1 
ATOM   4646  C  CB    . ILE D 4  511  ? 6.509   -64.508  46.602  1.00 105.15 ? 511  ILE A CB    1 
ATOM   4647  C  CG1   . ILE D 4  511  ? 5.851   -64.347  45.234  1.00 103.73 ? 511  ILE A CG1   1 
ATOM   4648  C  CG2   . ILE D 4  511  ? 5.404   -64.601  47.657  1.00 104.88 ? 511  ILE A CG2   1 
ATOM   4649  C  CD1   . ILE D 4  511  ? 5.299   -65.631  44.693  1.00 103.80 ? 511  ILE A CD1   1 
ATOM   4650  N  N     . VAL D 4  512  ? 8.645   -64.488  48.727  1.00 108.09 ? 512  VAL A N     1 
ATOM   4651  C  CA    . VAL D 4  512  ? 9.126   -64.733  50.082  1.00 109.83 ? 512  VAL A CA    1 
ATOM   4652  C  C     . VAL D 4  512  ? 10.537  -64.129  50.236  1.00 110.41 ? 512  VAL A C     1 
ATOM   4653  O  O     . VAL D 4  512  ? 11.427  -64.431  49.445  1.00 111.12 ? 512  VAL A O     1 
ATOM   4654  C  CB    . VAL D 4  512  ? 9.063   -66.230  50.413  1.00 109.74 ? 512  VAL A CB    1 
ATOM   4655  C  CG1   . VAL D 4  512  ? 10.218  -66.998  49.735  1.00 111.05 ? 512  VAL A CG1   1 
ATOM   4656  C  CG2   . VAL D 4  512  ? 9.038   -66.430  51.919  1.00 110.22 ? 512  VAL A CG2   1 
ATOM   4657  N  N     . SER D 4  513  ? 10.733  -63.257  51.222  1.00 110.96 ? 513  SER A N     1 
ATOM   4658  C  CA    . SER D 4  513  ? 11.865  -62.330  51.160  1.00 111.66 ? 513  SER A CA    1 
ATOM   4659  C  C     . SER D 4  513  ? 12.820  -62.264  52.353  1.00 112.42 ? 513  SER A C     1 
ATOM   4660  O  O     . SER D 4  513  ? 12.385  -62.078  53.504  1.00 112.39 ? 513  SER A O     1 
ATOM   4661  C  CB    . SER D 4  513  ? 11.369  -60.929  50.891  1.00 111.54 ? 513  SER A CB    1 
ATOM   4662  O  OG    . SER D 4  513  ? 12.008  -60.043  51.793  1.00 112.02 ? 513  SER A OG    1 
ATOM   4663  N  N     . PRO D 4  514  ? 14.141  -62.328  52.064  1.00 113.09 ? 514  PRO A N     1 
ATOM   4664  C  CA    . PRO D 4  514  ? 15.164  -62.353  53.104  1.00 113.38 ? 514  PRO A CA    1 
ATOM   4665  C  C     . PRO D 4  514  ? 14.821  -61.437  54.257  1.00 113.54 ? 514  PRO A C     1 
ATOM   4666  O  O     . PRO D 4  514  ? 15.049  -61.769  55.397  1.00 113.94 ? 514  PRO A O     1 
ATOM   4667  C  CB    . PRO D 4  514  ? 16.431  -61.836  52.388  1.00 113.01 ? 514  PRO A CB    1 
ATOM   4668  C  CG    . PRO D 4  514  ? 16.020  -61.578  50.965  1.00 113.40 ? 514  PRO A CG    1 
ATOM   4669  C  CD    . PRO D 4  514  ? 14.759  -62.352  50.727  1.00 113.21 ? 514  PRO A CD    1 
ATOM   4670  N  N     . GLN D 4  515  ? 14.241  -60.295  53.967  1.00 113.84 ? 515  GLN A N     1 
ATOM   4671  C  CA    . GLN D 4  515  ? 14.204  -59.257  54.960  1.00 114.15 ? 515  GLN A CA    1 
ATOM   4672  C  C     . GLN D 4  515  ? 13.654  -59.750  56.256  1.00 114.24 ? 515  GLN A C     1 
ATOM   4673  O  O     . GLN D 4  515  ? 14.282  -59.543  57.276  1.00 114.71 ? 515  GLN A O     1 
ATOM   4674  C  CB    . GLN D 4  515  ? 13.383  -58.095  54.474  1.00 114.42 ? 515  GLN A CB    1 
ATOM   4675  C  CG    . GLN D 4  515  ? 13.553  -56.848  55.251  1.00 114.64 ? 515  GLN A CG    1 
ATOM   4676  C  CD    . GLN D 4  515  ? 12.888  -55.753  54.502  1.00 117.43 ? 515  GLN A CD    1 
ATOM   4677  O  OE1   . GLN D 4  515  ? 13.339  -55.397  53.403  1.00 117.24 ? 515  GLN A OE1   1 
ATOM   4678  N  NE2   . GLN D 4  515  ? 11.763  -55.242  55.039  1.00 117.59 ? 515  GLN A NE2   1 
ATOM   4679  N  N     . SER D 4  516  ? 12.505  -60.418  56.217  1.00 114.37 ? 516  SER A N     1 
ATOM   4680  C  CA    . SER D 4  516  ? 11.797  -60.753  57.440  1.00 114.61 ? 516  SER A CA    1 
ATOM   4681  C  C     . SER D 4  516  ? 11.429  -62.206  57.452  1.00 115.09 ? 516  SER A C     1 
ATOM   4682  O  O     . SER D 4  516  ? 10.467  -62.596  58.113  1.00 115.34 ? 516  SER A O     1 
ATOM   4683  C  CB    . SER D 4  516  ? 10.543  -59.910  57.558  1.00 114.47 ? 516  SER A CB    1 
ATOM   4684  O  OG    . SER D 4  516  ? 10.858  -58.551  57.322  1.00 114.94 ? 516  SER A OG    1 
ATOM   4685  N  N     . ASN D 4  517  ? 12.213  -63.000  56.723  1.00 115.54 ? 517  ASN A N     1 
ATOM   4686  C  CA    . ASN D 4  517  ? 11.959  -64.422  56.528  1.00 115.95 ? 517  ASN A CA    1 
ATOM   4687  C  C     . ASN D 4  517  ? 10.485  -64.678  56.439  1.00 116.19 ? 517  ASN A C     1 
ATOM   4688  O  O     . ASN D 4  517  ? 9.940   -65.513  57.149  1.00 116.62 ? 517  ASN A O     1 
ATOM   4689  C  CB    . ASN D 4  517  ? 12.619  -65.298  57.611  1.00 116.19 ? 517  ASN A CB    1 
ATOM   4690  C  CG    . ASN D 4  517  ? 12.284  -64.865  59.033  1.00 116.44 ? 517  ASN A CG    1 
ATOM   4691  O  OD1   . ASN D 4  517  ? 11.120  -64.788  59.424  1.00 117.30 ? 517  ASN A OD1   1 
ATOM   4692  N  ND2   . ASN D 4  517  ? 13.317  -64.606  59.822  1.00 117.01 ? 517  ASN A ND2   1 
ATOM   4693  N  N     . LYS D 4  518  ? 9.834   -63.900  55.591  1.00 116.42 ? 518  LYS A N     1 
ATOM   4694  C  CA    . LYS D 4  518  ? 8.416   -64.044  55.351  1.00 116.79 ? 518  LYS A CA    1 
ATOM   4695  C  C     . LYS D 4  518  ? 8.131   -63.371  53.999  1.00 116.59 ? 518  LYS A C     1 
ATOM   4696  O  O     . LYS D 4  518  ? 9.007   -62.695  53.447  1.00 116.57 ? 518  LYS A O     1 
ATOM   4697  C  CB    . LYS D 4  518  ? 7.590   -63.457  56.515  1.00 116.79 ? 518  LYS A CB    1 
ATOM   4698  C  CG    . LYS D 4  518  ? 7.534   -61.930  56.527  1.00 118.40 ? 518  LYS A CG    1 
ATOM   4699  C  CD    . LYS D 4  518  ? 6.147   -61.424  56.980  1.00 120.42 ? 518  LYS A CD    1 
ATOM   4700  C  CE    . LYS D 4  518  ? 5.689   -60.205  56.176  1.00 120.06 ? 518  LYS A CE    1 
ATOM   4701  N  NZ    . LYS D 4  518  ? 6.736   -59.123  56.096  1.00 121.32 ? 518  LYS A NZ    1 
ATOM   4702  N  N     . PRO D 4  519  ? 6.907   -63.541  53.466  1.00 116.43 ? 519  PRO A N     1 
ATOM   4703  C  CA    . PRO D 4  519  ? 6.689   -63.110  52.111  1.00 116.17 ? 519  PRO A CA    1 
ATOM   4704  C  C     . PRO D 4  519  ? 6.132   -61.670  52.033  1.00 116.16 ? 519  PRO A C     1 
ATOM   4705  O  O     . PRO D 4  519  ? 5.239   -61.286  52.823  1.00 116.22 ? 519  PRO A O     1 
ATOM   4706  C  CB    . PRO D 4  519  ? 5.678   -64.133  51.614  1.00 116.14 ? 519  PRO A CB    1 
ATOM   4707  C  CG    . PRO D 4  519  ? 4.834   -64.449  52.866  1.00 116.54 ? 519  PRO A CG    1 
ATOM   4708  C  CD    . PRO D 4  519  ? 5.672   -64.094  54.060  1.00 116.52 ? 519  PRO A CD    1 
ATOM   4709  N  N     . CYS D 4  520  ? 6.640   -60.900  51.068  1.00 115.35 ? 520  CYS A N     1 
ATOM   4710  C  CA    . CYS D 4  520  ? 6.353   -59.475  50.994  1.00 114.72 ? 520  CYS A CA    1 
ATOM   4711  C  C     . CYS D 4  520  ? 5.190   -59.023  50.105  1.00 113.83 ? 520  CYS A C     1 
ATOM   4712  O  O     . CYS D 4  520  ? 4.977   -57.805  49.975  1.00 114.09 ? 520  CYS A O     1 
ATOM   4713  C  CB    . CYS D 4  520  ? 7.615   -58.726  50.590  1.00 115.33 ? 520  CYS A CB    1 
ATOM   4714  S  SG    . CYS D 4  520  ? 8.299   -59.238  48.984  1.00 117.30 ? 520  CYS A SG    1 
ATOM   4715  N  N     . MET D 4  521  ? 4.468   -59.973  49.494  1.00 112.61 ? 521  MET A N     1 
ATOM   4716  C  CA    . MET D 4  521  ? 3.213   -59.729  48.736  1.00 111.48 ? 521  MET A CA    1 
ATOM   4717  C  C     . MET D 4  521  ? 2.083   -60.564  49.341  1.00 111.23 ? 521  MET A C     1 
ATOM   4718  O  O     . MET D 4  521  ? 2.286   -61.752  49.608  1.00 111.52 ? 521  MET A O     1 
ATOM   4719  C  CB    . MET D 4  521  ? 3.360   -60.157  47.283  1.00 110.40 ? 521  MET A CB    1 
ATOM   4720  C  CG    . MET D 4  521  ? 4.379   -59.390  46.507  1.00 111.14 ? 521  MET A CG    1 
ATOM   4721  S  SD    . MET D 4  521  ? 5.401   -60.354  45.338  1.00 111.93 ? 521  MET A SD    1 
ATOM   4722  C  CE    . MET D 4  521  ? 6.426   -59.079  44.605  1.00 110.26 ? 521  MET A CE    1 
ATOM   4723  N  N     . GLY D 4  522  ? 0.895   -59.984  49.550  1.00 110.46 ? 522  GLY A N     1 
ATOM   4724  C  CA    . GLY D 4  522  ? -0.272  -60.823  49.888  1.00 108.87 ? 522  GLY A CA    1 
ATOM   4725  C  C     . GLY D 4  522  ? -1.482  -60.572  49.005  1.00 108.10 ? 522  GLY A C     1 
ATOM   4726  O  O     . GLY D 4  522  ? -1.381  -59.969  47.945  1.00 107.71 ? 522  GLY A O     1 
ATOM   4727  N  N     . ILE D 4  523  ? -2.633  -61.043  49.468  1.00 107.47 ? 523  ILE A N     1 
ATOM   4728  C  CA    . ILE D 4  523  ? -3.953  -60.601  49.001  1.00 106.93 ? 523  ILE A CA    1 
ATOM   4729  C  C     . ILE D 4  523  ? -4.341  -59.239  49.700  1.00 106.78 ? 523  ILE A C     1 
ATOM   4730  O  O     . ILE D 4  523  ? -4.060  -59.036  50.894  1.00 106.05 ? 523  ILE A O     1 
ATOM   4731  C  CB    . ILE D 4  523  ? -4.984  -61.803  49.179  1.00 106.93 ? 523  ILE A CB    1 
ATOM   4732  C  CG1   . ILE D 4  523  ? -5.073  -62.688  47.920  1.00 107.18 ? 523  ILE A CG1   1 
ATOM   4733  C  CG2   . ILE D 4  523  ? -6.397  -61.365  49.537  1.00 106.46 ? 523  ILE A CG2   1 
ATOM   4734  C  CD1   . ILE D 4  523  ? -3.765  -63.346  47.437  1.00 106.82 ? 523  ILE A CD1   1 
ATOM   4735  N  N     . VAL D 4  524  ? -4.928  -58.298  48.942  1.00 106.75 ? 524  VAL A N     1 
ATOM   4736  C  CA    . VAL D 4  524  ? -5.300  -56.945  49.467  1.00 106.82 ? 524  VAL A CA    1 
ATOM   4737  C  C     . VAL D 4  524  ? -6.691  -56.378  49.100  1.00 106.64 ? 524  VAL A C     1 
ATOM   4738  O  O     . VAL D 4  524  ? -7.342  -56.850  48.138  1.00 106.98 ? 524  VAL A O     1 
ATOM   4739  C  CB    . VAL D 4  524  ? -4.282  -55.882  49.035  1.00 106.92 ? 524  VAL A CB    1 
ATOM   4740  C  CG1   . VAL D 4  524  ? -3.059  -55.968  49.932  1.00 108.72 ? 524  VAL A CG1   1 
ATOM   4741  C  CG2   . VAL D 4  524  ? -3.926  -56.006  47.520  1.00 106.55 ? 524  VAL A CG2   1 
ATOM   4742  N  N     . GLN D 4  525  ? -7.131  -55.349  49.836  1.00 105.96 ? 525  GLN A N     1 
ATOM   4743  C  CA    . GLN D 4  525  ? -8.377  -54.582  49.478  1.00 105.43 ? 525  GLN A CA    1 
ATOM   4744  C  C     . GLN D 4  525  ? -9.736  -55.351  49.118  1.00 105.92 ? 525  GLN A C     1 
ATOM   4745  O  O     . GLN D 4  525  ? -10.262 -56.099  49.987  1.00 105.89 ? 525  GLN A O     1 
ATOM   4746  C  CB    . GLN D 4  525  ? -8.033  -53.450  48.523  1.00 104.33 ? 525  GLN A CB    1 
ATOM   4747  C  CG    . GLN D 4  525  ? -7.114  -52.503  49.210  1.00 101.97 ? 525  GLN A CG    1 
ATOM   4748  C  CD    . GLN D 4  525  ? -7.446  -51.054  48.937  1.00 100.42 ? 525  GLN A CD    1 
ATOM   4749  O  OE1   . GLN D 4  525  ? -8.100  -50.705  47.937  1.00 100.11 ? 525  GLN A OE1   1 
ATOM   4750  N  NE2   . GLN D 4  525  ? -6.986  -50.184  49.827  1.00 98.77  ? 525  GLN A NE2   1 
ATOM   4751  N  N     . ASP D 4  526  ? -10.333 -55.178  47.919  1.00 105.54 ? 526  ASP A N     1 
ATOM   4752  C  CA    . ASP D 4  526  ? -11.557 -55.985  47.606  1.00 105.26 ? 526  ASP A CA    1 
ATOM   4753  C  C     . ASP D 4  526  ? -11.269 -57.481  47.842  1.00 105.89 ? 526  ASP A C     1 
ATOM   4754  O  O     . ASP D 4  526  ? -11.991 -58.178  48.563  1.00 105.60 ? 526  ASP A O     1 
ATOM   4755  C  CB    . ASP D 4  526  ? -12.083 -55.821  46.162  1.00 104.32 ? 526  ASP A CB    1 
ATOM   4756  C  CG    . ASP D 4  526  ? -12.479 -54.409  45.826  1.00 103.10 ? 526  ASP A CG    1 
ATOM   4757  O  OD1   . ASP D 4  526  ? -12.099 -53.484  46.601  1.00 97.12  ? 526  ASP A OD1   1 
ATOM   4758  O  OD2   . ASP D 4  526  ? -13.167 -54.235  44.767  1.00 103.36 ? 526  ASP A OD2   1 
ATOM   4759  N  N     . THR D 4  527  ? -10.180 -57.954  47.222  1.00 106.73 ? 527  THR A N     1 
ATOM   4760  C  CA    . THR D 4  527  ? -9.858  -59.384  47.167  1.00 106.34 ? 527  THR A CA    1 
ATOM   4761  C  C     . THR D 4  527  ? -9.901  -59.877  48.614  1.00 107.13 ? 527  THR A C     1 
ATOM   4762  O  O     . THR D 4  527  ? -10.727 -60.746  48.955  1.00 107.38 ? 527  THR A O     1 
ATOM   4763  C  CB    . THR D 4  527  ? -8.509  -59.626  46.402  1.00 105.65 ? 527  THR A CB    1 
ATOM   4764  O  OG1   . THR D 4  527  ? -8.592  -58.972  45.135  1.00 104.85 ? 527  THR A OG1   1 
ATOM   4765  C  CG2   . THR D 4  527  ? -8.245  -61.085  46.156  1.00 103.33 ? 527  THR A CG2   1 
ATOM   4766  N  N     . LEU D 4  528  ? -9.084  -59.219  49.450  1.00 107.37 ? 528  LEU A N     1 
ATOM   4767  C  CA    . LEU D 4  528  ? -8.893  -59.534  50.857  1.00 107.52 ? 528  LEU A CA    1 
ATOM   4768  C  C     . LEU D 4  528  ? -10.171 -59.325  51.645  1.00 107.44 ? 528  LEU A C     1 
ATOM   4769  O  O     . LEU D 4  528  ? -10.431 -60.059  52.603  1.00 107.45 ? 528  LEU A O     1 
ATOM   4770  C  CB    . LEU D 4  528  ? -7.741  -58.706  51.458  1.00 107.15 ? 528  LEU A CB    1 
ATOM   4771  C  CG    . LEU D 4  528  ? -7.405  -58.964  52.934  1.00 107.74 ? 528  LEU A CG    1 
ATOM   4772  C  CD1   . LEU D 4  528  ? -6.883  -60.344  53.117  1.00 108.46 ? 528  LEU A CD1   1 
ATOM   4773  C  CD2   . LEU D 4  528  ? -6.393  -58.000  53.488  1.00 108.30 ? 528  LEU A CD2   1 
ATOM   4774  N  N     . CYS D 4  529  ? -10.966 -58.341  51.236  1.00 107.47 ? 529  CYS A N     1 
ATOM   4775  C  CA    . CYS D 4  529  ? -12.180 -58.027  51.976  1.00 107.33 ? 529  CYS A CA    1 
ATOM   4776  C  C     . CYS D 4  529  ? -13.359 -58.970  51.703  1.00 106.69 ? 529  CYS A C     1 
ATOM   4777  O  O     . CYS D 4  529  ? -13.940 -59.487  52.633  1.00 107.33 ? 529  CYS A O     1 
ATOM   4778  C  CB    . CYS D 4  529  ? -12.557 -56.562  51.817  1.00 107.53 ? 529  CYS A CB    1 
ATOM   4779  S  SG    . CYS D 4  529  ? -14.311 -56.302  51.814  1.00 108.69 ? 529  CYS A SG    1 
ATOM   4780  N  N     . GLY D 4  530  ? -13.694 -59.217  50.450  1.00 106.05 ? 530  GLY A N     1 
ATOM   4781  C  CA    . GLY D 4  530  ? -14.700 -60.213  50.125  1.00 105.76 ? 530  GLY A CA    1 
ATOM   4782  C  C     . GLY D 4  530  ? -14.277 -61.672  50.310  1.00 105.82 ? 530  GLY A C     1 
ATOM   4783  O  O     . GLY D 4  530  ? -15.122 -62.568  50.320  1.00 105.37 ? 530  GLY A O     1 
ATOM   4784  N  N     . ILE D 4  531  ? -12.977 -61.946  50.439  1.00 105.94 ? 531  ILE A N     1 
ATOM   4785  C  CA    . ILE D 4  531  ? -12.569 -63.346  50.588  1.00 105.86 ? 531  ILE A CA    1 
ATOM   4786  C  C     . ILE D 4  531  ? -13.100 -63.778  51.908  1.00 105.81 ? 531  ILE A C     1 
ATOM   4787  O  O     . ILE D 4  531  ? -13.386 -64.944  52.098  1.00 105.64 ? 531  ILE A O     1 
ATOM   4788  C  CB    . ILE D 4  531  ? -11.059 -63.579  50.603  1.00 105.85 ? 531  ILE A CB    1 
ATOM   4789  C  CG1   . ILE D 4  531  ? -10.758 -64.947  50.008  1.00 105.65 ? 531  ILE A CG1   1 
ATOM   4790  C  CG2   . ILE D 4  531  ? -10.517 -63.544  52.036  1.00 105.76 ? 531  ILE A CG2   1 
ATOM   4791  C  CD1   . ILE D 4  531  ? -9.303  -65.201  49.725  1.00 105.39 ? 531  ILE A CD1   1 
ATOM   4792  N  N     . ARG D 4  532  ? -13.202 -62.801  52.808  1.00 105.91 ? 532  ARG A N     1 
ATOM   4793  C  CA    . ARG D 4  532  ? -13.763 -62.982  54.115  1.00 106.18 ? 532  ARG A CA    1 
ATOM   4794  C  C     . ARG D 4  532  ? -15.253 -63.180  53.951  1.00 106.18 ? 532  ARG A C     1 
ATOM   4795  O  O     . ARG D 4  532  ? -15.849 -64.121  54.524  1.00 106.57 ? 532  ARG A O     1 
ATOM   4796  C  CB    . ARG D 4  532  ? -13.508 -61.769  54.983  1.00 105.99 ? 532  ARG A CB    1 
ATOM   4797  C  CG    . ARG D 4  532  ? -13.185 -62.200  56.379  1.00 109.43 ? 532  ARG A CG    1 
ATOM   4798  C  CD    . ARG D 4  532  ? -13.698 -61.256  57.462  1.00 115.69 ? 532  ARG A CD    1 
ATOM   4799  N  NE    . ARG D 4  532  ? -15.135 -61.391  57.748  1.00 118.32 ? 532  ARG A NE    1 
ATOM   4800  C  CZ    . ARG D 4  532  ? -16.084 -60.654  57.163  1.00 119.08 ? 532  ARG A CZ    1 
ATOM   4801  N  NH1   . ARG D 4  532  ? -15.761 -59.732  56.240  1.00 119.89 ? 532  ARG A NH1   1 
ATOM   4802  N  NH2   . ARG D 4  532  ? -17.355 -60.832  57.506  1.00 117.62 ? 532  ARG A NH2   1 
ATOM   4803  N  N     . LYS D 4  533  ? -15.862 -62.309  53.152  1.00 105.51 ? 533  LYS A N     1 
ATOM   4804  C  CA    . LYS D 4  533  ? -17.281 -62.433  52.888  1.00 105.26 ? 533  LYS A CA    1 
ATOM   4805  C  C     . LYS D 4  533  ? -17.639 -63.801  52.255  1.00 105.52 ? 533  LYS A C     1 
ATOM   4806  O  O     . LYS D 4  533  ? -18.426 -64.574  52.819  1.00 105.45 ? 533  LYS A O     1 
ATOM   4807  C  CB    . LYS D 4  533  ? -17.773 -61.257  52.066  1.00 104.63 ? 533  LYS A CB    1 
ATOM   4808  C  CG    . LYS D 4  533  ? -17.800 -59.987  52.847  1.00 104.37 ? 533  LYS A CG    1 
ATOM   4809  C  CD    . LYS D 4  533  ? -18.292 -58.858  51.988  1.00 107.19 ? 533  LYS A CD    1 
ATOM   4810  C  CE    . LYS D 4  533  ? -19.798 -58.938  51.723  1.00 109.77 ? 533  LYS A CE    1 
ATOM   4811  N  NZ    . LYS D 4  533  ? -20.574 -58.648  52.969  1.00 112.30 ? 533  LYS A NZ    1 
ATOM   4812  N  N     . LEU D 4  534  ? -17.017 -64.108  51.117  1.00 105.91 ? 534  LEU A N     1 
ATOM   4813  C  CA    . LEU D 4  534  ? -17.268 -65.353  50.370  1.00 105.63 ? 534  LEU A CA    1 
ATOM   4814  C  C     . LEU D 4  534  ? -17.156 -66.572  51.256  1.00 105.95 ? 534  LEU A C     1 
ATOM   4815  O  O     . LEU D 4  534  ? -17.752 -67.612  50.959  1.00 105.77 ? 534  LEU A O     1 
ATOM   4816  C  CB    . LEU D 4  534  ? -16.245 -65.517  49.222  1.00 105.95 ? 534  LEU A CB    1 
ATOM   4817  C  CG    . LEU D 4  534  ? -16.159 -66.887  48.526  1.00 104.49 ? 534  LEU A CG    1 
ATOM   4818  C  CD1   . LEU D 4  534  ? -17.285 -67.023  47.542  1.00 103.21 ? 534  LEU A CD1   1 
ATOM   4819  C  CD2   . LEU D 4  534  ? -14.824 -67.097  47.852  1.00 104.28 ? 534  LEU A CD2   1 
ATOM   4820  N  N     . THR D 4  535  ? -16.372 -66.440  52.324  1.00 105.89 ? 535  THR A N     1 
ATOM   4821  C  CA    . THR D 4  535  ? -15.925 -67.593  53.039  1.00 106.23 ? 535  THR A CA    1 
ATOM   4822  C  C     . THR D 4  535  ? -16.697 -67.830  54.327  1.00 107.42 ? 535  THR A C     1 
ATOM   4823  O  O     . THR D 4  535  ? -16.713 -68.956  54.855  1.00 107.66 ? 535  THR A O     1 
ATOM   4824  C  CB    . THR D 4  535  ? -14.431 -67.559  53.241  1.00 105.87 ? 535  THR A CB    1 
ATOM   4825  O  OG1   . THR D 4  535  ? -13.913 -68.869  53.036  1.00 105.76 ? 535  THR A OG1   1 
ATOM   4826  C  CG2   . THR D 4  535  ? -14.069 -67.067  54.610  1.00 105.21 ? 535  THR A CG2   1 
ATOM   4827  N  N     . LEU D 4  536  ? -17.369 -66.793  54.821  1.00 108.50 ? 536  LEU A N     1 
ATOM   4828  C  CA    . LEU D 4  536  ? -18.323 -66.976  55.914  1.00 109.83 ? 536  LEU A CA    1 
ATOM   4829  C  C     . LEU D 4  536  ? -19.058 -68.350  55.839  1.00 110.83 ? 536  LEU A C     1 
ATOM   4830  O  O     . LEU D 4  536  ? -19.183 -68.942  54.752  1.00 110.96 ? 536  LEU A O     1 
ATOM   4831  C  CB    . LEU D 4  536  ? -19.319 -65.812  55.901  1.00 109.77 ? 536  LEU A CB    1 
ATOM   4832  C  CG    . LEU D 4  536  ? -18.946 -64.492  56.595  1.00 109.87 ? 536  LEU A CG    1 
ATOM   4833  C  CD1   . LEU D 4  536  ? -19.770 -63.316  56.027  1.00 108.38 ? 536  LEU A CD1   1 
ATOM   4834  C  CD2   . LEU D 4  536  ? -19.112 -64.615  58.142  1.00 110.11 ? 536  LEU A CD2   1 
ATOM   4835  N  N     . ARG D 4  537  ? -19.530 -68.872  56.977  1.00 112.02 ? 537  ARG A N     1 
ATOM   4836  C  CA    . ARG D 4  537  ? -20.295 -70.137  56.958  1.00 112.95 ? 537  ARG A CA    1 
ATOM   4837  C  C     . ARG D 4  537  ? -21.595 -69.937  56.242  1.00 112.99 ? 537  ARG A C     1 
ATOM   4838  O  O     . ARG D 4  537  ? -22.089 -70.821  55.574  1.00 112.39 ? 537  ARG A O     1 
ATOM   4839  C  CB    . ARG D 4  537  ? -20.568 -70.656  58.365  1.00 113.45 ? 537  ARG A CB    1 
ATOM   4840  C  CG    . ARG D 4  537  ? -19.391 -71.400  58.992  1.00 115.55 ? 537  ARG A CG    1 
ATOM   4841  C  CD    . ARG D 4  537  ? -19.844 -72.689  59.674  1.00 118.62 ? 537  ARG A CD    1 
ATOM   4842  N  NE    . ARG D 4  537  ? -20.074 -72.514  61.109  1.00 121.19 ? 537  ARG A NE    1 
ATOM   4843  C  CZ    . ARG D 4  537  ? -19.195 -72.828  62.062  1.00 122.23 ? 537  ARG A CZ    1 
ATOM   4844  N  NH1   . ARG D 4  537  ? -18.007 -73.344  61.746  1.00 122.61 ? 537  ARG A NH1   1 
ATOM   4845  N  NH2   . ARG D 4  537  ? -19.508 -72.632  63.339  1.00 122.81 ? 537  ARG A NH2   1 
ATOM   4846  N  N     . ASP D 4  538  ? -22.110 -68.728  56.380  1.00 114.12 ? 538  ASP A N     1 
ATOM   4847  C  CA    . ASP D 4  538  ? -23.375 -68.316  55.812  1.00 115.75 ? 538  ASP A CA    1 
ATOM   4848  C  C     . ASP D 4  538  ? -23.409 -68.229  54.296  1.00 115.87 ? 538  ASP A C     1 
ATOM   4849  O  O     . ASP D 4  538  ? -24.491 -68.190  53.709  1.00 116.22 ? 538  ASP A O     1 
ATOM   4850  C  CB    . ASP D 4  538  ? -23.799 -66.963  56.411  1.00 116.49 ? 538  ASP A CB    1 
ATOM   4851  C  CG    . ASP D 4  538  ? -24.891 -67.104  57.502  1.00 119.12 ? 538  ASP A CG    1 
ATOM   4852  O  OD1   . ASP D 4  538  ? -25.655 -68.114  57.486  1.00 120.97 ? 538  ASP A OD1   1 
ATOM   4853  O  OD2   . ASP D 4  538  ? -24.988 -66.194  58.369  1.00 121.55 ? 538  ASP A OD2   1 
ATOM   4854  N  N     . THR D 4  539  ? -22.243 -68.192  53.661  1.00 116.10 ? 539  THR A N     1 
ATOM   4855  C  CA    . THR D 4  539  ? -22.182 -67.958  52.222  1.00 116.26 ? 539  THR A CA    1 
ATOM   4856  C  C     . THR D 4  539  ? -22.289 -69.219  51.382  1.00 116.40 ? 539  THR A C     1 
ATOM   4857  O  O     . THR D 4  539  ? -21.460 -70.129  51.488  1.00 116.10 ? 539  THR A O     1 
ATOM   4858  C  CB    . THR D 4  539  ? -20.928 -67.189  51.837  1.00 116.26 ? 539  THR A CB    1 
ATOM   4859  O  OG1   . THR D 4  539  ? -20.946 -65.911  52.482  1.00 116.56 ? 539  THR A OG1   1 
ATOM   4860  C  CG2   . THR D 4  539  ? -20.878 -66.979  50.338  1.00 116.88 ? 539  THR A CG2   1 
ATOM   4861  N  N     . PHE D 4  540  ? -23.327 -69.236  50.545  1.00 116.93 ? 540  PHE A N     1 
ATOM   4862  C  CA    . PHE D 4  540  ? -23.621 -70.332  49.619  1.00 117.43 ? 540  PHE A CA    1 
ATOM   4863  C  C     . PHE D 4  540  ? -23.789 -69.822  48.205  1.00 117.73 ? 540  PHE A C     1 
ATOM   4864  O  O     . PHE D 4  540  ? -24.287 -68.723  47.985  1.00 118.00 ? 540  PHE A O     1 
ATOM   4865  C  CB    . PHE D 4  540  ? -24.896 -71.078  50.035  1.00 117.39 ? 540  PHE A CB    1 
ATOM   4866  C  CG    . PHE D 4  540  ? -24.761 -71.810  51.328  1.00 117.78 ? 540  PHE A CG    1 
ATOM   4867  C  CD1   . PHE D 4  540  ? -25.359 -71.326  52.479  1.00 118.06 ? 540  PHE A CD1   1 
ATOM   4868  C  CD2   . PHE D 4  540  ? -23.994 -72.968  51.409  1.00 118.69 ? 540  PHE A CD2   1 
ATOM   4869  C  CE1   . PHE D 4  540  ? -25.207 -71.991  53.696  1.00 118.40 ? 540  PHE A CE1   1 
ATOM   4870  C  CE2   . PHE D 4  540  ? -23.837 -73.642  52.620  1.00 118.67 ? 540  PHE A CE2   1 
ATOM   4871  C  CZ    . PHE D 4  540  ? -24.450 -73.152  53.766  1.00 118.13 ? 540  PHE A CZ    1 
ATOM   4872  N  N     . ILE D 4  541  ? -23.379 -70.621  47.239  1.00 118.16 ? 541  ILE A N     1 
ATOM   4873  C  CA    . ILE D 4  541  ? -23.601 -70.252  45.854  1.00 119.06 ? 541  ILE A CA    1 
ATOM   4874  C  C     . ILE D 4  541  ? -24.330 -71.365  45.141  1.00 119.56 ? 541  ILE A C     1 
ATOM   4875  O  O     . ILE D 4  541  ? -24.255 -72.526  45.545  1.00 119.71 ? 541  ILE A O     1 
ATOM   4876  C  CB    . ILE D 4  541  ? -22.295 -69.840  45.139  1.00 119.05 ? 541  ILE A CB    1 
ATOM   4877  C  CG1   . ILE D 4  541  ? -21.116 -70.617  45.709  1.00 118.54 ? 541  ILE A CG1   1 
ATOM   4878  C  CG2   . ILE D 4  541  ? -22.046 -68.335  45.322  1.00 119.47 ? 541  ILE A CG2   1 
ATOM   4879  C  CD1   . ILE D 4  541  ? -20.006 -69.733  46.163  1.00 117.61 ? 541  ILE A CD1   1 
ATOM   4880  N  N     . GLU D 4  542  ? -25.082 -71.011  44.113  1.00 120.15 ? 542  GLU A N     1 
ATOM   4881  C  CA    . GLU D 4  542  ? -25.834 -72.022  43.407  1.00 120.84 ? 542  GLU A CA    1 
ATOM   4882  C  C     . GLU D 4  542  ? -25.348 -72.163  41.975  1.00 121.03 ? 542  GLU A C     1 
ATOM   4883  O  O     . GLU D 4  542  ? -24.583 -71.305  41.495  1.00 121.51 ? 542  GLU A O     1 
ATOM   4884  C  CB    . GLU D 4  542  ? -27.318 -71.746  43.489  1.00 121.05 ? 542  GLU A CB    1 
ATOM   4885  C  CG    . GLU D 4  542  ? -27.685 -70.292  43.487  1.00 122.81 ? 542  GLU A CG    1 
ATOM   4886  C  CD    . GLU D 4  542  ? -29.189 -70.119  43.600  1.00 126.63 ? 542  GLU A CD    1 
ATOM   4887  O  OE1   . GLU D 4  542  ? -29.926 -70.580  42.691  1.00 128.61 ? 542  GLU A OE1   1 
ATOM   4888  O  OE2   . GLU D 4  542  ? -29.648 -69.544  44.612  1.00 128.13 ? 542  GLU A OE2   1 
ATOM   4889  N  N     . LEU D 4  543  ? -25.797 -73.233  41.307  1.00 120.68 ? 543  LEU A N     1 
ATOM   4890  C  CA    . LEU D 4  543  ? -25.117 -73.773  40.124  1.00 120.48 ? 543  LEU A CA    1 
ATOM   4891  C  C     . LEU D 4  543  ? -24.561 -72.752  39.101  1.00 120.98 ? 543  LEU A C     1 
ATOM   4892  O  O     . LEU D 4  543  ? -23.353 -72.626  38.942  1.00 120.66 ? 543  LEU A O     1 
ATOM   4893  C  CB    . LEU D 4  543  ? -25.977 -74.838  39.457  1.00 119.88 ? 543  LEU A CB    1 
ATOM   4894  C  CG    . LEU D 4  543  ? -25.264 -75.709  38.426  1.00 118.72 ? 543  LEU A CG    1 
ATOM   4895  C  CD1   . LEU D 4  543  ? -24.230 -76.660  39.030  1.00 116.36 ? 543  LEU A CD1   1 
ATOM   4896  C  CD2   . LEU D 4  543  ? -26.318 -76.465  37.671  1.00 118.87 ? 543  LEU A CD2   1 
ATOM   4897  N  N     . ASP D 4  544  ? -25.445 -72.041  38.417  1.00 121.80 ? 544  ASP A N     1 
ATOM   4898  C  CA    . ASP D 4  544  ? -25.079 -70.976  37.485  1.00 122.71 ? 544  ASP A CA    1 
ATOM   4899  C  C     . ASP D 4  544  ? -23.750 -70.319  37.808  1.00 122.58 ? 544  ASP A C     1 
ATOM   4900  O  O     . ASP D 4  544  ? -22.823 -70.386  37.002  1.00 123.16 ? 544  ASP A O     1 
ATOM   4901  C  CB    . ASP D 4  544  ? -26.167 -69.910  37.501  1.00 123.40 ? 544  ASP A CB    1 
ATOM   4902  C  CG    . ASP D 4  544  ? -26.816 -69.776  38.882  1.00 126.67 ? 544  ASP A CG    1 
ATOM   4903  O  OD1   . ASP D 4  544  ? -26.172 -69.175  39.787  1.00 128.47 ? 544  ASP A OD1   1 
ATOM   4904  O  OD2   . ASP D 4  544  ? -27.954 -70.309  39.069  1.00 129.97 ? 544  ASP A OD2   1 
ATOM   4905  N  N     . GLN D 4  545  ? -23.667 -69.690  38.983  1.00 122.26 ? 545  GLN A N     1 
ATOM   4906  C  CA    . GLN D 4  545  ? -22.517 -68.862  39.401  1.00 122.07 ? 545  GLN A CA    1 
ATOM   4907  C  C     . GLN D 4  545  ? -21.325 -69.785  39.640  1.00 120.99 ? 545  GLN A C     1 
ATOM   4908  O  O     . GLN D 4  545  ? -20.212 -69.533  39.183  1.00 120.39 ? 545  GLN A O     1 
ATOM   4909  C  CB    . GLN D 4  545  ? -22.885 -68.134  40.704  1.00 122.21 ? 545  GLN A CB    1 
ATOM   4910  C  CG    . GLN D 4  545  ? -22.433 -66.666  40.889  1.00 123.05 ? 545  GLN A CG    1 
ATOM   4911  C  CD    . GLN D 4  545  ? -22.805 -66.120  42.311  1.00 123.55 ? 545  GLN A CD    1 
ATOM   4912  O  OE1   . GLN D 4  545  ? -22.352 -65.039  42.731  1.00 125.12 ? 545  GLN A OE1   1 
ATOM   4913  N  NE2   . GLN D 4  545  ? -23.628 -66.887  43.047  1.00 124.36 ? 545  GLN A NE2   1 
ATOM   4914  N  N     . VAL D 4  546  ? -21.600 -70.879  40.349  1.00 120.23 ? 546  VAL A N     1 
ATOM   4915  C  CA    . VAL D 4  546  ? -20.599 -71.887  40.696  1.00 119.14 ? 546  VAL A CA    1 
ATOM   4916  C  C     . VAL D 4  546  ? -19.833 -72.377  39.463  1.00 119.02 ? 546  VAL A C     1 
ATOM   4917  O  O     . VAL D 4  546  ? -18.643 -72.631  39.529  1.00 118.82 ? 546  VAL A O     1 
ATOM   4918  C  CB    . VAL D 4  546  ? -21.240 -73.073  41.482  1.00 118.81 ? 546  VAL A CB    1 
ATOM   4919  C  CG1   . VAL D 4  546  ? -20.190 -74.150  41.825  1.00 117.90 ? 546  VAL A CG1   1 
ATOM   4920  C  CG2   . VAL D 4  546  ? -21.950 -72.562  42.735  1.00 116.93 ? 546  VAL A CG2   1 
ATOM   4921  N  N     . LEU D 4  547  ? -20.522 -72.484  38.336  1.00 118.88 ? 547  LEU A N     1 
ATOM   4922  C  CA    . LEU D 4  547  ? -19.877 -72.902  37.101  1.00 118.66 ? 547  LEU A CA    1 
ATOM   4923  C  C     . LEU D 4  547  ? -19.082 -71.780  36.410  1.00 118.56 ? 547  LEU A C     1 
ATOM   4924  O  O     . LEU D 4  547  ? -18.122 -72.077  35.698  1.00 118.83 ? 547  LEU A O     1 
ATOM   4925  C  CB    . LEU D 4  547  ? -20.882 -73.544  36.147  1.00 118.43 ? 547  LEU A CB    1 
ATOM   4926  C  CG    . LEU D 4  547  ? -21.823 -74.544  36.819  1.00 118.80 ? 547  LEU A CG    1 
ATOM   4927  C  CD1   . LEU D 4  547  ? -23.151 -74.567  36.084  1.00 120.32 ? 547  LEU A CD1   1 
ATOM   4928  C  CD2   . LEU D 4  547  ? -21.228 -75.938  36.916  1.00 118.83 ? 547  LEU A CD2   1 
ATOM   4929  N  N     . ASN D 4  548  ? -19.452 -70.510  36.609  1.00 118.00 ? 548  ASN A N     1 
ATOM   4930  C  CA    . ASN D 4  548  ? -18.669 -69.416  36.010  1.00 117.53 ? 548  ASN A CA    1 
ATOM   4931  C  C     . ASN D 4  548  ? -17.410 -69.130  36.771  1.00 116.75 ? 548  ASN A C     1 
ATOM   4932  O  O     . ASN D 4  548  ? -16.392 -68.863  36.166  1.00 116.91 ? 548  ASN A O     1 
ATOM   4933  C  CB    . ASN D 4  548  ? -19.459 -68.129  35.862  1.00 117.90 ? 548  ASN A CB    1 
ATOM   4934  C  CG    . ASN D 4  548  ? -20.177 -68.044  34.543  1.00 119.84 ? 548  ASN A CG    1 
ATOM   4935  O  OD1   . ASN D 4  548  ? -19.663 -68.456  33.492  1.00 120.49 ? 548  ASN A OD1   1 
ATOM   4936  N  ND2   . ASN D 4  548  ? -21.388 -67.510  34.586  1.00 122.69 ? 548  ASN A ND2   1 
ATOM   4937  N  N     . MET D 4  549  ? -17.498 -69.171  38.098  1.00 116.01 ? 549  MET A N     1 
ATOM   4938  C  CA    . MET D 4  549  ? -16.332 -69.106  38.957  1.00 114.89 ? 549  MET A CA    1 
ATOM   4939  C  C     . MET D 4  549  ? -15.469 -70.283  38.608  1.00 114.28 ? 549  MET A C     1 
ATOM   4940  O  O     . MET D 4  549  ? -14.298 -70.116  38.336  1.00 114.84 ? 549  MET A O     1 
ATOM   4941  C  CB    . MET D 4  549  ? -16.697 -69.222  40.425  1.00 114.68 ? 549  MET A CB    1 
ATOM   4942  C  CG    . MET D 4  549  ? -18.035 -68.682  40.790  1.00 114.44 ? 549  MET A CG    1 
ATOM   4943  S  SD    . MET D 4  549  ? -17.961 -68.281  42.522  1.00 115.36 ? 549  MET A SD    1 
ATOM   4944  C  CE    . MET D 4  549  ? -19.543 -67.506  42.770  1.00 115.80 ? 549  MET A CE    1 
ATOM   4945  N  N     . LEU D 4  550  ? -16.034 -71.483  38.593  1.00 113.35 ? 550  LEU A N     1 
ATOM   4946  C  CA    . LEU D 4  550  ? -15.204 -72.625  38.301  1.00 112.54 ? 550  LEU A CA    1 
ATOM   4947  C  C     . LEU D 4  550  ? -14.466 -72.315  37.032  1.00 112.65 ? 550  LEU A C     1 
ATOM   4948  O  O     . LEU D 4  550  ? -13.241 -72.337  37.023  1.00 112.56 ? 550  LEU A O     1 
ATOM   4949  C  CB    . LEU D 4  550  ? -15.993 -73.931  38.196  1.00 112.20 ? 550  LEU A CB    1 
ATOM   4950  C  CG    . LEU D 4  550  ? -16.254 -74.674  39.509  1.00 110.76 ? 550  LEU A CG    1 
ATOM   4951  C  CD1   . LEU D 4  550  ? -16.661 -76.094  39.220  1.00 108.06 ? 550  LEU A CD1   1 
ATOM   4952  C  CD2   . LEU D 4  550  ? -15.031 -74.639  40.434  1.00 109.38 ? 550  LEU A CD2   1 
ATOM   4953  N  N     . TYR D 4  551  ? -15.208 -71.956  35.985  1.00 112.92 ? 551  TYR A N     1 
ATOM   4954  C  CA    . TYR D 4  551  ? -14.609 -71.735  34.671  1.00 113.38 ? 551  TYR A CA    1 
ATOM   4955  C  C     . TYR D 4  551  ? -13.593 -70.591  34.733  1.00 113.87 ? 551  TYR A C     1 
ATOM   4956  O  O     . TYR D 4  551  ? -12.543 -70.655  34.087  1.00 113.97 ? 551  TYR A O     1 
ATOM   4957  C  CB    . TYR D 4  551  ? -15.672 -71.559  33.565  1.00 113.29 ? 551  TYR A CB    1 
ATOM   4958  C  CG    . TYR D 4  551  ? -15.083 -71.434  32.179  1.00 113.24 ? 551  TYR A CG    1 
ATOM   4959  C  CD1   . TYR D 4  551  ? -14.147 -72.349  31.722  1.00 113.88 ? 551  TYR A CD1   1 
ATOM   4960  C  CD2   . TYR D 4  551  ? -15.451 -70.398  31.328  1.00 113.18 ? 551  TYR A CD2   1 
ATOM   4961  C  CE1   . TYR D 4  551  ? -13.554 -72.228  30.462  1.00 114.42 ? 551  TYR A CE1   1 
ATOM   4962  C  CE2   . TYR D 4  551  ? -14.882 -70.277  30.054  1.00 113.73 ? 551  TYR A CE2   1 
ATOM   4963  C  CZ    . TYR D 4  551  ? -13.920 -71.196  29.632  1.00 114.16 ? 551  TYR A CZ    1 
ATOM   4964  O  OH    . TYR D 4  551  ? -13.314 -71.101  28.386  1.00 113.97 ? 551  TYR A OH    1 
ATOM   4965  N  N     . TRP D 4  552  ? -13.889 -69.587  35.559  1.00 114.45 ? 552  TRP A N     1 
ATOM   4966  C  CA    . TRP D 4  552  ? -12.990 -68.454  35.820  1.00 115.09 ? 552  TRP A CA    1 
ATOM   4967  C  C     . TRP D 4  552  ? -11.655 -68.821  36.438  1.00 115.81 ? 552  TRP A C     1 
ATOM   4968  O  O     . TRP D 4  552  ? -10.739 -68.024  36.406  1.00 116.26 ? 552  TRP A O     1 
ATOM   4969  C  CB    . TRP D 4  552  ? -13.638 -67.437  36.741  1.00 114.96 ? 552  TRP A CB    1 
ATOM   4970  C  CG    . TRP D 4  552  ? -14.031 -66.156  36.093  1.00 114.94 ? 552  TRP A CG    1 
ATOM   4971  C  CD1   . TRP D 4  552  ? -15.283 -65.648  35.996  1.00 115.51 ? 552  TRP A CD1   1 
ATOM   4972  C  CD2   . TRP D 4  552  ? -13.167 -65.195  35.504  1.00 114.01 ? 552  TRP A CD2   1 
ATOM   4973  N  NE1   . TRP D 4  552  ? -15.258 -64.443  35.364  1.00 114.57 ? 552  TRP A NE1   1 
ATOM   4974  C  CE2   . TRP D 4  552  ? -13.965 -64.139  35.057  1.00 113.73 ? 552  TRP A CE2   1 
ATOM   4975  C  CE3   . TRP D 4  552  ? -11.789 -65.126  35.310  1.00 115.27 ? 552  TRP A CE3   1 
ATOM   4976  C  CZ2   . TRP D 4  552  ? -13.443 -63.036  34.411  1.00 115.15 ? 552  TRP A CZ2   1 
ATOM   4977  C  CZ3   . TRP D 4  552  ? -11.264 -64.028  34.679  1.00 115.50 ? 552  TRP A CZ3   1 
ATOM   4978  C  CH2   . TRP D 4  552  ? -12.089 -62.994  34.228  1.00 115.53 ? 552  TRP A CH2   1 
ATOM   4979  N  N     . VAL D 4  553  ? -11.530 -69.999  37.025  1.00 116.70 ? 553  VAL A N     1 
ATOM   4980  C  CA    . VAL D 4  553  ? -10.210 -70.442  37.442  1.00 117.55 ? 553  VAL A CA    1 
ATOM   4981  C  C     . VAL D 4  553  ? -9.534  -71.209  36.280  1.00 118.89 ? 553  VAL A C     1 
ATOM   4982  O  O     . VAL D 4  553  ? -10.106 -72.157  35.723  1.00 118.99 ? 553  VAL A O     1 
ATOM   4983  C  CB    . VAL D 4  553  ? -10.274 -71.214  38.753  1.00 117.29 ? 553  VAL A CB    1 
ATOM   4984  C  CG1   . VAL D 4  553  ? -9.003  -71.999  38.964  1.00 117.91 ? 553  VAL A CG1   1 
ATOM   4985  C  CG2   . VAL D 4  553  ? -10.515 -70.257  39.897  1.00 115.29 ? 553  VAL A CG2   1 
ATOM   4986  N  N     . PRO D 4  554  ? -8.334  -70.758  35.881  1.00 120.22 ? 554  PRO A N     1 
ATOM   4987  C  CA    . PRO D 4  554  ? -7.629  -71.121  34.625  1.00 121.53 ? 554  PRO A CA    1 
ATOM   4988  C  C     . PRO D 4  554  ? -6.891  -72.446  34.601  1.00 122.86 ? 554  PRO A C     1 
ATOM   4989  O  O     . PRO D 4  554  ? -6.489  -72.903  33.536  1.00 122.51 ? 554  PRO A O     1 
ATOM   4990  C  CB    . PRO D 4  554  ? -6.612  -70.006  34.473  1.00 121.51 ? 554  PRO A CB    1 
ATOM   4991  C  CG    . PRO D 4  554  ? -6.349  -69.558  35.881  1.00 121.28 ? 554  PRO A CG    1 
ATOM   4992  C  CD    . PRO D 4  554  ? -7.581  -69.779  36.680  1.00 120.06 ? 554  PRO A CD    1 
ATOM   4993  N  N     . ASP D 4  555  ? -6.697  -73.027  35.777  1.00 124.98 ? 555  ASP A N     1 
ATOM   4994  C  CA    . ASP D 4  555  ? -6.032  -74.321  35.921  1.00 127.06 ? 555  ASP A CA    1 
ATOM   4995  C  C     . ASP D 4  555  ? -7.010  -75.363  36.458  1.00 127.35 ? 555  ASP A C     1 
ATOM   4996  O  O     . ASP D 4  555  ? -6.611  -76.416  37.004  1.00 127.64 ? 555  ASP A O     1 
ATOM   4997  C  CB    . ASP D 4  555  ? -4.801  -74.193  36.836  1.00 127.95 ? 555  ASP A CB    1 
ATOM   4998  C  CG    . ASP D 4  555  ? -3.603  -73.540  36.123  1.00 130.65 ? 555  ASP A CG    1 
ATOM   4999  O  OD1   . ASP D 4  555  ? -3.181  -74.066  35.042  1.00 131.78 ? 555  ASP A OD1   1 
ATOM   5000  O  OD2   . ASP D 4  555  ? -3.102  -72.500  36.651  1.00 133.54 ? 555  ASP A OD2   1 
ATOM   5001  N  N     . TRP D 4  556  ? -8.295  -75.056  36.283  1.00 127.46 ? 556  TRP A N     1 
ATOM   5002  C  CA    . TRP D 4  556  ? -9.364  -75.893  36.776  1.00 127.38 ? 556  TRP A CA    1 
ATOM   5003  C  C     . TRP D 4  556  ? -9.535  -77.090  35.865  1.00 127.40 ? 556  TRP A C     1 
ATOM   5004  O  O     . TRP D 4  556  ? -9.859  -76.946  34.687  1.00 127.57 ? 556  TRP A O     1 
ATOM   5005  C  CB    . TRP D 4  556  ? -10.663 -75.101  36.878  1.00 127.52 ? 556  TRP A CB    1 
ATOM   5006  C  CG    . TRP D 4  556  ? -11.816 -75.963  37.199  1.00 127.47 ? 556  TRP A CG    1 
ATOM   5007  C  CD1   . TRP D 4  556  ? -11.952 -76.754  38.285  1.00 128.09 ? 556  TRP A CD1   1 
ATOM   5008  C  CD2   . TRP D 4  556  ? -12.992 -76.150  36.415  1.00 127.34 ? 556  TRP A CD2   1 
ATOM   5009  N  NE1   . TRP D 4  556  ? -13.140 -77.427  38.237  1.00 127.99 ? 556  TRP A NE1   1 
ATOM   5010  C  CE2   . TRP D 4  556  ? -13.804 -77.067  37.098  1.00 127.37 ? 556  TRP A CE2   1 
ATOM   5011  C  CE3   . TRP D 4  556  ? -13.438 -75.633  35.200  1.00 128.40 ? 556  TRP A CE3   1 
ATOM   5012  C  CZ2   . TRP D 4  556  ? -15.046 -77.479  36.614  1.00 127.93 ? 556  TRP A CZ2   1 
ATOM   5013  C  CZ3   . TRP D 4  556  ? -14.683 -76.047  34.713  1.00 128.38 ? 556  TRP A CZ3   1 
ATOM   5014  C  CH2   . TRP D 4  556  ? -15.469 -76.958  35.422  1.00 127.83 ? 556  TRP A CH2   1 
ATOM   5015  N  N     . ASP D 4  557  ? -9.329  -78.270  36.438  1.00 127.35 ? 557  ASP A N     1 
ATOM   5016  C  CA    . ASP D 4  557  ? -9.351  -79.543  35.710  1.00 127.39 ? 557  ASP A CA    1 
ATOM   5017  C  C     . ASP D 4  557  ? -10.707 -79.994  35.166  1.00 126.48 ? 557  ASP A C     1 
ATOM   5018  O  O     . ASP D 4  557  ? -10.850 -81.157  34.778  1.00 126.61 ? 557  ASP A O     1 
ATOM   5019  C  CB    . ASP D 4  557  ? -8.814  -80.659  36.613  1.00 128.18 ? 557  ASP A CB    1 
ATOM   5020  C  CG    . ASP D 4  557  ? -9.476  -80.672  37.990  1.00 130.49 ? 557  ASP A CG    1 
ATOM   5021  O  OD1   . ASP D 4  557  ? -10.655 -80.238  38.093  1.00 133.10 ? 557  ASP A OD1   1 
ATOM   5022  O  OD2   . ASP D 4  557  ? -8.809  -81.107  38.966  1.00 132.69 ? 557  ASP A OD2   1 
ATOM   5023  N  N     . GLY D 4  558  ? -11.698 -79.104  35.153  1.00 125.37 ? 558  GLY A N     1 
ATOM   5024  C  CA    . GLY D 4  558  ? -13.018 -79.445  34.622  1.00 123.84 ? 558  GLY A CA    1 
ATOM   5025  C  C     . GLY D 4  558  ? -13.705 -80.572  35.381  1.00 122.71 ? 558  GLY A C     1 
ATOM   5026  O  O     . GLY D 4  558  ? -14.308 -81.476  34.781  1.00 122.63 ? 558  GLY A O     1 
ATOM   5027  N  N     . VAL D 4  559  ? -13.597 -80.528  36.707  1.00 121.33 ? 559  VAL A N     1 
ATOM   5028  C  CA    . VAL D 4  559  ? -14.253 -81.511  37.564  1.00 119.96 ? 559  VAL A CA    1 
ATOM   5029  C  C     . VAL D 4  559  ? -15.140 -80.779  38.589  1.00 118.72 ? 559  VAL A C     1 
ATOM   5030  O  O     . VAL D 4  559  ? -14.691 -80.505  39.711  1.00 118.85 ? 559  VAL A O     1 
ATOM   5031  C  CB    . VAL D 4  559  ? -13.210 -82.435  38.297  1.00 120.19 ? 559  VAL A CB    1 
ATOM   5032  C  CG1   . VAL D 4  559  ? -13.911 -83.581  39.019  1.00 120.54 ? 559  VAL A CG1   1 
ATOM   5033  C  CG2   . VAL D 4  559  ? -12.152 -82.987  37.328  1.00 119.90 ? 559  VAL A CG2   1 
ATOM   5034  N  N     . ILE D 4  560  ? -16.378 -80.447  38.202  1.00 116.74 ? 560  ILE A N     1 
ATOM   5035  C  CA    . ILE D 4  560  ? -17.353 -79.873  39.137  1.00 114.73 ? 560  ILE A CA    1 
ATOM   5036  C  C     . ILE D 4  560  ? -17.304 -80.713  40.403  1.00 113.67 ? 560  ILE A C     1 
ATOM   5037  O  O     . ILE D 4  560  ? -17.581 -81.912  40.372  1.00 113.74 ? 560  ILE A O     1 
ATOM   5038  C  CB    . ILE D 4  560  ? -18.808 -79.941  38.607  1.00 114.67 ? 560  ILE A CB    1 
ATOM   5039  C  CG1   . ILE D 4  560  ? -18.863 -79.858  37.078  1.00 114.86 ? 560  ILE A CG1   1 
ATOM   5040  C  CG2   . ILE D 4  560  ? -19.716 -78.924  39.314  1.00 113.76 ? 560  ILE A CG2   1 
ATOM   5041  C  CD1   . ILE D 4  560  ? -18.604 -78.493  36.500  1.00 115.40 ? 560  ILE A CD1   1 
ATOM   5042  N  N     . PRO D 4  561  ? -16.907 -80.105  41.517  1.00 112.48 ? 561  PRO A N     1 
ATOM   5043  C  CA    . PRO D 4  561  ? -16.905 -80.831  42.762  1.00 111.78 ? 561  PRO A CA    1 
ATOM   5044  C  C     . PRO D 4  561  ? -18.299 -80.959  43.350  1.00 111.05 ? 561  PRO A C     1 
ATOM   5045  O  O     . PRO D 4  561  ? -19.172 -80.093  43.150  1.00 110.54 ? 561  PRO A O     1 
ATOM   5046  C  CB    . PRO D 4  561  ? -16.047 -79.957  43.668  1.00 111.86 ? 561  PRO A CB    1 
ATOM   5047  C  CG    . PRO D 4  561  ? -16.291 -78.599  43.185  1.00 111.86 ? 561  PRO A CG    1 
ATOM   5048  C  CD    . PRO D 4  561  ? -16.418 -78.732  41.690  1.00 112.49 ? 561  PRO A CD    1 
ATOM   5049  N  N     . THR D 4  562  ? -18.481 -82.050  44.080  1.00 110.13 ? 562  THR A N     1 
ATOM   5050  C  CA    . THR D 4  562  ? -19.732 -82.344  44.705  1.00 109.15 ? 562  THR A CA    1 
ATOM   5051  C  C     . THR D 4  562  ? -19.999 -81.273  45.733  1.00 108.93 ? 562  THR A C     1 
ATOM   5052  O  O     . THR D 4  562  ? -19.078 -80.877  46.457  1.00 108.40 ? 562  THR A O     1 
ATOM   5053  C  CB    . THR D 4  562  ? -19.656 -83.687  45.332  1.00 108.95 ? 562  THR A CB    1 
ATOM   5054  O  OG1   . THR D 4  562  ? -19.242 -84.608  44.321  1.00 108.51 ? 562  THR A OG1   1 
ATOM   5055  C  CG2   . THR D 4  562  ? -21.008 -84.093  45.871  1.00 109.03 ? 562  THR A CG2   1 
ATOM   5056  N  N     . PRO D 4  563  ? -21.250 -80.766  45.759  1.00 108.75 ? 563  PRO A N     1 
ATOM   5057  C  CA    . PRO D 4  563  ? -21.674 -79.705  46.645  1.00 108.77 ? 563  PRO A CA    1 
ATOM   5058  C  C     . PRO D 4  563  ? -21.784 -80.215  48.057  1.00 108.98 ? 563  PRO A C     1 
ATOM   5059  O  O     . PRO D 4  563  ? -22.026 -81.403  48.253  1.00 109.03 ? 563  PRO A O     1 
ATOM   5060  C  CB    . PRO D 4  563  ? -23.062 -79.356  46.113  1.00 108.35 ? 563  PRO A CB    1 
ATOM   5061  C  CG    . PRO D 4  563  ? -23.539 -80.570  45.552  1.00 108.14 ? 563  PRO A CG    1 
ATOM   5062  C  CD    . PRO D 4  563  ? -22.363 -81.190  44.898  1.00 108.54 ? 563  PRO A CD    1 
ATOM   5063  N  N     . ALA D 4  564  ? -21.595 -79.317  49.019  1.00 109.34 ? 564  ALA A N     1 
ATOM   5064  C  CA    . ALA D 4  564  ? -21.825 -79.606  50.425  1.00 110.26 ? 564  ALA A CA    1 
ATOM   5065  C  C     . ALA D 4  564  ? -23.301 -79.912  50.684  1.00 111.11 ? 564  ALA A C     1 
ATOM   5066  O  O     . ALA D 4  564  ? -23.658 -80.719  51.546  1.00 111.11 ? 564  ALA A O     1 
ATOM   5067  C  CB    . ALA D 4  564  ? -21.390 -78.446  51.265  1.00 110.15 ? 564  ALA A CB    1 
ATOM   5068  N  N     . ILE D 4  565  ? -24.160 -79.273  49.912  1.00 112.19 ? 565  ILE A N     1 
ATOM   5069  C  CA    . ILE D 4  565  ? -25.575 -79.481  50.055  1.00 112.98 ? 565  ILE A CA    1 
ATOM   5070  C  C     . ILE D 4  565  ? -26.105 -80.123  48.790  1.00 114.13 ? 565  ILE A C     1 
ATOM   5071  O  O     . ILE D 4  565  ? -25.904 -79.605  47.702  1.00 113.95 ? 565  ILE A O     1 
ATOM   5072  C  CB    . ILE D 4  565  ? -26.236 -78.153  50.382  1.00 112.69 ? 565  ILE A CB    1 
ATOM   5073  C  CG1   . ILE D 4  565  ? -25.839 -77.780  51.809  1.00 111.97 ? 565  ILE A CG1   1 
ATOM   5074  C  CG2   . ILE D 4  565  ? -27.737 -78.225  50.200  1.00 112.44 ? 565  ILE A CG2   1 
ATOM   5075  C  CD1   . ILE D 4  565  ? -26.140 -76.390  52.184  1.00 112.02 ? 565  ILE A CD1   1 
ATOM   5076  N  N     . ILE D 4  566  ? -26.733 -81.285  48.948  1.00 115.86 ? 566  ILE A N     1 
ATOM   5077  C  CA    . ILE D 4  566  ? -27.406 -81.967  47.842  1.00 117.79 ? 566  ILE A CA    1 
ATOM   5078  C  C     . ILE D 4  566  ? -28.914 -82.038  48.070  1.00 119.11 ? 566  ILE A C     1 
ATOM   5079  O  O     . ILE D 4  566  ? -29.672 -82.187  47.106  1.00 119.49 ? 566  ILE A O     1 
ATOM   5080  C  CB    . ILE D 4  566  ? -26.888 -83.406  47.589  1.00 117.62 ? 566  ILE A CB    1 
ATOM   5081  C  CG1   . ILE D 4  566  ? -25.418 -83.543  47.958  1.00 117.98 ? 566  ILE A CG1   1 
ATOM   5082  C  CG2   . ILE D 4  566  ? -27.090 -83.798  46.111  1.00 117.98 ? 566  ILE A CG2   1 
ATOM   5083  C  CD1   . ILE D 4  566  ? -24.935 -84.977  47.935  1.00 118.06 ? 566  ILE A CD1   1 
ATOM   5084  N  N     . LYS D 4  567  ? -29.342 -81.947  49.335  1.00 120.57 ? 567  LYS A N     1 
ATOM   5085  C  CA    . LYS D 4  567  ? -30.774 -81.828  49.712  1.00 122.35 ? 567  LYS A CA    1 
ATOM   5086  C  C     . LYS D 4  567  ? -31.450 -80.731  48.874  1.00 122.01 ? 567  LYS A C     1 
ATOM   5087  O  O     . LYS D 4  567  ? -30.785 -80.136  47.997  1.00 122.35 ? 567  LYS A O     1 
ATOM   5088  C  CB    . LYS D 4  567  ? -30.903 -81.462  51.198  1.00 122.34 ? 567  LYS A CB    1 
ATOM   5089  C  CG    . LYS D 4  567  ? -30.711 -79.949  51.468  1.00 124.66 ? 567  LYS A CG    1 
ATOM   5090  C  CD    . LYS D 4  567  ? -30.212 -79.585  52.884  1.00 124.88 ? 567  LYS A CD    1 
ATOM   5091  C  CE    . LYS D 4  567  ? -28.679 -79.277  52.944  1.00 127.52 ? 567  LYS A CE    1 
ATOM   5092  N  NZ    . LYS D 4  567  ? -28.192 -78.366  54.055  1.00 126.23 ? 567  LYS A NZ    1 
ATOM   5093  N  N     . PRO D 4  568  ? -32.730 -80.389  49.187  1.00 121.59 ? 568  PRO A N     1 
ATOM   5094  C  CA    . PRO D 4  568  ? -33.455 -79.413  48.370  1.00 121.39 ? 568  PRO A CA    1 
ATOM   5095  C  C     . PRO D 4  568  ? -32.494 -78.344  47.812  1.00 121.56 ? 568  PRO A C     1 
ATOM   5096  O  O     . PRO D 4  568  ? -31.933 -77.562  48.587  1.00 121.95 ? 568  PRO A O     1 
ATOM   5097  C  CB    . PRO D 4  568  ? -34.428 -78.781  49.385  1.00 121.09 ? 568  PRO A CB    1 
ATOM   5098  C  CG    . PRO D 4  568  ? -34.100 -79.440  50.741  1.00 120.61 ? 568  PRO A CG    1 
ATOM   5099  C  CD    . PRO D 4  568  ? -33.527 -80.760  50.364  1.00 121.06 ? 568  PRO A CD    1 
ATOM   5100  N  N     . LYS D 4  569  ? -32.256 -78.348  46.496  1.00 121.39 ? 569  LYS A N     1 
ATOM   5101  C  CA    . LYS D 4  569  ? -31.405 -77.329  45.827  1.00 120.57 ? 569  LYS A CA    1 
ATOM   5102  C  C     . LYS D 4  569  ? -29.930 -77.526  46.141  1.00 120.22 ? 569  LYS A C     1 
ATOM   5103  O  O     . LYS D 4  569  ? -29.470 -77.044  47.154  1.00 120.30 ? 569  LYS A O     1 
ATOM   5104  C  CB    . LYS D 4  569  ? -31.849 -75.915  46.237  1.00 120.30 ? 569  LYS A CB    1 
ATOM   5105  C  CG    . LYS D 4  569  ? -31.319 -74.798  45.408  1.00 119.82 ? 569  LYS A CG    1 
ATOM   5106  C  CD    . LYS D 4  569  ? -31.956 -73.488  45.823  1.00 119.17 ? 569  LYS A CD    1 
ATOM   5107  C  CE    . LYS D 4  569  ? -31.469 -72.368  44.918  1.00 119.26 ? 569  LYS A CE    1 
ATOM   5108  N  NZ    . LYS D 4  569  ? -32.412 -71.214  44.790  1.00 119.21 ? 569  LYS A NZ    1 
ATOM   5109  N  N     . PRO D 4  570  ? -29.193 -78.256  45.287  1.00 120.21 ? 570  PRO A N     1 
ATOM   5110  C  CA    . PRO D 4  570  ? -27.730 -78.348  45.389  1.00 120.22 ? 570  PRO A CA    1 
ATOM   5111  C  C     . PRO D 4  570  ? -27.021 -76.993  45.510  1.00 119.88 ? 570  PRO A C     1 
ATOM   5112  O  O     . PRO D 4  570  ? -26.965 -76.233  44.533  1.00 119.72 ? 570  PRO A O     1 
ATOM   5113  C  CB    . PRO D 4  570  ? -27.312 -79.041  44.075  1.00 120.33 ? 570  PRO A CB    1 
ATOM   5114  C  CG    . PRO D 4  570  ? -28.534 -79.080  43.221  1.00 120.81 ? 570  PRO A CG    1 
ATOM   5115  C  CD    . PRO D 4  570  ? -29.697 -79.078  44.178  1.00 120.57 ? 570  PRO A CD    1 
ATOM   5116  N  N     . LEU D 4  571  ? -26.493 -76.723  46.707  1.00 119.48 ? 571  LEU A N     1 
ATOM   5117  C  CA    . LEU D 4  571  ? -25.787 -75.489  47.030  1.00 119.25 ? 571  LEU A CA    1 
ATOM   5118  C  C     . LEU D 4  571  ? -24.370 -75.815  47.432  1.00 119.58 ? 571  LEU A C     1 
ATOM   5119  O  O     . LEU D 4  571  ? -24.126 -76.872  48.013  1.00 119.86 ? 571  LEU A O     1 
ATOM   5120  C  CB    . LEU D 4  571  ? -26.462 -74.803  48.203  1.00 118.89 ? 571  LEU A CB    1 
ATOM   5121  C  CG    . LEU D 4  571  ? -27.197 -73.483  48.030  1.00 118.16 ? 571  LEU A CG    1 
ATOM   5122  C  CD1   . LEU D 4  571  ? -28.288 -73.530  46.994  1.00 117.77 ? 571  LEU A CD1   1 
ATOM   5123  C  CD2   . LEU D 4  571  ? -27.795 -73.153  49.348  1.00 118.74 ? 571  LEU A CD2   1 
ATOM   5124  N  N     . TRP D 4  572  ? -23.448 -74.904  47.128  1.00 119.77 ? 572  TRP A N     1 
ATOM   5125  C  CA    . TRP D 4  572  ? -22.037 -75.027  47.493  1.00 120.03 ? 572  TRP A CA    1 
ATOM   5126  C  C     . TRP D 4  572  ? -21.707 -74.018  48.575  1.00 120.49 ? 572  TRP A C     1 
ATOM   5127  O  O     . TRP D 4  572  ? -22.325 -72.956  48.618  1.00 120.87 ? 572  TRP A O     1 
ATOM   5128  C  CB    . TRP D 4  572  ? -21.178 -74.700  46.290  1.00 119.86 ? 572  TRP A CB    1 
ATOM   5129  C  CG    . TRP D 4  572  ? -21.110 -75.779  45.314  1.00 119.93 ? 572  TRP A CG    1 
ATOM   5130  C  CD1   . TRP D 4  572  ? -20.048 -76.597  45.089  1.00 121.06 ? 572  TRP A CD1   1 
ATOM   5131  C  CD2   . TRP D 4  572  ? -22.133 -76.191  44.409  1.00 119.59 ? 572  TRP A CD2   1 
ATOM   5132  N  NE1   . TRP D 4  572  ? -20.341 -77.503  44.094  1.00 121.41 ? 572  TRP A NE1   1 
ATOM   5133  C  CE2   . TRP D 4  572  ? -21.617 -77.272  43.658  1.00 120.56 ? 572  TRP A CE2   1 
ATOM   5134  C  CE3   . TRP D 4  572  ? -23.429 -75.753  44.152  1.00 119.41 ? 572  TRP A CE3   1 
ATOM   5135  C  CZ2   . TRP D 4  572  ? -22.351 -77.918  42.672  1.00 120.27 ? 572  TRP A CZ2   1 
ATOM   5136  C  CZ3   . TRP D 4  572  ? -24.159 -76.397  43.178  1.00 120.53 ? 572  TRP A CZ3   1 
ATOM   5137  C  CH2   . TRP D 4  572  ? -23.617 -77.469  42.447  1.00 120.44 ? 572  TRP A CH2   1 
ATOM   5138  N  N     . SER D 4  573  ? -20.740 -74.316  49.442  1.00 120.85 ? 573  SER A N     1 
ATOM   5139  C  CA    . SER D 4  573  ? -20.245 -73.283  50.348  1.00 121.19 ? 573  SER A CA    1 
ATOM   5140  C  C     . SER D 4  573  ? -19.192 -72.423  49.670  1.00 121.50 ? 573  SER A C     1 
ATOM   5141  O  O     . SER D 4  573  ? -18.428 -72.902  48.826  1.00 121.38 ? 573  SER A O     1 
ATOM   5142  C  CB    . SER D 4  573  ? -19.638 -73.851  51.611  1.00 121.25 ? 573  SER A CB    1 
ATOM   5143  O  OG    . SER D 4  573  ? -18.956 -72.800  52.296  1.00 121.47 ? 573  SER A OG    1 
ATOM   5144  N  N     . GLY D 4  574  ? -19.153 -71.150  50.056  1.00 121.77 ? 574  GLY A N     1 
ATOM   5145  C  CA    . GLY D 4  574  ? -18.153 -70.238  49.545  1.00 121.96 ? 574  GLY A CA    1 
ATOM   5146  C  C     . GLY D 4  574  ? -16.817 -70.917  49.739  1.00 122.44 ? 574  GLY A C     1 
ATOM   5147  O  O     . GLY D 4  574  ? -16.040 -71.079  48.780  1.00 122.91 ? 574  GLY A O     1 
ATOM   5148  N  N     . LYS D 4  575  ? -16.575 -71.352  50.979  1.00 122.36 ? 575  LYS A N     1 
ATOM   5149  C  CA    . LYS D 4  575  ? -15.355 -72.066  51.349  1.00 122.22 ? 575  LYS A CA    1 
ATOM   5150  C  C     . LYS D 4  575  ? -15.007 -73.074  50.259  1.00 122.45 ? 575  LYS A C     1 
ATOM   5151  O  O     . LYS D 4  575  ? -13.914 -73.043  49.688  1.00 122.19 ? 575  LYS A O     1 
ATOM   5152  C  CB    . LYS D 4  575  ? -15.538 -72.795  52.684  1.00 122.11 ? 575  LYS A CB    1 
ATOM   5153  C  CG    . LYS D 4  575  ? -15.872 -71.912  53.880  1.00 121.24 ? 575  LYS A CG    1 
ATOM   5154  C  CD    . LYS D 4  575  ? -15.757 -72.696  55.175  1.00 119.17 ? 575  LYS A CD    1 
ATOM   5155  C  CE    . LYS D 4  575  ? -16.453 -72.004  56.329  1.00 117.85 ? 575  LYS A CE    1 
ATOM   5156  N  NZ    . LYS D 4  575  ? -15.811 -70.747  56.753  1.00 114.77 ? 575  LYS A NZ    1 
ATOM   5157  N  N     . GLN D 4  576  ? -15.980 -73.928  49.951  1.00 122.81 ? 576  GLN A N     1 
ATOM   5158  C  CA    . GLN D 4  576  ? -15.829 -74.994  48.971  1.00 123.14 ? 576  GLN A CA    1 
ATOM   5159  C  C     . GLN D 4  576  ? -15.209 -74.526  47.653  1.00 123.04 ? 576  GLN A C     1 
ATOM   5160  O  O     . GLN D 4  576  ? -14.058 -74.871  47.364  1.00 123.63 ? 576  GLN A O     1 
ATOM   5161  C  CB    . GLN D 4  576  ? -17.172 -75.661  48.717  1.00 123.17 ? 576  GLN A CB    1 
ATOM   5162  C  CG    . GLN D 4  576  ? -17.103 -77.145  48.554  1.00 123.98 ? 576  GLN A CG    1 
ATOM   5163  C  CD    . GLN D 4  576  ? -18.478 -77.749  48.677  1.00 126.29 ? 576  GLN A CD    1 
ATOM   5164  O  OE1   . GLN D 4  576  ? -19.484 -77.049  48.524  1.00 126.83 ? 576  GLN A OE1   1 
ATOM   5165  N  NE2   . GLN D 4  576  ? -18.542 -79.053  48.957  1.00 127.62 ? 576  GLN A NE2   1 
ATOM   5166  N  N     . ILE D 4  577  ? -15.934 -73.728  46.865  1.00 122.50 ? 577  ILE A N     1 
ATOM   5167  C  CA    . ILE D 4  577  ? -15.450 -73.391  45.508  1.00 121.79 ? 577  ILE A CA    1 
ATOM   5168  C  C     . ILE D 4  577  ? -14.102 -72.687  45.520  1.00 121.11 ? 577  ILE A C     1 
ATOM   5169  O  O     . ILE D 4  577  ? -13.316 -72.833  44.583  1.00 120.56 ? 577  ILE A O     1 
ATOM   5170  C  CB    . ILE D 4  577  ? -16.437 -72.550  44.697  1.00 121.76 ? 577  ILE A CB    1 
ATOM   5171  C  CG1   . ILE D 4  577  ? -16.600 -71.200  45.358  1.00 121.99 ? 577  ILE A CG1   1 
ATOM   5172  C  CG2   . ILE D 4  577  ? -17.783 -73.258  44.545  1.00 121.88 ? 577  ILE A CG2   1 
ATOM   5173  C  CD1   . ILE D 4  577  ? -16.641 -70.103  44.374  1.00 124.02 ? 577  ILE A CD1   1 
ATOM   5174  N  N     . LEU D 4  578  ? -13.852 -71.937  46.596  1.00 120.50 ? 578  LEU A N     1 
ATOM   5175  C  CA    . LEU D 4  578  ? -12.586 -71.230  46.798  1.00 119.80 ? 578  LEU A CA    1 
ATOM   5176  C  C     . LEU D 4  578  ? -11.382 -72.177  46.751  1.00 119.88 ? 578  LEU A C     1 
ATOM   5177  O  O     . LEU D 4  578  ? -10.339 -71.856  46.147  1.00 119.50 ? 578  LEU A O     1 
ATOM   5178  C  CB    . LEU D 4  578  ? -12.633 -70.450  48.112  1.00 118.88 ? 578  LEU A CB    1 
ATOM   5179  C  CG    . LEU D 4  578  ? -11.377 -69.718  48.567  1.00 117.49 ? 578  LEU A CG    1 
ATOM   5180  C  CD1   . LEU D 4  578  ? -10.577 -69.009  47.451  1.00 113.85 ? 578  LEU A CD1   1 
ATOM   5181  C  CD2   . LEU D 4  578  ? -11.816 -68.762  49.656  1.00 117.16 ? 578  LEU A CD2   1 
ATOM   5182  N  N     . SER D 4  579  ? -11.575 -73.353  47.360  1.00 119.90 ? 579  SER A N     1 
ATOM   5183  C  CA    . SER D 4  579  ? -10.532 -74.362  47.568  1.00 120.21 ? 579  SER A CA    1 
ATOM   5184  C  C     . SER D 4  579  ? -9.998  -74.876  46.259  1.00 120.37 ? 579  SER A C     1 
ATOM   5185  O  O     . SER D 4  579  ? -8.889  -75.444  46.187  1.00 120.59 ? 579  SER A O     1 
ATOM   5186  C  CB    . SER D 4  579  ? -11.088 -75.536  48.362  1.00 120.12 ? 579  SER A CB    1 
ATOM   5187  O  OG    . SER D 4  579  ? -11.881 -75.087  49.447  1.00 120.72 ? 579  SER A OG    1 
ATOM   5188  N  N     . VAL D 4  580  ? -10.815 -74.676  45.229  1.00 120.25 ? 580  VAL A N     1 
ATOM   5189  C  CA    . VAL D 4  580  ? -10.451 -75.027  43.869  1.00 119.95 ? 580  VAL A CA    1 
ATOM   5190  C  C     . VAL D 4  580  ? -9.306  -74.132  43.404  1.00 119.54 ? 580  VAL A C     1 
ATOM   5191  O  O     . VAL D 4  580  ? -8.758  -74.336  42.335  1.00 119.77 ? 580  VAL A O     1 
ATOM   5192  C  CB    . VAL D 4  580  ? -11.664 -74.922  42.902  1.00 119.96 ? 580  VAL A CB    1 
ATOM   5193  C  CG1   . VAL D 4  580  ? -11.416 -75.722  41.628  1.00 119.53 ? 580  VAL A CG1   1 
ATOM   5194  C  CG2   . VAL D 4  580  ? -12.925 -75.405  43.584  1.00 119.66 ? 580  VAL A CG2   1 
ATOM   5195  N  N     . ALA D 4  581  ? -8.932  -73.148  44.204  1.00 118.87 ? 581  ALA A N     1 
ATOM   5196  C  CA    . ALA D 4  581  ? -7.816  -72.333  43.814  1.00 118.98 ? 581  ALA A CA    1 
ATOM   5197  C  C     . ALA D 4  581  ? -6.563  -72.830  44.511  1.00 119.33 ? 581  ALA A C     1 
ATOM   5198  O  O     . ALA D 4  581  ? -5.427  -72.631  44.018  1.00 119.38 ? 581  ALA A O     1 
ATOM   5199  C  CB    . ALA D 4  581  ? -8.079  -70.922  44.160  1.00 119.18 ? 581  ALA A CB    1 
ATOM   5200  N  N     . ILE D 4  582  ? -6.784  -73.471  45.662  1.00 119.28 ? 582  ILE A N     1 
ATOM   5201  C  CA    . ILE D 4  582  ? -5.708  -73.943  46.526  1.00 119.00 ? 582  ILE A CA    1 
ATOM   5202  C  C     . ILE D 4  582  ? -5.271  -75.319  46.073  1.00 119.49 ? 582  ILE A C     1 
ATOM   5203  O  O     . ILE D 4  582  ? -6.096  -76.244  46.057  1.00 119.69 ? 582  ILE A O     1 
ATOM   5204  C  CB    . ILE D 4  582  ? -6.158  -74.034  47.968  1.00 118.48 ? 582  ILE A CB    1 
ATOM   5205  C  CG1   . ILE D 4  582  ? -6.527  -72.651  48.485  1.00 117.46 ? 582  ILE A CG1   1 
ATOM   5206  C  CG2   . ILE D 4  582  ? -5.045  -74.596  48.799  1.00 118.72 ? 582  ILE A CG2   1 
ATOM   5207  C  CD1   . ILE D 4  582  ? -7.272  -72.659  49.797  1.00 116.39 ? 582  ILE A CD1   1 
ATOM   5208  N  N     . PRO D 4  583  ? -3.981  -75.455  45.701  1.00 119.81 ? 583  PRO A N     1 
ATOM   5209  C  CA    . PRO D 4  583  ? -3.371  -76.637  45.085  1.00 120.53 ? 583  PRO A CA    1 
ATOM   5210  C  C     . PRO D 4  583  ? -3.404  -77.925  45.922  1.00 121.29 ? 583  PRO A C     1 
ATOM   5211  O  O     . PRO D 4  583  ? -4.058  -77.995  46.967  1.00 121.51 ? 583  PRO A O     1 
ATOM   5212  C  CB    . PRO D 4  583  ? -1.924  -76.193  44.840  1.00 120.40 ? 583  PRO A CB    1 
ATOM   5213  C  CG    . PRO D 4  583  ? -1.980  -74.740  44.815  1.00 119.93 ? 583  PRO A CG    1 
ATOM   5214  C  CD    . PRO D 4  583  ? -2.993  -74.380  45.842  1.00 119.61 ? 583  PRO A CD    1 
ATOM   5215  N  N     . ASN D 4  584  ? -2.702  -78.951  45.461  1.00 121.84 ? 584  ASN A N     1 
ATOM   5216  C  CA    . ASN D 4  584  ? -2.837  -80.252  46.092  1.00 122.26 ? 584  ASN A CA    1 
ATOM   5217  C  C     . ASN D 4  584  ? -1.768  -80.515  47.143  1.00 122.48 ? 584  ASN A C     1 
ATOM   5218  O  O     . ASN D 4  584  ? -0.577  -80.204  46.956  1.00 122.41 ? 584  ASN A O     1 
ATOM   5219  C  CB    . ASN D 4  584  ? -2.880  -81.353  45.031  1.00 122.36 ? 584  ASN A CB    1 
ATOM   5220  C  CG    . ASN D 4  584  ? -3.805  -81.006  43.878  1.00 122.49 ? 584  ASN A CG    1 
ATOM   5221  O  OD1   . ASN D 4  584  ? -3.667  -79.953  43.233  1.00 122.34 ? 584  ASN A OD1   1 
ATOM   5222  N  ND2   . ASN D 4  584  ? -4.765  -81.880  43.622  1.00 122.79 ? 584  ASN A ND2   1 
ATOM   5223  N  N     . GLY D 4  585  ? -2.224  -81.065  48.261  1.00 122.59 ? 585  GLY A N     1 
ATOM   5224  C  CA    . GLY D 4  585  ? -1.352  -81.456  49.358  1.00 122.96 ? 585  GLY A CA    1 
ATOM   5225  C  C     . GLY D 4  585  ? -0.924  -80.264  50.183  1.00 123.06 ? 585  GLY A C     1 
ATOM   5226  O  O     . GLY D 4  585  ? 0.119   -80.305  50.851  1.00 123.48 ? 585  GLY A O     1 
ATOM   5227  N  N     . ILE D 4  586  ? -1.720  -79.195  50.122  1.00 122.71 ? 586  ILE A N     1 
ATOM   5228  C  CA    . ILE D 4  586  ? -1.444  -77.985  50.889  1.00 122.13 ? 586  ILE A CA    1 
ATOM   5229  C  C     . ILE D 4  586  ? -2.086  -78.131  52.254  1.00 122.36 ? 586  ILE A C     1 
ATOM   5230  O  O     . ILE D 4  586  ? -3.297  -78.130  52.381  1.00 122.29 ? 586  ILE A O     1 
ATOM   5231  C  CB    . ILE D 4  586  ? -1.955  -76.720  50.162  1.00 121.78 ? 586  ILE A CB    1 
ATOM   5232  C  CG1   . ILE D 4  586  ? -1.071  -76.393  48.952  1.00 120.13 ? 586  ILE A CG1   1 
ATOM   5233  C  CG2   . ILE D 4  586  ? -2.085  -75.545  51.122  1.00 121.24 ? 586  ILE A CG2   1 
ATOM   5234  C  CD1   . ILE D 4  586  ? 0.362   -76.234  49.253  1.00 117.63 ? 586  ILE A CD1   1 
ATOM   5235  N  N     . HIS D 4  587  ? -1.265  -78.299  53.273  1.00 122.86 ? 587  HIS A N     1 
ATOM   5236  C  CA    . HIS D 4  587  ? -1.789  -78.495  54.606  1.00 123.70 ? 587  HIS A CA    1 
ATOM   5237  C  C     . HIS D 4  587  ? -1.389  -77.279  55.435  1.00 123.71 ? 587  HIS A C     1 
ATOM   5238  O  O     . HIS D 4  587  ? -0.309  -76.719  55.256  1.00 123.77 ? 587  HIS A O     1 
ATOM   5239  C  CB    . HIS D 4  587  ? -1.311  -79.831  55.228  1.00 124.07 ? 587  HIS A CB    1 
ATOM   5240  C  CG    . HIS D 4  587  ? -1.215  -80.977  54.250  1.00 126.03 ? 587  HIS A CG    1 
ATOM   5241  N  ND1   . HIS D 4  587  ? -2.288  -81.420  53.499  1.00 127.54 ? 587  HIS A ND1   1 
ATOM   5242  C  CD2   . HIS D 4  587  ? -0.169  -81.778  53.912  1.00 127.31 ? 587  HIS A CD2   1 
ATOM   5243  C  CE1   . HIS D 4  587  ? -1.905  -82.429  52.732  1.00 127.41 ? 587  HIS A CE1   1 
ATOM   5244  N  NE2   . HIS D 4  587  ? -0.624  -82.668  52.963  1.00 127.17 ? 587  HIS A NE2   1 
ATOM   5245  N  N     . LEU D 4  588  ? -2.277  -76.858  56.325  1.00 123.86 ? 588  LEU A N     1 
ATOM   5246  C  CA    . LEU D 4  588  ? -2.061  -75.656  57.101  1.00 123.88 ? 588  LEU A CA    1 
ATOM   5247  C  C     . LEU D 4  588  ? -3.091  -75.588  58.216  1.00 124.36 ? 588  LEU A C     1 
ATOM   5248  O  O     . LEU D 4  588  ? -4.275  -75.845  57.985  1.00 124.27 ? 588  LEU A O     1 
ATOM   5249  C  CB    . LEU D 4  588  ? -2.177  -74.464  56.172  1.00 123.66 ? 588  LEU A CB    1 
ATOM   5250  C  CG    . LEU D 4  588  ? -2.076  -73.052  56.716  1.00 123.32 ? 588  LEU A CG    1 
ATOM   5251  C  CD1   . LEU D 4  588  ? -1.357  -72.152  55.707  1.00 121.94 ? 588  LEU A CD1   1 
ATOM   5252  C  CD2   . LEU D 4  588  ? -3.472  -72.536  57.034  1.00 122.60 ? 588  LEU A CD2   1 
ATOM   5253  N  N     . GLN D 4  589  ? -2.635  -75.255  59.421  1.00 125.00 ? 589  GLN A N     1 
ATOM   5254  C  CA    . GLN D 4  589  ? -3.486  -75.279  60.605  1.00 126.04 ? 589  GLN A CA    1 
ATOM   5255  C  C     . GLN D 4  589  ? -3.226  -74.068  61.474  1.00 126.35 ? 589  GLN A C     1 
ATOM   5256  O  O     . GLN D 4  589  ? -2.079  -73.659  61.575  1.00 126.64 ? 589  GLN A O     1 
ATOM   5257  C  CB    . GLN D 4  589  ? -3.187  -76.521  61.425  1.00 126.27 ? 589  GLN A CB    1 
ATOM   5258  C  CG    . GLN D 4  589  ? -4.332  -76.894  62.349  1.00 128.36 ? 589  GLN A CG    1 
ATOM   5259  C  CD    . GLN D 4  589  ? -3.959  -77.969  63.340  1.00 131.11 ? 589  GLN A CD    1 
ATOM   5260  O  OE1   . GLN D 4  589  ? -3.115  -77.748  64.215  1.00 132.93 ? 589  GLN A OE1   1 
ATOM   5261  N  NE2   . GLN D 4  589  ? -4.596  -79.141  63.224  1.00 132.01 ? 589  GLN A NE2   1 
ATOM   5262  N  N     . ARG D 4  590  ? -4.247  -73.497  62.121  1.00 126.81 ? 590  ARG A N     1 
ATOM   5263  C  CA    . ARG D 4  590  ? -3.954  -72.362  62.990  1.00 127.67 ? 590  ARG A CA    1 
ATOM   5264  C  C     . ARG D 4  590  ? -4.378  -72.334  64.446  1.00 128.99 ? 590  ARG A C     1 
ATOM   5265  O  O     . ARG D 4  590  ? -3.511  -72.370  65.326  1.00 129.59 ? 590  ARG A O     1 
ATOM   5266  C  CB    . ARG D 4  590  ? -4.340  -71.036  62.380  1.00 127.35 ? 590  ARG A CB    1 
ATOM   5267  C  CG    . ARG D 4  590  ? -3.378  -69.953  62.879  1.00 127.07 ? 590  ARG A CG    1 
ATOM   5268  C  CD    . ARG D 4  590  ? -4.007  -68.580  63.141  1.00 125.87 ? 590  ARG A CD    1 
ATOM   5269  N  NE    . ARG D 4  590  ? -4.925  -68.146  62.095  1.00 124.36 ? 590  ARG A NE    1 
ATOM   5270  C  CZ    . ARG D 4  590  ? -4.621  -68.047  60.804  1.00 124.86 ? 590  ARG A CZ    1 
ATOM   5271  N  NH1   . ARG D 4  590  ? -3.402  -68.366  60.351  1.00 124.64 ? 590  ARG A NH1   1 
ATOM   5272  N  NH2   . ARG D 4  590  ? -5.563  -67.650  59.954  1.00 125.48 ? 590  ARG A NH2   1 
ATOM   5273  N  N     . PHE D 4  591  ? -5.685  -72.232  64.700  1.00 130.33 ? 591  PHE A N     1 
ATOM   5274  C  CA    . PHE D 4  591  ? -6.236  -71.887  66.039  1.00 131.39 ? 591  PHE A CA    1 
ATOM   5275  C  C     . PHE D 4  591  ? -5.940  -70.423  66.416  1.00 131.86 ? 591  PHE A C     1 
ATOM   5276  O  O     . PHE D 4  591  ? -4.816  -70.095  66.777  1.00 132.10 ? 591  PHE A O     1 
ATOM   5277  C  CB    . PHE D 4  591  ? -5.727  -72.828  67.158  1.00 131.66 ? 591  PHE A CB    1 
ATOM   5278  C  CG    . PHE D 4  591  ? -5.984  -74.283  66.903  1.00 132.12 ? 591  PHE A CG    1 
ATOM   5279  C  CD1   . PHE D 4  591  ? -4.976  -75.098  66.397  1.00 132.43 ? 591  PHE A CD1   1 
ATOM   5280  C  CD2   . PHE D 4  591  ? -7.234  -74.843  67.179  1.00 133.03 ? 591  PHE A CD2   1 
ATOM   5281  C  CE1   . PHE D 4  591  ? -5.210  -76.443  66.152  1.00 133.66 ? 591  PHE A CE1   1 
ATOM   5282  C  CE2   . PHE D 4  591  ? -7.490  -76.198  66.941  1.00 133.76 ? 591  PHE A CE2   1 
ATOM   5283  C  CZ    . PHE D 4  591  ? -6.475  -77.004  66.425  1.00 133.77 ? 591  PHE A CZ    1 
ATOM   5284  N  N     . ASP D 4  592  ? -6.933  -69.543  66.314  1.00 132.64 ? 592  ASP A N     1 
ATOM   5285  C  CA    . ASP D 4  592  ? -6.782  -68.163  66.799  1.00 133.41 ? 592  ASP A CA    1 
ATOM   5286  C  C     . ASP D 4  592  ? -7.052  -68.170  68.314  1.00 133.80 ? 592  ASP A C     1 
ATOM   5287  O  O     . ASP D 4  592  ? -6.187  -68.573  69.083  1.00 134.09 ? 592  ASP A O     1 
ATOM   5288  C  CB    . ASP D 4  592  ? -7.695  -67.174  66.040  1.00 133.60 ? 592  ASP A CB    1 
ATOM   5289  C  CG    . ASP D 4  592  ? -7.407  -67.124  64.528  1.00 133.99 ? 592  ASP A CG    1 
ATOM   5290  O  OD1   . ASP D 4  592  ? -6.350  -66.589  64.126  1.00 134.95 ? 592  ASP A OD1   1 
ATOM   5291  O  OD2   . ASP D 4  592  ? -8.256  -67.591  63.735  1.00 134.04 ? 592  ASP A OD2   1 
ATOM   5292  N  N     . GLU D 4  593  ? -8.247  -67.774  68.747  1.00 134.11 ? 593  GLU A N     1 
ATOM   5293  C  CA    . GLU D 4  593  ? -8.564  -67.814  70.160  1.00 134.32 ? 593  GLU A CA    1 
ATOM   5294  C  C     . GLU D 4  593  ? -9.190  -69.144  70.508  1.00 134.24 ? 593  GLU A C     1 
ATOM   5295  O  O     . GLU D 4  593  ? -8.581  -70.179  70.257  1.00 134.15 ? 593  GLU A O     1 
ATOM   5296  C  CB    . GLU D 4  593  ? -9.464  -66.652  70.552  1.00 134.62 ? 593  GLU A CB    1 
ATOM   5297  C  CG    . GLU D 4  593  ? -9.508  -66.394  72.059  1.00 136.72 ? 593  GLU A CG    1 
ATOM   5298  C  CD    . GLU D 4  593  ? -8.136  -66.066  72.658  1.00 139.11 ? 593  GLU A CD    1 
ATOM   5299  O  OE1   . GLU D 4  593  ? -7.702  -66.772  73.605  1.00 140.47 ? 593  GLU A OE1   1 
ATOM   5300  O  OE2   . GLU D 4  593  ? -7.494  -65.100  72.187  1.00 140.01 ? 593  GLU A OE2   1 
ATOM   5301  N  N     . GLY D 4  594  ? -10.402 -69.112  71.072  1.00 134.51 ? 594  GLY A N     1 
ATOM   5302  C  CA    . GLY D 4  594  ? -11.095 -70.310  71.577  1.00 134.53 ? 594  GLY A CA    1 
ATOM   5303  C  C     . GLY D 4  594  ? -11.578 -71.254  70.484  1.00 134.44 ? 594  GLY A C     1 
ATOM   5304  O  O     . GLY D 4  594  ? -12.780 -71.297  70.195  1.00 134.80 ? 594  GLY A O     1 
ATOM   5305  N  N     . THR D 4  595  ? -10.636 -72.023  69.916  1.00 133.93 ? 595  THR A N     1 
ATOM   5306  C  CA    . THR D 4  595  ? -10.816 -72.808  68.684  1.00 133.27 ? 595  THR A CA    1 
ATOM   5307  C  C     . THR D 4  595  ? -10.734 -74.291  68.987  1.00 132.93 ? 595  THR A C     1 
ATOM   5308  O  O     . THR D 4  595  ? -9.756  -74.754  69.540  1.00 132.93 ? 595  THR A O     1 
ATOM   5309  C  CB    . THR D 4  595  ? -9.713  -72.469  67.668  1.00 133.20 ? 595  THR A CB    1 
ATOM   5310  O  OG1   . THR D 4  595  ? -9.502  -71.054  67.643  1.00 133.05 ? 595  THR A OG1   1 
ATOM   5311  C  CG2   . THR D 4  595  ? -10.084 -72.940  66.285  1.00 133.05 ? 595  THR A CG2   1 
ATOM   5312  N  N     . THR D 4  596  ? -11.746 -75.043  68.603  1.00 132.75 ? 596  THR A N     1 
ATOM   5313  C  CA    . THR D 4  596  ? -11.910 -76.353  69.197  1.00 133.21 ? 596  THR A CA    1 
ATOM   5314  C  C     . THR D 4  596  ? -11.948 -77.547  68.224  1.00 133.26 ? 596  THR A C     1 
ATOM   5315  O  O     . THR D 4  596  ? -12.500 -78.606  68.569  1.00 133.79 ? 596  THR A O     1 
ATOM   5316  C  CB    . THR D 4  596  ? -13.171 -76.389  70.159  1.00 133.46 ? 596  THR A CB    1 
ATOM   5317  O  OG1   . THR D 4  596  ? -14.328 -75.877  69.482  1.00 133.50 ? 596  THR A OG1   1 
ATOM   5318  C  CG2   . THR D 4  596  ? -12.942 -75.565  71.436  1.00 133.61 ? 596  THR A CG2   1 
ATOM   5319  N  N     . LEU D 4  597  ? -11.344 -77.416  67.040  1.00 132.81 ? 597  LEU A N     1 
ATOM   5320  C  CA    . LEU D 4  597  ? -11.568 -78.399  65.956  1.00 132.37 ? 597  LEU A CA    1 
ATOM   5321  C  C     . LEU D 4  597  ? -13.073 -78.519  65.714  1.00 132.27 ? 597  LEU A C     1 
ATOM   5322  O  O     . LEU D 4  597  ? -13.526 -79.319  64.903  1.00 132.36 ? 597  LEU A O     1 
ATOM   5323  C  CB    . LEU D 4  597  ? -10.984 -79.788  66.275  1.00 132.14 ? 597  LEU A CB    1 
ATOM   5324  C  CG    . LEU D 4  597  ? -9.558  -79.960  66.804  1.00 132.18 ? 597  LEU A CG    1 
ATOM   5325  C  CD1   . LEU D 4  597  ? -9.535  -80.998  67.944  1.00 132.19 ? 597  LEU A CD1   1 
ATOM   5326  C  CD2   . LEU D 4  597  ? -8.567  -80.305  65.686  1.00 131.24 ? 597  LEU A CD2   1 
ATOM   5327  N  N     . LEU D 4  598  ? -13.834 -77.722  66.458  1.00 132.18 ? 598  LEU A N     1 
ATOM   5328  C  CA    . LEU D 4  598  ? -15.258 -77.545  66.251  1.00 132.27 ? 598  LEU A CA    1 
ATOM   5329  C  C     . LEU D 4  598  ? -15.591 -76.040  66.095  1.00 132.31 ? 598  LEU A C     1 
ATOM   5330  O  O     . LEU D 4  598  ? -16.765 -75.654  66.100  1.00 132.57 ? 598  LEU A O     1 
ATOM   5331  C  CB    . LEU D 4  598  ? -16.021 -78.183  67.408  1.00 132.31 ? 598  LEU A CB    1 
ATOM   5332  C  CG    . LEU D 4  598  ? -17.453 -78.701  67.200  1.00 133.38 ? 598  LEU A CG    1 
ATOM   5333  C  CD1   . LEU D 4  598  ? -18.451 -78.011  68.143  1.00 134.20 ? 598  LEU A CD1   1 
ATOM   5334  C  CD2   . LEU D 4  598  ? -17.901 -78.634  65.730  1.00 133.81 ? 598  LEU A CD2   1 
ATOM   5335  N  N     . SER D 4  599  ? -14.538 -75.221  65.933  1.00 131.98 ? 599  SER A N     1 
ATOM   5336  C  CA    . SER D 4  599  ? -14.575 -73.754  65.737  1.00 131.35 ? 599  SER A CA    1 
ATOM   5337  C  C     . SER D 4  599  ? -15.925 -73.093  65.902  1.00 131.48 ? 599  SER A C     1 
ATOM   5338  O  O     . SER D 4  599  ? -16.516 -72.694  64.907  1.00 131.52 ? 599  SER A O     1 
ATOM   5339  C  CB    . SER D 4  599  ? -14.052 -73.394  64.351  1.00 131.27 ? 599  SER A CB    1 
ATOM   5340  O  OG    . SER D 4  599  ? -12.889 -74.118  64.034  1.00 130.63 ? 599  SER A OG    1 
ATOM   5341  N  N     . PRO D 4  600  ? -16.406 -72.939  67.155  1.00 131.68 ? 600  PRO A N     1 
ATOM   5342  C  CA    . PRO D 4  600  ? -17.741 -72.383  67.412  1.00 131.64 ? 600  PRO A CA    1 
ATOM   5343  C  C     . PRO D 4  600  ? -17.783 -70.885  67.112  1.00 131.73 ? 600  PRO A C     1 
ATOM   5344  O  O     . PRO D 4  600  ? -18.792 -70.227  67.377  1.00 131.84 ? 600  PRO A O     1 
ATOM   5345  C  CB    . PRO D 4  600  ? -17.926 -72.615  68.910  1.00 131.65 ? 600  PRO A CB    1 
ATOM   5346  C  CG    . PRO D 4  600  ? -16.549 -72.550  69.466  1.00 131.75 ? 600  PRO A CG    1 
ATOM   5347  C  CD    . PRO D 4  600  ? -15.699 -73.233  68.416  1.00 131.88 ? 600  PRO A CD    1 
ATOM   5348  N  N     . LYS D 4  601  ? -16.675 -70.366  66.577  1.00 131.32 ? 601  LYS A N     1 
ATOM   5349  C  CA    . LYS D 4  601  ? -16.590 -69.002  66.117  1.00 130.75 ? 601  LYS A CA    1 
ATOM   5350  C  C     . LYS D 4  601  ? -16.417 -69.016  64.614  1.00 129.80 ? 601  LYS A C     1 
ATOM   5351  O  O     . LYS D 4  601  ? -16.567 -67.984  63.963  1.00 129.69 ? 601  LYS A O     1 
ATOM   5352  C  CB    . LYS D 4  601  ? -15.392 -68.320  66.766  1.00 130.90 ? 601  LYS A CB    1 
ATOM   5353  C  CG    . LYS D 4  601  ? -15.615 -67.882  68.219  1.00 132.18 ? 601  LYS A CG    1 
ATOM   5354  C  CD    . LYS D 4  601  ? -14.461 -66.983  68.755  1.00 131.86 ? 601  LYS A CD    1 
ATOM   5355  C  CE    . LYS D 4  601  ? -13.432 -67.788  69.574  1.00 133.20 ? 601  LYS A CE    1 
ATOM   5356  N  NZ    . LYS D 4  601  ? -12.763 -66.979  70.651  1.00 133.18 ? 601  LYS A NZ    1 
ATOM   5357  N  N     . ASP D 4  602  ? -16.142 -70.204  64.072  1.00 129.08 ? 602  ASP A N     1 
ATOM   5358  C  CA    . ASP D 4  602  ? -15.586 -70.387  62.708  1.00 128.68 ? 602  ASP A CA    1 
ATOM   5359  C  C     . ASP D 4  602  ? -14.316 -69.515  62.507  1.00 127.95 ? 602  ASP A C     1 
ATOM   5360  O  O     . ASP D 4  602  ? -14.114 -68.851  61.469  1.00 127.78 ? 602  ASP A O     1 
ATOM   5361  C  CB    . ASP D 4  602  ? -16.647 -70.241  61.576  1.00 128.99 ? 602  ASP A CB    1 
ATOM   5362  C  CG    . ASP D 4  602  ? -16.194 -70.875  60.217  1.00 129.43 ? 602  ASP A CG    1 
ATOM   5363  O  OD1   . ASP D 4  602  ? -15.946 -72.110  60.152  1.00 130.54 ? 602  ASP A OD1   1 
ATOM   5364  O  OD2   . ASP D 4  602  ? -16.116 -70.136  59.201  1.00 129.07 ? 602  ASP A OD2   1 
ATOM   5365  N  N     . ASN D 4  603  ? -13.484 -69.512  63.550  1.00 126.76 ? 603  ASN A N     1 
ATOM   5366  C  CA    . ASN D 4  603  ? -12.165 -68.922  63.489  1.00 125.28 ? 603  ASN A CA    1 
ATOM   5367  C  C     . ASN D 4  603  ? -11.139 -70.020  63.613  1.00 124.15 ? 603  ASN A C     1 
ATOM   5368  O  O     . ASN D 4  603  ? -11.482 -71.193  63.818  1.00 123.61 ? 603  ASN A O     1 
ATOM   5369  C  CB    . ASN D 4  603  ? -11.965 -67.825  64.542  1.00 125.46 ? 603  ASN A CB    1 
ATOM   5370  C  CG    . ASN D 4  603  ? -11.760 -68.368  65.943  1.00 125.88 ? 603  ASN A CG    1 
ATOM   5371  O  OD1   . ASN D 4  603  ? -11.880 -69.569  66.200  1.00 126.85 ? 603  ASN A OD1   1 
ATOM   5372  N  ND2   . ASN D 4  603  ? -11.451 -67.466  66.869  1.00 126.71 ? 603  ASN A ND2   1 
ATOM   5373  N  N     . GLY D 4  604  ? -9.881  -69.618  63.491  1.00 123.08 ? 604  GLY A N     1 
ATOM   5374  C  CA    . GLY D 4  604  ? -8.806  -70.541  63.205  1.00 121.66 ? 604  GLY A CA    1 
ATOM   5375  C  C     . GLY D 4  604  ? -8.815  -70.794  61.720  1.00 120.53 ? 604  GLY A C     1 
ATOM   5376  O  O     . GLY D 4  604  ? -9.509  -70.113  60.963  1.00 120.02 ? 604  GLY A O     1 
ATOM   5377  N  N     . MET D 4  605  ? -8.041  -71.782  61.310  1.00 119.89 ? 605  MET A N     1 
ATOM   5378  C  CA    . MET D 4  605  ? -7.949  -72.148  59.913  1.00 119.73 ? 605  MET A CA    1 
ATOM   5379  C  C     . MET D 4  605  ? -7.362  -73.533  59.856  1.00 119.73 ? 605  MET A C     1 
ATOM   5380  O  O     . MET D 4  605  ? -6.343  -73.799  60.506  1.00 120.31 ? 605  MET A O     1 
ATOM   5381  C  CB    . MET D 4  605  ? -7.020  -71.184  59.165  1.00 119.74 ? 605  MET A CB    1 
ATOM   5382  C  CG    . MET D 4  605  ? -6.771  -71.517  57.693  1.00 119.04 ? 605  MET A CG    1 
ATOM   5383  S  SD    . MET D 4  605  ? -8.082  -70.990  56.561  1.00 117.61 ? 605  MET A SD    1 
ATOM   5384  C  CE    . MET D 4  605  ? -9.181  -72.391  56.657  1.00 118.31 ? 605  MET A CE    1 
ATOM   5385  N  N     . LEU D 4  606  ? -7.999  -74.414  59.093  1.00 119.12 ? 606  LEU A N     1 
ATOM   5386  C  CA    . LEU D 4  606  ? -7.474  -75.746  58.885  1.00 118.62 ? 606  LEU A CA    1 
ATOM   5387  C  C     . LEU D 4  606  ? -7.665  -76.100  57.436  1.00 118.33 ? 606  LEU A C     1 
ATOM   5388  O  O     . LEU D 4  606  ? -8.798  -76.302  56.995  1.00 118.32 ? 606  LEU A O     1 
ATOM   5389  C  CB    . LEU D 4  606  ? -8.202  -76.746  59.768  1.00 118.75 ? 606  LEU A CB    1 
ATOM   5390  C  CG    . LEU D 4  606  ? -7.921  -78.223  59.501  1.00 119.19 ? 606  LEU A CG    1 
ATOM   5391  C  CD1   . LEU D 4  606  ? -6.450  -78.564  59.707  1.00 120.10 ? 606  LEU A CD1   1 
ATOM   5392  C  CD2   . LEU D 4  606  ? -8.789  -79.063  60.400  1.00 119.28 ? 606  LEU A CD2   1 
ATOM   5393  N  N     . ILE D 4  607  ? -6.564  -76.144  56.692  1.00 117.86 ? 607  ILE A N     1 
ATOM   5394  C  CA    . ILE D 4  607  ? -6.624  -76.483  55.286  1.00 117.55 ? 607  ILE A CA    1 
ATOM   5395  C  C     . ILE D 4  607  ? -5.944  -77.809  55.166  1.00 117.92 ? 607  ILE A C     1 
ATOM   5396  O  O     . ILE D 4  607  ? -4.769  -77.905  55.486  1.00 118.22 ? 607  ILE A O     1 
ATOM   5397  C  CB    . ILE D 4  607  ? -5.916  -75.460  54.392  1.00 117.14 ? 607  ILE A CB    1 
ATOM   5398  C  CG1   . ILE D 4  607  ? -6.466  -74.059  54.637  1.00 116.58 ? 607  ILE A CG1   1 
ATOM   5399  C  CG2   . ILE D 4  607  ? -6.120  -75.825  52.933  1.00 117.28 ? 607  ILE A CG2   1 
ATOM   5400  C  CD1   . ILE D 4  607  ? -5.843  -72.975  53.787  1.00 115.50 ? 607  ILE A CD1   1 
ATOM   5401  N  N     . ILE D 4  608  ? -6.692  -78.823  54.724  1.00 118.38 ? 608  ILE A N     1 
ATOM   5402  C  CA    . ILE D 4  608  ? -6.211  -80.210  54.651  1.00 118.91 ? 608  ILE A CA    1 
ATOM   5403  C  C     . ILE D 4  608  ? -6.115  -80.686  53.211  1.00 119.45 ? 608  ILE A C     1 
ATOM   5404  O  O     . ILE D 4  608  ? -7.112  -81.073  52.620  1.00 119.80 ? 608  ILE A O     1 
ATOM   5405  C  CB    . ILE D 4  608  ? -7.148  -81.182  55.408  1.00 118.59 ? 608  ILE A CB    1 
ATOM   5406  C  CG1   . ILE D 4  608  ? -7.188  -80.848  56.889  1.00 118.52 ? 608  ILE A CG1   1 
ATOM   5407  C  CG2   . ILE D 4  608  ? -6.684  -82.616  55.234  1.00 118.54 ? 608  ILE A CG2   1 
ATOM   5408  C  CD1   . ILE D 4  608  ? -7.723  -81.972  57.730  1.00 119.11 ? 608  ILE A CD1   1 
ATOM   5409  N  N     . ASP D 4  609  ? -4.921  -80.689  52.644  1.00 120.12 ? 609  ASP A N     1 
ATOM   5410  C  CA    . ASP D 4  609  ? -4.793  -80.954  51.214  1.00 121.00 ? 609  ASP A CA    1 
ATOM   5411  C  C     . ASP D 4  609  ? -5.767  -80.061  50.418  1.00 121.09 ? 609  ASP A C     1 
ATOM   5412  O  O     . ASP D 4  609  ? -6.979  -80.315  50.373  1.00 120.89 ? 609  ASP A O     1 
ATOM   5413  C  CB    . ASP D 4  609  ? -5.012  -82.447  50.905  1.00 121.11 ? 609  ASP A CB    1 
ATOM   5414  C  CG    . ASP D 4  609  ? -4.610  -82.834  49.468  1.00 122.77 ? 609  ASP A CG    1 
ATOM   5415  O  OD1   . ASP D 4  609  ? -4.459  -81.937  48.591  1.00 125.89 ? 609  ASP A OD1   1 
ATOM   5416  O  OD2   . ASP D 4  609  ? -4.450  -84.050  49.208  1.00 122.71 ? 609  ASP A OD2   1 
ATOM   5417  N  N     . GLY D 4  610  ? -5.218  -79.008  49.816  1.00 121.18 ? 610  GLY A N     1 
ATOM   5418  C  CA    . GLY D 4  610  ? -5.946  -78.114  48.909  1.00 121.35 ? 610  GLY A CA    1 
ATOM   5419  C  C     . GLY D 4  610  ? -7.452  -77.935  49.005  1.00 121.23 ? 610  GLY A C     1 
ATOM   5420  O  O     . GLY D 4  610  ? -8.104  -77.619  47.987  1.00 121.16 ? 610  GLY A O     1 
ATOM   5421  N  N     . GLN D 4  611  ? -7.984  -78.136  50.215  1.00 120.89 ? 611  GLN A N     1 
ATOM   5422  C  CA    . GLN D 4  611  ? -9.406  -77.966  50.527  1.00 120.97 ? 611  GLN A CA    1 
ATOM   5423  C  C     . GLN D 4  611  ? -9.508  -77.423  51.950  1.00 120.68 ? 611  GLN A C     1 
ATOM   5424  O  O     . GLN D 4  611  ? -8.781  -77.888  52.820  1.00 120.98 ? 611  GLN A O     1 
ATOM   5425  C  CB    . GLN D 4  611  ? -10.174 -79.301  50.410  1.00 120.95 ? 611  GLN A CB    1 
ATOM   5426  C  CG    . GLN D 4  611  ? -10.248 -79.924  48.997  1.00 122.29 ? 611  GLN A CG    1 
ATOM   5427  C  CD    . GLN D 4  611  ? -11.056 -79.087  47.970  1.00 124.71 ? 611  GLN A CD    1 
ATOM   5428  O  OE1   . GLN D 4  611  ? -12.279 -78.929  48.102  1.00 125.00 ? 611  GLN A OE1   1 
ATOM   5429  N  NE2   . GLN D 4  611  ? -10.367 -78.573  46.929  1.00 125.32 ? 611  GLN A NE2   1 
ATOM   5430  N  N     . ILE D 4  612  ? -10.394 -76.454  52.192  1.00 120.38 ? 612  ILE A N     1 
ATOM   5431  C  CA    . ILE D 4  612  ? -10.539 -75.840  53.534  1.00 120.37 ? 612  ILE A CA    1 
ATOM   5432  C  C     . ILE D 4  612  ? -11.656 -76.443  54.430  1.00 120.50 ? 612  ILE A C     1 
ATOM   5433  O  O     . ILE D 4  612  ? -12.830 -76.524  54.057  1.00 120.43 ? 612  ILE A O     1 
ATOM   5434  C  CB    . ILE D 4  612  ? -10.642 -74.273  53.475  1.00 120.31 ? 612  ILE A CB    1 
ATOM   5435  C  CG1   . ILE D 4  612  ? -12.085 -73.785  53.568  1.00 120.46 ? 612  ILE A CG1   1 
ATOM   5436  C  CG2   . ILE D 4  612  ? -9.991  -73.703  52.219  1.00 120.34 ? 612  ILE A CG2   1 
ATOM   5437  C  CD1   . ILE D 4  612  ? -12.216 -72.400  54.135  1.00 120.06 ? 612  ILE A CD1   1 
ATOM   5438  N  N     . ILE D 4  613  ? -11.279 -76.865  55.625  1.00 120.83 ? 613  ILE A N     1 
ATOM   5439  C  CA    . ILE D 4  613  ? -12.177 -77.676  56.448  1.00 121.21 ? 613  ILE A CA    1 
ATOM   5440  C  C     . ILE D 4  613  ? -13.040 -76.825  57.386  1.00 121.92 ? 613  ILE A C     1 
ATOM   5441  O  O     . ILE D 4  613  ? -14.209 -77.171  57.641  1.00 122.19 ? 613  ILE A O     1 
ATOM   5442  C  CB    . ILE D 4  613  ? -11.398 -78.765  57.246  1.00 120.98 ? 613  ILE A CB    1 
ATOM   5443  C  CG1   . ILE D 4  613  ? -10.400 -79.511  56.343  1.00 120.31 ? 613  ILE A CG1   1 
ATOM   5444  C  CG2   . ILE D 4  613  ? -12.346 -79.700  57.964  1.00 120.09 ? 613  ILE A CG2   1 
ATOM   5445  C  CD1   . ILE D 4  613  ? -10.955 -80.020  55.038  1.00 119.00 ? 613  ILE A CD1   1 
ATOM   5446  N  N     . PHE D 4  614  ? -12.452 -75.741  57.911  1.00 122.24 ? 614  PHE A N     1 
ATOM   5447  C  CA    . PHE D 4  614  ? -13.184 -74.710  58.665  1.00 122.56 ? 614  PHE A CA    1 
ATOM   5448  C  C     . PHE D 4  614  ? -12.413 -73.402  58.699  1.00 122.47 ? 614  PHE A C     1 
ATOM   5449  O  O     . PHE D 4  614  ? -11.224 -73.377  58.392  1.00 122.66 ? 614  PHE A O     1 
ATOM   5450  C  CB    . PHE D 4  614  ? -13.484 -75.158  60.101  1.00 122.93 ? 614  PHE A CB    1 
ATOM   5451  C  CG    . PHE D 4  614  ? -12.253 -75.338  60.967  1.00 123.91 ? 614  PHE A CG    1 
ATOM   5452  C  CD1   . PHE D 4  614  ? -11.478 -74.252  61.353  1.00 124.62 ? 614  PHE A CD1   1 
ATOM   5453  C  CD2   . PHE D 4  614  ? -11.898 -76.598  61.436  1.00 125.13 ? 614  PHE A CD2   1 
ATOM   5454  C  CE1   . PHE D 4  614  ? -10.356 -74.428  62.160  1.00 124.89 ? 614  PHE A CE1   1 
ATOM   5455  C  CE2   . PHE D 4  614  ? -10.777 -76.777  62.251  1.00 124.49 ? 614  PHE A CE2   1 
ATOM   5456  C  CZ    . PHE D 4  614  ? -10.008 -75.697  62.607  1.00 124.03 ? 614  PHE A CZ    1 
ATOM   5457  N  N     . GLY D 4  615  ? -13.092 -72.321  59.081  1.00 122.31 ? 615  GLY A N     1 
ATOM   5458  C  CA    . GLY D 4  615  ? -12.405 -71.085  59.450  1.00 121.98 ? 615  GLY A CA    1 
ATOM   5459  C  C     . GLY D 4  615  ? -12.389 -69.987  58.408  1.00 121.71 ? 615  GLY A C     1 
ATOM   5460  O  O     . GLY D 4  615  ? -11.778 -70.133  57.352  1.00 121.67 ? 615  GLY A O     1 
ATOM   5461  N  N     . VAL D 4  616  ? -13.061 -68.880  58.738  1.00 121.31 ? 616  VAL A N     1 
ATOM   5462  C  CA    . VAL D 4  616  ? -13.192 -67.686  57.892  1.00 120.32 ? 616  VAL A CA    1 
ATOM   5463  C  C     . VAL D 4  616  ? -11.835 -67.240  57.381  1.00 119.59 ? 616  VAL A C     1 
ATOM   5464  O  O     . VAL D 4  616  ? -11.025 -66.803  58.172  1.00 119.51 ? 616  VAL A O     1 
ATOM   5465  C  CB    . VAL D 4  616  ? -13.859 -66.519  58.720  1.00 120.47 ? 616  VAL A CB    1 
ATOM   5466  C  CG1   . VAL D 4  616  ? -13.720 -65.165  58.012  1.00 120.94 ? 616  VAL A CG1   1 
ATOM   5467  C  CG2   . VAL D 4  616  ? -15.330 -66.821  59.069  1.00 119.33 ? 616  VAL A CG2   1 
ATOM   5468  N  N     . VAL D 4  617  ? -11.574 -67.373  56.083  1.00 119.32 ? 617  VAL A N     1 
ATOM   5469  C  CA    . VAL D 4  617  ? -10.314 -66.857  55.490  1.00 119.57 ? 617  VAL A CA    1 
ATOM   5470  C  C     . VAL D 4  617  ? -10.235 -65.328  55.620  1.00 120.51 ? 617  VAL A C     1 
ATOM   5471  O  O     . VAL D 4  617  ? -11.242 -64.640  55.406  1.00 120.80 ? 617  VAL A O     1 
ATOM   5472  C  CB    . VAL D 4  617  ? -10.167 -67.205  53.990  1.00 118.89 ? 617  VAL A CB    1 
ATOM   5473  C  CG1   . VAL D 4  617  ? -8.931  -66.585  53.424  1.00 118.09 ? 617  VAL A CG1   1 
ATOM   5474  C  CG2   . VAL D 4  617  ? -10.096 -68.661  53.793  1.00 118.24 ? 617  VAL A CG2   1 
ATOM   5475  N  N     . GLU D 4  618  ? -9.056  -64.806  55.977  1.00 121.22 ? 618  GLU A N     1 
ATOM   5476  C  CA    . GLU D 4  618  ? -8.786  -63.348  55.953  1.00 122.34 ? 618  GLU A CA    1 
ATOM   5477  C  C     . GLU D 4  618  ? -7.279  -62.999  55.927  1.00 122.36 ? 618  GLU A C     1 
ATOM   5478  O  O     . GLU D 4  618  ? -6.490  -63.713  55.295  1.00 122.52 ? 618  GLU A O     1 
ATOM   5479  C  CB    . GLU D 4  618  ? -9.499  -62.632  57.106  1.00 122.66 ? 618  GLU A CB    1 
ATOM   5480  C  CG    . GLU D 4  618  ? -9.362  -63.353  58.421  1.00 125.33 ? 618  GLU A CG    1 
ATOM   5481  C  CD    . GLU D 4  618  ? -7.911  -63.657  58.731  1.00 128.53 ? 618  GLU A CD    1 
ATOM   5482  O  OE1   . GLU D 4  618  ? -7.232  -62.725  59.255  1.00 130.21 ? 618  GLU A OE1   1 
ATOM   5483  O  OE2   . GLU D 4  618  ? -7.460  -64.801  58.406  1.00 127.49 ? 618  GLU A OE2   1 
ATOM   5484  N  N     . LYS D 4  619  ? -6.880  -61.921  56.616  1.00 122.18 ? 619  LYS A N     1 
ATOM   5485  C  CA    . LYS D 4  619  ? -5.485  -61.472  56.590  1.00 122.02 ? 619  LYS A CA    1 
ATOM   5486  C  C     . LYS D 4  619  ? -4.470  -62.519  57.056  1.00 121.86 ? 619  LYS A C     1 
ATOM   5487  O  O     . LYS D 4  619  ? -3.503  -62.788  56.355  1.00 121.62 ? 619  LYS A O     1 
ATOM   5488  C  CB    . LYS D 4  619  ? -5.294  -60.167  57.369  1.00 122.35 ? 619  LYS A CB    1 
ATOM   5489  C  CG    . LYS D 4  619  ? -3.970  -59.430  57.010  1.00 122.99 ? 619  LYS A CG    1 
ATOM   5490  C  CD    . LYS D 4  619  ? -3.812  -58.059  57.688  1.00 122.08 ? 619  LYS A CD    1 
ATOM   5491  C  CE    . LYS D 4  619  ? -2.983  -57.145  56.801  1.00 120.95 ? 619  LYS A CE    1 
ATOM   5492  N  NZ    . LYS D 4  619  ? -3.104  -55.708  57.165  1.00 121.05 ? 619  LYS A NZ    1 
ATOM   5493  N  N     . LYS D 4  620  ? -4.687  -63.111  58.229  1.00 121.79 ? 620  LYS A N     1 
ATOM   5494  C  CA    . LYS D 4  620  ? -3.686  -64.004  58.832  1.00 121.74 ? 620  LYS A CA    1 
ATOM   5495  C  C     . LYS D 4  620  ? -3.401  -65.237  57.996  1.00 121.44 ? 620  LYS A C     1 
ATOM   5496  O  O     . LYS D 4  620  ? -2.417  -65.924  58.233  1.00 121.46 ? 620  LYS A O     1 
ATOM   5497  C  CB    . LYS D 4  620  ? -4.041  -64.382  60.277  1.00 121.44 ? 620  LYS A CB    1 
ATOM   5498  C  CG    . LYS D 4  620  ? -3.792  -63.252  61.300  1.00 122.43 ? 620  LYS A CG    1 
ATOM   5499  C  CD    . LYS D 4  620  ? -4.524  -63.482  62.637  1.00 122.70 ? 620  LYS A CD    1 
ATOM   5500  C  CE    . LYS D 4  620  ? -6.064  -63.396  62.484  1.00 123.86 ? 620  LYS A CE    1 
ATOM   5501  N  NZ    . LYS D 4  620  ? -6.817  -63.965  63.646  1.00 123.11 ? 620  LYS A NZ    1 
ATOM   5502  N  N     . THR D 4  621  ? -4.246  -65.504  57.008  1.00 121.62 ? 621  THR A N     1 
ATOM   5503  C  CA    . THR D 4  621  ? -4.050  -66.645  56.121  1.00 121.96 ? 621  THR A CA    1 
ATOM   5504  C  C     . THR D 4  621  ? -3.468  -66.198  54.782  1.00 122.90 ? 621  THR A C     1 
ATOM   5505  O  O     . THR D 4  621  ? -2.343  -66.550  54.362  1.00 123.04 ? 621  THR A O     1 
ATOM   5506  C  CB    . THR D 4  621  ? -5.378  -67.300  55.803  1.00 121.53 ? 621  THR A CB    1 
ATOM   5507  O  OG1   . THR D 4  621  ? -6.139  -67.462  57.008  1.00 121.53 ? 621  THR A OG1   1 
ATOM   5508  C  CG2   . THR D 4  621  ? -5.149  -68.628  55.119  1.00 120.71 ? 621  THR A CG2   1 
ATOM   5509  N  N     . VAL D 4  622  ? -4.268  -65.406  54.101  1.00 123.51 ? 622  VAL A N     1 
ATOM   5510  C  CA    . VAL D 4  622  ? -3.950  -65.054  52.773  1.00 123.86 ? 622  VAL A CA    1 
ATOM   5511  C  C     . VAL D 4  622  ? -3.336  -63.688  52.795  1.00 124.72 ? 622  VAL A C     1 
ATOM   5512  O  O     . VAL D 4  622  ? -3.265  -63.042  51.766  1.00 125.04 ? 622  VAL A O     1 
ATOM   5513  C  CB    . VAL D 4  622  ? -5.206  -65.116  51.929  1.00 123.79 ? 622  VAL A CB    1 
ATOM   5514  C  CG1   . VAL D 4  622  ? -6.202  -64.011  52.315  1.00 123.16 ? 622  VAL A CG1   1 
ATOM   5515  C  CG2   . VAL D 4  622  ? -4.844  -65.126  50.459  1.00 124.06 ? 622  VAL A CG2   1 
ATOM   5516  N  N     . GLY D 4  623  ? -2.882  -63.247  53.970  1.00 125.88 ? 623  GLY A N     1 
ATOM   5517  C  CA    . GLY D 4  623  ? -2.231  -61.932  54.119  1.00 127.36 ? 623  GLY A CA    1 
ATOM   5518  C  C     . GLY D 4  623  ? -0.808  -62.088  53.662  1.00 128.32 ? 623  GLY A C     1 
ATOM   5519  O  O     . GLY D 4  623  ? -0.491  -63.068  53.008  1.00 128.61 ? 623  GLY A O     1 
ATOM   5520  N  N     . SER D 4  624  ? 0.077   -61.161  53.981  1.00 129.34 ? 624  SER A N     1 
ATOM   5521  C  CA    . SER D 4  624  ? 1.457   -61.521  53.718  1.00 130.78 ? 624  SER A CA    1 
ATOM   5522  C  C     . SER D 4  624  ? 2.102   -62.025  55.002  1.00 131.40 ? 624  SER A C     1 
ATOM   5523  O  O     . SER D 4  624  ? 3.331   -62.029  55.131  1.00 132.39 ? 624  SER A O     1 
ATOM   5524  C  CB    . SER D 4  624  ? 2.268   -60.457  52.939  1.00 130.78 ? 624  SER A CB    1 
ATOM   5525  O  OG    . SER D 4  624  ? 2.218   -59.179  53.535  1.00 131.74 ? 624  SER A OG    1 
ATOM   5526  N  N     . SER D 4  625  ? 1.250   -62.512  55.912  1.00 131.61 ? 625  SER A N     1 
ATOM   5527  C  CA    . SER D 4  625  ? 1.654   -63.027  57.236  1.00 131.87 ? 625  SER A CA    1 
ATOM   5528  C  C     . SER D 4  625  ? 2.701   -64.162  57.233  1.00 131.77 ? 625  SER A C     1 
ATOM   5529  O  O     . SER D 4  625  ? 3.076   -64.688  56.169  1.00 131.90 ? 625  SER A O     1 
ATOM   5530  C  CB    . SER D 4  625  ? 0.418   -63.500  57.994  1.00 131.93 ? 625  SER A CB    1 
ATOM   5531  O  OG    . SER D 4  625  ? -0.133  -64.628  57.336  1.00 132.07 ? 625  SER A OG    1 
ATOM   5532  N  N     . ASN D 4  626  ? 3.133   -64.538  58.440  1.00 131.31 ? 626  ASN A N     1 
ATOM   5533  C  CA    . ASN D 4  626  ? 4.207   -65.507  58.651  1.00 131.01 ? 626  ASN A CA    1 
ATOM   5534  C  C     . ASN D 4  626  ? 3.892   -66.959  58.262  1.00 129.68 ? 626  ASN A C     1 
ATOM   5535  O  O     . ASN D 4  626  ? 4.499   -67.522  57.337  1.00 129.39 ? 626  ASN A O     1 
ATOM   5536  C  CB    . ASN D 4  626  ? 4.658   -65.447  60.118  1.00 131.95 ? 626  ASN A CB    1 
ATOM   5537  C  CG    . ASN D 4  626  ? 5.813   -66.423  60.437  1.00 135.31 ? 626  ASN A CG    1 
ATOM   5538  O  OD1   . ASN D 4  626  ? 5.781   -67.134  61.462  1.00 139.01 ? 626  ASN A OD1   1 
ATOM   5539  N  ND2   . ASN D 4  626  ? 6.840   -66.453  59.565  1.00 138.11 ? 626  ASN A ND2   1 
ATOM   5540  N  N     . GLY D 4  627  ? 2.963   -67.574  58.986  1.00 128.22 ? 627  GLY A N     1 
ATOM   5541  C  CA    . GLY D 4  627  ? 2.677   -68.994  58.787  1.00 126.62 ? 627  GLY A CA    1 
ATOM   5542  C  C     . GLY D 4  627  ? 1.620   -69.212  57.733  1.00 125.34 ? 627  GLY A C     1 
ATOM   5543  O  O     . GLY D 4  627  ? 1.082   -70.309  57.602  1.00 125.08 ? 627  GLY A O     1 
ATOM   5544  N  N     . GLY D 4  628  ? 1.344   -68.150  56.981  1.00 124.35 ? 628  GLY A N     1 
ATOM   5545  C  CA    . GLY D 4  628  ? 0.234   -68.090  56.034  1.00 123.01 ? 628  GLY A CA    1 
ATOM   5546  C  C     . GLY D 4  628  ? 0.350   -68.899  54.751  1.00 122.07 ? 628  GLY A C     1 
ATOM   5547  O  O     . GLY D 4  628  ? 1.341   -69.616  54.530  1.00 122.37 ? 628  GLY A O     1 
ATOM   5548  N  N     . LEU D 4  629  ? -0.667  -68.755  53.897  1.00 120.37 ? 629  LEU A N     1 
ATOM   5549  C  CA    . LEU D 4  629  ? -0.868  -69.646  52.755  1.00 119.40 ? 629  LEU A CA    1 
ATOM   5550  C  C     . LEU D 4  629  ? 0.198   -69.456  51.698  1.00 118.90 ? 629  LEU A C     1 
ATOM   5551  O  O     . LEU D 4  629  ? 0.551   -70.412  51.024  1.00 118.44 ? 629  LEU A O     1 
ATOM   5552  C  CB    . LEU D 4  629  ? -2.280  -69.464  52.169  1.00 119.05 ? 629  LEU A CB    1 
ATOM   5553  C  CG    . LEU D 4  629  ? -3.020  -70.397  51.185  1.00 118.64 ? 629  LEU A CG    1 
ATOM   5554  C  CD1   . LEU D 4  629  ? -3.194  -69.775  49.812  1.00 116.29 ? 629  LEU A CD1   1 
ATOM   5555  C  CD2   . LEU D 4  629  ? -2.425  -71.772  51.079  1.00 116.40 ? 629  LEU A CD2   1 
ATOM   5556  N  N     . ILE D 4  630  ? 0.716   -68.232  51.568  1.00 118.70 ? 630  ILE A N     1 
ATOM   5557  C  CA    . ILE D 4  630  ? 1.681   -67.940  50.508  1.00 118.25 ? 630  ILE A CA    1 
ATOM   5558  C  C     . ILE D 4  630  ? 3.057   -68.382  50.947  1.00 118.41 ? 630  ILE A C     1 
ATOM   5559  O  O     . ILE D 4  630  ? 3.845   -68.887  50.121  1.00 118.34 ? 630  ILE A O     1 
ATOM   5560  C  CB    . ILE D 4  630  ? 1.711   -66.464  50.070  1.00 118.10 ? 630  ILE A CB    1 
ATOM   5561  C  CG1   . ILE D 4  630  ? 0.309   -65.973  49.750  1.00 116.64 ? 630  ILE A CG1   1 
ATOM   5562  C  CG2   . ILE D 4  630  ? 2.651   -66.266  48.867  1.00 117.29 ? 630  ILE A CG2   1 
ATOM   5563  C  CD1   . ILE D 4  630  ? -0.298  -65.374  50.935  1.00 115.70 ? 630  ILE A CD1   1 
ATOM   5564  N  N     . HIS D 4  631  ? 3.345   -68.205  52.239  1.00 118.07 ? 631  HIS A N     1 
ATOM   5565  C  CA    . HIS D 4  631  ? 4.578   -68.760  52.770  1.00 117.82 ? 631  HIS A CA    1 
ATOM   5566  C  C     . HIS D 4  631  ? 4.641   -70.238  52.420  1.00 116.88 ? 631  HIS A C     1 
ATOM   5567  O  O     . HIS D 4  631  ? 5.588   -70.679  51.772  1.00 116.45 ? 631  HIS A O     1 
ATOM   5568  C  CB    . HIS D 4  631  ? 4.729   -68.574  54.280  1.00 118.34 ? 631  HIS A CB    1 
ATOM   5569  C  CG    . HIS D 4  631  ? 6.159   -68.542  54.720  1.00 120.11 ? 631  HIS A CG    1 
ATOM   5570  N  ND1   . HIS D 4  631  ? 7.165   -69.176  54.014  1.00 122.03 ? 631  HIS A ND1   1 
ATOM   5571  C  CD2   . HIS D 4  631  ? 6.762   -67.932  55.766  1.00 121.23 ? 631  HIS A CD2   1 
ATOM   5572  C  CE1   . HIS D 4  631  ? 8.324   -68.966  54.613  1.00 121.96 ? 631  HIS A CE1   1 
ATOM   5573  N  NE2   . HIS D 4  631  ? 8.108   -68.212  55.677  1.00 122.29 ? 631  HIS A NE2   1 
ATOM   5574  N  N     . VAL D 4  632  ? 3.614   -70.984  52.830  1.00 116.10 ? 632  VAL A N     1 
ATOM   5575  C  CA    . VAL D 4  632  ? 3.507   -72.413  52.511  1.00 115.58 ? 632  VAL A CA    1 
ATOM   5576  C  C     . VAL D 4  632  ? 3.650   -72.674  50.990  1.00 115.75 ? 632  VAL A C     1 
ATOM   5577  O  O     . VAL D 4  632  ? 4.688   -73.162  50.532  1.00 115.32 ? 632  VAL A O     1 
ATOM   5578  C  CB    . VAL D 4  632  ? 2.182   -73.032  53.044  1.00 115.11 ? 632  VAL A CB    1 
ATOM   5579  C  CG1   . VAL D 4  632  ? 2.171   -74.516  52.832  1.00 114.58 ? 632  VAL A CG1   1 
ATOM   5580  C  CG2   . VAL D 4  632  ? 2.013   -72.751  54.486  1.00 114.35 ? 632  VAL A CG2   1 
ATOM   5581  N  N     . VAL D 4  633  ? 2.611   -72.308  50.224  1.00 116.04 ? 633  VAL A N     1 
ATOM   5582  C  CA    . VAL D 4  633  ? 2.513   -72.610  48.785  1.00 115.59 ? 633  VAL A CA    1 
ATOM   5583  C  C     . VAL D 4  633  ? 3.830   -72.333  48.064  1.00 115.73 ? 633  VAL A C     1 
ATOM   5584  O  O     . VAL D 4  633  ? 4.253   -73.162  47.263  1.00 115.93 ? 633  VAL A O     1 
ATOM   5585  C  CB    . VAL D 4  633  ? 1.237   -71.993  48.083  1.00 115.33 ? 633  VAL A CB    1 
ATOM   5586  C  CG1   . VAL D 4  633  ? 1.157   -72.394  46.625  1.00 115.21 ? 633  VAL A CG1   1 
ATOM   5587  C  CG2   . VAL D 4  633  ? -0.017  -72.481  48.752  1.00 114.13 ? 633  VAL A CG2   1 
ATOM   5588  N  N     . THR D 4  634  ? 4.507   -71.222  48.380  1.00 115.75 ? 634  THR A N     1 
ATOM   5589  C  CA    . THR D 4  634  ? 5.847   -71.001  47.802  1.00 115.96 ? 634  THR A CA    1 
ATOM   5590  C  C     . THR D 4  634  ? 6.800   -72.117  48.199  1.00 116.37 ? 634  THR A C     1 
ATOM   5591  O  O     . THR D 4  634  ? 7.054   -73.001  47.386  1.00 116.32 ? 634  THR A O     1 
ATOM   5592  C  CB    . THR D 4  634  ? 6.474   -69.644  48.128  1.00 115.68 ? 634  THR A CB    1 
ATOM   5593  O  OG1   . THR D 4  634  ? 5.499   -68.618  47.939  1.00 116.23 ? 634  THR A OG1   1 
ATOM   5594  C  CG2   . THR D 4  634  ? 7.674   -69.388  47.219  1.00 114.48 ? 634  THR A CG2   1 
ATOM   5595  N  N     . ARG D 4  635  ? 7.293   -72.082  49.443  1.00 117.08 ? 635  ARG A N     1 
ATOM   5596  C  CA    . ARG D 4  635  ? 8.254   -73.070  49.978  1.00 117.71 ? 635  ARG A CA    1 
ATOM   5597  C  C     . ARG D 4  635  ? 7.928   -74.471  49.483  1.00 118.10 ? 635  ARG A C     1 
ATOM   5598  O  O     . ARG D 4  635  ? 8.798   -75.190  48.983  1.00 118.33 ? 635  ARG A O     1 
ATOM   5599  C  CB    . ARG D 4  635  ? 8.254   -73.066  51.519  1.00 117.78 ? 635  ARG A CB    1 
ATOM   5600  C  CG    . ARG D 4  635  ? 9.253   -72.157  52.175  1.00 118.33 ? 635  ARG A CG    1 
ATOM   5601  C  CD    . ARG D 4  635  ? 10.649  -72.714  52.025  1.00 121.27 ? 635  ARG A CD    1 
ATOM   5602  N  NE    . ARG D 4  635  ? 11.545  -71.657  51.570  1.00 124.53 ? 635  ARG A NE    1 
ATOM   5603  C  CZ    . ARG D 4  635  ? 11.825  -71.386  50.292  1.00 126.09 ? 635  ARG A CZ    1 
ATOM   5604  N  NH1   . ARG D 4  635  ? 11.304  -72.111  49.300  1.00 126.43 ? 635  ARG A NH1   1 
ATOM   5605  N  NH2   . ARG D 4  635  ? 12.644  -70.380  50.001  1.00 126.76 ? 635  ARG A NH2   1 
ATOM   5606  N  N     . GLU D 4  636  ? 6.646   -74.812  49.603  1.00 118.49 ? 636  GLU A N     1 
ATOM   5607  C  CA    . GLU D 4  636  ? 6.109   -76.132  49.347  1.00 118.70 ? 636  GLU A CA    1 
ATOM   5608  C  C     . GLU D 4  636  ? 6.080   -76.504  47.878  1.00 118.56 ? 636  GLU A C     1 
ATOM   5609  O  O     . GLU D 4  636  ? 6.757   -77.442  47.481  1.00 118.86 ? 636  GLU A O     1 
ATOM   5610  C  CB    . GLU D 4  636  ? 4.695   -76.182  49.889  1.00 118.81 ? 636  GLU A CB    1 
ATOM   5611  C  CG    . GLU D 4  636  ? 4.158   -77.552  49.976  1.00 121.29 ? 636  GLU A CG    1 
ATOM   5612  C  CD    . GLU D 4  636  ? 4.925   -78.400  50.955  1.00 125.37 ? 636  GLU A CD    1 
ATOM   5613  O  OE1   . GLU D 4  636  ? 4.989   -79.631  50.720  1.00 127.28 ? 636  GLU A OE1   1 
ATOM   5614  O  OE2   . GLU D 4  636  ? 5.460   -77.843  51.952  1.00 126.97 ? 636  GLU A OE2   1 
ATOM   5615  N  N     . LYS D 4  637  ? 5.322   -75.744  47.083  1.00 118.24 ? 637  LYS A N     1 
ATOM   5616  C  CA    . LYS D 4  637  ? 4.990   -76.085  45.697  1.00 117.78 ? 637  LYS A CA    1 
ATOM   5617  C  C     . LYS D 4  637  ? 5.879   -75.529  44.574  1.00 117.62 ? 637  LYS A C     1 
ATOM   5618  O  O     . LYS D 4  637  ? 6.169   -76.232  43.616  1.00 117.24 ? 637  LYS A O     1 
ATOM   5619  C  CB    . LYS D 4  637  ? 3.554   -75.678  45.440  1.00 117.58 ? 637  LYS A CB    1 
ATOM   5620  C  CG    . LYS D 4  637  ? 2.593   -76.583  46.097  1.00 118.23 ? 637  LYS A CG    1 
ATOM   5621  C  CD    . LYS D 4  637  ? 1.839   -77.391  45.058  1.00 121.28 ? 637  LYS A CD    1 
ATOM   5622  C  CE    . LYS D 4  637  ? 2.360   -78.810  44.873  1.00 121.93 ? 637  LYS A CE    1 
ATOM   5623  N  NZ    . LYS D 4  637  ? 1.411   -79.566  43.990  1.00 122.37 ? 637  LYS A NZ    1 
ATOM   5624  N  N     . GLY D 4  638  ? 6.283   -74.267  44.679  1.00 117.75 ? 638  GLY A N     1 
ATOM   5625  C  CA    . GLY D 4  638  ? 7.019   -73.576  43.610  1.00 118.41 ? 638  GLY A CA    1 
ATOM   5626  C  C     . GLY D 4  638  ? 6.973   -72.063  43.810  1.00 119.01 ? 638  GLY A C     1 
ATOM   5627  O  O     . GLY D 4  638  ? 6.339   -71.584  44.743  1.00 119.49 ? 638  GLY A O     1 
ATOM   5628  N  N     . PRO D 4  639  ? 7.680   -71.284  42.979  1.00 119.15 ? 639  PRO A N     1 
ATOM   5629  C  CA    . PRO D 4  639  ? 7.262   -69.909  43.044  1.00 119.30 ? 639  PRO A CA    1 
ATOM   5630  C  C     . PRO D 4  639  ? 6.143   -69.739  42.028  1.00 119.82 ? 639  PRO A C     1 
ATOM   5631  O  O     . PRO D 4  639  ? 5.195   -69.023  42.270  1.00 119.85 ? 639  PRO A O     1 
ATOM   5632  C  CB    . PRO D 4  639  ? 8.519   -69.139  42.631  1.00 118.90 ? 639  PRO A CB    1 
ATOM   5633  C  CG    . PRO D 4  639  ? 9.526   -70.162  42.203  1.00 118.83 ? 639  PRO A CG    1 
ATOM   5634  C  CD    . PRO D 4  639  ? 8.801   -71.455  42.045  1.00 119.30 ? 639  PRO A CD    1 
ATOM   5635  N  N     . GLN D 4  640  ? 6.250   -70.455  40.919  1.00 120.75 ? 640  GLN A N     1 
ATOM   5636  C  CA    . GLN D 4  640  ? 5.339   -70.338  39.792  1.00 121.66 ? 640  GLN A CA    1 
ATOM   5637  C  C     . GLN D 4  640  ? 3.981   -70.794  40.210  1.00 121.68 ? 640  GLN A C     1 
ATOM   5638  O  O     . GLN D 4  640  ? 2.997   -70.086  40.023  1.00 121.91 ? 640  GLN A O     1 
ATOM   5639  C  CB    . GLN D 4  640  ? 5.817   -71.232  38.653  1.00 122.00 ? 640  GLN A CB    1 
ATOM   5640  C  CG    . GLN D 4  640  ? 7.333   -71.261  38.520  1.00 124.77 ? 640  GLN A CG    1 
ATOM   5641  C  CD    . GLN D 4  640  ? 7.919   -69.852  38.402  1.00 128.25 ? 640  GLN A CD    1 
ATOM   5642  O  OE1   . GLN D 4  640  ? 8.778   -69.451  39.201  1.00 129.96 ? 640  GLN A OE1   1 
ATOM   5643  N  NE2   . GLN D 4  640  ? 7.433   -69.084  37.414  1.00 128.92 ? 640  GLN A NE2   1 
ATOM   5644  N  N     . VAL D 4  641  ? 3.948   -71.987  40.791  1.00 121.74 ? 641  VAL A N     1 
ATOM   5645  C  CA    . VAL D 4  641  ? 2.725   -72.632  41.233  1.00 121.74 ? 641  VAL A CA    1 
ATOM   5646  C  C     . VAL D 4  641  ? 2.024   -71.771  42.264  1.00 121.43 ? 641  VAL A C     1 
ATOM   5647  O  O     . VAL D 4  641  ? 0.824   -71.912  42.494  1.00 120.98 ? 641  VAL A O     1 
ATOM   5648  C  CB    . VAL D 4  641  ? 3.065   -73.963  41.882  1.00 122.11 ? 641  VAL A CB    1 
ATOM   5649  C  CG1   . VAL D 4  641  ? 1.781   -74.788  42.153  1.00 122.89 ? 641  VAL A CG1   1 
ATOM   5650  C  CG2   . VAL D 4  641  ? 4.102   -74.724  41.023  1.00 122.30 ? 641  VAL A CG2   1 
ATOM   5651  N  N     . CYS D 4  642  ? 2.802   -70.887  42.884  1.00 121.47 ? 642  CYS A N     1 
ATOM   5652  C  CA    . CYS D 4  642  ? 2.289   -69.922  43.837  1.00 121.19 ? 642  CYS A CA    1 
ATOM   5653  C  C     . CYS D 4  642  ? 1.859   -68.596  43.200  1.00 120.87 ? 642  CYS A C     1 
ATOM   5654  O  O     . CYS D 4  642  ? 0.835   -68.030  43.572  1.00 120.69 ? 642  CYS A O     1 
ATOM   5655  C  CB    . CYS D 4  642  ? 3.323   -69.642  44.913  1.00 121.08 ? 642  CYS A CB    1 
ATOM   5656  S  SG    . CYS D 4  642  ? 2.817   -68.223  45.894  1.00 122.60 ? 642  CYS A SG    1 
ATOM   5657  N  N     . ALA D 4  643  ? 2.666   -68.091  42.272  1.00 120.69 ? 643  ALA A N     1 
ATOM   5658  C  CA    . ALA D 4  643  ? 2.350   -66.880  41.543  1.00 120.41 ? 643  ALA A CA    1 
ATOM   5659  C  C     . ALA D 4  643  ? 1.058   -67.099  40.758  1.00 120.70 ? 643  ALA A C     1 
ATOM   5660  O  O     . ALA D 4  643  ? 0.214   -66.190  40.680  1.00 121.08 ? 643  ALA A O     1 
ATOM   5661  C  CB    . ALA D 4  643  ? 3.485   -66.509  40.627  1.00 120.18 ? 643  ALA A CB    1 
ATOM   5662  N  N     . LYS D 4  644  ? 0.899   -68.302  40.191  1.00 120.52 ? 644  LYS A N     1 
ATOM   5663  C  CA    . LYS D 4  644  ? -0.369  -68.725  39.573  1.00 120.62 ? 644  LYS A CA    1 
ATOM   5664  C  C     . LYS D 4  644  ? -1.488  -68.720  40.605  1.00 119.84 ? 644  LYS A C     1 
ATOM   5665  O  O     . LYS D 4  644  ? -2.612  -68.295  40.330  1.00 120.00 ? 644  LYS A O     1 
ATOM   5666  C  CB    . LYS D 4  644  ? -0.249  -70.113  38.951  1.00 120.67 ? 644  LYS A CB    1 
ATOM   5667  C  CG    . LYS D 4  644  ? -0.239  -70.130  37.431  1.00 121.81 ? 644  LYS A CG    1 
ATOM   5668  C  CD    . LYS D 4  644  ? 0.194   -71.505  36.894  1.00 122.01 ? 644  LYS A CD    1 
ATOM   5669  C  CE    . LYS D 4  644  ? 0.014   -71.595  35.372  1.00 124.05 ? 644  LYS A CE    1 
ATOM   5670  N  NZ    . LYS D 4  644  ? 0.437   -72.939  34.840  1.00 125.13 ? 644  LYS A NZ    1 
ATOM   5671  N  N     . LEU D 4  645  ? -1.160  -69.178  41.803  1.00 118.99 ? 645  LEU A N     1 
ATOM   5672  C  CA    . LEU D 4  645  ? -2.079  -69.111  42.916  1.00 118.13 ? 645  LEU A CA    1 
ATOM   5673  C  C     . LEU D 4  645  ? -2.526  -67.702  43.239  1.00 117.95 ? 645  LEU A C     1 
ATOM   5674  O  O     . LEU D 4  645  ? -3.630  -67.510  43.732  1.00 118.14 ? 645  LEU A O     1 
ATOM   5675  C  CB    . LEU D 4  645  ? -1.438  -69.690  44.158  1.00 117.83 ? 645  LEU A CB    1 
ATOM   5676  C  CG    . LEU D 4  645  ? -2.037  -69.152  45.438  1.00 116.02 ? 645  LEU A CG    1 
ATOM   5677  C  CD1   . LEU D 4  645  ? -3.272  -69.951  45.789  1.00 114.34 ? 645  LEU A CD1   1 
ATOM   5678  C  CD2   . LEU D 4  645  ? -0.976  -69.239  46.499  1.00 116.42 ? 645  LEU A CD2   1 
ATOM   5679  N  N     . PHE D 4  646  ? -1.682  -66.712  43.000  1.00 117.67 ? 646  PHE A N     1 
ATOM   5680  C  CA    . PHE D 4  646  ? -2.088  -65.359  43.332  1.00 117.80 ? 646  PHE A CA    1 
ATOM   5681  C  C     . PHE D 4  646  ? -3.356  -64.973  42.565  1.00 118.26 ? 646  PHE A C     1 
ATOM   5682  O  O     . PHE D 4  646  ? -4.423  -64.654  43.164  1.00 117.86 ? 646  PHE A O     1 
ATOM   5683  C  CB    . PHE D 4  646  ? -0.966  -64.382  43.047  1.00 117.54 ? 646  PHE A CB    1 
ATOM   5684  C  CG    . PHE D 4  646  ? -0.262  -63.918  44.270  1.00 117.24 ? 646  PHE A CG    1 
ATOM   5685  C  CD1   . PHE D 4  646  ? 1.016   -64.363  44.558  1.00 117.68 ? 646  PHE A CD1   1 
ATOM   5686  C  CD2   . PHE D 4  646  ? -0.882  -63.047  45.142  1.00 118.22 ? 646  PHE A CD2   1 
ATOM   5687  C  CE1   . PHE D 4  646  ? 1.682   -63.946  45.691  1.00 118.19 ? 646  PHE A CE1   1 
ATOM   5688  C  CE2   . PHE D 4  646  ? -0.235  -62.627  46.285  1.00 120.10 ? 646  PHE A CE2   1 
ATOM   5689  C  CZ    . PHE D 4  646  ? 1.065   -63.082  46.563  1.00 119.02 ? 646  PHE A CZ    1 
ATOM   5690  N  N     . GLY D 4  647  ? -3.204  -65.045  41.235  1.00 118.50 ? 647  GLY A N     1 
ATOM   5691  C  CA    . GLY D 4  647  ? -4.243  -64.745  40.248  1.00 117.83 ? 647  GLY A CA    1 
ATOM   5692  C  C     . GLY D 4  647  ? -5.542  -65.445  40.550  1.00 117.10 ? 647  GLY A C     1 
ATOM   5693  O  O     . GLY D 4  647  ? -6.573  -64.782  40.697  1.00 117.50 ? 647  GLY A O     1 
ATOM   5694  N  N     . ASN D 4  648  ? -5.490  -66.773  40.673  1.00 115.73 ? 648  ASN A N     1 
ATOM   5695  C  CA    . ASN D 4  648  ? -6.699  -67.552  40.868  1.00 114.63 ? 648  ASN A CA    1 
ATOM   5696  C  C     . ASN D 4  648  ? -7.545  -67.037  41.995  1.00 113.78 ? 648  ASN A C     1 
ATOM   5697  O  O     . ASN D 4  648  ? -8.749  -66.854  41.829  1.00 113.66 ? 648  ASN A O     1 
ATOM   5698  C  CB    . ASN D 4  648  ? -6.375  -69.013  41.088  1.00 114.72 ? 648  ASN A CB    1 
ATOM   5699  C  CG    . ASN D 4  648  ? -5.761  -69.638  39.878  1.00 116.12 ? 648  ASN A CG    1 
ATOM   5700  O  OD1   . ASN D 4  648  ? -5.315  -68.941  38.972  1.00 117.56 ? 648  ASN A OD1   1 
ATOM   5701  N  ND2   . ASN D 4  648  ? -5.728  -70.962  39.844  1.00 119.11 ? 648  ASN A ND2   1 
ATOM   5702  N  N     . ILE D 4  649  ? -6.912  -66.763  43.132  1.00 112.86 ? 649  ILE A N     1 
ATOM   5703  C  CA    . ILE D 4  649  ? -7.661  -66.354  44.320  1.00 111.94 ? 649  ILE A CA    1 
ATOM   5704  C  C     . ILE D 4  649  ? -8.534  -65.137  44.020  1.00 111.26 ? 649  ILE A C     1 
ATOM   5705  O  O     . ILE D 4  649  ? -9.736  -65.161  44.250  1.00 111.17 ? 649  ILE A O     1 
ATOM   5706  C  CB    . ILE D 4  649  ? -6.762  -66.135  45.534  1.00 111.82 ? 649  ILE A CB    1 
ATOM   5707  C  CG1   . ILE D 4  649  ? -5.873  -67.367  45.721  1.00 111.26 ? 649  ILE A CG1   1 
ATOM   5708  C  CG2   . ILE D 4  649  ? -7.626  -65.924  46.749  1.00 111.90 ? 649  ILE A CG2   1 
ATOM   5709  C  CD1   . ILE D 4  649  ? -5.111  -67.443  47.033  1.00 111.12 ? 649  ILE A CD1   1 
ATOM   5710  N  N     . GLN D 4  650  ? -7.905  -64.106  43.467  1.00 110.48 ? 650  GLN A N     1 
ATOM   5711  C  CA    . GLN D 4  650  ? -8.568  -62.933  42.883  1.00 109.46 ? 650  GLN A CA    1 
ATOM   5712  C  C     . GLN D 4  650  ? -9.653  -63.267  41.850  1.00 108.84 ? 650  GLN A C     1 
ATOM   5713  O  O     . GLN D 4  650  ? -10.830 -62.919  42.037  1.00 108.63 ? 650  GLN A O     1 
ATOM   5714  C  CB    . GLN D 4  650  ? -7.500  -62.047  42.224  1.00 109.45 ? 650  GLN A CB    1 
ATOM   5715  C  CG    . GLN D 4  650  ? -6.470  -61.584  43.229  1.00 108.62 ? 650  GLN A CG    1 
ATOM   5716  C  CD    . GLN D 4  650  ? -5.229  -61.011  42.625  1.00 105.72 ? 650  GLN A CD    1 
ATOM   5717  O  OE1   . GLN D 4  650  ? -4.474  -61.720  41.938  1.00 104.91 ? 650  GLN A OE1   1 
ATOM   5718  N  NE2   . GLN D 4  650  ? -4.983  -59.721  42.904  1.00 102.34 ? 650  GLN A NE2   1 
ATOM   5719  N  N     . LYS D 4  651  ? -9.250  -63.940  40.768  1.00 107.73 ? 651  LYS A N     1 
ATOM   5720  C  CA    . LYS D 4  651  ? -10.158 -64.196  39.661  1.00 106.50 ? 651  LYS A CA    1 
ATOM   5721  C  C     . LYS D 4  651  ? -11.508 -64.688  40.197  1.00 106.08 ? 651  LYS A C     1 
ATOM   5722  O  O     . LYS D 4  651  ? -12.550 -64.128  39.847  1.00 106.11 ? 651  LYS A O     1 
ATOM   5723  C  CB    . LYS D 4  651  ? -9.512  -65.055  38.566  1.00 105.49 ? 651  LYS A CB    1 
ATOM   5724  C  CG    . LYS D 4  651  ? -8.433  -64.265  37.858  1.00 105.27 ? 651  LYS A CG    1 
ATOM   5725  C  CD    . LYS D 4  651  ? -8.188  -64.626  36.393  1.00 106.36 ? 651  LYS A CD    1 
ATOM   5726  C  CE    . LYS D 4  651  ? -7.013  -65.654  36.172  1.00 108.61 ? 651  LYS A CE    1 
ATOM   5727  N  NZ    . LYS D 4  651  ? -5.625  -65.372  36.750  1.00 108.51 ? 651  LYS A NZ    1 
ATOM   5728  N  N     . VAL D 4  652  ? -11.478 -65.650  41.112  1.00 105.34 ? 652  VAL A N     1 
ATOM   5729  C  CA    . VAL D 4  652  ? -12.690 -66.071  41.750  1.00 105.15 ? 652  VAL A CA    1 
ATOM   5730  C  C     . VAL D 4  652  ? -13.267 -64.965  42.624  1.00 105.94 ? 652  VAL A C     1 
ATOM   5731  O  O     . VAL D 4  652  ? -14.413 -64.544  42.382  1.00 106.57 ? 652  VAL A O     1 
ATOM   5732  C  CB    . VAL D 4  652  ? -12.520 -67.281  42.652  1.00 105.05 ? 652  VAL A CB    1 
ATOM   5733  C  CG1   . VAL D 4  652  ? -13.898 -67.897  42.889  1.00 104.50 ? 652  VAL A CG1   1 
ATOM   5734  C  CG2   . VAL D 4  652  ? -11.556 -68.288  42.073  1.00 104.21 ? 652  VAL A CG2   1 
ATOM   5735  N  N     . VAL D 4  653  ? -12.497 -64.507  43.635  1.00 105.93 ? 653  VAL A N     1 
ATOM   5736  C  CA    . VAL D 4  653  ? -13.015 -63.609  44.701  1.00 105.27 ? 653  VAL A CA    1 
ATOM   5737  C  C     . VAL D 4  653  ? -13.533 -62.361  44.061  1.00 105.85 ? 653  VAL A C     1 
ATOM   5738  O  O     . VAL D 4  653  ? -14.676 -61.979  44.279  1.00 106.09 ? 653  VAL A O     1 
ATOM   5739  C  CB    . VAL D 4  653  ? -11.989 -63.282  45.835  1.00 104.88 ? 653  VAL A CB    1 
ATOM   5740  C  CG1   . VAL D 4  653  ? -12.391 -62.053  46.647  1.00 103.93 ? 653  VAL A CG1   1 
ATOM   5741  C  CG2   . VAL D 4  653  ? -11.838 -64.443  46.765  1.00 103.81 ? 653  VAL A CG2   1 
ATOM   5742  N  N     . ASN D 4  654  ? -12.712 -61.753  43.229  1.00 106.77 ? 654  ASN A N     1 
ATOM   5743  C  CA    . ASN D 4  654  ? -13.148 -60.586  42.493  1.00 108.47 ? 654  ASN A CA    1 
ATOM   5744  C  C     . ASN D 4  654  ? -14.534 -60.782  41.870  1.00 109.28 ? 654  ASN A C     1 
ATOM   5745  O  O     . ASN D 4  654  ? -15.447 -59.937  42.044  1.00 109.74 ? 654  ASN A O     1 
ATOM   5746  C  CB    . ASN D 4  654  ? -12.136 -60.255  41.400  1.00 108.50 ? 654  ASN A CB    1 
ATOM   5747  C  CG    . ASN D 4  654  ? -10.839 -59.720  41.953  1.00 108.83 ? 654  ASN A CG    1 
ATOM   5748  O  OD1   . ASN D 4  654  ? -10.781 -59.156  43.051  1.00 106.72 ? 654  ASN A OD1   1 
ATOM   5749  N  ND2   . ASN D 4  654  ? -9.779  -59.900  41.185  1.00 111.09 ? 654  ASN A ND2   1 
ATOM   5750  N  N     . PHE D 4  655  ? -14.670 -61.901  41.148  1.00 109.74 ? 655  PHE A N     1 
ATOM   5751  C  CA    . PHE D 4  655  ? -15.877 -62.225  40.400  1.00 109.84 ? 655  PHE A CA    1 
ATOM   5752  C  C     . PHE D 4  655  ? -17.056 -62.298  41.346  1.00 109.58 ? 655  PHE A C     1 
ATOM   5753  O  O     . PHE D 4  655  ? -18.065 -61.607  41.145  1.00 109.38 ? 655  PHE A O     1 
ATOM   5754  C  CB    . PHE D 4  655  ? -15.699 -63.544  39.646  1.00 110.38 ? 655  PHE A CB    1 
ATOM   5755  C  CG    . PHE D 4  655  ? -16.926 -63.997  38.932  1.00 110.77 ? 655  PHE A CG    1 
ATOM   5756  C  CD1   . PHE D 4  655  ? -17.158 -63.605  37.627  1.00 112.16 ? 655  PHE A CD1   1 
ATOM   5757  C  CD2   . PHE D 4  655  ? -17.853 -64.799  39.568  1.00 111.58 ? 655  PHE A CD2   1 
ATOM   5758  C  CE1   . PHE D 4  655  ? -18.301 -63.999  36.950  1.00 113.68 ? 655  PHE A CE1   1 
ATOM   5759  C  CE2   . PHE D 4  655  ? -18.996 -65.205  38.917  1.00 113.77 ? 655  PHE A CE2   1 
ATOM   5760  C  CZ    . PHE D 4  655  ? -19.228 -64.804  37.595  1.00 113.99 ? 655  PHE A CZ    1 
ATOM   5761  N  N     . TRP D 4  656  ? -16.904 -63.117  42.386  1.00 109.25 ? 656  TRP A N     1 
ATOM   5762  C  CA    . TRP D 4  656  ? -17.915 -63.254  43.416  1.00 109.10 ? 656  TRP A CA    1 
ATOM   5763  C  C     . TRP D 4  656  ? -18.378 -61.897  43.921  1.00 109.31 ? 656  TRP A C     1 
ATOM   5764  O  O     . TRP D 4  656  ? -19.583 -61.662  44.061  1.00 109.26 ? 656  TRP A O     1 
ATOM   5765  C  CB    . TRP D 4  656  ? -17.382 -64.056  44.574  1.00 108.79 ? 656  TRP A CB    1 
ATOM   5766  C  CG    . TRP D 4  656  ? -18.438 -64.302  45.550  1.00 109.64 ? 656  TRP A CG    1 
ATOM   5767  C  CD1   . TRP D 4  656  ? -19.382 -65.282  45.500  1.00 110.66 ? 656  TRP A CD1   1 
ATOM   5768  C  CD2   . TRP D 4  656  ? -18.714 -63.542  46.735  1.00 110.48 ? 656  TRP A CD2   1 
ATOM   5769  N  NE1   . TRP D 4  656  ? -20.225 -65.192  46.591  1.00 110.86 ? 656  TRP A NE1   1 
ATOM   5770  C  CE2   . TRP D 4  656  ? -19.831 -64.131  47.362  1.00 109.76 ? 656  TRP A CE2   1 
ATOM   5771  C  CE3   . TRP D 4  656  ? -18.117 -62.432  47.337  1.00 110.88 ? 656  TRP A CE3   1 
ATOM   5772  C  CZ2   . TRP D 4  656  ? -20.359 -63.645  48.548  1.00 108.93 ? 656  TRP A CZ2   1 
ATOM   5773  C  CZ3   . TRP D 4  656  ? -18.662 -61.949  48.521  1.00 109.70 ? 656  TRP A CZ3   1 
ATOM   5774  C  CH2   . TRP D 4  656  ? -19.763 -62.554  49.107  1.00 108.86 ? 656  TRP A CH2   1 
ATOM   5775  N  N     . LEU D 4  657  ? -17.408 -61.011  44.185  1.00 109.76 ? 657  LEU A N     1 
ATOM   5776  C  CA    . LEU D 4  657  ? -17.668 -59.624  44.658  1.00 109.60 ? 657  LEU A CA    1 
ATOM   5777  C  C     . LEU D 4  657  ? -18.288 -58.698  43.569  1.00 110.21 ? 657  LEU A C     1 
ATOM   5778  O  O     . LEU D 4  657  ? -19.220 -57.909  43.887  1.00 110.77 ? 657  LEU A O     1 
ATOM   5779  C  CB    . LEU D 4  657  ? -16.411 -58.996  45.311  1.00 109.20 ? 657  LEU A CB    1 
ATOM   5780  C  CG    . LEU D 4  657  ? -16.644 -57.881  46.339  1.00 107.98 ? 657  LEU A CG    1 
ATOM   5781  C  CD1   . LEU D 4  657  ? -16.992 -58.475  47.658  1.00 107.60 ? 657  LEU A CD1   1 
ATOM   5782  C  CD2   . LEU D 4  657  ? -15.444 -56.992  46.514  1.00 108.48 ? 657  LEU A CD2   1 
ATOM   5783  N  N     . LEU D 4  658  ? -17.805 -58.802  42.312  1.00 109.46 ? 658  LEU A N     1 
ATOM   5784  C  CA    . LEU D 4  658  ? -18.427 -58.074  41.192  1.00 109.15 ? 658  LEU A CA    1 
ATOM   5785  C  C     . LEU D 4  658  ? -19.944 -58.277  41.205  1.00 109.23 ? 658  LEU A C     1 
ATOM   5786  O  O     . LEU D 4  658  ? -20.710 -57.359  40.896  1.00 108.41 ? 658  LEU A O     1 
ATOM   5787  C  CB    . LEU D 4  658  ? -17.838 -58.460  39.823  1.00 109.14 ? 658  LEU A CB    1 
ATOM   5788  C  CG    . LEU D 4  658  ? -18.575 -57.900  38.569  1.00 108.64 ? 658  LEU A CG    1 
ATOM   5789  C  CD1   . LEU D 4  658  ? -18.153 -56.485  38.161  1.00 104.14 ? 658  LEU A CD1   1 
ATOM   5790  C  CD2   . LEU D 4  658  ? -18.508 -58.847  37.361  1.00 108.45 ? 658  LEU A CD2   1 
ATOM   5791  N  N     . HIS D 4  659  ? -20.357 -59.479  41.583  1.00 109.83 ? 659  HIS A N     1 
ATOM   5792  C  CA    . HIS D 4  659  ? -21.764 -59.742  41.797  1.00 111.17 ? 659  HIS A CA    1 
ATOM   5793  C  C     . HIS D 4  659  ? -22.127 -59.909  43.279  1.00 111.32 ? 659  HIS A C     1 
ATOM   5794  O  O     . HIS D 4  659  ? -23.143 -60.523  43.570  1.00 111.61 ? 659  HIS A O     1 
ATOM   5795  C  CB    . HIS D 4  659  ? -22.296 -60.913  40.920  1.00 111.51 ? 659  HIS A CB    1 
ATOM   5796  C  CG    . HIS D 4  659  ? -21.831 -60.868  39.491  1.00 113.89 ? 659  HIS A CG    1 
ATOM   5797  N  ND1   . HIS D 4  659  ? -22.440 -60.088  38.530  1.00 115.49 ? 659  HIS A ND1   1 
ATOM   5798  C  CD2   . HIS D 4  659  ? -20.799 -61.495  38.865  1.00 115.45 ? 659  HIS A CD2   1 
ATOM   5799  C  CE1   . HIS D 4  659  ? -21.798 -60.231  37.378  1.00 115.93 ? 659  HIS A CE1   1 
ATOM   5800  N  NE2   . HIS D 4  659  ? -20.802 -61.084  37.551  1.00 114.86 ? 659  HIS A NE2   1 
ATOM   5801  N  N     . ASN D 4  660  ? -21.341 -59.376  44.224  1.00 111.80 ? 660  ASN A N     1 
ATOM   5802  C  CA    . ASN D 4  660  ? -21.939 -59.167  45.578  1.00 112.58 ? 660  ASN A CA    1 
ATOM   5803  C  C     . ASN D 4  660  ? -22.101 -57.756  46.092  1.00 112.21 ? 660  ASN A C     1 
ATOM   5804  O  O     . ASN D 4  660  ? -23.037 -57.434  46.859  1.00 111.72 ? 660  ASN A O     1 
ATOM   5805  C  CB    . ASN D 4  660  ? -21.352 -59.998  46.715  1.00 112.93 ? 660  ASN A CB    1 
ATOM   5806  C  CG    . ASN D 4  660  ? -22.399 -60.203  47.854  1.00 114.25 ? 660  ASN A CG    1 
ATOM   5807  O  OD1   . ASN D 4  660  ? -23.532 -60.651  47.572  1.00 113.97 ? 660  ASN A OD1   1 
ATOM   5808  N  ND2   . ASN D 4  660  ? -22.042 -59.843  49.113  1.00 112.93 ? 660  ASN A ND2   1 
ATOM   5809  N  N     . GLY D 4  661  ? -21.170 -56.920  45.682  1.00 111.80 ? 661  GLY A N     1 
ATOM   5810  C  CA    . GLY D 4  661  ? -21.203 -55.553  46.116  1.00 111.22 ? 661  GLY A CA    1 
ATOM   5811  C  C     . GLY D 4  661  ? -20.524 -55.411  47.455  1.00 110.36 ? 661  GLY A C     1 
ATOM   5812  O  O     . GLY D 4  661  ? -20.437 -56.360  48.232  1.00 110.71 ? 661  GLY A O     1 
ATOM   5813  N  N     . PHE D 4  662  ? -19.978 -54.230  47.680  1.00 109.17 ? 662  PHE A N     1 
ATOM   5814  C  CA    . PHE D 4  662  ? -19.681 -53.783  49.001  1.00 108.62 ? 662  PHE A CA    1 
ATOM   5815  C  C     . PHE D 4  662  ? -19.583 -52.263  48.863  1.00 109.78 ? 662  PHE A C     1 
ATOM   5816  O  O     . PHE D 4  662  ? -19.167 -51.734  47.807  1.00 109.39 ? 662  PHE A O     1 
ATOM   5817  C  CB    . PHE D 4  662  ? -18.434 -54.458  49.499  1.00 107.29 ? 662  PHE A CB    1 
ATOM   5818  C  CG    . PHE D 4  662  ? -18.109 -54.179  50.912  1.00 105.80 ? 662  PHE A CG    1 
ATOM   5819  C  CD1   . PHE D 4  662  ? -18.251 -55.151  51.859  1.00 106.37 ? 662  PHE A CD1   1 
ATOM   5820  C  CD2   . PHE D 4  662  ? -17.583 -52.984  51.293  1.00 103.90 ? 662  PHE A CD2   1 
ATOM   5821  C  CE1   . PHE D 4  662  ? -17.902 -54.912  53.173  1.00 104.82 ? 662  PHE A CE1   1 
ATOM   5822  C  CE2   . PHE D 4  662  ? -17.257 -52.750  52.591  1.00 103.32 ? 662  PHE A CE2   1 
ATOM   5823  C  CZ    . PHE D 4  662  ? -17.417 -53.709  53.529  1.00 103.94 ? 662  PHE A CZ    1 
ATOM   5824  N  N     . SER D 4  663  ? -20.073 -51.573  49.893  1.00 111.18 ? 663  SER A N     1 
ATOM   5825  C  CA    . SER D 4  663  ? -20.228 -50.120  49.882  1.00 112.44 ? 663  SER A CA    1 
ATOM   5826  C  C     . SER D 4  663  ? -19.639 -49.691  51.202  1.00 113.05 ? 663  SER A C     1 
ATOM   5827  O  O     . SER D 4  663  ? -19.207 -50.551  51.949  1.00 113.88 ? 663  SER A O     1 
ATOM   5828  C  CB    . SER D 4  663  ? -21.729 -49.743  49.822  1.00 112.71 ? 663  SER A CB    1 
ATOM   5829  O  OG    . SER D 4  663  ? -21.967 -48.570  49.021  1.00 113.11 ? 663  SER A OG    1 
ATOM   5830  N  N     . THR D 4  664  ? -19.593 -48.394  51.495  1.00 113.29 ? 664  THR A N     1 
ATOM   5831  C  CA    . THR D 4  664  ? -19.479 -47.941  52.883  1.00 113.81 ? 664  THR A CA    1 
ATOM   5832  C  C     . THR D 4  664  ? -20.213 -46.633  53.041  1.00 114.20 ? 664  THR A C     1 
ATOM   5833  O  O     . THR D 4  664  ? -19.717 -45.605  52.536  1.00 114.54 ? 664  THR A O     1 
ATOM   5834  C  CB    . THR D 4  664  ? -18.018 -47.767  53.323  1.00 113.78 ? 664  THR A CB    1 
ATOM   5835  O  OG1   . THR D 4  664  ? -17.468 -49.052  53.588  1.00 115.01 ? 664  THR A OG1   1 
ATOM   5836  C  CG2   . THR D 4  664  ? -17.902 -46.952  54.602  1.00 113.29 ? 664  THR A CG2   1 
ATOM   5837  N  N     . GLY D 4  665  ? -21.377 -46.668  53.720  1.00 114.10 ? 665  GLY A N     1 
ATOM   5838  C  CA    . GLY D 4  665  ? -22.209 -45.462  53.974  1.00 113.65 ? 665  GLY A CA    1 
ATOM   5839  C  C     . GLY D 4  665  ? -21.891 -44.669  55.244  1.00 113.44 ? 665  GLY A C     1 
ATOM   5840  O  O     . GLY D 4  665  ? -21.236 -45.170  56.155  1.00 113.07 ? 665  GLY A O     1 
ATOM   5841  N  N     . ILE D 4  666  ? -22.342 -43.423  55.309  1.00 113.42 ? 666  ILE A N     1 
ATOM   5842  C  CA    . ILE D 4  666  ? -22.262 -42.689  56.556  1.00 113.99 ? 666  ILE A CA    1 
ATOM   5843  C  C     . ILE D 4  666  ? -23.189 -43.304  57.616  1.00 113.95 ? 666  ILE A C     1 
ATOM   5844  O  O     . ILE D 4  666  ? -22.964 -43.154  58.838  1.00 114.23 ? 666  ILE A O     1 
ATOM   5845  C  CB    . ILE D 4  666  ? -22.548 -41.189  56.380  1.00 114.29 ? 666  ILE A CB    1 
ATOM   5846  C  CG1   . ILE D 4  666  ? -21.933 -40.412  57.538  1.00 115.97 ? 666  ILE A CG1   1 
ATOM   5847  C  CG2   . ILE D 4  666  ? -24.058 -40.885  56.353  1.00 115.05 ? 666  ILE A CG2   1 
ATOM   5848  C  CD1   . ILE D 4  666  ? -21.085 -39.243  57.089  1.00 118.42 ? 666  ILE A CD1   1 
ATOM   5849  N  N     . GLY D 4  667  ? -24.226 -43.998  57.154  1.00 113.58 ? 667  GLY A N     1 
ATOM   5850  C  CA    . GLY D 4  667  ? -24.990 -44.837  58.051  1.00 113.71 ? 667  GLY A CA    1 
ATOM   5851  C  C     . GLY D 4  667  ? -24.067 -45.785  58.810  1.00 113.97 ? 667  GLY A C     1 
ATOM   5852  O  O     . GLY D 4  667  ? -24.424 -46.322  59.854  1.00 114.16 ? 667  GLY A O     1 
ATOM   5853  N  N     . ASP D 4  668  ? -22.863 -45.999  58.287  1.00 114.25 ? 668  ASP A N     1 
ATOM   5854  C  CA    . ASP D 4  668  ? -21.915 -46.935  58.906  1.00 114.15 ? 668  ASP A CA    1 
ATOM   5855  C  C     . ASP D 4  668  ? -21.210 -46.356  60.157  1.00 113.46 ? 668  ASP A C     1 
ATOM   5856  O  O     . ASP D 4  668  ? -20.437 -47.068  60.818  1.00 113.82 ? 668  ASP A O     1 
ATOM   5857  C  CB    . ASP D 4  668  ? -20.913 -47.491  57.866  1.00 114.24 ? 668  ASP A CB    1 
ATOM   5858  C  CG    . ASP D 4  668  ? -21.545 -48.560  56.922  1.00 116.30 ? 668  ASP A CG    1 
ATOM   5859  O  OD1   . ASP D 4  668  ? -22.147 -49.555  57.421  1.00 117.29 ? 668  ASP A OD1   1 
ATOM   5860  O  OD2   . ASP D 4  668  ? -21.416 -48.421  55.668  1.00 118.03 ? 668  ASP A OD2   1 
ATOM   5861  N  N     . THR D 4  669  ? -21.485 -45.089  60.495  1.00 112.16 ? 669  THR A N     1 
ATOM   5862  C  CA    . THR D 4  669  ? -20.894 -44.495  61.707  1.00 110.63 ? 669  THR A CA    1 
ATOM   5863  C  C     . THR D 4  669  ? -21.910 -43.843  62.677  1.00 109.75 ? 669  THR A C     1 
ATOM   5864  O  O     . THR D 4  669  ? -21.594 -42.895  63.404  1.00 109.29 ? 669  THR A O     1 
ATOM   5865  C  CB    . THR D 4  669  ? -19.556 -43.650  61.435  1.00 110.88 ? 669  THR A CB    1 
ATOM   5866  O  OG1   . THR D 4  669  ? -19.419 -43.331  60.040  1.00 109.07 ? 669  THR A OG1   1 
ATOM   5867  C  CG2   . THR D 4  669  ? -18.304 -44.434  61.937  1.00 109.35 ? 669  THR A CG2   1 
ATOM   5868  N  N     . ILE D 4  670  ? -23.110 -44.423  62.707  1.00 108.93 ? 670  ILE A N     1 
ATOM   5869  C  CA    . ILE D 4  670  ? -24.248 -44.021  63.579  1.00 108.19 ? 670  ILE A CA    1 
ATOM   5870  C  C     . ILE D 4  670  ? -24.451 -45.024  64.755  1.00 107.41 ? 670  ILE A C     1 
ATOM   5871  O  O     . ILE D 4  670  ? -24.653 -46.208  64.524  1.00 107.49 ? 670  ILE A O     1 
ATOM   5872  C  CB    . ILE D 4  670  ? -25.563 -43.943  62.716  1.00 108.11 ? 670  ILE A CB    1 
ATOM   5873  C  CG1   . ILE D 4  670  ? -25.558 -42.749  61.738  1.00 107.70 ? 670  ILE A CG1   1 
ATOM   5874  C  CG2   . ILE D 4  670  ? -26.799 -43.929  63.584  1.00 109.02 ? 670  ILE A CG2   1 
ATOM   5875  C  CD1   . ILE D 4  670  ? -26.076 -41.434  62.324  1.00 107.08 ? 670  ILE A CD1   1 
ATOM   5876  N  N     . ALA D 4  671  ? -24.406 -44.598  66.007  1.00 106.31 ? 671  ALA A N     1 
ATOM   5877  C  CA    . ALA D 4  671  ? -24.599 -45.609  67.023  1.00 106.35 ? 671  ALA A CA    1 
ATOM   5878  C  C     . ALA D 4  671  ? -26.024 -45.601  67.639  1.00 107.48 ? 671  ALA A C     1 
ATOM   5879  O  O     . ALA D 4  671  ? -26.886 -44.756  67.307  1.00 108.46 ? 671  ALA A O     1 
ATOM   5880  C  CB    . ALA D 4  671  ? -23.561 -45.484  68.060  1.00 105.60 ? 671  ALA A CB    1 
ATOM   5881  N  N     . ASP D 4  672  ? -26.294 -46.532  68.551  1.00 107.66 ? 672  ASP A N     1 
ATOM   5882  C  CA    . ASP D 4  672  ? -27.531 -46.470  69.333  1.00 107.06 ? 672  ASP A CA    1 
ATOM   5883  C  C     . ASP D 4  672  ? -27.769 -45.138  70.020  1.00 105.94 ? 672  ASP A C     1 
ATOM   5884  O  O     . ASP D 4  672  ? -26.843 -44.402  70.355  1.00 105.00 ? 672  ASP A O     1 
ATOM   5885  C  CB    . ASP D 4  672  ? -27.594 -47.599  70.363  1.00 107.66 ? 672  ASP A CB    1 
ATOM   5886  C  CG    . ASP D 4  672  ? -27.964 -48.963  69.735  1.00 111.25 ? 672  ASP A CG    1 
ATOM   5887  O  OD1   . ASP D 4  672  ? -28.196 -49.934  70.519  1.00 113.58 ? 672  ASP A OD1   1 
ATOM   5888  O  OD2   . ASP D 4  672  ? -28.010 -49.072  68.465  1.00 114.98 ? 672  ASP A OD2   1 
ATOM   5889  N  N     . GLY D 4  673  ? -29.057 -44.841  70.182  1.00 105.83 ? 673  GLY A N     1 
ATOM   5890  C  CA    . GLY D 4  673  ? -29.550 -43.761  71.050  1.00 104.34 ? 673  GLY A CA    1 
ATOM   5891  C  C     . GLY D 4  673  ? -29.020 -44.015  72.437  1.00 102.88 ? 673  GLY A C     1 
ATOM   5892  O  O     . GLY D 4  673  ? -28.326 -43.166  73.019  1.00 102.05 ? 673  GLY A O     1 
ATOM   5893  N  N     . PRO D 4  674  ? -29.319 -45.206  72.961  1.00 102.26 ? 674  PRO A N     1 
ATOM   5894  C  CA    . PRO D 4  674  ? -28.641 -45.616  74.182  1.00 102.31 ? 674  PRO A CA    1 
ATOM   5895  C  C     . PRO D 4  674  ? -27.113 -45.411  74.105  1.00 102.33 ? 674  PRO A C     1 
ATOM   5896  O  O     . PRO D 4  674  ? -26.521 -44.859  75.025  1.00 101.88 ? 674  PRO A O     1 
ATOM   5897  C  CB    . PRO D 4  674  ? -29.032 -47.102  74.345  1.00 102.12 ? 674  PRO A CB    1 
ATOM   5898  C  CG    . PRO D 4  674  ? -29.823 -47.469  73.107  1.00 102.04 ? 674  PRO A CG    1 
ATOM   5899  C  CD    . PRO D 4  674  ? -30.301 -46.197  72.490  1.00 102.00 ? 674  PRO A CD    1 
ATOM   5900  N  N     . THR D 4  675  ? -26.500 -45.791  72.992  1.00 102.74 ? 675  THR A N     1 
ATOM   5901  C  CA    . THR D 4  675  ? -25.058 -45.884  72.924  1.00 103.24 ? 675  THR A CA    1 
ATOM   5902  C  C     . THR D 4  675  ? -24.281 -44.555  72.776  1.00 104.43 ? 675  THR A C     1 
ATOM   5903  O  O     . THR D 4  675  ? -23.285 -44.350  73.491  1.00 103.59 ? 675  THR A O     1 
ATOM   5904  C  CB    . THR D 4  675  ? -24.744 -46.858  71.886  1.00 103.04 ? 675  THR A CB    1 
ATOM   5905  O  OG1   . THR D 4  675  ? -25.471 -48.041  72.217  1.00 101.29 ? 675  THR A OG1   1 
ATOM   5906  C  CG2   . THR D 4  675  ? -23.239 -47.145  71.830  1.00 104.04 ? 675  THR A CG2   1 
ATOM   5907  N  N     . MET D 4  676  ? -24.742 -43.674  71.875  1.00 106.19 ? 676  MET A N     1 
ATOM   5908  C  CA    . MET D 4  676  ? -24.441 -42.233  71.938  1.00 108.47 ? 676  MET A CA    1 
ATOM   5909  C  C     . MET D 4  676  ? -24.703 -41.665  73.341  1.00 109.66 ? 676  MET A C     1 
ATOM   5910  O  O     . MET D 4  676  ? -23.821 -41.042  73.923  1.00 109.91 ? 676  MET A O     1 
ATOM   5911  C  CB    . MET D 4  676  ? -25.287 -41.454  70.954  1.00 108.79 ? 676  MET A CB    1 
ATOM   5912  C  CG    . MET D 4  676  ? -24.940 -41.694  69.515  1.00 113.32 ? 676  MET A CG    1 
ATOM   5913  S  SD    . MET D 4  676  ? -23.202 -41.397  68.887  1.00 122.15 ? 676  MET A SD    1 
ATOM   5914  C  CE    . MET D 4  676  ? -23.550 -41.380  67.084  1.00 114.58 ? 676  MET A CE    1 
ATOM   5915  N  N     . ARG D 4  677  ? -25.909 -41.876  73.889  1.00 111.06 ? 677  ARG A N     1 
ATOM   5916  C  CA    . ARG D 4  677  ? -26.214 -41.453  75.252  1.00 112.17 ? 677  ARG A CA    1 
ATOM   5917  C  C     . ARG D 4  677  ? -25.067 -41.899  76.182  1.00 113.73 ? 677  ARG A C     1 
ATOM   5918  O  O     . ARG D 4  677  ? -24.221 -41.082  76.597  1.00 113.97 ? 677  ARG A O     1 
ATOM   5919  C  CB    . ARG D 4  677  ? -27.563 -42.025  75.689  1.00 112.18 ? 677  ARG A CB    1 
ATOM   5920  C  CG    . ARG D 4  677  ? -28.339 -41.265  76.810  1.00 111.97 ? 677  ARG A CG    1 
ATOM   5921  C  CD    . ARG D 4  677  ? -29.775 -41.859  77.088  1.00 111.16 ? 677  ARG A CD    1 
ATOM   5922  N  NE    . ARG D 4  677  ? -30.653 -41.941  75.892  1.00 108.86 ? 677  ARG A NE    1 
ATOM   5923  C  CZ    . ARG D 4  677  ? -31.313 -43.038  75.457  1.00 107.18 ? 677  ARG A CZ    1 
ATOM   5924  N  NH1   . ARG D 4  677  ? -31.242 -44.203  76.116  1.00 104.88 ? 677  ARG A NH1   1 
ATOM   5925  N  NH2   . ARG D 4  677  ? -32.059 -42.976  74.344  1.00 105.33 ? 677  ARG A NH2   1 
ATOM   5926  N  N     . GLU D 4  678  ? -25.006 -43.202  76.447  1.00 115.26 ? 678  GLU A N     1 
ATOM   5927  C  CA    . GLU D 4  678  ? -23.980 -43.790  77.312  1.00 116.60 ? 678  GLU A CA    1 
ATOM   5928  C  C     . GLU D 4  678  ? -22.531 -43.427  76.965  1.00 117.41 ? 678  GLU A C     1 
ATOM   5929  O  O     . GLU D 4  678  ? -21.738 -43.248  77.889  1.00 117.42 ? 678  GLU A O     1 
ATOM   5930  C  CB    . GLU D 4  678  ? -24.141 -45.303  77.391  1.00 116.35 ? 678  GLU A CB    1 
ATOM   5931  C  CG    . GLU D 4  678  ? -23.111 -45.992  78.271  1.00 116.56 ? 678  GLU A CG    1 
ATOM   5932  C  CD    . GLU D 4  678  ? -23.099 -47.527  78.118  1.00 117.20 ? 678  GLU A CD    1 
ATOM   5933  O  OE1   . GLU D 4  678  ? -22.447 -48.201  78.958  1.00 118.42 ? 678  GLU A OE1   1 
ATOM   5934  O  OE2   . GLU D 4  678  ? -23.724 -48.068  77.163  1.00 116.88 ? 678  GLU A OE2   1 
ATOM   5935  N  N     . ILE D 4  679  ? -22.189 -43.325  75.671  1.00 118.59 ? 679  ILE A N     1 
ATOM   5936  C  CA    . ILE D 4  679  ? -20.867 -42.785  75.252  1.00 120.14 ? 679  ILE A CA    1 
ATOM   5937  C  C     . ILE D 4  679  ? -20.586 -41.377  75.807  1.00 121.67 ? 679  ILE A C     1 
ATOM   5938  O  O     . ILE D 4  679  ? -19.450 -41.065  76.233  1.00 121.35 ? 679  ILE A O     1 
ATOM   5939  C  CB    . ILE D 4  679  ? -20.672 -42.744  73.697  1.00 119.92 ? 679  ILE A CB    1 
ATOM   5940  C  CG1   . ILE D 4  679  ? -19.692 -43.828  73.238  1.00 119.68 ? 679  ILE A CG1   1 
ATOM   5941  C  CG2   . ILE D 4  679  ? -20.150 -41.356  73.223  1.00 118.91 ? 679  ILE A CG2   1 
ATOM   5942  C  CD1   . ILE D 4  679  ? -19.946 -44.363  71.817  1.00 118.36 ? 679  ILE A CD1   1 
ATOM   5943  N  N     . THR D 4  680  ? -21.618 -40.526  75.791  1.00 123.53 ? 680  THR A N     1 
ATOM   5944  C  CA    . THR D 4  680  ? -21.418 -39.130  76.177  1.00 125.12 ? 680  THR A CA    1 
ATOM   5945  C  C     . THR D 4  680  ? -21.310 -39.062  77.693  1.00 125.64 ? 680  THR A C     1 
ATOM   5946  O  O     . THR D 4  680  ? -20.388 -38.420  78.211  1.00 126.34 ? 680  THR A O     1 
ATOM   5947  C  CB    . THR D 4  680  ? -22.440 -38.110  75.544  1.00 125.30 ? 680  THR A CB    1 
ATOM   5948  O  OG1   . THR D 4  680  ? -22.119 -37.883  74.154  1.00 124.75 ? 680  THR A OG1   1 
ATOM   5949  C  CG2   . THR D 4  680  ? -22.377 -36.757  76.279  1.00 125.94 ? 680  THR A CG2   1 
ATOM   5950  N  N     . GLU D 4  681  ? -22.180 -39.782  78.395  1.00 125.81 ? 681  GLU A N     1 
ATOM   5951  C  CA    . GLU D 4  681  ? -22.030 -39.908  79.844  1.00 126.62 ? 681  GLU A CA    1 
ATOM   5952  C  C     . GLU D 4  681  ? -20.762 -40.681  80.265  1.00 125.72 ? 681  GLU A C     1 
ATOM   5953  O  O     . GLU D 4  681  ? -20.375 -40.632  81.432  1.00 125.64 ? 681  GLU A O     1 
ATOM   5954  C  CB    . GLU D 4  681  ? -23.279 -40.509  80.482  1.00 126.58 ? 681  GLU A CB    1 
ATOM   5955  C  CG    . GLU D 4  681  ? -23.488 -41.978  80.145  1.00 128.71 ? 681  GLU A CG    1 
ATOM   5956  C  CD    . GLU D 4  681  ? -24.781 -42.544  80.716  1.00 129.20 ? 681  GLU A CD    1 
ATOM   5957  O  OE1   . GLU D 4  681  ? -25.772 -41.781  80.797  1.00 134.30 ? 681  GLU A OE1   1 
ATOM   5958  O  OE2   . GLU D 4  681  ? -24.817 -43.750  81.081  1.00 132.39 ? 681  GLU A OE2   1 
ATOM   5959  N  N     . THR D 4  682  ? -20.119 -41.383  79.326  1.00 125.18 ? 682  THR A N     1 
ATOM   5960  C  CA    . THR D 4  682  ? -18.754 -41.903  79.553  1.00 124.43 ? 682  THR A CA    1 
ATOM   5961  C  C     . THR D 4  682  ? -17.766 -40.775  79.751  1.00 123.63 ? 682  THR A C     1 
ATOM   5962  O  O     . THR D 4  682  ? -16.923 -40.823  80.660  1.00 123.44 ? 682  THR A O     1 
ATOM   5963  C  CB    . THR D 4  682  ? -18.211 -42.726  78.388  1.00 124.30 ? 682  THR A CB    1 
ATOM   5964  O  OG1   . THR D 4  682  ? -18.812 -44.022  78.412  1.00 125.07 ? 682  THR A OG1   1 
ATOM   5965  C  CG2   . THR D 4  682  ? -16.704 -42.897  78.530  1.00 124.15 ? 682  THR A CG2   1 
ATOM   5966  N  N     . ILE D 4  683  ? -17.859 -39.770  78.889  1.00 122.60 ? 683  ILE A N     1 
ATOM   5967  C  CA    . ILE D 4  683  ? -16.971 -38.635  79.020  1.00 122.25 ? 683  ILE A CA    1 
ATOM   5968  C  C     . ILE D 4  683  ? -17.319 -37.820  80.277  1.00 121.77 ? 683  ILE A C     1 
ATOM   5969  O  O     . ILE D 4  683  ? -16.437 -37.503  81.077  1.00 121.54 ? 683  ILE A O     1 
ATOM   5970  C  CB    . ILE D 4  683  ? -16.917 -37.781  77.728  1.00 122.42 ? 683  ILE A CB    1 
ATOM   5971  C  CG1   . ILE D 4  683  ? -16.941 -38.680  76.480  1.00 122.38 ? 683  ILE A CG1   1 
ATOM   5972  C  CG2   . ILE D 4  683  ? -15.662 -36.879  77.716  1.00 122.02 ? 683  ILE A CG2   1 
ATOM   5973  C  CD1   . ILE D 4  683  ? -15.564 -39.034  75.903  1.00 119.92 ? 683  ILE A CD1   1 
ATOM   5974  N  N     . ALA D 4  684  ? -18.608 -37.546  80.462  1.00 121.51 ? 684  ALA A N     1 
ATOM   5975  C  CA    . ALA D 4  684  ? -19.149 -36.820  81.630  1.00 121.28 ? 684  ALA A CA    1 
ATOM   5976  C  C     . ALA D 4  684  ? -18.606 -37.259  83.002  1.00 121.05 ? 684  ALA A C     1 
ATOM   5977  O  O     . ALA D 4  684  ? -18.288 -36.415  83.855  1.00 120.56 ? 684  ALA A O     1 
ATOM   5978  C  CB    . ALA D 4  684  ? -20.695 -36.873  81.623  1.00 121.13 ? 684  ALA A CB    1 
ATOM   5979  N  N     . GLU D 4  685  ? -18.514 -38.573  83.203  1.00 121.03 ? 685  GLU A N     1 
ATOM   5980  C  CA    . GLU D 4  685  ? -18.050 -39.134  84.475  1.00 121.53 ? 685  GLU A CA    1 
ATOM   5981  C  C     . GLU D 4  685  ? -16.558 -38.922  84.646  1.00 121.09 ? 685  GLU A C     1 
ATOM   5982  O  O     . GLU D 4  685  ? -16.095 -38.625  85.755  1.00 120.93 ? 685  GLU A O     1 
ATOM   5983  C  CB    . GLU D 4  685  ? -18.402 -40.633  84.596  1.00 121.69 ? 685  GLU A CB    1 
ATOM   5984  C  CG    . GLU D 4  685  ? -17.316 -41.625  84.105  1.00 122.99 ? 685  GLU A CG    1 
ATOM   5985  C  CD    . GLU D 4  685  ? -17.849 -43.033  83.812  1.00 122.87 ? 685  GLU A CD    1 
ATOM   5986  O  OE1   . GLU D 4  685  ? -17.863 -43.420  82.606  1.00 124.50 ? 685  GLU A OE1   1 
ATOM   5987  O  OE2   . GLU D 4  685  ? -18.248 -43.742  84.780  1.00 123.72 ? 685  GLU A OE2   1 
ATOM   5988  N  N     . ALA D 4  686  ? -15.828 -39.085  83.536  1.00 120.77 ? 686  ALA A N     1 
ATOM   5989  C  CA    . ALA D 4  686  ? -14.389 -38.965  83.507  1.00 120.18 ? 686  ALA A CA    1 
ATOM   5990  C  C     . ALA D 4  686  ? -14.015 -37.503  83.400  1.00 120.15 ? 686  ALA A C     1 
ATOM   5991  O  O     . ALA D 4  686  ? -12.909 -37.125  83.742  1.00 120.05 ? 686  ALA A O     1 
ATOM   5992  C  CB    . ALA D 4  686  ? -13.838 -39.744  82.380  1.00 120.19 ? 686  ALA A CB    1 
ATOM   5993  N  N     . LYS D 4  687  ? -14.951 -36.683  82.937  1.00 120.42 ? 687  LYS A N     1 
ATOM   5994  C  CA    . LYS D 4  687  ? -14.867 -35.229  83.111  1.00 121.01 ? 687  LYS A CA    1 
ATOM   5995  C  C     . LYS D 4  687  ? -14.780 -34.815  84.589  1.00 121.27 ? 687  LYS A C     1 
ATOM   5996  O  O     . LYS D 4  687  ? -13.812 -34.160  84.980  1.00 121.46 ? 687  LYS A O     1 
ATOM   5997  C  CB    . LYS D 4  687  ? -16.065 -34.521  82.477  1.00 121.05 ? 687  LYS A CB    1 
ATOM   5998  C  CG    . LYS D 4  687  ? -15.936 -34.229  81.009  1.00 121.56 ? 687  LYS A CG    1 
ATOM   5999  C  CD    . LYS D 4  687  ? -15.153 -32.948  80.747  1.00 121.92 ? 687  LYS A CD    1 
ATOM   6000  C  CE    . LYS D 4  687  ? -15.111 -32.613  79.244  1.00 121.43 ? 687  LYS A CE    1 
ATOM   6001  N  NZ    . LYS D 4  687  ? -16.413 -32.095  78.735  1.00 119.63 ? 687  LYS A NZ    1 
ATOM   6002  N  N     . LYS D 4  688  ? -15.781 -35.175  85.404  1.00 121.26 ? 688  LYS A N     1 
ATOM   6003  C  CA    . LYS D 4  688  ? -15.744 -34.801  86.828  1.00 121.45 ? 688  LYS A CA    1 
ATOM   6004  C  C     . LYS D 4  688  ? -14.749 -35.653  87.605  1.00 121.07 ? 688  LYS A C     1 
ATOM   6005  O  O     . LYS D 4  688  ? -14.747 -35.638  88.832  1.00 121.26 ? 688  LYS A O     1 
ATOM   6006  C  CB    . LYS D 4  688  ? -17.121 -34.850  87.531  1.00 121.86 ? 688  LYS A CB    1 
ATOM   6007  C  CG    . LYS D 4  688  ? -18.299 -34.106  86.867  1.00 122.90 ? 688  LYS A CG    1 
ATOM   6008  C  CD    . LYS D 4  688  ? -18.281 -32.577  87.011  1.00 123.81 ? 688  LYS A CD    1 
ATOM   6009  C  CE    . LYS D 4  688  ? -17.815 -31.903  85.709  1.00 124.00 ? 688  LYS A CE    1 
ATOM   6010  N  NZ    . LYS D 4  688  ? -18.208 -32.652  84.455  1.00 123.82 ? 688  LYS A NZ    1 
ATOM   6011  N  N     . LYS D 4  689  ? -13.923 -36.409  86.890  1.00 120.53 ? 689  LYS A N     1 
ATOM   6012  C  CA    . LYS D 4  689  ? -12.811 -37.119  87.508  1.00 120.11 ? 689  LYS A CA    1 
ATOM   6013  C  C     . LYS D 4  689  ? -11.614 -36.189  87.483  1.00 119.32 ? 689  LYS A C     1 
ATOM   6014  O  O     . LYS D 4  689  ? -10.998 -35.940  88.525  1.00 119.40 ? 689  LYS A O     1 
ATOM   6015  C  CB    . LYS D 4  689  ? -12.497 -38.402  86.737  1.00 120.36 ? 689  LYS A CB    1 
ATOM   6016  C  CG    . LYS D 4  689  ? -11.549 -39.376  87.441  1.00 120.54 ? 689  LYS A CG    1 
ATOM   6017  C  CD    . LYS D 4  689  ? -11.274 -40.612  86.549  1.00 120.59 ? 689  LYS A CD    1 
ATOM   6018  C  CE    . LYS D 4  689  ? -12.192 -41.804  86.846  1.00 120.14 ? 689  LYS A CE    1 
ATOM   6019  N  NZ    . LYS D 4  689  ? -11.974 -42.320  88.240  1.00 120.90 ? 689  LYS A NZ    1 
ATOM   6020  N  N     . VAL D 4  690  ? -11.312 -35.684  86.280  1.00 118.18 ? 690  VAL A N     1 
ATOM   6021  C  CA    . VAL D 4  690  ? -10.262 -34.689  86.043  1.00 117.01 ? 690  VAL A CA    1 
ATOM   6022  C  C     . VAL D 4  690  ? -10.520 -33.436  86.843  1.00 116.51 ? 690  VAL A C     1 
ATOM   6023  O  O     . VAL D 4  690  ? -9.586  -32.841  87.373  1.00 116.45 ? 690  VAL A O     1 
ATOM   6024  C  CB    . VAL D 4  690  ? -10.176 -34.284  84.564  1.00 116.86 ? 690  VAL A CB    1 
ATOM   6025  C  CG1   . VAL D 4  690  ? -9.382  -33.003  84.398  1.00 115.97 ? 690  VAL A CG1   1 
ATOM   6026  C  CG2   . VAL D 4  690  ? -9.546  -35.390  83.761  1.00 117.13 ? 690  VAL A CG2   1 
ATOM   6027  N  N     . LEU D 4  691  ? -11.796 -33.054  86.919  1.00 115.87 ? 691  LEU A N     1 
ATOM   6028  C  CA    . LEU D 4  691  ? -12.263 -31.885  87.671  1.00 114.92 ? 691  LEU A CA    1 
ATOM   6029  C  C     . LEU D 4  691  ? -11.997 -32.031  89.159  1.00 113.97 ? 691  LEU A C     1 
ATOM   6030  O  O     . LEU D 4  691  ? -11.794 -31.041  89.842  1.00 113.97 ? 691  LEU A O     1 
ATOM   6031  C  CB    . LEU D 4  691  ? -13.761 -31.655  87.415  1.00 115.11 ? 691  LEU A CB    1 
ATOM   6032  C  CG    . LEU D 4  691  ? -14.621 -30.523  88.017  1.00 115.59 ? 691  LEU A CG    1 
ATOM   6033  C  CD1   . LEU D 4  691  ? -15.092 -30.782  89.480  1.00 114.68 ? 691  LEU A CD1   1 
ATOM   6034  C  CD2   . LEU D 4  691  ? -13.942 -29.172  87.860  1.00 115.78 ? 691  LEU A CD2   1 
ATOM   6035  N  N     . ASP D 4  692  ? -11.980 -33.255  89.662  1.00 112.96 ? 692  ASP A N     1 
ATOM   6036  C  CA    . ASP D 4  692  ? -11.833 -33.432  91.094  1.00 112.48 ? 692  ASP A CA    1 
ATOM   6037  C  C     . ASP D 4  692  ? -10.395 -33.512  91.548  1.00 111.72 ? 692  ASP A C     1 
ATOM   6038  O  O     . ASP D 4  692  ? -10.056 -33.084  92.642  1.00 111.08 ? 692  ASP A O     1 
ATOM   6039  C  CB    . ASP D 4  692  ? -12.699 -34.596  91.595  1.00 113.10 ? 692  ASP A CB    1 
ATOM   6040  C  CG    . ASP D 4  692  ? -14.149 -34.145  91.935  1.00 113.53 ? 692  ASP A CG    1 
ATOM   6041  O  OD1   . ASP D 4  692  ? -14.305 -33.204  92.753  1.00 113.10 ? 692  ASP A OD1   1 
ATOM   6042  O  OD2   . ASP D 4  692  ? -15.124 -34.709  91.375  1.00 113.90 ? 692  ASP A OD2   1 
ATOM   6043  N  N     . VAL D 4  693  ? -9.552  -34.028  90.670  1.00 111.73 ? 693  VAL A N     1 
ATOM   6044  C  CA    . VAL D 4  693  ? -8.104  -34.007  90.854  1.00 111.56 ? 693  VAL A CA    1 
ATOM   6045  C  C     . VAL D 4  693  ? -7.565  -32.583  90.762  1.00 111.66 ? 693  VAL A C     1 
ATOM   6046  O  O     . VAL D 4  693  ? -6.704  -32.209  91.547  1.00 111.51 ? 693  VAL A O     1 
ATOM   6047  C  CB    . VAL D 4  693  ? -7.416  -34.892  89.824  1.00 111.20 ? 693  VAL A CB    1 
ATOM   6048  C  CG1   . VAL D 4  693  ? -5.941  -34.832  90.002  1.00 111.65 ? 693  VAL A CG1   1 
ATOM   6049  C  CG2   . VAL D 4  693  ? -7.883  -36.312  89.982  1.00 111.37 ? 693  VAL A CG2   1 
ATOM   6050  N  N     . THR D 4  694  ? -8.081  -31.804  89.808  1.00 112.10 ? 694  THR A N     1 
ATOM   6051  C  CA    . THR D 4  694  ? -7.770  -30.378  89.669  1.00 113.01 ? 694  THR A CA    1 
ATOM   6052  C  C     . THR D 4  694  ? -8.114  -29.622  90.926  1.00 114.14 ? 694  THR A C     1 
ATOM   6053  O  O     . THR D 4  694  ? -7.383  -28.729  91.336  1.00 114.52 ? 694  THR A O     1 
ATOM   6054  C  CB    . THR D 4  694  ? -8.593  -29.714  88.572  1.00 112.70 ? 694  THR A CB    1 
ATOM   6055  O  OG1   . THR D 4  694  ? -8.747  -30.610  87.477  1.00 113.09 ? 694  THR A OG1   1 
ATOM   6056  C  CG2   . THR D 4  694  ? -7.912  -28.462  88.078  1.00 113.31 ? 694  THR A CG2   1 
ATOM   6057  N  N     . LYS D 4  695  ? -9.252  -29.981  91.516  1.00 115.50 ? 695  LYS A N     1 
ATOM   6058  C  CA    . LYS D 4  695  ? -9.735  -29.392  92.752  1.00 116.54 ? 695  LYS A CA    1 
ATOM   6059  C  C     . LYS D 4  695  ? -8.894  -29.841  93.952  1.00 116.87 ? 695  LYS A C     1 
ATOM   6060  O  O     . LYS D 4  695  ? -8.864  -29.171  94.976  1.00 117.38 ? 695  LYS A O     1 
ATOM   6061  C  CB    . LYS D 4  695  ? -11.204 -29.770  92.963  1.00 116.78 ? 695  LYS A CB    1 
ATOM   6062  C  CG    . LYS D 4  695  ? -12.076 -28.617  93.452  1.00 118.77 ? 695  LYS A CG    1 
ATOM   6063  C  CD    . LYS D 4  695  ? -12.640 -27.773  92.286  1.00 121.28 ? 695  LYS A CD    1 
ATOM   6064  C  CE    . LYS D 4  695  ? -12.455 -26.250  92.497  1.00 123.21 ? 695  LYS A CE    1 
ATOM   6065  N  NZ    . LYS D 4  695  ? -12.564 -25.741  93.925  1.00 125.08 ? 695  LYS A NZ    1 
ATOM   6066  N  N     . GLU D 4  696  ? -8.218  -30.976  93.822  1.00 117.14 ? 696  GLU A N     1 
ATOM   6067  C  CA    . GLU D 4  696  ? -7.329  -31.460  94.859  1.00 117.38 ? 696  GLU A CA    1 
ATOM   6068  C  C     . GLU D 4  696  ? -5.964  -30.791  94.753  1.00 117.45 ? 696  GLU A C     1 
ATOM   6069  O  O     . GLU D 4  696  ? -5.445  -30.286  95.735  1.00 117.46 ? 696  GLU A O     1 
ATOM   6070  C  CB    . GLU D 4  696  ? -7.184  -32.961  94.730  1.00 117.57 ? 696  GLU A CB    1 
ATOM   6071  C  CG    . GLU D 4  696  ? -6.845  -33.662  96.018  1.00 118.83 ? 696  GLU A CG    1 
ATOM   6072  C  CD    . GLU D 4  696  ? -7.030  -35.169  95.915  1.00 120.25 ? 696  GLU A CD    1 
ATOM   6073  O  OE1   . GLU D 4  696  ? -6.912  -35.701  94.784  1.00 120.70 ? 696  GLU A OE1   1 
ATOM   6074  O  OE2   . GLU D 4  696  ? -7.291  -35.813  96.964  1.00 120.80 ? 696  GLU A OE2   1 
ATOM   6075  N  N     . ALA D 4  697  ? -5.389  -30.783  93.554  1.00 117.78 ? 697  ALA A N     1 
ATOM   6076  C  CA    . ALA D 4  697  ? -4.123  -30.090  93.292  1.00 118.24 ? 697  ALA A CA    1 
ATOM   6077  C  C     . ALA D 4  697  ? -4.159  -28.636  93.740  1.00 118.66 ? 697  ALA A C     1 
ATOM   6078  O  O     . ALA D 4  697  ? -3.118  -27.966  93.774  1.00 118.79 ? 697  ALA A O     1 
ATOM   6079  C  CB    . ALA D 4  697  ? -3.793  -30.148  91.822  1.00 118.11 ? 697  ALA A CB    1 
ATOM   6080  N  N     . GLN D 4  698  ? -5.365  -28.175  94.080  1.00 118.96 ? 698  GLN A N     1 
ATOM   6081  C  CA    . GLN D 4  698  ? -5.662  -26.770  94.344  1.00 119.17 ? 698  GLN A CA    1 
ATOM   6082  C  C     . GLN D 4  698  ? -5.703  -26.495  95.816  1.00 119.26 ? 698  GLN A C     1 
ATOM   6083  O  O     . GLN D 4  698  ? -5.546  -25.361  96.253  1.00 119.13 ? 698  GLN A O     1 
ATOM   6084  C  CB    . GLN D 4  698  ? -6.994  -26.380  93.698  1.00 119.06 ? 698  GLN A CB    1 
ATOM   6085  C  CG    . GLN D 4  698  ? -6.810  -25.613  92.391  1.00 119.92 ? 698  GLN A CG    1 
ATOM   6086  C  CD    . GLN D 4  698  ? -7.994  -25.693  91.440  1.00 120.61 ? 698  GLN A CD    1 
ATOM   6087  O  OE1   . GLN D 4  698  ? -9.151  -25.792  91.857  1.00 120.09 ? 698  GLN A OE1   1 
ATOM   6088  N  NE2   . GLN D 4  698  ? -7.699  -25.634  90.137  1.00 121.72 ? 698  GLN A NE2   1 
ATOM   6089  N  N     . ALA D 4  699  ? -5.932  -27.549  96.578  1.00 119.98 ? 699  ALA A N     1 
ATOM   6090  C  CA    . ALA D 4  699  ? -5.894  -27.466  98.025  1.00 120.94 ? 699  ALA A CA    1 
ATOM   6091  C  C     . ALA D 4  699  ? -4.561  -28.015  98.490  1.00 121.63 ? 699  ALA A C     1 
ATOM   6092  O  O     . ALA D 4  699  ? -4.356  -28.229  99.695  1.00 121.78 ? 699  ALA A O     1 
ATOM   6093  C  CB    . ALA D 4  699  ? -7.045  -28.244  98.643  1.00 120.92 ? 699  ALA A CB    1 
ATOM   6094  N  N     . ASN D 4  700  ? -3.670  -28.249  97.517  1.00 122.37 ? 700  ASN A N     1 
ATOM   6095  C  CA    . ASN D 4  700  ? -2.272  -28.602  97.770  1.00 123.09 ? 700  ASN A CA    1 
ATOM   6096  C  C     . ASN D 4  700  ? -2.151  -29.955  98.461  1.00 123.87 ? 700  ASN A C     1 
ATOM   6097  O  O     . ASN D 4  700  ? -1.323  -30.146  99.354  1.00 123.99 ? 700  ASN A O     1 
ATOM   6098  C  CB    . ASN D 4  700  ? -1.604  -27.496  98.599  1.00 122.86 ? 700  ASN A CB    1 
ATOM   6099  C  CG    . ASN D 4  700  ? -0.109  -27.498  98.485  1.00 122.36 ? 700  ASN A CG    1 
ATOM   6100  O  OD1   . ASN D 4  700  ? 0.478   -28.316  97.768  1.00 123.31 ? 700  ASN A OD1   1 
ATOM   6101  N  ND2   . ASN D 4  700  ? 0.527   -26.572  99.193  1.00 121.28 ? 700  ASN A ND2   1 
ATOM   6102  N  N     . LEU D 4  701  ? -2.998  -30.890  98.040  1.00 124.96 ? 701  LEU A N     1 
ATOM   6103  C  CA    . LEU D 4  701  ? -3.059  -32.222  98.641  1.00 125.94 ? 701  LEU A CA    1 
ATOM   6104  C  C     . LEU D 4  701  ? -2.584  -33.278  97.645  1.00 126.85 ? 701  LEU A C     1 
ATOM   6105  O  O     . LEU D 4  701  ? -2.263  -34.402  98.019  1.00 126.90 ? 701  LEU A O     1 
ATOM   6106  C  CB    . LEU D 4  701  ? -4.477  -32.533  99.155  1.00 125.59 ? 701  LEU A CB    1 
ATOM   6107  C  CG    . LEU D 4  701  ? -5.165  -31.468  100.012 1.00 124.69 ? 701  LEU A CG    1 
ATOM   6108  C  CD1   . LEU D 4  701  ? -6.635  -31.794  100.180 1.00 124.34 ? 701  LEU A CD1   1 
ATOM   6109  C  CD2   . LEU D 4  701  ? -4.471  -31.314  101.360 1.00 124.35 ? 701  LEU A CD2   1 
ATOM   6110  N  N     . LEU D 4  702  ? -2.537  -32.909  96.372  1.00 128.16 ? 702  LEU A N     1 
ATOM   6111  C  CA    . LEU D 4  702  ? -1.912  -33.756  95.382  1.00 129.65 ? 702  LEU A CA    1 
ATOM   6112  C  C     . LEU D 4  702  ? -0.509  -34.071  95.901  1.00 130.80 ? 702  LEU A C     1 
ATOM   6113  O  O     . LEU D 4  702  ? 0.291   -33.164  96.150  1.00 130.79 ? 702  LEU A O     1 
ATOM   6114  C  CB    . LEU D 4  702  ? -1.856  -33.032  94.033  1.00 129.56 ? 702  LEU A CB    1 
ATOM   6115  C  CG    . LEU D 4  702  ? -2.397  -33.722  92.779  1.00 129.31 ? 702  LEU A CG    1 
ATOM   6116  C  CD1   . LEU D 4  702  ? -1.404  -34.727  92.198  1.00 129.15 ? 702  LEU A CD1   1 
ATOM   6117  C  CD2   . LEU D 4  702  ? -3.770  -34.356  93.057  1.00 129.08 ? 702  LEU A CD2   1 
ATOM   6118  N  N     . THR D 4  703  ? -0.237  -35.355  96.119  1.00 132.46 ? 703  THR A N     1 
ATOM   6119  C  CA    . THR D 4  703  ? 1.073   -35.780  96.616  1.00 134.11 ? 703  THR A CA    1 
ATOM   6120  C  C     . THR D 4  703  ? 2.076   -35.946  95.467  1.00 135.16 ? 703  THR A C     1 
ATOM   6121  O  O     . THR D 4  703  ? 1.720   -36.302  94.331  1.00 135.13 ? 703  THR A O     1 
ATOM   6122  C  CB    . THR D 4  703  ? 1.018   -37.084  97.488  1.00 134.14 ? 703  THR A CB    1 
ATOM   6123  O  OG1   . THR D 4  703  ? -0.181  -37.112  98.275  1.00 134.23 ? 703  THR A OG1   1 
ATOM   6124  C  CG2   . THR D 4  703  ? 2.232   -37.162  98.432  1.00 134.30 ? 703  THR A CG2   1 
ATOM   6125  N  N     . ALA D 4  704  ? 3.335   -35.671  95.790  1.00 136.62 ? 704  ALA A N     1 
ATOM   6126  C  CA    . ALA D 4  704  ? 4.433   -35.754  94.840  1.00 137.81 ? 704  ALA A CA    1 
ATOM   6127  C  C     . ALA D 4  704  ? 4.767   -37.202  94.529  1.00 138.48 ? 704  ALA A C     1 
ATOM   6128  O  O     . ALA D 4  704  ? 5.427   -37.889  95.329  1.00 138.49 ? 704  ALA A O     1 
ATOM   6129  C  CB    . ALA D 4  704  ? 5.666   -35.026  95.401  1.00 138.13 ? 704  ALA A CB    1 
ATOM   6130  N  N     . LYS D 4  705  ? 4.294   -37.666  93.374  1.00 139.34 ? 705  LYS A N     1 
ATOM   6131  C  CA    . LYS D 4  705  ? 4.723   -38.957  92.840  1.00 140.21 ? 705  LYS A CA    1 
ATOM   6132  C  C     . LYS D 4  705  ? 6.251   -38.942  92.813  1.00 140.66 ? 705  LYS A C     1 
ATOM   6133  O  O     . LYS D 4  705  ? 6.852   -38.002  92.258  1.00 141.11 ? 705  LYS A O     1 
ATOM   6134  C  CB    . LYS D 4  705  ? 4.175   -39.174  91.426  1.00 140.25 ? 705  LYS A CB    1 
ATOM   6135  C  CG    . LYS D 4  705  ? 2.671   -39.333  91.347  1.00 140.72 ? 705  LYS A CG    1 
ATOM   6136  C  CD    . LYS D 4  705  ? 2.249   -39.770  89.958  1.00 141.32 ? 705  LYS A CD    1 
ATOM   6137  C  CE    . LYS D 4  705  ? 0.740   -39.735  89.821  1.00 141.48 ? 705  LYS A CE    1 
ATOM   6138  N  NZ    . LYS D 4  705  ? 0.296   -40.689  88.771  1.00 141.48 ? 705  LYS A NZ    1 
ATOM   6139  N  N     . HIS D 4  706  ? 6.876   -39.949  93.428  1.00 140.78 ? 706  HIS A N     1 
ATOM   6140  C  CA    . HIS D 4  706  ? 8.335   -39.976  93.543  1.00 140.89 ? 706  HIS A CA    1 
ATOM   6141  C  C     . HIS D 4  706  ? 9.042   -39.819  92.199  1.00 140.54 ? 706  HIS A C     1 
ATOM   6142  O  O     . HIS D 4  706  ? 8.717   -40.496  91.219  1.00 140.50 ? 706  HIS A O     1 
ATOM   6143  C  CB    . HIS D 4  706  ? 8.826   -41.240  94.231  1.00 141.21 ? 706  HIS A CB    1 
ATOM   6144  C  CG    . HIS D 4  706  ? 10.317  -41.327  94.301  1.00 142.81 ? 706  HIS A CG    1 
ATOM   6145  N  ND1   . HIS D 4  706  ? 11.044  -40.787  95.341  1.00 144.42 ? 706  HIS A ND1   1 
ATOM   6146  C  CD2   . HIS D 4  706  ? 11.222  -41.860  93.444  1.00 143.97 ? 706  HIS A CD2   1 
ATOM   6147  C  CE1   . HIS D 4  706  ? 12.332  -41.002  95.132  1.00 144.89 ? 706  HIS A CE1   1 
ATOM   6148  N  NE2   . HIS D 4  706  ? 12.466  -41.649  93.987  1.00 144.72 ? 706  HIS A NE2   1 
ATOM   6149  N  N     . GLY D 4  707  ? 10.007  -38.908  92.168  1.00 140.27 ? 707  GLY A N     1 
ATOM   6150  C  CA    . GLY D 4  707  ? 10.785  -38.654  90.965  1.00 139.87 ? 707  GLY A CA    1 
ATOM   6151  C  C     . GLY D 4  707  ? 10.224  -37.632  89.988  1.00 139.56 ? 707  GLY A C     1 
ATOM   6152  O  O     . GLY D 4  707  ? 10.876  -37.329  88.995  1.00 139.67 ? 707  GLY A O     1 
ATOM   6153  N  N     . MET D 4  708  ? 9.030   -37.095  90.254  1.00 139.21 ? 708  MET A N     1 
ATOM   6154  C  CA    . MET D 4  708  ? 8.428   -36.053  89.388  1.00 138.74 ? 708  MET A CA    1 
ATOM   6155  C  C     . MET D 4  708  ? 7.913   -34.784  90.124  1.00 138.32 ? 708  MET A C     1 
ATOM   6156  O  O     . MET D 4  708  ? 7.773   -34.778  91.360  1.00 138.46 ? 708  MET A O     1 
ATOM   6157  C  CB    . MET D 4  708  ? 7.344   -36.664  88.487  1.00 138.55 ? 708  MET A CB    1 
ATOM   6158  C  CG    . MET D 4  708  ? 6.876   -38.049  88.907  1.00 138.16 ? 708  MET A CG    1 
ATOM   6159  S  SD    . MET D 4  708  ? 5.535   -38.693  87.883  1.00 139.31 ? 708  MET A SD    1 
ATOM   6160  C  CE    . MET D 4  708  ? 6.248   -38.685  86.234  1.00 137.37 ? 708  MET A CE    1 
ATOM   6161  N  N     . THR D 4  709  ? 7.650   -33.718  89.358  1.00 137.48 ? 709  THR A N     1 
ATOM   6162  C  CA    . THR D 4  709  ? 7.049   -32.475  89.873  1.00 136.76 ? 709  THR A CA    1 
ATOM   6163  C  C     . THR D 4  709  ? 5.742   -32.759  90.593  1.00 136.43 ? 709  THR A C     1 
ATOM   6164  O  O     . THR D 4  709  ? 5.231   -33.873  90.549  1.00 136.53 ? 709  THR A O     1 
ATOM   6165  C  CB    . THR D 4  709  ? 6.667   -31.506  88.717  1.00 136.74 ? 709  THR A CB    1 
ATOM   6166  O  OG1   . THR D 4  709  ? 7.592   -31.626  87.638  1.00 136.49 ? 709  THR A OG1   1 
ATOM   6167  C  CG2   . THR D 4  709  ? 6.606   -30.053  89.179  1.00 136.42 ? 709  THR A CG2   1 
ATOM   6168  N  N     . LEU D 4  710  ? 5.194   -31.738  91.243  1.00 136.04 ? 710  LEU A N     1 
ATOM   6169  C  CA    . LEU D 4  710  ? 3.791   -31.745  91.643  1.00 135.69 ? 710  LEU A CA    1 
ATOM   6170  C  C     . LEU D 4  710  ? 2.951   -31.603  90.364  1.00 135.22 ? 710  LEU A C     1 
ATOM   6171  O  O     . LEU D 4  710  ? 2.050   -32.404  90.104  1.00 135.10 ? 710  LEU A O     1 
ATOM   6172  C  CB    . LEU D 4  710  ? 3.516   -30.593  92.619  1.00 135.86 ? 710  LEU A CB    1 
ATOM   6173  C  CG    . LEU D 4  710  ? 2.417   -30.540  93.707  1.00 136.59 ? 710  LEU A CG    1 
ATOM   6174  C  CD1   . LEU D 4  710  ? 0.975   -30.726  93.179  1.00 137.22 ? 710  LEU A CD1   1 
ATOM   6175  C  CD2   . LEU D 4  710  ? 2.713   -31.468  94.892  1.00 136.67 ? 710  LEU A CD2   1 
ATOM   6176  N  N     . ARG D 4  711  ? 3.282   -30.591  89.559  1.00 134.80 ? 711  ARG A N     1 
ATOM   6177  C  CA    . ARG D 4  711  ? 2.577   -30.298  88.303  1.00 134.32 ? 711  ARG A CA    1 
ATOM   6178  C  C     . ARG D 4  711  ? 2.552   -31.476  87.356  1.00 134.16 ? 711  ARG A C     1 
ATOM   6179  O  O     . ARG D 4  711  ? 1.511   -31.828  86.824  1.00 133.86 ? 711  ARG A O     1 
ATOM   6180  C  CB    . ARG D 4  711  ? 3.235   -29.120  87.565  1.00 134.32 ? 711  ARG A CB    1 
ATOM   6181  C  CG    . ARG D 4  711  ? 2.871   -27.757  88.101  1.00 133.37 ? 711  ARG A CG    1 
ATOM   6182  C  CD    . ARG D 4  711  ? 2.823   -26.715  86.993  1.00 131.29 ? 711  ARG A CD    1 
ATOM   6183  N  NE    . ARG D 4  711  ? 1.893   -25.643  87.334  1.00 129.98 ? 711  ARG A NE    1 
ATOM   6184  C  CZ    . ARG D 4  711  ? 2.055   -24.786  88.340  1.00 129.91 ? 711  ARG A CZ    1 
ATOM   6185  N  NH1   . ARG D 4  711  ? 3.121   -24.861  89.129  1.00 129.72 ? 711  ARG A NH1   1 
ATOM   6186  N  NH2   . ARG D 4  711  ? 1.144   -23.846  88.561  1.00 129.96 ? 711  ARG A NH2   1 
ATOM   6187  N  N     . GLU D 4  712  ? 3.733   -32.059  87.170  1.00 134.13 ? 712  GLU A N     1 
ATOM   6188  C  CA    . GLU D 4  712  ? 4.046   -33.023  86.129  1.00 134.13 ? 712  GLU A CA    1 
ATOM   6189  C  C     . GLU D 4  712  ? 3.326   -34.336  86.385  1.00 132.96 ? 712  GLU A C     1 
ATOM   6190  O  O     . GLU D 4  712  ? 2.996   -35.065  85.444  1.00 132.73 ? 712  GLU A O     1 
ATOM   6191  C  CB    . GLU D 4  712  ? 5.557   -33.243  86.129  1.00 134.08 ? 712  GLU A CB    1 
ATOM   6192  C  CG    . GLU D 4  712  ? 6.176   -33.792  84.852  1.00 135.93 ? 712  GLU A CG    1 
ATOM   6193  C  CD    . GLU D 4  712  ? 7.560   -34.439  85.100  1.00 136.40 ? 712  GLU A CD    1 
ATOM   6194  O  OE1   . GLU D 4  712  ? 8.320   -33.943  85.976  1.00 139.03 ? 712  GLU A OE1   1 
ATOM   6195  O  OE2   . GLU D 4  712  ? 7.885   -35.450  84.418  1.00 139.53 ? 712  GLU A OE2   1 
ATOM   6196  N  N     . SER D 4  713  ? 3.081   -34.633  87.660  1.00 132.01 ? 713  SER A N     1 
ATOM   6197  C  CA    . SER D 4  713  ? 2.289   -35.801  88.009  1.00 131.27 ? 713  SER A CA    1 
ATOM   6198  C  C     . SER D 4  713  ? 0.795   -35.569  87.676  1.00 130.81 ? 713  SER A C     1 
ATOM   6199  O  O     . SER D 4  713  ? 0.078   -36.514  87.342  1.00 131.02 ? 713  SER A O     1 
ATOM   6200  C  CB    . SER D 4  713  ? 2.533   -36.227  89.462  1.00 131.12 ? 713  SER A CB    1 
ATOM   6201  O  OG    . SER D 4  713  ? 1.663   -35.576  90.362  1.00 131.51 ? 713  SER A OG    1 
ATOM   6202  N  N     . PHE D 4  714  ? 0.355   -34.310  87.737  1.00 129.85 ? 714  PHE A N     1 
ATOM   6203  C  CA    . PHE D 4  714  ? -0.963  -33.870  87.245  1.00 128.89 ? 714  PHE A CA    1 
ATOM   6204  C  C     . PHE D 4  714  ? -1.156  -34.075  85.709  1.00 128.62 ? 714  PHE A C     1 
ATOM   6205  O  O     . PHE D 4  714  ? -2.190  -34.563  85.242  1.00 127.97 ? 714  PHE A O     1 
ATOM   6206  C  CB    . PHE D 4  714  ? -1.138  -32.395  87.638  1.00 128.54 ? 714  PHE A CB    1 
ATOM   6207  C  CG    . PHE D 4  714  ? -2.542  -31.867  87.489  1.00 128.06 ? 714  PHE A CG    1 
ATOM   6208  C  CD1   . PHE D 4  714  ? -3.520  -32.181  88.421  1.00 125.67 ? 714  PHE A CD1   1 
ATOM   6209  C  CD2   . PHE D 4  714  ? -2.874  -31.023  86.426  1.00 127.08 ? 714  PHE A CD2   1 
ATOM   6210  C  CE1   . PHE D 4  714  ? -4.794  -31.686  88.276  1.00 125.07 ? 714  PHE A CE1   1 
ATOM   6211  C  CE2   . PHE D 4  714  ? -4.162  -30.524  86.290  1.00 125.29 ? 714  PHE A CE2   1 
ATOM   6212  C  CZ    . PHE D 4  714  ? -5.115  -30.854  87.211  1.00 125.10 ? 714  PHE A CZ    1 
ATOM   6213  N  N     . GLU D 4  715  ? -0.150  -33.701  84.925  1.00 128.88 ? 715  GLU A N     1 
ATOM   6214  C  CA    . GLU D 4  715  ? -0.136  -34.024  83.496  1.00 128.92 ? 715  GLU A CA    1 
ATOM   6215  C  C     . GLU D 4  715  ? -0.330  -35.523  83.261  1.00 128.92 ? 715  GLU A C     1 
ATOM   6216  O  O     . GLU D 4  715  ? -1.216  -35.899  82.499  1.00 129.73 ? 715  GLU A O     1 
ATOM   6217  C  CB    . GLU D 4  715  ? 1.130   -33.511  82.805  1.00 128.71 ? 715  GLU A CB    1 
ATOM   6218  C  CG    . GLU D 4  715  ? 1.191   -31.993  82.697  1.00 129.33 ? 715  GLU A CG    1 
ATOM   6219  C  CD    . GLU D 4  715  ? 0.015   -31.393  81.928  1.00 130.42 ? 715  GLU A CD    1 
ATOM   6220  O  OE1   . GLU D 4  715  ? -0.417  -31.997  80.928  1.00 130.12 ? 715  GLU A OE1   1 
ATOM   6221  O  OE2   . GLU D 4  715  ? -0.475  -30.307  82.316  1.00 131.86 ? 715  GLU A OE2   1 
ATOM   6222  N  N     . ASP D 4  716  ? 0.457   -36.380  83.918  1.00 128.15 ? 716  ASP A N     1 
ATOM   6223  C  CA    . ASP D 4  716  ? 0.152   -37.813  83.907  1.00 127.27 ? 716  ASP A CA    1 
ATOM   6224  C  C     . ASP D 4  716  ? -1.319  -38.057  84.259  1.00 125.93 ? 716  ASP A C     1 
ATOM   6225  O  O     . ASP D 4  716  ? -2.047  -38.612  83.437  1.00 125.60 ? 716  ASP A O     1 
ATOM   6226  C  CB    . ASP D 4  716  ? 1.088   -38.605  84.840  1.00 128.08 ? 716  ASP A CB    1 
ATOM   6227  C  CG    . ASP D 4  716  ? 0.470   -39.955  85.349  1.00 129.87 ? 716  ASP A CG    1 
ATOM   6228  O  OD1   . ASP D 4  716  ? 0.320   -40.106  86.589  1.00 130.51 ? 716  ASP A OD1   1 
ATOM   6229  O  OD2   . ASP D 4  716  ? 0.152   -40.869  84.534  1.00 131.82 ? 716  ASP A OD2   1 
ATOM   6230  N  N     . ASN D 4  717  ? -1.750  -37.612  85.449  1.00 124.55 ? 717  ASN A N     1 
ATOM   6231  C  CA    . ASN D 4  717  ? -3.084  -37.952  86.004  1.00 123.37 ? 717  ASN A CA    1 
ATOM   6232  C  C     . ASN D 4  717  ? -4.217  -37.657  85.037  1.00 122.85 ? 717  ASN A C     1 
ATOM   6233  O  O     . ASN D 4  717  ? -5.223  -38.359  85.026  1.00 122.56 ? 717  ASN A O     1 
ATOM   6234  C  CB    . ASN D 4  717  ? -3.376  -37.245  87.351  1.00 123.10 ? 717  ASN A CB    1 
ATOM   6235  C  CG    . ASN D 4  717  ? -2.850  -38.005  88.567  1.00 122.00 ? 717  ASN A CG    1 
ATOM   6236  O  OD1   . ASN D 4  717  ? -2.441  -39.151  88.465  1.00 122.36 ? 717  ASN A OD1   1 
ATOM   6237  N  ND2   . ASN D 4  717  ? -2.858  -37.353  89.725  1.00 119.90 ? 717  ASN A ND2   1 
ATOM   6238  N  N     . VAL D 4  718  ? -4.050  -36.620  84.225  1.00 122.31 ? 718  VAL A N     1 
ATOM   6239  C  CA    . VAL D 4  718  ? -5.103  -36.237  83.303  1.00 122.07 ? 718  VAL A CA    1 
ATOM   6240  C  C     . VAL D 4  718  ? -5.071  -36.980  81.956  1.00 121.92 ? 718  VAL A C     1 
ATOM   6241  O  O     . VAL D 4  718  ? -5.960  -37.783  81.679  1.00 121.83 ? 718  VAL A O     1 
ATOM   6242  C  CB    . VAL D 4  718  ? -5.181  -34.734  83.130  1.00 122.12 ? 718  VAL A CB    1 
ATOM   6243  C  CG1   . VAL D 4  718  ? -5.794  -34.393  81.771  1.00 122.64 ? 718  VAL A CG1   1 
ATOM   6244  C  CG2   . VAL D 4  718  ? -6.004  -34.142  84.275  1.00 121.43 ? 718  VAL A CG2   1 
ATOM   6245  N  N     . VAL D 4  719  ? -4.065  -36.720  81.127  1.00 121.44 ? 719  VAL A N     1 
ATOM   6246  C  CA    . VAL D 4  719  ? -3.908  -37.461  79.885  1.00 121.35 ? 719  VAL A CA    1 
ATOM   6247  C  C     . VAL D 4  719  ? -4.214  -38.968  80.041  1.00 121.52 ? 719  VAL A C     1 
ATOM   6248  O  O     . VAL D 4  719  ? -4.647  -39.635  79.088  1.00 121.75 ? 719  VAL A O     1 
ATOM   6249  C  CB    . VAL D 4  719  ? -2.513  -37.292  79.335  1.00 121.21 ? 719  VAL A CB    1 
ATOM   6250  C  CG1   . VAL D 4  719  ? -2.538  -37.408  77.804  1.00 122.27 ? 719  VAL A CG1   1 
ATOM   6251  C  CG2   . VAL D 4  719  ? -1.985  -35.961  79.725  1.00 120.88 ? 719  VAL A CG2   1 
ATOM   6252  N  N     . ARG D 4  720  ? -3.992  -39.501  81.238  1.00 121.32 ? 720  ARG A N     1 
ATOM   6253  C  CA    . ARG D 4  720  ? -4.416  -40.852  81.550  1.00 121.10 ? 720  ARG A CA    1 
ATOM   6254  C  C     . ARG D 4  720  ? -5.918  -40.937  81.741  1.00 120.57 ? 720  ARG A C     1 
ATOM   6255  O  O     . ARG D 4  720  ? -6.544  -41.792  81.147  1.00 120.56 ? 720  ARG A O     1 
ATOM   6256  C  CB    . ARG D 4  720  ? -3.714  -41.366  82.793  1.00 121.46 ? 720  ARG A CB    1 
ATOM   6257  C  CG    . ARG D 4  720  ? -2.630  -42.425  82.556  1.00 122.86 ? 720  ARG A CG    1 
ATOM   6258  C  CD    . ARG D 4  720  ? -2.393  -43.208  83.855  1.00 124.52 ? 720  ARG A CD    1 
ATOM   6259  N  NE    . ARG D 4  720  ? -3.670  -43.492  84.544  1.00 126.24 ? 720  ARG A NE    1 
ATOM   6260  C  CZ    . ARG D 4  720  ? -4.051  -42.992  85.727  1.00 126.01 ? 720  ARG A CZ    1 
ATOM   6261  N  NH1   . ARG D 4  720  ? -3.265  -42.170  86.422  1.00 125.55 ? 720  ARG A NH1   1 
ATOM   6262  N  NH2   . ARG D 4  720  ? -5.230  -43.331  86.226  1.00 126.09 ? 720  ARG A NH2   1 
ATOM   6263  N  N     . PHE D 4  721  ? -6.502  -40.062  82.561  1.00 120.24 ? 721  PHE A N     1 
ATOM   6264  C  CA    . PHE D 4  721  ? -7.969  -40.098  82.797  1.00 120.17 ? 721  PHE A CA    1 
ATOM   6265  C  C     . PHE D 4  721  ? -8.725  -39.746  81.520  1.00 120.23 ? 721  PHE A C     1 
ATOM   6266  O  O     . PHE D 4  721  ? -9.966  -39.897  81.466  1.00 120.29 ? 721  PHE A O     1 
ATOM   6267  C  CB    . PHE D 4  721  ? -8.454  -39.120  83.905  1.00 119.85 ? 721  PHE A CB    1 
ATOM   6268  C  CG    . PHE D 4  721  ? -8.140  -39.537  85.331  1.00 118.85 ? 721  PHE A CG    1 
ATOM   6269  C  CD1   . PHE D 4  721  ? -8.209  -38.590  86.348  1.00 117.49 ? 721  PHE A CD1   1 
ATOM   6270  C  CD2   . PHE D 4  721  ? -7.782  -40.845  85.660  1.00 118.22 ? 721  PHE A CD2   1 
ATOM   6271  C  CE1   . PHE D 4  721  ? -7.926  -38.932  87.658  1.00 117.38 ? 721  PHE A CE1   1 
ATOM   6272  C  CE2   . PHE D 4  721  ? -7.487  -41.193  86.975  1.00 118.02 ? 721  PHE A CE2   1 
ATOM   6273  C  CZ    . PHE D 4  721  ? -7.556  -40.233  87.975  1.00 117.99 ? 721  PHE A CZ    1 
ATOM   6274  N  N     . LEU D 4  722  ? -7.972  -39.246  80.525  1.00 120.15 ? 722  LEU A N     1 
ATOM   6275  C  CA    . LEU D 4  722  ? -8.524  -38.688  79.266  1.00 119.87 ? 722  LEU A CA    1 
ATOM   6276  C  C     . LEU D 4  722  ? -8.397  -39.625  78.084  1.00 119.92 ? 722  LEU A C     1 
ATOM   6277  O  O     . LEU D 4  722  ? -9.277  -39.679  77.225  1.00 119.87 ? 722  LEU A O     1 
ATOM   6278  C  CB    . LEU D 4  722  ? -7.927  -37.307  78.918  1.00 119.89 ? 722  LEU A CB    1 
ATOM   6279  C  CG    . LEU D 4  722  ? -8.914  -36.134  78.860  1.00 119.35 ? 722  LEU A CG    1 
ATOM   6280  C  CD1   . LEU D 4  722  ? -9.806  -36.107  80.107  1.00 121.13 ? 722  LEU A CD1   1 
ATOM   6281  C  CD2   . LEU D 4  722  ? -8.225  -34.807  78.676  1.00 118.84 ? 722  LEU A CD2   1 
ATOM   6282  N  N     . ASN D 4  723  ? -7.301  -40.359  78.029  1.00 120.07 ? 723  ASN A N     1 
ATOM   6283  C  CA    . ASN D 4  723  ? -7.229  -41.411  77.053  1.00 120.38 ? 723  ASN A CA    1 
ATOM   6284  C  C     . ASN D 4  723  ? -8.131  -42.515  77.543  1.00 120.37 ? 723  ASN A C     1 
ATOM   6285  O  O     . ASN D 4  723  ? -9.134  -42.822  76.905  1.00 120.31 ? 723  ASN A O     1 
ATOM   6286  C  CB    . ASN D 4  723  ? -5.790  -41.805  76.800  1.00 120.23 ? 723  ASN A CB    1 
ATOM   6287  C  CG    . ASN D 4  723  ? -5.026  -40.682  76.140  1.00 121.04 ? 723  ASN A CG    1 
ATOM   6288  O  OD1   . ASN D 4  723  ? -5.509  -39.550  76.061  1.00 121.57 ? 723  ASN A OD1   1 
ATOM   6289  N  ND2   . ASN D 4  723  ? -3.843  -40.979  75.653  1.00 122.94 ? 723  ASN A ND2   1 
ATOM   6290  N  N     . GLU D 4  724  ? -7.825  -43.038  78.723  1.00 120.51 ? 724  GLU A N     1 
ATOM   6291  C  CA    . GLU D 4  724  ? -8.709  -43.958  79.412  1.00 120.58 ? 724  GLU A CA    1 
ATOM   6292  C  C     . GLU D 4  724  ? -10.143 -43.702  78.968  1.00 119.98 ? 724  GLU A C     1 
ATOM   6293  O  O     . GLU D 4  724  ? -10.810 -44.628  78.528  1.00 120.22 ? 724  GLU A O     1 
ATOM   6294  C  CB    . GLU D 4  724  ? -8.552  -43.807  80.933  1.00 120.64 ? 724  GLU A CB    1 
ATOM   6295  C  CG    . GLU D 4  724  ? -9.335  -44.794  81.809  1.00 121.47 ? 724  GLU A CG    1 
ATOM   6296  C  CD    . GLU D 4  724  ? -9.438  -44.316  83.270  1.00 121.70 ? 724  GLU A CD    1 
ATOM   6297  O  OE1   . GLU D 4  724  ? -9.681  -43.102  83.515  1.00 122.26 ? 724  GLU A OE1   1 
ATOM   6298  O  OE2   . GLU D 4  724  ? -9.281  -45.160  84.181  1.00 123.29 ? 724  GLU A OE2   1 
ATOM   6299  N  N     . ALA D 4  725  ? -10.593 -42.446  79.039  1.00 119.55 ? 725  ALA A N     1 
ATOM   6300  C  CA    . ALA D 4  725  ? -11.998 -42.094  78.764  1.00 119.23 ? 725  ALA A CA    1 
ATOM   6301  C  C     . ALA D 4  725  ? -12.406 -42.266  77.295  1.00 119.32 ? 725  ALA A C     1 
ATOM   6302  O  O     . ALA D 4  725  ? -13.553 -42.695  77.023  1.00 119.16 ? 725  ALA A O     1 
ATOM   6303  C  CB    . ALA D 4  725  ? -12.326 -40.676  79.256  1.00 118.78 ? 725  ALA A CB    1 
ATOM   6304  N  N     . ARG D 4  726  ? -11.476 -41.940  76.370  1.00 119.09 ? 726  ARG A N     1 
ATOM   6305  C  CA    . ARG D 4  726  ? -11.739 -41.979  74.921  1.00 118.65 ? 726  ARG A CA    1 
ATOM   6306  C  C     . ARG D 4  726  ? -11.713 -43.377  74.341  1.00 118.74 ? 726  ARG A C     1 
ATOM   6307  O  O     . ARG D 4  726  ? -12.445 -43.690  73.408  1.00 118.51 ? 726  ARG A O     1 
ATOM   6308  C  CB    . ARG D 4  726  ? -10.764 -41.137  74.138  1.00 118.25 ? 726  ARG A CB    1 
ATOM   6309  C  CG    . ARG D 4  726  ? -10.973 -41.352  72.625  1.00 119.77 ? 726  ARG A CG    1 
ATOM   6310  C  CD    . ARG D 4  726  ? -9.757  -41.075  71.691  1.00 120.19 ? 726  ARG A CD    1 
ATOM   6311  N  NE    . ARG D 4  726  ? -8.659  -41.993  71.909  1.00 120.48 ? 726  ARG A NE    1 
ATOM   6312  C  CZ    . ARG D 4  726  ? -7.625  -41.720  72.696  1.00 123.76 ? 726  ARG A CZ    1 
ATOM   6313  N  NH1   . ARG D 4  726  ? -7.522  -40.546  73.331  1.00 122.95 ? 726  ARG A NH1   1 
ATOM   6314  N  NH2   . ARG D 4  726  ? -6.675  -42.628  72.847  1.00 127.33 ? 726  ARG A NH2   1 
ATOM   6315  N  N     . ASP D 4  727  ? -10.842 -44.214  74.872  1.00 119.22 ? 727  ASP A N     1 
ATOM   6316  C  CA    . ASP D 4  727  ? -10.763 -45.572  74.393  1.00 119.81 ? 727  ASP A CA    1 
ATOM   6317  C  C     . ASP D 4  727  ? -11.950 -46.322  74.883  1.00 119.56 ? 727  ASP A C     1 
ATOM   6318  O  O     . ASP D 4  727  ? -12.510 -47.110  74.131  1.00 120.05 ? 727  ASP A O     1 
ATOM   6319  C  CB    . ASP D 4  727  ? -9.480  -46.237  74.839  1.00 120.20 ? 727  ASP A CB    1 
ATOM   6320  C  CG    . ASP D 4  727  ? -8.271  -45.427  74.447  1.00 123.02 ? 727  ASP A CG    1 
ATOM   6321  O  OD1   . ASP D 4  727  ? -8.060  -45.188  73.222  1.00 125.10 ? 727  ASP A OD1   1 
ATOM   6322  O  OD2   . ASP D 4  727  ? -7.546  -44.997  75.373  1.00 126.90 ? 727  ASP A OD2   1 
ATOM   6323  N  N     . LYS D 4  728  ? -12.352 -46.065  76.126  1.00 119.22 ? 728  LYS A N     1 
ATOM   6324  C  CA    . LYS D 4  728  ? -13.534 -46.716  76.683  1.00 119.05 ? 728  LYS A CA    1 
ATOM   6325  C  C     . LYS D 4  728  ? -14.775 -46.362  75.882  1.00 118.58 ? 728  LYS A C     1 
ATOM   6326  O  O     . LYS D 4  728  ? -15.544 -47.262  75.519  1.00 118.35 ? 728  LYS A O     1 
ATOM   6327  C  CB    . LYS D 4  728  ? -13.742 -46.374  78.151  1.00 119.21 ? 728  LYS A CB    1 
ATOM   6328  C  CG    . LYS D 4  728  ? -14.611 -47.383  78.846  1.00 119.97 ? 728  LYS A CG    1 
ATOM   6329  C  CD    . LYS D 4  728  ? -14.268 -47.449  80.303  1.00 123.03 ? 728  LYS A CD    1 
ATOM   6330  C  CE    . LYS D 4  728  ? -14.966 -46.340  81.081  1.00 125.50 ? 728  LYS A CE    1 
ATOM   6331  N  NZ    . LYS D 4  728  ? -14.754 -46.502  82.559  1.00 127.25 ? 728  LYS A NZ    1 
ATOM   6332  N  N     . ALA D 4  729  ? -14.944 -45.066  75.588  1.00 117.97 ? 729  ALA A N     1 
ATOM   6333  C  CA    . ALA D 4  729  ? -16.037 -44.593  74.733  1.00 117.67 ? 729  ALA A CA    1 
ATOM   6334  C  C     . ALA D 4  729  ? -16.015 -45.309  73.386  1.00 118.04 ? 729  ALA A C     1 
ATOM   6335  O  O     . ALA D 4  729  ? -17.046 -45.845  72.946  1.00 117.22 ? 729  ALA A O     1 
ATOM   6336  C  CB    . ALA D 4  729  ? -15.946 -43.108  74.544  1.00 117.16 ? 729  ALA A CB    1 
ATOM   6337  N  N     . GLY D 4  730  ? -14.808 -45.320  72.778  1.00 119.04 ? 730  GLY A N     1 
ATOM   6338  C  CA    . GLY D 4  730  ? -14.462 -45.957  71.488  1.00 119.40 ? 730  GLY A CA    1 
ATOM   6339  C  C     . GLY D 4  730  ? -14.808 -47.436  71.390  1.00 120.30 ? 730  GLY A C     1 
ATOM   6340  O  O     . GLY D 4  730  ? -15.543 -47.843  70.474  1.00 120.46 ? 730  GLY A O     1 
ATOM   6341  N  N     . ARG D 4  731  ? -14.298 -48.245  72.328  1.00 120.79 ? 731  ARG A N     1 
ATOM   6342  C  CA    . ARG D 4  731  ? -14.665 -49.674  72.414  1.00 121.57 ? 731  ARG A CA    1 
ATOM   6343  C  C     . ARG D 4  731  ? -16.135 -49.909  72.822  1.00 120.80 ? 731  ARG A C     1 
ATOM   6344  O  O     . ARG D 4  731  ? -16.617 -51.051  72.807  1.00 120.69 ? 731  ARG A O     1 
ATOM   6345  C  CB    . ARG D 4  731  ? -13.696 -50.466  73.314  1.00 121.55 ? 731  ARG A CB    1 
ATOM   6346  C  CG    . ARG D 4  731  ? -12.496 -51.152  72.573  1.00 122.85 ? 731  ARG A CG    1 
ATOM   6347  C  CD    . ARG D 4  731  ? -11.334 -51.528  73.519  1.00 123.91 ? 731  ARG A CD    1 
ATOM   6348  N  NE    . ARG D 4  731  ? -10.905 -50.424  74.405  1.00 130.68 ? 731  ARG A NE    1 
ATOM   6349  C  CZ    . ARG D 4  731  ? -11.405 -50.143  75.629  1.00 133.69 ? 731  ARG A CZ    1 
ATOM   6350  N  NH1   . ARG D 4  731  ? -12.381 -50.870  76.177  1.00 135.35 ? 731  ARG A NH1   1 
ATOM   6351  N  NH2   . ARG D 4  731  ? -10.936 -49.108  76.327  1.00 134.97 ? 731  ARG A NH2   1 
ATOM   6352  N  N     . LEU D 4  732  ? -16.840 -48.827  73.148  1.00 120.13 ? 732  LEU A N     1 
ATOM   6353  C  CA    . LEU D 4  732  ? -18.261 -48.911  73.428  1.00 119.87 ? 732  LEU A CA    1 
ATOM   6354  C  C     . LEU D 4  732  ? -19.083 -48.726  72.152  1.00 120.67 ? 732  LEU A C     1 
ATOM   6355  O  O     . LEU D 4  732  ? -20.221 -49.207  72.066  1.00 120.95 ? 732  LEU A O     1 
ATOM   6356  C  CB    . LEU D 4  732  ? -18.662 -47.899  74.509  1.00 119.47 ? 732  LEU A CB    1 
ATOM   6357  C  CG    . LEU D 4  732  ? -19.805 -48.128  75.504  1.00 115.51 ? 732  LEU A CG    1 
ATOM   6358  C  CD1   . LEU D 4  732  ? -19.921 -46.934  76.424  1.00 110.90 ? 732  LEU A CD1   1 
ATOM   6359  C  CD2   . LEU D 4  732  ? -21.071 -48.306  74.745  1.00 112.87 ? 732  LEU A CD2   1 
ATOM   6360  N  N     . ALA D 4  733  ? -18.518 -48.031  71.172  1.00 121.19 ? 733  ALA A N     1 
ATOM   6361  C  CA    . ALA D 4  733  ? -19.059 -48.079  69.815  1.00 122.28 ? 733  ALA A CA    1 
ATOM   6362  C  C     . ALA D 4  733  ? -18.771 -49.421  69.141  1.00 123.01 ? 733  ALA A C     1 
ATOM   6363  O  O     . ALA D 4  733  ? -19.592 -49.912  68.360  1.00 122.90 ? 733  ALA A O     1 
ATOM   6364  C  CB    . ALA D 4  733  ? -18.490 -46.974  68.969  1.00 122.42 ? 733  ALA A CB    1 
ATOM   6365  N  N     . GLU D 4  734  ? -17.603 -49.998  69.429  1.00 123.96 ? 734  GLU A N     1 
ATOM   6366  C  CA    . GLU D 4  734  ? -17.194 -51.266  68.817  1.00 125.21 ? 734  GLU A CA    1 
ATOM   6367  C  C     . GLU D 4  734  ? -18.087 -52.448  69.194  1.00 124.93 ? 734  GLU A C     1 
ATOM   6368  O  O     . GLU D 4  734  ? -18.416 -53.250  68.314  1.00 124.82 ? 734  GLU A O     1 
ATOM   6369  C  CB    . GLU D 4  734  ? -15.723 -51.577  69.096  1.00 125.28 ? 734  GLU A CB    1 
ATOM   6370  C  CG    . GLU D 4  734  ? -15.124 -52.656  68.161  1.00 126.80 ? 734  GLU A CG    1 
ATOM   6371  C  CD    . GLU D 4  734  ? -13.614 -52.862  68.356  1.00 127.38 ? 734  GLU A CD    1 
ATOM   6372  O  OE1   . GLU D 4  734  ? -13.185 -53.036  69.542  1.00 129.64 ? 734  GLU A OE1   1 
ATOM   6373  O  OE2   . GLU D 4  734  ? -12.868 -52.851  67.323  1.00 129.79 ? 734  GLU A OE2   1 
ATOM   6374  N  N     . VAL D 4  735  ? -18.453 -52.553  70.486  1.00 125.22 ? 735  VAL A N     1 
ATOM   6375  C  CA    . VAL D 4  735  ? -19.591 -53.414  70.967  1.00 125.28 ? 735  VAL A CA    1 
ATOM   6376  C  C     . VAL D 4  735  ? -20.870 -53.189  70.170  1.00 124.88 ? 735  VAL A C     1 
ATOM   6377  O  O     . VAL D 4  735  ? -21.456 -54.146  69.674  1.00 124.66 ? 735  VAL A O     1 
ATOM   6378  C  CB    . VAL D 4  735  ? -19.958 -53.199  72.479  1.00 125.26 ? 735  VAL A CB    1 
ATOM   6379  C  CG1   . VAL D 4  735  ? -21.406 -53.592  72.764  1.00 125.20 ? 735  VAL A CG1   1 
ATOM   6380  C  CG2   . VAL D 4  735  ? -19.039 -53.991  73.384  1.00 126.06 ? 735  VAL A CG2   1 
ATOM   6381  N  N     . ASN D 4  736  ? -21.277 -51.921  70.049  1.00 124.69 ? 736  ASN A N     1 
ATOM   6382  C  CA    . ASN D 4  736  ? -22.487 -51.538  69.312  1.00 124.61 ? 736  ASN A CA    1 
ATOM   6383  C  C     . ASN D 4  736  ? -22.463 -51.706  67.790  1.00 125.07 ? 736  ASN A C     1 
ATOM   6384  O  O     . ASN D 4  736  ? -23.468 -51.422  67.134  1.00 125.29 ? 736  ASN A O     1 
ATOM   6385  C  CB    . ASN D 4  736  ? -22.951 -50.109  69.657  1.00 124.17 ? 736  ASN A CB    1 
ATOM   6386  C  CG    . ASN D 4  736  ? -24.408 -49.857  69.253  1.00 122.48 ? 736  ASN A CG    1 
ATOM   6387  O  OD1   . ASN D 4  736  ? -24.700 -48.997  68.417  1.00 119.17 ? 736  ASN A OD1   1 
ATOM   6388  N  ND2   . ASN D 4  736  ? -25.324 -50.637  69.832  1.00 122.32 ? 736  ASN A ND2   1 
ATOM   6389  N  N     . LEU D 4  737  ? -21.356 -52.157  67.209  1.00 125.54 ? 737  LEU A N     1 
ATOM   6390  C  CA    . LEU D 4  737  ? -21.384 -52.366  65.763  1.00 126.23 ? 737  LEU A CA    1 
ATOM   6391  C  C     . LEU D 4  737  ? -22.040 -53.675  65.325  1.00 126.87 ? 737  LEU A C     1 
ATOM   6392  O  O     . LEU D 4  737  ? -21.677 -54.763  65.802  1.00 127.22 ? 737  LEU A O     1 
ATOM   6393  C  CB    . LEU D 4  737  ? -20.033 -52.110  65.115  1.00 125.66 ? 737  LEU A CB    1 
ATOM   6394  C  CG    . LEU D 4  737  ? -19.877 -50.582  65.141  1.00 126.26 ? 737  LEU A CG    1 
ATOM   6395  C  CD1   . LEU D 4  737  ? -18.841 -50.095  64.107  1.00 126.15 ? 737  LEU A CD1   1 
ATOM   6396  C  CD2   . LEU D 4  737  ? -21.233 -49.793  65.019  1.00 124.51 ? 737  LEU A CD2   1 
ATOM   6397  N  N     . LYS D 4  738  ? -23.049 -53.549  64.456  1.00 127.28 ? 738  LYS A N     1 
ATOM   6398  C  CA    . LYS D 4  738  ? -23.749 -54.690  63.882  1.00 127.50 ? 738  LYS A CA    1 
ATOM   6399  C  C     . LYS D 4  738  ? -22.735 -55.442  63.057  1.00 127.94 ? 738  LYS A C     1 
ATOM   6400  O  O     . LYS D 4  738  ? -21.705 -54.866  62.656  1.00 128.49 ? 738  LYS A O     1 
ATOM   6401  C  CB    . LYS D 4  738  ? -24.878 -54.205  62.974  1.00 127.59 ? 738  LYS A CB    1 
ATOM   6402  C  CG    . LYS D 4  738  ? -25.955 -53.348  63.657  1.00 127.85 ? 738  LYS A CG    1 
ATOM   6403  C  CD    . LYS D 4  738  ? -27.138 -54.199  64.170  1.00 127.03 ? 738  LYS A CD    1 
ATOM   6404  C  CE    . LYS D 4  738  ? -28.169 -53.334  64.893  1.00 127.52 ? 738  LYS A CE    1 
ATOM   6405  N  NZ    . LYS D 4  738  ? -28.332 -51.999  64.236  1.00 127.88 ? 738  LYS A NZ    1 
ATOM   6406  N  N     . ASP D 4  739  ? -22.998 -56.713  62.780  1.00 128.17 ? 739  ASP A N     1 
ATOM   6407  C  CA    . ASP D 4  739  ? -22.047 -57.499  61.960  1.00 128.58 ? 739  ASP A CA    1 
ATOM   6408  C  C     . ASP D 4  739  ? -22.032 -57.163  60.443  1.00 127.76 ? 739  ASP A C     1 
ATOM   6409  O  O     . ASP D 4  739  ? -21.060 -57.459  59.739  1.00 127.52 ? 739  ASP A O     1 
ATOM   6410  C  CB    . ASP D 4  739  ? -22.221 -59.003  62.213  1.00 129.21 ? 739  ASP A CB    1 
ATOM   6411  C  CG    . ASP D 4  739  ? -21.122 -59.577  63.111  1.00 131.22 ? 739  ASP A CG    1 
ATOM   6412  O  OD1   . ASP D 4  739  ? -19.966 -59.055  63.069  1.00 131.27 ? 739  ASP A OD1   1 
ATOM   6413  O  OD2   . ASP D 4  739  ? -21.426 -60.558  63.842  1.00 133.83 ? 739  ASP A OD2   1 
ATOM   6414  N  N     . LEU D 4  740  ? -23.122 -56.542  59.984  1.00 126.92 ? 740  LEU A N     1 
ATOM   6415  C  CA    . LEU D 4  740  ? -23.335 -56.107  58.606  1.00 125.71 ? 740  LEU A CA    1 
ATOM   6416  C  C     . LEU D 4  740  ? -22.794 -54.726  58.409  1.00 125.19 ? 740  LEU A C     1 
ATOM   6417  O  O     . LEU D 4  740  ? -23.236 -54.033  57.502  1.00 125.28 ? 740  LEU A O     1 
ATOM   6418  C  CB    . LEU D 4  740  ? -24.836 -56.042  58.318  1.00 125.88 ? 740  LEU A CB    1 
ATOM   6419  C  CG    . LEU D 4  740  ? -25.720 -55.417  59.415  1.00 125.30 ? 740  LEU A CG    1 
ATOM   6420  C  CD1   . LEU D 4  740  ? -26.158 -54.023  59.014  1.00 124.48 ? 740  LEU A CD1   1 
ATOM   6421  C  CD2   . LEU D 4  740  ? -26.936 -56.310  59.741  1.00 124.50 ? 740  LEU A CD2   1 
ATOM   6422  N  N     . ASN D 4  741  ? -21.858 -54.314  59.260  1.00 124.47 ? 741  ASN A N     1 
ATOM   6423  C  CA    . ASN D 4  741  ? -21.355 -52.951  59.212  1.00 124.00 ? 741  ASN A CA    1 
ATOM   6424  C  C     . ASN D 4  741  ? -20.131 -52.786  58.323  1.00 123.83 ? 741  ASN A C     1 
ATOM   6425  O  O     . ASN D 4  741  ? -19.041 -53.251  58.658  1.00 123.92 ? 741  ASN A O     1 
ATOM   6426  C  CB    . ASN D 4  741  ? -21.075 -52.426  60.615  1.00 123.76 ? 741  ASN A CB    1 
ATOM   6427  C  CG    . ASN D 4  741  ? -20.754 -50.939  60.624  1.00 123.64 ? 741  ASN A CG    1 
ATOM   6428  O  OD1   . ASN D 4  741  ? -21.401 -50.164  61.344  1.00 123.97 ? 741  ASN A OD1   1 
ATOM   6429  N  ND2   . ASN D 4  741  ? -19.760 -50.529  59.821  1.00 120.07 ? 741  ASN A ND2   1 
ATOM   6430  N  N     . ASN D 4  742  ? -20.319 -52.104  57.198  1.00 123.53 ? 742  ASN A N     1 
ATOM   6431  C  CA    . ASN D 4  742  ? -19.240 -51.915  56.214  1.00 123.49 ? 742  ASN A CA    1 
ATOM   6432  C  C     . ASN D 4  742  ? -17.838 -51.571  56.800  1.00 122.96 ? 742  ASN A C     1 
ATOM   6433  O  O     . ASN D 4  742  ? -16.822 -52.087  56.310  1.00 122.21 ? 742  ASN A O     1 
ATOM   6434  C  CB    . ASN D 4  742  ? -19.643 -50.881  55.146  1.00 123.60 ? 742  ASN A CB    1 
ATOM   6435  C  CG    . ASN D 4  742  ? -20.726 -51.384  54.175  1.00 124.39 ? 742  ASN A CG    1 
ATOM   6436  O  OD1   . ASN D 4  742  ? -20.772 -52.570  53.797  1.00 124.55 ? 742  ASN A OD1   1 
ATOM   6437  N  ND2   . ASN D 4  742  ? -21.568 -50.447  53.714  1.00 124.38 ? 742  ASN A ND2   1 
ATOM   6438  N  N     . VAL D 4  743  ? -17.793 -50.711  57.832  1.00 122.68 ? 743  VAL A N     1 
ATOM   6439  C  CA    . VAL D 4  743  ? -16.524 -50.370  58.513  1.00 122.34 ? 743  VAL A CA    1 
ATOM   6440  C  C     . VAL D 4  743  ? -16.047 -51.634  59.244  1.00 122.49 ? 743  VAL A C     1 
ATOM   6441  O  O     . VAL D 4  743  ? -14.936 -52.163  58.968  1.00 122.43 ? 743  VAL A O     1 
ATOM   6442  C  CB    . VAL D 4  743  ? -16.591 -49.158  59.550  1.00 121.92 ? 743  VAL A CB    1 
ATOM   6443  C  CG1   . VAL D 4  743  ? -15.259 -48.437  59.630  1.00 120.82 ? 743  VAL A CG1   1 
ATOM   6444  C  CG2   . VAL D 4  743  ? -17.649 -48.158  59.213  1.00 121.80 ? 743  VAL A CG2   1 
ATOM   6445  N  N     . LYS D 4  744  ? -16.901 -52.126  60.151  1.00 121.85 ? 744  LYS A N     1 
ATOM   6446  C  CA    . LYS D 4  744  ? -16.565 -53.276  60.986  1.00 121.61 ? 744  LYS A CA    1 
ATOM   6447  C  C     . LYS D 4  744  ? -16.128 -54.460  60.125  1.00 121.57 ? 744  LYS A C     1 
ATOM   6448  O  O     . LYS D 4  744  ? -15.333 -55.297  60.560  1.00 121.78 ? 744  LYS A O     1 
ATOM   6449  C  CB    . LYS D 4  744  ? -17.753 -53.671  61.859  1.00 121.84 ? 744  LYS A CB    1 
ATOM   6450  C  CG    . LYS D 4  744  ? -17.390 -54.359  63.163  1.00 121.37 ? 744  LYS A CG    1 
ATOM   6451  C  CD    . LYS D 4  744  ? -18.527 -55.230  63.650  1.00 119.84 ? 744  LYS A CD    1 
ATOM   6452  C  CE    . LYS D 4  744  ? -18.044 -56.156  64.739  1.00 119.13 ? 744  LYS A CE    1 
ATOM   6453  N  NZ    . LYS D 4  744  ? -17.528 -55.365  65.887  1.00 119.81 ? 744  LYS A NZ    1 
ATOM   6454  N  N     . GLN D 4  745  ? -16.631 -54.499  58.891  1.00 121.20 ? 745  GLN A N     1 
ATOM   6455  C  CA    . GLN D 4  745  ? -16.349 -55.592  57.974  1.00 120.47 ? 745  GLN A CA    1 
ATOM   6456  C  C     . GLN D 4  745  ? -14.984 -55.568  57.298  1.00 120.52 ? 745  GLN A C     1 
ATOM   6457  O  O     . GLN D 4  745  ? -14.405 -56.627  57.064  1.00 120.27 ? 745  GLN A O     1 
ATOM   6458  C  CB    . GLN D 4  745  ? -17.441 -55.685  56.949  1.00 119.92 ? 745  GLN A CB    1 
ATOM   6459  C  CG    . GLN D 4  745  ? -18.611 -56.413  57.466  1.00 117.83 ? 745  GLN A CG    1 
ATOM   6460  C  CD    . GLN D 4  745  ? -19.500 -56.818  56.346  1.00 117.29 ? 745  GLN A CD    1 
ATOM   6461  O  OE1   . GLN D 4  745  ? -20.049 -55.972  55.637  1.00 116.09 ? 745  GLN A OE1   1 
ATOM   6462  N  NE2   . GLN D 4  745  ? -19.642 -58.119  56.149  1.00 117.56 ? 745  GLN A NE2   1 
ATOM   6463  N  N     . MET D 4  746  ? -14.494 -54.368  56.979  1.00 120.88 ? 746  MET A N     1 
ATOM   6464  C  CA    . MET D 4  746  ? -13.131 -54.183  56.440  1.00 121.22 ? 746  MET A CA    1 
ATOM   6465  C  C     . MET D 4  746  ? -12.136 -54.361  57.578  1.00 122.54 ? 746  MET A C     1 
ATOM   6466  O  O     . MET D 4  746  ? -11.010 -54.850  57.378  1.00 122.57 ? 746  MET A O     1 
ATOM   6467  C  CB    . MET D 4  746  ? -12.932 -52.794  55.777  1.00 121.16 ? 746  MET A CB    1 
ATOM   6468  C  CG    . MET D 4  746  ? -13.345 -52.681  54.293  1.00 119.80 ? 746  MET A CG    1 
ATOM   6469  S  SD    . MET D 4  746  ? -13.560 -50.986  53.675  1.00 118.78 ? 746  MET A SD    1 
ATOM   6470  C  CE    . MET D 4  746  ? -14.678 -50.361  54.905  1.00 119.06 ? 746  MET A CE    1 
ATOM   6471  N  N     . VAL D 4  747  ? -12.563 -53.965  58.776  1.00 123.63 ? 747  VAL A N     1 
ATOM   6472  C  CA    . VAL D 4  747  ? -11.733 -54.116  59.968  1.00 124.77 ? 747  VAL A CA    1 
ATOM   6473  C  C     . VAL D 4  747  ? -11.522 -55.606  60.227  1.00 125.21 ? 747  VAL A C     1 
ATOM   6474  O  O     . VAL D 4  747  ? -10.424 -56.006  60.623  1.00 125.46 ? 747  VAL A O     1 
ATOM   6475  C  CB    . VAL D 4  747  ? -12.337 -53.354  61.207  1.00 125.00 ? 747  VAL A CB    1 
ATOM   6476  C  CG1   . VAL D 4  747  ? -11.929 -53.980  62.554  1.00 125.16 ? 747  VAL A CG1   1 
ATOM   6477  C  CG2   . VAL D 4  747  ? -11.987 -51.851  61.161  1.00 124.91 ? 747  VAL A CG2   1 
ATOM   6478  N  N     . MET D 4  748  ? -12.558 -56.412  59.953  1.00 125.54 ? 748  MET A N     1 
ATOM   6479  C  CA    . MET D 4  748  ? -12.523 -57.857  60.194  1.00 125.93 ? 748  MET A CA    1 
ATOM   6480  C  C     . MET D 4  748  ? -11.758 -58.653  59.140  1.00 125.94 ? 748  MET A C     1 
ATOM   6481  O  O     . MET D 4  748  ? -11.104 -59.640  59.453  1.00 126.01 ? 748  MET A O     1 
ATOM   6482  C  CB    . MET D 4  748  ? -13.926 -58.396  60.395  1.00 125.80 ? 748  MET A CB    1 
ATOM   6483  C  CG    . MET D 4  748  ? -14.557 -57.866  61.686  1.00 126.53 ? 748  MET A CG    1 
ATOM   6484  S  SD    . MET D 4  748  ? -16.171 -58.549  62.158  1.00 126.75 ? 748  MET A SD    1 
ATOM   6485  C  CE    . MET D 4  748  ? -17.235 -58.122  60.771  1.00 126.45 ? 748  MET A CE    1 
ATOM   6486  N  N     . ALA D 4  749  ? -11.824 -58.215  57.893  1.00 126.36 ? 749  ALA A N     1 
ATOM   6487  C  CA    . ALA D 4  749  ? -10.922 -58.732  56.863  1.00 126.48 ? 749  ALA A CA    1 
ATOM   6488  C  C     . ALA D 4  749  ? -9.525  -58.316  57.189  1.00 126.28 ? 749  ALA A C     1 
ATOM   6489  O  O     . ALA D 4  749  ? -8.606  -59.107  57.032  1.00 126.68 ? 749  ALA A O     1 
ATOM   6490  C  CB    . ALA D 4  749  ? -11.281 -58.188  55.486  1.00 126.83 ? 749  ALA A CB    1 
ATOM   6491  N  N     . GLY D 4  750  ? -9.388  -57.071  57.640  1.00 125.95 ? 750  GLY A N     1 
ATOM   6492  C  CA    . GLY D 4  750  ? -8.093  -56.412  57.782  1.00 126.04 ? 750  GLY A CA    1 
ATOM   6493  C  C     . GLY D 4  750  ? -7.662  -55.855  56.434  1.00 126.00 ? 750  GLY A C     1 
ATOM   6494  O  O     . GLY D 4  750  ? -6.527  -56.074  55.995  1.00 126.33 ? 750  GLY A O     1 
ATOM   6495  N  N     . SER D 4  751  ? -8.573  -55.141  55.772  1.00 125.65 ? 751  SER A N     1 
ATOM   6496  C  CA    . SER D 4  751  ? -8.334  -54.618  54.431  1.00 125.26 ? 751  SER A CA    1 
ATOM   6497  C  C     . SER D 4  751  ? -8.038  -53.140  54.455  1.00 125.09 ? 751  SER A C     1 
ATOM   6498  O  O     . SER D 4  751  ? -7.154  -52.683  53.738  1.00 125.59 ? 751  SER A O     1 
ATOM   6499  C  CB    . SER D 4  751  ? -9.534  -54.889  53.544  1.00 125.44 ? 751  SER A CB    1 
ATOM   6500  O  OG    . SER D 4  751  ? -10.737 -54.554  54.207  1.00 125.80 ? 751  SER A OG    1 
ATOM   6501  N  N     . LYS D 4  752  ? -8.825  -52.402  55.238  1.00 124.94 ? 752  LYS A N     1 
ATOM   6502  C  CA    . LYS D 4  752  ? -8.519  -51.036  55.711  1.00 124.67 ? 752  LYS A CA    1 
ATOM   6503  C  C     . LYS D 4  752  ? -9.306  -50.861  56.986  1.00 124.39 ? 752  LYS A C     1 
ATOM   6504  O  O     . LYS D 4  752  ? -10.384 -51.438  57.158  1.00 123.32 ? 752  LYS A O     1 
ATOM   6505  C  CB    . LYS D 4  752  ? -8.965  -49.915  54.745  1.00 124.67 ? 752  LYS A CB    1 
ATOM   6506  C  CG    . LYS D 4  752  ? -8.008  -49.490  53.627  1.00 124.64 ? 752  LYS A CG    1 
ATOM   6507  C  CD    . LYS D 4  752  ? -6.524  -49.466  54.022  1.00 125.31 ? 752  LYS A CD    1 
ATOM   6508  C  CE    . LYS D 4  752  ? -5.745  -48.316  53.329  1.00 126.27 ? 752  LYS A CE    1 
ATOM   6509  N  NZ    . LYS D 4  752  ? -6.029  -48.097  51.857  1.00 126.09 ? 752  LYS A NZ    1 
ATOM   6510  N  N     . GLY D 4  753  ? -8.765  -50.048  57.874  1.00 124.91 ? 753  GLY A N     1 
ATOM   6511  C  CA    . GLY D 4  753  ? -9.484  -49.680  59.087  1.00 126.01 ? 753  GLY A CA    1 
ATOM   6512  C  C     . GLY D 4  753  ? -9.032  -50.449  60.309  1.00 126.47 ? 753  GLY A C     1 
ATOM   6513  O  O     . GLY D 4  753  ? -8.859  -51.663  60.256  1.00 126.75 ? 753  GLY A O     1 
ATOM   6514  N  N     . SER D 4  754  ? -8.853  -49.743  61.418  1.00 126.81 ? 754  SER A N     1 
ATOM   6515  C  CA    . SER D 4  754  ? -8.469  -50.380  62.672  1.00 127.39 ? 754  SER A CA    1 
ATOM   6516  C  C     . SER D 4  754  ? -9.388  -49.942  63.830  1.00 127.07 ? 754  SER A C     1 
ATOM   6517  O  O     . SER D 4  754  ? -10.498 -49.438  63.607  1.00 126.91 ? 754  SER A O     1 
ATOM   6518  C  CB    . SER D 4  754  ? -7.001  -50.076  62.972  1.00 127.69 ? 754  SER A CB    1 
ATOM   6519  O  OG    . SER D 4  754  ? -6.806  -48.671  63.147  1.00 129.73 ? 754  SER A OG    1 
ATOM   6520  N  N     . PHE D 4  755  ? -8.938  -50.126  65.062  1.00 126.64 ? 755  PHE A N     1 
ATOM   6521  C  CA    . PHE D 4  755  ? -9.771  -49.694  66.146  1.00 126.79 ? 755  PHE A CA    1 
ATOM   6522  C  C     . PHE D 4  755  ? -9.986  -48.194  66.243  1.00 126.77 ? 755  PHE A C     1 
ATOM   6523  O  O     . PHE D 4  755  ? -11.120 -47.749  66.509  1.00 127.69 ? 755  PHE A O     1 
ATOM   6524  C  CB    . PHE D 4  755  ? -9.251  -50.142  67.494  1.00 127.12 ? 755  PHE A CB    1 
ATOM   6525  C  CG    . PHE D 4  755  ? -10.055 -49.583  68.649  1.00 126.41 ? 755  PHE A CG    1 
ATOM   6526  C  CD1   . PHE D 4  755  ? -11.403 -49.846  68.756  1.00 124.77 ? 755  PHE A CD1   1 
ATOM   6527  C  CD2   . PHE D 4  755  ? -9.461  -48.774  69.599  1.00 126.26 ? 755  PHE A CD2   1 
ATOM   6528  C  CE1   . PHE D 4  755  ? -12.121 -49.333  69.787  1.00 125.77 ? 755  PHE A CE1   1 
ATOM   6529  C  CE2   . PHE D 4  755  ? -10.192 -48.267  70.645  1.00 126.00 ? 755  PHE A CE2   1 
ATOM   6530  C  CZ    . PHE D 4  755  ? -11.515 -48.541  70.738  1.00 125.80 ? 755  PHE A CZ    1 
ATOM   6531  N  N     . ILE D 4  756  ? -8.914  -47.417  66.106  1.00 125.68 ? 756  ILE A N     1 
ATOM   6532  C  CA    . ILE D 4  756  ? -8.997  -45.994  66.441  1.00 124.52 ? 756  ILE A CA    1 
ATOM   6533  C  C     . ILE D 4  756  ? -9.962  -45.299  65.513  1.00 123.32 ? 756  ILE A C     1 
ATOM   6534  O  O     . ILE D 4  756  ? -10.628 -44.359  65.928  1.00 123.29 ? 756  ILE A O     1 
ATOM   6535  C  CB    . ILE D 4  756  ? -7.641  -45.262  66.405  1.00 124.93 ? 756  ILE A CB    1 
ATOM   6536  C  CG1   . ILE D 4  756  ? -6.479  -46.199  66.794  1.00 127.47 ? 756  ILE A CG1   1 
ATOM   6537  C  CG2   . ILE D 4  756  ? -7.686  -44.027  67.291  1.00 123.98 ? 756  ILE A CG2   1 
ATOM   6538  C  CD1   . ILE D 4  756  ? -6.705  -47.069  68.096  1.00 130.33 ? 756  ILE A CD1   1 
ATOM   6539  N  N     . ASN D 4  757  ? -10.058 -45.784  64.275  1.00 121.83 ? 757  ASN A N     1 
ATOM   6540  C  CA    . ASN D 4  757  ? -10.931 -45.173  63.273  1.00 120.60 ? 757  ASN A CA    1 
ATOM   6541  C  C     . ASN D 4  757  ? -12.374 -45.120  63.704  1.00 119.66 ? 757  ASN A C     1 
ATOM   6542  O  O     . ASN D 4  757  ? -12.945 -44.019  63.753  1.00 119.77 ? 757  ASN A O     1 
ATOM   6543  C  CB    . ASN D 4  757  ? -10.824 -45.898  61.951  1.00 120.62 ? 757  ASN A CB    1 
ATOM   6544  C  CG    . ASN D 4  757  ? -9.430  -46.004  61.499  1.00 121.09 ? 757  ASN A CG    1 
ATOM   6545  O  OD1   . ASN D 4  757  ? -8.680  -45.028  61.550  1.00 121.23 ? 757  ASN A OD1   1 
ATOM   6546  N  ND2   . ASN D 4  757  ? -9.038  -47.195  61.083  1.00 120.99 ? 757  ASN A ND2   1 
ATOM   6547  N  N     . ILE D 4  758  ? -12.936 -46.306  64.001  1.00 117.97 ? 758  ILE A N     1 
ATOM   6548  C  CA    . ILE D 4  758  ? -14.270 -46.481  64.579  1.00 116.01 ? 758  ILE A CA    1 
ATOM   6549  C  C     . ILE D 4  758  ? -14.361 -45.533  65.741  1.00 115.45 ? 758  ILE A C     1 
ATOM   6550  O  O     . ILE D 4  758  ? -15.282 -44.713  65.786  1.00 115.39 ? 758  ILE A O     1 
ATOM   6551  C  CB    . ILE D 4  758  ? -14.511 -47.919  65.105  1.00 115.85 ? 758  ILE A CB    1 
ATOM   6552  C  CG1   . ILE D 4  758  ? -13.793 -48.986  64.245  1.00 115.27 ? 758  ILE A CG1   1 
ATOM   6553  C  CG2   . ILE D 4  758  ? -16.016 -48.200  65.319  1.00 114.91 ? 758  ILE A CG2   1 
ATOM   6554  C  CD1   . ILE D 4  758  ? -13.768 -48.772  62.747  1.00 112.38 ? 758  ILE A CD1   1 
ATOM   6555  N  N     . ALA D 4  759  ? -13.372 -45.626  66.641  1.00 114.69 ? 759  ALA A N     1 
ATOM   6556  C  CA    . ALA D 4  759  ? -13.220 -44.739  67.818  1.00 114.56 ? 759  ALA A CA    1 
ATOM   6557  C  C     . ALA D 4  759  ? -13.470 -43.265  67.506  1.00 114.20 ? 759  ALA A C     1 
ATOM   6558  O  O     . ALA D 4  759  ? -14.550 -42.736  67.776  1.00 113.84 ? 759  ALA A O     1 
ATOM   6559  C  CB    . ALA D 4  759  ? -11.845 -44.921  68.459  1.00 114.36 ? 759  ALA A CB    1 
ATOM   6560  N  N     . GLN D 4  760  ? -12.456 -42.611  66.951  1.00 114.08 ? 760  GLN A N     1 
ATOM   6561  C  CA    . GLN D 4  760  ? -12.632 -41.331  66.256  1.00 114.26 ? 760  GLN A CA    1 
ATOM   6562  C  C     . GLN D 4  760  ? -14.046 -41.091  65.721  1.00 114.80 ? 760  GLN A C     1 
ATOM   6563  O  O     . GLN D 4  760  ? -14.968 -40.563  66.414  1.00 114.36 ? 760  GLN A O     1 
ATOM   6564  C  CB    . GLN D 4  760  ? -11.721 -41.281  65.018  1.00 113.54 ? 760  GLN A CB    1 
ATOM   6565  C  CG    . GLN D 4  760  ? -10.293 -41.570  65.300  1.00 111.62 ? 760  GLN A CG    1 
ATOM   6566  C  CD    . GLN D 4  760  ? -9.673  -40.605  66.261  1.00 108.36 ? 760  GLN A CD    1 
ATOM   6567  O  OE1   . GLN D 4  760  ? -8.491  -40.343  66.171  1.00 107.86 ? 760  GLN A OE1   1 
ATOM   6568  N  NE2   . GLN D 4  760  ? -10.459 -40.069  67.189  1.00 106.68 ? 760  GLN A NE2   1 
ATOM   6569  N  N     . MET D 4  761  ? -14.162 -41.481  64.444  1.00 114.64 ? 761  MET A N     1 
ATOM   6570  C  CA    . MET D 4  761  ? -15.352 -41.260  63.640  1.00 113.98 ? 761  MET A CA    1 
ATOM   6571  C  C     . MET D 4  761  ? -16.646 -41.233  64.397  1.00 112.60 ? 761  MET A C     1 
ATOM   6572  O  O     . MET D 4  761  ? -17.288 -40.206  64.360  1.00 111.99 ? 761  MET A O     1 
ATOM   6573  C  CB    . MET D 4  761  ? -15.421 -42.233  62.490  1.00 114.09 ? 761  MET A CB    1 
ATOM   6574  C  CG    . MET D 4  761  ? -14.268 -42.085  61.561  1.00 112.96 ? 761  MET A CG    1 
ATOM   6575  S  SD    . MET D 4  761  ? -14.767 -42.915  60.048  1.00 114.87 ? 761  MET A SD    1 
ATOM   6576  C  CE    . MET D 4  761  ? -14.698 -44.673  60.510  1.00 113.15 ? 761  MET A CE    1 
ATOM   6577  N  N     . SER D 4  762  ? -16.986 -42.316  65.102  1.00 111.86 ? 762  SER A N     1 
ATOM   6578  C  CA    . SER D 4  762  ? -18.302 -42.412  65.778  1.00 111.81 ? 762  SER A CA    1 
ATOM   6579  C  C     . SER D 4  762  ? -18.464 -41.958  67.246  1.00 111.73 ? 762  SER A C     1 
ATOM   6580  O  O     . SER D 4  762  ? -19.505 -41.376  67.589  1.00 111.25 ? 762  SER A O     1 
ATOM   6581  C  CB    . SER D 4  762  ? -18.894 -43.805  65.648  1.00 111.73 ? 762  SER A CB    1 
ATOM   6582  O  OG    . SER D 4  762  ? -20.258 -43.735  65.990  1.00 110.29 ? 762  SER A OG    1 
ATOM   6583  N  N     . ALA D 4  763  ? -17.437 -42.212  68.071  1.00 111.65 ? 763  ALA A N     1 
ATOM   6584  C  CA    . ALA D 4  763  ? -17.461 -42.057  69.546  1.00 111.42 ? 763  ALA A CA    1 
ATOM   6585  C  C     . ALA D 4  763  ? -17.060 -40.699  70.105  1.00 111.54 ? 763  ALA A C     1 
ATOM   6586  O  O     . ALA D 4  763  ? -17.883 -39.860  70.410  1.00 111.57 ? 763  ALA A O     1 
ATOM   6587  C  CB    . ALA D 4  763  ? -16.563 -43.100  70.157  1.00 111.31 ? 763  ALA A CB    1 
ATOM   6588  N  N     . CYS D 4  764  ? -15.760 -40.528  70.284  1.00 112.34 ? 764  CYS A N     1 
ATOM   6589  C  CA    . CYS D 4  764  ? -15.140 -39.259  70.659  1.00 112.33 ? 764  CYS A CA    1 
ATOM   6590  C  C     . CYS D 4  764  ? -13.806 -39.180  69.892  1.00 111.83 ? 764  CYS A C     1 
ATOM   6591  O  O     . CYS D 4  764  ? -13.283 -40.205  69.472  1.00 111.62 ? 764  CYS A O     1 
ATOM   6592  C  CB    . CYS D 4  764  ? -14.993 -39.190  72.193  1.00 112.40 ? 764  CYS A CB    1 
ATOM   6593  S  SG    . CYS D 4  764  ? -13.379 -38.672  72.810  1.00 112.87 ? 764  CYS A SG    1 
ATOM   6594  N  N     . VAL D 4  765  ? -13.287 -37.985  69.642  1.00 111.83 ? 765  VAL A N     1 
ATOM   6595  C  CA    . VAL D 4  765  ? -12.026 -37.895  68.898  1.00 111.87 ? 765  VAL A CA    1 
ATOM   6596  C  C     . VAL D 4  765  ? -10.861 -38.060  69.849  1.00 112.47 ? 765  VAL A C     1 
ATOM   6597  O  O     . VAL D 4  765  ? -9.871  -38.670  69.503  1.00 112.43 ? 765  VAL A O     1 
ATOM   6598  C  CB    . VAL D 4  765  ? -11.865 -36.598  68.071  1.00 111.46 ? 765  VAL A CB    1 
ATOM   6599  C  CG1   . VAL D 4  765  ? -10.398 -36.324  67.832  1.00 111.13 ? 765  VAL A CG1   1 
ATOM   6600  C  CG2   . VAL D 4  765  ? -12.614 -36.695  66.738  1.00 110.38 ? 765  VAL A CG2   1 
ATOM   6601  N  N     . GLY D 4  766  ? -10.990 -37.501  71.047  1.00 113.46 ? 766  GLY A N     1 
ATOM   6602  C  CA    . GLY D 4  766  ? -9.982  -37.650  72.101  1.00 114.79 ? 766  GLY A CA    1 
ATOM   6603  C  C     . GLY D 4  766  ? -9.169  -36.415  72.435  1.00 115.70 ? 766  GLY A C     1 
ATOM   6604  O  O     . GLY D 4  766  ? -9.479  -35.311  71.985  1.00 116.12 ? 766  GLY A O     1 
ATOM   6605  N  N     . GLN D 4  767  ? -8.119  -36.607  73.230  1.00 116.48 ? 767  GLN A N     1 
ATOM   6606  C  CA    . GLN D 4  767  ? -7.146  -35.538  73.492  1.00 117.23 ? 767  GLN A CA    1 
ATOM   6607  C  C     . GLN D 4  767  ? -6.107  -35.338  72.335  1.00 117.71 ? 767  GLN A C     1 
ATOM   6608  O  O     . GLN D 4  767  ? -5.505  -36.293  71.784  1.00 116.91 ? 767  GLN A O     1 
ATOM   6609  C  CB    . GLN D 4  767  ? -6.497  -35.740  74.875  1.00 117.14 ? 767  GLN A CB    1 
ATOM   6610  C  CG    . GLN D 4  767  ? -5.293  -34.893  75.175  1.00 117.81 ? 767  GLN A CG    1 
ATOM   6611  C  CD    . GLN D 4  767  ? -5.651  -33.480  75.568  1.00 120.54 ? 767  GLN A CD    1 
ATOM   6612  O  OE1   . GLN D 4  767  ? -5.955  -33.198  76.728  1.00 122.25 ? 767  GLN A OE1   1 
ATOM   6613  N  NE2   . GLN D 4  767  ? -5.579  -32.564  74.606  1.00 123.07 ? 767  GLN A NE2   1 
ATOM   6614  N  N     . GLN D 4  768  ? -5.961  -34.063  71.977  1.00 118.45 ? 768  GLN A N     1 
ATOM   6615  C  CA    . GLN D 4  768  ? -4.981  -33.588  71.015  1.00 119.04 ? 768  GLN A CA    1 
ATOM   6616  C  C     . GLN D 4  768  ? -3.636  -33.323  71.704  1.00 119.40 ? 768  GLN A C     1 
ATOM   6617  O  O     . GLN D 4  768  ? -3.576  -33.106  72.907  1.00 119.32 ? 768  GLN A O     1 
ATOM   6618  C  CB    . GLN D 4  768  ? -5.511  -32.306  70.377  1.00 118.90 ? 768  GLN A CB    1 
ATOM   6619  C  CG    . GLN D 4  768  ? -5.425  -32.290  68.854  1.00 118.97 ? 768  GLN A CG    1 
ATOM   6620  C  CD    . GLN D 4  768  ? -6.244  -33.391  68.206  1.00 119.14 ? 768  GLN A CD    1 
ATOM   6621  O  OE1   . GLN D 4  768  ? -7.461  -33.461  68.391  1.00 120.23 ? 768  GLN A OE1   1 
ATOM   6622  N  NE2   . GLN D 4  768  ? -5.578  -34.262  67.446  1.00 117.83 ? 768  GLN A NE2   1 
ATOM   6623  N  N     . SER D 4  769  ? -2.549  -33.352  70.950  1.00 120.17 ? 769  SER A N     1 
ATOM   6624  C  CA    . SER D 4  769  ? -1.245  -33.109  71.554  1.00 121.05 ? 769  SER A CA    1 
ATOM   6625  C  C     . SER D 4  769  ? -0.236  -32.669  70.539  1.00 121.44 ? 769  SER A C     1 
ATOM   6626  O  O     . SER D 4  769  ? -0.210  -33.180  69.417  1.00 121.44 ? 769  SER A O     1 
ATOM   6627  C  CB    . SER D 4  769  ? -0.689  -34.365  72.221  1.00 121.37 ? 769  SER A CB    1 
ATOM   6628  O  OG    . SER D 4  769  ? 0.229   -35.032  71.354  1.00 121.80 ? 769  SER A OG    1 
ATOM   6629  N  N     . VAL D 4  770  ? 0.602   -31.737  70.979  1.00 121.97 ? 770  VAL A N     1 
ATOM   6630  C  CA    . VAL D 4  770  ? 1.776   -31.291  70.261  1.00 122.61 ? 770  VAL A CA    1 
ATOM   6631  C  C     . VAL D 4  770  ? 2.909   -31.355  71.260  1.00 123.36 ? 770  VAL A C     1 
ATOM   6632  O  O     . VAL D 4  770  ? 2.728   -31.002  72.436  1.00 123.99 ? 770  VAL A O     1 
ATOM   6633  C  CB    . VAL D 4  770  ? 1.663   -29.843  69.803  1.00 122.33 ? 770  VAL A CB    1 
ATOM   6634  C  CG1   . VAL D 4  770  ? 2.294   -29.680  68.426  1.00 121.83 ? 770  VAL A CG1   1 
ATOM   6635  C  CG2   . VAL D 4  770  ? 0.197   -29.382  69.810  1.00 123.33 ? 770  VAL A CG2   1 
ATOM   6636  N  N     . GLU D 4  771  ? 4.069   -31.817  70.785  1.00 123.82 ? 771  GLU A N     1 
ATOM   6637  C  CA    . GLU D 4  771  ? 5.287   -32.002  71.586  1.00 123.85 ? 771  GLU A CA    1 
ATOM   6638  C  C     . GLU D 4  771  ? 5.077   -32.965  72.758  1.00 122.49 ? 771  GLU A C     1 
ATOM   6639  O  O     . GLU D 4  771  ? 5.629   -32.772  73.826  1.00 122.35 ? 771  GLU A O     1 
ATOM   6640  C  CB    . GLU D 4  771  ? 5.808   -30.646  72.075  1.00 124.60 ? 771  GLU A CB    1 
ATOM   6641  C  CG    . GLU D 4  771  ? 7.329   -30.531  72.102  1.00 129.12 ? 771  GLU A CG    1 
ATOM   6642  C  CD    . GLU D 4  771  ? 7.914   -29.855  70.853  1.00 134.59 ? 771  GLU A CD    1 
ATOM   6643  O  OE1   . GLU D 4  771  ? 7.550   -28.674  70.564  1.00 136.03 ? 771  GLU A OE1   1 
ATOM   6644  O  OE2   . GLU D 4  771  ? 8.757   -30.507  70.180  1.00 136.57 ? 771  GLU A OE2   1 
ATOM   6645  N  N     . GLY D 4  772  ? 4.263   -33.990  72.562  1.00 121.40 ? 772  GLY A N     1 
ATOM   6646  C  CA    . GLY D 4  772  ? 3.947   -34.916  73.641  1.00 120.58 ? 772  GLY A CA    1 
ATOM   6647  C  C     . GLY D 4  772  ? 3.111   -34.389  74.812  1.00 119.85 ? 772  GLY A C     1 
ATOM   6648  O  O     . GLY D 4  772  ? 2.624   -35.177  75.621  1.00 119.90 ? 772  GLY A O     1 
ATOM   6649  N  N     . LYS D 4  773  ? 2.952   -33.075  74.928  1.00 118.94 ? 773  LYS A N     1 
ATOM   6650  C  CA    . LYS D 4  773  ? 2.155   -32.504  76.007  1.00 118.30 ? 773  LYS A CA    1 
ATOM   6651  C  C     . LYS D 4  773  ? 0.832   -32.079  75.419  1.00 117.78 ? 773  LYS A C     1 
ATOM   6652  O  O     . LYS D 4  773  ? 0.755   -31.851  74.210  1.00 117.20 ? 773  LYS A O     1 
ATOM   6653  C  CB    . LYS D 4  773  ? 2.847   -31.278  76.604  1.00 118.48 ? 773  LYS A CB    1 
ATOM   6654  C  CG    . LYS D 4  773  ? 4.264   -31.518  77.119  1.00 118.95 ? 773  LYS A CG    1 
ATOM   6655  C  CD    . LYS D 4  773  ? 5.151   -30.279  76.895  1.00 118.94 ? 773  LYS A CD    1 
ATOM   6656  C  CE    . LYS D 4  773  ? 6.597   -30.533  77.300  1.00 118.58 ? 773  LYS A CE    1 
ATOM   6657  N  NZ    . LYS D 4  773  ? 6.793   -30.429  78.775  1.00 118.24 ? 773  LYS A NZ    1 
ATOM   6658  N  N     . ARG D 4  774  ? -0.210  -31.966  76.252  1.00 117.35 ? 774  ARG A N     1 
ATOM   6659  C  CA    . ARG D 4  774  ? -1.433  -31.312  75.780  1.00 116.93 ? 774  ARG A CA    1 
ATOM   6660  C  C     . ARG D 4  774  ? -1.122  -29.889  75.315  1.00 117.23 ? 774  ARG A C     1 
ATOM   6661  O  O     . ARG D 4  774  ? 0.037   -29.453  75.378  1.00 116.95 ? 774  ARG A O     1 
ATOM   6662  C  CB    . ARG D 4  774  ? -2.621  -31.388  76.755  1.00 116.47 ? 774  ARG A CB    1 
ATOM   6663  C  CG    . ARG D 4  774  ? -2.319  -31.402  78.216  1.00 115.09 ? 774  ARG A CG    1 
ATOM   6664  C  CD    . ARG D 4  774  ? -3.356  -32.266  78.941  1.00 113.51 ? 774  ARG A CD    1 
ATOM   6665  N  NE    . ARG D 4  774  ? -4.573  -31.572  79.379  1.00 112.08 ? 774  ARG A NE    1 
ATOM   6666  C  CZ    . ARG D 4  774  ? -4.744  -30.994  80.578  1.00 111.64 ? 774  ARG A CZ    1 
ATOM   6667  N  NH1   . ARG D 4  774  ? -3.770  -30.983  81.492  1.00 110.89 ? 774  ARG A NH1   1 
ATOM   6668  N  NH2   . ARG D 4  774  ? -5.898  -30.402  80.868  1.00 110.13 ? 774  ARG A NH2   1 
ATOM   6669  N  N     . ILE D 4  775  ? -2.145  -29.187  74.822  1.00 117.75 ? 775  ILE A N     1 
ATOM   6670  C  CA    . ILE D 4  775  ? -1.933  -27.992  73.981  1.00 118.03 ? 775  ILE A CA    1 
ATOM   6671  C  C     . ILE D 4  775  ? -1.183  -26.917  74.730  1.00 117.90 ? 775  ILE A C     1 
ATOM   6672  O  O     . ILE D 4  775  ? -1.566  -26.565  75.854  1.00 118.11 ? 775  ILE A O     1 
ATOM   6673  C  CB    . ILE D 4  775  ? -3.264  -27.378  73.473  1.00 118.16 ? 775  ILE A CB    1 
ATOM   6674  C  CG1   . ILE D 4  775  ? -4.241  -28.464  73.011  1.00 119.16 ? 775  ILE A CG1   1 
ATOM   6675  C  CG2   . ILE D 4  775  ? -3.002  -26.411  72.331  1.00 117.75 ? 775  ILE A CG2   1 
ATOM   6676  C  CD1   . ILE D 4  775  ? -3.912  -29.049  71.649  1.00 122.78 ? 775  ILE A CD1   1 
ATOM   6677  N  N     . ALA D 4  776  ? -0.127  -26.398  74.109  1.00 117.43 ? 776  ALA A N     1 
ATOM   6678  C  CA    . ALA D 4  776  ? 0.613   -25.261  74.667  1.00 117.37 ? 776  ALA A CA    1 
ATOM   6679  C  C     . ALA D 4  776  ? -0.281  -24.096  75.205  1.00 117.17 ? 776  ALA A C     1 
ATOM   6680  O  O     . ALA D 4  776  ? -1.305  -23.762  74.613  1.00 117.07 ? 776  ALA A O     1 
ATOM   6681  C  CB    . ALA D 4  776  ? 1.623   -24.737  73.608  1.00 117.51 ? 776  ALA A CB    1 
ATOM   6682  N  N     . PHE D 4  777  ? 0.091   -23.492  76.331  1.00 116.99 ? 777  PHE A N     1 
ATOM   6683  C  CA    . PHE D 4  777  ? -0.424  -22.166  76.696  1.00 116.87 ? 777  PHE A CA    1 
ATOM   6684  C  C     . PHE D 4  777  ? 0.293   -21.143  75.796  1.00 117.08 ? 777  PHE A C     1 
ATOM   6685  O  O     . PHE D 4  777  ? 1.439   -20.771  76.054  1.00 117.18 ? 777  PHE A O     1 
ATOM   6686  C  CB    . PHE D 4  777  ? -0.133  -21.875  78.172  1.00 116.67 ? 777  PHE A CB    1 
ATOM   6687  C  CG    . PHE D 4  777  ? -1.271  -22.159  79.094  1.00 116.57 ? 777  PHE A CG    1 
ATOM   6688  C  CD1   . PHE D 4  777  ? -1.213  -21.750  80.417  1.00 117.14 ? 777  PHE A CD1   1 
ATOM   6689  C  CD2   . PHE D 4  777  ? -2.412  -22.812  78.657  1.00 117.51 ? 777  PHE A CD2   1 
ATOM   6690  C  CE1   . PHE D 4  777  ? -2.279  -22.001  81.317  1.00 116.67 ? 777  PHE A CE1   1 
ATOM   6691  C  CE2   . PHE D 4  777  ? -3.483  -23.069  79.548  1.00 117.79 ? 777  PHE A CE2   1 
ATOM   6692  C  CZ    . PHE D 4  777  ? -3.408  -22.656  80.878  1.00 116.63 ? 777  PHE A CZ    1 
ATOM   6693  N  N     . GLY D 4  778  ? -0.359  -20.703  74.727  1.00 117.29 ? 778  GLY A N     1 
ATOM   6694  C  CA    . GLY D 4  778  ? 0.348   -19.967  73.665  1.00 117.67 ? 778  GLY A CA    1 
ATOM   6695  C  C     . GLY D 4  778  ? 0.223   -18.474  73.805  1.00 117.98 ? 778  GLY A C     1 
ATOM   6696  O  O     . GLY D 4  778  ? 1.188   -17.746  73.593  1.00 118.08 ? 778  GLY A O     1 
ATOM   6697  N  N     . PHE D 4  779  ? -0.989  -18.032  74.130  1.00 118.40 ? 779  PHE A N     1 
ATOM   6698  C  CA    . PHE D 4  779  ? -1.236  -16.704  74.640  1.00 119.03 ? 779  PHE A CA    1 
ATOM   6699  C  C     . PHE D 4  779  ? -0.912  -16.820  76.113  1.00 119.26 ? 779  PHE A C     1 
ATOM   6700  O  O     . PHE D 4  779  ? -1.071  -17.891  76.700  1.00 119.73 ? 779  PHE A O     1 
ATOM   6701  C  CB    . PHE D 4  779  ? -2.703  -16.293  74.415  1.00 119.44 ? 779  PHE A CB    1 
ATOM   6702  C  CG    . PHE D 4  779  ? -3.045  -16.074  72.960  1.00 120.42 ? 779  PHE A CG    1 
ATOM   6703  C  CD1   . PHE D 4  779  ? -3.700  -17.053  72.229  1.00 121.54 ? 779  PHE A CD1   1 
ATOM   6704  C  CD2   . PHE D 4  779  ? -2.671  -14.901  72.304  1.00 121.64 ? 779  PHE A CD2   1 
ATOM   6705  C  CE1   . PHE D 4  779  ? -3.973  -16.864  70.861  1.00 121.90 ? 779  PHE A CE1   1 
ATOM   6706  C  CE2   . PHE D 4  779  ? -2.962  -14.696  70.938  1.00 121.59 ? 779  PHE A CE2   1 
ATOM   6707  C  CZ    . PHE D 4  779  ? -3.610  -15.677  70.222  1.00 121.03 ? 779  PHE A CZ    1 
ATOM   6708  N  N     . VAL D 4  780  ? -0.419  -15.738  76.697  1.00 119.05 ? 780  VAL A N     1 
ATOM   6709  C  CA    . VAL D 4  780  ? -0.084  -15.701  78.113  1.00 119.01 ? 780  VAL A CA    1 
ATOM   6710  C  C     . VAL D 4  780  ? -1.170  -16.298  79.024  1.00 118.80 ? 780  VAL A C     1 
ATOM   6711  O  O     . VAL D 4  780  ? -2.282  -15.748  79.135  1.00 118.82 ? 780  VAL A O     1 
ATOM   6712  C  CB    . VAL D 4  780  ? 0.233   -14.260  78.518  1.00 119.07 ? 780  VAL A CB    1 
ATOM   6713  C  CG1   . VAL D 4  780  ? 0.152   -14.065  80.023  1.00 119.41 ? 780  VAL A CG1   1 
ATOM   6714  C  CG2   . VAL D 4  780  ? 1.605   -13.886  77.996  1.00 119.75 ? 780  VAL A CG2   1 
ATOM   6715  N  N     . ASP D 4  781  ? -0.817  -17.433  79.645  1.00 118.27 ? 781  ASP A N     1 
ATOM   6716  C  CA    . ASP D 4  781  ? -1.647  -18.173  80.639  1.00 118.12 ? 781  ASP A CA    1 
ATOM   6717  C  C     . ASP D 4  781  ? -3.050  -18.675  80.200  1.00 117.61 ? 781  ASP A C     1 
ATOM   6718  O  O     . ASP D 4  781  ? -4.006  -18.703  81.004  1.00 117.51 ? 781  ASP A O     1 
ATOM   6719  C  CB    . ASP D 4  781  ? -1.720  -17.448  82.003  1.00 118.44 ? 781  ASP A CB    1 
ATOM   6720  C  CG    . ASP D 4  781  ? -0.517  -17.759  82.933  1.00 119.20 ? 781  ASP A CG    1 
ATOM   6721  O  OD1   . ASP D 4  781  ? 0.112   -18.853  82.853  1.00 118.93 ? 781  ASP A OD1   1 
ATOM   6722  O  OD2   . ASP D 4  781  ? -0.208  -16.877  83.771  1.00 120.37 ? 781  ASP A OD2   1 
ATOM   6723  N  N     . ARG D 4  782  ? -3.133  -19.096  78.933  1.00 116.65 ? 782  ARG A N     1 
ATOM   6724  C  CA    . ARG D 4  782  ? -4.289  -19.785  78.349  1.00 115.43 ? 782  ARG A CA    1 
ATOM   6725  C  C     . ARG D 4  782  ? -3.962  -20.091  76.890  1.00 114.68 ? 782  ARG A C     1 
ATOM   6726  O  O     . ARG D 4  782  ? -3.012  -19.546  76.314  1.00 114.18 ? 782  ARG A O     1 
ATOM   6727  C  CB    . ARG D 4  782  ? -5.540  -18.935  78.440  1.00 115.37 ? 782  ARG A CB    1 
ATOM   6728  C  CG    . ARG D 4  782  ? -5.253  -17.550  77.961  1.00 116.16 ? 782  ARG A CG    1 
ATOM   6729  C  CD    . ARG D 4  782  ? -6.429  -16.657  78.059  1.00 117.44 ? 782  ARG A CD    1 
ATOM   6730  N  NE    . ARG D 4  782  ? -6.089  -15.379  77.452  1.00 118.28 ? 782  ARG A NE    1 
ATOM   6731  C  CZ    . ARG D 4  782  ? -6.980  -14.456  77.124  1.00 117.94 ? 782  ARG A CZ    1 
ATOM   6732  N  NH1   . ARG D 4  782  ? -8.276  -14.671  77.332  1.00 116.55 ? 782  ARG A NH1   1 
ATOM   6733  N  NH2   . ARG D 4  782  ? -6.567  -13.326  76.577  1.00 117.99 ? 782  ARG A NH2   1 
ATOM   6734  N  N     . THR D 4  783  ? -4.785  -20.946  76.295  1.00 113.97 ? 783  THR A N     1 
ATOM   6735  C  CA    . THR D 4  783  ? -4.532  -21.545  74.975  1.00 112.99 ? 783  THR A CA    1 
ATOM   6736  C  C     . THR D 4  783  ? -5.124  -20.754  73.803  1.00 112.30 ? 783  THR A C     1 
ATOM   6737  O  O     . THR D 4  783  ? -4.470  -20.504  72.796  1.00 111.37 ? 783  THR A O     1 
ATOM   6738  C  CB    . THR D 4  783  ? -5.135  -22.934  74.966  1.00 112.83 ? 783  THR A CB    1 
ATOM   6739  O  OG1   . THR D 4  783  ? -6.507  -22.842  75.377  1.00 113.25 ? 783  THR A OG1   1 
ATOM   6740  C  CG2   . THR D 4  783  ? -4.399  -23.815  75.955  1.00 112.67 ? 783  THR A CG2   1 
ATOM   6741  N  N     . LEU D 4  784  ? -6.391  -20.391  73.952  1.00 112.21 ? 784  LEU A N     1 
ATOM   6742  C  CA    . LEU D 4  784  ? -7.083  -19.521  73.010  1.00 112.01 ? 784  LEU A CA    1 
ATOM   6743  C  C     . LEU D 4  784  ? -7.750  -18.339  73.738  1.00 112.13 ? 784  LEU A C     1 
ATOM   6744  O  O     . LEU D 4  784  ? -8.290  -18.521  74.863  1.00 111.99 ? 784  LEU A O     1 
ATOM   6745  C  CB    . LEU D 4  784  ? -8.142  -20.296  72.235  1.00 111.73 ? 784  LEU A CB    1 
ATOM   6746  C  CG    . LEU D 4  784  ? -7.638  -21.253  71.178  1.00 110.39 ? 784  LEU A CG    1 
ATOM   6747  C  CD1   . LEU D 4  784  ? -8.818  -22.051  70.753  1.00 110.01 ? 784  LEU A CD1   1 
ATOM   6748  C  CD2   . LEU D 4  784  ? -7.055  -20.503  70.016  1.00 109.76 ? 784  LEU A CD2   1 
ATOM   6749  N  N     . PRO D 4  785  ? -7.727  -17.135  73.092  1.00 111.68 ? 785  PRO A N     1 
ATOM   6750  C  CA    . PRO D 4  785  ? -8.230  -15.882  73.645  1.00 111.04 ? 785  PRO A CA    1 
ATOM   6751  C  C     . PRO D 4  785  ? -9.648  -15.947  74.144  1.00 110.45 ? 785  PRO A C     1 
ATOM   6752  O  O     . PRO D 4  785  ? -10.136 -14.950  74.625  1.00 110.30 ? 785  PRO A O     1 
ATOM   6753  C  CB    . PRO D 4  785  ? -8.149  -14.925  72.451  1.00 111.10 ? 785  PRO A CB    1 
ATOM   6754  C  CG    . PRO D 4  785  ? -7.025  -15.424  71.659  1.00 110.75 ? 785  PRO A CG    1 
ATOM   6755  C  CD    . PRO D 4  785  ? -7.177  -16.916  71.736  1.00 111.42 ? 785  PRO A CD    1 
ATOM   6756  N  N     . HIS D 4  786  ? -10.281 -17.110  74.052  1.00 110.44 ? 786  HIS A N     1 
ATOM   6757  C  CA    . HIS D 4  786  ? -11.688 -17.274  74.424  1.00 111.06 ? 786  HIS A CA    1 
ATOM   6758  C  C     . HIS D 4  786  ? -12.003 -17.819  75.823  1.00 111.30 ? 786  HIS A C     1 
ATOM   6759  O  O     . HIS D 4  786  ? -13.178 -17.870  76.192  1.00 110.98 ? 786  HIS A O     1 
ATOM   6760  C  CB    . HIS D 4  786  ? -12.404 -18.160  73.412  1.00 111.10 ? 786  HIS A CB    1 
ATOM   6761  C  CG    . HIS D 4  786  ? -12.083 -17.828  72.005  1.00 111.35 ? 786  HIS A CG    1 
ATOM   6762  N  ND1   . HIS D 4  786  ? -12.667 -16.772  71.346  1.00 112.41 ? 786  HIS A ND1   1 
ATOM   6763  C  CD2   . HIS D 4  786  ? -11.224 -18.396  71.133  1.00 112.78 ? 786  HIS A CD2   1 
ATOM   6764  C  CE1   . HIS D 4  786  ? -12.185 -16.706  70.119  1.00 113.45 ? 786  HIS A CE1   1 
ATOM   6765  N  NE2   . HIS D 4  786  ? -11.313 -17.686  69.962  1.00 114.05 ? 786  HIS A NE2   1 
ATOM   6766  N  N     . PHE D 4  787  ? -10.992 -18.281  76.565  1.00 112.01 ? 787  PHE A N     1 
ATOM   6767  C  CA    . PHE D 4  787  ? -11.194 -18.712  77.964  1.00 112.55 ? 787  PHE A CA    1 
ATOM   6768  C  C     . PHE D 4  787  ? -10.472 -17.770  78.944  1.00 113.54 ? 787  PHE A C     1 
ATOM   6769  O  O     . PHE D 4  787  ? -9.530  -17.036  78.574  1.00 113.35 ? 787  PHE A O     1 
ATOM   6770  C  CB    . PHE D 4  787  ? -10.716 -20.160  78.278  1.00 112.00 ? 787  PHE A CB    1 
ATOM   6771  C  CG    . PHE D 4  787  ? -10.844 -21.161  77.152  1.00 110.93 ? 787  PHE A CG    1 
ATOM   6772  C  CD1   . PHE D 4  787  ? -9.785  -21.358  76.251  1.00 109.83 ? 787  PHE A CD1   1 
ATOM   6773  C  CD2   . PHE D 4  787  ? -11.971 -21.969  77.052  1.00 109.54 ? 787  PHE A CD2   1 
ATOM   6774  C  CE1   . PHE D 4  787  ? -9.880  -22.283  75.246  1.00 108.41 ? 787  PHE A CE1   1 
ATOM   6775  C  CE2   . PHE D 4  787  ? -12.070 -22.903  76.042  1.00 109.50 ? 787  PHE A CE2   1 
ATOM   6776  C  CZ    . PHE D 4  787  ? -11.020 -23.058  75.138  1.00 109.54 ? 787  PHE A CZ    1 
ATOM   6777  N  N     . SER D 4  788  ? -10.897 -17.827  80.203  1.00 114.68 ? 788  SER A N     1 
ATOM   6778  C  CA    . SER D 4  788  ? -10.166 -17.178  81.269  1.00 116.43 ? 788  SER A CA    1 
ATOM   6779  C  C     . SER D 4  788  ? -8.719  -17.704  81.355  1.00 117.66 ? 788  SER A C     1 
ATOM   6780  O  O     . SER D 4  788  ? -8.411  -18.802  80.878  1.00 118.26 ? 788  SER A O     1 
ATOM   6781  C  CB    . SER D 4  788  ? -10.898 -17.385  82.588  1.00 116.35 ? 788  SER A CB    1 
ATOM   6782  O  OG    . SER D 4  788  ? -12.258 -17.023  82.456  1.00 116.96 ? 788  SER A OG    1 
ATOM   6783  N  N     . LYS D 4  789  ? -7.829  -16.914  81.950  1.00 118.97 ? 789  LYS A N     1 
ATOM   6784  C  CA    . LYS D 4  789  ? -6.452  -17.339  82.185  1.00 120.03 ? 789  LYS A CA    1 
ATOM   6785  C  C     . LYS D 4  789  ? -6.375  -18.456  83.223  1.00 121.01 ? 789  LYS A C     1 
ATOM   6786  O  O     . LYS D 4  789  ? -7.315  -18.666  84.015  1.00 120.83 ? 789  LYS A O     1 
ATOM   6787  C  CB    . LYS D 4  789  ? -5.594  -16.156  82.632  1.00 119.90 ? 789  LYS A CB    1 
ATOM   6788  C  CG    . LYS D 4  789  ? -4.985  -15.365  81.493  1.00 120.02 ? 789  LYS A CG    1 
ATOM   6789  C  CD    . LYS D 4  789  ? -4.551  -14.002  81.974  1.00 119.91 ? 789  LYS A CD    1 
ATOM   6790  C  CE    . LYS D 4  789  ? -3.561  -13.367  81.034  1.00 120.03 ? 789  LYS A CE    1 
ATOM   6791  N  NZ    . LYS D 4  789  ? -2.875  -12.264  81.757  1.00 120.99 ? 789  LYS A NZ    1 
ATOM   6792  N  N     . ASP D 4  790  ? -5.243  -19.163  83.218  1.00 122.34 ? 790  ASP A N     1 
ATOM   6793  C  CA    . ASP D 4  790  ? -4.996  -20.247  84.175  1.00 123.65 ? 790  ASP A CA    1 
ATOM   6794  C  C     . ASP D 4  790  ? -6.146  -21.266  84.102  1.00 124.06 ? 790  ASP A C     1 
ATOM   6795  O  O     . ASP D 4  790  ? -6.841  -21.488  85.108  1.00 124.38 ? 790  ASP A O     1 
ATOM   6796  C  CB    . ASP D 4  790  ? -4.839  -19.711  85.632  1.00 123.83 ? 790  ASP A CB    1 
ATOM   6797  C  CG    . ASP D 4  790  ? -3.521  -18.924  85.865  1.00 124.66 ? 790  ASP A CG    1 
ATOM   6798  O  OD1   . ASP D 4  790  ? -3.601  -17.715  86.208  1.00 125.07 ? 790  ASP A OD1   1 
ATOM   6799  O  OD2   . ASP D 4  790  ? -2.416  -19.514  85.735  1.00 124.63 ? 790  ASP A OD2   1 
ATOM   6800  N  N     . ASP D 4  791  ? -6.370  -21.847  82.915  1.00 124.28 ? 791  ASP A N     1 
ATOM   6801  C  CA    . ASP D 4  791  ? -7.429  -22.867  82.758  1.00 124.32 ? 791  ASP A CA    1 
ATOM   6802  C  C     . ASP D 4  791  ? -6.930  -24.271  82.411  1.00 123.75 ? 791  ASP A C     1 
ATOM   6803  O  O     . ASP D 4  791  ? -6.647  -24.583  81.237  1.00 123.57 ? 791  ASP A O     1 
ATOM   6804  C  CB    . ASP D 4  791  ? -8.528  -22.431  81.776  1.00 124.75 ? 791  ASP A CB    1 
ATOM   6805  C  CG    . ASP D 4  791  ? -9.884  -23.104  82.079  1.00 125.70 ? 791  ASP A CG    1 
ATOM   6806  O  OD1   . ASP D 4  791  ? -10.122 -23.480  83.253  1.00 126.29 ? 791  ASP A OD1   1 
ATOM   6807  O  OD2   . ASP D 4  791  ? -10.716 -23.256  81.155  1.00 126.59 ? 791  ASP A OD2   1 
ATOM   6808  N  N     . TYR D 4  792  ? -6.865  -25.115  83.444  1.00 122.96 ? 792  TYR A N     1 
ATOM   6809  C  CA    . TYR D 4  792  ? -6.238  -26.432  83.320  1.00 122.22 ? 792  TYR A CA    1 
ATOM   6810  C  C     . TYR D 4  792  ? -7.158  -27.567  82.863  1.00 122.02 ? 792  TYR A C     1 
ATOM   6811  O  O     . TYR D 4  792  ? -6.683  -28.526  82.242  1.00 121.87 ? 792  TYR A O     1 
ATOM   6812  C  CB    . TYR D 4  792  ? -5.422  -26.779  84.575  1.00 121.95 ? 792  TYR A CB    1 
ATOM   6813  C  CG    . TYR D 4  792  ? -4.103  -26.046  84.575  1.00 120.77 ? 792  TYR A CG    1 
ATOM   6814  C  CD1   . TYR D 4  792  ? -3.842  -25.047  85.492  1.00 119.29 ? 792  TYR A CD1   1 
ATOM   6815  C  CD2   . TYR D 4  792  ? -3.138  -26.323  83.597  1.00 120.94 ? 792  TYR A CD2   1 
ATOM   6816  C  CE1   . TYR D 4  792  ? -2.647  -24.359  85.460  1.00 120.49 ? 792  TYR A CE1   1 
ATOM   6817  C  CE2   . TYR D 4  792  ? -1.933  -25.638  83.548  1.00 120.52 ? 792  TYR A CE2   1 
ATOM   6818  C  CZ    . TYR D 4  792  ? -1.687  -24.656  84.484  1.00 121.13 ? 792  TYR A CZ    1 
ATOM   6819  O  OH    . TYR D 4  792  ? -0.492  -23.964  84.445  1.00 120.76 ? 792  TYR A OH    1 
ATOM   6820  N  N     . SER D 4  793  ? -8.452  -27.443  83.177  1.00 121.56 ? 793  SER A N     1 
ATOM   6821  C  CA    . SER D 4  793  ? -9.565  -28.184  82.534  1.00 121.00 ? 793  SER A CA    1 
ATOM   6822  C  C     . SER D 4  793  ? -9.266  -28.780  81.137  1.00 120.62 ? 793  SER A C     1 
ATOM   6823  O  O     . SER D 4  793  ? -8.405  -28.271  80.427  1.00 120.75 ? 793  SER A O     1 
ATOM   6824  C  CB    . SER D 4  793  ? -10.742 -27.224  82.384  1.00 121.08 ? 793  SER A CB    1 
ATOM   6825  O  OG    . SER D 4  793  ? -10.358 -26.115  81.577  1.00 120.26 ? 793  SER A OG    1 
ATOM   6826  N  N     . PRO D 4  794  ? -10.016 -29.825  80.715  1.00 120.12 ? 794  PRO A N     1 
ATOM   6827  C  CA    . PRO D 4  794  ? -9.714  -30.462  79.422  1.00 119.59 ? 794  PRO A CA    1 
ATOM   6828  C  C     . PRO D 4  794  ? -9.992  -29.603  78.173  1.00 119.12 ? 794  PRO A C     1 
ATOM   6829  O  O     . PRO D 4  794  ? -9.090  -29.451  77.331  1.00 119.52 ? 794  PRO A O     1 
ATOM   6830  C  CB    . PRO D 4  794  ? -10.592 -31.719  79.425  1.00 119.44 ? 794  PRO A CB    1 
ATOM   6831  C  CG    . PRO D 4  794  ? -11.695 -31.421  80.336  1.00 120.14 ? 794  PRO A CG    1 
ATOM   6832  C  CD    . PRO D 4  794  ? -11.171 -30.458  81.384  1.00 120.25 ? 794  PRO A CD    1 
ATOM   6833  N  N     . GLU D 4  795  ? -11.209 -29.062  78.048  1.00 118.27 ? 795  GLU A N     1 
ATOM   6834  C  CA    . GLU D 4  795  ? -11.613 -28.318  76.847  1.00 117.69 ? 795  GLU A CA    1 
ATOM   6835  C  C     . GLU D 4  795  ? -10.815 -27.062  76.609  1.00 117.13 ? 795  GLU A C     1 
ATOM   6836  O  O     . GLU D 4  795  ? -10.770 -26.595  75.475  1.00 117.20 ? 795  GLU A O     1 
ATOM   6837  C  CB    . GLU D 4  795  ? -13.119 -28.010  76.799  1.00 117.73 ? 795  GLU A CB    1 
ATOM   6838  C  CG    . GLU D 4  795  ? -13.597 -27.017  77.830  1.00 118.45 ? 795  GLU A CG    1 
ATOM   6839  C  CD    . GLU D 4  795  ? -13.718 -27.670  79.204  1.00 120.71 ? 795  GLU A CD    1 
ATOM   6840  O  OE1   . GLU D 4  795  ? -14.004 -28.896  79.240  1.00 121.84 ? 795  GLU A OE1   1 
ATOM   6841  O  OE2   . GLU D 4  795  ? -13.517 -26.981  80.240  1.00 120.10 ? 795  GLU A OE2   1 
ATOM   6842  N  N     . SER D 4  796  ? -10.203 -26.520  77.667  1.00 116.74 ? 796  SER A N     1 
ATOM   6843  C  CA    . SER D 4  796  ? -9.268  -25.376  77.560  1.00 116.44 ? 796  SER A CA    1 
ATOM   6844  C  C     . SER D 4  796  ? -7.964  -25.851  76.977  1.00 116.57 ? 796  SER A C     1 
ATOM   6845  O  O     . SER D 4  796  ? -7.386  -25.197  76.120  1.00 116.42 ? 796  SER A O     1 
ATOM   6846  C  CB    . SER D 4  796  ? -8.980  -24.734  78.929  1.00 116.20 ? 796  SER A CB    1 
ATOM   6847  O  OG    . SER D 4  796  ? -7.867  -23.846  78.891  1.00 114.09 ? 796  SER A OG    1 
ATOM   6848  N  N     . LYS D 4  797  ? -7.535  -27.016  77.448  1.00 116.94 ? 797  LYS A N     1 
ATOM   6849  C  CA    . LYS D 4  797  ? -6.180  -27.528  77.245  1.00 117.47 ? 797  LYS A CA    1 
ATOM   6850  C  C     . LYS D 4  797  ? -6.069  -28.433  76.019  1.00 117.36 ? 797  LYS A C     1 
ATOM   6851  O  O     . LYS D 4  797  ? -4.963  -28.696  75.514  1.00 117.26 ? 797  LYS A O     1 
ATOM   6852  C  CB    . LYS D 4  797  ? -5.686  -28.242  78.523  1.00 117.87 ? 797  LYS A CB    1 
ATOM   6853  C  CG    . LYS D 4  797  ? -5.195  -27.303  79.667  1.00 118.34 ? 797  LYS A CG    1 
ATOM   6854  C  CD    . LYS D 4  797  ? -3.664  -27.332  79.865  1.00 119.01 ? 797  LYS A CD    1 
ATOM   6855  C  CE    . LYS D 4  797  ? -2.873  -27.195  78.550  1.00 119.12 ? 797  LYS A CE    1 
ATOM   6856  N  NZ    . LYS D 4  797  ? -1.392  -27.192  78.760  1.00 119.61 ? 797  LYS A NZ    1 
ATOM   6857  N  N     . GLY D 4  798  ? -7.212  -28.922  75.560  1.00 117.01 ? 798  GLY A N     1 
ATOM   6858  C  CA    . GLY D 4  798  ? -7.292  -29.332  74.181  1.00 117.02 ? 798  GLY A CA    1 
ATOM   6859  C  C     . GLY D 4  798  ? -7.877  -30.680  73.898  1.00 116.84 ? 798  GLY A C     1 
ATOM   6860  O  O     . GLY D 4  798  ? -7.471  -31.333  72.896  1.00 117.00 ? 798  GLY A O     1 
ATOM   6861  N  N     . PHE D 4  799  ? -8.814  -31.092  74.764  1.00 115.87 ? 799  PHE A N     1 
ATOM   6862  C  CA    . PHE D 4  799  ? -9.583  -32.317  74.553  1.00 115.18 ? 799  PHE A CA    1 
ATOM   6863  C  C     . PHE D 4  799  ? -10.691 -32.022  73.550  1.00 114.88 ? 799  PHE A C     1 
ATOM   6864  O  O     . PHE D 4  799  ? -11.205 -30.900  73.521  1.00 114.80 ? 799  PHE A O     1 
ATOM   6865  C  CB    . PHE D 4  799  ? -10.142 -32.827  75.877  1.00 115.19 ? 799  PHE A CB    1 
ATOM   6866  C  CG    . PHE D 4  799  ? -10.965 -34.098  75.767  1.00 115.50 ? 799  PHE A CG    1 
ATOM   6867  C  CD1   . PHE D 4  799  ? -10.345 -35.345  75.620  1.00 115.29 ? 799  PHE A CD1   1 
ATOM   6868  C  CD2   . PHE D 4  799  ? -12.361 -34.050  75.862  1.00 115.66 ? 799  PHE A CD2   1 
ATOM   6869  C  CE1   . PHE D 4  799  ? -11.096 -36.518  75.533  1.00 114.03 ? 799  PHE A CE1   1 
ATOM   6870  C  CE2   . PHE D 4  799  ? -13.114 -35.213  75.781  1.00 115.53 ? 799  PHE A CE2   1 
ATOM   6871  C  CZ    . PHE D 4  799  ? -12.473 -36.452  75.609  1.00 115.18 ? 799  PHE A CZ    1 
ATOM   6872  N  N     . VAL D 4  800  ? -11.010 -33.011  72.703  1.00 114.61 ? 800  VAL A N     1 
ATOM   6873  C  CA    . VAL D 4  800  ? -12.068 -32.905  71.684  1.00 114.25 ? 800  VAL A CA    1 
ATOM   6874  C  C     . VAL D 4  800  ? -13.215 -33.840  72.019  1.00 114.08 ? 800  VAL A C     1 
ATOM   6875  O  O     . VAL D 4  800  ? -13.356 -34.915  71.438  1.00 113.76 ? 800  VAL A O     1 
ATOM   6876  C  CB    . VAL D 4  800  ? -11.596 -33.293  70.286  1.00 114.39 ? 800  VAL A CB    1 
ATOM   6877  C  CG1   . VAL D 4  800  ? -12.654 -32.914  69.260  1.00 115.17 ? 800  VAL A CG1   1 
ATOM   6878  C  CG2   . VAL D 4  800  ? -10.239 -32.668  69.944  1.00 114.76 ? 800  VAL A CG2   1 
ATOM   6879  N  N     . GLU D 4  801  ? -13.999 -33.413  72.999  1.00 114.14 ? 801  GLU A N     1 
ATOM   6880  C  CA    . GLU D 4  801  ? -15.289 -33.971  73.366  1.00 113.96 ? 801  GLU A CA    1 
ATOM   6881  C  C     . GLU D 4  801  ? -16.033 -34.770  72.291  1.00 112.74 ? 801  GLU A C     1 
ATOM   6882  O  O     . GLU D 4  801  ? -16.730 -35.739  72.608  1.00 112.44 ? 801  GLU A O     1 
ATOM   6883  C  CB    . GLU D 4  801  ? -16.172 -32.797  73.794  1.00 114.87 ? 801  GLU A CB    1 
ATOM   6884  C  CG    . GLU D 4  801  ? -16.426 -32.704  75.282  1.00 118.29 ? 801  GLU A CG    1 
ATOM   6885  C  CD    . GLU D 4  801  ? -17.543 -33.656  75.749  1.00 122.69 ? 801  GLU A CD    1 
ATOM   6886  O  OE1   . GLU D 4  801  ? -17.842 -34.654  75.029  1.00 123.14 ? 801  GLU A OE1   1 
ATOM   6887  O  OE2   . GLU D 4  801  ? -18.122 -33.400  76.843  1.00 125.58 ? 801  GLU A OE2   1 
ATOM   6888  N  N     . ASN D 4  802  ? -15.878 -34.357  71.028  1.00 111.46 ? 802  ASN A N     1 
ATOM   6889  C  CA    . ASN D 4  802  ? -16.740 -34.823  69.924  1.00 110.00 ? 802  ASN A CA    1 
ATOM   6890  C  C     . ASN D 4  802  ? -16.218 -35.878  68.962  1.00 108.21 ? 802  ASN A C     1 
ATOM   6891  O  O     . ASN D 4  802  ? -15.021 -36.120  68.875  1.00 107.84 ? 802  ASN A O     1 
ATOM   6892  C  CB    . ASN D 4  802  ? -17.257 -33.628  69.135  1.00 110.29 ? 802  ASN A CB    1 
ATOM   6893  C  CG    . ASN D 4  802  ? -18.333 -32.905  69.875  1.00 111.33 ? 802  ASN A CG    1 
ATOM   6894  O  OD1   . ASN D 4  802  ? -19.380 -33.501  70.202  1.00 113.40 ? 802  ASN A OD1   1 
ATOM   6895  N  ND2   . ASN D 4  802  ? -18.077 -31.632  70.209  1.00 110.36 ? 802  ASN A ND2   1 
ATOM   6896  N  N     . SER D 4  803  ? -17.156 -36.484  68.243  1.00 106.23 ? 803  SER A N     1 
ATOM   6897  C  CA    . SER D 4  803  ? -16.866 -37.482  67.210  1.00 104.28 ? 803  SER A CA    1 
ATOM   6898  C  C     . SER D 4  803  ? -16.629 -36.829  65.821  1.00 102.89 ? 803  SER A C     1 
ATOM   6899  O  O     . SER D 4  803  ? -16.623 -35.617  65.711  1.00 102.63 ? 803  SER A O     1 
ATOM   6900  C  CB    . SER D 4  803  ? -18.017 -38.514  67.193  1.00 104.88 ? 803  SER A CB    1 
ATOM   6901  O  OG    . SER D 4  803  ? -19.279 -37.971  67.552  1.00 101.70 ? 803  SER A OG    1 
ATOM   6902  N  N     . TYR D 4  804  ? -16.438 -37.570  64.749  1.00 100.99 ? 804  TYR A N     1 
ATOM   6903  C  CA    . TYR D 4  804  ? -16.354 -36.815  63.508  1.00 100.59 ? 804  TYR A CA    1 
ATOM   6904  C  C     . TYR D 4  804  ? -17.686 -36.609  62.843  1.00 99.67  ? 804  TYR A C     1 
ATOM   6905  O  O     . TYR D 4  804  ? -17.987 -35.540  62.330  1.00 99.00  ? 804  TYR A O     1 
ATOM   6906  C  CB    . TYR D 4  804  ? -15.420 -37.456  62.505  1.00 101.92 ? 804  TYR A CB    1 
ATOM   6907  C  CG    . TYR D 4  804  ? -13.963 -37.266  62.732  1.00 101.19 ? 804  TYR A CG    1 
ATOM   6908  C  CD1   . TYR D 4  804  ? -13.226 -38.246  63.382  1.00 102.11 ? 804  TYR A CD1   1 
ATOM   6909  C  CD2   . TYR D 4  804  ? -13.320 -36.137  62.264  1.00 101.03 ? 804  TYR A CD2   1 
ATOM   6910  C  CE1   . TYR D 4  804  ? -11.859 -38.110  63.565  1.00 106.10 ? 804  TYR A CE1   1 
ATOM   6911  C  CE2   . TYR D 4  804  ? -11.931 -35.958  62.450  1.00 104.27 ? 804  TYR A CE2   1 
ATOM   6912  C  CZ    . TYR D 4  804  ? -11.181 -36.960  63.085  1.00 105.12 ? 804  TYR A CZ    1 
ATOM   6913  O  OH    . TYR D 4  804  ? -9.795  -36.847  63.266  1.00 101.95 ? 804  TYR A OH    1 
ATOM   6914  N  N     . LEU D 4  805  ? -18.438 -37.690  62.777  1.00 99.35  ? 805  LEU A N     1 
ATOM   6915  C  CA    . LEU D 4  805  ? -19.913 -37.632  62.689  1.00 99.77  ? 805  LEU A CA    1 
ATOM   6916  C  C     . LEU D 4  805  ? -20.660 -36.649  63.676  1.00 98.69  ? 805  LEU A C     1 
ATOM   6917  O  O     . LEU D 4  805  ? -21.659 -36.016  63.307  1.00 98.58  ? 805  LEU A O     1 
ATOM   6918  C  CB    . LEU D 4  805  ? -20.479 -39.041  62.852  1.00 100.13 ? 805  LEU A CB    1 
ATOM   6919  C  CG    . LEU D 4  805  ? -21.927 -39.170  62.430  1.00 101.84 ? 805  LEU A CG    1 
ATOM   6920  C  CD1   . LEU D 4  805  ? -22.069 -40.280  61.293  1.00 101.51 ? 805  LEU A CD1   1 
ATOM   6921  C  CD2   . LEU D 4  805  ? -22.856 -39.302  63.724  1.00 103.20 ? 805  LEU A CD2   1 
ATOM   6922  N  N     . ARG D 4  806  ? -20.195 -36.515  64.906  1.00 97.11  ? 806  ARG A N     1 
ATOM   6923  C  CA    . ARG D 4  806  ? -20.715 -35.436  65.693  1.00 96.77  ? 806  ARG A CA    1 
ATOM   6924  C  C     . ARG D 4  806  ? -20.545 -34.038  65.109  1.00 95.76  ? 806  ARG A C     1 
ATOM   6925  O  O     . ARG D 4  806  ? -21.449 -33.205  65.306  1.00 95.85  ? 806  ARG A O     1 
ATOM   6926  C  CB    . ARG D 4  806  ? -20.187 -35.457  67.130  1.00 97.46  ? 806  ARG A CB    1 
ATOM   6927  C  CG    . ARG D 4  806  ? -21.307 -35.074  68.178  1.00 100.75 ? 806  ARG A CG    1 
ATOM   6928  C  CD    . ARG D 4  806  ? -22.609 -35.967  68.061  1.00 101.76 ? 806  ARG A CD    1 
ATOM   6929  N  NE    . ARG D 4  806  ? -23.154 -36.281  69.369  1.00 105.17 ? 806  ARG A NE    1 
ATOM   6930  C  CZ    . ARG D 4  806  ? -22.443 -36.688  70.427  1.00 108.92 ? 806  ARG A CZ    1 
ATOM   6931  N  NH1   . ARG D 4  806  ? -21.118 -36.822  70.332  1.00 109.72 ? 806  ARG A NH1   1 
ATOM   6932  N  NH2   . ARG D 4  806  ? -23.057 -36.930  71.609  1.00 110.69 ? 806  ARG A NH2   1 
ATOM   6933  N  N     . GLY D 4  807  ? -19.422 -33.787  64.412  1.00 94.73  ? 807  GLY A N     1 
ATOM   6934  C  CA    . GLY D 4  807  ? -18.918 -32.420  64.129  1.00 93.68  ? 807  GLY A CA    1 
ATOM   6935  C  C     . GLY D 4  807  ? -17.924 -31.993  65.203  1.00 93.96  ? 807  GLY A C     1 
ATOM   6936  O  O     . GLY D 4  807  ? -17.775 -32.664  66.220  1.00 94.39  ? 807  GLY A O     1 
ATOM   6937  N  N     . LEU D 4  808  ? -17.221 -30.883  65.004  1.00 94.28  ? 808  LEU A N     1 
ATOM   6938  C  CA    . LEU D 4  808  ? -16.140 -30.443  65.959  1.00 94.34  ? 808  LEU A CA    1 
ATOM   6939  C  C     . LEU D 4  808  ? -16.415 -28.990  66.362  1.00 93.80  ? 808  LEU A C     1 
ATOM   6940  O  O     . LEU D 4  808  ? -17.113 -28.289  65.627  1.00 94.94  ? 808  LEU A O     1 
ATOM   6941  C  CB    . LEU D 4  808  ? -14.760 -30.522  65.283  1.00 94.81  ? 808  LEU A CB    1 
ATOM   6942  C  CG    . LEU D 4  808  ? -13.879 -31.753  65.516  1.00 95.14  ? 808  LEU A CG    1 
ATOM   6943  C  CD1   . LEU D 4  808  ? -14.437 -32.936  64.786  1.00 95.55  ? 808  LEU A CD1   1 
ATOM   6944  C  CD2   . LEU D 4  808  ? -12.428 -31.508  65.085  1.00 94.17  ? 808  LEU A CD2   1 
ATOM   6945  N  N     . THR D 4  809  ? -15.936 -28.498  67.490  1.00 92.09  ? 809  THR A N     1 
ATOM   6946  C  CA    . THR D 4  809  ? -16.225 -27.085  67.708  1.00 90.49  ? 809  THR A CA    1 
ATOM   6947  C  C     . THR D 4  809  ? -15.119 -26.251  67.091  1.00 89.38  ? 809  THR A C     1 
ATOM   6948  O  O     . THR D 4  809  ? -14.081 -26.805  66.712  1.00 88.97  ? 809  THR A O     1 
ATOM   6949  C  CB    . THR D 4  809  ? -16.502 -26.727  69.166  1.00 90.68  ? 809  THR A CB    1 
ATOM   6950  O  OG1   . THR D 4  809  ? -16.307 -27.890  69.982  1.00 90.45  ? 809  THR A OG1   1 
ATOM   6951  C  CG2   . THR D 4  809  ? -17.952 -26.215  69.313  1.00 90.06  ? 809  THR A CG2   1 
ATOM   6952  N  N     . PRO D 4  810  ? -15.372 -24.940  66.917  1.00 88.11  ? 810  PRO A N     1 
ATOM   6953  C  CA    . PRO D 4  810  ? -14.361 -23.959  66.553  1.00 87.36  ? 810  PRO A CA    1 
ATOM   6954  C  C     . PRO D 4  810  ? -13.046 -24.206  67.294  1.00 87.00  ? 810  PRO A C     1 
ATOM   6955  O  O     . PRO D 4  810  ? -12.077 -24.614  66.672  1.00 87.15  ? 810  PRO A O     1 
ATOM   6956  C  CB    . PRO D 4  810  ? -14.984 -22.646  66.996  1.00 87.26  ? 810  PRO A CB    1 
ATOM   6957  C  CG    . PRO D 4  810  ? -16.362 -23.007  67.543  1.00 87.34  ? 810  PRO A CG    1 
ATOM   6958  C  CD    . PRO D 4  810  ? -16.696 -24.320  67.024  1.00 87.68  ? 810  PRO A CD    1 
ATOM   6959  N  N     . GLN D 4  811  ? -13.000 -24.013  68.610  1.00 86.44  ? 811  GLN A N     1 
ATOM   6960  C  CA    . GLN D 4  811  ? -11.742 -24.259  69.317  1.00 85.91  ? 811  GLN A CA    1 
ATOM   6961  C  C     . GLN D 4  811  ? -11.259 -25.676  69.054  1.00 86.32  ? 811  GLN A C     1 
ATOM   6962  O  O     . GLN D 4  811  ? -10.116 -25.888  68.645  1.00 86.40  ? 811  GLN A O     1 
ATOM   6963  C  CB    . GLN D 4  811  ? -11.854 -24.049  70.822  1.00 85.59  ? 811  GLN A CB    1 
ATOM   6964  C  CG    . GLN D 4  811  ? -12.599 -22.835  71.257  1.00 83.58  ? 811  GLN A CG    1 
ATOM   6965  C  CD    . GLN D 4  811  ? -13.916 -23.208  71.804  1.00 81.36  ? 811  GLN A CD    1 
ATOM   6966  O  OE1   . GLN D 4  811  ? -14.819 -22.372  71.919  1.00 80.86  ? 811  GLN A OE1   1 
ATOM   6967  N  NE2   . GLN D 4  811  ? -14.057 -24.486  72.154  1.00 80.51  ? 811  GLN A NE2   1 
ATOM   6968  N  N     . GLU D 4  812  ? -12.145 -26.644  69.289  1.00 86.77  ? 812  GLU A N     1 
ATOM   6969  C  CA    . GLU D 4  812  ? -11.840 -28.065  69.090  1.00 87.10  ? 812  GLU A CA    1 
ATOM   6970  C  C     . GLU D 4  812  ? -11.186 -28.255  67.731  1.00 86.03  ? 812  GLU A C     1 
ATOM   6971  O  O     . GLU D 4  812  ? -10.211 -28.998  67.633  1.00 85.45  ? 812  GLU A O     1 
ATOM   6972  C  CB    . GLU D 4  812  ? -13.109 -28.932  69.200  1.00 87.25  ? 812  GLU A CB    1 
ATOM   6973  C  CG    . GLU D 4  812  ? -13.434 -29.512  70.596  1.00 88.67  ? 812  GLU A CG    1 
ATOM   6974  C  CD    . GLU D 4  812  ? -14.781 -30.271  70.624  1.00 89.58  ? 812  GLU A CD    1 
ATOM   6975  O  OE1   . GLU D 4  812  ? -15.553 -30.151  71.623  1.00 92.09  ? 812  GLU A OE1   1 
ATOM   6976  O  OE2   . GLU D 4  812  ? -15.079 -30.975  69.622  1.00 93.75  ? 812  GLU A OE2   1 
ATOM   6977  N  N     . PHE D 4  813  ? -11.722 -27.566  66.706  1.00 85.11  ? 813  PHE A N     1 
ATOM   6978  C  CA    . PHE D 4  813  ? -11.180 -27.630  65.356  1.00 84.29  ? 813  PHE A CA    1 
ATOM   6979  C  C     . PHE D 4  813  ? -9.773  -27.129  65.383  1.00 84.37  ? 813  PHE A C     1 
ATOM   6980  O  O     . PHE D 4  813  ? -8.860  -27.827  64.942  1.00 84.86  ? 813  PHE A O     1 
ATOM   6981  C  CB    . PHE D 4  813  ? -12.000 -26.833  64.345  1.00 83.89  ? 813  PHE A CB    1 
ATOM   6982  C  CG    . PHE D 4  813  ? -11.503 -26.941  62.914  1.00 83.20  ? 813  PHE A CG    1 
ATOM   6983  C  CD1   . PHE D 4  813  ? -10.799 -28.062  62.465  1.00 85.09  ? 813  PHE A CD1   1 
ATOM   6984  C  CD2   . PHE D 4  813  ? -11.776 -25.948  62.006  1.00 81.70  ? 813  PHE A CD2   1 
ATOM   6985  C  CE1   . PHE D 4  813  ? -10.342 -28.169  61.135  1.00 84.58  ? 813  PHE A CE1   1 
ATOM   6986  C  CE2   . PHE D 4  813  ? -11.336 -26.051  60.692  1.00 82.66  ? 813  PHE A CE2   1 
ATOM   6987  C  CZ    . PHE D 4  813  ? -10.618 -27.160  60.255  1.00 82.92  ? 813  PHE A CZ    1 
ATOM   6988  N  N     . PHE D 4  814  ? -9.573  -25.940  65.930  1.00 84.21  ? 814  PHE A N     1 
ATOM   6989  C  CA    . PHE D 4  814  ? -8.226  -25.403  65.942  1.00 84.26  ? 814  PHE A CA    1 
ATOM   6990  C  C     . PHE D 4  814  ? -7.252  -26.343  66.597  1.00 83.83  ? 814  PHE A C     1 
ATOM   6991  O  O     . PHE D 4  814  ? -6.264  -26.705  65.971  1.00 83.90  ? 814  PHE A O     1 
ATOM   6992  C  CB    . PHE D 4  814  ? -8.125  -24.015  66.560  1.00 84.81  ? 814  PHE A CB    1 
ATOM   6993  C  CG    . PHE D 4  814  ? -6.903  -23.250  66.118  1.00 85.64  ? 814  PHE A CG    1 
ATOM   6994  C  CD1   . PHE D 4  814  ? -6.404  -23.392  64.826  1.00 85.79  ? 814  PHE A CD1   1 
ATOM   6995  C  CD2   . PHE D 4  814  ? -6.265  -22.377  66.978  1.00 87.06  ? 814  PHE A CD2   1 
ATOM   6996  C  CE1   . PHE D 4  814  ? -5.301  -22.689  64.404  1.00 85.55  ? 814  PHE A CE1   1 
ATOM   6997  C  CE2   . PHE D 4  814  ? -5.151  -21.667  66.551  1.00 87.92  ? 814  PHE A CE2   1 
ATOM   6998  C  CZ    . PHE D 4  814  ? -4.673  -21.831  65.258  1.00 86.31  ? 814  PHE A CZ    1 
ATOM   6999  N  N     . PHE D 4  815  ? -7.523  -26.767  67.824  1.00 83.41  ? 815  PHE A N     1 
ATOM   7000  C  CA    . PHE D 4  815  ? -6.579  -27.657  68.480  1.00 83.58  ? 815  PHE A CA    1 
ATOM   7001  C  C     . PHE D 4  815  ? -6.258  -28.864  67.592  1.00 83.97  ? 815  PHE A C     1 
ATOM   7002  O  O     . PHE D 4  815  ? -5.106  -29.290  67.493  1.00 83.80  ? 815  PHE A O     1 
ATOM   7003  C  CB    . PHE D 4  815  ? -7.066  -28.094  69.853  1.00 83.19  ? 815  PHE A CB    1 
ATOM   7004  C  CG    . PHE D 4  815  ? -7.400  -26.975  70.741  1.00 82.96  ? 815  PHE A CG    1 
ATOM   7005  C  CD1   . PHE D 4  815  ? -8.652  -26.900  71.337  1.00 83.47  ? 815  PHE A CD1   1 
ATOM   7006  C  CD2   . PHE D 4  815  ? -6.486  -25.968  70.975  1.00 83.43  ? 815  PHE A CD2   1 
ATOM   7007  C  CE1   . PHE D 4  815  ? -9.004  -25.832  72.186  1.00 82.85  ? 815  PHE A CE1   1 
ATOM   7008  C  CE2   . PHE D 4  815  ? -6.828  -24.893  71.819  1.00 84.74  ? 815  PHE A CE2   1 
ATOM   7009  C  CZ    . PHE D 4  815  ? -8.098  -24.833  72.429  1.00 82.79  ? 815  PHE A CZ    1 
ATOM   7010  N  N     . HIS D 4  816  ? -7.279  -29.395  66.929  1.00 84.66  ? 816  HIS A N     1 
ATOM   7011  C  CA    . HIS D 4  816  ? -7.072  -30.470  65.980  1.00 85.30  ? 816  HIS A CA    1 
ATOM   7012  C  C     . HIS D 4  816  ? -6.077  -29.960  64.966  1.00 85.90  ? 816  HIS A C     1 
ATOM   7013  O  O     . HIS D 4  816  ? -4.957  -30.500  64.844  1.00 85.67  ? 816  HIS A O     1 
ATOM   7014  C  CB    . HIS D 4  816  ? -8.373  -30.835  65.283  1.00 85.30  ? 816  HIS A CB    1 
ATOM   7015  C  CG    . HIS D 4  816  ? -8.387  -32.228  64.758  1.00 85.38  ? 816  HIS A CG    1 
ATOM   7016  N  ND1   . HIS D 4  816  ? -7.522  -33.198  65.214  1.00 85.47  ? 816  HIS A ND1   1 
ATOM   7017  C  CD2   . HIS D 4  816  ? -9.178  -32.829  63.840  1.00 86.11  ? 816  HIS A CD2   1 
ATOM   7018  C  CE1   . HIS D 4  816  ? -7.764  -34.334  64.588  1.00 85.83  ? 816  HIS A CE1   1 
ATOM   7019  N  NE2   . HIS D 4  816  ? -8.764  -34.137  63.747  1.00 86.32  ? 816  HIS A NE2   1 
ATOM   7020  N  N     . ALA D 4  817  ? -6.485  -28.897  64.267  1.00 86.24  ? 817  ALA A N     1 
ATOM   7021  C  CA    . ALA D 4  817  ? -5.588  -28.152  63.413  1.00 86.80  ? 817  ALA A CA    1 
ATOM   7022  C  C     . ALA D 4  817  ? -4.145  -28.291  63.902  1.00 87.47  ? 817  ALA A C     1 
ATOM   7023  O  O     . ALA D 4  817  ? -3.284  -28.715  63.135  1.00 87.64  ? 817  ALA A O     1 
ATOM   7024  C  CB    . ALA D 4  817  ? -5.997  -26.709  63.363  1.00 86.35  ? 817  ALA A CB    1 
ATOM   7025  N  N     . MET D 4  818  ? -3.901  -27.994  65.182  1.00 88.22  ? 818  MET A N     1 
ATOM   7026  C  CA    . MET D 4  818  ? -2.539  -27.929  65.735  1.00 89.41  ? 818  MET A CA    1 
ATOM   7027  C  C     . MET D 4  818  ? -1.798  -29.254  65.830  1.00 90.10  ? 818  MET A C     1 
ATOM   7028  O  O     . MET D 4  818  ? -0.588  -29.327  65.575  1.00 89.90  ? 818  MET A O     1 
ATOM   7029  C  CB    . MET D 4  818  ? -2.554  -27.278  67.100  1.00 88.85  ? 818  MET A CB    1 
ATOM   7030  C  CG    . MET D 4  818  ? -2.806  -25.802  67.049  1.00 89.70  ? 818  MET A CG    1 
ATOM   7031  S  SD    . MET D 4  818  ? -2.818  -25.135  68.712  1.00 90.47  ? 818  MET A SD    1 
ATOM   7032  C  CE    . MET D 4  818  ? -1.342  -25.974  69.354  1.00 89.79  ? 818  MET A CE    1 
ATOM   7033  N  N     . GLY D 4  819  ? -2.514  -30.297  66.227  1.00 91.23  ? 819  GLY A N     1 
ATOM   7034  C  CA    . GLY D 4  819  ? -1.930  -31.633  66.260  1.00 92.88  ? 819  GLY A CA    1 
ATOM   7035  C  C     . GLY D 4  819  ? -1.703  -32.077  64.828  1.00 94.02  ? 819  GLY A C     1 
ATOM   7036  O  O     . GLY D 4  819  ? -0.786  -32.857  64.524  1.00 93.81  ? 819  GLY A O     1 
ATOM   7037  N  N     . GLY D 4  820  ? -2.552  -31.549  63.947  1.00 95.04  ? 820  GLY A N     1 
ATOM   7038  C  CA    . GLY D 4  820  ? -2.484  -31.847  62.526  1.00 95.82  ? 820  GLY A CA    1 
ATOM   7039  C  C     . GLY D 4  820  ? -1.104  -31.549  62.021  1.00 96.08  ? 820  GLY A C     1 
ATOM   7040  O  O     . GLY D 4  820  ? -0.337  -32.464  61.762  1.00 95.44  ? 820  GLY A O     1 
ATOM   7041  N  N     . ARG D 4  821  ? -0.793  -30.260  61.933  1.00 97.14  ? 821  ARG A N     1 
ATOM   7042  C  CA    . ARG D 4  821  ? 0.436   -29.820  61.318  1.00 98.59  ? 821  ARG A CA    1 
ATOM   7043  C  C     . ARG D 4  821  ? 1.566   -30.620  61.901  1.00 100.16 ? 821  ARG A C     1 
ATOM   7044  O  O     . ARG D 4  821  ? 2.381   -31.152  61.151  1.00 100.87 ? 821  ARG A O     1 
ATOM   7045  C  CB    . ARG D 4  821  ? 0.696   -28.335  61.522  1.00 98.15  ? 821  ARG A CB    1 
ATOM   7046  C  CG    . ARG D 4  821  ? 1.454   -27.715  60.379  1.00 97.29  ? 821  ARG A CG    1 
ATOM   7047  C  CD    . ARG D 4  821  ? 0.611   -26.709  59.629  1.00 96.03  ? 821  ARG A CD    1 
ATOM   7048  N  NE    . ARG D 4  821  ? 0.830   -25.386  60.191  1.00 96.53  ? 821  ARG A NE    1 
ATOM   7049  C  CZ    . ARG D 4  821  ? 0.235   -24.278  59.769  1.00 98.21  ? 821  ARG A CZ    1 
ATOM   7050  N  NH1   . ARG D 4  821  ? -0.630  -24.334  58.771  1.00 99.02  ? 821  ARG A NH1   1 
ATOM   7051  N  NH2   . ARG D 4  821  ? 0.507   -23.106  60.344  1.00 99.16  ? 821  ARG A NH2   1 
ATOM   7052  N  N     . GLU D 4  822  ? 1.602   -30.768  63.225  1.00 101.76 ? 822  GLU A N     1 
ATOM   7053  C  CA    . GLU D 4  822  ? 2.762   -31.422  63.846  1.00 103.21 ? 822  GLU A CA    1 
ATOM   7054  C  C     . GLU D 4  822  ? 3.164   -32.697  63.123  1.00 103.74 ? 822  GLU A C     1 
ATOM   7055  O  O     . GLU D 4  822  ? 4.328   -32.873  62.773  1.00 103.52 ? 822  GLU A O     1 
ATOM   7056  C  CB    . GLU D 4  822  ? 2.563   -31.699  65.324  1.00 103.27 ? 822  GLU A CB    1 
ATOM   7057  C  CG    . GLU D 4  822  ? 3.815   -32.247  65.926  1.00 104.45 ? 822  GLU A CG    1 
ATOM   7058  C  CD    . GLU D 4  822  ? 3.621   -32.697  67.338  1.00 107.01 ? 822  GLU A CD    1 
ATOM   7059  O  OE1   . GLU D 4  822  ? 4.241   -32.066  68.213  1.00 109.46 ? 822  GLU A OE1   1 
ATOM   7060  O  OE2   . GLU D 4  822  ? 2.861   -33.666  67.582  1.00 106.73 ? 822  GLU A OE2   1 
ATOM   7061  N  N     . GLY D 4  823  ? 2.181   -33.558  62.892  1.00 104.95 ? 823  GLY A N     1 
ATOM   7062  C  CA    . GLY D 4  823  ? 2.353   -34.746  62.066  1.00 106.69 ? 823  GLY A CA    1 
ATOM   7063  C  C     . GLY D 4  823  ? 2.914   -34.431  60.693  1.00 107.89 ? 823  GLY A C     1 
ATOM   7064  O  O     . GLY D 4  823  ? 4.037   -34.832  60.373  1.00 108.00 ? 823  GLY A O     1 
ATOM   7065  N  N     . LEU D 4  824  ? 2.142   -33.706  59.889  1.00 109.13 ? 824  LEU A N     1 
ATOM   7066  C  CA    . LEU D 4  824  ? 2.578   -33.296  58.565  1.00 110.88 ? 824  LEU A CA    1 
ATOM   7067  C  C     . LEU D 4  824  ? 4.020   -32.803  58.561  1.00 112.46 ? 824  LEU A C     1 
ATOM   7068  O  O     . LEU D 4  824  ? 4.743   -33.059  57.586  1.00 112.81 ? 824  LEU A O     1 
ATOM   7069  C  CB    . LEU D 4  824  ? 1.661   -32.216  57.997  1.00 110.67 ? 824  LEU A CB    1 
ATOM   7070  C  CG    . LEU D 4  824  ? 0.204   -32.629  57.808  1.00 110.97 ? 824  LEU A CG    1 
ATOM   7071  C  CD1   . LEU D 4  824  ? -0.652  -31.413  57.413  1.00 109.84 ? 824  LEU A CD1   1 
ATOM   7072  C  CD2   . LEU D 4  824  ? 0.069   -33.816  56.809  1.00 110.65 ? 824  LEU A CD2   1 
ATOM   7073  N  N     . ILE D 4  825  ? 4.432   -32.111  59.640  1.00 114.26 ? 825  ILE A N     1 
ATOM   7074  C  CA    . ILE D 4  825  ? 5.814   -31.625  59.795  1.00 115.87 ? 825  ILE A CA    1 
ATOM   7075  C  C     . ILE D 4  825  ? 6.771   -32.802  59.777  1.00 117.91 ? 825  ILE A C     1 
ATOM   7076  O  O     . ILE D 4  825  ? 7.512   -32.997  58.810  1.00 118.61 ? 825  ILE A O     1 
ATOM   7077  C  CB    . ILE D 4  825  ? 6.078   -30.876  61.109  1.00 115.19 ? 825  ILE A CB    1 
ATOM   7078  C  CG1   . ILE D 4  825  ? 5.165   -29.672  61.280  1.00 115.25 ? 825  ILE A CG1   1 
ATOM   7079  C  CG2   . ILE D 4  825  ? 7.523   -30.454  61.170  1.00 115.16 ? 825  ILE A CG2   1 
ATOM   7080  C  CD1   . ILE D 4  825  ? 5.350   -28.577  60.281  1.00 115.67 ? 825  ILE A CD1   1 
ATOM   7081  N  N     . ASP D 4  826  ? 6.751   -33.602  60.838  1.00 119.82 ? 826  ASP A N     1 
ATOM   7082  C  CA    . ASP D 4  826  ? 7.754   -34.649  60.964  1.00 121.70 ? 826  ASP A CA    1 
ATOM   7083  C  C     . ASP D 4  826  ? 7.644   -35.735  59.906  1.00 122.60 ? 826  ASP A C     1 
ATOM   7084  O  O     . ASP D 4  826  ? 8.616   -36.444  59.681  1.00 122.80 ? 826  ASP A O     1 
ATOM   7085  C  CB    . ASP D 4  826  ? 7.796   -35.234  62.374  1.00 122.07 ? 826  ASP A CB    1 
ATOM   7086  C  CG    . ASP D 4  826  ? 6.457   -35.193  63.051  1.00 123.53 ? 826  ASP A CG    1 
ATOM   7087  O  OD1   . ASP D 4  826  ? 6.252   -34.304  63.913  1.00 125.31 ? 826  ASP A OD1   1 
ATOM   7088  O  OD2   . ASP D 4  826  ? 5.607   -36.033  62.696  1.00 125.64 ? 826  ASP A OD2   1 
ATOM   7089  N  N     . THR D 4  827  ? 6.490   -35.863  59.246  1.00 123.73 ? 827  THR A N     1 
ATOM   7090  C  CA    . THR D 4  827  ? 6.428   -36.748  58.078  1.00 124.85 ? 827  THR A CA    1 
ATOM   7091  C  C     . THR D 4  827  ? 7.368   -36.191  57.019  1.00 125.25 ? 827  THR A C     1 
ATOM   7092  O  O     . THR D 4  827  ? 8.077   -36.954  56.372  1.00 125.53 ? 827  THR A O     1 
ATOM   7093  C  CB    . THR D 4  827  ? 4.996   -36.991  57.511  1.00 124.92 ? 827  THR A CB    1 
ATOM   7094  O  OG1   . THR D 4  827  ? 4.146   -37.488  58.550  1.00 125.24 ? 827  THR A OG1   1 
ATOM   7095  C  CG2   . THR D 4  827  ? 5.029   -38.037  56.382  1.00 125.00 ? 827  THR A CG2   1 
ATOM   7096  N  N     . ALA D 4  828  ? 7.403   -34.867  56.875  1.00 125.76 ? 828  ALA A N     1 
ATOM   7097  C  CA    . ALA D 4  828  ? 8.386   -34.233  55.994  1.00 126.57 ? 828  ALA A CA    1 
ATOM   7098  C  C     . ALA D 4  828  ? 9.810   -34.407  56.520  1.00 127.01 ? 828  ALA A C     1 
ATOM   7099  O  O     . ALA D 4  828  ? 10.730  -34.651  55.746  1.00 127.21 ? 828  ALA A O     1 
ATOM   7100  C  CB    . ALA D 4  828  ? 8.072   -32.764  55.793  1.00 126.47 ? 828  ALA A CB    1 
ATOM   7101  N  N     . VAL D 4  829  ? 9.976   -34.297  57.834  1.00 127.54 ? 829  VAL A N     1 
ATOM   7102  C  CA    . VAL D 4  829  ? 11.290  -34.401  58.477  1.00 128.15 ? 829  VAL A CA    1 
ATOM   7103  C  C     . VAL D 4  829  ? 11.826  -35.857  58.552  1.00 128.68 ? 829  VAL A C     1 
ATOM   7104  O  O     . VAL D 4  829  ? 12.992  -36.125  58.250  1.00 128.23 ? 829  VAL A O     1 
ATOM   7105  C  CB    . VAL D 4  829  ? 11.254  -33.689  59.857  1.00 128.05 ? 829  VAL A CB    1 
ATOM   7106  C  CG1   . VAL D 4  829  ? 12.353  -34.191  60.795  1.00 127.90 ? 829  VAL A CG1   1 
ATOM   7107  C  CG2   . VAL D 4  829  ? 11.323  -32.176  59.658  1.00 127.80 ? 829  VAL A CG2   1 
ATOM   7108  N  N     . LYS D 4  830  ? 10.958  -36.785  58.943  1.00 129.62 ? 830  LYS A N     1 
ATOM   7109  C  CA    . LYS D 4  830  ? 11.274  -38.223  58.955  1.00 130.44 ? 830  LYS A CA    1 
ATOM   7110  C  C     . LYS D 4  830  ? 11.803  -38.721  57.614  1.00 130.35 ? 830  LYS A C     1 
ATOM   7111  O  O     . LYS D 4  830  ? 12.922  -39.228  57.555  1.00 130.85 ? 830  LYS A O     1 
ATOM   7112  C  CB    . LYS D 4  830  ? 10.044  -39.063  59.371  1.00 130.63 ? 830  LYS A CB    1 
ATOM   7113  C  CG    . LYS D 4  830  ? 10.003  -40.533  58.840  1.00 131.07 ? 830  LYS A CG    1 
ATOM   7114  C  CD    . LYS D 4  830  ? 8.993   -41.385  59.606  1.00 131.11 ? 830  LYS A CD    1 
ATOM   7115  C  CE    . LYS D 4  830  ? 9.461   -41.640  61.065  1.00 132.43 ? 830  LYS A CE    1 
ATOM   7116  N  NZ    . LYS D 4  830  ? 9.674   -40.410  61.930  1.00 131.58 ? 830  LYS A NZ    1 
ATOM   7117  N  N     . THR D 4  831  ? 11.007  -38.585  56.548  1.00 129.83 ? 831  THR A N     1 
ATOM   7118  C  CA    . THR D 4  831  ? 11.350  -39.236  55.291  1.00 129.24 ? 831  THR A CA    1 
ATOM   7119  C  C     . THR D 4  831  ? 12.671  -38.671  54.764  1.00 128.82 ? 831  THR A C     1 
ATOM   7120  O  O     . THR D 4  831  ? 13.416  -39.362  54.077  1.00 128.80 ? 831  THR A O     1 
ATOM   7121  C  CB    . THR D 4  831  ? 10.195  -39.226  54.235  1.00 129.35 ? 831  THR A CB    1 
ATOM   7122  O  OG1   . THR D 4  831  ? 9.508   -37.975  54.294  1.00 129.56 ? 831  THR A OG1   1 
ATOM   7123  C  CG2   . THR D 4  831  ? 9.182   -40.420  54.446  1.00 128.98 ? 831  THR A CG2   1 
ATOM   7124  N  N     . ALA D 4  832  ? 12.993  -37.440  55.143  1.00 128.30 ? 832  ALA A N     1 
ATOM   7125  C  CA    . ALA D 4  832  ? 14.303  -36.893  54.823  1.00 127.81 ? 832  ALA A CA    1 
ATOM   7126  C  C     . ALA D 4  832  ? 15.376  -37.515  55.686  1.00 127.49 ? 832  ALA A C     1 
ATOM   7127  O  O     . ALA D 4  832  ? 16.351  -38.022  55.166  1.00 127.45 ? 832  ALA A O     1 
ATOM   7128  C  CB    . ALA D 4  832  ? 14.309  -35.417  54.990  1.00 128.18 ? 832  ALA A CB    1 
ATOM   7129  N  N     . GLU D 4  833  ? 15.182  -37.474  57.002  1.00 127.34 ? 833  GLU A N     1 
ATOM   7130  C  CA    . GLU D 4  833  ? 16.140  -38.026  57.982  1.00 127.59 ? 833  GLU A CA    1 
ATOM   7131  C  C     . GLU D 4  833  ? 16.482  -39.502  57.700  1.00 126.22 ? 833  GLU A C     1 
ATOM   7132  O  O     . GLU D 4  833  ? 17.650  -39.855  57.485  1.00 126.43 ? 833  GLU A O     1 
ATOM   7133  C  CB    . GLU D 4  833  ? 15.581  -37.866  59.405  1.00 127.50 ? 833  GLU A CB    1 
ATOM   7134  C  CG    . GLU D 4  833  ? 16.601  -37.484  60.488  1.00 129.34 ? 833  GLU A CG    1 
ATOM   7135  C  CD    . GLU D 4  833  ? 15.950  -36.767  61.709  1.00 130.19 ? 833  GLU A CD    1 
ATOM   7136  O  OE1   . GLU D 4  833  ? 14.745  -37.021  61.993  1.00 132.87 ? 833  GLU A OE1   1 
ATOM   7137  O  OE2   . GLU D 4  833  ? 16.643  -35.948  62.385  1.00 133.42 ? 833  GLU A OE2   1 
ATOM   7138  N  N     . THR D 4  834  ? 15.450  -40.345  57.676  1.00 124.69 ? 834  THR A N     1 
ATOM   7139  C  CA    . THR D 4  834  ? 15.606  -41.762  57.403  1.00 122.95 ? 834  THR A CA    1 
ATOM   7140  C  C     . THR D 4  834  ? 16.144  -41.972  56.004  1.00 122.30 ? 834  THR A C     1 
ATOM   7141  O  O     . THR D 4  834  ? 16.759  -42.980  55.723  1.00 122.25 ? 834  THR A O     1 
ATOM   7142  C  CB    . THR D 4  834  ? 14.283  -42.535  57.552  1.00 122.77 ? 834  THR A CB    1 
ATOM   7143  O  OG1   . THR D 4  834  ? 13.655  -42.685  56.276  1.00 122.30 ? 834  THR A OG1   1 
ATOM   7144  C  CG2   . THR D 4  834  ? 13.342  -41.835  58.521  1.00 122.12 ? 834  THR A CG2   1 
ATOM   7145  N  N     . GLY D 4  835  ? 15.921  -41.012  55.122  1.00 121.63 ? 835  GLY A N     1 
ATOM   7146  C  CA    . GLY D 4  835  ? 16.423  -41.127  53.756  1.00 121.06 ? 835  GLY A CA    1 
ATOM   7147  C  C     . GLY D 4  835  ? 17.931  -41.021  53.671  1.00 120.38 ? 835  GLY A C     1 
ATOM   7148  O  O     . GLY D 4  835  ? 18.545  -41.520  52.722  1.00 120.31 ? 835  GLY A O     1 
ATOM   7149  N  N     . TYR D 4  836  ? 18.513  -40.356  54.666  1.00 119.77 ? 836  TYR A N     1 
ATOM   7150  C  CA    . TYR D 4  836  ? 19.942  -40.182  54.752  1.00 119.25 ? 836  TYR A CA    1 
ATOM   7151  C  C     . TYR D 4  836  ? 20.575  -41.334  55.516  1.00 118.39 ? 836  TYR A C     1 
ATOM   7152  O  O     . TYR D 4  836  ? 21.666  -41.802  55.160  1.00 118.55 ? 836  TYR A O     1 
ATOM   7153  C  CB    . TYR D 4  836  ? 20.275  -38.869  55.430  1.00 119.76 ? 836  TYR A CB    1 
ATOM   7154  C  CG    . TYR D 4  836  ? 21.758  -38.672  55.643  1.00 121.05 ? 836  TYR A CG    1 
ATOM   7155  C  CD1   . TYR D 4  836  ? 22.685  -38.934  54.619  1.00 121.36 ? 836  TYR A CD1   1 
ATOM   7156  C  CD2   . TYR D 4  836  ? 22.238  -38.206  56.857  1.00 122.15 ? 836  TYR A CD2   1 
ATOM   7157  C  CE1   . TYR D 4  836  ? 24.043  -38.738  54.816  1.00 121.12 ? 836  TYR A CE1   1 
ATOM   7158  C  CE2   . TYR D 4  836  ? 23.591  -38.000  57.058  1.00 122.32 ? 836  TYR A CE2   1 
ATOM   7159  C  CZ    . TYR D 4  836  ? 24.485  -38.269  56.042  1.00 121.63 ? 836  TYR A CZ    1 
ATOM   7160  O  OH    . TYR D 4  836  ? 25.824  -38.071  56.284  1.00 122.52 ? 836  TYR A OH    1 
ATOM   7161  N  N     . ILE D 4  837  ? 19.886  -41.773  56.567  1.00 116.99 ? 837  ILE A N     1 
ATOM   7162  C  CA    . ILE D 4  837  ? 20.266  -42.950  57.350  1.00 115.54 ? 837  ILE A CA    1 
ATOM   7163  C  C     . ILE D 4  837  ? 20.600  -44.145  56.445  1.00 114.92 ? 837  ILE A C     1 
ATOM   7164  O  O     . ILE D 4  837  ? 21.692  -44.716  56.503  1.00 114.77 ? 837  ILE A O     1 
ATOM   7165  C  CB    . ILE D 4  837  ? 19.134  -43.295  58.352  1.00 115.17 ? 837  ILE A CB    1 
ATOM   7166  C  CG1   . ILE D 4  837  ? 19.178  -42.350  59.553  1.00 115.06 ? 837  ILE A CG1   1 
ATOM   7167  C  CG2   . ILE D 4  837  ? 19.204  -44.725  58.810  1.00 114.48 ? 837  ILE A CG2   1 
ATOM   7168  C  CD1   . ILE D 4  837  ? 20.584  -42.075  60.089  1.00 115.10 ? 837  ILE A CD1   1 
ATOM   7169  N  N     . GLN D 4  838  ? 19.645  -44.486  55.595  1.00 114.22 ? 838  GLN A N     1 
ATOM   7170  C  CA    . GLN D 4  838  ? 19.760  -45.557  54.625  1.00 113.53 ? 838  GLN A CA    1 
ATOM   7171  C  C     . GLN D 4  838  ? 20.970  -45.324  53.696  1.00 113.04 ? 838  GLN A C     1 
ATOM   7172  O  O     . GLN D 4  838  ? 21.808  -46.205  53.532  1.00 112.99 ? 838  GLN A O     1 
ATOM   7173  C  CB    . GLN D 4  838  ? 18.436  -45.649  53.852  1.00 113.57 ? 838  GLN A CB    1 
ATOM   7174  C  CG    . GLN D 4  838  ? 17.992  -47.026  53.486  1.00 113.69 ? 838  GLN A CG    1 
ATOM   7175  C  CD    . GLN D 4  838  ? 18.219  -47.344  52.017  1.00 115.16 ? 838  GLN A CD    1 
ATOM   7176  O  OE1   . GLN D 4  838  ? 19.122  -46.803  51.362  1.00 115.28 ? 838  GLN A OE1   1 
ATOM   7177  N  NE2   . GLN D 4  838  ? 17.383  -48.227  51.484  1.00 116.35 ? 838  GLN A NE2   1 
ATOM   7178  N  N     . ARG D 4  839  ? 21.089  -44.130  53.123  1.00 112.44 ? 839  ARG A N     1 
ATOM   7179  C  CA    . ARG D 4  839  ? 22.213  -43.837  52.244  1.00 111.81 ? 839  ARG A CA    1 
ATOM   7180  C  C     . ARG D 4  839  ? 23.547  -44.179  52.901  1.00 111.22 ? 839  ARG A C     1 
ATOM   7181  O  O     . ARG D 4  839  ? 24.460  -44.658  52.224  1.00 111.35 ? 839  ARG A O     1 
ATOM   7182  C  CB    . ARG D 4  839  ? 22.221  -42.378  51.829  1.00 112.10 ? 839  ARG A CB    1 
ATOM   7183  C  CG    . ARG D 4  839  ? 23.190  -42.092  50.718  1.00 112.74 ? 839  ARG A CG    1 
ATOM   7184  C  CD    . ARG D 4  839  ? 23.958  -40.794  50.971  1.00 114.02 ? 839  ARG A CD    1 
ATOM   7185  N  NE    . ARG D 4  839  ? 25.252  -40.708  50.267  1.00 114.42 ? 839  ARG A NE    1 
ATOM   7186  C  CZ    . ARG D 4  839  ? 25.671  -41.508  49.276  1.00 114.24 ? 839  ARG A CZ    1 
ATOM   7187  N  NH1   . ARG D 4  839  ? 24.913  -42.496  48.804  1.00 113.06 ? 839  ARG A NH1   1 
ATOM   7188  N  NH2   . ARG D 4  839  ? 26.867  -41.307  48.736  1.00 114.19 ? 839  ARG A NH2   1 
ATOM   7189  N  N     . ARG D 4  840  ? 23.657  -43.938  54.213  1.00 110.41 ? 840  ARG A N     1 
ATOM   7190  C  CA    . ARG D 4  840  ? 24.894  -44.235  54.974  1.00 109.37 ? 840  ARG A CA    1 
ATOM   7191  C  C     . ARG D 4  840  ? 25.053  -45.718  55.226  1.00 108.37 ? 840  ARG A C     1 
ATOM   7192  O  O     . ARG D 4  840  ? 26.111  -46.284  55.011  1.00 108.31 ? 840  ARG A O     1 
ATOM   7193  C  CB    . ARG D 4  840  ? 24.912  -43.513  56.306  1.00 109.27 ? 840  ARG A CB    1 
ATOM   7194  C  CG    . ARG D 4  840  ? 25.076  -42.028  56.194  1.00 111.17 ? 840  ARG A CG    1 
ATOM   7195  C  CD    . ARG D 4  840  ? 24.324  -41.367  57.325  1.00 114.18 ? 840  ARG A CD    1 
ATOM   7196  N  NE    . ARG D 4  840  ? 24.834  -41.855  58.597  1.00 116.64 ? 840  ARG A NE    1 
ATOM   7197  C  CZ    . ARG D 4  840  ? 24.365  -41.522  59.791  1.00 117.63 ? 840  ARG A CZ    1 
ATOM   7198  N  NH1   . ARG D 4  840  ? 23.343  -40.671  59.904  1.00 118.45 ? 840  ARG A NH1   1 
ATOM   7199  N  NH2   . ARG D 4  840  ? 24.934  -42.054  60.873  1.00 117.02 ? 840  ARG A NH2   1 
ATOM   7200  N  N     . LEU D 4  841  ? 23.989  -46.350  55.687  1.00 107.28 ? 841  LEU A N     1 
ATOM   7201  C  CA    . LEU D 4  841  ? 23.999  -47.782  55.854  1.00 106.13 ? 841  LEU A CA    1 
ATOM   7202  C  C     . LEU D 4  841  ? 24.475  -48.481  54.596  1.00 106.07 ? 841  LEU A C     1 
ATOM   7203  O  O     . LEU D 4  841  ? 25.438  -49.229  54.622  1.00 105.48 ? 841  LEU A O     1 
ATOM   7204  C  CB    . LEU D 4  841  ? 22.606  -48.248  56.207  1.00 105.53 ? 841  LEU A CB    1 
ATOM   7205  C  CG    . LEU D 4  841  ? 22.315  -47.977  57.654  1.00 103.70 ? 841  LEU A CG    1 
ATOM   7206  C  CD1   . LEU D 4  841  ? 20.873  -48.074  57.827  1.00 105.17 ? 841  LEU A CD1   1 
ATOM   7207  C  CD2   . LEU D 4  841  ? 22.959  -49.053  58.437  1.00 104.27 ? 841  LEU A CD2   1 
ATOM   7208  N  N     . VAL D 4  842  ? 23.793  -48.202  53.496  1.00 106.43 ? 842  VAL A N     1 
ATOM   7209  C  CA    . VAL D 4  842  ? 24.056  -48.834  52.228  1.00 106.93 ? 842  VAL A CA    1 
ATOM   7210  C  C     . VAL D 4  842  ? 25.498  -48.637  51.798  1.00 107.93 ? 842  VAL A C     1 
ATOM   7211  O  O     . VAL D 4  842  ? 26.124  -49.550  51.241  1.00 107.91 ? 842  VAL A O     1 
ATOM   7212  C  CB    . VAL D 4  842  ? 23.141  -48.268  51.165  1.00 106.59 ? 842  VAL A CB    1 
ATOM   7213  C  CG1   . VAL D 4  842  ? 23.646  -48.631  49.800  1.00 106.40 ? 842  VAL A CG1   1 
ATOM   7214  C  CG2   . VAL D 4  842  ? 21.752  -48.795  51.360  1.00 106.63 ? 842  VAL A CG2   1 
ATOM   7215  N  N     . LYS D 4  843  ? 26.029  -47.445  52.051  1.00 108.93 ? 843  LYS A N     1 
ATOM   7216  C  CA    . LYS D 4  843  ? 27.406  -47.168  51.699  1.00 109.97 ? 843  LYS A CA    1 
ATOM   7217  C  C     . LYS D 4  843  ? 28.398  -47.664  52.752  1.00 111.18 ? 843  LYS A C     1 
ATOM   7218  O  O     . LYS D 4  843  ? 29.606  -47.732  52.520  1.00 111.48 ? 843  LYS A O     1 
ATOM   7219  C  CB    . LYS D 4  843  ? 27.570  -45.698  51.387  1.00 109.56 ? 843  LYS A CB    1 
ATOM   7220  C  CG    . LYS D 4  843  ? 27.556  -45.425  49.898  1.00 109.90 ? 843  LYS A CG    1 
ATOM   7221  C  CD    . LYS D 4  843  ? 28.918  -45.734  49.250  1.00 109.64 ? 843  LYS A CD    1 
ATOM   7222  C  CE    . LYS D 4  843  ? 28.821  -45.907  47.742  1.00 110.13 ? 843  LYS A CE    1 
ATOM   7223  N  NZ    . LYS D 4  843  ? 27.788  -45.047  47.096  1.00 111.03 ? 843  LYS A NZ    1 
ATOM   7224  N  N     . ALA D 4  844  ? 27.872  -48.041  53.907  1.00 112.70 ? 844  ALA A N     1 
ATOM   7225  C  CA    . ALA D 4  844  ? 28.692  -48.611  54.959  1.00 113.82 ? 844  ALA A CA    1 
ATOM   7226  C  C     . ALA D 4  844  ? 28.765  -50.148  54.894  1.00 114.60 ? 844  ALA A C     1 
ATOM   7227  O  O     . ALA D 4  844  ? 29.675  -50.731  55.482  1.00 115.19 ? 844  ALA A O     1 
ATOM   7228  C  CB    . ALA D 4  844  ? 28.216  -48.126  56.348  1.00 113.64 ? 844  ALA A CB    1 
ATOM   7229  N  N     . LEU D 4  845  ? 27.835  -50.808  54.193  1.00 115.27 ? 845  LEU A N     1 
ATOM   7230  C  CA    . LEU D 4  845  ? 27.859  -52.291  54.100  1.00 115.92 ? 845  LEU A CA    1 
ATOM   7231  C  C     . LEU D 4  845  ? 28.169  -52.834  52.684  1.00 116.94 ? 845  LEU A C     1 
ATOM   7232  O  O     . LEU D 4  845  ? 29.048  -53.689  52.524  1.00 117.19 ? 845  LEU A O     1 
ATOM   7233  C  CB    . LEU D 4  845  ? 26.609  -52.932  54.725  1.00 115.13 ? 845  LEU A CB    1 
ATOM   7234  C  CG    . LEU D 4  845  ? 26.219  -52.350  56.090  1.00 114.46 ? 845  LEU A CG    1 
ATOM   7235  C  CD1   . LEU D 4  845  ? 24.994  -53.010  56.647  1.00 114.36 ? 845  LEU A CD1   1 
ATOM   7236  C  CD2   . LEU D 4  845  ? 27.335  -52.461  57.084  1.00 113.53 ? 845  LEU A CD2   1 
ATOM   7237  N  N     . GLU D 4  846  ? 27.464  -52.334  51.667  1.00 118.01 ? 846  GLU A N     1 
ATOM   7238  C  CA    . GLU D 4  846  ? 27.865  -52.511  50.265  1.00 118.97 ? 846  GLU A CA    1 
ATOM   7239  C  C     . GLU D 4  846  ? 28.412  -53.909  49.974  1.00 119.19 ? 846  GLU A C     1 
ATOM   7240  O  O     . GLU D 4  846  ? 27.647  -54.829  49.676  1.00 119.31 ? 846  GLU A O     1 
ATOM   7241  C  CB    . GLU D 4  846  ? 28.921  -51.458  49.926  1.00 119.38 ? 846  GLU A CB    1 
ATOM   7242  C  CG    . GLU D 4  846  ? 29.038  -51.052  48.473  1.00 121.49 ? 846  GLU A CG    1 
ATOM   7243  C  CD    . GLU D 4  846  ? 29.219  -49.532  48.327  1.00 124.83 ? 846  GLU A CD    1 
ATOM   7244  O  OE1   . GLU D 4  846  ? 30.325  -49.062  47.944  1.00 125.88 ? 846  GLU A OE1   1 
ATOM   7245  O  OE2   . GLU D 4  846  ? 28.244  -48.804  48.622  1.00 125.98 ? 846  GLU A OE2   1 
ATOM   7246  N  N     . ASP D 4  847  ? 29.733  -54.059  50.107  1.00 119.47 ? 847  ASP A N     1 
ATOM   7247  C  CA    . ASP D 4  847  ? 30.473  -55.234  49.613  1.00 119.96 ? 847  ASP A CA    1 
ATOM   7248  C  C     . ASP D 4  847  ? 30.680  -56.362  50.623  1.00 119.49 ? 847  ASP A C     1 
ATOM   7249  O  O     . ASP D 4  847  ? 31.404  -57.332  50.351  1.00 119.44 ? 847  ASP A O     1 
ATOM   7250  C  CB    . ASP D 4  847  ? 31.832  -54.801  49.080  1.00 120.48 ? 847  ASP A CB    1 
ATOM   7251  C  CG    . ASP D 4  847  ? 32.638  -54.058  50.121  1.00 122.85 ? 847  ASP A CG    1 
ATOM   7252  O  OD1   . ASP D 4  847  ? 32.019  -53.236  50.854  1.00 124.63 ? 847  ASP A OD1   1 
ATOM   7253  O  OD2   . ASP D 4  847  ? 33.872  -54.301  50.213  1.00 125.30 ? 847  ASP A OD2   1 
ATOM   7254  N  N     . ILE D 4  848  ? 30.060  -56.233  51.786  1.00 119.14 ? 848  ILE A N     1 
ATOM   7255  C  CA    . ILE D 4  848  ? 29.954  -57.352  52.698  1.00 118.78 ? 848  ILE A CA    1 
ATOM   7256  C  C     . ILE D 4  848  ? 29.092  -58.396  51.967  1.00 118.97 ? 848  ILE A C     1 
ATOM   7257  O  O     . ILE D 4  848  ? 27.877  -58.383  52.080  1.00 119.01 ? 848  ILE A O     1 
ATOM   7258  C  CB    . ILE D 4  848  ? 29.322  -56.921  54.063  1.00 118.63 ? 848  ILE A CB    1 
ATOM   7259  C  CG1   . ILE D 4  848  ? 30.023  -55.696  54.671  1.00 118.57 ? 848  ILE A CG1   1 
ATOM   7260  C  CG2   . ILE D 4  848  ? 29.323  -58.036  55.055  1.00 117.92 ? 848  ILE A CG2   1 
ATOM   7261  C  CD1   . ILE D 4  848  ? 31.511  -55.822  54.865  1.00 119.45 ? 848  ILE A CD1   1 
ATOM   7262  N  N     . MET D 4  849  ? 29.723  -59.250  51.162  1.00 119.09 ? 849  MET A N     1 
ATOM   7263  C  CA    . MET D 4  849  ? 29.030  -60.370  50.515  1.00 119.57 ? 849  MET A CA    1 
ATOM   7264  C  C     . MET D 4  849  ? 29.552  -61.683  51.084  1.00 119.03 ? 849  MET A C     1 
ATOM   7265  O  O     . MET D 4  849  ? 30.680  -61.733  51.568  1.00 119.31 ? 849  MET A O     1 
ATOM   7266  C  CB    . MET D 4  849  ? 29.232  -60.355  48.993  1.00 119.77 ? 849  MET A CB    1 
ATOM   7267  C  CG    . MET D 4  849  ? 30.677  -60.640  48.505  1.00 120.95 ? 849  MET A CG    1 
ATOM   7268  S  SD    . MET D 4  849  ? 30.828  -61.276  46.798  1.00 121.36 ? 849  MET A SD    1 
ATOM   7269  C  CE    . MET D 4  849  ? 32.550  -60.912  46.456  1.00 121.76 ? 849  MET A CE    1 
ATOM   7270  N  N     . VAL D 4  850  ? 28.750  -62.741  51.022  1.00 118.37 ? 850  VAL A N     1 
ATOM   7271  C  CA    . VAL D 4  850  ? 29.209  -64.049  51.461  1.00 117.91 ? 850  VAL A CA    1 
ATOM   7272  C  C     . VAL D 4  850  ? 30.051  -64.685  50.381  1.00 117.80 ? 850  VAL A C     1 
ATOM   7273  O  O     . VAL D 4  850  ? 29.550  -64.909  49.286  1.00 117.96 ? 850  VAL A O     1 
ATOM   7274  C  CB    . VAL D 4  850  ? 28.068  -64.995  51.707  1.00 117.77 ? 850  VAL A CB    1 
ATOM   7275  C  CG1   . VAL D 4  850  ? 28.599  -66.231  52.400  1.00 118.34 ? 850  VAL A CG1   1 
ATOM   7276  C  CG2   . VAL D 4  850  ? 27.002  -64.335  52.542  1.00 118.20 ? 850  VAL A CG2   1 
ATOM   7277  N  N     . HIS D 4  851  ? 31.314  -64.985  50.697  1.00 117.72 ? 851  HIS A N     1 
ATOM   7278  C  CA    . HIS D 4  851  ? 32.266  -65.602  49.754  1.00 117.68 ? 851  HIS A CA    1 
ATOM   7279  C  C     . HIS D 4  851  ? 32.112  -67.109  49.697  1.00 117.64 ? 851  HIS A C     1 
ATOM   7280  O  O     . HIS D 4  851  ? 31.294  -67.696  50.424  1.00 117.81 ? 851  HIS A O     1 
ATOM   7281  C  CB    . HIS D 4  851  ? 33.716  -65.264  50.101  1.00 117.61 ? 851  HIS A CB    1 
ATOM   7282  C  CG    . HIS D 4  851  ? 34.091  -63.849  49.816  1.00 118.39 ? 851  HIS A CG    1 
ATOM   7283  N  ND1   . HIS D 4  851  ? 35.131  -63.514  48.980  1.00 119.29 ? 851  HIS A ND1   1 
ATOM   7284  C  CD2   . HIS D 4  851  ? 33.564  -62.680  50.253  1.00 119.32 ? 851  HIS A CD2   1 
ATOM   7285  C  CE1   . HIS D 4  851  ? 35.231  -62.197  48.916  1.00 120.15 ? 851  HIS A CE1   1 
ATOM   7286  N  NE2   . HIS D 4  851  ? 34.295  -61.668  49.684  1.00 120.13 ? 851  HIS A NE2   1 
ATOM   7287  N  N     . TYR D 4  852  ? 32.911  -67.732  48.837  1.00 117.40 ? 852  TYR A N     1 
ATOM   7288  C  CA    . TYR D 4  852  ? 32.764  -69.151  48.573  1.00 117.55 ? 852  TYR A CA    1 
ATOM   7289  C  C     . TYR D 4  852  ? 33.372  -70.061  49.650  1.00 117.61 ? 852  TYR A C     1 
ATOM   7290  O  O     . TYR D 4  852  ? 33.659  -71.227  49.383  1.00 117.74 ? 852  TYR A O     1 
ATOM   7291  C  CB    . TYR D 4  852  ? 33.390  -69.506  47.226  1.00 117.95 ? 852  TYR A CB    1 
ATOM   7292  C  CG    . TYR D 4  852  ? 32.526  -69.390  45.987  1.00 117.63 ? 852  TYR A CG    1 
ATOM   7293  C  CD1   . TYR D 4  852  ? 32.878  -68.507  44.966  1.00 118.13 ? 852  TYR A CD1   1 
ATOM   7294  C  CD2   . TYR D 4  852  ? 31.414  -70.207  45.802  1.00 116.70 ? 852  TYR A CD2   1 
ATOM   7295  C  CE1   . TYR D 4  852  ? 32.115  -68.405  43.810  1.00 118.78 ? 852  TYR A CE1   1 
ATOM   7296  C  CE2   . TYR D 4  852  ? 30.640  -70.113  44.653  1.00 117.27 ? 852  TYR A CE2   1 
ATOM   7297  C  CZ    . TYR D 4  852  ? 30.992  -69.207  43.657  1.00 118.17 ? 852  TYR A CZ    1 
ATOM   7298  O  OH    . TYR D 4  852  ? 30.228  -69.085  42.508  1.00 118.03 ? 852  TYR A OH    1 
ATOM   7299  N  N     . ASP D 4  853  ? 33.596  -69.549  50.853  1.00 117.63 ? 853  ASP A N     1 
ATOM   7300  C  CA    . ASP D 4  853  ? 33.873  -70.443  51.976  1.00 117.63 ? 853  ASP A CA    1 
ATOM   7301  C  C     . ASP D 4  853  ? 32.824  -70.262  53.067  1.00 117.42 ? 853  ASP A C     1 
ATOM   7302  O  O     . ASP D 4  853  ? 33.021  -70.703  54.204  1.00 117.70 ? 853  ASP A O     1 
ATOM   7303  C  CB    . ASP D 4  853  ? 35.314  -70.300  52.503  1.00 117.86 ? 853  ASP A CB    1 
ATOM   7304  C  CG    . ASP D 4  853  ? 35.644  -68.889  52.986  1.00 118.20 ? 853  ASP A CG    1 
ATOM   7305  O  OD1   . ASP D 4  853  ? 34.698  -68.147  53.349  1.00 117.74 ? 853  ASP A OD1   1 
ATOM   7306  O  OD2   . ASP D 4  853  ? 36.856  -68.538  53.012  1.00 117.82 ? 853  ASP A OD2   1 
ATOM   7307  N  N     . ASN D 4  854  ? 31.711  -69.626  52.685  1.00 116.85 ? 854  ASN A N     1 
ATOM   7308  C  CA    . ASN D 4  854  ? 30.621  -69.265  53.593  1.00 116.57 ? 854  ASN A CA    1 
ATOM   7309  C  C     . ASN D 4  854  ? 30.972  -68.207  54.672  1.00 115.91 ? 854  ASN A C     1 
ATOM   7310  O  O     . ASN D 4  854  ? 30.208  -67.997  55.627  1.00 116.21 ? 854  ASN A O     1 
ATOM   7311  C  CB    . ASN D 4  854  ? 29.975  -70.525  54.208  1.00 116.90 ? 854  ASN A CB    1 
ATOM   7312  C  CG    . ASN D 4  854  ? 28.524  -70.731  53.757  1.00 118.22 ? 854  ASN A CG    1 
ATOM   7313  O  OD1   . ASN D 4  854  ? 27.636  -69.915  54.066  1.00 118.20 ? 854  ASN A OD1   1 
ATOM   7314  N  ND2   . ASN D 4  854  ? 28.272  -71.837  53.040  1.00 119.41 ? 854  ASN A ND2   1 
ATOM   7315  N  N     . THR D 4  855  ? 32.103  -67.525  54.501  1.00 114.49 ? 855  THR A N     1 
ATOM   7316  C  CA    . THR D 4  855  ? 32.529  -66.502  55.439  1.00 113.26 ? 855  THR A CA    1 
ATOM   7317  C  C     . THR D 4  855  ? 32.177  -65.118  54.898  1.00 112.66 ? 855  THR A C     1 
ATOM   7318  O  O     . THR D 4  855  ? 32.524  -64.831  53.779  1.00 113.13 ? 855  THR A O     1 
ATOM   7319  C  CB    . THR D 4  855  ? 34.042  -66.614  55.662  1.00 113.20 ? 855  THR A CB    1 
ATOM   7320  O  OG1   . THR D 4  855  ? 34.409  -65.900  56.836  1.00 113.67 ? 855  THR A OG1   1 
ATOM   7321  C  CG2   . THR D 4  855  ? 34.822  -66.051  54.500  1.00 112.49 ? 855  THR A CG2   1 
ATOM   7322  N  N     . THR D 4  856  ? 31.490  -64.268  55.664  1.00 111.88 ? 856  THR A N     1 
ATOM   7323  C  CA    . THR D 4  856  ? 31.137  -62.888  55.223  1.00 110.97 ? 856  THR A CA    1 
ATOM   7324  C  C     . THR D 4  856  ? 32.332  -61.926  55.189  1.00 110.67 ? 856  THR A C     1 
ATOM   7325  O  O     . THR D 4  856  ? 32.913  -61.652  56.224  1.00 110.65 ? 856  THR A O     1 
ATOM   7326  C  CB    . THR D 4  856  ? 30.113  -62.232  56.176  1.00 110.80 ? 856  THR A CB    1 
ATOM   7327  O  OG1   . THR D 4  856  ? 29.179  -63.196  56.660  1.00 110.51 ? 856  THR A OG1   1 
ATOM   7328  C  CG2   . THR D 4  856  ? 29.366  -61.192  55.461  1.00 110.50 ? 856  THR A CG2   1 
ATOM   7329  N  N     . ARG D 4  857  ? 32.682  -61.380  54.028  1.00 110.59 ? 857  ARG A N     1 
ATOM   7330  C  CA    . ARG D 4  857  ? 33.909  -60.558  53.913  1.00 110.97 ? 857  ARG A CA    1 
ATOM   7331  C  C     . ARG D 4  857  ? 33.755  -59.189  53.242  1.00 111.53 ? 857  ARG A C     1 
ATOM   7332  O  O     . ARG D 4  857  ? 32.641  -58.698  53.081  1.00 112.22 ? 857  ARG A O     1 
ATOM   7333  C  CB    . ARG D 4  857  ? 35.002  -61.330  53.197  1.00 110.62 ? 857  ARG A CB    1 
ATOM   7334  C  CG    . ARG D 4  857  ? 35.298  -62.645  53.837  1.00 110.51 ? 857  ARG A CG    1 
ATOM   7335  C  CD    . ARG D 4  857  ? 36.783  -62.868  53.977  1.00 109.27 ? 857  ARG A CD    1 
ATOM   7336  N  NE    . ARG D 4  857  ? 37.073  -64.288  54.091  1.00 106.49 ? 857  ARG A NE    1 
ATOM   7337  C  CZ    . ARG D 4  857  ? 38.284  -64.795  54.228  1.00 104.83 ? 857  ARG A CZ    1 
ATOM   7338  N  NH1   . ARG D 4  857  ? 39.348  -64.006  54.259  1.00 104.08 ? 857  ARG A NH1   1 
ATOM   7339  N  NH2   . ARG D 4  857  ? 38.420  -66.101  54.307  1.00 104.74 ? 857  ARG A NH2   1 
ATOM   7340  N  N     . ASN D 4  858  ? 34.872  -58.561  52.869  1.00 111.74 ? 858  ASN A N     1 
ATOM   7341  C  CA    . ASN D 4  858  ? 34.826  -57.318  52.077  1.00 111.95 ? 858  ASN A CA    1 
ATOM   7342  C  C     . ASN D 4  858  ? 36.044  -57.058  51.197  1.00 112.33 ? 858  ASN A C     1 
ATOM   7343  O  O     . ASN D 4  858  ? 36.915  -57.923  51.057  1.00 112.34 ? 858  ASN A O     1 
ATOM   7344  C  CB    . ASN D 4  858  ? 34.556  -56.102  52.956  1.00 111.58 ? 858  ASN A CB    1 
ATOM   7345  C  CG    . ASN D 4  858  ? 35.597  -55.911  54.003  1.00 111.34 ? 858  ASN A CG    1 
ATOM   7346  O  OD1   . ASN D 4  858  ? 36.802  -56.056  53.750  1.00 110.91 ? 858  ASN A OD1   1 
ATOM   7347  N  ND2   . ASN D 4  858  ? 35.149  -55.563  55.204  1.00 110.77 ? 858  ASN A ND2   1 
ATOM   7348  N  N     . SER D 4  859  ? 36.092  -55.854  50.622  1.00 112.84 ? 859  SER A N     1 
ATOM   7349  C  CA    . SER D 4  859  ? 37.101  -55.482  49.608  1.00 113.67 ? 859  SER A CA    1 
ATOM   7350  C  C     . SER D 4  859  ? 38.570  -55.753  50.023  1.00 113.98 ? 859  SER A C     1 
ATOM   7351  O  O     . SER D 4  859  ? 39.446  -56.069  49.177  1.00 113.84 ? 859  SER A O     1 
ATOM   7352  C  CB    . SER D 4  859  ? 36.899  -54.031  49.078  1.00 113.96 ? 859  SER A CB    1 
ATOM   7353  O  OG    . SER D 4  859  ? 36.202  -53.168  49.971  1.00 113.45 ? 859  SER A OG    1 
ATOM   7354  N  N     . LEU D 4  860  ? 38.812  -55.630  51.327  1.00 114.04 ? 860  LEU A N     1 
ATOM   7355  C  CA    . LEU D 4  860  ? 40.106  -55.935  51.908  1.00 114.21 ? 860  LEU A CA    1 
ATOM   7356  C  C     . LEU D 4  860  ? 40.164  -57.412  52.274  1.00 113.78 ? 860  LEU A C     1 
ATOM   7357  O  O     . LEU D 4  860  ? 41.230  -57.939  52.589  1.00 113.86 ? 860  LEU A O     1 
ATOM   7358  C  CB    . LEU D 4  860  ? 40.336  -55.073  53.150  1.00 114.49 ? 860  LEU A CB    1 
ATOM   7359  C  CG    . LEU D 4  860  ? 40.473  -53.566  52.927  1.00 115.26 ? 860  LEU A CG    1 
ATOM   7360  C  CD1   . LEU D 4  860  ? 39.761  -52.796  54.052  1.00 115.67 ? 860  LEU A CD1   1 
ATOM   7361  C  CD2   . LEU D 4  860  ? 41.953  -53.151  52.773  1.00 116.18 ? 860  LEU A CD2   1 
ATOM   7362  N  N     . GLY D 4  861  ? 39.010  -58.070  52.224  1.00 113.11 ? 861  GLY A N     1 
ATOM   7363  C  CA    . GLY D 4  861  ? 38.888  -59.438  52.676  1.00 112.42 ? 861  GLY A CA    1 
ATOM   7364  C  C     . GLY D 4  861  ? 39.006  -59.555  54.185  1.00 112.02 ? 861  GLY A C     1 
ATOM   7365  O  O     . GLY D 4  861  ? 39.646  -60.476  54.680  1.00 112.16 ? 861  GLY A O     1 
ATOM   7366  N  N     . ASN D 4  862  ? 38.408  -58.614  54.917  1.00 111.50 ? 862  ASN A N     1 
ATOM   7367  C  CA    . ASN D 4  862  ? 38.252  -58.756  56.370  1.00 110.85 ? 862  ASN A CA    1 
ATOM   7368  C  C     . ASN D 4  862  ? 37.105  -59.705  56.688  1.00 110.18 ? 862  ASN A C     1 
ATOM   7369  O  O     . ASN D 4  862  ? 36.124  -59.763  55.960  1.00 110.08 ? 862  ASN A O     1 
ATOM   7370  C  CB    . ASN D 4  862  ? 38.030  -57.403  57.061  1.00 110.84 ? 862  ASN A CB    1 
ATOM   7371  C  CG    . ASN D 4  862  ? 39.326  -56.616  57.263  1.00 111.59 ? 862  ASN A CG    1 
ATOM   7372  O  OD1   . ASN D 4  862  ? 40.417  -57.063  56.891  1.00 112.34 ? 862  ASN A OD1   1 
ATOM   7373  N  ND2   . ASN D 4  862  ? 39.205  -55.430  57.848  1.00 112.05 ? 862  ASN A ND2   1 
ATOM   7374  N  N     . VAL D 4  863  ? 37.254  -60.472  57.759  1.00 109.67 ? 863  VAL A N     1 
ATOM   7375  C  CA    . VAL D 4  863  ? 36.201  -61.364  58.206  1.00 109.16 ? 863  VAL A CA    1 
ATOM   7376  C  C     . VAL D 4  863  ? 35.266  -60.513  59.018  1.00 109.05 ? 863  VAL A C     1 
ATOM   7377  O  O     . VAL D 4  863  ? 35.693  -59.600  59.693  1.00 109.09 ? 863  VAL A O     1 
ATOM   7378  C  CB    . VAL D 4  863  ? 36.745  -62.528  59.066  1.00 109.11 ? 863  VAL A CB    1 
ATOM   7379  C  CG1   . VAL D 4  863  ? 35.604  -63.439  59.530  1.00 108.95 ? 863  VAL A CG1   1 
ATOM   7380  C  CG2   . VAL D 4  863  ? 37.794  -63.328  58.298  1.00 108.27 ? 863  VAL A CG2   1 
ATOM   7381  N  N     . ILE D 4  864  ? 33.981  -60.787  58.930  1.00 109.28 ? 864  ILE A N     1 
ATOM   7382  C  CA    . ILE D 4  864  ? 33.018  -60.015  59.693  1.00 109.73 ? 864  ILE A CA    1 
ATOM   7383  C  C     . ILE D 4  864  ? 32.155  -60.983  60.516  1.00 110.55 ? 864  ILE A C     1 
ATOM   7384  O  O     . ILE D 4  864  ? 32.032  -60.863  61.759  1.00 111.02 ? 864  ILE A O     1 
ATOM   7385  C  CB    . ILE D 4  864  ? 32.130  -59.150  58.776  1.00 109.25 ? 864  ILE A CB    1 
ATOM   7386  C  CG1   . ILE D 4  864  ? 32.903  -58.664  57.552  1.00 107.48 ? 864  ILE A CG1   1 
ATOM   7387  C  CG2   . ILE D 4  864  ? 31.513  -58.003  59.567  1.00 109.34 ? 864  ILE A CG2   1 
ATOM   7388  C  CD1   . ILE D 4  864  ? 33.774  -57.518  57.814  1.00 106.36 ? 864  ILE A CD1   1 
ATOM   7389  N  N     . GLN D 4  865  ? 31.551  -61.930  59.801  1.00 110.58 ? 865  GLN A N     1 
ATOM   7390  C  CA    . GLN D 4  865  ? 30.962  -63.094  60.416  1.00 110.47 ? 865  GLN A CA    1 
ATOM   7391  C  C     . GLN D 4  865  ? 31.679  -64.286  59.806  1.00 110.06 ? 865  GLN A C     1 
ATOM   7392  O  O     . GLN D 4  865  ? 31.640  -64.460  58.593  1.00 110.37 ? 865  GLN A O     1 
ATOM   7393  C  CB    . GLN D 4  865  ? 29.478  -63.168  60.086  1.00 110.52 ? 865  GLN A CB    1 
ATOM   7394  C  CG    . GLN D 4  865  ? 28.644  -62.061  60.667  1.00 111.11 ? 865  GLN A CG    1 
ATOM   7395  C  CD    . GLN D 4  865  ? 27.208  -62.180  60.222  1.00 111.93 ? 865  GLN A CD    1 
ATOM   7396  O  OE1   . GLN D 4  865  ? 26.880  -63.024  59.386  1.00 111.88 ? 865  GLN A OE1   1 
ATOM   7397  N  NE2   . GLN D 4  865  ? 26.338  -61.340  60.776  1.00 112.07 ? 865  GLN A NE2   1 
ATOM   7398  N  N     . PHE D 4  866  ? 32.333  -65.097  60.627  1.00 109.26 ? 866  PHE A N     1 
ATOM   7399  C  CA    . PHE D 4  866  ? 32.966  -66.308  60.138  1.00 108.80 ? 866  PHE A CA    1 
ATOM   7400  C  C     . PHE D 4  866  ? 32.048  -67.266  59.351  1.00 109.21 ? 866  PHE A C     1 
ATOM   7401  O  O     . PHE D 4  866  ? 32.508  -68.006  58.462  1.00 109.32 ? 866  PHE A O     1 
ATOM   7402  C  CB    . PHE D 4  866  ? 33.630  -67.003  61.298  1.00 108.22 ? 866  PHE A CB    1 
ATOM   7403  C  CG    . PHE D 4  866  ? 34.894  -66.350  61.706  1.00 107.46 ? 866  PHE A CG    1 
ATOM   7404  C  CD1   . PHE D 4  866  ? 34.889  -65.324  62.630  1.00 107.25 ? 866  PHE A CD1   1 
ATOM   7405  C  CD2   . PHE D 4  866  ? 36.097  -66.735  61.138  1.00 106.49 ? 866  PHE A CD2   1 
ATOM   7406  C  CE1   . PHE D 4  866  ? 36.075  -64.705  63.005  1.00 106.14 ? 866  PHE A CE1   1 
ATOM   7407  C  CE2   . PHE D 4  866  ? 37.277  -66.121  61.496  1.00 105.30 ? 866  PHE A CE2   1 
ATOM   7408  C  CZ    . PHE D 4  866  ? 37.266  -65.105  62.428  1.00 106.06 ? 866  PHE A CZ    1 
ATOM   7409  N  N     . ILE D 4  867  ? 30.758  -67.241  59.682  1.00 109.45 ? 867  ILE A N     1 
ATOM   7410  C  CA    . ILE D 4  867  ? 29.731  -68.041  59.013  1.00 109.80 ? 867  ILE A CA    1 
ATOM   7411  C  C     . ILE D 4  867  ? 28.469  -67.174  58.917  1.00 110.04 ? 867  ILE A C     1 
ATOM   7412  O  O     . ILE D 4  867  ? 27.904  -66.802  59.943  1.00 110.50 ? 867  ILE A O     1 
ATOM   7413  C  CB    . ILE D 4  867  ? 29.467  -69.346  59.798  1.00 109.84 ? 867  ILE A CB    1 
ATOM   7414  C  CG1   . ILE D 4  867  ? 30.691  -70.283  59.689  1.00 111.67 ? 867  ILE A CG1   1 
ATOM   7415  C  CG2   . ILE D 4  867  ? 28.219  -70.069  59.306  1.00 108.87 ? 867  ILE A CG2   1 
ATOM   7416  C  CD1   . ILE D 4  867  ? 31.726  -70.267  60.912  1.00 111.94 ? 867  ILE A CD1   1 
ATOM   7417  N  N     . TYR D 4  868  ? 28.036  -66.827  57.700  1.00 109.93 ? 868  TYR A N     1 
ATOM   7418  C  CA    . TYR D 4  868  ? 26.988  -65.807  57.530  1.00 109.59 ? 868  TYR A CA    1 
ATOM   7419  C  C     . TYR D 4  868  ? 25.805  -66.027  58.450  1.00 110.00 ? 868  TYR A C     1 
ATOM   7420  O  O     . TYR D 4  868  ? 25.304  -67.135  58.581  1.00 109.85 ? 868  TYR A O     1 
ATOM   7421  C  CB    . TYR D 4  868  ? 26.505  -65.707  56.078  1.00 109.08 ? 868  TYR A CB    1 
ATOM   7422  C  CG    . TYR D 4  868  ? 25.232  -64.893  55.921  1.00 108.67 ? 868  TYR A CG    1 
ATOM   7423  C  CD1   . TYR D 4  868  ? 25.282  -63.551  55.660  1.00 108.24 ? 868  TYR A CD1   1 
ATOM   7424  C  CD2   . TYR D 4  868  ? 23.967  -65.474  56.054  1.00 109.99 ? 868  TYR A CD2   1 
ATOM   7425  C  CE1   . TYR D 4  868  ? 24.116  -62.800  55.541  1.00 108.24 ? 868  TYR A CE1   1 
ATOM   7426  C  CE2   . TYR D 4  868  ? 22.787  -64.706  55.930  1.00 109.09 ? 868  TYR A CE2   1 
ATOM   7427  C  CZ    . TYR D 4  868  ? 22.881  -63.369  55.666  1.00 107.66 ? 868  TYR A CZ    1 
ATOM   7428  O  OH    . TYR D 4  868  ? 21.763  -62.580  55.531  1.00 106.85 ? 868  TYR A OH    1 
ATOM   7429  N  N     . GLY D 4  869  ? 25.359  -64.955  59.085  1.00 111.03 ? 869  GLY A N     1 
ATOM   7430  C  CA    . GLY D 4  869  ? 24.139  -64.992  59.897  1.00 112.24 ? 869  GLY A CA    1 
ATOM   7431  C  C     . GLY D 4  869  ? 24.323  -65.819  61.151  1.00 112.80 ? 869  GLY A C     1 
ATOM   7432  O  O     . GLY D 4  869  ? 23.379  -66.011  61.917  1.00 112.64 ? 869  GLY A O     1 
ATOM   7433  N  N     . GLU D 4  870  ? 25.559  -66.278  61.345  1.00 113.44 ? 870  GLU A N     1 
ATOM   7434  C  CA    . GLU D 4  870  ? 25.973  -67.214  62.411  1.00 114.53 ? 870  GLU A CA    1 
ATOM   7435  C  C     . GLU D 4  870  ? 25.696  -68.703  62.131  1.00 114.64 ? 870  GLU A C     1 
ATOM   7436  O  O     . GLU D 4  870  ? 26.195  -69.566  62.855  1.00 115.04 ? 870  GLU A O     1 
ATOM   7437  C  CB    . GLU D 4  870  ? 25.497  -66.779  63.819  1.00 114.72 ? 870  GLU A CB    1 
ATOM   7438  C  CG    . GLU D 4  870  ? 26.534  -66.003  64.628  1.00 116.07 ? 870  GLU A CG    1 
ATOM   7439  C  CD    . GLU D 4  870  ? 25.907  -65.083  65.658  1.00 118.49 ? 870  GLU A CD    1 
ATOM   7440  O  OE1   . GLU D 4  870  ? 25.611  -65.528  66.789  1.00 119.92 ? 870  GLU A OE1   1 
ATOM   7441  O  OE2   . GLU D 4  870  ? 25.709  -63.896  65.337  1.00 119.42 ? 870  GLU A OE2   1 
ATOM   7442  N  N     . ASP D 4  871  ? 24.961  -69.004  61.061  1.00 114.78 ? 871  ASP A N     1 
ATOM   7443  C  CA    . ASP D 4  871  ? 24.507  -70.378  60.802  1.00 114.86 ? 871  ASP A CA    1 
ATOM   7444  C  C     . ASP D 4  871  ? 24.572  -70.827  59.335  1.00 114.63 ? 871  ASP A C     1 
ATOM   7445  O  O     . ASP D 4  871  ? 24.112  -71.919  58.995  1.00 114.35 ? 871  ASP A O     1 
ATOM   7446  C  CB    . ASP D 4  871  ? 23.069  -70.490  61.250  1.00 115.04 ? 871  ASP A CB    1 
ATOM   7447  C  CG    . ASP D 4  871  ? 22.147  -69.712  60.356  1.00 115.63 ? 871  ASP A CG    1 
ATOM   7448  O  OD1   . ASP D 4  871  ? 22.596  -68.707  59.743  1.00 115.26 ? 871  ASP A OD1   1 
ATOM   7449  O  OD2   . ASP D 4  871  ? 20.974  -70.117  60.257  1.00 117.41 ? 871  ASP A OD2   1 
ATOM   7450  N  N     . GLY D 4  872  ? 25.092  -69.960  58.477  1.00 114.54 ? 872  GLY A N     1 
ATOM   7451  C  CA    . GLY D 4  872  ? 25.264  -70.260  57.073  1.00 114.65 ? 872  GLY A CA    1 
ATOM   7452  C  C     . GLY D 4  872  ? 23.957  -70.417  56.341  1.00 114.99 ? 872  GLY A C     1 
ATOM   7453  O  O     . GLY D 4  872  ? 23.883  -71.149  55.368  1.00 115.21 ? 872  GLY A O     1 
ATOM   7454  N  N     . MET D 4  873  ? 22.918  -69.730  56.791  1.00 115.53 ? 873  MET A N     1 
ATOM   7455  C  CA    . MET D 4  873  ? 21.602  -69.911  56.182  1.00 116.20 ? 873  MET A CA    1 
ATOM   7456  C  C     . MET D 4  873  ? 21.123  -68.648  55.489  1.00 116.60 ? 873  MET A C     1 
ATOM   7457  O  O     . MET D 4  873  ? 21.368  -67.548  55.985  1.00 116.85 ? 873  MET A O     1 
ATOM   7458  C  CB    . MET D 4  873  ? 20.575  -70.332  57.235  1.00 116.04 ? 873  MET A CB    1 
ATOM   7459  C  CG    . MET D 4  873  ? 19.716  -71.519  56.844  1.00 116.51 ? 873  MET A CG    1 
ATOM   7460  S  SD    . MET D 4  873  ? 20.653  -73.059  56.734  1.00 119.80 ? 873  MET A SD    1 
ATOM   7461  C  CE    . MET D 4  873  ? 21.198  -73.317  58.446  1.00 118.73 ? 873  MET A CE    1 
ATOM   7462  N  N     . ASP D 4  874  ? 20.448  -68.825  54.349  1.00 116.93 ? 874  ASP A N     1 
ATOM   7463  C  CA    . ASP D 4  874  ? 19.702  -67.765  53.672  1.00 117.51 ? 874  ASP A CA    1 
ATOM   7464  C  C     . ASP D 4  874  ? 18.377  -67.462  54.388  1.00 117.15 ? 874  ASP A C     1 
ATOM   7465  O  O     . ASP D 4  874  ? 17.618  -68.355  54.723  1.00 116.70 ? 874  ASP A O     1 
ATOM   7466  C  CB    . ASP D 4  874  ? 19.449  -68.162  52.213  1.00 118.14 ? 874  ASP A CB    1 
ATOM   7467  C  CG    . ASP D 4  874  ? 18.635  -67.100  51.424  1.00 121.02 ? 874  ASP A CG    1 
ATOM   7468  O  OD1   . ASP D 4  874  ? 17.369  -67.002  51.575  1.00 120.59 ? 874  ASP A OD1   1 
ATOM   7469  O  OD2   . ASP D 4  874  ? 19.289  -66.385  50.615  1.00 124.41 ? 874  ASP A OD2   1 
ATOM   7470  N  N     . ALA D 4  875  ? 18.081  -66.190  54.592  1.00 117.45 ? 875  ALA A N     1 
ATOM   7471  C  CA    . ALA D 4  875  ? 16.932  -65.826  55.412  1.00 117.89 ? 875  ALA A CA    1 
ATOM   7472  C  C     . ALA D 4  875  ? 15.546  -66.011  54.772  1.00 118.26 ? 875  ALA A C     1 
ATOM   7473  O  O     . ALA D 4  875  ? 14.536  -65.733  55.407  1.00 118.19 ? 875  ALA A O     1 
ATOM   7474  C  CB    . ALA D 4  875  ? 17.095  -64.417  55.901  1.00 117.98 ? 875  ALA A CB    1 
ATOM   7475  N  N     . ALA D 4  876  ? 15.489  -66.475  53.527  1.00 118.74 ? 876  ALA A N     1 
ATOM   7476  C  CA    . ALA D 4  876  ? 14.200  -66.724  52.884  1.00 119.13 ? 876  ALA A CA    1 
ATOM   7477  C  C     . ALA D 4  876  ? 13.656  -68.101  53.261  1.00 119.31 ? 876  ALA A C     1 
ATOM   7478  O  O     . ALA D 4  876  ? 12.447  -68.303  53.412  1.00 119.10 ? 876  ALA A O     1 
ATOM   7479  C  CB    . ALA D 4  876  ? 14.336  -66.605  51.389  1.00 119.48 ? 876  ALA A CB    1 
ATOM   7480  N  N     . HIS D 4  877  ? 14.583  -69.032  53.442  1.00 119.63 ? 877  HIS A N     1 
ATOM   7481  C  CA    . HIS D 4  877  ? 14.276  -70.441  53.632  1.00 119.92 ? 877  HIS A CA    1 
ATOM   7482  C  C     . HIS D 4  877  ? 14.202  -70.806  55.101  1.00 119.53 ? 877  HIS A C     1 
ATOM   7483  O  O     . HIS D 4  877  ? 14.685  -71.855  55.507  1.00 119.90 ? 877  HIS A O     1 
ATOM   7484  C  CB    . HIS D 4  877  ? 15.370  -71.271  52.966  1.00 120.26 ? 877  HIS A CB    1 
ATOM   7485  C  CG    . HIS D 4  877  ? 15.619  -70.897  51.542  1.00 121.45 ? 877  HIS A CG    1 
ATOM   7486  N  ND1   . HIS D 4  877  ? 15.542  -71.808  50.512  1.00 122.59 ? 877  HIS A ND1   1 
ATOM   7487  C  CD2   . HIS D 4  877  ? 15.914  -69.705  50.974  1.00 122.26 ? 877  HIS A CD2   1 
ATOM   7488  C  CE1   . HIS D 4  877  ? 15.797  -71.196  49.370  1.00 123.24 ? 877  HIS A CE1   1 
ATOM   7489  N  NE2   . HIS D 4  877  ? 16.020  -69.918  49.622  1.00 123.68 ? 877  HIS A NE2   1 
ATOM   7490  N  N     . ILE D 4  878  ? 13.559  -69.959  55.886  1.00 118.95 ? 878  ILE A N     1 
ATOM   7491  C  CA    . ILE D 4  878  ? 13.703  -69.990  57.323  1.00 118.28 ? 878  ILE A CA    1 
ATOM   7492  C  C     . ILE D 4  878  ? 12.328  -69.756  57.915  1.00 117.79 ? 878  ILE A C     1 
ATOM   7493  O  O     . ILE D 4  878  ? 11.559  -69.012  57.320  1.00 118.48 ? 878  ILE A O     1 
ATOM   7494  C  CB    . ILE D 4  878  ? 14.705  -68.890  57.678  1.00 118.32 ? 878  ILE A CB    1 
ATOM   7495  C  CG1   . ILE D 4  878  ? 16.072  -69.530  57.926  1.00 118.82 ? 878  ILE A CG1   1 
ATOM   7496  C  CG2   . ILE D 4  878  ? 14.228  -68.030  58.839  1.00 118.78 ? 878  ILE A CG2   1 
ATOM   7497  C  CD1   . ILE D 4  878  ? 17.238  -68.569  57.948  1.00 119.81 ? 878  ILE A CD1   1 
ATOM   7498  N  N     . GLU D 4  879  ? 11.971  -70.390  59.032  1.00 116.80 ? 879  GLU A N     1 
ATOM   7499  C  CA    . GLU D 4  879  ? 10.626  -70.129  59.606  1.00 116.46 ? 879  GLU A CA    1 
ATOM   7500  C  C     . GLU D 4  879  ? 10.358  -70.495  61.056  1.00 116.03 ? 879  GLU A C     1 
ATOM   7501  O  O     . GLU D 4  879  ? 10.837  -71.480  61.563  1.00 115.82 ? 879  GLU A O     1 
ATOM   7502  C  CB    . GLU D 4  879  ? 9.508   -70.683  58.723  1.00 116.55 ? 879  GLU A CB    1 
ATOM   7503  C  CG    . GLU D 4  879  ? 9.926   -71.836  57.845  1.00 117.43 ? 879  GLU A CG    1 
ATOM   7504  C  CD    . GLU D 4  879  ? 8.848   -72.278  56.884  1.00 119.24 ? 879  GLU A CD    1 
ATOM   7505  O  OE1   . GLU D 4  879  ? 9.196   -72.583  55.718  1.00 120.39 ? 879  GLU A OE1   1 
ATOM   7506  O  OE2   . GLU D 4  879  ? 7.661   -72.332  57.294  1.00 120.29 ? 879  GLU A OE2   1 
ATOM   7507  N  N     . LYS D 4  880  ? 9.530   -69.685  61.688  1.00 116.06 ? 880  LYS A N     1 
ATOM   7508  C  CA    . LYS D 4  880  ? 9.313   -69.692  63.126  1.00 116.30 ? 880  LYS A CA    1 
ATOM   7509  C  C     . LYS D 4  880  ? 8.932   -71.080  63.654  1.00 115.84 ? 880  LYS A C     1 
ATOM   7510  O  O     . LYS D 4  880  ? 7.777   -71.297  64.020  1.00 116.41 ? 880  LYS A O     1 
ATOM   7511  C  CB    . LYS D 4  880  ? 8.212   -68.638  63.441  1.00 116.85 ? 880  LYS A CB    1 
ATOM   7512  C  CG    . LYS D 4  880  ? 7.723   -68.498  64.909  1.00 118.17 ? 880  LYS A CG    1 
ATOM   7513  C  CD    . LYS D 4  880  ? 7.465   -67.037  65.282  1.00 120.63 ? 880  LYS A CD    1 
ATOM   7514  C  CE    . LYS D 4  880  ? 8.772   -66.378  65.808  1.00 122.81 ? 880  LYS A CE    1 
ATOM   7515  N  NZ    . LYS D 4  880  ? 8.948   -64.891  65.549  1.00 123.74 ? 880  LYS A NZ    1 
ATOM   7516  N  N     . GLN D 4  881  ? 9.875   -72.022  63.706  1.00 114.87 ? 881  GLN A N     1 
ATOM   7517  C  CA    . GLN D 4  881  ? 9.552   -73.375  64.211  1.00 114.06 ? 881  GLN A CA    1 
ATOM   7518  C  C     . GLN D 4  881  ? 9.700   -73.493  65.726  1.00 113.75 ? 881  GLN A C     1 
ATOM   7519  O  O     . GLN D 4  881  ? 10.670  -73.018  66.297  1.00 113.54 ? 881  GLN A O     1 
ATOM   7520  C  CB    . GLN D 4  881  ? 10.404  -74.458  63.559  1.00 113.97 ? 881  GLN A CB    1 
ATOM   7521  C  CG    . GLN D 4  881  ? 10.689  -74.280  62.097  1.00 113.29 ? 881  GLN A CG    1 
ATOM   7522  C  CD    . GLN D 4  881  ? 11.266  -75.529  61.488  1.00 112.50 ? 881  GLN A CD    1 
ATOM   7523  O  OE1   . GLN D 4  881  ? 10.775  -76.629  61.743  1.00 112.58 ? 881  GLN A OE1   1 
ATOM   7524  N  NE2   . GLN D 4  881  ? 12.306  -75.373  60.672  1.00 111.11 ? 881  GLN A NE2   1 
ATOM   7525  N  N     . SER D 4  882  ? 8.747   -74.164  66.362  1.00 113.51 ? 882  SER A N     1 
ATOM   7526  C  CA    . SER D 4  882  ? 8.689   -74.244  67.809  1.00 113.21 ? 882  SER A CA    1 
ATOM   7527  C  C     . SER D 4  882  ? 9.514   -75.382  68.364  1.00 113.48 ? 882  SER A C     1 
ATOM   7528  O  O     . SER D 4  882  ? 9.195   -76.546  68.118  1.00 113.16 ? 882  SER A O     1 
ATOM   7529  C  CB    . SER D 4  882  ? 7.241   -74.391  68.240  1.00 113.27 ? 882  SER A CB    1 
ATOM   7530  O  OG    . SER D 4  882  ? 7.102   -75.316  69.294  1.00 113.45 ? 882  SER A OG    1 
ATOM   7531  N  N     . LEU D 4  883  ? 10.551  -75.016  69.133  1.00 114.26 ? 883  LEU A N     1 
ATOM   7532  C  CA    . LEU D 4  883  ? 11.509  -75.925  69.840  1.00 114.70 ? 883  LEU A CA    1 
ATOM   7533  C  C     . LEU D 4  883  ? 10.926  -76.809  70.966  1.00 115.79 ? 883  LEU A C     1 
ATOM   7534  O  O     . LEU D 4  883  ? 10.889  -76.428  72.146  1.00 115.84 ? 883  LEU A O     1 
ATOM   7535  C  CB    . LEU D 4  883  ? 12.696  -75.130  70.391  1.00 113.86 ? 883  LEU A CB    1 
ATOM   7536  C  CG    . LEU D 4  883  ? 13.642  -74.577  69.348  1.00 112.41 ? 883  LEU A CG    1 
ATOM   7537  C  CD1   . LEU D 4  883  ? 14.982  -74.312  69.960  1.00 111.96 ? 883  LEU A CD1   1 
ATOM   7538  C  CD2   . LEU D 4  883  ? 13.789  -75.561  68.238  1.00 111.11 ? 883  LEU A CD2   1 
ATOM   7539  N  N     . ASP D 4  884  ? 10.536  -78.017  70.586  1.00 117.03 ? 884  ASP A N     1 
ATOM   7540  C  CA    . ASP D 4  884  ? 9.678   -78.868  71.396  1.00 118.52 ? 884  ASP A CA    1 
ATOM   7541  C  C     . ASP D 4  884  ? 10.118  -79.236  72.801  1.00 118.82 ? 884  ASP A C     1 
ATOM   7542  O  O     . ASP D 4  884  ? 9.336   -79.838  73.553  1.00 119.25 ? 884  ASP A O     1 
ATOM   7543  C  CB    . ASP D 4  884  ? 9.413   -80.160  70.643  1.00 119.03 ? 884  ASP A CB    1 
ATOM   7544  C  CG    . ASP D 4  884  ? 8.169   -80.085  69.836  1.00 121.22 ? 884  ASP A CG    1 
ATOM   7545  O  OD1   . ASP D 4  884  ? 7.179   -79.506  70.355  1.00 123.88 ? 884  ASP A OD1   1 
ATOM   7546  O  OD2   . ASP D 4  884  ? 8.186   -80.587  68.689  1.00 123.70 ? 884  ASP A OD2   1 
ATOM   7547  N  N     . THR D 4  885  ? 11.354  -78.913  73.158  1.00 118.67 ? 885  THR A N     1 
ATOM   7548  C  CA    . THR D 4  885  ? 11.860  -79.420  74.415  1.00 118.45 ? 885  THR A CA    1 
ATOM   7549  C  C     . THR D 4  885  ? 12.068  -78.370  75.498  1.00 118.49 ? 885  THR A C     1 
ATOM   7550  O  O     . THR D 4  885  ? 12.378  -78.704  76.641  1.00 118.50 ? 885  THR A O     1 
ATOM   7551  C  CB    . THR D 4  885  ? 13.074  -80.385  74.215  1.00 118.43 ? 885  THR A CB    1 
ATOM   7552  O  OG1   . THR D 4  885  ? 14.106  -79.766  73.440  1.00 118.10 ? 885  THR A OG1   1 
ATOM   7553  C  CG2   . THR D 4  885  ? 12.612  -81.633  73.490  1.00 118.48 ? 885  THR A CG2   1 
ATOM   7554  N  N     . ILE D 4  886  ? 11.851  -77.102  75.151  1.00 118.47 ? 886  ILE A N     1 
ATOM   7555  C  CA    . ILE D 4  886  ? 12.107  -76.013  76.091  1.00 118.62 ? 886  ILE A CA    1 
ATOM   7556  C  C     . ILE D 4  886  ? 11.060  -75.926  77.188  1.00 118.89 ? 886  ILE A C     1 
ATOM   7557  O  O     . ILE D 4  886  ? 11.410  -75.967  78.367  1.00 119.00 ? 886  ILE A O     1 
ATOM   7558  C  CB    . ILE D 4  886  ? 12.270  -74.643  75.389  1.00 118.72 ? 886  ILE A CB    1 
ATOM   7559  C  CG1   . ILE D 4  886  ? 13.671  -74.526  74.797  1.00 118.76 ? 886  ILE A CG1   1 
ATOM   7560  C  CG2   . ILE D 4  886  ? 12.023  -73.463  76.363  1.00 118.38 ? 886  ILE A CG2   1 
ATOM   7561  C  CD1   . ILE D 4  886  ? 14.736  -74.200  75.817  1.00 118.37 ? 886  ILE A CD1   1 
ATOM   7562  N  N     . GLY D 4  887  ? 9.788   -75.817  76.806  1.00 119.12 ? 887  GLY A N     1 
ATOM   7563  C  CA    . GLY D 4  887  ? 8.707   -75.649  77.783  1.00 119.30 ? 887  GLY A CA    1 
ATOM   7564  C  C     . GLY D 4  887  ? 8.314   -76.915  78.543  1.00 119.26 ? 887  GLY A C     1 
ATOM   7565  O  O     . GLY D 4  887  ? 9.025   -77.931  78.507  1.00 119.07 ? 887  GLY A O     1 
ATOM   7566  N  N     . GLY D 4  888  ? 7.182   -76.839  79.247  1.00 119.12 ? 888  GLY A N     1 
ATOM   7567  C  CA    . GLY D 4  888  ? 6.601   -77.996  79.920  1.00 118.93 ? 888  GLY A CA    1 
ATOM   7568  C  C     . GLY D 4  888  ? 7.373   -78.530  81.117  1.00 118.81 ? 888  GLY A C     1 
ATOM   7569  O  O     . GLY D 4  888  ? 8.590   -78.317  81.260  1.00 118.48 ? 888  GLY A O     1 
ATOM   7570  N  N     . SER D 4  889  ? 6.649   -79.238  81.978  1.00 118.62 ? 889  SER A N     1 
ATOM   7571  C  CA    . SER D 4  889  ? 7.236   -79.835  83.162  1.00 118.56 ? 889  SER A CA    1 
ATOM   7572  C  C     . SER D 4  889  ? 8.313   -80.840  82.778  1.00 118.53 ? 889  SER A C     1 
ATOM   7573  O  O     . SER D 4  889  ? 8.382   -81.270  81.620  1.00 118.55 ? 889  SER A O     1 
ATOM   7574  C  CB    . SER D 4  889  ? 6.155   -80.514  84.006  1.00 118.68 ? 889  SER A CB    1 
ATOM   7575  O  OG    . SER D 4  889  ? 5.383   -81.406  83.227  1.00 118.12 ? 889  SER A OG    1 
ATOM   7576  N  N     . ASP D 4  890  ? 9.158   -81.191  83.748  1.00 118.31 ? 890  ASP A N     1 
ATOM   7577  C  CA    . ASP D 4  890  ? 10.075  -82.311  83.604  1.00 118.11 ? 890  ASP A CA    1 
ATOM   7578  C  C     . ASP D 4  890  ? 9.238   -83.565  83.558  1.00 117.63 ? 890  ASP A C     1 
ATOM   7579  O  O     . ASP D 4  890  ? 9.531   -84.485  82.803  1.00 117.59 ? 890  ASP A O     1 
ATOM   7580  C  CB    . ASP D 4  890  ? 11.044  -82.369  84.774  1.00 118.45 ? 890  ASP A CB    1 
ATOM   7581  C  CG    . ASP D 4  890  ? 11.794  -81.069  84.967  1.00 119.64 ? 890  ASP A CG    1 
ATOM   7582  O  OD1   . ASP D 4  890  ? 12.344  -80.537  83.975  1.00 120.47 ? 890  ASP A OD1   1 
ATOM   7583  O  OD2   . ASP D 4  890  ? 11.832  -80.573  86.115  1.00 121.52 ? 890  ASP A OD2   1 
ATOM   7584  N  N     . ALA D 4  891  ? 8.180   -83.570  84.362  1.00 117.05 ? 891  ALA A N     1 
ATOM   7585  C  CA    . ALA D 4  891  ? 7.182   -84.611  84.342  1.00 116.73 ? 891  ALA A CA    1 
ATOM   7586  C  C     . ALA D 4  891  ? 6.586   -84.801  82.946  1.00 116.66 ? 891  ALA A C     1 
ATOM   7587  O  O     . ALA D 4  891  ? 6.562   -85.910  82.429  1.00 116.56 ? 891  ALA A O     1 
ATOM   7588  C  CB    . ALA D 4  891  ? 6.107   -84.285  85.339  1.00 116.81 ? 891  ALA A CB    1 
ATOM   7589  N  N     . ALA D 4  892  ? 6.124   -83.713  82.335  1.00 116.86 ? 892  ALA A N     1 
ATOM   7590  C  CA    . ALA D 4  892  ? 5.481   -83.754  81.009  1.00 117.02 ? 892  ALA A CA    1 
ATOM   7591  C  C     . ALA D 4  892  ? 6.430   -84.109  79.864  1.00 116.98 ? 892  ALA A C     1 
ATOM   7592  O  O     . ALA D 4  892  ? 6.020   -84.763  78.901  1.00 117.02 ? 892  ALA A O     1 
ATOM   7593  C  CB    . ALA D 4  892  ? 4.784   -82.435  80.715  1.00 117.12 ? 892  ALA A CB    1 
ATOM   7594  N  N     . PHE D 4  893  ? 7.675   -83.639  79.969  1.00 116.85 ? 893  PHE A N     1 
ATOM   7595  C  CA    . PHE D 4  893  ? 8.765   -83.998  79.061  1.00 116.66 ? 893  PHE A CA    1 
ATOM   7596  C  C     . PHE D 4  893  ? 9.079   -85.481  79.190  1.00 117.20 ? 893  PHE A C     1 
ATOM   7597  O  O     . PHE D 4  893  ? 9.259   -86.174  78.192  1.00 117.18 ? 893  PHE A O     1 
ATOM   7598  C  CB    . PHE D 4  893  ? 9.996   -83.150  79.400  1.00 115.99 ? 893  PHE A CB    1 
ATOM   7599  C  CG    . PHE D 4  893  ? 11.298  -83.611  78.763  1.00 114.77 ? 893  PHE A CG    1 
ATOM   7600  C  CD1   . PHE D 4  893  ? 11.881  -82.880  77.751  1.00 112.90 ? 893  PHE A CD1   1 
ATOM   7601  C  CD2   . PHE D 4  893  ? 11.977  -84.726  79.229  1.00 114.57 ? 893  PHE A CD2   1 
ATOM   7602  C  CE1   . PHE D 4  893  ? 13.090  -83.269  77.184  1.00 112.04 ? 893  PHE A CE1   1 
ATOM   7603  C  CE2   . PHE D 4  893  ? 13.192  -85.116  78.656  1.00 113.49 ? 893  PHE A CE2   1 
ATOM   7604  C  CZ    . PHE D 4  893  ? 13.743  -84.377  77.633  1.00 112.76 ? 893  PHE A CZ    1 
ATOM   7605  N  N     . GLU D 4  894  ? 9.142   -85.963  80.424  1.00 118.02 ? 894  GLU A N     1 
ATOM   7606  C  CA    . GLU D 4  894  ? 9.492   -87.355  80.680  1.00 119.08 ? 894  GLU A CA    1 
ATOM   7607  C  C     . GLU D 4  894  ? 8.624   -88.283  79.858  1.00 119.25 ? 894  GLU A C     1 
ATOM   7608  O  O     . GLU D 4  894  ? 9.133   -88.999  78.998  1.00 119.56 ? 894  GLU A O     1 
ATOM   7609  C  CB    . GLU D 4  894  ? 9.360   -87.689  82.170  1.00 119.42 ? 894  GLU A CB    1 
ATOM   7610  C  CG    . GLU D 4  894  ? 9.536   -89.162  82.526  1.00 121.01 ? 894  GLU A CG    1 
ATOM   7611  C  CD    . GLU D 4  894  ? 10.255  -89.348  83.854  1.00 123.47 ? 894  GLU A CD    1 
ATOM   7612  O  OE1   . GLU D 4  894  ? 9.740   -90.096  84.728  1.00 124.84 ? 894  GLU A OE1   1 
ATOM   7613  O  OE2   . GLU D 4  894  ? 11.341  -88.737  84.021  1.00 123.75 ? 894  GLU A OE2   1 
ATOM   7614  N  N     . LYS D 4  895  ? 7.316   -88.238  80.112  1.00 119.34 ? 895  LYS A N     1 
ATOM   7615  C  CA    . LYS D 4  895  ? 6.353   -89.143  79.489  1.00 119.46 ? 895  LYS A CA    1 
ATOM   7616  C  C     . LYS D 4  895  ? 6.273   -88.934  77.981  1.00 119.17 ? 895  LYS A C     1 
ATOM   7617  O  O     . LYS D 4  895  ? 5.530   -89.625  77.289  1.00 119.08 ? 895  LYS A O     1 
ATOM   7618  C  CB    . LYS D 4  895  ? 4.969   -88.947  80.109  1.00 119.40 ? 895  LYS A CB    1 
ATOM   7619  C  CG    . LYS D 4  895  ? 4.277   -87.662  79.653  1.00 120.10 ? 895  LYS A CG    1 
ATOM   7620  C  CD    . LYS D 4  895  ? 2.820   -87.574  80.100  1.00 120.24 ? 895  LYS A CD    1 
ATOM   7621  C  CE    . LYS D 4  895  ? 1.884   -88.487  79.291  1.00 121.17 ? 895  LYS A CE    1 
ATOM   7622  N  NZ    . LYS D 4  895  ? 1.655   -89.786  79.999  1.00 120.86 ? 895  LYS A NZ    1 
ATOM   7623  N  N     . ARG D 4  896  ? 7.051   -87.982  77.479  1.00 119.10 ? 896  ARG A N     1 
ATOM   7624  C  CA    . ARG D 4  896  ? 6.977   -87.602  76.080  1.00 119.15 ? 896  ARG A CA    1 
ATOM   7625  C  C     . ARG D 4  896  ? 8.098   -88.217  75.240  1.00 118.67 ? 896  ARG A C     1 
ATOM   7626  O  O     . ARG D 4  896  ? 7.895   -88.512  74.062  1.00 118.92 ? 896  ARG A O     1 
ATOM   7627  C  CB    . ARG D 4  896  ? 6.989   -86.083  75.968  1.00 119.23 ? 896  ARG A CB    1 
ATOM   7628  C  CG    . ARG D 4  896  ? 5.944   -85.521  75.053  1.00 120.78 ? 896  ARG A CG    1 
ATOM   7629  C  CD    . ARG D 4  896  ? 6.534   -85.108  73.715  1.00 123.67 ? 896  ARG A CD    1 
ATOM   7630  N  NE    . ARG D 4  896  ? 6.005   -83.811  73.278  1.00 126.34 ? 896  ARG A NE    1 
ATOM   7631  C  CZ    . ARG D 4  896  ? 6.501   -82.621  73.642  1.00 127.65 ? 896  ARG A CZ    1 
ATOM   7632  N  NH1   . ARG D 4  896  ? 7.554   -82.530  74.454  1.00 126.97 ? 896  ARG A NH1   1 
ATOM   7633  N  NH2   . ARG D 4  896  ? 5.940   -81.505  73.191  1.00 129.05 ? 896  ARG A NH2   1 
ATOM   7634  N  N     . TYR D 4  897  ? 9.262   -88.425  75.853  1.00 117.93 ? 897  TYR A N     1 
ATOM   7635  C  CA    . TYR D 4  897  ? 10.459  -88.873  75.137  1.00 117.22 ? 897  TYR A CA    1 
ATOM   7636  C  C     . TYR D 4  897  ? 11.084  -90.149  75.714  1.00 116.94 ? 897  TYR A C     1 
ATOM   7637  O  O     . TYR D 4  897  ? 11.905  -90.806  75.057  1.00 116.90 ? 897  TYR A O     1 
ATOM   7638  C  CB    . TYR D 4  897  ? 11.498  -87.756  75.136  1.00 117.02 ? 897  TYR A CB    1 
ATOM   7639  C  CG    . TYR D 4  897  ? 11.124  -86.580  74.284  1.00 116.91 ? 897  TYR A CG    1 
ATOM   7640  C  CD1   . TYR D 4  897  ? 10.150  -85.677  74.687  1.00 117.46 ? 897  TYR A CD1   1 
ATOM   7641  C  CD2   . TYR D 4  897  ? 11.748  -86.361  73.067  1.00 117.72 ? 897  TYR A CD2   1 
ATOM   7642  C  CE1   . TYR D 4  897  ? 9.805   -84.579  73.886  1.00 118.05 ? 897  TYR A CE1   1 
ATOM   7643  C  CE2   . TYR D 4  897  ? 11.410  -85.257  72.251  1.00 117.82 ? 897  TYR A CE2   1 
ATOM   7644  C  CZ    . TYR D 4  897  ? 10.441  -84.375  72.668  1.00 117.35 ? 897  TYR A CZ    1 
ATOM   7645  O  OH    . TYR D 4  897  ? 10.119  -83.296  71.878  1.00 116.67 ? 897  TYR A OH    1 
ATOM   7646  N  N     . ARG D 4  898  ? 10.696  -90.486  76.943  1.00 116.45 ? 898  ARG A N     1 
ATOM   7647  C  CA    . ARG D 4  898  ? 11.246  -91.632  77.648  1.00 115.91 ? 898  ARG A CA    1 
ATOM   7648  C  C     . ARG D 4  898  ? 10.789  -92.952  77.051  1.00 115.11 ? 898  ARG A C     1 
ATOM   7649  O  O     . ARG D 4  898  ? 9.585   -93.223  76.911  1.00 114.74 ? 898  ARG A O     1 
ATOM   7650  C  CB    . ARG D 4  898  ? 10.899  -91.570  79.142  1.00 116.24 ? 898  ARG A CB    1 
ATOM   7651  C  CG    . ARG D 4  898  ? 11.643  -92.590  80.036  1.00 118.38 ? 898  ARG A CG    1 
ATOM   7652  C  CD    . ARG D 4  898  ? 13.152  -92.721  79.699  1.00 120.85 ? 898  ARG A CD    1 
ATOM   7653  N  NE    . ARG D 4  898  ? 13.844  -93.667  80.583  1.00 122.54 ? 898  ARG A NE    1 
ATOM   7654  C  CZ    . ARG D 4  898  ? 15.039  -94.213  80.338  1.00 123.36 ? 898  ARG A CZ    1 
ATOM   7655  N  NH1   . ARG D 4  898  ? 15.712  -93.923  79.216  1.00 122.80 ? 898  ARG A NH1   1 
ATOM   7656  N  NH2   . ARG D 4  898  ? 15.558  -95.063  81.223  1.00 123.07 ? 898  ARG A NH2   1 
ATOM   7657  N  N     . VAL D 4  899  ? 11.779  -93.759  76.693  1.00 114.26 ? 899  VAL A N     1 
ATOM   7658  C  CA    . VAL D 4  899  ? 11.542  -95.133  76.296  1.00 113.68 ? 899  VAL A CA    1 
ATOM   7659  C  C     . VAL D 4  899  ? 12.430  -96.043  77.140  1.00 113.50 ? 899  VAL A C     1 
ATOM   7660  O  O     . VAL D 4  899  ? 13.658  -95.927  77.104  1.00 113.86 ? 899  VAL A O     1 
ATOM   7661  C  CB    . VAL D 4  899  ? 11.794  -95.335  74.795  1.00 113.52 ? 899  VAL A CB    1 
ATOM   7662  C  CG1   . VAL D 4  899  ? 11.896  -96.794  74.463  1.00 113.19 ? 899  VAL A CG1   1 
ATOM   7663  C  CG2   . VAL D 4  899  ? 10.668  -94.717  73.996  1.00 113.42 ? 899  VAL A CG2   1 
ATOM   7664  N  N     . ASP D 4  900  ? 11.792  -96.931  77.903  1.00 112.93 ? 900  ASP A N     1 
ATOM   7665  C  CA    . ASP D 4  900  ? 12.465  -97.820  78.848  1.00 112.50 ? 900  ASP A CA    1 
ATOM   7666  C  C     . ASP D 4  900  ? 11.983  -99.238  78.559  1.00 112.14 ? 900  ASP A C     1 
ATOM   7667  O  O     . ASP D 4  900  ? 10.904  -99.636  79.004  1.00 112.17 ? 900  ASP A O     1 
ATOM   7668  C  CB    . ASP D 4  900  ? 12.098  -97.399  80.285  1.00 112.82 ? 900  ASP A CB    1 
ATOM   7669  C  CG    . ASP D 4  900  ? 13.070  -97.922  81.358  1.00 112.85 ? 900  ASP A CG    1 
ATOM   7670  O  OD1   . ASP D 4  900  ? 14.021  -98.671  81.032  1.00 113.23 ? 900  ASP A OD1   1 
ATOM   7671  O  OD2   . ASP D 4  900  ? 12.863  -97.564  82.546  1.00 111.78 ? 900  ASP A OD2   1 
ATOM   7672  N  N     . LEU D 4  901  ? 12.764  -99.993  77.792  1.00 111.58 ? 901  LEU A N     1 
ATOM   7673  C  CA    . LEU D 4  901  ? 12.373  -101.352 77.397  1.00 111.16 ? 901  LEU A CA    1 
ATOM   7674  C  C     . LEU D 4  901  ? 12.472  -102.305 78.584  1.00 111.26 ? 901  LEU A C     1 
ATOM   7675  O  O     . LEU D 4  901  ? 11.746  -103.300 78.674  1.00 111.27 ? 901  LEU A O     1 
ATOM   7676  C  CB    . LEU D 4  901  ? 13.237  -101.863 76.245  1.00 110.81 ? 901  LEU A CB    1 
ATOM   7677  C  CG    . LEU D 4  901  ? 13.431  -100.924 75.059  1.00 110.48 ? 901  LEU A CG    1 
ATOM   7678  C  CD1   . LEU D 4  901  ? 14.606  -101.325 74.175  1.00 109.92 ? 901  LEU A CD1   1 
ATOM   7679  C  CD2   . LEU D 4  901  ? 12.150  -100.818 74.261  1.00 110.40 ? 901  LEU A CD2   1 
ATOM   7680  N  N     . LEU D 4  902  ? 13.379  -101.979 79.498  1.00 111.29 ? 902  LEU A N     1 
ATOM   7681  C  CA    . LEU D 4  902  ? 13.617  -102.781 80.687  1.00 111.02 ? 902  LEU A CA    1 
ATOM   7682  C  C     . LEU D 4  902  ? 12.533  -102.551 81.741  1.00 111.14 ? 902  LEU A C     1 
ATOM   7683  O  O     . LEU D 4  902  ? 12.460  -103.301 82.716  1.00 111.25 ? 902  LEU A O     1 
ATOM   7684  C  CB    . LEU D 4  902  ? 15.003  -102.483 81.257  1.00 110.80 ? 902  LEU A CB    1 
ATOM   7685  C  CG    . LEU D 4  902  ? 16.193  -102.498 80.299  1.00 110.15 ? 902  LEU A CG    1 
ATOM   7686  C  CD1   . LEU D 4  902  ? 17.275  -101.580 80.814  1.00 110.14 ? 902  LEU A CD1   1 
ATOM   7687  C  CD2   . LEU D 4  902  ? 16.730  -103.894 80.084  1.00 109.86 ? 902  LEU A CD2   1 
ATOM   7688  N  N     . ASN D 4  903  ? 11.714  -101.508 81.554  1.00 111.13 ? 903  ASN A N     1 
ATOM   7689  C  CA    . ASN D 4  903  ? 10.496  -101.319 82.348  1.00 111.09 ? 903  ASN A CA    1 
ATOM   7690  C  C     . ASN D 4  903  ? 9.298   -101.716 81.518  1.00 111.19 ? 903  ASN A C     1 
ATOM   7691  O  O     . ASN D 4  903  ? 9.045   -101.150 80.458  1.00 111.04 ? 903  ASN A O     1 
ATOM   7692  C  CB    . ASN D 4  903  ? 10.334  -99.878  82.866  1.00 111.00 ? 903  ASN A CB    1 
ATOM   7693  C  CG    . ASN D 4  903  ? 9.147   -99.721  83.834  1.00 110.76 ? 903  ASN A CG    1 
ATOM   7694  O  OD1   . ASN D 4  903  ? 8.282   -100.588 83.927  1.00 110.38 ? 903  ASN A OD1   1 
ATOM   7695  N  ND2   . ASN D 4  903  ? 9.112   -98.606  84.551  1.00 110.56 ? 903  ASN A ND2   1 
ATOM   7696  N  N     . THR D 4  904  ? 8.564   -102.697 82.023  1.00 111.49 ? 904  THR A N     1 
ATOM   7697  C  CA    . THR D 4  904  ? 7.361   -103.198 81.375  1.00 111.87 ? 904  THR A CA    1 
ATOM   7698  C  C     . THR D 4  904  ? 6.308   -102.086 81.148  1.00 112.12 ? 904  THR A C     1 
ATOM   7699  O  O     . THR D 4  904  ? 5.471   -102.176 80.247  1.00 111.91 ? 904  THR A O     1 
ATOM   7700  C  CB    . THR D 4  904  ? 6.794   -104.441 82.147  1.00 111.82 ? 904  THR A CB    1 
ATOM   7701  O  OG1   . THR D 4  904  ? 5.516   -104.811 81.627  1.00 112.39 ? 904  THR A OG1   1 
ATOM   7702  C  CG2   . THR D 4  904  ? 6.650   -104.173 83.630  1.00 111.60 ? 904  THR A CG2   1 
ATOM   7703  N  N     . ASP D 4  905  ? 6.387   -101.024 81.940  1.00 112.56 ? 905  ASP A N     1 
ATOM   7704  C  CA    . ASP D 4  905  ? 5.388   -99.981  81.890  1.00 113.24 ? 905  ASP A CA    1 
ATOM   7705  C  C     . ASP D 4  905  ? 5.763   -98.840  80.978  1.00 113.71 ? 905  ASP A C     1 
ATOM   7706  O  O     . ASP D 4  905  ? 4.892   -98.108  80.519  1.00 113.95 ? 905  ASP A O     1 
ATOM   7707  C  CB    . ASP D 4  905  ? 5.104   -99.461  83.289  1.00 113.35 ? 905  ASP A CB    1 
ATOM   7708  C  CG    . ASP D 4  905  ? 4.335   -100.464 84.133  1.00 114.25 ? 905  ASP A CG    1 
ATOM   7709  O  OD1   . ASP D 4  905  ? 4.488   -101.687 83.901  1.00 114.88 ? 905  ASP A OD1   1 
ATOM   7710  O  OD2   . ASP D 4  905  ? 3.574   -100.035 85.033  1.00 114.95 ? 905  ASP A OD2   1 
ATOM   7711  N  N     . HIS D 4  906  ? 7.051   -98.685  80.706  1.00 114.31 ? 906  HIS A N     1 
ATOM   7712  C  CA    . HIS D 4  906  ? 7.508   -97.581  79.863  1.00 115.04 ? 906  HIS A CA    1 
ATOM   7713  C  C     . HIS D 4  906  ? 8.113   -98.039  78.535  1.00 114.92 ? 906  HIS A C     1 
ATOM   7714  O  O     . HIS D 4  906  ? 8.955   -97.333  77.969  1.00 114.72 ? 906  HIS A O     1 
ATOM   7715  C  CB    . HIS D 4  906  ? 8.520   -96.708  80.611  1.00 115.53 ? 906  HIS A CB    1 
ATOM   7716  C  CG    . HIS D 4  906  ? 7.965   -96.014  81.817  1.00 117.69 ? 906  HIS A CG    1 
ATOM   7717  N  ND1   . HIS D 4  906  ? 7.233   -96.668  82.790  1.00 119.71 ? 906  HIS A ND1   1 
ATOM   7718  C  CD2   . HIS D 4  906  ? 8.071   -94.726  82.229  1.00 119.63 ? 906  HIS A CD2   1 
ATOM   7719  C  CE1   . HIS D 4  906  ? 6.895   -95.809  83.736  1.00 120.62 ? 906  HIS A CE1   1 
ATOM   7720  N  NE2   . HIS D 4  906  ? 7.391   -94.623  83.420  1.00 120.87 ? 906  HIS A NE2   1 
ATOM   7721  N  N     . THR D 4  907  ? 7.702   -99.215  78.054  1.00 114.97 ? 907  THR A N     1 
ATOM   7722  C  CA    . THR D 4  907  ? 8.079   -99.674  76.711  1.00 115.13 ? 907  THR A CA    1 
ATOM   7723  C  C     . THR D 4  907  ? 7.126   -99.132  75.673  1.00 115.11 ? 907  THR A C     1 
ATOM   7724  O  O     . THR D 4  907  ? 6.089   -98.559  76.008  1.00 115.22 ? 907  THR A O     1 
ATOM   7725  C  CB    . THR D 4  907  ? 8.023   -101.194 76.547  1.00 115.08 ? 907  THR A CB    1 
ATOM   7726  O  OG1   . THR D 4  907  ? 6.737   -101.681 76.955  1.00 115.53 ? 907  THR A OG1   1 
ATOM   7727  C  CG2   . THR D 4  907  ? 9.096   -101.845 77.347  1.00 115.57 ? 907  THR A CG2   1 
ATOM   7728  N  N     . LEU D 4  908  ? 7.479   -99.326  74.407  1.00 115.06 ? 908  LEU A N     1 
ATOM   7729  C  CA    . LEU D 4  908  ? 6.576   -99.001  73.326  1.00 115.01 ? 908  LEU A CA    1 
ATOM   7730  C  C     . LEU D 4  908  ? 5.641   -100.173 73.170  1.00 115.23 ? 908  LEU A C     1 
ATOM   7731  O  O     . LEU D 4  908  ? 6.030   -101.216 72.644  1.00 115.21 ? 908  LEU A O     1 
ATOM   7732  C  CB    . LEU D 4  908  ? 7.322   -98.765  72.020  1.00 114.79 ? 908  LEU A CB    1 
ATOM   7733  C  CG    . LEU D 4  908  ? 8.538   -97.866  72.086  1.00 113.85 ? 908  LEU A CG    1 
ATOM   7734  C  CD1   . LEU D 4  908  ? 9.761   -98.733  72.062  1.00 113.40 ? 908  LEU A CD1   1 
ATOM   7735  C  CD2   . LEU D 4  908  ? 8.511   -96.980  70.891  1.00 113.37 ? 908  LEU A CD2   1 
ATOM   7736  N  N     . ASP D 4  909  ? 4.416   -99.998  73.657  1.00 115.49 ? 909  ASP A N     1 
ATOM   7737  C  CA    . ASP D 4  909  ? 3.355   -100.973 73.494  1.00 115.80 ? 909  ASP A CA    1 
ATOM   7738  C  C     . ASP D 4  909  ? 3.505   -101.663 72.129  1.00 115.49 ? 909  ASP A C     1 
ATOM   7739  O  O     . ASP D 4  909  ? 3.581   -100.987 71.105  1.00 115.64 ? 909  ASP A O     1 
ATOM   7740  C  CB    . ASP D 4  909  ? 1.998   -100.273 73.615  1.00 116.11 ? 909  ASP A CB    1 
ATOM   7741  C  CG    . ASP D 4  909  ? 0.856   -101.247 73.839  1.00 117.84 ? 909  ASP A CG    1 
ATOM   7742  O  OD1   . ASP D 4  909  ? -0.193  -101.098 73.169  1.00 119.19 ? 909  ASP A OD1   1 
ATOM   7743  O  OD2   . ASP D 4  909  ? 1.010   -102.168 74.681  1.00 119.51 ? 909  ASP A OD2   1 
ATOM   7744  N  N     . PRO D 4  910  ? 3.587   -103.008 72.111  1.00 115.17 ? 910  PRO A N     1 
ATOM   7745  C  CA    . PRO D 4  910  ? 3.831   -103.754 70.866  1.00 114.98 ? 910  PRO A CA    1 
ATOM   7746  C  C     . PRO D 4  910  ? 2.767   -103.516 69.788  1.00 114.84 ? 910  PRO A C     1 
ATOM   7747  O  O     . PRO D 4  910  ? 2.843   -104.092 68.692  1.00 114.88 ? 910  PRO A O     1 
ATOM   7748  C  CB    . PRO D 4  910  ? 3.825   -105.214 71.320  1.00 114.86 ? 910  PRO A CB    1 
ATOM   7749  C  CG    . PRO D 4  910  ? 3.115   -105.201 72.620  1.00 115.15 ? 910  PRO A CG    1 
ATOM   7750  C  CD    . PRO D 4  910  ? 3.461   -103.910 73.264  1.00 115.16 ? 910  PRO A CD    1 
ATOM   7751  N  N     . SER D 4  911  ? 1.784   -102.677 70.110  1.00 114.50 ? 911  SER A N     1 
ATOM   7752  C  CA    . SER D 4  911  ? 0.836   -102.179 69.124  1.00 114.16 ? 911  SER A CA    1 
ATOM   7753  C  C     . SER D 4  911  ? 1.507   -101.161 68.192  1.00 113.77 ? 911  SER A C     1 
ATOM   7754  O  O     . SER D 4  911  ? 1.184   -101.098 67.006  1.00 113.93 ? 911  SER A O     1 
ATOM   7755  C  CB    . SER D 4  911  ? -0.414  -101.583 69.803  1.00 114.28 ? 911  SER A CB    1 
ATOM   7756  O  OG    . SER D 4  911  ? -0.139  -100.381 70.513  1.00 114.20 ? 911  SER A OG    1 
ATOM   7757  N  N     . LEU D 4  912  ? 2.450   -100.393 68.733  1.00 113.10 ? 912  LEU A N     1 
ATOM   7758  C  CA    . LEU D 4  912  ? 3.103   -99.322  68.003  1.00 112.64 ? 912  LEU A CA    1 
ATOM   7759  C  C     . LEU D 4  912  ? 4.129   -99.887  67.040  1.00 112.81 ? 912  LEU A C     1 
ATOM   7760  O  O     . LEU D 4  912  ? 3.973   -99.797  65.833  1.00 112.69 ? 912  LEU A O     1 
ATOM   7761  C  CB    . LEU D 4  912  ? 3.757   -98.336  68.971  1.00 112.42 ? 912  LEU A CB    1 
ATOM   7762  C  CG    . LEU D 4  912  ? 3.013   -97.996  70.268  1.00 112.06 ? 912  LEU A CG    1 
ATOM   7763  C  CD1   . LEU D 4  912  ? 3.871   -97.131  71.174  1.00 111.23 ? 912  LEU A CD1   1 
ATOM   7764  C  CD2   . LEU D 4  912  ? 1.646   -97.356  70.026  1.00 112.09 ? 912  LEU A CD2   1 
ATOM   7765  N  N     . LEU D 4  913  ? 5.182   -100.480 67.568  1.00 113.42 ? 913  LEU A N     1 
ATOM   7766  C  CA    . LEU D 4  913  ? 6.173   -101.112 66.712  1.00 113.98 ? 913  LEU A CA    1 
ATOM   7767  C  C     . LEU D 4  913  ? 5.766   -102.556 66.358  1.00 114.33 ? 913  LEU A C     1 
ATOM   7768  O  O     . LEU D 4  913  ? 4.973   -103.177 67.073  1.00 114.47 ? 913  LEU A O     1 
ATOM   7769  C  CB    . LEU D 4  913  ? 7.551   -101.033 67.381  1.00 113.94 ? 913  LEU A CB    1 
ATOM   7770  C  CG    . LEU D 4  913  ? 8.836   -101.661 66.811  1.00 114.00 ? 913  LEU A CG    1 
ATOM   7771  C  CD1   . LEU D 4  913  ? 8.943   -101.712 65.279  1.00 114.37 ? 913  LEU A CD1   1 
ATOM   7772  C  CD2   . LEU D 4  913  ? 10.040  -100.942 67.391  1.00 114.28 ? 913  LEU A CD2   1 
ATOM   7773  N  N     . GLU D 4  914  ? 6.287   -103.071 65.241  1.00 114.60 ? 914  GLU A N     1 
ATOM   7774  C  CA    . GLU D 4  914  ? 6.050   -104.458 64.838  1.00 114.99 ? 914  GLU A CA    1 
ATOM   7775  C  C     . GLU D 4  914  ? 6.886   -105.430 65.645  1.00 114.90 ? 914  GLU A C     1 
ATOM   7776  O  O     . GLU D 4  914  ? 6.473   -106.578 65.836  1.00 115.07 ? 914  GLU A O     1 
ATOM   7777  C  CB    . GLU D 4  914  ? 6.359   -104.667 63.364  1.00 115.19 ? 914  GLU A CB    1 
ATOM   7778  C  CG    . GLU D 4  914  ? 5.473   -105.695 62.701  1.00 116.40 ? 914  GLU A CG    1 
ATOM   7779  C  CD    . GLU D 4  914  ? 4.922   -105.169 61.387  1.00 118.98 ? 914  GLU A CD    1 
ATOM   7780  O  OE1   . GLU D 4  914  ? 5.733   -104.969 60.453  1.00 120.44 ? 914  GLU A OE1   1 
ATOM   7781  O  OE2   . GLU D 4  914  ? 3.690   -104.925 61.288  1.00 119.38 ? 914  GLU A OE2   1 
ATOM   7782  N  N     . SER D 4  915  ? 8.064   -104.981 66.091  1.00 114.64 ? 915  SER A N     1 
ATOM   7783  C  CA    . SER D 4  915  ? 8.919   -105.799 66.962  1.00 114.40 ? 915  SER A CA    1 
ATOM   7784  C  C     . SER D 4  915  ? 8.578   -105.701 68.463  1.00 114.40 ? 915  SER A C     1 
ATOM   7785  O  O     . SER D 4  915  ? 8.808   -106.645 69.212  1.00 114.45 ? 915  SER A O     1 
ATOM   7786  C  CB    . SER D 4  915  ? 10.417  -105.574 66.684  1.00 114.20 ? 915  SER A CB    1 
ATOM   7787  O  OG    . SER D 4  915  ? 10.770  -104.210 66.647  1.00 113.62 ? 915  SER A OG    1 
ATOM   7788  N  N     . GLY D 4  916  ? 8.011   -104.566 68.874  1.00 114.35 ? 916  GLY A N     1 
ATOM   7789  C  CA    . GLY D 4  916  ? 7.534   -104.302 70.248  1.00 114.28 ? 916  GLY A CA    1 
ATOM   7790  C  C     . GLY D 4  916  ? 7.614   -105.359 71.339  1.00 114.16 ? 916  GLY A C     1 
ATOM   7791  O  O     . GLY D 4  916  ? 8.274   -105.154 72.365  1.00 113.84 ? 916  GLY A O     1 
ATOM   7792  N  N     . SER D 4  917  ? 6.921   -106.474 71.124  1.00 114.35 ? 917  SER A N     1 
ATOM   7793  C  CA    . SER D 4  917  ? 6.882   -107.581 72.088  1.00 114.70 ? 917  SER A CA    1 
ATOM   7794  C  C     . SER D 4  917  ? 8.219   -108.295 72.170  1.00 114.71 ? 917  SER A C     1 
ATOM   7795  O  O     . SER D 4  917  ? 8.618   -108.774 73.228  1.00 114.73 ? 917  SER A O     1 
ATOM   7796  C  CB    . SER D 4  917  ? 5.795   -108.598 71.713  1.00 114.78 ? 917  SER A CB    1 
ATOM   7797  O  OG    . SER D 4  917  ? 6.104   -109.263 70.493  1.00 115.17 ? 917  SER A OG    1 
ATOM   7798  N  N     . GLU D 4  918  ? 8.893   -108.371 71.030  1.00 114.80 ? 918  GLU A N     1 
ATOM   7799  C  CA    . GLU D 4  918  ? 10.192  -108.993 70.924  1.00 115.02 ? 918  GLU A CA    1 
ATOM   7800  C  C     . GLU D 4  918  ? 11.277  -108.046 71.428  1.00 114.91 ? 918  GLU A C     1 
ATOM   7801  O  O     . GLU D 4  918  ? 12.428  -108.454 71.582  1.00 115.01 ? 918  GLU A O     1 
ATOM   7802  C  CB    . GLU D 4  918  ? 10.440  -109.361 69.466  1.00 115.24 ? 918  GLU A CB    1 
ATOM   7803  C  CG    . GLU D 4  918  ? 11.692  -110.166 69.200  1.00 116.55 ? 918  GLU A CG    1 
ATOM   7804  C  CD    . GLU D 4  918  ? 12.207  -109.974 67.780  1.00 118.62 ? 918  GLU A CD    1 
ATOM   7805  O  OE1   . GLU D 4  918  ? 13.205  -110.640 67.433  1.00 120.14 ? 918  GLU A OE1   1 
ATOM   7806  O  OE2   . GLU D 4  918  ? 11.624  -109.167 67.011  1.00 118.22 ? 918  GLU A OE2   1 
ATOM   7807  N  N     . ILE D 4  919  ? 10.908  -106.789 71.688  1.00 114.84 ? 919  ILE A N     1 
ATOM   7808  C  CA    . ILE D 4  919  ? 11.860  -105.776 72.158  1.00 114.68 ? 919  ILE A CA    1 
ATOM   7809  C  C     . ILE D 4  919  ? 11.995  -105.759 73.687  1.00 114.73 ? 919  ILE A C     1 
ATOM   7810  O  O     . ILE D 4  919  ? 13.104  -105.609 74.207  1.00 114.68 ? 919  ILE A O     1 
ATOM   7811  C  CB    . ILE D 4  919  ? 11.505  -104.356 71.662  1.00 114.48 ? 919  ILE A CB    1 
ATOM   7812  C  CG1   . ILE D 4  919  ? 11.223  -104.336 70.153  1.00 114.80 ? 919  ILE A CG1   1 
ATOM   7813  C  CG2   . ILE D 4  919  ? 12.634  -103.410 71.970  1.00 114.47 ? 919  ILE A CG2   1 
ATOM   7814  C  CD1   . ILE D 4  919  ? 12.392  -103.849 69.257  1.00 115.73 ? 919  ILE A CD1   1 
ATOM   7815  N  N     . LEU D 4  920  ? 10.867  -105.918 74.388  1.00 114.85 ? 920  LEU A N     1 
ATOM   7816  C  CA    . LEU D 4  920  ? 10.801  -105.901 75.863  1.00 114.94 ? 920  LEU A CA    1 
ATOM   7817  C  C     . LEU D 4  920  ? 11.903  -106.704 76.523  1.00 114.96 ? 920  LEU A C     1 
ATOM   7818  O  O     . LEU D 4  920  ? 12.185  -107.826 76.118  1.00 114.96 ? 920  LEU A O     1 
ATOM   7819  C  CB    . LEU D 4  920  ? 9.463   -106.445 76.351  1.00 115.05 ? 920  LEU A CB    1 
ATOM   7820  C  CG    . LEU D 4  920  ? 8.787   -105.813 77.574  1.00 115.26 ? 920  LEU A CG    1 
ATOM   7821  C  CD1   . LEU D 4  920  ? 7.491   -106.561 77.842  1.00 116.04 ? 920  LEU A CD1   1 
ATOM   7822  C  CD2   . LEU D 4  920  ? 9.652   -105.785 78.835  1.00 114.94 ? 920  LEU A CD2   1 
ATOM   7823  N  N     . GLY D 4  921  ? 12.478  -106.137 77.578  1.00 115.15 ? 921  GLY A N     1 
ATOM   7824  C  CA    . GLY D 4  921  ? 13.748  -106.607 78.115  1.00 115.47 ? 921  GLY A CA    1 
ATOM   7825  C  C     . GLY D 4  921  ? 14.794  -105.979 77.227  1.00 115.75 ? 921  GLY A C     1 
ATOM   7826  O  O     . GLY D 4  921  ? 14.546  -104.925 76.650  1.00 115.86 ? 921  GLY A O     1 
ATOM   7827  N  N     . ASP D 4  922  ? 15.953  -106.618 77.105  1.00 116.09 ? 922  ASP A N     1 
ATOM   7828  C  CA    . ASP D 4  922  ? 16.964  -106.231 76.098  1.00 116.62 ? 922  ASP A CA    1 
ATOM   7829  C  C     . ASP D 4  922  ? 17.922  -105.099 76.508  1.00 116.74 ? 922  ASP A C     1 
ATOM   7830  O  O     . ASP D 4  922  ? 17.537  -103.930 76.609  1.00 116.83 ? 922  ASP A O     1 
ATOM   7831  C  CB    . ASP D 4  922  ? 16.312  -105.912 74.734  1.00 116.62 ? 922  ASP A CB    1 
ATOM   7832  C  CG    . ASP D 4  922  ? 17.333  -105.691 73.629  1.00 117.04 ? 922  ASP A CG    1 
ATOM   7833  O  OD1   . ASP D 4  922  ? 18.354  -104.994 73.857  1.00 117.40 ? 922  ASP A OD1   1 
ATOM   7834  O  OD2   . ASP D 4  922  ? 17.107  -106.219 72.521  1.00 117.47 ? 922  ASP A OD2   1 
ATOM   7835  N  N     . LEU D 4  923  ? 19.186  -105.462 76.692  1.00 116.76 ? 923  LEU A N     1 
ATOM   7836  C  CA    . LEU D 4  923  ? 20.208  -104.504 77.071  1.00 116.61 ? 923  LEU A CA    1 
ATOM   7837  C  C     . LEU D 4  923  ? 20.729  -103.783 75.834  1.00 116.57 ? 923  LEU A C     1 
ATOM   7838  O  O     . LEU D 4  923  ? 20.701  -102.557 75.771  1.00 116.85 ? 923  LEU A O     1 
ATOM   7839  C  CB    . LEU D 4  923  ? 21.332  -105.215 77.822  1.00 116.52 ? 923  LEU A CB    1 
ATOM   7840  C  CG    . LEU D 4  923  ? 20.810  -106.388 78.662  1.00 116.54 ? 923  LEU A CG    1 
ATOM   7841  C  CD1   . LEU D 4  923  ? 21.942  -107.330 79.088  1.00 116.79 ? 923  LEU A CD1   1 
ATOM   7842  C  CD2   . LEU D 4  923  ? 20.000  -105.889 79.864  1.00 115.98 ? 923  LEU A CD2   1 
ATOM   7843  N  N     . LYS D 4  924  ? 21.157  -104.545 74.832  1.00 116.43 ? 924  LYS A N     1 
ATOM   7844  C  CA    . LYS D 4  924  ? 21.844  -103.976 73.675  1.00 116.29 ? 924  LYS A CA    1 
ATOM   7845  C  C     . LYS D 4  924  ? 21.146  -102.751 73.094  1.00 115.83 ? 924  LYS A C     1 
ATOM   7846  O  O     . LYS D 4  924  ? 21.816  -101.810 72.695  1.00 115.98 ? 924  LYS A O     1 
ATOM   7847  C  CB    . LYS D 4  924  ? 22.121  -105.041 72.610  1.00 116.29 ? 924  LYS A CB    1 
ATOM   7848  C  CG    . LYS D 4  924  ? 23.131  -106.109 73.075  1.00 116.88 ? 924  LYS A CG    1 
ATOM   7849  C  CD    . LYS D 4  924  ? 23.470  -107.110 71.980  1.00 117.10 ? 924  LYS A CD    1 
ATOM   7850  C  CE    . LYS D 4  924  ? 24.450  -106.514 70.977  1.00 118.84 ? 924  LYS A CE    1 
ATOM   7851  N  NZ    . LYS D 4  924  ? 24.210  -107.025 69.597  1.00 120.04 ? 924  LYS A NZ    1 
ATOM   7852  N  N     . LEU D 4  925  ? 19.813  -102.751 73.084  1.00 115.51 ? 925  LEU A N     1 
ATOM   7853  C  CA    . LEU D 4  925  ? 19.033  -101.604 72.578  1.00 115.15 ? 925  LEU A CA    1 
ATOM   7854  C  C     . LEU D 4  925  ? 18.825  -100.530 73.616  1.00 114.87 ? 925  LEU A C     1 
ATOM   7855  O  O     . LEU D 4  925  ? 18.884  -99.353  73.294  1.00 114.88 ? 925  LEU A O     1 
ATOM   7856  C  CB    . LEU D 4  925  ? 17.651  -102.020 72.075  1.00 115.04 ? 925  LEU A CB    1 
ATOM   7857  C  CG    . LEU D 4  925  ? 17.570  -102.823 70.795  1.00 114.95 ? 925  LEU A CG    1 
ATOM   7858  C  CD1   . LEU D 4  925  ? 16.201  -103.446 70.705  1.00 115.15 ? 925  LEU A CD1   1 
ATOM   7859  C  CD2   . LEU D 4  925  ? 17.831  -101.907 69.633  1.00 116.20 ? 925  LEU A CD2   1 
ATOM   7860  N  N     . GLN D 4  926  ? 18.544  -100.932 74.853  1.00 114.59 ? 926  GLN A N     1 
ATOM   7861  C  CA    . GLN D 4  926  ? 18.286  -99.962  75.902  1.00 114.35 ? 926  GLN A CA    1 
ATOM   7862  C  C     . GLN D 4  926  ? 19.447  -99.017  76.077  1.00 114.64 ? 926  GLN A C     1 
ATOM   7863  O  O     . GLN D 4  926  ? 19.259  -97.892  76.525  1.00 114.83 ? 926  GLN A O     1 
ATOM   7864  C  CB    . GLN D 4  926  ? 17.942  -100.623 77.227  1.00 113.93 ? 926  GLN A CB    1 
ATOM   7865  C  CG    . GLN D 4  926  ? 16.493  -100.439 77.582  1.00 113.43 ? 926  GLN A CG    1 
ATOM   7866  C  CD    . GLN D 4  926  ? 16.105  -98.983  77.736  1.00 112.77 ? 926  GLN A CD    1 
ATOM   7867  O  OE1   . GLN D 4  926  ? 16.873  -98.176  78.249  1.00 113.44 ? 926  GLN A OE1   1 
ATOM   7868  N  NE2   . GLN D 4  926  ? 14.907  -98.644  77.296  1.00 111.13 ? 926  GLN A NE2   1 
ATOM   7869  N  N     . VAL D 4  927  ? 20.639  -99.466  75.696  1.00 114.84 ? 927  VAL A N     1 
ATOM   7870  C  CA    . VAL D 4  927  ? 21.826  -98.639  75.805  1.00 114.98 ? 927  VAL A CA    1 
ATOM   7871  C  C     . VAL D 4  927  ? 21.806  -97.543  74.751  1.00 114.88 ? 927  VAL A C     1 
ATOM   7872  O  O     . VAL D 4  927  ? 22.445  -96.507  74.920  1.00 115.09 ? 927  VAL A O     1 
ATOM   7873  C  CB    . VAL D 4  927  ? 23.117  -99.469  75.718  1.00 115.04 ? 927  VAL A CB    1 
ATOM   7874  C  CG1   . VAL D 4  927  ? 23.615  -99.576  74.260  1.00 114.72 ? 927  VAL A CG1   1 
ATOM   7875  C  CG2   . VAL D 4  927  ? 24.176  -98.860  76.633  1.00 115.65 ? 927  VAL A CG2   1 
ATOM   7876  N  N     . LEU D 4  928  ? 21.058  -97.785  73.677  1.00 114.86 ? 928  LEU A N     1 
ATOM   7877  C  CA    . LEU D 4  928  ? 20.864  -96.803  72.614  1.00 114.94 ? 928  LEU A CA    1 
ATOM   7878  C  C     . LEU D 4  928  ? 19.728  -95.824  72.888  1.00 114.99 ? 928  LEU A C     1 
ATOM   7879  O  O     . LEU D 4  928  ? 19.890  -94.640  72.658  1.00 115.01 ? 928  LEU A O     1 
ATOM   7880  C  CB    . LEU D 4  928  ? 20.638  -97.485  71.264  1.00 114.94 ? 928  LEU A CB    1 
ATOM   7881  C  CG    . LEU D 4  928  ? 21.852  -97.821  70.396  1.00 114.82 ? 928  LEU A CG    1 
ATOM   7882  C  CD1   . LEU D 4  928  ? 21.384  -98.394  69.059  1.00 113.91 ? 928  LEU A CD1   1 
ATOM   7883  C  CD2   . LEU D 4  928  ? 22.744  -96.591  70.185  1.00 114.63 ? 928  LEU A CD2   1 
ATOM   7884  N  N     . LEU D 4  929  ? 18.581  -96.309  73.361  1.00 115.27 ? 929  LEU A N     1 
ATOM   7885  C  CA    . LEU D 4  929  ? 17.485  -95.421  73.774  1.00 115.61 ? 929  LEU A CA    1 
ATOM   7886  C  C     . LEU D 4  929  ? 17.824  -94.640  75.024  1.00 116.18 ? 929  LEU A C     1 
ATOM   7887  O  O     . LEU D 4  929  ? 17.202  -93.616  75.309  1.00 116.01 ? 929  LEU A O     1 
ATOM   7888  C  CB    . LEU D 4  929  ? 16.212  -96.202  74.043  1.00 115.37 ? 929  LEU A CB    1 
ATOM   7889  C  CG    . LEU D 4  929  ? 15.488  -96.721  72.818  1.00 115.18 ? 929  LEU A CG    1 
ATOM   7890  C  CD1   . LEU D 4  929  ? 14.786  -97.983  73.192  1.00 116.70 ? 929  LEU A CD1   1 
ATOM   7891  C  CD2   . LEU D 4  929  ? 14.504  -95.725  72.322  1.00 114.63 ? 929  LEU A CD2   1 
ATOM   7892  N  N     . ASP D 4  930  ? 18.783  -95.161  75.786  1.00 117.02 ? 930  ASP A N     1 
ATOM   7893  C  CA    . ASP D 4  930  ? 19.283  -94.472  76.950  1.00 117.85 ? 930  ASP A CA    1 
ATOM   7894  C  C     . ASP D 4  930  ? 20.099  -93.306  76.479  1.00 118.25 ? 930  ASP A C     1 
ATOM   7895  O  O     . ASP D 4  930  ? 19.717  -92.163  76.696  1.00 118.49 ? 930  ASP A O     1 
ATOM   7896  C  CB    . ASP D 4  930  ? 20.118  -95.392  77.842  1.00 118.01 ? 930  ASP A CB    1 
ATOM   7897  C  CG    . ASP D 4  930  ? 19.331  -95.924  79.028  1.00 119.00 ? 930  ASP A CG    1 
ATOM   7898  O  OD1   . ASP D 4  930  ? 18.179  -95.459  79.221  1.00 120.19 ? 930  ASP A OD1   1 
ATOM   7899  O  OD2   . ASP D 4  930  ? 19.862  -96.795  79.764  1.00 119.29 ? 930  ASP A OD2   1 
ATOM   7900  N  N     . GLU D 4  931  ? 21.207  -93.574  75.802  1.00 118.86 ? 931  GLU A N     1 
ATOM   7901  C  CA    . GLU D 4  931  ? 22.066  -92.469  75.413  1.00 119.70 ? 931  GLU A CA    1 
ATOM   7902  C  C     . GLU D 4  931  ? 21.375  -91.533  74.391  1.00 119.49 ? 931  GLU A C     1 
ATOM   7903  O  O     . GLU D 4  931  ? 21.850  -90.427  74.151  1.00 119.72 ? 931  GLU A O     1 
ATOM   7904  C  CB    . GLU D 4  931  ? 23.506  -92.918  75.051  1.00 119.89 ? 931  GLU A CB    1 
ATOM   7905  C  CG    . GLU D 4  931  ? 23.674  -93.722  73.775  1.00 122.97 ? 931  GLU A CG    1 
ATOM   7906  C  CD    . GLU D 4  931  ? 23.495  -92.867  72.513  1.00 128.40 ? 931  GLU A CD    1 
ATOM   7907  O  OE1   . GLU D 4  931  ? 23.796  -91.644  72.580  1.00 130.55 ? 931  GLU A OE1   1 
ATOM   7908  O  OE2   . GLU D 4  931  ? 23.048  -93.408  71.457  1.00 130.07 ? 931  GLU A OE2   1 
ATOM   7909  N  N     . GLU D 4  932  ? 20.243  -91.967  73.826  1.00 119.35 ? 932  GLU A N     1 
ATOM   7910  C  CA    . GLU D 4  932  ? 19.384  -91.076  73.039  1.00 119.14 ? 932  GLU A CA    1 
ATOM   7911  C  C     . GLU D 4  932  ? 18.686  -90.133  74.013  1.00 118.86 ? 932  GLU A C     1 
ATOM   7912  O  O     . GLU D 4  932  ? 18.606  -88.929  73.761  1.00 119.36 ? 932  GLU A O     1 
ATOM   7913  C  CB    . GLU D 4  932  ? 18.320  -91.840  72.223  1.00 119.17 ? 932  GLU A CB    1 
ATOM   7914  C  CG    . GLU D 4  932  ? 17.373  -90.942  71.337  1.00 119.65 ? 932  GLU A CG    1 
ATOM   7915  C  CD    . GLU D 4  932  ? 15.851  -91.358  71.303  1.00 119.63 ? 932  GLU A CD    1 
ATOM   7916  O  OE1   . GLU D 4  932  ? 15.279  -91.436  70.184  1.00 119.99 ? 932  GLU A OE1   1 
ATOM   7917  O  OE2   . GLU D 4  932  ? 15.217  -91.563  72.377  1.00 119.07 ? 932  GLU A OE2   1 
ATOM   7918  N  N     . TYR D 4  933  ? 18.177  -90.681  75.117  1.00 118.04 ? 933  TYR A N     1 
ATOM   7919  C  CA    . TYR D 4  933  ? 17.421  -89.892  76.081  1.00 117.09 ? 933  TYR A CA    1 
ATOM   7920  C  C     . TYR D 4  933  ? 18.335  -89.053  76.959  1.00 116.70 ? 933  TYR A C     1 
ATOM   7921  O  O     . TYR D 4  933  ? 17.858  -88.127  77.604  1.00 116.55 ? 933  TYR A O     1 
ATOM   7922  C  CB    . TYR D 4  933  ? 16.520  -90.787  76.925  1.00 117.15 ? 933  TYR A CB    1 
ATOM   7923  C  CG    . TYR D 4  933  ? 15.639  -90.065  77.921  1.00 117.08 ? 933  TYR A CG    1 
ATOM   7924  C  CD1   . TYR D 4  933  ? 14.396  -89.562  77.550  1.00 118.01 ? 933  TYR A CD1   1 
ATOM   7925  C  CD2   . TYR D 4  933  ? 16.027  -89.918  79.248  1.00 117.14 ? 933  TYR A CD2   1 
ATOM   7926  C  CE1   . TYR D 4  933  ? 13.567  -88.902  78.485  1.00 117.71 ? 933  TYR A CE1   1 
ATOM   7927  C  CE2   . TYR D 4  933  ? 15.208  -89.263  80.184  1.00 116.87 ? 933  TYR A CE2   1 
ATOM   7928  C  CZ    . TYR D 4  933  ? 13.987  -88.759  79.795  1.00 116.84 ? 933  TYR A CZ    1 
ATOM   7929  O  OH    . TYR D 4  933  ? 13.187  -88.122  80.712  1.00 116.66 ? 933  TYR A OH    1 
ATOM   7930  N  N     . LYS D 4  934  ? 19.636  -89.357  76.989  1.00 116.31 ? 934  LYS A N     1 
ATOM   7931  C  CA    . LYS D 4  934  ? 20.576  -88.451  77.661  1.00 116.19 ? 934  LYS A CA    1 
ATOM   7932  C  C     . LYS D 4  934  ? 20.894  -87.289  76.752  1.00 115.36 ? 934  LYS A C     1 
ATOM   7933  O  O     . LYS D 4  934  ? 20.839  -86.142  77.160  1.00 115.46 ? 934  LYS A O     1 
ATOM   7934  C  CB    . LYS D 4  934  ? 21.871  -89.116  78.131  1.00 116.00 ? 934  LYS A CB    1 
ATOM   7935  C  CG    . LYS D 4  934  ? 22.685  -88.148  79.007  1.00 116.72 ? 934  LYS A CG    1 
ATOM   7936  C  CD    . LYS D 4  934  ? 24.050  -88.677  79.429  1.00 117.39 ? 934  LYS A CD    1 
ATOM   7937  C  CE    . LYS D 4  934  ? 23.971  -89.574  80.667  1.00 119.17 ? 934  LYS A CE    1 
ATOM   7938  N  NZ    . LYS D 4  934  ? 23.480  -90.942  80.286  1.00 120.88 ? 934  LYS A NZ    1 
ATOM   7939  N  N     . GLN D 4  935  ? 21.214  -87.603  75.512  1.00 114.79 ? 935  GLN A N     1 
ATOM   7940  C  CA    . GLN D 4  935  ? 21.435  -86.599  74.487  1.00 114.54 ? 935  GLN A CA    1 
ATOM   7941  C  C     . GLN D 4  935  ? 20.306  -85.550  74.453  1.00 114.22 ? 935  GLN A C     1 
ATOM   7942  O  O     . GLN D 4  935  ? 20.540  -84.378  74.164  1.00 113.80 ? 935  GLN A O     1 
ATOM   7943  C  CB    . GLN D 4  935  ? 21.604  -87.326  73.141  1.00 114.84 ? 935  GLN A CB    1 
ATOM   7944  C  CG    . GLN D 4  935  ? 22.122  -86.528  71.953  1.00 115.09 ? 935  GLN A CG    1 
ATOM   7945  C  CD    . GLN D 4  935  ? 22.824  -85.259  72.354  1.00 115.38 ? 935  GLN A CD    1 
ATOM   7946  O  OE1   . GLN D 4  935  ? 23.937  -85.288  72.895  1.00 115.33 ? 935  GLN A OE1   1 
ATOM   7947  N  NE2   . GLN D 4  935  ? 22.170  -84.121  72.093  1.00 115.07 ? 935  GLN A NE2   1 
ATOM   7948  N  N     . LEU D 4  936  ? 19.090  -85.977  74.780  1.00 114.21 ? 936  LEU A N     1 
ATOM   7949  C  CA    . LEU D 4  936  ? 17.940  -85.074  74.819  1.00 114.32 ? 936  LEU A CA    1 
ATOM   7950  C  C     . LEU D 4  936  ? 17.743  -84.330  76.140  1.00 114.74 ? 936  LEU A C     1 
ATOM   7951  O  O     . LEU D 4  936  ? 16.870  -83.468  76.200  1.00 115.12 ? 936  LEU A O     1 
ATOM   7952  C  CB    . LEU D 4  936  ? 16.631  -85.798  74.493  1.00 113.99 ? 936  LEU A CB    1 
ATOM   7953  C  CG    . LEU D 4  936  ? 16.342  -86.470  73.165  1.00 113.09 ? 936  LEU A CG    1 
ATOM   7954  C  CD1   . LEU D 4  936  ? 14.971  -87.076  73.268  1.00 112.03 ? 936  LEU A CD1   1 
ATOM   7955  C  CD2   . LEU D 4  936  ? 16.382  -85.474  72.058  1.00 113.22 ? 936  LEU A CD2   1 
ATOM   7956  N  N     . VAL D 4  937  ? 18.480  -84.668  77.202  1.00 114.82 ? 937  VAL A N     1 
ATOM   7957  C  CA    . VAL D 4  937  ? 18.495  -83.764  78.359  1.00 114.89 ? 937  VAL A CA    1 
ATOM   7958  C  C     . VAL D 4  937  ? 19.567  -82.712  78.171  1.00 114.99 ? 937  VAL A C     1 
ATOM   7959  O  O     . VAL D 4  937  ? 19.289  -81.530  78.348  1.00 114.91 ? 937  VAL A O     1 
ATOM   7960  C  CB    . VAL D 4  937  ? 18.612  -84.437  79.750  1.00 114.87 ? 937  VAL A CB    1 
ATOM   7961  C  CG1   . VAL D 4  937  ? 17.345  -85.219  80.078  1.00 114.35 ? 937  VAL A CG1   1 
ATOM   7962  C  CG2   . VAL D 4  937  ? 19.903  -85.272  79.893  1.00 115.32 ? 937  VAL A CG2   1 
ATOM   7963  N  N     . LYS D 4  938  ? 20.771  -83.142  77.783  1.00 115.31 ? 938  LYS A N     1 
ATOM   7964  C  CA    . LYS D 4  938  ? 21.854  -82.230  77.413  1.00 115.89 ? 938  LYS A CA    1 
ATOM   7965  C  C     . LYS D 4  938  ? 21.272  -81.136  76.549  1.00 115.95 ? 938  LYS A C     1 
ATOM   7966  O  O     . LYS D 4  938  ? 21.742  -80.003  76.593  1.00 116.52 ? 938  LYS A O     1 
ATOM   7967  C  CB    . LYS D 4  938  ? 22.960  -82.945  76.636  1.00 115.88 ? 938  LYS A CB    1 
ATOM   7968  C  CG    . LYS D 4  938  ? 23.548  -84.169  77.344  1.00 118.64 ? 938  LYS A CG    1 
ATOM   7969  C  CD    . LYS D 4  938  ? 24.766  -83.838  78.220  1.00 122.66 ? 938  LYS A CD    1 
ATOM   7970  C  CE    . LYS D 4  938  ? 26.084  -83.870  77.419  1.00 124.30 ? 938  LYS A CE    1 
ATOM   7971  N  NZ    . LYS D 4  938  ? 26.048  -82.981  76.202  1.00 125.54 ? 938  LYS A NZ    1 
ATOM   7972  N  N     . ASP D 4  939  ? 20.237  -81.480  75.781  1.00 115.55 ? 939  ASP A N     1 
ATOM   7973  C  CA    . ASP D 4  939  ? 19.549  -80.532  74.937  1.00 115.19 ? 939  ASP A CA    1 
ATOM   7974  C  C     . ASP D 4  939  ? 18.708  -79.542  75.733  1.00 114.59 ? 939  ASP A C     1 
ATOM   7975  O  O     . ASP D 4  939  ? 18.917  -78.339  75.624  1.00 114.74 ? 939  ASP A O     1 
ATOM   7976  C  CB    . ASP D 4  939  ? 18.694  -81.272  73.916  1.00 115.79 ? 939  ASP A CB    1 
ATOM   7977  C  CG    . ASP D 4  939  ? 19.490  -81.691  72.680  1.00 118.16 ? 939  ASP A CG    1 
ATOM   7978  O  OD1   . ASP D 4  939  ? 20.751  -81.645  72.748  1.00 119.77 ? 939  ASP A OD1   1 
ATOM   7979  O  OD2   . ASP D 4  939  ? 18.853  -82.047  71.641  1.00 119.99 ? 939  ASP A OD2   1 
ATOM   7980  N  N     . ARG D 4  940  ? 17.771  -80.038  76.538  1.00 113.78 ? 940  ARG A N     1 
ATOM   7981  C  CA    . ARG D 4  940  ? 16.873  -79.178  77.311  1.00 112.88 ? 940  ARG A CA    1 
ATOM   7982  C  C     . ARG D 4  940  ? 17.650  -78.316  78.283  1.00 112.79 ? 940  ARG A C     1 
ATOM   7983  O  O     . ARG D 4  940  ? 17.291  -77.175  78.507  1.00 112.66 ? 940  ARG A O     1 
ATOM   7984  C  CB    . ARG D 4  940  ? 15.845  -80.017  78.052  1.00 112.71 ? 940  ARG A CB    1 
ATOM   7985  C  CG    . ARG D 4  940  ? 14.807  -79.271  78.879  1.00 111.96 ? 940  ARG A CG    1 
ATOM   7986  C  CD    . ARG D 4  940  ? 13.717  -80.258  79.260  1.00 111.27 ? 940  ARG A CD    1 
ATOM   7987  N  NE    . ARG D 4  940  ? 12.961  -79.922  80.463  1.00 111.80 ? 940  ARG A NE    1 
ATOM   7988  C  CZ    . ARG D 4  940  ? 11.695  -79.501  80.468  1.00 112.88 ? 940  ARG A CZ    1 
ATOM   7989  N  NH1   . ARG D 4  940  ? 11.036  -79.338  79.327  1.00 113.42 ? 940  ARG A NH1   1 
ATOM   7990  N  NH2   . ARG D 4  940  ? 11.077  -79.234  81.615  1.00 112.89 ? 940  ARG A NH2   1 
ATOM   7991  N  N     . LYS D 4  941  ? 18.712  -78.862  78.864  1.00 112.87 ? 941  LYS A N     1 
ATOM   7992  C  CA    . LYS D 4  941  ? 19.652  -78.045  79.617  1.00 113.20 ? 941  LYS A CA    1 
ATOM   7993  C  C     . LYS D 4  941  ? 20.184  -76.942  78.731  1.00 113.35 ? 941  LYS A C     1 
ATOM   7994  O  O     . LYS D 4  941  ? 20.044  -75.768  79.072  1.00 113.73 ? 941  LYS A O     1 
ATOM   7995  C  CB    . LYS D 4  941  ? 20.834  -78.866  80.135  1.00 113.51 ? 941  LYS A CB    1 
ATOM   7996  C  CG    . LYS D 4  941  ? 22.234  -78.311  79.735  1.00 114.04 ? 941  LYS A CG    1 
ATOM   7997  C  CD    . LYS D 4  941  ? 23.294  -78.652  80.755  1.00 115.63 ? 941  LYS A CD    1 
ATOM   7998  C  CE    . LYS D 4  941  ? 23.290  -77.620  81.886  1.00 116.07 ? 941  LYS A CE    1 
ATOM   7999  N  NZ    . LYS D 4  941  ? 23.564  -78.308  83.194  1.00 117.17 ? 941  LYS A NZ    1 
ATOM   8000  N  N     . PHE D 4  942  ? 20.783  -77.329  77.597  1.00 113.26 ? 942  PHE A N     1 
ATOM   8001  C  CA    . PHE D 4  942  ? 21.533  -76.399  76.740  1.00 113.00 ? 942  PHE A CA    1 
ATOM   8002  C  C     . PHE D 4  942  ? 20.673  -75.289  76.182  1.00 113.06 ? 942  PHE A C     1 
ATOM   8003  O  O     . PHE D 4  942  ? 21.116  -74.157  76.102  1.00 113.56 ? 942  PHE A O     1 
ATOM   8004  C  CB    . PHE D 4  942  ? 22.258  -77.100  75.587  1.00 112.75 ? 942  PHE A CB    1 
ATOM   8005  C  CG    . PHE D 4  942  ? 22.742  -76.154  74.530  1.00 111.94 ? 942  PHE A CG    1 
ATOM   8006  C  CD1   . PHE D 4  942  ? 24.017  -75.616  74.595  1.00 112.17 ? 942  PHE A CD1   1 
ATOM   8007  C  CD2   . PHE D 4  942  ? 21.901  -75.764  73.491  1.00 110.29 ? 942  PHE A CD2   1 
ATOM   8008  C  CE1   . PHE D 4  942  ? 24.454  -74.714  73.622  1.00 112.29 ? 942  PHE A CE1   1 
ATOM   8009  C  CE2   . PHE D 4  942  ? 22.328  -74.878  72.521  1.00 109.77 ? 942  PHE A CE2   1 
ATOM   8010  C  CZ    . PHE D 4  942  ? 23.603  -74.349  72.581  1.00 111.30 ? 942  PHE A CZ    1 
ATOM   8011  N  N     . LEU D 4  943  ? 19.457  -75.607  75.778  1.00 113.09 ? 943  LEU A N     1 
ATOM   8012  C  CA    . LEU D 4  943  ? 18.566  -74.563  75.305  1.00 113.46 ? 943  LEU A CA    1 
ATOM   8013  C  C     . LEU D 4  943  ? 18.126  -73.596  76.442  1.00 113.89 ? 943  LEU A C     1 
ATOM   8014  O  O     . LEU D 4  943  ? 18.217  -72.371  76.304  1.00 113.90 ? 943  LEU A O     1 
ATOM   8015  C  CB    . LEU D 4  943  ? 17.356  -75.161  74.564  1.00 113.37 ? 943  LEU A CB    1 
ATOM   8016  C  CG    . LEU D 4  943  ? 17.453  -76.051  73.325  1.00 111.84 ? 943  LEU A CG    1 
ATOM   8017  C  CD1   . LEU D 4  943  ? 16.059  -76.369  72.910  1.00 109.87 ? 943  LEU A CD1   1 
ATOM   8018  C  CD2   . LEU D 4  943  ? 18.164  -75.363  72.201  1.00 111.14 ? 943  LEU A CD2   1 
ATOM   8019  N  N     . ARG D 4  944  ? 17.668  -74.144  77.565  1.00 114.35 ? 944  ARG A N     1 
ATOM   8020  C  CA    . ARG D 4  944  ? 17.140  -73.312  78.641  1.00 114.72 ? 944  ARG A CA    1 
ATOM   8021  C  C     . ARG D 4  944  ? 18.159  -72.274  79.091  1.00 116.07 ? 944  ARG A C     1 
ATOM   8022  O  O     . ARG D 4  944  ? 17.788  -71.251  79.684  1.00 116.51 ? 944  ARG A O     1 
ATOM   8023  C  CB    . ARG D 4  944  ? 16.661  -74.160  79.818  1.00 114.03 ? 944  ARG A CB    1 
ATOM   8024  C  CG    . ARG D 4  944  ? 15.261  -74.688  79.638  1.00 111.15 ? 944  ARG A CG    1 
ATOM   8025  C  CD    . ARG D 4  944  ? 14.711  -75.186  80.929  1.00 106.13 ? 944  ARG A CD    1 
ATOM   8026  N  NE    . ARG D 4  944  ? 13.315  -75.580  80.825  1.00 102.96 ? 944  ARG A NE    1 
ATOM   8027  C  CZ    . ARG D 4  944  ? 12.563  -75.934  81.865  1.00 102.78 ? 944  ARG A CZ    1 
ATOM   8028  N  NH1   . ARG D 4  944  ? 13.069  -75.940  83.089  1.00 102.22 ? 944  ARG A NH1   1 
ATOM   8029  N  NH2   . ARG D 4  944  ? 11.296  -76.284  81.695  1.00 102.93 ? 944  ARG A NH2   1 
ATOM   8030  N  N     . GLU D 4  945  ? 19.433  -72.529  78.796  1.00 117.12 ? 945  GLU A N     1 
ATOM   8031  C  CA    . GLU D 4  945  ? 20.487  -71.581  79.132  1.00 118.68 ? 945  GLU A CA    1 
ATOM   8032  C  C     . GLU D 4  945  ? 20.859  -70.688  77.943  1.00 118.44 ? 945  GLU A C     1 
ATOM   8033  O  O     . GLU D 4  945  ? 21.503  -69.658  78.120  1.00 118.66 ? 945  GLU A O     1 
ATOM   8034  C  CB    . GLU D 4  945  ? 21.705  -72.276  79.785  1.00 118.83 ? 945  GLU A CB    1 
ATOM   8035  C  CG    . GLU D 4  945  ? 22.608  -73.132  78.847  1.00 120.60 ? 945  GLU A CG    1 
ATOM   8036  C  CD    . GLU D 4  945  ? 23.763  -73.879  79.579  1.00 120.87 ? 945  GLU A CD    1 
ATOM   8037  O  OE1   . GLU D 4  945  ? 23.518  -74.576  80.615  1.00 122.26 ? 945  GLU A OE1   1 
ATOM   8038  O  OE2   . GLU D 4  945  ? 24.919  -73.772  79.083  1.00 123.89 ? 945  GLU A OE2   1 
ATOM   8039  N  N     . VAL D 4  946  ? 20.445  -71.064  76.739  1.00 118.62 ? 946  VAL A N     1 
ATOM   8040  C  CA    . VAL D 4  946  ? 20.512  -70.133  75.615  1.00 118.95 ? 946  VAL A CA    1 
ATOM   8041  C  C     . VAL D 4  946  ? 19.282  -69.229  75.677  1.00 119.89 ? 946  VAL A C     1 
ATOM   8042  O  O     . VAL D 4  946  ? 19.376  -68.056  76.033  1.00 120.31 ? 946  VAL A O     1 
ATOM   8043  C  CB    . VAL D 4  946  ? 20.635  -70.843  74.242  1.00 118.50 ? 946  VAL A CB    1 
ATOM   8044  C  CG1   . VAL D 4  946  ? 19.980  -70.043  73.135  1.00 117.84 ? 946  VAL A CG1   1 
ATOM   8045  C  CG2   . VAL D 4  946  ? 22.070  -71.067  73.905  1.00 117.85 ? 946  VAL A CG2   1 
ATOM   8046  N  N     . PHE D 4  947  ? 18.123  -69.780  75.365  1.00 120.67 ? 947  PHE A N     1 
ATOM   8047  C  CA    . PHE D 4  947  ? 16.915  -69.000  75.384  1.00 121.74 ? 947  PHE A CA    1 
ATOM   8048  C  C     . PHE D 4  947  ? 16.345  -68.951  76.806  1.00 122.21 ? 947  PHE A C     1 
ATOM   8049  O  O     . PHE D 4  947  ? 15.436  -69.714  77.145  1.00 122.49 ? 947  PHE A O     1 
ATOM   8050  C  CB    . PHE D 4  947  ? 15.917  -69.601  74.396  1.00 122.24 ? 947  PHE A CB    1 
ATOM   8051  C  CG    . PHE D 4  947  ? 16.435  -69.701  72.975  1.00 122.77 ? 947  PHE A CG    1 
ATOM   8052  C  CD1   . PHE D 4  947  ? 16.450  -70.916  72.312  1.00 123.77 ? 947  PHE A CD1   1 
ATOM   8053  C  CD2   . PHE D 4  947  ? 16.894  -68.579  72.300  1.00 123.68 ? 947  PHE A CD2   1 
ATOM   8054  C  CE1   . PHE D 4  947  ? 16.912  -71.010  70.993  1.00 124.26 ? 947  PHE A CE1   1 
ATOM   8055  C  CE2   . PHE D 4  947  ? 17.354  -68.662  70.982  1.00 123.65 ? 947  PHE A CE2   1 
ATOM   8056  C  CZ    . PHE D 4  947  ? 17.362  -69.874  70.331  1.00 123.60 ? 947  PHE A CZ    1 
ATOM   8057  N  N     . VAL D 4  948  ? 16.871  -68.034  77.623  1.00 122.62 ? 948  VAL A N     1 
ATOM   8058  C  CA    . VAL D 4  948  ? 16.639  -68.024  79.087  1.00 122.93 ? 948  VAL A CA    1 
ATOM   8059  C  C     . VAL D 4  948  ? 15.244  -67.630  79.572  1.00 123.33 ? 948  VAL A C     1 
ATOM   8060  O  O     . VAL D 4  948  ? 14.963  -67.667  80.765  1.00 122.74 ? 948  VAL A O     1 
ATOM   8061  C  CB    . VAL D 4  948  ? 17.669  -67.141  79.812  1.00 122.81 ? 948  VAL A CB    1 
ATOM   8062  C  CG1   . VAL D 4  948  ? 18.856  -67.985  80.251  1.00 122.97 ? 948  VAL A CG1   1 
ATOM   8063  C  CG2   . VAL D 4  948  ? 18.098  -65.962  78.931  1.00 122.43 ? 948  VAL A CG2   1 
ATOM   8064  N  N     . ASP D 4  949  ? 14.384  -67.264  78.629  1.00 124.51 ? 949  ASP A N     1 
ATOM   8065  C  CA    . ASP D 4  949  ? 13.034  -66.750  78.903  1.00 125.65 ? 949  ASP A CA    1 
ATOM   8066  C  C     . ASP D 4  949  ? 11.930  -67.797  78.684  1.00 125.92 ? 949  ASP A C     1 
ATOM   8067  O  O     . ASP D 4  949  ? 10.742  -67.525  78.915  1.00 125.90 ? 949  ASP A O     1 
ATOM   8068  C  CB    . ASP D 4  949  ? 12.760  -65.481  78.059  1.00 125.89 ? 949  ASP A CB    1 
ATOM   8069  C  CG    . ASP D 4  949  ? 13.283  -65.592  76.599  1.00 127.27 ? 949  ASP A CG    1 
ATOM   8070  O  OD1   . ASP D 4  949  ? 14.278  -66.325  76.333  1.00 127.53 ? 949  ASP A OD1   1 
ATOM   8071  O  OD2   . ASP D 4  949  ? 12.700  -64.915  75.710  1.00 128.93 ? 949  ASP A OD2   1 
ATOM   8072  N  N     . GLY D 4  950  ? 12.336  -68.990  78.247  1.00 126.25 ? 950  GLY A N     1 
ATOM   8073  C  CA    . GLY D 4  950  ? 11.400  -70.044  77.875  1.00 126.57 ? 950  GLY A CA    1 
ATOM   8074  C  C     . GLY D 4  950  ? 10.935  -69.957  76.428  1.00 126.87 ? 950  GLY A C     1 
ATOM   8075  O  O     . GLY D 4  950  ? 10.515  -70.961  75.850  1.00 127.06 ? 950  GLY A O     1 
ATOM   8076  N  N     . GLU D 4  951  ? 10.999  -68.758  75.844  1.00 126.88 ? 951  GLU A N     1 
ATOM   8077  C  CA    . GLU D 4  951  ? 10.627  -68.536  74.442  1.00 126.85 ? 951  GLU A CA    1 
ATOM   8078  C  C     . GLU D 4  951  ? 11.134  -69.652  73.530  1.00 126.30 ? 951  GLU A C     1 
ATOM   8079  O  O     . GLU D 4  951  ? 12.331  -69.780  73.243  1.00 125.97 ? 951  GLU A O     1 
ATOM   8080  C  CB    . GLU D 4  951  ? 11.079  -67.149  73.963  1.00 127.18 ? 951  GLU A CB    1 
ATOM   8081  C  CG    . GLU D 4  951  ? 10.661  -66.754  72.545  1.00 129.68 ? 951  GLU A CG    1 
ATOM   8082  C  CD    . GLU D 4  951  ? 9.213   -67.116  72.173  1.00 134.05 ? 951  GLU A CD    1 
ATOM   8083  O  OE1   . GLU D 4  951  ? 8.382   -67.439  73.067  1.00 136.20 ? 951  GLU A OE1   1 
ATOM   8084  O  OE2   . GLU D 4  951  ? 8.898   -67.064  70.956  1.00 136.02 ? 951  GLU A OE2   1 
ATOM   8085  N  N     . ALA D 4  952  ? 10.184  -70.475  73.110  1.00 125.97 ? 952  ALA A N     1 
ATOM   8086  C  CA    . ALA D 4  952  ? 10.483  -71.706  72.405  1.00 125.55 ? 952  ALA A CA    1 
ATOM   8087  C  C     . ALA D 4  952  ? 10.239  -71.563  70.914  1.00 125.10 ? 952  ALA A C     1 
ATOM   8088  O  O     . ALA D 4  952  ? 10.489  -72.496  70.160  1.00 125.40 ? 952  ALA A O     1 
ATOM   8089  C  CB    . ALA D 4  952  ? 9.650   -72.846  72.976  1.00 125.56 ? 952  ALA A CB    1 
ATOM   8090  N  N     . ASN D 4  953  ? 9.763   -70.395  70.490  1.00 124.26 ? 953  ASN A N     1 
ATOM   8091  C  CA    . ASN D 4  953  ? 9.468   -70.183  69.084  1.00 123.72 ? 953  ASN A CA    1 
ATOM   8092  C  C     . ASN D 4  953  ? 10.513  -69.368  68.347  1.00 123.56 ? 953  ASN A C     1 
ATOM   8093  O  O     . ASN D 4  953  ? 10.508  -68.138  68.397  1.00 123.89 ? 953  ASN A O     1 
ATOM   8094  C  CB    . ASN D 4  953  ? 8.082   -69.587  68.926  1.00 123.40 ? 953  ASN A CB    1 
ATOM   8095  C  CG    . ASN D 4  953  ? 7.015   -70.533  69.378  1.00 123.19 ? 953  ASN A CG    1 
ATOM   8096  O  OD1   . ASN D 4  953  ? 7.133   -71.739  69.187  1.00 122.76 ? 953  ASN A OD1   1 
ATOM   8097  N  ND2   . ASN D 4  953  ? 5.966   -70.003  69.992  1.00 123.19 ? 953  ASN A ND2   1 
ATOM   8098  N  N     . TRP D 4  954  ? 11.408  -70.054  67.650  1.00 123.02 ? 954  TRP A N     1 
ATOM   8099  C  CA    . TRP D 4  954  ? 12.458  -69.367  66.933  1.00 122.70 ? 954  TRP A CA    1 
ATOM   8100  C  C     . TRP D 4  954  ? 12.523  -69.681  65.442  1.00 122.02 ? 954  TRP A C     1 
ATOM   8101  O  O     . TRP D 4  954  ? 12.307  -70.815  65.040  1.00 122.47 ? 954  TRP A O     1 
ATOM   8102  C  CB    . TRP D 4  954  ? 13.771  -69.667  67.598  1.00 123.21 ? 954  TRP A CB    1 
ATOM   8103  C  CG    . TRP D 4  954  ? 13.790  -69.174  68.986  1.00 124.20 ? 954  TRP A CG    1 
ATOM   8104  C  CD1   . TRP D 4  954  ? 13.591  -69.909  70.121  1.00 124.99 ? 954  TRP A CD1   1 
ATOM   8105  C  CD2   . TRP D 4  954  ? 14.017  -67.822  69.412  1.00 125.04 ? 954  TRP A CD2   1 
ATOM   8106  N  NE1   . TRP D 4  954  ? 13.698  -69.099  71.235  1.00 125.12 ? 954  TRP A NE1   1 
ATOM   8107  C  CE2   . TRP D 4  954  ? 13.955  -67.814  70.827  1.00 125.05 ? 954  TRP A CE2   1 
ATOM   8108  C  CE3   . TRP D 4  954  ? 14.270  -66.619  68.737  1.00 125.12 ? 954  TRP A CE3   1 
ATOM   8109  C  CZ2   . TRP D 4  954  ? 14.140  -66.641  71.583  1.00 124.45 ? 954  TRP A CZ2   1 
ATOM   8110  C  CZ3   . TRP D 4  954  ? 14.443  -65.454  69.489  1.00 124.90 ? 954  TRP A CZ3   1 
ATOM   8111  C  CH2   . TRP D 4  954  ? 14.384  -65.477  70.898  1.00 124.60 ? 954  TRP A CH2   1 
ATOM   8112  N  N     . PRO D 4  955  ? 12.786  -68.659  64.614  1.00 121.00 ? 955  PRO A N     1 
ATOM   8113  C  CA    . PRO D 4  955  ? 13.044  -68.813  63.181  1.00 119.82 ? 955  PRO A CA    1 
ATOM   8114  C  C     . PRO D 4  955  ? 14.169  -69.791  62.897  1.00 118.26 ? 955  PRO A C     1 
ATOM   8115  O  O     . PRO D 4  955  ? 15.251  -69.645  63.454  1.00 118.15 ? 955  PRO A O     1 
ATOM   8116  C  CB    . PRO D 4  955  ? 13.452  -67.400  62.756  1.00 120.11 ? 955  PRO A CB    1 
ATOM   8117  C  CG    . PRO D 4  955  ? 12.638  -66.527  63.673  1.00 121.00 ? 955  PRO A CG    1 
ATOM   8118  C  CD    . PRO D 4  955  ? 12.791  -67.238  65.006  1.00 121.26 ? 955  PRO A CD    1 
ATOM   8119  N  N     . LEU D 4  956  ? 13.888  -70.762  62.021  1.00 116.58 ? 956  LEU A N     1 
ATOM   8120  C  CA    . LEU D 4  956  ? 14.743  -71.931  61.753  1.00 114.60 ? 956  LEU A CA    1 
ATOM   8121  C  C     . LEU D 4  956  ? 14.482  -72.555  60.376  1.00 113.59 ? 956  LEU A C     1 
ATOM   8122  O  O     . LEU D 4  956  ? 13.395  -72.398  59.839  1.00 113.11 ? 956  LEU A O     1 
ATOM   8123  C  CB    . LEU D 4  956  ? 14.552  -72.967  62.847  1.00 114.20 ? 956  LEU A CB    1 
ATOM   8124  C  CG    . LEU D 4  956  ? 15.516  -72.744  63.996  1.00 112.91 ? 956  LEU A CG    1 
ATOM   8125  C  CD1   . LEU D 4  956  ? 14.998  -73.398  65.247  1.00 111.11 ? 956  LEU A CD1   1 
ATOM   8126  C  CD2   . LEU D 4  956  ? 16.915  -73.255  63.599  1.00 112.24 ? 956  LEU A CD2   1 
ATOM   8127  N  N     . PRO D 4  957  ? 15.493  -73.234  59.794  1.00 112.82 ? 957  PRO A N     1 
ATOM   8128  C  CA    . PRO D 4  957  ? 15.424  -73.708  58.408  1.00 112.48 ? 957  PRO A CA    1 
ATOM   8129  C  C     . PRO D 4  957  ? 14.793  -75.055  58.294  1.00 112.30 ? 957  PRO A C     1 
ATOM   8130  O  O     . PRO D 4  957  ? 14.929  -75.852  59.199  1.00 112.36 ? 957  PRO A O     1 
ATOM   8131  C  CB    . PRO D 4  957  ? 16.892  -73.820  57.988  1.00 112.17 ? 957  PRO A CB    1 
ATOM   8132  C  CG    . PRO D 4  957  ? 17.695  -73.554  59.220  1.00 112.55 ? 957  PRO A CG    1 
ATOM   8133  C  CD    . PRO D 4  957  ? 16.790  -73.562  60.396  1.00 112.57 ? 957  PRO A CD    1 
ATOM   8134  N  N     . VAL D 4  958  ? 14.116  -75.307  57.179  1.00 112.56 ? 958  VAL A N     1 
ATOM   8135  C  CA    . VAL D 4  958  ? 13.504  -76.618  56.902  1.00 113.08 ? 958  VAL A CA    1 
ATOM   8136  C  C     . VAL D 4  958  ? 12.310  -76.949  57.823  1.00 112.95 ? 958  VAL A C     1 
ATOM   8137  O  O     . VAL D 4  958  ? 12.429  -77.753  58.746  1.00 112.49 ? 958  VAL A O     1 
ATOM   8138  C  CB    . VAL D 4  958  ? 14.576  -77.777  56.951  1.00 113.18 ? 958  VAL A CB    1 
ATOM   8139  C  CG1   . VAL D 4  958  ? 14.087  -78.998  56.220  1.00 113.65 ? 958  VAL A CG1   1 
ATOM   8140  C  CG2   . VAL D 4  958  ? 15.892  -77.336  56.348  1.00 113.39 ? 958  VAL A CG2   1 
ATOM   8141  N  N     . ASN D 4  959  ? 11.160  -76.335  57.568  1.00 113.39 ? 959  ASN A N     1 
ATOM   8142  C  CA    . ASN D 4  959  ? 9.979   -76.582  58.404  1.00 114.17 ? 959  ASN A CA    1 
ATOM   8143  C  C     . ASN D 4  959  ? 9.708   -78.086  58.515  1.00 114.46 ? 959  ASN A C     1 
ATOM   8144  O  O     . ASN D 4  959  ? 9.242   -78.695  57.557  1.00 114.97 ? 959  ASN A O     1 
ATOM   8145  C  CB    . ASN D 4  959  ? 8.737   -75.829  57.866  1.00 114.14 ? 959  ASN A CB    1 
ATOM   8146  C  CG    . ASN D 4  959  ? 7.473   -75.999  58.761  1.00 114.52 ? 959  ASN A CG    1 
ATOM   8147  O  OD1   . ASN D 4  959  ? 7.277   -77.039  59.409  1.00 115.21 ? 959  ASN A OD1   1 
ATOM   8148  N  ND2   . ASN D 4  959  ? 6.605   -74.971  58.770  1.00 113.67 ? 959  ASN A ND2   1 
ATOM   8149  N  N     . ILE D 4  960  ? 10.008  -78.683  59.669  1.00 114.53 ? 960  ILE A N     1 
ATOM   8150  C  CA    . ILE D 4  960  ? 9.807   -80.122  59.839  1.00 114.44 ? 960  ILE A CA    1 
ATOM   8151  C  C     . ILE D 4  960  ? 8.335   -80.504  59.927  1.00 115.02 ? 960  ILE A C     1 
ATOM   8152  O  O     . ILE D 4  960  ? 7.934   -81.508  59.345  1.00 115.33 ? 960  ILE A O     1 
ATOM   8153  C  CB    . ILE D 4  960  ? 10.619  -80.735  61.006  1.00 114.04 ? 960  ILE A CB    1 
ATOM   8154  C  CG1   . ILE D 4  960  ? 12.010  -81.120  60.536  1.00 113.21 ? 960  ILE A CG1   1 
ATOM   8155  C  CG2   . ILE D 4  960  ? 9.988   -81.990  61.513  1.00 113.57 ? 960  ILE A CG2   1 
ATOM   8156  C  CD1   . ILE D 4  960  ? 13.091  -80.322  61.188  1.00 113.07 ? 960  ILE A CD1   1 
ATOM   8157  N  N     . ARG D 4  961  ? 7.513   -79.720  60.614  1.00 115.60 ? 961  ARG A N     1 
ATOM   8158  C  CA    . ARG D 4  961  ? 6.113   -80.122  60.710  1.00 116.47 ? 961  ARG A CA    1 
ATOM   8159  C  C     . ARG D 4  961  ? 5.523   -80.412  59.336  1.00 116.41 ? 961  ARG A C     1 
ATOM   8160  O  O     . ARG D 4  961  ? 4.888   -81.448  59.174  1.00 116.69 ? 961  ARG A O     1 
ATOM   8161  C  CB    . ARG D 4  961  ? 5.239   -79.134  61.471  1.00 116.89 ? 961  ARG A CB    1 
ATOM   8162  C  CG    . ARG D 4  961  ? 3.886   -79.729  61.810  1.00 119.26 ? 961  ARG A CG    1 
ATOM   8163  C  CD    . ARG D 4  961  ? 3.246   -79.079  63.025  1.00 124.71 ? 961  ARG A CD    1 
ATOM   8164  N  NE    . ARG D 4  961  ? 1.857   -78.716  62.726  1.00 129.48 ? 961  ARG A NE    1 
ATOM   8165  C  CZ    . ARG D 4  961  ? 1.461   -77.509  62.300  1.00 131.95 ? 961  ARG A CZ    1 
ATOM   8166  N  NH1   . ARG D 4  961  ? 2.356   -76.527  62.140  1.00 133.07 ? 961  ARG A NH1   1 
ATOM   8167  N  NH2   . ARG D 4  961  ? 0.167   -77.275  62.035  1.00 131.82 ? 961  ARG A NH2   1 
ATOM   8168  N  N     . ARG D 4  962  ? 5.754   -79.535  58.351  1.00 116.37 ? 962  ARG A N     1 
ATOM   8169  C  CA    . ARG D 4  962  ? 5.233   -79.757  56.977  1.00 116.05 ? 962  ARG A CA    1 
ATOM   8170  C  C     . ARG D 4  962  ? 5.759   -81.033  56.323  1.00 116.08 ? 962  ARG A C     1 
ATOM   8171  O  O     . ARG D 4  962  ? 5.022   -81.690  55.597  1.00 116.25 ? 962  ARG A O     1 
ATOM   8172  C  CB    . ARG D 4  962  ? 5.414   -78.548  56.038  1.00 115.83 ? 962  ARG A CB    1 
ATOM   8173  C  CG    . ARG D 4  962  ? 4.285   -77.514  56.130  1.00 115.37 ? 962  ARG A CG    1 
ATOM   8174  C  CD    . ARG D 4  962  ? 4.412   -76.365  55.112  1.00 115.70 ? 962  ARG A CD    1 
ATOM   8175  N  NE    . ARG D 4  962  ? 5.551   -75.448  55.294  1.00 115.08 ? 962  ARG A NE    1 
ATOM   8176  C  CZ    . ARG D 4  962  ? 6.723   -75.558  54.653  1.00 115.38 ? 962  ARG A CZ    1 
ATOM   8177  N  NH1   . ARG D 4  962  ? 6.933   -76.560  53.800  1.00 115.43 ? 962  ARG A NH1   1 
ATOM   8178  N  NH2   . ARG D 4  962  ? 7.703   -74.680  54.870  1.00 113.88 ? 962  ARG A NH2   1 
ATOM   8179  N  N     . ILE D 4  963  ? 7.009   -81.400  56.585  1.00 115.94 ? 963  ILE A N     1 
ATOM   8180  C  CA    . ILE D 4  963  ? 7.515   -82.642  56.029  1.00 116.16 ? 963  ILE A CA    1 
ATOM   8181  C  C     . ILE D 4  963  ? 6.788   -83.863  56.625  1.00 116.92 ? 963  ILE A C     1 
ATOM   8182  O  O     . ILE D 4  963  ? 6.524   -84.827  55.912  1.00 117.14 ? 963  ILE A O     1 
ATOM   8183  C  CB    . ILE D 4  963  ? 9.040   -82.796  56.142  1.00 115.70 ? 963  ILE A CB    1 
ATOM   8184  C  CG1   . ILE D 4  963  ? 9.763   -81.497  55.826  1.00 114.94 ? 963  ILE A CG1   1 
ATOM   8185  C  CG2   . ILE D 4  963  ? 9.522   -83.825  55.143  1.00 116.43 ? 963  ILE A CG2   1 
ATOM   8186  C  CD1   . ILE D 4  963  ? 11.232  -81.691  55.499  1.00 113.01 ? 963  ILE A CD1   1 
ATOM   8187  N  N     . ILE D 4  964  ? 6.451   -83.815  57.914  1.00 117.71 ? 964  ILE A N     1 
ATOM   8188  C  CA    . ILE D 4  964  ? 5.690   -84.901  58.564  1.00 118.34 ? 964  ILE A CA    1 
ATOM   8189  C  C     . ILE D 4  964  ? 4.285   -85.133  57.969  1.00 119.27 ? 964  ILE A C     1 
ATOM   8190  O  O     . ILE D 4  964  ? 3.968   -86.256  57.572  1.00 119.38 ? 964  ILE A O     1 
ATOM   8191  C  CB    . ILE D 4  964  ? 5.659   -84.751  60.121  1.00 118.15 ? 964  ILE A CB    1 
ATOM   8192  C  CG1   . ILE D 4  964  ? 6.731   -85.641  60.755  1.00 117.96 ? 964  ILE A CG1   1 
ATOM   8193  C  CG2   . ILE D 4  964  ? 4.281   -85.100  60.725  1.00 117.30 ? 964  ILE A CG2   1 
ATOM   8194  C  CD1   . ILE D 4  964  ? 8.131   -85.458  60.180  1.00 118.19 ? 964  ILE A CD1   1 
ATOM   8195  N  N     . GLN D 4  965  ? 3.456   -84.089  57.891  1.00 120.18 ? 965  GLN A N     1 
ATOM   8196  C  CA    . GLN D 4  965  ? 2.110   -84.247  57.348  1.00 121.18 ? 965  GLN A CA    1 
ATOM   8197  C  C     . GLN D 4  965  ? 2.248   -84.718  55.913  1.00 121.74 ? 965  GLN A C     1 
ATOM   8198  O  O     . GLN D 4  965  ? 1.573   -85.663  55.511  1.00 121.86 ? 965  GLN A O     1 
ATOM   8199  C  CB    . GLN D 4  965  ? 1.306   -82.951  57.397  1.00 121.27 ? 965  GLN A CB    1 
ATOM   8200  C  CG    . GLN D 4  965  ? 1.576   -82.050  58.588  1.00 122.69 ? 965  GLN A CG    1 
ATOM   8201  C  CD    . GLN D 4  965  ? 1.097   -80.634  58.326  1.00 125.17 ? 965  GLN A CD    1 
ATOM   8202  O  OE1   . GLN D 4  965  ? -0.102  -80.406  58.135  1.00 127.93 ? 965  GLN A OE1   1 
ATOM   8203  N  NE2   . GLN D 4  965  ? 2.028   -79.675  58.293  1.00 124.43 ? 965  GLN A NE2   1 
ATOM   8204  N  N     . ASN D 4  966  ? 3.151   -84.064  55.170  1.00 122.54 ? 966  ASN A N     1 
ATOM   8205  C  CA    . ASN D 4  966  ? 3.542   -84.439  53.791  1.00 123.20 ? 966  ASN A CA    1 
ATOM   8206  C  C     . ASN D 4  966  ? 3.982   -85.895  53.622  1.00 123.84 ? 966  ASN A C     1 
ATOM   8207  O  O     . ASN D 4  966  ? 3.905   -86.459  52.525  1.00 124.14 ? 966  ASN A O     1 
ATOM   8208  C  CB    . ASN D 4  966  ? 4.699   -83.564  53.312  1.00 122.91 ? 966  ASN A CB    1 
ATOM   8209  C  CG    . ASN D 4  966  ? 4.243   -82.342  52.581  1.00 122.33 ? 966  ASN A CG    1 
ATOM   8210  O  OD1   . ASN D 4  966  ? 3.165   -81.806  52.834  1.00 121.51 ? 966  ASN A OD1   1 
ATOM   8211  N  ND2   . ASN D 4  966  ? 5.077   -81.876  51.666  1.00 121.92 ? 966  ASN A ND2   1 
ATOM   8212  N  N     . ALA D 4  967  ? 4.487   -86.481  54.699  1.00 124.16 ? 967  ALA A N     1 
ATOM   8213  C  CA    . ALA D 4  967  ? 4.864   -87.859  54.672  1.00 124.42 ? 967  ALA A CA    1 
ATOM   8214  C  C     . ALA D 4  967  ? 3.634   -88.682  54.951  1.00 124.87 ? 967  ALA A C     1 
ATOM   8215  O  O     . ALA D 4  967  ? 3.365   -89.635  54.229  1.00 125.09 ? 967  ALA A O     1 
ATOM   8216  C  CB    . ALA D 4  967  ? 5.928   -88.126  55.688  1.00 124.59 ? 967  ALA A CB    1 
ATOM   8217  N  N     . GLN D 4  968  ? 2.869   -88.316  55.978  1.00 125.54 ? 968  GLN A N     1 
ATOM   8218  C  CA    . GLN D 4  968  ? 1.721   -89.153  56.376  1.00 126.53 ? 968  GLN A CA    1 
ATOM   8219  C  C     . GLN D 4  968  ? 0.484   -88.948  55.493  1.00 126.87 ? 968  GLN A C     1 
ATOM   8220  O  O     . GLN D 4  968  ? -0.629  -89.376  55.821  1.00 127.32 ? 968  GLN A O     1 
ATOM   8221  C  CB    . GLN D 4  968  ? 1.406   -89.063  57.887  1.00 126.61 ? 968  GLN A CB    1 
ATOM   8222  C  CG    . GLN D 4  968  ? 0.859   -87.737  58.423  1.00 126.70 ? 968  GLN A CG    1 
ATOM   8223  C  CD    . GLN D 4  968  ? 0.903   -87.686  59.946  1.00 126.73 ? 968  GLN A CD    1 
ATOM   8224  O  OE1   . GLN D 4  968  ? 1.180   -86.641  60.532  1.00 126.73 ? 968  GLN A OE1   1 
ATOM   8225  N  NE2   . GLN D 4  968  ? 0.654   -88.829  60.591  1.00 127.46 ? 968  GLN A NE2   1 
ATOM   8226  N  N     . GLN D 4  969  ? 0.713   -88.330  54.344  1.00 127.01 ? 969  GLN A N     1 
ATOM   8227  C  CA    . GLN D 4  969  ? -0.344  -88.021  53.418  1.00 126.92 ? 969  GLN A CA    1 
ATOM   8228  C  C     . GLN D 4  969  ? 0.007   -88.650  52.075  1.00 126.73 ? 969  GLN A C     1 
ATOM   8229  O  O     . GLN D 4  969  ? -0.844  -89.289  51.455  1.00 126.67 ? 969  GLN A O     1 
ATOM   8230  C  CB    . GLN D 4  969  ? -0.472  -86.506  53.331  1.00 127.18 ? 969  GLN A CB    1 
ATOM   8231  C  CG    . GLN D 4  969  ? -1.880  -86.014  53.331  1.00 127.34 ? 969  GLN A CG    1 
ATOM   8232  C  CD    . GLN D 4  969  ? -2.454  -86.061  51.958  1.00 127.32 ? 969  GLN A CD    1 
ATOM   8233  O  OE1   . GLN D 4  969  ? -3.562  -86.540  51.767  1.00 127.62 ? 969  GLN A OE1   1 
ATOM   8234  N  NE2   . GLN D 4  969  ? -1.689  -85.585  50.974  1.00 127.43 ? 969  GLN A NE2   1 
ATOM   8235  N  N     . THR D 4  970  ? 1.270   -88.482  51.659  1.00 126.51 ? 970  THR A N     1 
ATOM   8236  C  CA    . THR D 4  970  ? 1.849   -89.164  50.500  1.00 126.45 ? 970  THR A CA    1 
ATOM   8237  C  C     . THR D 4  970  ? 1.732   -90.665  50.669  1.00 127.24 ? 970  THR A C     1 
ATOM   8238  O  O     . THR D 4  970  ? 1.323   -91.368  49.744  1.00 127.36 ? 970  THR A O     1 
ATOM   8239  C  CB    . THR D 4  970  ? 3.352   -88.837  50.321  1.00 126.01 ? 970  THR A CB    1 
ATOM   8240  O  OG1   . THR D 4  970  ? 3.521   -87.446  50.071  1.00 125.19 ? 970  THR A OG1   1 
ATOM   8241  C  CG2   . THR D 4  970  ? 3.964   -89.609  49.163  1.00 125.62 ? 970  THR A CG2   1 
ATOM   8242  N  N     . PHE D 4  971  ? 2.073   -91.140  51.863  1.00 128.23 ? 971  PHE A N     1 
ATOM   8243  C  CA    . PHE D 4  971  ? 2.231   -92.567  52.116  1.00 129.40 ? 971  PHE A CA    1 
ATOM   8244  C  C     . PHE D 4  971  ? 1.017   -93.290  52.728  1.00 130.56 ? 971  PHE A C     1 
ATOM   8245  O  O     . PHE D 4  971  ? 1.034   -94.518  52.882  1.00 130.47 ? 971  PHE A O     1 
ATOM   8246  C  CB    . PHE D 4  971  ? 3.499   -92.802  52.927  1.00 129.06 ? 971  PHE A CB    1 
ATOM   8247  C  CG    . PHE D 4  971  ? 4.760   -92.561  52.148  1.00 128.69 ? 971  PHE A CG    1 
ATOM   8248  C  CD1   . PHE D 4  971  ? 5.429   -91.360  52.244  1.00 128.05 ? 971  PHE A CD1   1 
ATOM   8249  C  CD2   . PHE D 4  971  ? 5.281   -93.549  51.315  1.00 129.19 ? 971  PHE A CD2   1 
ATOM   8250  C  CE1   . PHE D 4  971  ? 6.599   -91.140  51.523  1.00 128.35 ? 971  PHE A CE1   1 
ATOM   8251  C  CE2   . PHE D 4  971  ? 6.453   -93.336  50.592  1.00 128.83 ? 971  PHE A CE2   1 
ATOM   8252  C  CZ    . PHE D 4  971  ? 7.108   -92.128  50.697  1.00 128.71 ? 971  PHE A CZ    1 
ATOM   8253  N  N     . HIS D 4  972  ? -0.029  -92.522  53.045  1.00 132.14 ? 972  HIS A N     1 
ATOM   8254  C  CA    . HIS D 4  972  ? -1.325  -93.056  53.482  1.00 133.72 ? 972  HIS A CA    1 
ATOM   8255  C  C     . HIS D 4  972  ? -1.175  -94.068  54.611  1.00 134.43 ? 972  HIS A C     1 
ATOM   8256  O  O     . HIS D 4  972  ? -1.370  -95.269  54.405  1.00 134.72 ? 972  HIS A O     1 
ATOM   8257  C  CB    . HIS D 4  972  ? -2.094  -93.672  52.294  1.00 133.93 ? 972  HIS A CB    1 
ATOM   8258  C  CG    . HIS D 4  972  ? -2.840  -92.667  51.464  1.00 135.42 ? 972  HIS A CG    1 
ATOM   8259  N  ND1   . HIS D 4  972  ? -4.198  -92.446  51.600  1.00 136.69 ? 972  HIS A ND1   1 
ATOM   8260  C  CD2   . HIS D 4  972  ? -2.418  -91.824  50.488  1.00 135.75 ? 972  HIS A CD2   1 
ATOM   8261  C  CE1   . HIS D 4  972  ? -4.579  -91.512  50.746  1.00 136.38 ? 972  HIS A CE1   1 
ATOM   8262  N  NE2   . HIS D 4  972  ? -3.517  -91.117  50.062  1.00 136.30 ? 972  HIS A NE2   1 
ATOM   8263  N  N     . ILE D 4  973  ? -0.823  -93.582  55.801  1.00 135.39 ? 973  ILE A N     1 
ATOM   8264  C  CA    . ILE D 4  973  ? -0.573  -94.475  56.941  1.00 136.31 ? 973  ILE A CA    1 
ATOM   8265  C  C     . ILE D 4  973  ? -1.751  -94.620  57.915  1.00 136.95 ? 973  ILE A C     1 
ATOM   8266  O  O     . ILE D 4  973  ? -2.236  -93.628  58.485  1.00 136.89 ? 973  ILE A O     1 
ATOM   8267  C  CB    . ILE D 4  973  ? 0.748   -94.129  57.700  1.00 136.29 ? 973  ILE A CB    1 
ATOM   8268  C  CG1   . ILE D 4  973  ? 1.054   -95.187  58.775  1.00 136.81 ? 973  ILE A CG1   1 
ATOM   8269  C  CG2   . ILE D 4  973  ? 0.699   -92.720  58.308  1.00 135.87 ? 973  ILE A CG2   1 
ATOM   8270  C  CD1   . ILE D 4  973  ? 1.003   -96.660  58.301  1.00 137.17 ? 973  ILE A CD1   1 
ATOM   8271  N  N     . ASP D 4  974  ? -2.196  -95.865  58.103  1.00 137.76 ? 974  ASP A N     1 
ATOM   8272  C  CA    . ASP D 4  974  ? -3.288  -96.140  59.041  1.00 138.62 ? 974  ASP A CA    1 
ATOM   8273  C  C     . ASP D 4  974  ? -2.795  -96.166  60.502  1.00 138.78 ? 974  ASP A C     1 
ATOM   8274  O  O     . ASP D 4  974  ? -1.784  -96.820  60.836  1.00 138.82 ? 974  ASP A O     1 
ATOM   8275  C  CB    . ASP D 4  974  ? -4.149  -97.364  58.620  1.00 138.83 ? 974  ASP A CB    1 
ATOM   8276  C  CG    . ASP D 4  974  ? -3.672  -98.692  59.218  1.00 139.62 ? 974  ASP A CG    1 
ATOM   8277  O  OD1   . ASP D 4  974  ? -3.758  -98.867  60.456  1.00 140.25 ? 974  ASP A OD1   1 
ATOM   8278  O  OD2   . ASP D 4  974  ? -3.263  -99.584  58.438  1.00 140.32 ? 974  ASP A OD2   1 
ATOM   8279  N  N     . HIS D 4  975  ? -3.519  -95.419  61.344  1.00 138.83 ? 975  HIS A N     1 
ATOM   8280  C  CA    . HIS D 4  975  ? -3.138  -95.158  62.737  1.00 138.61 ? 975  HIS A CA    1 
ATOM   8281  C  C     . HIS D 4  975  ? -3.633  -96.232  63.734  1.00 137.92 ? 975  HIS A C     1 
ATOM   8282  O  O     . HIS D 4  975  ? -3.964  -95.918  64.883  1.00 137.95 ? 975  HIS A O     1 
ATOM   8283  C  CB    . HIS D 4  975  ? -3.583  -93.736  63.156  1.00 138.97 ? 975  HIS A CB    1 
ATOM   8284  C  CG    . HIS D 4  975  ? -2.730  -92.626  62.594  1.00 140.30 ? 975  HIS A CG    1 
ATOM   8285  N  ND1   . HIS D 4  975  ? -1.936  -91.818  63.385  1.00 140.95 ? 975  HIS A ND1   1 
ATOM   8286  C  CD2   . HIS D 4  975  ? -2.564  -92.178  61.324  1.00 141.21 ? 975  HIS A CD2   1 
ATOM   8287  C  CE1   . HIS D 4  975  ? -1.312  -90.931  62.628  1.00 140.60 ? 975  HIS A CE1   1 
ATOM   8288  N  NE2   . HIS D 4  975  ? -1.676  -91.127  61.373  1.00 140.97 ? 975  HIS A NE2   1 
ATOM   8289  N  N     . THR D 4  976  ? -3.688  -97.490  63.273  1.00 136.91 ? 976  THR A N     1 
ATOM   8290  C  CA    . THR D 4  976  ? -3.861  -98.677  64.141  1.00 135.75 ? 976  THR A CA    1 
ATOM   8291  C  C     . THR D 4  976  ? -2.826  -99.773  63.849  1.00 134.84 ? 976  THR A C     1 
ATOM   8292  O  O     . THR D 4  976  ? -2.311  -100.401 64.787  1.00 135.03 ? 976  THR A O     1 
ATOM   8293  C  CB    . THR D 4  976  ? -5.280  -99.311  64.070  1.00 135.78 ? 976  THR A CB    1 
ATOM   8294  O  OG1   . THR D 4  976  ? -5.837  -99.107  62.767  1.00 135.65 ? 976  THR A OG1   1 
ATOM   8295  C  CG2   . THR D 4  976  ? -6.204  -98.715  65.133  1.00 135.61 ? 976  THR A CG2   1 
ATOM   8296  N  N     . LYS D 4  977  ? -2.538  -100.007 62.562  1.00 133.26 ? 977  LYS A N     1 
ATOM   8297  C  CA    . LYS D 4  977  ? -1.504  -100.972 62.149  1.00 131.55 ? 977  LYS A CA    1 
ATOM   8298  C  C     . LYS D 4  977  ? -0.072  -100.540 62.516  1.00 130.48 ? 977  LYS A C     1 
ATOM   8299  O  O     . LYS D 4  977  ? 0.337   -99.400  62.202  1.00 130.35 ? 977  LYS A O     1 
ATOM   8300  C  CB    . LYS D 4  977  ? -1.599  -101.299 60.658  1.00 131.36 ? 977  LYS A CB    1 
ATOM   8301  C  CG    . LYS D 4  977  ? -2.229  -102.643 60.370  1.00 130.73 ? 977  LYS A CG    1 
ATOM   8302  C  CD    . LYS D 4  977  ? -3.728  -102.624 60.576  1.00 129.85 ? 977  LYS A CD    1 
ATOM   8303  C  CE    . LYS D 4  977  ? -4.385  -103.691 59.718  1.00 129.42 ? 977  LYS A CE    1 
ATOM   8304  N  NZ    . LYS D 4  977  ? -5.866  -103.683 59.844  1.00 129.17 ? 977  LYS A NZ    1 
ATOM   8305  N  N     . PRO D 4  978  ? 0.688   -101.463 63.171  1.00 129.10 ? 978  PRO A N     1 
ATOM   8306  C  CA    . PRO D 4  978  ? 2.027   -101.278 63.743  1.00 127.95 ? 978  PRO A CA    1 
ATOM   8307  C  C     . PRO D 4  978  ? 3.095   -100.893 62.722  1.00 126.86 ? 978  PRO A C     1 
ATOM   8308  O  O     . PRO D 4  978  ? 3.141   -101.457 61.630  1.00 127.19 ? 978  PRO A O     1 
ATOM   8309  C  CB    . PRO D 4  978  ? 2.353   -102.661 64.316  1.00 127.85 ? 978  PRO A CB    1 
ATOM   8310  C  CG    . PRO D 4  978  ? 1.062   -103.305 64.507  1.00 128.15 ? 978  PRO A CG    1 
ATOM   8311  C  CD    . PRO D 4  978  ? 0.224   -102.847 63.380  1.00 128.86 ? 978  PRO A CD    1 
ATOM   8312  N  N     . SER D 4  979  ? 3.956   -99.952  63.090  1.00 125.20 ? 979  SER A N     1 
ATOM   8313  C  CA    . SER D 4  979  ? 5.047   -99.520  62.237  1.00 123.61 ? 979  SER A CA    1 
ATOM   8314  C  C     . SER D 4  979  ? 5.977   -100.680 61.941  1.00 122.71 ? 979  SER A C     1 
ATOM   8315  O  O     . SER D 4  979  ? 5.813   -101.754 62.498  1.00 122.51 ? 979  SER A O     1 
ATOM   8316  C  CB    . SER D 4  979  ? 5.816   -98.412  62.942  1.00 123.70 ? 979  SER A CB    1 
ATOM   8317  O  OG    . SER D 4  979  ? 7.051   -98.166  62.303  1.00 123.27 ? 979  SER A OG    1 
ATOM   8318  N  N     . ASP D 4  980  ? 6.964   -100.463 61.080  1.00 121.81 ? 980  ASP A N     1 
ATOM   8319  C  CA    . ASP D 4  980  ? 7.920   -101.515 60.753  1.00 121.33 ? 980  ASP A CA    1 
ATOM   8320  C  C     . ASP D 4  980  ? 9.407   -101.112 60.783  1.00 121.07 ? 980  ASP A C     1 
ATOM   8321  O  O     . ASP D 4  980  ? 10.167  -101.542 59.924  1.00 121.34 ? 980  ASP A O     1 
ATOM   8322  C  CB    . ASP D 4  980  ? 7.577   -102.130 59.392  1.00 121.32 ? 980  ASP A CB    1 
ATOM   8323  C  CG    . ASP D 4  980  ? 7.544   -101.098 58.270  1.00 121.47 ? 980  ASP A CG    1 
ATOM   8324  O  OD1   . ASP D 4  980  ? 6.663   -100.219 58.312  1.00 122.52 ? 980  ASP A OD1   1 
ATOM   8325  O  OD2   . ASP D 4  980  ? 8.382   -101.168 57.340  1.00 120.76 ? 980  ASP A OD2   1 
ATOM   8326  N  N     . LEU D 4  981  ? 9.837   -100.316 61.766  1.00 120.50 ? 981  LEU A N     1 
ATOM   8327  C  CA    . LEU D 4  981  ? 11.257  -99.916  61.865  1.00 119.69 ? 981  LEU A CA    1 
ATOM   8328  C  C     . LEU D 4  981  ? 11.876  -100.350 63.201  1.00 119.43 ? 981  LEU A C     1 
ATOM   8329  O  O     . LEU D 4  981  ? 11.224  -100.243 64.239  1.00 119.25 ? 981  LEU A O     1 
ATOM   8330  C  CB    . LEU D 4  981  ? 11.419  -98.399  61.686  1.00 119.55 ? 981  LEU A CB    1 
ATOM   8331  C  CG    . LEU D 4  981  ? 10.246  -97.504  61.255  1.00 119.30 ? 981  LEU A CG    1 
ATOM   8332  C  CD1   . LEU D 4  981  ? 9.356   -97.160  62.429  1.00 118.46 ? 981  LEU A CD1   1 
ATOM   8333  C  CD2   . LEU D 4  981  ? 10.754  -96.222  60.648  1.00 119.38 ? 981  LEU A CD2   1 
ATOM   8334  N  N     . THR D 4  982  ? 13.125  -100.830 63.185  1.00 119.09 ? 982  THR A N     1 
ATOM   8335  C  CA    . THR D 4  982  ? 13.813  -101.179 64.438  1.00 118.94 ? 982  THR A CA    1 
ATOM   8336  C  C     . THR D 4  982  ? 14.111  -99.902  65.180  1.00 118.72 ? 982  THR A C     1 
ATOM   8337  O  O     . THR D 4  982  ? 14.171  -98.825  64.586  1.00 118.60 ? 982  THR A O     1 
ATOM   8338  C  CB    . THR D 4  982  ? 15.202  -101.884 64.256  1.00 119.17 ? 982  THR A CB    1 
ATOM   8339  O  OG1   . THR D 4  982  ? 15.307  -102.495 62.961  1.00 119.24 ? 982  THR A OG1   1 
ATOM   8340  C  CG2   . THR D 4  982  ? 15.499  -102.920 65.425  1.00 118.90 ? 982  THR A CG2   1 
ATOM   8341  N  N     . ILE D 4  983  ? 14.326  -100.028 66.483  1.00 118.59 ? 983  ILE A N     1 
ATOM   8342  C  CA    . ILE D 4  983  ? 14.913  -98.939  67.217  1.00 118.22 ? 983  ILE A CA    1 
ATOM   8343  C  C     . ILE D 4  983  ? 16.177  -98.549  66.494  1.00 118.48 ? 983  ILE A C     1 
ATOM   8344  O  O     . ILE D 4  983  ? 16.404  -97.374  66.289  1.00 118.96 ? 983  ILE A O     1 
ATOM   8345  C  CB    . ILE D 4  983  ? 15.235  -99.301  68.646  1.00 117.96 ? 983  ILE A CB    1 
ATOM   8346  C  CG1   . ILE D 4  983  ? 13.957  -99.702  69.390  1.00 117.58 ? 983  ILE A CG1   1 
ATOM   8347  C  CG2   . ILE D 4  983  ? 15.930  -98.133  69.320  1.00 117.60 ? 983  ILE A CG2   1 
ATOM   8348  C  CD1   . ILE D 4  983  ? 12.857  -98.648  69.372  1.00 116.09 ? 983  ILE A CD1   1 
ATOM   8349  N  N     . LYS D 4  984  ? 16.974  -99.521  66.061  1.00 118.67 ? 984  LYS A N     1 
ATOM   8350  C  CA    . LYS D 4  984  ? 18.159  -99.202  65.258  1.00 119.05 ? 984  LYS A CA    1 
ATOM   8351  C  C     . LYS D 4  984  ? 17.861  -98.376  63.979  1.00 119.12 ? 984  LYS A C     1 
ATOM   8352  O  O     . LYS D 4  984  ? 18.697  -97.584  63.548  1.00 119.12 ? 984  LYS A O     1 
ATOM   8353  C  CB    . LYS D 4  984  ? 18.988  -100.459 64.943  1.00 119.31 ? 984  LYS A CB    1 
ATOM   8354  C  CG    . LYS D 4  984  ? 20.448  -100.172 64.496  1.00 119.36 ? 984  LYS A CG    1 
ATOM   8355  C  CD    . LYS D 4  984  ? 21.291  -101.447 64.423  1.00 119.02 ? 984  LYS A CD    1 
ATOM   8356  C  CE    . LYS D 4  984  ? 21.767  -101.866 65.795  1.00 118.29 ? 984  LYS A CE    1 
ATOM   8357  N  NZ    . LYS D 4  984  ? 21.429  -103.283 66.023  1.00 118.91 ? 984  LYS A NZ    1 
ATOM   8358  N  N     . ASP D 4  985  ? 16.680  -98.540  63.386  1.00 119.23 ? 985  ASP A N     1 
ATOM   8359  C  CA    . ASP D 4  985  ? 16.346  -97.779  62.176  1.00 119.51 ? 985  ASP A CA    1 
ATOM   8360  C  C     . ASP D 4  985  ? 16.225  -96.307  62.458  1.00 119.02 ? 985  ASP A C     1 
ATOM   8361  O  O     . ASP D 4  985  ? 16.768  -95.483  61.725  1.00 118.99 ? 985  ASP A O     1 
ATOM   8362  C  CB    . ASP D 4  985  ? 15.045  -98.263  61.549  1.00 119.99 ? 985  ASP A CB    1 
ATOM   8363  C  CG    . ASP D 4  985  ? 15.247  -99.470  60.670  1.00 122.17 ? 985  ASP A CG    1 
ATOM   8364  O  OD1   . ASP D 4  985  ? 15.566  -100.562 61.209  1.00 124.62 ? 985  ASP A OD1   1 
ATOM   8365  O  OD2   . ASP D 4  985  ? 15.090  -99.328  59.436  1.00 124.08 ? 985  ASP A OD2   1 
ATOM   8366  N  N     . ILE D 4  986  ? 15.498  -95.990  63.523  1.00 118.62 ? 986  ILE A N     1 
ATOM   8367  C  CA    . ILE D 4  986  ? 15.242  -94.609  63.908  1.00 118.33 ? 986  ILE A CA    1 
ATOM   8368  C  C     . ILE D 4  986  ? 16.527  -93.989  64.448  1.00 118.40 ? 986  ILE A C     1 
ATOM   8369  O  O     . ILE D 4  986  ? 17.220  -93.243  63.754  1.00 118.03 ? 986  ILE A O     1 
ATOM   8370  C  CB    . ILE D 4  986  ? 14.087  -94.520  64.949  1.00 117.97 ? 986  ILE A CB    1 
ATOM   8371  C  CG1   . ILE D 4  986  ? 12.779  -94.969  64.320  1.00 117.84 ? 986  ILE A CG1   1 
ATOM   8372  C  CG2   . ILE D 4  986  ? 13.894  -93.110  65.454  1.00 117.39 ? 986  ILE A CG2   1 
ATOM   8373  C  CD1   . ILE D 4  986  ? 11.690  -95.181  65.320  1.00 118.43 ? 986  ILE A CD1   1 
ATOM   8374  N  N     . VAL D 4  987  ? 16.840  -94.349  65.686  1.00 118.73 ? 987  VAL A N     1 
ATOM   8375  C  CA    . VAL D 4  987  ? 17.937  -93.775  66.437  1.00 119.03 ? 987  VAL A CA    1 
ATOM   8376  C  C     . VAL D 4  987  ? 19.186  -93.710  65.586  1.00 119.68 ? 987  VAL A C     1 
ATOM   8377  O  O     . VAL D 4  987  ? 19.769  -92.638  65.412  1.00 119.94 ? 987  VAL A O     1 
ATOM   8378  C  CB    . VAL D 4  987  ? 18.187  -94.577  67.723  1.00 118.64 ? 987  VAL A CB    1 
ATOM   8379  C  CG1   . VAL D 4  987  ? 19.405  -94.065  68.433  1.00 118.95 ? 987  VAL A CG1   1 
ATOM   8380  C  CG2   . VAL D 4  987  ? 16.979  -94.485  68.631  1.00 117.70 ? 987  VAL A CG2   1 
ATOM   8381  N  N     . LEU D 4  988  ? 19.567  -94.853  65.031  1.00 120.52 ? 988  LEU A N     1 
ATOM   8382  C  CA    . LEU D 4  988  ? 20.806  -94.961  64.279  1.00 121.47 ? 988  LEU A CA    1 
ATOM   8383  C  C     . LEU D 4  988  ? 20.744  -94.239  62.928  1.00 121.67 ? 988  LEU A C     1 
ATOM   8384  O  O     . LEU D 4  988  ? 21.783  -93.937  62.350  1.00 121.75 ? 988  LEU A O     1 
ATOM   8385  C  CB    . LEU D 4  988  ? 21.210  -96.437  64.125  1.00 121.75 ? 988  LEU A CB    1 
ATOM   8386  C  CG    . LEU D 4  988  ? 22.660  -96.851  63.832  1.00 122.49 ? 988  LEU A CG    1 
ATOM   8387  C  CD1   . LEU D 4  988  ? 22.945  -96.901  62.310  1.00 123.54 ? 988  LEU A CD1   1 
ATOM   8388  C  CD2   . LEU D 4  988  ? 23.678  -95.976  64.592  1.00 122.28 ? 988  LEU A CD2   1 
ATOM   8389  N  N     . GLY D 4  989  ? 19.534  -93.945  62.451  1.00 121.93 ? 989  GLY A N     1 
ATOM   8390  C  CA    . GLY D 4  989  ? 19.343  -93.189  61.204  1.00 122.41 ? 989  GLY A CA    1 
ATOM   8391  C  C     . GLY D 4  989  ? 19.203  -91.674  61.355  1.00 122.67 ? 989  GLY A C     1 
ATOM   8392  O  O     . GLY D 4  989  ? 19.508  -90.917  60.425  1.00 122.46 ? 989  GLY A O     1 
ATOM   8393  N  N     . VAL D 4  990  ? 18.722  -91.236  62.521  1.00 123.09 ? 990  VAL A N     1 
ATOM   8394  C  CA    . VAL D 4  990  ? 18.638  -89.808  62.867  1.00 123.30 ? 990  VAL A CA    1 
ATOM   8395  C  C     . VAL D 4  990  ? 20.051  -89.241  63.093  1.00 123.89 ? 990  VAL A C     1 
ATOM   8396  O  O     . VAL D 4  990  ? 20.351  -88.145  62.636  1.00 123.71 ? 990  VAL A O     1 
ATOM   8397  C  CB    . VAL D 4  990  ? 17.680  -89.558  64.085  1.00 123.10 ? 990  VAL A CB    1 
ATOM   8398  C  CG1   . VAL D 4  990  ? 18.406  -89.696  65.448  1.00 123.65 ? 990  VAL A CG1   1 
ATOM   8399  C  CG2   . VAL D 4  990  ? 17.026  -88.228  63.977  1.00 121.88 ? 990  VAL A CG2   1 
ATOM   8400  N  N     . LYS D 4  991  ? 20.913  -90.010  63.772  1.00 124.68 ? 991  LYS A N     1 
ATOM   8401  C  CA    . LYS D 4  991  ? 22.339  -89.685  63.914  1.00 125.37 ? 991  LYS A CA    1 
ATOM   8402  C  C     . LYS D 4  991  ? 23.084  -89.756  62.574  1.00 125.98 ? 991  LYS A C     1 
ATOM   8403  O  O     . LYS D 4  991  ? 24.156  -89.168  62.413  1.00 125.95 ? 991  LYS A O     1 
ATOM   8404  C  CB    . LYS D 4  991  ? 23.004  -90.613  64.928  1.00 125.20 ? 991  LYS A CB    1 
ATOM   8405  C  CG    . LYS D 4  991  ? 24.371  -90.128  65.385  1.00 125.33 ? 991  LYS A CG    1 
ATOM   8406  C  CD    . LYS D 4  991  ? 25.030  -91.129  66.313  1.00 126.03 ? 991  LYS A CD    1 
ATOM   8407  C  CE    . LYS D 4  991  ? 26.160  -90.493  67.119  1.00 126.20 ? 991  LYS A CE    1 
ATOM   8408  N  NZ    . LYS D 4  991  ? 26.670  -91.410  68.182  1.00 125.84 ? 991  LYS A NZ    1 
ATOM   8409  N  N     . ASP D 4  992  ? 22.504  -90.483  61.623  1.00 126.84 ? 992  ASP A N     1 
ATOM   8410  C  CA    . ASP D 4  992  ? 23.037  -90.581  60.271  1.00 127.82 ? 992  ASP A CA    1 
ATOM   8411  C  C     . ASP D 4  992  ? 22.700  -89.383  59.439  1.00 127.57 ? 992  ASP A C     1 
ATOM   8412  O  O     . ASP D 4  992  ? 23.490  -88.964  58.596  1.00 127.93 ? 992  ASP A O     1 
ATOM   8413  C  CB    . ASP D 4  992  ? 22.511  -91.822  59.574  1.00 128.39 ? 992  ASP A CB    1 
ATOM   8414  C  CG    . ASP D 4  992  ? 23.516  -92.942  59.605  1.00 132.21 ? 992  ASP A CG    1 
ATOM   8415  O  OD1   . ASP D 4  992  ? 24.723  -92.624  59.396  1.00 136.03 ? 992  ASP A OD1   1 
ATOM   8416  O  OD2   . ASP D 4  992  ? 23.124  -94.122  59.852  1.00 136.21 ? 992  ASP A OD2   1 
ATOM   8417  N  N     . LEU D 4  993  ? 21.508  -88.846  59.661  1.00 127.22 ? 993  LEU A N     1 
ATOM   8418  C  CA    . LEU D 4  993  ? 21.087  -87.650  58.975  1.00 126.57 ? 993  LEU A CA    1 
ATOM   8419  C  C     . LEU D 4  993  ? 22.104  -86.566  59.249  1.00 126.51 ? 993  LEU A C     1 
ATOM   8420  O  O     . LEU D 4  993  ? 22.699  -86.018  58.325  1.00 126.34 ? 993  LEU A O     1 
ATOM   8421  C  CB    . LEU D 4  993  ? 19.717  -87.219  59.484  1.00 126.29 ? 993  LEU A CB    1 
ATOM   8422  C  CG    . LEU D 4  993  ? 19.122  -85.993  58.812  1.00 125.41 ? 993  LEU A CG    1 
ATOM   8423  C  CD1   . LEU D 4  993  ? 19.136  -86.169  57.289  1.00 125.61 ? 993  LEU A CD1   1 
ATOM   8424  C  CD2   . LEU D 4  993  ? 17.719  -85.761  59.337  1.00 123.67 ? 993  LEU A CD2   1 
ATOM   8425  N  N     . GLN D 4  994  ? 22.327  -86.331  60.541  1.00 126.50 ? 994  GLN A N     1 
ATOM   8426  C  CA    . GLN D 4  994  ? 23.048  -85.176  61.051  1.00 126.46 ? 994  GLN A CA    1 
ATOM   8427  C  C     . GLN D 4  994  ? 24.441  -85.083  60.515  1.00 125.95 ? 994  GLN A C     1 
ATOM   8428  O  O     . GLN D 4  994  ? 25.053  -84.035  60.553  1.00 125.90 ? 994  GLN A O     1 
ATOM   8429  C  CB    . GLN D 4  994  ? 23.121  -85.237  62.562  1.00 126.72 ? 994  GLN A CB    1 
ATOM   8430  C  CG    . GLN D 4  994  ? 21.822  -84.936  63.266  1.00 128.49 ? 994  GLN A CG    1 
ATOM   8431  C  CD    . GLN D 4  994  ? 21.844  -85.415  64.711  1.00 131.98 ? 994  GLN A CD    1 
ATOM   8432  O  OE1   . GLN D 4  994  ? 22.803  -86.071  65.145  1.00 133.68 ? 994  GLN A OE1   1 
ATOM   8433  N  NE2   . GLN D 4  994  ? 20.789  -85.093  65.468  1.00 132.99 ? 994  GLN A NE2   1 
ATOM   8434  N  N     . GLU D 4  995  ? 24.957  -86.187  60.031  1.00 125.74 ? 995  GLU A N     1 
ATOM   8435  C  CA    . GLU D 4  995  ? 26.231  -86.132  59.367  1.00 125.97 ? 995  GLU A CA    1 
ATOM   8436  C  C     . GLU D 4  995  ? 26.110  -85.394  58.035  1.00 125.15 ? 995  GLU A C     1 
ATOM   8437  O  O     . GLU D 4  995  ? 26.983  -84.615  57.689  1.00 125.36 ? 995  GLU A O     1 
ATOM   8438  C  CB    . GLU D 4  995  ? 26.788  -87.541  59.152  1.00 126.72 ? 995  GLU A CB    1 
ATOM   8439  C  CG    . GLU D 4  995  ? 27.314  -88.208  60.420  1.00 129.42 ? 995  GLU A CG    1 
ATOM   8440  C  CD    . GLU D 4  995  ? 28.530  -87.490  60.983  1.00 133.09 ? 995  GLU A CD    1 
ATOM   8441  O  OE1   . GLU D 4  995  ? 29.475  -87.223  60.198  1.00 134.59 ? 995  GLU A OE1   1 
ATOM   8442  O  OE2   . GLU D 4  995  ? 28.539  -87.192  62.203  1.00 134.78 ? 995  GLU A OE2   1 
ATOM   8443  N  N     . ASN D 4  996  ? 25.023  -85.621  57.303  1.00 124.06 ? 996  ASN A N     1 
ATOM   8444  C  CA    . ASN D 4  996  ? 24.922  -85.152  55.920  1.00 123.00 ? 996  ASN A CA    1 
ATOM   8445  C  C     . ASN D 4  996  ? 24.467  -83.710  55.713  1.00 121.88 ? 996  ASN A C     1 
ATOM   8446  O  O     . ASN D 4  996  ? 24.368  -83.263  54.557  1.00 121.91 ? 996  ASN A O     1 
ATOM   8447  C  CB    . ASN D 4  996  ? 24.019  -86.086  55.118  1.00 123.37 ? 996  ASN A CB    1 
ATOM   8448  C  CG    . ASN D 4  996  ? 24.684  -87.407  54.810  1.00 124.89 ? 996  ASN A CG    1 
ATOM   8449  O  OD1   . ASN D 4  996  ? 25.882  -87.589  55.080  1.00 126.37 ? 996  ASN A OD1   1 
ATOM   8450  N  ND2   . ASN D 4  996  ? 23.916  -88.347  54.235  1.00 125.82 ? 996  ASN A ND2   1 
ATOM   8451  N  N     . LEU D 4  997  ? 24.210  -82.986  56.810  1.00 120.13 ? 997  LEU A N     1 
ATOM   8452  C  CA    . LEU D 4  997  ? 23.600  -81.658  56.736  1.00 118.41 ? 997  LEU A CA    1 
ATOM   8453  C  C     . LEU D 4  997  ? 24.629  -80.574  56.574  1.00 118.28 ? 997  LEU A C     1 
ATOM   8454  O  O     . LEU D 4  997  ? 24.560  -79.563  57.243  1.00 118.32 ? 997  LEU A O     1 
ATOM   8455  C  CB    . LEU D 4  997  ? 22.764  -81.362  57.973  1.00 117.63 ? 997  LEU A CB    1 
ATOM   8456  C  CG    . LEU D 4  997  ? 21.625  -82.275  58.385  1.00 115.88 ? 997  LEU A CG    1 
ATOM   8457  C  CD1   . LEU D 4  997  ? 20.645  -81.463  59.154  1.00 114.16 ? 997  LEU A CD1   1 
ATOM   8458  C  CD2   . LEU D 4  997  ? 20.939  -82.870  57.197  1.00 115.08 ? 997  LEU A CD2   1 
ATOM   8459  N  N     . LEU D 4  998  ? 25.565  -80.788  55.659  1.00 118.20 ? 998  LEU A N     1 
ATOM   8460  C  CA    . LEU D 4  998  ? 26.690  -79.879  55.407  1.00 118.14 ? 998  LEU A CA    1 
ATOM   8461  C  C     . LEU D 4  998  ? 26.401  -78.389  55.103  1.00 117.90 ? 998  LEU A C     1 
ATOM   8462  O  O     . LEU D 4  998  ? 25.654  -78.045  54.177  1.00 117.71 ? 998  LEU A O     1 
ATOM   8463  C  CB    . LEU D 4  998  ? 27.542  -80.430  54.264  1.00 118.34 ? 998  LEU A CB    1 
ATOM   8464  C  CG    . LEU D 4  998  ? 28.463  -81.608  54.509  1.00 118.60 ? 998  LEU A CG    1 
ATOM   8465  C  CD1   . LEU D 4  998  ? 29.270  -81.410  55.792  1.00 120.11 ? 998  LEU A CD1   1 
ATOM   8466  C  CD2   . LEU D 4  998  ? 27.670  -82.903  54.535  1.00 119.84 ? 998  LEU A CD2   1 
ATOM   8467  N  N     . VAL D 4  999  ? 27.055  -77.529  55.881  1.00 117.47 ? 999  VAL A N     1 
ATOM   8468  C  CA    . VAL D 4  999  ? 27.110  -76.098  55.653  1.00 116.98 ? 999  VAL A CA    1 
ATOM   8469  C  C     . VAL D 4  999  ? 28.539  -75.816  55.197  1.00 117.25 ? 999  VAL A C     1 
ATOM   8470  O  O     . VAL D 4  999  ? 28.771  -75.085  54.234  1.00 117.32 ? 999  VAL A O     1 
ATOM   8471  C  CB    . VAL D 4  999  ? 26.778  -75.328  56.947  1.00 116.51 ? 999  VAL A CB    1 
ATOM   8472  C  CG1   . VAL D 4  999  ? 27.149  -73.886  56.825  1.00 116.76 ? 999  VAL A CG1   1 
ATOM   8473  C  CG2   . VAL D 4  999  ? 25.322  -75.444  57.259  1.00 115.84 ? 999  VAL A CG2   1 
ATOM   8474  N  N     . LEU D 4  1000 ? 29.490  -76.430  55.887  1.00 117.48 ? 1000 LEU A N     1 
ATOM   8475  C  CA    . LEU D 4  1000 ? 30.889  -76.280  55.574  1.00 118.13 ? 1000 LEU A CA    1 
ATOM   8476  C  C     . LEU D 4  1000 ? 31.503  -77.625  55.286  1.00 118.69 ? 1000 LEU A C     1 
ATOM   8477  O  O     . LEU D 4  1000 ? 31.125  -78.639  55.879  1.00 118.64 ? 1000 LEU A O     1 
ATOM   8478  C  CB    . LEU D 4  1000 ? 31.591  -75.653  56.747  1.00 118.05 ? 1000 LEU A CB    1 
ATOM   8479  C  CG    . LEU D 4  1000 ? 31.592  -74.150  56.603  1.00 118.94 ? 1000 LEU A CG    1 
ATOM   8480  C  CD1   . LEU D 4  1000 ? 31.328  -73.550  57.966  1.00 119.07 ? 1000 LEU A CD1   1 
ATOM   8481  C  CD2   . LEU D 4  1000 ? 32.920  -73.662  55.962  1.00 120.27 ? 1000 LEU A CD2   1 
ATOM   8482  N  N     . ARG D 4  1001 ? 32.473  -77.651  54.388  1.00 119.39 ? 1001 ARG A N     1 
ATOM   8483  C  CA    . ARG D 4  1001 ? 32.934  -78.945  53.939  1.00 120.19 ? 1001 ARG A CA    1 
ATOM   8484  C  C     . ARG D 4  1001 ? 34.389  -79.295  54.198  1.00 121.00 ? 1001 ARG A C     1 
ATOM   8485  O  O     . ARG D 4  1001 ? 34.757  -80.459  54.076  1.00 121.10 ? 1001 ARG A O     1 
ATOM   8486  C  CB    . ARG D 4  1001 ? 32.569  -79.143  52.474  1.00 120.19 ? 1001 ARG A CB    1 
ATOM   8487  C  CG    . ARG D 4  1001 ? 31.387  -80.079  52.287  1.00 119.60 ? 1001 ARG A CG    1 
ATOM   8488  C  CD    . ARG D 4  1001 ? 30.880  -80.039  50.878  1.00 117.39 ? 1001 ARG A CD    1 
ATOM   8489  N  NE    . ARG D 4  1001 ? 29.772  -79.114  50.801  1.00 116.32 ? 1001 ARG A NE    1 
ATOM   8490  C  CZ    . ARG D 4  1001 ? 28.504  -79.491  50.855  1.00 116.72 ? 1001 ARG A CZ    1 
ATOM   8491  N  NH1   . ARG D 4  1001 ? 28.217  -80.791  50.968  1.00 115.64 ? 1001 ARG A NH1   1 
ATOM   8492  N  NH2   . ARG D 4  1001 ? 27.531  -78.572  50.781  1.00 116.18 ? 1001 ARG A NH2   1 
ATOM   8493  N  N     . GLY D 4  1002 ? 35.201  -78.302  54.563  1.00 121.96 ? 1002 GLY A N     1 
ATOM   8494  C  CA    . GLY D 4  1002 ? 36.628  -78.499  54.830  1.00 122.82 ? 1002 GLY A CA    1 
ATOM   8495  C  C     . GLY D 4  1002 ? 36.905  -79.753  55.630  1.00 123.84 ? 1002 GLY A C     1 
ATOM   8496  O  O     . GLY D 4  1002 ? 36.201  -80.046  56.594  1.00 123.68 ? 1002 GLY A O     1 
ATOM   8497  N  N     . LYS D 4  1003 ? 37.940  -80.488  55.222  1.00 125.11 ? 1003 LYS A N     1 
ATOM   8498  C  CA    . LYS D 4  1003 ? 38.285  -81.788  55.810  1.00 126.23 ? 1003 LYS A CA    1 
ATOM   8499  C  C     . LYS D 4  1003 ? 39.180  -81.711  57.048  1.00 126.54 ? 1003 LYS A C     1 
ATOM   8500  O  O     . LYS D 4  1003 ? 39.673  -82.741  57.511  1.00 126.99 ? 1003 LYS A O     1 
ATOM   8501  C  CB    . LYS D 4  1003 ? 38.978  -82.677  54.772  1.00 126.23 ? 1003 LYS A CB    1 
ATOM   8502  C  CG    . LYS D 4  1003 ? 38.081  -83.284  53.686  1.00 127.25 ? 1003 LYS A CG    1 
ATOM   8503  C  CD    . LYS D 4  1003 ? 38.816  -84.452  52.984  1.00 127.19 ? 1003 LYS A CD    1 
ATOM   8504  C  CE    . LYS D 4  1003 ? 38.628  -84.438  51.464  1.00 127.86 ? 1003 LYS A CE    1 
ATOM   8505  N  NZ    . LYS D 4  1003 ? 39.755  -85.153  50.801  1.00 127.10 ? 1003 LYS A NZ    1 
ATOM   8506  N  N     . ASN D 4  1004 ? 39.410  -80.512  57.579  1.00 126.93 ? 1004 ASN A N     1 
ATOM   8507  C  CA    . ASN D 4  1004 ? 40.182  -80.376  58.815  1.00 127.34 ? 1004 ASN A CA    1 
ATOM   8508  C  C     . ASN D 4  1004 ? 39.332  -79.975  60.020  1.00 127.56 ? 1004 ASN A C     1 
ATOM   8509  O  O     . ASN D 4  1004 ? 38.264  -79.389  59.873  1.00 127.53 ? 1004 ASN A O     1 
ATOM   8510  C  CB    . ASN D 4  1004 ? 41.333  -79.398  58.619  1.00 127.55 ? 1004 ASN A CB    1 
ATOM   8511  C  CG    . ASN D 4  1004 ? 40.858  -77.991  58.354  1.00 127.58 ? 1004 ASN A CG    1 
ATOM   8512  O  OD1   . ASN D 4  1004 ? 40.421  -77.287  59.265  1.00 128.10 ? 1004 ASN A OD1   1 
ATOM   8513  N  ND2   . ASN D 4  1004 ? 40.956  -77.563  57.102  1.00 127.57 ? 1004 ASN A ND2   1 
ATOM   8514  N  N     . GLU D 4  1005 ? 39.827  -80.285  61.212  1.00 127.96 ? 1005 GLU A N     1 
ATOM   8515  C  CA    . GLU D 4  1005 ? 39.062  -80.118  62.454  1.00 128.66 ? 1005 GLU A CA    1 
ATOM   8516  C  C     . GLU D 4  1005 ? 38.497  -78.709  62.713  1.00 128.29 ? 1005 GLU A C     1 
ATOM   8517  O  O     . GLU D 4  1005 ? 37.329  -78.576  63.085  1.00 128.13 ? 1005 GLU A O     1 
ATOM   8518  C  CB    . GLU D 4  1005 ? 39.862  -80.636  63.660  1.00 128.94 ? 1005 GLU A CB    1 
ATOM   8519  C  CG    . GLU D 4  1005 ? 41.229  -79.971  63.868  1.00 131.95 ? 1005 GLU A CG    1 
ATOM   8520  C  CD    . GLU D 4  1005 ? 42.310  -80.415  62.849  1.00 135.64 ? 1005 GLU A CD    1 
ATOM   8521  O  OE1   . GLU D 4  1005 ? 42.152  -80.142  61.627  1.00 136.22 ? 1005 GLU A OE1   1 
ATOM   8522  O  OE2   . GLU D 4  1005 ? 43.332  -81.017  63.285  1.00 136.42 ? 1005 GLU A OE2   1 
ATOM   8523  N  N     . ILE D 4  1006 ? 39.312  -77.672  62.501  1.00 128.05 ? 1006 ILE A N     1 
ATOM   8524  C  CA    . ILE D 4  1006 ? 38.892  -76.281  62.745  1.00 127.60 ? 1006 ILE A CA    1 
ATOM   8525  C  C     . ILE D 4  1006 ? 37.580  -75.997  62.039  1.00 127.50 ? 1006 ILE A C     1 
ATOM   8526  O  O     . ILE D 4  1006 ? 36.636  -75.534  62.677  1.00 127.67 ? 1006 ILE A O     1 
ATOM   8527  C  CB    . ILE D 4  1006 ? 39.976  -75.228  62.341  1.00 127.37 ? 1006 ILE A CB    1 
ATOM   8528  C  CG1   . ILE D 4  1006 ? 41.305  -75.487  63.065  1.00 128.58 ? 1006 ILE A CG1   1 
ATOM   8529  C  CG2   . ILE D 4  1006 ? 39.532  -73.826  62.647  1.00 126.44 ? 1006 ILE A CG2   1 
ATOM   8530  C  CD1   . ILE D 4  1006 ? 41.225  -75.812  64.589  1.00 129.73 ? 1006 ILE A CD1   1 
ATOM   8531  N  N     . ILE D 4  1007 ? 37.520  -76.305  60.740  1.00 127.31 ? 1007 ILE A N     1 
ATOM   8532  C  CA    . ILE D 4  1007 ? 36.324  -76.077  59.908  1.00 127.19 ? 1007 ILE A CA    1 
ATOM   8533  C  C     . ILE D 4  1007 ? 35.153  -76.951  60.374  1.00 127.59 ? 1007 ILE A C     1 
ATOM   8534  O  O     . ILE D 4  1007 ? 34.033  -76.448  60.599  1.00 127.47 ? 1007 ILE A O     1 
ATOM   8535  C  CB    . ILE D 4  1007 ? 36.615  -76.334  58.400  1.00 126.84 ? 1007 ILE A CB    1 
ATOM   8536  C  CG1   . ILE D 4  1007 ? 37.738  -75.430  57.884  1.00 126.69 ? 1007 ILE A CG1   1 
ATOM   8537  C  CG2   . ILE D 4  1007 ? 35.378  -76.150  57.557  1.00 126.67 ? 1007 ILE A CG2   1 
ATOM   8538  C  CD1   . ILE D 4  1007 ? 37.344  -73.995  57.597  1.00 126.85 ? 1007 ILE A CD1   1 
ATOM   8539  N  N     . GLN D 4  1008 ? 35.443  -78.249  60.534  1.00 127.81 ? 1008 GLN A N     1 
ATOM   8540  C  CA    . GLN D 4  1008 ? 34.487  -79.263  61.000  1.00 128.08 ? 1008 GLN A CA    1 
ATOM   8541  C  C     . GLN D 4  1008 ? 33.913  -78.972  62.390  1.00 127.99 ? 1008 GLN A C     1 
ATOM   8542  O  O     . GLN D 4  1008 ? 32.852  -79.495  62.763  1.00 127.84 ? 1008 GLN A O     1 
ATOM   8543  C  CB    . GLN D 4  1008 ? 35.147  -80.642  60.984  1.00 128.19 ? 1008 GLN A CB    1 
ATOM   8544  C  CG    . GLN D 4  1008 ? 35.349  -81.209  59.588  1.00 129.90 ? 1008 GLN A CG    1 
ATOM   8545  C  CD    . GLN D 4  1008 ? 34.029  -81.545  58.895  1.00 132.67 ? 1008 GLN A CD    1 
ATOM   8546  O  OE1   . GLN D 4  1008 ? 33.080  -82.002  59.536  1.00 134.25 ? 1008 GLN A OE1   1 
ATOM   8547  N  NE2   . GLN D 4  1008 ? 33.962  -81.316  57.583  1.00 133.71 ? 1008 GLN A NE2   1 
ATOM   8548  N  N     . ASN D 4  1009 ? 34.640  -78.141  63.139  1.00 127.98 ? 1009 ASN A N     1 
ATOM   8549  C  CA    . ASN D 4  1009 ? 34.253  -77.678  64.471  1.00 127.72 ? 1009 ASN A CA    1 
ATOM   8550  C  C     . ASN D 4  1009 ? 33.321  -76.480  64.462  1.00 127.32 ? 1009 ASN A C     1 
ATOM   8551  O  O     . ASN D 4  1009 ? 32.664  -76.215  65.458  1.00 127.45 ? 1009 ASN A O     1 
ATOM   8552  C  CB    . ASN D 4  1009 ? 35.492  -77.336  65.300  1.00 127.90 ? 1009 ASN A CB    1 
ATOM   8553  C  CG    . ASN D 4  1009 ? 35.881  -78.440  66.242  1.00 128.01 ? 1009 ASN A CG    1 
ATOM   8554  O  OD1   . ASN D 4  1009 ? 35.658  -78.337  67.448  1.00 128.84 ? 1009 ASN A OD1   1 
ATOM   8555  N  ND2   . ASN D 4  1009 ? 36.458  -79.510  65.704  1.00 127.99 ? 1009 ASN A ND2   1 
ATOM   8556  N  N     . ALA D 4  1010 ? 33.298  -75.735  63.363  1.00 126.83 ? 1010 ALA A N     1 
ATOM   8557  C  CA    . ALA D 4  1010 ? 32.287  -74.701  63.184  1.00 126.63 ? 1010 ALA A CA    1 
ATOM   8558  C  C     . ALA D 4  1010 ? 31.092  -75.330  62.467  1.00 126.30 ? 1010 ALA A C     1 
ATOM   8559  O  O     . ALA D 4  1010 ? 29.941  -74.870  62.599  1.00 125.92 ? 1010 ALA A O     1 
ATOM   8560  C  CB    . ALA D 4  1010 ? 32.843  -73.521  62.395  1.00 126.83 ? 1010 ALA A CB    1 
ATOM   8561  N  N     . GLN D 4  1011 ? 31.383  -76.388  61.706  1.00 125.77 ? 1011 GLN A N     1 
ATOM   8562  C  CA    . GLN D 4  1011 ? 30.341  -77.191  61.089  1.00 124.98 ? 1011 GLN A CA    1 
ATOM   8563  C  C     . GLN D 4  1011 ? 29.518  -77.847  62.172  1.00 125.02 ? 1011 GLN A C     1 
ATOM   8564  O  O     . GLN D 4  1011 ? 28.296  -77.856  62.094  1.00 125.11 ? 1011 GLN A O     1 
ATOM   8565  C  CB    . GLN D 4  1011 ? 30.919  -78.255  60.165  1.00 124.66 ? 1011 GLN A CB    1 
ATOM   8566  C  CG    . GLN D 4  1011 ? 29.909  -79.333  59.762  1.00 122.87 ? 1011 GLN A CG    1 
ATOM   8567  C  CD    . GLN D 4  1011 ? 28.678  -78.747  59.115  1.00 120.69 ? 1011 GLN A CD    1 
ATOM   8568  O  OE1   . GLN D 4  1011 ? 28.782  -77.861  58.271  1.00 121.07 ? 1011 GLN A OE1   1 
ATOM   8569  N  NE2   . GLN D 4  1011 ? 27.507  -79.233  59.506  1.00 118.65 ? 1011 GLN A NE2   1 
ATOM   8570  N  N     . ARG D 4  1012 ? 30.183  -78.391  63.186  1.00 124.90 ? 1012 ARG A N     1 
ATOM   8571  C  CA    . ARG D 4  1012 ? 29.462  -78.949  64.302  1.00 125.11 ? 1012 ARG A CA    1 
ATOM   8572  C  C     . ARG D 4  1012 ? 28.617  -77.849  64.921  1.00 124.91 ? 1012 ARG A C     1 
ATOM   8573  O  O     . ARG D 4  1012 ? 27.497  -78.106  65.358  1.00 125.17 ? 1012 ARG A O     1 
ATOM   8574  C  CB    . ARG D 4  1012 ? 30.410  -79.544  65.335  1.00 125.57 ? 1012 ARG A CB    1 
ATOM   8575  C  CG    . ARG D 4  1012 ? 29.818  -80.736  66.097  1.00 127.71 ? 1012 ARG A CG    1 
ATOM   8576  C  CD    . ARG D 4  1012 ? 30.451  -80.928  67.485  1.00 131.51 ? 1012 ARG A CD    1 
ATOM   8577  N  NE    . ARG D 4  1012 ? 31.830  -81.436  67.433  1.00 134.53 ? 1012 ARG A NE    1 
ATOM   8578  C  CZ    . ARG D 4  1012 ? 32.919  -80.723  67.736  1.00 135.72 ? 1012 ARG A CZ    1 
ATOM   8579  N  NH1   . ARG D 4  1012 ? 32.819  -79.444  68.119  1.00 135.93 ? 1012 ARG A NH1   1 
ATOM   8580  N  NH2   . ARG D 4  1012 ? 34.119  -81.296  67.654  1.00 135.73 ? 1012 ARG A NH2   1 
ATOM   8581  N  N     . ASP D 4  1013 ? 29.132  -76.616  64.901  1.00 124.57 ? 1013 ASP A N     1 
ATOM   8582  C  CA    . ASP D 4  1013 ? 28.504  -75.465  65.586  1.00 124.19 ? 1013 ASP A CA    1 
ATOM   8583  C  C     . ASP D 4  1013 ? 27.326  -74.753  64.908  1.00 123.14 ? 1013 ASP A C     1 
ATOM   8584  O  O     . ASP D 4  1013 ? 26.421  -74.279  65.587  1.00 122.89 ? 1013 ASP A O     1 
ATOM   8585  C  CB    . ASP D 4  1013 ? 29.561  -74.421  65.937  1.00 124.71 ? 1013 ASP A CB    1 
ATOM   8586  C  CG    . ASP D 4  1013 ? 30.179  -74.655  67.304  1.00 127.22 ? 1013 ASP A CG    1 
ATOM   8587  O  OD1   . ASP D 4  1013 ? 29.742  -75.597  68.032  1.00 129.23 ? 1013 ASP A OD1   1 
ATOM   8588  O  OD2   . ASP D 4  1013 ? 31.111  -73.882  67.651  1.00 130.58 ? 1013 ASP A OD2   1 
ATOM   8589  N  N     . ALA D 4  1014 ? 27.356  -74.652  63.586  1.00 121.83 ? 1014 ALA A N     1 
ATOM   8590  C  CA    . ALA D 4  1014 ? 26.336  -73.922  62.856  1.00 120.72 ? 1014 ALA A CA    1 
ATOM   8591  C  C     . ALA D 4  1014 ? 25.010  -74.682  62.841  1.00 119.89 ? 1014 ALA A C     1 
ATOM   8592  O  O     . ALA D 4  1014 ? 23.946  -74.168  62.448  1.00 120.06 ? 1014 ALA A O     1 
ATOM   8593  C  CB    . ALA D 4  1014 ? 26.817  -73.681  61.453  1.00 121.06 ? 1014 ALA A CB    1 
ATOM   8594  N  N     . VAL D 4  1015 ? 25.087  -75.915  63.306  1.00 118.56 ? 1015 VAL A N     1 
ATOM   8595  C  CA    . VAL D 4  1015 ? 24.033  -76.882  63.108  1.00 117.34 ? 1015 VAL A CA    1 
ATOM   8596  C  C     . VAL D 4  1015 ? 23.407  -77.234  64.460  1.00 116.29 ? 1015 VAL A C     1 
ATOM   8597  O  O     . VAL D 4  1015 ? 22.250  -77.637  64.553  1.00 115.86 ? 1015 VAL A O     1 
ATOM   8598  C  CB    . VAL D 4  1015 ? 24.635  -78.106  62.398  1.00 117.34 ? 1015 VAL A CB    1 
ATOM   8599  C  CG1   . VAL D 4  1015 ? 23.605  -79.137  62.157  1.00 118.02 ? 1015 VAL A CG1   1 
ATOM   8600  C  CG2   . VAL D 4  1015 ? 25.222  -77.694  61.063  1.00 117.03 ? 1015 VAL A CG2   1 
ATOM   8601  N  N     . THR D 4  1016 ? 24.196  -77.028  65.504  1.00 115.27 ? 1016 THR A N     1 
ATOM   8602  C  CA    . THR D 4  1016 ? 23.806  -77.263  66.888  1.00 114.48 ? 1016 THR A CA    1 
ATOM   8603  C  C     . THR D 4  1016 ? 22.359  -76.956  67.248  1.00 114.25 ? 1016 THR A C     1 
ATOM   8604  O  O     . THR D 4  1016 ? 21.705  -77.771  67.900  1.00 113.81 ? 1016 THR A O     1 
ATOM   8605  C  CB    . THR D 4  1016 ? 24.696  -76.464  67.819  1.00 114.35 ? 1016 THR A CB    1 
ATOM   8606  O  OG1   . THR D 4  1016 ? 26.031  -76.459  67.297  1.00 113.31 ? 1016 THR A OG1   1 
ATOM   8607  C  CG2   . THR D 4  1016 ? 24.661  -77.060  69.225  1.00 114.46 ? 1016 THR A CG2   1 
ATOM   8608  N  N     . LEU D 4  1017 ? 21.870  -75.778  66.854  1.00 114.44 ? 1017 LEU A N     1 
ATOM   8609  C  CA    . LEU D 4  1017 ? 20.478  -75.437  67.131  1.00 114.48 ? 1017 LEU A CA    1 
ATOM   8610  C  C     . LEU D 4  1017 ? 19.600  -76.351  66.310  1.00 114.79 ? 1017 LEU A C     1 
ATOM   8611  O  O     . LEU D 4  1017 ? 18.865  -77.146  66.893  1.00 115.23 ? 1017 LEU A O     1 
ATOM   8612  C  CB    . LEU D 4  1017 ? 20.100  -73.954  66.932  1.00 114.02 ? 1017 LEU A CB    1 
ATOM   8613  C  CG    . LEU D 4  1017 ? 18.836  -73.722  67.790  1.00 113.45 ? 1017 LEU A CG    1 
ATOM   8614  C  CD1   . LEU D 4  1017 ? 19.213  -73.407  69.209  1.00 112.76 ? 1017 LEU A CD1   1 
ATOM   8615  C  CD2   . LEU D 4  1017 ? 17.900  -72.653  67.299  1.00 113.20 ? 1017 LEU A CD2   1 
ATOM   8616  N  N     . PHE D 4  1018 ? 19.707  -76.294  64.979  1.00 114.80 ? 1018 PHE A N     1 
ATOM   8617  C  CA    . PHE D 4  1018 ? 18.851  -77.134  64.132  1.00 114.65 ? 1018 PHE A CA    1 
ATOM   8618  C  C     . PHE D 4  1018 ? 18.658  -78.574  64.672  1.00 115.09 ? 1018 PHE A C     1 
ATOM   8619  O  O     . PHE D 4  1018 ? 17.531  -79.059  64.829  1.00 115.03 ? 1018 PHE A O     1 
ATOM   8620  C  CB    . PHE D 4  1018 ? 19.320  -77.149  62.679  1.00 113.99 ? 1018 PHE A CB    1 
ATOM   8621  C  CG    . PHE D 4  1018 ? 18.333  -77.780  61.756  1.00 112.98 ? 1018 PHE A CG    1 
ATOM   8622  C  CD1   . PHE D 4  1018 ? 16.984  -77.430  61.823  1.00 112.57 ? 1018 PHE A CD1   1 
ATOM   8623  C  CD2   . PHE D 4  1018 ? 18.729  -78.730  60.839  1.00 112.26 ? 1018 PHE A CD2   1 
ATOM   8624  C  CE1   . PHE D 4  1018 ? 16.052  -78.015  60.986  1.00 112.23 ? 1018 PHE A CE1   1 
ATOM   8625  C  CE2   . PHE D 4  1018 ? 17.804  -79.326  59.998  1.00 112.47 ? 1018 PHE A CE2   1 
ATOM   8626  C  CZ    . PHE D 4  1018 ? 16.462  -78.963  60.067  1.00 112.80 ? 1018 PHE A CZ    1 
ATOM   8627  N  N     . CYS D 4  1019 ? 19.757  -79.227  65.012  1.00 115.47 ? 1019 CYS A N     1 
ATOM   8628  C  CA    . CYS D 4  1019 ? 19.697  -80.610  65.452  1.00 116.03 ? 1019 CYS A CA    1 
ATOM   8629  C  C     . CYS D 4  1019 ? 18.990  -80.810  66.770  1.00 116.05 ? 1019 CYS A C     1 
ATOM   8630  O  O     . CYS D 4  1019 ? 18.566  -81.925  67.073  1.00 116.58 ? 1019 CYS A O     1 
ATOM   8631  C  CB    . CYS D 4  1019 ? 21.092  -81.183  65.526  1.00 116.19 ? 1019 CYS A CB    1 
ATOM   8632  S  SG    . CYS D 4  1019 ? 22.024  -80.682  64.095  1.00 117.62 ? 1019 CYS A SG    1 
ATOM   8633  N  N     . CYS D 4  1020 ? 18.871  -79.746  67.556  1.00 115.87 ? 1020 CYS A N     1 
ATOM   8634  C  CA    . CYS D 4  1020 ? 18.034  -79.789  68.745  1.00 115.63 ? 1020 CYS A CA    1 
ATOM   8635  C  C     . CYS D 4  1020 ? 16.634  -80.056  68.334  1.00 115.28 ? 1020 CYS A C     1 
ATOM   8636  O  O     . CYS D 4  1020 ? 15.985  -80.962  68.875  1.00 115.50 ? 1020 CYS A O     1 
ATOM   8637  C  CB    . CYS D 4  1020 ? 18.024  -78.462  69.441  1.00 115.57 ? 1020 CYS A CB    1 
ATOM   8638  S  SG    . CYS D 4  1020 ? 19.285  -78.378  70.587  1.00 116.44 ? 1020 CYS A SG    1 
ATOM   8639  N  N     . LEU D 4  1021 ? 16.178  -79.246  67.378  1.00 114.65 ? 1021 LEU A N     1 
ATOM   8640  C  CA    . LEU D 4  1021 ? 14.837  -79.378  66.848  1.00 114.64 ? 1021 LEU A CA    1 
ATOM   8641  C  C     . LEU D 4  1021 ? 14.687  -80.763  66.242  1.00 114.49 ? 1021 LEU A C     1 
ATOM   8642  O  O     . LEU D 4  1021 ? 13.663  -81.434  66.440  1.00 115.05 ? 1021 LEU A O     1 
ATOM   8643  C  CB    . LEU D 4  1021 ? 14.533  -78.312  65.798  1.00 114.56 ? 1021 LEU A CB    1 
ATOM   8644  C  CG    . LEU D 4  1021 ? 13.165  -78.461  65.110  1.00 114.76 ? 1021 LEU A CG    1 
ATOM   8645  C  CD1   . LEU D 4  1021 ? 12.005  -78.182  66.068  1.00 113.43 ? 1021 LEU A CD1   1 
ATOM   8646  C  CD2   . LEU D 4  1021 ? 13.086  -77.578  63.863  1.00 114.89 ? 1021 LEU A CD2   1 
ATOM   8647  N  N     . LEU D 4  1022 ? 15.716  -81.194  65.517  1.00 113.61 ? 1022 LEU A N     1 
ATOM   8648  C  CA    . LEU D 4  1022 ? 15.676  -82.497  64.897  1.00 112.35 ? 1022 LEU A CA    1 
ATOM   8649  C  C     . LEU D 4  1022 ? 15.397  -83.527  65.959  1.00 111.71 ? 1022 LEU A C     1 
ATOM   8650  O  O     . LEU D 4  1022 ? 14.365  -84.189  65.943  1.00 111.81 ? 1022 LEU A O     1 
ATOM   8651  C  CB    . LEU D 4  1022 ? 16.992  -82.814  64.221  1.00 112.06 ? 1022 LEU A CB    1 
ATOM   8652  C  CG    . LEU D 4  1022 ? 16.715  -83.560  62.940  1.00 110.99 ? 1022 LEU A CG    1 
ATOM   8653  C  CD1   . LEU D 4  1022 ? 16.528  -82.538  61.838  1.00 111.07 ? 1022 LEU A CD1   1 
ATOM   8654  C  CD2   . LEU D 4  1022 ? 17.894  -84.390  62.683  1.00 110.84 ? 1022 LEU A CD2   1 
ATOM   8655  N  N     . ARG D 4  1023 ? 16.299  -83.629  66.912  1.00 110.69 ? 1023 ARG A N     1 
ATOM   8656  C  CA    . ARG D 4  1023 ? 16.185  -84.680  67.863  1.00 110.30 ? 1023 ARG A CA    1 
ATOM   8657  C  C     . ARG D 4  1023 ? 14.876  -84.558  68.605  1.00 110.15 ? 1023 ARG A C     1 
ATOM   8658  O  O     . ARG D 4  1023 ? 14.374  -85.539  69.125  1.00 110.01 ? 1023 ARG A O     1 
ATOM   8659  C  CB    . ARG D 4  1023 ? 17.363  -84.657  68.812  1.00 110.41 ? 1023 ARG A CB    1 
ATOM   8660  C  CG    . ARG D 4  1023 ? 18.678  -84.868  68.130  1.00 110.18 ? 1023 ARG A CG    1 
ATOM   8661  C  CD    . ARG D 4  1023 ? 19.749  -84.595  69.105  1.00 110.86 ? 1023 ARG A CD    1 
ATOM   8662  N  NE    . ARG D 4  1023 ? 20.964  -84.110  68.476  1.00 111.93 ? 1023 ARG A NE    1 
ATOM   8663  C  CZ    . ARG D 4  1023 ? 21.563  -82.963  68.786  1.00 113.19 ? 1023 ARG A CZ    1 
ATOM   8664  N  NH1   . ARG D 4  1023 ? 21.046  -82.162  69.718  1.00 112.70 ? 1023 ARG A NH1   1 
ATOM   8665  N  NH2   . ARG D 4  1023 ? 22.692  -82.622  68.161  1.00 114.19 ? 1023 ARG A NH2   1 
ATOM   8666  N  N     . SER D 4  1024 ? 14.300  -83.368  68.641  1.00 110.07 ? 1024 SER A N     1 
ATOM   8667  C  CA    . SER D 4  1024 ? 13.062  -83.217  69.392  1.00 110.58 ? 1024 SER A CA    1 
ATOM   8668  C  C     . SER D 4  1024 ? 11.796  -83.621  68.606  1.00 111.16 ? 1024 SER A C     1 
ATOM   8669  O  O     . SER D 4  1024 ? 10.775  -83.990  69.209  1.00 111.59 ? 1024 SER A O     1 
ATOM   8670  C  CB    . SER D 4  1024 ? 12.947  -81.822  70.021  1.00 110.49 ? 1024 SER A CB    1 
ATOM   8671  O  OG    . SER D 4  1024 ? 12.839  -80.798  69.057  1.00 110.10 ? 1024 SER A OG    1 
ATOM   8672  N  N     . ARG D 4  1025 ? 11.874  -83.571  67.274  1.00 111.32 ? 1025 ARG A N     1 
ATOM   8673  C  CA    . ARG D 4  1025 ? 10.796  -84.024  66.384  1.00 111.21 ? 1025 ARG A CA    1 
ATOM   8674  C  C     . ARG D 4  1025 ? 10.978  -85.489  65.900  1.00 111.27 ? 1025 ARG A C     1 
ATOM   8675  O  O     . ARG D 4  1025 ? 10.004  -86.174  65.565  1.00 111.03 ? 1025 ARG A O     1 
ATOM   8676  C  CB    . ARG D 4  1025 ? 10.690  -83.073  65.190  1.00 111.19 ? 1025 ARG A CB    1 
ATOM   8677  C  CG    . ARG D 4  1025 ? 9.550   -82.077  65.259  1.00 112.01 ? 1025 ARG A CG    1 
ATOM   8678  C  CD    . ARG D 4  1025 ? 9.902   -80.855  66.059  1.00 114.17 ? 1025 ARG A CD    1 
ATOM   8679  N  NE    . ARG D 4  1025 ? 8.841   -79.852  66.017  1.00 116.90 ? 1025 ARG A NE    1 
ATOM   8680  C  CZ    . ARG D 4  1025 ? 8.696   -78.962  65.038  1.00 120.48 ? 1025 ARG A CZ    1 
ATOM   8681  N  NH1   . ARG D 4  1025 ? 9.552   -78.964  64.024  1.00 122.81 ? 1025 ARG A NH1   1 
ATOM   8682  N  NH2   . ARG D 4  1025 ? 7.706   -78.064  65.055  1.00 121.88 ? 1025 ARG A NH2   1 
ATOM   8683  N  N     . LEU D 4  1026 ? 12.228  -85.958  65.879  1.00 111.26 ? 1026 LEU A N     1 
ATOM   8684  C  CA    . LEU D 4  1026 ? 12.574  -87.294  65.381  1.00 111.19 ? 1026 LEU A CA    1 
ATOM   8685  C  C     . LEU D 4  1026 ? 13.089  -88.244  66.452  1.00 111.35 ? 1026 LEU A C     1 
ATOM   8686  O  O     . LEU D 4  1026 ? 14.087  -88.965  66.244  1.00 111.15 ? 1026 LEU A O     1 
ATOM   8687  C  CB    . LEU D 4  1026 ? 13.633  -87.183  64.304  1.00 111.08 ? 1026 LEU A CB    1 
ATOM   8688  C  CG    . LEU D 4  1026 ? 13.199  -86.468  63.050  1.00 111.20 ? 1026 LEU A CG    1 
ATOM   8689  C  CD1   . LEU D 4  1026 ? 14.313  -86.577  62.038  1.00 111.58 ? 1026 LEU A CD1   1 
ATOM   8690  C  CD2   . LEU D 4  1026 ? 11.923  -87.116  62.548  1.00 111.94 ? 1026 LEU A CD2   1 
ATOM   8691  N  N     . ALA D 4  1027 ? 12.414  -88.241  67.598  1.00 111.50 ? 1027 ALA A N     1 
ATOM   8692  C  CA    . ALA D 4  1027 ? 12.764  -89.153  68.674  1.00 111.49 ? 1027 ALA A CA    1 
ATOM   8693  C  C     . ALA D 4  1027 ? 11.816  -90.333  68.688  1.00 111.51 ? 1027 ALA A C     1 
ATOM   8694  O  O     . ALA D 4  1027 ? 10.630  -90.215  68.353  1.00 111.75 ? 1027 ALA A O     1 
ATOM   8695  C  CB    . ALA D 4  1027 ? 12.757  -88.456  70.008  1.00 111.61 ? 1027 ALA A CB    1 
ATOM   8696  N  N     . THR D 4  1028 ? 12.378  -91.463  69.099  1.00 111.16 ? 1028 THR A N     1 
ATOM   8697  C  CA    . THR D 4  1028 ? 11.753  -92.762  69.078  1.00 110.36 ? 1028 THR A CA    1 
ATOM   8698  C  C     . THR D 4  1028 ? 10.326  -92.760  69.559  1.00 110.33 ? 1028 THR A C     1 
ATOM   8699  O  O     . THR D 4  1028 ? 9.441   -93.143  68.817  1.00 110.35 ? 1028 THR A O     1 
ATOM   8700  C  CB    . THR D 4  1028 ? 12.551  -93.674  69.942  1.00 110.24 ? 1028 THR A CB    1 
ATOM   8701  O  OG1   . THR D 4  1028 ? 13.907  -93.652  69.482  1.00 109.75 ? 1028 THR A OG1   1 
ATOM   8702  C  CG2   . THR D 4  1028 ? 11.999  -95.066  69.871  1.00 110.55 ? 1028 THR A CG2   1 
ATOM   8703  N  N     . ARG D 4  1029 ? 10.093  -92.321  70.789  1.00 110.43 ? 1029 ARG A N     1 
ATOM   8704  C  CA    . ARG D 4  1029 ? 8.737   -92.291  71.316  1.00 110.74 ? 1029 ARG A CA    1 
ATOM   8705  C  C     . ARG D 4  1029 ? 7.815   -91.555  70.376  1.00 110.43 ? 1029 ARG A C     1 
ATOM   8706  O  O     . ARG D 4  1029 ? 6.746   -92.046  70.061  1.00 110.43 ? 1029 ARG A O     1 
ATOM   8707  C  CB    . ARG D 4  1029 ? 8.693   -91.589  72.657  1.00 111.31 ? 1029 ARG A CB    1 
ATOM   8708  C  CG    . ARG D 4  1029 ? 8.133   -92.444  73.771  1.00 112.79 ? 1029 ARG A CG    1 
ATOM   8709  C  CD    . ARG D 4  1029 ? 6.624   -92.564  73.823  1.00 113.96 ? 1029 ARG A CD    1 
ATOM   8710  N  NE    . ARG D 4  1029 ? 6.303   -92.937  75.196  1.00 115.83 ? 1029 ARG A NE    1 
ATOM   8711  C  CZ    . ARG D 4  1029 ? 6.386   -94.171  75.686  1.00 116.67 ? 1029 ARG A CZ    1 
ATOM   8712  N  NH1   . ARG D 4  1029 ? 6.733   -95.183  74.893  1.00 117.20 ? 1029 ARG A NH1   1 
ATOM   8713  N  NH2   . ARG D 4  1029 ? 6.097   -94.393  76.967  1.00 116.40 ? 1029 ARG A NH2   1 
ATOM   8714  N  N     . ARG D 4  1030 ? 8.254   -90.382  69.926  1.00 110.10 ? 1030 ARG A N     1 
ATOM   8715  C  CA    . ARG D 4  1030 ? 7.485   -89.527  69.034  1.00 109.84 ? 1030 ARG A CA    1 
ATOM   8716  C  C     . ARG D 4  1030 ? 7.194   -90.102  67.650  1.00 109.36 ? 1030 ARG A C     1 
ATOM   8717  O  O     . ARG D 4  1030 ? 6.026   -90.153  67.234  1.00 109.54 ? 1030 ARG A O     1 
ATOM   8718  C  CB    . ARG D 4  1030 ? 8.199   -88.211  68.869  1.00 109.91 ? 1030 ARG A CB    1 
ATOM   8719  C  CG    . ARG D 4  1030 ? 7.668   -87.176  69.769  1.00 111.88 ? 1030 ARG A CG    1 
ATOM   8720  C  CD    . ARG D 4  1030 ? 7.603   -85.893  69.009  1.00 115.51 ? 1030 ARG A CD    1 
ATOM   8721  N  NE    . ARG D 4  1030 ? 6.906   -84.851  69.748  1.00 117.35 ? 1030 ARG A NE    1 
ATOM   8722  C  CZ    . ARG D 4  1030 ? 6.846   -83.590  69.346  1.00 118.52 ? 1030 ARG A CZ    1 
ATOM   8723  N  NH1   . ARG D 4  1030 ? 7.444   -83.225  68.216  1.00 119.10 ? 1030 ARG A NH1   1 
ATOM   8724  N  NH2   . ARG D 4  1030 ? 6.189   -82.697  70.074  1.00 119.26 ? 1030 ARG A NH2   1 
ATOM   8725  N  N     . VAL D 4  1031 ? 8.249   -90.505  66.935  1.00 108.57 ? 1031 VAL A N     1 
ATOM   8726  C  CA    . VAL D 4  1031 ? 8.107   -91.067  65.593  1.00 107.71 ? 1031 VAL A CA    1 
ATOM   8727  C  C     . VAL D 4  1031 ? 7.099   -92.198  65.671  1.00 107.91 ? 1031 VAL A C     1 
ATOM   8728  O  O     . VAL D 4  1031 ? 6.206   -92.288  64.851  1.00 108.16 ? 1031 VAL A O     1 
ATOM   8729  C  CB    . VAL D 4  1031 ? 9.446   -91.560  65.009  1.00 107.27 ? 1031 VAL A CB    1 
ATOM   8730  C  CG1   . VAL D 4  1031 ? 9.279   -92.016  63.591  1.00 106.43 ? 1031 VAL A CG1   1 
ATOM   8731  C  CG2   . VAL D 4  1031 ? 10.454  -90.459  65.030  1.00 107.13 ? 1031 VAL A CG2   1 
ATOM   8732  N  N     . LEU D 4  1032 ? 7.209   -93.026  66.699  1.00 108.01 ? 1032 LEU A N     1 
ATOM   8733  C  CA    . LEU D 4  1032 ? 6.299   -94.140  66.867  1.00 108.07 ? 1032 LEU A CA    1 
ATOM   8734  C  C     . LEU D 4  1032 ? 4.940   -93.712  67.374  1.00 108.50 ? 1032 LEU A C     1 
ATOM   8735  O  O     . LEU D 4  1032 ? 3.935   -94.014  66.753  1.00 108.79 ? 1032 LEU A O     1 
ATOM   8736  C  CB    . LEU D 4  1032 ? 6.903   -95.182  67.801  1.00 107.79 ? 1032 LEU A CB    1 
ATOM   8737  C  CG    . LEU D 4  1032 ? 7.665   -96.344  67.170  1.00 107.15 ? 1032 LEU A CG    1 
ATOM   8738  C  CD1   . LEU D 4  1032 ? 6.669   -97.410  66.749  1.00 107.58 ? 1032 LEU A CD1   1 
ATOM   8739  C  CD2   . LEU D 4  1032 ? 8.562   -95.921  66.007  1.00 105.03 ? 1032 LEU A CD2   1 
ATOM   8740  N  N     . GLN D 4  1033 ? 4.912   -93.001  68.492  1.00 109.09 ? 1033 GLN A N     1 
ATOM   8741  C  CA    . GLN D 4  1033 ? 3.662   -92.695  69.175  1.00 109.91 ? 1033 GLN A CA    1 
ATOM   8742  C  C     . GLN D 4  1033 ? 2.770   -91.772  68.390  1.00 110.51 ? 1033 GLN A C     1 
ATOM   8743  O  O     . GLN D 4  1033 ? 1.623   -92.117  68.099  1.00 110.72 ? 1033 GLN A O     1 
ATOM   8744  C  CB    . GLN D 4  1033 ? 3.938   -92.005  70.502  1.00 110.09 ? 1033 GLN A CB    1 
ATOM   8745  C  CG    . GLN D 4  1033 ? 2.832   -92.138  71.491  1.00 110.50 ? 1033 GLN A CG    1 
ATOM   8746  C  CD    . GLN D 4  1033 ? 2.818   -93.520  72.034  1.00 112.29 ? 1033 GLN A CD    1 
ATOM   8747  O  OE1   . GLN D 4  1033 ? 2.238   -94.418  71.424  1.00 113.43 ? 1033 GLN A OE1   1 
ATOM   8748  N  NE2   . GLN D 4  1033 ? 3.501   -93.729  73.166  1.00 112.55 ? 1033 GLN A NE2   1 
ATOM   8749  N  N     . GLU D 4  1034 ? 3.309   -90.592  68.073  1.00 111.07 ? 1034 GLU A N     1 
ATOM   8750  C  CA    . GLU D 4  1034 ? 2.505   -89.442  67.670  1.00 111.51 ? 1034 GLU A CA    1 
ATOM   8751  C  C     . GLU D 4  1034 ? 2.137   -89.509  66.202  1.00 111.55 ? 1034 GLU A C     1 
ATOM   8752  O  O     . GLU D 4  1034 ? 0.964   -89.629  65.856  1.00 111.64 ? 1034 GLU A O     1 
ATOM   8753  C  CB    . GLU D 4  1034 ? 3.207   -88.125  68.046  1.00 111.58 ? 1034 GLU A CB    1 
ATOM   8754  C  CG    . GLU D 4  1034 ? 2.933   -87.681  69.496  1.00 112.53 ? 1034 GLU A CG    1 
ATOM   8755  C  CD    . GLU D 4  1034 ? 4.104   -86.942  70.157  1.00 114.08 ? 1034 GLU A CD    1 
ATOM   8756  O  OE1   . GLU D 4  1034 ? 4.326   -85.756  69.828  1.00 114.92 ? 1034 GLU A OE1   1 
ATOM   8757  O  OE2   . GLU D 4  1034 ? 4.789   -87.539  71.025  1.00 114.25 ? 1034 GLU A OE2   1 
ATOM   8758  N  N     . TYR D 4  1035 ? 3.135   -89.466  65.341  1.00 111.63 ? 1035 TYR A N     1 
ATOM   8759  C  CA    . TYR D 4  1035 ? 2.860   -89.579  63.934  1.00 112.11 ? 1035 TYR A CA    1 
ATOM   8760  C  C     . TYR D 4  1035 ? 3.459   -90.860  63.368  1.00 112.13 ? 1035 TYR A C     1 
ATOM   8761  O  O     . TYR D 4  1035 ? 4.657   -90.902  63.105  1.00 112.79 ? 1035 TYR A O     1 
ATOM   8762  C  CB    . TYR D 4  1035 ? 3.408   -88.361  63.213  1.00 112.70 ? 1035 TYR A CB    1 
ATOM   8763  C  CG    . TYR D 4  1035 ? 4.599   -87.609  63.839  1.00 113.33 ? 1035 TYR A CG    1 
ATOM   8764  C  CD1   . TYR D 4  1035 ? 5.882   -88.170  63.910  1.00 112.42 ? 1035 TYR A CD1   1 
ATOM   8765  C  CD2   . TYR D 4  1035 ? 4.443   -86.270  64.258  1.00 114.88 ? 1035 TYR A CD2   1 
ATOM   8766  C  CE1   . TYR D 4  1035 ? 6.961   -87.422  64.436  1.00 113.72 ? 1035 TYR A CE1   1 
ATOM   8767  C  CE2   . TYR D 4  1035 ? 5.513   -85.521  64.785  1.00 114.49 ? 1035 TYR A CE2   1 
ATOM   8768  C  CZ    . TYR D 4  1035 ? 6.760   -86.096  64.871  1.00 113.64 ? 1035 TYR A CZ    1 
ATOM   8769  O  OH    . TYR D 4  1035 ? 7.772   -85.330  65.401  1.00 112.82 ? 1035 TYR A OH    1 
ATOM   8770  N  N     . ARG D 4  1036 ? 2.638   -91.887  63.150  1.00 111.52 ? 1036 ARG A N     1 
ATOM   8771  C  CA    . ARG D 4  1036 ? 3.144   -93.276  63.132  1.00 110.97 ? 1036 ARG A CA    1 
ATOM   8772  C  C     . ARG D 4  1036 ? 3.834   -93.744  61.859  1.00 110.43 ? 1036 ARG A C     1 
ATOM   8773  O  O     . ARG D 4  1036 ? 3.331   -94.593  61.158  1.00 110.26 ? 1036 ARG A O     1 
ATOM   8774  C  CB    . ARG D 4  1036 ? 2.028   -94.241  63.536  1.00 111.20 ? 1036 ARG A CB    1 
ATOM   8775  C  CG    . ARG D 4  1036 ? 1.252   -93.751  64.747  1.00 112.01 ? 1036 ARG A CG    1 
ATOM   8776  C  CD    . ARG D 4  1036 ? -0.190  -94.181  64.723  1.00 113.25 ? 1036 ARG A CD    1 
ATOM   8777  N  NE    . ARG D 4  1036 ? -0.374  -95.488  65.338  1.00 115.34 ? 1036 ARG A NE    1 
ATOM   8778  C  CZ    . ARG D 4  1036 ? -0.365  -95.707  66.653  1.00 116.37 ? 1036 ARG A CZ    1 
ATOM   8779  N  NH1   . ARG D 4  1036 ? -0.171  -94.696  67.499  1.00 116.34 ? 1036 ARG A NH1   1 
ATOM   8780  N  NH2   . ARG D 4  1036 ? -0.551  -96.940  67.126  1.00 116.68 ? 1036 ARG A NH2   1 
ATOM   8781  N  N     . LEU D 4  1037 ? 5.020   -93.217  61.605  1.00 110.44 ? 1037 LEU A N     1 
ATOM   8782  C  CA    . LEU D 4  1037 ? 5.769   -93.444  60.358  1.00 110.94 ? 1037 LEU A CA    1 
ATOM   8783  C  C     . LEU D 4  1037 ? 6.220   -94.890  60.102  1.00 111.26 ? 1037 LEU A C     1 
ATOM   8784  O  O     . LEU D 4  1037 ? 6.715   -95.562  61.007  1.00 111.27 ? 1037 LEU A O     1 
ATOM   8785  C  CB    . LEU D 4  1037 ? 7.006   -92.517  60.310  1.00 110.86 ? 1037 LEU A CB    1 
ATOM   8786  C  CG    . LEU D 4  1037 ? 7.023   -91.048  59.822  1.00 110.93 ? 1037 LEU A CG    1 
ATOM   8787  C  CD1   . LEU D 4  1037 ? 7.732   -90.943  58.483  1.00 110.26 ? 1037 LEU A CD1   1 
ATOM   8788  C  CD2   . LEU D 4  1037 ? 5.638   -90.317  59.793  1.00 110.55 ? 1037 LEU A CD2   1 
ATOM   8789  N  N     . THR D 4  1038 ? 6.065   -95.347  58.857  1.00 111.80 ? 1038 THR A N     1 
ATOM   8790  C  CA    . THR D 4  1038 ? 6.608   -96.637  58.405  1.00 112.18 ? 1038 THR A CA    1 
ATOM   8791  C  C     . THR D 4  1038 ? 7.977   -96.459  57.781  1.00 112.65 ? 1038 THR A C     1 
ATOM   8792  O  O     . THR D 4  1038 ? 8.209   -95.495  57.064  1.00 112.66 ? 1038 THR A O     1 
ATOM   8793  C  CB    . THR D 4  1038 ? 5.725   -97.291  57.340  1.00 112.09 ? 1038 THR A CB    1 
ATOM   8794  O  OG1   . THR D 4  1038 ? 5.417   -96.323  56.326  1.00 112.09 ? 1038 THR A OG1   1 
ATOM   8795  C  CG2   . THR D 4  1038 ? 4.435   -97.861  57.964  1.00 112.03 ? 1038 THR A CG2   1 
ATOM   8796  N  N     . LYS D 4  1039 ? 8.869   -97.408  58.039  1.00 113.54 ? 1039 LYS A N     1 
ATOM   8797  C  CA    . LYS D 4  1039 ? 10.223  -97.403  57.491  1.00 114.63 ? 1039 LYS A CA    1 
ATOM   8798  C  C     . LYS D 4  1039 ? 10.326  -96.682  56.149  1.00 115.28 ? 1039 LYS A C     1 
ATOM   8799  O  O     . LYS D 4  1039 ? 11.109  -95.743  56.021  1.00 115.63 ? 1039 LYS A O     1 
ATOM   8800  C  CB    . LYS D 4  1039 ? 10.773  -98.835  57.406  1.00 114.71 ? 1039 LYS A CB    1 
ATOM   8801  C  CG    . LYS D 4  1039 ? 11.847  -99.077  56.340  1.00 115.57 ? 1039 LYS A CG    1 
ATOM   8802  C  CD    . LYS D 4  1039 ? 13.227  -98.552  56.734  1.00 116.26 ? 1039 LYS A CD    1 
ATOM   8803  C  CE    . LYS D 4  1039 ? 14.306  -99.139  55.819  1.00 117.13 ? 1039 LYS A CE    1 
ATOM   8804  N  NZ    . LYS D 4  1039 ? 15.631  -98.471  55.988  1.00 117.67 ? 1039 LYS A NZ    1 
ATOM   8805  N  N     . GLN D 4  1040 ? 9.527   -97.111  55.167  1.00 116.03 ? 1040 GLN A N     1 
ATOM   8806  C  CA    . GLN D 4  1040 ? 9.531   -96.524  53.806  1.00 116.48 ? 1040 GLN A CA    1 
ATOM   8807  C  C     . GLN D 4  1040 ? 9.339   -94.989  53.801  1.00 116.06 ? 1040 GLN A C     1 
ATOM   8808  O  O     . GLN D 4  1040 ? 10.104  -94.256  53.159  1.00 115.76 ? 1040 GLN A O     1 
ATOM   8809  C  CB    . GLN D 4  1040 ? 8.478   -97.220  52.914  1.00 116.90 ? 1040 GLN A CB    1 
ATOM   8810  C  CG    . GLN D 4  1040 ? 8.722   -97.093  51.400  1.00 118.12 ? 1040 GLN A CG    1 
ATOM   8811  C  CD    . GLN D 4  1040 ? 7.445   -96.840  50.597  1.00 119.56 ? 1040 GLN A CD    1 
ATOM   8812  O  OE1   . GLN D 4  1040 ? 6.357   -96.650  51.154  1.00 119.98 ? 1040 GLN A OE1   1 
ATOM   8813  N  NE2   . GLN D 4  1040 ? 7.583   -96.824  49.278  1.00 119.99 ? 1040 GLN A NE2   1 
ATOM   8814  N  N     . ALA D 4  1041 ? 8.323   -94.533  54.535  1.00 115.80 ? 1041 ALA A N     1 
ATOM   8815  C  CA    . ALA D 4  1041 ? 8.003   -93.113  54.681  1.00 115.73 ? 1041 ALA A CA    1 
ATOM   8816  C  C     . ALA D 4  1041 ? 9.089   -92.365  55.435  1.00 115.63 ? 1041 ALA A C     1 
ATOM   8817  O  O     . ALA D 4  1041 ? 9.439   -91.235  55.086  1.00 115.65 ? 1041 ALA A O     1 
ATOM   8818  C  CB    . ALA D 4  1041 ? 6.670   -92.947  55.403  1.00 115.76 ? 1041 ALA A CB    1 
ATOM   8819  N  N     . PHE D 4  1042 ? 9.602   -92.999  56.483  1.00 115.46 ? 1042 PHE A N     1 
ATOM   8820  C  CA    . PHE D 4  1042 ? 10.612  -92.389  57.323  1.00 115.27 ? 1042 PHE A CA    1 
ATOM   8821  C  C     . PHE D 4  1042 ? 11.833  -92.033  56.503  1.00 115.58 ? 1042 PHE A C     1 
ATOM   8822  O  O     . PHE D 4  1042 ? 12.317  -90.911  56.587  1.00 115.99 ? 1042 PHE A O     1 
ATOM   8823  C  CB    . PHE D 4  1042 ? 10.985  -93.322  58.469  1.00 114.79 ? 1042 PHE A CB    1 
ATOM   8824  C  CG    . PHE D 4  1042 ? 12.072  -92.789  59.371  1.00 114.05 ? 1042 PHE A CG    1 
ATOM   8825  C  CD1   . PHE D 4  1042 ? 11.756  -91.989  60.465  1.00 112.89 ? 1042 PHE A CD1   1 
ATOM   8826  C  CD2   . PHE D 4  1042 ? 13.407  -93.113  59.142  1.00 112.84 ? 1042 PHE A CD2   1 
ATOM   8827  C  CE1   . PHE D 4  1042 ? 12.740  -91.520  61.294  1.00 111.45 ? 1042 PHE A CE1   1 
ATOM   8828  C  CE2   . PHE D 4  1042 ? 14.395  -92.654  59.978  1.00 111.62 ? 1042 PHE A CE2   1 
ATOM   8829  C  CZ    . PHE D 4  1042 ? 14.061  -91.857  61.051  1.00 112.22 ? 1042 PHE A CZ    1 
ATOM   8830  N  N     . ASP D 4  1043 ? 12.310  -92.975  55.695  1.00 115.71 ? 1043 ASP A N     1 
ATOM   8831  C  CA    . ASP D 4  1043 ? 13.503  -92.755  54.898  1.00 116.10 ? 1043 ASP A CA    1 
ATOM   8832  C  C     . ASP D 4  1043 ? 13.301  -91.610  53.936  1.00 115.88 ? 1043 ASP A C     1 
ATOM   8833  O  O     . ASP D 4  1043 ? 14.267  -90.943  53.556  1.00 116.18 ? 1043 ASP A O     1 
ATOM   8834  C  CB    . ASP D 4  1043 ? 13.879  -94.013  54.140  1.00 116.62 ? 1043 ASP A CB    1 
ATOM   8835  C  CG    . ASP D 4  1043 ? 14.342  -95.128  55.066  1.00 118.89 ? 1043 ASP A CG    1 
ATOM   8836  O  OD1   . ASP D 4  1043 ? 15.015  -94.820  56.091  1.00 121.03 ? 1043 ASP A OD1   1 
ATOM   8837  O  OD2   . ASP D 4  1043 ? 14.033  -96.310  54.770  1.00 120.03 ? 1043 ASP A OD2   1 
ATOM   8838  N  N     . TRP D 4  1044 ? 12.044  -91.383  53.554  1.00 115.34 ? 1044 TRP A N     1 
ATOM   8839  C  CA    . TRP D 4  1044 ? 11.675  -90.217  52.764  1.00 114.72 ? 1044 TRP A CA    1 
ATOM   8840  C  C     . TRP D 4  1044 ? 11.752  -88.933  53.607  1.00 114.39 ? 1044 TRP A C     1 
ATOM   8841  O  O     . TRP D 4  1044 ? 12.347  -87.953  53.160  1.00 114.78 ? 1044 TRP A O     1 
ATOM   8842  C  CB    . TRP D 4  1044 ? 10.299  -90.406  52.112  1.00 114.78 ? 1044 TRP A CB    1 
ATOM   8843  C  CG    . TRP D 4  1044 ? 9.821   -89.239  51.296  1.00 114.70 ? 1044 TRP A CG    1 
ATOM   8844  C  CD1   . TRP D 4  1044 ? 10.134  -88.963  50.002  1.00 114.65 ? 1044 TRP A CD1   1 
ATOM   8845  C  CD2   . TRP D 4  1044 ? 8.934   -88.195  51.725  1.00 114.90 ? 1044 TRP A CD2   1 
ATOM   8846  N  NE1   . TRP D 4  1044 ? 9.509   -87.809  49.598  1.00 114.81 ? 1044 TRP A NE1   1 
ATOM   8847  C  CE2   . TRP D 4  1044 ? 8.763   -87.321  50.637  1.00 114.82 ? 1044 TRP A CE2   1 
ATOM   8848  C  CE3   . TRP D 4  1044 ? 8.272   -87.912  52.931  1.00 114.74 ? 1044 TRP A CE3   1 
ATOM   8849  C  CZ2   . TRP D 4  1044 ? 7.960   -86.183  50.714  1.00 115.08 ? 1044 TRP A CZ2   1 
ATOM   8850  C  CZ3   . TRP D 4  1044 ? 7.472   -86.786  53.004  1.00 114.41 ? 1044 TRP A CZ3   1 
ATOM   8851  C  CH2   . TRP D 4  1044 ? 7.323   -85.935  51.907  1.00 114.81 ? 1044 TRP A CH2   1 
ATOM   8852  N  N     . VAL D 4  1045 ? 11.188  -88.927  54.818  1.00 113.65 ? 1045 VAL A N     1 
ATOM   8853  C  CA    . VAL D 4  1045 ? 11.332  -87.757  55.698  1.00 112.88 ? 1045 VAL A CA    1 
ATOM   8854  C  C     . VAL D 4  1045 ? 12.797  -87.390  55.837  1.00 112.88 ? 1045 VAL A C     1 
ATOM   8855  O  O     . VAL D 4  1045 ? 13.190  -86.260  55.602  1.00 112.43 ? 1045 VAL A O     1 
ATOM   8856  C  CB    . VAL D 4  1045 ? 10.728  -87.987  57.077  1.00 112.66 ? 1045 VAL A CB    1 
ATOM   8857  C  CG1   . VAL D 4  1045 ? 11.405  -87.100  58.113  1.00 111.81 ? 1045 VAL A CG1   1 
ATOM   8858  C  CG2   . VAL D 4  1045 ? 9.247   -87.712  57.029  1.00 112.43 ? 1045 VAL A CG2   1 
ATOM   8859  N  N     . LEU D 4  1046 ? 13.606  -88.376  56.189  1.00 113.48 ? 1046 LEU A N     1 
ATOM   8860  C  CA    . LEU D 4  1046 ? 15.058  -88.225  56.232  1.00 114.14 ? 1046 LEU A CA    1 
ATOM   8861  C  C     . LEU D 4  1046 ? 15.679  -87.717  54.942  1.00 115.08 ? 1046 LEU A C     1 
ATOM   8862  O  O     . LEU D 4  1046 ? 16.759  -87.106  54.964  1.00 115.67 ? 1046 LEU A O     1 
ATOM   8863  C  CB    . LEU D 4  1046 ? 15.728  -89.548  56.586  1.00 113.58 ? 1046 LEU A CB    1 
ATOM   8864  C  CG    . LEU D 4  1046 ? 16.277  -89.555  57.989  1.00 112.15 ? 1046 LEU A CG    1 
ATOM   8865  C  CD1   . LEU D 4  1046 ? 15.118  -89.687  58.943  1.00 110.75 ? 1046 LEU A CD1   1 
ATOM   8866  C  CD2   . LEU D 4  1046 ? 17.272  -90.682  58.122  1.00 111.79 ? 1046 LEU A CD2   1 
ATOM   8867  N  N     . SER D 4  1047 ? 15.028  -87.990  53.818  1.00 115.61 ? 1047 SER A N     1 
ATOM   8868  C  CA    . SER D 4  1047 ? 15.629  -87.643  52.549  1.00 116.22 ? 1047 SER A CA    1 
ATOM   8869  C  C     . SER D 4  1047 ? 15.334  -86.197  52.204  1.00 116.09 ? 1047 SER A C     1 
ATOM   8870  O  O     . SER D 4  1047 ? 16.254  -85.451  51.869  1.00 116.27 ? 1047 SER A O     1 
ATOM   8871  C  CB    . SER D 4  1047 ? 15.191  -88.594  51.438  1.00 116.51 ? 1047 SER A CB    1 
ATOM   8872  O  OG    . SER D 4  1047 ? 16.284  -88.867  50.578  1.00 117.74 ? 1047 SER A OG    1 
ATOM   8873  N  N     . ASN D 4  1048 ? 14.063  -85.806  52.306  1.00 116.05 ? 1048 ASN A N     1 
ATOM   8874  C  CA    . ASN D 4  1048 ? 13.653  -84.424  52.057  1.00 116.21 ? 1048 ASN A CA    1 
ATOM   8875  C  C     . ASN D 4  1048 ? 14.494  -83.459  52.881  1.00 115.74 ? 1048 ASN A C     1 
ATOM   8876  O  O     . ASN D 4  1048 ? 15.082  -82.511  52.332  1.00 115.80 ? 1048 ASN A O     1 
ATOM   8877  C  CB    . ASN D 4  1048 ? 12.167  -84.216  52.377  1.00 116.55 ? 1048 ASN A CB    1 
ATOM   8878  C  CG    . ASN D 4  1048 ? 11.268  -84.414  51.170  1.00 118.59 ? 1048 ASN A CG    1 
ATOM   8879  O  OD1   . ASN D 4  1048 ? 10.335  -83.629  50.956  1.00 121.12 ? 1048 ASN A OD1   1 
ATOM   8880  N  ND2   . ASN D 4  1048 ? 11.536  -85.464  50.369  1.00 120.05 ? 1048 ASN A ND2   1 
ATOM   8881  N  N     . ILE D 4  1049 ? 14.564  -83.735  54.192  1.00 114.91 ? 1049 ILE A N     1 
ATOM   8882  C  CA    . ILE D 4  1049 ? 15.239  -82.870  55.149  1.00 113.40 ? 1049 ILE A CA    1 
ATOM   8883  C  C     . ILE D 4  1049 ? 16.626  -82.586  54.639  1.00 113.24 ? 1049 ILE A C     1 
ATOM   8884  O  O     . ILE D 4  1049 ? 16.937  -81.451  54.359  1.00 113.52 ? 1049 ILE A O     1 
ATOM   8885  C  CB    . ILE D 4  1049 ? 15.280  -83.452  56.547  1.00 112.77 ? 1049 ILE A CB    1 
ATOM   8886  C  CG1   . ILE D 4  1049 ? 13.901  -83.342  57.190  1.00 111.47 ? 1049 ILE A CG1   1 
ATOM   8887  C  CG2   . ILE D 4  1049 ? 16.225  -82.658  57.354  1.00 112.78 ? 1049 ILE A CG2   1 
ATOM   8888  C  CD1   . ILE D 4  1049 ? 13.773  -83.964  58.568  1.00 109.13 ? 1049 ILE A CD1   1 
ATOM   8889  N  N     . GLU D 4  1050 ? 17.439  -83.610  54.448  1.00 112.98 ? 1050 GLU A N     1 
ATOM   8890  C  CA    . GLU D 4  1050 ? 18.757  -83.392  53.878  1.00 113.24 ? 1050 GLU A CA    1 
ATOM   8891  C  C     . GLU D 4  1050 ? 18.739  -82.453  52.650  1.00 112.83 ? 1050 GLU A C     1 
ATOM   8892  O  O     . GLU D 4  1050 ? 19.490  -81.468  52.602  1.00 112.46 ? 1050 GLU A O     1 
ATOM   8893  C  CB    . GLU D 4  1050 ? 19.402  -84.725  53.517  1.00 113.66 ? 1050 GLU A CB    1 
ATOM   8894  C  CG    . GLU D 4  1050 ? 20.923  -84.680  53.471  1.00 115.70 ? 1050 GLU A CG    1 
ATOM   8895  C  CD    . GLU D 4  1050 ? 21.490  -85.612  52.423  1.00 118.63 ? 1050 GLU A CD    1 
ATOM   8896  O  OE1   . GLU D 4  1050 ? 21.944  -86.726  52.793  1.00 119.94 ? 1050 GLU A OE1   1 
ATOM   8897  O  OE2   . GLU D 4  1050 ? 21.452  -85.233  51.225  1.00 119.31 ? 1050 GLU A OE2   1 
ATOM   8898  N  N     . ALA D 4  1051 ? 17.879  -82.762  51.676  1.00 112.56 ? 1051 ALA A N     1 
ATOM   8899  C  CA    . ALA D 4  1051 ? 17.808  -82.005  50.428  1.00 112.31 ? 1051 ALA A CA    1 
ATOM   8900  C  C     . ALA D 4  1051 ? 17.254  -80.610  50.682  1.00 112.54 ? 1051 ALA A C     1 
ATOM   8901  O  O     . ALA D 4  1051 ? 17.773  -79.636  50.122  1.00 112.99 ? 1051 ALA A O     1 
ATOM   8902  C  CB    . ALA D 4  1051 ? 16.988  -82.737  49.375  1.00 111.88 ? 1051 ALA A CB    1 
ATOM   8903  N  N     . GLN D 4  1052 ? 16.225  -80.501  51.529  1.00 112.31 ? 1052 GLN A N     1 
ATOM   8904  C  CA    . GLN D 4  1052 ? 15.667  -79.188  51.880  1.00 112.24 ? 1052 GLN A CA    1 
ATOM   8905  C  C     . GLN D 4  1052 ? 16.689  -78.309  52.596  1.00 112.24 ? 1052 GLN A C     1 
ATOM   8906  O  O     . GLN D 4  1052 ? 16.808  -77.115  52.304  1.00 112.40 ? 1052 GLN A O     1 
ATOM   8907  C  CB    . GLN D 4  1052 ? 14.401  -79.303  52.726  1.00 112.00 ? 1052 GLN A CB    1 
ATOM   8908  C  CG    . GLN D 4  1052 ? 13.125  -79.427  51.928  1.00 112.86 ? 1052 GLN A CG    1 
ATOM   8909  C  CD    . GLN D 4  1052 ? 11.919  -78.792  52.625  1.00 113.74 ? 1052 GLN A CD    1 
ATOM   8910  O  OE1   . GLN D 4  1052 ? 11.812  -77.570  52.695  1.00 114.44 ? 1052 GLN A OE1   1 
ATOM   8911  N  NE2   . GLN D 4  1052 ? 10.992  -79.624  53.110  1.00 113.18 ? 1052 GLN A NE2   1 
ATOM   8912  N  N     . PHE D 4  1053 ? 17.423  -78.912  53.527  1.00 112.27 ? 1053 PHE A N     1 
ATOM   8913  C  CA    . PHE D 4  1053 ? 18.438  -78.212  54.288  1.00 112.17 ? 1053 PHE A CA    1 
ATOM   8914  C  C     . PHE D 4  1053 ? 19.444  -77.679  53.309  1.00 112.99 ? 1053 PHE A C     1 
ATOM   8915  O  O     . PHE D 4  1053 ? 19.507  -76.471  53.086  1.00 113.26 ? 1053 PHE A O     1 
ATOM   8916  C  CB    . PHE D 4  1053 ? 19.116  -79.138  55.277  1.00 111.58 ? 1053 PHE A CB    1 
ATOM   8917  C  CG    . PHE D 4  1053 ? 20.046  -78.444  56.202  1.00 110.93 ? 1053 PHE A CG    1 
ATOM   8918  C  CD1   . PHE D 4  1053 ? 19.562  -77.826  57.356  1.00 110.16 ? 1053 PHE A CD1   1 
ATOM   8919  C  CD2   . PHE D 4  1053 ? 21.418  -78.411  55.935  1.00 111.26 ? 1053 PHE A CD2   1 
ATOM   8920  C  CE1   . PHE D 4  1053 ? 20.418  -77.168  58.236  1.00 109.81 ? 1053 PHE A CE1   1 
ATOM   8921  C  CE2   . PHE D 4  1053 ? 22.295  -77.757  56.803  1.00 110.97 ? 1053 PHE A CE2   1 
ATOM   8922  C  CZ    . PHE D 4  1053 ? 21.789  -77.133  57.961  1.00 111.17 ? 1053 PHE A CZ    1 
ATOM   8923  N  N     . LEU D 4  1054 ? 20.206  -78.577  52.691  1.00 113.63 ? 1054 LEU A N     1 
ATOM   8924  C  CA    . LEU D 4  1054 ? 21.155  -78.179  51.643  1.00 114.13 ? 1054 LEU A CA    1 
ATOM   8925  C  C     . LEU D 4  1054 ? 20.671  -77.036  50.693  1.00 114.41 ? 1054 LEU A C     1 
ATOM   8926  O  O     . LEU D 4  1054 ? 21.459  -76.138  50.362  1.00 114.89 ? 1054 LEU A O     1 
ATOM   8927  C  CB    . LEU D 4  1054 ? 21.647  -79.406  50.872  1.00 114.04 ? 1054 LEU A CB    1 
ATOM   8928  C  CG    . LEU D 4  1054 ? 22.748  -80.179  51.595  1.00 114.13 ? 1054 LEU A CG    1 
ATOM   8929  C  CD1   . LEU D 4  1054 ? 22.861  -81.623  51.093  1.00 114.33 ? 1054 LEU A CD1   1 
ATOM   8930  C  CD2   . LEU D 4  1054 ? 24.103  -79.432  51.502  1.00 114.66 ? 1054 LEU A CD2   1 
ATOM   8931  N  N     . ARG D 4  1055 ? 19.399  -77.050  50.286  1.00 114.05 ? 1055 ARG A N     1 
ATOM   8932  C  CA    . ARG D 4  1055 ? 18.858  -75.941  49.517  1.00 114.25 ? 1055 ARG A CA    1 
ATOM   8933  C  C     . ARG D 4  1055 ? 18.714  -74.625  50.278  1.00 113.78 ? 1055 ARG A C     1 
ATOM   8934  O  O     . ARG D 4  1055 ? 18.515  -73.573  49.655  1.00 113.75 ? 1055 ARG A O     1 
ATOM   8935  C  CB    . ARG D 4  1055 ? 17.530  -76.315  48.909  1.00 114.54 ? 1055 ARG A CB    1 
ATOM   8936  C  CG    . ARG D 4  1055 ? 17.678  -76.660  47.457  1.00 117.76 ? 1055 ARG A CG    1 
ATOM   8937  C  CD    . ARG D 4  1055 ? 16.322  -76.844  46.779  1.00 122.59 ? 1055 ARG A CD    1 
ATOM   8938  N  NE    . ARG D 4  1055 ? 15.709  -78.149  47.059  1.00 125.56 ? 1055 ARG A NE    1 
ATOM   8939  C  CZ    . ARG D 4  1055 ? 14.733  -78.349  47.944  1.00 127.42 ? 1055 ARG A CZ    1 
ATOM   8940  N  NH1   . ARG D 4  1055 ? 14.246  -77.325  48.653  1.00 127.74 ? 1055 ARG A NH1   1 
ATOM   8941  N  NH2   . ARG D 4  1055 ? 14.243  -79.576  48.121  1.00 128.04 ? 1055 ARG A NH2   1 
ATOM   8942  N  N     . SER D 4  1056 ? 18.824  -74.683  51.609  1.00 113.23 ? 1056 SER A N     1 
ATOM   8943  C  CA    . SER D 4  1056 ? 18.628  -73.511  52.491  1.00 112.56 ? 1056 SER A CA    1 
ATOM   8944  C  C     . SER D 4  1056 ? 19.923  -72.742  52.772  1.00 112.01 ? 1056 SER A C     1 
ATOM   8945  O  O     . SER D 4  1056 ? 19.879  -71.582  53.161  1.00 112.07 ? 1056 SER A O     1 
ATOM   8946  C  CB    . SER D 4  1056 ? 17.938  -73.909  53.815  1.00 112.49 ? 1056 SER A CB    1 
ATOM   8947  O  OG    . SER D 4  1056 ? 16.641  -74.469  53.595  1.00 112.61 ? 1056 SER A OG    1 
ATOM   8948  N  N     . VAL D 4  1057 ? 21.067  -73.393  52.566  1.00 111.31 ? 1057 VAL A N     1 
ATOM   8949  C  CA    . VAL D 4  1057 ? 22.392  -72.762  52.681  1.00 110.51 ? 1057 VAL A CA    1 
ATOM   8950  C  C     . VAL D 4  1057 ? 22.518  -71.529  51.792  1.00 109.90 ? 1057 VAL A C     1 
ATOM   8951  O  O     . VAL D 4  1057 ? 22.252  -71.581  50.587  1.00 109.47 ? 1057 VAL A O     1 
ATOM   8952  C  CB    . VAL D 4  1057 ? 23.503  -73.774  52.317  1.00 110.59 ? 1057 VAL A CB    1 
ATOM   8953  C  CG1   . VAL D 4  1057 ? 24.846  -73.085  52.042  1.00 111.39 ? 1057 VAL A CG1   1 
ATOM   8954  C  CG2   . VAL D 4  1057 ? 23.657  -74.765  53.414  1.00 110.83 ? 1057 VAL A CG2   1 
ATOM   8955  N  N     . VAL D 4  1058 ? 22.928  -70.416  52.391  1.00 109.67 ? 1058 VAL A N     1 
ATOM   8956  C  CA    . VAL D 4  1058 ? 23.056  -69.163  51.638  1.00 109.31 ? 1058 VAL A CA    1 
ATOM   8957  C  C     . VAL D 4  1058 ? 24.060  -69.333  50.503  1.00 108.91 ? 1058 VAL A C     1 
ATOM   8958  O  O     . VAL D 4  1058 ? 25.099  -69.988  50.682  1.00 109.23 ? 1058 VAL A O     1 
ATOM   8959  C  CB    . VAL D 4  1058 ? 23.409  -67.940  52.533  1.00 109.24 ? 1058 VAL A CB    1 
ATOM   8960  C  CG1   . VAL D 4  1058 ? 24.918  -67.794  52.752  1.00 107.98 ? 1058 VAL A CG1   1 
ATOM   8961  C  CG2   . VAL D 4  1058 ? 22.864  -66.711  51.892  1.00 109.48 ? 1058 VAL A CG2   1 
ATOM   8962  N  N     . HIS D 4  1059 ? 23.729  -68.755  49.348  1.00 107.85 ? 1059 HIS A N     1 
ATOM   8963  C  CA    . HIS D 4  1059 ? 24.500  -68.949  48.128  1.00 107.09 ? 1059 HIS A CA    1 
ATOM   8964  C  C     . HIS D 4  1059 ? 25.703  -68.068  48.087  1.00 106.18 ? 1059 HIS A C     1 
ATOM   8965  O  O     . HIS D 4  1059 ? 25.565  -66.873  48.156  1.00 106.16 ? 1059 HIS A O     1 
ATOM   8966  C  CB    . HIS D 4  1059 ? 23.650  -68.647  46.912  1.00 107.20 ? 1059 HIS A CB    1 
ATOM   8967  C  CG    . HIS D 4  1059 ? 22.667  -69.721  46.591  1.00 108.96 ? 1059 HIS A CG    1 
ATOM   8968  N  ND1   . HIS D 4  1059 ? 22.499  -70.215  45.316  1.00 110.18 ? 1059 HIS A ND1   1 
ATOM   8969  C  CD2   . HIS D 4  1059 ? 21.810  -70.412  47.383  1.00 110.91 ? 1059 HIS A CD2   1 
ATOM   8970  C  CE1   . HIS D 4  1059 ? 21.575  -71.161  45.332  1.00 111.82 ? 1059 HIS A CE1   1 
ATOM   8971  N  NE2   . HIS D 4  1059 ? 21.143  -71.303  46.575  1.00 112.32 ? 1059 HIS A NE2   1 
ATOM   8972  N  N     . PRO D 4  1060 ? 26.899  -68.656  47.991  1.00 105.80 ? 1060 PRO A N     1 
ATOM   8973  C  CA    . PRO D 4  1060 ? 28.083  -67.837  47.776  1.00 105.59 ? 1060 PRO A CA    1 
ATOM   8974  C  C     . PRO D 4  1060 ? 27.938  -66.871  46.589  1.00 105.34 ? 1060 PRO A C     1 
ATOM   8975  O  O     . PRO D 4  1060 ? 27.542  -67.273  45.488  1.00 105.15 ? 1060 PRO A O     1 
ATOM   8976  C  CB    . PRO D 4  1060 ? 29.170  -68.877  47.537  1.00 105.60 ? 1060 PRO A CB    1 
ATOM   8977  C  CG    . PRO D 4  1060 ? 28.720  -70.051  48.340  1.00 105.72 ? 1060 PRO A CG    1 
ATOM   8978  C  CD    . PRO D 4  1060 ? 27.242  -70.084  48.133  1.00 105.71 ? 1060 PRO A CD    1 
ATOM   8979  N  N     . GLY D 4  1061 ? 28.253  -65.606  46.845  1.00 105.04 ? 1061 GLY A N     1 
ATOM   8980  C  CA    . GLY D 4  1061 ? 27.989  -64.531  45.918  1.00 105.52 ? 1061 GLY A CA    1 
ATOM   8981  C  C     . GLY D 4  1061 ? 27.097  -63.494  46.573  1.00 106.22 ? 1061 GLY A C     1 
ATOM   8982  O  O     . GLY D 4  1061 ? 27.424  -62.296  46.574  1.00 106.36 ? 1061 GLY A O     1 
ATOM   8983  N  N     . GLU D 4  1062 ? 25.975  -63.966  47.133  1.00 106.73 ? 1062 GLU A N     1 
ATOM   8984  C  CA    . GLU D 4  1062 ? 24.936  -63.148  47.779  1.00 107.41 ? 1062 GLU A CA    1 
ATOM   8985  C  C     . GLU D 4  1062 ? 25.442  -61.844  48.316  1.00 107.25 ? 1062 GLU A C     1 
ATOM   8986  O  O     . GLU D 4  1062 ? 26.339  -61.832  49.142  1.00 108.18 ? 1062 GLU A O     1 
ATOM   8987  C  CB    . GLU D 4  1062 ? 24.348  -63.910  48.936  1.00 107.25 ? 1062 GLU A CB    1 
ATOM   8988  C  CG    . GLU D 4  1062 ? 23.087  -64.601  48.562  1.00 112.06 ? 1062 GLU A CG    1 
ATOM   8989  C  CD    . GLU D 4  1062 ? 21.859  -63.784  48.912  1.00 118.43 ? 1062 GLU A CD    1 
ATOM   8990  O  OE1   . GLU D 4  1062 ? 21.961  -62.961  49.850  1.00 121.06 ? 1062 GLU A OE1   1 
ATOM   8991  O  OE2   . GLU D 4  1062 ? 20.789  -63.965  48.268  1.00 121.89 ? 1062 GLU A OE2   1 
ATOM   8992  N  N     . MET D 4  1063 ? 24.882  -60.735  47.874  1.00 106.68 ? 1063 MET A N     1 
ATOM   8993  C  CA    . MET D 4  1063 ? 25.404  -59.482  48.347  1.00 106.22 ? 1063 MET A CA    1 
ATOM   8994  C  C     . MET D 4  1063 ? 24.722  -59.109  49.623  1.00 105.78 ? 1063 MET A C     1 
ATOM   8995  O  O     . MET D 4  1063 ? 23.819  -58.297  49.618  1.00 105.78 ? 1063 MET A O     1 
ATOM   8996  C  CB    . MET D 4  1063 ? 25.203  -58.411  47.307  1.00 106.60 ? 1063 MET A CB    1 
ATOM   8997  C  CG    . MET D 4  1063 ? 26.048  -58.624  46.075  1.00 107.59 ? 1063 MET A CG    1 
ATOM   8998  S  SD    . MET D 4  1063 ? 27.778  -58.662  46.498  1.00 108.72 ? 1063 MET A SD    1 
ATOM   8999  C  CE    . MET D 4  1063 ? 27.952  -56.999  47.175  1.00 107.35 ? 1063 MET A CE    1 
ATOM   9000  N  N     . VAL D 4  1064 ? 25.167  -59.712  50.721  1.00 105.62 ? 1064 VAL A N     1 
ATOM   9001  C  CA    . VAL D 4  1064 ? 24.545  -59.532  52.049  1.00 105.41 ? 1064 VAL A CA    1 
ATOM   9002  C  C     . VAL D 4  1064 ? 24.735  -58.153  52.744  1.00 105.49 ? 1064 VAL A C     1 
ATOM   9003  O  O     . VAL D 4  1064 ? 24.040  -57.838  53.742  1.00 105.22 ? 1064 VAL A O     1 
ATOM   9004  C  CB    . VAL D 4  1064 ? 24.965  -60.627  53.016  1.00 104.81 ? 1064 VAL A CB    1 
ATOM   9005  C  CG1   . VAL D 4  1064 ? 24.226  -60.424  54.290  1.00 105.33 ? 1064 VAL A CG1   1 
ATOM   9006  C  CG2   . VAL D 4  1064 ? 24.608  -61.953  52.447  1.00 104.63 ? 1064 VAL A CG2   1 
ATOM   9007  N  N     . GLY D 4  1065 ? 25.667  -57.353  52.212  1.00 105.31 ? 1065 GLY A N     1 
ATOM   9008  C  CA    . GLY D 4  1065 ? 25.900  -55.997  52.676  1.00 105.01 ? 1065 GLY A CA    1 
ATOM   9009  C  C     . GLY D 4  1065 ? 24.647  -55.199  52.416  1.00 104.94 ? 1065 GLY A C     1 
ATOM   9010  O  O     . GLY D 4  1065 ? 23.912  -54.869  53.347  1.00 105.38 ? 1065 GLY A O     1 
ATOM   9011  N  N     . VAL D 4  1066 ? 24.386  -54.929  51.142  1.00 104.36 ? 1066 VAL A N     1 
ATOM   9012  C  CA    . VAL D 4  1066 ? 23.262  -54.123  50.744  1.00 104.15 ? 1066 VAL A CA    1 
ATOM   9013  C  C     . VAL D 4  1066 ? 22.003  -54.739  51.330  1.00 104.83 ? 1066 VAL A C     1 
ATOM   9014  O  O     . VAL D 4  1066 ? 21.151  -54.063  51.935  1.00 104.85 ? 1066 VAL A O     1 
ATOM   9015  C  CB    . VAL D 4  1066 ? 23.143  -54.124  49.248  1.00 103.85 ? 1066 VAL A CB    1 
ATOM   9016  C  CG1   . VAL D 4  1066 ? 22.113  -53.131  48.820  1.00 104.16 ? 1066 VAL A CG1   1 
ATOM   9017  C  CG2   . VAL D 4  1066 ? 24.483  -53.814  48.615  1.00 104.07 ? 1066 VAL A CG2   1 
ATOM   9018  N  N     . LEU D 4  1067 ? 21.911  -56.051  51.176  1.00 105.34 ? 1067 LEU A N     1 
ATOM   9019  C  CA    . LEU D 4  1067 ? 20.786  -56.783  51.686  1.00 105.60 ? 1067 LEU A CA    1 
ATOM   9020  C  C     . LEU D 4  1067 ? 20.519  -56.350  53.093  1.00 106.35 ? 1067 LEU A C     1 
ATOM   9021  O  O     . LEU D 4  1067 ? 19.383  -56.058  53.403  1.00 106.76 ? 1067 LEU A O     1 
ATOM   9022  C  CB    . LEU D 4  1067 ? 21.046  -58.273  51.646  1.00 105.20 ? 1067 LEU A CB    1 
ATOM   9023  C  CG    . LEU D 4  1067 ? 19.865  -58.880  50.938  1.00 104.71 ? 1067 LEU A CG    1 
ATOM   9024  C  CD1   . LEU D 4  1067 ? 20.200  -60.299  50.516  1.00 102.46 ? 1067 LEU A CD1   1 
ATOM   9025  C  CD2   . LEU D 4  1067 ? 18.567  -58.735  51.812  1.00 105.12 ? 1067 LEU A CD2   1 
ATOM   9026  N  N     . ALA D 4  1068 ? 21.567  -56.280  53.922  1.00 107.27 ? 1068 ALA A N     1 
ATOM   9027  C  CA    . ALA D 4  1068 ? 21.419  -55.960  55.348  1.00 108.35 ? 1068 ALA A CA    1 
ATOM   9028  C  C     . ALA D 4  1068 ? 21.015  -54.524  55.612  1.00 108.99 ? 1068 ALA A C     1 
ATOM   9029  O  O     . ALA D 4  1068 ? 20.237  -54.260  56.524  1.00 109.14 ? 1068 ALA A O     1 
ATOM   9030  C  CB    . ALA D 4  1068 ? 22.665  -56.316  56.134  1.00 107.89 ? 1068 ALA A CB    1 
ATOM   9031  N  N     . ALA D 4  1069 ? 21.520  -53.596  54.814  1.00 109.99 ? 1069 ALA A N     1 
ATOM   9032  C  CA    . ALA D 4  1069 ? 21.199  -52.193  55.051  1.00 111.68 ? 1069 ALA A CA    1 
ATOM   9033  C  C     . ALA D 4  1069 ? 19.720  -51.907  54.787  1.00 112.97 ? 1069 ALA A C     1 
ATOM   9034  O  O     . ALA D 4  1069 ? 19.006  -51.404  55.664  1.00 112.76 ? 1069 ALA A O     1 
ATOM   9035  C  CB    . ALA D 4  1069 ? 22.098  -51.266  54.232  1.00 111.30 ? 1069 ALA A CB    1 
ATOM   9036  N  N     . GLN D 4  1070 ? 19.262  -52.255  53.585  1.00 114.62 ? 1070 GLN A N     1 
ATOM   9037  C  CA    . GLN D 4  1070 ? 17.890  -51.975  53.187  1.00 116.13 ? 1070 GLN A CA    1 
ATOM   9038  C  C     . GLN D 4  1070 ? 16.949  -52.833  54.007  1.00 116.79 ? 1070 GLN A C     1 
ATOM   9039  O  O     . GLN D 4  1070 ? 15.752  -52.604  54.049  1.00 117.02 ? 1070 GLN A O     1 
ATOM   9040  C  CB    . GLN D 4  1070 ? 17.641  -52.275  51.709  1.00 116.18 ? 1070 GLN A CB    1 
ATOM   9041  C  CG    . GLN D 4  1070 ? 18.819  -52.203  50.788  1.00 117.72 ? 1070 GLN A CG    1 
ATOM   9042  C  CD    . GLN D 4  1070 ? 18.498  -52.841  49.451  1.00 121.35 ? 1070 GLN A CD    1 
ATOM   9043  O  OE1   . GLN D 4  1070 ? 17.720  -53.806  49.380  1.00 123.42 ? 1070 GLN A OE1   1 
ATOM   9044  N  NE2   . GLN D 4  1070 ? 19.073  -52.297  48.375  1.00 122.92 ? 1070 GLN A NE2   1 
ATOM   9045  N  N     . SER D 4  1071 ? 17.484  -53.841  54.657  1.00 117.82 ? 1071 SER A N     1 
ATOM   9046  C  CA    . SER D 4  1071 ? 16.618  -54.664  55.427  1.00 119.32 ? 1071 SER A CA    1 
ATOM   9047  C  C     . SER D 4  1071 ? 16.367  -53.986  56.779  1.00 120.30 ? 1071 SER A C     1 
ATOM   9048  O  O     . SER D 4  1071 ? 15.302  -54.181  57.384  1.00 120.27 ? 1071 SER A O     1 
ATOM   9049  C  CB    . SER D 4  1071 ? 17.173  -56.082  55.491  1.00 119.56 ? 1071 SER A CB    1 
ATOM   9050  O  OG    . SER D 4  1071 ? 17.158  -56.649  54.172  1.00 120.19 ? 1071 SER A OG    1 
ATOM   9051  N  N     . ILE D 4  1072 ? 17.309  -53.131  57.202  1.00 121.35 ? 1072 ILE A N     1 
ATOM   9052  C  CA    . ILE D 4  1072 ? 17.082  -52.215  58.350  1.00 122.37 ? 1072 ILE A CA    1 
ATOM   9053  C  C     . ILE D 4  1072 ? 16.468  -50.844  57.974  1.00 123.41 ? 1072 ILE A C     1 
ATOM   9054  O  O     . ILE D 4  1072 ? 15.563  -50.365  58.667  1.00 123.47 ? 1072 ILE A O     1 
ATOM   9055  C  CB    . ILE D 4  1072 ? 18.351  -51.961  59.190  1.00 122.14 ? 1072 ILE A CB    1 
ATOM   9056  C  CG1   . ILE D 4  1072 ? 19.064  -53.282  59.505  1.00 122.24 ? 1072 ILE A CG1   1 
ATOM   9057  C  CG2   . ILE D 4  1072 ? 17.970  -51.215  60.470  1.00 121.62 ? 1072 ILE A CG2   1 
ATOM   9058  C  CD1   . ILE D 4  1072 ? 20.548  -53.160  59.797  1.00 120.97 ? 1072 ILE A CD1   1 
ATOM   9059  N  N     . GLY D 4  1073 ? 16.965  -50.222  56.896  1.00 124.38 ? 1073 GLY A N     1 
ATOM   9060  C  CA    . GLY D 4  1073 ? 16.479  -48.906  56.413  1.00 125.45 ? 1073 GLY A CA    1 
ATOM   9061  C  C     . GLY D 4  1073 ? 15.016  -48.775  55.999  1.00 126.22 ? 1073 GLY A C     1 
ATOM   9062  O  O     . GLY D 4  1073 ? 14.401  -47.732  56.215  1.00 125.74 ? 1073 GLY A O     1 
ATOM   9063  N  N     . GLU D 4  1074 ? 14.470  -49.832  55.400  1.00 127.39 ? 1074 GLU A N     1 
ATOM   9064  C  CA    . GLU D 4  1074 ? 13.073  -49.875  54.989  1.00 129.04 ? 1074 GLU A CA    1 
ATOM   9065  C  C     . GLU D 4  1074 ? 12.020  -49.779  56.117  1.00 130.34 ? 1074 GLU A C     1 
ATOM   9066  O  O     . GLU D 4  1074 ? 11.094  -48.982  56.006  1.00 130.35 ? 1074 GLU A O     1 
ATOM   9067  C  CB    . GLU D 4  1074 ? 12.809  -51.094  54.123  1.00 128.85 ? 1074 GLU A CB    1 
ATOM   9068  C  CG    . GLU D 4  1074 ? 11.588  -50.966  53.216  1.00 131.06 ? 1074 GLU A CG    1 
ATOM   9069  C  CD    . GLU D 4  1074 ? 10.219  -51.274  53.879  1.00 133.87 ? 1074 GLU A CD    1 
ATOM   9070  O  OE1   . GLU D 4  1074 ? 10.181  -51.950  54.938  1.00 134.44 ? 1074 GLU A OE1   1 
ATOM   9071  O  OE2   . GLU D 4  1074 ? 9.171   -50.849  53.308  1.00 134.97 ? 1074 GLU A OE2   1 
ATOM   9072  N  N     . PRO D 4  1075 ? 12.111  -50.605  57.186  1.00 131.99 ? 1075 PRO A N     1 
ATOM   9073  C  CA    . PRO D 4  1075 ? 11.093  -50.329  58.208  1.00 133.11 ? 1075 PRO A CA    1 
ATOM   9074  C  C     . PRO D 4  1075 ? 11.217  -48.907  58.710  1.00 134.59 ? 1075 PRO A C     1 
ATOM   9075  O  O     . PRO D 4  1075 ? 10.208  -48.235  58.864  1.00 134.57 ? 1075 PRO A O     1 
ATOM   9076  C  CB    . PRO D 4  1075 ? 11.408  -51.331  59.326  1.00 132.87 ? 1075 PRO A CB    1 
ATOM   9077  C  CG    . PRO D 4  1075 ? 12.174  -52.416  58.661  1.00 132.59 ? 1075 PRO A CG    1 
ATOM   9078  C  CD    . PRO D 4  1075 ? 12.968  -51.749  57.563  1.00 132.13 ? 1075 PRO A CD    1 
ATOM   9079  N  N     . ALA D 4  1076 ? 12.452  -48.444  58.906  1.00 136.69 ? 1076 ALA A N     1 
ATOM   9080  C  CA    . ALA D 4  1076 ? 12.723  -47.091  59.398  1.00 139.02 ? 1076 ALA A CA    1 
ATOM   9081  C  C     . ALA D 4  1076 ? 11.885  -46.006  58.713  1.00 140.72 ? 1076 ALA A C     1 
ATOM   9082  O  O     . ALA D 4  1076 ? 11.515  -45.010  59.334  1.00 140.72 ? 1076 ALA A O     1 
ATOM   9083  C  CB    . ALA D 4  1076 ? 14.197  -46.777  59.298  1.00 138.73 ? 1076 ALA A CB    1 
ATOM   9084  N  N     . THR D 4  1077 ? 11.570  -46.216  57.442  1.00 143.16 ? 1077 THR A N     1 
ATOM   9085  C  CA    . THR D 4  1077 ? 10.702  -45.310  56.717  1.00 145.67 ? 1077 THR A CA    1 
ATOM   9086  C  C     . THR D 4  1077 ? 9.261   -45.386  57.195  1.00 147.81 ? 1077 THR A C     1 
ATOM   9087  O  O     . THR D 4  1077 ? 8.543   -44.383  57.183  1.00 148.21 ? 1077 THR A O     1 
ATOM   9088  C  CB    . THR D 4  1077 ? 10.766  -45.594  55.237  1.00 145.27 ? 1077 THR A CB    1 
ATOM   9089  O  OG1   . THR D 4  1077 ? 12.131  -45.504  54.831  1.00 144.55 ? 1077 THR A OG1   1 
ATOM   9090  C  CG2   . THR D 4  1077 ? 9.944   -44.574  54.463  1.00 146.07 ? 1077 THR A CG2   1 
ATOM   9091  N  N     . GLN D 4  1078 ? 8.858   -46.570  57.641  1.00 150.66 ? 1078 GLN A N     1 
ATOM   9092  C  CA    . GLN D 4  1078 ? 7.475   -46.824  58.043  1.00 153.73 ? 1078 GLN A CA    1 
ATOM   9093  C  C     . GLN D 4  1078 ? 7.196   -46.557  59.531  1.00 155.65 ? 1078 GLN A C     1 
ATOM   9094  O  O     . GLN D 4  1078 ? 6.156   -46.966  60.044  1.00 155.87 ? 1078 GLN A O     1 
ATOM   9095  C  CB    . GLN D 4  1078 ? 7.059   -48.262  57.666  1.00 153.70 ? 1078 GLN A CB    1 
ATOM   9096  C  CG    . GLN D 4  1078 ? 7.493   -48.736  56.259  1.00 154.96 ? 1078 GLN A CG    1 
ATOM   9097  C  CD    . GLN D 4  1078 ? 7.176   -47.730  55.140  1.00 156.90 ? 1078 GLN A CD    1 
ATOM   9098  O  OE1   . GLN D 4  1078 ? 6.032   -47.271  55.008  1.00 158.36 ? 1078 GLN A OE1   1 
ATOM   9099  N  NE2   . GLN D 4  1078 ? 8.188   -47.395  54.326  1.00 156.00 ? 1078 GLN A NE2   1 
ATOM   9100  N  N     . MET D 4  1079 ? 8.109   -45.863  60.215  1.00 158.42 ? 1079 MET A N     1 
ATOM   9101  C  CA    . MET D 4  1079 ? 7.971   -45.616  61.661  1.00 161.04 ? 1079 MET A CA    1 
ATOM   9102  C  C     . MET D 4  1079 ? 6.992   -44.484  61.907  1.00 163.53 ? 1079 MET A C     1 
ATOM   9103  O  O     . MET D 4  1079 ? 7.199   -43.372  61.416  1.00 163.77 ? 1079 MET A O     1 
ATOM   9104  C  CB    . MET D 4  1079 ? 9.333   -45.348  62.331  1.00 160.64 ? 1079 MET A CB    1 
ATOM   9105  C  CG    . MET D 4  1079 ? 10.351  -46.475  62.052  1.00 160.96 ? 1079 MET A CG    1 
ATOM   9106  S  SD    . MET D 4  1079 ? 11.748  -46.755  63.166  1.00 160.20 ? 1079 MET A SD    1 
ATOM   9107  C  CE    . MET D 4  1079 ? 12.308  -48.359  62.631  1.00 159.12 ? 1079 MET A CE    1 
ATOM   9108  N  N     . THR D 4  1080 ? 5.903   -44.786  62.626  1.00 166.63 ? 1080 THR A N     1 
ATOM   9109  C  CA    . THR D 4  1080 ? 4.859   -43.781  62.934  1.00 169.52 ? 1080 THR A CA    1 
ATOM   9110  C  C     . THR D 4  1080 ? 5.269   -42.995  64.171  1.00 171.28 ? 1080 THR A C     1 
ATOM   9111  O  O     . THR D 4  1080 ? 6.333   -43.259  64.756  1.00 171.27 ? 1080 THR A O     1 
ATOM   9112  C  CB    . THR D 4  1080 ? 3.414   -44.388  63.154  1.00 169.48 ? 1080 THR A CB    1 
ATOM   9113  O  OG1   . THR D 4  1080 ? 3.262   -45.614  62.424  1.00 170.03 ? 1080 THR A OG1   1 
ATOM   9114  C  CG2   . THR D 4  1080 ? 2.309   -43.394  62.717  1.00 169.70 ? 1080 THR A CG2   1 
ATOM   9115  N  N     . LEU D 4  1081 ? 4.422   -42.031  64.545  1.00 173.81 ? 1081 LEU A N     1 
ATOM   9116  C  CA    . LEU D 4  1081 ? 4.612   -41.213  65.739  1.00 176.31 ? 1081 LEU A CA    1 
ATOM   9117  C  C     . LEU D 4  1081 ? 6.019   -41.449  66.342  1.00 178.27 ? 1081 LEU A C     1 
ATOM   9118  O  O     . LEU D 4  1081 ? 6.212   -42.317  67.219  1.00 178.51 ? 1081 LEU A O     1 
ATOM   9119  C  CB    . LEU D 4  1081 ? 3.477   -41.455  66.766  1.00 176.09 ? 1081 LEU A CB    1 
ATOM   9120  C  CG    . LEU D 4  1081 ? 1.983   -41.422